3TDVA

Structure of the gdp complex of wild-type aminoglycoside 2'-phosphotransferase-iiia
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
QNKLHYTTMIMTQFPDISIQSVESLGEGFRNYAILVNGDWVFRFPKSQQGADELNKEIQLLPLLVGCVKVNIPQYVYIGKRSDGNPFVGYRKVQGQILGEDGMAVFPDDAKDRLALQLAEFMNELSAFPVETAISAGVPVTNLKNKILLLSEAVEDQVFPLLDESLRDYLTLRFQSYMTHPVYTRYTPRLIHGDLSPDHFLTNLNSRQTPLTGIIDFGDAAISDPDYDYVYLLEDCGELFTRQVMAYRGEVDLDTHIRKVSLFVTFDQVSYLLEGLRARDQDWISEGLELLEEDKANNFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentamicin resistance protein
publication title Aminoglycoside-2' phosphotransferase-IIIa (APH(2')-IIIa) prefers GTP over ATP: Structural templates for nucleotide recognition in the bacterial aminoglycoside-2' kinases.
pubmed doi rcsb
source organism Enterococcus gallinarum
molecule tags Transferase
total genus 101
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tdvA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3tdvA02
1UU7A 3FY0A 2W17A 4W4YA 2ITTA 2JD5A 4TNBA 5EM7A 2AYPA 3R9HA 4ANMA 4TYIA 1W84A 4E73A 5IISA 5ANIA 3QD2B 4GK2A 3VF9A 4ZMFA 5HE1A 2H96A 5JGDA 3F5PA 4LUDA 3OC1A 4QMOA 2HK5A 3R1YA 3PG1A 4NK9A 3S2PA 4PTGA 4ZTSA 4O83A 5FUTA 4WO5A 5F4NA 2PMOX 3HV3A 3BE2A 3LAUA 1QCFA 3GC8A 4FNYA 5DWRA 4FT9A 4L3LA 4PWNA 1WAKA 2Y9QA 3FJQE 4R3PA 5DNRA 3RAKA 3DFCB 4BBMA 2X8EA 4BCJA 3BHHA 3F61A 3IDBA 4M15A 1A9UA 3IW7A 5C8NA 4ANLA 5JFVA 3LQ3A 5FEDA 2DQ7X 3ZO4A 3ZSGA 5J9LA 2O3PA 5TR6A 2YM6A 4J97A 4JJRA 4X2KA 2YABA 3FMNA 1XBBA 1VZOA 1GIJA 1BLXA 2VTTA 2C5VA 3WILA 2OXXA 3TCPA 4BDFA 2W1HA 4GT5A 3PJ8A 4JR7A 5AIRA 4BDIA 4TTHB 3TJCA 2PVFA 3LFQA 5CU0A 5KHWA 3FV8A 4ZJJA 2YDJA 4K2RA 1Q3DA 4IVBA 3TZ7A 4C3FA 2BIYA 3FI4A 3GNIB 1IEPA 3AC1A 1AD5A 3SD0A 2XIKA 1X8BA 2V7OA 4GT4A 1YWVA 3UQCA 4ITJA 4RIWA 3WI6A 4BTKA 4I4FA 3E62A 4NL0A 4E4XA 3FQHA 2W1FA 4BR3A 2WTKC 5IQIA 4O0RA 3F2NA 4RFZA 4GL9A 3TNIA 5GJGA 2PUNA 2CKEA 5IA0A 1WMKA 3COHA 3BU3A 1HOWA 1Y8YA 2QCSA 4KAOA 4L53A 3RCDA 5CSPA 2X9FA 1Q97A 4XG4A 3NIZA 4CFVA 1WFCA 3F3VA 2QU5A 4Q2AA 3V5JA 4ENXA 5I9VA 2UW5A 4YLLA 5HORA 5HLPA 4MXCA 1VJYA 3MJ2A 1H26A 4W4VA 1SMHA 2WTVA 5ETFA 4ACCA 3V8TA 3LLAA 3GC7A 4WRGA 2R3NA 3RAWA 2OI4X 3R2YA 2PMIA 4HJOA 4JBPA 5LMAA 2I40A 3Q60A 3ZFXA 3GU4A 4FV7A 4Q5EA 2JAMA 5BVFA 5CS6A 4EH9A 1Q62A 4IHPA 5TKDA 2BPMA 2WMRA 2OFUA 3MPTA 4U80A 4UBAA 3KGAA 4DINA 3HA6A 2OJFE 1OECA 5CZIA 4C0TA 4GVAA 3RPSA 5IQCA 1H0VA 3MIAA 4X3FA 4HCUA 4TT7A 2OU7A 2XNMA 3UODA 3DBQA 4XG7A 4DHFA 1WBTA 5H9BA 4RFMA 5I9WA 3COKA 4AT5A 4BBFA 4QMQA 3C4FA 3FLYA 3W8LA 2H9VA 3NGAA 4WNKA 3R7EA 1AQ1A 2UW4A 4ZY5A 4KS7A 1UV5A 2EU9A 3EFJA 3R8VA 3VVHA 3QF9A 4RX8A 4AA5A 5AV3A 2VGOA 3N4TA 3HMOA 4O21A 5B0XA 4F08A 2UZOA 2C3JA 4C2WA 3L8SA 2NP8A 3M2WA 4WNPA 5AUZA 2WTIA 4CNHA 4L8MA 4APCA 2OG8A 1U5QA 2PVHA 5HD7A 3F3TA 3R1SA 4HVHA 4OGRA 4O7TA 4XG2A 3GI3A 4MXXA 4UWYA 3KC3A 3FMKA 3D94A 3U4WA 4MNEA 4RIXA 1UU8A 2GNLA 4C36A 2J5FA 1W98A 3MGYA 4BF2A 2QHMA 3CD8A 4JOAA 4M67A 4FKWA 2C6KA 5JFSA 3GCPA 3NS9A 1Z57A 4GUEA 4MD7E 5BMSA 2YCSA 1H28A 4YGAA 4MF1A 3CJFA 3S00A 5F20A 2X9EA 2C0OA 3VBXA 1NVQA 3I6WA 1PW2A 4TRLA 4CRLA 5M4IA 3PXKA 4DGMA 4FV9A 2FSOX 3FPMA 3KMMA 4HZSA 4QNYA 3I60A 3FMMA 4F9YA 4QQCA 4AXAA 3VC4A 3VUMA 3BHUA 2P2IA 3PA5A 3FSKA 5EH0A 3QBNA 4KD1A 3VQUA 3S3IA 4RX7A 3QTQA 2YAKA 5CF6A 2HCKA 4FSUA 3PLAE 4JNWA 5IH5A 3KVXA 4FODA 4ZSLA 5G1XA 4O7PA 4UV0A 4ASEA 3RCJA 2C68A 2DWBA 2VWUA 5A4CA 4ANSA 3PFQA 4DCEA 3LXNA 2Y4PA 4IB5A 4JQEA 4IB0A 5M55A 2W0JA 4ZTNA 4EK3A 3ZM9A 1SVEA 3ZRLA 2YJRA 3KXXA 1GOLA 3Q96A 2CCIA 5CAPA 1Q8YA 4NW6A 1VEBA 3TM0A 4KSPA 3VO3A 3SQQA 2GNJA 3H3CA 1ZYCA 3QQGA 3MH2A 3TEIA 3WZEA 5IQHA 5JT2A 2ZB0A 2B9IA 3F7ZA 3LCSA 3QQKA 4FKJA 3G90X 2I0YA 4DITA 4KRCA 3LZBA 3Q52A 3LFDA 4LRMA 3EZRA 2BRNA 2CNVA 5LWNA 5KCVA 2IPXA 4I6FA 4RWIA 5CF5A 2YM4A 4RPVA 1XKKA 4RJ6A 4IAYA 5LVMA 4F0FA 1FOTA 3FYKX 2QVSE 3N4UA 4H3PA 3D2IA 5AX9A 4C4EA 4DFZE 4KBCA 5BVDA 2GTNA 3ATTA 3D7ZA 1QMZA 4FT7A 5F95A 3UIUA 4ENYA 5EHYA 4QMVA 2XK6A 4RIYA 3ORMA 5C03A 3H0YA 4QTAA 3MFUA 2NNWB 2WIPA 4USFA 5EHOA 2VX0A 3PXYA 4WBBB 4M3QA 3R83A 3AC5A 2R3RA 3BU6A 5TOZA 4BDHA 4KUJA 3KCFA 3HECA 3ZDUA 1PRYA 1V0BA 1BYGA 4KBKA 3I4BA 4IADA 2WMQA 4PDPA 3PXFA 3KXHA 3Q4ZA 3UO6A 5BVNA 1U4DA 4WRSA 2PE1A 5A3XA 2IVVA 1AGWA 2QOOA 3SRVA 1XH9A 3VS6A 4C7TA 4G34A 3B2WA 3PXQA 2YWVA 4PMSA 4U9AA 4C33A 1IR3A 3U6IA 2ONLC 4O2PA 2E9UA 2JEDA 3W0NA 4TWOA 2Z02A 3MH1A 2QR8A 5AUWA 2FGIA 1OL1A 1W8CA 3QUEA 5DT0A 2W5AA 3G0EA 3QFVA 3DLZA 1TKIA 3DOGA 3A99A 4S32A 4RIWB 2XIYA 1OGUA 3O7LB 5H3QA 4KKHA 5IUIA 3VUIA 3NLBA 3UYSA 4CFUA 3TYKA 2VNYA 5A4QA 2VGPA 2J9MA 3G33A 3QD3A 4C3PA 1KE6A 2B52A 2VWZA 2WU6A 4GG5A 2BRBA 5BVWA 5HU9A 3HKOA 3CKXA 5DRDA 3OT3A 3IK3A 3R7UA 3OCGA 4K11A 5E7RA 4MXOA 4XH6A 2PZ5A 4WG5A 4ZZOA 3EL8A 3EN9A 3T3VA 5AP6A 3FMJA 3LM5A 1CSNA 3F9NA 4RA4A 1H08A 3R1NA 2JIVA 4CTCA 3NAYA 3KRJA 3SOCA 4ZJIA 3FSFA 4M12A 5EW8A 3TT0A 2CN8A 3WE4A 4BDKA 2C3LA 4EEVA 2ITQA 2PU8A 2GQSA 2XNOA 4MBJA 5DVRA 3W2QA 2GU8A 4TWCA 1P4OA 4RVLA 4O7YA 3PJ2A 5D11A 1XO2B 3TJDA 3QXPA 4GSBA 1IASA 2BZKB 2C6DA 1YDRE 4BCMA 3HNGA 2VX3A 5AP5A 3UP7A 3MY5A 1OKWA 1UKHA 2R3LA 5AUVA 2Q0BA 2R3KA 4X3FB 3RALA 2C4GA 3U51A 4AZFA 2BTSA 1YXTA 3F2AA 3KK8A 4MQ1A 4M14A 4DT9A 3ENMA 4NJ3A 5A46A 4G3DA 1UWHA 3EKNA 5HCZA 2PULA 3F69A 5GIPE 3PIYA 5EYMA 4DA5A 3GUBA 3FAAA 2C3IB 4YUQA 1WBOA 2B53A 3V01A 2VD5A 4U79A 4DGGA 2P33A 3KB7A 2GQRA 2JC6A 3PVWA 3TV6A 3NZ0A 4XV3A 2CSNA 4TKSA 4E6DA 5ANGA 2G1TA 2BDWA 2XB7A 3FLQA 3CP9A 3DU8A 3R71A 2I0HA 4G3EA 5CEMA 4E8AA 4JDJA 5EOBA 4C4JA 2GDOA 2WOUA 4QMMA 5E9EA 2XF0A 3EQGA 1GZKA 4AX8A 4JL9A 5HD4A 2W1CA 3MYGA 3PPZA 5I5ZA 2PVJA 4MNEB 4QMWA 3QC9A 4RIXB 1NVRA 4PDOA 4LMUA 4E6QA 3ZLWA 2R3HA 3V5QA 1UNHA 3I79A 3ZZWA 3MH0A 5ICPA 5GJFA 3OVVA 5C9CA 3WZJA 3FQEA 4TYEA 1U46A 4X3FC 4JDKA 5FDXA 2JDSA 3H4JA 3NR9A 4GIHA 4GV1A 1H00A 2KTYA 4FSZA 3ZMMA 3BYUA 2YIXA 4R1VA 3PUPA 3O71A 3UMWA 1NW1A 3AT3A 3DV3A 1SVHA 4L3JA 2CKOA 4XBUA 4EZ3A 5LCKA 1OUKA 3FUPA 1DS5A 3KXMA 4KKGA 4RQVA 5EI6A 5HKMA 4AQCA 3OBGA 4QP6A 4D4YA 3TACA 2UZTA 5DG5A 4B8MA 2R4BA 4E5BA 5CTPA 3FI3A 4LRJA 1OPKA 2XKCA 4NKAA 4PMMA 1OIQA 5E4HA 2YN8A 2W4JA 2W9ZB 4NM3A 3D4QA 4NFMA 2CKQA 3MB7A 4KBAA 3FZTA 2FUMA 3GENA 1FGIA 2JKKA 3GU8A 4KSQA 4DFBA 2YCQA 3KCKA 2VTJA 3M1SA 3COIA 3OD6X 4J53A 3VW8A 4G17A 4C34A 4CT2A 2BDJA 4FTOA 3RK7A 1CKIA 1UU3A 2W05A 3MJ1A 4AN3A 3FC1X 3NDMA 4G5PA 5EHLA 3LHJA 4LOOA 1E9HA 2QI8A 4HYSA 4DTAA 5HX8A 2FSLX 2C6MA 3BYVA 2ITZA 3F88A 3LCKA 5LVOA 3QUPA 2OF4A 4AGUA 4JVGA 2A1AB 3C5UA 3U4UA 2VV9A 4LV8A 1Y57A 3GQIA 4U94A 4IZAA 3G15A 3BLRA 3DK3A 4IE9A 4DEAA 3QA8A 5CSXA 4XP0A 1Y8GA 4GKHA 1J7UA 4LL0A 2YIYA 3ERKA 3LIJA 5CEIA 3G6HA 2BCJA 3S0OA 3MWUA 4UZHA 5IQEA 5AP1A 4RIYB 3CGFA 5LJJA 3OMVA 4QP4A 3AD5A 3DAKA 5AP4A 2YISA 4I5HA 2WZJA 2J7TA 5ANOA 5CXHA 2UW0A 2XIRA 3Q6UA 1NT2A 4YBJA 1YOJA 1W82A 3QRKA 3ZRMA 2CJMA 3FL4A 5ANKA 4ZSGA 4BTJA 5L2IA 2I0EA 4EH5A 2C6LA 4MEDA 4OTRA 2UW3A 2X7FA 2WO6A 4FG8A 4FNZA 2YERA 4I6HA 4J95A 1OBGA 3QGYA 4K77A 3SRVB 3UVQA 4FKIA 2UV2A 4RJ3A 4FKRA 1TQMA 4BCOA 3DBDA 4B0GA 4NJDA 1OBDA 4MQ2A 2WPAA 4FV5A 4I1ZA 3VBQA 4V0GA 5H2UA 3S1HA 2UW8A 4C38A 5IA3A 5E1EA 4ZZNA 3FKNA 5L8JA 3LFBA 3ULIA 4BDGA 4TYGA 3ORTA 4ALWA 3D7TA 3ET7A 2BRGA 4WSYA 4X2NA 1M14A 3SAYA 3WYXA 2C5NA 4QMZA 2G2FA 2A19B 2X2KA 4GU9A 4E4MA 5AA9A 2ZM3A 4EHZA 2YWPA 2EB2A 2XBAA 3AGMA 5HESA 2IW8A 4AZSA 1GZNA 3CIKA 3R1QA 1OL2A 3B8RA 2GPHA 2JITA 2RFEA 3OY3A 3FXWA 1FQ1B 4U0IA 3MFRA 4E1ZA 2YZLA 3A7GA 4FV3A 4OBQA 3QA0A 3UE4A 3DDPA 5FQDC 1JWHA 4J8NA 4E4NA 2VTRA 5E8VA 3DXNA 3TI1A 2R3MA 5AIKA 4F1MA 2UW6A 4BTFA 3RK5A 3EN5A 4LUEA 4PV0A 1ZRZA 4FNXA 3LW0A 4A7CA 4AA4A 2QOQA 2V62A 3ZM4A 2NRYA 3LM0A 1PMEA 1OZ1A 5C4KA 5K5XA 3F66A 4FTIA 4UN0C 4NCTA 5T6KA 2YJSA 4ZTMA 4CCBA 3EQIA 1F3MC 3BGZA 4JI9A 4CCUA 3A4OX 4HCTA 2OFVA 3MBLA 5HICA 4EH6A 4D2RA 5BVOA 5HBJA 3R9DA 1FBNA 2UZBA 3E64A 3E8EA 3JVRA 4JS8A 4RIOA 3L8PA 4L52A 1DAWA 4O96A 3ZSHA 2RG6A 5K3YA 4A9RA 5C8KA 1OIUA 2VTOA 5M4CA 3P7CA 3IW4A 3N51A 4CSVA 3EFWA 4FNWA 4YO4A 2GHGA 2Z7QA 2HZNA 5IH4A 1S9JA 3FEGA 4NU1A 4O7VA 2R3OA 3CSVA 1E1VA 2Y7JA 4ASXA 4EQUA 1EH4A 2YAAA 3BHVA 4MBLA 4F65A 4D9TA 4DBNA 4FG7A 1XJDA 5HLNA 3UQFA 2BRHA 2ZV7A 3KA0A 3VNTA 2B9FA 3QZIA 4WNMA 2BFYA 5G6VA 1W83A 4FL1A 1E1XA 2Z60A 3ZFMA 3IONA 3ZS5A 4HCVA 4ZJVA 4D4SA 5CEKA 3LVPA 3ETAA 2JIUA 2WTJA 2QOCA 4D55A 4ZIMA 3CEKA 4FV0A 4L7SA 3P5KA 3Q9XA 3IW6A 3EQRA 4L7FA 2J5EA 3LE6A 1G8SA 3QRUA 3RZBA 5FXRA 4BCNA 3ZOSA 3BLHA 3DK7A 3BEAA 3UNJA 1WBVA 1ZY5A 2PUIA 5FBNC 3D83A 4AW2A 5FDPA 5AP7A 4ACHA 5K5NA 4DFLA 4U42A 3LFSA 4K0YA 3MY1A 3ZUUA 3GVUA 1NY3A 4EH8A 2OICA 2FYSA 3SA0A 1ZLTA 2IO6A 1Q24A 2IZUA 3COMA 4IDVA 3RPYA 5K9IA 5HX6A 2IZSA 5HU3A 3O0GA 4BDCA 3FZSA 3MW1A 5B2KA 2H8HA 4DEHA 4AT3A 4EOLA 1H1PA 2GNFA 4P90A 5CT0A 5IQAA 4AF3A 2BDFA 4FTMA 4RWKA 3R63A 1LR4A 4YJPA 4M97A 3PPJA 1OL5A 3CPBA 3GCQA 4I5CA 4U3YA 2XA4A 4O7LA 2XIXA 2PL0A 4FVRA 4XLIA 5J5SA 2YCFA 4O7ZA 5LARA 4AGCA 4YSMA 4AP7A 5ITAA 3DKFA 3MVHA 3BQCA 2QODA 3W16A 2P2HA 3AT4A 4IACA 4RJ7A 4AW0A 5DLSA 4Z55A 3ZONA 1MP8A 3KK9A 2C47A 4F1OA 4WHZA 5KMJA 1GIHA 1O6LA 1SVGA 3U54A 4C4FA 4RFYA 2ZB1A 4GFGA 1JKLA 5ETCA 4EWQA 4I6QA 4ZTRA 4F9BA 4FTNA 3D2KA 4TWPA 3WOWA 4HPTE 4HYUA 3R8MA 3UP2A 4HVIA 3SXSA 4D0WA 4UEUA 3UPZA 4WOVA 2YDIA 5C1QB 2YEXA 3KRLA 5IQBA 2ZV8A 5E8WA 3C4ZA 4YC8A 1URWA 2KULA 3TZ9A 3FZOA 5IA2A 5FLFA 4O0VA 4X2GA 1CMKE 3NW6A 5JRQA 1XH6A 4N70A 3BV3A 1YDTE 1UWJA 5L3AA 4U98A 5LOHA 3KXNA 3AT2A 3TKIA 4O86A 5CF8A 4YZBA 3TZMA 2XCKA 4F6UA 5KBQA 1O9UA 3NSZA 4WD5A 3ALOA 4TN6A 4JQ8A 4OTHA 4A9TA 3A7IA 4I20A 3CY2A 5HIEA 1PXNA 2V55A 4YJUA 5A14A 3TDVA 3W2PA 5IEXA 2ONLA 2I1MA 2PUPA 1DM2A 2JBPA 4JBOA 5J8IA 3SKCA 2WKMA 2ZVAA 3QRIA 4RZWA 4V0GB 3FE3A 3QYZA 5KO1A 4Q5HA 4EK4A 4RGJA 4NWMA 3ZCLA 5FRIA 3MSSA 1KE5A 3P9JA 1I09A 4XP2A 3TG1A 3PZEA 5CSWA 3ORKA 4CV9A 2A2AA 2J6MA 4IZ7A 1MRYA 3BQRA 2GMXA 4R77A 4AZWA 2WTKB 1YKRA 2VAGA 3PA3A 4RWJA 5ACKA 4E26A 3D7TB 5LWMA 3F5XA 5DI1A 5KMOA 4EC9A 2V5QA 3LXLA 3U8WA 4DGNA 2ZMDA 2VWBA 4DTBA 3UTOA 1LP4A 4PTCA 4XLVA 2CGXA 4C61A 2R3QA 4GCJA 3KRRA 4X2FA 4XV1A 1DAYA 3MN3A 3LOKA 3PPKA 2JGZA 5DYJA 3PSCA 3ANQA 3QWJA 4IEBA 1ZYJA 3W33A 2X8DA 2ACXA 3D9VA 4AE9A 5HTBA 3QXOA 2IG7A 2EUFB 4ZK5A 4O6LA 2F2CB 2FVDA 3THBA 3ZTXA 5EKNA 3I1AA 2PYWA 3CPCA 4FEWA 5DIAA 2GHMA 3EFKA 4IWOA 3NCZA 5HCXA 4RX5A 5DFPA 3FKOA 3DCVA 1M2PA 3Q4CA 4FVQA 4U81A 1OKZA 2ZYBA 3PVGA 5BMMA 2IW9A 3BE9A 4O0WA 1XHAA 1ZZLA 2XZSA 4KNBA 4ZY6A 3IKAA 5FTOA 4IVDA 5FTGA 4FSYA 1BL7A 3BRBA 3ACKA 3TKUA 2OWBA 3C50A 2JAVA 3ITZA 3F2RA 3KULA 3MA6A 3ODZX 3OHTA 4FOBA 4Z9LA 5AAFA 4WG4A 4FTCA 5TF9A 4IC8A 3FMLA 4C02A 3RHKA 3E5AA 4YURA 3W0QA 3H10A 5EYCA 4EL9A 2UVZA 3PJCA 3V5LA 3PY0A 3U9NA 3NEWA 4FK6A 2VNWA 3NWWA 1WBPA 3A62A 3CGOA 3VHEA 5J9YA 5LVNA 2VTMA 3QQJA 1KE8A 3G2FA 3OY1A 4XRLA 3EOCA 4QMXA 3DXQA 4FICA 1OMWA 4BN1A 2CCHA 3GCSA 4FIFA 2IZRA 5EDQA 3QHRA 3QTRA 4ZP5A 5AUTA 3VBYA 2W5BA 1V1KA 4H39A 1NA7A 3K5UA 4EZ7A 5JQ5A 4R6VA 2Z8CA 4Z7HA 3TWJA 3K2LA 4QMPA 1Y6BA 4RG0A 3SOAA 4M7IA 1FVVA 4FEQA 3HMNA 4DEIA 5HG9A 1CDKA 3VS1A 4HGEA 1Q61A 1H1QA 4DE4A 4XCUA 4BZOA 3V8SA 2F7ZE 5KKRB 4AWIA 1CKPA 3OROA 3PSDA 1L3RE 4FIGA 5IH6A 1Q8ZA 2OZAA 2DYLA 2WMVA 5ETIA 2QNJA 4YZCA 4GW8A 4I94A 4UZDA 4EOKA 2UZDA 3VS3A 1HCLA 3LJ1A 4NCTC 5CASA 2VWXA 4N57A 4ZTQA 2R7IA 1I44A 2GS2A 2OJIA 3UG1A 2ZJWA 4JAJA 4CFMA 3AMAA 4APPA 4FTRA 2C1AA 4MD9E 2BR1A 2J50A 3CS9A 4ORKA 5A4TA 1P2AA 2SRCA 5BUIA 3NUPA 3RM7A 4JX7A 3RWQA 3O96A 4B7TA 1T45A 3KRXA 4PNIA 4EBVA 4AN2A 3ZC6A 2PTKA 2F2UA 4MXZA 1V0PA 3W2RA 2HXQA 2PMLX 3R02A 5GHVA 3SXFA 3TXOA 2E9VA 4HYIA 1WVYA 4ERWA 5AV1A 2ZV9A 3PE2A 3SC1A 4DTKA 3F5GA 2W1ZA 5EDPA 4F99A 3TZ8A 5AP2A 4LQMA 2VZ6A 4OW8A 4PDSA 3HP2A 4IM0A 3Q32A 2P4IA 4FV1A 4L3PA 4FG9A 2H6DA 4ZSAA 5D41A 1YOMA 4YC3A 4LI5A 3ZU7A 5IA5A 4YTFA 5CI6A 1Z9XA 4I23A 3QCQA 3PE1A 4ZS4A 3ZC5A 2DUVA 3WIGA 1J1CA 1PXLA 3A60A 4L9IA 3SLSA 5KKRC 3QTSA 4BCGA 3EJ1A 3ORNA 4NYEA 3EYGA 4GMYA 3E87A 5B2LA 3F3UA 3HAVA 5CVGA 4RA5A 4XG6A 3T9TA 5CAOA 2QU6A 3VQHA 2WHBA 1SYKA 1UKIA 3ENHA 3BBWA 2W1GA 2OJ9A 3DJ7A 2X2MA 3E7OA 2YCRA 3OXIA 5CU4A 4F4PA 3ODYX 2JBOA 2G2HA 4AOJA 2GNGA 4N6ZA 2EXMA 3P7BA 4D1SA 3UIXA 3BYOA 4FKGA 4B8LA 4CZTA 4R5SA 4A9YA 2WOTA 1OIYA 1V0OA 4FT0A 3ZO3A 3UDBA 5DEYA 3UIMA 5JFXA 4D28A 4FKOA 4YJSA 2X1NA 3CLYA 4G31A 5DBXA 4CG9A 5LCJA 1JQHA 2CPKE 2J90A 4HPUE 1IA8A 4RC2A 4EHGA 2BFXA 3PY1A 2I6LA 3DPKA 4R78A 4LGGA 2WQEA 5I9ZA 3BHYA 3W0OA 1M2RA 3Q4UA 4FTKA 3BCEA 5CX9A 3JY0A 3HLLA 4C59A 3R28A 2E9OA 4FUXA 4L44A 4H1JA 3C0IA 3ORZA 1PKGA 3TKHA 3K3IA 4I93A 4CLIA 3QKMA 4XS2A 2UZVA 3QWKA 1RDQE 2ZM4A 4AZVA 4BZNA 4ZY4A 3CJGA 2CGWA 4FZAB 3L9NA 4KIQA 4OTDA 3UOJA 3RWPA 4HGSA 3VJNA 3NUSA 3HV6A 2BUJA 3RJCA 4F1TA 4U7ZA 4J98A 5H8EA 3OT8A 2E9NA 4R3RA 5KNJA 3AG9A 4JBQA 4LFIA 3QX4A 1KWPA 4IX5A 5EM6A 4ZTHA 3L8VA 5CT7A 3CTQA 5M06A 3O7LD 5EM5A 4JAIA 4PL4A 5KE0A 2OK1A 3QZFA 5DT4A 3SHEA 4EJNA 3GOPA 5HIBA 2XRUA 4AN9A 3OF0A 4F9WA 4XX9A 2EWAA 3HEGA 4MXYA 5CAQA 3FI2A 4OBOA 1FINA 1YDSE 5JGAA 3VWAA 5A4EA 4FUYA 5BYLA 4EI4A 3KULB 4FVPA 4QP1A 2XJ1A 3A7FA 5BX0A 2GNIA 2ETRA 2FO0A 4YTIA 3PXRA 4YSJA 3EN7A 3UZTA 5HG7A 4MAOA 1KSWA 3LFAA 2HY81 3DS6A 3BELA 2ITPA 3DAEA 2JDRA 3L8XA 3N9XA 3QZHA 3DBCA 3GEQA 5A6OA 2PY3A 3O8UA 3UC3A 4YJRA 2VWIA 4ERKA 4XJ0A 5AM7A 3F5UA 4B6LA 3W18A 3CR0A 4DBXA 1PMNA 2OBJA 5KZIA 4MYGA 4YLKA 2XYUA 3PDTA 2WTWA 4Z3VA 1BMKA 3QX2A 2WTDA 4YBKA 4EK8A 5FEEA 4HZRA 5HNBA 4CFXA 2XK8A 2XNPA 5HTCA 1Z5MA 3GU5A 4MWHA 3NUYA 4GK4A 3FMEA 4YNEA 3ZXZA 3G5DA 4Y5QA 1LEWA 1S9IA 4MXAA 3VJOA 4E5WA 3E3PA 2AUHA 1YI4A 2OIQA 2REIA 3QKLA 4USDA 3QTXA 4F7JA 1OPJA 4IANA 4WZYA 1ZMWA 3ORIA 4C4IA 2JDTA 2Y6OA 3R0TA 4KA3A 3SG9A 5D7VA 4L46A 3VUHA 4XOZA 2OZAB 2QOHA 3NMUF 3CCNA 3R9OA 3FMHA 3HP5A 4I0RA 3NNUA 3FXZA 4XMOA 4AFJA 4Q9ZA 5DR2A 2WB8A 5ANJA 2VO3A 4XG8A 4K9YA 3QQHA 4Y8DA 4HVGA 4QMUA 2HW7A 4EBWA 2XIZA 3VS5A 4DAWA 3KFAA 4BKJA 1H27A 1PHKA 3PP0A 3LJ0A 4NUSA 3R22A 2R64A 4BCKA 4F63A 3HUCA 1Q5KA 1WVXA 5M53A 5B7VA 1UNLA 5DGZA 2I0VA 4Z7GA 4YZNA 4IAKA 2QOFA 1LEZA 5CYIA 4JT3A 4DT8A 4CKRA 4GH2A 4B9DA 3QD4A 4EUUA 5HCYA 1ERKA 2BAKA 4H36A 4L01A 4EOMA 5DH3A 4IW0A 1JSTA 4CFNA 4TWNA 1W0XC 4QTEA 1IRKA 2OH4A 2ZMCA 3I0QA 2WMUA 4EJ7A 2C6IA 4G9CA 1J91A 4I21A 4KWPA 3ANRA 3HYHA 4AW5A 1J7LA 5D12A 3AGLA 2PVLA 3E8DA 3UIBA 4DEBA 3AC2A 2OF2A 4LOQA 5KUPA 3HV5A 3ZLXA 2QD9A 2RFSA 4YZDA 4M84A 1GNGA 2QOBA 3TV4A 3NX8A 2ETMA 1YI6A 5CANA 4AOIA 2JKQA 5CVFA 3REPA 2WQOA 4OTWA 2HZIA 4L6QA 1R1WA 1XH4A 2C5XA 3QCSA 4IWPA 4PP9A 3CC6A 4X3JA 4AT4A 4BYJA 4GYGA 2Z7SA 3LMIA 3V04A 4OBPA 4BIBA 1TQIA 3DKOA 5KBRA 2QKRA 3R8LA 2BMCA 4GEOA 1KUTA 4RZVA 4BDJA 3U6HA 1XR1A 5ETAA 2BRMA 1XH7A 3NW5A 4QMNA 2WELA 2XNEA 3HV4A 3KF4A 5IQFA 5CZHA 2FH9A 3SVVA 4RC3A 2PHKA 3Q9YA 4FEXA 3ZXTA 3NPCA 3PJ1A 5J7HA 2O63A 4XRJA 1BI8A 2OKRA 3A7JA 3OWJA 4CD0A 2VO7A 4QQTA 1J1BA 4FYNA 2QO2A 2QOKA 4D1XA 1ZOGA 1R78A 5HHWA 1L8TA 5EYDA 3MI9A 1P4FA 2VWVA 3TN8A 3ZZEA 2BZHB 4K1BA 3CKWA 1MQ4A 1GIIA 5CALA 3OWLA 4ITHA 2RL5A 5A6NA 2JIIA 3AXWA 5AWMA 4W4XA 4BGGA 3CBLA 5JKGA 2WTCA 4IVCA 5HVJA 2WQMA 3VRZA 1KOBA 3OTVA 4FTTA 2Z2WA 4GJ2A 1VYWA 4WUNA 3RGFA 3WF6A 1YXXA 4LM5A 1WVWA 2R3GA 2JDOA 2YIWA 4QP7A 5LXMA 4PL3A 1Q3WA 5FP5A 3SGCA 3OTUA 5JSMA 4QPSA 3DJ5A 3G0FA 3L1SA 4EZ5A 3W0SA 4L67A 4U44A 4BIEA 3FZRA 2VN9A 5CEPA 3GP0A 4IC7A 1J3HA 4KIPA 4RSSA 2VUWA 4WG3A 1PXMA 4O7SA 4U45A 4QNAA 2J51A 3A4PA 2HWOA 2H34A 4J71A 4PL5A 5EQEA 4ZLOA 4YJVA 3W10A 4RVKA 3UG2A 3MESA 1BUHA 1PMUA 5EW9A 5AFVA 4FEVA 2B54A 4JX3A 4O0SA 5HG5A 3R00A 4BGHA 3MS9A 3EN4A 5C26A 3FHRA 4Y83A 3HAMA 5LVPA 1RQQA 3GFEA 2IWIA 3UJGA 3UGCA 4U41A 4X2JA 5F1ZA 5AUXA 2UZWE 4QQJA 4E4LA 2UVXA 3FC2A 1XWSA 3GU7A 4FSNA 3DBEA 3PRFA 2WFYA 3H9OA 4EH3A 4K8AA 3EWHA 1JNKA 2XYNA 2O5KA 4PX6A 5M4UA 3VBVA 4BC6A 2XH5A 3FQSA 3NAXA 4AAAA 3QRTA 4EWHA 4ZOGA 4DFYA 5IDNA 2YM5A 2BHHA 3ZLYA 4FV2A 2IJMA 4E7WA 2XVDA 4QMSA 2UUEA 3JXWA 4ANQA 4YP8A 4BDEA 2OZOA 2W1IA 4BCHA 5M56A 3ZBFA 1VYZA 3QD0A 3PZHA 4G3FA 3LKMA 4AE6A 3OW4A 2HXLA 2ITNA 4JG7A 3BKBA 1JKTA 1YHWA 1ZOEA 3O8TA 2WQNA 4BYIA 3R8UA 2UZUE 4ASDA 3K3JA 4R1YA 3WZUA 2VWWA 5FM2A 3HRCA 4C58A 4F9AA 2OO8X 4BDBA 2HIWA 5EOLA 5L6WL 3BIZA 4IB3A 3FLZA 4L43A 4PMTA 5A4LA 4S2ZA 4CQEA 3LXKA 3W8QA 4KRDA 2R9SA 4B99A 2ERKA 4S33A 4USEA 3LFFA 2Y4IC 4PF4A 4YHFA 4PUZA 5HG8A 4ONAA 3R04A 3MVJA 4M8TA 4YJTA 4EH7A 4GK3A 5K4JA 4QYFA 2PZRA 2ZDTA 5AEPA 4F09A 2OLCA 3BLQA 3F3WA 3EQHA 3RAIA 4AGDA 3B8QA 3C4XA 5CF4A 2QO7A 4MH7A 3JPVA 1KV1A 4I5PA 4QPAA 3MPAA 4HNFA 4G1WA 1GZ8A 4C4GA 2XNNA 3E3BX 4ID7A 5LMKA 4A4XA 3EB0A 4NTSA 2HELA 3IGOA 5BVEA 5E92A 3O23A 2OW3A 2ITVA 1YRPA 3DLSA 3UNZA 2XJ0A 3CY3A 3BWFA 1FPUA 4IMYA 3SX9A 4RMZA 4HVSA 1U5RA 4J52A 3BGQA 4G5JA 4V01A 4FV8A 2B55A 2WNTA 4GYIA 5ACBC 3AMBA 3OP5A 4EH4A 3SXRA 5M57A 4C2VA 2F4JA 3TIZA 4ZS0A 3II5A 3UVPA 4CZUA 4YPDA 3QTIA 4FSRA 4QMYA 3T3UA 4ZLYA 5IUGA 3MB6A 5C4LA 3UNKA 4DG2E 5E1SA 2PVYA 1YQJA 2PVNA 1YW2A 4UYNA 2RG5A 4YTCA 4FOCA 3O50A 2PWLA 3WF5A 1FGKA 3Q53A 4YC6A 4AW1A 2C6TA 2OSCA 2FSTX 3FZ1A 3R7VA 1QPCA 3O17A 4L45A 5I9UA 4FI1A 5HIDA 3LMGA 4W4WA 2B0QA 5L8KA 5IQDA 5H8BA 3O51A 4BY9E 3KU2A 1OKVA 3P08A 4QMLA 3NNXA 3FXXA 3V5PA 3MFSA 2RFNA 4DG3E 4JXFA 4XOYA 3DY7A 5J95A 4C3RA 3PY3A 1PXIA 3EH9A 2WMAA 3NUAA 4RT7A 4FL2A 3BYSA 2HYYA 4CMUA 5J1WA 2YM7A 3L9LA 4FGBA 5JZNA 3V6SA 2WQBA 4RJ4A 3MVMA 4DH5A 3G6GA 2XCHA 5HZNA 4CFWA 4G6LA 2G2IA 5FG8A 4AGWA 4J96A 5ANDA 3NNWA 3GCVA 3RNIA 2GS7A 3W55A 2GFCA 4JBVA 3UO5A 5E8SA 4BI2A 3E7VA 3HRBA 4DGOA 3E8CA 4QOXA 1Q99A 1XH5A 4DH7A 4IX6A 2XKEA 1QPDA 4KB8A 3R6XA 2P0CA 3KRWA 1OPLA 3NIEA 3BU5A 2B7AA 2ITYA 2OH0E 4ACGA 4CTBA 4F6WA 3FY2A 3FLNC 4PQNA 2BHEA 4OTIA 4XBRA 4ACDA 4CT1A 5AV4A 2ZV2A 4QQ5A 4AACA 4CKIA 5AAGA 3DBFA 3HV7A 1CKJA 3SV0A 1J7IA 2ETKA 4DN5A 3LQ8A 5CU2A 3CQWA 3PG3A 5M4FA 4U43A 4HNIA 2W99B 3GOKA 3OXTA 4FIIA 5IF1A 4QYEA 4RVMA 5EQPA 5JK3A 2VTIA 2VTPA 4H1MA 4IAAA 1JKKA 4LGHA 3ELJA 4I0TA 3ZYAA 2OIBA 3P79A 4UALA 5DPVA 2CKPA 4I3ZA 5DR6A 4QTCA 5CSVA 5E8UA 4PP7A 1JBPE 4IFGA 1YWNA 4AZEA 5M51A 3AC3A 3F3ZA 4EONA 4FGRA 4MK0A 3DFAA 3QHWA 2HY0A 2G15A 2WIHA 3OXZA 4MNFA 3WF8A 4BHZA 4Y85A 2GFSA 5KZ0A 3AQVA 3WARA 5HNIX 4WT6A 5FXQA 4X6RA 2ITXA 3IO7A 4KS8A 4UWCA 3AMYA 3NCGA 1O6YA 3W0RA 3PJ3A 3C1XA 3DTCA 3PRIA 2R7BA 2VTNA 4Q9SA 3JVSA 1FMOE 4NZWB 4IM2A 2PE0A 4BICA 5BYZA 3NYVA 3EN6A 2HENA 2JKMA 3DNDA 5C27A 3DZQA 3K5VA 5DA3A 2CLXA 4IB1A 3WYYA 3DNEA 2VTSA 4DC2A 5E91A 5HE3A 2Y6MA 3R2BA 4DH8A 1PJKA 1YI3A 5LQFA 4QYYA 3MPMA 2PVKA 2YDKA 1LPUA 4DEGA 5JZJA 2CGVA 4F6SA 2GNHA 1JLUE 3TUCA 1O6KA 4O27B 5CI7A 5HO8A 3C51A 5AP3A 2CHLA 1URCA 2Q0NA 2V0DA 3RI1A 3D5UA 2W96B 2IN6A 3D5XA 4M13A 2NPQA 2WEVA 5CEOA 4BGQA 2EXCX 5GINE 3KL8A 4H58A 5IU2A 3NYOA 3DQXA 4YJNA 4JRVA 3I6UA 2HOGA 3QL8A 4Y73A 4IDTA 2GQGA 2Z7LA 5EDRA 1APME 2PVMA 2CLQA 3IQ7A 5JFWA 1OVEA 4TXCA 4D58A 1PYXA 3KQ7A 2XK9A 3I5NA 5CNNA 4EK6A 4EQCA 3NVKI 1JVPP 2F9GA 3P86A 3P7AA 1H8FA 4X0MA 5BUEA 1WBNA 3E92A 5I9YA 4CGAA 3KREA 4S30A 4Y95A 2RIOA 5GJDA 4PRJA 4ANBA 2XK7A 3W2OA 1WCCA 4O0TA 3LXPA 4N4SA 1A48A 5FP6A 1DI9A 2X0GA 3A8XA 4IJ9A 4BRXA 4WNOA 1ZAOA 4CRSA 3CTHA 1F5QA 4GUBA 1UNGA 3DKCA 5IA1A 4FTQA 3QZGA 5AV2A 2WAJA 1Q8WA 4UWBA 3RPOA 1MUOA 1R0PA 3Q9WA 2PSQA 3NUNA 3DA6A 4DFUA 4FZ7A 4A4LA 3EQPA 5JH6A 1B39A 3W0PA 2X39A 4BCQA 3QCYA 4EQMA 3FI8A 4RRVA 5HQ0A 4WKQA 3PP1A 4TPTA 3ZBXA 1SNXA 3WF7A 2HZ0A 2NRUA 3DB6A 1BL6A 2EVAA 2W4OA 5AX3A 4AA0A 5AA8A 3M42A 3W2CA 3QC4A 1G8AA 1YXVA 5L6OA 4JDHA 3EQBA 3VIDA 3RMFA 3ACJA 3TNHA 3HA8A 2W4KA 4D9UA 2B9HA 2ERZE 3AC8A 4OT5A 4UY9A 5DT3A 4NW5A 4ZSJA 5M44A 3R7OA 1K3AA 1YHSA 1XBCA 3C9WA 4C62A 3VS4A 4HW7A 3EMGA 4IAIA 2G9XA 1NXKA 1KV2A 3D15A 4NT4A 5E8XA 3BZ3A 4E20A 1ZARA 3RKBA 4J7BA 4GU6A 3JYAA 4H3QA 3VF8A 5IZFA 2O2UA 3BBTB 3Q6WA 4BDAA 5E8TA 4BIDA 3BHTA 1M52A 4NM7A 2YM8A 5EFQA 3TNPC 4FSMA 3QTWA 1P14A 2WEIA 3MVLA 3GQLA 1RJBA 3U87A 1OL6A 4LYNA 3HMIA 4FSWA 2JFLA 1PMVA 3PWYA 1KE9A 5FTQA 2UZEA 2JKOA 3OUKA 4D4VA 4XNEA 4NTTA 4FKPA 1ZYDA 2PVRA 4YHTA 5A54A 2XEYA 4R3CA 2P3GX 1U54A 3RM6A 3E63A 2VTAA 3R8PA 4AG8A 4JIKA 3R21A 3Q5IA 4A9UA 5E90A 2QOLA 5AUYA 5HO7A 5CAVA 4L00A 3Q4TA 3PVUA 3ULZA 2ZOQA 4CVAA 4O7WA 3R7YA 3PLSA 4GT3A 3SDJA 3ZO2A 5HE2A 2YA9A 4FL3A 4MD8E 3FDNA 4QP2A 1XH8A 2QLQA 4CKJA 4FIHA 3HL7A 4I4EA 2W7XA 2QO9A 2O8YA 2XKFA 3ID6C 4ZMEA 4YJOA 5AUUA 1BKXA 4RBLA 4L68A 3OZ6A 4YNOA 5F94A 4EOPA 3MFTA 3C13A 4DEDA 3H30A 4O0XA 5HGIA 5KMLA 4TZRA 2A4LA 2C6OA 3ZLSA 4DH3A 3UOHA 4PMPA 1UU9A 4A4OA 1B6CB 3QCXA 1PF8A 3IOPA 3UMXA 5EI2A 5EK7A 3D0EA 3Q04A 1F0QA 5FD2A 5EG3A 1H1RA 3NRMA 4MKCA 2PK9A 3ROYA 3SW4A 4FK3A 3UYTA 4BCIA 4YHJA 4I0SA 3QGWA 4K6ZA 2RKUA 3IG7A 2UZNA 2GTMA 3JY9A 4LRKA 1MQBA 2PE2A 4MHAA 4XYFA 5EYKA 5I9XA 4R7HA 2JLDA 3BV2A 1FMKA 2YZAA 3MV5A 4TY1A 3SW7A 3WZKA 1PYEA 4XG3A 1JAMA 4PDYA 5DEWA 3NYXA 3T9IA 3ATSA 5EQYA 3ZFYA 5HVKA 3BX5A 3VAPA 4EOOA 5AM6A 2BILB 2XRWA 4IAZA 3GFWA 2GS6A 3DB8A 1GJOA 2J0KA 4XUFA 1CM8A 3FHIA 2W06A 4DYMA 2XM9A 3D5WA 2X7OA 4FIJA 4P7EA 2DS1A 3TTIA 3VS7A 4O22A 3VUKA 4ALUA 3TNQB 2F7XE 2C5OA 1SM2A 3POOA 3EZVA 2QURA 3V5TA 4D0XA 1H25A 5HI2A 3KEXA 4Y5HA 3POZA 4LOPA 1ZXEA 4BHNA 5EM8A 3HVCA 1ZMUA 1G3NA 2QC6A 3U55A 1GZOA 3GXLA 2QQ7A 3EFLA 4OTQA 3WBLA 4DF3A 2VWYA 4RLLA 4GKIA 2X6EA 4F7NA 4YJQA 4RVTA 1STCE 4ARKA 3DTWA 4ZZMA 2XEZA 3ZH8A 2XP2A 4O7NA 4X21A 5B2MA 2VO0A 3LLTA 3A61A 5D10A 5JEBA 2C30A 3UQGA 3ORXA 4FSTA 3U6JA 2XNGA 3K54A 3KY2A 3NYNA 4LV5A 4A07A 2BAJA 3TDWA 3HRFA 1QL6A 4CMOA 2IVTA 4GIIA 4QRCA 5DE2A 3TUBA 2ITWA 2QOIA 3P78A 3Q2JA 4J99A 3AOXA 5D9HA 3E88A 2AC5A 1H0WA 4G16A 4P4CA 2R3FA 2IZTA 4RWLA 3RAHA 4G6NA 4IAFA 3NUXA 3UZRA 5L2TA 3FLSA 2WMSA 3G9LX 1Q8UA 3ALNA 2YIQA 4R5YA 2ZAZA 4A9SA 3EHAA 2CNQA 3UVRA 3OS3A 5LMKC 4R7IA 4MX9A 3VS0A 4DFXE 2Y8OA 5E8YA 3PA4A 3VBWA 3Q5ZA 4KKEA 4C4HA 4EK5A 1VR2A 2FSMX 4EC8A 3R30A 3V51A 2BTRA 2Z7RA 4HGTA 4HYHA 4N6YA 4Y46A 3W1FA 5J1VA 5AV0A 4HGLA 2QG5A 2G01A 3R9NA 1K2PA 3V3VA 3MY0A 2BROA 3F6XA 4TYHA 3LMHA 4AZTA 3QTZA 3P0MA 3TNWA 4XP3A 3R8ZA 3JUHA 4TYJA 3GCUA 1ZY4A 5IMXA 3FKLA 1IG1A 2HAKA 3NVMB 3DKGA 4FR4A 4FZFB 3UOLA 2XM8A 5C8MA 4S34A 4FT5A 4PY1A 5CXZA 2J0IA 5AJQA 2JDVA 2V7AA 2CMWA 4O91A 4QTDA 2J0LA 5CNOA 4QT1A 3KMUA 3H9FA 5HLWA 2VTHA 3N4VA 3OWKA 4U6RA 1BX6A 1JSVA 5BPYA 5CVHA 1T46A 3VW6A 5FGKA 1YXSA 3DXPA 4I6BA 4WA9A 5EI8A 2P55A 4UYAA 5TT7A 2AC3A 4D1ZA 2ESMA 1K9AA 3HX4A 4I92A 4IBMA 5CQUA 5KMIA 4G3GA 5DOSA 1M17A 2YFXA 3TV7A 3VBTA 4BB4A 3QALE 3QRJA 2IW6A 5LVLA 5IG1A 2BKKA 2BZIB 3LPBA 4A06A 4FC0A 5DRBA 1OI9A 3EQFA 4L42A 4EYMA 4CMTA 1PY5A 4HOKA 3GBZA 1OIRA 4F64A 3RPRA 5KHXA 4FTAA 1U54B 2C3KA 4YR8A 4NH1A 2R0UA 4BVUA 2F57A 4FKSA 4UXLA 2QONA 3OCTA 3TL8A 3ZUVA 4U3ZA 1OB3A 2OGVA 3IGGA 5I0BA 4IM3A 3WE8A 3KKVA 4ZLZA 3JR1A 3RP9A 2WGJA 3BEGA 3I0OA 3BGPA 2YITA 4LG4A 1Y6AA 4RX9A 2X4FA 3GC0A 5JRSA 4GFOA 3QUDA 4FKTA 1PXKA 2UVYA 4GRBA 2PUUA 3FZPA 3HDMA 4O2ZA 3LFCA 2X7GA 4P5QA 1M7NA 2XK4A 4RJ5A 5AAEA 2Y0AA 2PMNX 4DGLC 1UVRA 1ZOHA 4CG8A 3DGKA 3I5ZA 1R0EA 1OUYA 4FX3A 1OITA 3H0ZA 3I81A 4IZ5A 3VULA 2QLUA 2XMYA 2PZPA 4FYOA 3VRYA 4E5AX 4FV4A 3MIYA 1ZWSA 3G9NA 5M07A 2R3PA 3PIZA 1H1WA 1U59A 2QG7A 2WU7A 4EKLA 5CEQA 4P2KA 3QKKA 4BI0A 4IWDA 1GY3A 1IAJA 1W7HA 2B1PA 3B2TA 1ZMVA 3QLGA 4IX4A 2J0JA 5HBHA 1YWRA 4FEUA 4F9CA 3AD4A 3P1AA 1FVRA 5DHJA 4JG6A 4UX9A 2GHLA 5F9EA 4KINA 3RVGA 4CLJA 2W9FB 2RF9A 3PTGA 3Q3BA 4YLJA 4JIAA 4FTJA 3QYWA 4EHVA 3A2CA 2CN5A 2R2PA 3OG7A 5BNJA 3CD3A 2PZIA 3UZPA 3HUBA 5L2SA 4JQ7A 3RHXA 2R5TA 5J87A 3QQLA 3C4EA 3HGKA 2RFDA 3FL5A 4RC4A 5KMMA 4EH2A 1P5EA 4FKVA 2WD1A 1QPEA 2W1EA 3Q2MA 2WMBA 2X6DA 5ANEA 4GJ3A 3O2MA 1PXPA 2I7QA 3VUDA 1A06A 3L9MA 4X7QA 2ZM1A 1R39A 1YXUA 5IPJA 4O81A 3KXZA 4EYJA 2QR7A 3ZHPC 4P5ZA 4EORA 1Q41A 2OXYA 5HBEA 2LGCA 3E8NA 3OCBA 3C4CA 3OEFX 4KABA 5IUHA 3I7CA 5M09A 4C35A 3DT1A 3OFMA 3OW3A 2LAVA 4D5KA 2WMXA 5KX8A 3EKKA 1JSUA 4OTGA 5E8ZA 1FVTA 1YHVA 2QHNA 1M2QA 3HMPA 3UC4A 5HE0A 4E93A 4I41A 3OCSA 3P23A 1JKSA 3ZDIA 1PXOA 4ASZA 3GB2A 4F0IA 3QLFA 1KOAA 1BI7A 2JFMA 3TIYA 1KE7A 3TTJA 4FMQA 3WZDA 3VN9A 4BDDA 4EOIA 5FBOA 1M7QA 2B4SB 1YOLA 2XK3A 3F82A 3P4KA 4OR5A 1REKA 4JR3A 2C5YA 4FTLA 4UB7A 3IPHA 4RQKA 5LMBA 3MDYA 3S4QA 4FA2A 5J9ZA 2XS0A 2VX1A 3FPQA 4BZDA 3IW5A 4MCVA 4MVFA 2BVAA 4QP9A 3S95A 3C7QA 4IZYA 5GIOE 4CXAA 4QTBA 4ZSEA 4M0ZA 4QP8A 3R01A 2Y4IB 4BTMA 3ZEWA 2ITUA 3RK9A 4W8DA 2C6EA 1WZYA 2XBJA 3EQCA 3FMDA 4O38A 3MTFA 4TNDA 5CQWA 3R9RA 4FV6A 4B4LA 1R3CA 3ZUTA 2UZLA 4ACMA 3DQWA 5KMNA 1XBAA 4FSQA 1SZMA 2ITOA 2IVSA 4I22A 4DH1A 3DAJA 3GGFA 2HWPA 3LCTA 4JRNA 5FEQA 4AUAA 3FBVA 4YMJA 4N0SA 3Q9ZA 4QYHA 3WF9A 2O0UA 3NUUA 3IDCA 1B38A 4BBEA 2X2LA 2C1BA 4J1RA 5AMNA 4IIRA 4NM0A 4NFNA 1RW8A 4TYHB 3EQDA 5C01A 5CAUA 3MA3A 5L2WA 5JQ8A 2CDZA 4DG0E 1H4LA 5AADA 3IDPA 5I4NA 5AP0A 1DI8A 4WUAA 2BKZA 4FE2A 4EUTA 3HMMA 3KN5A 4JLCA 3E93A 3IECA 4NM5A 3KMWA 2XKDA 4F70A 4QO9A 4M68A 5H8GA 2J2IB 3QQFA 1Q4LA 4OUCA 4K33A 4PNKA 4KIOA 3UBDA 3L9PA 4OT6A 5T68A 4BCPA 5IEYA 3SG8A 4XG9A 3OOGA 2YM3A 2WMWA 3D14A 4DCAA 3C0HA 5BQ0A 2F7EE 2X8IA 2B9JA 2VTLA 1QPJA 5CU6A 5DR9A 5DN3A 4O7RA 3V5WA 4K18A 3LCOA 4V05A 3OWPA 4F7SA 4GG7A 3AD6A 2QKWB 2O64A 3KN6A 4U8ZA 2R3IA 5CSHA 3A8WA 4O6EA 5IQGA 4DFNA 2GSFA 3UO4A 3M11A 2BZJA 2VTQA 2YACA 4OLIA 1WBSA 2XNBA 3ZEPA 4XHKB 1MRVA 4GS6A 2YIRA 1IAHA 2YHVA 3PSBA 2PZYA 4R7BA 4RJ8A 3LFEA 5GNKA 3VUGA 4DLJA 4WIHA 4E6AA 2UW7A 3RTPA 5CU3A 3UOKA 4E6CA 4MTAA 4I24A 2W5HA 3W32A 3BPRA 3IW8A 3WIKA 3FWQA 1H1SA 3C0GA 1Q8TA 1REJA 1SNUA 3OOMA 3V8WA 4J8MA 3VS2A 1OM1A 1UA2A 2XUUA 3GT8A 4IJPA 3RINA 3C4WA 3W0MA 3OUNB 4IFCA 3LFNA 5IDPA 4S31A 3FLWA 2J4ZA 4FIEA 3W2SA 4FKLA 3VHKA 3I7BA 4M69B 4NKSA 4MBIA 3A7HA 3R73A 4ITIA 3ORLA 5FM3A 3O8PA 3OEZA 1YVJA 2C69A 3KF7A 4W8EA 3PIXA 4U5JA 3QTUA 2J0MB 4Y72A 1RE8A 1OL7A 1G5SA 3GU6A 4YZ9A 2C0TA 3QQUA 4XV9A 4O82A 4AU8A 2WMTA 4YTHA 2BAQA 5TO8A 3R7IA 4H05A 4NSTA 5BYYA 4BI1A 1IA9A 4EKKA 3KVWA 2FA2A 4G9RA 4TW9A 4ALVA 5A9UA 4FT3A 3ZSIA 4II5A 4D2SA 4D5HA 5L8LA 3DJ6A 3NNVA 4QYGA 1ZYSA 3DK6A 3D5VA 1ZZ2A 4RLKA 4DEEA 3LCDA 4HVDA 4LMNA 1NVSA 3KXGA 2A0CX 2NO3A 3EL7A 2FB8A 3HZTA 3NW7A 4FBXA 4FTUA 4TL0A 3ZRKA 1H07A 4EOJA 4O84A 1GAGA 5FXSA 4FZ6A 5M08A 2XJ2A 4G2FA 5CY3A 5D7AA 4BCFA 1JOWB 2V22A 2W1DA 2RGPA 4X6QC 4O0YA 2HZ4A 3TUDA 1TQPA 4PTEA 3T8OA 4CV8A 4G3CA 1ND4A 4ZAUA 2OJJA 4CEGA 5CWZA 3BYMA 4EOSA 4EOQA 4MWIA 3ZO1A 1Y91A 4GFMA 5K4IA 4FKUA 4YZMA 2OXDA 5CENA 2C0IA 5CLPA 1OKYA 2IVUA 2O65A 4YO6A 3IOKA 4U97A 2ZDUA 5IA4A 3OBJA 3G51A 4ZTLA 4JDIA 1TVOA 4GVJA 5EW3A 3DDQA 5JN2A 4AS0A 3BI6A 1PKDA 5JMSA 3LJ2A 5KMKA 3CQEA 3U9CA 4IWQA 2A27A 4IH8A 2CGUA 4XEYA 3GC9A 3LQ5A 3PWDA 3CE3A 1H01A 2WXVA 4M0YA 1H24A 3ORPA 4C37A 3C5IA 5HEZA 4QMTA 4YPSA 3RPVA 1HCKA 3PXZA 2X4ZA 3BWJA 4FZDB 3AC4A 5IEVA 1ATPE 4Z16A 2UW9A 3F7WA 5HNGA 2VO6A 3JS2A 4U40A 5BUJA 2HW6A 5IMEA 2BALA 4IVAA 3PYYA 2VU3A 4G6OA 5T3QA 4LL5A 4QP3A 4WBOA 5JGBA 3V6RA 4DLIA 4EHEA 4H3BA 2CNUA 5D1JA 2X81A 4AFEA 4ZXTA 2PPQA 4O0UA 4CFFA 5EKOA 4F0GA 4YU2A 2Q83A 4IX3A 4AOTA 4FKQA 4UXQA 3HDNA 3IS5A 4V04A 1JPAA 2BIKB 3CQUA 1XQZA 2E9PA 2OIDA 2GCDA 4OTFA 4IQ6A 1MRUA 2OJGA 2EB3A 2R3JA 4O7OA 2F49A 1LUFA 3H9RA 3PVBA 3ROCA 4F7LA 2E2BA 2R0IA 3CXWA 3MTLA 3DZOA 1WBWA 3CTJA 3QU0A 4I5MA 4ZEGA 4JG8A 3UPXA 4XV2A 4NIFB 5L6PA 2VRXA 1CTPE 3QAME 5HVYA 4D4RA 5BVKA 3EIDA 3MH3A 1PXJA 3EYHA 3FYJX
chains in the Genus database with same CATH superfamily
1UU7A 3FY0A 2W17A 4W4YA 2ITTA 2JD5A 4TNBA 5EM7A 2AYPA 3R9HA 4ANMA 4TYIA 1W84A 4E73A 5IISA 5ANIA 3QD2B 4GK2A 3VF9A 4ZMFA 5HE1A 2H96A 5JGDA 3F5PA 4LUDA 3OC1A 4QMOA 3AKKA 2HK5A 3R1YA 3PG1A 4NK9A 3S2PA 4PTGA 4ZTSA 4O83A 5FUTA 3P5JC 4DDGA 4WO5A 5F4NA 2PMOX 3HV3A 3BE2A 3LAUA 5BV3A 1QCFA 3GC8A 4FNYA 5DWRA 4FT9A 4L3LA 4PWNA 1WAKA 2Y9QA 3FJQE 4R3PA 5DNRA 3RAKA 3DFCB 4BBMA 2X8EA 4BCJA 3BHHA 3F61A 3IDBA 4M15A 1A9UA 3IW7A 5C8NA 4ANLA 5JFVA 3LQ3A 5FEDA 2DQ7X 3ZO4A 3ZSGA 5J9LA 2O3PA 5TR6A 2YM6A 4J97A 4JJRA 4X2KA 2YABA 3FMNA 1XBBA 1VZOA 1GIJA 1BLXA 2VTTA 2C5VA 3WILA 2OXXA 3TCPA 4BDFA 2W1HA 4GT5A 3PJ8A 4JR7A 5AIRA 4BDIA 4TTHB 3TJCA 2PVFA 3LFQA 5CU0A 5KHWA 3FV8A 4ZJJA 2YDJA 4K2RA 1Q3DA 4IVBA 3TZ7A 4C3FA 2BIYA 3FI4A 3GNIB 1IEPA 3AC1A 1AD5A 3SD0A 2XIKA 1X8BA 2V7OA 4GT4A 1YWVA 3UQCA 4ITJA 4RIWA 3WI6A 4BTKA 4I4FA 3E62A 4NL0A 4E4XA 3FQHA 2W1FA 4BR3A 2WTKC 5IQIA 4O0RA 3F2NA 4RFZA 4GL9A 3TNIA 5GJGA 2PUNA 2CKEA 5IA0A 1WMKA 3COHA 3BU3A 1HOWA 1Y8YA 2QCSA 4KAOA 4L53A 3RCDA 5CSPA 2X9FA 1Q97A 4XG4A 3NIZA 4CFVA 1WFCA 3F3VA 2QU5A 4Q2AA 3V5JA 4ENXA 5I9VA 2UW5A 4YLLA 5HORA 5HLPA 4MXCA 1VJYA 3MJ2A 1H26A 4W4VA 4AQKA 1SMHA 2WTVA 5ETFA 4ACCA 3V8TA 3LLAA 3GC7A 4WRGA 2R3NA 3RAWA 2OI4X 3R2YA 2PMIA 4HJOA 4JBPA 5LMAA 2I40A 3Q60A 3ZFXA 3GU4A 4FV7A 4Q5EA 2JAMA 5BVFA 5CS6A 4EH9A 1Q62A 4IHPA 5TKDA 2BPMA 2WMRA 1OGYA 2OFUA 3MPTA 4U80A 4UBAA 3KGAA 4DINA 3HA6A 2OJFE 1OECA 5CZIA 4C0TA 4GVAA 3RPSA 5IQCA 1H0VA 3MIAA 4X3FA 4HCUA 4TT7A 2OU7A 2XNMA 4DDIA 3UODA 3DBQA 4XG7A 4DHFA 1WBTA 5H9BA 4RFMA 5I9WA 3COKA 4AT5A 4BBFA 4QMQA 3C4FA 3FLYA 3W8LA 2H9VA 3NGAA 4WNKA 3R7EA 1AQ1A 2UW4A 4DHJA 4ZY5A 4KS7A 1UV5A 2EU9A 3EFJA 3R8VA 3VVHA 3QF9A 4RX8A 4AA5A 5AV3A 2VGOA 3N4TA 3HMOA 4O21A 5B0XA 4F08A 2UZOA 2C3JA 4C2WA 3L8SA 2NP8A 3M2WA 4WNPA 5AUZA 2WTIA 4CNHA 4L8MA 4APCA 2OG8A 1U5QA 2PVHA 5HD7A 3F3TA 3R1SA 4HVHA 4OGRA 4O7TA 3AKJA 4XG2A 3GI3A 4MXXA 4UWYA 3KC3A 3FMKA 3D94A 3U4WA 4MNEA 4RIXA 1UU8A 2GNLA 4C36A 2J5FA 1W98A 3MGYA 4BF2A 2QHMA 3CD8A 4JOAA 4M67A 4FKWA 2C6KA 4AXEA 3GCPA 5JFSA 3NS9A 1Z57A 4GUEA 4MD7E 5BMSA 2YCSA 1H28A 4YGAA 4MF1A 3CJFA 3S00A 5F20A 2X9EA 2C0OA 3VBXA 1NVQA 3I6WA 1PW2A 4TRLA 3PFYA 4CRLA 3PXKA 4DGMA 4FV9A 5M4IA 2FSOX 3FPMA 3KMMA 4HZSA 4QNYA 3I60A 3FMMA 4F9YA 4QQCA 4AXAA 3VC4A 3VUMA 3BHUA 2P2IA 3PA5A 3FSKA 5EH0A 3QBNA 4KD1A 3VQUA 3S3IA 4RX7A 3QTQA 2YAKA 5CF6A 2HCKA 4FSUA 3PLAE 4JNWA 5IH5A 3KVXA 4FODA 4ZSLA 5G1XA 4O7PA 4UV0A 4ASEA 3RCJA 2C68A 2DWBA 2VWUA 5A4CA 4ANSA 3BL9A 3PFQA 4QDEA 4DCEA 3LXNA 2Y4PA 4IB5A 4JQEA 4IB0A 5M55A 2W0JA 4ZTNA 4EK3A 3ZM9A 1SVEA 3ZRLA 2YJRA 3KXXA 1GOLA 3Q96A 2CCIA 5CAPA 1Q8YA 4NW6A 1VEBA 3TM0A 4KSPA 3VO3A 3SQQA 2GNJA 3H3CA 1ZYCA 3QQGA 3MH2A 3TEIA 3WZEA 5IQHA 5JT2A 2ZB0A 2B9IA 3F7ZA 3LCSA 3QQKA 4FKJA 3G90X 2I0YA 4DITA 4KRCA 3LZBA 3Q52A 3LFDA 4LRMA 3EZRA 2BRNA 2CNVA 5LWNA 5KCVA 2IPXA 4I6FA 4RWIA 5CF5A 2YM4A 4RPVA 1XKKA 4RJ6A 4IAYA 5LVMA 4F0FA 1FOTA 3FYKX 2QVSE 3N4UA 4H3PA 3D2IA 1TFFA 5AX9A 4C4EA 4KBCA 4DHIB 4DFZE 5BVDA 2GTNA 3ATTA 3D7ZA 1QMZA 4FT7A 5F95A 3UIUA 4ENYA 5EHYA 4QMVA 2XK6A 4RIYA 3ORMA 5C03A 3H0YA 4QTAA 3MFUA 2NNWB 2WIPA 4USFA 5EHOA 2VX0A 3PXYA 4WBBB 4M3QA 3R83A 3AC5A 2R3RA 3BU6A 5TOZA 4BDHA 4KUJA 3KCFA 3HECA 3ZDUA 1PRYA 1V0BA 1BYGA 4KBKA 3I4BA 4IADA 2WMQA 4PDPA 3PXFA 3KXHA 3Q4ZA 3UO6A 5BVNA 1U4DA 4WRSA 2PE1A 5A3XA 2IVVA 1AGWA 2QOOA 3SRVA 1XH9A 3VS6A 4C7TA 4G34A 3B2WA 3PXQA 2YWVA 4PMSA 4U9AA 4C33A 1IR3A 3U6IA 2ONLC 4O2PA 2E9UA 2JEDA 4TWOA 2Z02A 3MH1A 2QR8A 5AUWA 2FGIA 1OL1A 1W8CA 3QUEA 5DT0A 2W5AA 3G0EA 3QFVA 3DLZA 1TKIA 3DOGA 3A99A 4S32A 4RIWB 2XIYA 1OGUA 3O7LB 5H3QA 4KKHA 5IUIA 3TYKA 3NLBA 3UYSA 3VUIA 4CFUA 2VNYA 5A4QA 2VGPA 2J9MA 3G33A 3QD3A 4C3PA 1KE6A 2B52A 2VWZA 2WU6A 4GG5A 2BRBA 5BVWA 5HU9A 3HKOA 3CKXA 5DRDA 3OT3A 3IK3A 3R7UA 3OCGA 4K11A 5E7RA 4MXOA 4XH6A 2PZ5A 4WG5A 4ZZOA 3EL8A 3EN9A 3T3VA 5AP6A 3FMJA 3LM5A 1CSNA 3F9NA 4RA4A 1H08A 3R1NA 2JIVA 4CTCA 3NAYA 3KRJA 3SOCA 4ZJIA 3FSFA 4M12A 5EW8A 3TT0A 2CN8A 3WE4A 4BDKA 2C3LA 4EEVA 2ITQA 2PU8A 2GQSA 2XNOA 4MBJA 5DVRA 3W2QA 2GU8A 4TWCA 1P4OA 4RVLA 4O7YA 3PJ2A 5D11A 1XO2B 3TJDA 3QXPA 4GSBA 1IASA 2BZKB 2C6DA 1YDRE 4BCMA 3HNGA 2VX3A 5AP5A 3UP7A 3MY5A 1OKWA 1UKHA 2R3LA 5AUVA 2Q0BA 2R3KA 4X3FB 4AAYA 3RALA 2C4GA 3U51A 4AZFA 2BTSA 1YXTA 3F2AA 3KK8A 4MQ1A 4M14A 4DT9A 3ENMA 4NJ3A 5A46A 4G3DA 1UWHA 3EKNA 5HCZA 2PULA 3F69A 5GIPE 3PIYA 5EYMA 4DA5A 3GUBA 3FAAA 2C3IB 4YUQA 1WBOA 2B53A 3V01A 2VD5A 4U79A 4DGGA 2P33A 3KB7A 2GQRA 2JC6A 3PVWA 3TV6A 3NZ0A 4XV3A 2CSNA 4TKSA 4E6DA 5ANGA 2G1TA 2BDWA 2XB7A 3FLQA 3CP9A 3DU8A 3R71A 2I0HA 4G3EA 5CEMA 4E8AA 4JDJA 5EOBA 4C4JA 2GDOA 2WOUA 4QMMA 5E9EA 2XF0A 3EQGA 1GZKA 4AX8A 4JL9A 5HD4A 2W1CA 2XAOA 3MYGA 3PPZA 2PVJA 4MNEB 5I5ZA 4QMWA 3QC9A 4RIXB 1NVRA 4PDOA 4LMUA 4E6QA 3ZLWA 2R3HA 3V5QA 1UNHA 3I79A 3ZZWA 3MH0A 5ICPA 5GJFA 3OVVA 5C9CA 3WZJA 3FQEA 4TYEA 1U46A 4X3FC 4JDKA 5FDXA 2JDSA 3H4JA 3NR9A 4GIHA 4GV1A 1H00A 2KTYA 4FSZA 2XALA 3ZMMA 3BYUA 2YIXA 4R1VA 3PUPA 3O71A 3UMWA 1NW1A 3AT3A 3DV3A 1SVHA 4L3JA 2CKOA 4XBUA 4EZ3A 5LCKA 1OUKA 3FUPA 1DS5A 3KXMA 4KKGA 4RQVA 5EI6A 5HKMA 4AQCA 3OBGA 4QP6A 4D4YA 3TACA 2UZTA 5DG5A 4B8MA 2R4BA 4E5BA 5CTPA 3FI3A 4LRJA 1OPKA 2XKCA 4NKAA 4PMMA 1OIQA 5E4HA 2YN8A 2W4JA 2W9ZB 4NM3A 3D4QA 4NFMA 2CKQA 2XAMA 3MB7A 4KBAA 3FZTA 2FUMA 3GENA 1FGIA 2JKKA 3GU8A 4KSQA 4DFBA 2YCQA 3KCKA 2VTJA 3M1SA 3COIA 3OD6X 4J53A 3VW8A 4G17A 4C34A 4CT2A 2BDJA 4FTOA 4DHZA 3RK7A 1CKIA 1UU3A 2W05A 3MJ1A 4AN3A 3FC1X 3NDMA 4G5PA 5EHLA 3LHJA 4LOOA 1E9HA 2QI8A 4HYSA 4DTAA 5HX8A 2FSLX 2C6MA 3BYVA 2ITZA 3F88A 3LCKA 3W0NA 3QUPA 2OF4A 4AGUA 4JVGA 2A1AB 3C5UA 3U4UA 2VV9A 4LV8A 1Y57A 3GQIA 4U94A 4IZAA 3G15A 3BLRA 3DK3A 4IE9A 4DEAA 3QA8A 5CSXA 3O5AA 4XP0A 1Y8GA 4GKHA 1J7UA 4LL0A 2YIYA 3ERKA 3LIJA 5CEIA 3G6HA 2BCJA 3S0OA 3MWUA 4UZHA 5IQEA 5AP1A 4RIYB 3CGFA 5LJJA 3OMVA 4QP4A 3AD5A 3DAKA 5AP4A 2YISA 4I5HA 2WZJA 2J7TA 5ANOA 5CXHA 2UW0A 2XIRA 3Q6UA 1NT2A 4YBJA 1YOJA 1W82A 3QRKA 3ZRMA 2CJMA 3FL4A 5ANKA 4ZSGA 4BTJA 5L2IA 2I0EA 4EH5A 2C6LA 4MEDA 4OTRA 2UW3A 2X7FA 2WO6A 4FG8A 4FNZA 2YERA 4I6HA 4J95A 1OBGA 3QGYA 4K77A 3SRVB 3UVQA 4FKIA 2UV2A 4RJ3A 4FKRA 1TQMA 4BCOA 3DBDA 4B0GA 4NJDA 1OBDA 4MQ2A 2WPAA 4FV5A 4I1ZA 3VBQA 4V0GA 5H2UA 3S1HA 2UW8A 4C38A 5IA3A 5E1EA 4ZZNA 3FKNA 5L8JA 3LFBA 3ULIA 4BDGA 4TYGA 3ORTA 4ALWA 3D7TA 3ET7A 2BRGA 4WSYA 4X2NA 1M14A 3SAYA 3WYXA 2C5NA 4QMZA 2G2FA 2A19B 2X2KA 4GU9A 4E4MA 5AA9A 2ZM3A 4EHZA 2YWPA 2EB2A 2XBAA 3AGMA 5HESA 2IW8A 4AZSA 1GZNA 3CIKA 3R1QA 1OL2A 3B8RA 2GPHA 2JITA 2RFEA 3OY3A 3FXWA 1FQ1B 4U0IA 3MFRA 4E1ZA 2YZLA 3A7GA 4FV3A 4OBQA 3QA0A 3UE4A 3DDPA 5FQDC 1JWHA 4J8NA 4E4NA 2VTRA 5E8VA 3DXNA 3TI1A 2R3MA 5AIKA 4F1MA 2UW6A 4BTFA 3RK5A 3EN5A 4LUEA 4PV0A 1ZRZA 4FNXA 3LW0A 4A7CA 4AA4A 2QOQA 2V62A 3ZM4A 2NRYA 3LM0A 1PMEA 1OZ1A 5C4KA 5K5XA 3F66A 4FTIA 4UN0C 4NCTA 5T6KA 2YJSA 4ZTMA 4CCBA 3EQIA 2ZFYA 1F3MC 3BGZA 4JI9A 4CCUA 3A4OX 4HCTA 2OFVA 3MBLA 5HICA 4EH6A 4D2RA 5BVOA 5HBJA 3R9DA 1FBNA 2UZBA 3E64A 3E8EA 3JVRA 4JS8A 4RIOA 3L8PA 4L52A 1DAWA 4O96A 3ZSHA 2RG6A 5K3YA 4A9RA 5C8KA 1OIUA 2VTOA 5M4CA 3P7CA 3IW4A 3N51A 4CSVA 3EFWA 4FNWA 4YO4A 2GHGA 2Z7QA 2HZNA 5IH4A 1S9JA 3FEGA 4NU1A 4O7VA 2R3OA 3CSVA 1E1VA 2Y7JA 4ASXA 4EQUA 1EH4A 2YAAA 3BHVA 4MBLA 4F65A 4D9TA 4DBNA 4FG7A 1XJDA 5HLNA 3UQFA 2BRHA 2ZV7A 3KA0A 3VNTA 2B9FA 3QZIA 4WNMA 2BFYA 5G6VA 1W83A 4FL1A 1E1XA 2Z60A 3ZFMA 3IONA 3ZS5A 4HCVA 4ZJVA 4D4SA 5CEKA 3LVPA 3ETAA 2JIUA 2WTJA 2QOCA 4D55A 4ZIMA 3CEKA 4FV0A 4L7SA 3P5KA 3Q9XA 3IW6A 3EQRA 4L7FA 2J5EA 3LE6A 1G8SA 3QRUA 3RZBA 5FXRA 4BCNA 3ZOSA 3BLHA 3DK7A 3BEAA 3UNJA 1WBVA 1ZY5A 2PUIA 5FBNC 3D83A 4AW2A 5FDPA 5AP7A 4ACHA 5K5NA 4DFLA 4U42A 3LFSA 4K0YA 3MY1A 3ZUUA 3GVUA 1NY3A 4EH8A 2OICA 2FYSA 3SA0A 1ZLTA 2IO6A 1Q24A 2IZUA 3COMA 4IDVA 3RPYA 5K9IA 5HX6A 2IZSA 5HU3A 3O0GA 4BDCA 3FZSA 3MW1A 5B2KA 2H8HA 4DEHA 4AT3A 4EOLA 1H1PA 2GNFA 4JMQA 4P90A 5CT0A 5IQAA 4AF3A 2BDFA 4FTMA 4RWKA 3R63A 1LR4A 4YJPA 4M97A 3PPJA 1OL5A 3CPBA 3GCQA 4I5CA 4U3YA 2XA4A 4O7LA 2XIXA 2PL0A 4FVRA 4XLIA 5J5SA 2YCFA 4O7ZA 5LARA 4AGCA 4YSMA 4AP7A 5ITAA 3DKFA 3MVHA 3BQCA 1VLRA 2QODA 3W16A 2P2HA 3AT4A 4IACA 4RJ7A 4AW0A 5DLSA 4Z55A 3ZONA 1MP8A 3KK9A 2C47A 4F1OA 4WHZA 5KMJA 1GIHA 1O6LA 1SVGA 3U54A 4C4FA 4RFYA 2ZB1A 4GFGA 1JKLA 5ETCA 4EWQA 4I6QA 4ZTRA 4F9BA 4FTNA 3D2KA 4TWPA 3WOWA 4HPTE 4HYUA 3R8MA 3UP2A 4HVIA 3SXSA 4D0WA 4UEUA 3UPZA 4WOVA 2YDIA 5C1QB 2YEXA 3KRLA 5IQBA 2ZV8A 5E8WA 3C4ZA 4YC8A 1URWA 2KULA 3TZ9A 3FZOA 5IA2A 5FLFA 4O0VA 4X2GA 1CMKE 3NW6A 5JRQA 1XH6A 4N70A 3BV3A 1YDTE 1UWJA 5L3AA 4U98A 5LOHA 3KXNA 3AT2A 3TKIA 4O86A 5CF8A 4YZBA 3TZMA 2XCKA 4F6UA 5KBQA 1O9UA 3NSZA 4WD5A 3ALOA 4TN6A 4JQ8A 4OTHA 4A9TA 3A7IA 4I20A 3CY2A 5HIEA 1PXNA 2V55A 4YJUA 5A14A 3TDVA 3W2PA 5IEXA 2ONLA 2I1MA 2PUPA 1DM2A 2JBPA 4JBOA 5J8IA 3SKCA 2WKMA 2ZVAA 3QRIA 4RZWA 4V0GB 3FE3A 3QYZA 5KO1A 4Q5HA 4EK4A 4RGJA 4NWMA 3ZCLA 5FRIA 3MSSA 1KE5A 3P9JA 1I09A 4XP2A 3TG1A 3PZEA 5CSWA 3ORKA 4CV9A 2A2AA 2J6MA 4IZ7A 1MRYA 3BQRA 2GMXA 4R77A 4AZWA 2WTKB 1YKRA 2VAGA 3PA3A 4RWJA 5ACKA 4E26A 3D7TB 5LWMA 3F5XA 5DI1A 5KMOA 4EC9A 2V5QA 3LXLA 3U8WA 4DGNA 2ZMDA 2VWBA 4DTBA 3UTOA 1G8JA 1LP4A 4PTCA 4XLVA 2CGXA 4C61A 2R3QA 4GCJA 3KRRA 4X2FA 4XV1A 1DAYA 3MN3A 3LOKA 3PPKA 2JGZA 5DYJA 3PSCA 3ANQA 3QWJA 4IEBA 1ZYJA 3W33A 2X8DA 2ACXA 3D9VA 4AE9A 5HTBA 3QXOA 2IG7A 2EUFB 4ZK5A 4O6LA 2F2CB 2FVDA 3THBA 3ZTXA 5EKNA 3I1AA 2PYWA 3CPCA 4FEWA 5DIAA 2GHMA 3EFKA 4IWOA 3NCZA 5HCXA 4RX5A 5DFPA 3FKOA 3DCVA 1M2PA 3Q4CA 4FVQA 4U81A 1OKZA 2ZYBA 3PVGA 5BMMA 2IW9A 3BE9A 4O0WA 1XHAA 1ZZLA 2XZSA 4KNBA 4ZY6A 3IKAA 5FTOA 4IVDA 5FTGA 4FSYA 1BL7A 3BRBA 3ACKA 3TKUA 2OWBA 3C50A 2JAVA 3ITZA 3F2RA 3KULA 3MA6A 3ODZX 3OHTA 4FOBA 4I6LA 4Z9LA 4WG4A 4FTCA 5TF9A 4IC8A 3FMLA 4C02A 3RHKA 3E5AA 3W0QA 4YURA 3H10A 5EYCA 4EL9A 2UVZA 3PJCA 3V5LA 3PY0A 3U9NA 3NEWA 4FK6A 2VNWA 3NWWA 1WBPA 3A62A 3CGOA 3VHEA 5J9YA 5LVNA 2VTMA 3QQJA 1KE8A 3G2FA 3OY1A 4XRLA 3EOCA 4QMXA 3DXQA 4FICA 1OMWA 4BN1A 2CCHA 3GCSA 4FIFA 2IZRA 5EDQA 3QHRA 3QTRA 4ZP5A 5AUTA 3VBYA 2W5BA 1V1KA 4H39A 1NA7A 3K5UA 4EZ7A 5JQ5A 4R6VA 2Z8CA 4Z7HA 3TWJA 3K2LA 4QMPA 1Y6BA 4RG0A 3SOAA 4M7IA 1FVVA 4FEQA 3HMNA 4DEIA 5HG9A 1CDKA 3NFFB 3VS1A 4HGEA 1Q61A 1H1QA 4DE4A 4XCUA 4BZOA 3V8SA 2F7ZE 5KKRB 4AWIA 1CKPA 3OROA 3PSDA 1L3RE 4FIGA 5IH6A 1Q8ZA 2OZAA 2DYLA 2WMVA 5ETIA 2QNJA 4YZCA 4GW8A 4LV7A 4I94A 4UZDA 4EOKA 2UZDA 3VS3A 1HCLA 3LJ1A 4NCTC 5CASA 2VWXA 4N57A 4ZTQA 2R7IA 1I44A 2GS2A 2OJIA 3UG1A 2ZJWA 4JAJA 4CFMA 3AMAA 4APPA 4FTRA 2C1AA 4MD9E 2BR1A 2J50A 3CS9A 4ORKA 5A4TA 4F78A 1P2AA 2SRCA 5BUIA 3NUPA 3RM7A 4JX7A 3RWQA 3O96A 4B7TA 1T45A 3KRXA 4PNIA 4EBVA 4AN2A 3ZC6A 2PTKA 2F2UA 4MXZA 1V0PA 3W2RA 2HXQA 2PMLX 3R02A 5GHVA 3SXFA 3TXOA 2E9VA 4HYIA 1WVYA 4ERWA 5AV1A 2ZV9A 3PE2A 3SC1A 4DTKA 3F5GA 2W1ZA 5EDPA 4F99A 3TZ8A 5AP2A 4LQMA 2VZ6A 4OW8A 4PDSA 3HP2A 4IM0A 3Q32A 2P4IA 4FV1A 4L3PA 4FG9A 2H6DA 4ZSAA 5D41A 1YOMA 3AKLA 4LI5A 4YC3A 5IA5A 3ZU7A 5CI6A 4YTFA 1Z9XA 4I23A 3QCQA 3PE1A 4ZS4A 3ZC5A 2DUVA 3WIGA 1J1CA 1PXLA 3A60A 4L9IA 3SLSA 5KKRC 3QTSA 4BCGA 3EJ1A 3ORNA 4NYEA 3EYGA 4GMYA 3E87A 3NFGB 5B2LA 3F3UA 3HAVA 5CVGA 4RA5A 4XG6A 3T9TA 5CAOA 2QU6A 3VQHA 2WHBA 1SYKA 1UKIA 3ENHA 3BBWA 2W1GA 2OJ9A 3DJ7A 2X2MA 1XMMA 3E7OA 2YCRA 3OXIA 5CU4A 4F4PA 3ODYX 2JBOA 2G2HA 4AOJA 2GNGA 4N6ZA 2EXMA 3P7BA 4D1SA 3UIXA 3BYOA 4FKGA 4B8LA 4CZTA 4R5SA 4A9YA 2WOTA 1OIYA 1V0OA 4FT0A 3ZO3A 3UDBA 5DEYA 3UIMA 5JFXA 4D28A 4FKOA 4YJSA 2X1NA 3CLYA 4G31A 5DBXA 4CG9A 5LCJA 1JQHA 2CPKE 2J90A 4HPUE 1IA8A 4RC2A 4EHGA 2BFXA 3PY1A 2I6LA 3DPKA 4R78A 4LGGA 2WQEA 5I9ZA 3BHYA 3W0OA 1M2RA 3Q4UA 4FTKA 3BCEA 5CX9A 3JY0A 3HLLA 4C59A 3R28A 2E9OA 4FUXA 4L44A 4H1JA 3C0IA 3ORZA 1PKGA 3TKHA 3K3IA 4I93A 4CLIA 3QKMA 4XS2A 2UZVA 3QWKA 1RDQE 2ZM4A 4AZVA 4BZNA 4ZY4A 3CJGA 2CGWA 4FZAB 3UDTA 3L9NA 4KIQA 4OTDA 3UOJA 3RWPA 4HGSA 3VJNA 3NUSA 3HV6A 2BUJA 3RJCA 4F1TA 4U7ZA 4J98A 5H8EA 3OT8A 2E9NA 4R3RA 5KNJA 3AG9A 4JBQA 4LFIA 3QX4A 1KWPA 4IX5A 5EM6A 4ZTHA 3L8VA 5CT7A 3CTQA 5M06A 3O7LD 5EM5A 4JAIA 4PL4A 5KE0A 2OK1A 3QZFA 5DT4A 3SHEA 4EJNA 3GOPA 5HIBA 2XRUA 4AN9A 3OF0A 3RNYA 4F9WA 4XX9A 2EWAA 3HEGA 4MXYA 5CAQA 3FI2A 4OBOA 1FINA 1YDSE 5JGAA 3VWAA 5A4EA 4FUYA 5BYLA 4EI4A 3KULB 4FVPA 4QP1A 2XJ1A 3A7FA 5BX0A 2GNIA 2ETRA 2FO0A 4YTIA 3PXRA 4YSJA 3EN7A 3UZTA 5HG7A 4MAOA 1KSWA 3LFAA 2HY81 3DS6A 3BELA 2ITPA 3DAEA 2JDRA 3L8XA 3N9XA 3QZHA 3DBCA 3GEQA 5A6OA 2PY3A 3O8UA 3UC3A 4YJRA 2VWIA 4ERKA 4XJ0A 5AM7A 3F5UA 4B6LA 3W18A 3CR0A 4DBXA 1PMNA 3KIOC 2OBJA 5KZIA 4MYGA 4YLKA 2XYUA 3PDTA 3UDZA 2WTWA 4Z3VA 1BMKA 3QX2A 2WTDA 4YBKA 4EK8A 5FEEA 4HZRA 5HNBA 4CFXA 2XK8A 2XNPA 5HTCA 1Z5MA 3GU5A 4MWHA 3NUYA 4GK4A 3FMEA 4YNEA 3ZXZA 3G5DA 4Y5QA 1LEWA 1S9IA 4MXAA 3VJOA 4E5WA 3E3PA 2AUHA 1YI4A 2OIQA 2REIA 3QKLA 4USDA 3QTXA 4F7JA 1OPJA 4IANA 4WZYA 1ZMWA 3ORIA 4C4IA 2JDTA 2Y6OA 3R0TA 4KA3A 3SG9A 5D7VA 4L46A 3VUHA 4XOZA 2OZAB 2QOHA 3NMUF 3CCNA 3R9OA 3FMHA 3HP5A 4I0RA 3NNUA 3FXZA 4XMOA 4AFJA 4Q9ZA 5DR2A 2WB8A 5ANJA 2VO3A 4XG8A 4K9YA 3QQHA 4Y8DA 4HVGA 4QMUA 2HW7A 4EBWA 2XIZA 3VS5A 4DAWA 3KFAA 4BKJA 1H27A 4AXFA 1PHKA 3PP0A 3LJ0A 4NUSA 3R22A 2R64A 4BCKA 4F63A 3HUCA 1Q5KA 1WVXA 5M53A 5B7VA 1UNLA 5DGZA 2I0VA 4Z7GA 4YZNA 4IAKA 2QOFA 1LEZA 5CYIA 4JT3A 4DT8A 4CKRA 4GH2A 4B9DA 3QD4A 4EUUA 5HCYA 1ERKA 2BAKA 4H36A 2AEGA 4L01A 4EOMA 5DH3A 4IW0A 1JSTA 4CFNA 4TWNA 1W0XC 4QTEA 1IRKA 2OH4A 2ZMCA 3I0QA 2WMUA 4FJVA 4EJ7A 2C6IA 4G9CA 1J91A 4I21A 4KWPA 3ANRA 3HYHA 4AW5A 1J7LA 5D12A 3AGLA 2PVLA 3E8DA 3UIBA 4DEBA 3AC2A 2OF2A 4LOQA 5KUPA 3HV5A 3ZLXA 2QD9A 2RFSA 4YZDA 4M84A 1GNGA 2QOBA 3TV4A 3NX8A 2ETMA 1YI6A 5CANA 4AOIA 2JKQA 5CVFA 3REPA 2WQOA 4OTWA 2HZIA 4LDTA 4L6QA 1R1WA 1XH4A 2C5XA 3QCSA 4IWPA 4PP9A 3CC6A 4X3JA 4AT4A 4BYJA 4GYGA 2Z7SA 3LMIA 3V04A 4OBPA 4BIBA 1TQIA 3DKOA 5KBRA 2QKRA 3R8LA 2BMCA 4GEOA 1KUTA 4RZVA 4BDJA 3U6HA 1XR1A 5ETAA 2BRMA 1XH7A 3NW5A 4QMNA 2WELA 2XNEA 3HV4A 3KF4A 5IQFA 5CZHA 2FH9A 3SVVA 4RC3A 2PHKA 3Q9YA 4FEXA 3ZXTA 3NPCA 3PJ1A 5J7HA 2O63A 4XRJA 1BI8A 2OKRA 3A7JA 3OWJA 4CD0A 2VO7A 4QQTA 1J1BA 4FYNA 2QO2A 2QOKA 3UDSA 4D1XA 1ZOGA 1R78A 5HHWA 1L8TA 5EYDA 3MI9A 1P4FA 2VWVA 3TN8A 3ZZEA 2BZHB 4K1BA 3CKWA 1MQ4A 1GIIA 5CALA 3OWLA 4ITHA 2RL5A 5A6NA 2JIIA 3AXWA 5AWMA 4W4XA 4BGGA 3CBLA 5JKGA