3TDVA

Structure of the gdp complex of wild-type aminoglycoside 2'-phosphotransferase-iiia
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
QNKLHYTTMIMTQFPDISIQSVESLGEGFRNYAILVNGDWVFRFPKSQQGADELNKEIQLLPLLVGCVKVNIPQYVYIGKRSDGNPFVGYRKVQGQILGEDGMAVFPDDAKDRLALQLAEFMNELSAFPVETAISAGVPVTNLKNKILLLSEAVEDQVFPLLDESLRDYLTLRFQSYMTHPVYTRYTPRLIHGDLSPDHFLTNLNSRQTPLTGIIDFGDAAISDPDYDYVYLLEDCGELFTRQVMAYRGEVDLDTHIRKVSLFVTFDQVSYLLEGLRARDQDWISEGLELLEEDKANNFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoglycoside-2' phosphotransferase-IIIa (APH(2')-IIIa) prefers GTP over ATP: Structural templates for nucleotide recognition in the bacterial aminoglycoside-2' kinases.
pubmed doi rcsb
source organism Enterococcus gallinarum
molecule tags Transferase
molecule keywords Gentamicin resistance protein
total genus 101
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tdvA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3tdvA02
2CGXA 3GC7A 3JXWA 3EFJA 1PXMA 3HV7A 4NCTA 2GNIA 4ASEA 3QUPA 3P0MA 4QP7A 3OG7A 2X2KA 4BN1A 3QQUA 2BZJA 2QLQA 4FT3A 4O7VA 4F09A 4IFGA 2CKQA 1OGUA 4FV3A 4GJ2A 3R7UA 4BBEA 1IASA 4IWPA 4HGTA 4EHEA 5KZIA 3Q9WA 4Y46A 4A9RA 3IO7A 1UWJA 3DFCB 4FSNA 4ITIA 2VTOA 4LOQA 1HCKA 2A27A 5AUXA 4CT1A 4BC6A 4GV1A 3C4WA 4C36A 3KFAA 2WTDA 2R7IA 5BMMA 4MQ2A 3UVPA 4CCUA 4UX9A 3ZCLA 4AA0A 2F2UA 2QONA 4FKRA 4YJSA 4BDJA 3COKA 3WF6A 4ACGA 4MD9E 3ENHA 5IZFA 3TYKA 2Z7RA 2QU5A 4XUFA 4TW9A 4XRLA 2QCSA 2VUWA 3CQEA 4AZSA 5IH5A 3L9LA 4JBVA 5M06A 3QL8A 3NDMA 4MQ1A 5CT7A 5CWZA 2JKMA 3D2KA 5ANGA 2HYYA 4DFLA 2ZDTA 3FDNA 5KO1A 5DG5A 5KCVA 2WMBA 3RM6A 4RJ8A 4GK2A 3I0OA 2O8YA 4IX6A 1PXLA 4DH5A 4IZ7A 4BCNA 5B2MA 3UIXA 4L7SA 3RAKA 2QKWB 3HDMA 2UW5A 2OZAA 2HCKA 2YWPA 4I93A 2Q83A 3P7CA 4PMMA 1MQ4A 1H25A 4EH8A 1YDRE 3D4QA 3WI6A 2BROA 2C3LA 2XBAA 3C0HA 3FI3A 4M97A 5AUZA 1GIIA 3GXLA 1SM2A 3K5VA 4FNWA 4IZAA 4F0FA 1WMKA 4I0SA 3R04A 5TF9A 1UVRA 3FI8A 5E8VA 4CZTA 1W0XC 3QKKA 4AN9A 3S0OA 4AF3A 4UB7A 2XK6A 2PVJA 3I7CA 3W33A 2PVRA 4S33A 4G3DA 3RCDA 1OPJA 4JNWA 3Q60A 4OBOA 5AFVA 3EQRA 2GHLA 2HY0A 1OB3A 2I0HA 4O0YA 2HXQA 4NSTA 4FSMA 2R3FA 3K5UA 4XG6A 4B9DA 2BAJA 4JG7A 4BRXA 1M7NA 4L46A 5EM8A 5D10A 3FSFA 5CEKA 3ZEPA 2X2MA 4WRSA 4E5BA 2XIZA 4FT9A 4YC6A 5CEMA 5CNNA 1KUTA 1PW2A 2J5EA 3FYJX 2BTRA 3D15A 3LHJA 2WELA 3B8QA 3VUHA 4K0YA 3W0QA 2C6DA 3VNTA 5DHJA 3W2PA 3HGKA 2HXLA 2XNNA 5T68A 1DM2A 3L9MA 4BDDA 4Y73A 2VTRA 2C5NA 4U40A 4GG5A 3LFDA 4EORA 4FIIA 2ZMCA 1STCE 1SVEA 1YRPA 1BUHA 3MDYA 5DR2A 4IB1A 5CX9A 4HZRA 4J53A 2JFLA 4O84A 1JKLA 2R4BA 3ORZA 3UIMA 2XYUA 2EVAA 4EQCA 4MCVA 3IW6A 2QOFA 1YHSA 3A61A 5J87A 2X7GA 3QKMA 3QZGA 2VN9A 4BTKA 3PJ1A 5F20A 1UWHA 3LPBA 1JKKA 3NRMA 3CSVA 3ATTA 3TZ9A 2OIDA 4FX3A 2XNOA 3HMOA 3C7QA 2YM7A 3LM5A 4UN0C 5E90A 3ZO3A 3Q3BA 4E4LA 4FGBA 3IGOA 2Y4IC 4O91A 2OF4A 4ZSEA 4KS8A 4NM0A 5HG5A 3NMUF 3Q6WA 3NLBA 4X6RA 5HLNA 1JKTA 4ORKA 3FL5A 4QMVA 3VO3A 4RJ4A 4HPUE 1GJOA 1M17A 4C4IA 2YM3A 3U6JA 2R5TA 3BHUA 5T6KA 4EOSA 5B2LA 4MVFA 2OJIA 2QC6A 2W1ZA 4RVMA 1ZAOA 3T9TA 3FZRA 3ZRMA 3QKLA 3M42A 3PYYA 4O0RA 5GJGA 4WUAA 3FZSA 5JT2A 5GIPE 1CTPE 4NW5A 4I5CA 3D7ZA 1IAHA 5FM3A 5KBQA 3EQDA 3VS2A 4YJPA 1W82A 5IQIA 5AUWA 3C5IA 3L8PA 2Y0AA 4CGAA 3ACKA 4HYUA 2B9HA 5FG8A 2ITZA 4FIFA 4OLIA 4KKEA 3NS9A 4XOZA 2P0CA 5FQDC 4EOOA 1YW2A 4B7TA 2WAJA 3F88A 3ROYA 5F4NA 1Q5KA 4E7WA 3AT3A 5G1XA 2IZSA 5JN2A 5J1WA 5DYJA 1QL6A 4X2KA 4FNXA 2KTYA 4FEWA 5BYZA 4U94A 3VRZA 4DF3A 5IA4A 2VTIA 4OTGA 4YJNA 5I4NA 3KXMA 1BKXA 1YWVA 2HY81 4FKSA 4YZMA 3O7LB 4U6RA 3RHXA 3DKGA 1GZNA 2XUUA 4J98A 3RJCA 3BLRA 3VF8A 3BX5A 4K1BA 2BRGA 3TNHA 3G0EA 3GU4A 3DKCA 5TT7A 5KMMA 2FVDA 2F7EE 5JFWA 3KRXA 1XHAA 2HZ4A 3OF0A 3HYHA 4NCTC 2GCDA 1MRUA 3AC3A 2UW6A 3FLSA 4FV7A 5CAUA 1JVPP 5LMAA 3E5AA 3QQKA 5HNIX 3FL4A 2HWOA 1TVOA 1QMZA 5A3XA 4M67A 2XRUA 4EONA 2HWPA 4EQUA 1E1XA 1QPJA 2CDZA 1APME 2WQMA 4QP3A 3OW4A 5E8WA 5HO7A 5K3YA 5IEXA 3PY0A 4JL9A 2VGPA 1BL6A 2VRXA 3R9OA 3H4JA 3KGAA 5AEPA 2PY3A 3GCPA 4S32A 2QOKA 5A4LA 5I9ZA 5IQEA 2W5HA 2QODA 2C68A 3HV6A 4TYHA 3VN9A 5CXZA 5LARA 2Y6OA 5E1SA 5BQ0A 3OT3A 1ZZLA 4LL5A 3ZLSA 1ZY4A 3AOXA 2PVNA 2W9ZB 3IW5A 3O50A 5IQDA 1WVXA 2HK5A 2XMYA 3Q4TA 3UTOA 1GAGA 3MGYA 4GFOA 4IM3A 4YLJA 5FM2A 1J1CA 3MA6A 4MAOA 2W1GA 5GJFA 3LCKA 3KCFA 2UZLA 2I1MA 2QHNA 4CZUA 5LVOA 4OTFA 1W83A 3QD3A 2W96B 4PDYA 4DTKA 3V5PA 4ASDA 4YC3A 2RL5A 3RVGA 2YIXA 4I21A 3HVCA 5M4UA 5BUIA 1WCCA 4EK6A 4EJ7A 4X6QC 4V0GA 3QWJA 5AV1A 4FSUA 4DA5A 3ZMMA 5C26A 1PXJA 3HV3A 5DRBA 2YACA 4EH2A 4EHGA 3TZ8A 2I0VA 2ZYBA 3LLTA 3IDCA 5CU6A 2YM5A 2VNWA 5HEZA 2O2UA 3RI1A 5FTOA 1T46A 3FY2A 4JIAA 4D28A 4IJPA 3D5VA 1Q8ZA 3KL8A 5ACKA 2NP8A 4CTCA 2OXYA 4TYJA 4D5KA 2OJ9A 2UW8A 3ZFXA 4F7NA 5ITAA 5JQ8A 3EQPA 2AUHA 4YZNA 1OIRA 4NW6A 5HIEA 2Y6MA 3U6HA 2R3MA 3PWDA 2X81A 2PMIA 4ZSGA 4HNIA 3CGOA 4C3PA 3RPYA 3ULIA 5J1VA 1R0EA 1WVYA 2R3QA 3VF9A 5KUPA 4JDKA 4TWNA 3OCGA 4P90A 2SRCA 4JXFA 3VVHA 5EG3A 4FL2A 3FMHA 1CKPA 3FHRA 4IQ6A 4JRVA 4TYHB 3QX2A 3CGFA 3A8XA 4BGGA 2AYPA 2BHEA 3HECA 3LKMA 5EM7A 3RAWA 5IUGA 4C3FA 2BIKB 3WBLA 3NNVA 3PA4A 1PXNA 4FKIA 4QTEA 1F3MC 2IZRA 3N4TA 1V0OA 3GU6A 3JY9A 3ORXA 3UZRA 4C7TA 5E92A 3SD0A 4B6LA 3W32A 4FZ6A 4GU6A 3KKVA 1ZWSA 2VTAA 1JSVA 1OM1A 2VO6A 3AGMA 1PXOA 3EN6A 3O8UA 4YURA 5BUJA 4H1JA 4BKJA 4B8LA 2GNGA 4U80A 1J3HA 5G6VA 4FTJA 2J90A 4YZ9A 2WTWA 4YBJA 3MIAA 3WILA 1U4DA 1MRYA 4IZYA 4ZEGA 3Q2JA 5HIDA 3PP0A 2VTLA 4FKVA 3FI2A 1FVVA 4U44A 5D9HA 1ZYSA 2WHBA 4AA5A 4BI1A 4R1YA 2ERKA 3CJFA 3A4PA 1TQIA 4GH2A 3QRKA 4K33A 3DGKA 2XK8A 3WARA 3KXNA 4LGGA 4G6OA 3RINA 2GFCA 1JBPE 4F0GA 4PUZA 4EBVA 4AACA 5E8XA 4V01A 4E6AA 1PRYA 2XKFA 3OS3A 5JQ5A 5IA2A 2CNVA 1JQHA 5IMEA 4G6LA 5IMXA 2Y9QA 4YNEA 4HVHA 1KOBA 1HCLA 4KINA 3A7IA 2XS0A 4EI4A 3SG8A 4NJDA 3AD5A 2F7XE 3CS9A 4JBOA 3W0SA 3CR0A 3UO6A 3M1SA 4FEVA 1OBGA 4FVPA 2C6TA 3GC9A 3UPZA 4EH7A 3ZUVA 2OFVA 3NWWA 5TO8A 4I6FA 3C5UA 4O22A 4WIHA 3QGYA 3LJ2A 3OBJA 4F4PA 4DEBA 4DEGA 4O82A 4CD0A 1V0BA 4AU8A 2JDRA 5CEOA 2VWVA 3HLLA 2OFUA 4LV5A 3TACA 4KRDA 3SXFA 3MW1A 4YSMA 4LM5A 4BY9E 4Q5EA 4DTBA 3EN5A 4NT4A 4A9SA 4EH9A 5A4TA 5HU9A 5LMKC 4IX5A 5D7AA 5EHOA 5AAEA 2BDFA 2QG7A 4BI2A 3FSKA 3FQEA 3HA6A 2JD5A 4YJOA 5IPJA 4UWCA 4F7SA 4ANQA 1KE7A 1Q8YA 1GIHA 4CEGA 3I6WA 3NVMB 4CNHA 3W2CA 1LPUA 2LGCA 3Q96A 1XKKA 2OKRA 3O23A 3PVGA 2VTSA 3DBFA 4Y95A 3QZHA 3R00A 3UO4A 4NTSA 2E9NA 5AP7A 1H1QA 2FH9A 4DLIA 4XV3A 4L67A 5FBNC 4GEOA 1TQPA 4QYGA 4UV0A 4EH5A 5CVHA 1YHWA 5CQWA 2C0OA 1KE5A 2F2CB 4BDKA 3BBWA 4DH8A 3B2WA 4O6LA 1Y8YA 4RLKA 3W0PA 4A9YA 3LAUA 4RZVA 3W55A 4AOIA 4ZOGA 2QOQA 4C37A 3BPRA 1FMKA 2Z02A 2V7OA 4L8MA 4BTFA 4E4MA 5DEWA 3S4QA 3EFWA 1J7LA 3GP0A 3ZBXA 4EZ7A 2OJJA 2ZB1A 3GU7A 3BRBA 1YXUA 2QR8A 3VS1A 2BIYA 1H8FA 3UC3A 3FI4A 4I94A 3HUCA 3KK9A 1Q4LA 4FT5A 3IECA 2BFXA 3DAEA 4FV8A 5CZIA 3PRIA 2R3OA 3BU3A 2ITNA 4X0MA 4NIFB 2FSMX 3P23A 3ODYX 4QTBA 4EOKA 4HYHA 4D9UA 4ZLZA 4DG3E 3OVVA 1H28A 2HZNA 1R0PA 2JDSA 3R30A 2QO9A 1Q3WA 4NU1A 4ZZMA 4IAZA 4DGLC 2VWIA 2YA9A 4L00A 3TNQB 4NWMA 2OF2A 1NVRA 4MEDA 3UMXA 3W0MA 4YP8A 1VJYA 2V5QA 2BALA 3COIA 3VHKA 4DEDA 4F6UA 5HE1A 1XH8A 3HA8A 4C59A 3PE2A 3WF7A 3UQFA 2XNMA 5AA8A 4H39A 4FBXA 3SA0A 3SOAA 1LEWA 1RDQE 5IA0A 2G2FA 4M3QA 3VBXA 3G6HA 3KXGA 3HUBA 2C47A 3BQCA 3GI3A 4ALWA 4ERKA 3JVSA 4IMYA 4FMQA 1PJKA 4LOOA 5B2KA 4E4NA 2ZV8A 4UBAA 3ZC5A 5DT3A 4BDAA 2JC6A 2WTKB 4YHJA 3FAAA 3ALNA 5AV4A 1UNHA 3BHTA 2IO6A 5FD2A 2C6MA 3QUDA 3SQQA 3U54A 1ZOEA 5JRQA 4M14A 3OXIA 1PXPA 5I9UA 3OWLA 2QURA 3BBTB 3BI6A 3EN7A 4BF2A 3G6GA 4MYGA 2F7ZE 3A4OX 1OL5A 4UY9A 3QTUA 4J52A 2XIXA 4C4EA 1OKWA 4QT1A 4FV6A 4B0GA 3SDJA 3WIKA 4DBXA 5EQYA 4L53A 3CD3A 1UU7A 3BZ3A 3B8RA 4FTMA 4GW8A 2ZM4A 5HESA 3QLGA 4ALVA 1ZMUA 2VV9A 3NUPA 4FIGA 3IW7A 5CI7A 1Y8GA 3FXWA 2PUNA 4AW2A 2BRMA 5CS6A 3SAYA 1X8BA 2YIQA 2ZM3A 3CJGA 4FKQA 4AP7A 2BKKA 3PSDA 4HPTE 3MH0A 4A06A 4CQEA 3QXPA 3LQ8A 2GS6A 3W8QA 3D0EA 2J7TA 3DAKA 3KN6A 4X3FB 4FTOA 4RVTA 3T9IA 4KD1A 3UP2A 1KV1A 4YMJA 3GU8A 1PMUA 2UW4A 4RX9A 5I0BA 1IAJA 3L8SA 4BCQA 4RQKA 3WYYA 4LI5A 5J5SA 2OJGA 5A46A 1AGWA 3TNWA 1LR4A 4FL1A 4NKSA 5JFSA 1OITA 2C5XA 2BZHB 1L8TA 4RPVA 5M4CA 4GYIA 2XEYA 3H9RA 3TDWA 3TKIA 3H30A 4FK6A 4CKRA 1I44A 1JLUE 1Y91A 4F9CA 2XF0A 4MWIA 5I9XA 3R28A 1BYGA 3GFEA 1FGIA 2PTKA 3OXTA 2WQNA 3PXRA 5J95A 4A9UA 4FTTA 4C02A 4Z7HA 5D7VA 5KZ0A 4DGOA 4WNPA 4FUYA 3CLYA 4S2ZA 3GOPA 1QPDA 3PVWA 2WB8A 3L9PA 4OT5A 4WUNA 4RFYA 2RFNA 4F9WA 4OTHA 4JX7A 4WHZA 4YTHA 4KBAA 4I0RA 3NNUA 5CSPA 2ZDUA 4FTAA 3W16A 2J5FA 4PP9A 2WMRA 4Z7GA 4EOQA 5FP6A 2FO0A 3Q4CA 3LCTA 3C4FA 3DNEA 1XH6A 5CEQA 3VQUA 5HX6A 5JZJA 3E63A 1B6CB 2IN6A 3I81A 5B0XA 4LL0A 5EYKA 3DBDA 3FMDA 5IQCA 3QQFA 1ERKA 2QR7A 2OICA 4X2JA 5BVNA 5J9YA 3W0NA 4V0GB 2O65A 3VS3A 4ALUA 2YITA 3OY3A 4BDIA 2EXMA 2GQGA 3CCNA 2A0CX 3EFKA 3ET7A 1U54A 3FQHA 4I3ZA 4NK9A 2ESMA 4FKWA 5HCZA 5ANEA 4WNMA 2W4KA 3LZBA 4O7RA 4PMPA 5BYYA 2JEDA 3EN9A 4PMSA 4V04A 4ZY4A 4E8AA 5GHVA 4QO9A 4CG8A 5LCJA 3DKFA 3GC8A 3OCSA 3P1AA 4YZCA 3FPQA 4DBNA 3R9HA 3ZH8A 4I23A 4YHTA 4M13A 2ONLC 4XHKB 3RKBA 2BZIB 3UE4A 4NFNA 3UYTA 2QKRA 3AC4A 2WTVA 3OHTA 3QLFA 3FJQE 4CV9A 1P4FA 2BFYA 2I6LA 4YO6A 5M08A 1Q8UA 3F82A 5KE0A 2BAQA 1GOLA 4C35A 3HX4A 2BHHA 3E8NA 4KB8A 4RJ5A 4WA9A 4XBRA 3WYXA 3R8MA 5IH4A 3FPMA 2BCJA 4FGRA 1J7UA 4YPDA 3FMJA 2GMXA 2B9FA 5DRDA 4FT0A 1Q97A 3GCSA 1Y57A 2WMQA 3G0FA 1Q8WA 4HGSA 3CKWA 3BGQA 3AMYA 4IEBA 4TYEA 5AP6A 1F0QA 4DFXE 3TTJA 2ITTA 5JEBA 1WBOA 3QAME 3V8WA 5HNGA 2PZRA 2WMVA 4TRLA 1KSWA 2CNQA 4O6EA 1DAWA 3GC0A 3GVUA 3KF4A 5L6PA 4FKPA 1Z57A 2WMXA 3E3PA 1XO2B 3F69A 3PXFA 4TWPA 4QPAA 4EKKA 2VWXA 4K8AA 3A60A 4XJ0A 4DFNA 4C58A 3VHEA 4F0IA 2YN8A 5IQFA 4O81A 2GHGA 4I5PA 5EQEA 2UZWE 5HBEA 4KIPA 3UDBA 2VTHA 3M11A 4ASXA 4ZAUA 4YJTA 2RKUA 4BDFA 5BMSA 2UZVA 3E62A 3QD0A 3QA0A 3DK3A 4FSTA 5H2UA 5BVWA 2R2PA 5CZHA 3RPOA 3BCEA 4I0TA 5EOLA 4KABA 3DDQA 4RA4A 3DLSA 4FSQA 3G51A 3CY2A 4FUXA 3R9NA 3E8CA 3HV5A 3CKXA 2C6KA 1OIQA 4L43A 4RMZA 4BICA 1KE6A 4BCMA 3BE9A 3CTJA 3QC9A 2YISA 2C3JA 4FEUA 3RZBA 4EOJA 1VZOA 5HD4A 2W99B 3OWJA 3PJ8A 3EHAA 2NRUA 4UALA 4M0YA 4IADA 3T8OA 4YR8A 3P7AA 4E20A 1ZOGA 3H0ZA 4ZTRA 1REKA 3KULA 5JFXA 1UU9A 3PVUA 1IA9A 3AMBA 3FZ1A 3KRRA 2V62A 3NAXA 3PWYA 4HGEA 4LQMA 3G2FA 3D2IA 3BIZA 2GHMA 2UZNA 3HP5A 4UWBA 5EYDA 5BYLA 3TM0A 4F9YA 3GT8A 1Q61A 3PA5A 3FWQA 1UV5A 3LFNA 2XNGA 1XH9A 3IDPA 4QYHA 3NUNA 5AX3A 4EOMA 4AE9A 1CMKE 2WKMA 3V5WA 1H00A 1OUYA 3PPZA 1O6KA 1KE8A 2HELA 3EL7A 2BTSA 4Y5QA 3BU5A 4U97A 3F66A 2UZEA 3U6IA 1MRVA 4KKGA 5HD7A 2ZB0A 5J9LA 5FEDA 3L1SA 4UYNA 3MY0A 2XKDA 3ANQA 4FT7A 2CN8A 3RAIA 3BYOA 1KV2A 4J99A 4YTFA 4CFUA 5AM7A 1JPAA 4MXCA 2OIQA 4AOJA 3EN4A 2J0LA 2P2HA 5KMJA 2PL0A 1J7IA 4IAFA 1B38A 4WO5A 3UNZA 3P9JA 4JI9A 3KA0A 4QMMA 2W1IA 2QD9A 2RG5A 5A14A 3RMFA 4EJNA 3NVKI 3MPTA 3H0YA 4JDIA 4QQ5A 3VBVA 1WBWA 3PIXA 2X4FA 4AQCA 3VS5A 3EYHA 2CLXA 3CEKA 4ZP5A 4MHAA 4E5AX 4AE6A 2VX3A 5B7VA 3D14A 1E9HA 5AP4A 1JSTA 3ZLXA 3RPRA 1BI7A 4O2ZA 4D1ZA 2JIIA 5HVJA 3UOLA 3W2RA 2DYLA 2QO2A 2EUFB 4CRLA 3OUKA 4DFUA 1Q8TA 1H1WA 3QHRA 3IKAA 4HOKA 3TIYA 2UW9A 4Y8DA 4C61A 2X9FA 4X2FA 3UO5A 1GY3A 5HI2A 3V3VA 3ZM9A 5J8IA 3TEIA 3EQHA 1M2QA 3IW4A 3KVXA 4IIRA 2UZDA 2JGZA 2QOOA 3IW8A 3SHEA 2XNEA 4FIJA 4K9YA 4XS2A 4AOTA 4CSVA 4FV2A 4G31A 1NA7A 3V01A 3I6UA 5IQGA 2YDIA 4FG8A 3F9NA 3HMIA 4K77A 2X7FA 2B0QA 5E7RA 4CLIA 1OI9A 3KRWA 3LFCA 4KRCA 4MXOA 4XX9A 3VBTA 1S9JA 3P08A 4FYNA 3RNIA 4YTIA 3VWAA 3R7IA 1WZYA 1U5QA 3Q9ZA 3EL8A 2G2IA 4IM2A 5FEEA 5KMOA 4XV1A 1YXXA 1OKYA 2OH0E 3ORTA 5HICA 4A7CA 4FEXA 3UQGA 4O7PA 4GT3A 3D5WA 3HNGA 2VTQA 4O7SA 2CGUA 2QOIA 5CALA 3CE3A 2WEIA 3HMMA 1IRKA 3KEXA 3ZZEA 3DK6A 1GZKA 2BR1A 3OWPA 2OH4A 3LFFA 4AGCA 1ZARA 2B53A 3PZHA 3MFSA 4IDVA 4Q2AA 1PF8A 3QQLA 3JVRA 3TN8A 4BBMA 3CPBA 3R1QA 1U59A 5ANDA 4GMYA 2J6MA 3ELJA 3EQFA 4KAOA 4LFIA 4W8DA 2QQ7A 2YHVA 3CC6A 4KA3A 5AV3A 4PTEA 4W4VA 4XYFA 3E8DA 3RGFA 3DXPA 3ORIA 2C6OA 1VR2A 2WNTA 2VNYA 4OT6A 5AADA 2VWWA 3OEZA 4RIOA 2B52A 3D7TB 1O6LA 4TWOA 4E26A 2Q0BA 5HQ0A 5KHXA 1U54B 4FTNA 3PDTA 4BZNA 4IHPA 3MN3A 4M8TA 3ZRKA 4ONAA 4N57A 4U81A 3ZO1A 4U41A 5KHWA 4O7LA 4DEIA 3F3UA 2W1EA 1PHKA 1YDSE 3MS9A 3TIZA 2YFXA 3BKBA 2UW3A 3QQJA 5A6OA 5LVNA 2C6EA 4JR3A 5HG8A 1YXSA 2E9VA 4GRBA 4GT4A 4MBJA 3FBVA 1M14A 4E6DA 4BYIA 5GINE 5L2IA 2P33A 2CKPA 4IW0A 3DNDA 3LXLA 4JS8A 3QU0A 4M84A 4FTRA 4ZK5A 4BGHA 2W06A 3BV2A 3GCQA 5HIBA 4D4SA 3N51A 3VBWA 3OCTA 3P86A 4WG4A 4L3JA 3FC1X 2XNPA 4R1VA 4XP2A 5EDQA 4F63A 4DGNA 2Z60A 1VYWA 5AP2A 5CSXA 2JKKA 4BDGA 4DC2A 2PSQA 5M56A 4QMPA 3VBQA 3WF5A 2Y4IB 3EH9A 3QRTA 3FLZA 2FA2A 1OECA 1RQQA 5FEQA 3ITZA 4AUAA 5BVOA 4DEEA 2C1AA 4J8MA 5CEIA 3WOWA 4AFEA 4ACMA 3C51A 5AAGA 5LJJA 4OBPA 3DZQA 4GUEA 4KIOA 4JVGA 3NR9A 3E3BX 2VTMA 4RIYB 4I4FA 5C27A 3PG1A 3FYKX 4TPTA 3TNIA 2WZJA 2H96A 3RALA 4JRNA 1MP8A 3EMGA 3TKUA 4HCTA 5M53A 5TR6A 3QUEA 4I5MA 4QTCA 2PVHA 3Q53A 5CXHA 4AA4A 4D0XA 5CVFA 5CF6A 2ZVAA 4FIEA 1EH4A 4NZWB 4EOIA 2PUUA 3R1YA 1K3AA 3V5LA 1YQJA 3RK7A 4QP8A 2JDVA 1WBPA 5CF8A 2YDKA 3C9WA 4CT2A 2UZTA 3F5UA 4DE4A 2LAVA 4CVAA 1YKRA 4ZJVA 3II5A 4DGGA 3PTGA 4RWJA 4C4GA 2ZOQA 3QQHA 4M68A 4EOLA 4IE9A 2BUJA 3F2AA 2IJMA 5FRIA 2ITVA 4MXZA 4LGHA 2XM8A 4FTCA 2B54A 3F2RA 3NIEA 3CTHA 4ZTSA 3RWPA 4ANSA 3S2PA 5EYMA 3LFSA 3Q52A 3QD2B 3FZTA 1UA2A 4TZRA 3TUBA 4D4YA 4XV2A 4WRGA 3RCJA 2IWIA 4RFZA 4MWHA 1XBAA 4KSQA 3JS2A 3OW3A 3PPJA 4W4XA 3VQHA 4NTTA 2PMLX 4A9TA 3F5PA 1WAKA 4TWCA 3W1FA 4LRMA 1Q41A 5HG7A 4N70A 2C5VA 1ZMWA 2WXVA 3MA3A 3ENMA 3I60A 3QTIA 3VJNA 4KBKA 4F7JA 4RA5A 4H3QA 1WBTA 3ID6C 4BTMA 4YSJA 4YGAA 5CLPA 1H0WA 4CFXA 2IW6A 3EFLA 4A4LA 2PVMA 2W9FB 4EC8A 4J95A 4M12A 3R1NA 2RGPA 4ACCA 3DS6A 3R22A 4IB5A 3QTQA 2Z7QA 4FTLA 3G33A 4XBUA 5AUVA 4C4JA 1G3NA 4X3FC 4XG8A 3CQWA 4O0VA 5JZNA 5AX9A 3R8UA 5DFPA 4ZSLA 3SXSA 3P78A 4A4OA 4D0WA 4DCEA 4CG9A 1IA8A 3FMNA 2R3HA 5E8TA 3DDPA 3IONA 4J97A 3R8PA 3EZVA 3Q4UA 4DGMA 5IEYA 3NYXA 5EOBA 5HVKA 2WOUA 3DZOA 3G9LX 3MH2A 5BVEA 3PRFA 1U5RA 3ZHPC 3SC1A 3OY1A 1H01A 2J0IA 3LXNA 4U79A 5J9ZA 4JDJA 5FBOA 1YOLA 3KRJA 4O86A 3V04A 2C0TA 2XK3A 4ZTQA 3DXNA 4GL9A 3ZYAA 3UP7A 2GTNA 4FSWA 4BCIA 3SW7A 1R1WA 1Q3DA 4Z16A 4K2RA 1UNGA 4GIIA 5CU3A 5E8ZA 5EHYA 1DAYA 5M07A 4GSBA 4YUQA 2FYSA 3C4EA 4D55A 5BUEA 4AGDA 5C8KA 4JX3A 1UKIA 5CU4A 3SRVB 4O96A 3FZOA 3V51A 2UZBA 2OLCA 4QP4A 3REPA 3H9FA 4H36A 4JT3A 5FXQA 5E4HA 3NNXA 4FKOA 2R3KA 3MPMA 4O83A 4Y85A 5EW9A 2YIYA 5CVGA 2UW0A 3RWQA 3MV5A 4JQEA 1XH5A 4QTAA 3LLAA 4C2VA 4EQMA 3KRLA 4BDEA 4B99A 3AQVA 5DVRA 2NPQA 3EQGA 4FKGA 2R3RA 3ZFMA 1PMEA 4L52A 3L8VA 3PXZA 2YCFA 2X0GA 3ZTXA 4QYYA 4O7WA 4E93A 5HTCA 3CIKA 3FC2A 5F94A 3UODA 5I9VA 4CMUA 2HZ0A 2ITOA 2XRWA 3LCDA 4WNKA 3W0OA 4RQVA 3V5TA 3T3UA 3CD8A 1RE8A 4X7QA 4I6HA 4D4RA 4RWIA 3QRJA 5H8BA 4KNBA 3TJDA 4A4XA 4AZFA 3FY0A 4F6SA 5CAVA 3O7LD 1K9AA 2BAKA 1A48A 2PVKA 3FE3A 3BU6A 4FIHA 4J71A 4F1TA 5ETFA 1UU3A 3R8VA 3NEWA 5EDRA 4DCAA 1CM8A 4LRKA 1PY5A 4OTRA 3OC1A 3MY5A 5CAPA 4CV8A 3LFBA 1NVSA 5EM5A 1ZRZA 4FNZA 4TY1A 3ZOSA 4BCGA 3ZC6A 4BZOA 5IA1A 4FV4A 4G17A 4HGLA 3KMUA 5L8JA 4M15A 4DG0E 4AX8A 4YHFA 4PNKA 3VJOA 1H24A 2W5BA 4IAAA 4C4FA 3CXWA 4XLIA 3QTWA 1P14A 4H3BA 5CYIA 5DA3A 1NW1A 3Q5IA 2W5AA 5IEVA 4IZ5A 4LRJA 3P5KA 2VWYA 2EB2A 3DB8A 4YJVA 1NT2A 4EEVA 4LUDA 3QQGA 3PSBA 3DCVA 3R71A 4GUBA 4BTJA 3FKLA 4E4XA 4USEA 1FVRA 2WEVA 4G9RA 3T3VA 5K4JA 5GJDA 3ZXTA 4EUTA 3F3TA 2QO7A 4HYIA 1PKDA 4USFA 4IX4A 4HVGA 3AC5A 3TT0A 5IUIA 3U8WA 1W84A 1LEZA 1ZOHA 4RX7A 1BX6A 2QI8A 1G8SA 3DFAA 3OD6X 4U3ZA 5ANKA 3QX4A 3Q6UA 2WMSA 4CKJA 4DH3A 3D94A 2OIBA 4NJ3A 2CPKE 3VUIA 3BWFA 5M57A 2PE2A 1ATPE 4BB4A 4BCOA 3FUPA 1WBNA 4A07A 3PVBA 4MNEA 4XG2A 3BE2A 1CKIA 5HG9A 2HIWA 2JLDA 4RJ3A 2PZIA 5HVYA 3R73A 4RIYA 5HE3A 4Q9ZA 2XJ2A 5K5XA 4E6CA 1T45A 1V1KA 3VRYA 1H08A 1XH7A 2WMAA 4H1MA 4TN6A 4FKTA 2B9IA 3E7VA 4ID7A 1SYKA 3ZXZA 4LV8A 1SVGA 3AD4A 4OUCA 4XEYA 1E1VA 3C0GA 3QCQA 3EQCA 2JFMA 5HCXA 3WZUA 2BDWA 3P4KA 3ZBFA 2HW6A 3ZRLA 3PJ3A 3S1HA 4J96A 2VX0A 5EDPA 3F3ZA 5BVKA 5L3AA 1YI3A 3PLSA 4U45A 4PV0A 2DQ7X 4B4LA 4FKLA 4U5JA 3IG7A 4MXAA 4QMZA 3VW6A 2CHLA 2DUVA 3C13A 2XH5A 3IQ7A 4TTHB 5EHLA 2VZ6A 4UZDA 1YHVA 4XG7A 3R8ZA 3TXOA 3JPVA 4NKAA 3BQRA 4R5SA 2J9MA 5HO8A 3V6RA 4BZDA 4EL9A 5HORA 4G3FA 4YLKA 4EWHA 4YLLA 2C0IA 5L8KA 5DIAA 4QPSA 3DA6A 5AV2A 3HMNA 4I4EA 1SZMA 1P4OA 2ZV7A 3JY0A 2X2LA 5F95A 5DH3A 2R3GA 3U9NA 4YO4A 4S30A 4D4VA 1G5SA 3E8EA 3DBCA 3RK9A 5HKMA 1FOTA 4MH7A 3LMIA 3TI1A 1ZYDA 2Z2WA 2WTCA 3Q5ZA 3K54A 4KBCA 3TV4A 1JAMA 4DFBA 4ANLA 5EW3A 1RW8A 3MFRA 3NX8A 5AUYA 3VS0A 3PUPA 2WOTA 3WZEA 2R3IA 3SX9A 4CTBA 3GU5A 4CFWA 4BDBA 4P2KA 4YNOA 4EBWA 3R7YA 2HOGA 4C38A 5CSHA 5IISA 1M52A 2PVLA 2ZAZA 4EH6A 4FG7A 2YIWA 2UVXA 3E87A 3KU2A 4U7ZA 3ZO2A 2FSOX 3DTWA 5E8YA 3BYUA 4NFMA 4EK8A 3F3WA 3E64A 3N9XA 2WIHA 5M55A 1FINA 4ASZA 3QC4A 4ZS0A 3KCKA 2XNBA 2ETMA 1OVEA 3ERKA 5JGBA 2R64A 5IH6A 4PL4A 2X39A 2Z7SA 3QD4A 1BI8A 1QCFA 3QTRA 4EH3A 5DR9A 1HOWA 3DB6A 5JGDA 2JBOA 4NH1A 4FKJA 2IG7A 2C3IB 3U87A 2XCKA 3OP5A 5CY3A 1PMNA 2VD5A 2X6EA 3POZA 5IF1A 4O21A 1WFCA 4IACA 2YZAA 2H6DA 4QNYA 4EH4A 2BZKB 3PLAE 3GQIA 4BCKA 3NCZA 4GJ3A 3C1XA 5GIOE 3R21A 4DHFA 3EOCA 2GS7A 5AUTA 5KKRB 3QTXA 2RG6A 2J0JA 2RFSA 3ZEWA 3R02A 2DWBA 5E91A 2A4LA 3DBEA 4MBIA 3ALOA 3D5UA 2P4IA 1J1BA 2H34A 3NAYA 2ZV2A 5CU2A 1Q24A 4DT8A 3VUMA 1OBDA 4FICA 1I09A 2XIRA 2OI4X 5D1JA 4KUJA 4CFNA 2XM9A 2GFSA 2R3PA 3DU8A 1P5EA 4CRSA 2VX1A 5CEPA 3SRVA 4IBMA 4TKSA 3OOGA 1BMKA 3R63A 5DI1A 4DFZE 3U4WA 2Y7JA 5I5ZA 4GU9A 3OCBA 3NW7A 2WMUA 1FBNA 4ITJA 4XRJA 3UG1A 5K9IA 2WIPA 2G15A 2IVTA 3F5XA 2C4GA 3F3VA 3S95A 1J91A 2WFYA 3EQBA 2XKEA 4GK3A 5AP3A 5HHWA 4F9BA 3H9OA 2PHKA 4GKIA 1QPCA 4XG3A 5C03A 3EZRA 4GIHA 3OT8A 1BLXA 5E1EA 4L68A 3R7OA 5DWRA 2GQSA 2I40A 2XVDA 2WPAA 4MTAA 3CY3A 2YCRA 1SVHA 1M2RA 4ZJJA 3DOGA 4QRCA 3O96A 5KKRC 4QMWA 4O0SA 3MESA 4JQ7A 3JYAA 5IA5A 4BDHA 5FXRA 3TUDA 3HL7A 3LM0A 2PMOX 3E93A 4I22A 4CMOA 3HRCA 2OK1A 3HEGA 2UW7A 5AV0A 4C33A 3SW4A 3LE6A 2CSNA 2NRYA 2V0DA 3DK7A 3L8XA 1H27A 4UYAA 1JOWB 4L9IA 5AA9A 3IOKA 5AP1A 3ACJA 3V5JA 4OW8A 3BHYA 4RC4A 1YI4A 2FSLX 4L3PA 1XQZA 2QNJA 2O64A 1R39A 4FTQA 4JIKA 1ZZ2A 3HV4A 3QBNA 4AZVA 5K5NA 1WBVA 3NZ0A 4APPA 4C34A 4JG8A 3TCPA 4RIWB 5JRSA 5LOHA 5LWMA 4DTAA 3OROA 3TUCA 1CDKA 1OL2A 5HX8A 3F7ZA 3KQ7A 3FZPA 4Y72A 2GQRA 5KX8A 3QGWA 4BIDA 3SG9A 2JKOA 1OL1A 5ANOA 2W0JA 5HBJA 2Q0NA 3ZONA 3RPVA 3BYMA 4QNAA 2OBJA 2JAMA 4ZSAA 3FMMA 4HW7A 3M2WA 3L9NA 4HYSA 5JGAA 4CXAA 4FEQA 3TL8A 3ZSGA 4YZDA 2XK4A 3DJ7A 5IQBA 2JDTA 3JUHA 4BCHA 4L7FA 3UIUA 5C4KA 2R0UA 4IM0A 3R8LA 1LP4A 1OKVA 1DI9A 4F6WA 3TWJA 3VUGA 5LMBA 3FLWA 4O0WA 4G34A 3PJ2A 5E9EA 1H0VA 4YZBA 4O0UA 3G5DA 2PVFA 3MJ2A 4N4SA 2XZSA 3MY1A 3U55A 2OSCA 1ZLTA 4GK4A 3F7WA 5AIRA 2WQEA 4EK3A 2XIYA 4RGJA 3NIZA 3DPKA 4K6ZA 1UU8A 4MD8E 2CKEA 5A54A 4N6ZA 2J50A 4C4HA 2HENA 3FKOA 1YVJA 3NGAA 3NYVA 4D1SA 1NVQA 1SMHA 2B7AA 4RVKA 2J4ZA 4JR7A 4MD7E 4FOBA 4UXLA 3ORKA 3TTIA 3VBYA 4U3YA 3LFQA 2ERZE 3ETAA 1B39A 2EWAA 4DH7A 3VS6A 4D58A 3HMPA 3RPSA 5AP0A 5ETCA 5DR6A 3F6XA 4G3CA 4LYNA 4C62A 2IW9A 5KBRA 2OWBA 3P7BA 4F7LA 4ZMFA 3KY2A 3O8TA 4BGQA 3R1SA 2XEZA 4RIWA 2OZOA 2PMNX 3ANRA 3FMKA 5BX0A 3SGCA 5EI6A 2YDJA 5DBXA 2R7BA 3MVLA 2EXCX 4FV0A 5DT0A 4BHNA 4YBKA 2VWUA 1O6YA 4ITHA 4ZJIA 5IG1A 2I0EA 3FLYA 5AIKA 4DITA 4BYJA 2GU8A 4D2RA 3UNKA 3OEFX 4D9TA 3QTSA 2G1TA 4ANBA 5A4CA 3PG3A 4IVCA 4LUEA 4FTKA 2C6LA 1TQMA 4MXYA 4F65A 3RAHA 5EW8A 4DAWA 1PMVA 2VTTA 5TKDA 3IK3A 1OL7A 3OWKA 1JNKA 3EYGA 4FC0A 1O9UA 2YWVA 4FZFB 3QXOA 2IPXA 3F5GA 4PDOA 4QMUA 3UYSA 1KWPA 3QWKA 2WO6A 4ENYA 3R2YA 5FGKA 2F9GA 3A7GA 1UNLA 4RX5A 2B4SB 3B2TA 3GGFA 4E5WA 2IZUA 5L2WA 1YI6A 3E7OA 5EYCA 5LCKA 3KULB 3UVQA 3OUNB 1W7HA 4FL3A 3D83A 2Z7LA 3IGGA 4L44A 4ZY6A 4IB3A 2QG5A 3SOCA 4E1ZA 1H26A 3GFWA 4D5HA 4FZ7A 2QOBA 3VC4A 3A2CA 2WMTA 3UOKA 1RJBA 2YZLA 1R3CA 3Q9XA 4LG4A 1WVWA 2EB3A 2PK9A 5TOZA 3MIYA 2PPQA 4CKIA 2YAAA 1JWHA 1H07A 4NYEA 4JAJA 4N0SA 3I0QA 4L45A 4PMTA 4QMYA 2R3JA 2Y4PA 4USDA 5GNKA 4AGWA 5EM6A 2XK9A 3UG2A 2CLQA 4ZS4A 4PTCA 5D11A 5LQFA 5EKOA 2DS1A 2PE0A 3UZTA 4TYIA 3R9RA 1L3RE 4YJUA 5ICPA 5AWMA 4FKUA 4OTWA 3VIDA 1PXIA 3LVPA 1Y6AA 4FG9A 4Y83A 3KMMA 2HW7A 2AC5A 1GZOA 2XA4A 4BDCA 4RJ6A 1AD5A 4EK5A 5C8NA 3DQXA 4FR4A 2PVYA 4ZSJA 2CJMA 3GQLA 4U9AA 3NUUA 2PE1A 5L6OA 4EUUA 4AGUA 5CAQA 4UWYA 3UOJA 2EU9A 1ND4A 2VU3A 2V55A 1WBSA 3MH1A 4R7BA 4XV9A 2W1HA 1OMWA 4KS7A 5BNJA 2WGJA 4IFCA 3I5NA 1QPEA 3W10A 3LCOA 4IVDA 4P7EA 3BELA 3BYVA 1REJA 2ZM1A 1GIJA 3KVWA 2CCIA 4XLVA 3EIDA 1MUOA 4BCFA 3ZZWA 4G3GA 3BGZA 5DOSA 3ZFYA 5I9YA 2J0KA 3ORNA 4WSYA 1H4LA 1YDTE 4M7IA 3QZFA 5CI6A 4ACDA 2BDJA 2QVSE 5C01A 3UIBA 1JKSA 1SNXA 4FOCA 1LUFA 2GSFA 2BILB 3R7EA 4RIXA 3UPXA 5BPYA 4YJQA 2R3LA 4BCJA 3TNPC 4FZDB 2O5KA 5AJQA 3SXRA 2JKQA 4NL0A 3MSSA 3R0TA 3NNWA 4QMQA 4R5YA 4O7TA 1JSUA 2FB8A 4KKHA 2WTIA 2YCQA 4AG8A 4OTDA 5DPVA 4Z3VA 3QF9A 2UV2A 1DS5A 3MVJA 4FSRA 4RX8A 4TT7A 4ZY5A 5M51A 3R2BA 3EJ1A 3V5QA 3JR1A 3DTCA 3N4UA 2HAKA 3K2LA 4TYGA 5HBHA 3DV3A 3WF8A 4ANMA 4AZTA 4ZTNA 4DFYA 3W2SA 2CNUA 4ZXTA 4PY1A 3OMVA 2VWZA 3QA8A 3TKHA 4P5QA 5BVDA 4I20A 4AZEA 3QTZA 2PU8A 4K11A 2RFDA 2WQBA 4QMSA 3NPCA 1Q99A 2JIUA 3E88A 3R9DA 3VULA 3O51A 2B1PA 4IX3A 3ZDUA 5JH6A 3WZJA 4G1WA 2ETRA 2QHMA 2FSTX 1W8CA 2F4JA 3QYWA 2ETKA 2WTKC 4DH1A 4JAIA 4RIXB 5M4IA 5LMKA 2OO8X 3AC8A 4X3JA 3CPCA 4RT7A 3HZTA 5EI2A 3I4BA 5HGIA 2JDOA 5IU2A 2BRNA 2GNLA 2H8HA 5EH0A 4S31A 3FV8A 3DLZA 1XH4A 4XNEA 2VTNA 2X8EA 2RFEA 3AT4A 3KB7A 3LMHA 3CBLA 4QQJA 3GNIB 2UUEA 4O27B 4R3PA 3OTUA 4N6YA 4IWQA 4DINA 2UVZA 4ZLOA 4CFVA 5IDNA 3I79A 5C9CA 2B9JA 1FPUA 3R83A 3FMEA 3PIYA 5ETAA 5HE0A 3S3IA 4PWNA 3W8LA 3LFEA 2X8DA 3COMA 4XP3A 4EZ3A 4AW0A 4AS0A 1XJDA 2VAGA 2Y8OA 4M0ZA 4O7OA 4PX6A 3SKCA 3PIZA 3NW6A 2OU7A 4FSYA 3DJ5A 3PPKA 3TV6A 2F49A 3BYSA 4PQNA 4X2NA 3Q2MA 4I6BA 5L2TA 1IR3A 2ITXA 3ZSIA 2C30A 1GZ8A 3FQSA 4JQ8A 4AT4A 1F5QA 3GBZA 5AMNA 3W0RA 4BR3A 3NYOA 2B55A 2R3NA 3ZU7A 4AAAA 4X21A 4DLJA 3SLSA 5F9EA 3C4CA 2J51A 4LMNA 5EQPA 3KN5A 4U42A 2YM4A 5DN3A 2UVYA 2YAKA 2YIRA 3NUSA 4FV9A 5FLFA 4G6NA 3UZPA 4ZIMA 3FMLA 4HJOA 3PSCA 3PP1A 3UC4A 2OG8A 3VUDA 3ORMA 4GS6A 4I6QA 5HLPA 2A2AA 4GFMA 4UZHA 5ACBC 3A8WA 2CKOA 4R78A 2R0IA 2WTJA 5L6WL 3NUYA 5D12A 4EHZA 1Z9XA 3U9CA 3ZLWA 2YM6A 4PL5A 5CAOA 2G01A 4FV1A 4P5ZA 4RC2A 4DG2E 3V8SA 2IW8A 1Y6BA 3BV3A 2GNFA 5JK3A 2XB7A 2GPHA 4AWIA 4B8MA 1URWA 3ORPA 3P79A 4FI1A 4EC9A 3DXQA 1YWNA 2REIA 3U51A 2VGOA 4R77A 3BLQA 5H3QA 4WG5A 2ITPA 2PWLA 4BVUA 1VEBA 4CFMA 3KREA 5CSWA 4C2WA 2QU6A 3O17A 1W98A 4HZSA 3QFVA 1CSNA 2CGWA 2PUPA 3PJCA 4MNEB 2X4ZA 2YERA 3TV7A 1A06A 2OJFE 4RFMA 2W05A 5HLWA 3QRUA 2P55A 2HZIA 2KULA 2O3PA 4EYMA 1YWRA 5LWNA 1GNGA 3NW5A 4R3CA 4R7HA 4KIQA 3VUKA 4W4YA 3V8TA 1KE9A 1OKZA 3D5XA 3MTFA 1U46A 3MH3A 4QQTA 4O0TA 4S34A 1KOAA 3EKNA 3HKOA 4PRJA 3A7HA 4O38A 2UZOA 3RM7A 3H10A 4F9AA 3DY7A 5EI8A 2XP2A 3FEGA 3COHA 2ITQA 4J1RA 4IAKA 4PDSA 5EK7A 4E73A 2QOLA 4O7YA 3CTQA 4WBBB 3ROCA 4MKCA 3R6XA 4I92A 2BPMA 5A4EA 4NM7A 2VO7A 2O0UA 3I5ZA 3F61A 2PULA 3LQ3A 4QP6A 3FKNA 4FK3A 4BIBA 4O7ZA 5A6NA 2QOHA 3LMGA 5LXMA 3QHWA 2XBJA 4G5JA 4JBPA 2YABA 3G9NA 4JDHA 3NUXA 5CT0A 2GS2A 3A7JA 3Q9YA 2O63A 4H3PA 2FGIA 2CN5A 4MNFA 4BBFA 4PDPA 2JIVA 3GCVA 4MX9A 3PA3A 1M2PA 3BWJA 5CANA 4U98A 5FDXA 1OZ1A 4FVRA 4E6QA 3K3JA 3PXKA 4YPSA 4F99A 3FLNC 2JBPA 3ODZX 4IJ9A 5C8MA 2NNWB 4GVAA 4Q5HA 4YC8A 3EKKA 5H9BA 4I5HA 4UEUA 3ULZA 5LVMA 3NYNA 5DEYA 5CQUA 4DT9A 4IDTA 3PY3A 2VWBA 2W1CA 4WOVA 2C1BA 2H9VA 3F2NA 4FVQA 4ACHA 2Z8CA 3LW0A 1PYXA 3TZMA 3MYGA 4NUSA 2FUMA 2UZUE 5H8GA 4FZAB 1OIUA 3HP2A 5FP5A 4RG0A 1H1RA 4FA2A 3S00A 4AZWA 1PYEA 3A7FA 3WZKA 2RF9A 5AUUA 4R6VA 3E92A 4QYFA 3QRIA 3MJ1A 2P3GX 4JLCA 2QLUA 4RC3A 4G2FA 3O71A 3RTPA 3W18A 5J7HA 2RIOA 2IVVA 4I1ZA 3POOA 5E8SA 1Z5MA 4AXAA 3A62A 1UKHA 2V22A 4XCUA 4I24A 5IQHA 4F1OA 2OGVA 4Q9SA 2XIKA 4QP2A 4FSZA 2YJSA 4PP7A 5JMSA 3TJCA 4JG6A 3BGPA 4PTGA 2OXXA 1AQ1A 5CU0A 1ZMVA 4DEHA 5A9UA 4WD5A 2JITA 4XG4A 3FXXA 3QCYA 4RSSA 3LXKA 2GDOA 1IG1A 3BEGA 2BKZA 4EZ5A 3KXZA 4QMNA 3PXQA 4IAIA 3C0IA 5L2SA 5H8EA 1PXKA 3FLQA 4JOAA 3HRBA 4FTUA 5HU3A 3QALE 4QYEA 5HNBA 4GT5A 4XMOA 2OXDA 5D41A 2ITYA 3OOMA 4HCVA 4AFJA 1H1SA 4GYGA 4I41A 4GKHA 3LJ1A 4ZTMA 5HTBA 4L42A 4MXXA 1BL7A 1OL6A 5FXSA 5FTQA 4PF4A 4UXQA 4XG9A 5KNJA 3MFUA 4ZLYA 3KK8A 4L3LA 3WF9A 4H58A 4CFFA 3A99A 5CASA 2F57A 4QP1A 4F1MA 4IC8A 3UQCA 3AXWA 4G16A 4RWLA 1S9IA 2PZYA 3MBLA 3ZUUA 2NO3A 5ANJA 2CGVA 3MB7A 4G9CA 4H05A 5AAFA 5DE2A 3N4VA 3VS4A 4M69B 3NCGA 5JSMA 3OFMA 4FYOA 4MBLA 4AT5A 3IDBA 5ETIA 4OTIA 4MK0A 5DLSA 5HCYA 1XBBA 4Z9LA 4QMLA 3EB0A 2A1AB 3HRFA 2IZTA 3LOKA 5KMKA 2GNHA 4IC7A 1URCA 4QMTA 4RWKA 2E9OA 3W2QA 4W8EA 4KSPA 4Z55A 2ITWA 3IPHA 4IH8A 4D2SA 4WKQA 4WNOA 3LQ5A 2C5YA 4W4WA 3MTLA 1P2AA 3MVMA 3VAPA 4AN2A 4FE2A 3O8PA 4RVLA 4HNFA 3WZDA 2C5OA 3VW8A 4EK4A 3OBGA 3MI9A 3OTVA 4J8NA 1G8AA 4RRVA 3WE8A 1OPLA 3PE1A 4JJRA 4IB0A 3WIGA 2A19B 2ZJWA 5KMIA 5DNRA 4RJ7A 4QOXA 5T3QA 3QYZA 4F08A 4IVBA 3NSZA 2XYNA 3LJ0A 4ZTHA 3FXZA 2BRHA 4F70A 4CCBA 2PZPA 5CSVA 4NM3A 4FODA 3R01A 3GEQA 2R9SA 5L8LA 5LVLA 5CF4A 2BRBA 2ZV9A 2VTJA 3V6SA 2W4JA 4HCUA 4EHVA 4EYJA 4J7BA 4JBQA 2E2BA 4LMUA 4QQCA 4GG7A 4XP0A 2GTMA 1PKGA 1NY3A 1VYZA 5CNOA 3UBDA 3MB6A 4GCJA 4V05A 1NXKA 3R7VA 3AC1A 4DN5A 4F64A 1YOJA 2VTPA 1A9UA 3QZIA 2WQOA 2IVUA 3MPAA 3NUAA 4HVDA 5HZNA 3LFAA 1FQ1B 3LXPA 4X3FA 4FNYA 3ZSHA 3AG9A 1M7QA 3TZ7A 3IS5A 3SVVA 3C4XA 3KMWA 3D9VA 4PNIA 3ZUTA 4HVSA 4U8ZA 3GB2A 4O7NA 1YOMA 2YM8A 4AW5A 4BIEA 5KMLA 2CCHA 4C0TA 5IDPA 2G2HA 3LIJA 2JAVA 4EKLA 2VO0A 3PXYA 3AMAA 3U4UA 3RP9A 4WG3A 1XWSA 3Q32A 4QMOA 5DT4A 4FV5A 2X9EA 4L6QA 3G15A 4LOPA 5I9WA 3GENA 4ZMEA 1ZXEA 4ZZOA 2W1FA 5FUTA 3O2MA 3PFQA 4HVIA 2WD1A 3G90X 4GVJA 2X6DA 3DBQA 3OZ6A 5E8UA 5KMNA 4TXCA 1Q62A 2PUIA 3C50A 3KXHA 4O0XA 3UMWA 5JKGA 2ACXA 3BHVA 3HAVA 2GNJA 3UJGA 4ARKA 2XCHA 3AC2A 3C4ZA 3H3CA 4FTIA 3TDVA 4G5PA 5M44A 1ZYJA 3KXXA 3ZDIA 1YXTA 3HAMA 4OBQA 2YJRA 5CTPA 2WU6A 1SNUA 4R7IA 3ZS5A 4AW1A 4CMTA 4K18A 4AT3A 3CQUA 2YEXA 4RZWA 3AGLA 4IAYA 2YCSA 3ATSA 1K2PA 5M09A 3THBA 3PZEA 3K3IA 4RBLA 4WBOA 4QMXA 5IUHA 3MWUA 3KC3A 4DEAA 3CP9A 2X1NA 3WE4A 3GUBA 4ERWA 2C69A 2W17A 3ORLA 4IVAA 2WMWA 2WU7A 1FGKA 1V0PA 4U0IA 2OW3A 2X7OA 3MVHA 3TG1A 3VS7A 2QOCA 4IANA 1IEPA 4OGRA 5IQAA 3GCUA 1OPKA 3SV0A 2XJ1A 4Y5HA 3UNJA 5FDPA 5K4IA 2X8IA 4L01A 4ZTLA 4ZZNA 5HE2A 2V7AA 4X2GA 2CMWA 2J2IB 3DAJA 3UGCA 4WZYA 4APCA 3RK5A 4WT6A 5JFVA 3MFTA 1ZYCA 2BMCA 4U43A 4CLJA 3O0GA 3Q04A 4DYMA 5M4FA 3I7BA 2W4OA 3BHHA 3UVRA 4KWPA 4QP9A 4TNBA 1XBCA 4OTQA 5AM6A 4O2PA 3EWHA 4GFGA 2I0YA 4II5A 2J0MB 3UOHA 4D1XA 1R78A 5EFQA 2C3KA 3KF7A 3W2OA 3AT2A 5BVFA 5CF5A 3DKOA 2P2IA 4R3RA 5EKNA 2ONLA 1TKIA 5C4LA 5LVPA 3Q4ZA 2G9XA 2E9UA 4TNDA 2XK7A 4YTCA 5FTGA 4XOYA 5IA3A 3ZO4A 4BCPA 4BHZA 1YXVA 3QCSA 3QCXA 1ZY5A 3PY1A 2BVAA 3HDNA 4BI0A 2ZMDA 5ANIA 1FVTA 2IVSA 2W7XA 3LCSA 4MF1A 4PL3A 4QTDA 4RLLA 4EOPA 4IWDA 2VO3A 1H1PA 2XJ0A 4XH6A 2ITUA 4OR5A 5C1QB 2E9PA 2AC3A 4C3RA 3IOPA 2I7QA 4G3EA 2XKCA 3RHKA 3OXZA 5F1ZA 2OZAB 3BEAA 3GOKA 3ZLYA 3EQIA 4NM5A 5A4QA 5DGZA 2PZ5A 1MQBA 3FHIA 4YU2A 5AP5A 1FMOE 1OIYA 4P4CA 2W1DA 3AD6A 3D7TA 3I1AA 1XR1A 4AN3A 1OUKA 1CKJA 4YJRA 3DQWA 3BLHA 3ZM4A 2PYWA 4EWQA 1DI8A 3DT1A 4ENXA 5CENA 2C6IA 4IWOA 4TL0A 3DJ6A
chains in the Genus database with same CATH superfamily
2CGXA 3GC7A 3JXWA 3EFJA 1PXMA 3HV7A 4NCTA 2GNIA 4ASEA 3QUPA 3P0MA 4QP7A 3OG7A 2X2KA 4BN1A 3QQUA 2BZJA 2QLQA 4FT3A 4O7VA 4F09A 4IFGA 2CKQA 1OGUA 4FV3A 4GJ2A 3R7UA 4BBEA 1IASA 3O5AA 4IWPA 4HGTA 3UDZA 4EHEA 5KZIA 3Q9WA 4LV7A 4Y46A 4A9RA 3IO7A 1UWJA 3DFCB 4FSNA 4ITIA 2VTOA 4LOQA 1HCKA 2A27A 5AUXA 4CT1A 4BC6A 4GV1A 3C4WA 4C36A 3KFAA 2WTDA 2R7IA 5BMMA 4MQ2A 3UVPA 4CCUA 4UX9A 3ZCLA 4AA0A 2F2UA 2QONA 4FKRA 4YJSA 4BDJA 3COKA 3WF6A 4ACGA 4MD9E 3ENHA 5IZFA 3TYKA 2Z7RA 2QU5A 4XUFA 4TW9A 4XRLA 2QCSA 2VUWA 3CQEA 4AZSA 5IH5A 3L9LA 4JBVA 5M06A 3QL8A 3NDMA 4MQ1A 5CT7A 5CWZA 2JKMA 3D2KA 5ANGA 2HYYA 4DFLA 2ZDTA 3FDNA 5KO1A 5DG5A 5KCVA 2WMBA 3RM6A 4RJ8A 4GK2A 3I0OA 2O8YA 4IX6A 1PXLA 4DH5A 4IZ7A 4BCNA 5B2MA 3UIXA 4L7SA 3RAKA 2QKWB 4LDTA 3HDMA 2UW5A 2OZAA 2HCKA 2YWPA 4I93A 2Q83A 3P7CA 4PMMA 1MQ4A 1H25A 4AXCA 1YDRE 3D4QA 3WI6A 4EH8A 2BROA 2C3LA 2XBAA 3C0HA 3FI3A 4M97A 5AUZA 1GIIA 3GXLA 1SM2A 3K5VA 4FNWA 4IZAA 4F0FA 1WMKA 4I0SA 3R04A 5TF9A 1UVRA 3FI8A 5E8VA 4CZTA 1W0XC 3QKKA 4AN9A 3S0OA 4AF3A 4UB7A 2XK6A 2PVJA 3I7CA 3W33A 2PVRA 4S33A 4G3DA 3RCDA 1OPJA 4JNWA 3Q60A 4OBOA 5AFVA 3EQRA 2GHLA 2HY0A 1OB3A 2I0HA 4O0YA 2HXQA 4NSTA 4FSMA 2R3FA 3K5UA 4XG6A 4B9DA 2BAJA 4JG7A 4BRXA 1M7NA 4L46A 5EM8A 5D10A 3FSFA 5CEKA 3ZEPA 2X2MA 4WRSA 4E5BA 2XIZA 4FT9A 4YC6A 5CEMA 5CNNA 1KUTA 1PW2A 2J5EA 3FYJX 2BTRA 3D15A 3LHJA 2WELA 3B8QA 3VUHA 4K0YA 3W0QA 2C6DA 3NFGB 3VNTA 5DHJA 3W2PA 3HGKA 2HXLA 2XNNA 5T68A 1DM2A 3L9MA 4BDDA 4Y73A 2VTRA 2C5NA 4U40A 4GG5A 4I6LA 3LFDA 4EORA 4FIIA 2ZMCA 1STCE 1SVEA 1YRPA 1BUHA 3MDYA 5DR2A 4IB1A 5CX9A 4HZRA 4J53A 2JFLA 4O84A 1JKLA 2R4BA 3ORZA 3UIMA 2XYUA 2EVAA 4EQCA 4MCVA 3IW6A 2QOFA 1YHSA 3A61A 5J87A 2X7GA 3QKMA 3QZGA 2VN9A 4BTKA 3PJ1A 5F20A 1UWHA 3LPBA 1JKKA 3NRMA 3CSVA 3ATTA 3TZ9A 2OIDA 4FX3A 2XNOA 3HMOA 3C7QA 2YM7A 3LM5A 4UN0C 5E90A 3ZO3A 3Q3BA 4E4LA 4FGBA 3IGOA 2Y4IC 4O91A 2OF4A 4ZSEA 4KS8A 4NM0A 5HG5A 3NMUF 3Q6WA 3NLBA 4X6RA 5HLNA 1JKTA 4ORKA 3FL5A 4QMVA 3VO3A 4RJ4A 4HPUE 1GJOA 1M17A 4C4IA 2YM3A 3U6JA 2R5TA 3BHUA 5T6KA 4EOSA 5B2LA 4MVFA 2OJIA 2QC6A 2W1ZA 4RVMA 1ZAOA 3T9TA 3FZRA 3ZRMA 3QKLA 3M42A 3PYYA 4O0RA 5GJGA 4WUAA 3FZSA 5JT2A 5GIPE 1CTPE 4NW5A 4I5CA 3D7ZA 1IAHA 5FM3A 5KBQA 3EQDA 3VS2A 4YJPA 1W82A 5IQIA 5AUWA 3C5IA 3L8PA 2Y0AA 4CGAA 3ACKA 4HYUA 2B9HA 5FG8A 2ITZA 4FIFA 4OLIA 4KKEA 3NS9A 4XOZA 2P0CA 5FQDC 4EOOA 1YW2A 4B7TA 2WAJA 3F88A 3ROYA 5F4NA 1Q5KA 4E7WA 3AT3A 5G1XA 2IZSA 5JN2A 5J1WA 5DYJA 1QL6A 4X2KA 4FNXA 2KTYA 4FEWA 5BYZA 4U94A 3VRZA 4DF3A 5IA4A 2VTIA 4OTGA 4YJNA 5I4NA 3KXMA 1BKXA 1YWVA 2HY81 4FKSA 4YZMA 3O7LB 4U6RA 3RHXA 3DKGA 1GZNA 2XUUA 4J98A 3RJCA 3BLRA 3VF8A 3BX5A 4K1BA 2BRGA 3TNHA 3G0EA 3GU4A 3DKCA 5TT7A 5KMMA 2FVDA 2F7EE 5JFWA 3KRXA 1XHAA 2HZ4A 3OF0A 3HYHA 4NCTC 2GCDA 1MRUA 3AC3A 2UW6A 3FLSA 4FV7A 5CAUA 1JVPP 5LMAA 3E5AA 3QQKA 5HNIX 3FL4A 2HWOA 1TVOA 1QMZA 5A3XA 4M67A 2XRUA 4EONA 2HWPA 4EQUA 1E1XA 1QPJA 2CDZA 1APME 2WQMA 4QP3A 3OW4A 5E8WA 5HO7A 5K3YA 5IEXA 3PY0A 4JL9A 2VGPA 1BL6A 2VRXA 3R9OA 3H4JA 3KGAA 5AEPA 2PY3A 3GCPA 4S32A 2QOKA 5A4LA 5I9ZA 5IQEA 2W5HA 2QODA 2C68A 3HV6A 4TYHA 3VN9A 5CXZA 5LARA 2Y6OA 5E1SA 5BQ0A 3OT3A 1ZZLA 4LL5A 3ZLSA 1ZY4A 3AOXA 2PVNA 2W9ZB 3IW5A 3O50A 5IQDA 1WVXA 2HK5A 2XMYA 3Q4TA 3UTOA 1GAGA 3MGYA 4GFOA 4IM3A 4QDEA 4YLJA 5FM2A 1J1CA 3MA6A 4MAOA 2W1GA 5GJFA 3LCKA 3KCFA 2UZLA 2I1MA 2QHNA 4CZUA 5LVOA 4OTFA 1W83A 3QD3A 2W96B 4PDYA 4DTKA 3V5PA 4ASDA 4YC3A 2RL5A 3RVGA 2YIXA 4I21A 3HVCA 5M4UA 5BUIA 1WCCA 4EK6A 4EJ7A 4X6QC 4V0GA 3QWJA 5AV1A 4FSUA 4DA5A 3ZMMA 5C26A 1PXJA 3HV3A 5DRBA 2YACA 4EH2A 4EHGA 3TZ8A 2I0VA 2ZYBA 3LLTA 3IDCA 5CU6A 2YM5A 2VNWA 5HEZA 2O2UA 3RI1A 5FTOA 1T46A 3FY2A 4JIAA 4D28A 4IJPA 3D5VA 1Q8ZA 3KL8A 5ACKA 2NP8A 4CTCA 2OXYA 4TYJA 4D5KA 2OJ9A 2UW8A 3ZFXA 4F7NA 5ITAA 5JQ8A 3EQPA 2AUHA 4YZNA 1OIRA 4NW6A 5HIEA 2Y6MA 3U6HA 2R3MA 3PWDA 2X81A 2PMIA 4ZSGA 4HNIA 3CGOA 4C3PA 3RPYA 3ULIA 5J1VA 1R0EA 1WVYA 2R3QA 3VF9A 5KUPA 4JDKA 4TWNA 3OCGA 4P90A 2SRCA 4JXFA 3VVHA 5EG3A 4FL2A 3FMHA 1CKPA 3FHRA 4IQ6A 4JRVA 4TYHB 3QX2A 3CGFA 3A8XA 4BGGA 2AYPA 2BHEA 3HECA 3LKMA 5EM7A 3AKLA 3RAWA 5IUGA 4C3FA 2BIKB 3WBLA 3NNVA 3PA4A 1PXNA 4FKIA 4QTEA 1F3MC 2IZRA 3N4TA 1V0OA 3GU6A 3JY9A 3ORXA 3UZRA 4C7TA 5E92A 3SD0A 4B6LA 3W32A 4FZ6A 4GU6A 3KKVA 1ZWSA 2VTAA 1JSVA 1OM1A 2VO6A 3AGMA 1PXOA 3EN6A 3O8UA 4YURA 5BUJA 4H1JA 4BKJA 4B8LA 2GNGA 4U80A 1J3HA 5G6VA 4FTJA 2J90A 4YZ9A 2WTWA 4YBJA 3MIAA 3WILA 1U4DA 1MRYA 4IZYA 4ZEGA 3Q2JA 5HIDA 3PP0A 2VTLA 4FKVA 3FI2A 1FVVA 4U44A 5D9HA 1ZYSA 2WHBA 4AA5A 4BI1A 4R1YA 2ERKA 3CJFA 3A4PA 1TQIA 4GH2A 3QRKA 4K33A 3DGKA 2XK8A 3WARA 3KXNA 4LGGA 4G6OA 3RINA 2GFCA 1JBPE 4F0GA 4PUZA 4EBVA 4AACA 5E8XA 4V01A 4E6AA 1PRYA 2XKFA 3OS3A 5JQ5A 5IA2A 2CNVA 1JQHA 5IMEA 4G6LA 5IMXA 2Y9QA 4YNEA 4HVHA 1KOBA 1HCLA 4KINA 3A7IA 2XS0A 4EI4A 3SG8A 4NJDA 3AD5A 2F7XE 3CS9A 4JBOA 3W0SA 3CR0A 3UO6A 3M1SA 4FEVA 1OBGA 4FVPA 2C6TA 3GC9A 3UPZA 4EH7A 3ZUVA 2OFVA 3NWWA 5TO8A 4I6FA 3C5UA 4O22A 4WIHA 3QGYA 3LJ2A 3OBJA 4F4PA 4DEBA 4DEGA 4O82A 4CD0A 1V0BA 4AU8A 2JDRA 5CEOA 2VWVA 3HLLA 2OFUA 4LV5A 3TACA 4KRDA 3SXFA 3MW1A 4YSMA 4LM5A 4BY9E 4Q5EA 4DTBA 3EN5A 4NT4A 4A9SA 4EH9A 5A4TA 5HU9A 5LMKC 4IX5A 5D7AA 5EHOA 5AAEA 2BDFA 2QG7A 4BI2A 3FSKA 3FQEA 3HA6A 2JD5A 4YJOA 5IPJA 4UWCA 4F7SA 4ANQA 1KE7A 1Q8YA 1GIHA 4CEGA 3I6WA 3NVMB 4CNHA 3W2CA 1LPUA 2LGCA 3Q96A 1XKKA 2OKRA 3O23A 3PVGA 2VTSA 3DBFA 4Y95A 3QZHA 3R00A 3UO4A 4NTSA 2E9NA 5AP7A 1H1QA 2FH9A 4DLIA 4XV3A 4L67A 5FBNC 4GEOA 1TQPA 2XANA 4QYGA 4UV0A 4EH5A 5CVHA 1YHWA 5CQWA 2C0OA 1KE5A 2F2CB 4BDKA 3BBWA 4DH8A 3B2WA 4O6LA 1Y8YA 4RLKA 3W0PA 4A9YA 3LAUA 4RZVA 3W55A 4AOIA 4ZOGA 2QOQA 4C37A 3BPRA 1FMKA 2Z02A 2V7OA 4L8MA 4BTFA 4E4MA 5DEWA 3S4QA 3EFWA 1J7LA 3GP0A 3ZBXA 4EZ7A 2OJJA 2ZB1A 3GU7A 3BRBA 1YXUA 2QR8A 3VS1A 2BIYA 1H8FA 3UC3A 3FI4A 4I94A 3HUCA 3KK9A 1Q4LA 4FT5A 3IECA 2BFXA 3DAEA 4FV8A 5CZIA 3PRIA 2R3OA 3BU3A 2ITNA 4X0MA 4NIFB 2FSMX 3P23A 3ODYX 4QTBA 4EOKA 4HYHA 4D9UA 4ZLZA 4DG3E 3OVVA 1H28A 2HZNA 1R0PA 2JDSA 3R30A 2QO9A 1Q3WA 4NU1A 4ZZMA 4IAZA 4DGLC 2VWIA 2YA9A 4L00A 3TNQB 4NWMA 2OF2A 1NVRA 4MEDA 3UMXA 3W0MA 4YP8A 1VJYA 2V5QA 2BALA 3COIA 3VHKA 4DEDA 4F6UA 5HE1A 1XH8A 3HA8A 4C59A 3PE2A 3WF7A 3UQFA 2XNMA 5AA8A 4H39A 4FBXA 3SA0A 3SOAA 1LEWA 1RDQE 5IA0A 2G2FA 4M3QA 3VBXA 3G6HA 3KXGA 3HUBA 2C47A 3BQCA 3GI3A 4ALWA 4ERKA 3JVSA 4IMYA 4FMQA 1PJKA 4LOOA 5B2KA 4E4NA 2ZV8A 4UBAA 3ZC5A 5DT3A 4BDAA 2JC6A 2WTKB 4YHJA 3FAAA 3ALNA 5AV4A 1UNHA 3BHTA 2IO6A 5FD2A 2XAMA 2C6MA 3QUDA 3SQQA 3U54A 1ZOEA 5JRQA 4M14A 3OXIA 1PXPA 5I9UA 3OWLA 2QURA 3BBTB 3BI6A 3EN7A 4BF2A 3G6GA 4MYGA 2F7ZE 3A4OX 1OL5A 4UY9A 3QTUA 4J52A 2XIXA 4C4EA 1OKWA 4QT1A 4FV6A 4B0GA 3SDJA 3WIKA 4DBXA 5EQYA 4L53A 3BL9A 3CD3A 1UU7A 3BZ3A 3B8RA 4FTMA 4GW8A 2ZM4A 5HESA 3QLGA 4ALVA 1ZMUA 2VV9A 3NUPA 4FIGA 3IW7A 5CI7A 1Y8GA 3FXWA 2PUNA 4AW2A 2XAOA 2BRMA 5CS6A 3SAYA 1X8BA 2YIQA 2ZM3A 3CJGA 4FKQA 4AP7A 2BKKA 3PSDA 4HPTE 3MH0A 4A06A 4CQEA 3QXPA 3LQ8A 2GS6A 3W8QA 3D0EA 2J7TA 3DAKA 3KN6A 4X3FB 4FTOA 4RVTA 3T9IA 4KD1A 3UP2A 1KV1A 4YMJA 3GU8A 1PMUA 2UW4A 4RX9A 5I0BA 1IAJA 3L8SA 4BCQA 4RQKA 3WYYA 4LI5A 5J5SA 2OJGA 5A46A 1AGWA 3TNWA 1LR4A 4FL1A 4NKSA 5JFSA 1OITA 2C5XA 2BZHB 1L8TA 4RPVA 5M4CA 4GYIA 2XEYA 3H9RA 3TDWA 4AAYA 3TKIA 3H30A 4FK6A 4CKRA 1I44A 1JLUE 1Y91A 4F9CA 2XF0A 4MWIA 5I9XA 3R28A 1BYGA 3GFEA 1FGIA 2PTKA 3OXTA 2WQNA 3PXRA 1VLRA 5J95A 4A9UA 4FTTA 4C02A 4Z7HA 5D7VA 5KZ0A 4DGOA 4WNPA 4FUYA 3CLYA 4S2ZA 3GOPA 1QPDA 3PVWA 2WB8A 3L9PA 4OT5A 4WUNA 4RFYA 2RFNA 4DDIA 4F9WA 4OTHA 4JX7A 3UDSA 4WHZA 4YTHA 4KBAA 4I0RA 3NNUA 5CSPA 2ZDUA 4FTAA 3W16A 2J5FA 4PP9A 2WMRA 3TMOA 4Z7GA 4EOQA 4AXFA 5FP6A 2FO0A 3Q4CA 3LCTA 3C4FA 3DNEA 1XH6A 5CEQA 3VQUA 5HX6A 5JZJA 3E63A 1B6CB 2IN6A 3I81A 5B0XA 4LL0A 5EYKA 3DBDA 3FMDA 5IQCA 3QQFA 1ERKA 2QR7A 2OICA 4X2JA 3W0NA 5BVNA 5J9YA 4V0GB 2O65A 3VS3A 4ALUA 2YITA 3OY3A 4BDIA 2EXMA 2GQGA 3CCNA 2A0CX 3EFKA 3ET7A 1U54A 3FQHA 4I3ZA 4NK9A 2ESMA 4FKWA 5HCZA 5ANEA 4WNMA 2W4KA 3LZBA 4O7RA 4PMPA 5BYYA 2JEDA 3EN9A 4PMSA 4V04A 4ZY4A 4E8AA 5GHVA 4QO9A 4CG8A 5LCJA 3DKFA 3GC8A 3OCSA 3P1AA 4YZCA 3FPQA 4DBNA 3R9HA 3ZH8A 4I23A 4YHTA 4M13A 2ONLC 4XHKB 3RKBA 2BZIB 3UE4A 4NFNA 3UYTA 2QKRA 3AC4A 2WTVA 3OHTA 3QLFA 3FJQE 4CV9A 1P4FA 2BFYA 2I6LA 4YO6A 5M08A 1Q8UA 3F82A 5KE0A 2BAQA 1GOLA 4C35A 3HX4A 2BHHA 3E8NA 4KB8A 4RJ5A 4WA9A 4XBRA 3WYXA 3R8MA 5IH4A 3FPMA 2BCJA 4FGRA 1J7UA 4YPDA 3FMJA 2GMXA 2B9FA 5DRDA 4FT0A 1Q97A 3GCSA 1Y57A 2WMQA 3G0FA 1Q8WA 4HGSA 3CKWA 3BGQA 3AMYA 4IEBA 4TYEA 5AP6A 1F0QA 4DFXE 3TTJA 2ITTA 5JEBA 1WBOA 3QAME 3V8WA 5HNGA 2PZRA 2WMVA 4TRLA 1KSWA 2CNQA 4O6EA 1DAWA 3GC0A 3GVUA 3KF4A 5L6PA 4FKPA 1Z57A 2WMXA 3E3PA 1XO2B 3F69A 3PXFA 4TWPA 4QPAA 4EKKA 2VWXA 4K8AA 3A60A 4XJ0A 4DFNA 4C58A 3VHEA 4F0IA 2YN8A 5IQFA 4O81A 2GHGA 4I5PA 5EQEA 2UZWE 5HBEA 4KIPA 3UDBA 2VTHA 3M11A 4ASXA 4ZAUA 4YJTA 2RKUA 4BDFA 5BMSA 2UZVA 3E62A 3QD0A 3QA0A 3DK3A 4FSTA 5H2UA 5BVWA 2R2PA 5CZHA 3RPOA 3BCEA 4I0TA 5EOLA 4KABA 3DDQA 1G8JA 4RA4A 3DLSA 4FSQA 3G51A 3CY2A 4FUXA 3R9NA 3E8CA 3HV5A 3CKXA 2C6KA 1OIQA 4L43A 4RMZA 4BICA 1KE6A 4BCMA 3BE9A 3CTJA 3QC9A 2YISA 2C3JA 4FEUA 3RZBA 4EOJA 1VZOA 5HD4A 2W99B 3OWJA 3PJ8A 3EHAA 2NRUA 4UALA 4M0YA 4IADA 3T8OA 4YR8A 3P7AA 4E20A 1ZOGA 3H0ZA 4ZTRA 1REKA 3KULA 5JFXA 1UU9A 3PVUA 1IA9A 3AMBA 3FZ1A 3KRRA 2V62A 3NAXA 3PWYA 4HGEA 4LQMA 3G2FA 3D2IA 3BIZA 2GHMA 2UZNA 3HP5A 4UWBA 5EYDA 5BYLA 3TM0A 4F9YA 3GT8A 1Q61A 3PA5A 3FWQA 4DHIB 1UV5A 3LFNA 2XNGA 1XH9A 3IDPA 4QYHA 3NUNA 5AX3A 4EOMA 4AE9A 1CMKE 2WKMA 3V5WA 1H00A 1OUYA 3PPZA 1O6KA 1KE8A 2HELA 3EL7A 2BTSA 4Y5QA 3BU5A 4U97A 3F66A 2UZEA 3U6IA 1MRVA 4KKGA 5HD7A 2ZB0A 5J9LA 5FEDA 3L1SA 4UYNA 3MY0A 2XKDA 3ANQA 4FT7A 2CN8A 3RAIA 3BYOA 1KV2A 4J99A 4YTFA 4CFUA 5AM7A 1JPAA 4MXCA 2OIQA 4AOJA 3EN4A 2J0LA 2P2HA 5KMJA 2PL0A 1J7IA 4IAFA 1B38A 4WO5A 3UNZA 3P9JA 4JI9A 3KA0A 4QMMA 2W1IA 2QD9A 2RG5A 5A14A 3RMFA 4EJNA 3NVKI 3MPTA 3H0YA 4JDIA 4QQ5A 3VBVA 1WBWA 3PIXA 2X4FA 4AQCA 3VS5A 3EYHA 2CLXA 3CEKA 4ZP5A 4MHAA 4E5AX 4AE6A 2VX3A 5B7VA 3D14A 1E9HA 5AP4A 1JSTA 3ZLXA 3RPRA 1BI7A 4O2ZA 4D1ZA 2JIIA 5HVJA 3UOLA 3W2RA 2DYLA 2QO2A 2EUFB 4CRLA 3OUKA 4DFUA 1Q8TA 1H1WA 3QHRA 3P5JC 3IKAA 4HOKA 3TIYA 2UW9A 4Y8DA 4C61A 2X9FA 4X2FA 3UO5A 1GY3A 5HI2A 3V3VA 3ZM9A 5J8IA 3TEIA 3EQHA 1M2QA 3IW4A 3KVXA 4IIRA 2UZDA 2JGZA 2QOOA 3IW8A 3SHEA 2XNEA 4FIJA 4K9YA 4XS2A 4AOTA 4CSVA 4FV2A 4G31A 1NA7A 3RNYA 3V01A 3I6UA 5IQGA 2YDIA 4FG8A 3F9NA 3HMIA 4K77A 2X7FA 2B0QA 5E7RA 4CLIA 1OI9A 3KRWA 3LFCA 4KRCA 4MXOA 4XX9A 3VBTA 1S9JA 3P08A 4FYNA 3RNIA 4YTIA 3VWAA 3R7IA 1WZYA 1U5QA 3Q9ZA 3EL8A 2G2IA 4IM2A 5FEEA 5KMOA 4XV1A 1YXXA 1OKYA 2OH0E 3ORTA 5HICA 4A7CA 4FEXA 3UQGA 4O7PA 4GT3A 3D5WA 3HNGA 2VTQA 4O7SA 2CGUA 2QOIA 5CALA 3CE3A 2WEIA 3HMMA 1IRKA 3KEXA 3ZZEA 3DK6A 1GZKA 2BR1A 3OWPA 2OH4A 3LFFA 4AGCA 1ZARA 2B53A 3PZHA 3MFSA 4IDVA 4Q2AA 1PF8A 3QQLA 3JVRA 3TN8A 4BBMA 3CPBA 3R1QA 1U59A 5ANDA 4GMYA 2J6MA 3ELJA 3EQFA 4KAOA 4LFIA 4W8DA 2QQ7A 2YHVA 3CC6A 4KA3A 5AV3A 4PTEA 4W4VA 4XYFA 3E8DA 3RGFA 3DXPA 3ORIA 2C6OA 1VR2A 2WNTA 2VNYA 4OT6A 5AADA 2VWWA 3OEZA 4RIOA 2B52A 3D7TB 1O6LA 4TWOA 4E26A 2Q0BA 5HQ0A 5KHXA 1ST4A 1U54B 4FTNA 3PDTA 4BZNA 4IHPA 3MN3A 4M8TA 3ZRKA 3VONA 4ONAA 4N57A 4U81A 3ZO1A 4U41A 3BLAA 4O7LA 4DEIA 5KHWA 3F3UA 2W1EA 1PHKA 1YDSE 3MS9A 3TIZA 2YFXA 3BKBA 2UW3A 3QQJA 5A6OA 5LVNA 2C6EA 4JR3A 5HG8A 1YXSA 2E9VA 4GRBA 4GT4A 4MBJA 3FBVA 1M14A 4E6DA 4BYIA 5GINE 5L2IA 2P33A 2CKPA 4IW0A 3DNDA 3LXLA 4JS8A 3QU0A 4M84A 4FTRA 4ZK5A 4BGHA 2W06A 3BV2A 3GCQA 5HIBA 4D4SA 3N51A 3VBWA 3OCTA 3P86A 4WG4A 4L3JA 3FC1X 2XNPA 4R1VA 4XP2A 5EDQA 4F63A 4DGNA 2Z60A 1VYWA 5AP2A 5CSXA 2JKKA 4BDGA 4DC2A 2PSQA 5M56A 4QMPA 3VBQA 3WF5A 2Y4IB 3EH9A 3QRTA 3FLZA 2FA2A 1OECA 1RQQA 5FEQA 3ITZA 4AUAA 5BVOA 4DEEA 2C1AA 4J8MA 5CEIA 3WOWA 4AFEA 4ACMA 3C51A 5AAGA 5LJJA 4OBPA 3DZQA 4GUEA 4KIOA 4JVGA 3NR9A 4QDVA 3E3BX 2VTMA 4RIYB 4I4FA 5C27A 3PG1A 3FYKX 4TPTA 3TNIA 2WZJA 2H96A 3RALA 1OGYA 4JRNA 1MP8A 3EMGA 3TKUA 4HCTA 5M53A 5TR6A 3QUEA 4I5MA 4QTCA 2PVHA 3Q53A 5CXHA 4AA4A 4D0XA 5CVFA 5CF6A 2ZVAA 4FIEA 1EH4A 4NZWB 4EOIA 2PUUA 3R1YA 1K3AA 1XMMA 3V5LA 1YQJA 3RK7A 4QP8A 2JDVA 1WBPA 5CF8A 3C9WA 2YDKA 4CT2A 2UZTA 3F5UA 4DE4A 2LAVA 4CVAA 1YKRA 4AXDA 4ZJVA 3II5A 4DGGA 3PTGA 4RWJA 4C4GA 2ZOQA 4TL0A 3QQHA 4M68A 4EOLA 4IE9A 2BUJA 3F2AA 2IJMA 5FRIA 2ITVA 4MXZA 4LGHA 2XM8A 4FTCA 2B54A 3F2RA 3NIEA 3CTHA 4ZTSA 3RWPA 4ANSA 3S2PA 5EYMA 3LFSA 3Q52A 3QD2B 3FZTA 1UA2A 4TZRA 3TUBA 4D4YA 4XV2A 4WRGA 3RCJA 2IWIA 4RFZA 4MWHA 1XBAA 4KSQA 3JS2A 3OW3A 3PPJA 4W4XA 3VQHA 4NTTA 2PMLX 4A9TA 3F5PA 1WAKA 4TWCA 3W1FA 4LRMA 1Q41A 5HG7A 4N70A 2C5VA 1ZMWA 2WXVA 3MA3A 3ENMA 3I60A 3QTIA 3VJNA 4KBKA 4F7JA 4RA5A 4H3QA 1WBTA 3ID6C 4BTMA 4YSJA 4YGAA 5CLPA 1H0WA 4CFXA 2IW6A 3EFLA 4A4LA 2PVMA 2W9FB 4EC8A 4J95A 4M12A 3R1NA 2RGPA 4ACCA 3DS6A 3R22A 4IB5A 3QTQA 2Z7QA 4FTLA 3G33A 4XBUA 5AUVA 4C4JA 1G3NA 4X3FC 4XG8A 3CQWA 4O0VA 5JZNA 5AX9A 3R8UA 5DFPA 4ZSLA 3SXSA 3P78A 4A4OA 4D0WA 4DCEA 4CG9A 1IA8A 3FMNA 2R3HA 5E8TA 3DDPA 3IONA 4J97A 3R8PA 3EZVA 3Q4UA 4DGMA 5IEYA 3NYXA 5EOBA 5HVKA 2WOUA 3DZOA 3G9LX 3MH2A 5BVEA 3PRFA 1U5RA 3ZHPC 3SC1A 3OY1A 1H01A 2J0IA 3LXNA 4U79A 5J9ZA 4JDJA 5FBOA 3BL7A 1YOLA 3KRJA 4O86A 3V04A 2C0TA 2XK3A 4ZTQA 3DXNA 4GL9A 3ZYAA 3UP7A 2GTNA 4FSWA 4BCIA 3SW7A 1R1WA 1Q3DA 4Z16A 4K2RA 1UNGA 4GIIA 5CU3A 5E8ZA 5EHYA 1DAYA 5M07A 4GSBA 4YUQA 2FYSA 3C4EA 4D55A 5BUEA 4AGDA 5C8KA 4JX3A 1UKIA 5CU4A 3SRVB 4O96A 3FZOA 3V51A 5BV3A 2UZBA 2OLCA 4QP4A 3REPA 3H9FA 4H36A 4JT3A 5FXQA 5E4HA 3NNXA 4FKOA 2R3KA 3MPMA 4O83A 4Y85A 5EW9A 2YIYA 5CVGA 2UW0A 3RWQA 3MV5A 4JQEA 1XH5A 4QTAA 3LLAA 4C2VA 4EQMA 3KRLA 4JMQA 4BDEA 4B99A 3AQVA 5DVRA 2NPQA 3EQGA 4FKGA 2R3RA 3ZFMA 1PMEA 4L52A 3L8VA 3PXZA 2YCFA 2X0GA 3ZTXA 4QYYA 4O7WA 4E93A 5HTCA 3CIKA 3FC2A 5F94A 3UODA 5I9VA 4CMUA 2HZ0A 2ITOA 2XRWA 3LCDA 4WNKA 3W0OA 4RQVA 3V5TA 3T3UA 3CD8A 1RE8A 4X7QA 2XALA 4I6HA 4D4RA 4RWIA 3QRJA 5H8BA 4KNBA 3TJDA 4A4XA 4AZFA 3FY0A 4F6SA 5CAVA 3O7LD 1K9AA 2BAKA 1A48A 2PVKA 3FE3A 3BU6A 4FIHA 4J71A 4F1TA 5ETFA 1UU3A 3R8VA 3NEWA 5EDRA 4DCAA 1CM8A 4LRKA 1PY5A 4OTRA 3OC1A 3MY5A 5CAPA 4CV8A 3LFBA 1NVSA 5EM5A 1ZRZA 4FNZA 4TY1A 3ZOSA 4BCGA 3ZC6A 4BZOA 5IA1A 4FV4A 4G17A 4HGLA 3KMUA 5L8JA 4M15A 4DG0E