3TDVA

Structure of the gdp complex of wild-type aminoglycoside 2'-phosphotransferase-iiia
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
QNKLHYTTMIMTQFPDISIQSVESLGEGFRNYAILVNGDWVFRFPKSQQGADELNKEIQLLPLLVGCVKVNIPQYVYIGKRSDGNPFVGYRKVQGQILGEDGMAVFPDDAKDRLALQLAEFMNELSAFPVETAISAGVPVTNLKNKILLLSEAVEDQVFPLLDESLRDYLTLRFQSYMTHPVYTRYTPRLIHGDLSPDHFLTNLNSRQTPLTGIIDFGDAAISDPDYDYVYLLEDCGELFTRQVMAYRGEVDLDTHIRKVSLFVTFDQVSYLLEGLRARDQDWISEGLELLEEDKANNFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoglycoside-2' phosphotransferase-IIIa (APH(2')-IIIa) prefers GTP over ATP: Structural templates for nucleotide recognition in the bacterial aminoglycoside-2' kinases.
pubmed doi rcsb
source organism Enterococcus gallinarum
molecule tags Transferase
molecule keywords Gentamicin resistance protein
total genus 101
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tdvA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3tdvA02
5DHJA 4OLIA 4FX3A 3NNXA 2PZ5A 4NU1A 4C59A 5KBRA 5D10A 3WF9A 5EYCA 2VU3A 3A7IA 3LCKA 4I5CA 2VNYA 3FDNA 5KKRC 2YIYA 1HCLA 4ITHA 5AUZA 4CVAA 2DUVA 3D0EA 5A14A 4BGHA 2QO7A 5KMLA 1H00A 4IWQA 1Y6AA 3PWYA 3K54A 4NK9A 3VRYA 3ZXZA 2OH4A 3GCVA 3IOPA 3AC1A 3E7OA 3NX8A 1HCKA 3TNQB 1W8CA 5EM8A 4J8NA 4JDHA 3EH9A 4V01A 3QZFA 2JC6A 4UB7A 5IEYA 3EN5A 3HV7A 4RPVA 3VHKA 4ZMFA 4BDBA 1YXSA 5DFPA 4HVGA 2VWIA 4EH9A 4EONA 3LMGA 3EWHA 3BE9A 4QMMA 5JQ8A 5E8TA 2VX0A 2J2IB 2WQNA 4YZNA 3DJ7A 4ZJJA 4D5KA 3PPZA 4DGNA 4YTCA 3PIXA 5IA1A 3Q4ZA 1P2AA 2WHBA 2R4BA 1IEPA 4Q5EA 4H1MA 2B7AA 3UTOA 4F7SA 3SA0A 2WMUA 3UIUA 3K5UA 4G34A 3F2AA 4XCUA 4BCGA 4D4RA 2I0YA 1PMVA 2JBPA 4RIYA 5CS6A 2R3LA 4U6RA 1PXKA 4L42A 4MQ1A 4ANQA 1H08A 3LM0A 3TI1A 2IVSA 4RX5A 4QTEA 1ZOEA 3MH1A 4QTBA 3A62A 4EL9A 4Y85A 4YPSA 5E8ZA 2VWYA 5M55A 3TEIA 1JSUA 3M42A 4O7TA 3VQUA 4AN9A 3R63A 4CFMA 4DE4A 5CI6A 3ACKA 4H36A 3IOKA 5EI6A 3O17A 4UWCA 5HGIA 4RFYA 3WZEA 2BR1A 2P3GX 2Z02A 1P4FA 3CJFA 4EZ3A 4A9SA 1B38A 5AP7A 1Q41A 1OKVA 2B9FA 5AV0A 2O63A 3BX5A 3RPOA 3VWAA 1YWVA 4QYYA 2YEXA 3LJ2A 1OL7A 2B4SB 3PVWA 4XX9A 5D41A 3AXWA 2CSNA 4AAAA 4EBWA 2C0OA 3TJDA 3MY5A 3A7GA 2VTMA 4F1MA 2VO7A 4YC3A 4ZLOA 3MV5A 5DNRA 4WRGA 5HHWA 4IB3A 4RFMA 2YWPA 5HIDA 2QHMA 4LMNA 4PL4A 5J1WA 1DS5A 3TL8A 1Q8WA 2AC3A 3OBJA 3RWPA 4XOYA 4AZEA 5M57A 3LXLA 3R9OA 4AGDA 4B8LA 3BQRA 3DQXA 4PMPA 2UZBA 5LMBA 1Q97A 1REKA 5BVDA 4L01A 2BZIB 4L67A 4TZRA 4XH6A 3C4ZA 5JT2A 3H0YA 4XJ0A 2VTNA 1PXNA 4P2KA 5GJFA 3MESA 1H0WA 4JX7A 1I44A 1J1CA 2DS1A 4Q9ZA 3PA3A 4CCUA 3VUDA 3O8TA 3VN9A 4IH8A 3MBLA 1KE9A 5CZIA 3HKOA 5DT3A 3R8LA 3VJOA 4FIGA 4V04A 3QRIA 4E20A 3TTIA 3FQEA 2C6IA 4J96A 3VUKA 4DEHA 3ZEPA 1FGKA 2FH9A 3EQDA 5IA2A 5JH6A 4PRJA 4GK3A 2I6LA 1VYWA 2ITQA 3UIMA 5CAVA 2UZTA 3Q04A 3PG3A 4A9TA 3OP5A 4QPSA 5TKDA 1PKDA 3Q52A 3NCZA 4JL9A 2ZMDA 4NWMA 3ATSA 2IG7A 4RJ8A 3QCYA 4IAIA 5TOZA 1JQHA 2ZB0A 3DK3A 4HNFA 4QQ5A 1PMUA 4TXCA 3R7EA 4FIEA 3A60A 3GU6A 2WQEA 3ZLSA 4C2WA 4FV1A 2BZKB 2WD1A 1NY3A 1G3NA 3EHAA 3D5WA 2OIBA 3IDPA 4ZLYA 4FSMA 5AUVA 4PQNA 2XNOA 4B6LA 4R3PA 4FL3A 4N0SA 3UQGA 3MWUA 5ANJA 3ZBFA 4CFFA 4EH4A 2H34A 5E8SA 1GZOA 2YDJA 4ID7A 5IZFA 4CKIA 4BIEA 3ORNA 4XMOA 3F7ZA 5K4IA 2C3JA 4AACA 3AD5A 1PXJA 4EK6A 3LIJA 1OKZA 4HVHA 3GNIB 2X4ZA 4P90A 5M4FA 4AW2A 5DRDA 2G01A 2QR7A 4Q5HA 4J97A 4GS6A 3LQ8A 3LCTA 3CPCA 2UZUE 4LM5A 3SG9A 3UO4A 2OKRA 4BCKA 4F65A 4DEBA 1YQJA 1J7IA 3V5LA 1NA7A 5J7HA 1R3CA 3BRBA 3MH2A 3E5AA 4F9YA 4O21A 5FXSA 1PMEA 3PSCA 5FTGA 3PWDA 4DFUA 4W4VA 3GQIA 3VBXA 1W82A 4OBPA 3NR9A 3MY1A 3AOXA 5B0XA 4XG3A 4X2FA 5EM7A 5HVJA 3C9WA 1PKGA 3Q9YA 4TPTA 1PXOA 4P5QA 4LGGA 4NM3A 5E8YA 3UNJA 3EL7A 3FMNA 4HVDA 5EI2A 3CQWA 3Q6WA 3D2IA 4M67A 2W4OA 3ZH8A 1PXMA 3V3VA 2JDOA 4MNEA 3ZSHA 1UWHA 3C4EA 2PUUA 4FV2A 5AJQA 4GKIA 5LXMA 3IG7A 4PTEA 2P4IA 3LPBA 3E7VA 3E63A 3VBVA 2Y4PA 3ZO3A 2VD5A 4RIWB 3G0EA 4G3EA 3CQEA 4D2SA 2OFUA 4E4LA 2UW9A 3Q2JA 4GG5A 4L52A 3CJGA 3FEGA 2C30A 5A54A 1UNGA 3ZCLA 2HCKA 4G3CA 5M56A 3MTFA 5CI7A 2XYUA 4FE2A 3V6RA 3RK7A 3ZZWA 3GU4A 4AW1A 3KK8A 4GL9A 4AOJA 3WI6A 5JGAA 4G6OA 3OT3A 5A4CA 3R9DA 3KK9A 5DPVA 2HXLA 1NVRA 4QMTA 2OIDA 3DFAA 3OTUA 2X2LA 3QTZA 5BUEA 3TT0A 4CSVA 2CMWA 5C27A 3PLSA 1PF8A 4BYIA 4DLIA 3OTVA 4RC2A 4G9RA 4FIFA 4RIXB 4JG7A 4LL5A 2F9GA 2E9UA 2PZIA 4E26A 4I93A 4U8ZA 4DEGA 5D11A 5F9EA 2F57A 5ICPA 5CT7A 4MXXA 4O2PA 5IQEA 3P4KA 4XG2A 5CWZA 2PTKA 4UBAA 3RAKA 4F63A 4S2ZA 4GEOA 1A9UA 1J1BA 1PY5A 4C33A 2OIQA 3QTWA 4XP2A 5EDQA 3UOHA 5I4NA 3NAYA 4CQEA 2BROA 2YCFA 2EUFB 4RWKA 2FYSA 2UZDA 3HP2A 3BWJA 3TZ8A 4YMJA 4KBCA 3ZM4A 2I0VA 1ZMUA 2CKEA 2UW3A 3TM0A 3ZUTA 2DYLA 2R64A 3POOA 1Y6BA 3D94A 1TQMA 1YXTA 4O0RA 3ZONA 3D83A 2VTRA 3HV4A 2XEZA 3LFCA 4L8MA 4NFMA 3QTUA 4RX8A 4YSMA 3R8ZA 3E87A 4DINA 5M53A 5AV3A 2ZM1A 1XBCA 4IVBA 4GVAA 1BL6A 5C01A 3GXLA 1H8FA 2G2IA 3W0QA 4YC6A 3F5XA 3LFBA 2EWAA 4AN2A 1J3HA 4FOCA 4HOKA 1YKRA 2PUNA 4OUCA 3VHEA 2RFSA 3P78A 4GU6A 3EMGA 5FTQA 5I9WA 4NZWB 3CY3A 5HE0A 4BN1A 2VTIA 3EQGA 1H28A 3S2PA 4R7HA 3M11A 5HTCA 4E5BA 2YIWA 3VUIA 3RHKA 5ANIA 3MI9A 1T45A 5LVLA 1BMKA 1CSNA 3TNWA 2A1AB 4A4OA 4MD7E 1URCA 2ITOA 4GK2A 3KY2A 3R8UA 5JFWA 3OWKA 3C4CA 4WSYA 1PYXA 3OFMA 5CU6A 5D7VA 3GT8A 5IH5A 4S33A 2KTYA 3GUBA 3DAJA 5IQIA 2HY81 3E92A 5E91A 4Z16A 2XNBA 4XV9A 3ZFMA 5I0BA 4PDYA 2XK3A 3AG9A 4OTQA 1ZYJA 3D7ZA 4ZSEA 2HENA 5K5NA 1YVJA 3H30A 1CM8A 2ZV8A 3UODA 4S32A 5E4HA 4C4IA 2HYYA 2J0LA 2P55A 2ZAZA 4C02A 5BQ0A 1XBBA 3WE4A 2Z7SA 3FLQA 3TDWA 2ITZA 3QA8A 5DH3A 5BPYA 3DLZA 4ASXA 3CGOA 4KBAA 3W2CA 2J50A 4ZSGA 4GIIA 3RAHA 4CRLA 4JG6A 2UZEA 3BEAA 2XRWA 4X2JA 4CCBA 3QHWA 3V51A 4FT7A 4DFZE 4AZFA 4IX6A 2C47A 4X2KA 4R5YA 3COIA 4FKVA 2R3QA 3FLZA 4IE9A 4UWBA 5A9UA 2CNQA 5C26A 5K9IA 1BLXA 3CGFA 3IW5A 3QWKA 2ITWA 4G1WA 4W4XA 5EI8A 3SQQA 5JFXA 3UPXA 3VO3A 4ZSAA 2W0JA 2O64A 4WT6A 4IHPA 2IO6A 3FZOA 4FV0A 3NIZA 4J98A 5BYYA 4BCJA 3BZ3A 4I1ZA 3T8OA 4ACGA 1F0QA 4WZYA 3BU5A 3KCKA 4AT4A 3ZUVA 4I20A 3ALNA 3SLSA 1UU3A 1YDSE 3G2FA 2RIOA 3R83A 3RINA 2PMOX 2PY3A 1I09A 3QZHA 1Q99A 2Y4IB 2XIKA 3C5IA 2HY0A 4L46A 2BRHA 2OWBA 3JYAA 4Y83A 5BVEA 1JKKA 4FTMA 4O0SA 4BDJA 2W4JA 4UYAA 1WBWA 2OG8A 4U3ZA 4RJ4A 2XYNA 4L3PA 4ANSA 3OW4A 2C6TA 4HGSA 2WZJA 2CGWA 2WNTA 3DAEA 4MTAA 3FSKA 3G5DA 4NJDA 3EZRA 3NEWA 4BVUA 1Z9XA 4I92A 1WMKA 3MA6A 2VO0A 3IPHA 3HA8A 4FGRA 4RIWA 3OUNB 5CSXA 2J0IA 5KMIA 4M7IA 1OUKA 2X2KA 5EW3A 4DH1A 3IGOA 5EK7A 4IEBA 1FMKA 4TN6A 4DC2A 3UVRA 4C58A 3BHHA 4ACCA 5J5SA 4EOMA 3ULZA 2WTKC 2BMCA 5FEEA 5EG3A 5HVKA 2JITA 1UNHA 3NUSA 3CEKA 4JDJA 4E6CA 3OF0A 4TKSA 3ZSGA 4DCAA 4YHJA 5LWNA 5AIRA 2B9JA 2PL0A 2QOBA 4FV8A 2J90A 2NRYA 3FC2A 2GTNA 3GU8A 3QCSA 3QYWA 5FEDA 3ZOSA 4AOIA 3VW8A 3FLNC 3ZMMA 4HPTE 3KMMA 2JAMA 4QP4A 3R7UA 4G3GA 2XB7A 5TR6A 4I6QA 2UZOA 2WU6A 2HK5A 3CC6A 3HMOA 4HJOA 3W8QA 4RLLA 3GP0A 3PY1A 3A99A 4F9BA 2OZAA 3LCDA 3PXQA 2C3IB 2Y9QA 2Z7RA 3ZBXA 4CFXA 4ENYA 4KINA 3VVHA 5H2UA 1YI3A 3PJ1A 3HDNA 4FV6A 4OW8A 3ZTXA 1QCFA 3W55A 1FMOE 2BAKA 2BRNA 4FEQA 4O0WA 4X21A 5D7AA 5D9HA 5GNKA 5A4EA 3BLQA 1BYGA 2WXVA 2W17A 4IC7A 4C3RA 4BIDA 2IW6A 3DLSA 4YSJA 4JOAA 2GS6A 2VX3A 2OXYA 3QWJA 3LJ1A 5LJJA 4DFBA 1AD5A 3A7HA 3ID6C 4CV8A 3TWJA 2G9XA 3VBTA 2BVAA 4I6FA 4IM3A 4BC6A 1T46A 5KZIA 5CXHA 5FQDC 4M3QA 3RKBA 3G0FA 3F3WA 3V5WA 3IW7A 4DYMA 4TYGA 4KRDA 3NVKI 1STCE 5HBHA 2BDJA 2NP8A 3ZHPC 4MXCA 4I5HA 4XHKB 2VWUA 3D5UA 3ROYA 1LPUA 3FLYA 4UV0A 1OL2A 2QD9A 2XF0A 3OXTA 3RZBA 2OU7A 4BDAA 2HWOA 3HMPA 1YXVA 5CAPA 5M09A 1XWSA 1GY3A 3ODZX 4WNOA 4IAZA 3HA6A 4U45A 4DFLA 3G90X 4KUJA 2OJIA 5M07A 1FPUA 1ZYCA 4BI1A 5AUTA 5HZNA 5DG5A 3FSFA 4RA5A 1WZYA 3MVJA 3BYMA 5HBJA 3C4FA 2CLQA 3ETAA 3GC7A 2UW0A 2WMQA 3LZBA 4J53A 4AQCA 1YXUA 4K8AA 4OTFA 2OJFE 4FK3A 3VS7A 3EL8A 1O6YA 3IDCA 3VS2A 2PVRA 4CGAA 3FQSA 5FEQA 3DTCA 4F0FA 4ERWA 2W1CA 3EJ1A 1AGWA 3PP1A 3QZIA 3VUGA 4F7LA 1Q61A 4RC3A 3Q9ZA 3TNIA 4EBVA 4PMSA 3KF4A 3ZC5A 3QQUA 4AGWA 4TT7A 2W1IA 3FMJA 4TYHA 2GMXA 4DG0E 4FA2A 4QP1A 4BCMA 3R1QA 2QKWB 4NT4A 4XV3A 4HVSA 1O6KA 2JKOA 5IDNA 2OXXA 4C35A 2GCDA 4QYFA 1ZARA 2W1FA 3PIYA 4C3FA 4ZMEA 5HNIX 3KGAA 3F5PA 2WTVA 2E9VA 1YOLA 2YN8A 1KV2A 3BIZA 3FMDA 3LMIA 1ZLTA 2QO9A 2F4JA 1HOWA 3DCVA 3CTHA 3PRFA 4OTWA 3ERKA 3L9NA 3LLTA 3QUEA 3MH0A 5CSVA 3PZHA 3CKWA 5BUJA 2PE2A 2PUPA 3FMEA 5CVHA 3OW3A 2R7IA 5AP6A 3F61A 2R3KA 3W33A 4RBLA 4G3FA 3ZRLA 3BE2A 3OMVA 4TWCA 1YDTE 4A07A 2ITVA 5G1XA 2ERKA 2W5AA 4IW0A 3PSBA 3HRFA 3UZPA 3PYYA 3RVGA 4M13A 4AZWA 1GJOA 3SKCA 3VC4A 2PMNX 3R2BA 2IZSA 3WF5A 4EC9A 3MPAA 4D4YA 3JY0A 5AAEA 4IQ6A 5J1VA 5HE2A 5CVGA 2CCHA 3WF7A 2OJ9A 4BDKA 5IQFA 4DTKA 2C5YA 2CNVA 4RIYB 5IF1A 4RZWA 2VZ6A 4W8DA 2WMWA 4EQMA 3QGYA 3O96A 3NIEA 4IZYA 4QO9A 3BYUA 4Y5QA 3OVVA 3HV3A 3OCGA 4FT0A 4PX6A 3NUAA 2PUIA 3EQCA 5CENA 5LCKA 3MFTA 4FTIA 3W2QA 4H3QA 3W10A 3E8CA 1KSWA 3E62A 3PY3A 1PXIA 4FZAB 3GC0A 1FINA 2XIZA 1DI9A 3UP7A 4CZTA 3DKCA 2XNGA 3D7TA 3ET7A 4YNOA 3EB0A 5EQYA 1FGIA 4AN3A 4BI0A 4HYHA 3HMNA 3OY3A 3KN5A 1U5QA 4GU9A 5LVNA 1UV5A 2WTIA 2AC5A 3UG1A 2IN6A 3A2CA 4TTHB 4U81A 4QQCA 3T9TA 5LVOA 1WFCA 2FB8A 2WQBA 2J6MA 3GCQA 3JVRA 4DTBA 3P5KA 1R0PA 3QX2A 4FL1A 5HD4A 2O65A 3C7QA 3CR0A 2BCJA 4CFWA 4DGLC 3QKLA 2QQ7A 4CZUA 5GIOE 4LUEA 4MVFA 5E8VA 5AM7A 5TO8A 3WOWA 4BCFA 2PZRA 2P2HA 5J95A 3FXZA 4BDDA 4IWPA 4KSPA 4DH3A 4L00A 1M2RA 1QMZA 4I41A 3TXOA 4H05A 4F0GA 4PP9A 1NVSA 4OBQA 2ZDTA 4FKWA 2FSLX 4ZEGA 3HX4A 5KO1A 4HPUE 4N6ZA 1KWPA 4CMTA 1RDQE 4I0RA 4HGLA 2JDRA 1M7NA 4TW9A 4ZS0A 3ALOA 5DYJA 3EOCA 3QRTA 4MXAA 3EKKA 5KCVA 3DOGA 4YTIA 2X4FA 3NYXA 2YM8A 2R3HA 2Z60A 2WTJA 3U6JA 1JKLA 4L7SA 1YWNA 5AAGA 5AM6A 3OWPA 3QQLA 5H3QA 4MCVA 5KHXA 3G6HA 2J9MA 3MJ2A 4YBJA 4FTAA 3QQGA 5T68A 3U6HA 4LYNA 4KS8A 2EVAA 3GCSA 4NIFB 1SVHA 4OR5A 4YC8A 5AIKA 4A7CA 3BGPA 2J7TA 2A19B 3R2YA 3KXNA 3ZU7A 4X0MA 2XJ0A 1WVWA 4RIXA 5IQBA 3DKGA 3DV3A 3MH3A 5HE1A 4D0XA 2XKEA 4FKPA 4LV5A 4BBFA 2ITXA 3GCUA 4AFJA 1PXPA 4FTRA 3QL8A 4AE6A 5A4LA 2W9FB 5A3XA 1VJYA 2GDOA 2Z7QA 3U87A 3UP2A 3RK5A 3U6IA 3W0NA 2VTLA 5KX8A 3NPCA 1JOWB 4BDHA 4D0WA 5I9XA 4ANMA 3MW1A 4EK4A 2PMLX 5HICA 1M52A 3LFNA 4IM2A 4CLJA 2UV2A 3GGFA 3SXSA 3Q9XA 5ANEA 3PVBA 4TYJA 4USFA 5DR6A 3EN9A 4O84A 4NTTA 4F7JA 4EHGA 1PJKA 1IR3A 2WOTA 4FTUA 4X3FA 2E9OA 3FE3A 4M14A 2C69A 3NS9A 4PNIA 4QPAA 1OI9A 1TKIA 3FI2A 3PPKA 3SW4A 3UVQA 2X6EA 5DEYA 1M2QA 3UYSA 5DE2A 3OWJA 1ND4A 3SVVA 4AOTA 2BRBA 5K5XA 4FYNA 5JSMA 3JY9A 4ALVA 1MRYA 2C6OA 2ZB1A 1IAHA 3LMHA 5ACKA 3TNPC 1Q8UA 3Q3BA 3P1AA 2YWVA 5DLSA 4D4VA 3NUPA 4RVTA 3P86A 4DGOA 4MXZA 4RC4A 5EKNA 3VS3A 3NNUA 5ACBC 4L45A 2V7OA 3VS1A 4IB0A 4TNBA 3RM7A 3FHIA 3A61A 4K1BA 5FXQA 3CE3A 5IMEA 3CKXA 3CSVA 3KC3A 2JLDA 5DA3A 4DTAA 2Q0NA 3H9RA 4YZDA 4NFNA 2I0EA 2O5KA 4NUSA 4AS0A 4EWHA 3QLGA 4I3ZA 3DJ5A 5E7RA 3LFAA 3VF8A 4U5JA 4EH8A 3UZTA 1NVQA 3PXZA 4K11A 3KXMA 5GJGA 2R0UA 4D1XA 3COKA 5GINE 5AUYA 2VN9A 2Y8OA 3G9NA 2HWPA 3Q4TA 3U4UA 5JN2A 3QC4A 2RF9A 4DITA 1O6LA 3ZEWA 3U54A 3S00A 3FZ1A 4KKHA 4ZK5A 3NYVA 1QPJA 3FZSA 3Q53A 1GZ8A 2Y7JA 4GJ2A 4C62A 1UU8A 4DFXE 3FYJX 2CKQA 4QNYA 3NUNA 4YHTA 4C34A 4IZ7A 4XG6A 3TIZA 3FI8A 1IAJA 2R9SA 4CTCA 2E9NA 3TZ7A 5AA9A 2AYPA 2OO8X 4Z9LA 3AT4A 4XG4A 3RCDA 2WMRA 4JBQA 3PJCA 3V8TA 5DEWA 4XLIA 3C0IA 4TYHB 4JIKA 2CJMA 5DT0A 4QOXA 1UWJA 2I40A 3Q4CA 5BYLA 2HELA 2XNPA 2GNLA 2F7XE 4XG9A 4R77A 3P23A 4BGQA 5HIEA 1WCCA 3F5UA 3Q32A 2HIWA 4PP7A 3PA5A 3E8EA 1XJDA 2PMIA 5HBEA 3TCPA 4F1OA 3HYHA 4M97A 2GHGA 2GNJA 4JXFA 3LQ5A 4EZ5A 3TUBA 4O6EA 2W99B 5AUWA 3TJCA 4FV4A 2C3KA 4RJ3A 4U41A 2PWLA 3LFSA 3D2KA 2IZUA 2GNGA 2JKMA 2R3IA 3LFFA 4HCVA 2IJMA 2XM9A 2R5TA 3GI3A 2IWIA 3LFQA 3QCQA 3ZLXA 3TDVA 3K5VA 3MY0A 3L9LA 4G2FA 4EH7A 3EN6A 4G5PA 5EDPA 2QONA 2YAAA 3MVMA 3P7BA 3VW6A 3D15A 3FYKX 3Q6UA 4BKJA 3C4WA 5CU0A 3LAUA 4IX4A 1XH8A 3OOGA 3QBNA 4LG4A 4NM0A 4ZZMA 2RGPA 2ZDUA 5KMNA 2JIIA 4M12A 3W16A 3QRKA 4LUDA 5DN3A 4EK3A 2F2UA 4L6QA 1SVGA 3DA6A 3HP5A 3IW8A 3RI1A 2ZOQA 4ASZA 4B8MA 5LVMA 2I0HA 1YI6A 2WAJA 5A4TA 4BI2A 1YHSA 2QHNA 4K77A 3F6XA 1E1XA 2GQSA 5ANGA 2X8IA 4O0UA 2YDKA 2W9ZB 3NUXA 1KOBA 3DK6A 4YTHA 5HCZA 3RNIA 4CRSA 3EQRA 5IH6A 4PL3A 4B9DA 4O7RA 3U8WA 3O23A 2VTPA 4FSNA 1IA8A 4FKSA 4YJTA 3SC1A 4MNEB 5CEQA 4Z3VA 3BV2A 4UWYA 4BCHA 4WNPA 4M84A 2BAQA 2OZAB 4P7EA 3TZ9A 2H6DA 3UQFA 5C8MA 1L3RE 1LEWA 4EKKA 3MFSA 3QU0A 3I0QA 3SGCA 4YURA 3W0RA 2JEDA 4L53A 4WBBB 5CZHA 5M08A 3EQBA 3OD6X 1U59A 3BBWA 1MQ4A 2J5FA 2BHEA 3ZC6A 3IK3A 3EFKA 3Q5IA 5CF4A 2QLUA 3K2LA 4IMYA 4Y95A 2QU5A 3FMLA 4QTDA 4EORA 2C68A 2YHVA 4ZY4A 2X7OA 3D14A 3DGKA 3R04A 3I7CA 3SV0A 5KUPA 1FVTA 3KULB 3O2MA 1YWRA 5BMMA 4BR3A 1WVXA 3EZVA 2CGXA 3GU7A 2PVLA 4FT5A 3UPZA 3RTPA 3ZYAA 1YRPA 4MHAA 4O7OA 3BHTA 3DBCA 4ACDA 4M0ZA 4XS2A 3TKIA 3UOLA 1FBNA 1H1QA 3EYGA 5IA5A 2ITUA 4JQ8A 4PL5A 1CKIA 1BX6A 3IQ7A 4QNAA 1YHVA 1YXXA 5FTOA 3WBLA 1B39A 1Z5MA 3BU6A 4DGGA 3DAKA 4QMVA 5A6OA 4TWOA 1B6CB 3V04A 1H25A 1OM1A 3IO7A 5DI1A 3UNKA 3S4QA 4U44A 4DGMA 5CAQA 5HLNA 3T3VA 1G5SA 1WBOA 3NCGA 1OZ1A 2W1ZA 4LV8A 1PRYA 3I7BA 2FUMA 5HNGA 4FSRA 4F6UA 4FNZA 3ANQA 4YO6A 4EHVA 4HZRA 4FL2A 3E8DA 4YJVA 2YCSA 4ZJIA 4II5A 2XMYA 4IB1A 4FMQA 4JLCA 3MPTA 4IADA 4GH2A 1Q8ZA 4LI5A 2YFXA 4LMUA 3PFQA 1NXKA 2JIUA 3DQWA 1PXLA 3ELJA 3LM5A 2QURA 5DGZA 3QYZA 2WMTA 5BVFA 2C0TA 4IVAA 4CNHA 2VNWA 1XHAA 2YABA 1Q3DA 1MQBA 1Y57A 4ITJA 4BTJA 3F2NA 3UOKA 2C5XA 3VBWA 3L1SA 4GKHA 4EOIA 4H3BA 4LRKA 2HAKA 2ITYA 2WMBA 4O7WA 5KMKA 3KRLA 1KE7A 2WMAA 3HL7A 4DFNA 4IVCA 2BTSA 5J9LA 4I0SA 3VF9A 3AD4A 5A4QA 3PE2A 4QMWA 4DAWA 5FM2A 1XR1A 4YJSA 4AW5A 3FXWA 2QR8A 3W2OA 2WMVA 3BELA 4FSQA 4DT9A 3W8LA 5M51A 3DXPA 3JXWA 3F82A 4RJ6A 3WILA 2QNJA 3SOAA 2Q0BA 4UX9A 1CTPE 3PIZA 3QALE 2PVMA 1ZMWA 2VTSA 2R3FA 5CX9A 1DM2A 3WZKA 4E6QA 5CF8A 3IW4A 3ODYX 2WTCA 2C6DA 1R78A 4PDOA 3OXZA 3NYOA 5BUIA 5IDPA 4I21A 4U98A 3P08A 4UXQA 1Y8YA 5AX3A 4MWHA 3TUDA 1RJBA 3UQCA 3P9JA 3FZTA 4JG8A 4R1VA 2ESMA 4WA9A 5IH4A 1BI8A 3QUDA 4F08A 3R0TA 3V5QA 3DFCB 3ZSIA 4Z55A 3PJ2A 3VBQA 1OBDA 4G31A 4PF4A 4F1TA 5LQFA 5AV1A 4V0GA 1JKSA 3RPVA 1JSTA 3QQJA 4FZ7A 5CVFA 4QP3A 4J71A 3FMMA 1K9AA 4RMZA 4AA5A 4X3FC 2R7BA 2BPMA 3NDMA 3WZDA 3B2TA 3VS6A 4EUTA 5IQAA 3AGMA 3WIGA 5BYZA 3UIBA 1OL5A 3RJCA 3S3IA 4IAKA 4CLIA 1ZWSA 5I9VA 3QLFA 1QL6A 2ZV7A 3UO5A 2GSFA 1OKWA 1OB3A 3QQFA 2CN8A 2YM5A 4TY1A 2YIXA 5CEPA 5ITAA 5IU2A 4WNMA 5CSWA 1MRUA 1ZYDA 3ORZA 3PSDA 4KSQA 4F09A 5CNNA 5HX6A 3C5UA 2WB8A 4ENXA 4NYEA 3G33A 1OPLA 3ZUUA 1H01A 5FDPA 3LJ0A 4GK4A 3DBEA 4O7PA 2E9PA 2QOKA 4A06A 1W0XC 2QOCA 4JBPA 4GG7A 5AWMA 1YOJA 3DXQA 3SOCA 4UN0C 3NNWA 5EYKA 3A8WA 3DTWA 1RQQA 3PLAE 5AP1A 2GNIA 4IAFA 3U55A 1W84A 2ZMCA 5L2TA 4E73A 3QKMA 3KREA 4OTIA 3QTXA 4FEXA 4YZMA 4F70A 2ITTA 3I6UA 2O3PA 4C61A 4OTGA 1VEBA 5C9CA 5JGDA 3UZRA 2FSMX 4FIIA 4FUYA 5BVKA 3LXPA 4MD8E 3M2WA 5HG7A 2WOUA 3MIYA 5FRIA 4KBKA 1QPDA 4HCUA 4PWNA 1KOAA 2JFMA 1JAMA 5IA4A 4H39A 1WBPA 2QKRA 1Q3WA 4UY9A 4ZXTA 3FPQA 4FODA 2WEIA 2XJ2A 3AC4A 4C7TA 5BVWA 3BWFA 3DZQA 4KIPA 1U54A 4XYFA 4Y46A 4IFGA 4FC0A 4APPA 3QA0A 4O83A 3R7OA 3ZDUA 2C5NA 3QD2B 4PDPA 3F3VA 3FXXA 4U42A 5H8EA 2VGPA 4JJRA 3TV4A 4HW7A 2RFEA 3MSSA 2A0CX 2B1PA 1XKKA 3NZ0A 3QRJA 1FQ1B 3BYVA 2BKKA 5HI2A 3RAWA 2H8HA 4CT1A 5I9ZA 5JMSA 4CXAA 1U54B 4LOPA 5M4UA 4KA3A 2QODA 3UDBA 4LOOA 2HW6A 3PP0A 3DB8A 3RK9A 2YITA 5DT4A 2X9FA 2H9VA 2VX1A 3D4QA 3LKMA 2SRCA 1PYEA 4LFIA 3MIAA 4MBIA 3R9RA 4AT5A 4E1ZA 4QRCA 4KKEA 4XG7A 5IQCA 4XRLA 4BBMA 2UVXA 4GYIA 4DG2E 3BBTB 3FZRA 5FDXA 3KB7A 2X81A 5E1SA 3ENHA 4MH7A 5DBXA 3IDBA 4NJ3A 3V5TA 2BILB 1DAWA 3D5VA 5F1ZA 1BUHA 1CDKA 2ITPA 5LMKA 2C1AA 3HUBA 3PXFA 4XBRA 4EH5A 5T6KA 5JFSA 4HYSA 1R39A 3DBFA 5EHYA 4FTOA 2PULA 4XBUA 4O0VA 3ENMA 5FUTA 3LFEA 2BZJA 4CFUA 3ZLYA 2Y0AA 4D58A 1XBAA 2BRMA 3I4BA 4OTHA 1S9JA 3LFDA 3UJGA 4BTFA 2GFCA 4RGJA 1H1SA 1Q62A 4L7FA 1TVOA 3ZRKA 4YTFA 2WIHA 4FSUA 2DQ7X 3OZ6A 2X39A 2PZYA 3O71A 4RWLA 4YPDA 4QMXA 1PHKA 3V8SA 4OBOA 3RALA 4BDFA 4O96A 3KXHA 4JI9A 3F5GA 4UXLA 4OTDA 2V7AA 2BUJA 2YAKA 5EW8A 3KFAA 1Q5KA 1Y91A 4IFCA 4YLLA 4FTQA 4JAJA 5AA8A 2R3JA 3F2RA 4EK8A 4TWPA 5AADA 4EWQA 2UW4A 3R73A 4F4PA 3R71A 4ZZOA 4I0TA 5F94A 4ZTMA 3ANRA 3BPRA 2BIYA 4O7LA 3R02A 3W2PA 3E3PA 1WBTA 4H3PA 4M68A 4X7QA 3HNGA 1H1WA 4ZTQA 4QMSA 4TRLA 3R00A 2C0IA 5B2LA 3F3TA 2VAGA 5EW9A 1ZXEA 3ZLWA 3MVHA 5CYIA 1OIQA 3RP9A 3T9IA 3W2SA 2ZM3A 2ERZE 2R3MA 3KU2A 3W2RA 2V62A 3ATTA 3FBVA 4MNFA 3AC2A 4F64A 3GENA 4O6LA 3LW0A 3BQCA 3MVLA 3UIXA 3FMKA 1UNLA 5AP2A 3PG1A 3SXFA 3GBZA 3L8SA 3OXIA 4B99A 2FSTX 5JRQA 3R7IA 4DHFA 4S34A 1REJA 4EOPA 3ZS5A 1BI7A 3FKNA 4NH1A 5IG1A 5CLPA 4E4XA 1IRKA 2BAJA 2CHLA 2VWWA 2C6MA 3RGFA 4F7NA 2IW9A 3PJ3A 5ANDA 4X6QC 4CKRA 2IVVA 2PK9A 3EYHA 3QRUA 5IMXA 4RLKA 2YJSA 4RX9A 4EI4A 4EYJA 2BTRA 3QHRA 5FP6A 2OSCA 4P4CA 4IM0A 2PE1A 5JFVA 1Q4LA 4DFYA 1VYZA 3TV7A 2W05A 4BB4A 1SNUA 5GJDA 2VWVA 2XIYA 4U43A 3UG2A 3FKLA 1F3MC 1ZMVA 2ONLC 2UUEA 4JS8A 4ITIA 4ACMA 4YGAA 3A4OX 3RWQA 3UMXA 3CXWA 2XEYA 4HCTA 4HGEA 4ZSLA 3G51A 3FWQA 2YM7A 5HX8A 1P14A 3N9XA 2XK8A 4JRVA 2W1HA 3D9VA 4A4LA 3NW5A 5GIPE 4Z7HA 3REPA 1E9HA 2FA2A 2VWZA 4MAOA 3N51A 2VRXA 3DDPA 2XKDA 3AGLA 3PXYA 3KRXA 3UGCA 2V22A 2B9HA 2W1EA 4QMOA 5L2SA 1L8TA 4YR8A 1OIYA 5LARA 1QPEA 3PJ8A 2XS0A 5DVRA 2PVYA 3ZO2A 1KV1A 2ZV9A 3BLHA 4DT8A 4N70A 4QT1A 4RQKA 4YU2A 4RJ7A 5CAOA 4BHNA 2YM4A 5E90A 4BDGA 4FKTA 3KXGA 4FG9A 4JT3A 2VTHA 5KBQA 4ZTNA 4RVMA 3RCJA 3OG7A 4R7BA 5AP5A 5JZNA 2PE0A 4FKJA 2B9IA 2JGZA 3CBLA 3SRVB 3AQVA 5E9EA 3F66A 3ITZA 2YA9A 4XEYA 2X1NA 2G2HA 4M15A 1M17A 3DKFA 4EJ7A 2J0MB 4FIJA 2P33A 3IGGA 3QC9A 3KN6A 4C4EA 2JKKA 1V1KA 3KRRA 3O7LB 3PA4A 2IVUA 4KD1A 2LGCA 1OL6A 4FNXA 3VULA 4B0GA 4DG3E 5CASA 3KL8A 4TNDA 3QZGA 4ARKA 5HU3A 2GTMA 4YBKA 2FO0A 4UYNA 3G6GA 4AXAA 3Q9WA 5KMMA 3KVWA 3UOJA 5KMOA 3N4UA 3EIDA 3E88A 4IZAA 3DU8A 1H26A 3THBA 3S95A 4F6SA 4C4JA 4AGCA 4GCJA 3FV8A 1ERKA 3OY1A 5JKGA 5GHVA 2V0DA 5I9UA 4QMNA 4OTRA 1O9UA 2E2BA 2QO2A 1W83A 2UW5A 3C50A 2CCIA 2XCHA 4FTTA 1P4OA 4G5JA 4R3CA 4D9UA 3R1YA 3O8UA 4I5PA 3GOPA 4EH3A 4J8MA 2J0JA 1GIHA 1ZRZA 4BTMA 1LEZA 4U80A 4EOQA 2WEVA 1M14A 2P0CA 3W0SA 2QLQA 3HMIA 4FZ6A 5CAUA 2UVYA 2Z7LA 3R01A 4QYGA 3OROA 4QP2A 4X3JA 4GT5A 5EM5A 2J51A 3SAYA 3FL5A 3T3UA 3NLBA 4AGUA 2ACXA 2OH0E 2X8DA 2UZNA 5IQDA 2ETMA 4N57A 2R0IA 4GFMA 3PPJA 4MYGA 5CU4A 4O7VA 4GVJA 5FP5A 4EOLA 2ZJWA 3MN3A 4CTBA 5JGBA 2R3PA 4BHZA 3NVMB 3P7AA 4O7ZA 1ZY4A 4F99A 4RVKA 4NSTA 3NSZA 5H9BA 3F9NA 4WD5A 2JFLA 3MFUA 4W4YA 5CQUA 2BDWA 1K3AA 4PV0A 4ZTHA 5AUUA 2UZVA 1JBPE 4GV1A 4L68A 4IAYA 4QQTA 4IANA 2PVNA 3KXXA 3D7TB 5AP3A 3U9NA 3HRBA 4KIOA 4E6DA 3A7FA 1GNGA 5J87A 1WBNA 5EFQA 4EC8A 4WUNA 1MRVA 2ZVAA 3RHXA 3QXPA 3UMWA 1F5QA 4CKJA 3FLSA 3V8WA 2XBAA 4BYJA 5IQHA 4RJ5A 4YHFA 3C13A 1JNKA 2YDIA 4O91A 5DRBA 3U51A 4RVLA 4FTNA 4GUEA 4I23A 3BYOA 3HGKA 5BVOA 3JVSA 3PVGA 2QC6A 3HUCA 2ZM4A 4QP6A 5BNJA 3G9LX 3QD0A 4AP7A 4RT7A 4I24A 3KMUA 5DR9A 3SG8A 2XNMA 1UKHA 5H8GA 4UALA 3R9NA 4JR7A 5EM6A 4W8EA 4EHZA 4E4NA 3HECA 3EQHA 2OZOA 3VAPA 5HKMA 4JBVA 2NO3A 4M8TA 2IVTA 4G16A 5E8UA 2B54A 1EH4A 3GCPA 3EFLA 4FNWA 4MKCA 3VS5A 1SNXA 2ETKA 3Q96A 3BI6A 3KEXA 3QQHA 5M4CA 1APME 2J5EA 5IUIA 4AU8A 5EOBA 5CALA 4CFNA 3O7LD 5M44A 4DH5A 4FNYA 4O7SA 4YZCA 2KULA 3OS3A 1NT2A 2BIKB 3UVPA 4IBMA 3V6SA 2G1TA 2W1DA 2ZV2A 5EHOA 4D2RA 3ORLA 5BX0A 1G8AA 4MBJA 3TTJA 5CF5A 4JX3A 2WTWA 4CEGA 4FSWA 4XRJA 1A48A 5KE0A 4GT4A 4L3LA 5IA0A 4FICA 3GQLA 2C6KA 2GPHA 3IECA 3R30A 1OPJA 3W32A 1OMWA 5JZJA 2VTTA 2PVJA 4ZTSA 3ZO4A 4IAAA 4ASEA 2WIPA 2R2PA 1OBGA 4E4MA 2BHHA 1GZNA 4PMMA 1GIJA 2YERA 4BRXA 4E93A 4J52A 2OBJA 4D55A 3GC8A 5ETCA 5HEZA 2CNUA 3NWWA 3OCSA 5J9YA 2GS2A 2QU6A 3QF9A 4KS7A 4E5AX 5IA3A 2Q83A 4XUFA 3QTIA 3FC1X 4CD0A 3VS0A 4IZ5A 3OCBA 2HXQA 2Z8CA 2B53A 1OECA 4O0TA 2IPXA 5J8IA 5HE3A 3AMYA 4CFVA 4EEVA 5CEIA 1UU9A 3UC4A 4XV1A 5L2WA 2REIA 3QTSA 3NRMA 5FGKA 4AE9A 4BIBA 5E8XA 5JRSA 4EQUA 3I5ZA 5HG8A 5IPJA 2C5VA 4MWIA 3R1NA 1BL7A 3AC3A 3BEGA 4KIQA 1RW8A 5F4NA 4U3YA 2O0UA 3JPVA 4C3PA 2YISA 4BCPA 3MB7A 2H96A 3FUPA 4KKGA 3CD8A 4PMTA 3R7VA 4BDIA 4PUZA 5IEXA 3B8RA 4Y72A 1ZAOA 4NL0A 4LRJA 3N4VA 4E8AA 4WG5A 1Q8YA 3NW6A 4IB5A 4NW6A 4YJNA 1X8BA 3D5XA 4DEDA 5L6OA 1ZZ2A 4GT3A 1NW1A 5B7VA 5CT0A 5E92A 2RL5A 3RPYA 1JVPP 3IKAA 5HLPA 2GHMA 3WZJA 1CMKE 3R8VA 4J99A 3PE1A 4DF3A 1XH5A 3L8XA 2WELA 2OI4X 3FJQE 3OUKA 3N4TA 4MD9E 2XIXA 5IQGA 2YM6A 4CT2A 2JDTA 4NKSA 2OW3A 2X2MA 2FGIA 3UC3A 2WO6A 1CKPA 5BMSA 4IJ9A 3MYGA 3TN8A 4AZSA 2CLXA 5CU2A 3W18A 4J95A 3TACA 5EH0A 4BGGA 4B4LA 4DH7A 5FG8A 2X9EA 4K9YA 4QMUA 2VTAA 3DNEA 4FV9A 4K18A 4FKUA 3B8QA 1OIRA 1SZMA 4FEWA 4C0TA 2QG5A 3AC5A 4XG8A 5AP4A 2NNWB 2VTJA 2BDFA 4QTCA 3FMHA 3MJ1A 3HRCA 2C1BA 3P79A 4DLJA 2CPKE 3QTRA 4ALWA 2PPQA 3LXNA 4FSYA 5CEMA 4QYEA 1MP8A 2W4KA 4RA4A 5AFVA 3GU5A 3CD3A 2HZ0A 3PY0A 5CY3A 2QOIA 4YNEA 4FTCA 5EQEA 4RQVA 4MBLA 1YOMA 4USEA 4BF2A 5IUHA 4YJUA 2YZLA 3O8PA 4BCNA 2ITNA 2OF2A 3A7JA 1V0PA 3H4JA 4FVQA 4IVDA 2ONLA 3KMWA 4UZHA 1ATPE 1DAYA 2XBJA 2EXMA 4MK0A 1H1PA 4KB8A 2OFVA 5CEKA 2WPAA 5CEOA 3ORMA 1WBSA 5HIBA 4G6LA 3FAAA 2NPQA 3HVCA 4AUAA 2NRUA 2JBOA 1FOTA 4Y73A 2XK7A 5TF9A 3EKNA 4EOOA 2OK1A 1K2PA 2PZPA 4IX3A 3BGQA 4O86A 3LCOA 3V5PA 4EHEA 3NAXA 4C2VA 3VBYA 3PTGA 5AAFA 5L6PA 3P7CA 1P5EA 3M1SA 4MX9A 2AUHA 3NW7A 3DBQA 2XKCA 4FK6A 3BHVA 1PMNA 3GC9A 3OOMA 1VZOA 2VO6A 3EQIA 4H58A 3PRIA 2GNFA 4FT3A 4K2RA 4QMLA 4D1ZA 4ANLA 4ZJVA 4DA5A 5I9YA 1PW2A 2J4ZA 3HAVA 5KHWA 4HGTA 5CTPA 2F49A 2CGVA 3MPMA 4BTKA 4H1JA 5T3QA 2F7ZE 1LUFA 5E1EA 3S0OA 3FY0A 2XKFA 4G6NA 3BGZA 5DIAA 5HESA 5KZ0A 1ZOHA 3UO6A 3WARA 4F9CA 3OT8A 1J91A 3R9HA 2XH5A 4IDTA 5B2MA 4GFOA 2GNHA 5KMJA 2OLCA 1URWA 1J7UA 3H9FA 4Z7GA 1YW2A 4WIHA 2EB2A 4FUXA 4IC8A 4PTGA 4RSSA 5F95A 4PNKA 1WBVA 4IJPA 3ULIA 2VWXA 4IDVA 5D1JA 5K3YA 5LOHA 2B52A 1S9IA 3VS4A 1VR2A 1FVRA 4F9WA 2XJ1A 1Q24A 3TG1A 4AW0A 4R78A 4GMYA 4V0GB 1ZOGA 3I79A 3LLAA 3CTQA 3KA0A 4U0IA 3FHRA 4AZTA 2GS7A 2B0QA 3ACJA 3FZPA 2XK4A 3CY2A 3HLLA 2HOGA 3RAIA 3QTQA 2WKMA 3JR1A 1H4LA 4QMPA 4A9UA 1UKIA 3HZTA 1V0OA 3R8MA 2G2FA 4GUBA 4PY1A 4JBOA 3WYXA 5A46A 4OT6A 1Y8GA 2W06A 3KRWA 4JQEA 2R3GA 3LHJA 3NUUA 3F7WA 4FG8A 4NM7A 4FEUA 2UZWE 2PYWA 4G17A 5H8BA 3UE4A 2QG7A 2DWBA 4JQ7A 2IZTA 5FXRA 2JDSA 4N6YA 5TT7A 4CMOA 4ZZNA 3Q2MA 3OEFX 3MFRA 2BRGA 2EXCX 2OJGA 2WMXA 2YM3A 4WRSA 3H3CA 4XV2A 4NTSA 3DBDA 2F2CB 2G15A 2GHLA 5HO7A 2C5OA 4O22A 3LQ3A 4QMYA 3QGWA 4F9AA 1TQPA 4I94A 2BFXA 3CCNA 4FSTA 3QAME 4QP9A 3WIKA 3GFWA 4C4HA 2ZYBA 3DZOA 1CKJA 5FLFA 3WE8A 3II5A 1H0VA 4FI1A 4EK5A 3HDMA 1U5RA 3MB6A 5J9ZA 4HYUA 4FVPA 5EQPA 2BALA 4I6BA 3W0PA 2XNEA 4ZSJA 3GFEA 1KE5A 4I5MA 4A9YA 4ASDA 2GFSA 3KQ7A 4QMZA 3TYKA 3MDYA 4FT9A 2XA4A 1JSVA 4K33A 4O7NA 2C6LA 3C4XA 2CGUA 3EN7A 5AMNA 3VUMA 4U94A 3PUPA 4ZIMA 4X2NA 4B7TA 5C4KA 4ZY6A 4IIRA 1YDRE 2X7FA 3HV5A 1UVRA 2XIRA 2UW6A 3R1SA 1R1WA 3O50A 4FKIA 4TYEA 5A6NA 2QI8A 5KKRB 2VV9A 3ORXA 2OGVA 4YJQA 3O0GA 2WTKB 2XK6A 2YIQA 2IW8A 4JR3A 3ZM9A 2PHKA 5ETAA 4R1YA 4AA0A 3BCEA 4O0XA 4OGRA 5EHLA 4APCA 4EKLA 4BDCA 5DOSA 5C03A 3SDJA 3I81A 1XO2B 4YJRA 3LXKA 1SMHA 4JDKA 4EJNA 5HVYA 5K4JA 5LWMA 3PDTA 3UYTA 3AMAA 5IUGA 2VTOA 5FBOA 3SRVA 2V5QA 4NCTA 3AMBA 5AP0A 2BZHB 2X6DA 2XVDA 3BKBA 5KNJA 4M0YA 4P5ZA 3EFJA 4K0YA 5B2KA 2YIRA 1WAKA 4R5SA 1M2PA 2BKZA 4O7YA 2QOLA 3DKOA 5I5ZA 3F88A 4S31A 1SM2A 1UU7A 4LL0A 3IONA 4RWIA 4QTAA 3MS9A 4L9IA 4EH2A 4MQ2A 3P0MA 3H10A 1BKXA 2HZNA 4WKQA 3C0HA 3PXRA 4BDEA 4BICA 2X0GA 1GAGA 3I1AA 1YI4A 3A4PA 4YUQA 3BHYA 3VIDA 5CSHA 4FV7A 4UZDA 2C6EA 3I5NA 4GFGA 4HVIA 3C1XA 2YZAA 3QQKA 2UW7A 2X8EA 3OEZA 2LAVA 2UVZA 5CQWA 2QCSA 4IWDA 2JDVA 4V05A 4JNWA 3VQHA 3W1FA 3CLYA 3MA3A 4L44A 2EU9A 4AT3A 4EOSA 2Z2WA 4AWIA 4F0IA 5C1QB 4D5HA 2Y4IC 3DY7A 4O0YA 3VJNA 3H9OA 1JKTA 3DK7A 1U4DA 3QKKA 2W5BA 2BFYA 4BBEA 4YO4A 3S1HA 4FGBA 3KRJA 2R3RA 5HG9A 2A27A 3RM6A 4F6WA 2Y6OA 3ZO1A 1OUYA 4D4SA 3TIYA 5ANKA 2J0KA 4BY9E 3COHA 3NGAA 2FSOX 4JRNA 2VWBA 3AD6A 3L8PA 4MXOA 2HZ4A 1XH7A 3HV6A 5EOLA 4XLVA 3OWLA 5DR2A 2OJJA 2P2IA 5JQ5A 2WTDA 2C3LA 2GQRA 2X7GA 3NNVA 4GJ3A 2VO3A 3OHTA 3GVUA 2PU8A 1IA9A 4RG0A 3R21A 4KAOA 1W7HA 1OPKA 3CP9A 4IWOA 4AA4A 4BZOA 3KULA 4ZTLA 5AX9A 2R3NA 5L6WL 5C8KA 3QD4A 5HLWA 2XRUA 4LGHA 2XK9A 4YZ9A 3SW7A 3POZA 1A06A 4YJPA 5EYMA 1XH4A 5AEPA 2QVSE 4ZS4A 4XNEA 3E3BX 2WMSA 1R0EA 2VUWA 3A8XA 3WZUA 4YP8A 4FZFB 3VUHA 3E93A 4KWPA 4QQJA 3FL4A 3FLWA 4A9RA 4R3RA 4YZBA 5HQ0A 3BYSA 2OXDA 4PTCA 4WNKA 3DT1A 5LVPA 3IS5A 4FKRA 4OT5A 4R6VA 4RX7A 4QYHA 2PVFA 4YJOA 3LE6A 5LMAA 4AX8A 4AG8A 4RFZA 3MGYA 5HG5A 4ZTRA 3QX4A 2RG5A 5CSPA 4U40A 3FY2A 4ZAUA 4FEVA 5CF6A 5EKOA 2W1GA 3UNZA 5EYDA 2HZIA 4XOZA 2VTQA 4CG9A 4JVGA 3L8VA 3QCXA 4O27B 3V5JA 3KCFA 3ZRMA 1XH9A 2RFNA 3CPBA 2WFYA 3EQPA 3IW6A 4EQCA 3I0OA 3EFWA 1JWHA 5CANA 2OICA 4MXYA 2UW8A 1XQZA 4S30A 2GQGA 2I1MA 2JKQA 3AT2A 4FR4A 4R7IA 1AQ1A 4GSBA 4UEUA 1XH6A 1OKYA 2PVHA 2QOOA 5C8NA 2OF4A 4E6AA 4YLKA 2W96B 4EOJA 2UZLA 3GEQA 3COMA 5EDRA 3TZMA 4NW5A 4FYOA 4TWNA 4Y5HA 4D1SA 2WQOA 4A4XA 2WU7A 1GZKA 3ZFYA 3WF8A 2YCRA 1H27A 3JS2A 1SVEA 5HD7A 3ZDIA 3Q4UA 3DJ6A 2O2UA 3KVXA 4FV3A 1OL1A 4RZVA 5BVNA 1FVVA 1ZYSA 3OBGA 3HEGA 3FPMA 4WUAA 3ZFXA 4NKAA 3ZZEA 3KF7A 4JAIA 4CG8A 1IASA 2EB3A 3L9PA 4L3JA 3NMUF 3AT3A 4KABA 3WF6A 1SYKA 3DNDA 3LOKA 3R7YA 3SXRA 2PVKA 2XUUA 4TL0A 3E64A 2CDZA 3K3JA 5L8KA 3PXKA 4ACHA 4O38A 1ZZLA 4E5WA 4BZDA 2QOFA 4EUUA 3SHEA 4BCQA 2F7EE 1OITA 4DBXA 4J7BA 3OCTA 2W7XA 3TKUA 3CIKA 4FTLA 5JEBA 2XM8A 3PZEA 4I6HA 1H07A 2A4LA 4AFEA 2I7QA 3CS9A 2HW7A 2XZSA 2ETRA 3ORTA 3W0MA 3RPRA 4IX5A 4LOQA 5LCJA 4USDA 3JUHA 4FSZA 2JD5A 4JIAA 1TQIA 3W0OA 3BLRA 5ETFA 4HZSA 4FOBA 3Q60A 5L3AA 3KXZA 5HTBA 4DH8A 4GYGA 3DDQA 5CNOA 3SX9A 4CMUA 1Q8TA 5IISA 1KE6A 4GIHA 3O51A 1WVYA 3FI4A 4RWJA 5L2IA 4M69B 4HNIA 3OC1A 1KUTA 2FVDA 3I60A 3K3IA 4X3FB 5M06A 4QMQA 2VGOA 4U97A 1OIUA 5LMKC 2YACA 3WYYA 4D9TA 4RIOA 4GRBA 3MTLA 3NYNA 4X2GA 3NUYA 3TV6A 4C36A 1UA2A 4FTJA 3HAMA 4EH6A 3QXOA 2YJRA 3KKVA 5C4LA 3FKOA 4G9CA 4FKGA 3FQHA 2JAVA 1GIIA 3EN4A 5ANOA 1OGUA 1QPCA 4FZDB 4LRMA 4WBOA 1H1RA 3F69A 3QFVA 3TKHA 4KNBA 2RFDA 3CQUA 3TNHA 1V0BA 4EOKA 3ORKA 3R28A 5HORA 4O2ZA 4ZOGA 2XP2A 4DCEA 1KE8A 2CKPA 2W5HA 3SD0A 3LVPA 4EYMA 4XP0A 4DN5A 2R3OA 2O8YA 5G6VA 3F3ZA 5AUXA 5F20A 4BZNA 4W4WA 5FBNC 2QOQA 1DI8A 2YCQA 3Q5ZA 4Q9SA 3VRZA 4ORKA 1J7LA 5DWRA 4FIHA 1U46A 5CXZA 3EQFA 4GW8A 2PSQA 2XCKA 3H0ZA 4FKOA 4Y8DA 5AV2A 3ROCA 4L43A 4U9AA 5D12A 4YLJA 4C37A 4ZP5A 1RE8A 3TUCA 5AV4A 4ALUA 3R22A 2QOHA 4PDSA 4KRCA 4MF1A 3RPSA 2JIVA 2CN5A 1OVEA 4WG3A 4K6ZA 4NM5A 3VNTA 4WG4A 4J1RA 4X6RA 1LR4A 1IG1A 3ORPA 1JPAA 2XNNA 4G3DA 3BHUA 4MEDA 3E8NA 2Y6MA 3UBDA 4RRVA 4I4FA 2B55A 5ETIA 5HU9A 4U7ZA 4QP7A 4WHZA 4EZ7A 2GU8A 4WO5A 5FD2A 2WQMA 4FVRA 3QUPA 4FBXA 4XP3A 4FG7A 1GOLA 2RKUA 4C4GA 1M7QA 1MUOA 4AZVA 2A2AA 3B2WA 4D28A 3F3UA 4HYIA 5M4IA 1H24A 1JLUE 4BCIA 4ERKA 4FKQA 3ZXTA 4I4EA 4FV5A 1YHWA 4DBNA 3CTJA 5HNBA 3PVUA 1W98A 3AC8A 4DEAA 4FKLA 5HO8A 4DEIA 3I6WA 1G8SA 4O81A 4NCTC 4U79A 3G15A 4C4FA 4I22A 3R6XA 3GB2A 3ORIA 3QD3A 3BV3A 4Q2AA 3DXNA 5E8WA 4O82A 5HCYA 3RMFA 3DB6A 4QP8A 4ZY5A 4LQMA 1Z57A 2V55A 3HMMA 4CV9A 5JK3A 5L8LA 3DPKA 1E1VA 2C4GA 3FI3A 2IZRA 1ZY5A 2RG6A 3C0GA 3LCSA 4JDIA 4N4SA 3U9CA 4DEEA 3DS6A 5CU3A 3L9MA 4FTKA 4BCOA 2WGJA 3U4WA 4TYIA 4AF3A 4WOVA 4E7WA 5IEVA 1LP4A 5HCXA 3BU3A 3R8PA 4C38A 2CKOA 4IACA 4ANBA 3V01A 4ZLZA 5FM3A 3C51A 5L8JA 3GOKA 4ONAA
chains in the Genus database with same CATH superfamily
5DHJA 4OLIA 4FX3A 3NNXA 2PZ5A 4NU1A 4C59A 5KBRA 5D10A 3WF9A 5EYCA 2VU3A 3A7IA 3LCKA 4I5CA 2VNYA 3FDNA 5KKRC 2YIYA 1HCLA 4ITHA 5AUZA 4CVAA 2DUVA 3D0EA 5A14A 4BGHA 2QO7A 5KMLA 1H00A 4IWQA 1Y6AA 3PWYA 3K54A 4NK9A 3VRYA 3ZXZA 2OH4A 3GCVA 3IOPA 3AC1A 3E7OA 3NX8A 1HCKA 3TNQB 1W8CA 5EM8A 4J8NA 4JDHA 1G8JA 3EH9A 4V01A 3QZFA 2JC6A 4UB7A 5IEYA 3EN5A 3HV7A 4RPVA 3VHKA 4ZMFA 4BDBA 1YXSA 5DFPA 4HVGA 2VWIA 4EH9A 4EONA 3LMGA 3EWHA 3BE9A 4QMMA 5JQ8A 5E8TA 2VX0A 2J2IB 2WQNA 4YZNA 3DJ7A 4ZJJA 4D5KA 3PPZA 4DGNA 4YTCA 3PIXA 4QDEA 5IA1A 3Q4ZA 1P2AA 3VONA 2WHBA 2R4BA 1IEPA 4Q5EA 4H1MA 2B7AA 3UTOA 4F7SA 3SA0A 2WMUA 3UIUA 3K5UA 4G34A 3F2AA 4XCUA 4BCGA 4D4RA 2I0YA 1PMVA 2JBPA 4RIYA 5CS6A 2R3LA 4U6RA 1PXKA 4L42A 4MQ1A 4ANQA 1H08A 3LM0A 3TI1A 2IVSA 4RX5A 4QTEA 1ZOEA 3MH1A 4QTBA 3A62A 4EL9A 4Y85A 4YPSA 5E8ZA 2VWYA 5M55A 3TEIA 1JSUA 3M42A 4O7TA 3VQUA 4AN9A 3R63A 4CFMA 4DE4A 5CI6A 3ACKA 4H36A 3IOKA 5EI6A 3O17A 4UWCA 5HGIA 4RFYA 3WZEA 2BR1A 2P3GX 2Z02A 1P4FA 3CJFA 4EZ3A 4A9SA 1B38A 5AP7A 1Q41A 1OKVA 2B9FA 5AV0A 2O63A 3BX5A 3RPOA 3VWAA 3PFYA 1YWVA 4QYYA 2YEXA 3LJ2A 1OL7A 2B4SB 3PVWA 4XX9A 5D41A 3AXWA 2CSNA 4AAAA 4EBWA 2C0OA 3TJDA 3MY5A 3A7GA 2VTMA 4F1MA 2VO7A 4YC3A 4ZLOA 3MV5A 5DNRA 4WRGA 5HHWA 4IB3A 4RFMA 2YWPA 5HIDA 2QHMA 4LMNA 4PL4A 5J1WA 1DS5A 3TL8A 1Q8WA 2AC3A 3OBJA 3RWPA 4DDGA 4XOYA 4AZEA 5M57A 3LXLA 3R9OA 4AGDA 4B8LA 3BQRA 3DQXA 4PMPA 2UZBA 5LMBA 1Q97A 1REKA 5BVDA 4L01A 2BZIB 4L67A 4TZRA 4XH6A 3C4ZA 5JT2A 3H0YA 4XJ0A 2VTNA 1PXNA 4P2KA 5GJFA 3MESA 1H0WA 4JX7A 1I44A 1J1CA 2DS1A 4Q9ZA 3PA3A 4CCUA 3VUDA 3O8TA 3VN9A 4IH8A 3MBLA 1KE9A 5CZIA 3HKOA 5DT3A 3R8LA 3VJOA 4FIGA 4V04A 3QRIA 4E20A 3TTIA 3FQEA 2C6IA 4J96A 3VUKA 4AXFA 4DEHA 2XALA 3ZEPA 1FGKA 2FH9A 3EQDA 5IA2A 5JH6A 4PRJA 4GK3A 2I6LA 1VYWA 2ITQA 3UIMA 5CAVA 2UZTA 3Q04A 3PG3A 4A9TA 3OP5A 4QPSA 5TKDA 1PKDA 3Q52A 3NCZA 4JL9A 2ZMDA 4NWMA 3ATSA 2IG7A 4RJ8A 3QCYA 4IAIA 5TOZA 1JQHA 2ZB0A 3DK3A 4HNFA 4QQ5A 1PMUA 4TXCA 3R7EA 4FIEA 3A60A 3GU6A 2WQEA 3ZLSA 4C2WA 4FV1A 2BZKB 2WD1A 1NY3A 1G3NA 3EHAA 3D5WA 2OIBA 3IDPA 4ZLYA 4FSMA 5AUVA 4PQNA 2XNOA 4B6LA 4R3PA 4FL3A 4N0SA 3UQGA 3MWUA 5ANJA 3ZBFA 4CFFA 4EH4A 2H34A 5E8SA 1GZOA 2YDJA 4ID7A 5IZFA 4CKIA 4BIEA 3PUFC 3ORNA 4XMOA 3F7ZA 5K4IA 2C3JA 4AACA 3AD5A 1PXJA 1TFFA 3LIJA 1OKZA 4EK6A 4HVHA 3GNIB 2X4ZA 4P90A 5M4FA 4AW2A 5DRDA 2G01A 2QR7A 4Q5HA 4J97A 4GS6A 3LQ8A 3LCTA 3CPCA 2UZUE 4LM5A 3SG9A 3UO4A 2OKRA 4BCKA 4F65A 4DEBA 1YQJA 1J7IA 3V5LA 1NA7A 5J7HA 1R3CA 3BRBA 3MH2A 3E5AA 3NFGB 4O21A 5FXSA 1PMEA 4F9YA 3PSCA 5FTGA 3PWDA 4DFUA 4W4VA 3GQIA 3VBXA 1W82A 4OBPA 3NR9A 3MY1A 3AOXA 5B0XA 4XG3A 4X2FA 5EM7A 5HVJA 3C9WA 1PKGA 3Q9YA 4TPTA 1PXOA 4P5QA 4LGGA 4NM3A 5E8YA 3UNJA 3EL7A 3FMNA 4HVDA 5EI2A 3CQWA 3Q6WA 3D2IA 4M67A 2W4OA 3ZH8A 1PXMA 3V3VA 2JDOA 4MNEA 3ZSHA 1UWHA 3C4EA 2PUUA 4FV2A 5AJQA 4GKIA 5LXMA 3IG7A 4PTEA 2P4IA 3LPBA 3E7VA 3E63A 3VBVA 2Y4PA 3ZO3A 2VD5A 4RIWB 3G0EA 4G3EA 3CQEA 4D2SA 2OFUA 4E4LA 2UW9A 3Q2JA 4GG5A 4L52A 3CJGA 3FEGA 2C30A 5A54A 1UNGA 3ZCLA 2HCKA 4G3CA 5M56A 3MTFA 5CI7A 2XYUA 4FE2A 3V6RA 3RK7A 3ZZWA 3GU4A 4AW1A 3KK8A 4GL9A 4AOJA 3WI6A 5JGAA 4G6OA 3OT3A 5A4CA 3R9DA 3KK9A 5DPVA 2HXLA 1NVRA 4QMTA 2OIDA 3DFAA 3OTUA 2X2LA 3QTZA 5BUEA 3TT0A 4CSVA 2CMWA 5C27A 3PLSA 1PF8A 4BYIA 4DLIA 3OTVA 4RC2A 4G9RA 4FIFA 4RIXB 4JG7A 4LL5A 2F9GA 2E9UA 2PZIA 4E26A 4I93A 4U8ZA 4DEGA 5D11A 5F9EA 2F57A 5ICPA 5CT7A 4MXXA 4O2PA 5IQEA 3P4KA 4XG2A 5CWZA 2PTKA 4UBAA 3RAKA 4F63A 4S2ZA 4GEOA 1A9UA 1J1BA 1PY5A 4C33A 2OIQA 1ST0A 3QTWA 4XP2A 5EDQA 3UOHA 3NAYA 5I4NA 4CQEA 2BROA 2YCFA 2EUFB 4RWKA 2FYSA 2UZDA 3HP2A 3BWJA 3TZ8A 3UDSA 4YMJA 4KBCA 3ZM4A 2I0VA 1ZMUA 2CKEA 1XMMA 2UW3A 3TM0A 3ZUTA 2DYLA 2R64A 3POOA 1Y6BA 3D94A 1TQMA 1YXTA 4O0RA 3ZONA 3D83A 2VTRA 3HV4A 2XEZA 3LFCA 4L8MA 4NFMA 3NFFB 3QTUA 4RX8A 4YSMA 3E87A 3R8ZA 4DINA 5M53A 5AV3A 2ZM1A 1XBCA 4IVBA 4GVAA 1BL6A 5C01A 3GXLA 1H8FA 2G2IA 3W0QA 4YC6A 3F5XA 3LFBA 2EWAA 4AN2A 1J3HA 4FOCA 4HOKA 1YKRA 2PUNA 4OUCA 3VHEA 2RFSA 3P78A 4GU6A 3EMGA 5FTQA 5I9WA 4NZWB 3CY3A 5HE0A 4BN1A 2VTIA 3EQGA 1H28A 3S2PA 4R7HA 3M11A 5HTCA 4E5BA 2YIWA 3VUIA 3RHKA 5ANIA 3MI9A 1T45A 5LVLA 1BMKA 1CSNA 3TNWA 2A1AB 4A4OA 4MD7E 1URCA 2ITOA 4GK2A 3KY2A 3R8UA 5JFWA 3OWKA 3C4CA 4WSYA 1PYXA 3OFMA 5CU6A 5D7VA 3GT8A 5IH5A 4S33A 2KTYA 3GUBA 3DAJA 5IQIA 2HY81 3E92A 5E91A 4Z16A 2XNBA 4XV9A 3ZFMA 5I0BA 4PDYA 2XK3A 3AG9A 4OTQA 1ZYJA 3D7ZA 4ZSEA 2HENA 5K5NA 1YVJA 3H30A 1CM8A 2ZV8A 3UODA 4S32A 5E4HA 4C4IA 2HYYA 2J0LA 2P55A 2ZAZA 4C02A 5BQ0A 1XBBA 3WE4A 2Z7SA 3FLQA 3TDWA 2ITZA 3QA8A 5DH3A 5BPYA 3DLZA 4ASXA 3CGOA 4KBAA 3W2CA 2J50A 4ZSGA 4GIIA 3RAHA 4CRLA 4JG6A 2UZEA 3BEAA 2XRWA 4X2JA 4CCBA 3QHWA 3V51A 4FT7A 4DFZE 4AZFA 3BL9A 4IX6A 2C47A 4X2KA 4R5YA 3COIA 4FKVA 2R3QA 3FLZA 4IE9A 4UWBA 5A9UA 2CNQA 5C26A 5K9IA 1BLXA 3CGFA 3IW5A 3QWKA 2ITWA 4G1WA 4W4XA 5EI8A 3SQQA 5JFXA 3UPXA 3VO3A 4ZSAA 2W0JA 2O64A 4WT6A 4IHPA 2IO6A 3FZOA 4FV0A 3NIZA 4J98A 5BYYA 4BCJA 3BZ3A 4I1ZA 3T8OA 4ACGA 1F0QA 4WZYA 3BU5A 3KCKA 4AT4A 3ZUVA 4I20A 3ALNA 3SLSA 1UU3A 1YDSE 3G2FA 2RIOA 3R83A 3RINA 2PMOX 2PY3A 1I09A 3QZHA 1Q99A 2Y4IB 2XIKA 3C5IA 2HY0A 4L46A 2BRHA 2OWBA 3JYAA 4Y83A 5BVEA 1JKKA 4FTMA 4O0SA 4BDJA 2W4JA 4UYAA 1WBWA 2OG8A 4U3ZA 4RJ4A 2XYNA 4L3PA 4ANSA 3OW4A 2C6TA 4HGSA 2WZJA 2CGWA 2WNTA 3DAEA 4MTAA 3FSKA 3G5DA 4NJDA 3EZRA 3NEWA 4BVUA 1Z9XA 4I92A 1WMKA 3MA6A 2VO0A 3IPHA 3HA8A 4FGRA 4RIWA 3OUNB 5CSXA 2J0IA 5KMIA 4M7IA 1OUKA 2X2KA 5EW3A 4DH1A 3IGOA 5EK7A 4IEBA 1FMKA 4TN6A 4DC2A 3UVRA 4C58A 3BHHA 4ACCA 5J5SA 4EOMA 3ULZA 2WTKC 2BMCA 4QEBA 5EG3A 5FEEA 5HVKA 2JITA 1UNHA 3NUSA 3CEKA 4JDJA 4E6CA 3OF0A 4TKSA 3ZSGA 4DCAA 4YHJA 5LWNA 5AIRA 2B9JA 2PL0A 2QOBA 4FV8A 2J90A 2NRYA 3FC2A 2GTNA 3GU8A 3QCSA 3QYWA 5FEDA 3ZOSA 4AOIA 3VW8A 3FLNC 3ZMMA 4HPTE 3KMMA 2JAMA 4QP4A 3R7UA 4G3GA 2XB7A 5TR6A 4I6QA 2UZOA 2WU6A 2HK5A 3CC6A 3HMOA 4HJOA 3W8QA 4RLLA 3GP0A 3PY1A 3A99A 4F9BA 2OZAA 3LCDA 3PXQA 2C3IB 2Y9QA 2Z7RA 3ZBXA 4CFXA 4ENYA 4KINA 3VVHA 5H2UA 1YI3A 3PJ1A 3HDNA 4FV6A 4OW8A 3ZTXA 1QCFA 3W55A 1FMOE 2BAKA 2BRNA 4FEQA 4O0WA 4X21A 5D7AA 5D9HA 5GNKA 5A4EA 3BLQA 1BYGA 2WXVA 2W17A 4IC7A 4C3RA 4BIDA 2IW6A 3DLSA 4YSJA 4JOAA 2GS6A 2VX3A 2OXYA 3QWJA 3LJ1A 5LJJA 4DFBA 1AD5A 3A7HA 3ID6C 4CV8A 3TWJA 2G9XA 3VBTA 2BVAA 4I6FA 4IM3A 4BC6A 1T46A 5KZIA 5CXHA 5FQDC 4M3QA 3RKBA 3G0FA 3F3WA 3V5WA 3IW7A 4DYMA 4TYGA 4KRDA 3NVKI 1STCE 5HBHA 2BDJA 2NP8A 3ZHPC 4MXCA 4I5HA 4XHKB 2VWUA 3D5UA 3ROYA 1LPUA 3FLYA 4UV0A 1OL2A 2QD9A 2XF0A 3OXTA 3RZBA 2OU7A 4BDAA 2HWOA 3HMPA 1YXVA 5CAPA 5M09A 1XWSA 1GY3A 3ODZX 4WNOA 4IAZA 3HA6A 4U45A 4DFLA 3G90X 4KUJA 1G8KA 2OJIA 5M07A 1FPUA 1ZYCA 4BI1A 5AUTA 5HZNA 5DG5A 3FSFA 4RA5A 1WZYA 3MVJA 3BYMA 5HBJA 3C4FA 2CLQA 3ETAA 3GC7A 2UW0A 2WMQA 3LZBA 4J53A 4AQCA 1YXUA 4K8AA 4OTFA 2OJFE 4FK3A 3VS7A 3EL8A 1O6YA 3IDCA 3VS2A 2PVRA 3UDTA 3FQSA 5FEQA 3DTCA 4CGAA 4F0FA 4ERWA 2W1CA 3EJ1A 1AGWA 3PP1A 3QZIA 4FJVA 3VUGA 4F7LA 1Q61A 4RC3A 3Q9ZA 3TNIA 4EBVA 4PMSA 3KF4A 3ZC5A 3QQUA 1ZYLA 4AGWA 4TT7A 2W1IA 3FMJA 4TYHA 2GMXA 4DG0E 4FA2A 4QP1A 4BCMA 3R1QA 2QKWB 4NT4A 4XV3A 4HVSA 1O6KA 2JKOA 5IDNA 2OXXA 4C35A 2GCDA 4QYFA 1ZARA 2W1FA 3PIYA 4C3FA 4ZMEA 5HNIX 3KGAA 3F5PA 2WTVA 2E9VA 1YOLA 2YN8A 1KV2A 3BIZA 3FMDA 3LMIA 1ZLTA 2QO9A 2F4JA 1HOWA 3DCVA 3CTHA 3PRFA 4OTWA 3ERKA 3L9NA 3LLTA 3QUEA 3MH0A 5CSVA 3PZHA 3CKWA 5BUJA 2PE2A 2PUPA 3FMEA 5CVHA 3OW3A 2R7IA 5AP6A 3F61A 2R3KA 3W33A 4RBLA 4G3FA 3ZRLA 3BE2A 3OMVA 4TWCA 1YDTE 4A07A 2ITVA 5G1XA 2ERKA 2W5AA 4IW0A 3PSBA 3HRFA 3UZPA 3PYYA 3RVGA 4M13A 4AZWA 1GJOA 3SKCA 3VC4A 2PMNX 3R2BA 2IZSA 3WF5A 4EC9A 3MPAA 3AKJA 4D4YA 3JY0A 5AAEA 4IQ6A 5J1VA 5HE2A 5CVGA 2CCHA 3WF7A 2OJ9A 4BDKA 5IQFA 4DTKA 2C5YA 2CNVA 4RIYB 5IF1A 4RZWA 2VZ6A 4W8DA 2WMWA 4EQMA 3QGYA 3O96A 3NIEA 4IZYA 4QO9A 3BYUA 4Y5QA 3OVVA 3HV3A 3OCGA 4FT0A 4PX6A 3NUAA 2PUIA 3EQCA 5CENA 5LCKA 3MFTA 4FTIA 3W2QA 4H3QA 3W10A 3E8CA 1KSWA 3E62A 3PY3A 1PXIA 4FZAB 3GC0A 1FINA 2XIZA 1DI9A 3UP7A 4CZTA 3DKCA 2XNGA 3D7TA 3ET7A 4YNOA 3EB0A 5EQYA 1FGIA 4AN3A 4BI0A 4HYHA 3HMNA 3OY3A 3KN5A 1U5QA 4GU9A 5LVNA 1UV5A 2WTIA 2AC5A 3UG1A 2IN6A 3A2CA 4TTHB 4U81A 4QQCA 3T9TA 5LVOA 1WFCA 2FB8A 2WQBA 2J6MA 3GCQA 3JVRA 4DTBA 3P5KA 1R0PA 3QX2A 4FL1A 5HD4A 2O65A 3C7QA 3CR0A 2BCJA 4CFWA 4DGLC 3UDZA 3QKLA 2QQ7A 4CZUA 5GIOE 4LUEA 4MVFA 5E8VA 5AM7A 5TO8A 3WOWA 4BCFA 2PZRA 2P2HA 5J95A 3FXZA 4BDDA 4IWPA 4KSPA 4DH3A 4L00A 1M2RA 1QMZA 4I41A 3TXOA 4H05A 4F0GA 4PP9A 1NVSA 4OBQA 2ZDTA 4FKWA 2FSLX 4ZEGA 3BLAA 3HX4A 5KO1A 4HPUE 4N6ZA 1KWPA 4CMTA 1RDQE 4I0RA 4HGLA 2JDRA 1M7NA 4TW9A 4ZS0A 3ALOA 5DYJA 3EOCA 3QRTA 4MXAA 3EKKA 5KCVA 3DOGA 4YTIA 2X4FA 3NYXA 2YM8A 2R3HA 2Z60A 2WTJA 3U6JA 1JKLA 4L7SA 1YWNA 5AAGA 5AM6A 3OWPA 3QQLA 5H3QA 4MCVA 5KHXA 3G6HA 2J9MA 3MJ2A 4YBJA 2XAMA 4FTAA 3QQGA 5T68A 3U6HA 4LYNA 4KS8A 2EVAA 3GCSA 4NIFB 1SVHA 4OR5A 4YC8A 5AIKA 4A7CA 3BGPA 2J7TA 2A19B 3R2YA 3KXNA 3ZU7A 4X0MA 2XJ0A 1WVWA 4RIXA 5IQBA 3DKGA 3DV3A 3MH3A 5HE1A 4D0XA 2XKEA 4FKPA 4LV5A 4BBFA 2ITXA 3GCUA 4AFJA 1PXPA 4FTRA 3QL8A 4AE6A 5A4LA 2W9FB 5A3XA 1VJYA 2GDOA 2Z7QA 3U87A 3UP2A 3RK5A 3U6IA 3W0NA 2VTLA 4DHIB 3NPCA 1JOWB 4BDHA 4D0WA 5I9XA 4ANMA 5KX8A 3MW1A 4EK4A 2PMLX 5HICA 1M52A 3LFNA 4IM2A 4CLJA 2UV2A 3GGFA 3SXSA 3Q9XA 5ANEA 3PVBA 4TYJA 4USFA 5DR6A 3EN9A 4O84A 4NTTA 4F7JA 4EHGA 1PJKA 1IR3A 2WOTA 4FTUA 4X3FA 2E9OA 3FE3A 4M14A 2C69A 3NS9A 4PNIA 4QPAA 1OI9A 1TKIA 3FI2A 3PPKA 3SW4A 3UVQA 2X6EA 5DEYA 1M2QA 3UYSA 5DE2A 3OWJA 1ND4A 3SVVA 4AOTA 2BRBA 5K5XA 4FYNA 5JSMA 3JY9A 4ALVA 1MRYA 2C6OA 2ZB1A 1IAHA 3LMHA 5ACKA 3TNPC 1Q8UA 3Q3BA 3P1AA 2YWVA 5DLSA 4D4VA 3NUPA 4RVTA 3P86A 4DGOA 4MXZA 4RC4A 5EKNA 3VS3A 3NNUA 5ACBC 4L45A 2V7OA 3VS1A 4IB0A 4TNBA 3RM7A 3FHIA 3A61A 4K1BA 5FXQA 3CE3A 5IMEA 3CKXA 3CSVA 3KC3A 2JLDA 5DA3A 4DTAA 2Q0NA 3H9RA 4YZDA 4NFNA 2I0EA 2O5KA 4NUSA 4AS0A 4EWHA 3QLGA 4I3ZA 3DJ5A 5E7RA 3LFAA 3VF8A 4U5JA 4EH8A 3UZTA 1NVQA 3PXZA 4K11A 3KXMA 5GJGA 2R0UA 4D1XA 3COKA 5GINE 5AUYA 2VN9A 2Y8OA 3G9NA 2HWPA 3Q4TA 3U4UA 5JN2A 3QC4A 2RF9A 4DITA 1O6LA 3ZEWA 3U54A 3S00A 3FZ1A 4KKHA 4ZK5A 3NYVA 1QPJA 3FZSA 3Q53A 1GZ8A 2Y7JA 4GJ2A 4C62A 1UU8A 4DFXE 3FYJX 2CKQA 4QNYA 3NUNA 4YHTA 4C34A 4DDIA 4IZ7A 4XG6A 3TIZA 3FI8A 1IAJA 2R9SA 4CTCA 2E9NA 3TZ7A 5AA9A 2AYPA 2OO8X 4Z9LA 3AT4A 4XG4A 3RCDA 2WMRA 4JBQA 3PJCA 3V8TA 5DEWA 4XLIA 3C0IA 4TYHB 4JIKA 2CJMA 5DT0A 4BJJA 4QOXA 1UWJA 2I40A 3Q4CA 5BYLA 2HELA 2XNPA 2GNLA 2F7XE 4XG9A 4R77A 3P23A 4BGQA 5HIEA 1WCCA 3F5UA 3Q32A 2HIWA 4PP7A 3PA5A 3E8EA 1XJDA 2PMIA 5HBEA 3TCPA 4F1OA 3HYHA 4M97A 2GHGA 2GNJA 4JXFA 3LQ5A 4EZ5A 3TUBA 4O6EA 2W99B 5AUWA 3TJCA 4FV4A 2C3KA 4RJ3A 4U41A 2PWLA 3LFSA 3D2KA 2IZUA 2GNGA 2JKMA 2R3IA 3LFFA 4HCVA 2IJMA 2XM9A 2R5TA 3GI3A 2IWIA 3LFQA 3QCQA 3ZLXA 3TDVA 3K5VA 3MY0A 3L9LA 4G2FA 4EH7A 3EN6A 4G5PA 5EDPA 2QONA 2YAAA 3MVMA 3P7BA 3VW6A 3D15A 3FYKX 3Q6UA 4BKJA 3C4WA 5CU0A 3LAUA 4IX4A 1XH8A 3OOGA 3QBNA 4LG4A 4NM0A 4ZZMA 2RGPA 2ZDUA 5KMNA 2JIIA 4M12A 3W16A 3QRKA 4LUDA 5DN3A 4EK3A 2F2UA 4L6QA 1SVGA 3DA6A 3HP5A 3IW8A 3RI1A 2ZOQA 4ASZA 4B8MA 5LVMA 2I0HA 1YI6A 2WAJA 5A4TA 4BI2A 1YHSA 2QHNA 4K77A 3F6XA 1E1XA 2GQSA 5ANGA 2X8IA 4O0UA 2YDKA 2W9ZB 3NUXA 1KOBA 3DK6A 4YTHA 5HCZA 3RNIA 4CRSA 3EQRA 5IH6A 4PL3A 4B9DA 4O7RA 3U8WA 3O23A 2VTPA 2XARA 4FSNA 1IA8A 4FKSA 4YJTA 3SC1A 4MNEB 5CEQA 4Z3VA 3BV2A 4UWYA 4BCHA 4WNPA 4M84A 2BAQA 2OZAB 4P7EA 3TZ9A 2H6DA 3UQFA 5C8MA 1L3RE 1LEWA 4EKKA 3MFSA 3QU0A 3I0QA 3SGCA 4YURA 3W0RA 2JEDA 4L53A 4WBBB 5CZHA 5M08A 3EQBA 3OD6X 1U59A 3BBWA 1MQ4A 2J5FA 2BHEA 3ZC6A 3IK3A 3EFKA 3Q5IA 5CF4A 2QLUA 3K2LA 4IMYA 4Y95A 2QU5A 3FMLA 4QTDA 4EORA 2C68A 2YHVA 4ZY4A 1XMLA 2X7OA 3D14A 3DGKA 3R04A 3I7CA 3SV0A 5KUPA 1FVTA 3KULB 3O2MA 1YWRA 5BMMA 4BR3A 1WVXA 3EZVA 2CGXA 3GU7A 2PVLA 4FT5A 3UPZA 3RTPA 3ZYAA 1YRPA 4MHAA 4O7OA 3BHTA 3DBCA 4ACDA 4M0ZA 4XS2A 3TKIA 3UOLA 1FBNA 1H1QA 3EYGA 5IA5A 2ITUA 4JQ8A 4PL5A 1CKIA 1BX6A 3IQ7A 4QNAA 1YHVA 1YXXA 5FTOA 3WBLA 1B39A 1Z5MA 3BU6A 4DGGA 3DAKA 4QMVA 5A6OA 4TWOA 1B6CB 3V04A 1H25A 1OM1A 3IO7A 5DI1A 3UNKA 3S4QA 4U44A 4DGMA 5CAQA 5HLNA 3T3VA 1G5SA 1WBOA 3AKKA 1OZ1A 2W1ZA 3NCGA 4LV8A 1PRYA 3I7BA 2FUMA 5HNGA 4FSRA 4F6UA 4FNZA 3ANQA 4YO6A 4EHVA 4HZRA 4FL2A 3E8DA 4YJVA 2YCSA 4ZJIA 4II5A 2XMYA 4IB1A 4FMQA 4JLCA 3MPTA 4IADA 4GH2A 1Q8ZA 4LI5A 2YFXA 4LMUA 3PFQA 1NXKA 2JIUA 3DQWA 1PXLA 3ELJA 3LM5A 2QURA 5DGZA 3QYZA 2WMTA 5BVFA 2C0TA 4IVAA 4CNHA 2VNWA 1XHAA 2YABA 1Q3DA 1MQBA 1Y57A 4ITJA 4BTJA 3F2NA 3UOKA 2C5XA 3VBWA 3L1SA 4GKHA 4EOIA 4H3BA 4LRKA 2HAKA 2ITYA 2WMBA 4O7WA 5KMKA 3KRLA 1KE7A 2WMAA 3HL7A 4DFNA 4IVCA 2BTSA 5J9LA 4I0SA 3VF9A 3AD4A 5A4QA 3PE2A 4QMWA 4DAWA 5FM2A 1XR1A 4YJSA 4AW5A 4AAYA 3FXWA 2QR8A 3W2OA 2WMVA 3BELA 4FSQA 4DT9A 3W8LA 5M51A 3DXPA 3JXWA 3F82A 4RJ6A 3WILA 2QNJA 3SOAA 2Q0BA 4UX9A 1CTPE 3PIZA 3QALE 2PVMA 1ZMWA 2VTSA 2R3FA 5CX9A 1DM2A 3WZKA 4E6QA 5CF8A 3IW4A 3ODYX 2WTCA 2C6DA 1R78A 4PDOA 3OXZA 3NYOA 5BUIA 5IDPA 4I21A 4U98A 3P08A 4UXQA 1Y8YA 5AX3A 4MWHA 3TUDA 1RJBA 3UQCA 3P9JA 3FZTA 4JG8A 4R1VA 2ESMA 4WA9A 5IH4A 1BI8A 3QUDA 4F08A 3R0TA 3V5QA 3DFCB 3ZSIA 4Z55A 3PJ2A 3VBQA 1OBDA 4G31A 4PF4A 4F1TA 5LQFA 5AV1A 4V0GA 1JKSA 3RPVA 1JSTA 3QQJA 4FZ7A 5CVFA 4QP3A 4J71A 3FMMA 1K9AA 4RMZA 4AA5A 4X3FC 2R7BA 2BPMA 3NDMA 3WZDA 3B2TA 3VS6A 4EUTA 5IQAA 3AGMA 3WIGA 5BYZA 3UIBA 1OL5A 3RJCA 3S3IA 4IAKA 4CLIA 1ZWSA 5I9VA 3QLFA 1QL6A 2ZV7A 3UO5A 2GSFA 1OKWA 1OB3A 3QQFA 2CN8A 2YM5A 4TY1A 2YIXA 5CEPA 5ITAA 5IU2A 3BL7A 4WNMA 5CSWA 1MRUA 1ZYDA 3ORZA 3PSDA 4KSQA 4F09A 5CNNA 5HX6A 3C5UA 2WB8A 4ENXA 4NYEA 3G33A 1OPLA 3ZUUA 1H01A 5FDPA 3LJ0A 4GK4A 3DBEA 4O7PA 2E9PA 2QOKA 4A06A 1W0XC 2QOCA 4JBPA 4GG7A 5AWMA 1YOJA 3DXQA 3SOCA 4UN0C 3NNWA 5EYKA 3A8WA 3DTWA 1RQQA 3PLAE 5AP1A 2GNIA 4IAFA 3U55A 1W84A 2ZMCA 5L2TA 4E73A 3QKMA 3KREA 4OTIA 3QTXA 4FEXA 4YZMA 4F70A 2ITTA 3I6UA 2O3PA 4C61A 4OTGA 1VEBA 5C9CA 5JGDA 3UZRA 2FSMX 4FIIA 4FUYA 5BVKA 3LXPA 4MD8E 3M2WA 5HG7A 2WOUA 3MIYA 5FRIA 4KBKA 1QPDA 4HCUA 4PWNA 3P5JC 1KOAA 2JFMA 1JAMA 5IA4A 4H39A 1WBPA 2QKRA 1Q3WA 4UY9A 4ZXTA 3FPQA 4FODA 2WEIA 2XJ2A 3AC4A 4C7TA 5BVWA 3BWFA 3DZQA 4KIPA 1U54A 4XYFA 4Y46A 4IFGA 4FC0A 4APPA 3QA0A 4O83A 3R7OA 3ZDUA 2C5NA 3QD2B 4PDPA 3F3VA 3FXXA 4U42A 5H8EA 2VGPA 4JJRA 3TV4A 4HW7A 2RFEA 3MSSA 2A0CX 2B1PA 1XKKA 3NZ0A 3QRJA 1FQ1B