3SGCA

Crystal structure of apo aminoglycoside-2''-phosphotransferase type iva
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords APH(2'')-Id
publication title Crystal Structures of Antibiotic-Bound Complexes of Aminoglycoside 2''-Phosphotransferase IVa Highlight the Diversity in Substrate Binding Modes among Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
total genus 95
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sgcA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3sgcA02
3DTWA 3H9FA 3LFDA 3IW5A 3QC9A 5LJJA 3B2WA 4DG2E 3E62A 4DC2A 4IB5A 4F9BA 3MYGA 3PIXA 2W99B 3Q9YA 3O7LB 1CSNA 4I20A 3S95A 4IAZA 4KWPA 2ITOA 4A9TA 2VWXA 2JBPA 3A7JA 4I6BA 5AP3A 5J1WA 5CU0A 3BGPA 4MYGA 4FKTA 3POZA 3WF6A 3Q4CA 5AAGA 4YJOA 4DTAA 5GIOE 4NKAA 3TN8A 5HX8A 4OTIA 5JGBA 2JDVA 4FSRA 4PNIA 3DFCB 4O7ZA 1IEPA 5L2SA 3LMIA 3OCGA 1W84A 4L8MA 5HVJA 4GS6A 3CTQA 3GT8A 5BVEA 2QC6A 3LCSA 3R2BA 4QMPA 4D4SA 3FPMA 3TYKA 5HTCA 1SZMA 1QPJA 1KOAA 4EUUA 2WTVA 5HZNA 3E88A 4E4NA 2XCKA 4HW7A 3R21A 1H07A 1BLXA 4JIAA 3H30A 1A06A 3E92A 4IFCA 4YC3A 3ZLXA 4M0ZA 3F69A 2CN8A 2XB7A 1GZKA 4MD7E 3R63A 4USDA 5GHVA 4RC4A 1QMZA 4YGAA 5M53A 2E9OA 4TNDA 4GJ3A 4U7ZA 2X7FA 2ZYBA 4AZFA 2Y6OA 3IDPA 3NNUA 3AD5A 4XBRA 3RCDA 2I0EA 4I5HA 4NL0A 4DH5A 4IAIA 4AS0A 1UU8A 4K33A 2IW6A 2QLUA 2JIIA 5C8KA 4PP7A 1J91A 5D41A 2ZDTA 4JDKA 4UV0A 4O7VA 1UKIA 3AC1A 4A9UA 4CQEA 5KKRC 3TKIA 2W17A 4EHGA 3SA0A 3W0RA 5FP5A 3OUNB 2YISA 3QRKA 5AAFA 2WGJA 2YIWA 2RGPA 3BEAA 3MY5A 4FSYA 4I23A 4PDOA 5HHWA 2VWIA 3NUUA 4FG9A 3SX9A 5EM8A 3R8MA 3QHRA 3U55A 4GK4A 2C5VA 4I6QA 4IIRA 2BFXA 3ET7A 5EDRA 1F5QA 1LUFA 1ZYDA 3ZO2A 5ACBC 3G51A 3ODYX 4H1JA 4FZFB 4JG8A 4MF1A 4OTRA 5AP5A 1XJDA 2F4JA 3AMAA 3BYSA 5H8BA 2Y4IC 3QA8A 5CVGA 3FI3A 2PVMA 2V22A 2ITNA 4YMJA 4ZEGA 1YXUA 5HU3A 3MGYA 2XNBA 1JSTA 3FJQE 4OTQA 5A4QA 1OPKA 2R4BA 2PVKA 3VUGA 3RPOA 4L3LA 5C1QB 4DFUA 1E1XA 4Y8DA 1PRYA 4DCEA 4EZ5A 4ZAUA 3DXQA 4TWPA 1YI3A 3VRYA 2UW0A 3CGOA 4NM5A 5KBRA 3TM0A 4X6QC 3GC7A 4ASXA 5BUJA 3QBNA 3K3JA 4G6NA 3HMPA 3U51A 3UNKA 3QD2B 3BU5A 4J98A 2WMQA 4PMPA 2VWWA 1W8CA 2UZDA 3DBDA 2ITWA 2OF2A 4GRBA 5EQYA 3R04A 3D5UA 4OTHA 2OJFE 1ZXEA 2BUJA 4GK3A 3BGQA 3TI1A 3ZBFA 3R9OA 2WMRA 4IWDA 4GUEA 5CSHA 2VUWA 5BYZA 2QOLA 1IR3A 2ZM1A 1PXIA 2P3GX 3BYVA 2QOQA 3NVMB 4I22A 5FEDA 2P33A 2VO3A 4L3PA 2CDZA 3EQFA 3ITZA 4O0RA 4OBOA 5C9CA 4P2KA 4YBJA 3FZSA 5IEVA 4JDIA 3DQXA 3E7VA 4TKSA 2YWPA 4H1MA 1PXPA 4LI5A 4X3FA 2IWIA 4AW5A 3KXMA 4MK0A 4D4VA 3NUNA 5IQDA 5CEIA 4NK9A 3VBVA 3K5VA 3R7VA 2A4LA 2BTSA 3A4OX 3BZ3A 4FL2A 4R3RA 4YTHA 2A0CX 1K9AA 2HENA 1NW1A 4JAJA 4BCPA 3EZVA 4G5JA 4BN1A 4YTFA 4F0GA 5K5XA 1OIRA 4CFNA 3NYOA 3LFFA 3L8VA 3P4KA 3GGFA 2W06A 2C6OA 3KQ7A 2YZAA 4A9SA 4YJTA 2BZJA 1OVEA 1L8TA 5CU6A 1DM2A 2YM3A 3GFWA 5DN3A 1Q99A 4LRMA 5FG8A 5C27A 2QOCA 5LMBA 1Q62A 2WOTA 1Q61A 1CKIA 4WG4A 3IW6A 2Z7LA 4PL3A 4RIWB 4MXCA 2H96A 3AG9A 1P14A 3UC4A 3QL8A 4GKHA 4WNKA 4XNEA 3QRTA 3EN4A 3UG2A 1IA8A 3EJ1A 3O96A 3ZC5A 4AWIA 1OL6A 2J0KA 2RKUA 3OUKA 2PL0A 3HYHA 2GU8A 4MXXA 4RFMA 4V0GA 4A9RA 4EH7A 4JJRA 2FVDA 3TTJA 2CNVA 2XVDA 3DNEA 5L2IA 3DAJA 4UEUA 5J9ZA 1KE5A 2JDOA 3P1AA 3R71A 4Z3VA 4NM0A 3W16A 4X2GA 2O0UA 4DH7A 3NVKI 4X6RA 4IB0A 4KKGA 4QYFA 5JFVA 3QZHA 1ZOEA 3QTQA 4Q5HA 4Y83A 4YHTA 1JKLA 3SOCA 1OUYA 4Q9ZA 2YM6A 4GJ2A 1UNLA 4O81A 3UOLA 3NGAA 1PXOA 1YOMA 3SW4A 5CEOA 3UZTA 1Q41A 3R30A 1JKTA 2VTPA 2LGCA 3GOPA 3TCPA 3Q32A 2YN8A 3F2AA 3HZTA 1R3CA 5EKOA 4BDFA 2QLQA 3Q04A 1YXXA 3S0OA 3F7ZA 2E9NA 5HG9A 2OIDA 4HOKA 3AD4A 5EYMA 1R1WA 5FD2A 2P2IA 3LW0A 2EXCX 4JT3A 4LG4A 5AV0A 2BFYA 3PIZA 3A4PA 4ZP5A 5HE3A 5CAPA 3QGWA 5I5ZA 2ZM3A 4IQ6A 4L68A 5AV4A 3L8PA 4FOBA 5CEMA 5FRIA 3U9CA 4C4IA 4U3ZA 4AW0A 3GQIA 4DINA 3QAME 5TR6A 4XG2A 3IOPA 4ALUA 1L3RE 3G9LX 5E8YA 4O7TA 4XMOA 3G15A 5E8XA 4E5WA 4FUXA 4IWQA 1ERKA 2UZTA 2OIBA 5AUXA 3FC1X 4TW9A 3PZEA 1VEBA 3PWDA 4NFMA 3TUDA 3U87A 4RVTA 4PY1A 5ETAA 1WBPA 3UTOA 5AFVA 2UW3A 1RQQA 2XJ0A 3A7HA 4O0WA 4O7LA 3LLTA 5AP2A 2JC6A 3ERKA 1PMNA 2UVYA 4G3FA 3KKVA 2EWAA 4XH6A 5J5SA 4CLIA 5JQ8A 3O2MA 4CFWA 3NYNA 3AGLA 5AA9A 3HLLA 2OJJA 2E9PA 3E87A 3R6XA 3HV4A 5BUIA 2FH9A 2XK4A 3VHKA 4C4GA 3QU0A 4QMUA 1ZLTA 5AX9A 3H3CA 4N6YA 3TNHA 3NW7A 3FI2A 3QTWA 3UMWA 4G3DA 4G6OA 3LHJA 3M11A 2ZVAA 4KUJA 3E8DA 5DR2A 4HJOA 4ZS0A 3MVMA 3U6HA 3UYSA 3KXHA 4DA5A 5JN2A 2RF9A 1XBBA 3VULA 3CS9A 4ASZA 3UIMA 2XIRA 3AC3A 4QMZA 4U0IA 2UZLA 2IN6A 2RFEA 3OD6X 4WKQA 5EOLA 4DFLA 2DUVA 3MFUA 2C1BA 4FYOA 3NRMA 2BRGA 3FZPA 4OR5A 5HIBA 4X2KA 2VWBA 3FPQA 1Y6BA 5AP4A 4RIYA 2FSLX 3FMNA 4LUEA 4XS2A 5KMMA 3UOHA 3R0TA 4O7OA 5F4NA 4MVFA 3DKGA 5CU4A 5H3QA 4EQCA 5HICA 4EK5A 3LMHA 5JSMA 3ZTXA 3FI8A 2PU8A 2WTKB 3F2RA 4BTKA 4LGHA 3BELA 5BVDA 2W4OA 1ZYCA 1MRYA 3DBEA 5FTGA 1H1QA 1PXJA 3OBGA 5LWMA 4DCAA 1DAWA 2C6MA 5HNBA 3LFEA 5KHXA 5BYLA 2BRHA 3U6IA 3L1SA 4ZLZA 3F2NA 3U9NA 4CCBA 2I7QA 2GS2A 2J9MA 5DGZA 5LVOA 4JQ7A 1QPCA 1QL6A 4YZBA 3ZHPC 3DQWA 4YHJA 3KN6A 3BLHA 4IZYA 5CSWA 2J4ZA 3CXWA 3OS3A 2CKQA 4L44A 3HAVA 3WIGA 1QPEA 2J51A 1YHVA 2BDFA 2WQOA 1UWJA 2GFSA 3I7CA 4G3GA 4ORKA 3GCSA 4IEBA 5IDPA 2C5NA 3FYJX 3W2PA 3V8SA 1YI6A 3FBVA 4BYIA 4FSQA 3PJ8A 4O0TA 4UYNA 3EQDA 5C8MA 3R1QA 1BL6A 3WE8A 5LMKA 2OJ9A 1CKJA 3LFQA 4JR3A 4QP2A 4DGOA 2FYSA 3O23A 5FXRA 3UVPA 2ITYA 3G2FA 1AGWA 3AMYA 5CENA 1UA2A 3UG1A 4C7TA 4X3FB 2ZV7A 2X2KA 3LFBA 4UB7A 3ZONA 4A06A 5CAQA 3BQCA 1Z9XA 4AXAA 3HDMA 3VBYA 4C4EA 5A4TA 1YRPA 3WZJA 3GFEA 5GJDA 5DRDA 5EOBA 2QOBA 2PVFA 3ALOA 4YZMA 5CEQA 3VS2A 2LAVA 1FGKA 1OMWA 4AE6A 3CP9A 4BCJA 2YJSA 5I0BA 4Q9SA 4KBCA 3S3IA 4GG5A 4FSWA 1ZZLA 3OY3A 3QRIA 2VTSA 2ZV2A 5H9BA 2QVSE 3UODA 1YW2A 4C02A 4L7SA 4S34A 4FA2A 2GS6A 3ZRMA 4U5JA 1JAMA 3WARA 4AP7A 3VF9A 3KXNA 3LJ2A 5HIEA 2JFLA 3ORNA 3EQGA 5D10A 1UNHA 3ZLSA 5A4LA 3K5UA 5E9EA 4DE4A 3MY0A 4R1VA 3BHHA 3DAEA 1Q8TA 3RVGA 2C5XA 4Q5EA 4XCUA 4MWHA 4P7EA 4GK2A 4TXCA 4V0GB 3MA6A 2IVVA 1GAGA 2PE0A 2WTKC 4U8ZA 4U80A 2XNOA 4EBWA 2W1CA 1OITA 2QG7A 4CGAA 4FT9A 4EOQA 4C3RA 3V5PA 2C0TA 4D55A 4V04A 3BGZA 4YR8A 5A54A 3GCQA 2Y8OA 4FOCA 5IA2A 3W0QA 2WB8A 5IQIA 4ZXTA 4AUAA 4IANA 2AC5A 2XP2A 3LFCA 1WFCA 5E92A 2YCFA 5AUWA 4E6CA 3FMLA 2XM8A 4O7WA 3MN3A 3G6GA 2XNMA 2PUUA 4TYGA 5HTBA 3I0OA 2Y9QA 2X9EA 1FVRA 3QTRA 4OT6A 5B2MA 3ROYA 3PXZA 2VO6A 2WNTA 4X2FA 2HZ4A 4F4PA 4XP2A 3R1NA 3KEXA 3F3VA 2W4JA 1REKA 3F6XA 3LCOA 3Q9XA 4JDHA 4PNKA 1QPDA 2Y7JA 2QU6A 2PUPA 4W4WA 2JFMA 3L8XA 4MXAA 4RJ5A 4FSZA 3TJDA 1H26A 4LOOA 4DEGA 3RMFA 1M7NA 2GNHA 4ZSJA 3NCZA 1UV5A 3O51A 2DQ7X 2ZJWA 4OW8A 4AZWA 2B54A 3QZFA 3DA6A 5JZJA 2J2IB 2OH0E 5HVYA 4ZSLA 3IPHA 4IAYA 4EK8A 4M14A 4X3FC 3LFAA 3PRIA 4FIFA 4MNEA 4DLJA 3FSKA 2PVLA 1PHKA 4FTNA 3RZBA 4KIQA 3O8TA 4JR7A 4C2VA 3PE1A 2XKCA 1Q8YA 3EL7A 3GU7A 4AW1A 3BKBA 3MDYA 2WMAA 5FP6A 1O9UA 2XJ1A 3CR0A 2VTQA 1URWA 1P4OA 4CFXA 4OBQA 4BIEA 4A4OA 4G5PA 5DPVA 4ZTNA 3Q6UA 4RFYA 2F9GA 4FBXA 4ZTRA 1YOLA 2B53A 1XH9A 3BHYA 2GNLA 2ERKA 3GU6A 1ZY4A 4O7PA 4DTBA 3BV2A 1JOWB 3BV3A 3IW7A 4N70A 5CTPA 4FKOA 1NVRA 1OM1A 2QG5A 3RM6A 4ACDA 2XKEA 1YI4A 3P79A 4Z55A 4F09A 4FVQA 4H3PA 3RINA 4ENXA 2C68A 5B2KA 3ZM9A 1H0VA 1TVOA 4CTBA 3H4JA 5HD7A 4PMTA 4PX6A 4QP1A 3L8SA 4RJ4A 2O3PA 3PYYA 4MCVA 3RKBA 2G01A 4ZS4A 2CLQA 4RG0A 3WF5A 4DFYA 5K4JA 2JGZA 2GSFA 3FHIA 5JFXA 3T9TA 4TWNA 3COMA 1YOJA 1WBSA 4MTAA 4BDAA 3UQFA 3AC4A 1YKRA 2X4FA 4LFIA 4MH7A 3ZLYA 5FTQA 3V5LA 1H24A 4RIYB 3C1XA 5CU3A 1ZMVA 2B9JA 2R3RA 3OTVA 4WIHA 5HEZA 4RVLA 4E26A 1GZNA 2UZVA 4BR3A 4RQKA 4AN3A 1APME 3DKFA 3OWPA 3FLNC 3FLZA 4RZVA 3UP2A 2E9UA 2YABA 4R7BA 1BI8A 5DVRA 4D9TA 4EC8A 2PUNA 4EK4A 2PE2A 3NUAA 4QPSA 4XG3A 1CDKA 3IOKA 3PFQA 3PPKA 3KCFA 4PDYA 3DK6A 3W2CA 4AN9A 2PVJA 3OEZA 4R78A 1U54A 3R8LA 4BDHA 4MXOA 2C47A 4N0SA 2IPXA 4DH3A 4BRXA 3R9RA 4GEOA 4F6WA 3VIDA 2R3FA 4X7QA 3R7IA 3S2PA 3TNWA 5EI2A 3W2QA 4N4SA 4CRLA 2J5EA 5HKMA 5A46A 4WUNA 4D5KA 4JQ8A 3R7OA 4NZWB 3S4QA 4AOIA 3NYXA 2B55A 2WHBA 1M2RA 2WEVA 3FMKA 5CQUA 4C4FA 3ORLA 3R22A 1NA7A 3TWJA 3A7GA 3QC4A 5D9HA 5E7RA 3ZO4A 4BDIA 4WNOA 3MH2A 4FT0A 4O27B 1Y8GA 5E91A 3LMGA 1H28A 4NTSA 4XRJA 4I4FA 3GBZA 4UY9A 5BYYA 2ZM4A 4FI1A 1I44A 3DV3A 1ATPE 3DJ5A 4KIPA 3AQVA 4EOJA 4WT6A 3RTPA 4QRCA 4YZCA 3D0EA 3G33A 2F57A 3MPMA 2OZOA 3OEFX 3OZ6A 3PE2A 2UZNA 2PVYA 4GFMA 5EW9A 1T45A 3QQFA 4XG7A 4BC6A 1OI9A 3ODZX 4I5CA 2W1GA 4Y46A 4NM3A 2YM4A 5ANGA 5IQFA 5I9YA 3HX4A 5HE2A 3R28A 2YWVA 2HY0A 2SRCA 2VU3A 5A4EA 4K2RA 1M2PA 1YXSA 2A19B 5I9UA 2C3IB 1E9HA 2PHKA 3P7CA 1U4DA 2W1EA 4MQ1A 2GS7A 1YVJA 1JBPE 3R9NA 2VTAA 1GNGA 3W0OA 4B6LA 3LCDA 5FDPA 3AC5A 5CZIA 1HCKA 3ID6C 4AW2A 4D58A 4JQEA 3AT2A 3PUPA 4BICA 2QU5A 3EQHA 4QP9A 1U5QA 2O64A 4ANQA 3FMMA 3ULIA 2E2BA 5FLFA 5IQEA 1XH4A 2JDTA 1REJA 3NMUF 3PVGA 3QA0A 4GT3A 3HV3A 1RE8A 4IHPA 3MB6A 1H8FA 4K18A 5TKDA 4F7SA 3UIXA 2IZSA 5GIPE 4CFUA 1PXNA 3LPBA 4I0RA 4RJ3A 4KRDA 4ZZNA 3KXZA 4KNBA 3D7TA 4YJNA 4E5AX 2E9VA 3FKOA 3K2LA 2ZB0A 3ZCLA 4RMZA 4FTAA 2X2LA 2ZDUA 2V55A 2W9FB 3PPZA 3IDBA 4U9AA 1OGUA 4GVJA 2XK6A 5KMNA 4L7FA 3KA0A 5L3AA 4GYGA 4B9DA 3COKA 3HNGA 4ZLYA 3UNZA 3O8PA 4RT7A 2YZLA 3NZ0A 3RCJA 2BHEA 2WPAA 4V05A 1GZOA 4DHFA 3ATTA 1OKZA 1IG1A 5AWMA 2ITTA 5GNKA 4BTJA 3QQGA 4IM2A 3SW7A 4ZY4A 4U44A 4DGNA 2RFDA 3D15A 1NY3A 2ITZA 3R7YA 3D9VA 4J8MA 4BZNA 1J7IA 2ETRA 5HIDA 3U8WA 3F5GA 3GCPA 3P86A 4JIKA 4R3PA 4IZ5A 4FYNA 1H01A 1FINA 2X8EA 5LMKC 3CQUA 4GIHA 1Y8YA 3EQRA 3PXQA 4R7IA 4DEDA 4AOTA 4RX5A 1Q3DA 4YO4A 2QOKA 5KO1A 4FMQA 3TXOA 3MY1A 3MFSA 2EVAA 1Z57A 3BLQA 4IVCA 3ZDIA 3ZFYA 4C4JA 3OCBA 4RGJA 4BZDA 4H39A 3I5NA 4MNEB 3BX5A 3HMMA 3DB8A 4CNHA 3PZHA 3FLQA 5CT7A 2XH5A 5LVLA 4G9RA 3RJCA 4FTUA 3KY2A 4FV5A 4WG5A 3CY3A 5ANOA 1VR2A 1JKSA 4GVAA 3SRVB 3KULA 3HMNA 3C7QA 5IQAA 3C5IA 3UZPA 2UZUE 5LARA 4LV8A 2OU7A 2W5HA 4AA4A 4U6RA 4C62A 2WTWA 3QHWA 3A60A 4E7WA 3ZXZA 4W4YA 4BF2A 4QTAA 4AZEA 5IDNA 1IASA 1Z5MA 3VJNA 1XR1A 3LAUA 5IA1A 2V62A 2YEXA 4MBJA 4ANMA 4B4LA 2PK9A 3PXKA 2PMOX 5HCXA 2QODA 3ZDUA 2R3HA 3BE2A 4IZAA 1MUOA 4YZDA 2XS0A 1OIUA 2QQ7A 1GY3A 5BMMA 2FSTX 4N6ZA 2I0VA 3CKXA 4QO9A 4RWLA 2QOIA 3BU3A 4C0TA 4JI9A 3EKNA 2PULA 1WAKA 4HCUA 4I24A 2WQMA 5CS6A 2V7AA 5F20A 1RDQE 4R6VA 3SVVA 3C4FA 4QMNA 2BDJA 5HE1A 4CVAA 5AV2A 5ITAA 2OSCA 3P7AA 3D7ZA 3E93A 4PL4A 5CF6A 3KVXA 5KMLA 4W4XA 3IKAA 3OW4A 3WILA 5ANKA 3I81A 2NNWB 4TZRA 3MBLA 2I6LA 2CMWA 4X3JA 4L46A 2R3QA 3LM5A 3LOKA 4OBPA 2ESMA 3O0GA 3VUDA 4EOPA 4EH3A 3T9IA 3E8NA 4FV4A 3QXOA 3D5VA 3MH1A 4RPVA 5AM6A 2CSNA 3CJGA 3QTZA 3QWJA 4XHKB 4XRLA 5DEYA 3RPYA 4O2PA 2CCIA 3W0MA 3KRJA 3LFSA 3QX2A 4D2SA 5J87A 3LXPA 5IQBA 1H08A 2PY3A 4AT3A 4BBEA 1U54B 3II5A 4CRSA 4HGSA 3TTIA 5JGAA 4PV0A 4MAOA 3EYGA 3MA3A 4E4XA 3GXLA 4LRKA 3BHVA 5FTOA 3ZC6A 3DBQA 1Q8UA 3GCVA 4FTTA 5FQDC 4L00A 4QMLA 4HNFA 2A2AA 4FIJA 3B2TA 4FEQA 4QQCA 2Q0BA 5DRBA 5M44A 4GUBA 4CFFA 5HG7A 1M7QA 3CTJA 3THBA 5JGDA 4UALA 3D5XA 3UBDA 2IVSA 4WD5A 3OT3A 1Q8ZA 4AAAA 3GU8A 4BBMA 5CF4A 5HBEA 2IZRA 4TYIA 2X9FA 3AC8A 3LIJA 3F3WA 4IAKA 4MNFA 3ZEWA 1DS5A 3F5UA 4BHZA 5EDPA 1Y91A 2EU9A 3DU8A 1W98A 3KRWA 4BB4A 2PYWA 2WZJA 2WTCA 4YBKA 3W8QA 2JLDA 3VUMA 4TL0A 4FL1A 4BGHA 3MV5A 3FKNA 3BYUA 2PUIA 4FTIA 4IACA 3I4BA 3GI3A 3W10A 5IU2A 3DPKA 3EFWA 4ASEA 4RIXA 4IAFA 4WZYA 5CAVA 1AD5A 1UWHA 2BAKA 4IX4A 3FZOA 4F7LA 4F6SA 4BCNA 4FSMA 1P2AA 3MW1A 3ZH8A 3UMXA 2XJ2A 3EN7A 3M2WA 5E8TA 3U54A 4E6QA 4EHEA 2W96B 1XH6A 3HRBA 3TZ7A 4LL5A 4QMSA 4YJVA 4D1XA 4IH8A 1PW2A 5AV3A 2R2PA 3DB6A 5L6WL 1GOLA 1ND4A 4Z7HA 5C4LA 2KULA 4E6AA 4BDDA 2CHLA 1K2PA 3QYZA 3I79A 3TZ9A 4YNEA 5CWZA 3VS5A 4BVUA 1LR4A 2WD1A 3F82A 3GNIB 3ACJA 3LXNA 4FV2A 2YDIA 2YIRA 3D7TB 3RNIA 2V0DA 4NKSA 4UYAA 1CTPE 5M07A 3VO3A 4JOAA 4FV3A 4EYMA 2JKKA 4ACGA 3UO5A 2DYLA 4F99A 2QCSA 2UW4A 5CF5A 1A48A 3MPTA 4FC0A 4GSBA 2QOHA 2R0UA 4FTQA 1W7HA 3HECA 4BKJA 1OPJA 4FKUA 2IVUA 4IFGA 5KX8A 3OFMA 2G1TA 2R3IA 3DLZA 3C13A 5IF1A 5KZ0A 3EQCA 4HGTA 5IA5A 3QKKA 3SV0A 4AE9A 3MTFA 2R3KA 5EKNA 2VWZA 2REIA 3HL7A 2WFYA 4TRLA 4DF3A 3N4TA 3CTHA 3A7IA 3G5DA 5DT0A 3SG9A 2F2CB 4FR4A 4QOXA 5EDQA 3ZYAA 5I4NA 4P4CA 1JWHA 1ZYSA 4M13A 4O0SA 3SAYA 4CV9A 4YUQA 1XBCA 5A14A 4TYHA 2OFVA 4TTHB 2B0QA 3BIZA 4NU1A 5IH4A 4BI0A 2FA2A 3ZM4A 4F63A 4QPAA 3EQIA 3MPAA 3L9MA 1OZ1A 2ITQA 3OXIA 3BI6A 4H3BA 3NAXA 4J8NA 3ZLWA 4EQMA 2B1PA 4NSTA 5DG5A 5KMIA 2RG5A 2R64A 2JIUA 4PQNA 4K8AA 2J5FA 4RX8A 5EI6A 3SXRA 5LCKA 3Q4ZA 4RJ6A 2XM9A 4EBVA 2W4KA 2GNFA 2G15A 4QMYA 3ETAA 3FUPA 2HXLA 2YJRA 1H1SA 4D1ZA 3SC1A 2XBJA 2RIOA 3VAPA 4H36A 4KSPA 2J0LA 3ANRA 3KULB 3VC4A 1NVQA 1KV2A 3NLBA 3W0PA 2P0CA 3FLSA 3NNVA 4GIIA 1XKKA 2HAKA 3Q4UA 4EZ3A 4AOJA 5KMKA 1ZMWA 3WF8A 2IG7A 2O5KA 3VS0A 2ZV9A 4DT9A 2QR8A 5J95A 1TQMA 2HY81 5HCZA 4BDBA 3K3IA 4MBLA 2VWVA 1IAHA 5KNJA 3R1YA 4IWOA 2VX0A 1XBAA 1CM8A 4M0YA 5K9IA 3F7WA 2XBAA 4JBQA 3C0IA 3OHTA 3PVWA 4PDSA 4XLVA 5KZIA 4DH1A 3MIYA 3PA4A 4G2FA 4J7BA 3T3VA 4M97A 4U94A 4FV7A 2CCHA 3K54A 4FT5A 2Y0AA 2QR7A 3O50A 4G16A 5AEPA 1SVGA 3GP0A 4U42A 4ANLA 4J96A 3LE6A 2XYNA 4YPSA 2OXYA 1KSWA 2OK1A 5IH5A 2X6EA 3DJ7A 3BYMA 3FEGA 3ANQA 3FE3A 4FSTA 4O82A 3NIEA 3RK5A 1G8SA 2WMXA 3P08A 2F7XE 4NYEA 1YQJA 2GPHA 3QD0A 1ZARA 3NWWA 1Q4LA 2CGWA 4PTEA 2P2HA 3QZIA 4FEWA 4GFGA 1M52A 2OZAA 2XNEA 3AOXA 4CMUA 4S32A 4W4VA 5LMAA 4R3CA 2JAVA 5M55A 3TJCA 1ZOHA 2ITXA 3QTXA 2GQSA 2YDJA 3SQQA 2QKRA 2OFUA 5ACKA 2OWBA 5CF8A 4MBIA 4I5PA 4I0TA 4XBUA 1OKVA 4DG3E 3QUPA 4UBAA 5JEBA 3TUCA 2X7GA 3EB0A 2WQBA 3KFAA 3BQRA 4OGRA 4XV3A 2W1DA 2W1FA 4UWCA 2CLXA 2YIXA 1LEWA 2C3LA 2WU6A 1VJYA 3I7BA 2GDOA 3MVHA 4GT4A 4MD9E 4FSUA 4IM0A 1V0BA 5M56A 4UX9A 5L8LA 5ANDA 1W83A 3PY3A 4EI4A 1JNKA 4MEDA 4QTEA 4I1ZA 2FSOX 4JS8A 4O22A 2F49A 5CXHA 2W05A 3UIBA 4BCGA 4CT1A 4DT8A 2X8DA 2PVRA 3F88A 2PVNA 3ORKA 4CD0A 3I6UA 3GU4A 4FV6A 3MJ2A 2UV2A 5TT7A 3PJ2A 4P5ZA 4U81A 3ZFMA 2VTHA 2XIKA 3A8WA 5LCJA 3F66A 3H0ZA 5CSXA 4DAWA 5FEQA 2UZBA 4ARKA 4BTFA 4BYJA 5AADA 2GTNA 2J50A 2F7ZE 3MS9A 1J7LA 2OGVA 2JAMA 2OO8X 4RIXB 4KD1A 3KB7A 4RLLA 3C4EA 4D2RA 5HLWA 1JKKA 2C6TA 5D7VA 3EFLA 4K0YA 5HCYA 2G2FA 2GQRA 4X21A 4CG8A 3F3TA 4QQ5A 4IB3A 2JD5A 5M4FA 4E4MA 4AA0A 3PTGA 5LOHA 4G34A 3FLWA 5BVNA 3NPCA 2UVXA 3KMUA 2HELA 3FLYA 4I21A 5C01A 2VO0A 5C8NA 1O6LA 4GL9A 5EQPA 3HA8A 4O0UA 4G1WA 4QMOA 4YJSA 4F9CA 2WMVA 3NDMA 1J3HA 4H05A 2HWOA 3QQJA 2B7AA 4JDJA 4E20A 3BPRA 1KE8A 3W2SA 4HVGA 3KF4A 5E8UA 4MKCA 2CGXA 5AUZA 3FXZA 3VS1A 4AFEA 3QD3A 3ORTA 1XHAA 5DHJA 2ZMDA 1H0WA 1SM2A 4EOKA 1B6CB 5G6VA 4J1RA 3NS9A 4IC8A 4F0FA 4FKIA 4FODA 2BCJA 4FTJA 1K3AA 1YHSA 4GH2A 1F3MC 5CEPA 5ANIA 3MJ1A 5AUYA 3UE4A 4NW6A 1KE9A 4M84A 2QHMA 3JY0A 4X2JA 4HVSA 4KS7A 4QYGA 4FV8A 4FTMA 1PXLA 5AAEA 5IZFA 1IA9A 3HP2A 4O6LA 4IX5A 2PZRA 4OTFA 2BRNA 3N4UA 1CKPA 2ERZE 2ZAZA 4M8TA 4ZMFA 3I60A 5A6NA 3FMEA 3NCGA 1PJKA 4P90A 5CANA 4NWMA 4JXFA 4LMNA 4QYYA 5AUVA 4Z9LA 3W33A 2PZPA 2WMBA 3FKLA 3QKMA 2BKZA 5C03A 3PJ3A 4HYSA 3WBLA 4AGWA 3Q9WA 4C33A 4O7RA 3R1SA 4O38A 2VWYA 3EH9A 2QO2A 5IH6A 2OKRA 3UVQA 2J0JA 2VGPA 3CLYA 3OOGA 4WSYA 4TYHB 3FDNA 4YZNA 3WYXA 3KMMA 4FVPA 4XG9A 3RAKA 5JKGA 1U5RA 4X2NA 4DBXA 3PXRA 4QMQA 3KVWA 1WBVA 3UYTA 1R78A 3OP5A 3QRUA 4FIHA 4QTBA 3OWKA 5ICPA 4PUZA 5DYJA 3V04A 3HUBA 3WZDA 1ZOGA 5CVFA 1URCA 3PVUA 5E8WA 3PXFA 4ITHA 4KRCA 2YA9A 3UPZA 5BMSA 5KHWA 4BDJA 3QWKA 4F7JA 3R7UA 3HGKA 1JVPP 2CGUA 2QURA 4M7IA 4TNBA 3UPXA 4D9UA 4YURA 4I6FA 3RWPA 1IAJA 5HBHA 3IO7A 1BX6A 2Y4PA 4AZTA 4C3FA 2WMUA 3SDJA 4DGMA 5AM7A 3I1AA 2I1MA 3EWHA 2YAAA 3TNIA 4FKVA 3WI6A 5JH6A 4S2ZA 1KV1A 3DKCA 4M69B 5ETIA 1Q24A 1SNUA 1H25A 4F9AA 4FEXA 5HORA 4KBAA 5I9VA 5F9EA 4RC3A 2XIXA 3IDCA 3UO6A 2WMWA 3ORMA 2PZIA 5FUTA 3OCTA 3RWQA 5CLPA 4EJ7A 4M3QA 1YWVA 4KSQA 4Y73A 5KMJA 3F61A 2J0MB 3R02A 1PXKA 1BI7A 3MB7A 3G0FA 2ZB1A 4EH6A 4R5YA 5BPYA 4IZ7A 2OF4A 1OKYA 4PP9A 4PRJA 5F1ZA 4D5HA 3RALA 2CNUA 3E8EA 4F1TA 5FBNC 2YM7A 5J9YA 5LQFA 2IO6A 3F5XA 2Z60A 4FV1A 2QKWB 4RA4A 5E4HA 4XX9A 4G9CA 3EQBA 3PP0A 1YXTA 3RAHA 5DT4A 3MTLA 4NUSA 3QCXA 5AP0A 2X4ZA 3FL4A 2BR1A 4U45A 1ZAOA 4YSMA 3C5UA 1BUHA 2JDRA 3VS7A 2WIHA 5DIAA 3NYVA 5BX0A 2BALA 2R9SA 3HKOA 5T68A 3DTCA 3DNDA 3L9PA 3ZU7A 4I41A 4F08A 5GJGA 1AQ1A 5D12A 1DAYA 1VZOA 3NUSA 4WA9A 4APPA 2F2UA 4ACMA 4KIOA 1FOTA 5DT3A 1YWNA 2HYYA 2OJIA 5E8SA 3CBLA 4AZVA 2B4SB 5IA4A 5HBJA 2BIYA 4RJ7A 3VNTA 1WCCA 2IZTA 2RG6A 2ONLA 3AT3A 4FKJA 3KXXA 4DLIA 3TNPC 4RX9A 3W8LA 3D2IA 3QD4A 2Q0NA 3PY1A 4N57A 3ORXA 2VTLA 3UC3A 3G0EA 3W2RA 2W5BA 2J6MA 3OG7A 4FKRA 4L6QA 4JLCA 2VRXA 3ULZA 1Y6AA 4FKLA 3DGKA 3P23A 4R5SA 5DBXA 5EW3A 4JAIA 3RK7A 1YXVA 3P5KA 2YDKA 3TL8A 2PMIA 2XNPA 4DEBA 2XKFA 3CD8A 3WIKA 5IMEA 1WVYA 4C58A 4QNYA 3OXTA 2X39A 1PY5A 2I0HA 4KKEA 3FMHA 4O6EA 5HO7A 2CPKE 4EHVA 1OIQA 3PG3A 4O0XA 3H9OA 5T3QA 5JFSA 2YM5A 3DLSA 3BHUA 3D4QA 4ERWA 3RAWA 1OIYA 3H10A 3ORZA 5CYIA 4LYNA 3GC8A 4FNZA 3WE4A 3LJ0A 4JX3A 3W2OA 1R39A 3REPA 4LM5A 3FMJA 4F64A 1GJOA 5D11A 2BRMA 3SXFA 1HCLA 2R0IA 3Q5ZA 4YTIA 5HESA 3GC0A 3ZSGA 4HNIA 2J7TA 4BCOA 3QXPA 3KMWA 5EM5A 2WMTA 3RGFA 3TDVA 3UGCA 5AUUA 5B7VA 3QX4A 3VJOA 4HVHA 4EH4A 3W0SA 1FPUA 3WZKA 3L9LA 4BTMA 2YACA 2GHMA 1S9IA 3PSCA 4HVDA 1XO2B 2HW6A 3LQ3A 3QKLA 5AUTA 2VTNA 3V5QA 4GYIA 3N4VA 4L45A 5ETCA 5JQ5A 2PPQA 3AT4A 4ITIA 2CKOA 4TWCA 3V5JA 1LPUA 4RRVA 5A6OA 4IVBA 4U43A 3R8VA 1YHWA 4KKHA 4AFJA 3UOJA 1LP4A 1Q3WA 4IADA 3VS3A 5EYKA 3OMVA 3QALE 3RHKA 1QCFA 3DKOA 3P78A 4EQUA 2XNGA 3PRFA 4E73A 1G8AA 2ETMA 3HDNA 4F0IA 1FGIA 1G3NA 5BVOA 3QCYA 3FWQA 2RFNA 2A27A 1WBTA 4IAAA 3ZOSA 3AXWA 3Q52A 5L6PA 4YJPA 4ZJVA 2BROA 4KA3A 3ZXTA 1G5SA 1OBDA 2QO9A 3PG1A 3NR9A 3OROA 1UU3A 4CMOA 3GB2A 4IM3A 1SYKA 2UVZA 2C0IA 3BBWA 4NJDA 5CSPA 2PWLA 2PZYA 4W8DA 3IW4A 3F3ZA 3TKHA 1RW8A 2Z7QA 4OTDA 4WUAA 3BYOA 3OVVA 1Q8WA 3DFAA 4FL3A 2X2MA 2XK9A 3SD0A 3A99A 4B0GA 4D28A 5HNIX 2VN9A 3UQCA 4GV1A 3Q2JA 4QQTA 5TOZA 4AQCA 5EQEA 1OL1A 2FSMX 3FYKX 5J7HA 1V1KA 2DWBA 4FIGA 2HZNA 3OY1A 3R9HA 5AV1A 5M06A 4GU9A 1R0PA 2C0OA 1MRUA 4ZJIA 3VBXA 2WELA 3OF0A 5IPJA 1PKGA 5EHYA 3VUIA 4O7SA 3DK3A 4IW0A 4FZ6A 3QF9A 3IONA 2CGVA 3EN9A 1NVSA 2C69A 3P0MA 4CFMA 3EFJA 3DBCA 4I3ZA 4QYHA 4DG0E 3IQ7A 4MD8E 3LLAA 3W1FA 4LUDA 4YPDA 3D14A 4PL5A 4ZOGA 1NT2A 3W32A 3BHTA 5DFPA 4DEIA 2C4GA 1W0XC 3P7BA 3QQHA 4HPTE 4ZY6A 4HZRA 3SXSA 5FGKA 4CSVA 4HVIA 5LVPA 2WU7A 4XYFA 3TZMA 3NUYA 3FZTA 2JEDA 4XG4A 4E5BA 1HOWA 2VTRA 1B39A 1B38A 4A4XA 3A7FA 4JG7A 1F0QA 5CZHA 4IE9A 2VO7A 2X1NA 3EN5A 4RJ8A 3BEGA 1ZY5A 2XK7A 3C0GA 4H58A 3ZUUA 3FI4A 1P5EA 1MQBA 2ACXA 2ITVA 4FTKA 4DGLC 4Z7GA 1KOBA 4QT1A 3WF7A 1LEZA 2R3LA 3NAYA 4HYUA 3UO4A 4XJ0A 4J99A 5FEEA 5EFQA 5TO8A 4FICA 4A9YA 3VW6A 5KBQA 5M51A 2XEYA 4E6DA 1XH8A 2H6DA 4E8AA 1IRKA 3OC1A 5AP7A 4DITA 3CE3A 5E90A 5KCVA 4UXQA 3DBFA 4ZJJA 5B2LA 3KN5A 4RFZA 4WBBB 4QMXA 5EI8A 5HI2A 3TV6A 4RWKA 2IZUA 2WQEA 4ALWA 4EONA 2GQGA 2O65A 2IW9A 1UU9A 4ALVA 5EYCA 4J71A 5A4CA 2YITA 4L67A 3A2CA 4UXLA 4B7TA 1BKXA 1JQHA 2R3NA 3CGFA 2OXXA 4FKPA 4ZSGA 3V3VA 4AN2A 4IB1A 2OXDA 3VBTA 3LKMA 5CT0A 3ZZWA 1YDRE 3EZRA 3PXYA 4PF4A 3HVCA 2PZ5A 2XEZA 1ZMUA 3KC3A 3HUCA 3B8QA 4EOLA 4YJUA 3RPRA 2QOFA 4GMYA 2Z8CA 4DGGA 3I0QA 4FTLA 4RQVA 4C34A 3FY2A 4B8MA 2YAKA 4F6UA 4XG6A 3UZRA 1ZZ2A 4C38A 3GEQA 2RFSA 4XP3A 4F9YA 3ORPA 4QMMA 3C0HA 3WF9A 3TV4A 2OIQA 3HP5A 3D94A 4YP8A 3W0NA 2ZMCA 3U6JA 1PMEA 3DK7A 3W18A 3UNJA 3W55A 3R7EA 4FUYA 4EWHA 3AD6A 3O17A 4BHNA 3JYAA 2HZ0A 3CCNA 4NCTA 3IK3A 2BAJA 5JRSA 4BCIA 2B9HA 4CZTA 2XZSA 2OICA 2WTDA 2XA4A 1MQ4A 1Q97A 2ITUA 3OT8A 4BBFA 5CX9A 4Y95A 5DEWA 3COIA 3IGOA 1WMKA 2BHHA 3EYHA 3MFRA 4NT4A 4EH9A 3AC2A 5AMNA 5JRQA 2O63A 4D0WA 1FVVA 4IDTA 4I4EA 4IDVA 4DEEA 5BVFA 4C37A 3LCKA 2R3PA 5LXMA 3ATSA 3U4WA 4I93A 4EH2A 2WKMA 4UZDA 4W8EA 5IEYA 4BGQA 4KBKA 3MVLA 2BZHB 3EL8A 2RL5A 1BL7A 2UW8A 4FZAB 4ITJA 5GINE 4HGEA 5HU9A 1WBOA 4QNAA 1I09A 2JKMA 3TDWA 3ELJA 5CEKA 3PVBA 4BCHA 4FV9A 4HYIA 5M4IA 2WOUA 2B52A 3JXWA 3NUXA 4O91A 4S31A 3PJ1A 2CN5A 1WBNA 4QMWA 2YIYA 3KRXA 2XRWA 3MI9A 5AA8A 3BU6A 4OUCA 2OLCA 4BIBA 5DA3A 4ZY5A 3PP1A 3H0YA 4GFOA 4MQ2A 5I9ZA 3WYYA 1H4LA 5DR6A 3DOGA 4MX9A 1SVEA 4FGBA 4IX6A 3Q6WA 4WNMA 4O0VA 3FXWA 4OTWA 2C6KA 4AT5A 2BVAA 1V0OA 3R8UA 4YTCA 4C59A 5M57A 3CJFA 4XV2A 3DDQA 2HW7A 4WRSA 1E1VA 4DBNA 1PKDA 4CMTA 1Y57A 2HWPA 4Y5HA 4EOIA 5M4CA 1O6KA 4F9WA 4UWBA 4ENYA 4FTRA 1XH7A 3H9RA 1OL2A 4I0SA 4I92A 4L9IA 4C61A 5HE0A 3PY0A 2PMNX 4FGRA 5E1SA 5EW8A 3R01A 3SKCA 4BCFA 4DH8A 2ONLC 4R7HA 3SHEA 3HEGA 4CV8A 3KF7A 4EK6A 2X0GA 3R73A 5HLPA 3JVSA 4QYEA 3ZEPA 4EHZA 2C1AA 2WTJA 5G1XA 5A9UA 2XKDA 2BZKB 2R5TA 2VV9A 3O8UA 5FXSA 5KUPA 4DEHA 5K3YA 2ZOQA 3LXLA 3BWJA 5L2TA 2G2IA 3KXGA 3R8ZA 2WQNA 3RAIA 4QP6A 2R7BA 1ZRZA 5M09A 2W9ZB 4Z16A 3PPJA 3OWJA 3VS4A 3OXZA 3NUPA 3TV7A 5DE2A 2IW8A 4EOSA 2V5QA 4CCUA 4NFNA 2C5YA 3QFVA 3V8WA 4EKLA 1WBWA 2WXVA 3ENHA 4Y85A 5L8KA 3PLAE 4OLIA 3ORIA 4IX3A 4ZZMA 5EM6A 3ZS5A 1P4FA 3S00A 4L01A 3RPVA 2JKOA 3IG7A 3BBTB 1KWPA 4TYEA 4D4RA 2YERA 2OI4X 1GIHA 4B99A 5CQWA 2GNGA 3OTUA 2I40A 4K11A 4YC6A 4YLKA 2C30A 3P9JA 2NPQA 5IEXA 2VZ6A 4FKSA 2YCRA 3QGYA 2W1HA 4O96A 1H1PA 2IVTA 1JSVA 1WZYA 2HCKA 5DNRA 2HZIA 2JBOA 4DTKA 4Q2AA 4RX7A 1M17A 2BRBA 5HGIA 1NXKA 5AP6A 5HG5A 2C6DA 2XUUA 3LQ5A 3WZEA 2FB8A 3ZO1A 4L43A 1WVWA 4ASDA 5JFWA 4BI1A 2Z02A 1OPLA 4AA5A 3QRJA 2O8YA 2HOGA 4L53A 5DLSA 3S1HA 2O2UA 4E4LA 2Z7RA 4FKQA 1OUKA 5AIKA 2FGIA 5BQ0A 3NW5A 4BCQA 4TPTA 2AYPA 2JIVA 3QTIA 1FVTA 4FNXA 2P4IA 4BIDA 5DH3A 4OTGA 3QTSA 2PSQA 3UDBA 3MIAA 3FHRA 4GCJA 3R8PA 4EK3A 3UJGA 5IG1A 4USFA 3ZZEA 3BE9A 3UOKA 5CU2A 3VQUA 3E5AA 1BMKA 3MVJA 4YZ9A 4TT7A 4D1SA 3KL8A 3CC6A 3OBJA 4EYJA 4EEVA 2Y6MA 4FV0A 2QONA 4O83A 2YM8A 3HRFA 2VNWA 5F95A 3QLGA 4ERKA 5EK7A 1H27A 2HIWA 2PE1A 3E64A 3V51A 3DXPA 4AACA 4C2WA 3QZGA 4JVGA 3T8OA 3UQGA 3GOKA 3Q96A 3BRBA 2R3MA 4F70A 3QCQA 4EORA 4FTOA 4IJPA 4C3PA 3T3UA 4F1OA 2Q83A 3QTUA 2BZIB 4FZ7A 4LRJA 5CAOA 1M14A 2QO7A 4FIIA 4HPUE 3VUHA 4BDKA 5IISA 2XYUA 2A1AB 4EZ7A 3V01A 4XUFA 3C4XA 4Y72A 5HX6A 2IJMA 5D7AA 4ZSEA 3CKWA 3AGMA 4S30A 3EQPA 3E7OA 4GG7A 2V7OA 3C51A 1U46A 2YIQA 3EIDA 3N9XA 4ID7A 1EH4A 4O86A 4TY1A 5AJQA 5E1EA 4AU8A 4R77A 4G17A 3HAMA 3IS5A 3Q9ZA 4FX3A 3PSDA 2BPMA 4IC7A 3CQWA 3MFTA 4ANBA 5M08A 3HV7A 4QMTA 4BCKA 3QYWA 2VNYA 4C35A 3C4ZA 2GTMA 3OCSA 4X0MA 4ZIMA 2XIYA 4RVKA 3V5TA 4KAOA 1BYGA 4IJ9A 3D5WA 3NIZA 3WOWA 1VYWA 1MRVA 3HA6A 5L8JA 4DFNA 3DCVA 2WO6A 3KCKA 4CKRA 5HD4A 4BDEA 3VRZA 5LVNA 4DEAA 5CNOA 4ZTSA 4JL9A 3COHA 5ETFA 3CPCA 4ZLOA 1UNGA 2FO0A 3TT0A 4FT7A 4NTTA 3DT1A 1WVXA 2I0YA 5IA0A 4BZOA 4LOQA 4ZMEA 2AC3A 3RK9A 3PIYA 3C4CA 4O2ZA 3SGCA 1DI8A 3ACKA 3LJ1A 1TKIA 1U59A 5AX3A 2VX1A 2GHGA 4JBVA 5DWRA 5IUHA 4WOVA 5EHLA 4FEUA 4FEVA 4U3YA 4WHZA 1CMKE 4EL9A 3G6HA 2ZV8A 3GCUA 1VYZA 4XP0A 3WZUA 3IW8A 1PYXA 2XF0A 4AF3A 2EB2A 5K5NA 5HG8A 4XOYA 2QNJA 3JS2A 2UW7A 5L6OA 4ZTHA 4ZTQA 4CZUA 5H2UA 4DFBA 1X8BA 2VTOA 2GNJA 5AP1A 2VAGA 4FK3A 4M12A 4QMVA 4RVMA 3Q2MA 3DS6A 4QQJA 5H8GA 3EFKA 3KRLA 2PTKA 4JX7A 4L3JA 2VTTA 3KK8A 4G6LA 5H8EA 3VW8A 4NM7A 5EM7A 3VBWA 1PXMA 3QQUA 4JBPA 3JR1A 4A7CA 4TN6A 3LVPA 4APCA 5CVHA 4B8LA 3IGGA 5CNNA 4GW8A 2PVHA 1XWSA 4FKWA 2UZEA 3ZRKA 5M4UA 2QOOA 2HXQA 4WG3A 3V5WA 3DJ6A 3FZRA 4HCTA 5HVKA 4J95A 4QTCA 3RI1A 4BCMA 5KMOA 4ZK5A 2VGOA 1ZWSA 5HO8A 3D2KA 3FQHA 4CKJA 5IUGA 3PJCA 2Z2WA 4NCTC 3C4WA 2VTJA 3ZFXA 4YJQA 4CKIA 4YU2A 3LQ8A 2X8IA 4AG8A 5CY3A 5FBOA 4IMYA 2R3GA 3M42A 4M68A 5DI1A 3JY9A 5FXQA 3LM0A 3ZUTA 3TEIA 4GT5A 4CG9A 4U98A 3NSZA 4PMSA 5KE0A 2W1IA 3MSSA 3CQEA 4G31A 4M15A 4MHAA 4O84A 5C26A 3PLSA 3N51A 2YHVA 1OBGA 2NRUA 4XLIA 3G9NA 3BWFA 3GUBA 3ZRLA 4O0YA 5CASA 4WNPA 1RJBA 3OW3A 1FMKA 4NW5A 1ZYJA 1J1CA 4G3EA 3TNQB 4K1BA 5J8IA 2C3JA 4I5MA 5E8ZA 2WEIA 1H00A 2DS1A 2F7EE 2P55A 3ZBXA 1UKHA 4RZWA 3BLRA 3PDTA 1KE7A 3E63A 4IVDA 2UZOA 3E3PA 3LXKA 5HNGA 1UVRA 3VN9A 5A3XA 3DAKA 4YNOA 2J0IA 3M1SA 2NP8A 3F9NA 4QP8A 3UIUA 4AX8A 2HK5A 4J53A 4A07A 2ETKA 4MXZA 2X6DA 5IUIA 4EH8A 3HRCA 1FBNA 2OG8A 2UZWE 4RSSA 2UUEA 5IQCA 3R83A 3CEKA 1OKWA 4GU6A 4DFZE 4RBLA 3DZQA 2B9FA 3D83A 5BUEA 3UVRA 4DFXE 2J90A 5JMSA 1PMUA 4HYHA 2EB3A 3GQLA 1JSUA 3UP7A 3SLSA 4EC9A 2BMCA 5EG3A 3POOA 3ZMMA 2H9VA 4YJRA 1JPAA 2UW9A 2H8HA 3FC2A 2W0JA 4ONAA 4RLKA 4I6HA 3R2YA 4ZSAA 4YC8A 5HQ0A 4O7YA 1KE6A 3NEWA 3NW6A 2C6LA 4AT4A 1PF8A 3Q5IA 3KRRA 3GENA 1PYEA 2VWUA 2XMYA 4AGUA 3HMOA 3C9WA 3EKKA 4USEA 4EOMA 4CTCA 4F7NA 2OJGA 2XRUA 4PTGA 5EYDA 2H34A 1XH5A 4YO6A 3NX8A 3FMDA 5JT2A 3AMBA 5LWNA 2JKQA 3EMGA 3SRVA 4Y5QA 1TQIA 2EUFB 4LMUA 3PA3A 4YLJA 3QQLA 5BVWA 3TG1A 2R3JA 4U40A 3DXNA 4P5QA 4PTCA 3TIYA 3CSVA 2UW5A 3RP9A 3I6WA 1XQZA 3VS6A 1H1WA 2CKEA 2OZAB 3KGAA 4BDCA 2NRYA 3ALNA 2XK8A 4KABA 1GZ8A 3EHAA 1V0PA 2WIPA 4FTCA 3TUBA 4OT5A 4JG6A 1T46A 2C3KA 4AGCA 3NNWA 5GJFA 1GIIA 1OECA 2PMLX 3PA5A 2G9XA 4R1YA 4BI2A 2QI8A 4C36A 2OBJA 5BVKA 4CT2A 3R00A 3SOAA 4F65A 2XNNA 2AUHA 4PWNA 3EN6A 2VX3A 3VQHA 5FDXA 3FQEA 3VF8A 5DOSA 2C6EA 4KINA 1H1RA 1M2QA 3FV8A 3FXXA 3V6RA 2YCSA 2QD9A 3HV6A 5AIRA 3OWLA 3ENMA 4YSJA 2GHLA 5C4KA 1SNXA 5IQGA 1W82A 4FKGA 4MXYA 3Q60A 4PMMA 4YLLA 3O71A 4II5A 4LGGA 4EWQA 4L42A 3PWYA 3ZO3A 1A9UA 4E93A 3GU5A 3LFNA 4YHFA 2BKKA 4K6ZA 4ZTLA 1OL5A 4RC2A 1FMOE 4I94A 3KREA 3V6SA 4J97A 4RA5A 5BNJA 4F1MA 2JITA 5K4IA 4LV5A 3RM7A 4MWIA 4ACHA 4WO5A 5J1VA 4AGDA 5IMXA 4XV1A 5L2WA 4A4LA 3TIZA 3BCEA 4XG8A 3CPBA 1Q5KA 2C5OA 3JVRA 4FK6A 4FT3A 4UN0C 3ZSIA 2X7OA 5J9LA 4JNWA 4XOZA 3MH3A 4QTDA 4ZZOA 4JBOA 4KS8A 4WBOA 3FSFA 4KB8A 3V8TA 4PDPA 3FAAA 3EOCA 4QP3A 4IBMA 3VUKA 4GKIA 2KTYA 3DY7A 4RIOA 5CXZA 3ROCA 4TWOA 3ZUVA 1S9JA 5FM2A 1UU7A 4U97A 5HLNA 3OOMA 3CD3A 2GFCA 3CY2A 4JRNA 4L52A 4UZHA 3KK9A 5DR9A 2JDSA 1R0EA 4CFVA 4NIFB 1JLUE 4XEYA 5CAUA 4HGLA 4TYJA 3HMIA 3VBQA 4BY9E 4DYMA 2R3OA 3DDPA 3Q4TA 4AZSA 4QP7A 2BAQA 4HCVA 3A8XA 3L9NA 4FG8A 4FG7A 4H3QA 4IWPA 4CXAA 4D0XA 4FE2A 2BIKB 3FY0A 4UWYA 3QLFA 3LCTA 5ANJA 5F94A 3VWAA 3O7LD 4CEGA 1OL7A 1YDTE 3E3BX 2OW3A 5LVMA 3GVUA 3E8CA 4G3CA 2YCQA 3CIKA 1OB3A 4FVRA 2BDWA 3FL5A 3IECA 4LL0A 2VTMA 4M67A 5CI7A 4ACCA 2W5AA 1FQ1B 1O6YA 5ANEA 2WAJA 1MP8A 1TQPA 5TF9A 4LQMA 1KUTA 3G90X 3Q3BA 3U4UA 2BILB 2XIZA 4K77A 3DZOA 4EH5A 4EKKA 5EH0A 2Z7SA 2NO3A 4O7NA 2WMSA 4NJ3A 2FUMA 2VTIA 3C50A 1STCE 3F3UA 5CSVA 3QUDA 2UW6A 4RWIA 3HV5A 3RPSA 3MWUA 3FQSA 4FSNA 5T6KA 3Q53A 1YWRA 4LOPA 3TKUA 2CNQA 3JPVA 3F5PA 2G2HA 3FZ1A 2GNIA 3B8RA 3PSBA 5FM3A 3A61A 1GIJA 2B9IA 4QP4A 4RIWA 3I5ZA 3MH0A 4V01A 2CJMA 3LZBA 3VHEA 3GC9A 2WTIA 3NNXA 4FIEA 5E8VA 2EXMA 4O21A 2CKPA 5EHOA 3SG8A 4S33A 4C4HA 4EUTA 3JUHA 2VD5A 4IVAA 5CALA 5KKRB 3TZ8A 3ZSHA 1J1BA 2X81A 4ZTMA 1YDSE 4WRGA 2XCHA 3MESA 1DI9A 2R7IA 2W1ZA 2GCDA 4EJNA 4E1ZA 2C6IA 2ITPA 4HZSA 4JRVA 1SVHA 4FZDB 2GMXA 5D1JA 3R9DA 5JK3A 1J7UA 4FNYA 5CI6A 4NH1A 3TACA 2YFXA 4XV9A 4BDGA 3QQKA 4K9YA 4FNWA 4U79A 5JZNA 4ANSA 4U41A 1PMVA 2W7XA 3A62A 4J52A 4BGGA 5I9XA 5IA3A 5IQHA 1SMHA 2BTRA 2Y4IB 3KU2A 4RWJA 3VVHA 5I9WA 4EOOA 4D4YA 2QHNA 3QUEA 3QCSA 4CLJA 2XK3A 4DN5A 3RHXA 2OH4A 5B0XA
chains in the Genus database with same CATH superfamily
3DTWA 3H9FA 3LFDA 3IW5A 3QC9A 5LJJA 3B2WA 4DG2E 3E62A 4DC2A 4IB5A 4F9BA 3MYGA 3PIXA 2W99B 3Q9YA 3O7LB 1CSNA 4I20A 3S95A 4IAZA 4KWPA 2ITOA 4A9TA 2VWXA 2JBPA 3A7JA 4I6BA 5AP3A 5J1WA 5CU0A 3BGPA 4MYGA 4FKTA 3POZA 3WF6A 3Q4CA 5AAGA 4YJOA 4DTAA 5GIOE 4NKAA 3TN8A 5HX8A 4OTIA 5JGBA 2JDVA 4FSRA 4PNIA 3DFCB 4O7ZA 1IEPA 5L2SA 3LMIA 3OCGA 1W84A 4L8MA 5HVJA 4GS6A 3CTQA 3GT8A 5BVEA 2QC6A 3LCSA 3R2BA 4QMPA 4D4SA 3FPMA 3TYKA 5HTCA 1SZMA 1QPJA 1KOAA 4EUUA 2WTVA 5HZNA 3E88A 4E4NA 2XCKA 4HW7A 3R21A 1H07A 1BLXA 4JIAA 3H30A 1A06A 3E92A 4IFCA 4YC3A 3ZLXA 4M0ZA 3F69A 2NYAA 2CN8A 2XB7A 1GZKA 4MD7E 3R63A 4USDA 5GHVA 4RC4A 1QMZA 4YGAA 5M53A 2E9OA 4TNDA 4GJ3A 4U7ZA 2X7FA 2ZYBA 4AZFA 2Y6OA 3IDPA 3NNUA 3AD5A 4XBRA 2ZFYA 3RCDA 2I0EA 4I5HA 4NL0A 4DH5A 4IAIA 4AS0A 1UU8A 4K33A 2IW6A 2QLUA 2JIIA 5C8KA 4PP7A 1J91A 5D41A 2ZDTA 4JDKA 4UV0A 4O7VA 1UKIA 3AC1A 4A9UA 4CQEA 5KKRC 3TKIA 2W17A 4EHGA 4LV7A 3SA0A 3W0RA 5FP5A 3OUNB 2YISA 3QRKA 5AAFA 2WGJA 2YIWA 2RGPA 3BEAA 3MY5A 4FSYA 4I23A 4PDOA 5HHWA 2VWIA 3NUUA 4FG9A 3SX9A 5EM8A 3R8MA 3QHRA 3U55A 4GK4A 2C5VA 4I6QA 4IIRA 2BFXA 3ET7A 5EDRA 1F5QA 1LUFA 1ZYDA 3ZO2A 5ACBC 3G51A 3ODYX 4H1JA 4FZFB 4JG8A 4MF1A 4OTRA 5AP5A 1XJDA 2F4JA 3AMAA 3BYSA 5H8BA 2Y4IC 3QA8A 5CVGA 3FI3A 2PVMA 2V22A 2ITNA 4YMJA 4ZEGA 1YXUA 5HU3A 3MGYA 2XNBA 1JSTA 3FJQE 4OTQA 5A4QA 1OPKA 2R4BA 2PVKA 3VUGA 3RPOA 4L3LA 5C1QB 4DFUA 1E1XA 4Y8DA 1PRYA 4DCEA 4EZ5A 4ZAUA 3DXQA 4TWPA 1YI3A 3VRYA 2UW0A 3CGOA 4NM5A 5KBRA 3TM0A 4X6QC 3GC7A 4ASXA 5BUJA 3QBNA 3K3JA 4G6NA 3HMPA 3U51A 3UNKA 3QD2B 3BU5A 4J98A 2WMQA 4PMPA 2VWWA 1W8CA 2UZDA 3DBDA 2ITWA 2OF2A 4GRBA 5EQYA 3R04A 3D5UA 4OTHA 2OJFE 1ZXEA 2BUJA 4GK3A 3BGQA 3TI1A 3ZBFA 3R9OA 2WMRA 4IWDA 4GUEA 5CSHA 2VUWA 5BYZA 2QOLA 1IR3A 2ZM1A 1PXIA 2P3GX 3BYVA 2QOQA 3NVMB 4I22A 5FEDA 2P33A 2VO3A 4L3PA 2CDZA 3EQFA 3ITZA 4O0RA 4OBOA 5C9CA 4P2KA 4YBJA 3FZSA 5IEVA 4JDIA 3DQXA 3E7VA 4TKSA 2YWPA 4H1MA 1PXPA 4LI5A 4X3FA 2IWIA 4AW5A 3KXMA 4MK0A 4D4VA 3NUNA 5IQDA 5CEIA 4NK9A 3VBVA 3K5VA 3R7VA 2A4LA 2BTSA 3A4OX 3BZ3A 4FL2A 4R3RA 4YTHA 2A0CX 1K9AA 2HENA 1NW1A 4JAJA 4BCPA 3EZVA 4G5JA 4BN1A 4YTFA 4F0GA 5K5XA 1OIRA 4CFNA 3NYOA 3LFFA 3L8VA 3P4KA 3GGFA 2W06A 2C6OA 3KQ7A 2YZAA 4A9SA 4YJTA 2BZJA 1OVEA 1L8TA 5CU6A 1DM2A 2YM3A 3GFWA 5DN3A 1Q99A 4LRMA 5FG8A 5C27A 2QOCA 5LMBA 1Q62A 2WOTA 1Q61A 1CKIA 4WG4A 3IW6A 2Z7LA 4PL3A 4RIWB 4MXCA 2H96A 3AG9A 1P14A 3UC4A 3QL8A 4GKHA 4WNKA 4XNEA 3QRTA 3EN4A 3UG2A 1IA8A 3EJ1A 3O96A 3ZC5A 4AWIA 1OL6A 2J0KA 2RKUA 3OUKA 2PL0A 3HYHA 2GU8A 4MXXA 4RFMA 4V0GA 4A9RA 4EH7A 4JJRA 2FVDA 3TTJA 2CNVA 2XVDA 3DNEA 5L2IA 3DAJA 4UEUA 5J9ZA 1KE5A 2JDOA 3P1AA 3R71A 4Z3VA 4NM0A 3W16A 4X2GA 2O0UA 4DH7A 3NVKI 4X6RA 4IB0A 4KKGA 4QYFA 5JFVA 3QZHA 1ZOEA 3QTQA 4Q5HA 4Y83A 4YHTA 1JKLA 3SOCA 1OUYA 4Q9ZA 2YM6A 4GJ2A 1UNLA 4O81A 3UOLA 3NGAA 1PXOA 1YOMA 3SW4A 5CEOA 3UZTA 1Q41A 3R30A 1JKTA 2VTPA 2LGCA 3GOPA 3TCPA 3Q32A 2YN8A 3F2AA 3HZTA 1R3CA 5EKOA 4BDFA 2QLQA 3Q04A 1YXXA 3S0OA 3F7ZA 2E9NA 5HG9A 2OIDA 4HOKA 3AD4A 5EYMA 1R1WA 5FD2A 2P2IA 3LW0A 2EXCX 4JT3A 4LG4A 5AV0A 2BFYA 3PIZA 3A4PA 4ZP5A 5HE3A 5CAPA 3QGWA 5I5ZA 2ZM3A 4IQ6A 4L68A 5AV4A 3L8PA 4FOBA 5CEMA 5FRIA 3U9CA 4C4IA 4U3ZA 4AW0A 3GQIA 4DINA 3QAME 5TR6A 4XG2A 3IOPA 4ALUA 1L3RE 3G9LX 5E8YA 4O7TA 4XMOA 3G15A 5E8XA 4E5WA 4FUXA 4IWQA 1ERKA 2UZTA 2OIBA 5AUXA 3FC1X 4TW9A 3PZEA 1VEBA 3PWDA 4NFMA 3TUDA 3U87A 4RVTA 4PY1A 5ETAA 1WBPA 3UTOA 5AFVA 2UW3A 1RQQA 2XJ0A 3A7HA 4O0WA 4O7LA 3LLTA 5AP2A 2JC6A 3ERKA 1PMNA 2UVYA 4G3FA 3KKVA 2EWAA 4XH6A 3BL9A 4CLIA 5J5SA 5JQ8A 3O2MA 4CFWA 3NYNA 3AGLA 5AA9A 3HLLA 2OJJA 2E9PA 3E87A 3R6XA 3HV4A 5BUIA 2FH9A 2XK4A 3VHKA 4C4GA 3QU0A 4QMUA 1ZLTA 5AX9A 3H3CA 4N6YA 3TNHA 3NW7A 3FI2A 3QTWA 3UMWA 4G3DA 4G6OA 3LHJA 3M11A 2ZVAA 4KUJA 3E8DA 5DR2A 4HJOA 4ZS0A 3MVMA 3U6HA 3UYSA 3KXHA 4DA5A 5JN2A 2RF9A 1XBBA 3VULA 3CS9A 4ASZA 3UIMA 2XIRA 3AC3A 4QMZA 4U0IA 2UZLA 2IN6A 2RFEA 3OD6X 4WKQA 5EOLA 4DFLA 2DUVA 3MFUA 2C1BA 4FYOA 3NRMA 2BRGA 3FZPA 4OR5A 5HIBA 4X2KA 2VWBA 3FPQA 1Y6BA 5AP4A 4RIYA 2FSLX 3FMNA 4LUEA 4XS2A 5KMMA 3UOHA 3R0TA 4O7OA 5F4NA 4MVFA 3DKGA 5CU4A 5H3QA 4EQCA 5HICA 4EK5A 3LMHA 5JSMA 3ZTXA 3FI8A 2PU8A 2WTKB 3F2RA 4BTKA 4LGHA 3BELA 5BVDA 2W4OA 1ZYCA 1MRYA 3DBEA 5FTGA 1H1QA 1PXJA 3OBGA 5LWMA 4DCAA 1DAWA 2C6MA 5HNBA 3LFEA 5KHXA 5BYLA 2BRHA 3U6IA 3L1SA 4ZLZA 3F2NA 3U9NA 4CCBA 2I7QA 2GS2A 2J9MA 5DGZA 5LVOA 4JQ7A 1QPCA 1QL6A 4YZBA 3ZHPC 3DQWA 4YHJA 3KN6A 3BLHA 4IZYA 5CSWA 2J4ZA 3CXWA 3OS3A 2CKQA 4L44A 3HAVA 3WIGA 1QPEA 1TFFA 2J51A 1YHVA 2BDFA 2WQOA 1UWJA 2GFSA 3I7CA 4G3GA 4ORKA 3GCSA 4IEBA 5IDPA 2C5NA 3FYJX 3W2PA 3V8SA 1YI6A 3FBVA 4BYIA 4FSQA 3PJ8A 4O0TA 4UYNA 3EQDA 5C8MA 3R1QA 1BL6A 3WE8A 5LMKA 2OJ9A 1CKJA 3LFQA 4JR3A 4QP2A 4DGOA 2FYSA 3O23A 5FXRA 3UVPA 2ITYA 3G2FA 1AGWA 3AMYA 5CENA 1UA2A 3UG1A 4C7TA 4X3FB 2ZV7A 2X2KA 3LFBA 4UB7A 3ZONA 4A06A 5CAQA 3BQCA 1Z9XA 4AXAA 3HDMA 3VBYA 4C4EA 5A4TA 1YRPA 3O5AA 3WZJA 3GFEA 5GJDA 5DRDA 5EOBA 2QOBA 2PVFA 3ALOA 4YZMA 5CEQA 3VS2A 2LAVA 1FGKA 1OMWA 4AE6A 3CP9A 4BCJA 2YJSA 5I0BA 4Q9SA 4KBCA 3S3IA 4GG5A 4FSWA 1ZZLA 3OY3A 3QRIA 2VTSA 2ZV2A 5H9BA 2QVSE 3UODA 1YW2A 4C02A 4L7SA 4S34A 4FA2A 2GS6A 3ZRMA 4U5JA 1JAMA 3WARA 4AP7A 3VF9A 3KXNA 3LJ2A 5HIEA 2JFLA 3ORNA 3EQGA 5D10A 1UNHA 3ZLSA 5A4LA 3K5UA 5E9EA 4DE4A 3MY0A 4R1VA 3BHHA 3DAEA 1Q8TA 3RVGA 2C5XA 4Q5EA 4XCUA 4MWHA 4P7EA 4GK2A 4TXCA 4V0GB 3MA6A 2IVVA 1GAGA 2PE0A 2WTKC 4U8ZA 4U80A 2XNOA 4EBWA 2W1CA 1OITA 2QG7A 4CGAA 4FT9A 4EOQA 4C3RA 3V5PA 2C0TA 4D55A 4V04A 3BGZA 4YR8A 5A54A 3GCQA 2Y8OA 4FOCA 5IA2A 3W0QA 2WB8A 2AEGA 4ZXTA 5IQIA 4AUAA 4IANA 2AC5A 2XP2A 3LFCA 1WFCA 5E92A 2YCFA 5AUWA 3UDSA 4E6CA 3AKLA 3FMLA 2XM8A 4O7WA 3MN3A 3G6GA 2XNMA 2PUUA 4TYGA 5HTBA 3I0OA 2Y9QA 2X9EA 1FVRA 3QTRA 4OT6A 5B2MA 3ROYA 3PXZA 2VO6A 2WNTA 4X2FA 4BJJA 2HZ4A 4F4PA 4XP2A 3R1NA 3KEXA 3F3VA 2W4JA 1REKA 3F6XA 3LCOA 3Q9XA 4JDHA 4PNKA 1QPDA 2Y7JA 2QU6A 2PUPA 4W4WA 2JFMA 3L8XA 4MXAA 4RJ5A 4FSZA 3TJDA 1H26A 4LOOA 4DEGA 3RMFA 1M7NA 2GNHA 4ZSJA 3NCZA 1UV5A 3O51A 2DQ7X 2ZJWA 4OW8A 4AZWA 2B54A 3QZFA 3DA6A 5JZJA 2J2IB 2OH0E 5HVYA 4ZSLA 3IPHA 3BL7A 4IAYA 4EK8A 4M14A 4X3FC 3LFAA 3PRIA 4FIFA 4MNEA 4DLJA 3FSKA 2PVLA 1PHKA 4FTNA 3RZBA 4KIQA 3O8TA 4JR7A 4C2VA 3PE1A 2XKCA 1Q8YA 3EL7A 3GU7A 4AW1A 3BKBA 3MDYA 2WMAA 5FP6A 1O9UA 2XJ1A 3CR0A 2VTQA 1URWA 1P4OA 4CFXA 4OBQA 4BIEA 4A4OA 4G5PA 5DPVA 4ZTNA 3Q6UA 4RFYA 2F9GA 4FBXA 4ZTRA 1YOLA 2B53A 1XH9A 3BHYA 2GNLA 2ERKA 3GU6A 1ZY4A 4O7PA 4DTBA 3BV2A 1JOWB 3BV3A 3IW7A 4N70A 5CTPA 4FKOA 1NVRA 1OM1A 2QG5A 3RM6A 4ACDA 2XKEA 1YI4A 3P79A 4Z55A 4F09A 4FVQA 4H3PA 3RINA 4ENXA 2C68A 5B2KA 3ZM9A 1H0VA 1TVOA 4CTBA 3H4JA 5HD7A 4PMTA 4PX6A 4QP1A 3L8SA 4RJ4A 2O3PA 3PYYA 4MCVA 3RKBA 2G01A 4ZS4A 2CLQA 4RG0A 3WF5A 4DFYA 5K4JA 2JGZA 2GSFA 3FHIA 5JFXA 3UDZA 3T9TA 4TWNA 3COMA 1YOJA 1WBSA 4MTAA 4BDAA 3UQFA 3AC4A 1YKRA 2X4FA 4LFIA 4MH7A 3ZLYA 5FTQA 3V5LA 3VONA 1H24A 4RIYB 3C1XA 5CU3A 1ZMVA 2B9JA 2R3RA 3OTVA 4WIHA 5HEZA 4RVLA 4E26A 1GZNA 2UZVA 4BR3A 4RQKA 4AN3A 1APME 3DKFA 3OWPA 3FLNC 3FLZA 4RZVA 3UP2A 2E9UA 2YABA 4R7BA 1BI8A 5DVRA 4D9TA 4EC8A 2PUNA 4EK4A 2PE2A 3NUAA 4QPSA 4XG3A 1CDKA 3IOKA 3PFQA 3PPKA 3KCFA 4PDYA 3DK6A 3W2CA 4AN9A 2PVJA 3OEZA 4R78A 1U54A 3R8LA 4BDHA 4MXOA 2C47A 4N0SA 2IPXA 4JMQA 4DH3A 4BRXA 3R9RA 4GEOA 4F6WA 3VIDA 2R3FA 4X7QA 3R7IA 3S2PA 3TNWA 5EI2A 3W2QA 4N4SA 4CRLA 2J5EA 5HKMA 5A46A 4WUNA 4D5KA 4JQ8A 3R7OA 4MUQA 4NZWB 3S4QA 4AOIA 3NYXA 2B55A 2WHBA 1M2RA 2WEVA 3FMKA 5CQUA 4C4FA 3ORLA 3R22A 1NA7A 3TWJA 3A7GA 3QC4A 5D9HA 5E7RA 3ZO4A 4BDIA 4WNOA 3MH2A 4FT0A 4O27B 1Y8GA 5E91A 3LMGA 1H28A 4NTSA 4XRJA 4I4FA 3GBZA 4UY9A 5BYYA 2ZM4A 4FI1A 1I44A 3DV3A 1ATPE 3DJ5A 4KIPA 3AQVA 4EOJA 4WT6A 3RTPA 4QRCA 4YZCA 3D0EA 3G33A 2F57A 3MPMA 2OZOA 3OEFX 3OZ6A 3PE2A 2UZNA 2PVYA 4GFMA 5EW9A 1T45A 3QQFA 4XG7A 4BC6A 1OI9A 3ODZX 4I5CA 2W1GA 4Y46A 4NM3A 2YM4A 5ANGA 5IQFA 5I9YA 3HX4A 5HE2A 3R28A 2YWVA 2HY0A 2SRCA 2VU3A 5A4EA 4K2RA 1M2PA 1YXSA 2A19B 5I9UA 2C3IB 1E9HA 2PHKA 3P7CA 1U4DA 2W1EA 4MQ1A 2GS7A 1YVJA 1JBPE 3R9NA 2VTAA 1GNGA 3W0OA 4B6LA 3LCDA 5FDPA 3AC5A 5CZIA 1HCKA 3ID6C 4AW2A 4D58A 4JQEA 2XAMA 3AT2A 3PUPA 4BICA 2QU5A 3EQHA 4QP9A 1U5QA 2O64A 4ANQA 3FMMA 3ULIA 2E2BA 5FLFA 5IQEA 1XH4A 2JDTA 1REJA 3NMUF 3PVGA 3QA0A 4GT3A 3HV3A 1RE8A 4IHPA 3MB6A 1H8FA 4K18A 5TKDA 4F7SA 3UIXA 2IZSA 5GIPE 4CFUA 1PXNA 3LPBA 4I0RA 4RJ3A 4KRDA 4ZZNA 3KXZA 4KNBA 3D7TA 2XALA 4YJNA 4E5AX 2E9VA 3FKOA 3K2LA 2ZB0A 3ZCLA 4RMZA 4FTAA 2X2LA 2ZDUA 2V55A 2W9FB 3PPZA 3IDBA 4U9AA 1OGUA 4GVJA 2XK6A 5KMNA 4L7FA 3KA0A 5L3AA 4GYGA 4B9DA 3COKA 3HNGA 4ZLYA 3UNZA 3O8PA 4RT7A 2YZLA 3NZ0A 3RCJA 2BHEA 2WPAA 4V05A 1GZOA 4DHFA 3ATTA 1OKZA 1IG1A 5AWMA 2ITTA 5GNKA 4BTJA 3P5JC 3QQGA 4IM2A 3SW7A 4ZY4A 4U44A 4DGNA 2RFDA 3D15A 1NY3A 2ITZA 3R7YA 3D9VA 4J8MA 4BJJB 1J7IA 4BZNA 2ETRA 5HIDA 3U8WA 3F5GA 3GCPA 3P86A 4JIKA 4R3PA 4IZ5A 4FYNA 1H01A 1FINA 2X8EA 4DDGA 5LMKC 3CQUA 4GIHA 1Y8YA 2XANA 3EQRA 3PXQA 4R7IA 4DEDA 4AOTA 4RX5A 1Q3DA 4YO4A 2QOKA 5KO1A 4FMQA 3TXOA 3MY1A 3MFSA 2EVAA 1Z57A 3BLQA 4IVCA 3ZDIA 3ZFYA 4C4JA 3OCBA 4RGJA 4AAYA 4BZDA 4H39A 3I5NA 4MNEB 3BX5A 3HMMA 3DB8A 4CNHA 3PZHA 3FLQA 5CT7A 2XH5A 5LVLA 4G9RA 3RJCA 4FTUA 3KY2A 4FV5A 4WG5A 3CY3A 5ANOA 1VR2A 1JKSA 4GVAA 3SRVB 3KULA 3HMNA 3C7QA 5IQAA 3C5IA 4FJVA 2UZUE 3UZPA 5LARA 4LV8A 2OU7A 2W5HA 3PUFC 4U6RA 4AA4A 4C62A 2WTWA 3QHWA 3A60A 4E7WA 3ZXZA 4W4YA 4BF2A 4QTAA 4AZEA 5IDNA 1IASA 1Z5MA 3VJNA 1XR1A 3LAUA 5IA1A 2V62A 2YEXA 4MBJA 4ANMA 4AXDA 2PK9A 3PXKA 2PMOX 5HCXA 4B4LA 2QODA 3ZDUA 2R3HA 3BE2A 4IZAA 1MUOA 4YZDA 2XS0A 1OIUA 2QQ7A 1GY3A 5BMMA 2FSTX 4N6ZA 2I0VA 3CKXA 4QO9A 4RWLA 4AXFA 2QOIA 3BU3A 4C0TA 4JI9A 3EKNA 2PULA 1WAKA 4HCUA 4I24A 2WQMA 5CS6A 2V7AA 5F20A 3PFYA 1RDQE 4R6VA 3SVVA 3C4FA 4QDVA 4QMNA 2BDJA 5HE1A 4CVAA 5AV2A 5ITAA 2OSCA 3P7AA 3D7ZA 3E93A 4PL4A 5CF6A 3KVXA 5KMLA 4W4XA 3IKAA 3OW4A 3WILA 5ANKA 3I81A 2NNWB 4TZRA 3MBLA 2I6LA 2CMWA 4X3JA 4L46A 2R3QA 3LM5A 3LOKA 4OBPA 2ESMA 3O0GA 3VUDA 4EOPA 4EH3A 3T9IA 3E8NA 4FV4A 3QXOA 3D5VA 3MH1A 4RPVA 5AM6A 2CSNA 3CJGA 3QTZA 3QWJA 4XHKB 4XRLA 5DEYA 3RPYA 4O2PA 2CCIA 3W0MA 3KRJA 3LFSA 3QX2A 4D2SA 5J87A 3LXPA 5IQBA 1H08A 2PY3A 4AT3A 4BBEA 1U54B 3II5A 4CRSA 4HGSA 3TTIA 5JGAA 4PV0A 4MAOA 3EYGA 3MA3A 4E4XA 3GXLA 4LRKA 3BHVA 5FTOA 3ZC6A 3DBQA 1Q8UA 3GCVA 4FTTA 5FQDC 4L00A 4QMLA 4HNFA 2A2AA 4FIJA 3B2TA 4FEQA 4QQCA 2Q0BA 5DRBA 5M44A 4GUBA 4CFFA 5HG7A 1M7QA 3CTJA 3THBA 5JGDA 4UALA 3D5XA 3UBDA 2IVSA 4WD5A 3OT3A 1Q8ZA 4AAAA 3GU8A 4BBMA 5CF4A 5HBEA 2IZRA 4TYIA 2X9FA 3AC8A 3LIJA 3F3WA 4IAKA 4MNFA 3ZEWA 1DS5A 3F5UA 4BHZA 5EDPA 1Y91A 2EU9A 3DU8A 1W98A 3KRWA 4BB4A 2PYWA 2WZJA 2XAOA 2WTCA 4YBKA 3W8QA 2JLDA 3VUMA 4TL0A 4FL1A 4BGHA 3MV5A 3FKNA 3BYUA 2PUIA 4FTIA 4IACA 3I4BA 3GI3A 3W10A 5IU2A 3DPKA 3EFWA 4ASEA 4RIXA 4IAFA 4WZYA 5CAVA 1AD5A 1UWHA 2BAKA 4IX4A 3FZOA 4F7LA 4F6SA 4BCNA 4FSMA 1P2AA 3MW1A 3ZH8A 3UMXA 2XJ2A 3EN7A 3M2WA 5E8TA 3U54A 4E6QA 4EHEA 2W96B 1XH6A 3HRBA 3TZ7A 4LL5A 4QMSA 4YJVA 4D1XA 4IH8A 1PW2A 5AV3A 2R2PA 3DB6A 5L6WL 1GOLA 1ND4A 4Z7HA 5C4LA 2KULA 4E6AA 4BDDA 2CHLA 1K2PA 3QYZA 3I79A 3TZ9A 4YNEA 5CWZA 3VS5A 4BVUA 1LR4A 2WD1A 3F82A 3GNIB 3ACJA 3LXNA 4FV2A 2YDIA 2YIRA 3D7TB 3RNIA 2XARA 2V0DA 4NKSA 4UYAA 1CTPE 5M07A 3VO3A 4JOAA 4FV3A 4EYMA 2JKKA 4ACGA 3UO5A 2DYLA 4F99A 2QCSA 2UW4A 5CF5A 1A48A 3MPTA 4FC0A 4GSBA 2QOHA 2R0UA 4FTQA 1W7HA 3HECA 4BKJA 1OPJA 4FKUA 2IVUA 4IFGA 5KX8A 3OFMA 2G1TA 2R3IA 3DLZA 3C13A 5IF1A 5KZ0A 3EQCA 4HGTA 5IA5A 3QKKA 3SV0A 4AE9A 3MTFA 2R3KA 5EKNA 2VWZA 2REIA 3HL7A 2WFYA 4TRLA 4DF3A 3N4TA 3CTHA 3A7IA 3G5DA 5DT0A 3SG9A 2F2CB 4FR4A 4QOXA 5EDQA 3ZYAA 5I4NA 4P4CA 1JWHA 1ZYSA 4M13A 4O0SA 3SAYA 4CV9A 4YUQA 1XBCA 5A14A 4TYHA 2OFVA 4TTHB 2B0QA 3BIZA 4NU1A 5IH4A 4BI0A 2FA2A 3ZM4A 4F63A 4QPAA 3EQIA 3MPAA 3L9MA 1OZ1A 2ITQA 3OXIA 3BI6A 4H3BA 3NAXA 4J8NA 3ZLWA 4EQMA 2B1PA 4NSTA 5DG5A 5KMIA 2RG5A 2R64A 2JIUA 4PQNA 4K8AA 2J5FA 4RX8A 5EI6A 3SXRA 5LCKA 3Q4ZA 4RJ6A 2XM9A 4EBVA 2W4KA 2GNFA 2G15A 4QMYA 3ETAA 3FUPA 2HXLA 2YJRA 1H1SA 4D1ZA 3SC1A 2XBJA 2RIOA 3VAPA 4H36A 4KSPA 2J0LA 3ANRA 3KULB 3VC4A 1NVQA 1KV2A 3NLBA 3W0PA 2P0CA 3FLSA 3NNVA 4GIIA 1XKKA 2HAKA 3Q4UA 4EZ3A 4AOJA 5KMKA 1ZMWA 3WF8A 2IG7A 2O5KA 3VS0A 2ZV9A 4DT9A 2QR8A 5J95A 1TQMA 2HY81 5HCZA 4BDBA 3K3IA 1OGYA 4MBLA 2VWVA 1IAHA 5KNJA 3R1YA 4IWOA 2VX0A 1XBAA 1CM8A 4M0YA 5K9IA 3F7WA 2XBAA 4JBQA 3C0IA 3OHTA 3PVWA 4PDSA 4XLVA 5KZIA 4DHZA 4DH1A 3MIYA 3PA4A 4G2FA 4J7BA 3T3VA 4M97A 4U94A 4FV7A 2CCHA 3K54A 4FT5A 2Y0AA 2QR7A 3O50A 4G16A 5AEPA 1SVGA 3GP0A 4U42A 4ANLA 4J96A 3LE6A 2XYNA 4YPSA 2OXYA 3NFFB 1KSWA 2OK1A 5IH5A 2X6EA 3DJ7A 3BYMA 3FEGA 3ANQA 3FE3A 4FSTA 4O82A 3NIEA 3RK5A 1G8SA 4F78A 2WMXA 3P08A 2F7XE 4NYEA 1YQJA 2GPHA 3QD0A 1ZARA 3NWWA 1Q4LA 2CGWA 4PTEA 2P2HA 3QZIA 4FEWA 4GFGA 1M52A 2OZAA 2XNEA 3AOXA 4CMUA 4S32A 4W4VA 5LMAA 4R3CA 2JAVA 5M55A 3TJCA 1ZOHA 2ITXA 3QTXA 2GQSA 2YDJA 3SQQA 2QKRA 2OFUA 5ACKA 2OWBA 5CF8A 4MBIA 5BV3A 4I5PA 4I0TA 4XBUA 1OKVA 4DG3E 3QUPA 4UBAA 5JEBA 3TUCA 2X7GA 3EB0A 2WQBA 3KFAA 3BQRA 4OGRA 4XV3A 2W1DA 2W1FA 4UWCA 2CLXA 2YIXA 1LEWA 2C3LA 2WU6A 1VJYA 3I7BA 2GDOA 3MVHA 4GT4A 4MD9E 4FSUA 4IM0A 1V0BA 5M56A 4UX9A 5L8LA 5ANDA 1W83A 3PY3A 4EI4A 1JNKA 4MEDA 4QTEA 4I1ZA 2FSOX 4JS8A 4O22A 2F49A 5CXHA 2W05A 3UIBA 4BCGA 4CT1A 4DT8A 2X8DA 2PVRA 3F88A 2PVNA 3ORKA 4CD0A 3I6UA 3GU4A 4FV6A 3MJ2A 2UV2A 5TT7A 3PJ2A 4P5ZA 4U81A 3ZFMA 2VTHA 2XIKA 3A8WA 5LCJA 3F66A 3H0ZA 5CSXA 4DAWA 5FEQA 2UZBA 4ARKA 4BTFA 4BYJA 5AADA 2GTNA 2J50A 2F7ZE 3MS9A 1J7LA 2OGVA 2JAMA 2OO8X 4RIXB 4KD1A 3KB7A 4RLLA 3C4EA 4D2RA 5HLWA 1JKKA 2C6TA 5D7VA 3EFLA 4K0YA 5HCYA 2G2FA 2GQRA 4X21A 1G8JA 3F3TA 4CG8A 4QQ5A 4IB3A 2JD5A 5M4FA 4E4MA 4AA0A 3PTGA 5LOHA 4G34A 3FLWA 5BVNA 3NPCA 2UVXA 3KMUA 2HELA 3FLYA 4I21A 5C01A 2VO0A 5C8NA 1O6LA 4GL9A 5EQPA 3HA8A 4O0UA 4G1WA 4QMOA 4YJSA 4F9CA 2WMVA 3NDMA 1J3HA 4H05A 2HWOA 3QQJA 2B7AA 4JDJA 4E20A 3BPRA 1KE8A 3W2SA 4HVGA 3KF4A 5E8UA 4MKCA 2CGXA 3NFGB 5AUZA 3FXZA 3VS1A 4AFEA 3QD3A 3ORTA 1XHAA 5DHJA 2ZMDA 1H0WA 1SM2A 4EOKA 1B6CB 5G6VA 4J1RA 3NS9A 4IC8A 4F0FA 4FKIA 4FODA 2BCJA 4FTJA 1K3AA 1YHSA 4GH2A 1F3MC 5CEPA 5ANIA 3MJ1A 5AUYA 3UE4A 4NW6A 1KE9A 4M84A 2QHMA 3JY0A 4X2JA 4HVSA 4KS7A 4QYGA 4FV8A 4FTMA 1PXLA 5AAEA 5IZFA 1IA9A 3HP2A 4LDTA 4O6LA 4IX5A 2PZRA