3SGCA

Crystal structure of apo aminoglycoside-2''-phosphotransferase type iva
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
b'MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Crystal Structures of Antibiotic-Bound Complexes of Aminoglycoside 2''-Phosphotransferase IVa Highlight the Diversity in Substrate Binding Modes among Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 95
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sgcA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3sgcA02
2BDJA 4B8MA 4BY9E 3NGAA 3EFJA 4XMOA 5E90A 1H1PA 4C4IA 4R1YA 5HCXA 3ORIA 3QBNA 3RK9A 3W33A 5KMJA 5IMEA 1Q8WA 3RK5A 1W0XC 3W16A 4MHAA 4K77A 3UNZA 2BAQA 2JEDA 4CMTA 4CRLA 5BUEA 4AT5A 1YKRA 2FGIA 2OJJA 3D7TA 4NU1A 3NZ0A 2ZV2A 4I21A 3CC6A 5J95A 4OTRA 2X2MA 4I5HA 3UYSA 5AUZA 1PJKA 3EHAA 1PW2A 3QRJA 5JQ5A 2EWAA 3L8SA 4FVQA 5HNBA 2EXCX 4ZOGA 3UVQA 4GYIA 5EDRA 5LOHA 4RLLA 1I44A 4V0GA 4TYHA 5JRQA 4FA2A 5AAEA 2QU5A 3HMNA 1G5SA 2JDVA 3ZUUA 4PL5A 3EZRA 4CT2A 3RMFA 1BYGA 3SA0A 4O2PA 4Y95A 3OHTA 3VVHA 2BILB 5FM3A 5HLPA 2HOGA 3FV8A 1WZYA 1PXNA 1M2PA 3A7GA 5HIBA 3ZM4A 4EH2A 4G3GA 5E8SA 5I9ZA 3EN5A 4FBXA 1YWNA 3ZDIA 1PMVA 3W2PA 4O0VA 3KXXA 2X8IA 4A9YA 3FL5A 4NM7A 5CY3A 4YSJA 3KN5A 5L8JA 4PRJA 3RKBA 3E8NA 4IACA 2X8EA 1PMUA 4YTHA 4GW8A 1SNUA 1OVEA 4WNMA 2XP2A 5GHVA 5CSPA 3QUEA 3PFQA 1OIQA 3MWUA 3QQJA 4ZTLA 5BVEA 2C3LA 2ERZE 5IA0A 3QHWA 4D9UA 4EK8A 4RSSA 5FP5A 4ZS4A 1QPJA 3DXNA 3G15A 4WD5A 3BQCA 3ET7A 4J7BA 1O6KA 2PVLA 3D2IA 2B9IA 5ETAA 5BQ0A 2XJ0A 4MXZA 3TG1A 5E8WA 2W4OA 3O51A 4ID7A 5CF4A 3DDPA 4DCEA 5HCZA 2CNQA 5M08A 4OT6A 3KVWA 4GG7A 4TN6A 1FPUA 3RPYA 2XK9A 4L7FA 2EXMA 3UQGA 2BIYA 4JG7A 4YPDA 4PWNA 4K33A 5DFPA 4D9TA 2A2AA 3Q9ZA 3C0GA 4BIDA 4I93A 3KRLA 4QP2A 2LGCA 4UYAA 4Y73A 5AUUA 4U94A 3MTLA 4E5BA 2WHBA 2BCJA 1QCFA 2OIQA 2RGPA 4EC8A 2XIXA 2RIOA 5AIKA 3TIZA 4G5PA 3KKVA 1ZWSA 3FLZA 2WOTA 3SHEA 3NAXA 5CU2A 1H01A 3ULIA 2CMWA 3DB6A 2NO3A 3FWQA 5F94A 5M57A 4L7SA 2WEIA 1FVRA 4GG5A 5E1EA 1Q61A 1RE8A 3EYGA 4NTTA 4FV3A 1OPJA 3G9NA 1H1QA 3ZDUA 4E1ZA 5K5XA 4JG6A 3OWJA 4GVAA 1H0VA 2ITNA 3FHRA 5HTCA 1IA8A 2C6OA 2WTIA 2XZSA 3POZA 4U43A 4QMQA 3W8LA 1BX6A 4XV2A 1PXIA 1QMZA 3DQWA 3O96A 4OGRA 3F7ZA 4ZJIA 3Q04A 5EQYA 5A4LA 1UNGA 3MN3A 3RTPA 2R64A 4TTHB 3DAEA 1A48A 4RA5A 3R1SA 5IA3A 3HAVA 4E4NA 2A27A 2R3PA 3LZBA 4DE4A 4HVHA 4KA3A 1URWA 4DEEA 2HAKA 3MIAA 1KE9A 4KKHA 4ZSJA 4OBPA 4XG2A 4EI4A 1YDSE 4FKPA 3FMHA 5EOBA 3EYHA 3KCKA 4FVRA 4F7LA 4XJ0A 3LCSA 3NYNA 4IZYA 4RJ5A 4DGOA 4S32A 2NNWB 2WMRA 3QU0A 3CJFA 3R1YA 2VTOA 2GS6A 4EUTA 4WG5A 5IUHA 4IM3A 3QC4A 4GK4A 2P0CA 1R0PA 4KB8A 5DR9A 4O7PA 4CFVA 2WMWA 3JYAA 4EKLA 2OW3A 1H1WA 1KE6A 4BGGA 4FKIA 3NIEA 4BIEA 4FTOA 4IX5A 3AMYA 4CEGA 2OH0E 2WAJA 2Y4IB 3ROCA 3R83A 2B9JA 4C36A 4QMXA 4NJDA 3ELJA 5FTQA 4N0SA 3FZOA 2WMBA 3QYZA 4QTDA 1JSUA 3ZLYA 3K3JA 5FQDC 5HG7A 4LV5A 2Z02A 4IFGA 4CFXA 3VBXA 3F2NA 3FUPA 4E6DA 3S4QA 4FC0A 5GJGA 3QQGA 3TIYA 3ZFYA 4BI2A 3C0HA 4K8AA 2B4SB 4GFMA 3FQHA 4MQ2A 3BBTB 5DLSA 5EM6A 4CGAA 4FX3A 3TZ7A 5C9CA 4O22A 5AADA 1IAHA 2WGJA 3R9NA 4C2WA 4XG4A 2X2KA 2JKKA 3W10A 3P7AA 2EB2A 3C4EA 3MPAA 4DFYA 5BVDA 1GNGA 1J7UA 2F2CB 1FGIA 1UU3A 3OOGA 4JX7A 2XRWA 4FEXA 3U55A 2ETKA 4QMUA 3NEWA 3V5PA 3PXKA 3T9IA 3HDNA 3HV3A 4QPAA 4FGBA 2QNJA 4EK6A 5BYLA 3RCJA 3RNIA 4ZTHA 4ANBA 3Q4TA 3LCOA 4IX4A 4NUSA 4C4FA 2FSMX 4ALVA 3TDWA 1TKIA 4D0WA 2WD1A 2W1ZA 3IK3A 4NH1A 2O64A 5LVOA 4C3PA 2C5XA 5AMNA 3ETAA 3LM5A 3PIYA 4ZXTA 5ACKA 3ZHPC 4EKKA 2YAKA 4DAWA 3LQ5A 4G1WA 2X7GA 4JG8A 4X3FB 2XKFA 4FMQA 3BX5A 4P90A 3ZUVA 3HVCA 4ZJJA 3S00A 2JAVA 5CQWA 1A9UA 2ZDTA 3ZO1A 1H26A 2JFLA 3U8WA 2X9FA 1JKTA 5CF5A 4J71A 2J50A 5EYCA 3GBZA 2XYUA 4ZTSA 4Z55A 5L2IA 4O86A 5LCKA 5AA9A 2ZYBA 3D5VA 4IX6A 5CXZA 5KKRC 3TWJA 4PP7A 4AQCA 2C5YA 1Q3DA 4QYFA 4DN5A 5TR6A 5EI2A 1SNXA 2PZYA 3I5ZA 4FSQA 2VTSA 4U7ZA 5TO8A 5DYJA 2XVDA 2QURA 1AQ1A 2NRUA 3UIBA 4L3JA 4I23A 3B8QA 3UOLA 1YXUA 2OIDA 3LQ8A 3EN4A 4AGDA 1ZOHA 4FEQA 1W8CA 3ZZWA 2OFVA 2XIZA 3IQ7A 3DKGA 4FSWA 3NNWA 4I0RA 4IM0A 1AGWA 3UO5A 4Y85A 4WZYA 3BWJA 5GIOE 3SX9A 3AC4A 3D14A 3M2WA 5IQGA 3NUXA 2XNPA 2ZM1A 3L9NA 3ATSA 4ENXA 2YA9A 2W4KA 2DQ7X 4S30A 5I5ZA 2PUPA 3OWKA 4GJ3A 3D7TB 4MD8E 3B2WA 3FI4A 1NVSA 4D1SA 3NW5A 1LP4A 3RZBA 3OP5A 4IJPA 2QO2A 2OK1A 5IISA 4PMTA 1X8BA 4JLCA 2W1EA 1RQQA 4E6AA 2BRHA 3CTJA 1I09A 3MJ2A 3CY2A 3PZHA 1FGKA 2UZBA 4FL1A 5ANEA 4DG0E 2FUMA 1U5QA 3PIXA 4EJ7A 4PDSA 5AV4A 2ZV9A 4LRJA 3TNHA 5E9EA 4E4LA 2X4FA 1Q41A 3TNWA 3WIGA 2OZAB 3PXRA 1JLUE 4V04A 3N4TA 4FKLA 3HA8A 4E4MA 1IEPA 1PXJA 4YMJA 4IDVA 4IADA 1Y91A 2E2BA 5HG5A 2ERKA 4IZAA 4GRBA 4HCVA 2CCHA 4IJ9A 3BRBA 4BCKA 2EUFB 4AOTA 5FEQA 2P3GX 3VS6A 4O83A 4D55A 3SOCA 2R3KA 3A8XA 4WG4A 5CEKA 1Y8GA 4FV4A 4ZMFA 3KC3A 3OT8A 3L9PA 4KBAA 3LHJA 3V5WA 1STCE 2IW6A 4GKHA 3O50A 4R7IA 2UZNA 3DFAA 4I4FA 4JX3A 4V05A 3QXOA 1HOWA 4R3PA 2HELA 3IOKA 4O0UA 4RT7A 3AT3A 3H9OA 5DT4A 4HVSA 4C3RA 4BYJA 3GU6A 4QP6A 3VRZA 4GT3A 4KRCA 4ZSGA 4KSPA 2UZUE 3V8SA 1SMHA 2HY0A 3Q9XA 2VO6A 3QWJA 2X81A 4WNPA 4EEVA 5IQFA 3LFCA 4L00A 5BYYA 4LRKA 3N51A 3PXFA 4IFCA 3S3IA 2J0JA 3ANQA 4I5PA 4O7ZA 3NS9A 4O91A 3LVPA 2R3QA 3HLLA 4JBQA 5LQFA 4MBIA 3AT2A 3VS7A 4C4JA 3R8VA 5CEQA 1YWRA 5JFVA 1XH8A 2XK4A 4IIRA 5ETIA 4NFNA 2PVJA 3C4CA 2PZPA 4I6QA 2DYLA 2YJSA 2YDIA 3DBQA 1ZYDA 2WTWA 3MVMA 3BV3A 3OBGA 4YSMA 2V55A 2UZWE 4DYMA 1M14A 5CAOA 2FSLX 4DH1A 4CFUA 5DH3A 2YIRA 2CCIA 4UB7A 4E20A 1IG1A 3KXMA 3UMWA 4FKVA 4H58A 3VS1A 2ZAZA 4UWYA 4RJ6A 2BAKA 2F57A 3F3UA 2JDOA 3FKOA 5AP5A 2WB8A 2ITPA 2W5BA 4NW6A 3E62A 4APPA 1CKPA 4FICA 1WAKA 4YNOA 1NVQA 2R3FA 3RP9A 4ITHA 2VO7A 3ZXZA 4CKIA 4YO6A 3DJ7A 4YBJA 3OVVA 4H3PA 3FYKX 4RVTA 4TWNA 3C5IA 4BC6A 5ETCA 2PSQA 4AZTA 1GIJA 2JFMA 5EH0A 1ND4A 3U9CA 4IWPA 4AF3A 3BYOA 4QPSA 4BDEA 4TWPA 3GGFA 2B0QA 3EOCA 3L8VA 3VQUA 3O8PA 4FV5A 4BDCA 3PWYA 4FZ7A 3QKMA 4QQTA 3GFEA 2GHGA 4YU2A 5M09A 3R71A 2G2IA 3ENHA 2VTLA 4CMUA 3VNTA 3AMBA 4M8TA 4LQMA 1YOMA 4YTFA 4O0WA 3DBCA 4NL0A 1M7NA 4ITJA 3ZRMA 3PVGA 5HD4A 1J3HA 2PHKA 4ASZA 2ZM4A 1ZYCA 3KRJA 1JKKA 3P79A 1FBNA 4CVAA 3BE2A 3RPSA 3BI6A 2XCKA 4F70A 4XEYA 4ZSAA 4YLLA 1WBPA 3QLFA 1JWHA 4KS8A 3F6XA 4DH7A 4IB3A 5M07A 2HXQA 4F09A 4BZOA 4AN2A 2B9HA 4XP3A 4ZSLA 4G3DA 3HV4A 3IONA 3RAWA 5J5SA 1U54A 4D4RA 4M0ZA 4BDFA 1PYXA 2UZLA 4WNOA 3UZRA 3MY5A 4Z9LA 4D1ZA 2QVSE 4JL9A 2E9NA 5AA8A 4U98A 3OEZA 2XJ1A 3I6WA 4JIKA 5F20A 3MA6A 2QLUA 4LV8A 3PJCA 3SQQA 3QC9A 3E93A 3FYJX 4RC3A 3VHEA 4DGLC 2VTJA 2ZDUA 3LFFA 2ITVA 3QGYA 5IH4A 3BELA 4ZY4A 3T8OA 4A4LA 3WF9A 5JKGA 2C1AA 3TL8A 3ZC5A 4CCUA 2H9VA 4DG2E 2QOKA 2W06A 3ORPA 3WZKA 4OBQA 4JVGA 2GNGA 5H2UA 4E7WA 5M4UA 1WBSA 5J9YA 3G2FA 4FL3A 4PV0A 4MQ1A 2WIPA 1UWJA 4QYEA 5IUGA 4QP7A 3EQGA 1OECA 4WT6A 5FEEA 3GEQA 4J95A 2V0DA 5D12A 5A6NA 3HMMA 3KVXA 4I5CA 1BKXA 3E3BX 3HV5A 3UVRA 4U80A 3DK3A 4J97A 4UWBA 3KREA 5EDPA 2VO3A 4M15A 4JNWA 3ZO3A 4TWCA 1GOLA 4AAAA 3WZJA 4BKJA 3CKWA 5E7RA 1G3NA 3RK7A 2QO9A 2VNYA 3R7IA 3QL8A 4EQUA 3C1XA 3DXQA 1R0EA 2PVHA 3S1HA 2VD5A 5DPVA 2O8YA 4HOKA 3IDBA 5IQAA 4B0GA 5T3QA 3LJ0A 2IVTA 1P5EA 3FY2A 3S95A 4ENYA 3OCSA 3R8UA 4FEUA 4XG3A 5IZFA 4AGCA 2CLXA 4IBMA 3IECA 4D28A 4BN1A 5CXHA 4CT1A 1YXTA 1OPLA 1JPAA 4CTCA 4WBOA 4WOVA 4D4YA 5HICA 4FKUA 4QMLA 5H9BA 4U3ZA 5BX0A 5ANDA 4EH7A 5HHWA 3DNEA 4ITIA 5FTOA 3NX8A 3QRKA 4FNXA 1OIRA 3HX4A 1MRYA 3UJGA 2GTMA 1IAJA 1QPEA 4GVJA 4G9RA 2E9VA 2VTNA 4MNFA 3TZMA 1OPKA 2ITXA 2CGXA 2X1NA 4FE2A 3JY9A 4J98A 3BLHA 3R04A 5LMKC 4I3ZA 3UNKA 4FV2A 4V01A 3TNQB 4QQ5A 3DTCA 4WHZA 5M56A 3V01A 4AGUA 3CP9A 5HNIX 2QR8A 2P2HA 4OTWA 2C30A 4EYJA 4X2NA 4N4SA 4QP3A 3IOPA 5C26A 2XH5A 2C6TA 3OC1A 3AMAA 3QXPA 4FTAA 1MRUA 3O0GA 3PIZA 2R0IA 4KABA 4ZY5A 2VTIA 3P9JA 2C3JA 2R3HA 3W0SA 3QQUA 2C3KA 3LLTA 4FSNA 5CSWA 4I0TA 2HIWA 4FSRA 1REKA 5KMMA 1UNHA 3ZOSA 2JBPA 2QHNA 3QQHA 2QQ7A 3ZXTA 3A60A 4WUNA 4MXXA 4F08A 3HMIA 2XNBA 5CYIA 5A54A 2PZ5A 3EN6A 4C4HA 5ETFA 3G90X 3FLQA 1UV5A 4CKRA 1M2RA 4PNKA 3D5WA 4FTLA 3LCKA 4CLIA 3QHRA 1OM1A 3W2QA 4BDBA 1CMKE 3ROYA 5JGAA 3LFEA 3AC3A 4O7WA 2PK9A 3HZTA 4Q9ZA 3CQEA 3TACA 2XM8A 4FTUA 3OMVA 2YABA 3FL4A 3SOAA 2UW3A 3ZLWA 3MH1A 3QLGA 2QD9A 2J5EA 4GK3A 3SRVB 2QOFA 3MW1A 1K3AA 3ZCLA 2V7OA 3LXKA 4U45A 3FDNA 5G6VA 5M4FA 1ZARA 5LMKA 4JDJA 1Y57A 2YN8A 5LVNA 1Q8ZA 2QG7A 2WMXA 2WOUA 3TM0A 4W4XA 1NVRA 4RIYA 1QPDA 3UZTA 2Z7LA 2C1BA 4JIAA 5FBNC 4FI1A 1GIIA 2CLQA 1J91A 1MQ4A 2VO0A 3E8CA 3LM0A 3LKMA 4CCBA 5CANA 1PXLA 3AGMA 5F4NA 2V5QA 3BBWA 5FLFA 1FVVA 3QCQA 3BU3A 5IPJA 4RJ3A 2X4ZA 4DCAA 3OXTA 4MNEA 4B6LA 5A4QA 1IA9A 1XKKA 2BZIB 2PWLA 5ITAA 2WXVA 5M4CA 4RWLA 4O7NA 3FPQA 4DLJA 3QTIA 3GVUA 4X2KA 4DGGA 5HCYA 2QOLA 2YAAA 4EONA 2I6LA 2YCSA 4YZDA 4AX8A 3PUPA 2VTMA 4DFZE 4GT4A 3R7VA 3MTFA 5AWMA 1UA2A 5HLNA 2YM3A 3NR9A 3QA8A 2BPMA 4ERWA 3Q4CA 4S34A 2F9GA 3FMEA 4C61A 3F61A 2WO6A 4Z7GA 4QMYA 5HIEA 1M17A 2JIVA 4Y5QA 5L2TA 1OGUA 2A4LA 3CTHA 3NRMA 5DEWA 5FXQA 5I9YA 5KMNA 5HLWA 3BLRA 4GMYA 3QZGA 4BGHA 3BGPA 2RL5A 3ZONA 3PVUA 4NSTA 5GINE 5CEIA 2IPXA 4MXAA 3KA0A 3I79A 3O7LB 3NSZA 4MWIA 2ZB0A 4IVCA 3QKKA 3V3VA 3FZSA 5CAUA 3G9LX 4OUCA 4FIJA 4TNDA 3KXNA 4GU6A 5CASA 5L6OA 3ACJA 3GU4A 5J87A 2W05A 2H96A 3S2PA 3UE4A 4U97A 4EH4A 2VWIA 2OJIA 4NWMA 4IE9A 2YM4A 4QQJA 5D1JA 4IB5A 4PX6A 3U4UA 4BB4A 3IW6A 3FMDA 4MAOA 5HIDA 4A9UA 4G2FA 2WMTA 2OICA 3UIMA 1U5RA 3CEKA 1NXKA 3PVBA 1W83A 2UW9A 3JVSA 4LI5A 3QTRA 4YNEA 3V6SA 5M55A 3VIDA 3V51A 3QTWA 4L01A 3SAYA 2LAVA 2HZNA 4EOQA 5BUJA 1K2PA 3ALOA 3VUGA 5HQ0A 5C8KA 1ZY5A 1SYKA 3DY7A 3AGLA 4DTAA 3QQLA 4ONAA 4RQKA 3SW4A 5L6PA 1GJOA 1M52A 1U54B 1Y6BA 4I24A 4IAIA 3OUKA 4BCHA 3MB7A 2X9EA 4AA4A 1WVYA 2C0IA 2W7XA 4U79A 5EYKA 2JDSA 4ZK5A 3U4WA 3H4JA 4F0FA 3BGQA 2JIIA 2PL0A 3MDYA 4LMNA 4AE6A 2FA2A 5FM2A 5FDXA 2R7IA 3R1QA 1YI6A 4ZSEA 4C38A 4EOSA 3BIZA 3TUCA 4ARKA 2E9UA 1ZLTA 2O63A 4LG4A 3WE8A 4W4YA 3DAJA 3PJ1A 4EQCA 2PPQA 3MIYA 3DXPA 4R7HA 3P08A 3V5TA 5H8BA 3TV6A 2DWBA 4UWCA 4LOOA 1YWVA 1Q8UA 4FUXA 4F9WA 2BHHA 2KULA 4LGGA 1OL6A 3H0ZA 4L67A 3D5XA 5KMIA 2R5TA 3JS2A 4RVMA 4F0GA 5HZNA 4ZTRA 4RWKA 3W2CA 2XEZA 4K18A 4YBKA 3DK7A 3MH2A 3IW5A 3VULA 2UZTA 2BTSA 5HNGA 4X21A 3FY0A 4TYEA 3RHXA 3WF7A 4PTEA 4JS8A 3ANRA 4FSTA 2YDKA 1F0QA 4AOIA 2WMUA 2YCRA 1LR4A 2GNFA 2IZTA 3C4WA 4D2RA 3GP0A 3U6IA 3VWAA 2W0JA 1JBPE 4TXCA 1PKGA 2ESMA 3UNJA 3MFUA 3VUIA 1GIHA 3EFLA 5AP2A 4DFNA 3PJ8A 3W2OA 4DEDA 5IEYA 5AP0A 5LARA 2OKRA 3D7ZA 3MSSA 3HMPA 3VW6A 4OTQA 3CQWA 5IQDA 4FKRA 1CDKA 4XHKB 2R3NA 4Y72A 4C4GA 3CTQA 4WIHA 3ORXA 4PF4A 5FBOA 2PY3A 1O6LA 5LVLA 2CNVA 2J0MB 3ODZX 3V5JA 2EB3A 3COKA 3R02A 2W9FB 5IH6A 2BHEA 2XNOA 3TKHA 5IUIA 3BGZA 4ANLA 3UP2A 1S9IA 4GFOA 1SVHA 3PE1A 3C9WA 3W8QA 3KB7A 3B8RA 4X6QC 3EQIA 5AIRA 4FKOA 1B39A 4YUQA 4ZLYA 4D0XA 5C4KA 4U3YA 1R3CA 2VWZA 4I1ZA 4X2GA 3DAKA 4Y83A 3ERKA 1OUYA 3WI6A 3D5UA 4MH7A 3AT4A 4YJQA 2YEXA 1JOWB 1JSTA 4E6CA 5JH6A 4I6BA 4F9CA 4Z3VA 2AC3A 3OEFX 3D15A 2Q0NA 3DGKA 4M14A 2QCSA 4FKJA 4U5JA 4YJRA 4YC8A 4HNFA 1HCLA 2RKUA 4FNYA 1J1CA 3DKFA 4F9YA 3OWLA 4CLJA 3I0QA 3ORTA 3CR0A 5J8IA 3NUAA 3QYWA 2XS0A 2R3OA 2XNNA 3FHIA 3QRUA 3SC1A 2VAGA 3DQXA 4FK3A 3R8ZA 3FZTA 3M1SA 1MP8A 2E9OA 4ZZMA 4O7YA 2F4JA 5ANGA 4GUBA 2PUUA 1ZRZA 3F2AA 3GQLA 2BMCA 2V62A 2XMYA 3DV3A 3K5VA 2PMLX 2XNMA 4YHFA 3P23A 5EQEA 5CEOA 4CFMA 5FRIA 4R5SA 4E6QA 4G17A 4NW5A 3R8MA 3KRXA 2GNIA 4IVBA 4S2ZA 1P2AA 5FUTA 5E8TA 3VUHA 4JR7A 3BYMA 5JZJA 4J96A 5HE0A 4H36A 3I7BA 3IDPA 3T3VA 4M0YA 5DHJA 3O17A 2GQGA 2YDJA 1EH4A 3KULB 4PMPA 2UV2A 4TYIA 4B7TA 2BIKB 2FYSA 5LVMA 2CKOA 3ZZEA 5AFVA 2VRXA 3L9LA 4RIYB 4XBRA 2HENA 4GV1A 2QOOA 4TL0A 4F7SA 4FV0A 2XJ2A 4WRSA 3T3UA 2PZIA 4FR4A 3PA3A 3E63A 4JI9A 4XH6A 3NW7A 5B2KA 4QYYA 2ZVAA 5BVKA 3QTQA 2GQSA 3D0EA 5K4JA 2GMXA 4YJPA 4QTBA 4G3CA 5EM8A 3W2RA 3U6HA 3DZOA 3A7FA 1H24A 3QUPA 3KRRA 2WEVA 5HVYA 5K5NA 3HL7A 3PDTA 4RGJA 5CI6A 1XBBA 4F0IA 3NUNA 3ALNA 3ITZA 3MVHA 2J7TA 4X7QA 4EK3A 3OUNB 2VWXA 2RFDA 2VX1A 3R28A 3LCTA 4BTJA 3UOKA 5AAGA 1XH7A 1FOTA 3OZ6A 3SDJA 5DGZA 3SLSA 4FZDB 2BFXA 4U9AA 3V8WA 1HCKA 2FB8A 1ZMWA 3ZBXA 1ZYSA 3PG3A 4O7VA 3UIXA 4F4PA 3P4KA 3E87A 3VJNA 4KKEA 4AA0A 4MEDA 4EOOA 4AU8A 3UPXA 3DB8A 4RX9A 5I9WA 2GNHA 3QRTA 4ZMEA 4PNIA 2ITQA 3BHUA 2PULA 5CNNA 4IVDA 5FTGA 4ZAUA 1P4FA 2OWBA 5A4TA 2J5FA 1OKZA 2A19B 3GCUA 3NUPA 3RM6A 3RCDA 2Y6MA 4EBVA 5ANJA 3ZM9A 3HV7A 2WTKC 4LYNA 4R3CA 1S9JA 1KE7A 2UUEA 1WBWA 1ATPE 3MJ1A 4U81A 4C4EA 3UQFA 2HW6A 2R3RA 1GAGA 3H30A 4I41A 4R5YA 4W8EA 4OTHA 1E1VA 2YIYA 4XLVA 2IVVA 4BICA 4D58A 4H39A 4IANA 5HG8A 3EZVA 3GU8A 5JRSA 4FZ6A 4V0GB 2EVAA 4M7IA 3ZLXA 4TYHB 4B99A 4O0XA 3A62A 4A9SA 3OCBA 3FMNA 4XP0A 3OS3A 5GIPE 5HD7A 2CN5A 5M44A 3NUSA 4NK9A 5LXMA 4FSMA 1WBNA 4RWIA 4IH8A 3KK9A 4DEAA 2JKMA 3GCSA 5AUXA 4L3PA 3VBWA 2JKQA 3REPA 4DHFA 3QKLA 1YDTE 4O6LA 4R6VA 3W0PA 4I0SA 4CV8A 4ASDA 4ERKA 3HNGA 1Q24A 3HAMA 4ASEA 3RWPA 5H3QA 4YJNA 1KV2A 1H0WA 2C6EA 5KO1A 5KZ0A 3ZO4A 3NYVA 4JJRA 3DOGA 1TQIA 5AEPA 2BZHB 3RHKA 3A4PA 2JDRA 3H0YA 4QT1A 3ZS5A 2ZOQA 4UXQA 5ANKA 4F1OA 3MS9A 5C01A 1ZXEA 5IA2A 4O6EA 3UMXA 2BKKA 2PMIA 3QF9A 4FTTA 3AC2A 4FG8A 3GUBA 4UEUA 5LMAA 3R63A 1MRVA 4ZJVA 3CE3A 4EZ5A 3L8XA 4GYGA 2JITA 5KX8A 3IGOA 4MXCA 3RPRA 5J9LA 3THBA 3AD6A 3EJ1A 3BHHA 5CI7A 3A8WA 2G1TA 3RM7A 3HGKA 2ONLC 4E73A 2WQMA 4ZLZA 2HK5A 2OH4A 1FMKA 3DJ6A 3ODYX 4ACGA 4S33A 4FKQA 1TQMA 3KRWA 1U59A 4BBEA 4ZTQA 5I9XA 4WKQA 4IZ7A 5AUYA 2WKMA 4OTDA 3ZSHA 3DBDA 5K3YA 1YXSA 3PLSA 5FDPA 2Z7QA 4LUDA 1QL6A 2UVXA 3WZUA 1M2QA 3UBDA 4O2ZA 4CV9A 4U42A 3PXQA 4D5HA 4FTNA 3UP7A 4QP4A 4BI0A 2X39A 3KXZA 2UZEA 3CIKA 4H3BA 3VS2A 1RW8A 3CY3A 4DH5A 2C3IB 4O82A 5CAVA 2B1PA 4G5JA 3QCXA 2UW5A 5HE2A 4W4WA 1SVEA 3D9VA 2UW0A 5GJDA 4GKIA 5FXRA 2ACXA 5HBJA 3ENMA 3PA4A 3CD3A 4EOMA 4FG7A 1Y8YA 5I4NA 4O0RA 2C6KA 2GFSA 4ACMA 3GCQA 4DINA 1W82A 3EQDA 2WPAA 2P55A 1PMNA 2WQBA 3EKNA 3VBVA 1KE8A 3BEGA 4RLKA 4FTCA 5CENA 3WF5A 4CG9A 4LRMA 5E8YA 1RJBA 2A1AB 4FUYA 3UZPA 3BYVA 1UKHA 3BKBA 3W18A 2X6DA 3E92A 3C4FA 4XG8A 3G6GA 3MV5A 4XRJA 1CKJA 2VGOA 2XF0A 3DDQA 4EUUA 3F3ZA 3KQ7A 2ONLA 5EFQA 2I0VA 1BI7A 4AN9A 4YHJA 4E5AX 1QPCA 3PPKA 1PY5A 5AV1A 5J1WA 4L45A 1H00A 4BR3A 3WZDA 5L2SA 3A61A 2X6EA 3MBLA 4JQ8A 2V7AA 4IM2A 4W8DA 5F95A 5HEZA 4U40A 4FKWA 1XR1A 3DKOA 3QTSA 4IW0A 3SW7A 2XKCA 5JEBA 5IF1A 1R39A 3FSFA 2NP8A 2XEYA 4ORKA 1H08A 4IC8A 2PVNA 1OKVA 5EHLA 4F6UA 4GCJA 4CZTA 4JR3A 4GT5A 1O9UA 3AOXA 3ZUTA 1XBAA 2YIQA 3Q2MA 4IAAA 3GCPA 3WIKA 4FK6A 4FOBA 4KWPA 2V22A 1XO2B 2FVDA 4EHEA 4FZFB 3FXZA 4F6SA 4CZUA 4IAFA 2XK7A 1WBVA 4RC4A 3FZRA 1YDRE 3OWPA 3A4OX 5E8ZA 1Z57A 3R73A 4UXLA 5BUIA 4FV8A 3LFQA 4FT9A 4XP2A 4KAOA 3R7YA 5A3XA 5LWMA 2RFSA 2PTKA 3Q4UA 4CMOA 5A4EA 2PVKA 2X7FA 2C0OA 1PMEA 3I6UA 2WU6A 4HZSA 4TPTA 3W0RA 3UOHA 1F5QA 5EG3A 3ZSIA 4BDGA 2CGUA 1OMWA 4XNEA 3L9MA 3PPZA 1MQBA 3NIZA 3IW7A 3I4BA 4XX9A 4FIHA 5HTBA 2B53A 4AZSA 4YPSA 4AZVA 5CZIA 5EHOA 1XBCA 2HY81 5JGDA 4FTQA 2IW8A 5L2WA 4G6OA 2UZOA 2XBAA 2CPKE 3OT3A 4RG0A 5EYMA 1UU8A 3BYSA 3OY1A 4BTKA 1VYZA 4UALA 3O2MA 3COHA 4PTGA 1UKIA 5AX3A 1E1XA 5AM7A 5DT0A 5HVJA 2BKZA 3JUHA 2YCQA 3NPCA 4RIXA 2IO6A 4I6FA 4QP9A 1WVWA 4JRNA 2O5KA 3FMMA 4DBXA 4NTSA 2XYNA 1IRKA 5BVFA 2J6MA 3PP0A 4E4XA 3ZRKA 5IQEA 2XKDA 3SG8A 4EBWA 2W96B 3FC2A 3TXOA 1JSVA 2OO8X 1Q8YA 4XUFA 1OI9A 1PRYA 3VJOA 5FEDA 3AD5A 3W0MA 1CM8A 2GSFA 3VRYA 5HX6A 5TT7A 2RG6A 4BI1A 2H8HA 2UW7A 5AX9A 3F5UA 4FTJA 4N70A 5TF9A 2OG8A 2OGVA 2YHVA 3DFCB 3DU8A 3M11A 4FODA 2R3JA 3H10A 4DFUA 4EYMA 3MVLA 3UG1A 4XS2A 1SM2A 2B55A 3VQHA 5JQ8A 4WA9A 2JDTA 3Q4ZA 1Q8TA 1W98A 2HW7A 5K9IA 1H1RA 2QOQA 4H1MA 1BLXA 3IO7A 1VZOA 3C51A 2GDOA 2PVFA 4CSVA 5D9HA 2KTYA 3IDCA 4F7JA 2CGVA 4BBMA 1OL2A 4NJ3A 5CX9A 3BWFA 3CPCA 4DTKA 2VX0A 3KL8A 3KMWA 4K9YA 1ZOGA 3EQPA 3EQBA 2BDFA 4BF2A 3HUBA 3LFAA 3NMUF 1GY3A 3OTUA 1V0OA 2R4BA 4UBAA 2XKEA 4QYGA 4YHTA 4BHNA 4EORA 5TOZA 4RRVA 4U0IA 3R8LA 3FJQE 2Q83A 3PY3A 4FTMA 4MYGA 1L3RE 4BDJA 1IR3A 2FO0A 3JPVA 3Q5IA 2OXXA 5HG9A 5HI2A 4M84A 3ZFMA 5CF8A 3L8PA 3Q9WA 5IA5A 3QD0A 4QRCA 4RPVA 1H25A 4B4LA 5I0BA 4EOIA 5D10A 5IQBA 2WNTA 3LFDA 5DR6A 5ANOA 3TJCA 1H1SA 4DH8A 3TUDA 5DIAA 1WVXA 2ITYA 3EFWA 3EQFA 4A07A 1WMKA 2JD5A 3ATTA 2JC6A 4LOPA 2IZUA 3LJ1A 2R3GA 3G0FA 5KKRB 3LXNA 2QONA 2YIWA 4Q5EA 4YJUA 4HVGA 1OL7A 4JRVA 4AUAA 3C5UA 5CS6A 5HBHA 4ZEGA 1P4OA 1Q97A 4JDHA 3N4UA 3SXSA 4J99A 4HCUA 3R9HA 2PVMA 3E8DA 4C3FA 3EB0A 3OXZA 2WTDA 2Z7SA 3VW8A 4L46A 4BCPA 3WOWA 2OZOA 4K0YA 1XQZA 4AE9A 4ANMA 1H28A 5AP4A 3TN8A 2QOCA 2ITZA 3IW4A 1R78A 3DT1A 5CU4A 2X7OA 3NNXA 2PMNX 4GL9A 4DG3E 2WQEA 3NYXA 3F5GA 3C0IA 4X3FC 3K3IA 5CU3A 4NKAA 2XIKA 4BCFA 3DPKA 4DGMA 5B2LA 4YC3A 4JBOA 4HGTA 1H07A 1ZMVA 1PXOA 3OCGA 3R9DA 4QMNA 5IDPA 3MFSA 3UVPA 1OBGA 3IPHA 1YOJA 4AZEA 4XG9A 3GXLA 2CKEA 2Y0AA 4IC7A 5DR2A 1OIYA 5HX8A 2XRUA 2NRYA 4X0MA 4J53A 2Z2WA 2GHMA 2NPQA 4KIQA 1OL1A 2BROA 1AD5A 4FOCA 4M12A 4BDHA 3NW6A 5LMBA 3QTZA 1GZKA 2CSNA 5AV0A 4EHGA 5CVGA 1XH5A 5C1QB 4HPUE 2B54A 5F9EA 3FZ1A 3MPMA 4FSUA 4AWIA 4FT0A 4G6NA 4ZTNA 1FINA 4FNZA 4CFFA 1VR2A 2VWVA 4Q5HA 3WBLA 1VJYA 3K2LA 1Y6AA 4WBBB 3KXGA 5KCVA 2HZIA 5L8KA 1ZYJA 3FI2A 3M42A 4I94A 3RJCA 1XHAA 4LL5A 5KMKA 2Y8OA 4FV7A 2VWUA 4X2FA 2ZB1A 2YJRA 3I60A 2CHLA 1JKLA 4I4EA 4MD9E 3FSKA 4AS0A 4Y46A 3LCDA 2VWBA 2PYWA 2VZ6A 4MWHA 5JMSA 5HKMA 4CQEA 4EZ3A 2W5HA 4UZDA 3V8TA 2YM6A 2QU6A 3FC1X 4QOXA 3DBFA 4KBCA 2I7QA 4HYHA 5C8MA 3POOA 1G8AA 3NCGA 3FQEA 4R3RA 1OBDA 1UWHA 3BE9A 2F7EE 4HVIA 5JFSA 4U8ZA 5M53A 3HP5A 4X3FA 4DTBA 3KY2A 5DBXA 5M4IA 2BAJA 2YFXA 3QZHA 4HYIA 2VTPA 3ZFXA 3TKUA 2XUUA 1Q3WA 2GNLA 4O7SA 5EW9A 5IH5A 3KF4A 4F9AA 3GCVA 4BIBA 3BHTA 1XH4A 3LFNA 3QUDA 2F49A 2W9ZB 2HXLA 3K5UA 5AP6A 3AQVA 2OSCA 5EM5A 3PSDA 1YQJA 4FTIA 4K11A 2Z60A 1OUKA 2C6IA 3KEXA 1YOLA 3AG9A 3L1SA 1LEZA 3VC4A 5BMSA 2PZRA 3AC8A 3OBJA 4DF3A 2C4GA 3LAUA 4EOKA 5T68A 3W0OA 2QODA 4GU9A 4DT8A 3W2SA 3JY0A 3G0EA 3I5NA 3LMGA 3BEAA 4FSZA 4ZIMA 4II5A 3MVJA 4I22A 3TCPA 3TNPC 4BTFA 1JQHA 4EWQA 1YHSA 5H8EA 2R9SA 2I40A 1H27A 4EK5A 3LXPA 3SV0A 5EM7A 1V0PA 3R7UA 2I0YA 5EW8A 3IGGA 4MXYA 3PXYA 4WNKA 3UC3A 3R30A 4QMWA 4DBNA 1FVTA 4MKCA 3MA3A 5AJQA 3Q53A 2Y4PA 3I7CA 5HBEA 4IVAA 4RVKA 4XOYA 2G01A 5CNOA 5KZIA 3IS5A 4GFGA 4DEGA 4JOAA 4RIOA 4RX5A 1WFCA 4LL0A 2RFEA 3VBYA 4MVFA 3RPOA 4QP1A 5D7AA 1G8SA 1BUHA 3TKIA 3TDVA 3ORNA 2JIUA 2AUHA 3F88A 5CZHA 5CAPA 3R00A 4GK2A 4DH3A 5E91A 1YXXA 2Z8CA 4MXOA 4IWOA 5DE2A 1M7QA 3QX2A 4NZWB 4PL4A 2C47A 2WELA 3NVMB 4AN3A 2ITWA 4HYSA 4QP8A 3OTVA 3RALA 3QD3A 2XM9A 4EH6A 1YW2A 4TWOA 4FIGA 5J7HA 3U6JA 3QTUA 3PWDA 3OCTA 4HW7A 4ACHA 2OZAA 4G6LA 4D4SA 4YJTA 3KK8A 3R1NA 1B6CB 4PMSA 3FMLA 2PVRA 3R21A 4H05A 4GEOA 2QR7A 3EH9A 4IWQA 2XIRA 3FI8A 4RIXB 3I81A 3FXWA 3FLSA 4FIIA 4NFMA 5E8XA 4EHVA 1APME 1OKYA 5JZNA 3NCZA 4P5ZA 5E8VA 3R7OA 3LFSA 4J1RA 3G51A 3BHYA 3HKOA 3UC4A 3QCYA 2R7BA 3GU5A 1FQ1B 1KOAA 2CKPA 2VUWA 2YITA 4U41A 3ORMA 2J2IB 1BL6A 2O65A 3OW4A 3AD4A 3UOJA 4EJNA 4RIWA 1Q5KA 2UZDA 3DS6A 3EL8A 5GNKA 2ZMDA 3NWWA 5HU9A 2ZV7A 1OZ1A 3Q2JA 1UNLA 2PU8A 1ZOEA 4XRLA 4F1MA 4NM3A 5IEXA 2AC5A 3K54A 4BDDA 2VN9A 5A9UA 1SVGA 4QYHA 4DEHA 3N4VA 4O84A 4GSBA 4EWHA 4USEA 2VU3A 3QX4A 2BZJA 3BYUA 3EQCA 4F1TA 3LMIA 2WTJA 2UW8A 4JQEA 4TW9A 4AG8A 2QLQA 3A7IA 2IN6A 2GNJA 3KFAA 3MGYA 4KIPA 5CSXA 4HCTA 2C5OA 4RJ8A 4PL3A 3WZEA 3DNDA 1SZMA 3COMA 3HP2A 4P5QA 4QMZA 4OTGA 3DLZA 3HMOA 4NM0A 2ITUA 4AFJA 1Q4LA 3W1FA 5JFXA 3FE3A 3O71A 2ZV8A 5HVKA 4RZVA 3RGFA 4M69B 2BVAA 4USDA 2YWPA 2JBOA 4C58A 4CNHA 3I1AA 1GZOA 4ACDA 4BTMA 3VF9A 2HZ4A 3OD6X 2X2LA 3U54A 4IHPA 3LE6A 4JQ7A 4AW1A 4GIIA 3UODA 1DAWA 3SXRA 4AGWA 5CAQA 3ORZA 5DRDA 3ZBFA 1Q99A 2YERA 4ACCA 3LQ3A 2VTQA 5CSHA 3UO6A 3UDBA 3U9NA 2I0EA 1U4DA 3EMGA 3F66A 3VS3A 4ZTMA 2OBJA 5EOLA 2R3MA 4AW2A 2WMVA 4BCJA 2ITOA 4TY1A 3E64A 3U51A 5B2MA 3E3PA 2XB7A 5KHWA 2CJMA 3II5A 3NYOA 2Z7RA 5IA1A 4XV3A 1NY3A 2HWOA 3Q6UA 1J1BA 5L6WL 1OL5A 4IMYA 3V6RA 3ZRLA 4PDOA 4LGHA 4ANQA 3PRFA 2BFYA 4NIFB 4F9BA 4KS7A 3CBLA 3ZYAA 2Y7JA 3E8EA 4RX7A 4ALUA 1WBTA 4MF1A 5IU2A 4IAYA 3CPBA 5E4HA 3WYXA 3MESA 2OXDA 1R1WA 3QAME 4KINA 1E9HA 3ZO2A 1GZ8A 2HYYA 3KMMA 2OXYA 4BRXA 5A14A 2PE0A 5EKNA 2IZSA 2ITTA 3GOKA 2OI4X 4A06A 1Z9XA 2QOBA 4GUEA 1ERKA 3EFKA 1WCCA 4IAKA 3UTOA 3R22A 3CCNA 4FNWA 1XH6A 4X6RA 3CKXA 4DLIA 3NUYA 2ZMCA 3CS9A 4O7LA 3F3TA 3HA6A 3HRCA 2Q0BA 1LPUA 4OR5A 4O38A 5DA3A 5DG5A 4A4OA 4ZZOA 5CTPA 2BRNA 3SKCA 5KMOA 5CU6A 2C0TA 3D2KA 4A9TA 4TNBA 5B7VA 4BCGA 4K1BA 5A4CA 4ZLOA 2W99B 3OF0A 5DWRA 5FXSA 4X2JA 3P7BA 3RAHA 1YRPA 4GJ2A 5G1XA 4XG7A 5LWNA 4MTAA 4LM5A 5F1ZA 2IJMA 2ETMA 4KUJA 1PXKA 4R1VA 5I9UA 2H34A 2P33A 3GNIB 5CALA 3GC0A 4I92A 2IVSA 2RF9A 2FH9A 3G33A 5C27A 4G9CA 5BVOA 4FZAB 3Q5ZA 3EQHA 3G5DA 4M67A 2C5NA 4O7OA 1NT2A 4HZRA 3AC5A 2HZ0A 4MNEB 5AUWA 2IWIA 3PE2A 3PZEA 4PMMA 4R77A 4KD1A 2PUIA 4XV1A 4F63A 2HWPA 3BV2A 3PLAE 2PE2A 2C68A 3PJ2A 5CEMA 4APCA 5DNRA 2XCHA 1OIUA 2UZVA 2I1MA 3P0MA 4IQ6A 3VS0A 5C8NA 4FT7A 4J52A 5HESA 2BDWA 3CQUA 3ZH8A 2X0GA 3JR1A 2J90A 4F6WA 1MUOA 2PUNA 2O2UA 4MK0A 4Z16A 5M06A 4L43A 5CEPA 4ZS0A 5CQUA 2J0KA 2OU7A 4FGRA 1YI4A 3TV7A 3KGAA 4UYNA 4QQCA 4H1JA 4O96A 5IQHA 5ICPA 3DKCA 3O23A 2B9FA 3AXWA 4FV6A 4WUAA 4UX9A 2QOIA 5DI1A 5BYZA 4FSYA 4RFZA 4RFMA 5E1SA 4GIHA 3VUDA 1LEWA 4Z7HA 3HUCA 4AOJA 2YCFA 4O21A 3EWHA 2JLDA 3QTXA 4UV0A 4XOZA 1YVJA 3C4XA 3R9OA 1BI8A 2W1HA 5KNJA 3E7VA 4MCVA 2A0CX 2G9XA 5EI8A 4RC2A 3FLNC 1DS5A 5HE3A 2F7ZE 3VBQA 4CRSA 1F3MC 1VEBA 3DJ5A 1RDQE 3QFVA 5AV2A 4A9RA 4YJSA 4FTRA 1J7LA 4JBPA 5AP7A 4YJOA 3BCEA 4L42A 3A99A 3PTGA 3FLWA 5FG8A 2QI8A 4JDIA 4EH5A 4WRGA 5DVRA 4YLKA 2XBJA 2WFYA 2C69A 3PRIA 4MBLA 2R0UA 5BVNA 5C03A 4DT9A 3ID6C 4XV9A 4L52A 5C4LA 4QO9A 3BU6A 4JBVA 2G15A 2GCDA 2C6LA 2XK6A 4TYJA 1KUTA 3HYHA 3PA5A 1KOBA 1PXMA 5L8LA 2JKOA 4BZNA 1NW1A 4FKGA 4O0YA 4YLJA 3EKKA 2CN8A 3TJDA 2GFCA 3FEGA 4AT3A 2C6DA 3R2YA 2OFUA 3C4ZA 2P2IA 2PMOX 4UN0C 1IASA 4BHZA 2OJGA 4D1XA 3P5KA 2RG5A 4QTCA 1VYWA 3QQFA 4Q2AA 3SD0A 4HJOA 4OW8A 4CKJA 5IA4A 4Y8DA 3BLQA 3Q60A 4KNBA 2VGPA 3P1AA 4TKSA 4C62A 3MY1A 5EDQA 3EIDA 4AACA 4EL9A 4AP7A 4YTIA 2UW6A 2XNGA 2RFNA 4A4XA 3VS5A 4F65A 4I20A 3F2RA 3TT0A 2XIYA 3D83A 5IQCA 4DA5A 2B7AA 4RMZA 5BVWA 5LVPA 3MY0A 5D41A 2CKQA 2QO7A 3F69A 3KU2A 3BPRA 3B2TA 1XH9A 2X8DA 4XLIA 3TV4A 4P2KA 5GJFA 3NLBA 5CU0A 2QKRA 3HV6A 3ZMMA 5DOSA 3E7OA 1ZZLA 1JAMA 2VX3A 4KBKA 2GU8A 4AFEA 5IG1A 3GFWA 2ETRA 4GS6A 4LOQA 5B0XA 3QA0A 3NDMA 5KHXA 5HU3A 5J9ZA 3P78A 1REJA 2W4JA 2BZKB 2W1DA 4FG9A 4TYGA 1ZY4A 4F7NA 3TTIA 3RVGA 2W1CA 2OF4A 3LPBA 2W1FA 4QMVA 3S0OA 4RIWB 4L53A 1W7HA 3FMJA 3MYGA 2XA4A 4CG8A 2UVYA 2WZJA 4RQVA 3CD8A 4FKSA 4U44A 2CGWA 4YZMA 4F99A 3WE4A 4EOLA 3QWKA 4BZDA 3VO3A 4MBJA 5CLPA 3SRVA 3TEIA 3F5XA 3QZIA 3RAIA 3PYYA 3CGOA 5JT2A 5CVHA 3ZEPA 5EKOA 4FIFA 3CGFA 2I0HA 3C50A 4PDYA 5ACBC 4FL2A 4YJVA 4EOPA 3I0OA 4BVUA 5A46A 4R78A 4TT7A 3H3CA 2E9PA 2VTTA 4BCQA 4PP9A 2QKWB 2GTNA 4HVDA 3OOMA 2O0UA 5ANIA 3F9NA 4O7TA 4EHZA 3PJ3A 3ACKA 2WMAA 3R6XA 1CTPE 3Q6WA 2ZM3A 2H6DA 4K2RA 4PQNA 5HGIA 5BPYA 2W1GA 3W0QA 4XYFA 3EQRA 2BALA 4QMMA 4ZZNA 5KBQA 5LCJA 1B38A 4TRLA 5HE1A 4ANSA 5K4IA 4BBFA 4EZ7A 5EK7A 3GC9A 4JAIA 2QG5A 3R9RA 4L68A 4YZCA 4OTIA 4RBLA 3BQRA 1PXPA 1DM2A 2OF2A 4F64A 1BL7A 5HORA 3ZC6A 3E88A 4AA5A 3ZU7A 2CDZA 4FT5A 4YR8A 2R2PA 3MH0A 2GS2A 3BU5A 4L6QA 4MX9A 4XG6A 4O7RA 3UYTA 4NM5A 5BMMA 3LOKA 4E8AA 5E92A 4EH3A 3P7CA 4JDKA 4NCTC 4AZFA 4J8NA 4EH9A 2BRBA 3KMUA 1T46A 4BDAA 5AV3A 4I5MA 4IZ5A 5CT0A 3ULZA 3IKAA 2J4ZA 3O8TA 4AXAA 3O8UA 4DFXE 1V0BA 5LJJA 5A6OA 4HNIA 1TQPA 3NAYA 4QTEA 1Q62A 5H8GA 5JN2A 4N6YA 3V5QA 3ZEWA 3RWQA 4KRDA 4WSYA 4X3JA 2YISA 1JVPP 3F3VA 3OFMA 3A2CA 2G2HA 1ZZ2A 3C7QA 3R0TA 2WTVA 3GENA 2F2UA 5TKDA 1H8FA 3HECA 4L9IA 3CSVA 2J0IA 2VTAA 4MD7E 1XWSA 3NUUA 4FV1A 3GOPA 3HDMA 3JVRA 3OY3A 3JXWA 1UU9A 2WMQA 2EU9A 3FXXA 3FMKA 1YHWA 1CKIA 3G6HA 1U46A 3R7EA 4USFA 4FVPA 3QRIA 4FT3A 1KE5A 2AYPA 1CSNA 2WMSA 3Q32A 4OTFA 3DK6A 3QD4A 2JGZA 3VHKA 3W0NA 1A06A 5CF6A 3TI1A 2IVUA 1WBOA 3MB6A 4ZY6A 4AZWA 3LLAA 4RJ4A 3D94A 3DZQA 4KIOA 5CVFA 3GT8A 4C37A 4NCTA 4C2VA 4CD0A 5KMLA 3Q3BA 3EL7A 4CFWA 4YO4A 3F7WA 4DEBA 2OJFE 4G31A 3U87A 2G2FA 4L44A 5EI6A 4N57A 3MI9A 4NKSA 1OITA 3ZTXA 3UIUA 2VTRA 2Y6OA 4O81A 4QMTA 3F82A 2CNUA 4G16A 4JAJA 3ZSGA 2WIHA 5E8UA 3R2BA 4EOJA 3DTWA 5IEVA 5CSVA 2VWYA 3BHVA 5EHYA 5I9VA 3ZLSA 4C35A 4PY1A 4G34A 1W84A 4BCOA 2WTCA 4CTBA 4D4VA 2YWVA 4IB0A 4D5KA 2J9MA 5KUPA 4HGEA 4CFNA 4QMPA 2YZLA 2R3LA 3KN6A 5DRBA 3PSCA 3WYYA 4EK4A 5DEYA 4FV9A 3VUMA 4K6ZA 1V1KA 3UO4A 3TNIA 4AW5A 2REIA 1Z5MA 2W17A 2VV9A 2XK8A 2J51A 3VUKA 1H4LA 4DGNA 5JGBA 4BGQA 4B8LA 3OW3A 3PY0A 4M13A 4LUEA 4C34A 3O7LD 4QTAA 4YTCA 3FKNA 2YM7A 4RJ7A 3QD2B 2BUJA 3QZFA 2C5VA 2HCKA 3KXHA 3OROA 3DCVA 2UW4A 3LXLA 4N6ZA 2WU7A 3GC8A 5KE0A 4Y5HA 4O27B 1NA7A 4QMOA 1DAYA 4DFLA 4G3FA 4YURA 4B9DA 3SVVA 2PVYA 2Y4IC 2YM5A 3PG1A 4RA4A 1UU7A 3NNUA 4WO5A 4HYUA 4H3QA 5IQIA 4FKTA 4FYNA 2GS7A 3DLSA 4I6HA 4QMSA 4S31A 5AP3A 3WILA 5CWZA 2ZJWA 3OG7A 4HPTE 3T9TA 3FBVA 4IEBA 5JFWA 4RZWA 2FSOX 2QOHA 2GHLA 5L3AA 3W55A 3QALE 3F5PA 4C33A 4IAZA 1PYEA 4JT3A 4M97A 5BNJA 3IG7A 2VNWA 4HGSA 1KWPA 4R7BA 2IW9A 4BDKA 1K9AA 1O6YA 4U6RA 3FLYA 3Q96A 5D7VA 2WQOA 3HRBA 4NYEA 3RAKA 3GC7A 4FEWA 2Y9QA 3HEGA 5IMXA 1XJDA 3MFTA 4GH2A 4OBOA 2YIXA 4UY9A 3PY1A 5JSMA 4C7TA 3LFBA 5AM6A 5AUVA 4LMUA 3TYKA 2OIBA 4M3QA 4YC6A 2JAMA 4YZBA 2SRCA 4TZRA 3V5LA 5DT3A 4DITA 2GQRA 1OB3A 4RWJA 3RPVA 3GI3A 4FYOA 4D2SA 4UZHA 3MH3A 2J0LA 4RFYA 1JKSA 3NVKI 2BR1A 3WARA 3SGCA 4KSQA 4ALWA 4LFIA 4C59A 5J1VA 4IX3A 1T45A 2XK3A 4EQMA 5FGKA 3E5AA 4FIEA 5AAFA 3FQSA 2WTKB 1LUFA 4EH8A 3CXWA 1L8TA 1FMOE 3IW8A 4Q9SA 4PTCA 5T6KA 5JK3A 3NNVA 1BMKA 4PDPA 4XBUA 5M51A 2IG7A 3Q9YA 2WQNA 1JNKA 2P4IA 3KCFA 4QNYA 3TZ8A 4BCNA 2PE1A 2W5AA 1OKWA 3BZ3A 2QHMA 4YP8A 3DA6A 4G3EA 4QNAA 3TUBA 4E26A 3LIJA 4EC9A 1DI8A 3LW0A 3MFRA 1UVRA 4BCIA 3ORLA 3UPZA 4E5WA 4IWDA 1URCA 3KF7A 3OXIA 1PKDA 2OJ9A 3D4QA 1YHVA 3LMHA 3ORKA 3QCSA 3R01A 4OT5A 4CXAA 1KSWA 4FEVA 4DC2A 3W32A 2YZAA 3RINA 3N9XA 4C02A 3UQCA 4RVLA 3H9RA 1YXVA 2YM8A 1TVOA 3DBEA 4L8MA 5FD2A 5EYDA 3GB2A 3HRFA 2VTHA 3MPTA 2YACA 2XNEA 4KKGA 4A7CA 4AW0A 3FPMA 3KULA 3UG2A 3VF8A 3PXZA 3V04A 3WF8A 4OLIA 4DEIA 3LJ2A 1PHKA 3FI3A 2IZRA 4YZNA 5FP6A 5IDNA 2R3IA 2UVZA 4RX8A 5CT7A 3GQIA 2W1IA 1ZMUA 3GU7A 4IB1A 2QC6A 4L3LA 3Q52A 3SG9A 4BDIA 5D11A 1DI9A 2GPHA 3H9FA 4IDTA 3QQKA 2VWWA 5EW3A 4BYIA 3VS4A 3PPJA 4M68A 4C0TA 5KBRA 3PSBA 3A7JA 1GZNA 1J7IA 5EQPA 3A7HA 3P86A 4P7EA 3COIA 4W4VA 3VN9A 5AUTA 2DS1A 3PVWA 3TTJA 3PP1A 3CJGA 2B52A 2BTRA 3F3WA 4P4CA 4BCMA 3EN7A 1P14A 4FTKA 4DFBA 4YZ9A 4O0TA 4HGLA 3WF6A 3QGWA 3SXFA 1YI3A 2BRMA 4JXFA 2C6MA 2DUVA 3AC1A 4J8MA 1KV1A 3TZ9A 4YGAA 4WG3A 4AT4A 2FSTX 2BRGA 3CLYA 3VBTA 4ASXA 4PUZA 2OLCA 3R8PA 3FZPA 3UGCA 4XCUA 4E93A 4NT4A 3FAAA 4ZP5A 3C13A 5AP1A 1PF8A 2O3PA 3FKLA 5DN3A 4O0SA 5HO8A 2F7XE 3EN9A 1ZAOA 3RI1A 3VAPA 5HO7A
chains in the Genus database with same CATH superfamily
2BDJA 4B8MA 4BY9E 3NGAA 3EFJA 4XMOA 5E90A 1H1PA 4C4IA 4R1YA 5HCXA 3ORIA 3QBNA 3RK9A 3W33A 5KMJA 5IMEA 1Q8WA 3RK5A 1W0XC 3W16A 4MHAA 4K77A 3UNZA 2BAQA 2JEDA 4CMTA 4CRLA 5BUEA 4AT5A 1YKRA 2FGIA 2OJJA 3D7TA 4NU1A 3NZ0A 2ZV2A 4I21A 3CC6A 5J95A 4OTRA 2X2MA 4I5HA 3UYSA 5AUZA 1PJKA 3EHAA 1PW2A 3QRJA 5JQ5A 2EWAA 3L8SA 4FVQA 5HNBA 2XANA 2EXCX 4ZOGA 3UVQA 4GYIA 5EDRA 5LOHA 4RLLA 1I44A 4V0GA 4TYHA 5JRQA 4FA2A 5AAEA 2QU5A 3HMNA 1G5SA 2JDVA 3ZUUA 4PL5A 3EZRA 4CT2A 3RMFA 1BYGA 3SA0A 4O2PA 4Y95A 4AXCA 3OHTA 3VVHA 2BILB 5FM3A 5HLPA 2HOGA 3FV8A 1WZYA 1PXNA 1M2PA 3A7GA 5HIBA 3ZM4A 4EH2A 4G3GA 5E8SA 5I9ZA 3EN5A 4FBXA 1YWNA 3ZDIA 1PMVA 3W2PA 4O0VA 3KXXA 2X8IA 4A9YA 3FL5A 4NM7A 5CY3A 4YSJA 3KN5A 5L8JA 4PRJA 3RKBA 3E8NA 4IACA 2X8EA 1PMUA 4YTHA 4GW8A 1SNUA 1OVEA 4WNMA 2XP2A 5GHVA 5CSPA 3QUEA 3PFQA 1OIQA 3MWUA 3QQJA 4ZTLA 5BVEA 2C3LA 2ERZE 5IA0A 3QHWA 4D9UA 4EK8A 4RSSA 5FP5A 4ZS4A 1QPJA 3DXNA 3G15A 4WD5A 3BQCA 3ET7A 4J7BA 1O6KA 2PVLA 3D2IA 2B9IA 5ETAA 5BQ0A 2XJ0A 4MXZA 3TG1A 5E8WA 2W4OA 3O51A 4ID7A 5CF4A 3DDPA 4DCEA 3AKJA 5HCZA 2CNQA 5M08A 4OT6A 3KVWA 4GG7A 4TN6A 1FPUA 3RPYA 2XK9A 4L7FA 2EXMA 3UQGA 2BIYA 4JG7A 4YPDA 4PWNA 5BV3A 4K33A 5DFPA 4D9TA 2A2AA 3Q9ZA 3C0GA 4BIDA 4I93A 3KRLA 4QP2A 2LGCA 4UYAA 4Y73A 5AUUA 4U94A 3MTLA 4E5BA 2WHBA 2BCJA 1QCFA 2OIQA 2RGPA 4EC8A 2XIXA 2RIOA 5AIKA 3O5AA 4G5PA 3TIZA 3KKVA 1ZWSA 3FLZA 2WOTA 3SHEA 3NAXA 5CU2A 1H01A 3ULIA 2CMWA 3DB6A 2NO3A 3FWQA 5F94A 5M57A 4L7SA 2WEIA 1FVRA 4GG5A 5E1EA 1Q61A 1RE8A 3EYGA 4NTTA 4FV3A 1OPJA 3G9NA 1H1QA 3ZDUA 4E1ZA 5K5XA 4JG6A 3OWJA 4GVAA 1H0VA 2ITNA 3FHRA 5HTCA 1IA8A 2C6OA 2WTIA 2XZSA 3POZA 4U43A 4QMQA 3W8LA 1BX6A 4XV2A 1PXIA 1QMZA 3DQWA 3O96A 4OGRA 3F7ZA 4ZJIA 3Q04A 5EQYA 5A4LA 1UNGA 3MN3A 3RTPA 2R64A 4TTHB 3DAEA 1A48A 4RA5A 3R1SA 5IA3A 3HAVA 4E4NA 2A27A 2R3PA 3LZBA 4DE4A 4HVHA 4KA3A 1URWA 4DEEA 2HAKA 3MIAA 1KE9A 4KKHA 4ZSJA 4OBPA 4XG2A 4EI4A 1YDSE 4FKPA 3FMHA 5EOBA 3EYHA 3KCKA 4FVRA 4F7LA 4XJ0A 3LCSA 3NYNA 4IZYA 4RJ5A 4DGOA 4S32A 2NNWB 2WMRA 3QU0A 3CJFA 3R1YA 2VTOA 2GS6A 4EUTA 4WG5A 5IUHA 4IM3A 3QC4A 4GK4A 2P0CA 1R0PA 4KB8A 5DR9A 4O7PA 4CFVA 2WMWA 3JYAA 4EKLA 2OW3A 1H1WA 1KE6A 4BGGA 4FKIA 3NIEA 4BIEA 4FTOA 4IX5A 3AMYA 4CEGA 2OH0E 2WAJA 2Y4IB 3ROCA 3R83A 2B9JA 4C36A 4QMXA 4NJDA 3ELJA 5FTQA 4N0SA 3FZOA 2WMBA 3QYZA 4QTDA 1JSUA 3ZLYA 3K3JA 5FQDC 5HG7A 4LV5A 2Z02A 4IFGA 4CFXA 3VBXA 3F2NA 3FUPA 4E6DA 3S4QA 4FC0A 5GJGA 3QQGA 3TIYA 3ZFYA 4BI2A 3C0HA 4K8AA 2B4SB 4GFMA 3FQHA 4MQ2A 3BBTB 5DLSA 5EM6A 4CGAA 4FX3A 3TZ7A 5C9CA 4O22A 5AADA 1IAHA 2WGJA 3R9NA 4C2WA 4XG4A 2X2KA 2JKKA 3W10A 3P7AA 2EB2A 3C4EA 3MPAA 4DFYA 5BVDA 1GNGA 1J7UA 2F2CB 1FGIA 1UU3A 3OOGA 4JX7A 2XRWA 4FEXA 3U55A 2ETKA 4QMUA 3NEWA 3V5PA 3PXKA 3T9IA 3HDNA 3HV3A 4QPAA 4FGBA 2QNJA 4EK6A 5BYLA 3RCJA 3RNIA 4ZTHA 4ANBA 3Q4TA 3LCOA 4IX4A 4NUSA 4C4FA 2FSMX 4ALVA 3TDWA 1TKIA 4D0WA 2WD1A 2W1ZA 3IK3A 4NH1A 2O64A 5LVOA 4C3PA 2C5XA 5AMNA 3ETAA 3LM5A 3PIYA 4ZXTA 5ACKA 3ZHPC 4EKKA 2YAKA 4DAWA 3LQ5A 4G1WA 2X7GA 4JG8A 4X3FB 2XKFA 4FMQA 3BX5A 4P90A 3ZUVA 3HVCA 4ZJJA 3S00A 2JAVA 5CQWA 1A9UA 2ZDTA 3UDZA 3ZO1A 1H26A 2JFLA 3U8WA 2X9FA 1JKTA 5CF5A 2XAOA 4J71A 2J50A 5EYCA 3GBZA 2XYUA 4ZTSA 4Z55A 5L2IA 4O86A 5LCKA 5AA9A 2ZYBA 3D5VA 4IX6A 5CXZA 5KKRC 3TWJA 4PP7A 4AQCA 2C5YA 1Q3DA 4QYFA 4DN5A 5TR6A 5EI2A 1SNXA 2PZYA 3I5ZA 4FSQA 2VTSA 4U7ZA 5TO8A 5DYJA 2XVDA 2QURA 1AQ1A 2NRUA 3UIBA 4L3JA 4I23A 3B8QA 3UOLA 1YXUA 2OIDA 3LQ8A 3EN4A 4AGDA 1ZOHA 4FEQA 1W8CA 3ZZWA 2OFVA 2XIZA 3IQ7A 3DKGA 4FSWA 3NNWA 4I0RA 4IM0A 1AGWA 3UO5A 4Y85A 4WZYA 3BWJA 4I6LA 5GIOE 3SX9A 3AC4A 3D14A 3M2WA 5IQGA 3NUXA 2XNPA 2ZM1A 3L9NA 3ATSA 4ENXA 2YA9A 2W4KA 2DQ7X 4S30A 5I5ZA 2PUPA 3OWKA 4GJ3A 3D7TB 4MD8E 3B2WA 3FI4A 1NVSA 4D1SA 3NW5A 1LP4A 3RZBA 3OP5A 4IJPA 2QO2A 2OK1A 5IISA 4PMTA 1X8BA 4JLCA 2W1EA 1RQQA 4E6AA 2BRHA 3CTJA 1I09A 3MJ2A 3CY2A 3PZHA 1FGKA 2UZBA 4FL1A 5ANEA 4DG0E 2FUMA 1U5QA 3PIXA 4EJ7A 4PDSA 5AV4A 2ZV9A 4LRJA 3TNHA 5E9EA 4E4LA 2X4FA 1Q41A 3TNWA 3WIGA 2OZAB 3PXRA 1JLUE 4V04A 3N4TA 4FKLA 3HA8A 4E4MA 1IEPA 1PXJA 4YMJA 4IDVA 4IADA 1Y91A 2E2BA 5HG5A 2ERKA 4IZAA 4GRBA 4HCVA 2CCHA 4DHZA 4IJ9A 3BRBA 4BCKA 2EUFB 4AOTA 2NYAA 5FEQA 2P3GX 3VS6A 4O83A 4D55A 3SOCA 2R3KA 3A8XA 4WG4A 5CEKA 1Y8GA 4FV4A 4ZMFA 3KC3A 3OT8A 3L9PA 4KBAA 3LHJA 3V5WA 1STCE 2IW6A 4GKHA 3O50A 4R7IA 2UZNA 3DFAA 4I4FA 4JX3A 4V05A 3QXOA 1HOWA 4R3PA 2HELA 3IOKA 4O0UA 4RT7A 3AT3A 3H9OA 5DT4A 4HVSA 4C3RA 4BYJA 3GU6A 4QP6A 3VRZA 4GT3A 4KRCA 4ZSGA 4KSPA 2UZUE 3V8SA 1SMHA 2HY0A 3Q9XA 2VO6A 3QWJA 2X81A 4WNPA 4EEVA 5IQFA 3LFCA 4L00A 5BYYA 4LRKA 3N51A 3PXFA 4IFCA 3S3IA 2J0JA 3ANQA 4I5PA 4O7ZA 3NS9A 4O91A 3LVPA 2R3QA 3HLLA 4JBQA 5LQFA 4MBIA 3AT2A 3VS7A 4C4JA 3R8VA 5CEQA 1YWRA 5JFVA 1XH8A 2XK4A 4IIRA 5ETIA 4NFNA 2PVJA 2PZPA 3C4CA 4I6QA 2DYLA 2YJSA 2YDIA 3DBQA 1ZYDA 2WTWA 3MVMA 3BV3A 3OBGA 4YSMA 2V55A 2UZWE 4DYMA 1M14A 5CAOA 2FSLX 4DH1A 4CFUA 5DH3A 2YIRA 2CCIA 4UB7A 4AXFA 4E20A 1IG1A 3KXMA 3UMWA 4FKVA 4H58A 3VS1A 2ZAZA 4UWYA 4RJ6A 2BAKA 2F57A 3F3UA 2JDOA 3FKOA 5AP5A 2WB8A 2ITPA 2W5BA 4NW6A 3E62A 4APPA 1CKPA 4FICA 1WAKA 4YNOA 1NVQA 2R3FA 3RP9A 4ITHA 2VO7A 3ZXZA 4CKIA 4YO6A 3DJ7A 4YBJA 3OVVA 4H3PA 3FYKX 4RVTA 4TWNA 3C5IA 4BC6A 5ETCA 2PSQA 4AZTA 1GIJA 2JFMA 5EH0A 1ND4A 1XMLA 3U9CA 4IWPA 4AF3A 3BYOA 4QPSA 4BDEA 4TWPA 3GGFA 2B0QA 3EOCA 3L8VA 3VQUA 3O8PA 4FV5A 4BDCA 3PWYA 4FZ7A 3QKMA 4QQTA 3GFEA 2GHGA 4YU2A 5M09A 3R71A 2G2IA 3ENHA 2VTLA 4CMUA 3VNTA 3AMBA 4M8TA 4LQMA 1YOMA 4YTFA 4O0WA 3DBCA 4NL0A 1M7NA 4ITJA 3ZRMA 3PVGA 5HD4A 1J3HA 2PHKA 4ASZA 2ZM4A 1ZYCA 3KRJA 1JKKA 3P79A 1FBNA 4CVAA 3BE2A 3RPSA 3BI6A 2XCKA 4F70A 4XEYA 4ZSAA 4YLLA 1WBPA 3QLFA 1JWHA 4KS8A 3F6XA 4DH7A 4IB3A 5M07A 2HXQA 4F09A 4BZOA 4AN2A 2B9HA 4XP3A 4ZSLA 4G3DA 3HV4A 3IONA 3RAWA 5J5SA 1U54A 4D4RA 4M0ZA 4BDFA 1PYXA 2UZLA 4WNOA 3UZRA 3MY5A 4Z9LA 4D1ZA 2QVSE 4JL9A 2E9NA 5AA8A 4U98A 3OEZA 2XJ1A 3I6WA 4JIKA 5F20A 3MA6A 2QLUA 4LV8A 3PJCA 3SQQA 3QC9A 3E93A 3FYJX 4RC3A 3VHEA 4DGLC 2VTJA 2ZDUA 3LFFA 2ITVA 3QGYA 5IH4A 3BELA 4ZY4A 3T8OA 4A4LA 3WF9A 5JKGA 2C1AA 3TL8A 3ZC5A 4CCUA 2H9VA 4DG2E 2QOKA 2W06A 3ORPA 3WZKA 4OBQA 4JVGA 2GNGA 5H2UA 4E7WA 5M4UA 1WBSA 5J9YA 3G2FA 4FL3A 4PV0A 4MQ1A 2WIPA 1UWJA 4QYEA 5IUGA 4QP7A 3EQGA 1OECA 4WT6A 5FEEA 3GEQA 4J95A 2V0DA 5D12A 5A6NA 3HMMA 3KVXA 4I5CA 1BKXA 3E3BX 3HV5A 3UVRA 4U80A 3DK3A 4J97A 4UWBA 3KREA 5EDPA 2VO3A 4M15A 4JNWA 3ZO3A 4TWCA 1GOLA 4AAAA 3WZJA 4BKJA 3CKWA 5E7RA 1G3NA 3RK7A 2QO9A 2VNYA 3R7IA 3QL8A 4EQUA 3C1XA 3DXQA 1R0EA 2PVHA 3NFGB 2VD5A 5DPVA 3S1HA 2O8YA 4HOKA 3IDBA 5IQAA 4B0GA 5T3QA 3LJ0A 2IVTA 1P5EA 3FY2A 3S95A 4ENYA 3OCSA 3R8UA 4FEUA 4XG3A 5IZFA 4AGCA 2CLXA 4IBMA 3IECA 4D28A 4BN1A 5CXHA 4CT1A 1YXTA 1OPLA 1JPAA 4CTCA 4WBOA 4WOVA 4D4YA 5HICA 4FKUA 4QMLA 5H9BA 4U3ZA 3VONA 5BX0A 5ANDA 4EH7A 5HHWA 3DNEA 4ITIA 5FTOA 3NX8A 3QRKA 4FNXA 1OIRA 3HX4A 1MRYA 3UJGA 2GTMA 1IAJA 1QPEA 4GVJA 4G9RA 2E9VA 2VTNA 4MNFA 3TZMA 1OPKA 2ITXA 2CGXA 2X1NA 4FE2A 3JY9A 4J98A 3BLHA 3R04A 5LMKC 4I3ZA 3UNKA 4FV2A 4V01A 3TNQB 4QQ5A 3DTCA 2XAMA 4WHZA 5M56A 3V01A 4AGUA 3CP9A 5HNIX 2QR8A 2P2HA 4OTWA 2C30A 4EYJA 4X2NA 3PUFC 4N4SA 3KIOC 4QP3A 3IOPA 5C26A 2XH5A 2C6TA 3OC1A 3AMAA 3QXPA 4FTAA 1MRUA 3O0GA 3PIZA 2R0IA 4KABA 4ZY5A 2VTIA 3P9JA 2C3JA 2R3HA 3W0SA 3QQUA 2C3KA 3LLTA 4FSNA 5CSWA 4I0TA 2HIWA 4FSRA 1REKA 5KMMA 1UNHA 3ZOSA 2JBPA 2QHNA 3QQHA 2QQ7A 3ZXTA 3A60A 4WUNA 4MXXA 4F08A 3HMIA 2XNBA 5CYIA 5A54A 2PZ5A 3EN6A 4C4HA 5ETFA 3G90X 3FLQA 1UV5A 4CKRA 1M2RA 4PNKA 3D5WA 4FTLA 3LCKA 4CLIA 3QHRA 1OM1A 3W2QA 4BDBA 1CMKE 3ROYA 3UDTA 5JGAA 3LFEA 3AC3A 4O7WA 2PK9A 3HZTA 4Q9ZA 3CQEA 3TACA 2XM8A 4FTUA 3OMVA 2YABA 3FL4A 3SOAA 2UW3A 3ZLWA 3MH1A 3QLGA 2QD9A 2J5EA 4GK3A 3SRVB 2QOFA 3MW1A 1K3AA 3ZCLA 2V7OA 3LXKA 4U45A 3FDNA 5G6VA 5M4FA 1ZARA 5LMKA 4JDJA 1Y57A 2YN8A 5LVNA 1Q8ZA 2QG7A 2WMXA 2WOUA 3TM0A 4W4XA 1NVRA 4RIYA 1QPDA 3UZTA 2Z7LA 2C1BA 4JIAA 5FBNC 4FI1A 1GIIA 2CLQA 1J91A 1MQ4A 2VO0A 3E8CA 3LM0A 3LKMA 4CCBA 5CANA 1PXLA 3AGMA 5F4NA 2V5QA 3BBWA 5FLFA 1FVVA 3QCQA 3BU3A 5IPJA 4RJ3A 2X4ZA 4DCAA 3OXTA 4MNEA 4B6LA 5A4QA 1IA9A 1XKKA 2BZIB 2PWLA 5ITAA 4QDVA 2WXVA 3NFFB 4RWLA 4O7NA 3FPQA 5M4CA 4DLJA 3QTIA 3GVUA 4X2KA 4DGGA 5HCYA 2QOLA 2YAAA 4EONA 2I6LA 2YCSA 4YZDA 4AX8A 3PUPA 2VTMA 4DFZE 4GT4A 3R7VA 3MTFA 5AWMA 1UA2A 5HLNA 2YM3A 3NR9A 3QA8A 2BPMA 4ERWA 3Q4CA 4S34A 2F9GA 3FMEA 4C61A 3F61A 2WO6A 4Z7GA 4QMYA 5HIEA 1M17A 2JIVA 4Y5QA 5L2TA 1OGUA 2A4LA 3CTHA 3NRMA 5DEWA 5FXQA 5I9YA 5KMNA 5HLWA 3BLRA 4GMYA 3QZGA 4BGHA 3BGPA 2RL5A 3ZONA 3PVUA 4NSTA 5GINE 5CEIA 2IPXA 4MXAA 3KA0A 3I79A 3O7LB 3NSZA 4MWIA 2ZB0A 4IVCA 3QKKA 3V3VA 3FZSA 5CAUA 3G9LX 4OUCA 4FIJA 4TNDA 3KXNA 4GU6A 5CASA 5L6OA 3ACJA 3GU4A 5J87A 2W05A 2H96A 3S2PA 3UE4A 4U97A 4EH4A 2VWIA 2OJIA 4NWMA 4IE9A 2YM4A 4QQJA 5D1JA 4IB5A 4PX6A 3U4UA 2AEGA 4BB4A 3IW6A 3FMDA 4MAOA 5HIDA 4A9UA 4G2FA 2WMTA 2OICA 3UIMA 1U5RA 3CEKA 1NXKA 3PVBA 1W83A 2UW9A 3JVSA 4LI5A 3QTRA 4YNEA 3V6SA 5M55A 3VIDA 3V51A 3QTWA 4L01A 3SAYA 2LAVA 2HZNA 4EOQA 5BUJA 1K2PA 3ALOA 3VUGA 5HQ0A 5C8KA 1ZY5A 1SYKA 3DY7A 3AGLA 4DTAA 3QQLA 4ONAA 4RQKA 3SW4A 5L6PA 1GJOA 1M52A 1U54B 1Y6BA 4I24A 4IAIA 3OUKA 4BCHA 3MB7A 2X9EA 1G8JA 4AA4A 1WVYA 1ST4A 2C0IA 2W7XA 4U79A 5EYKA 2JDSA 4ZK5A 3U4WA 3H4JA 4F0FA 3BGQA 3P5JC 2JIIA 2PL0A 3MDYA 4LMNA 4AE6A 2FA2A 5FM2A 2ZFYA 5FDXA 2R7IA 3R1QA 1YI6A 4ZSEA 4C38A 4EOSA 3BIZA 3TUCA 4ARKA 4AAYA 2E9UA 1ZLTA 2O63A 4LG4A 3WE8A 4W4YA 3DAJA 3PJ1A 4EQCA 2PPQA 3MIYA 3DXPA 4R7HA 3P08A 3V5TA 5H8BA 3TV6A 2DWBA 4UWCA 4LOOA 1YWVA 1Q8UA 4FUXA 4F9WA 2BHHA 2KULA 4LGGA 1OL6A 3H0ZA 4L67A 3D5XA 5KMIA 2R5TA 3JS2A 4RVMA 4F0GA 5HZNA 4ZTRA 4RWKA 3W2CA 2XEZA 4K18A 4YBKA 3DK7A 3MH2A 3IW5A 3VULA 2UZTA 2BTSA 5HNGA 4X21A 3FY0A 4TYEA 3RHXA 3WF7A 4PTEA 4JS8A 3ANRA 4FSTA 2YDKA 1F0QA 2XALA 4AOIA 2WMUA 2YCRA 1LR4A 2GNFA 2IZTA 3C4WA 4D2RA 3GP0A 3U6IA 3VWAA 2W0JA 1JBPE 4TXCA 1PKGA 2ESMA 3UNJA 3MFUA 3VUIA 1GIHA 3EFLA 5AP2A 4DFNA 3PJ8A 3W2OA 4DEDA 5IEYA 5AP0A 5LARA 2OKRA 3D7ZA 3MSSA 3HMPA 3VW6A 4OTQA 3CQWA 5IQDA 4FKRA 1CDKA 4XHKB 2R3NA 4Y72A 4C4GA 3CTQA 4WIHA 3ORXA 4PF4A 5FBOA 2PY3A 1O6LA 5LVLA 2CNVA 2J0MB 3ODZX 3V5JA 2EB3A 3COKA 3R02A 2W9FB 5IH6A 2BHEA 2XNOA 3TKHA 5IUIA 3BGZA 4ANLA 3UP2A 1S9IA 4GFOA 1SVHA 3PE1A 3C9WA 3W8QA 4MUQA 3KB7A 3B8RA 4X6QC 3EQIA 5AIRA 4FKOA 1B39A 4YUQA 4ZLYA 4D0XA 5C4KA 4U3YA 1R3CA 2VWZA 4I1ZA 4X2GA 3DAKA 4Y83A 3ERKA 1OUYA 3WI6A 3D5UA 4MH7A 3AT4A 4YJQA 2YEXA 1JOWB 1JSTA 4E6CA 5JH6A 4I6BA 4F9CA 4Z3VA 2AC3A 3OEFX 3D15A 2Q0NA 3DGKA 4M14A 2QCSA 1ST0A 4FKJA 4U5JA 4YJRA 4HNFA 4YC8A 1HCLA 2RKUA 4FNYA 1J1CA 3DKFA 4F9YA 3OWLA 4CLJA 3I0QA 3ORTA 3CR0A 5J8IA 3NUAA 3QYWA 2XS0A 2R3OA 2XNNA 3FHIA 3QRUA 3SC1A 2VAGA 3DQXA 4FK3A 3R8ZA 3FZTA 3M1SA 1MP8A 2E9OA 4ZZMA 4O7YA 2F4JA 5ANGA 4GUBA 2PUUA 1ZRZA 3F2AA 3GQLA 2BMCA 2V62A 2XMYA 3DV3A 3K5VA 2PMLX 2XNMA 4YHFA 3P23A 5EQEA 5CEOA 4CFMA 5FRIA 4R5SA 4E6QA 4G17A 4NW5A 3R8MA 3KRXA 2GNIA 4IVBA 4S2ZA 1P2AA 5FUTA 5E8TA 3VUHA 4JR7A 3BYMA 3BL7A 4J96A 5HE0A 5JZJA 4H36A 3I7BA 3IDPA 3T3VA 4M0YA 5DHJA 3O17A 2GQGA 2YDJA 1EH4A 3KULB 4PMPA 2UV2A 4TYIA 4B7TA 2BIKB 2FYSA 5LVMA 2CKOA 3ZZEA 5AFVA 2VRXA 3L9LA 4RIYB 4XBRA 2HENA 4GV1A 2QOOA 4TL0A 4F7SA 4FV0A 2XJ2A 4WRSA 3T3UA 2PZIA 4FR4A 3PA3A 3E63A 4JI9A 4XH6A 3NW7A 5B2KA 4QYYA 2ZVAA 5BVKA 3QTQA 2GQSA 3D0EA 5K4JA 2GMXA 4YJPA 4QTBA 4G3CA 5EM8A 3W2RA 3U6HA 3DZOA 3A7FA 1H24A 3QUPA 3KRRA 2WEVA 5HVYA 5K5NA 3HL7A 3PDTA 4RGJA 5CI6A 1XBBA 4F0IA 3NUNA 3ALNA 3ITZA 3MVHA 2J7TA 4X7QA 4EK3A 3OUNB 2VWXA 2RFDA 2VX1A 3R28A 3LCTA 4BTJA 3UOKA 5AAGA 1XH7A 1FOTA 3OZ6A 3SDJA 3AKKA 5DGZA 3SLSA 4FZDB 2BFXA 4U9AA 3V8WA 1HCKA 2FB8A 1ZMWA 3ZBXA 1ZYSA 3PG3A 4O7VA 3UIXA 4F4PA 3P4KA 3E87A 3VJNA 4KKEA 4AA0A 4MEDA 4EOOA 4AU8A 3UPXA 3DB8A 4RX9A 5I9WA 2GNHA 3QRTA 4ZMEA 4PNIA 2ITQA 3BHUA 2PULA 5CNNA 4IVDA 5FTGA 4ZAUA 1P4FA 2OWBA 5A4TA 2J5FA 1OKZA 2A19B 3GCUA 3NUPA 3RM6A 3RCDA 2Y6MA 4EBVA 1OGYA 5ANJA 3ZM9A 3HV7A 2WTKC 4LYNA 4R3CA 1S9JA 1KE7A 2UUEA 1WBWA 1ATPE 3MJ1A 4U81A 4C4EA 3UQFA 2HW6A 2R3RA 1GAGA 3H30A 4I41A 4R5YA 4W8EA 4OTHA 1E1VA 2YIYA 4XLVA 2IVVA 4BICA 4D58A 4H39A 4IANA 5HG8A 3EZVA 3GU8A 5JRSA 4FZ6A 4V0GB 2EVAA 4M7IA 3ZLXA 4TYHB 4B99A 4O0XA 3A62A 4A9SA 3OCBA 3FMNA 4XP0A 3OS3A 5GIPE 5HD7A 2CN5A 3UDSA 3NUSA 4NK9A 5LXMA 4FSMA 5M44A 1WBNA 4RWIA 4IH8A 3KK9A 4DEAA 2JKMA 3GCSA 5AUXA 4L3PA 3VBWA 2JKQA 3REPA 4DHFA 3QKLA 1YDTE 4O6LA 4R6VA 3W0PA 4I0SA 4CV8A 4ASDA 4ERKA 3HNGA 1Q24A 3HAMA 4ASEA 3RWPA 5H3QA 4YJNA 1KV2A 1H0WA 2C6EA 5KO1A 5KZ0A 3ZO4A 3NYVA 4JJRA 3DOGA 1TQIA 5AEPA 2BZHB 3RHKA 3A4PA 2JDRA 3H0YA 4QT1A 3ZS5A 2ZOQA 4UXQA 5ANKA 4F1OA 3MS9A 5C01A 1ZXEA 5IA2A 4O6EA 3UMXA 2BKKA 2PMIA 3QF9A 4FTTA 3AC2A 4FG8A 3GUBA 4UEUA 5LMAA 3R63A 1MRVA 4ZJVA 3CE3A 4EZ5A 3L8XA 4GYGA 2JITA 5KX8A 3IGOA 4MXCA 3RPRA 5J9LA 3THBA 3AD6A 3EJ1A 3BHHA 5CI7A 3A8WA 2G1TA 3RM7A 3HGKA 2ONLC 4E73A 2WQMA 4ZLZA 2HK5A 2OH4A 1FMKA 3DJ6A 3ODYX 4ACGA 4S33A 4FKQA 1TQMA 4LV7A 3KRWA 1U59A 4BBEA 4ZTQA 5I9XA 4WKQA 4IZ7A 5AUYA 2WKMA 4OTDA 3ZSHA 3DBDA 5K3YA 1YXSA 3PLSA 5FDPA 2Z7QA 4LUDA 3ML1A 1QL6A 2UVXA 3WZUA 1M2QA 3UBDA 4O2ZA 4CV9A 4U42A 3PXQA 4D5HA 4FTNA 3UP7A 4QP4A 4BI0A 2X39A 3KXZA 2UZEA 3CIKA 4H3BA 3VS2A 1RW8A 3CY3A 4DH5A 2C3IB 4O82A 5CAVA 2B1PA 4G5JA 3QCXA 2UW5A 5HE2A 4W4WA 1G8KA 1SVEA 3D9VA 2UW0A 5GJDA 4GKIA 5FXRA 2ACXA 5HBJA 3ENMA 3PA4A 3CD3A 4EOMA 4FG7A 1Y8YA 5I4NA 4O0RA 2C6KA 2GFSA 4ACMA 3GCQA 4DINA 1W82A 3EQDA 2WPAA 2P55A 1PMNA 2WQBA 3EKNA 3VBVA 1KE8A 3BEGA 4RLKA 4FTCA 5CENA 3WF5A 4CG9A 4LRMA 5E8YA 1RJBA 2A1AB 4FUYA 3UZPA 3BYVA 1UKHA 3BKBA 4JMQA 3W18A 2X6DA 3E92A 3C4FA 4XG8A 3G6GA 3MV5A 4XRJA 1CKJA 2VGOA 2XF0A 3DDQA 4EUUA 3F3ZA 3KQ7A 2ONLA 5EFQA 2I0VA 1BI7A 4AN9A 4YHJA 4E5AX 1QPCA 3PPKA 1PY5A 5AV1A 5J1WA 4L45A 1H00A 4BR3A 3WZDA 5L2SA 3A61A 2X6EA 3MBLA 4JQ8A 2V7AA 4IM2A 4W8DA 5F95A 5HEZA 4U40A 4FKWA 1XR1A 3DKOA 3QTSA 4IW0A 3SW7A 2XKCA 5JEBA 5IF1A 1R39A 3FSFA 2NP8A 2XEYA 4ORKA 1H08A 4IC8A 2PVNA 1OKVA 5EHLA 4F6UA 4GCJA 4CZTA 4JR3A 4GT5A 1O9UA 3AOXA 3ZUTA 1XBAA 2YIQA 3Q2MA 4IAAA 3GCPA 3WIKA 4FK6A 4FOBA 4KWPA 2V22A 1XO2B 2FVDA 4EHEA 4FZFB 3FXZA 4F6SA 4CZUA 4IAFA 2XK7A 1WBVA 4RC4A 3FZRA 1YDRE 3BLAA 3A4OX 3OWPA 1Z57A 5E8ZA 3R73A 4UXLA 5BUIA 4FV8A 3LFQA 4FT9A 4XP2A 4KAOA 3R7YA 4F78A 5A3XA 5LWMA 2RFSA 2PTKA 3Q4UA