3SGCA

Crystal structure of apo aminoglycoside-2''-phosphotransferase type iva
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Antibiotic-Bound Complexes of Aminoglycoside 2''-Phosphotransferase IVa Highlight the Diversity in Substrate Binding Modes among Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
molecule keywords APH(2'')-Id
total genus 95
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3sgcA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3sgcA02
5L2TA 4EC8A 4IFCA 3A2CA 1JSVA 3TCPA 4X3JA 2YCQA 4C3PA 4AFEA 3A7IA 2IW9A 2GHGA 4ANLA 4DFUA 4EH3A 3TDVA 4BVUA 5M08A 2R2PA 4NTSA 1KE8A 4JG7A 4R5SA 3LVPA 4DFYA 3ET7A 4EHZA 1ZYSA 2OG8A 2PMNX 3AMAA 3U9CA 4IH8A 3OC1A 5FD2A 1J1CA 3AC1A 1DAWA 3DKOA 3NPCA 2WMWA 2B0QA 2OJIA 5JSMA 3O8UA 1TVOA 1W0XC 2FYSA 3E7VA 4PTCA 5D10A 5IG1A 1FPUA 2X8DA 1BX6A 2XM9A 4PTEA 3RWPA 5CI7A 1RDQE 1H1SA 4PQNA 1U54B 2J5FA 4B0GA 3AD5A 2P33A 3BPRA 5CQUA 2R3KA 4FKGA 4V0GB 3PE1A 4JDHA 2F4JA 4GKIA 2BRBA 3GFWA 2I1MA 1WZYA 3KA0A 5EI2A 4J8MA 2I0YA 5EYDA 3G51A 3MH2A 5E7RA 3DK6A 5ANEA 3FMJA 5CEQA 3KGAA 4XV3A 3BGQA 1YWNA 3FLQA 4DLJA 4ZTSA 4O22A 3VIDA 4X3FC 3K3JA 3CKWA 4M0ZA 1OI9A 4WIHA 2VUWA 4H3PA 4V04A 2XNMA 5DH3A 4F4PA 2GFCA 1JSTA 4YURA 4DGGA 3HMNA 3LCTA 4EORA 4CTBA 2YFXA 3FMHA 4S32A 2XRWA 2UW7A 4NJ3A 2BZIB 3PIZA 4QOXA 1KE7A 5I4NA 4TTHB 5E90A 3SQQA 1YI6A 3I7CA 3W16A 5LXMA 1OPLA 2IZTA 3EFWA 3W33A 1PF8A 5LQFA 5M09A 1UWHA 1YOMA 3VS0A 2PMLX 3I6WA 1OKWA 2QOFA 4GJ2A 4PDSA 3UIUA 1GZ8A 1OL5A 3CTQA 3P9JA 3FKLA 4GMYA 4K11A 3DTCA 2HW7A 3G5DA 3HZTA 5HNGA 4Z7GA 5KBRA 2QD9A 2B9JA 2VTMA 4FYOA 3UZPA 3C4EA 4QP2A 5A14A 4IX3A 5EI8A 3HNGA 2R9SA 3PRFA 3Q9YA 3DQXA 2WKMA 4C2WA 5JZNA 4UYNA 4R7HA 4G3EA 3P7CA 3KVXA 3Q6UA 4NM0A 4C4JA 4F1TA 3QCSA 3VQHA 5EOLA 3O23A 5CU6A 3GC9A 3DGKA 4FTLA 5LCKA 4FKWA 2R3NA 4L00A 3M42A 4PL3A 1PHKA 4Q9SA 3EL8A 4FEXA 5HCYA 4O86A 4IWOA 3TACA 3DBEA 4L46A 1QL6A 2Z7QA 4IC8A 4RVMA 4XJ0A 5ANDA 5E8WA 4ZY5A 3BCEA 3MWUA 5ANOA 4YMJA 4RVTA 5FRIA 4MK0A 2WMSA 2P3GX 5BMMA 4Y95A 3ZRKA 3GBZA 4ZS4A 3R8VA 3WBLA 2WZJA 4IM3A 5EHYA 4FTRA 4WOVA 5D12A 4DTKA 4BHNA 1DI9A 4FKJA 4O0RA 2CKEA 4X2JA 4IVAA 4RFMA 3CSVA 5HI2A 2C5XA 3EL7A 1PYXA 2X6EA 4G16A 3W0QA 2NRYA 3DDQA 4TXCA 5CX9A 1JVPP 4G1WA 3RTPA 1F5QA 2QR8A 3RPYA 3DKGA 1CSNA 2GPHA 4JIAA 2QLUA 3Q04A 3HKOA 4IADA 4ZLZA 4IZ5A 2XIKA 1FVVA 3QRUA 4L43A 3ZM4A 5IU2A 5LMKA 3GCQA 3AGLA 3QKLA 5AWMA 3KF7A 5CXZA 2HZIA 1KUTA 4S34A 3QRJA 4BI1A 1IR3A 1ZOEA 2ZJWA 1RE8A 4BTKA 3NSZA 1FVRA 3ORPA 3ZZWA 4FV3A 5H2UA 2OW3A 1YRPA 2J0KA 5M4CA 1YOLA 3NNVA 3NS9A 3LFSA 5L2WA 1H07A 2HAKA 2XNEA 4GFMA 3EJ1A 4ALVA 2JFMA 3W2PA 5CEKA 5CT0A 2W1ZA 4I5CA 4BCIA 4L3JA 2VWZA 5E4HA 5HIEA 2Y4IC 3HMMA 3MS9A 5KZ0A 2GTNA 2IPXA 3FBVA 2I6LA 4XLVA 4EZ5A 3QD4A 3PG3A 5L6WL 4QMZA 5HEZA 2FUMA 3FPQA 4F7LA 5J9YA 5CVGA 1YXXA 3OW4A 4FKRA 4KAOA 2PZIA 3FXZA 3DFAA 1Q3DA 2UZWE 2ITTA 2XK7A 5C03A 4EK3A 5BX0A 5CZHA 1I09A 3FI4A 1OITA 4DFXE 5HO7A 5LMBA 2WOUA 3FQEA 2V7OA 3LJ0A 3W0SA 1Q24A 1YOJA 2Y4PA 3LKMA 1GZOA 4DGOA 1UVRA 3PA5A 4QMOA 3R30A 3R7UA 2CCHA 3QUEA 4I4EA 3L8PA 4IB5A 2J51A 4N6YA 3QKMA 4K0YA 1SM2A 5AEPA 4RJ3A 5E1EA 3NNWA 5IA4A 2J0LA 3S95A 3ZFXA 1MUOA 4YPSA 2X1NA 3G9LX 4EHEA 5CSPA 4CV8A 5GJDA 5HE2A 1QMZA 3P78A 4WNKA 4O6EA 4EL9A 4OTGA 2JBPA 3L9NA 2UZBA 4TNDA 2B7AA 2F7ZE 3UDBA 3UMWA 4ANSA 5AIKA 2PVJA 3O71A 1OL6A 2FB8A 2CN5A 3V51A 1YDTE 2CGUA 1URCA 2BRGA 2ERKA 2YDJA 4KINA 1BLXA 2VNYA 4JBPA 3F3TA 3DS6A 1LPUA 4Z55A 2VRXA 3ZDUA 3O96A 2QCSA 2VTSA 3K5UA 3UPZA 2UZNA 4JXFA 2WNTA 5CLPA 1TQIA 4RSSA 3OXTA 4YSMA 5M53A 2XF0A 2XZSA 1GIHA 3E64A 4H39A 2EB3A 4BI0A 4I5HA 4HVDA 3VW6A 4BKJA 1VZOA 1T45A 3KULB 4LI5A 3RK9A 4IWPA 1K3AA 1Z57A 2UZOA 4L6QA 3SRVB 3LM5A 3ACJA 4CFVA 4CLIA 3F5UA 3D5UA 4H3QA 3BV3A 3ALOA 4FKPA 4R5YA 5LARA 2IZRA 4DINA 5FDXA 3E8CA 3O0GA 5JFVA 4O6LA 3PVUA 2BRNA 2XBJA 3VHEA 3GU8A 3IW5A 3Q5IA 4YGAA 3C4XA 3W2SA 3EFLA 4CFNA 4FKIA 4BDHA 4HZRA 3VUIA 5KZIA 2ZM3A 2XNBA 4ANBA 4O0SA 2QKWB 2CSNA 2A27A 4KBAA 4DITA 1WVWA 3EKKA 5JMSA 5HE0A 2H8HA 1V1KA 3Q9WA 5H3QA 5J8IA 3OOGA 4F1MA 3RP9A 3RNIA 5IQIA 1H27A 4TWNA 2VTJA 2BIYA 2Q83A 1M17A 4I6FA 5IEVA 3BYSA 2VWVA 4JQ8A 3RHKA 5EHOA 5CEMA 3UOHA 3OT8A 3V3VA 3N4UA 4RIXB 2V55A 4RA4A 3RMFA 2UVYA 5H9BA 2JFLA 4FNWA 3KU2A 4N4SA 2R4BA 4BTMA 2X2MA 1YQJA 4G3DA 4GV1A 4FSQA 3VBVA 4CLJA 3F3WA 3FE3A 3CQUA 3C9WA 2YAAA 3RCDA 2XKCA 3LM0A 5C01A 3TZ8A 4NH1A 3WZEA 4C3FA 4PNIA 5B0XA 3BBWA 4EOLA 3LZBA 3MBLA 4E6DA 1HCLA 5HORA 2PVYA 3MN3A 2QO7A 3MSSA 4FTQA 4U3ZA 3W1FA 4B99A 2YJSA 1M7QA 2A4LA 2OBJA 3RWQA 5IZFA 5DNRA 3KREA 5KX8A 1A9UA 3HL7A 2JKQA 4FZDB 3VS4A 2YCRA 4AZEA 2HWPA 3Q4ZA 1VYWA 4UZDA 4I3ZA 3R6XA 4O81A 3TZMA 3DXPA 3RGFA 4DT9A 3HECA 4RZWA 5CTPA 4PMTA 3KQ7A 2OXDA 2GNLA 5IQAA 4DEGA 4M15A 3AT3A 4RJ8A 4E4NA 3NUNA 5JN2A 4M13A 5LVLA 3EWHA 2YM8A 1ZZLA 3R1YA 5IQCA 2WMAA 4IJPA 4D0XA 4AW1A 2HZNA 1CTPE 3GC8A 4ZTNA 5BVEA 3MW1A 4M14A 3ZLYA 4YO6A 1NVRA 2PVLA 4ZLOA 3S00A 4IAAA 1PKGA 4WRGA 3HV7A 4IIRA 5CSVA 2QOLA 4U5JA 1JNKA 2X4ZA 4IVDA 1R39A 2JAMA 3QAME 4RWIA 2ZOQA 1Q8ZA 3QHWA 4IDVA 2UZVA 3BEGA 4P5QA 4ERKA 5M06A 3OY1A 4WA9A 2C3LA 3BRBA 4LQMA 5DLSA 3AD4A 2WMVA 3IOPA 5BMSA 1MRUA 3WIKA 3LFEA 4G6LA 4QP8A 1F3MC 2BROA 3A7JA 3VS1A 4F9WA 3E88A 4NWMA 3ERKA 3NVMB 4Z16A 3F7WA 4Q2AA 2H34A 4TYIA 2ZV2A 3A99A 2YJRA 3LFFA 4F63A 3DNEA 4R6VA 2AYPA 3FSFA 2PZYA 4JDJA 4YZDA 3LPBA 2P4IA 4QPAA 3LMGA 5K4JA 2NNWB 3NUYA 3WE8A 5A46A 3MVMA 1P5EA 3DJ5A 3LQ5A 2OO8X 3FY2A 4EQUA 4A06A 5L6OA 2JBOA 3HUBA 4ZAUA 2O5KA 1DAYA 1DM2A 4IDTA 5EW8A 2IW8A 2Z2WA 3FL5A 2F57A 3LXNA 4K18A 3AC3A 4ANQA 2XK9A 3GOPA 4QTAA 2DS1A 4O0XA 4U6RA 5BVNA 3C1XA 3EQHA 4TWCA 5CAOA 2PL0A 3EQCA 5L8LA 2CN8A 4FTTA 4FKTA 5M07A 3NZ0A 1Q5KA 4NM5A 3QD3A 4FIHA 2EWAA 2IVSA 4GT3A 4FTJA 4XG2A 1O9UA 1VEBA 2C5OA 4R7BA 3WF8A 4FV8A 1XKKA 4BYJA 2XP2A 1YI3A 2PTKA 3UO6A 3PZEA 3PDTA 1JLUE 5CNOA 4ACCA 2WU7A 2YZLA 2GNGA 5I9UA 4FT3A 5J1WA 4DEEA 4TYHA 3WZJA 4DN5A 3QC4A 5AV0A 5FM3A 3DY7A 4LOPA 3ANRA 3HV4A 4O91A 3OCTA 4GS6A 2X9FA 3VS3A 2ZM4A 2V7AA 3FMMA 5AM6A 4F7NA 2W9ZB 3MA3A 4GUEA 2A0CX 3CR0A 3F2AA 4A9TA 3KK8A 4W8EA 4L52A 3DNDA 3IK3A 4XG8A 4EWHA 4IQ6A 3QZFA 3KXHA 3BI6A 4M67A 3QD0A 5E9EA 1PXNA 2J7TA 5TF9A 3KRRA 4CKJA 4WG4A 5ACBC 5HNBA 3ODZX 2ERZE 2PYWA 4AZWA 3ZU7A 5KNJA 2BKZA 2X2LA 2J0MB 2WTWA 2J0JA 2WTKC 5IH6A 2X39A 4QYGA 4XX9A 2RF9A 4RFYA 4FTKA 5CSXA 2WMQA 3E87A 3MH0A 3Q5ZA 3FMEA 3L8VA 5CNNA 4Y46A 3MB7A 5E8VA 3V5QA 4BGHA 3JXWA 3PUPA 2IZUA 3QF9A 5EYKA 5HVYA 4F0FA 1R78A 1KE6A 2ITVA 4IB3A 3UP2A 5HIDA 1PXLA 5EG3A 4HVGA 5I9XA 3BE2A 1Y91A 3R2YA 4L3PA 4X3FB 4NL0A 4C3RA 2PUNA 3FXWA 4XV1A 2ITWA 4C7TA 3FXXA 3ORZA 5HVJA 1UNGA 4RJ6A 4WKQA 3F69A 2JLDA 4ZEGA 2W5AA 4DTBA 3B8QA 3OVVA 5IQEA 2ZVAA 2GQSA 4GKHA 4IZYA 3V5PA 3E3PA 5D41A 4ONAA 4ZTRA 3BYUA 3UO4A 3A7FA 5GJGA 2YACA 2QKRA 3BU5A 2Y8OA 3DV3A 3TNWA 4N6ZA 3PXQA 2WAJA 3FI8A 3HGKA 1PW2A 4J7BA 4M97A 3EKNA 2ACXA 4WBOA 1OKYA 3R7YA 2ZMDA 4QYYA 3I60A 3OWKA 5GIOE 2RIOA 3IW6A 4E1ZA 2X7FA 5GJFA 3R28A 4YZ9A 5CAVA 5M4IA 4IE9A 5ETIA 5M51A 3GU4A 2I0EA 3F9NA 4QYFA 4X0MA 3TKUA 3QQHA 3R7OA 4B8MA 3QUPA 3QQFA 2XRUA 4EOPA 1OIQA 1JKKA 1JPAA 3UG2A 2J9MA 5K9IA 2C6IA 1FGKA 3M2WA 3NYNA 3QTUA 2O8YA 3EFKA 3QA0A 3PP0A 4TRLA 2Y0AA 4KKHA 4WBBB 4LV5A 3VUMA 5CEPA 3LOKA 5HG7A 3U4UA 5L8KA 2SRCA 3T9IA 4GJ3A 4D28A 3TJCA 4XHKB 1YWVA 2OJGA 3C7QA 4F6WA 3ACKA 3CKXA 5LVMA 3IW4A 3DDPA 1ATPE 5HX6A 4O7PA 3GT8A 2UW5A 4FZAB 2R3GA 2QODA 3VBWA 5M57A 3QWJA 4F0IA 3CD8A 4X2FA 2HZ4A 3ULZA 2G2IA 4EK5A 4F9AA 5AP4A 3G33A 4FKSA 1ZYJA 3HDNA 3NYXA 2WTDA 3C0IA 3V6RA 4AT5A 2ITZA 1FQ1B 2PWLA 4Y72A 5AP0A 4FEVA 4B7TA 2E2BA 2V0DA 3QRKA 2JAVA 3MTLA 2YIQA 4I5MA 1F0QA 1UU9A 4JOAA 5HBJA 3QZGA 1NVSA 5AJQA 1B38A 4ZY6A 2C6EA 3PWDA 4G2FA 3F3UA 4ZY4A 2Y6OA 4KKEA 4XUFA 4JBQA 1SNUA 2XK6A 3FQSA 5DT0A 4O2ZA 3VVHA 3EZRA 5A3XA 3SW7A 4FV5A 3ZHPC 4O7WA 4JVGA 3OWPA 4LL0A 3FLNC 3ZLWA 4AZSA 5GINE 4FT9A 5JGAA 1OIYA 3NVKI 4DH1A 2QOQA 5CEIA 4PUZA 3NIZA 3GENA 4CFXA 1H0VA 4GG7A 3EHAA 3UYTA 4C38A 3QZHA 3RCJA 4DFZE 2VWUA 3D2KA 4FUYA 3WF6A 5A6OA 5E8UA 4I0SA 1U54A 4M0YA 2JDTA 2Y6MA 2UV2A 4BBEA 1A48A 4WG3A 5KMIA 3ENMA 2Y4IB 2OJFE 3SXFA 2BAKA 3VN9A 2HOGA 3ETAA 3ZO4A 5EFQA 1ZAOA 3ZEPA 2XMYA 5FP5A 1W98A 1OVEA 1Y8GA 2Z8CA 4CG8A 2O64A 4O27B 4JRVA 3QGYA 3FC2A 3I1AA 4XRJA 1G3NA 4J8NA 3PJ3A 5FXSA 1V0PA 3HRBA 2B55A 5H8EA 4EH2A 5IQFA 3IQ7A 5EM5A 3SDJA 2BCJA 3F88A 4QP9A 3KXXA 3L8XA 2J5EA 2C0TA 4DEAA 2J0IA 5DWRA 2GFSA 3V5JA 3TV4A 4FOBA 2GHLA 5BVKA 2R3IA 3P08A 4WNOA 4B8LA 4RWLA 4YBJA 4EK6A 2R3OA 3CD3A 4LRMA 1CKIA 2RKUA 2NPQA 3CQWA 3MH3A 1R0EA 4GFGA 3UJGA 3KMWA 3QD2B 1WBSA 4QP1A 3W2RA 5CI6A 4R77A 2WGJA 3KXMA 1H28A 2XYUA 5CSWA 3NUXA 2UVZA 1CM8A 4L8MA 4YJUA 5I9YA 5DFPA 3BX5A 1NVQA 2A2AA 2WTVA 3AOXA 3BELA 5EW9A 2HIWA 1Q8TA 3EQDA 4IVBA 3AC8A 3QXOA 5IUHA 3RAHA 2W1HA 3F2NA 1UKHA 4D4YA 4YJNA 4YSJA 3LIJA 3REPA 5KMMA 4O0TA 3PA4A 3JS2A 4UBAA 3PIYA 1OBGA 4AZVA 5FEDA 3RPVA 3EQRA 4X2NA 1BI7A 4EUTA 3QQLA 4EH4A 4FSMA 3SD0A 4B9DA 1X8BA 5AP2A 3R1SA 3OY3A 3CEKA 4K9YA 4QRCA 3PSBA 4KS7A 1OGUA 3FPMA 3T8OA 4KRCA 3D9VA 4DEBA 1Q99A 4O82A 3SC1A 5AV3A 4DA5A 2YIYA 3R21A 5DR9A 4APPA 4B6LA 4DTAA 5J7HA 3PG1A 2GS7A 3R9HA 1YKRA 1XBCA 4DCEA 5K5XA 3AC4A 1GIIA 1YVJA 2WMBA 3NWWA 2FSMX 4D4RA 3MA6A 1ZXEA 3QRIA 5BVDA 1W84A 2A19B 4G3GA 2QC6A 3R9RA 3UTOA 3ZDIA 4BZNA 3TIYA 2WD1A 5CANA 3S0OA 3MGYA 3P1AA 4TN6A 4YTIA 4U3YA 3TXOA 2UW8A 3O8TA 4U0IA 4XV9A 3NCGA 3W32A 2OXXA 4TKSA 4X21A 2Q0NA 3PJ1A 4CCUA 3LHJA 4EQCA 1HOWA 4LMNA 1ZYCA 4RVLA 5FLFA 5CF6A 5IISA 4ZS0A 1VYZA 5KCVA 1MQBA 2CKOA 5FDPA 4CZTA 4OTQA 5HTBA 3UZRA 3FI3A 3UQFA 5FBNC 4FUXA 2IJMA 5JZJA 5CALA 5HLWA 3KXZA 3RHXA 5LCJA 3COKA 4ASDA 1BL6A 1XBAA 4FVQA 4RIXA 4BCNA 2VTOA 2UVXA 1JKSA 4O84A 2UW3A 3POZA 4OTRA 4DFLA 1NA7A 2EB2A 2QOKA 4BIEA 4ZJIA 4E8AA 3O2MA 2QO2A 3E92A 4FK3A 5EQYA 5BNJA 1OL2A 3N4TA 3FZOA 4FK6A 4GSBA 4XG6A 4MNEA 4AE9A 4YZMA 4CMUA 4DT8A 3O7LD 4YTHA 4RMZA 2C5NA 3V8WA 3UOKA 2QR7A 5JFXA 1XJDA 4MXAA 1GNGA 4YJVA 1URWA 2CPKE 4PL5A 1O6LA 3KF4A 2PK9A 4TNBA 2XJ0A 2E9NA 4W4YA 1G8AA 2JDVA 1K9AA 2I0HA 2GS2A 5GHVA 5HICA 5CENA 4YJTA 3B2WA 4Q9ZA 1PYEA 2XKDA 4RJ4A 2YERA 3Q4CA 5K3YA 2WIPA 4NFMA 4CV9A 1LEWA 3BHVA 3QCXA 1E1XA 2YM3A 4ZSGA 2E9OA 4C36A 5DGZA 3G9NA 4MBJA 3UNZA 4GW8A 5DN3A 3ZO1A 5J9LA 2NO3A 2VX1A 2IVVA 3MDYA 3TNQB 4G31A 2OXYA 4LOQA 2CKPA 2YEXA 3W10A 4LV8A 1GAGA 5ETAA 4KUJA 4BDEA 4EBWA 2WELA 3UG1A 4N57A 3MVLA 1R1WA 2X0GA 3IDPA 2QLQA 2BIKB 2B9HA 3QU0A 4U79A 2EU9A 3OROA 2YISA 4LGHA 3R22A 4EJNA 2C6MA 2W5BA 2B52A 3ZTXA 5I5ZA 1PRYA 5IQDA 1M2RA 3D2IA 3EN5A 3QTZA 4OBOA 3QQUA 1WMKA 4IM0A 1U5RA 3TKHA 3POOA 3KXNA 4RWJA 5DEWA 3VBQA 4AGDA 5B2LA 3GI3A 1WAKA 5CF5A 5AM7A 1Y6AA 3TDWA 2VTRA 4CGAA 3FQHA 4RT7A 3HV5A 4OT5A 3OXZA 4RJ7A 3OMVA 3AQVA 2C4GA 2OIBA 4O0WA 1CKJA 3GOKA 4DAWA 3TUDA 2DYLA 3BHTA 2JKMA 3CY3A 1YI4A 3FUPA 4PMPA 4KWPA 5EH0A 5FM2A 3MYGA 5HG9A 5E8TA 1DI8A 3PIXA 2YIRA 4Q5EA 4F09A 2F2UA 3U51A 5C1QB 1A06A 5AAGA 2UZEA 1FMOE 2C47A 5JK3A 4JR7A 3MFUA 3IGGA 4J99A 3BLRA 3O51A 3A7HA 3H3CA 3MV5A 3I0OA 4LOOA 2QOCA 2C3JA 3IECA 2WQOA 4MX9A 4O38A 2C1AA 4BDJA 4K8AA 2ZV8A 3E62A 5DVRA 4C34A 2ETMA 3LFAA 4BBFA 3UVRA 4J1RA 5C9CA 2O63A 3OWJA 5AFVA 5ITAA 1J7IA 3PLSA 5DT4A 3ZBFA 4AW0A 4BRXA 1Q97A 5DG5A 4LUEA 3GU7A 4ZJJA 3E8DA 3AC5A 1RW8A 5BPYA 5EKOA 4YJRA 1VJYA 2YIXA 4GK3A 2V62A 3DZQA 3ROCA 2EUFB 2YM5A 5AUVA 3PXRA 3IOKA 5K4IA 2Z7LA 3V04A 4L68A 1JKLA 4IX6A 2PE1A 3HYHA 2UZDA 1OECA 2CKQA 2R7IA 4MQ1A 2R3FA 2BTRA 2I0VA 4U43A 2XNNA 3BLHA 3R1NA 2CJMA 1M2PA 1KV2A 3E63A 1H1QA 1XR1A 3DK3A 4H3BA 4J52A 5A6NA 4O7OA 4O7TA 4TYJA 4M84A 5FEEA 2XNOA 3EQGA 3EOCA 4M8TA 2WO6A 5HLPA 4CKRA 2HCKA 2PVFA 3I81A 3TT0A 4PL4A 3DTWA 2ZMCA 4DEHA 3MJ1A 2OJ9A 2VTPA 4FX3A 1QPCA 3E93A 4DLIA 2F7EE 4ZOGA 5HHWA 3U8WA 1ERKA 2OI4X 2GU8A 1PJKA 2BILB 3A62A 4YJSA 4HYUA 3C4CA 4JL9A 3T9TA 2ZB0A 3L9MA 2BTSA 2RL5A 3L1SA 4G9RA 4JQEA 3UODA 3ALNA 5AUTA 4FL2A 4BC6A 5FXQA 1G8SA 4PP7A 4FOCA 4OTWA 4YC6A 3RINA 3Q3BA 1Q3WA 4QPSA 4QP7A 4EOMA 3R7IA 4EWQA 5E8SA 4YO4A 2R5TA 3A60A 3EN9A 3R00A 2PMIA 4AP7A 4AUAA 3ZC5A 1BUHA 1H8FA 2Z7SA 3WI6A 4DYMA 3KN6A 4YLLA 2BALA 5AUZA 3LCOA 1BI8A 3IO7A 3LLAA 1STCE 1ZRZA 4V0GA 4AF3A 2E9PA 4XP2A 4LRJA 4QMTA 3PJCA 3CCNA 1OKVA 3SW4A 4AW2A 3ZONA 1VR2A 5KO1A 3ENHA 4GH2A 1IAHA 4NJDA 4QP4A 2FGIA 4AGCA 2H9VA 3CS9A 3IPHA 4TWOA 2WMXA 1WCCA 1CDKA 5F95A 3RI1A 4FT0A 1SYKA 4UXLA 5C8MA 3VJNA 4MBIA 2R3JA 4M3QA 4WT6A 4CQEA 2R3LA 3WF9A 3O8PA 3SOAA 3TZ9A 3JPVA 4WG5A 1OL1A 3Q60A 1XQZA 3KC3A 4MH7A 4GEOA 5TO8A 3BU3A 5IQGA 1XHAA 3LJ2A 3ZEWA 1BKXA 5AA9A 4QQCA 3F61A 2XEYA 3MPMA 5JT2A 3C50A 5BVFA 3NW6A 3OS3A 4XNEA 2I40A 2E9UA 1UU8A 4PV0A 4ASXA 2PVKA 2ZYBA 4EKKA 5JFSA 3DBFA 3T3VA 4G6OA 2CNUA 4WUNA 4BHZA 3NUSA 3D15A 2ZV7A 3RAIA 3B2TA 3F5PA 5EK7A 5ANIA 5IMEA 3P86A 5BQ0A 1H0WA 3D94A 4IAYA 2X4FA 3W18A 5TOZA 3CBLA 4XS2A 4FNXA 5FGKA 2ONLA 5BVWA 3DKCA 4EZ7A 3SLSA 1NW1A 2CNVA 5IA3A 2C5YA 2VX3A 2ZDTA 3MY1A 2DWBA 3VUHA 4ACGA 4CFFA 5LWNA 4ALWA 5KUPA 4BCFA 4CKIA 3A4OX 4NCTC 2JC6A 3CE3A 4I92A 1MQ4A 3QC9A 4GRBA 1OM1A 3VQUA 3R2BA 1H25A 3AG9A 3PSCA 3Q6WA 3OW3A 4DEIA 3R8PA 4X2GA 5D9HA 3TI1A 5HNIX 3HX4A 3ATSA 1XH7A 1ZMVA 4W4VA 3PXFA 3ZRLA 4BCGA 1XWSA 3V6SA 4Y83A 2PY3A 4RA5A 4HCTA 4EH6A 1J1BA 1ZOGA 3LCDA 3BE9A 5E1SA 5FTOA 2GTMA 1PXOA 4H05A 4BDFA 3MJ2A 2HXLA 4DCAA 4ITIA 3M1SA 1GY3A 4PDYA 3QHRA 4M7IA 3BHHA 3EMGA 4EOKA 1PMUA 2W1EA 2WTIA 5EDRA 1JAMA 3VF8A 3ORXA 4IMYA 1APME 4BICA 5DOSA 1SNXA 3FL4A 1Z9XA 1WBWA 3FC1X 4DH5A 3OUKA 4NSTA 1UNHA 4QMUA 3EB0A 3CQEA 4KIOA 2OIQA 4O7ZA 2HY81 3H9RA 3EN4A 3I5NA 3Q53A 3IDCA 5FTGA 4FTNA 5LMAA 4EOIA 1HCKA 3VUKA 3CTJA 4F0GA 4Y85A 4GVAA 5EQEA 2ITNA 2UZLA 3DK7A 3MTFA 3QTQA 4ERWA 5AIRA 4L01A 3SVVA 5HG8A 4GIIA 4EH9A 4I94A 1I44A 2JEDA 2PVRA 3TV6A 3FKNA 4K2RA 4U42A 4WD5A 4PWNA 1MRYA 3C4FA 4JAJA 4R1VA 3R9DA 4K77A 4ZP5A 5F1ZA 2J2IB 4TYEA 4MNEB 2FSLX 1J3HA 5J1VA 4AAAA 4W8DA 1OPKA 3O50A 3GEQA 4OT6A 3RAKA 4QTBA 4BTJA 5AMNA 2XIXA 5E8YA 1QPEA 2J90A 4GYIA 5HVKA 4AX8A 5CY3A 2JIIA 5AUYA 3SV0A 4WNPA 2BDFA 3PLAE 2BVAA 5CZIA 4XV2A 4E4LA 5DHJA 4R1YA 4NCTA 4O21A 5CVHA 4USDA 3WZUA 2YA9A 4I5PA 1YXTA 3NAYA 2O0UA 3QQKA 3LFNA 4MNFA 3G90X 4FZ7A 2GCDA 3GU6A 3LE6A 4RX9A 3KULA 5AV1A 5HIBA 4ZK5A 3PYYA 3VAPA 5JFWA 1TKIA 5AP3A 2YAKA 4LL5A 3BGPA 3ZRMA 3WZKA 4D2RA 2VGPA 3R8LA 3VS2A 5IQBA 2C5VA 5B2KA 3UMXA 1XO2B 2PVHA 4HGEA 4HYHA 2E9VA 4FI1A 3DB6A 2R64A 4AE6A 1DS5A 4CT2A 2YITA 5CF4A 3G0FA 2ITOA 4S33A 5L6PA 2BPMA 5KMLA 5DR2A 4PTGA 3P0MA 2XUUA 3E8NA 1SMHA 4YUQA 4I4FA 3CY2A 4FVPA 3MPTA 3UIBA 4RQVA 2IG7A 5EYCA 4ZJVA 5HESA 4QYHA 1IRKA 4E6CA 4KABA 4WHZA 3NX8A 3VC4A 5CT7A 5JGBA 5ICPA 4G34A 2W05A 2C3IB 3A8WA 5EHLA 4UWBA 3Q4TA 2C69A 4JBVA 2OK1A 5CAQA 5HKMA 4U44A 1WBPA 3QTSA 3NRMA 2B1PA 2OWBA 3Q96A 3DZOA 4QNAA 3HDMA 1PMVA 4FA2A 2C30A 3Q4UA 4C37A 3W0OA 4KSPA 4FTMA 2BHHA 3PXYA 3U6IA 3Q32A 3GU5A 2JKOA 4DGNA 4ZSLA 5E91A 2NP8A 4FG8A 4OTDA 4EYMA 5A4LA 5BUIA 2JIVA 3B8RA 4FV7A 5C8KA 4WO5A 2WOTA 3R0TA 3TL8A 3LMIA 4QP3A 1BL7A 3H10A 4TWPA 3UQGA 4RJ5A 3V5WA 3OWLA 5EQPA 4AN3A 2GNJA 3PPJA 3W8QA 4QQ5A 4MXCA 4CMTA 3H4JA 1H01A 2R3RA 4GL9A 4PDPA 4PMSA 2YWVA 4XMOA 3WZDA 2WPAA 1H26A 3G15A 4MD9E 4Y8DA 5AP6A 3TM0A 2X81A 3ZUVA 5A54A 4HOKA 4JR3A 4GVJA 2XIRA 4YJPA 4AFJA 2EXCX 2VV9A 3HAMA 4DHFA 1P4FA 2XB7A 5DIAA 4FSWA 5HU3A 3KK9A 1FINA 3ZXTA 5L8JA 2OGVA 3S1HA 3C4ZA 5D1JA 4ZZNA 2XM8A 4KA3A 4RIWB 4CT1A 2JGZA 2QU6A 2GSFA 2VTQA 2VWIA 3QKKA 3D83A 2VO0A 4GYGA 3KMUA 3NCZA 3ZM9A 3ZXZA 4DBNA 2Z60A 4KIPA 4L7FA 4U45A 3TEIA 3Q52A 5F4NA 5I9ZA 2XS0A 4KB8A 5HU9A 1L3RE 2A1AB 4BIDA 5AA8A 4PNKA 3G6GA 3QX4A 3EYGA 3LAUA 2YABA 3R1QA 1OUKA 4FIGA 4FSYA 4HNIA 2RFNA 3IONA 2V22A 1YDSE 5HG5A 4F70A 5CAPA 4P4CA 5IEYA 5JGDA 4G9CA 1OB3A 4L7SA 3UQCA 3COHA 1Z5MA 4MHAA 4L9IA 4G5PA 2HY0A 4APCA 4QMVA 2X2KA 5LVNA 4O2PA 3A61A 3VS6A 3ZZEA 4TPTA 5CASA 4O7VA 4O83A 4ZZMA 2YDIA 2GS6A 4O7LA 4U81A 4FBXA 3VNTA 3HV3A 4RPVA 3DXQA 1SVEA 2ITYA 4CEGA 3VULA 4OUCA 4YC8A 4F64A 4FIJA 4J96A 3HMPA 3JVSA 2WTKB 5T3QA 3FLYA 1FGIA 4OR5A 5AP1A 4RX7A 2XCKA 2F2CB 2CGXA 5HBEA 4CSVA 3TTIA 2Z02A 3WYXA 3QTRA 4JLCA 3FLWA 4W4XA 4FIFA 4QP6A 3D0EA 5G6VA 5TT7A 4UX9A 3DA6A 1T46A 5A4QA 2XK8A 3GCSA 3ELJA 3F7ZA 3C13A 3QTXA 4DG3E 1GIJA 1OL7A 3K54A 2W1IA 3RAWA 5FG8A 1UNLA 3IDBA 1QPDA 4GU6A 4N0SA 4BCQA 5LMKC 4IBMA 2PUUA 4QMLA 5M4UA 4G3CA 4OBQA 2C6LA 4MXOA 4MEDA 4K6ZA 1Y57A 3O7LB 3ULIA 3ZO2A 4QQJA 4AT4A 1JSUA 3EZVA 1P14A 3VW8A 2CDZA 2JITA 4R3PA 5FTQA 2BZJA 3O17A 3UVQA 3M11A 3OG7A 4QO9A 3I7BA 4Y5QA 3W8LA 3PE2A 2QQ7A 4J53A 2C1BA 4FEWA 5KHXA 2PUPA 3QLFA 5JKGA 2VWBA 4UALA 3UPXA 2VTHA 3WE4A 4DG0E 4AOJA 5LJJA 3FI2A 1Q8YA 2KTYA 2WQMA 3ZCLA 4XP0A 4AGUA 3QQJA 3EN6A 2C68A 4WNMA 5IMXA 4CRSA 5HZNA 3DAEA 4FSNA 3UZTA 3UO5A 3NAXA 4P5ZA 3WF5A 3QX2A 4JIKA 3WILA 4E93A 1U5QA 4FC0A 3FMDA 4FEUA 4A4OA 3ORTA 3OOMA 4I0TA 1BYGA 2X9EA 3FZTA 2GQGA 4FTCA 3LXPA 5AUXA 2WQBA 2BZHB 4RZVA 4TYHB 3AD6A 4FNZA 3F5XA 5EI6A 2XJ1A 4FKLA 4ZIMA 1MRVA 1Q8UA 3L8SA 4QMYA 3R7EA 4QMNA 2P0CA 3RKBA 4ZZOA 5AV2A 1OKZA 2WEVA 4K33A 4WUAA 5IA2A 3ID6C 4RIOA 5CF8A 1REKA 1FBNA 4BGQA 1OZ1A 4RRVA 3HRCA 3VS5A 4JAIA 2CGVA 4Q5HA 2I7QA 5GIPE 2QI8A 4USEA 2W9FB 3TNIA 4LRKA 3DLSA 4BCPA 3I4BA 2BZKB 4I0RA 2J50A 3D7TA 2X8IA 3ZYAA 4I23A 4ZTLA 2XIZA 5CWZA 4R3CA 2XNPA 2ITUA 3C4WA 3H30A 3UP7A 1AGWA 2R3QA 2UZUE 3VUGA 4ACHA 2J4ZA 3DCVA 3IW7A 1J7LA 2JDOA 4FKVA 4NZWB 3TUBA 5J9ZA 4E5BA 1H1RA 1JOWB 3V8SA 5LVPA 3GCUA 3NYOA 1W83A 3IG7A 4XEYA 5LVOA 4RIYA 2G01A 2XIYA 4UY9A 1OIUA 4KSQA 2O3PA 3WOWA 3F82A 1YW2A 1IG1A 4R7IA 3DFCB 5AAEA 1SZMA 3I6UA 3R71A 2B9IA 2O2UA 4PMMA 1OBDA 1H00A 4RQKA 4A9RA 3E3BX 2ZB1A 4D1SA 3BQCA 5CSHA 4E6QA 3PY0A 1P2AA 2YCSA 4TT7A 3HMOA 3ORIA 5AP7A 3SRVA 3U9NA 4ZMFA 4WZYA 2X8EA 2XKEA 3F3ZA 3MVJA 3VF9A 4AU8A 1YHVA 4A7CA 4DH7A 2VTLA 3JUHA 3KY2A 4NK9A 3U4WA 5HTCA 4RFZA 1XBBA 4YZBA 3SGCA 4MYGA 4MWHA 1LP4A 1YHSA 3EYHA 2GDOA 3BHUA 4A4XA 1GJOA 2GNHA 4BF2A 4C4GA 4HGTA 3RM7A 4O0VA 5JEBA 3UGCA 4FNYA 3PY3A 1BMKA 5IA5A 2WIHA 4U98A 4V01A 1E9HA 1XH5A 2HELA 3CP9A 3PJ8A 1OUYA 2IVTA 2LGCA 2P2IA 4FL3A 4P2KA 4C0TA 3GFEA 4ZLYA 5G1XA 2R3PA 3F2RA 3NR9A 4BDAA 5EYMA 1LR4A 2QOBA 4YHJA 3OXIA 1UU3A 3COIA 5HGIA 3S4QA 3LXLA 4NU1A 3R63A 4F1OA 4F9YA 3CPCA 5C26A 2JIUA 1Q62A 4BCMA 3W0NA 3FY0A 3AT4A 4Z3VA 3BGZA 3HP2A 3Q2MA 1MP8A 1AQ1A 4EOJA 4FV1A 4F9BA 3ATTA 3KCKA 1UWJA 5AUWA 1V0OA 1PKDA 1WBTA 4Y73A 4CMOA 3ZH8A 2QG7A 4IB1A 5CU4A 5DBXA 3K3IA 2RFEA 1M52A 4U8ZA 4FTUA 4JS8A 3ZSHA 5HD4A 3PXKA 4I20A 2HXQA 3F5GA 4FV0A 3S3IA 1KOAA 4DC2A 3CJFA 3FMKA 2BFXA 5HE3A 1M7NA 2EVAA 3ORMA 4LGGA 2BHEA 1KE9A 3I5ZA 2JD5A 4EHVA 3QBNA 4LUDA 3RK7A 4XCUA 1PY5A 4AZTA 1S9IA 2XA4A 1Y6BA 3QCQA 3SXSA 2XK3A 4ANMA 3U6JA 3OBJA 4QQTA 5FBOA 4II5A 4OTHA 4IAFA 2W5HA 3DJ6A 2C6DA 3OUNB 2G1TA 3JYAA 1M2QA 3BHYA 4MF1A 3PSDA 3PVGA 1IAJA 4C02A 1B6CB 2VO3A 3RM6A 3P7BA 3KXGA 1H1WA 3FLSA 1IA8A 4N70A 2VAGA 2DUVA 3RPOA 3SAYA 3MY5A 3DOGA 4FYNA 4BR3A 4UN0C 3QYZA 2XKFA 2QOHA 4S30A 4XLIA 4YTFA 1PXJA 4D0WA 5FP6A 3DXNA 2PHKA 3DAKA 4C4EA 4O7YA 2JKKA 2C0OA 2C6KA 4FSRA 4FKQA 4MWIA 4NIFB 5IQHA 4EKLA 5FQDC 4BY9E 3R8UA 3W2CA 2WQEA 2VZ6A 4NUSA 5C27A 4BN1A 4KD1A 3I0QA 4DF3A 4I93A 1YXSA 3R01A 1Y8YA 5IUGA 1KSWA 1ND4A 3OCBA 4PY1A 4E73A 4U94A 5E8XA 1AD5A 2ETKA 3Q9XA 4HZSA 2W4KA 4HVHA 3LMHA 5IUIA 4JDKA 2GNFA 3KEXA 3QXPA 4I1ZA 3HV6A 3U54A 4E7WA 2H6DA 4O7SA 4XG7A 2HYYA 1GOLA 3CXWA 4D2SA 4DEDA 3PVBA 4ARKA 4QT1A 4M68A 3F3VA 3RPRA 1TQMA 2AC5A 3JVRA 1JWHA 3HAVA 5I0BA 5HO8A 1UU7A 2VO6A 3TG1A 3LFBA 4LG4A 5L3AA 4X2KA 1UKIA 2QHMA 2VWXA 3EQPA 3NYVA 4A9YA 4AA5A 2XYNA 2VTTA 4JBOA 3PY1A 4IZ7A 3R9OA 4UWCA 3BBTB 3AXWA 4FG7A 4EH7A 2GNIA 3TZ7A 3R73A 1W7HA 4GIHA 4RC4A 2G9XA 3HA6A 4F7JA 3NUAA 4RG0A 4CVAA 1FVTA 3CGFA 3ZOSA 2WHBA 3ZBXA 2XJ2A 1R0PA 3QRTA 4PRJA 4F08A 3BLQA 2PVMA 4AOIA 4MVFA 4QMWA 3BWJA 3E5AA 3W2OA 4BGGA 4ZSJA 3COMA 2BUJA 2OLCA 4FZ6A 4XOYA 2XEZA 1GZKA 3HEGA 2UZTA 3ANQA 5JRSA 4M69B 1J7UA 1QPJA 4FODA 4ITHA 4MD8E 2VO7A 3FHIA 2VTAA 4H36A 4FSTA 4HCVA 2C0IA 4AQCA 3U6HA 4KIQA 4PX6A 4I22A 2OFVA 2CGWA 2B53A 5M44A 3TWJA 3L9LA 4YP8A 3VHKA 5CAUA 2Z7RA 3DB8A 2ETRA 3SHEA 3UNKA 3D5VA 3OD6X 4FR4A 5KHWA 4CFMA 4AW5A 1O6YA 3TUCA 1CKPA 3NW5A 4FV2A 1S9JA 2QOOA 3ZUUA 3K5VA 3VRYA 3HRFA 5CU0A 2BRHA 4TW9A 2W99B 4HJOA 3IW8A 4I6QA 5AV4A 5KKRC 4AT3A 1XH8A 2Q0BA 1YDRE 4RIYB 3UC3A 4GU9A 3GCVA 2RFSA 4AXAA 1ZY5A 4UB7A 4D1XA 1P4OA 3G6HA 4UEUA 4IW0A 3MFTA 2VD5A 4YJQA 4S31A 2B54A 2XBAA 4UV0A 4I6HA 5AUUA 3BYOA 4GT4A 2FH9A 3NGAA 3ZFYA 4AA4A 5EW3A 4ZTMA 2X7OA 1H08A 3OTVA 2QHNA 4AZFA 5L2SA 2IWIA 2W06A 2IW6A 2CLXA 2Y9QA 2OU7A 2VWWA 2ZV9A 3D7TB 4EJ7A 3H0ZA 3FZSA 2ONLC 3LCSA 3FZ1A 4FICA 4RLLA 5M55A 2ITXA 4NM3A 3ZLSA 3TNHA 4EC9A 2ZDUA 4NTTA 2OSCA 4O7NA 3DBDA 4YZCA 4YNOA 5F94A 5GNKA 4FTOA 3R83A 4HVIA 2RGPA 5C4LA 4ALUA 2YWPA 2GHMA 4UWYA 4C4FA 5IF1A 2Y7JA 3R8MA 3H9OA 3DBCA 4FVRA 4AGWA 3NUUA 4D1ZA 2WMTA 5DYJA 4DH3A 5IDPA 4EONA 3QLGA 2BFYA 4FTAA 4WSYA 2G2HA 3ORLA 3RZBA 3CLYA 2QOIA 4QTDA 5KMOA 1U59A 2VTNA 2XVDA 4J97A 4QYEA 4BB4A 4IAIA 3LJ1A 3AT2A 3UE4A 4FKUA 4IZAA 3OTUA 1E1VA 4CXAA 5K5NA 4FV4A 4RX8A 1SVHA 3Q2JA 4O96A 4BCJA 3C5IA 1WBOA 3D5XA 4HVSA 5H8GA 3QZIA 3EN7A 3FMLA 2UW4A 3PPZA 1GZNA 4FGBA 5A4TA 3NUPA 3VJOA 4Y5HA 5EM7A 4BCOA 3R7VA 5HD7A 3PJ2A 1ZWSA 2YIWA 1G5SA 3SX9A 3UNJA 3SA0A 1CMKE 2QO9A 3QTIA 4A4LA 4BTFA 2QURA 1SVGA 4BDGA 1PXPA 5KMJA 4ENXA 5M56A 3CPBA 3QQGA 4UZHA 5DT3A 3OEZA 4IACA 4B4LA 3GNIB 4D5HA 3ZO3A 2W4OA 3ZC6A 2HENA 2PZ5A 2VX0A 4KKGA 5ANGA 3RK5A 4DGLC 3BQRA 3W0MA 5CYIA 4C4HA 3EFJA 2IVUA 3TN8A 4G6NA 4TY1A 2O65A 4D5KA 4L53A 3KB7A 2FO0A 3P7AA 4I24A 1IASA 4IJ9A 4IWDA 3WIGA 4D55A 5HX8A 2QVSE 3W55A 4Z7HA 1H1PA 3SG8A 5EDQA 4EHGA 3R8ZA 2QNJA 4HGLA 3LXKA 3QGWA 4EZ3A 4W4WA 4BDKA 1YWRA 3N51A 4ZTHA 5B7VA 1ZMWA 4JX3A 4HCUA 4IFGA 4UYAA 4AG8A 3R04A 4OLIA 1LUFA 2R3MA 3OF0A 2X6DA 1Q8WA 4FMQA 4D4SA 4KBKA 4PP9A 2GQRA 4F65A 1EH4A 2W1GA 5IH5A 3FV8A 4FL1A 4FSUA 4IANA 4L67A 4LFIA 3F6XA 4EYJA 5B2MA 2OF2A 3FZPA 2PZPA 5TKDA 5T6KA 1PMEA 3CTHA 3KN5A 3QTWA 3SG9A 4FIIA 4EOQA 3GC0A 4NM7A 3I79A 4YTCA 4EUUA 5DE2A 3UOJA 4AN2A 5D7VA 2WB8A 4ASZA 5JQ5A 3PPKA 5JQ8A 5AAFA 3EQBA 3MY0A 5J95A 3C0GA 3NW7A 3DLZA 4C2VA 4D9TA 1KE5A 2AUHA 5BVOA 1ZARA 4RC3A 3SKCA 3U55A 1ZOHA 4E5AX 2OFUA 4A07A 1O6KA 2HWOA 2R7BA 1QCFA 2CLQA 3IS5A 3R02A 4EK4A 4L44A 5CU2A 4EOSA 3FKOA 3C0HA 3AMYA 3IGOA 4CTCA 3VO3A 4XG3A 5KMNA 4JRNA 4L42A 1OPJA 3NDMA 4RWKA 3BV2A 4ZSAA 2YHVA 4XYFA 3ROYA 3NLBA 5EM8A 2NRUA 3W0PA 1ZLTA 3S2PA 1FMKA 1WFCA 1ZY4A 3NNXA 2FVDA 3CGOA 3ORKA 4J71A 4BZOA 4DFNA 4MCVA 4E20A 5CU3A 5A4CA 3ODYX 3CJGA 2G2FA 4XOZA 2PE0A 2WEIA 3IKAA 4D4VA 5F9EA 5A4EA 3PTGA 4PF4A 3KRXA 4IB0A 4G17A 4EEVA 3TYKA 5EM6A 5ETFA 3EQFA 1U46A 2C6OA 4YR8A 3LQ3A 4WRSA 5E8ZA 3LQ8A 4IX4A 4O0YA 3K2LA 3OCGA 3QYWA 3PA3A 4FIEA 4V05A 5DI1A 2F9GA 5TR6A 3RVGA 4MBLA 3P23A 1XH9A 2BDJA 4GK2A 3L9PA 3F66A 4NFNA 5BUEA 2F49A 4FZFB 3EQIA 4XBRA 2XK4A 4IVCA 4AACA 4CFUA 1TQPA 4RLKA 2VN9A 4BI2A 4KBCA 4YC3A 1H24A 4NW6A 3OBGA 2FSTX 4YZNA 3UIXA 4TL0A 2H96A 2BAJA 3MIAA 4FTIA 3KVWA 4I41A 1WVYA 3QFVA 5DRDA 4CNHA 3H0YA 4HYIA 2DQ7X 2QU5A 4TZRA 3FAAA 3W2QA 2REIA 3GQIA 3ZUTA 4MXXA 2ITQA 2CNQA 3UVPA 2BRMA 3TJDA 3E7OA 3QA8A 5CXHA 5I9WA 1PXIA 2WMUA 2X7GA 2ESMA 3LW0A 5BYZA 3D14A 5DEYA 3DKFA 2W1DA 4E6AA 2W1CA 2P55A 3MFRA 4IAZA 3NIEA 3C51A 3GCPA 5ANJA 3CIKA 2UW0A 2BDWA 3BEAA 5DPVA 5CS6A 3BIZA 5FEQA 3FEGA 3MESA 4ZSEA 2JDSA 4XG4A 5IPJA 3DJ7A 3G2FA 3HMIA 4ITJA 4OW8A 3PXZA 2ITPA 4GFOA 1NY3A 3NMUF 4USFA 3MFSA 2W7XA 5LOHA 4FKOA 4E4XA 2OKRA 5KE0A 3N9XA 4ZMEA 4DG2E 4CFWA 4QMQA 3A8XA 3DBQA 4JI9A 4BDIA 5IA0A 5CQWA 1REJA 3A7GA 4ORKA 4X7QA 1XH4A 2HZ0A 5JH6A 5HE1A 3W0RA 3OFMA 2RG6A 4HPTE 2VGOA 4C35A 3JY0A 3NEWA 4YPDA 1UA2A 4DH8A 4G3FA 4X3FA 4GG5A 4BDCA 2YZAA 3P5KA 2UUEA 3Q9ZA 3TIZA 4E26A 2B4SB 4C33A 3MI9A 3NNUA 4XP3A 2PZRA 4XH6A 4YLJA 5J87A 3HA8A 1JBPE 4YHFA 3PWYA 4HNFA 4AWIA 2PULA 3HP5A 2FSOX 3GB2A 4RIWA 3DT1A 4LMUA 2QG5A 1KWPA 2YM4A 3FDNA 3N4VA 4Z9LA 3ZSGA 4ASEA 2W96B 4RC2A 4FG9A 3MH1A 2P2HA 5EOBA 5AX9A 2W17A 4NKSA 2CHLA 4CRLA 1ZYDA 4ID7A 4OBPA 4A9SA 4IC7A 1WBVA 1PXMA 4NKAA 3QWKA 4J95A 1OIRA 4F6SA 3KKVA 1H4LA 1RJBA 2AC3A 2PSQA 4GK4A 4I6BA 4QMMA 1V0BA 3FJQE 4U80A 4OGRA 5A9UA 3BYMA 3PVWA 4S2ZA 5FXRA 4IHPA 4NT4A 5D7AA 3V01A 3GVUA 4MXZA 2ZM1A 3FWQA 3RJCA 4EH8A 4M12A 1Q41A 2W4JA 3QCYA 1W8CA 5AADA 1IA9A 4U9AA 4EK8A 3ITZA 1KV1A 3D5WA 3GUBA 2R0IA 3II5A 5AX3A 2OF4A 2BAQA 5BYYA 4ACDA 4QMSA 2R0UA 4ACMA 4BYIA 4BZDA 3R9NA 3VWAA 4EI4A 3DPKA 5IEXA 1K2PA 3BU6A 4XRLA 1IEPA 4EQMA 4U97A 3VRZA 1NXKA 2V5QA 3RPSA 3GQLA 4ZXTA 4MTAA 4BIBA 3HUCA 4GT5A 4JG8A 4QTCA 3OEFX 4FGRA 3UIMA 4NW5A 3KRWA 4JNWA 2F7XE 3FZRA 4FT7A 3MPAA 4FSZA 3FMNA 1JQHA 4X6RA 5HQ0A 3VBYA 4U7ZA 4FV6A 3E8EA 2BKKA 5CVFA 2UW6A 3HLLA 3PRIA 1R3CA 4YLKA 5IA1A 4C61A 4JT3A 5ACKA 4CZUA 3KMMA 1WVXA 4AA0A 2W0JA 4JG6A 4HYSA 3U87A 2OZAA 3OZ6A 4RX5A 3QALE 2OZOA 3OT3A 4D58A 5C4KA 3OCSA 2W1FA 4IEBA 4CD0A 4BDDA 4HGSA 3RALA 2IZSA 4G5JA 5H8BA 5KBQA 2OJJA 5JRQA 5DRBA 4UXQA 3ZFMA 1RQQA 2YDKA 3VBXA 2ZAZA 1YXUA 2G15A 3FLZA 4TYGA 3BWFA 3A4PA 3LFDA 3BKBA 3TTJA 1PMNA 4BCHA 2HW6A 3MIYA 2HK5A 3JY9A 4BDBA 3LFCA 3ORNA 3AMBA 3T3UA 2PU8A 2VNWA 4YNEA 3D4QA 4OTIA 5HLNA 5LWMA 3OHTA 5M4FA 1ZZ2A 4DE4A 4IAKA 3TV7A 4LM5A 4R78A 4ENYA 2XH5A 3MVHA 3VS7A 4F6UA 5CEOA 4CG9A 3UBDA 5DR6A 2BR1A 1Q61A 3TKIA 2CMWA 4MQ2A 2YM6A 2C6TA 3ZS5A 3D7ZA 2OICA 3WARA 2LAVA 2OZAB 4FE2A 2KULA 4DBXA 2VWYA 2OH4A 4FT5A 4L3LA 4QTEA 2WXVA 4XBUA 3V5LA 3QL8A 3H9FA 4EBVA 3EIDA 1YHWA 2QONA 2IO6A 2WU6A 2PVNA 3KCFA 4YBKA 5HBHA 4LYNA 4QMXA 4MAOA 3GC7A 4GCJA 3WYYA 4A9UA 3GXLA 4E5WA 4JDIA 3GP0A 2RG5A 2EXMA 4KS8A 3FYKX 5EKNA 4KNBA 1NT2A 4FV9A 1B39A 5E92A 5BUJA 4MXYA 3VBTA 2YN8A 3GGFA 2GMXA 2OIDA 2YCFA 1L8TA 3LFQA 2WTCA 2VTIA 4U40A 5ETCA 4F9CA 4X6QC 3PZHA 5C8NA 3AGMA 1W82A 3FHRA 3ZLXA 3THBA 5IDNA 2CCIA 4IWQA 3TNPC 4AOTA 4YU2A 5KKRB 4J98A 4AS0A 3LCKA 4D9UA 4QMPA 3UOLA 3DU8A 3OP5A 4O7RA 4K1BA 3LLTA 3G0EA 1U4DA 1XH6A 4JQ7A 4DFBA 3ZMMA 5DA3A 4MD7E 4F99A 4RVKA 4CCBA 2B9FA 3BYVA 2XNGA 5HCXA 5ANKA 3P4KA 4PDOA 4QNYA 4C59A 3FSKA 3HVCA 4C4IA 4C62A 3JR1A 4P7EA 3MB6A 5FUTA 3VUDA 2OH0E 2VU3A 3ZSIA 2R3HA 2J6MA 3BZ3A 3KL8A 1J91A 4HPUE 2WTJA 4XG9A 4YJOA 4NYEA 4H1MA 5F20A 4H1JA 1KOBA 4L45A 3V8TA 4HW7A 5J5SA 2XCHA 2PUIA 4I21A 2PE2A 3KRLA 4RGJA 3UYSA 4BBMA 4MKCA 4EH5A 4H58A 4F7SA 5L2IA 4OTFA 1LEZA 3C5UA 4IM2A 4JJRA 1PXKA 2UW9A 5T68A 4R3RA 4RBLA 3V5TA 2JDRA 1OMWA 2BMCA 2IN6A 2WFYA 1Q4LA 1FOTA 2PPQA 4KRDA 3UC4A 4E4MA 3DQWA 4FEQA 5KMKA 1JKTA 2RFDA 2WMRA 5D11A 4U41A 2YM7A 3FYJX 4YHTA 5HCZA 2PMOX 2FA2A 3SOCA 4DGMA 4C58A 5I9VA 3CC6A 2C3KA 4EOOA 3EH9A 1M14A 5EDPA 4BCKA 1WBNA 3KRJA 3WF7A 1ZMUA 4IX5A 4AN9A 5AP5A 1YXVA 4GUBA 4ZTQA 4P90A 2WQNA 5BYLA 5IH4A 3QUDA 3P79A 3SXRA 3KFAA 3DAJA 3PP1A 3AC2A 4O0UA 3PFQA 1UV5A 4JX7A
chains in the Genus database with same CATH superfamily
4BJJA 5L2TA 4EC8A 4IFCA 3A2CA 1JSVA 3TCPA 4X3JA 2YCQA 4C3PA 4AFEA 3A7IA 2IW9A 2GHGA 4ANLA 4DFUA 4EH3A 3TDVA 4BVUA 5M08A 2R2PA 4NTSA 1KE8A 4JG7A 4R5SA 3LVPA 4DFYA 3ET7A 4EHZA 1ZYSA 2OG8A 2PMNX 3AMAA 3U9CA 4IH8A 3OC1A 5FD2A 1J1CA 3AC1A 1DAWA 3DKOA 3NPCA 2WMWA 2B0QA 2OJIA 5JSMA 3O8UA 1TVOA 1W0XC 2FYSA 3E7VA 4PTCA 5D10A 5IG1A 1FPUA 2X8DA 1BX6A 2XM9A 4PTEA 3RWPA 5CI7A 1RDQE 1H1SA 4PQNA 1U54B 2J5FA 4B0GA 3AD5A 2P33A 3BPRA 5CQUA 2R3KA 4FKGA 4V0GB 3PE1A 4JDHA 2F4JA 4GKIA 2BRBA 3GFWA 2I1MA 1WZYA 3KA0A 5EI2A 4J8MA 2I0YA 5EYDA 3G51A 3MH2A 5E7RA 3DK6A 5ANEA 3FMJA 5CEQA 3KGAA 4XV3A 3BGQA 1YWNA 3FLQA 4DLJA 4ZTSA 4O22A 3VIDA 4X3FC 3K3JA 3CKWA 4M0ZA 1OI9A 4WIHA 2VUWA 4H3PA 4V04A 2XNMA 5DH3A 4F4PA 2GFCA 1JSTA 4YURA 4DGGA 3HMNA 3LCTA 4EORA 4CTBA 2YFXA 3FMHA 4S32A 2XRWA 2UW7A 4NJ3A 2BZIB 3PIZA 4QOXA 1KE7A 5I4NA 4TTHB 5E90A 3SQQA 1YI6A 3I7CA 3W16A 5LXMA 1OPLA 2IZTA 3EFWA 3W33A 1PF8A 5LQFA 5M09A 1UWHA 1YOMA 3VS0A 2PMLX 3I6WA 1OKWA 2QOFA 4GJ2A 4PDSA 3UIUA 1GZ8A 1OL5A 3CTQA 3P9JA 3FKLA 4GMYA 4K11A 3DTCA 2HW7A 3G5DA 3HZTA 5HNGA 4Z7GA 5KBRA 2QD9A 2B9JA 2VTMA 4FYOA 3UZPA 3C4EA 4QP2A 5A14A 4IX3A 5EI8A 3HNGA 2R9SA 3PRFA 3Q9YA 3DQXA 2WKMA 4C2WA 5JZNA 4UYNA 4R7HA 3UDSA 4G3EA 3P7CA 3KVXA 3Q6UA 4NM0A 4C4JA 4F1TA 3QCSA 3VQHA 5EOLA 3O23A 5CU6A 3GC9A 3DGKA 4FTLA 5LCKA 4FKWA 2R3NA 4L00A 3M42A 4PL3A 1PHKA 4Q9SA 3EL8A 4FEXA 5HCYA 4O86A 4IWOA 3TACA 3DBEA 2AEGA 4L46A 1QL6A 2Z7QA 4IC8A 4RVMA 4XJ0A 5ANDA 5E8WA 4ZY5A 3BCEA 3MWUA 5ANOA 4YMJA 4RVTA 5FRIA 4MK0A 2WMSA 2P3GX 5BMMA 4Y95A 3ZRKA 3GBZA 4ZS4A 3R8VA 3WBLA 2WZJA 4IM3A 5EHYA 4FTRA 4WOVA 5D12A 4DTKA 4BHNA 1DI9A 4FKJA 4O0RA 2CKEA 4X2JA 4IVAA 4RFMA 3CSVA 5HI2A 2C5XA 3EL7A 1PYXA 2X6EA 4G16A 3W0QA 2NRYA 3DDQA 4TXCA 5CX9A 1JVPP 4G1WA 3RTPA 1F5QA 2QR8A 3RPYA 3DKGA 1CSNA 2GPHA 4JIAA 2QLUA 3Q04A 3HKOA 4IADA 4ZLZA 4IZ5A 2XIKA 1FVVA 3QRUA 4L43A 3ZM4A 5IU2A 5LMKA 3GCQA 3AGLA 3QKLA 5AWMA 3KF7A 5CXZA 2HZIA 1KUTA 4S34A 3QRJA 4BI1A 1IR3A 1ST4A 1ZOEA 1RE8A 2ZJWA 4BTKA 3NSZA 1FVRA 3ORPA 3ZZWA 4FV3A 5H2UA 2OW3A 1YRPA 2J0KA 5M4CA 1YOLA 3NNVA 3NS9A 3LFSA 5L2WA 1H07A 2HAKA 2XNEA 4GFMA 3EJ1A 4ALVA 2JFMA 3W2PA 5CEKA 5CT0A 2W1ZA 3O5AA 4I5CA 4BCIA 4L3JA 2VWZA 5E4HA 5HIEA 2Y4IC 3HMMA 3MS9A 5KZ0A 1OGYA 2GTNA 2IPXA 3FBVA 2I6LA 4XLVA 4EZ5A 3QD4A 3PG3A 5L6WL 4QMZA 5HEZA 2FUMA 3FPQA 4F7LA 5J9YA 5CVGA 1YXXA 3OW4A 4FKRA 4KAOA 2PZIA 3FXZA 3DFAA 1Q3DA 2UZWE 2ITTA 2XK7A 5C03A 4EK3A 5BX0A 5CZHA 1I09A 3FI4A 1OITA 4DFXE 3W0SA 5HO7A 2WOUA 3FQEA 2V7OA 3LJ0A 5LMBA 1Q24A 1YOJA 2Y4PA 3LKMA 1GZOA 4DGOA 1UVRA 3PA5A 4QMOA 3R30A 3R7UA 2CCHA 3QUEA 4I4EA 3L8PA 4IB5A 2J51A 4N6YA 3QKMA 4K0YA 1SM2A 5AEPA 4RJ3A 5E1EA 3NNWA 5IA4A 2J0LA 3S95A 3ZFXA 1MUOA 4YPSA 2X1NA 3G9LX 4EHEA 5CSPA 4CV8A 5GJDA 5HE2A 1QMZA 3P78A 4WNKA 4O6EA 4EL9A 4OTGA 2JBPA 3L9NA 2UZBA 4TNDA 2B7AA 2F7ZE 3UDBA 3UMWA 4ANSA 5AIKA 2PVJA 3O71A 1OL6A 2FB8A 2CN5A 3V51A 1YDTE 2CGUA 1URCA 2BRGA 2ERKA 2YDJA 4KINA 1BLXA 2VNYA 4JBPA 4AXDA 3F3TA 3DS6A 1LPUA 4Z55A 2VRXA 3ZDUA 3O96A 2QCSA 2VTSA 3K5UA 3UPZA 2UZNA 4JXFA 2WNTA 5CLPA 1TQIA 4RSSA 3OXTA 4YSMA 5M53A 2XF0A 2XZSA 1GIHA 3E64A 4H39A 2EB3A 4BI0A 4I5HA 4HVDA 3VW6A 4BKJA 1VZOA 1T45A 3KULB 4LI5A 3RK9A 4IWPA 1K3AA 1Z57A 2UZOA 4L6QA 3SRVB 3LM5A 3ACJA 4CFVA 4CLIA 3F5UA 3D5UA 4H3QA 3BV3A 3ALOA 4FKPA 4R5YA 5LARA 2IZRA 4DINA 5FDXA 3E8CA 3O0GA 5JFVA 4O6LA 3PVUA 2BRNA 2XBJA 3VHEA 3GU8A 3IW5A 3Q5IA 4YGAA 3C4XA 3W2SA 3EFLA 4CFNA 4FKIA 4BDHA 4HZRA 3VUIA 5KZIA 2ZM3A 2XNBA 4ANBA 4O0SA 2QKWB 2CSNA 2A27A 4KBAA 4DITA 1WVWA 3EKKA 5JMSA 5HE0A 2H8HA 1V1KA 3Q9WA 5H3QA 5J8IA 3OOGA 4F1MA 3RP9A 3RNIA 5IQIA 1H27A 4TWNA 2VTJA 2BIYA 2Q83A 1M17A 4I6FA 5IEVA 3BYSA 2VWVA 4JQ8A 3RHKA 5EHOA 5CEMA 3UOHA 3OT8A 3V3VA 3N4UA 4RIXB 2V55A 3NFFB 4RA4A 3RMFA 2UVYA 5H9BA 2JFLA 4FNWA 3KU2A 4N4SA 2R4BA 4BTMA 2X2MA 1YQJA 4G3DA 4GV1A 4FSQA 3VBVA 4CLJA 3F3WA 3FE3A 3CQUA 3C9WA 2YAAA 3RCDA 2XKCA 3LM0A 5C01A 3TZ8A 4NH1A 3WZEA 4C3FA 4PNIA 5B0XA 3BBWA 4EOLA 3LZBA 3MBLA 4E6DA 1HCLA 5HORA 2PVYA 3MN3A 2QO7A 3MSSA 4FTQA 4U3ZA 3W1FA 4B99A 2YJSA 1M7QA 2A4LA 2OBJA 3RWQA 5IZFA 5DNRA 3KREA 5KX8A 1A9UA 3HL7A 2JKQA 4FZDB 3VS4A 2YCRA 4AZEA 2HWPA 3Q4ZA 1VYWA 4UZDA 4I3ZA 3R6XA 4O81A 3TZMA 3DXPA 3RGFA 4DT9A 3HECA 4RZWA 5CTPA 1VLRA 3KQ7A 4PMTA 2OXDA 2GNLA 5IQAA 4DEGA 4M15A 3AT3A 4RJ8A 4E4NA 3NUNA 5JN2A 4M13A 5LVLA 3EWHA 2YM8A 1ZZLA 3R1YA 5IQCA 2WMAA 4IJPA 4D0XA 4AW1A 2HZNA 1CTPE 3GC8A 4ZTNA 5BVEA 3MW1A 4M14A 3ZLYA 4YO6A 1NVRA 2PVLA 4ZLOA 3S00A 4IAAA 1PKGA 4WRGA 3HV7A 4IIRA 5CSVA 2QOLA 4U5JA 1JNKA 2X4ZA 4IVDA 1R39A 2JAMA 3QAME 4RWIA 2ZOQA 1Q8ZA 3QHWA 4IDVA 2UZVA 3BEGA 4P5QA 4ERKA 5M06A 3OY1A 4WA9A 2C3LA 3BRBA 5BV3A 4LQMA 5DLSA 3AD4A 2WMVA 3IOPA 5BMSA 1MRUA 3WIKA 3LFEA 4G6LA 4QP8A 1F3MC 2BROA 3A7JA 3VS1A 4F9WA 3E88A 4NWMA 3ERKA 3NVMB 4Z16A 3F7WA 4Q2AA 2H34A 4TYIA 2ZV2A 3A99A 2YJRA 3LFFA 4F63A 3DNEA 4R6VA 2AYPA 3FSFA 2PZYA 4JDJA 4YZDA 3LPBA 2P4IA 4QPAA 3LMGA 5K4JA 2NNWB 3NUYA 3WE8A 5A46A 3MVMA 1P5EA 3DJ5A 3LQ5A 2OO8X 3FY2A 4EQUA 4A06A 5L6OA 2ZFYA 2JBOA 3HUBA 4ZAUA 2O5KA 1DAYA 1DM2A 4IDTA 5EW8A 2IW8A 2Z2WA 3FL5A 2F57A 3LXNA 4K18A 3AC3A 4ANQA 2XK9A 3GOPA 3KIOC 2DS1A 4QTAA 4O0XA 4U6RA 5BVNA 3C1XA 3EQHA 4TWCA 5CAOA 2PL0A 3EQCA 5L8LA 2CN8A 4FTTA 4FKTA 5M07A 3NZ0A 1Q5KA 4NM5A 3QD3A 4FIHA 2EWAA 2IVSA 4GT3A 4FTJA 4XG2A 1O9UA 1VEBA 2C5OA 4R7BA 3WF8A 4FV8A 1XKKA 4BYJA 2XP2A 1YI3A 2PTKA 3UO6A 3PZEA 3PDTA 1JLUE 5CNOA 4ACCA 2WU7A 2YZLA 2GNGA 5I9UA 4FT3A 5J1WA 4DEEA 4TYHA 3WZJA 4DN5A 3QC4A 5AV0A 5FM3A 3DY7A 4LOPA 3ANRA 3HV4A 4O91A 3OCTA 4GS6A 2X9FA 3VS3A 2ZM4A 2V7AA 3FMMA 5AM6A 4F7NA 2W9ZB 3MA3A 4GUEA 2A0CX 3CR0A 3F2AA 4A9TA 3KK8A 4W8EA 4L52A 3DNDA 3IK3A 4XG8A 4EWHA 4IQ6A 3QZFA 3KXHA 3BI6A 4M67A 3QD0A 4LDTA 5E9EA 1PXNA 2J7TA 5TF9A 3KRRA 4CKJA 4WG4A 5ACBC 5HNBA 3ODZX 2ERZE 2PYWA 4AZWA 3ZU7A 5KNJA 2BKZA 2X2LA 2J0MB 2WTWA 2J0JA 2WTKC 5IH6A 2X39A 4QYGA 4XX9A 2RF9A 4RFYA 4FTKA 5CSXA 2WMQA 3E87A 3MH0A 3Q5ZA 3FMEA 3L8VA 5CNNA 4Y46A 3MB7A 5E8VA 3V5QA 4BGHA 3JXWA 3PUPA 2IZUA 3QF9A 5EYKA 5HVYA 4F0FA 1R78A 1KE6A 2ITVA 4IB3A 3UP2A 5HIDA 1PXLA 5EG3A 4HVGA 5I9XA 3BE2A 1Y91A 3R2YA 4L3PA 4X3FB 4NL0A 4C3RA 2PUNA 3FXWA 4XV1A 2ITWA 4C7TA 3FXXA 3ORZA 5HVJA 1UNGA 4RJ6A 4WKQA 3F69A 2JLDA 4ZEGA 2W5AA 4DTBA 3B8QA 3OVVA 5IQEA 2ZVAA 2GQSA 4GKHA 4IZYA 3V5PA 3E3PA 5D41A 4ONAA 4ZTRA 3BYUA 3UO4A 3A7FA 5GJGA 2YACA 2QKRA 3BU5A 2Y8OA 3DV3A 3TNWA 4N6ZA 3PXQA 2WAJA 3FI8A 3HGKA 1PW2A 4J7BA 4M97A 3EKNA 2ACXA 4WBOA 1OKYA 3R7YA 2ZMDA 4QYYA 3I60A 3OWKA 5GIOE 2RIOA 3IW6A 4E1ZA 2X7FA 5GJFA 3R28A 4YZ9A 5CAVA 5M4IA 4IE9A 5ETIA 5M51A 3GU4A 2I0EA 3F9NA 4QYFA 4X0MA 3TKUA 3QQHA 3R7OA 4B8MA 3QUPA 3QQFA 2XRUA 4EOPA 1OIQA 1JKKA 3AKJA 1JPAA 3UG2A 2J9MA 5K9IA 2C6IA 1FGKA 3M2WA 3NYNA 3QTUA 2O8YA 3EFKA 3QA0A 3PP0A 4TRLA 2Y0AA 4KKHA 4WBBB 4LV5A 3VUMA 5CEPA 3LOKA 5HG7A 3U4UA 5L8KA 2SRCA 3T9IA 4GJ3A 4D28A 4AAYA 3TJCA 4XHKB 1YWVA 2OJGA 3C7QA 4F6WA 3ACKA 3CKXA 5LVMA 3IW4A 3DDPA 1ATPE 5HX6A 4O7PA 3GT8A 2UW5A 4FZAB 2R3GA 2QODA 3VBWA 5M57A 3QWJA 4F0IA 3CD8A 4X2FA 2HZ4A 3ULZA 2G2IA 4EK5A 4F9AA 5AP4A 3G33A 4FKSA 1ZYJA 3HDNA 3NYXA 2WTDA 3C0IA 3V6RA 4AT5A 2ITZA 1FQ1B 2PWLA 4Y72A 5AP0A 4FEVA 4B7TA 2E2BA 2V0DA 3QRKA 1ZYLA 2JAVA 3MTLA 2YIQA 4I5MA 1F0QA 1UU9A 4JOAA 5HBJA 3QZGA 1NVSA 5AJQA 1B38A 4ZY6A 2C6EA 3PWDA 4G2FA 3F3UA 4ZY4A 2Y6OA 4KKEA 4XUFA 4JBQA 1SNUA 2XK6A 3FQSA 5DT0A 4O2ZA 3VVHA 3EZRA 5A3XA 3SW7A 4FV5A 3ZHPC 4O7WA 4JVGA 3OWPA 4LL0A 3FLNC 3ZLWA 4AZSA 5GINE 4FT9A 5JGAA 1OIYA 3NVKI 4DH1A 2QOQA 5CEIA 4PUZA 3NIZA 3GENA 4CFXA 1H0VA 4GG7A 3EHAA 3UYTA 4C38A 3QZHA 3RCJA 4DFZE 2VWUA 3D2KA 4FUYA 3WF6A 5A6OA 5E8UA 4I0SA 1U54A 4M0YA 2JDTA 2Y6MA 2UV2A 4BBEA 1A48A 4WG3A 5KMIA 3ENMA 2Y4IB 2OJFE 3SXFA 2BAKA 3VN9A 2HOGA 3ETAA 3ZO4A 5EFQA 1ZAOA 3ZEPA 2XMYA 4DHZA 5FP5A 1W98A 1OVEA 1Y8GA 2Z8CA 4CG8A 2O64A 4O27B 4JRVA 3QGYA 3FC2A 3I1AA 4XRJA 1G3NA 4J8NA 3PJ3A 5FXSA 1V0PA 3HRBA 2B55A 5H8EA 4EH2A 5IQFA 3IQ7A 5EM5A 3SDJA 2BCJA 3F88A 4QP9A 3KXXA 3L8XA 2J5EA 2C0TA 4DEAA 2J0IA 5DWRA 2GFSA 3V5JA 3TV4A 4FOBA 2GHLA 5BVKA 2R3IA 3P08A 4WNOA 4B8LA 4RWLA 4YBJA 4EK6A 2XALA 2R3OA 3CD3A 4LRMA 1CKIA 2RKUA 2NPQA 3CQWA 3MH3A 1R0EA 4GFGA 3UJGA 3KMWA 3QD2B 1WBSA 4QP1A 3W2RA 5CI6A 4R77A 2WGJA 3KXMA 1H28A 2XYUA 5CSWA 3NUXA 2UVZA 1CM8A 4L8MA 4YJUA 5I9YA 5DFPA 3BX5A 1NVQA 2A2AA 2WTVA 3AOXA 3BELA 5EW9A 2HIWA 1Q8TA 4DHIB 3AKLA 3EQDA 4IVBA 3AC8A 3QXOA 5IUHA 3RAHA 2W1HA 3F2NA 1UKHA 4D4YA 4YJNA 4YSJA 3LIJA 3REPA 5KMMA 4O0TA 3PA4A 3JS2A 4UBAA 3PIYA 1OBGA 4AZVA 5FEDA 3RPVA 3EQRA 4X2NA 1BI7A 4EUTA 3QQLA 4EH4A 4FSMA 3SD0A 4B9DA 1X8BA 5AP2A 3R1SA 3OY3A 3CEKA 4K9YA 4QRCA 3PSBA 4KS7A 1OGUA 3FPMA 3ML1A 3T8OA 4KRCA 3D9VA 4DEBA 1Q99A 4O82A 3SC1A 5AV3A 4DA5A 2YIYA 3R21A 5DR9A 4APPA 4B6LA 4DTAA 5J7HA 3PG1A 2GS7A 3R9HA 1YKRA 1XBCA 4DCEA 5K5XA 3AC4A 1GIIA 1YVJA 2WMBA 3NWWA 2FSMX 4D4RA 3MA6A 1ZXEA 3QRIA 5BVDA 1W84A 2A19B 4G3GA 2QC6A 3R9RA 3UTOA 3ZDIA 4BZNA 3TIYA 2WD1A 5CANA 3S0OA 3MGYA 3P1AA 4TN6A 4YTIA 4U3YA 3TXOA 2UW8A 3O8TA 4U0IA 4XV9A 3NCGA 3W32A 2OXXA 4TKSA 4X21A 2Q0NA 3PJ1A 4CCUA 3LHJA 4EQCA 1HOWA 4LMNA 1ZYCA 4RVLA 5FLFA 5CF6A 5IISA 4ZS0A 1VYZA 5KCVA 1MQBA 2CKOA 5FDPA 4CZTA 4OTQA 5HTBA 3UZRA 3FI3A 3UQFA 5FBNC 4FUXA 2IJMA 5JZJA 5CALA 5HLWA 3KXZA 3RHXA 5LCJA 3AKKA 3COKA 1BL6A 1XBAA 4FVQA 4RIXA 4ASDA 4BCNA 2VTOA 2UVXA 1JKSA 4O84A 2UW3A 3POZA 4OTRA 4DFLA 1NA7A 2EB2A 2QOKA 4BIEA 4ZJIA 4E8AA 3O2MA 2QO2A 3E92A 4FK3A 5EQYA 5BNJA 1OL2A 3N4TA 3FZOA 4FK6A 4GSBA 4XG6A 4MNEA 4AE9A 4YZMA 4CMUA 4DT8A 3O7LD 4YTHA 4RMZA 2C5NA 3V8WA 3UOKA 2QR7A 5JFXA 1XJDA 4MXAA 1GNGA 4YJVA 1URWA 2CPKE 4PL5A 1O6LA 3KF4A 2PK9A 4TNBA 2XJ0A 2E9NA 4W4YA 1G8AA 2JDVA 1K9AA 2I0HA 2GS2A 5GHVA 5HICA 5CENA 4YJTA 3B2WA 4Q9ZA 1PYEA 2XKDA 4RJ4A 2YERA 3Q4CA 5K3YA 2WIPA 4NFMA 4CV9A 1LEWA 3BHVA 3QCXA 1E1XA 2YM3A 4ZSGA 2E9OA 4C36A 5DGZA 3G9NA 4MBJA 3UNZA 4GW8A 5DN3A 3ZO1A 5J9LA 2NO3A 2VX1A 2IVVA 3MDYA 3TNQB 4G31A 2OXYA 4LOQA 2CKPA 2YEXA 3W10A 4LV8A 1GAGA 5ETAA 4KUJA 4BDEA 4EBWA 2WELA 3UG1A 4N57A 3TMOA 3MVLA 1R1WA 2X0GA 3IDPA 2QLQA 2BIKB 2B9HA 3QU0A 4U79A 2EU9A 3OROA 2YISA 4LGHA 3R22A 4EJNA 2C6MA 2W5BA 2B52A 3ZTXA 5I5ZA 1PRYA 5IQDA 1M2RA 3D2IA 3EN5A 3QTZA 4OBOA 3QQUA 1WMKA 4IM0A 1U5RA 3TKHA 3POOA 3KXNA 4RWJA 5DEWA 3VBQA 4AGDA 5B2LA 3GI3A 1WAKA 5CF5A 5AM7A 1Y6AA 3TDWA 2VTRA 4CGAA 3FQHA 4RT7A 3HV5A 4OT5A 3OXZA 4RJ7A 3OMVA 3AQVA 2C4GA 2OIBA 4O0WA 1CKJA 3GOKA 4DAWA 3TUDA 2DYLA 3BHTA 2JKMA 3CY3A 1YI4A 3FUPA 4PMPA 4KWPA 5EH0A 5FM2A 3MYGA 5HG9A 5E8TA 1DI8A 3PIXA 2YIRA 4Q5EA 4F09A 2F2UA 3U51A 5C1QB 1A06A 5AAGA 2UZEA 1FMOE 2C47A 5JK3A 4JR7A 3MFUA 3IGGA 4J99A 3BLRA 3O51A 3A7HA 3H3CA 3MV5A 3I0OA 4LOOA 2QOCA 2C3JA 3IECA 2WQOA 4MX9A 4O38A 2C1AA 4BDJA 4K8AA 3E62A 2ZV8A 5DVRA 4C34A 2XAOA 2ETMA 3LFAA 4BBFA 3UVRA 4J1RA 5C9CA 2O63A 3OWJA 5AFVA 5ITAA 1J7IA 3PLSA 5DT4A 3ZBFA 4AW0A 4BRXA 1Q97A 5DG5A 4LUEA 3GU7A 4ZJJA 3E8DA 3AC5A 1RW8A 5BPYA 5EKOA 4YJRA 1VJYA 2YIXA 4GK3A 2V62A 3DZQA 3ROCA 2EUFB 2YM5A 5AUVA 3PXRA 3IOKA 5K4IA 2Z7LA 3V04A 4L68A 1JKLA 4IX6A 2PE1A 3HYHA 2UZDA 1OECA 2CKQA 2R7IA 4MQ1A 2R3FA 2BTRA 2I0VA 4U43A 2XNNA 3BLHA 3R1NA 2CJMA 1M2PA 1KV2A 3E63A 1H1QA 1XR1A 3DK3A 4H3BA 4J52A 5A6NA 4O7OA 4O7TA 4TYJA 1G8KA 4M84A 5FEEA 2XNOA 3EQGA 3EOCA 4M8TA 2WO6A 5HLPA 4CKRA 2HCKA 2PVFA 3I81A 3TT0A 4PL4A 3DTWA 2ZMCA 4DEHA 3MJ1A 2OJ9A 2VTPA 4FX3A 1QPCA 3E93A 4DLIA 2F7EE 4ZOGA 5HHWA 3U8WA 1ERKA 2OI4X 2GU8A 1PJKA 2BILB 3A62A 4YJSA 4HYUA 3C4CA 4JL9A 3T9TA 2ZB0A 3L9MA 2BTSA 2RL5A 3L1SA 4G9RA 4JQEA 3UODA 3ALNA 5AUTA 4FL2A 4BC6A 5FXQA 1G8SA 4PP7A 4FOCA 4OTWA 4YC6A 3RINA 3Q3BA 1Q3WA 4QPSA 4QP7A 4EOMA 3R7IA 4EWQA 5E8SA 4YO4A 2R5TA 3A60A 3EN9A 3R00A 2PMIA 4AP7A 4AUAA 3ZC5A 1BUHA 1H8FA 2Z7SA 3WI6A 4DYMA 3KN6A 4YLLA 2BALA 5AUZA 3LCOA 1BI8A 3IO7A 3LLAA 1STCE 1ZRZA 4V0GA 4AF3A 2E9PA 4XP2A 4LRJA 4QMTA 3PJCA 3CCNA 1OKVA 3SW4A 4AW2A 3ZONA 1VR2A 5KO1A 3ENHA 4GH2A 1IAHA 4NJDA 4QP4A 2FGIA 4AGCA 2H9VA 3CS9A 3IPHA 4TWOA 2WMXA 1WCCA 1CDKA 5F95A 3RI1A 4FT0A 1SYKA 4UXLA 5C8MA 3VJNA 4MBIA 2R3JA 4M3QA 4WT6A 4CQEA 2R3LA 3WF9A 3O8PA 3SOAA 3TZ9A 3JPVA 4WG5A 1OL1A 3Q60A 1XQZA 3KC3A 4MH7A 4GEOA 5TO8A 3BU3A 5IQGA 1XHAA 3LJ2A 3ZEWA 1BKXA 5AA9A 4QQCA 3F61A 2XEYA 3MPMA 4QDVA 5JT2A 3C50A 5BVFA 3NW6A 3OS3A 4XNEA 2I40A 2E9UA 1UU8A 4BJJB 4PV0A 4ASXA 2PVKA 2ZYBA 4EKKA 5JFSA 3DBFA 3T3VA 4G6OA 2CNUA 4WUNA 4BHZA 3NUSA 3D15A 2ZV7A 3RAIA 3B2TA 3F5PA 5EK7A 5ANIA 5IMEA 3P86A 5BQ0A 1H0WA 3D94A 4IAYA 2X4FA 3W18A 5TOZA 3CBLA 4XS2A 4FNXA 5FGKA 2ONLA 5BVWA 3DKCA 4EZ7A 3SLSA 1NW1A 2CNVA 5IA3A 2C5YA 2VX3A 2ZDTA 3MY1A 2DWBA 3VUHA 4ACGA 4CFFA 5LWNA 4ALWA 5KUPA 4BCFA 4CKIA 3A4OX 4NCTC 2JC6A 3CE3A 4I92A 1MQ4A 3QC9A 4GRBA 1OM1A 3VQUA 3R2BA 1H25A 3AG9A 3PSCA 3Q6WA 3OW3A 4DEIA 3R8PA 4X2GA 5D9HA 3TI1A 5HNIX 3HX4A 3ATSA 1XH7A 1ZMVA 4W4VA 3PXFA 3ZRLA 4BCGA 1XWSA 3V6SA 4Y83A 2PY3A 4RA5A 4HCTA 4EH6A 1J1BA 1ZOGA 3LCDA 3BE9A 5E1SA 5FTOA 2GTMA 1PXOA 4H05A 4BDFA 3MJ2A 2HXLA 4DCAA 4ITIA 3M1SA 1GY3A 4PDYA 3QHRA 4M7IA 3BHHA 3EMGA 4EOKA 1PMUA 2W1EA 2WTIA 5EDRA 1JAMA 3VF8A 3ORXA 4IMYA 1APME 4BICA 5DOSA 1SNXA 3FL4A 4AXEA 4DDGA 1Z9XA 1WBWA 3FC1X 4DH5A 3OUKA 4NSTA 1UNHA 4QMUA 3EB0A 3CQEA 4KIOA 2OIQA 4O7ZA 2HY81 3H9RA 3EN4A 3I5NA 3Q53A 3IDCA 5FTGA 4FTNA 5LMAA 4EOIA 1HCKA 3VUKA 3CTJA 4F0GA 4Y85A 4GVAA 5EQEA 2ITNA 2UZLA 3DK7A 3MTFA 3QTQA 4ERWA 5AIRA 4L01A 3SVVA 5HG8A 4GIIA 4EH9A 4I94A 1I44A 2JEDA 2PVRA 3TV6A 3FKNA 4K2RA 4U42A 4WD5A 4PWNA 1MRYA 3C4FA 4JAJA 4R1VA 3R9DA 4FJVA 4K77A 4ZP5A 5F1ZA 2J2IB 4TYEA 4MNEB 2FSLX 1J3HA 5J1VA 4AAAA 4W8DA 1OPKA 3O50A 3GEQA 4OT6A 3RAKA 4QTBA 4BTJA 1ST0A 5AMNA 2XIXA 5E8YA 1QPEA 2J90A 4GYIA 5HVKA 4AX8A 5CY3A 2JIIA 5AUYA 3SV0A 4WNPA 2BDFA 3PLAE 2BVAA 5CZIA 4XV2A 4E4LA 5DHJA 4R1YA 4NCTA 4O21A 5CVHA 4USDA 3WZUA 2YA9A 4I5PA 1YXTA 3NAYA 2O0UA 3QQKA 3LFNA 4MNFA 3G90X 4FZ7A 2GCDA 3GU6A 3LE6A 4RX9A 3KULA 5AV1A 5HIBA 4ZK5A 3PYYA 3VAPA 5JFWA 1TKIA 5AP3A 2YAKA 4LL5A 3BGPA 3ZRMA 3WZKA 4D2RA 2VGPA 3R8LA 3VS2A 5IQBA 2C5VA 5B2KA 3UMXA 1XO2B 2PVHA 4HGEA 4HYHA 2E9VA 4FI1A 3DB6A 2R64A 4AE6A 1DS5A 4CT2A 2YITA 5CF4A 3G0FA 2ITOA 4S33A 5L6PA 2BPMA 5KMLA 5DR2A 3UDTA 4PTGA 3P0MA 2XUUA 3E8NA 1SMHA 4YUQA 4I4FA 3CY2A 4FVPA 3MPTA 3UIBA 4RQVA 2IG7A 5EYCA 4ZJVA 5HESA 4QYHA 1IRKA 4E6CA 4AXFA 4KABA 4WHZA 3NX8A 3VC4A 5CT7A 5JGBA 5ICPA