4N57A

Crystal structure of aminoglycoside phosphotransferase aph(2'')-iva adp complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
RTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-IVa ADP complex
rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 93
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4n57A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4n57A02
2ZB1A 4JBOA 1R0PA 3AOXA 3WI6A 4ALWA 5DLSA 4RIXA 3HDMA 5HHWA 3Q6WA 3F2NA 2QOLA 3COHA 5C8NA 5EM8A 3VRYA 3PLAE 3W0SA 4OT6A 3U6IA 2C3IB 2EVAA 2VAGA 5FTQA 2OFUA 2ZDTA 2C1BA 2VO0A 3PP0A 5AA8A 4GW8A 4DT9A 4XRLA 4J71A 2PUPA 3UBDA 5L8KA 1H08A 3ZMMA 2PVLA 4XV9A 3DV3A 2GS2A 2JFMA 5IA5A 3SRVA 4B6LA 4NK9A 5EI2A 4BZOA 4OTWA 4WZYA 4FKOA 3FMKA 4FVQA 3FMDA 3PIXA 3W10A 3U4UA 5BVEA 2JKMA 3MA3A 5HD4A 3BKBA 5AMNA 3UG2A 4Z55A 2BIKB 3VBQA 2BIYA 3KXGA 3MFUA 3VUIA 3EQDA 3N4VA 4YPSA 4D5KA 5EG3A 3P7AA 3SXRA 2X8IA 4YTHA 1OVEA 5BUJA 4FZ7A 1VYZA 3PZEA 4TRLA 4AGDA 1O6KA 4TYIA 5CALA 3P79A 2NPQA 4G1WA 4U9AA 3NRMA 5HO7A 5LQFA 3ZFMA 2NNWB 2WQEA 4MD9E 4QYEA 3ZFYA 1ZWSA 4UWCA 4YJNA 4BCFA 1B6CB 4E4XA 5L8JA 3H10A 4UV0A 2QOKA 3TACA 3I5NA 2Y4IB 3KU2A 3OCSA 3ORTA 3DAJA 1H26A 2QKRA 3K2LA 4J95A 2YISA 5CI7A 3RPVA 5CT7A 5GJFA 5CANA 4W4XA 2W96B 2W1IA 1FVTA 3L9NA 2EB3A 3E8CA 4B99A 1E1XA 2A19B 4YC8A 3FPQA 2QODA 3DA6A 1GIIA 4X3FA 5C4LA 4DBNA 4TT7A 3WF8A 4ZZNA 4DFUA 4GUEA 2XKEA 2JIVA 2PK9A 4QMVA 4DFXE 3FSKA 4APPA 2OG8A 2YIWA 2OICA 5B2LA 4DH5A 5D9HA 2XNMA 3P1AA 1OI9A 4I0SA 5JEBA 4IAZA 3KEXA 4O6EA 5CNNA 2I1MA 2YDJA 3ZO2A 4DHFA 3CXWA 1WBVA 3G90X 4MNFA 2VV9A 3DQXA 4Z9LA 5FEQA 1I09A 2YM3A 2C6TA 4GCJA 4LFIA 2XNOA 2A2AA 5I9VA 2E2BA 2YIRA 4WUNA 4ZLOA 3VF8A 2NRYA 4ANMA 3G9LX 2XJ2A 4BDCA 5KHXA 2I40A 3Q04A 1UWHA 4U42A 3R9DA 3U55A 4FUXA 2XNPA 3OXZA 4IIRA 3PYYA 4FV6A 4H3BA 5EDQA 3TZ7A 2BKKA 2OZAA 4IACA 4CG8A 4PP9A 2YM7A 4JG7A 1PMVA 1LPUA 2XIKA 2W1FA 3D0EA 3VJNA 4C3RA 4GEOA 5KNJA 5E8TA 3EHAA 1M52A 1RW8A 4XJ0A 2VTJA 3R7OA 2CN8A 1OKWA 2PUNA 5IA2A 3ZXTA 3UPZA 4GVAA 4ZLZA 4MKCA 3PSDA 5KMKA 2WHBA 1KV2A 2XIYA 4FKUA 4QQCA 2ONLC 2H9VA 4ASEA 5FTOA 3U4WA 4EOQA 5M53A 5CY3A 2VNWA 3F5GA 3LFSA 2RFDA 4L3JA 5EYCA 5M51A 2GQSA 1MQ4A 4D58A 2BDJA 3EQPA 4BCIA 3QQHA 5F9EA 5CVFA 4YO6A 5IA0A 3W33A 3OG7A 3LAUA 2FUMA 5ANEA 3UIXA 2C6KA 3P7CA 1AGWA 3OEFX 4ZJJA 2XKDA 4CMOA 4XEYA 3Q32A 4NUSA 4ONAA 3UC3A 4AWIA 3A4PA 4PDPA 4Q2AA 2F7XE 2BILB 4XG6A 4FEWA 3OXIA 1OECA 3VVHA 5BX0A 5I4NA 1SNUA 4R3RA 2ZMCA 4XUFA 4D9TA 5AJQA 5GHVA 3F3WA 1M7NA 4XV3A 1P5EA 5HU3A 3KXHA 4O0SA 4MYGA 4A4LA 4BYIA 3MH0A 4OTIA 3DTCA 5KCVA 1Y57A 3BZ3A 2W4OA 3PG3A 3QZGA 4LGHA 3FQHA 4NH1A 4QYHA 3ZZEA 4NTSA 2CNUA 4JG8A 3L1SA 1YOMA 3BLHA 4JAIA 4BCMA 4EOLA 5IQAA 3A62A 4R7BA 3ORKA 3U51A 3V8WA 4X6QC 1NY3A 2XBAA 3RM7A 2GSFA 5AFVA 4CCUA 4UX9A 4BCQA 4RZVA 5IUIA 5J8IA 5C4KA 2VTNA 2ITZA 3FY0A 2CKOA 3L9MA 3ORNA 5I0BA 4O7ZA 3MY0A 1WAKA 4HGLA 2GS6A 4AN3A 3FEGA 3QF9A 3ROCA 4GYIA 4QMYA 4MBLA 2QOBA 2YM8A 3DQWA 3EKNA 3QGWA 2R3NA 4DT8A 3UVRA 4MXXA 2QU6A 4E4LA 1IRKA 1E9HA 3S00A 3CQUA 4MD8E 2R5TA 3F2AA 5CSHA 3ZLXA 3UMWA 3D14A 5HX8A 4B4LA 2BAJA 3AC1A 3KQ7A 4QMNA 5BYZA 3G0EA 3VS5A 4QMXA 3COMA 4DTBA 2CGWA 4EQMA 5DI1A 4IJPA 3GC8A 5FM3A 3U9NA 3W1FA 4IB1A 4J8NA 3LXPA 2W4KA 3ZLYA 2WTWA 3R9NA 5H8EA 3PWYA 3F7WA 2CDZA 3HDNA 3LE6A 1R1WA 2PVMA 2WFYA 3LCKA 4AP7A 5GJGA 5A9UA 1K3AA 2UW9A 2C6IA 1YHWA 2OLCA 4Y5HA 3TNIA 3FZPA 5CF6A 4RVLA 2JDTA 2P55A 3D7ZA 1Q5KA 4BTMA 4JQEA 1GZNA 1BL7A 4O81A 1ERKA 3OTVA 4M8TA 3PXYA 2OXXA 2JBOA 1OBGA 3QFVA 3SQQA 4J7BA 3LM5A 3C9WA 1OGUA 3QUDA 3V51A 1SNXA 5L8LA 1KE7A 1Q8WA 3MA6A 4HW7A 3FV8A 4CG9A 5KMOA 4F09A 2X2MA 1OBDA 1PYXA 4DE4A 2FSMX 3LCSA 1XBBA 2PVKA 4RT7A 1LEWA 4JOAA 3H4JA 5HICA 3RPRA 3ZXZA 2W1ZA 4DEDA 4H1MA 1SVHA 5HNGA 5HG7A 4CMTA 2CNQA 2R3QA 3EB0A 1GNGA 3MDYA 4U40A 2C5XA 3KGAA 5GJDA 5IF1A 3I0QA 5KUPA 5M09A 4XHKB 4IM2A 2C3KA 3CQWA 4ZTLA 4JBPA 4JXFA 2VX1A 4RQVA 2F2CB 4I1ZA 4E5AX 2HIWA 4EH9A 4IADA 4NT4A 5HE0A 4AZEA 5AV2A 2UVZA 3R71A 4E73A 2ZAZA 2HY0A 3GI3A 5AV0A 4EORA 5BVOA 3VW6A 4N0SA 4CKJA 3EFWA 3PJ1A 1YI6A 4M3QA 5IEXA 2O0UA 4FSWA 2XZSA 4FVRA 3LM0A 4IX3A 4K33A 5IDNA 3F82A 4AT5A 2YITA 3FWQA 3DCVA 4G31A 4K8AA 4QP4A 1F5QA 3AC3A 5E8ZA 5FRIA 4PDOA 4ZOGA 1ZAOA 3WBLA 4TWCA 2JDRA 2W5AA 1QPDA 3Q9ZA 2VN9A 3OWPA 4W8DA 5CSWA 4C3FA 1YI4A 1M2QA 5BVNA 3E8NA 4FKWA 3DLSA 4S2ZA 5I9XA 3TKIA 1H01A 3F7ZA 3POZA 4I5HA 4RJ3A 3IONA 4OTGA 1XH5A 4Z7HA 3F3TA 2WMQA 2C6DA 4KKEA 4F7SA 5M4IA 3SVVA 1OUYA 2AC5A 2QO7A 2QO2A 4GV1A 1J7UA 3I7BA 1Q24A 3S95A 3ERKA 5J95A 5A3XA 2C69A 4B9DA 4R7HA 4X2FA 3OEZA 3DKOA 1YWRA 3I5ZA 3V5TA 4O0TA 3QKMA 1GIHA 3IS5A 4EH6A 3QTQA 5C8KA 2PZPA 3BRBA 3QD0A 5DT4A 5KMMA 3PTGA 2PUUA 1JKLA 2BRMA 2C5OA 4IVCA 1O9UA 3FLYA 4JDIA 5DG5A 1H0VA 2JD5A 2VTOA 3ELJA 3TV4A 2IZUA 3DB6A 3HA6A 2XRWA 4FG7A 2W1EA 4HVDA 3E7VA 2R3FA 3KF7A 3R22A 5CTPA 2ZYBA 4DTAA 1OIRA 3MB6A 3F3UA 2PU8A 4U3YA 1PMNA 4FIFA 3GFWA 1XWSA 2P4IA 2E9OA 3VJOA 4QP3A 4GH2A 3E5AA 3O7LB 2W06A 3A60A 1FPUA 4QPAA 2H34A 3NNXA 2VTTA 4JQ7A 2BDFA 2OW3A 4YUQA 5ANJA 4Y85A 4QMZA 2IW8A 5IQEA 1JBPE 3OP5A 5BVDA 4PMMA 2HK5A 3MTLA 3DJ7A 4TWPA 4FKTA 1KE8A 3H0ZA 5HU9A 4Y83A 5CU3A 4BBMA 1UVRA 5M07A 2GTNA 2YERA 4C2VA 4R78A 4IAYA 4YJQA 4EKKA 3RWPA 3QBNA 4B7TA 2ETKA 2GNGA 3UP7A 3ZH8A 5G1XA 4BDBA 2PZ5A 4TTHB 2Y4IC 3QQUA 2WGJA 4E20A 4I23A 4WG4A 2VO6A 4XOYA 2R2PA 4O7VA 4F6UA 4Z3VA 5JZJA 4GFGA 1ATPE 4FNWA 1YKRA 4EQCA 2IVTA 4YJOA 2BZIB 2X0GA 4YLLA 3IGGA 3RI1A 2GNIA 5A4EA 1H1WA 3NIZA 5BVKA 4XG2A 4NM7A 1YW2A 5JGAA 1U5QA 3A7JA 4GU9A 4BRXA 3HRFA 2QQ7A 4A9TA 2KULA 4FV1A 3PVUA 4BCJA 4QTAA 1GOLA 4Y5QA 3TNHA 4O0UA 1XBAA 2OJJA 1TQMA 2PVNA 1RE8A 4QYFA 3UOLA 5HG9A 3JYAA 5JK3A 3D5WA 2WOUA 2QLUA 1YXVA 2A27A 2CHLA 4DG2E 4F70A 4EOOA 3K54A 4L8MA 4I22A 3LFDA 1TQIA 4E6DA 5IZFA 4AXAA 2Y6MA 2ITQA 3CKXA 3FPMA 3NUSA 4HOKA 1NA7A 4CGAA 4DH3A 1V0BA 2WTKB 2WXVA 3LIJA 4J1RA 4S30A 4XBUA 3RTPA 3HZTA 5IISA 2BDWA 4DEBA 2R3IA 5L6WL 4TNBA 3PY1A 1O6LA 2B9HA 5D1JA 4C36A 1XH4A 4TYHA 3C4CA 2WQOA 3TDWA 3SKCA 3HAVA 4JVGA 3VRZA 2R3GA 2W5HA 2W17A 2PY3A 2V7AA 4BIBA 3D5XA 3LOKA 2OGVA 5D7AA 1OZ1A 3ZSHA 5K4IA 4K6ZA 1UWJA 2WTVA 4CT1A 5EDRA 5EM5A 4FV5A 3K3IA 5IA1A 3GU7A 4DG0E 2V7OA 3BYMA 3FHRA 4V0GB 3CS9A 5BMSA 3DBFA 4CVAA 4RIWA 3LJ2A 4FT5A 5CYIA 3W0RA 4M67A 2ZV8A 5CAUA 2C47A 3GQIA 3DOGA 3ZONA 5A14A 5LVMA 3L8PA 2BAKA 3TXOA 5H8BA 4EH7A 3TZMA 4LUEA 5K5XA 3WF6A 4AUAA 4AE9A 4FTMA 1T46A 2ITTA 4H36A 3DLZA 5LVNA 3UQGA 5HNIX 1PMUA 1G3NA 2J50A 4C34A 3BWJA 1H1RA 2W7XA 1P2AA 2BPMA 2G2FA 2GQRA 3B8RA 3NDMA 3WYXA 5GIPE 4W4YA 5C01A 5DWRA 2DQ7X 3RZBA 4RA4A 1Y6AA 3UNZA 3UPXA 4IB0A 4XNEA 4A7CA 3ULZA 2C0IA 3R2YA 3KMMA 3ANRA 1L3RE 4MNEB 4BTJA 1Q3WA 2QKWB 4RIOA 3EQGA 5HTBA 1G8SA 2OXDA 2WTDA 3QHWA 3GOKA 4FV7A 4HCUA 2VWBA 3FC1X 4O83A 3UJGA 4F1TA 2BFXA 4QMOA 5LVOA 1SM2A 1I44A 3NWWA 4LOQA 4LL5A 4A9SA 3ZZWA 5IQGA 3PXFA 4M12A 4FK3A 5E90A 2YJRA 4H1JA 1W82A 4OTQA 3NLBA 5F95A 4O0XA 4KKGA 3QRTA 3KRWA 3Q4UA 3VS2A 4FEVA 2V0DA 3Q4CA 5ANIA 3JVSA 3PA4A 4L67A 3D5UA 4WD5A 3EYHA 4E26A 5IEVA 5BYYA 1YVJA 3GC0A 4CNHA 2RL5A 3QZIA 1EH4A 5AEPA 4IX4A 4BCNA 4AE6A 3AMAA 1NT2A 2VTSA 3G5DA 3KK8A 3N4TA 1OIYA 2B55A 4BICA 2ESMA 3S3IA 3E93A 2QO9A 3MESA 1OIQA 3PSCA 2UW5A 3TL8A 2GHGA 3CD3A 4TYEA 4GJ3A 2HENA 4O6LA 4RPVA 3ORIA 5FQDC 4BF2A 4FTQA 3DS6A 4WT6A 1MP8A 4U80A 2BUJA 4WBBB 3RK9A 4FTOA 5HNBA 3SXFA 2HYYA 4BZDA 1PRYA 4LV5A 2BVAA 4RRVA 3WE8A 3R04A 1J3HA 3C50A 5CF8A 3U6HA 2WO6A 2HW7A 5IQDA 4V04A 2PULA 1VYWA 4RIXB 5B0XA 5HE1A 5EKNA 4AN9A 5JRQA 1OM1A 3DDQA 1P4OA 4GYGA 5IEYA 5JQ8A 3NCZA 3QCQA 5B2MA 3F6XA 3QRIA 3QU0A 5AUUA 1ZYSA 4DLIA 4I4FA 1M17A 2RGPA 1M2RA 3KKVA 3HV4A 3SRVB 3COIA 4HCVA 4F0IA 2ZM1A 2F7ZE 5ACKA 4C38A 2OJFE 4AW5A 4C3PA 1REKA 3K3JA 4JG6A 2PMOX 2JAVA 4N4SA 4ZTQA 4YJVA 4EC8A 3NGAA 5FGKA 4GL9A 3PPJA 2Z7SA 4PQNA 2CKEA 4XBRA 5LMKA 2QI8A 3ZLSA 2O3PA 3O51A 4I5MA 3D15A 5KZIA 3ZSIA 5AAGA 5HLNA 3PFQA 2QOHA 3F5UA 2BFYA 2LGCA 3PPKA 3PUPA 4IFCA 5D7VA 1WFCA 4NM5A 3GENA 4AZSA 3GU4A 4LGGA 2XB7A 3R02A 2BR1A 5CU0A 4CFNA 5DGZA 2XCKA 3EQBA 5CS6A 5TO8A 1WBSA 3GNIB 3E3PA 3GCUA 2WMRA 5AUTA 5E8SA 5AP7A 1YQJA 3CBLA 3FKNA 4YJTA 1HOWA 2XA4A 2GNJA 1PJKA 5DR9A 3CGOA 1BLXA 4LYNA 3I4BA 4DGGA 3E64A 2OI4X 3BV3A 2A0CX 4RIYA 4X3FB 4RFMA 4RLLA 1ZMUA 4D28A 4UXLA 2F7EE 3C5UA 4IHPA 1Y91A 4GJ2A 4IMYA 5EFQA 3LFFA 3N51A 3WZEA 4QTDA 5AAFA 4IM3A 3RVGA 4KKHA 3P78A 3FAAA 1PYEA 4MAOA 1UKIA 2J51A 2QURA 4LM5A 4AZVA 1J1CA 5HIEA 4BGQA 2PZIA 2CSNA 2OFVA 2J0KA 2I7QA 5KMJA 5IG1A 4JT3A 3GT8A 2QOCA 4PWNA 4CFVA 5KMIA 3A8WA 2B0QA 1GZOA 2GPHA 3HYHA 3OMVA 4IX5A 4A07A 3F69A 3NEWA 2WELA 2O64A 5DNRA 5C03A 2OJIA 2XK7A 2OIDA 2FSOX 3C4FA 3DGKA 3MH3A 4S32A 4WA9A 3NIEA 4ZY6A 4NU1A 2VGPA 2XYUA 1W7HA 3QD4A 4O38A 4EHGA 4EH8A 1ZRZA 1ZZ2A 2QG5A 2OZAB 2RG6A 3LFBA 4FTTA 4J98A 4AFJA 5BUEA 3DBEA 4QMPA 3UO4A 2GDOA 4G5JA 4PX6A 5HBHA 3UZRA 5KX8A 3WZDA 3HUBA 1OPKA 4TW9A 4JBVA 5TF9A 4USFA 3AC8A 4DF3A 5EOBA 1CM8A 3C51A 5CLPA 1WBNA 4F1OA 4OGRA 2P2HA 4BCPA 3NUUA 2CCHA 4BI1A 4O2ZA 4WNPA 3F5PA 4O7PA 3HMMA 4IWQA 4C2WA 3C5IA 2DS1A 4KS7A 2BRHA 2XM9A 2H8HA 4IH8A 2C1AA 3LXLA 3FYJX 4L3LA 5E4HA 1U54A 3R8PA 5DR6A 5KKRB 2XRUA 3LCTA 3NX8A 4ASZA 2WMWA 4M7IA 3ENMA 3OTUA 4U81A 1OKZA 2J2IB 4UBAA 1VEBA 3PA5A 3MYGA 5FXSA 4TWOA 3MY5A 4QOXA 2O5KA 1G5SA 2ZJWA 3QQJA 4KSPA 4QP8A 3IQ7A 3E92A 3QYWA 5AP3A 2RFNA 3CE3A 2ITNA 1STCE 4FT3A 2W99B 4FGBA 1S9IA 3MTFA 3PY0A 4H3PA 2B52A 3B8QA 1DM2A 3I7CA 3NYVA 2X7OA 2F9GA 4DCAA 5GIOE 3IECA 1FGKA 3VIDA 3UNKA 4CLJA 4RVKA 4M69B 3OFMA 2YDIA 4L3PA 3NR9A 3KULA 2QOQA 3EQFA 2R4BA 2BTRA 3R01A 4U97A 3SXSA 2WMTA 5LJJA 1H25A 3A61A 4OTHA 3V6SA 4BDDA 1BX6A 3GGFA 4HVSA 4YZBA 4QP9A 3FSFA 4FTAA 4MVFA 1JSTA 1WBWA 4WIHA 4RC4A 2R64A 5EI8A 4YURA 4ZSJA 2WTKC 2J7TA 3ZBFA 5ETIA 3NNWA 4GS6A 4E6CA 4YHFA 4I0TA 3CKWA 3ZLWA 5FEDA 3QD3A 3UVPA 5ANOA 4FKPA 2B9JA 3LFCA 5I5ZA 2GNLA 1Q97A 1UU3A 2GHMA 4FSYA 3L8XA 2JKOA 3MJ1A 3E87A 4XYFA 3ZUVA 4BIEA 3TV6A 4ZLYA 4I20A 5KO1A 3A7FA 3GUBA 4EI4A 3S4QA 4YHTA 2YACA 1XJDA 3CTQA 3EOCA 3UGCA 3O71A 4MTAA 3FI2A 4Y72A 4QP6A 1W84A 4I5CA 5BQ0A 3H30A 5HVKA 3D83A 2IN6A 4L44A 3E3BX 4NFNA 4FKSA 4U94A 3OVVA 3UNJA 4IZ5A 4U45A 4NWMA 3BELA 5EYDA 4NM0A 4F9AA 1CKPA 4LRMA 3VBTA 1WBOA 2YIQA 3PSBA 3VS0A 3NVKI 2ZV7A 2ZMDA 3H9RA 3HRBA 4KS8A 4YNEA 4AGUA 4F7LA 3CC6A 3EQCA 3OT3A 3DFCB 3QGYA 5C8MA 4CV8A 3VW8A 5HBJA 3UTOA 3HRCA 4JL9A 2QD9A 5IH4A 4RWKA 4N70A 1PXKA 4PMTA 3KCFA 2VWWA 4ZTNA 3ZOSA 3EZVA 4ASXA 3BX5A 1J7LA 3LQ3A 2IPXA 4HYHA 1NVRA 2XIZA 4DYMA 2ZM3A 3ROYA 4C7TA 1TQPA 1MQBA 4MK0A 2VO3A 2J6MA 3MFTA 3ZUTA 3R9OA 3VQUA 3PY3A 3VQHA 4CD0A 5JFSA 2PPQA 3IK3A 4PTCA 1E1VA 1WZYA 5CXHA 4DGMA 2QHMA 4TZRA 3R83A 2CKQA 3DPKA 2I0YA 2XF0A 5CAVA 2Y8OA 3GC9A 4HZRA 1OUKA 3CEKA 4AX8A 3NSZA 5JH6A 1IAJA 5FBNC 3EH9A 5KHWA 3HLLA 4MBJA 3O0GA 4DGLC 4WG3A 4BZNA 3W0PA 1IR3A 5CU2A 4B8LA 3GOPA 1FVVA 1PXJA 2RFSA 1Q8TA 5DT0A 2ITUA 4RBLA 3SHEA 4RJ5A 1JKSA 4J8MA 4TL0A 2PTKA 4DFNA 5AV4A 3MPTA 3UQFA 3OBJA 4JAJA 4L45A 2HZIA 2BHEA 4L43A 3C4ZA 3ZFXA 3F3ZA 4WNMA 3WILA 5ETCA 2YCFA 5T3QA 3A7HA 3COKA 3KREA 3W0NA 4ITHA 4LOPA 5JZNA 3WF7A 2XP2A 3NNVA 5D41A 1WCCA 4E6AA 3TZ9A 4EYJA 3KL8A 3CCNA 1ZLTA 4I6BA 4IWDA 2F49A 5JQ5A 3R1SA 4IJ9A 3RJCA 4EOPA 3CSVA 2PWLA 2R3PA 4NM3A 4QMWA 5CSVA 2GMXA 2IZRA 1JKTA 5K4JA 4BDGA 4YTCA 3OCBA 4C4HA 2HCKA 2WIPA 4N57A 4O7WA 5EYKA 2PVFA 2ITYA 3QYZA 5HLPA 2OKRA 4AFEA 2B9IA 4PDSA 3VUMA 4ORKA 4A4OA 5HTCA 4RJ7A 3FQSA 3VS4A 2VTIA 1ND4A 4IAKA 2W05A 3HV5A 4C0TA 3VWAA 4O7YA 2V62A 5F4NA 4FG9A 4FSQA 2B53A 3QXPA 3BYVA 3UIBA 3DJ6A 4O7RA 4FGRA 4FTJA 3PRFA 4OTDA 3FBVA 4J97A 2W0JA 3BYOA 5A46A 4O2PA 4C02A 3GCVA 4FSUA 1KE6A 2ZDUA 3L9LA 1Y8YA 4KSQA 5CU6A 3F5XA 2BHHA 4UWBA 3TTJA 3LFEA 2OJGA 4D0XA 2ACXA 3FZTA 4IQ6A 4UN0C 4NTTA 3BPRA 2WTCA 4NCTC 2C68A 4R1YA 3NUNA 3ORPA 3GP0A 4BR3A 3W0QA 3LPBA 1IA8A 4QMLA 2OH0E 1PF8A 3DXNA 3QAME 4BB4A 4HYUA 4AQCA 5DT3A 3EFJA 3C4XA 1SMHA 4FOCA 3ZC6A 3TG1A 2IZTA 3DFAA 3AXWA 5CSXA 3QX4A 5K3YA 4AG8A 4EWHA 4R5SA 4FTKA 3UOHA 3P08A 2O65A 3QTXA 4GVJA 4X3FC 4YBJA 3SOAA 2QHNA 2ZV9A 4F9WA 3QTZA 3R1QA 4TN6A 2C3JA 5CT0A 2H96A 4IVBA 4AS0A 4F9YA 5CAPA 2XYNA 4E4NA 3BU5A 3EL7A 2J9MA 1FINA 3HEGA 2F2UA 2JIUA 3OUNB 4GK2A 4JX7A 4LV8A 2UVYA 2Y0AA 1Z57A 3TN8A 3S1HA 4UXQA 4D4YA 2Y4PA 5M55A 3D9VA 3C7QA 4W8EA 4U98A 4QT1A 2R3LA 4DA5A 2UZUE 3LVPA 5E8XA 3RK5A 3ACJA 2O8YA 1KWPA 4L46A 3HV3A 1URWA 4RX7A 3B2TA 3Q2JA 4AZWA 5M06A 4PTGA 4R3CA 5CQUA 1BI7A 4FKQA 3T9TA 4FUYA 4FZFB 5DYJA 5CXZA 5L2WA 5EW8A 5FG8A 5TOZA 1PMEA 4AOJA 5DRBA 5AUVA 4D4VA 4TYHB 4G2FA 3QA8A 1QMZA 4V01A 4KA3A 1Q8UA 4LUDA 2EXCX 1TVOA 2RFEA 4O27B 3PG1A 4Q9SA 4DEHA 2GQGA 3W0MA 3EL8A 3RKBA 5HORA 5CWZA 4BY9E 1JPAA 4AT3A 1AQ1A 2WEIA 3IW4A 1H28A 4G3CA 4I94A 2UZWE 5HIDA 3TNWA 1FMKA 1YDSE 3AT2A 4ANQA 4MX9A 1WVYA 5DPVA 1Q3DA 2ITOA 4RIWB 4FTUA 2WOTA 1ZZLA 1WMKA 3WIKA 2XCHA 3LFQA 3JY9A 4RFYA 1XH7A 2XEZA 4FT9A 3C0HA 5DEYA 1UU9A 4AF3A 2PVJA 1JSUA 3GB2A 4C58A 4IZ7A 4RJ8A 2WEVA 2WTJA 5KE0A 5KKRC 2CGVA 4FSNA 2WPAA 3W2RA 2B7AA 2Z2WA 5BNJA 4E93A 5CVHA 4RX9A 2XK4A 5FTGA 3UYSA 4FTIA 2BROA 2UZBA 4DGOA 3HV7A 3KN5A 4C37A 1XKKA 4C59A 1DI8A 2RG5A 2VUWA 3TKHA 5HQ0A 1WBPA 1OIUA 3A4OX 3AGLA 3M2WA 4AGCA 3RAKA 4YJSA 4FIEA 4F0FA 3FMLA 4MHAA 2VU3A 4YPDA 3OCGA 3ZEPA 4ZZOA 4FV4A 4XV2A 4CXAA 4QQJA 3SV0A 4JJRA 3RAIA 3CTJA 2J5FA 1ZOEA 2W4JA 3I0OA 3RHXA 3QCSA 3JS2A 4ARKA 5AX3A 1FQ1B 4PRJA 4DINA 2VWYA 3V5LA 5JFVA 4EZ3A 1SVEA 5JGDA 5F94A 1IA9A 3SLSA 3IDCA 4CFUA 4EH4A 3R8UA 3W2SA 4J53A 4MXZA 3DBDA 5F20A 4IZYA 4L52A 3FMEA 2IZSA 5M44A 3BHTA 3KXMA 3QRKA 4NL0A 3M42A 3RPSA 4FIHA 3P9JA 4RZWA 4EOSA 2IG7A 4PF4A 1W8CA 3UOJA 5AV1A 1V1KA 3TTIA 2R3KA 1JQHA 4EJ7A 3ET7A 3JPVA 2O2UA 3KRRA 4F7JA 3R8LA 5BVFA 3D4QA 4TPTA 2F57A 4LL0A 1LEZA 5AUYA 2C0OA 5AUXA 2VX3A 3WF5A 5CEQA 5M4UA 3V5PA 3RHKA 2FSTX 3FI3A 2WQMA 3ZM9A 4A9YA 2ZM4A 3CTHA 3FY2A 4M84A 3RPYA 5CF4A 2IVSA 4GIHA 3QZHA 1YWVA 1VJYA 3Q9WA 3SG9A 3PVGA 5IQHA 2BKZA 4CQEA 3CLYA 4KD1A 1QPEA 4TXCA 3RWQA 2BTSA 3DAKA 2G1TA 3QRJA 4EH5A 2VD5A 2OWBA 2AYPA 4FL2A 3UODA 3U6JA 4O0WA 4U43A 3AC4A 3SG8A 4EBWA 5CSPA 3A7GA 4BCGA 5LCJA 1XH6A 4GIIA 4R1VA 3HUCA 2X8EA 2P2IA 1R39A 3RGFA 3KA0A 4FV9A 3DNDA 4YMJA 4FV3A 4IB5A 4OT5A 3GCPA 4MXOA 3MWUA 3FYKX 1PXNA 2VWIA 3MBLA 3OC1A 3QTSA 3BEGA 4WKQA 4FEXA 4YZNA 1UU8A 3W32A 5CEOA 3UQCA 1ZYCA 2JDOA 2YZAA 4G34A 4JDHA 4EL9A 3FDNA 4IAFA 4J52A 4YZ9A 3TDVA 4DTKA 4EZ7A 2I6LA 4QTCA 4RWJA 5FDXA 3PXQA 5EW3A 2XVDA 4DG3E 3KFAA 3EMGA 3PA3A 4JX3A 5ETFA 3K5VA 4ACMA 1BUHA 3HMOA 5FUTA 3HV6A 4ZXTA 4B0GA 4ZMEA 3LMIA 4G5PA 5LVLA 5EKOA 2X4FA 2G9XA 3TV7A 4C61A 4A9UA 3GFEA 5HD7A 1KE9A 3Q9XA 4K1BA 5EI6A 3A8XA 4TY1A 4U44A 4L9IA 4HYSA 2GU8A 5HI2A 2WTIA 1TKIA 4GMYA 4Y73A 5EH0A 4EHEA 1IEPA 3BQCA 4WNOA 1H4LA 4JDJA 2XKCA 2C4GA 2R9SA 4BHZA 5ANGA 2QG7A 2Y9QA 3EYGA 3Q9YA 4U6RA 4BHNA 1YOLA 3KRLA 2V5QA 3FKLA 3TM0A 3U54A 3ZUUA 4DLJA 1P4FA 4MXCA 4LMUA 3VNTA 5FD2A 4F99A 3I81A 5IQCA 3O17A 4G6LA 3LLAA 4YNOA 4OR5A 4QPSA 4YO4A 3IDBA 3LMGA 5AP6A 3R1NA 4QQ5A 4RIYB 3PP1A 4D2RA 3BHYA 2ZOQA 2YN8A 3UMXA 4DBXA 5HCYA 2JLDA 1UKHA 2OF2A 3EZRA 4QQTA 5AM7A 4BYJA 4O7OA 2YIXA 4E5BA 4I5PA 4AW1A 2C5VA 3MSSA 4ERWA 1BMKA 4X2JA 5B2KA 2FVDA 5HG8A 3Q4ZA 3ZRLA 4FX3A 4FKVA 4IW0A 4ZMFA 1UU7A 1H00A 3C4WA 2Q0NA 4FV8A 4ZSLA 5B7VA 3F3VA 5EDPA 4DH8A 1U4DA 3HVCA 2VX0A 3JUHA 5JT2A 3ODZX 1A06A 3LCOA 1BKXA 2XNNA 4FBXA 4FKRA 4L7SA 4UY9A 1H1PA 4NSTA 1XHAA 4FIIA 4G9RA 4DITA 5HESA 4MD7E 2IW6A 4YZDA 4MQ2A 4IDTA 2SRCA 5E8UA 3OBGA 3QXOA 1ZYJA 4KABA 3OW3A 5ANDA 5I9YA 1NVQA 2GCDA 3O50A 3GVUA 3VBVA 5GNKA 3TJCA 4EK8A 3FLSA 4KIQA 4UEUA 1OL7A 2C6OA 4DEGA 4JDKA 4XG9A 4MF1A 2WAJA 2R3JA 3FJQE 4EOIA 5JFXA 4CTBA 2PVHA 2XH5A 2Z8CA 3CPBA 3QTIA 3SA0A 4O7LA 3TUCA 2OH4A 1UNGA 3OWJA 4RA5A 3FQEA 1H27A 3GU5A 3BYSA 5ICPA 2JKQA 2ITXA 4HNIA 4QYYA 4U41A 4WOVA 3MFRA 2CPKE 4PL4A 5TR6A 4JIAA 5HO8A 3S2PA 2VWXA 1REJA 1VR2A 1MRUA 2OO8X 4FEQA 3R8MA 4I21A 3MJ2A 1U54B 3GXLA 4PV0A 3O96A 1KSWA 4QNYA 4JQ8A 2DYLA 5CEPA 4D4RA 4O84A 4ZS0A 4WUAA 4IZAA 1PKGA 2GFSA 3VN9A 5CZHA 5HKMA 4XS2A 3Q5IA 2UZLA 3KC3A 4XG4A 3OOMA 3R30A 5BYLA 3VBYA 3KXNA 4FSZA 3ENHA 3FLWA 3U8WA 2FH9A 4ENXA 1B38A 1YDRE 3R8ZA 3QUEA 3RCDA 5EW9A 4FKGA 5H3QA 4RMZA 4AOTA 2XS0A 2BRGA 1O6YA 1ZXEA 2C5NA 3BE9A 3H9OA 4RVTA 4E7WA 3UIUA 4I92A 4S34A 2XK8A 4NKSA 3I79A 2C0TA 3TIYA 3P86A 3EWHA 5TKDA 4X0MA 4H58A 3KULB 2CNVA 4RC3A 3EQHA 3GC7A 1R78A 3ALOA 3NW7A 2XIRA 5CZIA 4DN5A 4O86A 3WYYA 5ITAA 4PMPA 5IH6A 5L2IA 3DJ5A 4FTCA 2B9FA 4W4VA 2OF4A 3CD8A 2C6LA 3QKLA 2CGXA 4KAOA 3FXZA 2ITWA 5EYMA 3FLNC 3PE1A 1CMKE 4EONA 5DN3A 4LRKA 1PY5A 3N4UA 4AW2A 2YJSA 4HZSA 3NUXA 1XO2B 5IQIA 4ZP5A 2Z60A 4C33A 1GY3A 2R7IA 4CLIA 2XJ1A 3PZHA 4F4PA 2VTMA 3BE2A 2BMCA 5J1VA 4MWHA 2JIIA 1JVPP 5A6NA 2X7GA 2R3HA 1OL6A 3MS9A 5HIBA 4AU8A 5FXRA 2ITVA 2EXMA 1CKJA 1KUTA 3BGPA 3RM6A 5A4CA 2PSQA 3PVWA 4GK4A 3TZ8A 4H39A 4NJDA 1JOWB 3QTWA 2BCJA 2A4LA 2BAQA 2XBJA 4FNYA 5EM6A 3DU8A 3UYTA 1NXKA 2QVSE 5ACBC 4C4EA 4EOKA 2VTAA 3CY3A 4MXAA 4F6SA 4J96A 4YHJA 4IAIA 3TEIA 5F1ZA 1ZY4A 3VULA 4ID7A 3DXPA 1Q62A 3SDJA 4NZWB 4JS8A 4NKAA 4WNKA 4AT4A 2YAAA 5BUIA 4CKRA 4XG8A 2OIBA 1YXTA 3MIYA 2XK3A 3WARA 4BGHA 4GRBA 4NJ3A 4P2KA 3DXQA 3EFKA 2OJ9A 3VS7A 3VUGA 2J0MB 4D2SA 5A4TA 5L2TA 4F1MA 3A99A 2UW0A 4CEGA 2YAKA 3V8TA 4EOMA 2Q0BA 4AZFA 5BMMA 3MPAA 4IAAA 5FEEA 1GIJA 1MRVA 1XR1A 3V6RA 4BCHA 3E8DA 4GK3A 4XOZA 3ZRKA 4AW0A 3P4KA 3Q3BA 5CEMA 5I9UA 5CAOA 4L6QA 4XP2A 5IQBA 5KMNA 3BHVA 3EN7A 3DKFA 4FKLA 3SAYA 1Q41A 2J4ZA 3THBA 3OUKA 3QA0A 3QQLA 3F2RA 5AM6A 1KOAA 3H3CA 2C3LA 4BTKA 2PZYA 3PJCA 4G6OA 1U5RA 4QRCA 4EQUA 4X3JA 4QP2A 2OXYA 3QL8A 3MPMA 5LWNA 2BZKB 3W2PA 3ORMA 4G3GA 1IAHA 3UDBA 3TKUA 4EHVA 4ZEGA 2C6EA 2JFLA 5FP6A 2JAMA 3NS9A 3BLQA 3QQGA 4WG5A 4F08A 3RINA 3V5JA 2W1GA 1P14A 3UG1A 3T3UA 3A7IA 4GG7A 2OK1A 2ONLA 4YSMA 5FM2A 2ITPA 3V01A 5LCKA 5AV3A 1GJOA 1UNHA 3H0YA 4FOBA 3PJ2A 2JITA 5JMSA 4FSMA 5CQWA 3SX9A 4M0YA 5A4LA 4X2KA 1KOBA 3CIKA 5KBRA 4PNKA 3DNEA 2C30A 2WQBA 3NUAA 1OL5A 3TNQB 3FKOA 1ZMWA 4HVHA 3MVLA 3ZDUA 4G3EA 4BBFA 4M68A 3AC2A 1DS5A 3WZUA 4ZZMA 4E5WA 4BI2A 3VS6A 3FI4A 4FIGA 3IPHA 1ZOHA 2FA2A 1B39A 4K11A 2FYSA 4KUJA 4AA5A 3OY1A 3GQLA 4EZ5A 3UZPA 4PMSA 5E8WA 5EHYA 2BALA 4EK6A 5J5SA 2V55A 3CY2A 4IANA 1W83A 2XKFA 5EQYA 1K2PA 3NYNA 4RVMA 3P5KA 4EK5A 3KRXA 4QMUA 4IBMA 3Q96A 3LMHA 4ZTSA 4ZY5A 3CQEA 4A4XA 4FEUA 2PE2A 2WMSA 4GFMA 3ZTXA 1YHVA 3GU6A 1BL6A 3ZM4A 2Y6OA 3CPCA 1JWHA 2UW3A 4AN2A 3MH1A 4JNWA 1YWNA 3AGMA 3LXNA 2B1PA 2KTYA 4NYEA 3O8TA 2X9FA 3BBTB 2QOIA 5DE2A 3WOWA 3QLFA 4IX6A 2UZOA 4FA2A 4FL1A 5AIRA 4BVUA 4FKJA 4XMOA 4QMSA 3LZBA 5LMKC 4HCTA 4BTFA 3K5UA 3PIYA 4ZS4A 3IGOA 2VTHA 2YWVA 3JXWA 4E6QA 3NAXA 2Z7QA 4GU6A 4NFMA 2UUEA 4BIDA 3DT1A 4ANBA 3Q6UA 4UYAA 3AD6A 4FT7A 5HVYA 4OTRA 4YU2A 2FO0A 4JIKA 5DOSA 3AMYA 3ZCLA 4PL3A 2HXQA 5EM7A 2CMWA 3IW6A 2VTRA 3NZ0A 5T68A 4TKSA 1H8FA 4NCTA 4XLVA 3QWJA 4ITIA 3DK6A 1Q8ZA 2VZ6A 3SD0A 1YXSA 4D9UA 5IMXA 4KWPA 3W2QA 4TYGA 1SYKA 2IO6A 4CV9A 4MH7A 5DH3A 5AP2A 2G2HA 4OBPA 5E92A 1M7QA 3VHEA 4DEAA 3UP2A 1Y8GA 3BHHA 1OPLA 4JLCA 4APCA 4CKIA 5JN2A 3VHKA 1UA2A 3U87A 3IDPA 3G6GA 4O91A 3R7VA 4ANLA 2XNGA 3BU3A 4D4SA 3SC1A 3GCSA 3WZKA 3HGKA 5JSMA 3C1XA 3M11A 5TT7A 2HW6A 4OUCA 4GT4A 3S0OA 2ZV2A 5FLFA 3R1YA 1NVSA 2GHLA 3CJGA 3FI8A 2PMNX 4RWLA 5E1EA 5LARA 5T6KA 4R77A 2ERZE 3BBWA 3LFAA 2QR7A 3CGFA 2W9ZB 1WVWA 2X39A 2JKKA 3W2CA 4CSVA 3NYXA 2VWUA 4K9YA 3TIZA 1CKIA 5JFWA 2VTPA 4EH2A 1QPJA 4I3ZA 4F9BA 5HZNA 3E7OA 1F3MC 3EN5A 3F61A 2X4ZA 5HLWA 3G0FA 4BGGA 3R7IA 5L3AA 2DWBA 5AP0A 1S9JA 1SVGA 3EN6A 4M13A 3ZBXA 4P7EA 3DBQA 4UWYA 3W0OA 3OF0A 2EU9A 4RSSA 3NAYA 2YFXA 4H3QA 4AA4A 2GS7A 5EHOA 5M4CA 2A1AB 2J5EA 3LXKA 5DHJA 3PXRA 4ZAUA 3O23A 3QD2B 1Q61A 1OB3A 2FB8A 2RKUA 5M57A 3HMIA 4P5QA 4ANSA 4N6ZA 3MGYA 4EK4A 3VBXA 2W1HA 1QPCA 5IU2A 5AUZA 5K5NA 3BLRA 3JR1A 2WQNA 3NCGA 5LWMA 1PXMA 3OT8A 3TYKA 4C4JA 2JDVA 2UZEA 1QL6A 3QHRA 1YDTE 1H1SA 2XK9A 3F9NA 5M08A 3NW5A 5CI6A 1PKDA 5C27A 3VUDA 4MBIA 3FZSA 3VUKA 4I0RA 2WU7A 1X8BA 4JI9A 2JEDA 4EKLA 2EWAA 1VZOA 4M0ZA 3D7TA 4ZSEA 5H2UA 2I0VA 3PJ3A 5FP5A 3EIDA 5IDPA 5GINE 2XM8A 4PP7A 5KMLA 3NYOA 1PXOA 5H8GA 4YR8A 1HCLA 4LG4A 2Z7RA 4DAWA 2BRNA 5HBEA 3LW0A 4WSYA 4RFZA 4C4FA 3PWDA 5C9CA 3ZU7A 5CEKA 1GAGA 4I6QA 3QCXA 5ETAA 3BQRA 1LR4A 3MY1A 2Q83A 5HCXA 4FMQA 4K77A 2QONA 4AZTA 1U59A 3M1SA 1YOJA 4S33A 4I93A 2XUUA 3RMFA 1BYGA 4AA0A 2WMBA 5AP1A 5J1WA 4D55A 4OBOA 5AUWA 3R6XA 3FUPA 4QNAA 1QCFA 3ZO1A 2OU7A 4USDA 3ZHPC 4F7NA 3N9XA 3G15A 1IASA 4Z7GA 4NW5A 4Q5EA 5BVWA 2REIA 5JRSA 3FL5A 5H9BA 1OITA 4JR3A 3VBWA 5AP4A 5JGBA 3QALE 5IUGA 3BYUA 4J99A 4U3ZA 3W8LA 3SGCA 4CRSA 2R7BA 3MVMA 2JGZA 2X6DA 2B54A 3W18A 3D2KA 2HZ4A 4L53A 3FMNA 3UOKA 4BDKA 4W4WA 5D11A 4N6YA 3KY2A 2P0CA 3QLGA 3C0IA 4RJ4A 5HX6A 2BZJA 4EYMA 1JKKA 4XG3A 3BCEA 4PNIA 5FBOA 5KZ0A 2Z7LA 3T3VA 5AIKA 3C0GA 4XV1A 5LOHA 4LRJA 2PZRA 2WKMA 2DUVA 3EJ1A 3O8PA 4DGNA 4DFZE 1NW1A 3BGZA 4FV0A 5E91A 3KN6A 3AT4A 1FGIA 4L42A 2O63A 3FLQA 3TJDA 5DFPA 5IQFA 4EOJA 2AC3A 5E1SA 3W2OA 4AAAA 1SZMA 3B2WA 2HWOA 3DKCA 4ACDA 3ODYX 2XMYA 3HECA 3ZSGA 3RAHA 2PL0A 2YM4A 1MRYA 4O0RA 4OTFA 4QO9A 4UYNA 2X2LA 3ORZA 2RF9A 3FZRA 3P0MA 4QMTA 3I60A 2QR8A 4TNDA 5C1QB 5IH5A 4RWIA 4FZ6A 4BC6A 3CP9A 2ZB0A 4HYIA 4YSJA 5LMAA 4Z16A 4KB8A 5AP5A 1PHKA 3ATTA 1CDKA 3IKAA 2QOFA 3KF4A 3PXKA 3DZQA 5AX9A 4QP7A 2W5BA 3FMMA 4YP8A 4BDIA 1UNLA 3IOKA 5HEZA 2JBPA 1M14A 4FODA 5IUHA 4MEDA 4YC3A 5K9IA 3LHJA 3UO6A 4GG5A 1H07A 2UW6A 3QC4A 2WNTA 3IOPA 1ZARA 3FE3A 4OLIA 2X7FA 2HAKA 2WMVA 4HPUE 4HNFA 4KIPA 4FC0A 4ITJA 2XNBA 4IM0A 3DZOA 2VNYA 4IFGA 5EOLA 1XH9A 2WZJA 2X1NA 3JVRA 4ACGA 2QLQA 2OSCA 1H1QA 2PMLX 3ZYAA 3HL7A 2CCIA 3LKMA 3V5QA 4E1ZA 4FT0A 4FTNA 4YJPA 5CASA 3MVHA 3BIZA 3I6UA 3HX4A 4QP1A 2ETRA 4RX5A 4PUZA 2C6MA 3WIGA 4C4IA 3P23A 2WMUA 1J91A 3EQIA 5IMEA 3EQRA 4XRJA 4PL5A 3EN4A 3TNPC 2PE0A 4BI0A 3FXXA 3D2IA 4U5JA 5A4QA 2PVRA 3DY7A 3BEAA 3UVQA 3I1AA 4M14A 3RP9A 5LMBA 2UW4A 4L7FA 4L01A 4IE9A 3V5WA 2UZVA 4O96A 4G3FA 4KBCA 3OCTA 3OY3A 3VAPA 4FR4A 4ZJVA 2E9VA 3RALA 2IVVA 4O21A 3LQ5A 3Q52A 2YZLA 4RLKA 5L2SA 2VO7A 3BWFA 4YLKA 4G17A 1Y6BA 2R3RA 3DBCA 2GNHA 3IW5A 5BPYA 4GKIA 2GTMA 3O7LD 3JY0A 4X6RA 5AAEA 4XP3A 2J0LA 2ZVAA 4I6FA 1RJBA 3FLZA 4ZTHA 4EBVA 4JRVA 4YLJA 3PIZA 4FV2A 4KIOA 4Y46A 3TT0A 2IWIA 4MWIA 3V8SA 1LP4A 2G01A 3BI6A 3ITZA 4IVAA 1UV5A 3HKOA 4LOOA 1PW2A 4LMNA 2WIHA 1H24A 3C4EA 3MI9A 2PYWA 4QMMA 5KBQA 2HY81 3W8QA 1MUOA 3QQKA 4BDFA 2WMAA 1GZ8A 2QOOA 1F0QA 3KMUA 3U9CA 2YABA 1YI3A 3AQVA 3C13A 1Z5MA 3Q53A 5EK7A 2QCSA 3HMPA 3LFNA 5J9LA 1R3CA 4WO5A 4FI1A 3VS1A 3R28A 4DFBA 2CGUA 5CU4A 2X8DA 3R73A 3L9PA 5EQEA 1JLUE 1H0WA 4FE2A 4I24A 2AUHA 4S31A 3G2FA 5AA9A 3DDPA 3UIMA 4MQ1A 1OL2A 3ULIA 2R3OA 2W1CA 3BGQA 1ZOGA 3QUPA 4TYJA 5CAQA 4HGSA 4YC6A 4ERKA 1DAWA 2EB2A 3OD6X 4U7ZA 5FXQA 4BDEA 4WRSA 1OPJA 3E62A 3MN3A 4DCEA 4EHZA 2ETMA 4O0YA 3MVJA 2NP8A 4O7TA 3TCPA 4CFFA 3TUBA 4ZJIA 3IG7A 5EQPA 4BN1A 4C35A 4FICA 1V0PA 3UZTA 2E9PA 2UW7A 3UO5A 2V22A 3E63A 3ORLA 2H6DA 4BDHA 3F88A 3ZDIA 4V05A 5DR2A 3QC9A 3MB7A 4UZDA 5CNOA 3OS3A 4FZAB 2E9NA 2OBJA 3WZJA 3ID6C 2J90A 3BU6A 4P4CA 4K2RA 2YWPA 4PTEA 4EK3A 4XX9A 4QYGA 3PXZA 3MFSA 1HCKA 1DAYA 2YA9A 2VWZA 1K9AA 3G33A 3FMHA 1JAMA 4I41A 4DH1A 2FSLX 4HVGA 1XH8A 3LLTA 4L00A 1DI9A 3E8EA 3KXZA 4A06A 4BCOA 1RQQA 3HP5A 5I9ZA 3EKKA 3L8VA 4WBOA 5J9YA 2IVUA 3OW4A 3QCYA 2GFCA 4G9CA 2YHVA 4IVDA 3OROA 3PLSA 4U8ZA 3WE4A 4EUUA 2HZNA 3SW7A 5AWMA 2VGOA 3R9RA 5D12A 2IJMA 3G9NA 3KB7A 4FKIA 4C4GA 1ZY5A 2G15A 3AD4A 3IW7A 4JRNA 1Q99A 4MCVA 5L6OA 4YBKA 5DEWA 3MH2A 4FYOA 2WMXA 3TI1A 1IG1A 4F9CA 2UV2A 3QQFA 4I6HA 1CSNA 4KRDA 4GUBA 3RAWA 4G3DA 3R7YA 5C26A 3ORXA 2NO3A 4GFOA 3T8OA 2B4SB 3CJFA 5DBXA 4ACHA 3SOCA 4FNXA 4YGAA 4KBKA 3MIAA 2ERKA 5E8YA 5HGIA 1WVXA 5M4FA 4BCKA 4GT3A 3MW1A 2PHKA 3DK7A 3OOGA 2YDKA 3ACKA 4XH6A 4CTCA 2W1DA 3PVBA 4C62A 3NUYA 2JC6A 3R0TA 4Q9ZA 3R21A 4PDYA 2C5YA 4YJRA 2W9FB 4HGTA 2XK6A 3EN9A 3I6WA 3GU8A 4H05A 2R3MA 3AMBA 2VTLA 2XEYA 3DB8A 3KK9A 3MV5A 3P7BA 3RNIA 5A6OA 3FHIA 4YTFA 2OZOA 3OZ6A 3NUPA 4XCUA 3FL4A 4G6NA 5L6PA 1W98A 2UZNA 3IO7A 2PMIA 2X2KA 3R63A 4QTBA 3W55A 5E7RA 4KNBA 1BI8A 3D94A 3HA8A 4F64A 1YRPA 3ZS5A 4IEBA 4FZDB 1V0OA 4KRCA 4TWNA 3RCJA 3Q5ZA 4IWPA 4FTLA 5IA4A 3PE2A 4WHZA 4DH7A 4ZY4A 2XNEA 4Q5HA 3QX2A 3HAMA 4NW6A 2UZDA 3O2MA 4I4EA 4QMQA 3KVWA 1XBCA 2VRXA 5CF5A 3ANQA 2P33A 3PJ8A 3F66A 5CVGA 4D5HA 4DFLA 3BHUA 2R0UA 2I0HA 3DK3A 4IB3A 4CZTA 3Q2MA 1FBNA 4X7QA 4ZTRA 4ALUA 1R0EA 1WBTA 4F6WA 4FL3A 4YTIA 3FZ1A 3PPZA 4F63A 1FOTA 5IA3A 3HNGA 4R6VA 4CMUA 4OBQA 4R5YA 4R7IA 1FVRA 2CLQA 2PUIA 3R00A 5G6VA 1Q4LA 3W16A 4O82A 3AD5A 3R8VA 4B8MA 1PXIA 1PXPA 5J87A 4RJ6A 1A9UA 4IC8A 3II5A 4MXYA 1KE5A 4HPTE 3EFLA 1W0XC 4CZUA 4CRLA 5FDPA 4ZSGA 4D1XA 5EHLA 3TWJA 5D10A 3GEQA 3KRJA 3ZEWA 4F0GA 3DKGA 2HXLA 4FYNA 3DTWA 3RK7A 3UC4A 4BBEA 3FMJA 2JDSA 3PRIA 2IW9A 3AT3A 5HE3A 2HWPA 4BDJA 1GZKA 3GCQA 4CFXA 4D1SA 2Z02A 2VWVA 3VUHA 1OL1A 3ZRMA 4ZIMA 1PXLA 4HVIA 1KV1A 5LXMA 1L8TA 3OWKA 3Q60A 5DRDA 4EUTA 2YM5A 4X2GA 4ALVA 4A9RA 2YCSA 5CX9A 4F65A 5HG5A 3VC4A 4BKJA 4X21A 4U0IA 4DFYA 4YJUA 3DAEA 3H9FA 3PDTA 4YZCA 3V04A 5CENA 4D0WA 3OWLA 4BDAA 3SW4A 4EJNA 4XG7A 3REPA 3ZO3A 2BRBA 1LUFA 3Q4TA 5HE2A 3CR0A 5HVJA 2XIXA 4U79A 2P3GX 3FC2A 1ZYDA 5HCZA 4KINA 1APME 1OMWA 3NNUA 2WD1A 3NMUF 5CEIA 4FK6A 5J7HA 1URCA 2F4JA 4ENYA 2YCQA 4RX8A 4D1ZA 4DEEA 1M2PA 4EWQA 2YEXA 3ATSA 4P5ZA 4FIJA 5DA3A 4IWOA 3R7UA 4O0VA 2HELA 4FG8A 4Y95A 3UE4A 3FZOA 2CJMA 4V0GA 2XJ0A 2QNJA 4EH3A 2PVYA 1OKYA 2X81A 3R2BA 4G16A 1T45A 3V3VA 1YHSA 2YIYA 3KVXA 2R0IA 4USEA 1CTPE 2Y7JA 4YZMA 4RGJA 3KXXA 4CT2A 2BZHB 4GSBA 3LCDA 4RQKA 4II5A 3G6HA 3D5VA 2GNFA 3ZC5A 4ZK5A 2HOGA 2CN5A 4IDVA 4FSRA 3WF9A 1Z9XA 4NIFB 4R3PA 3HP2A 1YXUA 2E9UA 4O22A 3IW8A 4HJOA 2CLXA 3ETAA 2PE1A 3FXWA 2RIOA 4PY1A 5J9ZA 3LJ1A 2FGIA 4K0YA 5E8VA 4IC7A 4CCBA 1G8AA 4ZSAA 1JSVA 3LJ0A 3QTUA 3GBZA 4AOIA 4DEIA 4AACA 3POOA 4M97A 3T9IA 4FSTA 1A48A 1YXXA 3QWKA 3KMWA 2HZ0A 4O7SA 4MNEA 4EEVA 2YM6A 4P90A 2J0IA 4UB7A 4DC2A 2UVXA 4E8AA 1U46A 3QRUA 4XP0A 4JR7A 4UZHA 4E4MA 2YCRA 2CKPA 3LQ8A 4L68A 4LI5A 4K18A 2VTQA 1RDQE 4RG0A 4Y8DA 3RPOA 3TUDA 2X6EA 5DIAA 3NW6A 5LVPA 4ZTMA 4ACCA 4EC9A 2WB8A 2WU6A 4FTRA 3VF9A 2OIQA 4AGWA 2EUFB 2UW8A 2QC6A 2G2IA 2X9EA 4KBAA 4WRGA 3NPCA 4FVPA 3AC5A 4CFMA 4FNZA 2LAVA 3OXTA 3NVMB 2QU5A 1AD5A 3QTRA 4RC2A 2J0JA 3QKKA 3O8UA 4QTEA 5A54A 5JKGA 4LQMA 3ZO4A 1FMOE 4M15A 3ALNA 3KCKA 4XLIA 1Q8YA 4GT5A 4GKHA 1XQZA 3QZFA 3R7EA 5IPJA 3HMNA 5DVRA 3OHTA 4CFWA 3A2CA 3AG9A 4JBQA 3R9HA 4UALA 3BV2A 1J7IA 1J1BA 3D7TB 5ANKA 3E88A 3VO3A 5I9WA 5AADA 1JNKA 2NRUA 3L8SA 4ASDA 5E9EA 4OW8A 4O7NA 3G51A 2I0EA 1OKVA 4X2NA 1ZMVA 4HGEA 3VS3A 5M56A 2UZTA
chains in the Genus database with same CATH superfamily
2ZB1A 4JBOA 1R0PA 3AOXA 3WI6A 4ALWA 1VLRA 5DLSA 4RIXA 3HDMA 5HHWA 3Q6WA 3F2NA 2QOLA 3COHA 3W0SA 5EM8A 3VRYA 5C8NA 3PLAE 4OT6A 3U6IA 2C3IB 2EVAA 2VAGA 5FTQA 2OFUA 2ZDTA 2C1BA 2VO0A 3PP0A 5AA8A 4GW8A 4DT9A 4XRLA 4J71A 2PUPA 3UBDA 5L8KA 1H08A 3ZMMA 2PVLA 4XV9A 3DV3A 2GS2A 2JFMA 5IA5A 3SRVA 4B6LA 4NK9A 5EI2A 4BZOA 4OTWA 4WZYA 4FKOA 3FMKA 4FVQA 3FMDA 3PIXA 3W10A 3U4UA 5BVEA 2JKMA 3MA3A 5HD4A 3BKBA 5AMNA 3UG2A 4Z55A 2BIKB 3VBQA 2BIYA 3KXGA 3MFUA 3VUIA 3EQDA 3N4VA 4YPSA 4D5KA 5EG3A 3P7AA 3SXRA 2X8IA 4YTHA 1OVEA 5BUJA 4FZ7A 1VYZA 3PZEA 4TRLA 4AGDA 1O6KA 4TYIA 5CALA 3P79A 2NPQA 4G1WA 4U9AA 3NRMA 2AEGA 5HO7A 5LQFA 3ZFMA 2NNWB 2WQEA 4MD9E 4QYEA 3ZFYA 1ZWSA 4UWCA 4YJNA 4BCFA 1B6CB 4E4XA 5L8JA 3H10A 4UV0A 2QOKA 3TACA 3I5NA 2Y4IB 3KU2A 3OCSA 3ORTA 2NYAA 3DAJA 1H26A 2QKRA 3K2LA 4J95A 2YISA 5CI7A 3RPVA 5CT7A 5GJFA 5CANA 4W4XA 2W96B 2W1IA 1FVTA 3L9NA 2EB3A 3E8CA 4B99A 1E1XA 2A19B 4YC8A 3FPQA 2QODA 3DA6A 1GIIA 4X3FA 5C4LA 4DBNA 4TT7A 3WF8A 4ZZNA 4DFUA 4GUEA 2XKEA 2JIVA 2PK9A 4QMVA 4DFXE 3FSKA 4APPA 2OG8A 2YIWA 2OICA 5B2LA 4DH5A 5D9HA 2XNMA 3P1AA 1OI9A 4I0SA 5JEBA 4IAZA 3KEXA 4AXCA 4O6EA 5CNNA 2I1MA 2YDJA 3ZO2A 4DHFA 3CXWA 1WBVA 3G90X 4MNFA 2VV9A 3DQXA 4Z9LA 5FEQA 1I09A 2YM3A 2C6TA 4GCJA 4LFIA 2XNOA 2A2AA 5I9VA 2E2BA 2YIRA 4WUNA 4ZLOA 3VF8A 2NRYA 4ANMA 3G9LX 2XJ2A 4BDCA 5KHXA 2I40A 3Q04A 1UWHA 4U42A 3R9DA 3U55A 4FUXA 2XNPA 3OXZA 4IIRA 3PYYA 4FV6A 4H3BA 5EDQA 3TZ7A 2BKKA 2OZAA 4IACA 4CG8A 4PP9A 2YM7A 4JG7A 1PMVA 1LPUA 2XIKA 2W1FA 3D0EA 3VJNA 4C3RA 4GEOA 5KNJA 5E8TA 3EHAA 1M52A 1RW8A 4XJ0A 2VTJA 3R7OA 2CN8A 1OKWA 2PUNA 5IA2A 3ZXTA 3UPZA 4GVAA 4ZLZA 4MKCA 3PSDA 5KMKA 2WHBA 1KV2A 2XIYA 4FKUA 4QQCA 2ONLC 2H9VA 4ASEA 5FTOA 3U4WA 4EOQA 5M53A 2ZFYA 5CY3A 2VNWA 3F5GA 3LFSA 2RFDA 4L3JA 5EYCA 5M51A 2GQSA 1MQ4A 4D58A 2BDJA 3EQPA 4BCIA 3QQHA 5F9EA 5CVFA 4YO6A 5IA0A 3W33A 3OG7A 3UDTA 3LAUA 2FUMA 5ANEA 3UIXA 2C6KA 3P7CA 1AGWA 3OEFX 4ZJJA 2XKDA 4CMOA 4XEYA 3Q32A 4NUSA 4ONAA 3UC3A 4AWIA 3A4PA 4PDPA 4Q2AA 2F7XE 2BILB 4XG6A 4FEWA 3OXIA 1OECA 3VVHA 5BX0A 5I4NA 1SNUA 4R3RA 2ZMCA 4XUFA 4D9TA 5AJQA 5GHVA 3F3WA 1M7NA 4XV3A 1P5EA 5HU3A 3KXHA 4O0SA 4MYGA 4A4LA 4BYIA 3MH0A 4OTIA 3DTCA 5KCVA 1Y57A 3BZ3A 2W4OA 3PG3A 3QZGA 4LGHA 3FQHA 4NH1A 4QYHA 3ZZEA 4NTSA 2CNUA 4JG8A 3L1SA 1YOMA 3BLHA 4JAIA 4BCMA 4EOLA 5IQAA 3A62A 4R7BA 3ORKA 3U51A 4DHJA 3V8WA 4X6QC 1NY3A 2XBAA 3RM7A 2GSFA 5AFVA 4CCUA 4UX9A 4BCQA 4RZVA 5IUIA 5J8IA 5C4KA 2VTNA 3KIOC 2ITZA 3FY0A 2CKOA 3L9MA 3ORNA 5I0BA 4O7ZA 3MY0A 1WAKA 4HGLA 2GS6A 4AN3A 3FEGA 3QF9A 3ROCA 4GYIA 4QMYA 4MBLA 2QOBA 2YM8A 3DQWA 3EKNA 3QGWA 2R3NA 4DT8A 3UVRA 4MXXA 2QU6A 4E4LA 1IRKA 1E9HA 3S00A 3CQUA 4MD8E 2R5TA 3F2AA 5CSHA 3ZLXA 3UMWA 3D14A 5HX8A 4B4LA 2BAJA 3AC1A 3KQ7A 4QMNA 5BYZA 3G0EA 3VS5A 4QMXA 3COMA 4DTBA 2CGWA 4EQMA 5DI1A 4IJPA 3GC8A 5FM3A 3U9NA 3W1FA 4IB1A 4J8NA 3LXPA 2W4KA 3ZLYA 2WTWA 3R9NA 5H8EA 3PWYA 3F7WA 2CDZA 3HDNA 3LE6A 1R1WA 2PVMA 2WFYA 3LCKA 4AP7A 5GJGA 5A9UA 1K3AA 2UW9A 2C6IA 1YHWA 2OLCA 4Y5HA 4F78A 3TNIA 3FZPA 5CF6A 4RVLA 2JDTA 2P55A 3D7ZA 1Q5KA 4BTMA 4JQEA 1GZNA 1BL7A 4O81A 1ERKA 3OTVA 4M8TA 3PXYA 2OXXA 2JBOA 1OBGA 3QFVA 3SQQA 4J7BA 3LM5A 3C9WA 1OGUA 3QUDA 3V51A 1SNXA 5L8LA 1KE7A 1Q8WA 3MA6A 4HW7A 3FV8A 4CG9A 5KMOA 4F09A 2X2MA 1OBDA 1PYXA 4DE4A 2FSMX 3LCSA 1XBBA 2PVKA 4RT7A 1LEWA 4JOAA 3H4JA 5HICA 3RPRA 3ZXZA 2W1ZA 4DEDA 4H1MA 1SVHA 5HNGA 5HG7A 4CMTA 2CNQA 2R3QA 3EB0A 1GNGA 3MDYA 4U40A 2C5XA 3KGAA 5GJDA 5IF1A 3I0QA 5KUPA 5M09A 4XHKB 4IM2A 2C3KA 3CQWA 4ZTLA 4JBPA 4JXFA 2VX1A 4RQVA 2F2CB 4I1ZA 4E5AX 2HIWA 4EH9A 4IADA 4NT4A 5HE0A 4AZEA 5AV2A 2UVZA 3R71A 4E73A 2ZAZA 2HY0A 3GI3A 5AV0A 4EORA 5BVOA 3VW6A 4N0SA 4CKJA 3EFWA 3PJ1A 1YI6A 4M3QA 5IEXA 2O0UA 4FSWA 2XZSA 4FVRA 3LM0A 4IX3A 4K33A 5IDNA 3F82A 4AT5A 2YITA 3FWQA 3DCVA 4G31A 4K8AA 4QP4A 1F5QA 3AC3A 5E8ZA 5FRIA 4PDOA 4ZOGA 1ZAOA 3WBLA 4TWCA 4BJJB 2JDRA 2W5AA 1QPDA 3Q9ZA 2VN9A 3OWPA 4W8DA 5CSWA 4C3FA 1YI4A 1M2QA 5BVNA 3E8NA 4FKWA 3DLSA 4S2ZA 5I9XA 3TKIA 1H01A 3F7ZA 3POZA 4I5HA 4RJ3A 3IONA 4OTGA 1XH5A 4Z7HA 3F3TA 2WMQA 2C6DA 4KKEA 4F7SA 5M4IA 3SVVA 1OUYA 2AC5A 2QO7A 2QO2A 4GV1A 1J7UA 3I7BA 1Q24A 3S95A 3ERKA 5J95A 5A3XA 2C69A 4B9DA 4R7HA 4X2FA 3OEZA 3DKOA 1YWRA 3I5ZA 3V5TA 4O0TA 3QKMA 1GIHA 3IS5A 4EH6A 3QTQA 5C8KA 2PZPA 3BRBA 3QD0A 5DT4A 5KMMA 3PTGA 2PUUA 1JKLA 2BRMA 2C5OA 4IVCA 1O9UA 3FLYA 4JDIA 5DG5A 1H0VA 2JD5A 2VTOA 3ELJA 3TV4A 2IZUA 3DB6A 3HA6A 2XRWA 4FG7A 2W1EA 4HVDA 3E7VA 2R3FA 3KF7A 3R22A 5CTPA 2ZYBA 4DTAA 1OIRA 3MB6A 3F3UA 2PU8A 4U3YA 1PMNA 4FIFA 3GFWA 1XWSA 2P4IA 2E9OA 3VJOA 4QP3A 4GH2A 3E5AA 3O7LB 2W06A 3A60A 1FPUA 4QPAA 2H34A 3NNXA 2VTTA 4JQ7A 2BDFA 2OW3A 4YUQA 5ANJA 4Y85A 4QMZA 2IW8A 5IQEA 1JBPE 3OP5A 5BVDA 4PMMA 2HK5A 3MTLA 3DJ7A 4TWPA 4FKTA 1KE8A 3H0ZA 5HU9A 4Y83A 5CU3A 4BBMA 1UVRA 5M07A 2GTNA 2YERA 4C2VA 4R78A 4IAYA 4YJQA 4EKKA 3RWPA 3QBNA 4B7TA 2ETKA 2GNGA 3UP7A 3ZH8A 5G1XA 4BDBA 2PZ5A 4TTHB 2Y4IC 3QQUA 2WGJA 4E20A 4I23A 4WG4A 2VO6A 4XOYA 2R2PA 4O7VA 4F6UA 4Z3VA 5JZJA 4GFGA 1ATPE 4FNWA 1YKRA 4EQCA 2IVTA 4YJOA 2BZIB 2X0GA 4YLLA 3IGGA 3RI1A 2GNIA 5A4EA 1H1WA 3NIZA 5BVKA 4XG2A 4NM7A 1YW2A 5JGAA 1U5QA 3A7JA 4GU9A 4BRXA 3HRFA 2QQ7A 4A9TA 2KULA 4FV1A 3PVUA 4BCJA 4QTAA 1GOLA 4Y5QA 3TNHA 4O0UA 1XBAA 2OJJA 1TQMA 2PVNA 1RE8A 4QYFA 3UOLA 5HG9A 3JYAA 5JK3A 3D5WA 2WOUA 2QLUA 1YXVA 2A27A 2CHLA 4DG2E 4F70A 4EOOA 3K54A 4L8MA 4I22A 3LFDA 1TQIA 4E6DA 5IZFA 4AXAA 2Y6MA 2ITQA 3CKXA 3FPMA 3NUSA 4HOKA 1NA7A 4CGAA 4DH3A 1V0BA 2WTKB 2WXVA 3LIJA 4J1RA 4S30A 4XBUA 3RTPA 3HZTA 3UDSA 2BDWA 4DEBA 2R3IA 5L6WL 5BV3A 5IISA 4TNBA 3PY1A 1O6LA 2B9HA 5D1JA 4C36A 1XH4A 4TYHA 3C4CA 2WQOA 3TDWA 3SKCA 3HAVA 4JVGA 3VRZA 2R3GA 2W5HA 2W17A 2PY3A 2V7AA 4BIBA 3D5XA 3LOKA 2OGVA 5D7AA 1OZ1A 3ZSHA 5K4IA 4K6ZA 1UWJA 2WTVA 4CT1A 5EDRA 5EM5A 4FV5A 3K3IA 5IA1A 3GU7A 4DG0E 2V7OA 3BYMA 3FHRA 4V0GB 3CS9A 5BMSA 3DBFA 4CVAA 4RIWA 3LJ2A 4FT5A 5CYIA 3W0RA 4M67A 2ZV8A 5CAUA 2C47A 3GQIA 3DOGA 3ZONA 5A14A 5LVMA 3L8PA 2BAKA 3TXOA 5H8BA 4EH7A 3TZMA 4LUEA 5K5XA 3WF6A 4AUAA 4AE9A 4FTMA 1T46A 2ITTA 4H36A 3DLZA 5LVNA 3UQGA 5HNIX 1PMUA 1G3NA 2J50A 4C34A 3AKLA 1H1RA 2W7XA 3BWJA 1P2AA 2BPMA 2G2FA 2GQRA 3B8RA 3NDMA 3WYXA 5GIPE 4W4YA 5C01A 5DWRA 2DQ7X 3RZBA 4RA4A 1Y6AA 3UNZA 3UPXA 4IB0A 4XNEA 4A7CA 3O5AA 3ULZA 2C0IA 3R2YA 3KMMA 3ANRA 1L3RE 4MNEB 4BTJA 1Q3WA 2QKWB 4RIOA 3EQGA 5HTBA 1G8SA 2OXDA 2WTDA 3QHWA 3GOKA 4FV7A 4HCUA 2VWBA 3FC1X 4O83A 3UJGA 4F1TA 2BFXA 4QMOA 5LVOA 1SM2A 1I44A 3NWWA 4LOQA 4LL5A 4A9SA 3ZZWA 5IQGA 3PXFA 4M12A 4FK3A 5E90A 2YJRA 4H1JA 1W82A 4OTQA 3NLBA 5F95A 4O0XA 4KKGA 3QRTA 3KRWA 3Q4UA 3VS2A 4FEVA 2V0DA 3Q4CA 2XANA 5ANIA 3JVSA 3PA4A 4L67A 3D5UA 4WD5A 3EYHA 4E26A 5IEVA 5BYYA 1YVJA 3GC0A 4CNHA 2RL5A 3QZIA 1EH4A 5AEPA 4IX4A 4BCNA 4AE6A 3AMAA 1NT2A 2VTSA 3G5DA 3KK8A 3N4TA 1OIYA 2B55A 4BICA 2ESMA 3S3IA 3E93A 2QO9A 3MESA 1OIQA 3PSCA 2UW5A 3RNYA 3TL8A 2GHGA 3CD3A 4TYEA 4GJ3A 2HENA 4O6LA 4RPVA 3ORIA 5FQDC 4BF2A 4FTQA 3DS6A 4WT6A 1MP8A 1OGYA 2BUJA 4U80A 4WBBB 1G8KA 4FTOA 5HNBA 2HYYA 3RK9A 3SXFA 4BZDA 1PRYA 4LV5A 2BVAA 4RRVA 3WE8A 3R04A 1J3HA 3C50A 5CF8A 3U6HA 2WO6A 2HW7A 5IQDA 4V04A 2PULA 1VYWA 4RIXB 5B0XA 5HE1A 5EKNA 4AN9A 5JRQA 1OM1A 3DDQA 1P4OA 4GYGA 5IEYA 5JQ8A 3NCZA 4QDEA 3QCQA 5B2MA 3F6XA 3QRIA 3QU0A 5AUUA 1ZYSA 4DLIA 4I4FA 1M17A 2RGPA 1M2RA 3KKVA 3HV4A 3SRVB 3COIA 4HCVA 4F0IA 2ZM1A 2F7ZE 5ACKA 4C38A 2OJFE 4AW5A 4C3PA 1REKA 3K3JA 4JG6A 2PMOX 2JAVA 4N4SA 4ZTQA 4YJVA 4EC8A 3NGAA 5FGKA 4GL9A 3PPJA 2Z7SA 4PQNA 2CKEA 4XBRA 5LMKA 2QI8A 3ZLSA 2O3PA 3O51A 4I5MA 3D15A 5KZIA 3ZSIA 5AAGA 5HLNA 3PFQA 2QOHA 3F5UA 2BFYA 2LGCA 3PPKA 3PUPA 4IFCA 5D7VA 1WFCA 4NM5A 3GENA 4AZSA 3GU4A 4LGGA 2XB7A 3R02A 2BR1A 5CU0A 4CFNA 5DGZA 2XCKA 3EQBA 5CS6A 5TO8A 1WBSA 3GNIB 3E3PA 3GCUA 2WMRA 5AUTA 5E8SA 5AP7A 1YQJA 3CBLA 3FKNA 4YJTA 1HOWA 2XA4A 2GNJA 1PJKA 5DR9A 3CGOA 1BLXA 4LYNA 3I4BA 4DGGA 3E64A 2OI4X 3BV3A 2A0CX 3NFGB 4RIYA 4X3FB 4RFMA 4RLLA 1ZMUA 4D28A 4UXLA 2F7EE 3C5UA 4IHPA 1Y91A 4GJ2A 4IMYA 5EFQA 3LFFA 3N51A 3WZEA 4QTDA 5AAFA 4IM3A 3RVGA 4KKHA 3P78A 3FAAA 1PYEA 4MAOA 1UKIA 2J51A 2QURA 4LM5A 4AZVA 1J1CA 5HIEA 4BGQA 2PZIA 2CSNA 2OFVA 2J0KA 2I7QA 5KMJA 5IG1A 4JT3A 3GT8A 2QOCA 4PWNA 4CFVA 5KMIA 3A8WA 2B0QA 1GZOA 2GPHA 3HYHA 3OMVA 4IX5A 4A07A 3F69A 3NEWA 2WELA 1ST4A 2O64A 5DNRA 5C03A 2OJIA 2XK7A 2OIDA 2FSOX 3C4FA 3DGKA 3MH3A 4S32A 4WA9A 3NIEA 4ZY6A 4NU1A 2VGPA 2XYUA 1W7HA 3QD4A 4O38A 4EHGA 4EH8A 1ZRZA 1ZZ2A 2QG5A 2OZAB 2RG6A 3LFBA 4FTTA 4J98A 4AFJA 5BUEA 3DBEA 4QMPA 3UO4A 2GDOA 4G5JA 4PX6A 5HBHA 3UZRA 5KX8A 3WZDA 3HUBA 1OPKA 4TW9A 4JBVA 5TF9A 4USFA 3AC8A 4DF3A 5EOBA 1CM8A 3C51A 5CLPA 1WBNA 4F1OA 4OGRA 2P2HA 4BCPA 3NUUA 2CCHA 4BI1A 4O2ZA 4WNPA 3F5PA 4O7PA 3HMMA 4IWQA 4C2WA 3C5IA 2DS1A 4KS7A 2BRHA 2XM9A 2H8HA 4IH8A 2C1AA 3LXLA 3FYJX 4L3LA 5E4HA 1U54A 3R8PA 5DR6A 5KKRB 2XRUA 3LCTA 3NX8A 4ASZA 2WMWA 4M7IA 3ENMA 3OTUA 4U81A 1OKZA 2J2IB 4UBAA 1VEBA 3PA5A 3MYGA 5FXSA 4TWOA 3MY5A 4QOXA 2O5KA 1G5SA 2ZJWA 3QQJA 4KSPA 4QP8A 3IQ7A 3E92A 3QYWA 5AP3A 2RFNA 3CE3A 2ITNA 1STCE 4FT3A 2W99B 4FGBA 1S9IA 3MTFA 3PY0A 4H3PA 2B52A 3B8QA 1DM2A 3I7CA 3NYVA 2X7OA 2F9GA 4DCAA 5GIOE 3IECA 1FGKA 3VIDA 3UNKA 4CLJA 4RVKA 4M69B 3OFMA 2YDIA 4L3PA 3NR9A 3KULA 2QOQA 3EQFA 2R4BA 2BTRA 3R01A 4U97A 3SXSA 2WMTA 5LJJA 1H25A 3A61A 4OTHA 3V6SA 4BDDA 1BX6A 3GGFA 4HVSA 4YZBA 4QP9A 3FSFA 4FTAA 4MVFA 1JSTA 1WBWA 4WIHA 4RC4A 2R64A 5EI8A 4YURA 4ZSJA 2WTKC 2J7TA 3ZBFA 5ETIA 3NNWA 4GS6A 4E6CA 4YHFA 4I0TA 3CKWA 3ZLWA 5FEDA 3QD3A 3UVPA 5ANOA 4FKPA 2B9JA 3LFCA 5I5ZA 2GNLA 1Q97A 1UU3A 2GHMA 4FSYA 3L8XA 2JKOA 3MJ1A 3E87A 4XYFA 3ZUVA 4BIEA 3TV6A 4ZLYA 4I20A 5KO1A 3A7FA 3GUBA 4EI4A 3S4QA 4YHTA 2YACA 1XJDA 3CTQA 3EOCA 3UGCA 3O71A 4MTAA 3FI2A 4Y72A 4QP6A 1W84A 4I5CA 5BQ0A 3H30A 5HVKA 3D83A 2IN6A 4L44A 3E3BX 4NFNA 4FKSA 4U94A 3OVVA 3UNJA 4IZ5A 4U45A 4NWMA 3BELA 5EYDA 4NM0A 4F9AA 1CKPA 4LV7A 4LRMA 3VBTA 1WBOA 2YIQA 3PSBA 3VS0A 3NVKI 2ZV7A 2ZMDA 3H9RA 3HRBA 4KS8A 4YNEA 4AGUA 4F7LA 3CC6A 3EQCA 3OT3A 3DFCB 3QGYA 5C8MA 4CV8A 3VW8A 5HBJA 3UTOA 3HRCA 4JL9A 2QD9A 5IH4A 4RWKA 4N70A 1PXKA 4PMTA 3KCFA 2VWWA 4ZTNA 3ZOSA 3EZVA 4ASXA 3BX5A 1J7LA 3LQ3A 2IPXA 4HYHA 1NVRA 2XIZA 4DYMA 2ZM3A 3ROYA 4C7TA 1TQPA 1MQBA 4MK0A 2VO3A 2J6MA 3MFTA 3ZUTA 3R9OA 3VQUA 3PY3A 3VQHA 4CD0A 5JFSA 2PPQA 3IK3A 4PTCA 1E1VA 1WZYA 2XAMA 5CXHA 4DGMA 2QHMA 4TZRA 3R83A 2CKQA 3DPKA 2I0YA 4AXDA 2XF0A 5CAVA 2Y8OA 3GC9A 4HZRA 1OUKA 3CEKA 4AX8A 3NSZA 5JH6A 1IAJA 5FBNC 3EH9A 5KHWA 3HLLA 4MBJA 3O0GA 4DGLC 4WG3A 4BZNA 3W0PA 1IR3A 5CU2A 4B8LA 3GOPA 1FVVA 1PXJA 2RFSA 1Q8TA 5DT0A 2ITUA 4RBLA 3SHEA 4RJ5A 1JKSA 4J8MA 4TL0A 2PTKA 4DFNA 5AV4A 3MPTA 3UQFA 3OBJA 4JAJA 4L45A 2HZIA 2BHEA 4L43A 3C4ZA 3ZFXA 3F3ZA 4WNMA 3WILA 5ETCA 2YCFA 5T3QA 3A7HA 3COKA 3KREA 3W0NA 4ITHA 4LOPA 5JZNA 3WF7A 2XP2A 3NNVA 5D41A 1WCCA 4E6AA 3TZ9A 4EYJA 3KL8A 3CCNA 1ZLTA 4I6BA 4IWDA 2F49A 5JQ5A 3R1SA 4IJ9A 3RJCA 4EOPA 3CSVA 2PWLA 2R3PA 4NM3A 4QMWA 5CSVA 2GMXA 2IZRA 1JKTA 5K4JA 4BDGA 4YTCA 3OCBA 4C4HA 2HCKA 2WIPA 4N57A 4O7WA 5EYKA 2PVFA 2ITYA 3QYZA 5HLPA 2OKRA 4AFEA 2B9IA 4PDSA 3VUMA 4ORKA 4A4OA 5HTCA 4RJ7A 3FQSA 3VS4A 2VTIA 1ND4A 4IAKA 2W05A 3HV5A 4C0TA 3VWAA 4O7YA 2V62A 5F4NA 4FG9A 4FSQA 2B53A 3QXPA 3BYVA 3UIBA 3DJ6A 4O7RA 4FGRA 4FTJA 3PRFA 4OTDA 3FBVA 4J97A 2W0JA 3BYOA 5A46A 4O2PA 4C02A 3GCVA 4FSUA 1KE6A 2ZDUA 3L9LA 1Y8YA 4KSQA 5CU6A 3F5XA 2BHHA 4UWBA 3TTJA 3LFEA 2OJGA 4D0XA 2ACXA 3FZTA 4IQ6A 4UN0C 4NTTA 3BPRA 2WTCA 4NCTC 2C68A 4R1YA 3NUNA 3ORPA 3GP0A 4BR3A 3W0QA 3LPBA 1IA8A 4QMLA 2OH0E 1PF8A 3DXNA 3QAME 4BB4A 4HYUA 4AQCA 5DT3A 3EFJA 3C4XA 1SMHA 4FOCA 3ZC6A 3TG1A 2IZTA 3DFAA 3AXWA 5CSXA 3QX4A 5K3YA 4AG8A 4EWHA 4R5SA 4FTKA 3UOHA 3P08A 2O65A 3QTXA 4GVJA 4X3FC 4YBJA 3SOAA 2QHNA 2ZV9A 4F9WA 3QTZA 3R1QA 4TN6A 2C3JA 5CT0A 2H96A 4IVBA 4AS0A 4F9YA 5CAPA 2XYNA 4E4NA 3BU5A 3EL7A 2J9MA 1FINA 3HEGA 2F2UA 2JIUA 3OUNB 4GK2A 4JX7A 4LV8A 2UVYA 2Y0AA 1Z57A 3TN8A 3S1HA 4UXQA 4D4YA 2Y4PA 5M55A 3D9VA 3C7QA 4W8EA 4U98A 4QT1A 2R3LA 4DA5A 2UZUE 3LVPA 5E8XA 3RK5A 3ACJA 2O8YA 1KWPA 4L46A 3HV3A 1URWA 4RX7A 4DHZA 3B2TA 3Q2JA 4AZWA 5M06A 4PTGA 4R3CA 5CQUA 1BI7A 4FKQA 3T9TA 4FUYA 4FZFB 5DYJA 5CXZA 5L2WA 5EW8A 5FG8A 5TOZA 1PMEA 4AOJA 5DRBA 5AUVA 4D4VA 4TYHB 4G2FA 3QA8A 1QMZA 4V01A 4KA3A 3UDZA 1Q8UA 4LUDA 2EXCX 1TVOA 2RFEA 4O27B 3PG1A 4Q9SA 4DEHA 2GQGA 3W0MA 3EL8A 3RKBA 5HORA 5CWZA 4BY9E 1JPAA 4AT3A 1AQ1A 2WEIA 3IW4A 1H28A 4G3CA 4I94A 2UZWE 5HIDA 3TNWA 1FMKA 1YDSE 3AT2A 4ANQA 4MX9A 1WVYA 5DPVA 1Q3DA 2ITOA 4RIWB 4FTUA 2WOTA 1ZZLA 1WMKA 3WIKA 2XCHA 3LFQA 3JY9A 4RFYA 1XH7A 2XEZA 4FT9A 3C0HA 5DEYA 1UU9A 4AF3A 2PVJA 1JSUA 3GB2A 4C58A 4IZ7A 4RJ8A 2WEVA 2WTJA 5KE0A 5KKRC 2CGVA 4FSNA 2WPAA 3W2RA 2B7AA 2Z2WA 5BNJA 4E93A 5CVHA 4RX9A 2XK4A 5FTGA 3UYSA 4FTIA 2BROA 2UZBA 4DGOA 3HV7A 3KN5A 4C37A 1XKKA 4C59A 1DI8A 2RG5A 2VUWA 3TKHA 5HQ0A 1WBPA 1OIUA 3A4OX 3AGLA 3M2WA 4AGCA 3RAKA 4YJSA 4FIEA 4F0FA 3BL9A 3FMLA 4MHAA 2VU3A 4YPDA 3OCGA 3ZEPA 4ZZOA 4FV4A 4XV2A 4CXAA 4QQJA 3SV0A 4JJRA 3RAIA 3CTJA 2J5FA 1ZOEA 2W4JA 3I0OA 3RHXA 3QCSA 3JS2A 4ARKA 5AX3A 1FQ1B 4PRJA 4DINA 2VWYA 3V5LA 5JFVA 4EZ3A 1SVEA 5JGDA 5F94A 1IA9A 3SLSA 3IDCA 4CFUA 4EH4A 3R8UA 3W2SA 4J53A 4MXZA 3DBDA 5F20A 4DDIA 4IZYA 4L52A 3FMEA 2IZSA 5M44A 3BHTA 3KXMA 3QRKA 4NL0A 3M42A 3RPSA 4FIHA 3P9JA 4RZWA 4EOSA 2IG7A 4PF4A 1W8CA 3UOJA 5AV1A 1V1KA 3TTIA 2R3KA 1JQHA 4EJ7A 3ET7A 3JPVA 2O2UA 3KRRA 4F7JA 3R8LA 5BVFA 3D4QA 4TPTA 2F57A 4LL0A 1LEZA 5AUYA 2C0OA 5AUXA 2VX3A 3WF5A 5CEQA 5M4UA 3V5PA 3RHKA 2FSTX 3FI3A 2WQMA 3ZM9A 4A9YA 2ZM4A 3CTHA 3FY2A 4M84A 3RPYA 5CF4A 2IVSA 4GIHA 3QZHA 1YWVA 1VJYA 3Q9WA 3SG9A 3PVGA 5IQHA 2BKZA 4CQEA 3CLYA 4KD1A 1QPEA 4TXCA 3RWQA 2BTSA 3DAKA 2G1TA 3QRJA 4EH5A 2VD5A 2OWBA 2AYPA 4FL2A 3UODA 3U6JA 4O0WA 4U43A 3AC4A 3SG8A 4EBWA 5CSPA 3A7GA 4BCGA 5LCJA 1XH6A 4GIIA 4R1VA 3HUCA 2X8EA 2P2IA 1R39A 3RGFA 3KA0A 4FV9A 3DNDA 4YMJA 4FV3A 4IB5A 4OT5A 3GCPA 4MXOA 3MWUA 3FYKX 1PXNA 2VWIA 3MBLA 3OC1A 3QTSA 3BEGA 4WKQA 4FEXA 4YZNA 1UU8A 3W32A 5CEOA 3UQCA 1ZYCA 2JDOA 2YZAA 4G34A 4JDHA 4EL9A 3FDNA 4IAFA 4J52A 4YZ9A 3TDVA 4DTKA 4EZ7A 2I6LA 4QTCA 4RWJA 5FDXA 3PXQA 5EW3A 2XVDA 4DG3E 3KFAA 3EMGA 3PA3A 4JX3A 5ETFA 3K5VA 4ACMA 1BUHA 3HMOA 5FUTA 3HV6A 4ZXTA 4B0GA 4ZMEA 3LMIA 4G5PA 5LVLA 5EKOA 2X4FA 2G9XA