4N57A

Crystal structure of aminoglycoside phosphotransferase aph(2'')-iva adp complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
RTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords APH(2'')-Id
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-IVa ADP complex
rcsb
source organism Enterococcus casseliflavus
total genus 93
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4n57A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4n57A02
3SA0A 4EH5A 3A61A 1OPJA 3UVQA 4MVFA 4K1BA 3AOXA 2IVVA 4FSZA 4XG2A 5M4CA 5AX9A 3ELJA 2CN5A 4FV7A 5GNKA 3PYYA 5LVMA 4DEBA 4RZVA 1FMOE 2GTNA 3ZMMA 2PVLA 4GV1A 1XH6A 3MBLA 3TKHA 3FLZA 4RC2A 1FVVA 1R1WA 2ZM3A 4G5PA 3C0GA 3DBEA 4OT6A 4QMXA 4EOKA 3GC7A 4I5CA 2WTWA 2HZIA 4X0MA 2OKRA 3IG7A 4DFUA 3OVVA 2GNFA 4FSRA 1Q24A 4FR4A 1OPLA 2QO9A 2C6KA 3G0EA 4O0YA 1JWHA 4CFMA 5HO8A 1JBPE 3QWKA 4W4XA 3BEGA 2LAVA 4EBWA 3N4VA 2RGPA 3AT2A 2UZUE 2JDOA 3FY0A 1XO2B 4USFA 3AD6A 4QQTA 4MYGA 3OFMA 3ZEPA 3CQUA 1SYKA 2PZ5A 4M67A 2PL0A 2HW7A 4RIOA 3B2WA 4CTBA 4PF4A 3QKKA 4AZTA 3G2FA 2R9SA 2XB7A 4QYGA 4IB1A 4BDCA 3GBZA 4O0WA 3EQGA 3UNZA 5IH4A 1WAKA 1YHSA 3W0QA 4CG8A 3EQFA 1R0PA 5BPYA 5HESA 1AQ1A 4DE4A 4EQUA 2VX1A 4RC4A 2QOCA 4ANLA 3R2YA 4RX5A 2C3KA 3BBTB 4ZIMA 3MH2A 2VTHA 3QRTA 2C6OA 5TOZA 3BKBA 5CF5A 2I0HA 2XIZA 2C5XA 3ALNA 5KMLA 3SGCA 1M52A 5IUGA 5FTQA 4G17A 4X2KA 4BYIA 3QBNA 3OEZA 4X3FC 3H9OA 3P7CA 4PMSA 4IWOA 3L8VA 4WRSA 3EZRA 3CY2A 3Q9YA 3I7BA 2G2HA 2O0UA 2XH5A 4TN6A 3FKOA 4Q9ZA 2PE2A 2YWPA 4N70A 1PYEA 1OUKA 4DEEA 3U6IA 1H01A 4QTCA 1W8CA 4WA9A 4O7NA 4DFNA 3KEXA 4FIIA 2JIUA 3ZRLA 5L6PA 1NVRA 1YXTA 3WZJA 3MSSA 4C4FA 3AD5A 3W2PA 3C50A 3OY3A 4QQCA 2C5VA 4I41A 4PQNA 1Q8WA 1M14A 2RF9A 1YWVA 1XHAA 3KULB 3FI8A 3ZOSA 2CCIA 3VUHA 3E63A 4EOPA 3T3VA 3VS7A 1OZ1A 4GVJA 5LOHA 4RWLA 4EH7A 3E88A 4ANSA 1Z5MA 4U9AA 2NP8A 4F09A 3MPTA 1UNHA 5AFVA 3IW7A 5HEZA 2X2KA 4XHKB 4IE9A 4BR3A 4OTFA 2VX3A 4O83A 4USEA 3MIAA 2CDZA 4YU2A 4HCTA 3DXPA 3F3WA 5A54A 4KIQA 2H9VA 3ITZA 3FMDA 5CVFA 3KRJA 2R3LA 5DT3A 5HI2A 3TDVA 2VO7A 4O86A 4ACMA 4YC8A 3NGAA 3I0QA 2HW6A 2EXCX 3ZRMA 3F88A 3EQCA 1URCA 4JBOA 1H1RA 1B38A 5M44A 1JNKA 4YHJA 4F0FA 5LCJA 3C5UA 4BCMA 5EM5A 4U94A 1U4DA 2YITA 2WU6A 3LXPA 3LM5A 4OTGA 4F08A 3MPAA 1I09A 2XNGA 1XH9A 2R0UA 4TPTA 2R3JA 4U42A 4EOSA 4ZK5A 5KMIA 3R6XA 3PPJA 4CCBA 4B7TA 2P2HA 4O27B 5LMBA 1J91A 2JKKA 1E1XA 3UP7A 4D28A 5HD7A 5GJGA 5KMNA 4FSMA 2Y0AA 3TJCA 2VTLA 5CEMA 5AP0A 4MCVA 3KF4A 5I9XA 4FUYA 2OXXA 3EYGA 3CGOA 4FKVA 2XEYA 4EUUA 2H96A 1U54B 4O7ZA 3MB7A 4V05A 2YM7A 3OZ6A 4ZY4A 4GK4A 3DAKA 3FYJX 3PTGA 2OZAB 1PF8A 4O7YA 1OPKA 4MBIA 4F1MA 2PVHA 5A3XA 3ZC6A 2C6MA 2QLQA 4CGAA 3V3VA 2BAJA 3V01A 3QTUA 3ZM4A 3TCPA 3HAVA 4BIDA 2PMLX 4C3RA 3LFNA 3TIYA 4IAZA 1Q97A 3E7OA 5HCXA 4ZJVA 4GCJA 4C4JA 3R7VA 5BMMA 4HOKA 3CGFA 2QG7A 4YLJA 3FI2A 3B8QA 4U8ZA 3FDNA 3LAUA 4BI2A 3O96A 4JBQA 1Y57A 3PDTA 1WBPA 3CC6A 5EW8A 4Z9LA 4FK6A 1U54A 5T6KA 2PMIA 4I6FA 1H4LA 4R3CA 2VTMA 4HYHA 2YN8A 3BI6A 5FM2A 3GOPA 4EK5A 1DM2A 1O6LA 4IVAA 5ACBC 4GSBA 4DC2A 4FEVA 4EZ7A 4ONAA 2JIVA 5K5XA 3PJ3A 1FGIA 3O50A 4GJ3A 4R5YA 2XRWA 3LFAA 4XV3A 5DT4A 4P5QA 3ZZWA 2KTYA 4BZOA 5IQHA 4EH4A 2QO7A 3VS1A 1U5QA 4X2GA 3BWFA 2R3IA 2XBAA 3TUCA 4IVCA 3G0FA 3RHKA 4AE9A 4EH9A 4X21A 5AUYA 3LCOA 2P55A 4BYJA 3PJ1A 3Q9XA 3TZMA 3THBA 2UV2A 3TTIA 2XVDA 3UVRA 3BU6A 2OJGA 1TKIA 5D7AA 5C27A 2F2CB 5D9HA 5FM3A 3QUDA 3UO6A 4BDAA 2RL5A 1PXMA 1ZWSA 5HU9A 4FKGA 3MY0A 5AP1A 1OKWA 1PXIA 5J95A 4DH3A 2XIRA 3IECA 2W17A 5ICPA 3C4WA 4I3ZA 4BZNA 5DN3A 3MN3A 1TQIA 4P2KA 5IQCA 2YA9A 4FTJA 3Q3BA 3DS6A 3RAKA 4CT2A 3AC1A 2W1IA 2PZIA 3AMAA 3EHAA 3KCFA 4RA5A 3UZTA 2VWWA 4O21A 4AOJA 2HZ0A 2OWBA 4IX4A 4HPTE 5AUVA 2X7FA 4O2ZA 4JR3A 5A14A 1GIHA 2XNPA 1PKGA 2EXMA 4C0TA 3M2WA 4FKRA 2GNLA 1IASA 5EM6A 3E62A 4IVDA 5C01A 2WD1A 3VBYA 4D55A 3WILA 5A4QA 4J71A 4B99A 1PY5A 2C30A 3EL7A 3V5WA 4E4NA 2Y4PA 5CLPA 3P79A 4IDVA 4QMUA 1BL7A 1P4OA 2DWBA 5ANKA 4DG0E 2EB3A 3GFWA 3PSCA 2YERA 3NIZA 5GJFA 5AA9A 3SOCA 4XV1A 1BX6A 3PJ2A 3OXZA 4YBJA 4FE2A 2WTDA 3V5JA 3KXNA 2G15A 5BVKA 3FQHA 1VZOA 1FQ1B 3CXWA 3QD2B 4U0IA 4UXLA 2WHBA 2YAAA 3ZXZA 1JLUE 1Q4LA 3TDWA 5JQ8A 3UQCA 4AX8A 4F64A 2C3JA 5EHOA 4J7BA 5D10A 3QX4A 2B4SB 2CJMA 2YIXA 3TTJA 3LMHA 5CALA 2YACA 4HGTA 4NFNA 4I92A 2RFNA 3K2LA 4QO9A 3MYGA 4YC6A 3BLRA 3V5PA 3L8XA 4C33A 3S0OA 5JZJA 4K8AA 4EQMA 4GG5A 1WBWA 2YZAA 3GT8A 4I6HA 4G5JA 3NCGA 5EQYA 2GQSA 1WVWA 4NCTC 3QCXA 4FTUA 1JKKA 3RPRA 3ACKA 3KREA 3PXFA 4LQMA 4O2PA 3AC4A 3KA0A 3PWYA 5K3YA 3HEGA 4YTCA 1M2PA 4HCVA 1CDKA 2I0EA 3QYWA 4RLKA 5BVDA 2B54A 1P2AA 2PE1A 3GCQA 2QOBA 3QYZA 4OBQA 4E73A 1BUHA 4JVGA 4B9DA 5CNNA 3PWDA 5TT7A 3NVKI 3HMNA 3I5NA 5JGAA 3WIGA 4FKSA 3EQIA 2CMWA 4RJ7A 3VRYA 3BLQA 4ITJA 3OTUA 5KMMA 3Q2JA 3S1HA 3QD0A 1XBAA 5C03A 4CMTA 4KIOA 5CVHA 4UYAA 5L2IA 1BI8A 1E9HA 4M15A 2WMQA 5AP2A 3PJ8A 4DITA 5IA1A 2ZV2A 5M09A 4TW9A 2BPMA 4HVGA 3GU7A 5M06A 4NKAA 5AP5A 2QHNA 1IEPA 5DA3A 5CZHA 4KSQA 4HJOA 2B0QA 1YXXA 3DK3A 2X6EA 3E3PA 4L9IA 4LI5A 2O63A 5EM8A 3PVBA 4G9RA 3TNQB 3EB0A 3EKKA 3CD3A 5HLWA 2WXVA 3BE2A 1M7QA 3NZ0A 4MNEA 3B2TA 3QRKA 3S3IA 5HG7A 5E1EA 2A19B 3KF7A 2F49A 4XG3A 5DLSA 4FX3A 2X81A 5DBXA 4JS8A 3ZEWA 4C34A 5L6OA 3VW8A 2RIOA 2B1PA 4CFWA 5K4JA 1GY3A 3MA6A 2YDJA 3QQHA 3TUBA 4JNWA 4BDHA 4L7SA 1UV5A 1KV2A 2XP2A 3F5GA 3H10A 1ZMVA 4DFZE 4OTIA 3F3UA 4EL9A 5HLPA 4TL0A 4R78A 2R2PA 3ZO3A 3CIKA 1KOBA 4ZLOA 5L2SA 4C62A 3D7TB 2JFLA 4JDHA 4L42A 2ITUA 2OH0E 4KAOA 4XJ0A 2RFEA 3H4JA 5KBQA 3BGZA 4PL4A 3LPBA 4D5KA 4LOPA 4N6ZA 4Y5HA 3ZUTA 5KKRB 2PULA 4LRJA 3G51A 1ZXEA 3HZTA 4HYIA 4PP9A 2VNYA 2UZTA 4FKTA 4I24A 5CT7A 5ANIA 4ZY6A 2BFYA 3W18A 1R78A 3JUHA 4A9UA 4LGHA 5CEKA 1ZY4A 4U3YA 2V7AA 4HVHA 2OF2A 2PVMA 1OIUA 3SRVB 3ZM9A 4D58A 4YZ9A 3S00A 4BBEA 3RALA 2OJFE 4NM5A 3LHJA 3TKIA 3Q9ZA 4FEWA 5DFPA 5C4KA 4W4YA 4EYJA 4ZLZA 3NNVA 1UU7A 4Q5HA 4DTAA 4S33A 2BDFA 3D7TA 4QNYA 5KE0A 2F57A 3F3TA 4XG8A 1L8TA 3PXYA 5HE1A 4BBMA 4J52A 2AC5A 5IF1A 3ZDUA 4BKJA 3QQGA 4FSUA 4JRNA 4HVIA 3OWKA 3O2MA 3QXOA 4UWYA 3UPXA 4ACDA 2GPHA 2UZVA 2H6DA 3Q4UA 4ASEA 2C68A 3ENMA 3ZONA 4FT5A 4U41A 1UKHA 3W2SA 2PVKA 5FG8A 3OROA 3QL8A 5CI7A 1MP8A 4BTKA 3ORTA 4K6ZA 5HE0A 3TNIA 5EQPA 2XS0A 4DLIA 2YZLA 4IZ5A 4DYMA 4EORA 4E4XA 3WZEA 5KKRC 4UX9A 1O9UA 5FGKA 3HL7A 2GS6A 3I81A 4AXAA 3P1AA 5HKMA 3WOWA 3Q9WA 3CKXA 3ULZA 3ID6C 5LVLA 4DFXE 4F9WA 3P08A 2HZNA 5LVPA 5M4IA 4RVMA 3IK3A 4RWJA 3Q4CA 5DG5A 3VBTA 3KN5A 3NIEA 1YOJA 3FXXA 4RJ5A 2GQGA 1CKJA 4MD9E 1H0VA 4UALA 3R7EA 4O7RA 4L67A 2FGIA 5FTOA 2R7BA 4TXCA 3OUNB 1TVOA 5E8XA 3OCGA 5M56A 4YJUA 3BYSA 2IN6A 3LQ5A 4L3LA 4O96A 4PTGA 2G2FA 5A4LA 2OFVA 2JD5A 2G1TA 1W83A 4GT3A 3ODZX 2WU7A 5FBNC 2WMXA 3PXQA 4G16A 3SV0A 4EOLA 2VGOA 4G9CA 4GU9A 4ZOGA 3QXPA 3GEQA 1GZNA 2YM4A 3G5DA 1U59A 2CNQA 4HZSA 3HP5A 3VF8A 4HVDA 4NM7A 2W99B 4KUJA 5CF8A 2X4FA 4A9TA 2UZWE 4GK2A 3ZH8A 3OG7A 5BQ0A 5LWNA 5FLFA 1JSTA 4FNYA 4ORKA 4QMZA 4R3PA 1OM1A 4C4EA 3TL8A 3NUPA 4F65A 2P3GX 4XP0A 5JZNA 5IH5A 2R3KA 3D2KA 3QZHA 2C69A 4RMZA 2WOTA 1QPDA 4QMWA 3DZQA 3LLTA 1K2PA 2HY0A 3JVRA 3DKCA 5HHWA 2XYNA 5BX0A 5I9VA 3I60A 4ZP5A 2PMNX 3MVLA 5GJDA 2XM9A 4FL1A 4JQ8A 5EYCA 4QP9A 4AA5A 3HRCA 4O7OA 4UWBA 2XF0A 3TV6A 2QR8A 1Q8UA 4RFZA 5CANA 3FLWA 4R1VA 5HVKA 1IR3A 2X2MA 4IC7A 4MXXA 3HP2A 1Y6BA 3GB2A 4FBXA 3LCSA 1FPUA 2ZM1A 4YPSA 2OIBA 2VWZA 4OR5A 2BIYA 4A4XA 2ACXA 3P7BA 3KB7A 4EK8A 2YCSA 3FLNC 4MH7A 5J1VA 3QKLA 4YC3A 3FMNA 4OGRA 4MXYA 5ANEA 2OJJA 4GU6A 4S31A 2J5FA 3EFKA 5E1SA 4YLLA 4O7WA 3VUGA 3LMIA 4ZXTA 5M57A 3F3ZA 4LMNA 2C1AA 2VV9A 4H3BA 4FTRA 4L43A 4PWNA 3A4PA 3EN6A 3ZLWA 4X2JA 3TN8A 4E5WA 3ODYX 1SVEA 5EI8A 4V01A 5C1QB 2XEZA 5DVRA 3GC9A 5AV3A 2PZPA 4HNFA 3R9OA 5A46A 3RVGA 3DKGA 3PIYA 1BKXA 4BGGA 4YUQA 5JFWA 2QHMA 3EQPA 2XKEA 1PXKA 2E9PA 3BGPA 4U43A 5FUTA 4DG2E 5F20A 1J7LA 3QQKA 1M7NA 1ZYDA 2IVUA 3EJ1A 3D2IA 4OW8A 2PUUA 4C59A 1Q41A 4F1OA 4GG7A 5EKNA 1B6CB 4IVBA 4V04A 2O3PA 3NMUF 1Z57A 2WMTA 5D11A 4PX6A 4U45A 2BHEA 4RIYB 3R1SA 3EWHA 3OEFX 5IQEA 4RQKA 3W2RA 3LFBA 3WBLA 3P4KA 4JJRA 3D5VA 3TWJA 3VHKA 4QP3A 3KVXA 3L8SA 4NKSA 4G3GA 4YNOA 3HV3A 3Q32A 3OP5A 3HV6A 2GS2A 2DYLA 5E91A 4XH6A 2BMCA 4CSVA 3MDYA 3PVGA 3T3UA 4EOMA 3R8UA 4F7LA 3I1AA 3DK7A 4O82A 2IW6A 1LR4A 3EMGA 4FTLA 2J0MB 5EDPA 4DA5A 3GCSA 4KKEA 4Y83A 3FXWA 4RIYA 3BLHA 3PRFA 1H1PA 3ZUVA 4FV2A 3UQFA 4J96A 3RZBA 3FZRA 3F7ZA 5FDPA 4YO6A 5J9YA 2OU7A 3QTZA 4H1MA 4EK4A 4JDIA 4XBUA 3MB6A 3LM0A 4EOQA 1LEZA 2CHLA 2V7OA 3ZS5A 3NR9A 3GUBA 4UV0A 5AUXA 2GMXA 4H36A 4RC3A 2A4LA 4FKJA 4R77A 3VBVA 4D4RA 2B9IA 3VVHA 2UZEA 3OXTA 3HMIA 5M55A 4AZFA 4JRVA 3EFWA 5IQBA 3UJGA 3F82A 3Q6UA 4CFNA 4A06A 5AAGA 3KXXA 1FOTA 4KKGA 3KXHA 4FIEA 4J53A 4KBAA 3UO4A 3HA8A 4IC8A 5D41A 1RE8A 2JIIA 3BPRA 2OFUA 3LFSA 4I21A 2XUUA 4IANA 5IQAA 3NS9A 3CY3A 3NPCA 4RJ4A 3COIA 3PY1A 3SKCA 4DGLC 5JN2A 4ZSGA 2OXDA 5GHVA 4ACGA 1SM2A 3BZ3A 2CLXA 3DFAA 3MV5A 3QQUA 2XCHA 2UZBA 3E8NA 3FLQA 5G6VA 2YIQA 1YXSA 2YAKA 2BFXA 4NK9A 3W55A 4K11A 4I20A 5CU3A 4ZTQA 5H8BA 1MRVA 5EQEA 4U40A 1JKSA 3FHIA 4FTOA 4EOOA 3PP1A 2F7EE 4BCIA 2IO6A 4DINA 3HVCA 4EKLA 3SQQA 3NYOA 3PSDA 4R3RA 4IH8A 4IM3A 3VS6A 2XJ1A 5C8KA 4ALVA 2ITVA 4XRLA 4P90A 4UZHA 5EH0A 1ATPE 1NY3A 2OG8A 4AE6A 4BDJA 4DG3E 2VTQA 4HZRA 3IONA 4H58A 1XH4A 4XOZA 3DTCA 3FBVA 3HV7A 4BZDA 5LVNA 5FP5A 4Y72A 4JG7A 4ZTRA 2BDJA 4MTAA 1UA2A 4YJTA 1BYGA 4YTHA 4AF3A 2X8EA 4MD8E 3P23A 4O7TA 2X2LA 4MK0A 2CGVA 3TXOA 1OECA 2YM3A 2W5AA 4X6QC 5J8IA 4DHFA 3BGQA 4DT9A 3M42A 5BVEA 3WYYA 1GIIA 5CU6A 3OW3A 5LCKA 3OT3A 2RFDA 3FKLA 3RKBA 3VS3A 2YJSA 4DAWA 1QL6A 2XMYA 2ERZE 4M69B 5AP7A 3ZZEA 4FZ7A 4JQ7A 4RFYA 3RMFA 1ERKA 1J1BA 4X3FB 3ZTXA 4A4OA 4MHAA 2GTMA 3F2AA 3W2QA 5B2MA 4QYFA 3SVVA 4CQEA 4C3FA 2FYSA 4UZDA 5A6OA 1XKKA 5JGDA 2P2IA 3COMA 3LQ8A 4Q5EA 3BELA 3TT0A 3D15A 3BHYA 1Y8GA 4RIWB 4QQJA 5H8EA 4ZY5A 1OL5A 3ZO2A 1SZMA 4OBPA 4GS6A 4BDBA 5IQFA 4QT1A 5ETIA 3W0PA 3A7JA 2PTKA 5GINE 4MXCA 1UNLA 3MA3A 2C5YA 2HOGA 3Q5ZA 4TYGA 4X3FA 4ZSEA 4BC6A 4EUTA 4F6UA 4ASDA 5L8KA 3KXZA 2JFMA 4C37A 3MESA 4BDIA 2FA2A 3C4CA 3R8ZA 3UMXA 5CSPA 3VNTA 4EH3A 4YZNA 5H2UA 2YDKA 1GIJA 4RBLA 4RZWA 3U6HA 5E8TA 3R1YA 4N4SA 2OW3A 4W8DA 4C4IA 2XKFA 5CAVA 3UPZA 2REIA 4HYSA 3POOA 5BYYA 3R01A 2QQ7A 5F4NA 3IW6A 4XUFA 4WNPA 5DNRA 1UWJA 4FSWA 2R3FA 4R1YA 4FKLA 4MWHA 3R9RA 5CZIA 4LG4A 4ALUA 4C2VA 3D5XA 4EWHA 1Q8ZA 5HBJA 4LV8A 3ORIA 4FSQA 5FXQA 4F1TA 1XBBA 3C51A 1MRUA 1Q3DA 4BCFA 4BI0A 4FEXA 3R9NA 4TRLA 3E5AA 3E92A 3LJ2A 4KRCA 3O0GA 1U46A 3PIXA 4XV2A 3U87A 3R0TA 3H9FA 3BQRA 4M7IA 3EQRA 5F1ZA 2QU6A 2ZM4A 3PG1A 3CD8A 3KMUA 3NYNA 5CEQA 3ZLSA 3C7QA 4UEUA 5LVOA 2J90A 2PVYA 4QP4A 3A7GA 5JRQA 4G31A 3W0OA 3OC1A 2GCDA 4MXOA 4AGDA 2X4ZA 3RWPA 3VUIA 1DAWA 3CTQA 4KBCA 2W06A 2HXQA 3FE3A 3VS2A 4J98A 4NUSA 4FV4A 2BZHB 3SXFA 4IAYA 2JAVA 1NW1A 5HNIX 2P4IA 3OWLA 1Y91A 4DEHA 3C4XA 4XX9A 5HBEA 4U81A 3LFDA 5LMKC 3KULA 2RFSA 4JG6A 3FI4A 3VN9A 3JPVA 2UW4A 3D7ZA 4IW0A 4C3PA 4AZEA 4PDSA 4ANQA 3UOJA 2CCHA 3I4BA 1WVYA 5BUJA 4LRKA 3VWAA 2VNWA 4U80A 3IDPA 2WOUA 4QMMA 3HECA 3G6GA 3PPKA 3QCQA 1WMKA 4O38A 2XK6A 3W8LA 2PUPA 1V1KA 4AN3A 4M13A 4FG8A 2YJRA 2CGUA 3IKAA 2IZRA 2OIDA 4YZCA 3VUKA 4QMVA 4AUAA 4X2FA 4WG5A 1K9AA 3MGYA 5C8MA 4RQVA 2WB8A 4CEGA 3LCTA 4EC9A 3RK7A 4DFLA 3DQXA 4L52A 1W0XC 3F61A 4F70A 5IH6A 5KNJA 1OIYA 3E87A 4DBXA 3O51A 2R3HA 1QMZA 5IEYA 2Y7JA 4LV5A 2JBPA 2WO6A 4B6LA 4M0ZA 1OL2A 4GIHA 3R73A 4QYYA 3IGOA 2BRGA 4OTRA 2HZ4A 3MH3A 4TTHB 1Q3WA 2F7ZE 5HE3A 4QMLA 4F4PA 2YCQA 4IB3A 5DT0A 5IZFA 1PJKA 3R7UA 3NUXA 4Z3VA 4PUZA 2OJ9A 4MWIA 4EH6A 3QZIA 4IX3A 1B39A 4APCA 3LFEA 4J97A 3PE1A 3FPMA 4ZS0A 4FYOA 3FPQA 3PVWA 1H0WA 4GK3A 3ZC5A 2ZJWA 3R02A 4CNHA 4IWDA 2FSMX 4CRLA 3QQLA 5D12A 4PY1A 3TG1A 2QONA 2XKCA 2XNNA 2C6DA 2G9XA 1YQJA 2OZAA 4CFVA 3KL8A 3BHTA 3D0EA 3F5UA 3WI6A 4O81A 3WF9A 2UW0A 2B52A 2X1NA 5GIPE 4A9SA 5L2WA 2O5KA 5E8ZA 1P14A 3GCVA 3HNGA 1JKLA 2W96B 2VTJA 4BHNA 3V8WA 4YURA 5I5ZA 3C0HA 3RTPA 4JIKA 2DQ7X 4IWQA 1SVGA 4AW5A 4O84A 2VWIA 4I0RA 4X2NA 4DEIA 2VTTA 4E4MA 4XG7A 3POZA 3PFQA 3L1SA 3DJ7A 4GUEA 5K4IA 1XWSA 3LXNA 3R63A 4WO5A 2GFCA 5BUEA 2QC6A 4O7SA 1BI7A 2WTKB 4JX3A 4EHEA 1T46A 3IW4A 3LMGA 5CTPA 5EKOA 3UOKA 1J3HA 3UIBA 4APPA 1X8BA 3V5LA 4NYEA 2X9FA 4FYNA 4M68A 3G33A 2WQOA 1MRYA 4EBVA 2Y6MA 4AWIA 5FTGA 4GRBA 1H07A 4KKHA 5C4LA 4Y73A 2R3NA 5FBOA 4MNFA 5JH6A 4II5A 4MD7E 4FK3A 1CSNA 2ZOQA 4EONA 3FI3A 3VW6A 5F9EA 2XNEA 3FL4A 3HKOA 3NWWA 4J8NA 5HG8A 2YM8A 2PPQA 4C02A 3QTWA 2XIKA 5AP3A 4IDTA 4AT3A 4I0TA 4FA2A 3KXGA 2XIXA 4Z55A 4RVTA 4KA3A 3NDMA 1URWA 2P0CA 3QUPA 4FTKA 1XJDA 2BRNA 2ITNA 2UZLA 2WTKC 4RJ8A 3FSKA 4TZRA 2ETKA 4MKCA 2I7QA 2VTNA 5EM7A 4XP2A 5HBHA 1H1QA 4TNDA 1GZ8A 2EU9A 4FTMA 1FMKA 4ZJIA 2Z7RA 2W1GA 3F9NA 5EHLA 3IW5A 3PLSA 3DOGA 3DU8A 3G90X 4QMOA 2X8IA 4WUNA 3UODA 4DEDA 2PVJA 2C47A 4ENXA 2X9EA 4AAAA 4D0XA 4FOCA 4I23A 2ITYA 4K77A 4NCTA 3SAYA 2PK9A 2KULA 2W1ZA 4RFMA 1ZMUA 2XJ0A 3DDPA 3EN7A 3D4QA 4JQEA 4P5ZA 5BVOA 4D4SA 4DT8A 4L45A 1P5EA 4YTIA 2GSFA 4RIXB 3PA5A 4FMQA 4JX7A 2XYUA 3EIDA 3EN4A 3FLYA 4EEVA 3VS0A 4AZVA 4TYIA 2VTOA 2OGVA 4PMTA 4AACA 1SMHA 3D5WA 4FKPA 1GJOA 5IISA 3C0IA 2GHLA 5HVJA 4YLKA 4DEGA 4FTQA 3COHA 2NRYA 4EZ3A 4BY9E 1ZOGA 2YHVA 2WNTA 4G1WA 1V0PA 5CF4A 3ZDIA 3AC3A 3ROCA 2XA4A 3OBGA 5EW9A 2RG5A 2ZVAA 2FB8A 2YFXA 5CQUA 1RW8A 3FJQE 1S9JA 5I9ZA 3S4QA 4MXZA 5J7HA 5DH3A 4RA4A 4RIXA 2BILB 2O8YA 3HMPA 2EUFB 4E6AA 3DCVA 4FI1A 2WQBA 3QLFA 1J7UA 2GFSA 2W4KA 3FMMA 3QTIA 4MQ1A 5AV2A 3A2CA 4A4LA 3MJ2A 1PKDA 5KBRA 3CPCA 4I94A 1BMKA 1H1WA 2BAQA 5EHYA 3QUEA 2GNHA 2XJ2A 3HUCA 3BBWA 3GQLA 3TEIA 5JK3A 2I1MA 3FQEA 3TKUA 2DUVA 1OGUA 2IZUA 2PY3A 2ITZA 2YABA 1V0BA 4NM3A 3AC8A 3E3BX 3W0NA 1SNXA 5FP6A 2W9FB 5CENA 4DFYA 4YHTA 3HGKA 3KXMA 4BTFA 2GQRA 3LVPA 5DR6A 3R7YA 4WBOA 4ITIA 4GJ2A 3SW7A 3DXQA 4U79A 2YM5A 2Y6OA 3UIUA 3IQ7A 3MS9A 4UB7A 4BF2A 4FG9A 2WMRA 3KKVA 3VF9A 2XNBA 4V0GB 4DTKA 5AAFA 2VU3A 5CSXA 2FH9A 4GEOA 3EOCA 3SD0A 5KMOA 1CKIA 1DS5A 5AUZA 3G9NA 3JY0A 4FEUA 4FV3A 5FEQA 3VIDA 4JAJA 3W2OA 2C6LA 1OBGA 5F95A 1YI4A 4GL9A 3E8CA 4CMUA 4ZMFA 1MQ4A 1Q8TA 5E8SA 4U7ZA 3R04A 2QKWB 4CTCA 3SC1A 4YJPA 4E6QA 4FIGA 1Z9XA 3D83A 3IDCA 4EK6A 5A4CA 3NNXA 2J9MA 2QR7A 4YO4A 5AIKA 4F99A 4UXQA 4ZTHA 3D94A 3R2BA 5LJJA 4GKHA 2GNJA 1MUOA 4MBLA 1ZMWA 2W05A 1ZOHA 1WCCA 5AWMA 3BYOA 5IA0A 4E1ZA 3ZFYA 2XM8A 5E8WA 3UOHA 3QFVA 3PZEA 4M0YA 4KRDA 3IW8A 4R7HA 4S2ZA 3ZLXA 5HG9A 3BU5A 3RK9A 3C9WA 1W7HA 2Z7QA 4J8MA 4L00A 3R9HA 2V62A 3RAHA 3DNEA 3FMHA 3JY9A 4Y46A 5LARA 4DEAA 1FVTA 2ESMA 4TYEA 5JFVA 2GS7A 1NVSA 1PXJA 2J2IB 3PXRA 4IEBA 3SRVA 4NTTA 4B0GA 4QTAA 5HE2A 3FUPA 3O8PA 4FEQA 4TWOA 2F2UA 2HELA 2PSQA 3Q4TA 1UU3A 2CGXA 2C5OA 3FZ1A 4G6OA 4IWPA 4O7LA 2ZB1A 3R21A 5BVNA 5KO1A 3R1QA 4C61A 3II5A 3JS2A 2B53A 3ZRKA 4DH8A 2Y4IC 3HUBA 4H39A 4H05A 2ITWA 5E90A 1YDSE 4QMSA 4F0GA 2J5EA 3DKOA 4YSJA 3W1FA 5L2TA 4CFFA 5DRBA 4QMNA 5ANDA 3NAXA 1PXOA 2Z8CA 2IW8A 3WE4A 4FTTA 4YJRA 3PZHA 4QRCA 4BICA 1H28A 2JKOA 3VS4A 5JMSA 4F63A 3OMVA 3QU0A 3LIJA 3DKFA 3UTOA 3HDNA 1NVQA 4DF3A 3KFAA 4EJNA 5DEWA 3RK5A 2C6IA 3QZFA 5CEIA 4BCGA 2ITPA 4KD1A 5JRSA 1YHWA 2QOKA 3FYKX 1G8AA 2O65A 3RCJA 3SXSA 4D5HA 2CSNA 4FSNA 5FEDA 5CAQA 2JC6A 3FSFA 2IZTA 2ONLC 4Y85A 4BN1A 4D1XA 5IMXA 4DCAA 5KHWA 5DEYA 2PWLA 5CU2A 1NA7A 1YW2A 3GU5A 1BL6A 1VYWA 4YZDA 5AMNA 4I93A 3SX9A 1JKTA 2UVYA 3QHWA 4M3QA 2IVSA 4OTQA 4FZAB 5TKDA 3W10A 3PA3A 5HIDA 4NJ3A 3LXKA 4FGRA 3G15A 2YIRA 4JDJA 3NSZA 4FNXA 4FSTA 4FKUA 3TM0A 3HRBA 1MQBA 3RHXA 3UGCA 2ITOA 5AV0A 3AC2A 2WEVA 1KWPA 5KZIA 3IS5A 4F9BA 3VBWA 3EQHA 1OIRA 5HICA 4CLJA 3QQFA 3AQVA 3K5VA 3P78A 3MY5A 3ENHA 3ZSIA 3WF6A 4NU1A 1NT2A 3TI1A 1QPEA 2AYPA 2C5NA 3LLAA 4FT0A 2J51A 2PVNA 4BRXA 4E6CA 4TY1A 3C1XA 4GFGA 5DHJA 1F5QA 3EN5A 4PL5A 4E7WA 3DY7A 1KUTA 3FAAA 1YHVA 4R5SA 5EDRA 1KE5A 1A9UA 2CGWA 3CR0A 3FMLA 2I40A 2X39A 1H8FA 3I7CA 1UKIA 5AX3A 3UIMA 3VBXA 5HORA 4QTEA 5J9ZA 1KSWA 4XG6A 3Q52A 3E64A 4ZTLA 5CXHA 5JKGA 4AU8A 5M51A 4GH2A 4ERKA 5AA8A 3ZO1A 1KE9A 1DI8A 3O23A 3D5UA 3AT4A 3ORNA 2FSTX 4IAFA 4EWQA 5JSMA 1JPAA 3KK8A 3R8VA 4RJ3A 5AJQA 3ANQA 3ETAA 4QP7A 2HWOA 4FOBA 4WT6A 1H08A 2X6DA 4QP6A 4BCOA 1OITA 4NWMA 4BVUA 3MIYA 2B7AA 4XBRA 4FC0A 4U5JA 5C9CA 1VEBA 2IWIA 4WHZA 5DE2A 3BV2A 4X3JA 3VULA 2E2BA 2FO0A 4I1ZA 2IW9A 3CJGA 3O17A 5CU0A 3SHEA 3MVHA 4CXAA 2VRXA 4C2WA 5B2LA 1GZOA 4FZ6A 1KV1A 3WYXA 3UNJA 3H0YA 2Z2WA 2BTRA 3Q60A 3ORLA 3EH9A 4H3QA 3N4UA 2R0IA 4FTIA 3SW4A 2RKUA 3QLGA 2WQNA 2RG6A 5CT0A 3ATSA 4FIJA 1G3NA 1WBOA 5CWZA 3UP2A 5E92A 4LFIA 5L8JA 4CMOA 3LW0A 5ANOA 4O22A 3V5TA 4FTAA 5I4NA 4DGGA 3DFCB 3PUPA 5EYDA 4ZTMA 1F3MC 3K5UA 3DPKA 4QMQA 4EQCA 4FKQA 2WQEA 4IZYA 3GFEA 4JBPA 4GT5A 4BDDA 4EI4A 2CKQA 2WTCA 2QURA 2XK8A 1FBNA 3PRIA 5HIBA 3L9LA 2OICA 3TYKA 4LOOA 2VO6A 5LXMA 4L3PA 4W4VA 3FMKA 2UZDA 3OWJA 5DR2A 2CN8A 3JR1A 2W9ZB 2HXLA 3DLSA 3A4OX 3HV4A 1CKPA 3PXKA 4PMMA 2J0JA 5FD2A 3ZBXA 3NUSA 4R6VA 3WZKA 3F69A 3Q04A 3SOAA 4EK3A 4QPSA 1A06A 1SNUA 2IVTA 5EDQA 2B55A 3NEWA 4ENYA 4KSPA 2QNJA 2ZAZA 3QC9A 4RJ6A 4ZTSA 5HLNA 4CD0A 4NW5A 4Y8DA 3HMOA 4DBNA 4L7FA 5CY3A 4AZSA 2V55A 2QODA 1PMNA 1WBNA 4N57A 5AM7A 4ANBA 5K9IA 2CKOA 2BAKA 4FUXA 4JT3A 3OHTA 4DTBA 3NX8A 3NUAA 4E6DA 1ZZLA 4AFEA 2PU8A 3W2CA 4RSSA 5KX8A 4OTDA 1STCE 2JDTA 4GYIA 3NLBA 4CFXA 4NL0A 3DDQA 4TWPA 2WZJA 1FGKA 2R7IA 3GU4A 4QYHA 1ZLTA 4DN5A 2H8HA 4AGUA 3L9NA 3CEKA 4R7BA 5DGZA 3DGKA 3RI1A 2WQMA 2AC3A 2BHHA 3ALOA 3QRIA 2ZMCA 4L53A 4FGBA 5H3QA 4G3DA 5CAOA 4E8AA 5IA3A 5CAUA 3E8DA 3LJ1A 1W82A 2A0CX 3JXWA 3GU6A 3BYMA 2XK7A 4YZMA 4U98A 2QD9A 2OI4X 1J7IA 2QG5A 4HW7A 5BVWA 1PHKA 5EFQA 4YSMA 5D7VA 3U4WA 4AT5A 1WBSA 4YJVA 3ORKA 5I9YA 3W0MA 2CNVA 4QTDA 1KE8A 2OK1A 3DA6A 1O6YA 3CJFA 2A1AB 3EZVA 4USDA 3ZO4A 2C3LA 3L8PA 3OOMA 3R28A 2HENA 3DBQA 2UW7A 1IAHA 4JXFA 4TYJA 3N51A 2J7TA 2BVAA 1OL1A 3GC0A 2J6MA 2Y9QA 2GNGA 3D9VA 2XK9A 4RX8A 2VN9A 2C6EA 2J0IA 2QCSA 3OXIA 3GCUA 4FSYA 5DR9A 5A4EA 1H00A 3FV8A 5T3QA 3RPOA 4U6RA 1OIQA 5AV4A 4IB0A 4K0YA 4DH7A 3NUUA 4RX9A 2UUEA 2UW6A 3WF7A 4IM0A 4A7CA 3ZFMA 1XQZA 2ITQA 4O0SA 4WSYA 4X6RA 4CRSA 5BUIA 4A9RA 5FXSA 1M2RA 2O64A 3LFCA 5AV1A 1UVRA 5AEPA 5JQ5A 1YXUA 4BDKA 1LP4A 3N9XA 2XZSA 2ERKA 1XH7A 1ZYSA 2ITTA 3ZBFA 1H26A 4B8LA 1JAMA 3K3IA 1OB3A 4XLVA 2O2UA 4AN2A 3FY2A 4WIHA 2I0YA 3UOLA 4JL9A 3VRZA 3R7OA 1G5SA 3GGFA 4YJSA 4O7VA 3CP9A 3UQGA 4DGMA 1OI9A 2WTVA 4FIFA 3RP9A 4FKWA 5EI2A 2ZV9A 4ACCA 4LMUA 4S34A 2WMSA 1VR2A 3VAPA 4YR8A 4N6YA 5CEPA 1VYZA 5IUIA 3VS5A 4XP3A 4AGCA 3HDMA 2JGZA 1IA9A 5CI6A 4ZSLA 3OW4A 4BIEA 4ZZNA 2QOIA 3OCSA 1A48A 2R3QA 3FMEA 3VO3A 3TACA 3G9LX 1OKZA 4F9YA 1P4FA 3IOPA 3R71A 4JBVA 5L6WL 5DI1A 4RIWA 2JLDA 2XIYA 3EFLA 2Z7SA 3FZSA 3OBJA 4TKSA 4WUAA 3MFUA 1OBDA 3C4FA 4YPDA 1JVPP 1Q62A 5DPVA 3A8XA 3W8QA 3DBFA 4JG8A 5A6NA 2IPXA 3U4UA 3U55A 5FXRA 3SG9A 2ZDUA 4FL2A 3VHEA 3COKA 4F6WA 2F4JA 3GNIB 2VX0A 4HPUE 5FDXA 1F0QA 2BTSA 1W98A 2DS1A 5CNOA 3HRFA 5HCZA 1ZYCA 3IDBA 2C0IA 4Z7GA 3W33A 3EYHA 5K5NA 3EFJA 2BZJA 4XYFA 3TUDA 3GOKA 4FT9A 4FV9A 3NW7A 4CT1A 4IHPA 3ZLYA 2E9OA 1CM8A 1M17A 4NW6A 4YJNA 1SVHA 3QTRA 4KBKA 2FUMA 4O6LA 4UYNA 4E5BA 1HOWA 2PE0A 3ANRA 3P9JA 3REPA 4KNBA 4ANMA 4C4HA 4WNOA 3PSBA 2W5BA 3GENA 5BMSA 1JOWB 4IFCA 1FINA 5LMKA 1ZY5A 5IU2A 1ND4A 5C26A 2BKKA 1WFCA 3UIXA 5CSHA 5IMEA 2YIYA 2CKPA 3V8SA 4B4LA 4WKQA 5CU4A 4XEYA 5CS6A 2UVXA 1XR1A 3PG3A 4DH1A 2UW9A 1ZZ2A 2Z60A 1H24A 4GIIA 4QQ5A 5I9WA 2QOQA 4KIPA 3EQDA 3OF0A 4PL3A 2QOFA 4PRJA 4FZDB 1YRPA 4BCJA 4XNEA 4AT4A 2ZV8A 3PP0A 1S9IA 3RGFA 3U9NA 2Z02A 4O6EA 4L8MA 5DRDA 5CXZA 2HYYA 4FT7A 2Q0BA 2R4BA 4L01A 3FLSA 3QA0A 5HX6A 2VWUA 5A4TA 3QTQA 4WD5A 2OSCA 4RG0A 1YI6A 5ANJA 3ATTA 1L3RE 3H30A 4TT7A 3CE3A 3QA8A 3PIZA 4LGGA 4QNAA 3ZCLA 1DI9A 5KHXA 2BRBA 2ETRA 2JBOA 3PXZA 2WMBA 3GP0A 4HYUA 4ZEGA 3ZSGA 1PRYA 2H34A 3NYXA 3U54A 2OO8X 3LOKA 4D1ZA 1IRKA 4IFGA 3K3JA 2HIWA 3EN9A 4J99A 5H9BA 4F0IA 4TWNA 4F7SA 3UVPA 3KRWA 1JQHA 3HYHA 4CFUA 3DAEA 2JKMA 5E8VA 4BGHA 1HCKA 1UU8A 3FMJA 3ORXA 4P7EA 2W1EA 2OBJA 3Q96A 4RGJA 3BHUA 4FNZA 2VTPA 2VTAA 2E9VA 2UZNA 4D9UA 5IG1A 2Y8OA 5HG5A 2BRMA 4P4CA 2CPKE 5J9LA 3KVWA 2WAJA 4D2SA 4NJDA 4FICA 2J50A 1IA8A 4TNBA 1RDQE 4Q9SA 2W1DA 4FKOA 4MAOA 3R1NA 3U8WA 3MWUA 2VZ6A 4OT5A 3NYVA 2WPAA 3QALE 4NTSA 3AD4A 3ZU7A 4HGSA 5CYIA 4EZ5A 1UWHA 2CLQA 2WIHA 2XCKA 3FZPA 4X7QA 4BDFA 4D9TA 3CKWA 4S32A 4PTCA 1J1CA 3LCDA 4EOJA 5CX9A 3LQ3A 3U6JA 2YIWA 3KMWA 5BVFA 2YISA 3I6WA 3WIKA 1YXVA 3UBDA 4E4LA 3TZ9A 2XK3A 4YMJA 5LMAA 5CSVA 4CVAA 4DGOA 3FKNA 1Q5KA 1RQQA 3KK9A 1TQPA 3QTXA 2Z7LA 3LXLA 3HMMA 1CTPE 3F6XA 2IJMA 3MH0A 4W8EA 3IOKA 4OUCA 2IG7A 3QGYA 4QMPA 3P0MA 3DXNA 3QD4A 4DGNA 4FV5A 2GHGA 3U9CA 3DBCA 4BB4A 4HGEA 4D0WA 5FQDC 3RPYA 1H25A 3DQWA 4AS0A 3QRUA 3HV5A 4GKIA 4F6SA 3PLAE 3DK6A 3LFQA 2BZIB 1YKRA 2W0JA 3T8OA 4RVKA 5EOLA 4BIBA 3SXRA 3VBQA 4FZFB 3VUMA 4N0SA 3DV3A 5CAPA 2R3OA 3RM6A 3T9IA 3DAJA 4IBMA 3WZDA 4UBAA 3SLSA 4EYMA 4QP8A 5M4UA 4GFMA 3F2RA 4FV0A 5J1WA 3TNWA 2A2AA 3DNDA 2YDIA 3QHRA 3UG1A 4AOTA 3PJCA 2VWXA 4AW2A 2PUNA 3DT1A 4HGLA 2R3PA 3MI9A 3QTSA 4EH2A 1O6KA 2JAMA 4UY9A 1H1SA 4Y95A 4GW8A 4FT3A 3UYSA 3KCKA 4OTWA 3I5ZA 4BBFA 2FSLX 3P5KA 3HAMA 3V6RA 3FEGA 3DBDA 3R8PA 4GVAA 2JDSA 3L9PA 4FODA 2JDRA 5E8UA 1YOMA 3I0OA 5HVYA 3PY0A 3W16A 3KRRA 3LE6A 2XK4A 5EK7A 4OLIA 2W4OA 4ERWA 2JDVA 2X7GA 4ITHA 3A8WA 5HX8A 5EYMA 3BX5A 5KZ0A 2OXYA 1R3CA 2QKRA 2ZDTA 3O8TA 1KE7A 3OWPA 4RX7A 3UG2A 2XKDA 4S30A 4CZTA 4KS8A 4ZLYA 2GU8A 2YWVA 4LYNA 5AADA 1ZRZA 3P86A 4BCKA 4QP1A 5HO7A 3QQJA 1IG1A 4QMTA 2OIQA 5JFSA 5J87A 4MBJA 1JSVA 3MTFA 4RVLA 4WBBB 5F94A 4Z7HA 1WZYA 1WVXA 3R8MA 3UO5A 3C4EA 4IAKA 4I22A 3E8EA 3HX4A 2JKQA 3QRJA 3FXZA 4FVQA 4CLIA 5LQFA 2VTRA 4WRGA 3PA4A 5CVGA 4DH5A 2WIPA 2J0KA 5B2KA 4K18A 4QP2A 3C13A 1JSUA 4KB8A 3BRBA 3F3VA 3GC8A 4MXAA 2ZYBA 4IAAA 3Q53A 3MY1A 5ETCA 4ACHA 4RRVA 4F7NA 3CBLA 4CG9A 3UDBA 1OKVA 3R9DA 4CCUA 4D2RA 5ITAA 3NNWA 4L6QA 4IQ6A 3QGWA 1G8SA 1XBCA 3MPMA 4L46A 4ZTNA 4H1JA 3GCPA 2W1CA 5HGIA 4C4GA 3VJNA 2YCFA 3W32A 3W0RA 1PMVA 3CTHA 2HCKA 2CNUA 3OT8A 1Y8YA 1OMWA 2C6TA 3TV7A 5JFXA 5CEOA 5IEVA 4BCPA 4AOIA 2UW3A 3GI3A 5E9EA 4YTFA 4EJ7A 1ZOEA 2VO0A 2W1HA 3KY2A 4O0TA 2V5QA 3FC1X 5DIAA 3OY1A 3R83A 3ET7A 1VJYA 4GYGA 4RWIA 5HD4A 5HU3A 4LL0A 5AUUA 4MNEB 5EI6A 3UC3A 4AFJA 4NH1A 1REJA 2V0DA 4WOVA 2VD5A 4G3FA 3MH1A 4LUEA 4XLIA 5B0XA 3UC4A 5C8NA 3OS3A 2PMOX 2VWBA 3KRXA 3MVMA 4CKRA 3Q2MA 2QOHA 4C38A 4ZMEA 4ALWA 2WTIA 4ZS4A 1GOLA 3BV3A 3KN6A 4NM0A 5IA2A 3NVMB 1BLXA 4IJ9A 3ERKA 2ZB0A 4BGQA 2UW5A 4C7TA 3ZFXA 4ID7A 3BEAA 2YCRA 2PVFA 2X7OA 3CQWA 3NCZA 5EOBA 3IO7A 2GNIA 3KGAA 1AD5A 3NNUA 3QCSA 4NIFB 1GNGA 4PDOA 4AZWA 4G3CA 4WNKA 4NSTA 1YWRA 3CS9A 3R30A 3BHVA 3VUDA 3S95A 5M53A 4FIHA 3UNKA 3GQIA 2E9UA 4IM2A 3TZ7A 2PZYA 2J0LA 4WG4A 2QVSE 4PP7A 2JITA 4NZWB 5TO8A 4HVSA 3BU3A 4XMOA 2R3RA 3ORMA 3A7IA 4IAIA 3ULIA 1T45A 4G6NA 5DOSA 4YZBA 5HQ0A 4LL5A 2P33A 2F7XE 3BYUA 3BYVA 3KRLA 3G6HA 1PXNA 3Q4ZA 5BYZA 4O91A 3DTWA 4V0GA 4AA4A 3A7HA 3MTLA 4I5PA 2Y4IB 1OKYA 2BRHA 1XH5A 2PYWA 4LOQA 4M12A 4JAIA 4ZAUA 4IB5A 4LUDA 4JI9A 2BDWA 4BDEA 5E4HA 3Q6WA 3BE9A 5TF9A 4QPAA 2BALA 5TR6A 3T9TA 1PXLA 4AW1A 4BTJA 4FNWA 3AGLA 4U97A 4H3PA 1ZYJA 1UNGA 2I0VA 4WG3A 5HNGA 1Q8YA 2LGCA 1PMEA 4FL3A 3WZUA 4XV9A 4NT4A 3ZSHA 4E26A 4I4FA 4GUBA 5E8YA 2A27A 3OCTA 5AM6A 4RT7A 2OLCA 2X8DA 3WF5A 4F7JA 2QU5A 3RM7A 4I6BA 2VWVA 4CZUA 3E93A 4EH8A 2BCJA 4D1SA 4ARKA 3PPZA 2FSOX 3BQCA 3F2NA 4FV6A 5AP4A 4M97A 5ANGA 3TIZA 4BCHA 3SDJA 2W1FA 2UZOA 2W7XA 1M2QA 3FZTA 1Q99A 4C36A 4FTCA 4UN0C 4M8TA 1R0EA 2VTSA 3ACJA 2QLUA 3F66A 4I5HA 5FRIA 1E1VA 3RINA 4E5AX 3QC4A 5AUTA 3RWQA 4PDYA 3V6SA 5IA4A 3A62A 3MJ1A 4AGWA 3RPVA 1CMKE 2PHKA 4D4YA 4L68A 3AMBA 3DJ5A 4TYHB 5AIRA 1OL6A 5HTBA 2XRUA 4IX6A 4TWCA 2BZKB 3DB6A 1FVRA 2HWPA 4EHZA 3NAYA 2B9FA 4DFBA 4IIRA 1PMUA 3FQSA 2JEDA 2VWYA 3I79A 2HK5A 4G2FA 4L44A 3VQHA 4FVPA 4A07A 4JLCA 2ONLA 3BCEA 4YJOA 4XOYA 4YNEA 4WZYA 4FVRA 1OL7A 4G6LA 3WF8A 2C1BA 3JYAA 3ZUUA 5JGBA 4I4EA 3R7IA 4A9YA 1K3AA 3K54A 2OJIA 2VGPA 3O71A 4BHZA 3MFTA 4XS2A 3RCDA 4AG8A 2G01A 3IGGA 5CSWA 5JEBA 4AA0A 3ZHPC 1IAJA 3W0SA 5J5SA 4TYHA 4CV9A 3TV4A 5GIOE 3UZPA 3QF9A 4FKIA 4YJQA 2SRCA 2ZMDA 3N4TA 4QTBA 3R8LA 3A7FA 5IDPA 2XNMA 2XNOA 5DYJA 5HIEA 2C0OA 3H0ZA 2NRUA 3KC3A 4IZAA 4O7PA 3L9MA 1Y6AA 5HCYA 2OZOA 3PVUA 5IUHA 5M4FA 4G34A 4IZ7A 3VJOA 2WELA 2BROA 5IQGA 4EHVA 1LEWA 2CKEA 3KU2A 2GDOA 2HAKA 3FHRA 3FWQA 3RNIA 3CTJA 4ASXA 5IPJA 3AMYA 2B9HA 4L3JA 4MX9A 4ZJJA 2WKMA 5ETAA 1W84A 3GVUA 3QX2A 3I6UA 4ZSJA 2NO3A 2BR1A 5KCVA 1NXKA 3CPBA 1XH8A 3MFSA 4QOXA 4QMYA 3CSVA 3OOGA 4ZZMA 5EYKA 1QPJA 2BKZA 4QYEA 1ZARA 4YHFA 1EH4A 3LKMA 3UYTA 4EC8A 4AP7A 3O7LD 3GXLA 5CQWA 3QKMA 2C3IB 2WMVA 2WFYA 3AC5A 2QO2A 1U5RA 3AT3A 3SG8A 4BCNA 4M84A 4GMYA 5E7RA 5T68A 2UW8A 4ASZA 1RJBA 4KS7A 5D1JA 3OTVA 4IADA 3OUKA 4PTEA 2I6LA 4LRMA 2GHMA 1YWNA 2YM6A 4YGAA 4Q2AA 1PYXA 2PUIA 5I9UA 3TNHA 3V8TA 3C4ZA 2ZV7A 5IEXA 4CKJA 4LM5A 4DCEA 2OF4A 3V5QA 1DAYA 3P7AA 2EB2A 2WMAA 3KMMA 2WMUA 1YDTE 2BUJA 2PVRA 3DLZA 3FC2A 3RAIA 2VUWA 3TNPC 4AW0A 3LJ0A 1YOLA 1HCLA 3IPHA 3NUNA 4GT4A 1WBVA 4RWKA 3BHHA 3CCNA 2WTJA 4D4VA 1OUYA 2VAGA 2IZSA 3M1SA 3GU8A 3R22A 1ZAOA 3RPSA 4K9YA 2QOLA 5HNBA 3VQUA 5FEEA 4JOAA 1UU9A 3VC4A 1LPUA 4E20A 5EW3A 3D14A 3TJDA 4PMPA 4ZZOA 5ETFA 1YDRE 4BTMA 1GZKA 1H27A 4F9CA 5L3AA 4YP8A 1Q61A 4EKKA 1KE6A 5IA5A 5JT2A 3DZOA 4W4WA 2OH4A 3BIZA 4GFOA 4CKIA 3MFRA 4RLLA 3R00A 4G3EA 4KINA 4FG7A 3A99A 2R5TA 2NPQA 4HCUA 3EL8A 3RAWA 1YI3A 1KOAA 4XCUA 3HLLA 4IJPA 4ZSAA 5A9UA 4EHGA 4PNKA 4MEDA 2BIKB 1WBTA 3V51A 2EVAA 2VTIA 3ORZA 2VO3A 3UMWA 5B7VA 5ACKA 5IDNA 2R64A 1YVJA 2W4JA 4O0XA 1LUFA 3FZOA 3H3CA 5KMKA 3DB8A 3QWJA 2R3MA 3H9RA 2HY81 4PV0A 4U44A 4BI1A 4K2RA 2AUHA 3LCKA 4AQCA 5I0BA 3V04A 4Z16A 4PNIA 4FV1A 4RPVA 4MQ2A 3O7LB 1R39A 2X0GA 5EG3A 5CF6A 4M14A 3NW6A 4F9AA 5HTCA 5KUPA 2J4ZA 5BNJA 5G1XA 1PXPA 5AUWA 1QCFA 4XG9A 3NRMA 3JVSA 5AP6A 3TZ8A 2WMWA 4FV8A 2UVZA 2XBJA 4NFMA 3Q5IA 3QZGA 2G2IA 3A60A 3ZXTA 3OCBA 4MF1A 4O0VA 3UZRA 2R3GA 3AGMA 4UWCA 4PDPA 3AXWA 2NNWB 3MW1A 3AG9A 5M08A 2FVDA 3ORPA 2B9JA 4IMYA 4I5MA 3ROYA 1AGWA 5IQIA 2QOOA 3EKNA 3QCYA 3KQ7A 4J1RA 4XG4A 3DJ6A 2Q83A 4I6QA 3CQEA 4WNMA 2F9GA 3M11A 3HA6A 4R7IA 4YBKA 3NUYA 3LFFA 5KMJA 5LWMA 4C35A 2V22A 4XRJA 2WEIA 2PZRA 3BWJA 4O0RA 3B8RA 4JDKA 4OBOA 4B8MA 4E93A 1GAGA 4IX5A 5DWRA 4DLJA 5AAEA 4K33A 3S2PA 3ZYAA 5M07A 2YEXA 1OVEA 3FL5A 1PW2A 4AN9A 4EOIA 1V0OA 2ETMA 2E9NA 4O0UA 3WE8A 4BDGA 1QPCA 4IACA 3F5XA 4J95A 4U3ZA 3U51A 1I44A 4BCQA 4FTNA 4HNIA 2Q0NA 3CLYA 1REKA 3MVJA 5CASA 1TQMA 2WGJA 4C58A 4KWPA 5HZNA 2QI8A 5L8LA 4CV8A 3QD3A 3E7VA 4JIAA 3O8UA 3PY3A 3LZBA 4JR7A 4I0SA 3F7WA 3EQBA 3PE2A 1APME 3RJCA 5H8GA 2ITXA 3UE4A 3WARA 2W5HA 5BYLA 4KABA 2C0TA 3OD6X 3C5IA 5IQDA 4Y5QA 2EWAA 3F5PA 2C4GA 3NW5A 4OTHA 3QAME
chains in the Genus database with same CATH superfamily
3SA0A 4EH5A 3A61A 1OPJA 3UVQA 4MVFA 4K1BA 3AOXA 2IVVA 4FSZA 4XG2A 5M4CA 5AX9A 3ELJA 2CN5A 4FV7A 5GNKA 3PYYA 5LVMA 4DEBA 4RZVA 1FMOE 2GTNA 3ZMMA 2PVLA 4GV1A 1XH6A 3MBLA 3TKHA 3FLZA 4RC2A 1FVVA 1R1WA 2ZM3A 4G5PA 3C0GA 3DBEA 4OT6A 4QMXA 4EOKA 3GC7A 4I5CA 2WTWA 2HZIA 4X0MA 2OKRA 3IG7A 4DFUA 3OVVA 2XALA 2GNFA 4FSRA 1Q24A 4FR4A 1OPLA 2QO9A 2C6KA 3G0EA 4O0YA 1JWHA 4CFMA 5HO8A 1JBPE 3QWKA 4W4XA 3BEGA 2LAVA 4EBWA 3N4VA 2RGPA 3AT2A 2UZUE 2JDOA 3FY0A 1XO2B 4USFA 3AD6A 4QQTA 4MYGA 3OFMA 3ZEPA 3CQUA 1SYKA 2PZ5A 4M67A 2PL0A 2HW7A 4RIOA 3B2WA 4CTBA 4PF4A 3QKKA 4AZTA 3G2FA 2R9SA 2XB7A 4QYGA 4IB1A 3PFYA 4BDCA 3GBZA 4O0WA 3EQGA 3UNZA 3W0QA 1WAKA 1YHSA 5IH4A 4CG8A 3EQFA 1R0PA 5BPYA 5HESA 1AQ1A 4DE4A 4EQUA 2VX1A 4RC4A 2QOCA 4ANLA 3R2YA 4RX5A 2C3KA 3BBTB 4ZIMA 3MH2A 2VTHA 3QRTA 2C6OA 5TOZA 3BKBA 5CF5A 2I0HA 2XIZA 2C5XA 3ALNA 5KMLA 3SGCA 1M52A 5IUGA 5FTQA 4G17A 4X2KA 4BYIA 3QBNA 3OEZA 4X3FC 3H9OA 3P7CA 4PMSA 4IWOA 3L8VA 4WRSA 3EZRA 3CY2A 3Q9YA 3I7BA 2G2HA 2O0UA 2XH5A 4TN6A 3FKOA 4Q9ZA 2PE2A 2YWPA 3BL9A 4N70A 1PYEA 1OUKA 4DEEA 3U6IA 1H01A 4QTCA 1W8CA 4WA9A 4O7NA 4DFNA 3KEXA 4FIIA 2JIUA 3ZRLA 5L6PA 1NVRA 1YXTA 3WZJA 3MSSA 4C4FA 3AD5A 3W2PA 3C50A 3OY3A 4QQCA 2C5VA 4I41A 4PQNA 1Q8WA 1M14A 2RF9A 1YWVA 1XHAA 3KULB 3FI8A 3ZOSA 2CCIA 3VUHA 3E63A 4EOPA 3T3VA 3VS7A 1OZ1A 4GVJA 5LOHA 4RWLA 4EH7A 3E88A 4ANSA 1Z5MA 4U9AA 2NP8A 4F09A 3MPTA 1UNHA 5AFVA 3IW7A 5HEZA 2X2KA 4XHKB 4IE9A 4BR3A 4OTFA 2VX3A 4O83A 4USEA 3MIAA 2CDZA 4YU2A 4HCTA 3DXPA 3F3WA 5A54A 4KIQA 4DHIB 2H9VA 3ITZA 3FMDA 5CVFA 3KRJA 2R3LA 5DT3A 5BV3A 5HI2A 3TDVA 2VO7A 4O86A 4ACMA 4YC8A 3NGAA 3I0QA 2HW6A 2EXCX 3ZRMA 3F88A 3EQCA 1URCA 4JBOA 1H1RA 1B38A 5M44A 1JNKA 4YHJA 4F0FA 5LCJA 3C5UA 4BCMA 5EM5A 4U94A 1U4DA 2YITA 2WU6A 3LXPA 3LM5A 4OTGA 4F08A 3MPAA 1I09A 2XNGA 1XH9A 2R0UA 4TPTA 2R3JA 4U42A 4EOSA 4ZK5A 5KMIA 3R6XA 3PPJA 4CCBA 4B7TA 2P2HA 4O27B 5LMBA 1J91A 2JKKA 1E1XA 3UP7A 4D28A 5HD7A 5GJGA 5KMNA 4FSMA 2Y0AA 3TJCA 2VTLA 5CEMA 5AP0A 4MCVA 3KF4A 5I9XA 4FUYA 2OXXA 3EYGA 3CGOA 4FKVA 2XEYA 4EUUA 2H96A 1U54B 4O7ZA 3MB7A 4V05A 2YM7A 3OZ6A 4ZY4A 4GK4A 3DAKA 3FYJX 3PTGA 2OZAB 1PF8A 4O7YA 1OPKA 4MBIA 4F1MA 2PVHA 5A3XA 3ZC6A 2C6MA 2QLQA 4CGAA 3V3VA 2BAJA 3V01A 3QTUA 3ZM4A 3TCPA 3HAVA 4BIDA 2PMLX 4C3RA 3LFNA 3TIYA 4IAZA 1Q97A 3E7OA 5HCXA 4ZJVA 4GCJA 4C4JA 3R7VA 5BMMA 4HOKA 3CGFA 2QG7A 4YLJA 3FI2A 3B8QA 4U8ZA 3FDNA 3LAUA 4BI2A 3O96A 4JBQA 1Y57A 3PDTA 1WBPA 3CC6A 5EW8A 4Z9LA 4FK6A 1U54A 5T6KA 2PMIA 4I6FA 1H4LA 4R3CA 2VTMA 4HYHA 2YN8A 3BI6A 5FM2A 3GOPA 4EK5A 1DM2A 1O6LA 4IVAA 5ACBC 4GSBA 4DC2A 4FEVA 4EZ7A 4ONAA 2JIVA 5K5XA 3PJ3A 1FGIA 3O50A 4GJ3A 4R5YA 2XRWA 3LFAA 4XV3A 5DT4A 4P5QA 3ZZWA 2KTYA 3UDSA 4BZOA 5IQHA 4EH4A 2QO7A 3VS1A 1U5QA 4X2GA 3BWFA 2R3IA 2XBAA 3TUCA 4IVCA 3G0FA 3RHKA 4AE9A 4EH9A 4X21A 5AUYA 3LCOA 2P55A 4BYJA 3PJ1A 3Q9XA 3TZMA 3THBA 2UV2A 3TTIA 2XVDA 3UVRA 3BU6A 2OJGA 1TKIA 5D7AA 5C27A 2F2CB 5D9HA 5FM3A 3QUDA 3UO6A 4BDAA 2RL5A 1PXMA 1ZWSA 5HU9A 4FKGA 3MY0A 5AP1A 1OKWA 1PXIA 5J95A 4DH3A 2XIRA 3IECA 2W17A 5ICPA 3C4WA 4I3ZA 4BZNA 5DN3A 3MN3A 1TQIA 4P2KA 5IQCA 2YA9A 4FTJA 3Q3BA 3DS6A 3RAKA 4CT2A 3AC1A 2W1IA 2PZIA 3AMAA 3EHAA 3KCFA 4RA5A 3UZTA 2VWWA 4O21A 4AOJA 2HZ0A 2OWBA 4IX4A 4HPTE 5AUVA 2X7FA 4O2ZA 4JR3A 5A14A 1GIHA 2XNPA 1PKGA 2EXMA 4C0TA 3M2WA 4FKRA 2GNLA 1IASA 5EM6A 3E62A 4IVDA 5C01A 2WD1A 3VBYA 4D55A 3WILA 5A4QA 4J71A 4B99A 1PY5A 2C30A 3EL7A 3V5WA 4E4NA 2Y4PA 5CLPA 3P79A 4IDVA 4QMUA 1BL7A 1P4OA 2DWBA 5ANKA 4DG0E 2EB3A 3GFWA 3PSCA 2YERA 3NIZA 5GJFA 5AA9A 3SOCA 4XV1A 1BX6A 3PJ2A 3OXZA 4YBJA 4FE2A 2WTDA 3V5JA 3KXNA 2G15A 5BVKA 3FQHA 1VZOA 1FQ1B 3CXWA 3QD2B 4U0IA 4UXLA 2WHBA 2YAAA 3ZXZA 1JLUE 4B8LA 1Q4LA 3TDWA 5JQ8A 3UQCA 4AX8A 4F64A 2C3JA 5EHOA 4J7BA 5D10A 3QX4A 2B4SB 2CJMA 2YIXA 3TTJA 3LMHA 5CALA 2YACA 4HGTA 4NFNA 4I92A 2RFNA 3K2LA 4QO9A 3MYGA 4YC6A 3BLRA 3V5PA 3L8XA 4C33A 3S0OA 5JZJA 4K8AA 4EQMA 4GG5A 1WBWA 2YZAA 3GT8A 4I6HA 4G5JA 3NCGA 5EQYA 2GQSA 1WVWA 4NCTC 3QCXA 4FTUA 1JKKA 3RPRA 3ACKA 3KREA 3PXFA 4LQMA 4O2PA 3AC4A 3KA0A 3PWYA 3ML1A 5K3YA 3HEGA 4YTCA 1M2PA 4HCVA 1CDKA 2I0EA 3QYWA 4RLKA 5BVDA 2B54A 1P2AA 2PE1A 3GCQA 2QOBA 3QYZA 4OBQA 4E73A 1BUHA 4JVGA 4B9DA 5CNNA 3PWDA 5TT7A 3NVKI 3HMNA 3I5NA 5JGAA 3WIGA 4FKSA 3EQIA 2CMWA 4RJ7A 3VRYA 3BLQA 4ITJA 3OTUA 5KMMA 3Q2JA 3S1HA 3QD0A 1XBAA 5C03A 4CMTA 4KIOA 5CVHA 4UYAA 5L2IA 1BI8A 1E9HA 4M15A 2WMQA 5AP2A 3PJ8A 4DITA 5IA1A 2ZV2A 5M09A 4TW9A 2BPMA 4HVGA 3GU7A 5M06A 4NKAA 5AP5A 2QHNA 1IEPA 5DA3A 5CZHA 4KSQA 2AEGA 4HJOA 2B0QA 1YXXA 3DK3A 2X6EA 3E3PA 4L9IA 4LI5A 2O63A 5EM8A 3PVBA 4G9RA 3TNQB 3EB0A 3EKKA 3CD3A 5HLWA 2WXVA 3BE2A 1M7QA 3NZ0A 4MNEA 3B2TA 3QRKA 3S3IA 5HG7A 5E1EA 2A19B 3KF7A 2F49A 4XG3A 5DLSA 4FX3A 2X81A 5DBXA 4JS8A 3ZEWA 4C34A 5L6OA 3VW8A 2RIOA 2B1PA 4CFWA 5K4JA 1GY3A 3MA6A 2YDJA 3QQHA 3TUBA 4JNWA 4BDHA 4L7SA 1UV5A 1KV2A 2XP2A 3F5GA 3H10A 1ZMVA 4DFZE 4OTIA 3F3UA 4EL9A 5HLPA 4TL0A 4R78A 2R2PA 3ZO3A 3CIKA 1KOBA 4ZLOA 5L2SA 4C62A 3D7TB 2JFLA 4JDHA 4L42A 2ITUA 2OH0E 4KAOA 4XJ0A 2RFEA 3H4JA 5KBQA 3BGZA 4PL4A 3LPBA 4D5KA 4LOPA 4N6ZA 4Y5HA 3ZUTA 5KKRB 2PULA 4LRJA 3G51A 1ZXEA 3HZTA 4HYIA 4PP9A 2VNYA 2UZTA 4FKTA 4I24A 5CT7A 5ANIA 4ZY6A 2BFYA 3W18A 1R78A 3JUHA 4A9UA 4LGHA 5CEKA 1ZY4A 4U3YA 2V7AA 4HVHA 2OF2A 2PVMA 1OIUA 3SRVB 3ZM9A 4D58A 4YZ9A 3S00A 4BBEA 3RALA 2OJFE 4NM5A 3LHJA 3TKIA 3Q9ZA 4FEWA 5DFPA 5C4KA 4W4YA 4EYJA 1ST4A 4ZLZA 3NNVA 1UU7A 4JMQA 4Q5HA 4DTAA 4S33A 2BDFA 3D7TA 4QNYA 4BJJA 5KE0A 2F57A 3F3TA 4XG8A 1L8TA 3PXYA 5HE1A 4BBMA 4J52A 2AC5A 5IF1A 3ZDUA 4BKJA 3QQGA 4FSUA 4JRNA 4HVIA 3OWKA 3O2MA 3QXOA 4UWYA 3UPXA 4ACDA 2GPHA 2UZVA 2H6DA 3Q4UA 4ASEA 2C68A 3ENMA 3ZONA 4FT5A 4U41A 1UKHA 3W2SA 2PVKA 5FG8A 3OROA 3QL8A 5CI7A 1MP8A 4BTKA 3ORTA 4K6ZA 5HE0A 3TNIA 5EQPA 2XS0A 4DLIA 2YZLA 4IZ5A 4DYMA 4EORA 4E4XA 3WZEA 5KKRC 4UX9A 1O9UA 5FGKA 3HL7A 2GS6A 3I81A 4AXAA 3P1AA 5HKMA 3WOWA 3Q9WA 3CKXA 3ULZA 3ID6C 5LVLA 4DFXE 4F9WA 3P08A 2HZNA 5LVPA 5M4IA 4RVMA 3IK3A 4RWJA 3Q4CA 5DG5A 3VBTA 3KN5A 3NIEA 1YOJA 3FXXA 4RJ5A 2GQGA 1CKJA 4MD9E 1H0VA 4UALA 3R7EA 4O7RA 4L67A 2FGIA 5FTOA 2R7BA 4TXCA 3OUNB 1TVOA 5E8XA 3OCGA 5M56A 4YJUA 3BYSA 2IN6A 3LQ5A 4L3LA 4O96A 4PTGA 2G2FA 5A4LA 2OFVA 2JD5A 2G1TA 1W83A 4GT3A 3ODZX 2WU7A 5FBNC 2WMXA 3PXQA 4G16A 3SV0A 4EOLA 2VGOA 4G9CA 4GU9A 4ZOGA 3QXPA 3GEQA 1GZNA 2YM4A 3G5DA 1U59A 2CNQA 4HZSA 3HP5A 3VF8A 4HVDA 4NM7A 2W99B 4KUJA 5CF8A 2X4FA 4A9TA 2UZWE 4GK2A 3ZH8A 3OG7A 5BQ0A 5LWNA 5FLFA 1JSTA 4FNYA 4ORKA 4QMZA 4R3PA 1OM1A 4C4EA 3TL8A 3NUPA 4F65A 2P3GX 4XP0A 5JZNA 5IH5A 2R3KA 3D2KA 3QZHA 2C69A 4RMZA 2WOTA 1QPDA 4QMWA 3DZQA 3LLTA 1K2PA 2HY0A 3JVRA 3DKCA 5HHWA 2XYNA 5BX0A 5I9VA 3I60A 4ZP5A 2PMNX 3MVLA 5GJDA 2XM9A 4FL1A 4JQ8A 5EYCA 4QP9A 4AA5A 3HRCA 4O7OA 4UWBA 2XF0A 3TV6A 2QR8A 1Q8UA 4RFZA 5CANA 3FLWA 4R1VA 5HVKA 1IR3A 2X2MA 4IC7A 4MXXA 3HP2A 1Y6BA 3GB2A 4FBXA 3LCSA 1FPUA 2ZM1A 3NFFB 4YPSA 2OIBA 2VWZA 4OR5A 2BIYA 4A4XA 2ACXA 3P7BA 3KB7A 4EK8A 2YCSA 3FLNC 4MH7A 5J1VA 3QKLA 4YC3A 3FMNA 4OGRA 4MXYA 5ANEA 2OJJA 4GU6A 4S31A 2J5FA 3EFKA 5E1SA 4YLLA 4O7WA 3VUGA 3LMIA 4ZXTA 5M57A 3F3ZA 4LMNA 2C1AA 2VV9A 4H3BA 4FTRA 4L43A 1XMMA 3A4PA 3EN6A 4PWNA 3ZLWA 4X2JA 3TN8A 4E5WA 3ODYX 1SVEA 5EI8A 4V01A 5C1QB 2XEZA 5DVRA 3GC9A 5AV3A 2PZPA 4HNFA 3R9OA 5A46A 3RVGA 3DKGA 3PIYA 1BKXA 4BGGA 4YUQA 5JFWA 2QHMA 3EQPA 2XKEA 1PXKA 2E9PA 3BGPA 4U43A 5FUTA 4DG2E 5F20A 1J7LA 3QQKA 1M7NA 1ZYDA 2IVUA 3EJ1A 3D2IA 4OW8A 2PUUA 4C59A 1Q41A 4F1OA 4GG7A 5EKNA 1B6CB 4IVBA 4V04A 2O3PA 3NMUF 1Z57A 2WMTA 5D11A 4PX6A 4U45A 2BHEA 4RIYB 3R1SA 3EWHA 3OEFX 5IQEA 4RQKA 3W2RA 3LFBA 3WBLA 3P4KA 4JJRA 3D5VA 3TWJA 3VHKA 4QP3A 3KVXA 3L8SA 4NKSA 4G3GA 4YNOA 3HV3A 3Q32A 3OP5A 3HV6A 2GS2A 2DYLA 5E91A 4XH6A 2BMCA 4CSVA 3MDYA 3PVGA 3T3UA 4EOMA 3R8UA 4F7LA 3I1AA 3DK7A 4O82A 2IW6A 1LR4A 3EMGA 4FTLA 3PUFC 2J0MB 5EDPA 4DA5A 3GCSA 4KKEA 4Y83A 3FXWA 4RIYA 3BLHA 3PRFA 1H1PA 3ZUVA 4FV2A 3UQFA 4LDTA 4J96A 3RZBA 3FZRA 3F7ZA 5FDPA 4YO6A 5J9YA 2OU7A 3QTZA 4H1MA 4EK4A 2XANA 4JDIA 4XBUA 3MB6A 3LM0A 4EOQA 1LEZA 2CHLA 2V7OA 3ZS5A 3NR9A 3GUBA 4UV0A 5AUXA 2GMXA 4H36A 4RC3A 2A4LA 4FKJA 4R77A 3VBVA 4D4RA 2B9IA 3VVHA 2UZEA 3OXTA 3HMIA 5M55A 4AZFA 4JRVA 3EFWA 5IQBA 3UJGA 3F82A 3Q6UA 4CFNA 4A06A 5AAGA 3KXXA 1FOTA 4KKGA 3KXHA 4FIEA 4J53A 4KBAA 3UO4A 3HA8A 4IC8A 5D41A 1RE8A 2JIIA 3BPRA 2OFUA 3LFSA 4I21A 2XUUA 4IANA 5IQAA 3NS9A 3CY3A 3NPCA 4RJ4A 3COIA 3PY1A 3BLAA 3SKCA 4DGLC 5JN2A 4ZSGA 2OXDA 5GHVA 4ACGA 1SM2A 3BZ3A 2CLXA 3DFAA 3MV5A 3QQUA 2XCHA 2UZBA 3E8NA 3FLQA 5G6VA 2YIQA 1YXSA 2YAKA 2BFXA 4NK9A 3W55A 4K11A 4I20A 5CU3A 4ZTQA 5H8BA 1MRVA 5EQEA 4U40A 1JKSA 1XMLA 3O5AA 3FHIA 4FTOA 4EOOA 3PP1A 2F7EE 4BCIA 2IO6A 4DINA 3HVCA 4EKLA 3SQQA 3NYOA 3PSDA 4R3RA 4IH8A 4IM3A 3VS6A 2XJ1A 5C8KA 4ALVA 2ITVA 4XRLA 4P90A 4UZHA 5EH0A 1ATPE 1NY3A 2OG8A 4AE6A 4BDJA 4DG3E 2VTQA 4HZRA 3IONA 4H58A 1XH4A 4XOZA 3AKKA 3DTCA 3FBVA 3HV7A 4BZDA 5LVNA 5FP5A 4Y72A 4JG7A 4ZTRA 2BDJA 4MTAA 1UA2A 4YJTA 1BYGA 4YTHA 4AF3A 2X8EA 4MD8E 3P23A 4O7TA 2X2LA 4MK0A 2CGVA 3TXOA 1OECA 2YM3A 2W5AA 4X6QC 5J8IA 4DHFA 3BGQA 4DT9A 3M42A 5BVEA 3WYYA 1GIIA 5CU6A 3OW3A 5LCKA 3OT3A 2RFDA 3FKLA 3RKBA 3VS3A 2YJSA 4DAWA 1QL6A 2XMYA 2ERZE 4M69B 5AP7A 3ZZEA 4FZ7A 4JQ7A 4RFYA 3RMFA 1ERKA 1J1BA 4X3FB 3ZTXA 4A4OA 4MHAA 2GTMA 4LV7A 3F2AA 3W2QA 5B2MA 4QYFA 3SVVA 4CQEA 4C3FA 2FYSA 4UZDA 5A6OA 1XKKA 5JGDA 2P2IA 1ZYLA 3COMA 3LQ8A 4Q5EA 3BELA 3TT0A 3D15A 3BHYA 1Y8GA 4RIWB 4QQJA 5H8EA 4ZY5A 1OL5A 3ZO2A 1SZMA 4OBPA 4GS6A 4BDBA 5IQFA 4QT1A 5ETIA 3W0PA 3A7JA 2PTKA 5GINE 4MXCA 1UNLA 3MA3A 2C5YA 2HOGA 3Q5ZA 4TYGA 4X3FA 4ZSEA 4BC6A 4EUTA 4F6UA 4ASDA 5L8KA 3KXZA 2JFMA 4C37A 3MESA 4BDIA 2FA2A 3C4CA 3R8ZA 3UMXA 5CSPA 3VNTA 4EH3A 4YZNA 5H2UA 2YDKA 1GIJA 4RBLA 4RZWA 3U6HA 5E8TA 3R1YA 4N4SA 2OW3A 4W8DA 4C4IA 2XKFA 5CAVA 3UPZA 2REIA 4HYSA 3POOA 5BYYA 3R01A 2QQ7A 5F4NA 3IW6A 4XUFA 4WNPA 5DNRA 1UWJA 4FSWA 2R3FA 4R1YA 4FKLA 4MWHA 3R9RA 5CZIA 4LG4A 4ALUA 4C2VA 3D5XA 4EWHA 1Q8ZA 5HBJA 4LV8A 3ORIA 4FSQA 5FXQA 4F1TA 1XBBA 3C51A 1MRUA 1Q3DA 4BCFA 4BI0A 4FEXA 3R9NA 4TRLA 3E5AA 3E92A 3LJ2A 4KRCA 3O0GA 1U46A 3PIXA 4XV2A 3U87A 3R0TA 3H9FA 3BQRA 4M7IA 3EQRA 5F1ZA 2QU6A 2ZM4A 3PG1A 3CD8A 3KMUA 3NYNA 5CEQA 3ZLSA 3C7QA 4UEUA 5LVOA 2J90A 2PVYA 4QP4A 3A7GA 5JRQA 4G31A 3W0OA 3OC1A 1OGYA 2GCDA 4MXOA 4AGDA 2X4ZA 3RWPA 3VUIA 1DAWA 3CTQA 4KBCA 2W06A 2HXQA 3FE3A 3VS2A 4J98A 4NUSA 4FV4A 2BZHB 3SXFA 4IAYA 2JAVA 1NW1A 5HNIX 2P4IA 3OWLA 1Y91A 4DEHA 3C4XA 4XX9A 5HBEA 4U81A 3LFDA 5LMKC 3KULA 2RFSA 4JG6A 3FI4A 3VN9A 3JPVA 2UW4A 3D7ZA 4IW0A 4C3PA 4AZEA 4PDSA 4ANQA 3UOJA 2CCHA 3I4BA 1WVYA 5BUJA 4LRKA 3VWAA 2VNWA 4U80A 3IDPA 2WOUA 4QMMA 3HECA 3G6GA 3PPKA 3QCQA 1WMKA 4O38A 2XK6A 3W8LA 2PUPA 1V1KA 4AN3A 4M13A 4FG8A 2YJRA 2CGUA 3IKAA 2IZRA 2OIDA 4YZCA 3VUKA 4QMVA 4AUAA 4X2FA 4WG5A 1K9AA 3MGYA 5C8MA 4RQVA 2WB8A 4CEGA 3LCTA 4EC9A 3RK7A 4DFLA 3DQXA 4L52A 1W0XC 3F61A 4F70A 5IH6A 5KNJA 1OIYA 3E87A 4DBXA 3O51A 2R3HA 1QMZA 5IEYA 2Y7JA 4LV5A 2JBPA 2WO6A 4B6LA 4M0ZA 1OL2A 4GIHA 3R73A 4QYYA 3IGOA 2BRGA 4OTRA 2HZ4A 3MH3A 4TTHB 1Q3WA 2F7ZE 5HE3A 4QMLA 4F4PA 2YCQA 4IB3A 5DT0A 5IZFA 1PJKA 3R7UA 3NUXA 4Z3VA 4PUZA 2OJ9A 4MWIA 4EH6A 3QZIA 4IX3A 1B39A 4APCA 3LFEA 4J97A 3PE1A 3FPMA 4ZS0A 4FYOA 3FPQA 3PVWA 1H0WA 4GK3A 3ZC5A 2ZJWA 3R02A 4CNHA 4IWDA 2FSMX 4CRLA 3QQLA 5D12A 4PY1A 3TG1A 2QONA 2XKCA 2XNNA 2C6DA 2G9XA 1YQJA 2OZAA 4CFVA 3KL8A 3BHTA 3D0EA 4DHJA 4DDGA 3F5UA 3WI6A 4O81A 3WF9A 2UW0A 2B52A 2X1NA 5GIPE 4A9SA 5L2WA 2O5KA 5E8ZA 1P14A 3GCVA 3HNGA 1JKLA 2W96B 2VTJA 4BHNA 3V8WA 4YURA 5I5ZA 3C0HA 3RTPA 4JIKA 2DQ7X 4IWQA 1SVGA 4AW5A 4O84A 2VWIA 4I0RA 4X2NA 4DEIA 2VTTA 4E4MA 4XG7A 3POZA 3PFQA 3L1SA 3DJ7A 4GUEA 5K4IA 1XWSA 3LXNA 3R63A 4WO5A 2GFCA 5BUEA 2QC6A 4O7SA 1BI7A 2WTKB 4JX3A 4EHEA 1T46A 3IW4A 3LMGA 5CTPA 5EKOA 3UOKA 1J3HA 3UIBA 4APPA 1X8BA 3V5LA 4NYEA 2X9FA 4FYNA 4M68A 3G33A 2WQOA 1MRYA 4EBVA 2Y6MA 4AWIA 5FTGA 4GRBA 1H07A 4KKHA 5C4LA 4Y73A 2R3NA 5FBOA 4MNFA 5JH6A 4II5A 4MD7E 4FK3A 1CSNA 2ZOQA 4EONA 3FI3A 3VW6A 5F9EA 2XNEA 3FL4A 3HKOA 3NWWA 4J8NA 5HG8A 2YM8A 2PPQA 4C02A 3QTWA 2XIKA 5AP3A 4IDTA 4AT3A 4I0TA 4FA2A 4QEBA 3KXGA 2XIXA 4Z55A 4RVTA 4KA3A 3NDMA 1URWA 2P0CA 3QUPA 4FTKA 1XJDA 2BRNA 2ITNA 2UZLA 2WTKC 4RJ8A 3FSKA 4TZRA 2ETKA 4MKCA 2I7QA 2VTNA 5EM7A 4XP2A 5HBHA 1H1QA 4TNDA 1GZ8A 2EU9A 4FTMA 1FMKA 4ZJIA 2Z7RA 2W1GA 3F9NA 5EHLA 3IW5A 3PLSA 3DOGA 3DU8A 3G90X 4QMOA 2X8IA 4WUNA 3UODA 4DEDA 2PVJA 2C47A 4ENXA 2X9EA 4AAAA 4D0XA 4FOCA 4I23A 2ITYA 4K77A 4NCTA 3SAYA 2PK9A 2KULA 2W1ZA 4RFMA 1ZMUA 2XJ0A 3DDPA 3EN7A 3D4QA 4JQEA 4P5ZA 5BVOA 4D4SA 4DT8A 4L45A 1P5EA 4YTIA 2GSFA 4RIXB 3PA5A 4FMQA 4JX7A 2XYUA 3EIDA 3EN4A 3FLYA 4EEVA 3VS0A 4AZVA 4TYIA 2VTOA 2OGVA 4PMTA 4AACA 1SMHA 3D5WA 4FKPA 1GJOA 5IISA 3C0IA 2GHLA 5HVJA 4YLKA 4DEGA 4FTQA 3COHA 2NRYA 4EZ3A 4BY9E 1ZOGA 2YHVA 2WNTA 4G1WA 1V0PA 5CF4A 3ZDIA 3AC3A 3ROCA 2XA4A 3OBGA 5EW9A 2RG5A 2ZVAA 2FB8A 2YFXA 5CQUA 1RW8A 3FJQE 1S9JA 5I9ZA 3S4QA 4MXZA 5J7HA 5DH3A 4RA4A 4RIXA 2BILB 2O8YA 3HMPA 2EUFB 4E6AA 3DCVA 4FI1A 2WQBA 3QLFA 1J7UA 2GFSA 2W4KA 3FMMA 3QTIA 4MQ1A 5AV2A 3A2CA 4A4LA 3MJ2A 1PKDA 5KBRA 3CPCA 4I94A 1BMKA 1H1WA 2BAQA 5EHYA 3QUEA 2GNHA 2XJ2A 3HUCA 3BBWA 3GQLA 3TEIA 5JK3A 2I1MA 3FQEA 3TKUA 2DUVA 1OGUA 2IZUA 2PY3A 2ITZA 2YABA 1V0BA 4NM3A 3AC8A 3E3BX 3W0NA 1SNXA 5FP6A 2W9FB 5CENA 4DFYA 4YHTA 3HGKA 3KXMA 4BTFA 2GQRA 3LVPA 5DR6A 3R7YA 4WBOA 4ITIA 4GJ2A 3SW7A 3DXQA 4U79A 2YM5A 2Y6OA 3UIUA 3IQ7A 3MS9A 4UB7A 4BF2A 4FG9A 2WMRA 3KKVA 3VF9A 2XNBA 4V0GB 4DTKA 5AAFA 2VU3A 5CSXA 2FH9A 4GEOA 3EOCA 3SD0A 5KMOA 1CKIA 1DS5A 5AUZA 3G9NA 3JY0A 4FEUA 4FV3A 5FEQA 3VIDA 4JAJA 3W2OA 2C6LA 1OBGA 5F95A 1YI4A 4GL9A 3E8CA 4CMUA 4ZMFA 1MQ4A 1Q8TA 5E8SA 4U7ZA 3R04A 2QKWB 4CTCA 3SC1A 4YJPA 4E6QA 4FIGA 1Z9XA 2ZFYA 3D83A 3IDCA 4EK6A 5A4CA 3NNXA 2J9MA 2QR7A 4YO4A 5AIKA 4F99A 4UXQA 4ZTHA 3D94A 3R2BA 5LJJA 4GKHA 2GNJA 1MUOA 4MBLA 1ZMWA 2W05A 1ZOHA 1WCCA 5AWMA 3BYOA 5IA0A 4E1ZA 3ZFYA 2XM8A 5E8WA 3UOHA 3QFVA 3PZEA 4M0YA 4KRDA 3IW8A 4R7HA 4S2ZA 3ZLXA 5HG9A 3BU5A 3RK9A 3C9WA 1W7HA 2Z7QA 4J8MA 4L00A 3R9HA 2V62A 3KIOC 3RAHA 3DNEA 3FMHA 3JY9A 4Y46A 5LARA 4DEAA 1FVTA 2ESMA 4TYEA 5JFVA 2GS7A 1NVSA 1PXJA 2J2IB 3PXRA 4IEBA 3SRVA 4NTTA 4B0GA 4QTAA 5HE2A 3FUPA 3O8PA 4FEQA 4TWOA 2F2UA