4N57A

Crystal structure of aminoglycoside phosphotransferase aph(2'')-iva adp complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
RTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-IVa ADP complex
rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
molecule keywords APH(2'')-Id
total genus 93
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4n57A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4n57A02
3LFDA 4PX6A 3GU7A 4PL5A 1M2RA 2ZDUA 5BX0A 5L3AA 2G1TA 3LLTA 3KK9A 4TXCA 5ETAA 1ZY5A 3P9JA 2XNEA 2WAJA 1P4OA 3KMWA 5CY3A 4Y5HA 3HV7A 3I0QA 4IADA 1OMWA 3DLSA 5ACBC 4BTMA 2F7EE 3OWLA 3EQIA 4UYNA 3IPHA 4A06A 4F64A 4YPSA 5IG1A 3JXWA 3E92A 4JDIA 4EH3A 4AN3A 3HRCA 3UNJA 4BCQA 1IASA 2QOKA 4O0YA 5CAQA 1M7QA 4JT3A 4H3BA 3VUMA 2WTIA 1M2QA 3P4KA 4BTFA 4HVDA 4HVSA 1WCCA 1CKIA 3LXLA 4ANSA 4HGLA 4DFZE 3DV3A 2PMNX 4G3EA 4K11A 5EDPA 4CFWA 2VWXA 3ZFMA 1XBBA 3CTQA 4FV1A 3UOHA 4FYNA 4FKWA 4RWKA 2VV9A 3MY1A 3TV7A 4QQTA 3BQRA 3R63A 4DLIA 4QMQA 3CTJA 4C02A 4ZTSA 2R3RA 3Q04A 1Q99A 2XYNA 4YC8A 4E93A 4F7LA 5B2LA 4BCFA 3FHIA 4NW6A 3ZHPC 4GW8A 3DBEA 1TVOA 1Y91A 4E5AX 5IQGA 4ZSLA 2J9MA 3CCNA 1OPKA 1YXTA 3ROYA 3L8SA 2GTMA 5FRIA 3DZOA 2JITA 3QZHA 5HNGA 4BDIA 4IVDA 4ZSJA 4QYHA 4L3LA 4V04A 2ITNA 3DNEA 3IW5A 4DH3A 2V62A 3Q53A 2ZB0A 4DCAA 1YI4A 3LLAA 3D83A 4DFNA 4DGOA 3GOKA 3OT3A 3HECA 5ANIA 2IZTA 1U4DA 4JLCA 4JAIA 2ZV8A 1H0VA 3IG7A 1SZMA 4PDOA 4ZZMA 3SQQA 3I5NA 3CJFA 3QTWA 3UQGA 4I21A 1REKA 2R7BA 4O7LA 5CAPA 2XK8A 2Z7RA 1P4FA 1Q24A 2Z8CA 4WSYA 3W2CA 4TT7A 4I6QA 5JH6A 3BLHA 2FO0A 1JSTA 3MGYA 4EK4A 2W9ZB 4MNEB 1ZYCA 3D14A 4NM7A 4I0SA 3C5IA 4CMOA 3OF0A 3G6HA 2R3GA 5HEZA 4J8MA 3OOMA 4U40A 3V04A 1OUKA 4UALA 3DXPA 4DGLC 3G90X 2BPMA 2W99B 4KUJA 2ESMA 4X2NA 5HLPA 4N6ZA 4A4XA 2QOBA 2WU6A 4IC7A 4MYGA 4BIEA 3ATSA 4RWIA 4EZ5A 2HWPA 4OGRA 1NVQA 2E9NA 2VWUA 3FLNC 4XG7A 4X2JA 4RBLA 1JVPP 4BDCA 2X7FA 4JR7A 4AP7A 5C1QB 3LQ3A 2UW7A 3VHEA 3A8XA 3GU8A 3P86A 3R21A 4BYIA 4ITJA 3BEAA 1E1VA 3BRBA 5CU0A 2ITXA 2IW9A 1I44A 3TNHA 4O7YA 4D9TA 5T6KA 3HA8A 4KBKA 2O63A 2UW6A 3RM6A 4A4LA 3UIUA 1GIIA 2QOHA 1XR1A 3DQWA 5CVGA 5B2MA 3W18A 3L8VA 2CLXA 4NKSA 4F70A 3RAWA 3PXYA 3R7OA 4YJTA 3C1XA 3E5AA 5F20A 2H9VA 3BHYA 3CTHA 4ORKA 5DLSA 4ZY5A 3PG3A 5J1WA 5A46A 4WUAA 5E1SA 3VUKA 4GG7A 1J7LA 2R3MA 1M2PA 3BHTA 5HLNA 5J87A 3VVHA 3DXQA 4FT9A 4I94A 4QT1A 4KS7A 4ZXTA 2UW5A 5HGIA 5TT7A 4ASXA 3VO3A 4XV3A 4C2WA 4EEVA 5CALA 3UMWA 5C9CA 1GZOA 3W0SA 5HCZA 3PTGA 3NPCA 3D15A 4AN2A 4G3FA 3AGMA 4B7TA 3G15A 3HMNA 4XV9A 1GOLA 3EQBA 3ORPA 4FSNA 2BIKB 2G2HA 4BIBA 5JQ8A 2R5TA 3DTWA 3KK8A 4YSJA 5AUXA 3QGWA 3TUDA 1KUTA 3DJ5A 3RPVA 3EZVA 3PVWA 4E1ZA 5LMAA 2J0IA 2WTDA 4EH8A 4B4LA 2C68A 4UXLA 3VF8A 1FVRA 2ZJWA 2WHBA 3TKIA 3W8LA 4PUZA 5B2KA 3ATTA 3SG8A 3R00A 4FTIA 4AW2A 3VC4A 2WO6A 1G8SA 3SKCA 4AA5A 1YDRE 1FBNA 3BGQA 4TWPA 2ZV7A 4NCTA 4D4RA 2VWIA 2FSLX 4HVIA 5E8ZA 4C58A 3NW7A 4HW7A 3OCBA 2XB7A 2OIQA 4BC6A 2WQEA 4QMWA 3ZRMA 2PHKA 4IZ7A 4P5ZA 1BMKA 3DPKA 4FKPA 1PMUA 2H6DA 2GHMA 2JAMA 4AW1A 4D4SA 1YW2A 3EKKA 3KRXA 2OICA 3C0IA 1O6LA 3DBFA 5EYCA 4BGQA 4GVJA 1GY3A 4ZEGA 3TYKA 4S30A 5CF5A 4R5SA 3FY0A 4RVMA 4WNMA 1G5SA 2GNGA 4GIHA 2WXVA 3ZC6A 3JY9A 2P2IA 5J7HA 4RWLA 4R7IA 3ZUVA 5EDRA 2YZAA 4C4IA 5HU3A 3FXXA 2WGJA 4G6LA 5ANDA 4MKCA 2QG7A 3NGAA 5AA9A 2PUNA 1T45A 2E9UA 4UWYA 5D41A 5HBHA 5L8LA 3EIDA 3KULA 5CNNA 4GT3A 5CLPA 4PTEA 4H58A 2XMYA 4PTCA 3VW8A 4PDPA 4P7EA 1ZOEA 3LHJA 2YJSA 2XEYA 5IMEA 5EKOA 3E88A 2PUPA 3QCSA 4QP3A 2GFSA 4FODA 3QCXA 4E26A 1S9JA 2XKEA 4FT3A 3DK6A 5LVLA 4EH5A 4L42A 3H3CA 4GK4A 3Q6UA 4F6SA 4O96A 3LOKA 4FV7A 4V0GB 5M57A 3PWDA 1R78A 5H8BA 1OM1A 3ITZA 4ZLOA 4RJ4A 3P0MA 4MD9E 2C6TA 3BHUA 4FBXA 4WHZA 4F7JA 1JSUA 4I5HA 2H96A 3U4UA 3V5PA 3IO7A 4JRVA 4O22A 4LQMA 3LQ8A 3ULZA 3F2RA 3WF9A 4KSQA 5HKMA 2BDFA 4D5HA 3EQHA 4EOJA 3QD2B 3GCVA 3DKFA 4TRLA 2PYWA 1WBNA 1ZOGA 5I9WA 1QPEA 5HTBA 4U44A 2YN8A 3ENHA 2J5EA 3GNIB 3V3VA 2VAGA 2BIYA 3AQVA 3OT8A 3OW4A 3VN9A 3PSDA 2BDWA 2XK6A 3DBQA 2Z02A 3EZRA 5LMKA 4ANQA 2PTKA 4FEVA 4BCIA 4XP3A 5EQEA 3C4FA 4GK2A 5LCKA 2XM9A 2C6IA 2R3NA 4U41A 4DBNA 4QP7A 4FUXA 5M09A 4U3ZA 2H8HA 4X21A 1V0PA 1YOJA 4O0WA 4CKIA 3DT1A 4FKGA 4RLKA 5KMJA 1HCKA 4BZNA 2PZIA 3EQCA 2EXCX 2C1BA 5F95A 2PVHA 4WBBB 3QHRA 4F9YA 4KKHA 3ZSGA 3OXTA 4EQUA 4PMSA 4AE9A 5ETIA 4HYIA 5E1EA 4BZOA 4EKLA 2V55A 2WMRA 2ZVAA 4G3GA 2PSQA 4M0ZA 4DFYA 2GNLA 3MPAA 5HNBA 3OZ6A 3R9RA 2EB2A 1FVVA 3R6XA 1YI3A 1KV2A 1YOLA 2ACXA 1PXKA 1YXVA 3JY0A 3KF4A 4LRJA 3K54A 4HGEA 4MNFA 2X9FA 3UC4A 4E7WA 2BCJA 3QTQA 4FT7A 2EXMA 4GFOA 5L6WL 3BYOA 3THBA 2CNUA 3UNZA 3H0YA 2UZVA 3HYHA 5D10A 5IUHA 3CBLA 4JBPA 4LOPA 4WO5A 5IF1A 2BFYA 3N4UA 4IDTA 4FYOA 3RZBA 3SHEA 2J6MA 4U3YA 1REJA 3IK3A 2XKFA 3C4EA 4MD7E 3COMA 4HCUA 3IOKA 4TYIA 2F57A 4W4YA 4YR8A 3NVKI 3O0GA 5KMLA 2O5KA 2EVAA 2X9EA 3I0OA 3OWPA 4R6VA 4OT6A 5DOSA 3A8WA 5KNJA 3T9IA 1VYZA 3IGOA 5GIOE 2VTMA 4AZSA 4KBCA 1NA7A 2F7ZE 3SC1A 4USFA 1YWVA 1YHVA 4K33A 3L9LA 3UE4A 3DKCA 3NR9A 2PK9A 3OCSA 5AJQA 5CF6A 3PRIA 1Q5KA 4I92A 4GK3A 3ZM4A 1WAKA 5HD7A 2YM5A 4FIFA 4BY9E 3R1QA 2QLQA 3LXPA 3DTCA 4GRBA 1URWA 1Q8WA 4KRCA 1GIHA 1OKVA 2XUUA 4L8MA 2BVAA 4H36A 3MY0A 5A14A 4YLJA 1XWSA 4D4YA 5E8VA 4PP9A 3EFKA 5JFSA 1VR2A 4JBOA 3E93A 3CSVA 3MH2A 4QPSA 4DE4A 2PULA 4QMUA 5AP1A 3WZEA 1SNXA 4FSUA 2C69A 4IZAA 4Y95A 4E73A 2C3LA 2YITA 4G6NA 4FIIA 4TTHB 3VS1A 4IEBA 5H8GA 3F88A 3ZCLA 4II5A 2VGOA 1BX6A 4ZTHA 2W1HA 5FG8A 4CXAA 2AC3A 3D5VA 5AV4A 3NW5A 3P79A 2NNWB 5FTQA 3UVRA 3PLAE 5EI2A 4YU2A 2GMXA 5EYMA 4JOAA 4YZBA 3E8EA 1KOBA 1GAGA 4GUEA 1OL6A 4K8AA 1OB3A 3LVPA 4DG0E 3QALE 1DI9A 4QOXA 4O21A 4BZDA 2FH9A 4IX4A 4LV8A 4M13A 5CSVA 5IDPA 2PVMA 4FT0A 2QOOA 1H08A 4JRNA 3R9DA 5JN2A 3RWQA 3EN4A 2RIOA 3V01A 3TUBA 5EYKA 2RG6A 2J2IB 5HIBA 2PU8A 1NVRA 4O0SA 2R2PA 4AGDA 3R8MA 4LG4A 2R9SA 3COIA 4FIHA 4XG9A 4FV2A 2QU6A 4W4VA 5M4IA 3PVGA 4F4PA 4G5JA 3OS3A 3NCZA 4J96A 5ITAA 3C4WA 4QP2A 5CXZA 2OZOA 3CS9A 1YOMA 4FKLA 4WBOA 5DWRA 5CENA 5EM8A 3ZUTA 2YCFA 1T46A 2VTTA 3POOA 4IWPA 4FK3A 3CP9A 3MS9A 4OUCA 1K9AA 4IAKA 5CXHA 4EQMA 2FYSA 3QBNA 4NIFB 5A6NA 3AG9A 4R1VA 2C0IA 4DC2A 2F4JA 4IACA 3O8PA 3FI4A 4O83A 2WEIA 3ZXZA 4Y46A 3SV0A 2WELA 5EDQA 1JKSA 5I4NA 5IMXA 3BBTB 4I93A 2VTRA 2QU5A 3A4PA 2OJ9A 1WBVA 3Q60A 3QLGA 4ZLYA 4O27B 2WQMA 1PYEA 4H1JA 2UW3A 4QP8A 2C1AA 3QYWA 3VW6A 4DEBA 3WF6A 5IUGA 5BYLA 4FE2A 5BUIA 3QZIA 3H10A 2V7OA 4S31A 3IW8A 4HNFA 5J95A 4ENYA 4WA9A 1WBOA 4CZUA 3U6JA 3GC7A 3N9XA 4CZTA 2PMIA 3ZC5A 2ITPA 3EN6A 3H9OA 1J3HA 2RL5A 3PPJA 3VBVA 2W1GA 3D2KA 3FI2A 1UA2A 2PMLX 3F5UA 3RM7A 5IU2A 3LFCA 3L9MA 3TJDA 4YJOA 1Q41A 2HY81 2YM6A 4H39A 2YABA 3JR1A 4O91A 3UYSA 4JDJA 3RCJA 5AAEA 4O7VA 4AGWA 3R8LA 3Q2JA 2UZEA 2I1MA 3PPZA 4TKSA 4YJQA 4TZRA 1H24A 4AZFA 5HX8A 3PVBA 4LOQA 4FTAA 5HU9A 1XQZA 3KXXA 4XV1A 1WMKA 3HAVA 4QMLA 2E9PA 2VTSA 3VIDA 2UVYA 4TN6A 2WNTA 4RIYA 1U54A 3NYNA 4GU6A 4YJRA 2YM3A 2UW0A 2PZPA 4DEAA 4C36A 5JMSA 3R04A 4G17A 2PE1A 3FKLA 2JC6A 3I60A 1JPAA 4ANMA 5FTOA 3ACJA 2GSFA 3ZRLA 5BYYA 4XH6A 3UC3A 4PRJA 3W0MA 4U97A 4M14A 3UMXA 5AM6A 2YIRA 5IA0A 3SAYA 4FZFB 5M44A 2B9HA 1H01A 2PUUA 5FQDC 4C7TA 3W55A 2GQGA 2XRUA 3UP2A 1J1BA 5HX6A 4IDVA 5DR2A 4M8TA 3TDWA 2XIZA 1OKWA 2W96B 3PXRA 4RPVA 1FMOE 3EKNA 4IWQA 4FKSA 4BVUA 2A27A 4HVGA 3CLYA 4JDKA 2PVNA 4D1SA 2HIWA 4Q5EA 5ETFA 5BMMA 5A9UA 2IPXA 3ZYAA 2UZWE 3CQUA 3AD5A 3A7FA 3O23A 2JDRA 3PXQA 4Y83A 4EOKA 3HMOA 3QC9A 2XNMA 3MA3A 4NM5A 3R7IA 4DBXA 4F08A 3ZONA 5AAFA 4MWHA 2X81A 5I9YA 3WF5A 3R0TA 4LM5A 2WB8A 5DVRA 3OVVA 2NRUA 4FNXA 2W05A 5L6OA 3PP1A 4PNIA 5CAOA 4DF3A 3Q2MA 5J8IA 2C30A 3WARA 2VO7A 5KCVA 3GC8A 2G2FA 3TDVA 2ZDTA 4M84A 2ZOQA 3F3UA 2CKOA 5I5ZA 4CEGA 3R1NA 5FP6A 4O7OA 4BDDA 4FR4A 1Y57A 3HLLA 3PIYA 4QP1A 3RNIA 2EB3A 4ZY4A 2J0LA 4AZTA 4L43A 2BRNA 1OITA 2GS7A 2XKCA 3NYOA 4IBMA 3OUNB 4IM3A 3SVVA 3EMGA 5KKRB 2Z7LA 3RK9A 1ZARA 4C2VA 5FLFA 3SXFA 1CDKA 3LMIA 2R3KA 3PSCA 4JX7A 4DFUA 4FSYA 3O17A 5M4CA 4FTKA 3Q3BA 2VZ6A 2BZIB 3NEWA 2X6EA 1UU9A 4MD8E 5TR6A 2YACA 1M7NA 4BI0A 4FTRA 2ITZA 2FUMA 2O2UA 2IVVA 3KMUA 4L52A 4E8AA 5IH4A 3VF9A 2HYYA 4CD0A 4UXQA 2C6LA 2G15A 3F9NA 1PJKA 1DS5A 2ZM1A 3KKVA 1Z9XA 2XNOA 4I41A 3AC1A 3AXWA 4AACA 3WYXA 4C33A 5DE2A 3MSSA 4APPA 4EJNA 1OL5A 4QYEA 3R9NA 4C0TA 2RGPA 4R1YA 1UKIA 1DM2A 3CGFA 3I5ZA 4F0FA 4ZAUA 4AFEA 2C6EA 1SVEA 4QMXA 3EQGA 3A4OX 1OI9A 3EQFA 3QRIA 3PUPA 5HIDA 3TACA 3DK3A 2CJMA 1OGUA 4EH7A 3ERKA 3MESA 3NS9A 3QQGA 4YNEA 5CSXA 2VWYA 3C4CA 4FVRA 4U6RA 4CMUA 1TQMA 1U5RA 2GTNA 2ZMDA 4USEA 4IX3A 2UW4A 2YJRA 3CQEA 3GI3A 4NSTA 3AC2A 5FEQA 1ZXEA 2CNQA 3TNPC 3JS2A 5I9VA 5EH0A 3PXFA 3A7HA 4CV8A 3ZTXA 3DOGA 5CASA 3HKOA 5AUTA 1SNUA 1Q61A 3TKUA 2C6MA 4BDAA 2UZUE 2YERA 2ITTA 4KB8A 3Q4TA 1B6CB 4AX8A 5DPVA 2Z7QA 4O7ZA 3S3IA 2WOUA 2C3IB 2BZJA 2YFXA 3EL8A 3OOGA 4OTIA 4HGSA 4U94A 3DKGA 1YXSA 2WTVA 5LOHA 2QODA 2B55A 1JKKA 4RC3A 4N57A 5K4IA 3TZ8A 4E6AA 2C3KA 2JFLA 4ZS0A 2ZM4A 1ZMWA 2R3PA 4V01A 4F63A 4QMZA 1YWNA 3ORTA 1SM2A 3AC3A 1CMKE 3DAKA 3BHHA 3BYSA 1M52A 1LP4A 1M14A 1MQBA 3C5UA 3PA5A 4FOCA 1ZOHA 3QTZA 5F4NA 1H07A 2F2UA 1XO2B 5FXQA 2PUIA 2PVFA 2XEZA 1VYWA 4G9CA 1H1RA 2HK5A 1W82A 1XH7A 4WNPA 5AP5A 1PXOA 4FSQA 2QO7A 1PXJA 2PY3A 4X2KA 4GYGA 4X2FA 4K77A 2C3JA 5T3QA 5CEOA 5AP0A 3F61A 2GS2A 3NIEA 5AX3A 2XIRA 3HMPA 4YPDA 1F0QA 3PLSA 3PJ8A 3C7QA 4L3JA 4ALUA 5AP4A 4BRXA 3LQ5A 4G5PA 5I9UA 3G5DA 5FEDA 4QMMA 3ETAA 4Y73A 1O9UA 3AC4A 3PP0A 4RGJA 3DAJA 3HV5A 4BI2A 4GSBA 4XOZA 4J1RA 4P2KA 3MI9A 2HXQA 4B8MA 2I6LA 2HZ0A 3W10A 5L2IA 3SXSA 3C51A 2ZMCA 5LQFA 1OPJA 3S2PA 5IQAA 1B38A 5BVDA 4L3PA 2XKDA 2OF4A 3MH3A 2XK9A 4HYSA 5TO8A 4CRLA 2UZTA 4J53A 2OI4X 3EHAA 3FLWA 5HORA 5ANOA 2IVUA 1PKGA 4H3QA 3VAPA 5BUEA 3ZFYA 3QTUA 4FG7A 3FE3A 4ANBA 2B0QA 2WMSA 3G0FA 2UV2A 4QTEA 3D4QA 2QURA 3P1AA 1JKLA 3PYYA 4PTGA 4ZSAA 3PA3A 4XRLA 2VX3A 2Y4PA 5F9EA 4YTIA 4RIWA 4CFNA 3UQCA 5IEXA 3QX2A 4O2PA 4AGCA 5CU3A 2KULA 2YM4A 2WTKC 3OHTA 5IQBA 3S4QA 4JG8A 3KEXA 4M3QA 4EOLA 5JFXA 1Q8ZA 3WIGA 4UWCA 2DWBA 4U79A 1PYXA 2IVSA 4QYFA 5EG3A 2EU9A 3FKOA 2XRWA 5DIAA 1W84A 2CCIA 5FDXA 3ZUUA 5CNOA 4XG2A 2QKWB 4F6UA 3MJ2A 3QHWA 4G31A 4O0XA 5AP7A 1U54B 3P7BA 2ZV9A 3F3ZA 4CCUA 4CG9A 5C03A 4ASZA 3II5A 4IB5A 3RVGA 4IB0A 3NSZA 4RX9A 3PVUA 5EOBA 2LAVA 1PY5A 2QO9A 1OIYA 3C0HA 2ITOA 5EQYA 2VTAA 5LWMA 2Z60A 3QRJA 1KE5A 3FLSA 3LW0A 1CKJA 4JI9A 1H1PA 5TKDA 2QNJA 3GOPA 4ZMEA 4JNWA 5CVFA 4FEXA 3RI1A 1IAHA 3AGLA 4A9SA 2CNVA 4X7QA 5CZIA 3ROCA 4RVLA 2W1IA 5E8XA 3HP5A 5DR9A 1Z57A 4BHNA 3MH0A 2XZSA 1GZKA 2X8EA 4KSPA 2Y6OA 3FQEA 3OD6X 4YJSA 5EM6A 3AT3A 4QYYA 4IC8A 5HE3A 3VBTA 5HZNA 2C5XA 1ZZLA 2ZV2A 3MN3A 1MUOA 4C59A 4DEHA 4XNEA 5LMKC 4XUFA 2F7XE 3DS6A 4CTCA 4U42A 5DBXA 4TL0A 3O71A 3MWUA 1XHAA 2W0JA 4UZDA 4J8NA 5FDPA 4XBRA 2XF0A 3ZMMA 4YP8A 3DZQA 4MK0A 3CC6A 5BYZA 4NK9A 4FL2A 3TZMA 4K9YA 1Q97A 4HZSA 3Q5ZA 3D5UA 4FV5A 3A99A 4MBIA 5BVEA 2R3FA 4U98A 2CLQA 3R7EA 3F7WA 1ZWSA 3OROA 5E7RA 1J91A 4NKAA 4AUAA 4Z9LA 3W0RA 4EI4A 1ZMUA 2OZAB 3UGCA 1G3NA 2JBOA 3Q9ZA 3TNQB 4PP7A 4M0YA 4BICA 3GC0A 1UNLA 3D7TB 1YDTE 1BL6A 1IAJA 1UNGA 4QMYA 3UO6A 1H1QA 4BCNA 4OBQA 4TWOA 5DHJA 4ZSGA 1OL7A 4GT4A 4CNHA 1FGKA 2YIWA 3DU8A 4B9DA 1UWHA 3PY0A 3GBZA 3ZEWA 3HL7A 5JFVA 5GJGA 4GIIA 1QPJA 1FPUA 1ZYJA 3N4VA 2CGUA 1XBAA 3DAEA 4RIWB 3OCTA 2WPAA 3BLRA 2X2MA 3NAYA 5CX9A 4XP2A 2ITQA 4N6YA 3V51A 2QQ7A 4NYEA 5KMOA 1H26A 2C5NA 4JS8A 2RFEA 4MF1A 4RT7A 1O6YA 3QXOA 3QYZA 4IVCA 4IX5A 1ND4A 3MVMA 4O0RA 1PW2A 2V7AA 4BYJA 4RQVA 3ZXTA 3RKBA 1PHKA 5M56A 3E87A 4QP4A 2QKRA 3ZO4A 3EN7A 1PKDA 3PJ3A 4IHPA 2VD5A 3UZRA 2WTCA 4ALVA 4BDKA 3FMJA 4QTCA 4YHFA 1B39A 3R1YA 3GCPA 2X7OA 4OTQA 5ICPA 1OBGA 4UBAA 5CI7A 4LL0A 3I6WA 3F3WA 1OIQA 4FSRA 5I9XA 3H0ZA 5CT7A 2JIUA 3MIAA 3PPKA 4ITIA 4MTAA 2XP2A 4Y85A 1FINA 3BWJA 3NUPA 4RIOA 1URCA 3PJ1A 5DH3A 2NRYA 3NZ0A 3DJ6A 4M69B 4HYHA 4MXZA 5ANKA 5D1JA 2XIKA 3BU3A 3FV8A 4YGAA 3RK5A 5J1VA 4U5JA 3A60A 3V5WA 3QFVA 3V6SA 5AIRA 3NMUF 4O82A 5HG8A 4MXCA 3WZDA 3TXOA 5HCYA 5IZFA 3ZBXA 5H9BA 5FXRA 5CWZA 1X8BA 4AOIA 4FSWA 3A7JA 3MFUA 3P7CA 2P33A 4CV9A 5GIPE 3PE2A 4KS8A 1W8CA 4I23A 4LFIA 3TIZA 3CD8A 3ZS5A 3D0EA 5L8KA 3CE3A 3TV4A 4LGGA 4C4HA 1OUYA 3RINA 1IEPA 3NUAA 1V0OA 3VWAA 3CQWA 3CY2A 3W2OA 5CAVA 4LV5A 4FT5A 4FKRA 1Q3WA 2R3OA 5AUZA 3VNTA 4EOQA 3LFBA 2Y4IB 4DLJA 2C5VA 3T3UA 4WZYA 5G6VA 1XH6A 5JZJA 4BCHA 4YURA 1ERKA 1STCE 2CSNA 4PL3A 4KKEA 5HG5A 3WILA 4CSVA 3UZTA 4XG8A 3HMMA 3BBWA 1ZYDA 3Q32A 1JQHA 1YHWA 2OZAA 4EOPA 5HESA 3IQ7A 3TEIA 2PL0A 2WMQA 3E62A 3HV4A 3UIXA 3MPMA 4RVKA 5C8MA 1YRPA 3QL8A 3K5VA 3O96A 3SOCA 4OTWA 3QA8A 3EQDA 3F5XA 4I6BA 2G01A 2VNYA 3SGCA 4A07A 5KUPA 2VX0A 2QD9A 4GMYA 4GJ3A 3OUKA 3H4JA 3PDTA 2OU7A 3REPA 2YWVA 4CFUA 3F5GA 3MTFA 3KB7A 5FD2A 3FPQA 3UPZA 4D58A 4APCA 5B7VA 4IFCA 4XG6A 2B54A 2YM8A 4FZAB 2OWBA 4C4EA 1JAMA 4EJ7A 2OLCA 5EFQA 5J9ZA 4ASEA 4B8LA 5JGDA 4ITHA 2OXDA 1H0WA 2WMVA 4OTGA 3L8PA 4E6QA 4M15A 4EHZA 2BZKB 4CQEA 4WKQA 2HZNA 1JKTA 4NCTC 5FM3A 4R7HA 3JVRA 2AUHA 2J4ZA 2PZRA 4K18A 1I09A 3QRUA 3O8UA 1W98A 1ZLTA 5EYDA 3FWQA 1BI7A 4FTUA 2JDOA 4LOOA 2IVTA 3T9TA 3LMHA 3M2WA 3U4WA 1LR4A 3ZO3A 3EB0A 3PE1A 4RG0A 5LVNA 2OXXA 5CS6A 1A06A 5D9HA 3WI6A 3KF7A 1QCFA 5L2SA 2OJJA 3C9WA 3B8QA 1QL6A 3VRZA 2A0CX 2R64A 3TI1A 4QPAA 4KNBA 4Y72A 4F9CA 5A3XA 4Q2AA 2B53A 5AP3A 4AGUA 2XCHA 3SW4A 5TOZA 4D0XA 1UU7A 3ZOSA 4O81A 5HVYA 2JKKA 5KMKA 3I81A 1UVRA 3A62A 5EM7A 2QHNA 3HDNA 3FSFA 4ZSEA 4J99A 4DT9A 1RJBA 3EQPA 3ORNA 4QP9A 4XG3A 3SD0A 4NM3A 5BQ0A 4AA4A 3Q4CA 2QVSE 3FYJX 5M06A 4KIQA 3DLZA 2HW6A 4I5CA 1YWRA 4IAIA 3FLYA 4L45A 4OBPA 4RRVA 5HBJA 1ZZ2A 5ANEA 5KX8A 4LMUA 4F9WA 4P90A 3JPVA 5M07A 4OTFA 1IRKA 3OC1A 2Y7JA 5M53A 3ZLYA 3V8TA 3E3BX 2OSCA 2QCSA 4CVAA 5KHWA 4I0RA 1Z5MA 4BCPA 4DITA 5BVWA 4EBVA 3SXRA 1JBPE 3U54A 4U8ZA 3R83A 4GFMA 2X7GA 3FZTA 3ULIA 4RC2A 3LJ2A 4EUTA 1BI8A 3D9VA 3NAXA 3BGZA 1XH5A 2ONLA 4IAYA 4GS6A 4JIAA 3HRFA 5E92A 2W1ZA 4EC8A 3QD3A 1WBPA 4RX5A 4LYNA 4B6LA 4BGHA 4D0WA 3R8PA 3UTOA 2HW7A 5JK3A 5E9EA 5D12A 3KC3A 3KL8A 3NVMB 2AC5A 4IIRA 3GB2A 3D5WA 3FY2A 2XA4A 4R3RA 2JD5A 5HVJA 3UG1A 3E64A 3VBYA 4FSMA 3UO4A 2VN9A 4PF4A 3FMDA 3QCYA 3QLFA 4BDJA 4L68A 2YCRA 5FBNC 4E4MA 5A4EA 3NNXA 2I0HA 3SW7A 3BV2A 5GJFA 4YZMA 4FNWA 4J95A 1MRUA 1ZY4A 2G2IA 5EKNA 3ODYX 2X2KA 4QQ5A 2CPKE 3O51A 4JQ7A 4DTKA 4LRKA 3ZLWA 2B9IA 4ENXA 4TYGA 2UVZA 4YBKA 3ZLSA 3NUUA 5E8SA 2HAKA 4QP6A 1OECA 1Q8TA 2XNBA 3NNWA 4F6WA 3EYGA 5CEMA 2Q0BA 3TN8A 3PRFA 1GJOA 2VO6A 3O50A 4FTOA 4NZWB 5EHLA 3PY3A 4FTNA 3AC5A 1DAYA 3FKNA 4X0MA 3UPXA 2FSTX 4A7CA 5AA8A 2BROA 3E8NA 1NXKA 2GCDA 3MH1A 4R3CA 4U43A 4EOSA 3LCSA 1SYKA 5LVMA 5LVOA 4BCMA 5LWNA 4C62A 3ZEPA 5A54A 4CCBA 3QXPA 4DT8A 5BMSA 2WMTA 2CGWA 3MA6A 2FB8A 4F99A 1PXNA 4UN0C 4PQNA 4H3PA 3WE8A 2PVRA 4X3FB 2GPHA 5D11A 2VTOA 2YDIA 3BE2A 2B4SB 2OFVA 4FEUA 2R4BA 4DFBA 3UJGA 5AMNA 4EORA 5IQDA 4ACGA 1UNHA 2RFNA 3MBLA 2VTJA 5IQIA 3RCDA 2X6DA 1JOWB 1R39A 4JX3A 1FOTA 1DAWA 3BPRA 3QC4A 3ZSHA 3FEGA 3ZRKA 4WUNA 3PFQA 4EUUA 4QMVA 2WQBA 2VWWA 2ZB1A 1RQQA 3R7VA 3AMBA 3C4ZA 3PXKA 5BNJA 3M11A 2XK3A 2OGVA 4C61A 4O2ZA 3G9LX 1CKPA 2JBPA 4YLKA 3O8TA 5FTGA 2GNIA 2EWAA 3QTSA 1XH9A 1YQJA 2WMAA 1MP8A 4JR3A 3TTJA 3KVXA 3TZ9A 4IZYA 4NTSA 4GL9A 4OLIA 2C4GA 2WTKB 3F3TA 2W1DA 4LI5A 4ZTRA 3BE9A 5H3QA 4EHVA 2KTYA 4XCUA 4FNZA 3LFSA 4OTDA 5AUYA 5AFVA 2QR7A 1NW1A 4NWMA 2B9JA 4I6FA 4DN5A 4NT4A 3KCFA 3IGGA 3MW1A 4NU1A 4RC4A 1BLXA 5D7AA 5KBRA 3QX4A 4F0GA 2V22A 4BCOA 2Y8OA 4RIXA 2X0GA 2YEXA 4DGNA 4EZ7A 4PDYA 3SOAA 2C5YA 3TNIA 3A2CA 1OPLA 3HAMA 3LXKA 4G16A 2JIIA 4R3PA 3ZZEA 1H1SA 1H25A 1LEZA 4ZZOA 3O7LB 3VS0A 4TWCA 4BN1A 3RPSA 2GNHA 4UY9A 3VS6A 3W16A 3FQHA 2BDJA 4P4CA 3EQRA 5AUVA 4DH1A 4KAOA 4RVTA 4TYHB 1PMNA 1AQ1A 3ACKA 2XVDA 5CTPA 4K6ZA 4LGHA 4CLIA 3FLZA 1PXMA 2YIQA 3NIZA 1MQ4A 1QPDA 2GQRA 2XBJA 4CLJA 5GHVA 3VUDA 2QOLA 4W8EA 4R5YA 4U81A 3FZ1A 3BGPA 3PIXA 2P3GX 3UIMA 2GHGA 5AV0A 4K2RA 2Z7SA 3UOKA 3MY5A 4ZLZA 2QOFA 3MIYA 4RX7A 4YUQA 5EI6A 4U80A 4EK3A 2XCKA 3V8WA 2C47A 2QLUA 5JRQA 3IW4A 4D1XA 1V0BA 4FZ6A 3HNGA 1KE6A 4FV4A 2BR1A 4IM0A 1CM8A 2YM7A 4YZNA 2BKZA 4RA4A 4RJ3A 4D4VA 3PWYA 3FSKA 4V0GA 1R0PA 2YDJA 3R22A 2NP8A 2VWZA 4I1ZA 5HHWA 5BVKA 3ALNA 1UU3A 4RQKA 4KIPA 1H27A 1KE7A 3CKWA 3UO5A 4F9AA 4FGBA 3GVUA 2A2AA 2GFCA 3HUCA 3NDMA 4RIYB 3VULA 3B2TA 1FGIA 2VTNA 1KE9A 4FKQA 4O86A 4ACDA 3MYGA 4FEWA 1P2AA 1XJDA 2VGPA 1OL2A 3ODZX 2Q83A 4OBOA 3FYKX 4TNDA 3DBDA 4KA3A 2RFDA 4FV0A 3F7ZA 1A48A 2WQOA 3OP5A 4FK6A 3NNVA 3RHXA 4BDHA 3VS3A 1JWHA 4FIJA 3DJ7A 3L8XA 4MQ2A 4RX8A 5HNIX 4XHKB 3FMHA 3NW6A 4IB3A 4JDHA 4G6OA 2A19B 2WTJA 3R8ZA 4DEEA 2PE0A 4NJ3A 4CFVA 5HVKA 2JDTA 3QQJA 1WBTA 1SVGA 3Q5IA 3KRWA 4ZTQA 3HVCA 3RAKA 2XBAA 3LM5A 3WZJA 2OO8X 3OXZA 5IQHA 5TF9A 4C4FA 4OTRA 4UWBA 4I4EA 3RJCA 1GZ8A 3ENMA 4IB1A 3UYTA 4C4JA 5IA3A 3QZGA 4AAAA 2DQ7X 1IA8A 4UB7A 2HCKA 2R3QA 3FZRA 4XP0A 2OG8A 3EFJA 3IONA 2XNNA 1HCLA 5KE0A 4Q9ZA 3VUGA 1OIRA 3PIZA 5CANA 3UNKA 3UOJA 1OKYA 4CKJA 4E20A 4Q9SA 4NFNA 1L8TA 2C0OA 2WFYA 4WNKA 1Y6AA 4N0SA 4NH1A 1R3CA 1QMZA 4F1TA 3U87A 3GFEA 4YBJA 4X6RA 4Z3VA 3WIKA 4UZHA 4Z7GA 2W06A 4F7NA 4A9RA 4JJRA 2VWBA 5FUTA 4NJDA 3NUYA 3NWWA 2VTHA 4YZDA 5CEQA 4OT5A 5FXSA 2V5QA 2C6DA 2BHEA 2BMCA 4IFGA 4LL5A 3TZ7A 2XK7A 2LGCA 3Q96A 3R02A 5BVOA 1WVYA 3RWPA 1Y6BA 3FJQE 4MAOA 5JGBA 2P4IA 2RKUA 3GUBA 4UV0A 4DG3E 4ZTNA 4BTKA 4OR5A 2WMBA 1ATPE 2W1CA 1F3MC 3FL5A 3PJ2A 2VTIA 1H8FA 4DFLA 4FV3A 5AUUA 2YZLA 5JFWA 3UODA 5J5SA 3OY3A 5IEVA 4TYHA 5HD4A 3ORLA 1FQ1B 3WBLA 5CEKA 3HDMA 1ZAOA 4JG7A 4X2GA 5CU2A 3GQIA 4PMPA 4AS0A 1O6KA 2FSMX 4YJNA 3CKXA 4A9UA 4A9YA 3IW6A 1PXPA 3KRJA 3KXMA 5ACKA 3NYVA 4EOMA 3LFQA 4PY1A 4B0GA 5GINE 2WMXA 4GV1A 4IANA 4EHGA 4EZ3A 4RZWA 3PXZA 1EH4A 2BRMA 4IE9A 3S0OA 4KD1A 4FV8A 4TY1A 4RIXB 3EL7A 3HEGA 2PWLA 3ORIA 3KY2A 2UZLA 4BBFA 3VQHA 4EWHA 1APME 4EYMA 4BTJA 4CFFA 2QG5A 3A61A 5AP2A 2VU3A 4KBAA 2QO2A 1J1CA 5E8YA 4AN9A 4DYMA 4XRJA 2FA2A 3E8DA 5FBOA 3G0EA 4E4XA 2R0UA 4AT4A 2BHHA 4BCKA 3MFSA 4TPTA 5CU6A 3LFFA 3BU5A 3FQSA 4V05A 1ZRZA 3QCQA 2HWOA 2ITWA 1LPUA 2CN8A 4FV6A 3R8UA 4ZY6A 3K5UA 4L7SA 3KXNA 3EOCA 2XM8A 2X4FA 2J0MB 2WMWA 4LRMA 3UP7A 4TWNA 3PJCA 5JZNA 4MBJA 5AEPA 3L9PA 4M67A 3KULB 3DK7A 4EONA 3G2FA 3H30A 3KVWA 4KINA 1JLUE 2J5FA 2QOCA 4RMZA 4CGAA 3RTPA 3P08A 3TIYA 2W4JA 5KBQA 4L53A 3SLSA 5HLWA 2XJ1A 3VUHA 4EOIA 5IH6A 4G34A 2HZIA 2IW6A 4QTAA 5ETCA 3W0QA 2F2CB 5K5NA 3WF8A 3QRTA 4U0IA 1P14A 5AV1A 4YJPA 4S33A 4EK5A 3DGKA 2O65A 3HA6A 3NUNA 3QKMA 2GNFA 5AWMA 2VO0A 2ZM3A 4YZCA 3LFNA 3LMGA 2OFUA 5DRDA 3VBQA 1CTPE 3RAHA 5CVHA 1YXXA 4G9RA 2QONA 4H1MA 4B99A 2XS0A 5CF8A 3WZUA 4AF3A 4AW5A 3POZA 1WBSA 5DRBA 5K3YA 2XJ0A 2OH0E 4CTBA 4L01A 4QMNA 2ITUA 3ELJA 3GT8A 4ERWA 5CSWA 1XBCA 3B8RA 2DYLA 3NUXA 3MJ1A 4L9IA 4NW5A 5I0BA 4FTLA 2WU7A 3D2IA 2J7TA 3EH9A 3I6UA 4IZ5A 3W2SA 3OBGA 4DEGA 4N70A 5IQFA 4CRSA 2XNGA 3CPBA 4TW9A 3AMAA 1UKHA 3KRRA 5EW9A 4QNYA 4BBEA 2W17A 5D7VA 1JNKA 4FG9A 4BGGA 2ITVA 3UVQA 4I5MA 2GNJA 3LCDA 4XLIA 2CGXA 2JFMA 3CY3A 2WZJA 4RJ7A 4YLLA 3G6GA 4FL1A 1YDSE 2W7XA 3FMNA 5T68A 5HE1A 2GDOA 4YHJA 4G1WA 3VBXA 1OVEA 4MQ1A 4RA5A 5C8NA 3MFRA 3FUPA 2VX1A 1FVTA 4XLVA 5F1ZA 3R9OA 3P78A 4MXXA 3W1FA 1PXIA 2PZ5A 3I4BA 5KMIA 4XJ0A 4KWPA 4PMTA 3BEGA 3ORMA 1Y8YA 2QHMA 3E8CA 2W1FA 3NLBA 4GVAA 5LJJA 3BELA 4E6CA 5DEWA 5HIEA 4YO6A 2B52A 4GFGA 3CD3A 4DCEA 4FKUA 1IA9A 1OIUA 2CN5A 3FMLA 3GU6A 3F2AA 5C01A 3I7CA 4K0YA 2OJFE 3R28A 5CEIA 3VJNA 2VRXA 3QWJA 5LXMA 3D7TA 2CKEA 4L6QA 3V5LA 3QKKA 4IX6A 1K2PA 4L67A 1GIJA 3DDPA 1W83A 4L7FA 4YTFA 4W4XA 3DXNA 3DFAA 4FEQA 4U7ZA 5DT0A 4AW0A 3NCGA 4IVAA 3NNUA 4GYIA 5C4KA 4D2SA 3OEFX 3VS5A 3Q4ZA 2JDVA 4AG8A 5CAUA 3RK7A 3QU0A 3GCQA 3QD4A 4CFMA 4JQ8A 1IG1A 4LUEA 1KE8A 4WIHA 5IEYA 4RSSA 4OW8A 2AYPA 2UVXA 3KN6A 4O38A 3FAAA 4HPUE 2HXLA 3EN5A 3V5QA 4BCJA 4MWIA 4JQEA 2VTQA 2BZHB 3KU2A 3QGYA 4QTBA 3RMFA 4DA5A 4EHEA 5C8KA 5AUWA 3GCUA 1DI8A 3QA0A 2J0JA 3OFMA 2VUWA 5HO7A 3GU4A 1UV5A 2GQSA 3DB8A 4XMOA 2W5HA 2BRBA 5IUIA 4ZJJA 5DT4A 3U8WA 4CFXA 3HMIA 4FNYA 4JIKA 4A9TA 4BDEA 4ZS4A 5EI8A 5EQPA 4CKRA 1TQIA 5CYIA 3OY1A 4MXYA 4O7RA 3OW3A 1GNGA 5DA3A 1RDQE 4NL0A 3BCEA 1XKKA 2C6KA 1YKRA 2YA9A 3EWHA 1OL1A 4XOYA 2HELA 4XS2A 5HICA 4G2FA 5KZ0A 2XJ2A 2J90A 5E90A 4BR3A 2JKQA 4C38A 2JIVA 4FZ7A 4JVGA 4YNOA 3BKBA 4GUBA 4GU9A 4FIEA 4IVBA 5BUJA 2IZRA 3KRLA 3LCKA 4AQCA 2UZDA 4O7SA 4S2ZA 4WD5A 2BTRA 3IOPA 4PL4A 5EHOA 2F9GA 4R7BA 5HTCA 3ZDIA 4YJUA 3VQUA 5E8UA 4J52A 2FVDA 4AE6A 3A7GA 5KZIA 2QOIA 3F5PA 3ZO2A 5CSPA 1NT2A 4BHZA 1TKIA 3C0GA 4KKGA 5HE0A 4DEIA 4EL9A 2H34A 3AT2A 2HZ4A 5IPJA 2JDSA 3EYHA 4MX9A 3ZU7A 4AWIA 5IISA 3BYUA 3R9HA 1WVWA 1MRVA 4O7WA 2FGIA 2YHVA 3G33A 4EH9A 4ZJIA 1NVSA 4FX3A 3FZSA 5JT2A 5DR6A 4YC6A 2O3PA 5A6OA 1U5QA 3W0NA 4IW0A 4F7SA 3IECA 4C3FA 2XYUA 3S1HA 4AOJA 3W8QA 5KMNA 4GEOA 4R78A 4RFMA 5CZHA 4ALWA 2NPQA 2UW8A 3BI6A 4EK6A 3GCSA 4XBUA 1VJYA 1R1WA 4HGTA 3GXLA 1RW8A 4C37A 2BKKA 3ORXA 1J7IA 4EBWA 2QOQA 4C34A 2VO3A 3VUIA 3WYYA 1ZYSA 4YTHA 3TTIA 4D9UA 5AV2A 2SRCA 3Q9YA 4J71A 4X6QC 3TJCA 3PZEA 3FDNA 4IJ9A 2OIBA 4JXFA 2CDZA 4I3ZA 4O0VA 4YZ9A 2WD1A 3P7AA 3LZBA 3W2RA 3EN9A 1VEBA 2OK1A 5L8JA 4DG2E 5M51A 4FTMA 2QR8A 2OH4A 3Q6WA 4YC3A 3DA6A 4PNKA 2OJGA 2Y0AA 4NUSA 4FV9A 3TCPA 4DGMA 3MVJA 4O7TA 3ZH8A 2R3HA 5DT3A 4UYAA 4AA0A 3ZZWA 3CGOA 4AU8A 1MRYA 1F5QA 2OJIA 3AD6A 4JBVA 5CQUA 3QUPA 4JL9A 3S95A 4EYJA 4YTCA 1H1WA 5A4CA 4RJ5A 4FTJA 4BDGA 2IG7A 3QF9A 4O0TA 3DDQA 3Q52A 4FSTA 5IQEA 4R77A 3N51A 4EK8A 4BF2A 5A4TA 5M08A 2XNPA 3RAIA 3F6XA 4A4OA 4IQ6A 5IQCA 1PXLA 4Y5QA 2A4LA 2RG5A 3VS4A 3GFWA 5KMMA 4M7IA 1PF8A 4DGGA 3QWKA 4YJVA 4AZWA 3NUSA 3UQFA 4UX9A 4BKJA 2ETMA 1W0XC 3F69A 3FBVA 3IKAA 3QTRA 4N4SA 4GH2A 4GT5A 3RPYA 1AGWA 2VWVA 3RALA 3BYVA 4ANLA 4YO4A 3SG9A 3QUEA 3UIBA 2ZAZA 5EW8A 4Z7HA 5HG7A 3D7ZA 5HQ0A 4FTTA 3C4XA 4XEYA 2ETKA 2B7AA 3QUDA 1TQPA 1Q8UA 5E8WA 5BPYA 2WKMA 3M42A 4FZDB 4AXAA 1KWPA 4DTAA 2Y6MA 3HP2A 5IDNA 2J0KA 4O6LA 1XH8A 4JG6A 2VTPA 3CXWA 3LE6A 4L00A 4MH7A 3R7UA 3ZM9A 3C50A 4DFXE 3OXIA 3QZFA 5LCJA 2XIXA 3KQ7A 3WF7A 3ZLXA 4FA2A 2W5AA 3T3VA 2ERZE 3V5TA 3QTIA 1U46A 2YDKA 3VHKA 2CMWA 5CU4A 3O2MA 4IAFA 3MFTA 3FHRA 3L9NA 3VRYA 5IA4A 5CQWA 2E2BA 3FL4A 3LIJA 2JKMA 3ZBFA 4F09A 5AP6A 4IWDA 1K3AA 2P55A 3ZDUA 2O8YA 5J9YA 2XK4A 4BCGA 4PMMA 4F0IA 3NX8A 5AADA 3LKMA 5A4QA 2W4KA 3ALOA 3BU6A 5G1XA 1Q62A 2WOTA 5F94A 3QQKA 2BFXA 2BAKA 4YSMA 2O64A 3DBCA 3U51A 5B0XA 4L44A 3LJ0A 4D2RA 2YIYA 2GU8A 2B1PA 2JKOA 1WZYA 4CT2A 3KXHA 3WZKA 4DEDA 2X39A 3WOWA 3HUBA 4IM2A 3UVPA 3ZFXA 4MXOA 5E91A 4CT1A 2G9XA 3AT4A 4I20A 4IH8A 2A1AB 4FGRA 2BRGA 3RP9A 4ACMA 3V8SA 3DCVA 2R3JA 3LJ1A 4FC0A 5C26A 3IS5A 2WEVA 2CCHA 3L1SA 4EH2A 3QAME 1YI6A 5ANJA 1BL7A 2ONLC 3V6RA 4AFJA 4G3DA 3E63A 3DB6A 4M12A 3PA4A 1ZMVA 4XV2A 5IA2A 5I9ZA 5EW3A 5L2WA 2E9VA 4ZTMA 5DFPA 4GG5A 4ID7A 3Q9XA 4WRSA 3FMEA 3B2WA 3AOXA 2C0TA 3RPOA 2Y9QA 3SRVA 3HGKA 4RLLA 2CGVA 3FI8A 3FLQA 2J51A 3PY1A 5E8TA 3ID6C 3G9NA 5BVNA 4YHTA 1Q8YA 2RFSA 5DGZA 3W0PA 2QI8A 2ZYBA 2I7QA 3R7YA 4F1MA 4WG3A 3COKA 3EJ1A 1BUHA 2PE2A 3DKOA 5DEYA 1FMKA 4LUDA 3C13A 4MEDA 4M97A 4DH7A 2C6OA 4P5QA 3MPTA 1XH4A 4ZMFA 1SMHA 4ACHA 4Z16A 4ZJVA 2I0YA 3MDYA 4FVQA 4FKTA 3VS7A 3W33A 3GGFA 2JEDA 4ZIMA 4NM0A 5HCXA 3E7OA 4G3CA 2O0UA 2JLDA 4FKIA 2YAKA 2CKPA 3FPMA 1W7HA 3PSBA 3ANQA 3KXGA 5KHXA 3OTVA 4I5PA 4ONAA 3JYAA 3I1AA 1KV1A 3DQXA 5DNRA 4HPTE 4E4LA 3GQLA 4F65A 3HV6A 3NRMA 2R0IA 3AMYA 5AM7A 5JRSA 5FP5A 4UEUA 3QD0A 5JKGA 1UU8A 3K3JA 4RFYA 5H2UA 1U59A 4Z55A 5L6PA 4XYFA 4HOKA 4FL3A 4C3RA 2YISA 5M4FA 2HY0A 4AT3A 3IDCA 2YAAA 1H00A 3R2BA 2WIHA 3QQFA 3R8VA 5E4HA 1CSNA 2BAQA 1J7UA 5BVFA 1YXUA 4TNBA 3VBWA 1VZOA 4QMOA 4EWQA 1Y8GA 2BUJA 1V1KA 2W9FB 5EHYA 1E9HA 4HCVA 5CF4A 2FSOX 2IZUA 2DS1A 3IW7A 1L3RE 4FVPA 4BDFA 2PVYA 3U6IA 3U55A 4HJOA 5M4UA 3OMVA 2IW8A 2Q0NA 3QQHA 3Q9WA 5HE2A 2OW3A 4ERKA 1HOWA 4J97A 5LARA 4QQCA 4QMPA 5H8EA 2OF2A 4GKHA 1JSVA 4XX9A 4BI1A 2GS6A 4C4GA 5J9LA 4D1ZA 4W8DA 3OWKA 3W2QA 4WG4A 3CR0A 2CHLA 2WIPA 4RFZA 4E5BA 1Q4LA 3RHKA 2VNWA 5LMBA 2JGZA 5HO8A 5A4LA 2PVKA 3TM0A 4QYGA 5LVPA 1LEWA 3BZ3A 4QQJA 4J98A 4S34A 2PVLA 4U45A 5ANGA 4ARKA 4DH8A 2I0VA 4FKJA 4EH4A 3P23A 3V5JA 4EC9A 3MV5A 3P5KA 4FTQA 4IJPA 5FGKA 5JGAA 4ZZNA 4QNAA 3OCGA 5K9IA 1OBDA 3KGAA 4I22A 2X2LA 4IMYA 3CPCA 3K2LA 3RGFA 3TT0A 2IZSA 3FC1X 2Z2WA 2OKRA 5C4LA 1H28A 5DYJA 1AD5A 2P2HA 3LCOA 5EM5A 2R3IA 4YMJA 4D55A 4DHFA 3CIKA 3KCKA 5DI1A 3RPRA 3ZO1A 1OKZA 1UWJA 3GU5A 4FMQA 4MHAA 4RZVA 4O84A 5HI2A 3VJOA 4DAWA 4S32A 3TKHA 4FKVA 3BX5A 4D5KA 3KA0A 3MTLA 4HVHA 4DINA 2RF9A 5IA5A 4QO9A 5DN3A 3EFLA 4HNIA 3TWJA 2XH5A 4FOBA 4USDA 4AT5A 3SDJA 2X8IA 2DUVA 2UZNA 3BHVA 2PVJA 3ET7A 3ZSIA 4CG8A 2YWPA 4MBLA 4WT6A 3I7BA 5FM2A 4W4WA 3R1SA 2ERKA 3TL8A 4WNOA 2BALA 2PZYA 3IDPA 2XIYA 3UZPA 3BLQA 3W32A 4X3JA 3D5XA 3FMKA 3KXZA 3LFAA 4E6DA 2OBJA 3QTXA 5AIKA 3U9CA 4L46A 2V0DA 4C3PA 2GHLA 4PWNA 2W1EA 3GP0A 1PMEA 3FMMA 4LMNA 4ACCA 5IA1A 4MXAA 4HZRA 3QKLA 1P5EA 5CEPA 3W0OA 4X3FA 3MB6A 3R71A 2PMOX 5GNKA 2P0CA 3H9FA 3TUCA 5AAGA 1G8AA 3BQCA 4FSZA 3IDBA 2I40A 1H4LA 2WQNA 3UOLA 3O7LD 4ZK5A 4EH6A 1M17A 4ZOGA 5DG5A 4OTHA 4F1OA 2VTLA 3E3PA 4KRDA 2IWIA 4WOVA 2CKQA 4O7NA 4FKOA 2C5OA 2IJMA 3UBDA 4TYEA 4FTCA 1PRYA 3F2NA 2NO3A 3GEQA 3T8OA 1BYGA 2BILB 4O6EA 3TV6A 4NTTA 1SVHA 4E5WA 4BB4A 2OIDA 4IAAA 4BIDA 4JBQA 3W2PA 2IN6A 3OTUA 2Y4IC 4FUYA 2WMUA 3LM0A 3MB7A 2B9FA 2ITYA 2W5BA 3N4TA 4ZTLA 3HX4A 4EKKA 2HOGA 3F3VA 3PG1A 4EQCA 3QQUA 5M55A 3KMMA 3SRVB 3SA0A 3FC2A 5C27A 4MCVA 4WG5A 1LUFA 4J7BA 2WTWA 2UW9A 2UZOA 3H9RA 4JAJA 4RJ6A 3R01A 4H05A 3U6HA 3SX9A 3LAUA 1RE8A 1WVXA 2X4ZA 3LPBA 5GJDA 3TG1A 3DY7A 3ORKA 3OWJA 2J50A 3VS2A 3GENA 4MVFA 3AD4A 3LXNA 3OBJA 4FICA 1IR3A 4ZP5A 3FXWA 3G51A 1OZ1A 1GZNA 3F66A 4QRCA 1E1XA 4GKIA 4D28A 1A9UA 1WBWA 4FG8A 4U9AA 4C35A 2X8DA 4CMTA 2E9OA 2IO6A 3CEKA 4AZVA 3BWFA 2BTSA 2YCQA 1S9IA 4EOOA 5JQ5A 3M1SA 4X3FC 5AX9A 5JSMA 4GCJA 3EFWA 5K5XA 3S00A 3MVHA 1Q3DA 3UG2A 4O7PA 3QQLA 1YHSA 2REIA 5AV3A 3BYMA 3OG7A 3AC8A 4DTBA 2X1NA 2UUEA 4BDBA 5HG9A 5L2TA 4PDSA 3WE4A 4IWOA 3COHA 2JAVA 3CJGA 4PV0A 4QMTA 5FEEA 3LCTA 1KSWA 4HYUA 4NFMA 3KFAA 4RJ8A 3UDBA 2OXYA 4M68A 3GC9A 1WFCA 2ETRA 2W4OA 3D94A 5K4JA 4IAZA 4AOTA 4XG4A 4I4FA 1QPCA 3I79A 3BIZA 2I0EA 4FI1A 4KABA 5EOLA 3R73A 3DNDA 5HBEA 4HCTA 3OEZA 2YIXA 4I24A 3FXZA 3K3IA 4AZEA 4Y8DA 1BKXA 3TNWA 4FIGA 5CI6A 4DH5A 4F9BA 2R7IA 2BRHA 3FI3A 1YVJA 4Q5HA 4I0TA 3A7IA 1PMVA 4RWJA 2BAJA 2UZBA 3HV3A 5IH5A 2QC6A 3JVSA 4ASDA 1KOAA 3Q4UA 2HENA 3HRBA 3PZHA 4QMSA 3FZOA 3JUHA 3MVLA 4MNEA 5KO1A 4I6HA 3R2YA 1R0EA 5KKRC 4KIOA 2EUFB 2F49A 3KREA 1NY3A 5CT0A 3NYXA 4WRGA 4GJ2A 3LFEA 5JEBA 3F82A 3ANRA 4TYJA 3FZPA 3E7VA 3KN5A 3BV3A 3DFCB 3QRKA 4K1BA 4O0UA 5EK7A 3U9NA 2R3LA 4QTDA 3HZTA 2PPQA 4E4NA 2YCSA 3R30A 5CSHA 4BBMA 3ORZA
chains in the Genus database with same CATH superfamily
3LFDA 4PX6A 3GU7A 4PL5A 1M2RA 2ZDUA 5BX0A 5L3AA 2G1TA 3LLTA 3KK9A 4TXCA 5ETAA 1ZY5A 3P9JA 2XNEA 2WAJA 1P4OA 3KMWA 5CY3A 4Y5HA 3HV7A 3I0QA 4IADA 1OMWA 3DLSA 5ACBC 4BTMA 2F7EE 3OWLA 3EQIA 4UYNA 3IPHA 4A06A 4F64A 4YPSA 5IG1A 3JXWA 3E92A 4JDIA 4EH3A 4AN3A 3HRCA 3UNJA 4BCQA 1IASA 2QOKA 4O0YA 5CAQA 1M7QA 4JT3A 4H3BA 3VUMA 2WTIA 1M2QA 3P4KA 4BTFA 4HVDA 4HVSA 1WCCA 1CKIA 2XALA 3LXLA 4HGLA 4ANSA 4DFZE 3DV3A 2PMNX 4G3EA 4K11A 5EDPA 4CFWA 2VWXA 3ZFMA 1XBBA 3CTQA 4FV1A 3UOHA 4FYNA 4FKWA 4RWKA 2VV9A 3MY1A 3TV7A 4QQTA 3BQRA 3R63A 4DLIA 4QMQA 3CTJA 4C02A 4ZTSA 2R3RA 3Q04A 1Q99A 2XYNA 4YC8A 4E93A 4F7LA 5B2LA 4BCFA 3FHIA 4NW6A 3ZHPC 4GW8A 3DBEA 1TVOA 1Y91A 4E5AX 5IQGA 4ZSLA 2J9MA 3CCNA 1OPKA 1YXTA 3ROYA 3L8SA 2GTMA 5FRIA 3DZOA 2JITA 3QZHA 5HNGA 4BDIA 4IVDA 4ZSJA 4QYHA 4L3LA 4V04A 2ITNA 3DNEA 3IW5A 4DH3A 2V62A 3Q53A 2ZB0A 4DCAA 1YI4A 3LLAA 3D83A 4DFNA 4DGOA 3GOKA 3OT3A 3HECA 5ANIA 2IZTA 1U4DA 4JLCA 4JAIA 2ZV8A 1H0VA 3IG7A 1SZMA 4PDOA 4ZZMA 3SQQA 3I5NA 3CJFA 3QTWA 3UQGA 4I21A 1REKA 2R7BA 4O7LA 5CAPA 2XK8A 2Z7RA 1P4FA 1Q24A 2Z8CA 4WSYA 3W2CA 4TT7A 4I6QA 5JH6A 3BLHA 2FO0A 1JSTA 3MGYA 4EK4A 2W9ZB 4MNEB 1ZYCA 3D14A 4NM7A 4I0SA 3C5IA 4CMOA 3OF0A 3G6HA 2R3GA 5HEZA 4J8MA 3OOMA 4U40A 3V04A 1OUKA 4UALA 3DXPA 4DGLC 3G90X 2BPMA 2W99B 4KUJA 2ESMA 4X2NA 5HLPA 4N6ZA 4A4XA 2QOBA 2WU6A 4IC7A 4MYGA 4BIEA 3ATSA 4RWIA 4EZ5A 2HWPA 4OGRA 1NVQA 2E9NA 2VWUA 3FLNC 4XG7A 1VLRA 4X2JA 4RBLA 1JVPP 4BDCA 2X7FA 4JR7A 4AP7A 5C1QB 3LQ3A 2UW7A 3VHEA 3A8XA 3GU8A 3P86A 3R21A 4BYIA 4ITJA 3BEAA 1E1VA 3BRBA 5CU0A 2ITXA 2IW9A 1I44A 3NFGB 4O7YA 3TNHA 4D9TA 5T6KA 3HA8A 4KBKA 2O63A 2UW6A 3RM6A 4A4LA 3UIUA 1GIIA 2QOHA 1XR1A 3DQWA 5CVGA 5B2MA 3W18A 3L8VA 2CLXA 4NKSA 4F70A 3RAWA 3PXYA 3R7OA 4YJTA 3C1XA 3E5AA 5F20A 2H9VA 3BHYA 3CTHA 4ORKA 5DLSA 4ZY5A 3PG3A 5J1WA 5A46A 4WUAA 5E1SA 3VUKA 4GG7A 1J7LA 2R3MA 1M2PA 3BHTA 5HLNA 5J87A 3VVHA 3DXQA 4FT9A 4I94A 4QT1A 4KS7A 4ZXTA 2UW5A 5HGIA 5TT7A 4ASXA 3VO3A 4XV3A 4C2WA 4EEVA 5CALA 3UMWA 5C9CA 1GZOA 3W0SA 5HCZA 3PTGA 3NPCA 3D15A 4AN2A 4G3FA 3AGMA 4B7TA 3G15A 3HMNA 4XV9A 1GOLA 3EQBA 3ORPA 4FSNA 2BIKB 2G2HA 4BIBA 5JQ8A 2R5TA 3DTWA 3KK8A 4YSJA 5AUXA 3QGWA 3TUDA 1KUTA 3DJ5A 3RPVA 3EZVA 3PVWA 4E1ZA 5LMAA 2J0IA 2WTDA 4EH8A 4B4LA 2C68A 4UXLA 3VF8A 1FVRA 2ZJWA 2WHBA 3TKIA 3W8LA 4PUZA 5B2KA 3ATTA 4DHZA 3SG8A 3R00A 4FTIA 4AW2A 3VC4A 2WO6A 1G8SA 3SKCA 4AA5A 1YDRE 1FBNA 3BGQA 4TWPA 2ZV7A 4NCTA 4D4RA 2VWIA 2FSLX 4HVIA 5E8ZA 4C58A 3NW7A 4HW7A 3OCBA 2XB7A 2OIQA 4BC6A 2WQEA 4QMWA 3ZRMA 2PHKA 4IZ7A 4P5ZA 1BMKA 3DPKA 4FKPA 1PMUA 2H6DA 2GHMA 2JAMA 4AW1A 4D4SA 1YW2A 3EKKA 3KRXA 2OICA 3C0IA 1O6LA 3DBFA 5EYCA 4BGQA 4GVJA 1GY3A 4ZEGA 3TYKA 4S30A 5CF5A 4R5SA 3FY0A 4RVMA 4WNMA 1G5SA 2GNGA 4GIHA 2WXVA 3ZC6A 3JY9A 2P2IA 5J7HA 4RWLA 4R7IA 3ZUVA 5EDRA 2YZAA 4C4IA 5HU3A 3FXXA 2WGJA 4G6LA 5ANDA 4MKCA 2QG7A 3NGAA 5AA9A 2PUNA 1T45A 2E9UA 4UWYA 5D41A 5HBHA 5L8LA 3EIDA 3KULA 5CNNA 4GT3A 5CLPA 4PTEA 4H58A 2XMYA 4PTCA 3VW8A 4PDPA 4P7EA 1ZOEA 3LHJA 2YJSA 2XEYA 5IMEA 5EKOA 3E88A 2PUPA 3QCSA 4QP3A 2GFSA 4FODA 3QCXA 4E26A 1S9JA 2XKEA 4FT3A 3DK6A 5LVLA 4EH5A 4L42A 3H3CA 4GK4A 3Q6UA 4F6SA 4O96A 3LOKA 4FV7A 4V0GB 5M57A 3PWDA 1R78A 5H8BA 1OM1A 3ITZA 4ZLOA 4RJ4A 3P0MA 4MD9E 2C6TA 3BHUA 4FBXA 4WHZA 4F7JA 1JSUA 4I5HA 2H96A 3U4UA 3V5PA 3IO7A 4JRVA 4O22A 4LQMA 3LQ8A 3ULZA 3F2RA 3WF9A 4KSQA 5HKMA 2BDFA 4D5HA 3EQHA 4EOJA 3QD2B 3GCVA 3DKFA 4TRLA 2PYWA 1WBNA 1ZOGA 4LV7A 5I9WA 1QPEA 5HTBA 4U44A 2YN8A 3ENHA 2J5EA 3GNIB 3V3VA 2VAGA 2BIYA 3AQVA 3OT8A 3OW4A 3VN9A 3PSDA 2BDWA 2XK6A 3DBQA 2Z02A 3EZRA 5LMKA 4ANQA 2PTKA 4FEVA 4BCIA 4XP3A 5EQEA 3C4FA 4GK2A 5LCKA 2XM9A 2C6IA 2R3NA 4U41A 4DBNA 4QP7A 4FUXA 5M09A 4U3ZA 2H8HA 4X21A 1V0PA 1YOJA 4O0WA 4CKIA 3DT1A 4FKGA 4RLKA 5KMJA 1HCKA 4BZNA 2PZIA 3EQCA 2EXCX 2C1BA 5F95A 2PVHA 4WBBB 3QHRA 4F9YA 4KKHA 3KIOC 3ZSGA 3OXTA 4EQUA 4PMSA 4AE9A 5ETIA 4HYIA 5E1EA 4BZOA 4EKLA 2V55A 2WMRA 2ZVAA 4G3GA 2PSQA 4M0ZA 4DFYA 2GNLA 3MPAA 5HNBA 3OZ6A 3R9RA 2EB2A 1FVVA 3R6XA 1YI3A 1KV2A 1YOLA 2ACXA 1PXKA 1YXVA 3JY0A 3KF4A 4LRJA 3K54A 4HGEA 4MNFA 2X9FA 3UC4A 4E7WA 2BCJA 3QTQA 4FT7A 2EXMA 4GFOA 5L6WL 3BYOA 3THBA 2CNUA 3UNZA 3H0YA 2UZVA 3HYHA 5D10A 5IUHA 3CBLA 4JBPA 4LOPA 4WO5A 5IF1A 2BFYA 3N4UA 4IDTA 4FYOA 3RZBA 3SHEA 2J6MA 4U3YA 1REJA 3IK3A 2XKFA 3C4EA 4MD7E 3COMA 4HCUA 3IOKA 4TYIA 2F57A 4W4YA 4YR8A 3NVKI 3O0GA 5KMLA 2O5KA 2EVAA 2X9EA 3I0OA 3OWPA 4R6VA 4OT6A 5DOSA 3A8WA 5KNJA 3T9IA 1VYZA 3IGOA 3O5AA 5GIOE 2VTMA 4AZSA 4KBCA 1NA7A 2F7ZE 3SC1A 4USFA 1YWVA 1YHVA 4K33A 3L9LA 3UE4A 3DKCA 3NR9A 2PK9A 3OCSA 5AJQA 5CF6A 3PRIA 1Q5KA 4I92A 4GK3A 3ZM4A 1WAKA 5HD7A 2YM5A 4FIFA 4BY9E 3R1QA 2QLQA 3LXPA 3DTCA 4GRBA 1URWA 1Q8WA 4KRCA 1GIHA 1OKVA 2XUUA 4L8MA 2BVAA 4H36A 3MY0A 5A14A 4YLJA 1XWSA 4D4YA 5E8VA 4PP9A 3EFKA 5JFSA 1VR2A 4JBOA 3E93A 3CSVA 3MH2A 4QPSA 4DE4A 2PULA 4QMUA 5AP1A 3WZEA 1SNXA 4FSUA 2C69A 4IZAA 4Y95A 4E73A 2C3LA 2YITA 4G6NA 4FIIA 4TTHB 3VS1A 4IEBA 5H8GA 3F88A 3ZCLA 4II5A 2VGOA 1BX6A 4ZTHA 4LDTA 2W1HA 5FG8A 4CXAA 2AC3A 3D5VA 5AV4A 3NW5A 3P79A 2NNWB 5FTQA 3UVRA 3PLAE 5EI2A 4YU2A 2GMXA 5EYMA 4JOAA 4YZBA 1KOBA 1GAGA 3E8EA 4GUEA 1OL6A 4K8AA 1OB3A 3LVPA 4DG0E 3QALE 1DI9A 4QOXA 4O21A 4BZDA 2FH9A 4IX4A 4LV8A 4M13A 5CSVA 5IDPA 2PVMA 4FT0A 2QOOA 1H08A 4JRNA 3R9DA 5JN2A 3RWQA 3EN4A 2RIOA 3V01A 3TUBA 5EYKA 2RG6A 2J2IB 5HIBA 2PU8A 1NVRA 4O0SA 2R2PA 4AGDA 3R8MA 4LG4A 2R9SA 3COIA 4FIHA 4XG9A 4FV2A 2QU6A 4W4VA 5M4IA 3PVGA 4F4PA 4G5JA 3OS3A 3NCZA 4J96A 5ITAA 3C4WA 4QP2A 5CXZA 2OZOA 3CS9A 1YOMA 4FKLA 4WBOA 5DWRA 5CENA 5EM8A 3ZUTA 2YCFA 1T46A 2VTTA 3POOA 4IWPA 4FK3A 3CP9A 3MS9A 4OUCA 1K9AA 4IAKA 5CXHA 4EQMA 2FYSA 3QBNA 4NIFB 5A6NA 3AG9A 4R1VA 2C0IA 4DC2A 2F4JA 4IACA 3O8PA 3FI4A 4O83A 2WEIA 3ZXZA 4Y46A 3SV0A 2WELA 5EDQA 1JKSA 5I4NA 3BLAA 5IMXA 3BBTB 4I93A 2VTRA 2QU5A 3A4PA 2OJ9A 1WBVA 3Q60A 3QLGA 4ZLYA 4O27B 2WQMA 1PYEA 4H1JA 2UW3A 4QP8A 2C1AA 3QYWA 3VW6A 4DEBA 3WF6A 5IUGA 5BYLA 4FE2A 5BUIA 3QZIA 3H10A 2V7OA 4S31A 3IW8A 4HNFA 5J95A 4ENYA 4WA9A 1WBOA 4CZUA 3U6JA 3GC7A 3N9XA 4CZTA 2PMIA 3ZC5A 2ITPA 3EN6A 3H9OA 1J3HA 2RL5A 3PPJA 3VBVA 2W1GA 3D2KA 3FI2A 1UA2A 2PMLX 3F5UA 3RM7A 3P5JC 5IU2A 3LFCA 3L9MA 3TJDA 4YJOA 1Q41A 2HY81 2YM6A 4H39A 2YABA 3JR1A 4O91A 3UYSA 4JDJA 3RCJA 5AAEA 4O7VA 4AGWA 3R8LA 3Q2JA 2UZEA 2I1MA 3PPZA 4TKSA 4YJQA 4TZRA 1H24A 4AZFA 5HX8A 3PVBA 4LOQA 4FTAA 3AKKA 5HU9A 1XQZA 3KXXA 4XV1A 1WMKA 3HAVA 4QMLA 2E9PA 2VTSA 3VIDA 2UVYA 4TN6A 2WNTA 4RIYA 1U54A 3NYNA 4GU6A 4YJRA 2YM3A 2UW0A 2PZPA 4DEAA 4C36A 5JMSA 3R04A 4G17A 2PE1A 3FKLA 2JC6A 3I60A 1JPAA 4ANMA 5FTOA 3ACJA 2GSFA 3ZRLA 5BYYA 4XH6A 3UC3A 4PRJA 3W0MA 4U97A 4M14A 3UMXA 5AM6A 2YIRA 5IA0A 3SAYA 4FZFB 5M44A 2B9HA 1H01A 2PUUA 5BV3A 5FQDC 4C7TA 3W55A 2GQGA 2XRUA 3UP2A 1J1BA 5HX6A 4IDVA 5DR2A 4M8TA 3TDWA 2XIZA 1OKWA 2W96B 3PXRA 4RPVA 1FMOE 3EKNA 4IWQA 4FKSA 4BVUA 2A27A 4HVGA 3CLYA 4JDKA 2PVNA 4D1SA 2HIWA 4Q5EA 5ETFA 5BMMA 5A9UA 2IPXA 3ZYAA 2UZWE 3CQUA 3AD5A 3A7FA 3O23A 2JDRA 3PXQA 4Y83A 4EOKA 3HMOA 3QC9A 2XNMA 3MA3A 4NM5A 3R7IA 4DBXA 4F08A 3ZONA 5AAFA 4MWHA 2X81A 5I9YA 3WF5A 3R0TA 4LM5A 2WB8A 5DVRA 3OVVA 2NRUA 4FNXA 2W05A 5L6OA 3PP1A 4PNIA 5CAOA 4DF3A 3Q2MA 5J8IA 2C30A 3WARA 2VO7A 5KCVA 3GC8A 2G2FA 3TDVA 2ZDTA 4M84A 2ZOQA 3F3UA 2CKOA 5I5ZA 4CEGA 3R1NA 5FP6A 4O7OA 4BDDA 4FR4A 1Y57A 3HLLA 3PIYA 4QP1A 3RNIA 2EB3A 4ZY4A 2J0LA 4AZTA 4L43A 2BRNA 1OITA 2GS7A 2XKCA 3NYOA 4IBMA 3OUNB 4IM3A 3SVVA 3EMGA 5KKRB 2Z7LA 3RK9A 1ZARA 4C2VA 4AAYA 5FLFA 3SXFA 1CDKA 3LMIA 2R3KA 3PSCA 4JX7A 4DFUA 4FSYA 3O17A 5M4CA 4FTKA 3Q3BA 2VZ6A 2BZIB 3NEWA 2X6EA 1UU9A 4MD8E 5TR6A 2YACA 1M7NA 4FJVA 4BI0A 4FTRA 2ITZA 2FUMA 2O2UA 2IVVA 3KMUA 4L52A 4E8AA 5IH4A 3VF9A 2HYYA 4CD0A 4UXQA 2C6LA 2G15A 3F9NA 1PJKA 1DS5A 2ZM1A 3KKVA 1Z9XA 2XNOA 4I41A 3AC1A 3AXWA 4AACA 3WYXA 4C33A 5DE2A 3MSSA 4APPA 4EJNA 1OL5A 4QYEA 3R9NA 4C0TA 2RGPA 4R1YA 1UKIA 1DM2A 3CGFA 3I5ZA 4F0FA 4ZAUA 4AFEA 2C6EA 1SVEA 4QMXA 3EQGA 3A4OX 1OI9A 3EQFA 3QRIA 3PUPA 5HIDA 3TACA 3DK3A 2CJMA 1OGUA 4EH7A 3ERKA 3MESA 3NS9A 3QQGA 4YNEA 5CSXA 2VWYA 3C4CA 4FVRA 4U6RA 4CMUA 1TQMA 1U5RA 2GTNA 2ZMDA 4USEA 4IX3A 2UW4A 2YJRA 3CQEA 3GI3A 4NSTA 3AC2A 5FEQA 1ZXEA 2CNQA 3TNPC 3JS2A 5I9VA 5EH0A 3PXFA 3A7HA 4CV8A 3ZTXA 3DOGA 5CASA 3HKOA 5AUTA 1SNUA 1Q61A 3TKUA 2C6MA 4BDAA 2UZUE 2YERA 2ITTA 4KB8A 3Q4TA 1B6CB 4AX8A 5DPVA 2Z7QA 4O7ZA 3S3IA 2WOUA 2C3IB 2BZJA 2YFXA 3EL8A 3OOGA 4OTIA 4HGSA 4U94A 3DKGA 1YXSA 2WTVA 5LOHA 2QODA 2B55A 1JKKA 4RC3A 4N57A 5K4IA 3TZ8A 4E6AA 2C3KA 2JFLA 4ZS0A 2ZM4A 1ZMWA 2R3PA 4V01A 4F63A 4QMZA 1YWNA 3ORTA 1SM2A 3AC3A 1CMKE 3DAKA 3BHHA 3BYSA 1M52A 1LP4A 1M14A 1MQBA 3C5UA 3PA5A 4FOCA 1ZOHA 3QTZA 5F4NA 1H07A 2F2UA 1XO2B 5FXQA 2PUIA 2PVFA 2XEZA 1VYWA 4G9CA 1H1RA 2HK5A 1W82A 1XH7A 4WNPA 5AP5A 1PXOA 4FSQA 2QO7A 1PXJA 2PY3A 4X2KA 4GYGA 4X2FA 4K77A 2C3JA 5T3QA 5CEOA 5AP0A 3F61A 2GS2A 3NIEA 5AX3A 2XIRA 3HMPA 4YPDA 1F0QA 3PLSA 3PJ8A 3C7QA 4L3JA 4ALUA 5AP4A 4BRXA 4DDIA 3LQ5A 4G5PA 5I9UA 3G5DA 5FEDA 4QMMA 3ETAA 4Y73A 1O9UA 3AC4A 3PP0A 4RGJA 3DAJA 3HV5A 4BI2A 4GSBA 4XOZA 4J1RA 4P2KA 3MI9A 2HXQA 4B8MA 2I6LA 2HZ0A 3W10A 5L2IA 3SXSA 3C51A 2ZMCA 5LQFA 1OPJA 3S2PA 5IQAA 1B38A 5BVDA 4L3PA 2XKDA 2OF4A 3MH3A 2XK9A 4HYSA 5TO8A 4CRLA 2UZTA 4J53A 2OI4X 3EHAA 3FLWA 5HORA 5ANOA 2IVUA 1PKGA 4H3QA 3VAPA 5BUEA 3ZFYA 3QTUA 4FG7A 3FE3A 4ANBA 2B0QA 2WMSA 3G0FA 2UV2A 4QTEA 3D4QA 2QURA 3P1AA 1JKLA 3PYYA 4PTGA 4ZSAA 3PA3A 4XRLA 2VX3A 2Y4PA 5F9EA 4YTIA 4RIWA 4CFNA 3UQCA 5IEXA 3QX2A 4O2PA 4AGCA 5CU3A 2KULA 2YM4A 2WTKC 3OHTA 5IQBA 3S4QA 4JG8A 3KEXA 4M3QA 4EOLA 5JFXA 1Q8ZA 3WIGA 4UWCA 2DWBA 4U79A 1PYXA 2IVSA 4QYFA 5EG3A 2EU9A 3FKOA 2XRWA 5DIAA 1W84A 2CCIA 5FDXA 3ZUUA 5CNOA 4XG2A 2QKWB 4F6UA 3MJ2A 3QHWA 4G31A 4O0XA 5AP7A 1U54B 3P7BA 2ZV9A 3F3ZA 4CCUA 4CG9A 5C03A 4ASZA 3II5A 4IB5A 3RVGA 4IB0A 3NSZA 4RX9A 3PVUA 5EOBA 2LAVA 1PY5A 2QO9A 1OIYA 3C0HA 2ITOA 5EQYA 2VTAA 5LWMA 1G8KA 2Z60A 3QRJA 1KE5A 3FLSA 3LW0A 1CKJA 4JI9A 1H1PA 5TKDA 2QNJA 3GOPA 4ZMEA 4JNWA 5CVFA 4FEXA 3RI1A 1IAHA 3AGLA 4A9SA 2CNVA 4X7QA 5CZIA 3ROCA 4RVLA 2W1IA 5E8XA 3HP5A 5DR9A 1Z57A 4BHNA 3MH0A 2XZSA 1GZKA 2X8EA 4KSPA 2Y6OA 3FQEA 3OD6X 4YJSA 5EM6A 3AT3A 4QYYA 4IC8A 5HE3A 3VBTA 5HZNA 2C5XA 1ZZLA 2ZV2A 3MN3A 1MUOA 4C59A 4DEHA 4XNEA 5LMKC 4XUFA 2F7XE 3DS6A 4CTCA 4U42A 5DBXA 4TL0A 3O71A 3MWUA 1XHAA 2W0JA 4UZDA 4J8NA 5FDPA 4XBRA 2XF0A 3ZMMA 4YP8A 3DZQA 4MK0A 4QEBA 3CC6A 5BYZA 4NK9A 4FL2A 3TZMA 4K9YA 1Q97A 4HZSA 3Q5ZA 3D5UA 4FV5A 3PFYA 3A99A 4MBIA 5BVEA 1TFFA 2R3FA 4U98A 2CLQA 3R7EA 3F7WA 1ZWSA 3OROA 5E7RA 1J91A 4NKAA 4AUAA 4Z9LA 3W0RA 4EI4A 1ZMUA 2OZAB 3UGCA 1G3NA 2JBOA 3Q9ZA 3TNQB 4PP7A 4M0YA 4BICA 3GC0A 1UNLA 3D7TB 1YDTE 1BL6A 1IAJA 1UNGA 4QMYA 3UO6A 1H1QA 4BCNA 4OBQA 4TWOA 5DHJA 4ZSGA 1OL7A 4GT4A 4CNHA 1FGKA 2YIWA 3DU8A 4B9DA 1UWHA 3PY0A 3GBZA 3ZEWA 3HL7A 5JFVA 5GJGA 4GIIA 1QPJA 1FPUA 1ZYJA 3N4VA 2CGUA 1XBAA 3DAEA 4RIWB 3OCTA 2WPAA 3BLRA 2X2MA 3NAYA 5CX9A 4XP2A 2ITQA 4N6YA 3V51A 2QQ7A 4NYEA 5KMOA 1H26A 2C5NA 4JS8A 2RFEA 4MF1A 4RT7A 1O6YA 3QXOA 3QYZA 4IVCA 4IX5A 1ND4A 3MVMA 4O0RA 1PW2A 2V7AA 4BYJA 4RQVA 3ZXTA 3RKBA 1PHKA 5M56A 3E87A 4QP4A 2QKRA 3ZO4A 3EN7A 1PKDA 3PJ3A 4IHPA 2VD5A 3UZRA 2WTCA 4ALVA 4BDKA 3FMJA 4QTCA 4YHFA 1B39A 3R1YA 3GCPA 4BJJB 2X7OA 4OTQA 5ICPA 1OBGA 4UBAA 5CI7A 4LL0A 3I6WA 3F3WA 1OIQA 4FSRA 5I9XA 3H0ZA 5CT7A 2JIUA 3MIAA 3PPKA 4ITIA 4MTAA 2XP2A 4Y85A 4AXFA 1FINA 3BWJA 3NUPA 4RIOA 1URCA 3PJ1A 5DH3A 2NRYA 3NZ0A 3DJ6A 4M69B 4HYHA 4MXZA 5ANKA 5D1JA 2XIKA 3BU3A 3FV8A 4YGAA 3RK5A 5J1VA 4U5JA 3A60A 3V5WA 3QFVA 3V6SA 5AIRA 3NMUF 4O82A 5HG8A 4MXCA 3WZDA 3TXOA 5HCYA 5IZFA 3ZBXA 5H9BA 5FXRA 5CWZA 1X8BA 4AOIA 4FSWA 3A7JA 3MFUA 3P7CA 2P33A 4CV9A 5GIPE 3PE2A 4KS8A 1W8CA 4I23A 4LFIA 3TIZA 3CD8A 3ZS5A 3D0EA 5L8KA 3CE3A 3TV4A 4LGGA 4C4HA 1OUYA 3RINA 1IEPA 3NUAA 1V0OA 3VWAA 3CQWA 3CY2A 3W2OA 5CAVA 4LV5A 4FT5A 4FKRA 1Q3WA 2R3OA 5AUZA 3VNTA 4EOQA 3LFBA 2Y4IB 4DLJA 2C5VA 3T3UA 4WZYA 5G6VA 1XH6A 5JZJA 4BCHA 4YURA 1ERKA 1STCE 2CSNA 4PL3A 4KKEA 5HG5A 3WILA 4CSVA 3UZTA 4XG8A 3HMMA 3BBWA 1ZYDA 3Q32A 1JQHA 1YHWA 2OZAA 4EOPA 5HESA 3IQ7A 3TEIA 2PL0A 2WMQA 3E62A 3HV4A 3UIXA 3MPMA 4RVKA 5C8MA 1YRPA 3QL8A 3K5VA 3O96A 3SOCA 4OTWA 3QA8A 3EQDA 3F5XA 4I6BA 2G01A 2VNYA 3SGCA 4A07A 5KUPA 2VX0A 2QD9A 4GMYA 4GJ3A 4JMQA 3OUKA 3H4JA 3PDTA 2OU7A 3REPA 2YWVA 4CFUA 3F5GA 3MTFA 3KB7A 5FD2A 3FPQA 3UPZA 4D58A 4APCA 5B7VA 4IFCA 4XG6A 2B54A 2YM8A 4FZAB 2OWBA 4C4EA 1JAMA 4EJ7A 2OLCA 5EFQA 5J9ZA 4ASEA 4B8LA 5JGDA 4ITHA 2OXDA 1H0WA 2WMVA 4OTGA 3L8PA 4E6QA 4M15A 4EHZA 2BZKB 4CQEA 4WKQA 2HZNA 1JKTA 4NCTC 5FM3A 4R7HA 3JVRA 2AUHA 2J4ZA 2PZRA 4K18A 1I09A 3QRUA 3O8UA 1W98A 1ZLTA 5EYDA 3BL7A 3FWQA 1BI7A 4FTUA 2JDOA 4LOOA 2IVTA 3T9TA 3LMHA 3M2WA 3U4WA 1LR4A 3ZO3A 3EB0A 3PE1A 4RG0A 5LVNA 2OXXA 5CS6A 1A06A 5D9HA 3WI6A 3KF7A 1QCFA 4ASDA 5L2SA 2OJJA 3C9WA 3B8QA 1QL6A 3VRZA 2A0CX 2R64A 3TI1A 4QPAA 4KNBA 4Y72A 4F9CA 5A3XA 4Q2AA 2B53A 5AP3A 4AGUA 2XCHA 3SW4A 5TOZA 4D0XA 1UU7A 3ZOSA 4O81A 5HVYA 2JKKA 5KMKA 3I81A 1UVRA 3A62A 5EM7A 2QHNA 3HDNA 3FSFA 4ZSEA 4J99A 4DT9A 1RJBA 3EQPA 3ORNA 4QP9A 4XG3A 3SD0A 4NM3A 5BQ0A 4AA4A 3Q4CA 2QVSE 3FYJX 5M06A 4KIQA 3DLZA 2HW6A 4I5CA 1YWRA 4IAIA 3FLYA 4L45A 4OBPA 4RRVA 5HBJA 1ZZ2A 5ANEA 5KX8A 4LMUA 4F9WA 4P90A 3JPVA 5M07A 4OTFA 1IRKA 3OC1A 2Y7JA 5M53A 3ZLYA 3V8TA 3E3BX 2OSCA 2QCSA 4CVAA 5KHWA 4I0RA 1Z5MA 4BCPA 4DITA 5BVWA 4EBVA 3SXRA 1JBPE 3U54A 4U8ZA 3R83A 3AKLA 4GFMA 2X7GA 3FZTA 3ULIA 4RC2A 3LJ2A 4EUTA 1BI8A 3D9VA 3NAXA 3BGZA 1XH5A 2ONLA 4IAYA 4GS6A 4JIAA 3HRFA 5E92A 2W1ZA 4EC8A 3QD3A 1WBPA 4RX5A 4LYNA 4B6LA 4BGHA 4D0WA 3R8PA 3UTOA 2HW7A 5JK3A 2NYAA 5E9EA 5D12A 3KC3A 3KL8A 3NVMB 2AC5A 4IIRA 3AKJA 3GB2A 3D5WA 3FY2A 2XA4A 4R3RA 2JD5A 5HVJA 3UG1A 3E64A 3VBYA 4FSMA 3UO4A 2VN9A 3VONA 4PF4A 3FMDA 3QCYA 3QLFA 4BDJA 4L68A 2YCRA 5FBNC 4E4MA 5A4EA 3NNXA 2I0HA 3SW7A 3BV2A 5GJFA 4YZMA 4FNWA 4J95A 1MRUA 1ZY4A 2G2IA 5EKNA 3ODYX 2X2KA 4QQ5A 2CPKE 3O51A 4JQ7A 4DTKA 4LRKA 3ZLWA 2B9IA 4ENXA 4TYGA 2UVZA 4YBKA 3TMOA 3ZLSA 3NUUA 5E8SA 2HAKA 4QP6A 1OECA 1Q8TA 2XNBA 3NNWA 4F6WA 3EYGA 5CEMA 2Q0BA 3TN8A 3PRFA 1GJOA 2VO6A 3O50A 4FTOA 4NZWB 5EHLA 3PY3A 4FTNA 3AC5A 1DAYA 3FKNA 4X0MA 3UPXA 2FSTX 4A7CA 5AA8A 2BROA 3E8NA 1NXKA 2GCDA 3MH1A 4R3CA 4U43A 4EOSA 3LCSA 1SYKA