4AQKA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase in complex with adp and ip6
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
437
structure length
414
Chain Sequence
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICREGRPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Apo Form of Insp5 2-K from Arabidopsis Thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 127
structure length 414
sequence length 437
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aqkA01
4AXCA 2XAMA 3UDTA 2XAOA 4LV7A 3UDZA 2XARA 2XANA 3UDSA 4AXFA 4AQKA 4AXDA 4AXEA 2XALA
chains in the Genus database with same CATH superfamily
2ZMDA 4M3QA 1FQ1B 2PY3A 5C4KA 3E63A 3UMWA 2XRWA 3ORMA 4NM0A 3EFLA 4CZUA 4F0GA 3PXQA 5DNRA 3TDWA 3T8OA 2XAMA 3QZGA 4FC0A 3QUPA 2XA4A 5HU3A 3UO5A 3ZBXA 3SG8A 3UOHA 2GHLA 1M7NA 2JFMA 4I41A 3QD4A 1XHAA 4Y46A 3ULIA 4MXOA 2IVUA 2QONA 3KXMA 4E6AA 3CC6A 5EOBA 3R9DA 1Q8ZA 2XS0A 2J4ZA 4FNWA 4JX3A 3EN7A 5CVGA 5KHWA 4RLKA 4YZ9A 4FKGA 4DH1A 5IF1A 5F20A 2ESMA 2YCRA 4IAFA 3W1FA 2PPQA 3QC4A 4HZSA 3ZH8A 3K54A 2PVRA 2CMWA 2HW7A 3DKOA 4MBIA 3W0RA 3EQGA 3GCSA 2ZAZA 5IQGA 5AUVA 3RVGA 5DYJA 5CSWA 2UZLA 1XH8A 4E1ZA 2CGVA 3VRYA 5IQCA 5M57A 2F2CB 2WIPA 4FTLA 1GAGA 3HV6A 3COMA 3ULZA 2E2BA 3M2WA 3MY1A 4AFEA 2BTSA 2UVYA 2CPKE 4D4VA 3F82A 1ZMUA 4J7BA 2F57A 3C0IA 1YW2A 4ENXA 3CCNA 5AV3A 4X21A 5C27A 4YPDA 4F9WA 2XCHA 1FBNA 2JD5A 3U9NA 5FDPA 3TNPC 5DT3A 1CKJA 2QO9A 3ENMA 4H3BA 4UWCA 4O0XA 1AGWA 1XWSA 1M14A 3LMHA 4FI1A 4U0IA 5FP6A 4AT5A 4AW5A 3FPQA 4QTCA 4D4SA 3KRRA 3VUDA 1L3RE 2C6KA 3F9NA 4BI2A 1Q8WA 1OGUA 2QOIA 3CXWA 2ZJWA 3FBVA 4FTAA 4I5MA 4C3RA 4TXCA 4D4RA 4QMQA 3PG1A 5CLPA 1OBDA 2EU9A 4FIFA 5LCKA 4DBXA 4AA0A 4ZY4A 4FBXA 2BUJA 2HELA 2CCHA 4AE9A 3WIKA 4CTBA 2I1MA 1XMLA 3GENA 1CM8A 3WZKA 2XK6A 3TV4A 2XYUA 4J96A 3OWJA 4FKRA 1YDRE 3QL8A 3EJ1A 4YZDA 3P7AA 4BDAA 3ANQA 3UMXA 4RIWB 4U9AA 5KMJA 3FXWA 3R28A 2BRNA 4FZFB 4QO9A 4EH5A 3WF5A 4EL9A 5FXRA 2UV2A 1IRKA 2QOBA 1WVWA 4FIHA 1YWVA 3BBWA 5DPVA 3TKIA 3D5WA 3VIDA 4CFXA 4FL3A 3II5A 3ZMMA 3D5VA 3TJCA 4DTBA 3SOCA 3UO6A 1H0WA 2J0KA 3KN6A 2QLUA 3Q4CA 5K5NA 4KBAA 4FGRA 5CAOA 5I0BA 3GC0A 1Y57A 1H07A 3UDZA 1W98A 5FUTA 2I0HA 2QLQA 4E4LA 2I0EA 2R7IA 3C4ZA 4PF4A 4AAAA 3HVCA 1NA7A 3IW5A 4DEGA 4ZZOA 2B52A 2R5TA 1VZOA 3QXOA 2WTDA 4FKQA 3ZZEA 4BCKA 2OZAA 5E8XA 4P5QA 3WBLA 2VTAA 2WXVA 3PSCA 4J52A 4EOQA 4O7YA 1UU7A 4TN6A 4C34A 3W8QA 4CKRA 3FQHA 4C38A 4AA5A 1Q99A 3TWJA 5KMIA 3Q5ZA 4KBKA 4OR5A 3VRZA 3SD0A 4J95A 2OJFE 3IO7A 3KCFA 1Q97A 4I24A 3ZYAA 3L8PA 2AEGA 5AP6A 4D9UA 3KXXA 4JVGA 4AS0A 2E9VA 2HCKA 4MD8E 4I0RA 5CEQA 3RNIA 3A7HA 3LZBA 3P23A 4L3JA 3MBLA 3IG7A 4FKIA 5HCZA 4A4LA 4RIYB 3ZO1A 3FI4A 4GKIA 2AC5A 2OLCA 4LFIA 2PU8A 1U59A 5BVNA 1FVTA 3FYKX 3KU2A 4FODA 5AAEA 5BPYA 4DEBA 2OF2A 1U46A 4QMSA 4E26A 2ERKA 5D7AA 1RJBA 4QMWA 2B55A 4XV9A 3VS1A 2JIUA 1ZOEA 3LXPA 2F7EE 4S34A 3I81A 1K9AA 2YAKA 3F7ZA 4C33A 3F3UA 4ZZMA 3VJOA 3RAHA 5LARA 4FEQA 4QMXA 2XEZA 2BROA 2YIYA 4AQKA 3DKFA 3OXZA 5HG8A 4C7TA 4YC3A 1URWA 3VNTA 4R1VA 4W4VA 5IA0A 4EKLA 3R7IA 4RG0A 2CNUA 4DFZE 4FIGA 3AD5A 3V5WA 2O5KA 3T3VA 2PSQA 4EEVA 3FXXA 2WD1A 4NW5A 5ANGA 4D55A 4BBEA 4WNPA 2YITA 4ACMA 3DTCA 4BYJA 3FZPA 3E8EA 5GIOE 4ZJIA 3U4WA 3G2FA 1H1WA 5HU9A 4R78A 3NAYA 3OTUA 4FSZA 2CKOA 4M68A 3G5DA 5GJFA 4BB4A 4FA2A 2YDIA 4FTJA 4IIRA 3QZFA 4LRKA 4RJ5A 4RPVA 3FDNA 4NUSA 3U87A 3OOMA 4FIJA 4TWPA 4UZDA 5TR6A 5E92A 5HD7A 3H10A 4E5WA 4QQTA 1VEBA 2ITQA 4JBPA 4MH7A 4NK9A 4XRLA 4BTJA 3RI1A 2GNJA 4O2ZA 4FL1A 4NYEA 4Q2AA 2YM7A 5HNIX 1Q4LA 4A9UA 2O64A 4X3FB 5ETFA 3JY0A 3TUCA 3EFKA 4IB3A 4LGHA 2R3QA 3KMWA 1GIHA 3DT1A 4JR3A 4M7IA 4AN9A 3PRIA 1OECA 2RFSA 4PDPA 4E6QA 3F2AA 2FUMA 3R7YA 2BFXA 4CGAA 4O7RA 3UVRA 2GFCA 1XKKA 4XRJA 5KBRA 2C1AA 2CKPA 5DR6A 3C4WA 4ASDA 3UZTA 2BPMA 3WE4A 2RFEA 5J9LA 5FXSA 5BVFA 2VTPA 3HKOA 3NW5A 4JMQA 4L3LA 4MXCA 5EYCA 3ZM4A 4BDGA 3WOWA 4ASZA 2BTRA 2C69A 2OBJA 5HNBA 3LCSA 3QYZA 3OXIA 4TZRA 3UOJA 1YKRA 2GS7A 4DG3E 3OEFX 3TMOA 4IFGA 2VTJA 3WI6A 4EBVA 3MI9A 3RAWA 4P4CA 3A7IA 3VS3A 3QD3A 4UBAA 3UP2A 4UYAA 1V0OA 2JIIA 4C58A 3FL5A 2HZ4A 4LMNA 4AACA 3ALNA 2VTLA 3VVHA 3FPMA 4AW1A 4O0TA 4CFUA 5T3QA 3LE6A 1H26A 2VWXA 1M7QA 3BV3A 1H28A 4FGBA 1JKKA 5HTCA 3DK7A 4RC2A 1YXSA 3M11A 1IR3A 2C4GA 2J0JA 4YSMA 3GC9A 4I4EA 4C0TA 4EONA 4XS2A 3NS9A 4YTIA 5HCYA 2XK3A 4A7CA 5A3XA 4F70A 4O7ZA 1WBNA 2RL5A 4DHIB 4NWMA 3V5QA 3RK5A 3IW8A 1ZRZA 4NJ3A 2GNFA 3COKA 4YURA 3BHVA 4PDYA 3AC8A 3MH0A 3ZLSA 4FTCA 4E5BA 4PQNA 3A4PA 4FEVA 4AGWA 3ZXTA 1H24A 3I0OA 4KKHA 3AQVA 3WARA 4AZFA 5CANA 4BDHA 4QDEA 4LL0A 1OL2A 2C6EA 4OTIA 4FKTA 2XANA 5C26A 4LGGA 3JY9A 2IO6A 4L42A 4YZMA 4O22A 4EH2A 3BLAA 4F4PA 3F2RA 4F7SA 1A06A 4OT6A 5M53A 4Z3VA 4O6EA 4K0YA 2EVAA 1XH5A 4H3PA 3SQQA 3CY3A 4JOAA 4DHFA 3PPKA 2X2KA 3Q9XA 1SVHA 4KIPA 1YHSA 4EHVA 4TTHB 3Q53A 3FYJX 3E8CA 4TNBA 4Z9LA 4BCQA 5C8NA 2BKKA 3FLNC 5E8YA 3QQUA 4AGCA 3VHEA 2C3IB 1R1WA 2OXXA 4HJOA 2XBAA 4L67A 3E64A 5AV2A 4KIQA 1DS5A 2C47A 2YIWA 3PY0A 3VF9A 3FZRA 4FT7A 2W1DA 3PZEA 5KMLA 3OROA 5AV4A 2VTIA 1QPEA 4CMTA 2H8HA 1OL1A 4FZ7A 2VX3A 3PJCA 3R7OA 4I4FA 3UZPA 3QKKA 3TDVA 1OGYA 2W1EA 5EQPA 5FBNC 1OPJA 3OMVA 3BZ3A 3RWQA 3R6XA 5HG5A 4IZ7A 4FKWA 4NM5A 5I4NA 4EWQA 4FEWA 1GNGA 4OBPA 4W8EA 3NVKI 3Q96A 4FTRA 3UC4A 4RSSA 4ZSGA 4CSVA 4JT3A 3O71A 4YLJA 3ZHPC 3HRFA 5LVLA 4P5ZA 3WILA 1YWNA 3OFMA 4XEYA 4AZEA 5IEVA 3QXPA 1U54B 3D7TA 4NM7A 5C8KA 1STCE 4ACHA 1R3CA 2GNHA 4H39A 4QNYA 3BI6A 1OM1A 4BZNA 4U97A 5HVYA 4X3JA 2GNGA 2J5EA 5CF8A 3NMUF 3PPZA 4WSYA 3DV3A 5LQFA 2BZIB 2ITNA 3KXZA 4DBNA 3MB7A 4XX9A 1OB3A 2VO6A 4PX6A 5DLSA 5FEQA 1EH4A 5HIDA 4D0XA 3ANRA 5CEIA 4WOVA 4BY9E 3LXLA 5ANDA 1PYXA 2A27A 1Q8TA 4HPTE 4MXYA 3O50A 4XG2A 5EW9A 5I9VA 1ND4A 5G1XA 2QC6A 2IVTA 4L52A 2IW8A 5JFSA 3FLSA 3NWWA 1ZAOA 5E8ZA 3QWJA 4ZJJA 2X4FA 3NCGA 2HXQA 4D2SA 4EWHA 2QD9A 3R7UA 2PZRA 4RIXB 3AC4A 1XH6A 2VO7A 3ZSIA 3TCPA 4EQCA 2QO7A 4BDJA 2FSLX 3DA6A 4IVDA 4EHZA 4PNKA 4ZSJA 1Q8UA 1PJKA 3FHRA 2O0UA 2BIYA 4GFGA 4ANLA 5DR9A 2ITUA 4FG8A 4DCAA 2A0CX 2OFVA 3WF7A 5EI2A 4K8AA 4WKQA 3RPOA 4EQMA 3A61A 2RFNA 2WEVA 2J0MB 4FSMA 4P90A 4YZNA 4FZAB 3K5VA 3TXOA 3ZU7A 2O2UA 4X0MA 4EH9A 3QALE 5GHVA 4F78A 3EQBA 3QZIA 4S2ZA 4CFNA 3VUMA 2BHHA 4ANBA 3ZXZA 2QU6A 5JH6A 1F5QA 2NNWB 3BU5A 3HMMA 1OUYA 5KZ0A 4G6LA 2ZYBA 1GIIA 2XALA 4MXZA 3TM0A 3UYSA 1OBGA 2OXYA 2UZUE 2ZB0A 4IAYA 2CDZA 2EWAA 2XKEA 4JJRA 4WG4A 3KMUA 5AX3A 3G0EA 3K3JA 4FOCA 4ACDA 4AUAA 5IH6A 4QT1A 3QTXA 4D28A 2ZDTA 1I09A 2HENA 2I6LA 4XOZA 4ITJA 1UNGA 3FJQE 4ITIA 2YEXA 4I1ZA 3LM0A 3MTLA 3HA8A 4R1YA 3GC8A 3O7LB 3F2NA 4YTHA 3EQFA 4YNEA 1IAJA 3R9HA 5DH3A 5JGBA 3TIYA 1B39A 3OP5A 2VTNA 3LFAA 4CV8A 3FC1X 5CX9A 3ROCA 4D1SA 3KRXA 5HE3A 2PE2A 2QR8A 3ENHA 4E4MA 3FKLA 4TWNA 5H8EA 3UPZA 3I5ZA 3W0OA 2F4JA 5EI8A 2BIKB 2WQNA 2BRHA 2NPQA 4PWNA 3FZOA 3CPCA 4TWCA 5ANJA 5L6PA 5ETAA 3GP0A 4X2NA 3NX8A 3VC4A 3ZBFA 2B53A 2WZJA 3UQCA 1MRUA 3HRBA 2ZM1A 3IDPA 4U8ZA 5EFQA 2JDVA 3THBA 2NRUA 4XCUA 5EQYA 5CXHA 3B2TA 2C5YA 5AX9A 5IUIA 2PMLX 3KKVA 2ZV7A 5EYDA 3DZOA 3I1AA 4I6LA 4ZSEA 3FY0A 5E1SA 5JQ8A 3OUKA 1WBSA 5T6KA 3DXPA 2CCIA 2LAVA 2KULA 4H1JA 2BR1A 2XMYA 3K5UA 4Q9SA 4BCFA 4NTSA 5DOSA 4PMSA 4U45A 4K2RA 3LHJA 3QFVA 4FNYA 1H1PA 2HK5A 3ORPA 3UGCA 4BCOA 4F9BA 4A9SA 5JFWA 4FMQA 4IEBA 3S4QA 3VUGA 1M2PA 2YA9A 3E62A 4QP3A 4EH7A 5DHJA 3GVUA 3ZC5A 4KABA 3B2WA 3JYAA 4IB1A 5CTPA 3HAVA 4JRVA 4I0SA 5BVWA 4FKLA 1U4DA 3HZTA 4CLJA 5IISA 3LM5A 4M13A 1PXNA 2VD5A 4LUEA 4A9YA 2YERA 3FQEA 4BCIA 3F69A 4ZAUA 1SMHA 2X7FA 5AIKA 3C7QA 5FBOA 4WA9A 5C03A 1XH7A 1O6KA 3OCSA 4LM5A 3HX4A 2ZVAA 1LUFA 4CFVA 4GK4A 3R00A 3W55A 3P7CA 2YJSA 2UZBA 3E87A 3MWUA 5AV0A 3OWPA 2YIQA 3R1NA 3ZZWA 3L8XA 4DFYA 3E8NA 1PHKA 3EOCA 3GI3A 4UV0A 3MYGA 4TY1A 3KVWA 5AUXA 3ZUTA 3LLAA 3PFQA 1VR2A 3EWHA 4N6YA 2ONLC 4PV0A 3ZDUA 3PJ3A 1HCLA 4F6SA 3IQ7A 5IUHA 4JG7A 4KRDA 3F3VA 4DN5A 5CEPA 3F7WA 5LVMA 2UW5A 4AQCA 4K9YA 5J87A 4ZP5A 2G9XA 2ETKA 3O7LD 2WMUA 5B0XA 3TKHA 1YXUA 3O17A 4GG7A 3BRBA 2UZVA 3ZDIA 3TYKA 2G1TA 1Q8YA 2ETRA 4BCPA 2QOCA 3R30A 3DGKA 4BN1A 4GU9A 1OZ1A 4ASEA 2EUFB 3F66A 3VJNA 4I94A 1E1VA 2AC3A 4LV5A 4EUTA 2C5XA 1U5RA 4BICA 4PTCA 3FEGA 1YI4A 4FX3A 4DE4A 5HZNA 3W0SA 2WTIA 4X3FC 5H8GA 4EORA 3GFWA 1GZKA 2QHNA 3JPVA 3MIAA 4BBMA 3KK8A 3GU5A 4F99A 4ITHA 3HECA 3OVVA 4JBQA 4FEXA 1H4LA 1PXKA 1H25A 3DZQA 1TQMA 4YJOA 4YP8A 3G33A 5CSHA 1SNUA 4R5SA 5IQFA 5EW3A 2J5FA 3KGAA 4X2KA 4YHTA 4PL5A 4YJQA 3R71A 5LMAA 2R7BA 4WNMA 4TNDA 1H1SA 2W1CA 2PWLA 2ITXA 3F88A 2VNYA 3PIZA 4BCNA 3PPJA 4FVPA 3TUBA 2QR7A 4BTFA 1BL7A 2E9OA 2V7OA 4IAKA 3GNIB 5IDNA 3QTSA 2W17A 5AUYA 1KV1A 3BKBA 3KF4A 3RAIA 4QTBA 3ZRKA 2VNWA 3R9OA 5C4LA 5J9YA 3KXNA 4IWOA 2ITWA 3RAKA 2NP8A 3R2YA 3NAXA 3DJ6A 5CVFA 2VWWA 4AN3A 5JMSA 2H9VA 4RT7A 3WYXA 3ODZX 3R8LA 2OJGA 3DK3A 4TYHA 3BEGA 3VS7A 4CT1A 2GS6A 3WE8A 4MBJA 3S0OA 2XM8A 4V0GA 2OW3A 2Y9QA 1WBTA 3BYOA 3WZUA 3DFCB 4DH3A 1P4FA 2FSOX 4FICA 3KB7A 4G9RA 4IC8A 3WZDA 3IGOA 2JDOA 4JIKA 2YZLA 4H3QA 3SRVB 4X2JA 4XG9A 3HP5A 5HE0A 4ZLOA 4UZHA 1ZY4A 2W1HA 1FGKA 2C6MA 3DY7A 2NYAA 1YOLA 3FSFA 3JVRA 4JAIA 1CMKE 2J9MA 2IN6A 4Y5HA 4QP7A 1PY5A 2PL0A 2VO3A 4O7LA 5HGIA 4PRJA 1XH9A 4ANSA 4FIIA 3JS2A 4UB7A 3DNEA 3L8VA 4K1BA 2PVLA 4HYUA 4KIOA 1ZYDA 3ZO3A 5C1QB 3TZ9A 1KV2A 5BYZA 4TT7A 2GDOA 3FMHA 3LFSA 2J7TA 2XNOA 2XZSA 3OY1A 1MRYA 4FOBA 1ZZLA 5CU6A 2VZ6A 1NVSA 3VS5A 3ZLWA 4DT8A 3OW4A 3DKGA 3MA6A 3VQUA 4B0GA 5CQUA 3QHWA 2XRUA 3BL9A 4QYFA 4WBOA 4XG8A 5HNGA 3F5GA 3IPHA 4D4YA 5IQBA 2R3RA 3UIUA 2C3KA 5AA8A 2VWIA 3KQ7A 2EXCX 1ZZ2A 4B8LA 5JQ5A 4BHNA 3W2RA 3JXWA 4O96A 4BDBA 5BV3A 2XNGA 1WBOA 5BUEA 2B4SB 4XHKB 4FT9A 2WTJA 4EBWA 1BYGA 2EB3A 3NUNA 4AU8A 4I20A 5FGKA 1KSWA 4IHPA 3DAEA 3FI2A 4M97A 3RK9A 5GINE 3PJ2A 5K9IA 3LIJA 4NL0A 5M55A 4Q5HA 2I7QA 4XG4A 5EM8A 4DTKA 4ZTMA 4USEA 5M4IA 4QP6A 4CCUA 3LFNA 5HKMA 3TNHA 5M51A 5AP7A 5ETCA 2JKOA 5BYLA 5D12A 4AP7A 5LVPA 3H9RA 4C4HA 2WQBA 3QCSA 3M1SA 4JL9A 4EK4A 3D2IA 3IS5A 2UW9A 4NCTC 4EK8A 1H8FA 4UX9A 2HY0A 5HVJA 3MVJA 5ANIA 3NLBA 4HOKA 4OT5A 3UODA 5EQEA 5CEKA 5KKRB 4YJNA 1Q62A 3UYTA 4GKHA 1JBPE 3EZVA 4E5AX 4BGGA 2C6LA 5LWNA 2PUNA 3LJ1A 3QRUA 5M4FA 1CKPA 2DS1A 2PVYA 3OG7A 5CAVA 5HLWA 3E3PA 4C4IA 4TPTA 5HE1A 3PE1A 2I0VA 3VHKA 4E4XA 4MX9A 2PULA 5CYIA 5M44A 3I7CA 3H0ZA 3NW7A 4CT2A 3OZ6A 3DB8A 1H01A 4QQ5A 2JKMA 4C59A 3W2OA 4IDVA 4IE9A 2UW8A 5JFXA 1Q41A 3AKJA 4GEOA 4GYIA 2W05A 3NYVA 2JKKA 4P2KA 2QOOA 4NKAA 3UG1A 5A4TA 4I5PA 5KMKA 2OIQA 3W2QA 1UA2A 2OICA 5IH4A 2UZOA 3C5UA 2JDTA 4D2RA 4C61A 3BGPA 1NVRA 2JIVA 2CHLA 2ITVA 4R3CA 4WRSA 2X39A 4YUQA 2GQRA 3NYNA 5IU2A 1YXVA 2Z8CA 4GSBA 5CENA 5BUJA 3BHYA 3Q9YA 4EOSA 3CGOA 3QZHA 4FG7A 5BX0A 3Q6WA 5HESA 3R8UA 5J7HA 2ZDUA 4U79A 2OGVA 2XNMA 5E8SA 2BAQA 3OXTA 4BRXA 1OITA 5LOHA 3OT3A 3TIZA 5CT7A 1G3NA 5J95A 2Y4IB 4AF3A 4D9TA 4YBJA 2PVFA 2REIA 4YBKA 5AP0A 2YM3A 2RF9A 4YNOA 3LLTA 4X2GA 3EKNA 5CI7A 3DS6A 4BC6A 3DBFA 5KMNA 2QNJA 1QL6A 4K77A 3OS3A 4GS6A 3PXZA 2XKFA 3GUBA 3F5UA 4I0TA 2LGCA 3MGYA 3HAMA 3TI1A 3ZC6A 3FL4A 1LR4A 3ACKA 3Q32A 3P7BA 4JQ7A 4O21A 1T45A 4G3EA 4QP2A 2WNTA 3WYYA 3EQRA 5M08A 3H0YA 3SXRA 2H6DA 2QURA 3QKLA 4U40A 3R1YA 5JGAA 4GT3A 4YU2A 5K5XA 3OUNB 2ZM3A 2XK4A 5AIRA 2W1IA 5KNJA 4D1ZA 5KBQA 5EKNA 2W06A 4MHAA 3LXNA 5ANOA 5HCXA 4O0VA 4F64A 4LV8A 4CMOA 5CF4A 3QCQA 4GV1A 4KAOA 2PUPA 4LUDA 2OI4X 3T9TA 4LOQA 4R3PA 1BLXA 1OMWA 3LCOA 4QEBA 4FKOA 4DG2E 5B2KA 3ORNA 4V01A 3KF7A 2VTRA 3HDNA 2OFUA 2OH4A 3MY0A 2UUEA 4NIFB 3TN8A 2HAKA 4CG8A 4XMOA 2UZDA 4OLIA 4PMPA 4QTAA 1ZYSA 4JIAA 4FK3A 5HBJA 2F49A 5I9WA 4QMMA 1UKIA 2E9PA 2X9EA 2YAAA 2V55A 5FTGA 3JVSA 5JGDA 1G8JA 2QODA 4CCBA 1CDKA 3V3VA 4XJ0A 3G90X 3O51A 1JSUA 3A2CA 1CSNA 3MFRA 3QD0A 5JN2A 1Z9XA 2X2LA 3FI3A 5E4HA 4I6QA 1UWHA 3QTZA 5L6OA 2WMAA 3DBDA 4KA3A 5FTQA 3V5LA 4A06A 3ODYX 5HD4A 3UPXA 1FGIA 3I4BA 5TO8A 3V6SA 3TUDA 4NT4A 5FM3A 5HQ0A 4PDSA 3MH3A 4A07A 4DAWA 4HYIA 4U43A 4DGNA 3QQKA 4PTEA 2PMNX 3RPRA 5HLPA 4AG8A 3LXKA 4G16A 4EQUA 3P78A 3IOPA 4NM3A 3AMBA 4GK3A 5AWMA 2WB8A 4OTFA 3CD3A 1P2AA 2Z2WA 3QTIA 1JAMA 4QTEA 5BVDA 2UZNA 2W99B 2WTKB 3G9LX 3PVGA 4PMMA 3MY5A 1Q5KA 5DT0A 4TRLA 4AOJA 3U6JA 1I44A 5CU4A 2PUUA 4E4NA 5JFVA 1M52A 4FTMA 4EOPA 2YM4A 4G1WA 4NH1A 1VLRA 4RC4A 4QP1A 1YVJA 3BBTB 1J1BA 3OWKA 4D58A 4RWJA 4U3ZA 3LFEA 3ZFXA 4NFNA 3D83A 3MTFA 3EYHA 4MD9E 1AQ1A 4I92A 4MKCA 4W4XA 4O81A 3F3WA 4FTTA 4IB0A 3ZO4A 4QDVA 4RVMA 2YM6A 2Z7LA 5EYKA 3RK7A 3V01A 5HO8A 3Q52A 2IZSA 4F6WA 4EH3A 1GY3A 1OKZA 4BR3A 5IH5A 1DM2A 5CAPA 4RX9A 1YHWA 4G6NA 1BX6A 2NO3A 3HUBA 3W18A 5HHWA 2RG5A 3PVBA 5KO1A 4IZAA 3HYHA 4FKJA 2R3MA 3FMEA 5DBXA 3BL7A 4G3DA 3UDSA 4NSTA 3RCJA 4YC6A 3ALOA 5HBEA 4HVGA 4ZK5A 2FH9A 2GSFA 1OIQA 4UYNA 5KZIA 2HOGA 1R78A 2GHGA 3TV7A 4EOKA 3PE2A 4RJ4A 3TACA 4DT9A 3NGAA 4DFUA 3AOXA 1G8KA 3IKAA 4L00A 3L9MA 3ELJA 3SC1A 2JBOA 3MVHA 4RJ6A 3R8PA 1XH4A 4X6RA 1TQPA 5ANKA 3V5JA 4FEUA 3SXFA 5JT2A 4F63A 2HWPA 3R9RA 1Y8GA 3HMPA 3W2CA 4K11A 5I5ZA 1LPUA 3LCTA 1URCA 2VAGA 3FSKA 3NFGB 3QQHA 2J50A 5JEBA 5AAGA 3K2LA 4HGTA 4WBBB 4ZXTA 3DB6A 3QLGA 3CP9A 5DWRA 2CN8A 3CPBA 3QA0A 4U81A 4D0WA 4FTOA 5TT7A 5J1VA 2WEIA 4KRCA 2C0OA 4AZTA 1NXKA 3MPAA 4FV6A 4CRLA 3W0MA 1H00A 3MIYA 2YIRA 4XUFA 5L2TA 2JDRA 5DRBA 4ZEGA 4KSQA 3DXNA 4HVHA 3HV3A 3UJGA 4Y5QA 1J91A 2Z02A 4MXXA 3ZO2A 1O9UA 1KOBA 3ID6C 5EH0A 4DGGA 2JBPA 1DI8A 1NY3A 2YDJA 4XNEA 4GRBA 2CN5A 4M0YA 3QD2B 4BDFA 1JKSA 4RJ8A 3BE9A 3FKOA 5EDQA 3E92A 4DDIA 1IAHA 4B6LA 3ET7A 5AUZA 5CEMA 1XQZA 3A7FA 3RM6A 3TG1A 4B9DA 1WFCA 4DDGA 3COHA 5IDPA 5LMBA 1Q24A 3FLQA 2X0GA 3QQGA 5CSXA 4QMVA 3E7OA 3GFEA 1OIUA 3GXLA 3TV6A 3LQ5A 3FC2A 5DEWA 5C8MA 2R3GA 4NU1A 1O6YA 4RMZA 1XO2B 3NUXA 4IVBA 4X7QA 4EOJA 1M2RA 5J5SA 4BJJB 1PXPA 1OL5A 4GL9A 4BDIA 4PP9A 5IMXA 5M56A 1OKVA 1QPJA 1XJDA 2OXDA 3ORXA 5F95A 4GU6A 4PY1A 1FMKA 4YLKA 4ZY5A 2ZB1A 2RGPA 4EOMA 3CKXA 2Z60A 4FVRA 3L8SA 3P9JA 2JLDA 2WU7A 4FV0A 4BTMA 4MVFA 4RFYA 3LJ0A 4OW8A 4B99A 2PHKA 3OD6X 1UVRA 3D9VA 4DGOA 4K18A 5ACBC 3CR0A 3H9FA 5I9ZA 1XR1A 3C1XA 2PZIA 4IDTA 3A7JA 5JZJA 2BZJA 3UVQA 3GB2A 4HW7A 4ZSLA 5GJDA 4I3ZA 2Y4PA 4AZWA 3HNGA 2QHMA 3N9XA 3ORTA 3Q3BA 5AFVA 2XP2A 3EYGA 5AP4A 3RMFA 3GOKA 5KHXA 4DGLC 5LVNA 5CU0A 3VS2A 2W4JA 3QBNA 4ZTRA 5A4CA 4L3PA 4M15A 2RG6A 3W8LA 5H8BA 3FE3A 2CJMA 4ACCA 4RVLA 2WMXA 3QWKA 4J99A 2WKMA 4QYGA 4O0WA 3FZ1A 4UWYA 4I5HA 2Z7SA 4WIHA 1PMUA 5A9UA 2P3GX 3CE3A 3CTQA 4PNIA 5CAUA 1W0XC 4QMTA 3A99A 3LKMA 3QX2A 5AMNA 3Q4ZA 2BDJA 3H4JA 4FV7A 4XBUA 3VS6A 4A4OA 1JQHA 1PXOA 3QAME 4M14A 5IZFA 5EOLA 3QA8A 2V7AA 4P7EA 5M07A 2XBJA 5E9EA 2QOQA 2VGOA 5AUTA 2IZUA 2HZ0A 2V5QA 3G9NA 3FMKA 4M84A 5DR2A 4BIDA 3IONA 4JG6A 3CJGA 2W7XA 2RIOA 5AAFA 5BVOA 3DJ5A 4O0SA 4JDHA 5K3YA 5LCJA 4QYHA 5TF9A 4ZTSA 1BI7A 5F9EA 5KKRC 3VN9A 3KVXA 1XBCA 3U55A 3KRLA 4HVIA 1K3AA 5HORA 4IX5A 3BU6A 2PUIA 2Q83A 4KNBA 1S9IA 1GZNA 4XBRA 3VBXA 3WF8A 4M0ZA 3QRKA 5E1EA 4KWPA 1YOMA 3I60A 3OBGA 3VW6A 2GCDA 3LMIA 3NFFB 1V0PA 3G0FA 4RWKA 4D5KA 1KE5A 3CIKA 4B7TA 2IVSA 3DLZA 1W7HA 4D1XA 1JLUE 4E6DA 2PE0A 4IANA 2I40A 5HG9A 3CBLA 5AV1A 3PLSA 2XIRA 4PDOA 4V04A 3EL7A 3REPA 3KY2A 2RFDA 3ORIA 4U42A 4LMUA 5D9HA 4J98A 4I5CA 2PZYA 4NKSA 4RGJA 4ANMA 3SX9A 5KMOA 1BI8A 3PY3A 4FZDB 5DGZA 2O63A 4ZTNA 4DEEA 2C5OA 5TKDA 5HICA 3UIBA 3ZCLA 2X2MA 4IWQA 1Y91A 2UW3A 4QTDA 2X8IA 4GIIA 3NW6A 2WU6A 4L7SA 4L7FA 4RWLA 4WUNA 2C6IA 5IQAA 4DHJA 1TVOA 3GCVA 3SXSA 4AE6A 5HIEA 4RIWA 3LFDA 3PJ8A 1PXMA 3TL8A 3D7ZA 4AOTA 5EK7A 5CSVA 2Y4IC 3QQLA 4ALWA 4FYNA 3O0GA 4YJTA 4BGHA 5D1JA 1FOTA 4TKSA 5EM7A 1H08A 4ZIMA 3V8WA 1M2QA 3DOGA 2HZIA 4FIEA 2R3PA 4S32A 3W32A 4ACGA 5CNOA 2W9ZB 3F6XA 2XJ0A 3VBVA 4DHZA 4QOXA 2YHVA 3HMOA 2OZAB 4DH5A 4EK5A 2XARA 3F61A 4XYFA 4J8MA 4R5YA 4RQVA 4XP2A 2XNNA 3VF8A 3UNKA 3AD6A 4TWOA 2HWOA 5T68A 3RKBA 3CQUA 2ZV2A 3QCXA 1YWRA 1KOAA 3RHXA 5LWMA 5M09A 2YFXA 3U54A 2X8DA 4AGUA 4UN0C 4R3RA 3ZFMA 5CASA 3HEGA 5EKOA 5DEYA 3B8QA 2BALA 4NW6A 5EM6A 2WGJA 2HIWA 4A9TA 2VV9A 2PVNA 4FTUA 5D10A 2DWBA 4WT6A 3ZSGA 5IQEA 2BZHB 3PDTA 5A6NA 4IADA 5GIPE 4BKJA 2J6MA 3A8WA 3OCGA 4CFMA 3ZM9A 3OC1A 2XH5A 3NNUA 3QRJA 4C62A 4ZLZA 2VWYA 2HYYA 3NUYA 4FSUA 5A14A 5JKGA 4F6UA 2UZEA 3R2BA 5HE2A 4QP9A 2BILB 3BLQA 4JXFA 5EDRA 4RIYA 4E73A 3CQEA 3ZEPA 3OTVA 2CKQA 4L44A 3TNIA 2ITPA 4FKUA 2WQOA 2C68A 3SAYA 5JK3A 4ZZNA 3UE4A 4MK0A 3C4FA 2ZM4A 4OBOA 4EH6A 4GVJA 2VO0A 3OOGA 2FGIA 1PMVA 3MH2A 3QKMA 1OIRA 4ZTHA 4CD0A 3R8ZA 4Y85A 3UO4A 4AXCA 4Q9ZA 3DNDA 2FB8A 3DU8A 3KRWA 5CS6A 1ZWSA 3UQFA 4FK6A 4JDKA 2QCSA 1O6LA 4BTKA 5HG7A 5HBHA 4FUXA 5HO7A 3POZA 3SHEA 4CXAA 5LMKC 4BIBA 5AP5A 3FMNA 2VGPA 3Q9WA 3QTUA 4HCTA 4DFBA 4FE2A 3PP0A 1LEZA 3LPBA 2GMXA 5IUGA 3MW1A 4S31A 2G2HA 5BMSA 2ONLA 2QI8A 4EYMA 2OO8X 3RZBA 4H36A 3O5AA 1JVPP 3GU8A 4BGQA 5L2SA 3W0PA 3LW0A 1X8BA 2R3IA 3ZRMA 2WTKC 2OK1A 4ORKA 3PWYA 3DQWA 3UVPA 4N0SA 4NJDA 4TL0A 4KD1A 2YM5A 3MJ2A 5AP2A 1SVEA 1HOWA 3GU6A 2PYWA 3BLRA 3HV5A 4TYIA 4KB8A 4C36A 3VBQA 1YDTE 2BFYA 2JDSA 5EI6A 4G5PA 3IGGA 3QTRA 4EYJA 3UDTA 4IC7A 4F1MA 4BHZA 4X3FA 5CI6A 3R8VA 2BHEA 5E8VA 4YTCA 3GQLA 4ERKA 4YR8A 4OTHA 1KE9A 2C3LA 3S95A 5IQHA 3KXGA 3GU4A 5CF6A 2J0LA 4FZ6A 3NPCA 4RJ3A 4ZSAA 2H34A 3NIEA 3DTWA 4BF2A 4CG9A 1REKA 5FD2A 5GJGA 2XIZA 4I6BA 4JDJA 3QC9A 2W4KA 4BVUA 4CEGA 2OH0E 2X8EA 2Y0AA 4Z7GA 3BPRA 2I0YA 2Z7QA 3D94A 3N4VA 3RHKA 3MSSA 4FTQA 3EN5A 2IVVA 4AZSA 4QRCA 4APPA 3KXHA 3UIMA 3FLWA 3GT8A 3PVWA 4QMNA 5IA4A 3EQDA 1PKDA 5DE2A 2VTTA 4C35A 4HCUA 3DAJA 3VBWA 5L2WA 4CTCA 2VTQA 3AG9A 2QOHA 2WMTA 1SNXA 2VTSA 2JC6A 2YN8A 3DDQA 2E9NA 3O2MA 3DBQA 4ALVA 3KK9A 4AXFA 1IASA 1REJA 3UP7A 2GQSA 5M4UA 5FLFA 1W82A 2CGXA 4R7IA 4R7BA 1YXXA 5EHOA 3TZ8A 3UOLA 2WMBA 3LMGA 3VONA 4AT4A 2VU3A 3DK6A 3LFBA 3EN4A 3SW7A 1UKHA 3A7GA 3PSDA 1QMZA 3TZMA 2WELA 3NDMA 4AGDA 5DA3A 3FQSA 3PVUA 3R1QA 3NNWA 4RVTA 2YWPA 2UW6A 3IDBA 3OBJA 4RA4A 4IM3A 3PG3A 3V8SA 4IW0A 3VS0A 4HNIA 1S9JA 2XCKA 2HXLA 2XB7A 2XIXA 3R63A 3AGLA 4W8DA 4XV3A 3NZ0A 3OW3A 2DYLA 1ZYJA 3SV0A 4AN2A 5AUWA 3EQIA 2R2PA 3F3TA 4ENYA 4RX5A 2SRCA 2IZTA 3BX5A 1Z5MA 2EB2A 2ZOQA 3R8MA 3ACJA 1W83A 1YQJA 2C6TA 1JKLA 4O82A 2BRGA 4CZTA 3FHIA 5IA2A 4O0RA 4MNEA 5E8UA 1APME 4OBQA 1PW2A 4WO5A 5IA3A 3C9WA 5BVKA 4RBLA 3MFSA 2XUUA 2C5NA 3QX4A 4YMJA 4D5HA 5KCVA 2B1PA 2F2UA 2QO2A 5ACKA 4N6ZA 3T3UA 2UW4A 4BCMA 4EKKA 4RIOA 4I93A 4JAJA 4QNAA 5BUIA 3H3CA 3MPMA 5A46A 1ZXEA 2FA2A 5DRDA 2R4BA 3DQXA 4H05A 3QRIA 4IX4A 4C4FA 3BIZA 1J7LA 4FNZA 3V51A 1OVEA 3DFAA 4IAZA 4O86A 4RWIA 5L8JA 3PXKA 4XG6A 4OUCA 3E7VA 5DFPA 3AKKA 4IJ9A 2ZV8A 4GCJA 2QVSE 5BNJA 4AW2A 4EK6A 5AEPA 3Q4TA 3RM7A 1OPKA 4IH8A 1JKTA 4APCA 4IACA 4MEDA 5DVRA 3N4UA 2FVDA 4HGSA 3EIDA 4LI5A 3U6IA 5B7VA 4CVAA 4IMYA 2QKWB 3S00A 4ZTQA 3OCBA 2P55A 3EH9A 3QLFA 4YJRA 3BYUA 3GEQA 3LCDA 3ITZA 5TOZA 3UNZA 3FMDA 1ZY5A 2PTKA 2XKCA 4GVAA 1WVXA 3FAAA 4IM0A 1OUKA 3D7TB 2P2HA 4NCTA 4QQJA 3BYMA 3HGKA 3IW4A 3FWQA 4JRNA 1DAYA 2UZTA 4WUAA 3D5XA 1FVRA 1ZARA 3OEZA 1U54A 2R0UA 3F3ZA 2A1AB 2F9GA 4HCVA 1G8AA 4IZYA 2WO6A 4OTGA 2R3JA 3GU7A 4YPSA 5D11A 3D2KA 4G31A 2CKEA 1H0VA 3HLLA 4TYJA 4J1RA 5D7VA 3I79A 3LQ3A 2Z7RA 3TTIA 1NW1A 2C30A 4ZOGA 4U80A 2G01A 5CQWA 3L9PA 4WNKA 3GC7A 3LFFA 3DJ7A 2WTWA 3UNJA 1IG1A 5JSMA 2CLQA 3IECA 4YTFA 2PZ5A 1V1KA 1E1XA 4EHGA 2YCFA 3MVLA 1PKGA 3R22A 4AXEA 4G3CA 4EHEA 3EB0A 3MPTA 4YJVA 5A4QA 5FEDA 5M4CA 3SA0A 2XNEA 2WOTA 2YACA 4GG5A 3HRCA 4Y8DA 4YJUA 5CEOA 3LVPA 3QHRA 1R39A 2YABA 3AT4A 4RIXA 4W4WA 3MESA 4XV1A 3VUKA 3ZFYA 4CV9A 3O8TA 3PXFA 2E9UA 2WQMA 1IA8A 3SDJA 4ZMEA 1JSTA 4LDTA 4FSWA 1QPCA 4K33A 4II5A 1WCCA 2WMRA 4EJ7A 3W0NA 5KUPA 1PF8A 5AJQA 3SLSA 2X7OA 5H9BA 2BAJA 3A62A 4EOOA 5IA1A 2J0IA 4JX7A 4KINA 4B4LA 4BDKA 3TJDA 3AD4A 1KWPA 3PJ1A 4L46A 2BCJA 1P5EA 2B9FA 3E5AA 3DLSA 3ZRLA 1GIJA 3R21A 3JR1A 4C4GA 2YWVA 2Y6MA 1Q3WA 4QMZA 3D14A 4RZWA 5EDPA 3NNXA 2B7AA 3DXQA 3PLAE 4F1OA 1PYEA 3AC5A 4FUYA 4JLCA 4MD7E 4O0UA 4HYHA 4L45A 4FKVA 3Q2JA 5FRIA 4PP7A 2OKRA 3I7BA 2EXMA 4FV4A 3BYSA 2BRBA 3HMNA 3P08A 4O7TA 4Y95A 5M06A 2CLXA 2VX1A 3QUEA 3D5UA 3AC3A 2QKRA 3GCPA 5CU2A 1PMNA 3A8XA 2B0QA 2R0IA 3EMGA 4X6QC 5ETIA 4PUZA 4C2WA 4BDDA 4DINA 1KUTA 4KBCA 3OY3A 2V62A 3DPKA 4GUBA 5HVKA 2OIDA 5HEZA 4YO6A 4EC9A 4Z16A 2BMCA 3D4QA 4E93A 3PY1A 4FKSA 3EN6A 1XBBA 3E88A 3BEAA 3QUDA 3MS9A 4BZDA 3F5PA 2R3NA 5G6VA 5HIBA 2B9HA 3WIGA 3QF9A 3EQPA 4GFMA 3Q9ZA 3BHTA 3RCDA 1YI6A 2V0DA 2P4IA 3D0EA 4KKEA 5IQIA 4EJNA 3P5JC 4DLIA 4DTAA 4EOIA 4DGMA 3RPVA 4GIHA 4MAOA 3B8RA 1JNKA 5K4IA 1V0BA 2XJ2A 3BELA 4G17A 3C5IA 2BRMA 2WMVA 2PVKA 4F0FA 5KMMA 4O83A 3PUPA 5L8LA 3I0QA 5GNKA 3KL8A 5I9UA 4QP8A 4FT3A 2IWIA 3RPYA 4YO4A 3FZSA 4TYGA 3HMIA 1OL7A 3HV7A 2ZMCA 3NVMB 3HDMA 3UC3A 2GHMA 4E20A 2OIBA 2WPAA 4BDEA 1YOJA 3ZLXA 4B8MA 2B54A 2ITZA 5ICPA 2ZV9A 4FR4A 5A6OA 4RA5A 2R9SA 3DBEA 3GCQA 3UBDA 4IAAA 4BCJA 2XIKA 4FV9A 5AP1A 3SVVA 4QMLA 1GJOA 3A60A 1U5QA 2IZRA 3AXWA 4FV2A 4JQEA 4S30A 1CTPE 1WBVA 2VWVA 3G51A 4TYEA 4F08A 3DCVA 1CKIA 5E7RA 1WMKA 4UXQA 4F7NA 3PUFC 4ZJVA 1HCKA 3GOPA 3V5PA 3FMJA 1OIYA 2PK9A 3C51A 4MUQA 2YCQA 5L6WL 4GH2A 2OJ9A 4HPUE 2ACXA 5DT4A 3RP9A 4IX3A 4AAYA 3HA6A 3NYOA 4GFOA 3BGZA 2DQ7X 3BHUA 4IVAA 4U44A 5FM2A 3W33A 5F1ZA 4MF1A 4XG7A 4BBFA 4OTQA 1UNLA 1PXJA 3VUIA 3PFYA 4M69B 4LRMA 4RX7A 2QU5A 3C13A 3SOAA 2CGUA 2JAVA 4HVDA 3RNYA 4C3FA 1PMEA 3R1SA 1AD5A 1RW8A 3MN3A 3FZTA 1ZMVA 4I23A 4CQEA 3DKCA 1SZMA 3R7VA 3AC1A 4DA5A 2WQEA 4AXDA 2Q0NA 5F94A 3U8WA 2Y8OA 1JOWB 4Z55A 2OU7A 3KN5A 3FMMA 3BE2A 3PTGA 4FSNA 3ERKA 2FO0A 4IBMA 2R3LA 3RTPA 4YZCA 5IEXA 2X1NA 1FINA 4L01A 5E8WA 4NTTA 3CKWA 2QOFA 1H1QA 2OF4A 3KULA 2GPHA 5B2MA 1MP8A 5BVEA 3P86A 3FI8A 4GT4A 1WBWA 4K6ZA 2PVJA 4JI9A 2W1ZA 1P4OA 3KC3A 2P2IA 3HUCA 4O7WA 4QMUA 4QPSA 1H1RA 1TQIA 3NSZA 3QCYA 4GUEA 3P5KA 3PIXA 4C4EA 4EH4A 2C0TA 2X6EA 4M12A 5A4EA 1OPLA 1LP4A 1GZ8A 2OZOA 4DFLA 2YDKA 4U5JA 3FLYA 4BI1A 3NUAA 3EL8A 3LCKA 2DUVA 4C4JA 3I6WA 3NYXA 4EK3A 4X2FA 3P79A 3M42A 4FKPA 4GJ2A 4ZTLA 2W1GA 3NUSA 4IWPA 2GFSA 2BKZA 1R0PA 3ATSA 4AX8A 4R7HA 4U6RA 4XOYA 1RQQA 3K3IA 4HYSA 3KA0A 2WIHA 1KE8A 3HL7A 1W84A 2UVXA 3OCTA 4TYHB 3FV8A 2A4LA 3LOKA 3WF9A 4IQ6A 4EZ3A 3RINA 4V0GB 5IQDA 1G5SA 2C6OA 2UW7A 3SGCA 4QMOA 3R01A 1M17A 5H2UA 3RALA 4I22A 1BUHA 4O7SA 4DEDA 4LYNA 5DG5A 1XMMA 2X6DA 4AFJA 2BDWA 3E93A 3PA3A 5IMEA 2P0CA 5IA5A 2VUWA 3SRVA 3CSVA 4WD5A 2G15A 3C0HA 3UDBA 5LVOA 2B9JA 2ITOA 4XV2A 4L9IA 2IW9A 4W4YA 5KX8A 4DFNA 1B38A 2O8YA 2YM8A 2R3OA 2G2IA 4FV8A 1MRVA 4IX6A 4N70A 2R3KA 3ZS5A 5L8KA 3QYWA 4MNEB 2HY81 4FVQA 2QG5A 1J3HA 3JUHA 2VTMA 3EFWA 2PMOX 2JEDA 1ZOHA 1IEPA 1FMOE 2A19B 3WZJA 4F1TA 4ZY6A 4FTKA 1OL6A 1SYKA 2AYPA 4IWDA 2W4OA 5LXMA 5CZHA 1Q3DA 4RC3A 4LRJA 3V5TA 3QTQA 3V04A 4FV1A 5EYMA 4BCHA 4FSRA 3C50A 4RRVA 3UG2A 1VYZA 3O96A 3T9IA 3KIOC 3MV5A 4DH8A 1MUOA 4MWIA 4YLLA 5CU3A 2WTVA 4MQ1A 4C02A 4F09A 5HX8A 4E6CA 2F7ZE 4QMYA 1QCFA 4WG5A 2OSCA 4LOOA 3LAUA 1MQ4A 5CZIA 3R7EA 4L68A 3IDCA 3EN9A 5IEYA 3O23A 1TFFA 3VS4A 4UEUA 4JBOA 4CKIA 3R73A 3W16A 3O8UA 3L9LA 4AA4A 5HTBA 5CSPA 2IJMA 3CD8A 2YCSA 3PXYA 4ZS0A 4O91A 3G6HA 3KEXA 4LL5A 4KS8A 1ZYCA 3MJ1A 1KE6A 1QPDA 2G2FA 3Q5IA 3L1SA 4KS7A 3MA3A 2ITYA 2C3JA 3RWPA 4CFFA 2GNIA 2W5AA 5E90A 4N57A 1SVGA 3NUPA 4JS8A 5L3AA 3AGMA 3TNQB 2CNVA 4O84A 4FT5A 4AZVA 4BZOA 3Q4UA 4JDIA 5C9CA 3C4CA 2B9IA 2O65A 3IW6A 2V22A 2JGZA 3EKKA 4EUUA 3U6HA 5CXZA 2BDFA 5A54A 5L2IA 4XLVA 3QTWA 3N51A 4DH7A 2YISA 2CSNA 4IAIA 4MNFA 2IG7A 4EZ7A 1Y6AA 4KUJA 4O6LA 1R0EA 2VX0A 1WZYA 3ZSHA 4CRSA 3CTHA 3NIZA 5J1WA 5DN3A 4DEIA 3EQCA 4U7ZA 3C4XA 5CF5A 3UZRA 3AMYA 4QPAA 3ZOSA 4DCEA 3L9NA 4JQ8A 3NEWA 3OWLA 1J7UA 2X7GA 4FSYA 4GYGA 4O0YA 5FEEA 1VJYA 1UV5A 3TTJA 4OGRA 3TNWA 5C01A 3C4EA 2C6DA 5H3QA 1RE8A 2XYNA 3IOKA 3P1AA 3Q6UA 4DC2A 4OTRA 4CKJA 3CEKA 5HLNA 4CLIA 1GOLA 4F0IA 5FG8A 4O27B 4G34A 5JZNA 4ANQA 5BMMA 2XVDA 1KE7A 3W0QA 4EZ5A 1PXLA 4ALUA 3R04A 3BWJA 4S33A 3ZUVA 3NNVA 4BCGA 2XK9A 3F5XA 3I5NA 4EOLA 4O7NA 2GNLA 3VBYA 3MFUA 4QYEA 3V8TA 4LG4A 1ZLTA 3NCZA 3COIA 2H96A 3OT8A 4XG3A 3AC2A 4LV7A 2VTOA 4MQ2A 4RVKA 5B2LA 4XP0A 4L6QA 1WBPA 2R3FA 3W2SA 2KTYA 4Y83A 2XNBA 4YJPA 3UIXA 3EFJA 3PP1A 3ATTA 2Q0BA 3BHHA 3R83A 1F0QA 5LJJA 3V6RA 2QG7A 4L43A 2GTNA 5EM5A 5EW8A 4PL4A 4ARKA 1E9HA 1B6CB 4ID7A 2W5HA 2XEYA 2JFLA 3ZEWA 3MFTA 3EQHA 3DAKA 5AUUA 4DLJA 4H1MA 3PA4A 3VBTA 5KE0A 4FL2A 5JRSA 3FKNA 3AT3A 3LFCA 3POOA 4O2PA 5ITAA 4C2VA 4G3FA 1Q61A 2XK8A 3PXRA 3UQGA 3OHTA 4QMPA 1ERKA 4MYGA 3ROYA 4A9RA 2OJIA 4GMYA 4G5JA 1BKXA 3A4OX 2VRXA 2ITTA 2WMSA 4IFCA 4IZ5A 4J71A 3TT0A 4CNHA 2P33A 2YZAA 2O3PA 5AADA 4FV5A 3KRJA 4RFMA 2FSMX 2WTCA 5I9YA 4KSPA 3DBCA 3H30A 3TZ7A 3NR9A 4FT0A 5HX6A 3ZLYA 3NRMA 3EHAA 5CWZA 3VQHA 4DG0E 3KMMA 2PZPA 3TKUA 3MDYA 2PVMA 3Q04A 1SM2A 4L8MA 5CT0A 3VW8A 4FSTA 4OTDA 4HNFA 3WZEA 4C3PA 2Y6OA 2PMIA 2R3HA 3H9OA 2XK7A 2FSTX 3MVMA 4ZLYA 1UNHA 2J51A 4NFMA 4RFZA 3IK3A 2C1BA 2IW6A 4J53A 1YI3A 2XNPA 3QGWA 4U3YA 4M67A 4PMTA 3PRFA 3AKLA 2R64A 2GU8A 4WNOA 3RGFA 4BIEA 4J8NA 2C0IA 4YC8A 3C0GA 2ETMA 2VWBA 3GQIA 3QU0A 3VWAA 1OKWA 2BVAA 2JITA 2UZWE 5AM6A 4OTWA 1H27A 5FQDC 1TKIA 3UOKA 4HZRA 3S3IA 5CVHA 1WAKA 1XBAA 4IJPA 3PA5A 1PRYA 2GTMA 4GW8A 4JR7A 1Z57A 5LMKA 4U41A 4A4XA 4EI4A 3SKCA 3CTJA 4USDA 4DF3A 3S1HA 3Q2MA 4DEHA 2OG8A 5EHYA 3LFQA 4MTAA 1DI9A 3VO3A 4G6OA 3ETAA 5FTOA 5CALA 5FP5A 5IG1A 3W2PA 5JRQA 5IPJA 3RPSA 3VAPA 2QOKA 3CQWA 3MB6A 1UU3A 3HP2A 2PVHA 3OF0A 1G8SA 3RJCA 3SW4A 2WMQA 4N4SA 1YHVA 3AMAA 4RLLA 3Q60A 3E8DA 5E8TA 4O7VA 4FTIA 4DEAA 4FJVA 3UTOA 4HVSA 4BI0A 2VWUA 4WG3A 3IW7A 1DAWA 4L53A 3R0TA 2WHBA 2QQ7A 2WFYA 1JPAA 4PTGA 4AXAA 5EG3A 1ATPE 4F65A 4XLIA 2PE1A 1JSVA 4R77A 1F3MC 5DIAA 1FPUA 2XAOA 5AP3A 4MBLA 3SG9A 3PZHA 3ZONA 3BQCA 5DI1A 1OKYA 4EC8A 4ERWA 4UALA 3BCEA 5ANEA 4LQMA 3ZUUA 2XJ1A 4G3GA 3QGYA 3PIYA 3VULA 3BYVA 3W10A 3KREA 4I6FA 3KCKA 4USFA 1P14A 4Z7HA 5J9ZA 3VUHA 2X81A 3CS9A 4QP4A 2GQGA 3CGFA 3FMLA 4G2FA 4YJSA 4F7LA 4F7JA 3KFAA 4WRGA 4E8AA 1Y6BA 2HW6A 2NRYA 3GBZA 4XP3A 5E91A 4IVCA 4FYOA 3BWFA 3U4UA 3U9CA 3GCUA 2XM9A 4FSQA 4LOPA 1IA9A 2HZNA 3EZRA 3U51A 4F9CA 4FG9A 2JAMA 3LQ8A 2J2IB 5D41A 2FYSA 3KULB 3QQFA 1Y8YA 3P0MA 3ZTXA 3BLHA 4RX8A 3R9NA 4BYIA 3ORLA 2GS2A 1ST0A 3ML1A 4IM2A 3FXZA 3FUPA 3BGQA 3QQJA 2WAJA 3CY2A 3G6GA 4ONAA 1ZMWA 2XF0A 4UY9A 4Y72A 4V05A 1YRPA 4H58A 4QYYA 1A9UA 1NT2A 1W8CA 1WVYA 5HI2A 3MH1A 4YHFA 4AT3A 1GZOA 4JG8A 3ORZA 4NZWB 3D15A 4HGEA 5CNNA 2W1FA 3WF6A 2W96B 4PL3A 1NVQA 5AA9A 4JNWA 5CY3A 4C37A 3G15A 5EHLA 3QRTA 4I21A 1FVVA 4G9CA 4M8TA 4DFXE 1L8TA 4ZMFA 4MXAA 4DITA 2X4ZA 5AM7A 5A4LA 4QQCA 4IB5A 4YZBA 3DDPA 4UXLA 1LEWA 2WOUA 1A48A 3NUUA 4JBVA 5FXQA 4I6HA 4YGAA 1VYWA 2W5BA 2XKDA 1PXIA 2OWBA 3P4KA 4MCVA 5BYYA 2IPXA 3CJFA 2RKUA 3AT2A 4FTNA 1JWHA 1T46A 4GT5A 3BQRA 1K2PA 4Y73A 3TEIA 1ZYLA 3GGFA 2OJJA 2W9FB 2CGWA 2YJRA 4RJ7A 2J90A 4J97A 4BDCA 4CFWA 4CMUA 1J1CA 3CLYA 1BMKA 4F9AA 5F4NA 4ASXA 4YSJA 4O38A 1OI9A 4TW9A 3S2PA 3I6UA 5FDXA 2A2AA 2JKQA 2Y7JA 2X9FA 4GJ3A 4HGLA 3PSBA 5I9XA 4AW0A 3BU3A 3PWDA 3R02A 4R6VA 2BAKA 4E7WA 2VWZA 1UU8A 5CAQA 2AUHA 1BL6A 1MQBA 3LJ2A 3O8PA 4AOIA 3HV4A 2C5VA 2ZFYA 4ZS4A 4YHJA 4DYMA 5J8IA 4BJJA 3ORKA 1ST4A 1YXTA 4UWBA 2VTHA 1ZOGA 3E3BX 4MWHA 3FY2A 1YDSE 2CNQA 4FV3A 5BQ0A 4FNXA 2XIYA 5K4JA 1UWJA 4F9YA 2F7XE 2UW0A 4AWIA 2W0JA 4Q5EA 2YIXA 1RDQE 3N4TA 1J7IA 4EH8A 4WHZA 3PYYA 2VN9A 1UU9A 2BZKB 2QOLA 3FLZA 4GK2A 4KKGA 4RQKA 3BV2A 4RZVA 4XH6A 2UVZA 2ERZE 2WMWA
chains in the Genus database with same CATH topology
2ZMDA 4M3QA 1FQ1B 2PY3A 5C4KA 3E63A 3UMWA 2XRWA 3ORMA 4NM0A 3EFLA 4CZUA 4F0GA 3PXQA 5DNRA 3TDWA 3T8OA 2XAMA 3QZGA 4FC0A 3QUPA 2XA4A 5HU3A 3UO5A 3ZBXA 3SG8A 3UOHA 2GHLA 1M7NA 2JFMA 4I41A 3QD4A 1XHAA 4Y46A 3ULIA 4MXOA 2IVUA 2QONA 3KXMA 4E6AA 3CC6A 5EOBA 3R9DA 1Q8ZA 2XS0A 2J4ZA 4FNWA 4JX3A 3EN7A 5CVGA 5KHWA 4RLKA 4YZ9A 4FKGA 4DH1A 5IF1A 5F20A 2ESMA 2YCRA 4IAFA 3W1FA 2PPQA 3QC4A 4HZSA 3ZH8A 3K54A 2PVRA 2CMWA 2HW7A 3DKOA 4MBIA 3W0RA 3EQGA 3GCSA 2ZAZA 5IQGA 5AUVA 3RVGA 5DYJA 5CSWA 2UZLA 1XH8A 4E1ZA 2CGVA 3VRYA 5IQCA 5M57A 2F2CB 2WIPA 4FTLA 1GAGA 3HV6A 3COMA 3ULZA 2E2BA 3M2WA 3MY1A 4AFEA 2BTSA 2UVYA 2CPKE 4D4VA 3F82A 1ZMUA 4J7BA 2F57A 3C0IA 1YW2A 4ENXA 3CCNA 5AV3A 4X21A 5C27A 4YPDA 4F9WA 2XCHA 1FBNA 2JD5A 3U9NA 5FDPA 3TNPC 5DT3A 1CKJA 2QO9A 3ENMA 4H3BA 4UWCA 4O0XA 1AGWA 1XWSA 1M14A 3LMHA 4FI1A 4U0IA 5FP6A 4AT5A 4AW5A 3FPQA 4QTCA 4D4SA 3KRRA 3VUDA 1L3RE 2C6KA 3F9NA 4BI2A 1Q8WA 1OGUA 2QOIA 3CXWA 2ZJWA 3FBVA 4FTAA 4I5MA 4C3RA 4TXCA 4D4RA 4QMQA 3PG1A 5CLPA 1OBDA 2EU9A 4FIFA 5LCKA 4DBXA 4AA0A 4ZY4A 4FBXA 2BUJA 2HELA 2CCHA 4AE9A 3WIKA 4CTBA 2I1MA 1XMLA 3GENA 1CM8A 3WZKA 2XK6A 3TV4A 2XYUA 4J96A 3OWJA 4FKRA 1YDRE 3QL8A 3EJ1A 4YZDA 3P7AA 4BDAA 3ANQA 3UMXA 4RIWB 4U9AA 5KMJA 3FXWA 3R28A 2BRNA 4FZFB 4QO9A 4EH5A 3WF5A 4EL9A 5FXRA 2UV2A 1IRKA 2QOBA 1WVWA 4FIHA 1YWVA 3BBWA 5DPVA 3TKIA 3D5WA 3VIDA 4CFXA 4FL3A 3II5A 3ZMMA 3D5VA 3TJCA 4DTBA 3SOCA 3UO6A 1H0WA 2J0KA 3KN6A 2QLUA 3Q4CA 5K5NA 4KBAA 4FGRA 5CAOA 5I0BA 3GC0A 1Y57A 1H07A 3UDZA 1W98A 5FUTA 2I0HA 2QLQA 4E4LA 2I0EA 2R7IA 3C4ZA 4PF4A 4AAAA 3HVCA 1NA7A 3IW5A 4DEGA 4ZZOA 2B52A 2R5TA 1VZOA 3QXOA 2WTDA 4FKQA 3ZZEA 4BCKA 2OZAA 5E8XA 4P5QA 3WBLA 2VTAA 2WXVA 3PSCA 4J52A 4EOQA 4O7YA 1UU7A 4TN6A 4C34A 3W8QA 4CKRA 3FQHA 4C38A 4AA5A 1Q99A 3TWJA 5KMIA 3Q5ZA 4KBKA 4OR5A 3VRZA 3SD0A 4J95A 2OJFE 3IO7A 3KCFA 1Q97A 4I24A 3ZYAA 3L8PA 2AEGA 5AP6A 4D9UA 3KXXA 4JVGA 4AS0A 2E9VA 2HCKA 4MD8E 4I0RA 5CEQA 3RNIA 3A7HA 3LZBA 3P23A 4L3JA 3MBLA 3IG7A 4FKIA 5HCZA 4A4LA 4RIYB 3ZO1A 3FI4A 4GKIA 2AC5A 2OLCA 4LFIA 2PU8A 1U59A 5BVNA 1FVTA 3FYKX 3KU2A 4FODA 5AAEA 5BPYA 4DEBA 2OF2A 1U46A 4QMSA 4E26A 2ERKA 5D7AA 1RJBA 4QMWA 2B55A 4XV9A 3VS1A 2JIUA 1ZOEA 3LXPA 2F7EE 4S34A 3I81A 1K9AA 2YAKA 3F7ZA 4C33A 3F3UA 4ZZMA 3VJOA 3RAHA 5LARA 4FEQA 4QMXA 2XEZA 2BROA 2YIYA 4AQKA 3DKFA 3OXZA 5HG8A 4C7TA 4YC3A 1URWA 3VNTA 4R1VA 4W4VA 5IA0A 4EKLA 3R7IA 4RG0A 2CNUA 4DFZE 4FIGA 3AD5A 3V5WA 2O5KA 3T3VA 2PSQA 4EEVA 3FXXA 2WD1A 4NW5A 5ANGA 4D55A 4BBEA 4WNPA 2YITA 4ACMA 3DTCA 4BYJA 3FZPA 3E8EA 5GIOE 4ZJIA 3U4WA 3G2FA 1H1WA 5HU9A 4R78A 3NAYA 3OTUA 4FSZA 2CKOA 4M68A 3G5DA 5GJFA 4BB4A 4FA2A 2YDIA 4FTJA 4IIRA 3QZFA 4LRKA 4RJ5A 4RPVA 3FDNA 4NUSA 3U87A 3OOMA 4FIJA 4TWPA 4UZDA 5TR6A 5E92A 5HD7A 3H10A 4E5WA 4QQTA 1VEBA 2ITQA 4JBPA 4MH7A 4NK9A 4XRLA 4BTJA 3RI1A 2GNJA 4O2ZA 4FL1A 4NYEA 4Q2AA 2YM7A 5HNIX 1Q4LA 4A9UA 2O64A 4X3FB 5ETFA 3JY0A 3TUCA 3EFKA 4IB3A 4LGHA 2R3QA 3KMWA 1GIHA 3DT1A 4JR3A 4M7IA 4AN9A 3PRIA 1OECA 2RFSA 4PDPA 4E6QA 3F2AA 2FUMA 3R7YA 2BFXA 4CGAA 4O7RA 3UVRA 2GFCA 1XKKA 4XRJA 5KBRA 2C1AA 2CKPA 5DR6A 3C4WA 4ASDA 3UZTA 2BPMA 3WE4A 2RFEA 5J9LA 5FXSA 5BVFA 2VTPA 3HKOA 3NW5A 4JMQA 4L3LA 4MXCA 5EYCA 3ZM4A 4BDGA 3WOWA 4ASZA 2BTRA 2C69A 2OBJA 5HNBA 3LCSA 3QYZA 3OXIA 4TZRA 3UOJA 1YKRA 2GS7A 4DG3E 3OEFX 3TMOA 4IFGA 2VTJA 3WI6A 4EBVA 3MI9A 3RAWA 4P4CA 3A7IA 3VS3A 3QD3A 4UBAA 3UP2A 4UYAA 1V0OA 2JIIA 4C58A 3FL5A 2HZ4A 4LMNA 4AACA 3ALNA 2VTLA 3VVHA 3FPMA 4AW1A 4O0TA 4CFUA 5T3QA 3LE6A 1H26A 2VWXA 1M7QA 3BV3A 1H28A 4FGBA 1JKKA 5HTCA 3DK7A 4RC2A 1YXSA 3M11A 1IR3A 2C4GA 2J0JA 4YSMA 3GC9A 4I4EA 4C0TA 4EONA 4XS2A 3NS9A 4YTIA 5HCYA 2XK3A 4A7CA 5A3XA 4F70A 4O7ZA 1WBNA 2RL5A 4DHIB 4NWMA 3V5QA 3RK5A 3IW8A 1ZRZA 4NJ3A 2GNFA 3COKA 4YURA 3BHVA 4PDYA 3AC8A 3MH0A 3ZLSA 4FTCA 4E5BA 4PQNA 3A4PA 4FEVA 4AGWA 3ZXTA 1H24A 3I0OA 4KKHA 3AQVA 3WARA 4AZFA 5CANA 4BDHA 4QDEA 4LL0A 1OL2A 2C6EA 4OTIA 4FKTA 2XANA 5C26A 4LGGA 3JY9A 2IO6A 4L42A 4YZMA 4O22A 4EH2A 3BLAA 4F4PA 3F2RA 4F7SA 1A06A 4OT6A 5M53A 4Z3VA 4O6EA 4K0YA 2EVAA 1XH5A 4H3PA 3SQQA 3CY3A 4JOAA 4DHFA 3PPKA 2X2KA 3Q9XA 1SVHA 4KIPA 1YHSA 4EHVA 4TTHB 3Q53A 3FYJX 3E8CA 4TNBA 4Z9LA 4BCQA 5C8NA 2BKKA 3FLNC 5E8YA 3QQUA 4AGCA 3VHEA 2C3IB 1R1WA 2OXXA 4HJOA 2XBAA 4L67A 3E64A 5AV2A 4KIQA 1DS5A 2C47A 2YIWA 3PY0A 3VF9A 3FZRA 4FT7A 2W1DA 3PZEA 5KMLA 3OROA 5AV4A 2VTIA 1QPEA 4CMTA 2H8HA 1OL1A 4FZ7A 2VX3A 3PJCA 3R7OA 4I4FA 3UZPA 3QKKA 3TDVA 1OGYA 2W1EA 5EQPA 5FBNC 1OPJA 3OMVA 3BZ3A 3RWQA 3R6XA 5HG5A 4IZ7A 4FKWA 4NM5A 5I4NA 4EWQA 4FEWA 1GNGA 4OBPA 4W8EA 3NVKI 3Q96A 4FTRA 3UC4A 4RSSA 4ZSGA 4CSVA 4JT3A 3O71A 4YLJA 3ZHPC 3HRFA 5LVLA 4P5ZA 3WILA 1YWNA 3OFMA 4XEYA 4AZEA 5IEVA 3QXPA 1U54B 3D7TA 4NM7A 5C8KA 1STCE 4ACHA 1R3CA 2GNHA 4H39A 4QNYA 3BI6A 1OM1A 4BZNA 4U97A 5HVYA 4X3JA 2GNGA 2J5EA 5CF8A 3NMUF 3PPZA 4WSYA 3DV3A 5LQFA 2BZIB 2ITNA 3KXZA 4DBNA 3MB7A 4XX9A 1OB3A 2VO6A 4PX6A 5DLSA 5FEQA 1EH4A 5HIDA 4D0XA 3ANRA 5CEIA 4WOVA 4BY9E 3LXLA 5ANDA 1PYXA 2A27A 1Q8TA 4HPTE 4MXYA 3O50A 4XG2A 5EW9A 5I9VA 1ND4A 5G1XA 2QC6A 2IVTA 4L52A 2IW8A 5JFSA 3FLSA 3NWWA 1ZAOA 5E8ZA 3QWJA 4ZJJA 2X4FA 3NCGA 2HXQA 4D2SA 4EWHA 2QD9A 3R7UA 2PZRA 4RIXB 3AC4A 1XH6A 2VO7A 3ZSIA 3TCPA 4EQCA 2QO7A 4BDJA 2FSLX 3DA6A 4IVDA 4EHZA 4PNKA 4ZSJA 1Q8UA 1PJKA 3FHRA 2O0UA 2BIYA 4GFGA 4ANLA 5DR9A 2ITUA 4FG8A 4DCAA 2A0CX 2OFVA 3WF7A 5EI2A 4K8AA 4WKQA 3RPOA 4EQMA 3A61A 2RFNA 2WEVA 2J0MB 4FSMA 4P90A 4YZNA 4FZAB 3K5VA 3TXOA 3ZU7A 2O2UA 4X0MA 4EH9A 3QALE 5GHVA 4F78A 3EQBA 3QZIA 4S2ZA 4CFNA 3VUMA 2BHHA 4ANBA 3ZXZA 2QU6A 5JH6A 1F5QA 2NNWB 3BU5A 3HMMA 1OUYA 5KZ0A 4G6LA 2ZYBA 1GIIA 2XALA 4MXZA 3TM0A 3UYSA 1OBGA 2OXYA 2UZUE 2ZB0A 4IAYA 2CDZA 2EWAA 2XKEA 4JJRA 4WG4A 3KMUA 5AX3A 3G0EA 3K3JA 4FOCA 4ACDA 4AUAA 5IH6A 4QT1A 3QTXA 4D28A 2ZDTA 1I09A 2HENA 2I6LA 4XOZA 4ITJA 1UNGA 3FJQE 4ITIA 2YEXA 4I1ZA 3LM0A 3MTLA 3HA8A 4R1YA 3GC8A 3O7LB 3F2NA 4YTHA 3EQFA 4YNEA 1IAJA 3R9HA 5DH3A 5JGBA 3TIYA 1B39A 3OP5A 2VTNA 3LFAA 4CV8A 3FC1X 5CX9A 3ROCA 4D1SA 3KRXA 5HE3A 2PE2A 2QR8A 3ENHA 4E4MA 3FKLA 4TWNA 5H8EA 3UPZA 3I5ZA 3W0OA 2F4JA 5EI8A 2BIKB 2WQNA 2BRHA 2NPQA 4PWNA 3FZOA 3CPCA 4TWCA 5ANJA 5L6PA 5ETAA 3GP0A 4X2NA 3NX8A 3VC4A 3ZBFA 2B53A 2WZJA 3UQCA 1MRUA 3HRBA 2ZM1A 3IDPA 4U8ZA 5EFQA 2JDVA 3THBA 2NRUA 4XCUA 5EQYA 5CXHA 3B2TA 2C5YA 5AX9A 5IUIA 2PMLX 3KKVA 2ZV7A 5EYDA 3DZOA 3I1AA 4I6LA 4ZSEA 3FY0A 5E1SA 5JQ8A 3OUKA 1WBSA 5T6KA 3DXPA 2CCIA 2LAVA 2KULA 4H1JA 2BR1A 2XMYA 3K5UA 4Q9SA 4BCFA 4NTSA 5DOSA 4PMSA 4U45A 4K2RA 3LHJA 3QFVA 4FNYA 1H1PA 2HK5A 3ORPA 3UGCA 4BCOA 4F9BA 4A9SA 5JFWA 4FMQA 4IEBA 3S4QA 3VUGA 1M2PA 2YA9A 3E62A 4QP3A 4EH7A 5DHJA 3GVUA 3ZC5A 4KABA 3B2WA 3JYAA 4IB1A 5CTPA 3HAVA 4JRVA 4I0SA 5BVWA 4FKLA 1U4DA 3HZTA 4CLJA 5IISA 3LM5A 4M13A 1PXNA 2VD5A 4LUEA 4A9YA 2YERA 3FQEA 4BCIA 3F69A 4ZAUA 1SMHA 2X7FA 5AIKA 3C7QA 5FBOA 4WA9A 5C03A 1XH7A 1O6KA 3OCSA 4LM5A 3HX4A 2ZVAA 1LUFA 4CFVA 4GK4A 3R00A 3W55A 3P7CA 2YJSA 2UZBA 3E87A 3MWUA 5AV0A 3OWPA 2YIQA 3R1NA 3ZZWA 3L8XA 4DFYA 3E8NA 1PHKA 3EOCA 3GI3A 4UV0A 3MYGA 4TY1A 3KVWA 5AUXA 3ZUTA 3LLAA 3PFQA 1VR2A 3EWHA 4N6YA 2ONLC 4PV0A 3ZDUA 3PJ3A 1HCLA 4F6SA 3IQ7A 5IUHA 4JG7A 4KRDA 3F3VA 4DN5A 5CEPA 3F7WA 5LVMA 2UW5A 4AQCA 4K9YA 5J87A 4ZP5A 2G9XA 2ETKA 3O7LD 2WMUA 5B0XA 3TKHA 1YXUA 3O17A 4GG7A 3BRBA 2UZVA 3ZDIA 3TYKA 2G1TA 1Q8YA 2ETRA 4BCPA 2QOCA 3R30A 3DGKA 4BN1A 4GU9A 1OZ1A 4ASEA 2EUFB 3F66A 3VJNA 4I94A 1E1VA 2AC3A 4LV5A 4EUTA 2C5XA 1U5RA 4BICA 4PTCA 3FEGA 1YI4A 4FX3A 4DE4A 5HZNA 3W0SA 2WTIA 4X3FC 5H8GA 4EORA 3GFWA 1GZKA 2QHNA 3JPVA 3MIAA 4BBMA 3KK8A 3GU5A 4F99A 4ITHA 3HECA 3OVVA 4JBQA 4FEXA 1H4LA 1PXKA 1H25A 3DZQA 1TQMA 4YJOA 4YP8A 3G33A 5CSHA 1SNUA 4R5SA 5IQFA 5EW3A 2J5FA 3KGAA 4X2KA 4YHTA 4PL5A 4YJQA 3R71A 5LMAA 2R7BA 4WNMA 4TNDA 1H1SA 2W1CA 2PWLA 2ITXA 3F88A 2VNYA 3PIZA 4BCNA 3PPJA 4FVPA 3TUBA 2QR7A 4BTFA 1BL7A 2E9OA 2V7OA 4IAKA 3GNIB 5IDNA 3QTSA 2W17A 5AUYA 1KV1A 3BKBA 3KF4A 3RAIA 4QTBA 3ZRKA 2VNWA 3R9OA 5C4LA 5J9YA 3KXNA 4IWOA 2ITWA 3RAKA 2NP8A 3R2YA 3NAXA 3DJ6A 5CVFA 2VWWA 4AN3A 5JMSA 2H9VA 4RT7A 3WYXA 3ODZX 3R8LA 2OJGA 3DK3A 4TYHA 3BEGA 3VS7A 4CT1A 2GS6A 3WE8A 4MBJA 3S0OA 2XM8A 4V0GA 2OW3A 2Y9QA 1WBTA 3BYOA 3WZUA 3DFCB 4DH3A 1P4FA 2FSOX 4FICA 3KB7A 4G9RA 4IC8A 3WZDA 3IGOA 2JDOA 4JIKA 2YZLA 4H3QA 3SRVB 4X2JA 4XG9A 3HP5A 5HE0A 4ZLOA 4UZHA 1ZY4A 2W1HA 1FGKA 2C6MA 3DY7A 2NYAA 1YOLA 3FSFA 3JVRA 4JAIA 1CMKE 2J9MA 2IN6A 4Y5HA 4QP7A 1PY5A 2PL0A 2VO3A 4O7LA 5HGIA 4PRJA 1XH9A 4ANSA 4FIIA 3JS2A 4UB7A 3DNEA 3L8VA 4K1BA 2PVLA 4HYUA 4KIOA 1ZYDA 3ZO3A 5C1QB 3TZ9A 1KV2A 5BYZA 4TT7A 2GDOA 3FMHA 3LFSA 2J7TA 2XNOA 2XZSA 3OY1A 1MRYA 4FOBA 1ZZLA 5CU6A 2VZ6A 1NVSA 3VS5A 3ZLWA 4DT8A 3OW4A 3DKGA 3MA6A 3VQUA 4B0GA 5CQUA 3QHWA 2XRUA 3BL9A 4QYFA 4WBOA 4XG8A 5HNGA 3F5GA 3IPHA 4D4YA 5IQBA 2R3RA 3UIUA 2C3KA 5AA8A 2VWIA 3KQ7A 2EXCX 1ZZ2A 4B8LA 5JQ5A 4BHNA 3W2RA 3JXWA 4O96A 4BDBA 5BV3A 2XNGA 1WBOA 5BUEA 2B4SB 4XHKB 4FT9A 2WTJA 4EBWA 1BYGA 2EB3A 3NUNA 4AU8A 4I20A 5FGKA 1KSWA 4IHPA 3DAEA 3FI2A 4M97A 3RK9A 5GINE 3PJ2A 5K9IA 3LIJA 4NL0A 5M55A 4Q5HA 2I7QA 4XG4A 5EM8A 4DTKA 4ZTMA 4USEA 5M4IA 4QP6A 4CCUA 3LFNA 5HKMA 3TNHA 5M51A 5AP7A 5ETCA 2JKOA 5BYLA 5D12A 4AP7A 5LVPA 3H9RA 4C4HA 2WQBA 3QCSA 3M1SA 4JL9A 4EK4A 3D2IA 3IS5A 2UW9A 4NCTC 4EK8A 1H8FA 4UX9A 2HY0A 5HVJA 3MVJA 5ANIA 3NLBA 4HOKA 4OT5A 3UODA 5EQEA 5CEKA 5KKRB 4YJNA 1Q62A 3UYTA 4GKHA 1JBPE 3EZVA 4E5AX 4BGGA 2C6LA 5LWNA 2PUNA 3LJ1A 3QRUA 5M4FA 1CKPA 2DS1A 2PVYA 3OG7A 5CAVA 5HLWA 3E3PA 4C4IA 4TPTA 5HE1A 3PE1A 2I0VA 3VHKA 4E4XA 4MX9A 2PULA 5CYIA 5M44A 3I7CA 3H0ZA 3NW7A 4CT2A 3OZ6A 3DB8A 1H01A 4QQ5A 2JKMA 4C59A 3W2OA 4IDVA 4IE9A 2UW8A 5JFXA 1Q41A 3AKJA 4GEOA 4GYIA 2W05A 3NYVA 2JKKA 4P2KA 2QOOA 4NKAA 3UG1A 5A4TA 4I5PA 5KMKA 2OIQA 3W2QA 1UA2A 2OICA 5IH4A 2UZOA 3C5UA 2JDTA 4D2RA 4C61A 3BGPA 1NVRA 2JIVA 2CHLA 2ITVA 4R3CA 4WRSA 2X39A 4YUQA 2GQRA 3NYNA 5IU2A 1YXVA 2Z8CA 4GSBA 5CENA 5BUJA 3BHYA 3Q9YA 4EOSA 3CGOA 3QZHA 4FG7A 5BX0A 3Q6WA 5HESA 3R8UA 5J7HA 2ZDUA 4U79A 2OGVA 2XNMA 5E8SA 2BAQA 3OXTA 4BRXA 1OITA 5LOHA 3OT3A 3TIZA 5CT7A 1G3NA 5J95A 2Y4IB 4AF3A 4D9TA 4YBJA 2PVFA 2REIA 4YBKA 5AP0A 2YM3A 2RF9A 4YNOA 3LLTA 4X2GA 3EKNA 5CI7A 3DS6A 4BC6A 3DBFA 5KMNA 2QNJA 1QL6A 4K77A 3OS3A 4GS6A 3PXZA 2XKFA 3GUBA 3F5UA 4I0TA 2LGCA 3MGYA 3HAMA 3TI1A 3ZC6A 3FL4A 1LR4A 3ACKA 3Q32A 3P7BA 4JQ7A 4O21A 1T45A 4G3EA 4QP2A 2WNTA 3WYYA 3EQRA 5M08A 3H0YA 3SXRA 2H6DA 2QURA 3QKLA 4U40A 3R1YA 5JGAA 4GT3A 4YU2A 5K5XA 3OUNB 2ZM3A 2XK4A 5AIRA 2W1IA 5KNJA 4D1ZA 5KBQA 5EKNA 2W06A 4MHAA 3LXNA 5ANOA 5HCXA 4O0VA 4F64A 4LV8A 4CMOA 5CF4A 3QCQA 4GV1A 4KAOA 2PUPA 4LUDA 2OI4X 3T9TA 4LOQA 4R3PA 1BLXA 1OMWA 3LCOA 4QEBA 4FKOA 4DG2E 5B2KA 3ORNA 4V01A 3KF7A 2VTRA 3HDNA 2OFUA 2OH4A 3MY0A 2UUEA 4NIFB 3TN8A 2HAKA 4CG8A 4XMOA 2UZDA 4OLIA 4PMPA 4QTAA 1ZYSA 4JIAA 4FK3A 5HBJA 2F49A 5I9WA 4QMMA 1UKIA 2E9PA 2X9EA 2YAAA 2V55A 5FTGA 3JVSA 5JGDA 1G8JA 2QODA 4CCBA 1CDKA 3V3VA 4XJ0A 3G90X 3O51A 1JSUA 3A2CA 1CSNA 3MFRA 3QD0A 5JN2A 1Z9XA 2X2LA 3FI3A 5E4HA 4I6QA 1UWHA 3QTZA 5L6OA 2WMAA 3DBDA 4KA3A 5FTQA 3V5LA 4A06A 3ODYX 5HD4A 3UPXA 1FGIA 3I4BA 5TO8A 3V6SA 3TUDA 4NT4A 5FM3A 5HQ0A 4PDSA 3MH3A 4A07A 4DAWA 4HYIA 4U43A 4DGNA 3QQKA 4PTEA 2PMNX 3RPRA 5HLPA 4AG8A 3LXKA 4G16A 4EQUA 3P78A 3IOPA 4NM3A 3AMBA 4GK3A 5AWMA 2WB8A 4OTFA 3CD3A 1P2AA 2Z2WA 3QTIA 1JAMA 4QTEA 5BVDA 2UZNA 2W99B 2WTKB 3G9LX 3PVGA 4PMMA 3MY5A 1Q5KA 5DT0A 4TRLA 4AOJA 3U6JA 1I44A 5CU4A 2PUUA 4E4NA 5JFVA 1M52A 4FTMA 4EOPA 2YM4A 4G1WA 4NH1A 1VLRA 4RC4A 4QP1A 1YVJA 3BBTB 1J1BA 3OWKA 4D58A 4RWJA 4U3ZA 3LFEA 3ZFXA 4NFNA 3D83A 3MTFA 3EYHA 4MD9E 1AQ1A 4I92A 4MKCA 4W4XA 4O81A 3F3WA 4FTTA 4IB0A 3ZO4A 4QDVA 4RVMA 2YM6A 2Z7LA 5EYKA 3RK7A 3V01A 5HO8A 3Q52A 2IZSA 4F6WA 4EH3A 1GY3A 1OKZA 4BR3A 5IH5A 1DM2A 5CAPA 4RX9A 1YHWA 4G6NA 1BX6A 2NO3A 3HUBA 3W18A 5HHWA 2RG5A 3PVBA 5KO1A 4IZAA 3HYHA 4FKJA 2R3MA 3FMEA 5DBXA 3BL7A 4G3DA 3UDSA 4NSTA 3RCJA 4YC6A 3ALOA 5HBEA 4HVGA 4ZK5A 2FH9A 2GSFA 1OIQA 4UYNA 5KZIA 2HOGA 1R78A 2GHGA 3TV7A 4EOKA 3PE2A 4RJ4A 3TACA 4DT9A 3NGAA 4DFUA 3AOXA 1G8KA 3IKAA 4L00A 3L9MA 3ELJA 3SC1A 2JBOA 3MVHA 4RJ6A 3R8PA 1XH4A 4X6RA 1TQPA 5ANKA 3V5JA 4FEUA 3SXFA 5JT2A 4F63A 2HWPA 3R9RA 1Y8GA 3HMPA 3W2CA 4K11A 5I5ZA 1LPUA 3LCTA 1URCA 2VAGA 3FSKA 3NFGB 3QQHA 2J50A 5JEBA 5AAGA 3K2LA 4HGTA 4WBBB 4ZXTA 3DB6A 3QLGA 3CP9A 5DWRA 2CN8A 3CPBA 3QA0A 4U81A 4D0WA 4FTOA 5TT7A 5J1VA 2WEIA 4KRCA 2C0OA 4AZTA 1NXKA 3MPAA 4FV6A 4CRLA 3W0MA 1H00A 3MIYA 2YIRA 4XUFA 5L2TA 2JDRA 5DRBA 4ZEGA 4KSQA 3DXNA 4HVHA 3HV3A 3UJGA 4Y5QA 1J91A 2Z02A 4MXXA 3ZO2A 1O9UA 1KOBA 3ID6C 5EH0A 4DGGA 2JBPA 1DI8A 1NY3A 2YDJA 4XNEA 4GRBA 2CN5A 4M0YA 3QD2B 4BDFA 1JKSA 4RJ8A 3BE9A 3FKOA 5EDQA 3E92A 4DDIA 1IAHA 4B6LA 3ET7A 5AUZA 5CEMA 1XQZA 3A7FA 3RM6A 3TG1A 4B9DA 1WFCA 4DDGA 3COHA 5IDPA 5LMBA 1Q24A 3FLQA 2X0GA 3QQGA 5CSXA 4QMVA 3E7OA 3GFEA 1OIUA 3GXLA 3TV6A 3LQ5A 3FC2A 5DEWA 5C8MA 2R3GA 4NU1A 1O6YA 4RMZA 1XO2B 3NUXA 4IVBA 4X7QA 4EOJA 1M2RA 5J5SA 4BJJB 1PXPA 1OL5A 4GL9A 4BDIA 4PP9A 5IMXA 5M56A 1OKVA 1QPJA 1XJDA 2OXDA 3ORXA 5F95A 4GU6A 4PY1A 1FMKA 4YLKA 4ZY5A 2ZB1A 2RGPA 4EOMA 3CKXA 2Z60A 4FVRA 3L8SA 3P9JA 2JLDA 2WU7A 4FV0A 4BTMA 4MVFA 4RFYA 3LJ0A 4OW8A 4B99A 2PHKA 3OD6X 1UVRA 3D9VA 4DGOA 4K18A 5ACBC 3CR0A 3H9FA 5I9ZA 1XR1A 3C1XA 2PZIA 4IDTA 3A7JA 5JZJA 2BZJA 3UVQA 3GB2A 4HW7A 4ZSLA 5GJDA 4I3ZA 2Y4PA 4AZWA 3HNGA 2QHMA 3N9XA 3ORTA 3Q3BA 5AFVA 2XP2A 3EYGA 5AP4A 3RMFA 3GOKA 5KHXA 4DGLC 5LVNA 5CU0A 3VS2A 2W4JA 3QBNA 4ZTRA 5A4CA 4L3PA 4M15A 2RG6A 3W8LA 5H8BA 3FE3A 2CJMA 4ACCA 4RVLA 2WMXA 3QWKA 4J99A 2WKMA 4QYGA 4O0WA 3FZ1A 4UWYA 4I5HA 2Z7SA 4WIHA 1PMUA 5A9UA 2P3GX 3CE3A 3CTQA 4PNIA 5CAUA 1W0XC 4QMTA 3A99A 3LKMA 3QX2A 5AMNA 3Q4ZA 2BDJA 3H4JA 4FV7A 4XBUA 3VS6A 4A4OA 1JQHA 1PXOA 3QAME 4M14A 5IZFA 5EOLA 3QA8A 2V7AA 4P7EA 5M07A 2XBJA <