4AQKA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase in complex with adp and ip6
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
437
structure length
414
Chain Sequence
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICREGRPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Apo Form of Insp5 2-K from Arabidopsis Thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 127
structure length 414
sequence length 437
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aqkA01
4AXFA 4AXEA 4AQKA 2XAOA 4LV7A 4AXDA 2XARA 3UDZA 3UDSA 2XALA 3UDTA 4AXCA 2XAMA 2XANA
chains in the Genus database with same CATH superfamily
5AV2A 3KQ7A 4Q9ZA 2XCHA 4E5WA 5L6OA 4C2WA 3FUPA 2RFNA 3NCGA 2OIQA 1PXJA 3KIOC 4USDA 4OTIA 4L43A 4DC2A 4CRLA 5H8BA 3K3JA 1OITA 4M8TA 3VC4A 3NIEA 1ZYDA 4HOKA 4XP2A 2QOIA 3ZLWA 4C4JA 5AA9A 3PJ3A 4D9UA 4AS0A 4C4EA 4JS8A 5JGBA 2JAVA 2QR8A 4BCMA 2IO6A 3CPCA 3OZ6A 4RIWB 2XEYA 4UEUA 3VHKA 4RWJA 3W0QA 5IH4A 4HVGA 3BRBA 4XP0A 4PNKA 5HZNA 5HO7A 3RPRA 2OIBA 3W0OA 3PJCA 4QP2A 5AA8A 4KSPA 1Q61A 4I4FA 2QURA 3KA0A 4QDEA 4YTHA 4BJJA 3CPBA 3LQ3A 3TJCA 5KMKA 3CSVA 5FEDA 4EQMA 4EKKA 3SOAA 4FSMA 1FQ1B 3VRZA 3R6XA 1JLUE 2YCRA 3TV7A 4PL3A 3VQHA 5ANKA 2XB7A 3R83A 3TCPA 2OBJA 3U9CA 4I5HA 4FTKA 4YBKA 3UJGA 4BCQA 4BTMA 2WQOA 5M07A 2R3FA 2Q83A 4RC4A 5KZ0A 3U8WA 3NIZA 3AKJA 2ZV2A 4O0UA 4ZSJA 4PF4A 3PJ8A 3RPSA 4EH2A 4O0TA 3RI1A 3AT3A 5FBOA 4C61A 4C37A 4YZNA 2BRBA 2UZDA 3DTWA 4L3LA 4IVAA 1R78A 2WOTA 4K18A 2I0EA 2WQNA 3S2PA 3TV4A 4ZOGA 5LVOA 3MPAA 3S1HA 2WPAA 5CI6A 1PXMA 3UYTA 1HCLA 4LMUA 2XA4A 3N4VA 5DPVA 5C9CA 2R3QA 4EKLA 4IMYA 2A2AA 5B2MA 5LVNA 1JNKA 3WF9A 4FG9A 2QU5A 1PKDA 4IX3A 2BAJA 4QNAA 3E5AA 1LPUA 1GJOA 3BV2A 4IJ9A 3BYOA 1G8JA 5CEIA 2ITYA 1PYEA 3GC9A 4Z9LA 3OT8A 3MY5A 3WE8A 3VN9A 5H9BA 4ZK5A 3ZOSA 2RIOA 1O6LA 2IJMA 3W0PA 2OH0E 1OGUA 2XIXA 3Q9YA 4F0IA 4MD7E 5KZIA 3N51A 2VWYA 3QZIA 4UV0A 4DG2E 3NNVA 3RPVA 3QCXA 4EYMA 4KS8A 4WNOA 4FKOA 1U5RA 3MJ1A 4D58A 2RFSA 2J50A 4JIKA 4O21A 3R8ZA 2VO0A 5EYMA 2YAAA 3IDCA 1IA8A 3MH0A 2QC6A 3KRWA 3VQUA 4C3PA 3TIZA 4AGCA 4R3PA 4JVGA 2JBOA 2UW0A 3GB2A 3D4QA 4AW5A 2I1MA 3V8TA 3NUNA 4BCGA 3ZUVA 5A14A 2XIZA 3A60A 3SG9A 2WEVA 3CBLA 4AXDA 3PYYA 4RVLA 5EDQA 3KC3A 4XV2A 2G15A 2QOKA 3FV8A 2NNWB 4FTMA 3BWFA 4B4LA 4IEBA 4F78A 5JGDA 4TZRA 2BROA 3PSBA 5BVNA 4LFIA 2BTRA 3KVXA 4PNIA 3LFCA 2HENA 3C7QA 4D4RA 1KOAA 5LVPA 2IPXA 2XEZA 5CEPA 4MVFA 4O6EA 4U41A 4YPSA 4O0XA 3ULIA 1WBTA 3I6WA 1W0XC 3H9OA 3CS9A 4M0YA 4X2FA 3MSSA 4YTIA 1TQPA 2BZJA 3IDBA 5E1SA 1F0QA 4U42A 4IH8A 3QQKA 4WNKA 3ORZA 5AUWA 2R3LA 4G5JA 3Q32A 4CEGA 3BYMA 3UZTA 2VAGA 1E9HA 4YO6A 3ET7A 4J8MA 4F09A 2Z02A 3EQBA 4IAYA 3CEKA 4MD9E 5CLPA 3WF5A 1OKZA 4C02A 4JQ8A 4QMXA 4DGGA 3M42A 3W16A 4AZFA 1FINA 4QQJA 2A19B 4LRJA 3NUSA 4NH1A 3G9LX 4OT5A 1KE6A 4RA4A 1W98A 3NLBA 4RX5A 3KXZA 1FVVA 1MQBA 2UZNA 2WQMA 4G3EA 4ZZMA 4LRMA 3T9TA 2NO3A 3PFQA 4O7YA 2ZYBA 2C6DA 4F0FA 4R7HA 4FK6A 4M67A 1ZXEA 4C35A 2YM7A 2AC5A 2YJRA 3DOGA 3QF9A 4U3YA 1J1BA 4Y5HA 4CKIA 3VBQA 2X0GA 2V22A 3JUHA 3L8VA 4Z7HA 5JSMA 4EJ7A 5BVFA 3T8OA 4RWIA 4W8EA 2OSCA 3DFCB 4MX9A 3RHXA 4FV4A 4LMNA 3KMWA 2VO3A 3BBWA 1PXKA 3EKNA 1KV2A 2BFXA 1Q24A 3HMNA 4QTCA 4RRVA 5EM5A 4AOTA 2IVUA 1QL6A 5HVJA 3L9MA 5GJGA 3R9OA 4HVHA 1YXXA 2XKDA 4RZWA 2R3NA 5CTPA 4C33A 2VZ6A 1P4FA 4DDIA 4I0SA 3PE1A 1XH8A 1M17A 1M2PA 5EK7A 3JVRA 3P08A 3F66A 2GSFA 2VX1A 3KF7A 2CJMA 3UOLA 4QMSA 3DV3A 5EI8A 2BTSA 4RFZA 1ZRZA 3EQFA 4RIXB 2Y0AA 3SRVB 3ZRMA 2UZOA 5DH3A 2J9MA 3E8NA 4I6HA 4UY9A 5HBEA 3LFQA 1OKWA 1S9IA 4ACMA 2Y4IC 3F61A 4FTRA 2WNTA 2GQSA 2V0DA 2GTMA 3NVMB 3V5TA 3BI6A 2B55A 3OCBA 4AZEA 3C9WA 3R7VA 4E26A 3EQIA 3BQRA 4AXCA 3KK9A 4AA5A 3D94A 2VTJA 4RJ8A 5BVWA 3R9NA 5C1QB 4GH2A 5KMOA 4AX8A 4D0WA 4K33A 3FSKA 3MFUA 3TV6A 3Q96A 2NRYA 3ROYA 2GNFA 1GAGA 2QOCA 2XALA 3LFBA 4M69B 5CZIA 5FLFA 5TKDA 3W0MA 3LJ1A 4I5CA 4JBVA 3ORTA 3QD2B 4GFOA 4H36A 1SVGA 1M14A 3PWYA 4RIYB 5M4FA 2WMXA 3QKLA 1ZMWA 2CN5A 3W0RA 4FT7A 3R8LA 4YUQA 3CTJA 1PKGA 3TKUA 1FGKA 1WVXA 4H58A 5L8LA 2FVDA 2HYYA 5E8SA 4A4LA 1YWVA 4L7FA 4ASEA 3R73A 5DR9A 3W2OA 1PY5A 1H1RA 3QQHA 1K3AA 1MUOA 3OG7A 4GT3A 3U55A 4QMNA 3QTZA 3VBYA 3DAKA 2XZSA 3VF8A 3W2RA 1REJA 2PTKA 2PZPA 5I9WA 3VF9A 3JXWA 3VHEA 4ASDA 5LMKA 2CKPA 3U54A 3OWLA 4WT6A 5J95A 1B39A 5CXZA 4FKRA 1SYKA 3DU8A 3FXXA 5FBNC 3WZKA 4W8DA 4F9AA 1BL7A 4G31A 4BIDA 4WSYA 3QXPA 2X4ZA 3OEFX 5CT7A 3ZM4A 4I41A 3ZO2A 4E4XA 3LIJA 4FICA 3EN5A 3DBFA 3GFWA 4AT3A 5IQAA 4YP8A 2WHBA 5CAPA 2VU3A 4FGBA 2XIKA 4DEAA 4J71A 2E9PA 3COHA 3OD6X 2WIPA 2Z60A 3ODZX 3I4BA 4BBEA 3MY0A 2B52A 1RW8A 4I93A 2VWZA 4CV9A 1V0OA 1UWJA 4DFXE 1T46A 3I5ZA 3ZCLA 2B7AA 4JBOA 2IVSA 4JDIA 4C4HA 4GYIA 3IW7A 5L2SA 4FV1A 4CD0A 3AMYA 2V7AA 3NZ0A 4YJRA 5CSXA 2J2IB 3W0NA 3BL9A 4BTJA 2VTOA 3PIXA 3VO3A 2W1FA 4APPA 2B53A 3EHAA 2GMXA 2X2LA 4Y83A 4ZY5A 4DGNA 4FSUA 5CAUA 3EQCA 1TKIA 5IUIA 2UW6A 3OTVA 4WBBB 4LM5A 3VUKA 4KKGA 2CGUA 3BHUA 3RHKA 2PE0A 1P2AA 2P55A 5FM2A 2QVSE 4FA2A 2IW6A 2O0UA 2WEIA 3R9DA 1OZ1A 1ZYJA 3GU8A 3LE6A 4FKQA 5DFPA 1UKHA 3QFVA 2HWOA 4GYGA 3I1AA 4R1VA 3VBXA 4O91A 4C34A 3BZ3A 1RE8A 4PP9A 5IQCA 4L45A 3C4CA 3R7OA 5K5XA 4E5AX 4K2RA 4TTHB 1YI3A 2PVMA 4XLVA 5FQDC 4DFYA 2VTTA 3F2AA 5HO8A 3W1FA 3UIXA 1CKJA 4LI5A 3THBA 4K6ZA 3Q4TA 5HE1A 4MF1A 5FDPA 2XAOA 4IM3A 3E64A 3WIKA 4CSVA 5IEYA 2JKKA 3GCQA 4EK5A 1YDRE 4ACHA 4F65A 1IAJA 4RVTA 2F57A 3RPOA 4C58A 3WE4A 4FEWA 5A4CA 2VTNA 1DM2A 3UQFA 3DBCA 4FSYA 3VUMA 3EIDA 4MH7A 2HZ0A 4UWYA 2X1NA 4IB1A 2IZSA 2BMCA 4L68A 3KCKA 2G2HA 4AUAA 3HMMA 4MUQA 2Y4IB 4RSSA 4HGSA 2IWIA 4RJ3A 4YHTA 5IZFA 2LGCA 4AZVA 4OR5A 4B9DA 5HTBA 3V5QA 5K4JA 4J97A 3UODA 3F2RA 4CMOA 4QYGA 4ZP5A 5CEMA 2JKQA 3FMJA 4IANA 2P2IA 2F7EE 2WMRA 3OF0A 1Y6AA 5FTOA 5T3QA 3FMLA 3UYSA 4NW6A 4FV2A 4IWOA 2I7QA 3SC1A 4ZS0A 4EOQA 5CEOA 4JT3A 2WOUA 3KXXA 3CE3A 3D5UA 3QTQA 3AC4A 3R7YA 1JSTA 5CF4A 4ZZNA 1X8BA 1OECA 3ZBXA 4A7CA 3ZLYA 2OFUA 4RPVA 2C1AA 4FKTA 2QODA 4RQVA 4FYOA 4EH8A 1WFCA 2C0OA 3BPRA 1OKVA 5C03A 3MW1A 1KSWA 5C01A 4OTRA 2PZIA 4CV8A 2YIWA 1OBGA 3PRIA 3HV4A 5IQGA 4RIYA 1UWHA 3P7AA 4FNZA 4HZRA 4FX3A 4NTSA 3ZO3A 4YJTA 1XH4A 3RP9A 1Q8YA 3FY2A 3FAAA 3OROA 3PY0A 2OK1A 3UC3A 5JGAA 3BGPA 3QAME 3GCSA 3NSZA 4CVAA 5DA3A 1VYWA 1QPCA 5BNJA 2FYSA 3OBJA 5B2LA 3CD3A 3KF4A 3FBVA 2X6DA 3IW4A 4IADA 4O7VA 2V5QA 3NW5A 3MJ2A 4N6YA 1PMVA 5JT2A 3ANQA 4G17A 3UO4A 3UO6A 4O27B 2V62A 4TKSA 4E4LA 1J91A 1YI6A 3DK3A 2BKZA 3ZBFA 4HW7A 3FXZA 1WVWA 3ORLA 3LCKA 5E1EA 5FRIA 1GZNA 4H3BA 4GUEA 5CVHA 5HNGA 1OPJA 5IA5A 1PXIA 4TPTA 3OTUA 2UZEA 3QRJA 2UZTA 2VTLA 2XK7A 3ALOA 1QPJA 3IONA 2R3OA 2JIUA 3O8TA 5JK3A 4O2PA 1OUKA 4IFGA 4NJDA 4CMUA 4M15A 4XHKB 3A4PA 3UQCA 4N70A 2J0KA 1H1PA 3AC5A 3F7WA 2XK8A 3RZBA 3UNKA 3PZEA 1I09A 2ZJWA 2PL0A 4ONAA 5GNKA 1TFFA 4J52A 1OPKA 3MI9A 2O65A 2W1GA 3K5VA 1WBPA 2ZOQA 3NVKI 4FZAB 3UTOA 4H05A 4UZDA 3OCGA 3VWAA 3FKOA 5AADA 2VWXA 2GNHA 4S32A 4BTFA 4HGLA 4V04A 4YSMA 5AM6A 2X4FA 4ZMFA 1ST4A 5A6OA 2X8IA 5CQWA 4JBQA 3O50A 2QHMA 4J98A 3AD6A 2UUEA 3KVWA 5L6WL 3UGCA 5AAGA 1YRPA 1YHSA 1JSVA 1S9JA 2IZUA 4DFUA 2BRGA 4LQMA 3SG8A 4O6LA 4AN3A 1ND4A 4RLLA 4YGAA 2ZM3A 3I6UA 5DT3A 2HAKA 4NM3A 4UYAA 4FSZA 4EHGA 5HG9A 1J7IA 2C3IB 5HG8A 3CQUA 4DEHA 4QP8A 2ZB0A 2JIVA 4L6QA 2BRNA 3RAWA 1BI8A 4QTBA 2BFYA 3LMGA 3BL7A 4OT6A 5FEEA 2YITA 2QKRA 3FLSA 3UNJA 3WZEA 3AOXA 2WQBA 4QT1A 5A4EA 2DYLA 2W1DA 3HLLA 2O2UA 3AT2A 3H0ZA 4DT8A 2XS0A 4KBCA 4AQCA 1BKXA 1G3NA 4W4XA 5HCYA 3PWDA 4LL5A 5CAQA 2I0VA 3ZONA 2O8YA 2HXQA 2W17A 4BGGA 5FXSA 5HLNA 5DEYA 2R64A 4KA3A 2QI8A 3AG9A 4E1ZA 4AZTA 4E5BA 3ALNA 2ITVA 3S00A 3K2LA 3QTWA 3MH3A 3BQCA 3P86A 3FI8A 4ZSGA 2BRMA 1H24A 2UZUE 3EYGA 4G9CA 3KN5A 4M7IA 4EORA 4TT7A 4BYIA 4BRXA 1ATPE 4IWDA 3SAYA 1Q41A 3D5XA 5E4HA 4DEDA 3CKXA 5EW3A 3BHTA 4ZJJA 2HW7A 2QO7A 2C6IA 2W5BA 4FZ6A 4LDTA 3TDVA 1AD5A 5AP4A 4ENXA 2JDVA 4FG8A 1YHVA 2R3MA 4IM2A 4XUFA 4BDDA 5HTCA 5AAFA 3GOPA 3ZO1A 5D10A 2OG8A 3QZHA 3DTCA 4PDSA 2WZJA 4YJQA 2C3KA 3FQSA 3TN8A 3HX4A 5L2WA 3EYHA 3MB6A 3UOHA 4GL9A 1LR4A 4QP6A 4TYGA 2I0HA 1UA2A 2F7XE 4Z55A 2IVTA 2FO0A 3SW7A 3EB0A 3HECA 1NVSA 2B4SB 2ZV9A 3A99A 4I92A 5IQIA 2QOBA 2BDWA 4BCFA 4KKHA 4OTDA 4YJUA 1YW2A 3LCSA 4EBVA 5M4CA 3JS2A 3LFDA 4QO9A 4AZSA 4ZTRA 5G1XA 3D2KA 1VR2A 4MXAA 3ZEPA 4O0WA 3LCOA 3MS9A 2W4JA 3L9NA 4P5ZA 5IDPA 3GQIA 3C4WA 5IMEA 3LCTA 5IH6A 3DBDA 4FIJA 3LZBA 4WIHA 3G90X 3HEGA 2O5KA 2BALA 4K0YA 3U9NA 3OXZA 3R63A 2BZHB 4AFEA 1XJDA 4JDJA 4LV5A 4D2SA 4RA5A 4FODA 5LCJA 3IO7A 3IGGA 4QP1A 5DN3A 4FV5A 5BYLA 3TKIA 2UW3A 4PMPA 3QTUA 4FE2A 1OIUA 1ZMVA 1YXUA 4X0MA 3WF7A 4CFWA 1Q3WA 3T3UA 3I7BA 3LQ8A 4JBPA 4CXAA 4LRKA 5JFWA 3DLZA 2C68A 4XS2A 2F2CB 2BVAA 4YTFA 4FZDB 4XG7A 3PRFA 2AC3A 4ZSAA 2PZYA 3FY0A 4FKJA 4EZ3A 5K9IA 2YDKA 1KOBA 3W2SA 4CFNA 3D0EA 4ERKA 4YR8A 2Y6OA 2UW8A 2OWBA 2YFXA 4TWCA 4GW8A 1YOMA 2OF4A 5HI2A 3GU7A 3SX9A 4ANQA 2QOQA 5D7VA 5HIBA 4FIGA 2C47A 4KBAA 5ACBC 4BBMA 3UG1A 4BIEA 4A9TA 2B9JA 4YLJA 4ALVA 4BCNA 3FMEA 4WG4A 4BDGA 3MVJA 4YZCA 4DH3A 4M3QA 4XBRA 4HPUE 4O0VA 1Q8TA 4CFMA 4CNHA 2ITUA 4GKIA 3G51A 2PVLA 4FTUA 1Q8WA 2JIIA 4NTTA 4AN9A 1GOLA 1IR3A 2CMWA 3FMMA 2HY0A 4FZ7A 5HVYA 4B0GA 5CF6A 5HIEA 3HMIA 1M2RA 2Z7QA 2XF0A 5CU4A 4IE9A 5ANEA 4DH7A 4C36A 2IVVA 2YWPA 4JNWA 2GNLA 2QOHA 4YMJA 5HQ0A 4EWHA 2YIQA 1PMNA 4AW1A 4IBMA 1E1VA 2ERKA 4PX6A 3V5JA 5AWMA 3ZDUA 5IG1A 3EFKA 3UIMA 4YC3A 1DAYA 4GFGA 5HD7A 3KXMA 5LMAA 3JY0A 5J8IA 2WTVA 4GIIA 3E92A 4B8LA 2P4IA 2G2IA 4NT4A 3W2QA 1NW1A 5BMSA 1SZMA 4EK8A 5IDNA 5J7HA 4RFMA 2GCDA 2ACXA 1OL2A 4AF3A 2XH5A 4EC8A 3RK5A 4FGRA 4PTEA 1M7NA 2FA2A 2Q0BA 3PG3A 2WB8A 3PVGA 4Q5EA 4U9AA 5EM8A 3FLYA 4LG4A 4AACA 2XK4A 4DGOA 1OL1A 4F4PA 2EWAA 3BYVA 1TQIA 3R02A 5JRSA 3RCJA 2GHLA 3NUYA 3UDTA 1WMKA 2JD5A 3PUFC 4BGQA 3C5IA 3OW3A 4EZ7A 2CNQA 2BAQA 5A9UA 3D5WA 3RVGA 4ZTHA 1XWSA 3HV3A 3MTLA 4J53A 2NP8A 3WZDA 3R71A 4GK4A 4XX9A 2JKOA 2WU6A 4ANSA 5CF8A 5A3XA 3LM0A 4YO4A 2ERZE 5LVMA 2XCKA 3OS3A 1J7UA 4YZDA 3R8MA 4FKUA 3QUDA 4RLKA 3PP0A 4BDKA 5IA3A 1OI9A 3BLRA 2YZLA 2GTNA 2JBPA 2ZV8A 2HZIA 5EHLA 4YJVA 4D1ZA 2EB3A 3AXWA 3BV3A 4E73A 3C50A 1ZZ2A 4KIPA 4R3RA 3R1YA 5BX0A 3ODYX 2WELA 3PTGA 3O96A 5L2IA 5AEPA 3PVBA 4NJ3A 4MK0A 3PXFA 3A4OX 2ZB1A 3FHIA 3RWPA 3M1SA 3TM0A 4ACDA 4BDEA 1NA7A 4UZHA 3HUBA 4RGJA 5BVKA 3COKA 3E3BX 3DKCA 2EUFB 3MTFA 2Z8CA 3TZMA 3A8WA 4O2ZA 4DEIA 2J5EA 2FSTX 2VWUA 1JOWB 2YA9A 1XBCA 4AQKA 5HORA 3O71A 3QZFA 3OOMA 3PSCA 4RT7A 1QPEA 4LV8A 1OVEA 3MPTA 3EQPA 2R7IA 4LOQA 4X6QC 5CU2A 1YQJA 3LJ2A 3MESA 1W7HA 4DN5A 4RBLA 2OLCA 5HKMA 3EWHA 5J1VA 2VO7A 4X21A 2XK9A 3CQWA 3R1QA 1LUFA 3DAJA 3EQGA 4DITA 1YHWA 3HVCA 1YVJA 3PXYA 1BL6A 5TF9A 3HA8A 3D7ZA 3U6HA 4O7TA 4O81A 4EOJA 1JKSA 3EQHA 4UXLA 3E62A 5ETFA 3ZUUA 4BN1A 3HV5A 4DA5A 1BUHA 3COIA 4MQ2A 2C6KA 1FMKA 1IRKA 3C0IA 2JAMA 3PSDA 2FH9A 4TWNA 3UOKA 5AAEA 3LHJA 5HBHA 1HCKA 4GK3A 3NR9A 2NYAA 3DY7A 4QMOA 4F9BA 5HCXA 4CFUA 4DLJA 3LMIA 5GHVA 4C4IA 3GGFA 2C3LA 3ITZA 4PY1A 1Y6BA 5TT7A 3FI3A 4I6FA 3DK6A 4XOYA 3QZGA 3RM7A 3W32A 5ETIA 2WMUA 4BCIA 2R0IA 3E63A 3QD4A 4HGTA 4IAZA 4FV6A 3SD0A 4IHPA 3UC4A 4Q5HA 5L2TA 2WU7A 4IAKA 1OIRA 2W96B 1WBSA 3EFJA 3GP0A 4AW2A 3BCEA 2GNIA 3TEIA 4BI1A 4N4SA 1REKA 2QOFA 2VX0A 4JQ7A 4U6RA 1P14A 5E9EA 3SV0A 3W33A 5AV4A 4AGWA 3HDMA 4RX7A 4BTKA 2F9GA 3CY2A 3RALA 2F49A 2PUUA 3TUCA 4R1YA 4G3CA 4L8MA 3TI1A 3V04A 4DF3A 2XAMA 2VNYA 2VUWA 4M12A 3ORXA 3Q6WA 2G01A 2W1HA 3NX8A 3AC8A 4M84A 4XOZA 1XMLA 4RZVA 2W1IA 1PYXA 3KRRA 2O3PA 5ACKA 1IEPA 1Q8UA 2UW5A 4GS6A 3O0GA 4H1MA 2YABA 4NWMA 3POZA 4BF2A 3ETAA 5FEQA 4OTFA 2AUHA 5KMNA 3R8UA 2UZBA 5EQPA 1H00A 3QRTA 5JZJA 5EYDA 1JKLA 2O64A 4FIEA 3CQEA 2J0LA 5KMJA 2Y6MA 1NXKA 4G3FA 4S33A 4BDAA 5BQ0A 2Z2WA 4NW5A 5FTQA 3Q04A 5CANA 2CN8A 3GOKA 4FMQA 4FTLA 5EYKA 2OXYA 3VAPA 3ZXTA 4ANMA 2GQGA 2WTIA 1GZ8A 1CSNA 2X2MA 4L42A 3FZSA 1PRYA 3BBTB 3GCUA 3UVRA 1SM2A 3WYXA 3DLSA 2C5XA 1T45A 2ZM1A 3QHWA 2DWBA 4U81A 4TYJA 2PUNA 3COMA 3DJ6A 3Q9ZA 1PMUA 5FG8A 4CFVA 4QMMA 3I7CA 5D41A 4RC3A 5EI2A 5CNOA 4ZSEA 1U54B 2A0CX 4EOMA 2PULA 5HNIX 2ESMA 3O51A 5AIRA 1QMZA 3WZUA 1MRYA 3A7JA 5CENA 2WMSA 4U40A 3H3CA 3AC1A 2VTIA 2WFYA 3NFGB 4O7RA 5C26A 3C5UA 4ITHA 5HLWA 4ANBA 3LOKA 4W4YA 1F5QA 3MH2A 3TUBA 3TT0A 2CHLA 3SKCA 3FI4A 3T9IA 5TR6A 1G8SA 4FV0A 4ZMEA 2C6EA 4ZTQA 5IQBA 4JAJA 2VTHA 2Q0NA 3TZ7A 4KKEA 5HNBA 2VX3A 2GNJA 3A7IA 5CQUA 4ZTMA 3F3TA 4PTGA 2PE2A 3PY3A 4GUBA 3V51A 3ZZWA 2ETKA 4BHZA 3F69A 1Q99A 3A61A 4JJRA 2X7FA 3LXLA 1ZYLA 4OBQA 4TNDA 5F20A 4AAYA 3ORPA 2HY81 3SXRA 4B99A 5JRQA 2GS7A 1DI9A 1CTPE 3NNXA 3TACA 4OTHA 4R7BA 4X2NA 1G8KA 4GG5A 4IQ6A 3D5VA 3IKAA 3NFFB 4S34A 5D1JA 5AV1A 4E4MA 2ZMCA 4IAAA 5IQDA 5C8MA 3U6JA 3QKMA 1O6YA 3SXSA 4QNYA 4AT5A 3AMAA 4YLKA 2P0CA 4CLJA 1KV1A 5FD2A 4DCAA 3L8SA 4R77A 5HLPA 4QMPA 5I5ZA 4AP7A 2R4BA 4CRSA 3V8WA 2QD9A 4FL3A 1PW2A 4XG8A 4XG2A 2WMWA 3RK7A 1OIYA 4XEYA 3RNIA 5LVLA 1PF8A 2HOGA 3MWUA 3VNTA 4WKQA 3WF8A 1U59A 1R39A 1ZYSA 2W05A 3GUBA 5AX3A 3NDMA 5LXMA 5M56A 2HXLA 1YOLA 4NM7A 4O7WA 4QYYA 4X2KA 4DTKA 4EEVA 4D0XA 2GFCA 4QYHA 3ZTXA 3NAYA 4IB3A 1XH5A 1W8CA 4DBNA 5M06A 5D11A 2OFVA 4XMOA 2ETMA 2VGOA 1AGWA 1UNLA 3FL5A 2GS2A 3FKNA 5JZNA 5J9ZA 4XG3A 4EH7A 5D7AA 2VTPA 2ITXA 3OWKA 1H0WA 3LM5A 3KGAA 3TZ8A 4I0RA 4O38A 4ARKA 4C7TA 3KFAA 3Q6UA 1OM1A 2C5NA 1Q97A 3W55A 4ZZOA 4IZ7A 1OMWA 3KRLA 3IGOA 4U0IA 3JYAA 4PP7A 4AU8A 3DGKA 5CSVA 1XQZA 4YPDA 4DH8A 1OPLA 3AMBA 1JKTA 4QDVA 1CKIA 5E8WA 5AUXA 5C4LA 3EZVA 4EI4A 4G6OA 3MVHA 5I9ZA 4MAOA 4G2FA 4FKGA 4BR3A 4CTBA 4LL0A 3RINA 4RMZA 2PZ5A 3VJNA 5M44A 4C2VA 4DEBA 4ZTSA 4EZ5A 4A9YA 1U4DA 3SGCA 4O7NA 4BKJA 3FLWA 3PXKA 4MQ1A 4MXCA 1B38A 2RFEA 3LKMA 3KMUA 3R1SA 2XIRA 5HG5A 3QCQA 2G2FA 4BHNA 4GV1A 1H0VA 5CEKA 2WTWA 2WMTA 3RAIA 3DNEA 3PVWA 3C51A 3NUUA 2C4GA 1YOJA 2H9VA 3KXNA 4U3ZA 3ZSHA 5KMLA 2PZRA 5CVFA 5HBJA 5DHJA 2PUPA 3OXTA 3VS1A 1U5QA 4FTTA 1H1WA 3DXQA 5F4NA 3QL8A 5I9VA 3UOJA 4EBWA 5KUPA 5DYJA 4AA4A 4QTDA 3B2WA 3UIUA 2WMQA 2X6EA 4ZLZA 4EH3A 4RIOA 4ZAUA 3K5UA 3UPXA 4Y95A 2CKQA 4YNEA 2FGIA 5A6NA 3EFLA 5IA0A 4E6CA 4AA0A 4YJNA 5ANGA 4N0SA 4DFZE 2X8EA 2BZKB 4AN2A 4E93A 2SRCA 5EH0A 3V01A 4M13A 5H8GA 3P7BA 4JQEA 3ZSGA 1O6KA 3EOCA 4CCBA 4FSNA 1U54A 3FDNA 5CS6A 3OVVA 2QCSA 4YC6A 4K11A 5DE2A 2JFLA 3LW0A 4ZEGA 5D9HA 2XYNA 3F9NA 2X39A 2CLXA 2GU8A 4KUJA 4EQCA 2B9HA 3PA4A 2VWVA 1TVOA 3MH1A 4QQCA 4EHEA 2H34A 3C4EA 4O84A 2HELA 1GZOA 3MIYA 3OBGA 2UW7A 5LQFA 4NYEA 3CTQA 3QA0A 5CU3A 2XIYA 2XKFA 3IK3A 3HRCA 3R1NA 4G9RA 1ERKA 4I6LA 3NW6A 4ZLOA 3V6RA 4Z7GA 5K3YA 4CCUA 3VONA 4S30A 3I79A 4NFMA 1UKIA 5M51A 3C4XA 3I0QA 4HYSA 2CCHA 5E7RA 3BEGA 3LJ0A 4NUSA 4FTAA 4XV3A 4BDCA 3BU5A 4MBJA 3HMPA 4PDPA 4BIBA 4I6BA 2WMAA 2XM8A 4FSTA 1URCA 2RFDA 3QWJA 2WTDA 3U4UA 5E8YA 3DK7A 3MFSA 4O0YA 5JEBA 4E6DA 4O96A 1OUYA 4ALUA 1QPDA 3ORNA 3UDZA 3QKKA 2RF9A 3W10A 2YACA 4CT1A 5IQHA 5EM6A 4BZOA 1JPAA 2OICA 5DI1A 3HV6A 2P3GX 1Z57A 3MPMA 3O23A 4V05A 3VBVA 3RAHA 2W1ZA 2R7BA 3CJGA 3UQGA 1YDSE 3CC6A 3SQQA 2PVJA 3P7CA 4R6VA 2UV2A 4NSTA 2KTYA 2C6MA 4FSWA 4D28A 4C0TA 3RK9A 4IX5A 3HP2A 4MWHA 5LJJA 3GBZA 4D5KA 3FEGA 3NUPA 3RPYA 3O17A 3G6HA 2JFMA 4L44A 3MYGA 4MYGA 1GIJA 3LQ5A 4UALA 3GC7A 2W1CA 5HHWA 3W18A 3MA3A 2R5TA 2YIRA 3QYWA 4ZIMA 3D9VA 5FUTA 3OT3A 3PPZA 3GT8A 3B8RA 4QP3A 4D4VA 3FWQA 3BWJA 4XLIA 4YBJA 1WBWA 4IACA 4MEDA 4I5PA 4DHZA 2PVNA 1MRVA 3QBNA 2YM8A 4XH6A 4BBFA 2XRUA 4L46A 4MBIA 5T68A 3R9RA 3ACKA 3EL7A 4FNYA 3WBLA 4AFJA 4ZY4A 5CALA 2AEGA 3ZU7A 3QTSA 4M68A 3OFMA 4HZSA 3RGFA 4F63A 5CF5A 1RDQE 3HZTA 4TW9A 2OJ9A 3FYJX 4L01A 4FOCA 2VTQA 5DWRA 3DB6A 4E6AA 3E87A 3QCSA 2PUIA 3H9RA 5I0BA 4IX6A 4X2GA 2E9NA 2PVKA 4GK2A 4C3RA 3CY3A 2UVXA 3HRBA 3LFFA 4YHFA 5GIPE 1FMOE 4FT3A 2EB2A 2BIKB 5DT0A 4KD1A 4BVUA 2WTJA 3OY1A 3M2WA 3DXPA 4IZ5A 4BZNA 5IQEA 3W8QA 4AXEA 4RC2A 1XMMA 4KAOA 4ZLYA 1OIQA 2C30A 2YZAA 4G1WA 3ZRLA 4E7WA 3ENHA 4HCUA 3LFSA 1V0PA 4MTAA 3HNGA 4JR7A 1WZYA 3DNDA 3REPA 3O5AA 3F82A 3SHEA 5EYCA 5EI6A 3RKBA 2A1AB 1PHKA 1OB3A 5FXQA 3TNPC 5A46A 1OKYA 4QMZA 1YXVA 4O22A 3ZFXA 4J7BA 3V8SA 3ZDIA 4KIOA 4OUCA 2VTAA 4U8ZA 4DLIA 5LCKA 3UMXA 3U6IA 2X7GA 1J3HA 2IW9A 4M97A 3SXFA 3V5WA 2YIYA 4EOPA 1AQ1A 3TJDA 3QXOA 3AC2A 3P0MA 4NIFB 3HYHA 2BRHA 2X81A 3VRYA 3RTPA 4BC6A 4Y73A 4TWPA 5KHXA 3VS2A 4OBPA 3SDJA 4EQUA 4FBXA 4OBOA 2ITQA 4K8AA 2R0UA 4BCHA 4EUUA 2YM6A 4D4YA 2PE1A 2C3JA 4IWQA 2PSQA 4F70A 3QGYA 4DHJA 4JG6A 4LUEA 4P7EA 3CP9A 3ZXZA 3OWJA 3GU6A 4XP3A 4AE6A 1V1KA 4TY1A 5EOLA 3Q9XA 1DAWA 3H10A 3IS5A 4G16A 4II5A 4LYNA 3A8XA 4Y46A 3DKGA 4YJOA 3WIGA 2C5YA 3FE3A 4BDBA 4FV7A 4JDHA 4FVRA 2Y7JA 5AMNA 5FM3A 4FVQA 3DZOA 4Q9SA 5EW8A 2VNWA 3HDNA 4U43A 3Q52A 2XKCA 3QWKA 4QMLA 3AQVA 3SA0A 3MY1A 3TNIA 3F2NA 1R1WA 3LLTA 2XJ2A 3IG7A 1H08A 3R22A 4FG7A 2OJIA 5B2KA 3TZ9A 2PMLX 5CNNA 2B9FA 3ZC5A 2V55A 2YAKA 3KY2A 3O8PA 3AGMA 3QQGA 5KO1A 4WG3A 5AIKA 2WGJA 3PIYA 3LFEA 3U4WA 4EUTA 4NZWB 4C62A 3F3VA 3VBTA 2VN9A 2DS1A 2KULA 3BHHA 3CKWA 1VZOA 3BHYA 1JAMA 2CGWA 2QQ7A 3ATSA 3CR0A 4X3JA 2R3PA 4PWNA 4RVMA 1XH9A 3IQ7A 4CTCA 3GU4A 1SMHA 2ZM4A 4X6RA 4QMQA 4QQTA 4C3FA 4USEA 4U80A 3IOKA 2QHNA 3RM6A 5KKRC 2QLQA 4FTOA 4NCTC 5CEQA 2DUVA 1K9AA 5EG3A 5EOBA 4FC0A 4JAIA 4Z16A 3F5GA 2BUJA 3NNWA 3E8EA 3GCVA 3QTRA 5CX9A 4FYNA 3QU0A 2J90A 5BUJA 5EHYA 5J1WA 5EDPA 5BVEA 4XRJA 3DA6A 3H0YA 5B7VA 3KXHA 3ZM9A 3NGAA 3QX2A 4HNFA 4I21A 2J0IA 4XNEA 3MB7A 4USFA 1H01A 1Y57A 3FKLA 4QMYA 4QYEA 4GRBA 2XM9A 3VS6A 4AZWA 3LCDA 4O86A 2PVHA 2XP2A 4CGAA 1YKRA 1UVRA 1HOWA 4RQKA 2C0TA 4L9IA 2O63A 5HVKA 2JDOA 3RNYA 2UW4A 3EN6A 3QRIA 4MD8E 1A06A 3P78A 3NW7A 2JDRA 5E8UA 5E8XA 1RJBA 4RG0A 3I0OA 3QQJA 5DLSA 5H8EA 4KINA 2W9ZB 5BPYA 2J7TA 3GCPA 5IEVA 2OU7A 5LMKC 3A7GA 1KE5A 3P9JA 2W9FB 3F3ZA 4QP4A 4UN0C 5ITAA 4C38A 3I81A 3HUCA 5IUHA 5EQEA 5CASA 2C6TA 3DKOA 2PK9A 4DDGA 3PLSA 5LOHA 4UX9A 4HPTE 4BB4A 5F9EA 1W82A 5EW9A 2OF2A 1UU8A 3EQDA 4O7ZA 5EKOA 3ML1A 4ZTLA 1FVTA 5TO8A 2OJJA 3H9FA 2XARA 2IG7A 2CDZA 1OL6A 3LFAA 3A7FA 4KS7A 1OL5A 3UBDA 2OGVA 2XMYA 1MP8A 4BDHA 5I9XA 3FZTA 3L8XA 4RJ4A 4BCPA 2JEDA 4Y8DA 3G2FA 3OOGA 3N4UA 3QQFA 4F99A 4W4VA 2OXDA 3GFEA 3Q2MA 4B7TA 3QHRA 1U46A 4FZFB 5GINE 2BDFA 2X9FA 1ZWSA 2RGPA 2QNJA 3JR1A 3V5PA 4LOOA 4ACCA 4HVSA 3EMGA 3FI2A 1BX6A 2I6LA 4OTQA 5HICA 3C4FA 5T6KA 3S95A 4PL4A 5AJQA 4O7SA 4QYFA 4EH5A 5AFVA 4A06A 4DGMA 1OBDA 1FGIA 2OO8X 4OTWA 3F3UA 4Y72A 3V3VA 3FLZA 2BIYA 3LVPA 2PPQA 3NS9A 4QP9A 3E93A 4FEQA 5HU3A 3MVMA 4L00A 3KKVA 4UB7A 2XYUA 4BI2A 2CSNA 2R3KA 2BPMA 3MN3A 3A62A 2JDSA 3O7LD 4FKVA 4CZUA 3OCTA 2J5FA 2CLQA 2FB8A 4DINA 4EK4A 4DT9A 4AAAA 2XNMA 1Y8YA 1VEBA 3PZHA 4I24A 4FK3A 3HGKA 3F5XA 3RWQA 4LGHA 4IM0A 2QONA 4IVBA 4JG8A 4PV0A 4GG7A 4F9YA 4LV7A 5JN2A 1CKPA 1UNHA 1A9UA 2R3IA 3PFYA 3BE2A 2ZFYA 2W0JA 1JSUA 4H3QA 2YM4A 3GC8A 3NYVA 3SW4A 4CG8A 1PXLA 5IH5A 3GU5A 3HA6A 1DI8A 1H1QA 5BVDA 5B0XA 1F3MC 5J5SA 5HG7A 3NPCA 4EHZA 2X7OA 2ZAZA 5BVOA 2PMNX 5IA2A 3ROCA 2XNGA 3S0OA 4FEUA 4NK9A 4WHZA 3G6GA 2J51A 3F6XA 3L9LA 4XYFA 5ANIA 4EH9A 3UPZA 3Q2JA 4YZBA 4D2RA 3KL8A 1Q5KA 3ZZEA 3W2PA 3PXQA 3ERKA 4FTNA 3R7IA 3W2CA 5AP2A 4EK6A 4MWIA 3VUHA 2QR7A 2YERA 1MRUA 3VUDA 3ZMMA 3I5NA 5IMXA 1H27A 4ENYA 2WKMA 3MV5A 4ERWA 5IPJA 5JH6A 2PVYA 3IW5A 5KKRB 3UVPA 5J9YA 4JR3A 1ZZLA 4E4NA 4FTQA 4L52A 3VS3A 4MKCA 3B2TA 4GVJA 3UMWA 4TXCA 4GCJA 5DT4A 2W4OA 3JPVA 2XNEA 1ZARA 2BHEA 4J1RA 4DCEA 5AUYA 4ZY6A 3VS5A 2EU9A 1Q8ZA 4FT0A 4ZXTA 3SLSA 4I22A 4FEXA 3TWJA 4ASXA 2XNOA 2ZDUA 1WAKA 5AX9A 5GJDA 5KE0A 4AG8A 4H1JA 4HYHA 4GIHA 2X2KA 2XKEA 4XJ0A 3DCVA 3ULZA 3ZSIA 4XCUA 3ENMA 2H8HA 4EH6A 4J95A 2Z7RA 5LMBA 5J9LA 3WYYA 3ID6C 3Q60A 3TL8A 4R7IA 1UU3A 4B6LA 4FV3A 3QX4A 1SNUA 2W99B 2REIA 1M2QA 4L3PA 4GJ2A 5AP6A 1GIHA 4UBAA 3BX5A 3TTJA 3D15A 2BHHA 2HWPA 3DKFA 3EKKA 4DHIB 2YM5A 3BYUA 3E8DA 4BDIA 4G6LA 2OXXA 3MBLA 2F7ZE 4NM5A 5CZHA 4C4FA 3BYSA 3D2IA 3K54A 4QP7A 1DS5A 1O9UA 4QPSA 2CPKE 3KB7A 4E20A 2WTKC 2H96A 3I60A 1KWPA 4FI1A 3PXZA 2IN6A 3HV7A 2FSMX 3KMMA 5DGZA 4DFLA 3AKKA 4IWPA 4I0TA 4K9YA 2EVAA 3G33A 4PRJA 4AGDA 4ID7A 2E9UA 2YN8A 3FSFA 2XNPA 3FZPA 4ZTNA 5AV0A 4QOXA 5C4KA 3FC2A 1MQ4A 1B6CB 4MXYA 4PMTA 4GKHA 5IQFA 1JKKA 4PMSA 5FTGA 2B0QA 3LXPA 3QLGA 2HK5A 2VO6A 1H8FA 3OW4A 3A7HA 2UW9A 3NUAA 5CI7A 4R3CA 4JI9A 1GIIA 4JX3A 3QALE 2C1BA 2R2PA 3VW6A 4CT2A 5CAVA 2J0JA 4UXQA 5JFVA 3PJ2A 3UO5A 3UP2A 1Y8GA 4O7LA 5M4IA 1GNGA 5H2UA 5A4LA 4JXFA 3TNQB 4I6QA 3R8VA 3W0SA 1BMKA 2CKOA 3DDQA 4G3GA 1STCE 2PVFA 4F6UA 4YLLA 3TMOA 4FNWA 4GVAA 2ZMDA 5E92A 5HIDA 2JITA 2W06A 2FUMA 4FNXA 4R5SA 5CAOA 1KE8A 3KK8A 5E91A 2NPQA 3N4TA 3NYNA 3B8QA 3H30A 4R5YA 4C4GA 4JG7A 4P2KA 1JVPP 4IAIA 5EKNA 5KX8A 3CD8A 3QCYA 5HX8A 4WUNA 4XV1A 3RJCA 3FMKA 4OGRA 4HCVA 2XANA 3EN4A 3UZRA 4JIAA 5IU2A 1ZY4A 2RG6A 2Y9QA 2OJGA 1E1XA 2VWBA 1LP4A 5DRBA 2EXCX 2ONLC 5BMMA 3KULA 2OZAB 3QYZA 5JQ8A 4FL1A 4JRNA 5E8ZA 2C5VA 1WBNA 2QU6A 4X3FC 4AT4A 2F2UA 2CNVA 3ZC6A 1RQQA 1M7QA 3KRJA 2VGPA 3EJ1A 3KN6A 5CWZA 4TL0A 5CSHA 5L6PA 1WVYA 1XH6A 3HMOA 2B54A 3JY9A 4U79A 3DQWA 4RWLA 3CLYA 3LXKA 1EH4A 2VD5A 2YM3A 3BHVA 4IDVA 3VW8A 4BGHA 3P4KA 2WMBA 2ITZA 5HESA 2PYWA 3OMVA 1APME 4RIWA 4WRGA 4XBUA 4NFNA 3UE4A 4CFFA 1GZKA 1ZYCA 3BGZA 4FR4A 5AUUA 5JMSA 2YDJA 5KHWA 3CCNA 5D12A 2OKRA 1ZLTA 5F1ZA 5LARA 2LAVA 5DEWA 4RJ7A 4QMUA 4DYMA 2ITOA 5CU0A 4WBOA 5LWNA 1H25A 4HJOA 2XVDA 4I3ZA 4EHVA 1R0EA 4JLCA 4AWIA 4F7JA 3ZUTA 2OI4X 4RFYA 3NUXA 4NCTA 4GU9A 4IVCA 3NWWA 3FMHA 3HAVA 1YXTA 2YISA 3D7TB 4GU6A 4U44A 2H6DA 2ITTA 2CGVA 2G1TA 3DBEA 4ITJA 3UDBA 3FC1X 2I40A 4G5PA 4IZYA 5M08A 2I0YA 2ITWA 3O2MA 1IASA 3VUGA 2VWIA 2UZVA 2GHMA 5HCZA 4HNIA 3W8LA 4A9RA 4E6QA 5HE0A 4OW8A 3DXNA 1NY3A 4EOOA 3N9XA 3F7ZA 3CGFA 4J96A 3Q5IA 4WG5A 2IZTA 5EFQA 3WARA 2ZDTA 2IW8A 1FVRA 3PP1A 2HCKA 3Q4CA 1I44A 4MXXA 1XH7A 3UIBA 4MXOA 4L53A 5E8TA 3L9PA 4DG0E 4FIHA 4PDOA 4IAFA 3UZPA 4TRLA 4DHFA 4YU2A 4XV9A 5A4TA 4D55A 4ORKA 4ACGA 3FPMA 4DTBA 2VV9A 1NVRA 3LAUA 3WILA 2CKEA 3O8UA 2AYPA 3QQLA 2PHKA 3MIAA 4N6ZA 5EQYA 3RMFA 4QEBA 4QMTA 5HE2A 3WF6A 2WXVA 5F94A 4NU1A 4HYIA 1YWRA 2WTKB 4JX7A 2VRXA 3EH9A 3PDTA 1KE7A 5M57A 2NRUA 3AC3A 4BICA 5G6VA 3KRXA 3VVHA 4RJ6A 4DEGA 5IISA 4WO5A 4KB8A 4WNMA 4MCVA 3R30A 3ZRKA 3OP5A 2JKMA 3EFWA 3EL8A 3TNWA 4CG9A 3WOWA 3CIKA 3GEQA 3OWPA 3FJQE 3L8PA 2YWVA 4M0ZA 4DH1A 3R21A 3BLAA 1WBVA 2R3RA 3DJ7A 3MVLA 4FKPA 2FSLX 2W4KA 3P23A 2YDIA 4WUAA 3F3WA 3DPKA 4PL5A 3NEWA 2A4LA 5AP1A 2YEXA 5AM7A 3C1XA 4KIQA 5CT0A 4FSRA 4DEEA 4GFMA 4NL0A 4PDYA 5DR2A 3IPHA 4FUXA 4FKIA 3R9HA 3R28A 4FTIA 3AD4A 3NYXA 1G8AA 5AUTA 1G5SA 4TWOA 5I4NA 5M4UA 3V5LA 4S31A 1P5EA 1ZAOA 5LWMA 2XUUA 4QPAA 1SNXA 4EL9A 4V0GB 4X2JA 3FZRA 3QRUA 5FGKA 1J1CA 4M14A 4K1BA 3WI6A 2UZWE 4YC8A 2HIWA 4QMWA 1A48A 3D83A 4W4WA 4D5HA 4Z3VA 4I94A 4ZJIA 5I9UA 5KBRA 5EDRA 3FL4A 4X7QA 3TIYA 4CLIA 2ITNA 3AKLA 3PLAE 4QMVA 5JQ5A 3FZOA 3OC1A 2QG5A 2R3HA 4FSQA 5C27A 4FV8A 4C59A 5TOZA 4ANLA 3QTXA 3PA5A 4FIFA 1M52A 3GQLA 4X3FB 1BYGA 2BILB 2XRWA 2RKUA 4BYJA 2QO9A 3BELA 4KRCA 4IZAA 2ITPA 4L67A 4HVDA 2QO2A 3R2YA 4RX9A 5CSWA 2UZLA 4EWQA 2OZAA 2WAJA 3NRMA 4A07A 1XR1A 2X8DA 3FLQA 3EZRA 4KNBA 1V0BA 2VTRA 4YSJA 5KBQA 4A4OA 2PMIA 3M11A 3P1AA 3HL7A 4P5QA 2WTCA 3TTIA 5E90A 2QOOA 1W84A 5AUZA 3RAKA 3UDSA 1H07A 1ZOEA 3NNUA 3TXOA 4ALWA 4F6WA 3TYKA 1JWHA 1NVQA 2E2BA 2P33A 3FMDA 4IDTA 2HZNA 4A9UA 1IA9A 3KCFA 4EOLA 5I9YA 3DAEA 4FTCA 5DNRA 4D4SA 1FBNA 3FQEA 5K4IA 3A2CA 1PXPA 3FLNC 4H3PA 2GHGA 4QTEA 4ASZA 2OIDA 1Q3DA 3AD5A 4EH4A 4IB5A 3ORMA 2XJ0A 4MBLA 3OCSA 5FP6A 4L3JA 3L1SA 3R00A 3G0EA 2XJ1A 3G0FA 5CU6A 4AE9A 3T3VA 4RIXA 4TNBA 3SRVA 3E8CA 4K77A 2VWWA 3DDPA 4E8AA 1Q4LA 3AGLA 3MFTA 2BR1A 2VTSA 2WIHA 4FV9A 4FJVA 4AOJA 5KMMA 2W5AA 4I20A 5BV3A 3EN7A 3F5PA 3R04A 2JGZA 4XG9A 1XBBA 1R3CA 4JDKA 2F4JA 3ZFYA 4EYJA 5HEZA 4KWPA 2YJSA 2WD1A 5DOSA 3F88A 4N57A 4ZJVA 3ZHPC 4U7ZA 5IA4A 5BUIA 3QD3A 2OH4A 3ZYAA 3QC4A 1IAHA 2PVRA 3D7TA 4CQEA 4BCJA 4BCKA 3TG1A 5AUVA 4FT5A 4NKSA 3DS6A 1FPUA 3FZ1A 3E7OA 4GEOA 2DQ7X 4RVKA 3MA6A 4U45A 5J87A 5A54A 2P2HA 4F1MA 2W5HA 4XRLA 1TQMA 1H26A 3FMNA 3IDPA 4S2ZA 4TYEA 3MFRA 3PG1A 4IB0A 5HE3A 4BDJA 4R78A 5CYIA 4O0RA 3ATTA 4Q2AA 4FL2A 1YDTE 1FOTA 2QG7A 3RCDA 3AT4A 4F0GA 4CKJA 2C5OA 3QC9A 4H39A 3E88A 4AW0A 3Q4ZA 3V6SA 5AP3A 4FKSA 1URWA 2PU8A 1K2PA 4I5MA 3E3PA 1CDKA 1XKKA 2E9OA 3P5JC 5K5NA 5C8KA 3BLQA 3LFNA 2HZ4A 2BCJA 3ELJA 3FXWA 5EM7A 2Y8OA 4A4XA 3SVVA 4PQNA 4PTCA 4FT9A 4LUDA 3TUDA 2J0MB 4DG3E 4F1OA 2A27A 4RJ5A 4MNEB 2GDOA 3C13A 1OL7A 1XBAA 4J99A 4DFBA 1SVHA 4AGUA 3DJ5A 5AV3A 2B1PA 5ANJA 1VJYA 2UVYA 2Z7SA 3FHRA 2XK3A 3G9NA 3KEXA 3KREA 4A9SA 4EJNA 5IUGA 3R7EA 3TDWA 3TKHA 3II5A 3R7UA 2G9XA 4QQ5A 5DIAA 4D1XA 5AP5A 3NCZA 5ETCA 3DZQA 2R9SA 2YCSA 4CZTA 3P79A 4I1ZA 1SVEA 3R01A 4QRCA 3ZH8A 5KMIA 5BYZA 2OZOA 4DFNA 3BKBA 3F5UA 1L8TA 2J4ZA 2Y4PA 5KCVA 4FIIA 3VULA 3IOPA 3QGWA 2CCIA 4GSBA 4EOKA 4U5JA 4JOAA 3BU3A 4AOIA 3CTHA 1ZY5A 2JLDA 3P5KA 1UV5A 1WBOA 3EQRA 4ZSLA 1YWNA 3QUPA 1OGYA 5ANOA 2X9EA 3U51A 5HU9A 4GT5A 2XNNA 1PXOA 1R0PA 3BU6A 4KABA 3S3IA 4PUZA 3QQUA 4OTGA 3NYOA 3Q9WA 2R3JA 4TYHB 3C0HA 5FDXA 4KSQA 4TYIA 4F08A 1PMEA 1GY3A 4V0GA 2JDTA 2YIXA 1XO2B 2HW6A 5JKGA 2XNBA 5A4QA 3U87A 3ACJA 4ZS4A 2C69A 3Q4UA 1UU9A 1UNGA 4NKAA 4BY9E 1Z5MA 5E8VA 2C6OA 4HGEA 4LOPA 4DTAA 5JFXA 3KU2A 5M09A 4U97A 2ETRA 2GFSA 2QKWB 3HAMA 4P4CA 1Q62A 1LEWA 3QA8A 3HKOA 3VS0A 3IW8A 4IIRA 4G6NA 5DR6A 5FP5A 2CGXA 3LMHA 4EONA 4F9WA 1WCCA 3G15A 2ONLA 4IVDA 4XG4A 5ETAA 1VYZA 3VBWA 3R0TA 3NMUF 4HYUA 4HCTA 4X3FA 4YZ9A 5FXRA 3CXWA 1KUTA 1Y91A 3OXIA 1IG1A 4YTCA 3PUPA 2OJFE 3HP5A 4CKRA 4TN6A 2GPHA 3C4ZA 4JMQA 2RL5A 3C0GA 4BJJB 3BIZA 4FUYA 5IF1A 3VUIA 4ITIA 2FSOX 2J6MA 3PPKA 2GS6A 4FVPA 4F9CA 1H1SA 2IZRA 3G5DA 2CNUA 2YHVA 4PMMA 3R8PA 2E9VA 1BLXA 5M53A 1H4LA 2ZVAA 4YHJA 3IECA 3DB8A 2W1EA 2GNGA 4O82A 4YURA 1YI4A 4MHAA 3PE2A 4FOBA 5CXHA 5IEXA 3FYKX 4G3DA 2GQRA 3UNZA 5HGIA 4F6SA 3PIZA 3ZLXA 5CSPA 3MGYA 5EHOA 1JBPE 3VJOA 3ORIA 2ZV7A 3R2BA 4YJSA 2W7XA 5DVRA 3ZLSA 4WRSA 5CY3A 4F64A 4KRDA 5L3AA 3VS4A 5C8NA 4Y5QA 2UVZA 4IW0A 5ICPA 3Q3BA 1W83A 2C6LA 3H4JA 4EOIA 4FKLA 2WO6A 4DE4A 3BEAA 2EXMA 2QLUA 4JL9A 5DG5A 3BE9A 3O7LB 1PXNA 5HD4A 4EK3A 2BDJA 4HVIA 1H28A 5IA1A 1BI7A 1NT2A 4GT4A 4APCA 2WMVA 5H3QA 4WOVA 2JC6A 4IJPA 3OEZA 3GXLA 1QCFA 3QTIA 4G34A 4UYNA 3PJ1A 4F7SA 3PY1A 3NAXA 3OY3A 3FPQA 4DH5A 2WQEA 4FKWA 1ZOGA 4EC9A 5KNJA 2XBAA 3GNIB 3VS7A 5BYYA 2Z7LA 5DBXA 4LGGA 3CJFA 4MNFA 3UP7A 2V7OA 1Z9XA 2R3GA 3Q5ZA 5DRDA 4AXFA 4O83A 1PJKA 5CVGA 3POOA 2PY3A 3BLHA 3JVSA 5F95A 4BZDA 3QUEA 1ZMUA 1KE9A 1YXSA 2XBJA 4I4EA 4QTAA 4WD5A 4YJPA 3LLAA 2XK6A 2C0IA 1ST0A 2VTMA 3DT1A 3K3IA 3OUNB 3DFAA 4WNPA 4DGLC 3Q53A 1JQHA 5AP0A 4F7LA 4KBKA 1CM8A 4J8NA 3GENA 4FTJA 2PWLA 3QD0A 4IC8A 4F7NA 4P90A 4AXAA 4IC7A 2PMOX 3ZS5A 4GJ3A 2B9IA 2YCQA 2BAKA 4CMTA 4D1SA 3DQXA 4MNEA 2BKKA 5JFSA 3GI3A 3DBQA 3GC0A 3UG2A 3ZO4A 4F1TA 3OUKA 4JRVA 3ZFMA 4WA9A 4OLIA 3D14A 3E7VA 4O0SA 4Y85A 4XG6A 5ANDA 4CFXA 4BDFA 3MDYA 1L3RE 4NM0A 1ZOHA 4GMYA 3VIDA 4DBXA 3KXGA 4BI0A 4L7SA 2QOLA 2RG5A 2YCFA 4D9TA 3GVUA 3S4QA 3CGOA 4YNOA 3PPJA 2BZIB 1UU7A 3SOCA 4EOSA 3FQHA 3BGQA 4FEVA 4IFCA 4RX8A 5AP7A 5L8JA 3LXNA 4IX4A 3OHTA 1J7LA 3PXRA 3QLFA 5M55A 3ORKA 1LEZA 3TNHA 4UWCA 4UWBA 3QRKA 5GJFA 1VLRA 3WZJA 1P4OA 4B8MA 3ZEWA 4BCOA 1XHAA 5HX6A 5GIOE 3PA3A 3UVQA 4MXZA 4YZMA 5BUEA 3PVUA 2OW3A 3EN9A 4DAWA 3IW6A 3ANRA 4RWKA 3LPBA 4TYHA 4I23A 3HRFA 5L8KA 1CMKE 3KULB 4V01A
chains in the Genus database with same CATH topology
5AV2A 3KQ7A 4Q9ZA 2XCHA 4E5WA 5L6OA 4C2WA 3FUPA 2RFNA 3NCGA 2OIQA 1PXJA 3KIOC 4USDA 4OTIA 4L43A 4DC2A 4CRLA 5H8BA 3K3JA 1OITA 4M8TA 3VC4A 3NIEA 1ZYDA 4HOKA 4XP2A 2QOIA 3ZLWA 4C4JA 5AA9A 3PJ3A 4D9UA 4AS0A 4C4EA 4JS8A 5JGBA 2JAVA 2QR8A 4BCMA 2IO6A 3CPCA 3OZ6A 4RIWB 2XEYA 4UEUA 3VHKA 4RWJA 3W0QA 5IH4A 4HVGA 3BRBA 4XP0A 4PNKA 5HZNA 5HO7A 3RPRA 2OIBA 3W0OA 3PJCA 4QP2A 5AA8A 4KSPA 1Q61A 4I4FA 2QURA 3KA0A 4QDEA 4YTHA 4BJJA 3CPBA 3LQ3A 3TJCA 5KMKA 3CSVA 5FEDA 4EQMA 4EKKA 3SOAA 4FSMA 1FQ1B 3VRZA 3R6XA 1JLUE 2YCRA 3TV7A 4PL3A 3VQHA 5ANKA 2XB7A 3R83A 3TCPA 2OBJA 3U9CA 4I5HA 4FTKA 4YBKA 3UJGA 4BCQA 4BTMA 2WQOA 5M07A 2R3FA 2Q83A 4RC4A 5KZ0A 3U8WA 3NIZA 3AKJA 2ZV2A 4O0UA 4ZSJA 4PF4A 3PJ8A 3RPSA 4EH2A 4O0TA 3RI1A 3AT3A 5FBOA 4C61A 4C37A 4YZNA 2BRBA 2UZDA 3DTWA 4L3LA 4IVAA 1R78A 2WOTA 4K18A 2I0EA 2WQNA 3S2PA 3TV4A 4ZOGA 5LVOA 3MPAA 3S1HA 2WPAA 5CI6A 1PXMA 3UYTA 1HCLA 4LMUA 2XA4A 3N4VA 5DPVA 5C9CA 2R3QA 4EKLA 4IMYA 2A2AA 5B2MA 5LVNA 1JNKA 3WF9A 4FG9A 2QU5A 1PKDA 4IX3A 2BAJA 4QNAA 3E5AA 1LPUA 1GJOA 3BV2A 4IJ9A 3BYOA 1G8JA 5CEIA 2ITYA 1PYEA 3GC9A 4Z9LA 3OT8A 3MY5A 3WE8A 3VN9A 5H9BA 4ZK5A 3ZOSA 2RIOA 1O6LA 2IJMA 3W0PA 2OH0E 1OGUA 2XIXA 3Q9YA 4F0IA 4MD7E 5KZIA 3N51A 2VWYA 3QZIA 4UV0A 4DG2E 3NNVA 3RPVA 3QCXA 4EYMA 4KS8A 4WNOA 4FKOA 1U5RA 3MJ1A 4D58A 2RFSA 2J50A 4JIKA 4O21A 3R8ZA 2VO0A 5EYMA 2YAAA 3IDCA 1IA8A 3MH0A 2QC6A 3KRWA 3VQUA 4C3PA 3TIZA 4AGCA 4R3PA 4JVGA 2JBOA 2UW0A 3GB2A 3D4QA 4AW5A 2I1MA 3V8TA 3NUNA 4BCGA 3ZUVA 5A14A 2XIZA 3A60A 3SG9A 2WEVA 3CBLA 4AXDA 3PYYA 4RVLA 5EDQA 3KC3A 4XV2A 2G15A 2QOKA 3FV8A 2NNWB 4FTMA 3BWFA 4B4LA 4IEBA 4F78A 5JGDA 4TZRA 2BROA 3PSBA 5BVNA 4LFIA 2BTRA 3KVXA 4PNIA 3LFCA 2HENA 3C7QA 4D4RA 1KOAA 5LVPA 2IPXA 2XEZA 5CEPA 4MVFA 4O6EA 4U41A 4YPSA 4O0XA 3ULIA 1WBTA 3I6WA 1W0XC 3H9OA 3CS9A 4M0YA 4X2FA 3MSSA 4YTIA 1TQPA 2BZJA 3IDBA 5E1SA 1F0QA 4U42A 4IH8A 3QQKA 4WNKA 3ORZA 5AUWA 2R3LA 4G5JA 3Q32A 4CEGA 3BYMA 3UZTA 2VAGA 1E9HA 4YO6A 3ET7A 4J8MA 4F09A 2Z02A 3EQBA 4IAYA 3CEKA 4MD9E 5CLPA 3WF5A 1OKZA 4C02A 4JQ8A 4QMXA 4DGGA 3M42A 3W16A 4AZFA 1FINA 4QQJA 2A19B 4LRJA 3NUSA 4NH1A 3G9LX 4OT5A 1KE6A 4RA4A 1W98A 3NLBA 4RX5A 3KXZA 1FVVA 1MQBA 2UZNA 2WQMA 4G3EA 4ZZMA 4LRMA 3T9TA 2NO3A 3PFQA 4O7YA 2ZYBA 2C6DA 4F0FA 4R7HA 4FK6A 4M67A 1ZXEA 4C35A 2YM7A 2AC5A 2YJRA 3DOGA 3QF9A 4U3YA 1J1BA 4Y5HA 4CKIA 3VBQA 2X0GA 2V22A 3JUHA 3L8VA 4Z7HA 5JSMA 4EJ7A 5BVFA 3T8OA 4RWIA 4W8EA 2OSCA 3DFCB 4MX9A 3RHXA 4FV4A 4LMNA 3KMWA 2VO3A 3BBWA 1PXKA 3EKNA 1KV2A 2BFXA 1Q24A 3HMNA 4QTCA 4RRVA 5EM5A 4AOTA 2IVUA 1QL6A 5HVJA 3L9MA 5GJGA 3R9OA 4HVHA 1YXXA 2XKDA 4RZWA 2R3NA 5CTPA 4C33A 2VZ6A 1P4FA 4DDIA 4I0SA 3PE1A 1XH8A 1M17A 1M2PA 5EK7A 3JVRA 3P08A 3F66A 2GSFA 2VX1A 3KF7A 2CJMA 3UOLA 4QMSA 3DV3A 5EI8A 2BTSA 4RFZA 1ZRZA 3EQFA 4RIXB 2Y0AA 3SRVB 3ZRMA 2UZOA 5DH3A 2J9MA 3E8NA 4I6HA 4UY9A 5HBEA 3LFQA 1OKWA 1S9IA 4ACMA 2Y4IC 3F61A 4FTRA 2WNTA 2GQSA 2V0DA 2GTMA 3NVMB 3V5TA 3BI6A 2B55A 3OCBA 4AZEA 3C9WA 3R7VA 4E26A 3EQIA 3BQRA 4AXCA 3KK9A 4AA5A 3D94A 2VTJA 4RJ8A 5BVWA 3R9NA 5C1QB 4GH2A 5KMOA 4AX8A 4D0WA 4K33A 3FSKA 3MFUA 3TV6A 3Q96A 2NRYA 3ROYA 2GNFA 1GAGA 2QOCA 2XALA 3LFBA 4M69B 5CZIA 5FLFA 5TKDA 3W0MA 3LJ1A 4I5CA 4JBVA 3ORTA 3QD2B 4GFOA 4H36A 1SVGA 1M14A 3PWYA 4RIYB 5M4FA 2WMXA 3QKLA 1ZMWA 2CN5A 3W0RA 4FT7A 3R8LA 4YUQA 3CTJA 1PKGA 3TKUA 1FGKA 1WVXA 4H58A 5L8LA 2FVDA 2HYYA 5E8SA 4A4LA 1YWVA 4L7FA 4ASEA 3R73A 5DR9A 3W2OA 1PY5A 1H1RA 3QQHA 1K3AA 1MUOA 3OG7A 4GT3A 3U55A 4QMNA 3QTZA 3VBYA 3DAKA 2XZSA 3VF8A 3W2RA 1REJA 2PTKA 2PZPA 5I9WA 3VF9A 3JXWA 3VHEA 4ASDA 5LMKA 2CKPA 3U54A 3OWLA 4WT6A 5J95A 1B39A 5CXZA 4FKRA 1SYKA 3DU8A 3FXXA 5FBNC 3WZKA 4W8DA 4F9AA 1BL7A 4G31A 4BIDA 4WSYA 3QXPA 2X4ZA 3OEFX 5CT7A 3ZM4A 4I41A 3ZO2A 4E4XA 3LIJA 4FICA 3EN5A 3DBFA 3GFWA 4AT3A 5IQAA 4YP8A 2WHBA 5CAPA 2VU3A 4FGBA 2XIKA 4DEAA 4J71A 2E9PA 3COHA 3OD6X 2WIPA 2Z60A 3ODZX 3I4BA 4BBEA 3MY0A 2B52A 1RW8A 4I93A 2VWZA 4CV9A 1V0OA 1UWJA 4DFXE 1T46A 3I5ZA 3ZCLA 2B7AA 4JBOA 2IVSA 4JDIA 4C4HA 4GYIA 3IW7A 5L2SA 4FV1A 4CD0A 3AMYA 2V7AA 3NZ0A 4YJRA 5CSXA 2J2IB 3W0NA 3BL9A 4BTJA 2VTOA 3PIXA 3VO3A 2W1FA 4APPA 2B53A 3EHAA 2GMXA 2X2LA 4Y83A 4ZY5A 4DGNA 4FSUA 5CAUA 3EQCA 1TKIA 5IUIA 2UW6A 3OTVA 4WBBB 4LM5A 3VUKA 4KKGA 2CGUA 3BHUA 3RHKA 2PE0A 1P2AA 2P55A 5FM2A 2QVSE 4FA2A 2IW6A 2O0UA 2WEIA 3R9DA 1OZ1A 1ZYJA 3GU8A 3LE6A 4FKQA 5DFPA 1UKHA 3QFVA 2HWOA 4GYGA 3I1AA 4R1VA 3VBXA 4O91A 4C34A 3BZ3A 1RE8A 4PP9A 5IQCA 4L45A 3C4CA 3R7OA 5K5XA 4E5AX 4K2RA 4TTHB 1YI3A 2PVMA 4XLVA 5FQDC 4DFYA 2VTTA 3F2AA 5HO8A 3W1FA 3UIXA 1CKJA 4LI5A 3THBA 4K6ZA 3Q4TA 5HE1A 4MF1A 5FDPA 2XAOA 4IM3A 3E64A 3WIKA 4CSVA 5IEYA 2JKKA 3GCQA 4EK5A 1YDRE 4ACHA 4F65A 1IAJA 4RVTA 2F57A 3RPOA 4C58A 3WE4A 4FEWA 5A4CA 2VTNA 1DM2A 3UQFA 3DBCA 4FSYA 3VUMA 3EIDA 4MH7A 2HZ0A 4UWYA 2X1NA 4IB1A 2IZSA 2BMCA 4L68A 3KCKA 2G2HA 4AUAA 3HMMA 4MUQA 2Y4IB 4RSSA 4HGSA 2IWIA 4RJ3A 4YHTA 5IZFA 2LGCA 4AZVA 4OR5A 4B9DA 5HTBA 3V5QA 5K4JA 4J97A 3UODA 3F2RA 4CMOA 4QYGA 4ZP5A 5CEMA 2JKQA 3FMJA 4IANA 2P2IA 2F7EE 2WMRA 3OF0A 1Y6AA 5FTOA 5T3QA 3FMLA 3UYSA 4NW6A 4FV2A 4IWOA 2I7QA 3SC1A 4ZS0A 4EOQA 5CEOA 4JT3A 2WOUA 3KXXA 3CE3A 3D5UA 3QTQA 3AC4A 3R7YA 1JSTA 5CF4A 4ZZNA 1X8BA 1OECA 3ZBXA 4A7CA 3ZLYA 2OFUA 4RPVA 2C1AA 4FKTA 2QODA 4RQVA 4FYOA 4EH8A 1WFCA 2C0OA 3BPRA 1OKVA 5C03A 3MW1A 1KSWA 5C01A 4OTRA 2PZIA 4CV8A 2YIWA 1OBGA 3PRIA 3HV4A 5IQGA 4RIYA 1UWHA 3P7AA 4FNZA 4HZRA 4FX3A 4NTSA 3ZO3A 4YJTA 1XH4A 3RP9A 1Q8YA 3FY2A 3FAAA 3OROA 3PY0A 2OK1A 3UC3A 5JGAA 3BGPA 3QAME 3GCSA 3NSZA 4CVAA 5DA3A 1VYWA 1QPCA 5BNJA 2FYSA 3OBJA 5B2LA 3CD3A 3KF4A 3FBVA 2X6DA 3IW4A 4IADA 4O7VA 2V5QA 3NW5A 3MJ2A 4N6YA 1PMVA 5JT2A 3ANQA 4G17A 3UO4A 3UO6A 4O27B 2V62A 4TKSA 4E4LA 1J91A 1YI6A 3DK3A 2BKZA 3ZBFA 4HW7A 3FXZA 1WVWA 3ORLA 3LCKA 5E1EA 5FRIA 1GZNA 4H3BA 4GUEA 5CVHA 5HNGA 1OPJA 5IA5A 1PXIA 4TPTA 3OTUA 2UZEA 3QRJA 2UZTA 2VTLA 2XK7A 3ALOA 1QPJA 3IONA 2R3OA 2JIUA 3O8TA 5JK3A 4O2PA 1OUKA 4IFGA 4NJDA 4CMUA 4M15A 4XHKB 3A4PA 3UQCA 4N70A 2J0KA 1H1PA 3AC5A 3F7WA 2XK8A 3RZBA 3UNKA 3PZEA 1I09A 2ZJWA 2PL0A 4ONAA 5GNKA 1TFFA 4J52A 1OPKA 3MI9A 2O65A 2W1GA 3K5VA 1WBPA 2ZOQA 3NVKI 4FZAB 3UTOA 4H05A 4UZDA 3OCGA 3VWAA 3FKOA 5AADA 2VWXA 2GNHA 4S32A 4BTFA 4HGLA 4V04A 4YSMA 5AM6A 2X4FA 4ZMFA 1ST4A 5A6OA 2X8IA 5CQWA 4JBQA 3O50A 2QHMA 4J98A 3AD6A 2UUEA 3KVWA 5L6WL 3UGCA 5AAGA 1YRPA 1YHSA 1JSVA 1S9JA 2IZUA 4DFUA 2BRGA 4LQMA 3SG8A 4O6LA 4AN3A 1ND4A 4RLLA 4YGAA 2ZM3A 3I6UA 5DT3A 2HAKA 4NM3A 4UYAA 4FSZA 4EHGA 5HG9A 1J7IA 2C3IB 5HG8A 3CQUA 4DEHA 4QP8A 2ZB0A 2JIVA 4L6QA 2BRNA 3RAWA 1BI8A 4QTBA 2BFYA 3LMGA 3BL7A 4OT6A 5FEEA 2YITA 2QKRA 3FLSA 3UNJA 3WZEA 3AOXA 2WQBA 4QT1A 5A4EA 2DYLA 2W1DA 3HLLA 2O2UA 3AT2A 3H0ZA 4DT8A 2XS0A 4KBCA 4AQCA 1BKXA 1G3NA 4W4XA 5HCYA 3PWDA 4LL5A 5CAQA 2I0VA 3ZONA 2O8YA 2HXQA 2W17A 4BGGA 5FXSA 5HLNA 5DEYA 2R64A 4KA3A 2QI8A 3AG9A 4E1ZA 4AZTA 4E5BA 3ALNA 2ITVA 3S00A 3K2LA 3QTWA 3MH3A 3BQCA 3P86A 3FI8A 4ZSGA 2BRMA 1H24A 2UZUE 3EYGA 4G9CA 3KN5A 4M7IA 4EORA 4TT7A 4BYIA 4BRXA 1ATPE 4IWDA 3SAYA 1Q41A 3D5XA 5E4HA 4DEDA 3CKXA 5EW3A 3BHTA 4ZJJA 2HW7A 2QO7A 2C6IA 2W5BA 4FZ6A 4LDTA 3TDVA 1AD5A 5AP4A 4ENXA 2JDVA 4FG8A 1YHVA 2R3MA 4IM2A 4XUFA 4BDDA 5HTCA 5AAFA 3GOPA 3ZO1A 5D10A 2OG8A 3QZHA 3DTCA 4PDSA 2WZJA 4YJQA 2C3KA 3FQSA 3TN8A 3HX4A 5L2WA 3EYHA 3MB6A 3UOHA 4GL9A 1LR4A 4QP6A 4TYGA 2I0HA 1UA2A 2F7XE 4Z55A 2IVTA 2FO0A 3SW7A 3EB0A 3HECA 1NVSA 2B4SB 2ZV9A 3A99A 4I92A 5IQIA 2QOBA 2BDWA 4BCFA 4KKHA 4OTDA 4YJUA 1YW2A 3LCSA 4EBVA 5M4CA 3JS2A 3LFDA 4QO9A 4AZSA 4ZTRA 5G1XA 3D2KA 1VR2A 4MXAA 3ZEPA 4O0WA 3LCOA 3MS9A 2W4JA 3L9NA 4P5ZA 5IDPA 3GQIA 3C4WA 5IMEA 3LCTA 5IH6A 3DBDA 4FIJA 3LZBA 4WIHA 3G90X 3HEGA 2O5KA 2BALA 4K0YA 3U9NA 3OXZA 3R63A 2BZHB 4AFEA 1XJDA 4JDJA 4LV5A 4D2SA 4RA5A 4FODA 5LCJA 3IO7A 3IGGA 4QP1A 5DN3A 4FV5A 5BYLA 3TKIA 2UW3A 4PMPA 3QTUA 4FE2A 1OIUA 1ZMVA 1YXUA 4X0MA 3WF7A 4CFWA 1Q3WA 3T3UA 3I7BA 3LQ8A 4JBPA 4CXAA 4LRKA 5JFWA 3DLZA 2C68A 4XS2A 2F2CB 2BVAA 4YTFA 4FZDB 4XG7A 3PRFA 2AC3A 4ZSAA 2PZYA 3FY0A 4FKJA 4EZ3A 5K9IA 2YDKA 1KOBA 3W2SA 4CFNA 3D0EA 4ERKA 4YR8A 2Y6OA 2UW8A 2OWBA 2YFXA 4TWCA 4GW8A 1YOMA 2OF4A 5HI2A 3GU7A 3SX9A 4ANQA 2QOQA 5D7VA 5HIBA 4FIGA 2C47A 4KBAA 5ACBC 4BBMA 3UG1A 4BIEA 4A9TA 2B9JA 4YLJA 4ALVA 4BCNA 3FMEA 4WG4A 4BDGA 3MVJA 4YZCA 4DH3A 4M3QA 4XBRA 4HPUE 4O0VA 1Q8TA 4CFMA 4CNHA 2ITUA 4GKIA 3G51A 2PVLA 4FTUA 1Q8WA 2JIIA 4NTTA 4AN9A 1GOLA 1IR3A 2CMWA 3FMMA 2HY0A 4FZ7A 5HVYA 4B0GA 5CF6A 5HIEA 3HMIA 1M2RA 2Z7QA 2XF0A 5CU4A 4IE9A 5ANEA 4DH7A 4C36A 2IVVA 2YWPA 4JNWA 2GNLA 2QOHA 4YMJA 5HQ0A 4EWHA 2YIQA 1PMNA 4AW1A 4IBMA 1E1VA 2ERKA 4PX6A 3V5JA 5AWMA 3ZDUA 5IG1A 3EFKA 3UIMA 4YC3A 1DAYA 4GFGA 5HD7A 3KXMA 5LMAA 3JY0A 5J8IA 2WTVA 4GIIA 3E92A 4B8LA 2P4IA 2G2IA 4NT4A 3W2QA 1NW1A 5BMSA 1SZMA 4EK8A 5IDNA 5J7HA 4RFMA 2GCDA 2ACXA 1OL2A 4AF3A 2XH5A 4EC8A 3RK5A 4FGRA 4PTEA 1M7NA 2FA2A 2Q0BA 3PG3A 2WB8A 3PVGA 4Q5EA 4U9AA 5EM8A 3FLYA 4LG4A 4AACA 2XK4A 4DGOA 1OL1A 4F4PA 2EWAA 3BYVA 1TQIA 3R02A 5JRSA 3RCJA 2GHLA 3NUYA 3UDTA 1WMKA 2JD5A 3PUFC 4BGQA 3C5IA 3OW3A 4EZ7A 2CNQA 2BAQA 5A9UA 3D5WA 3RVGA 4ZTHA 1XWSA 3HV3A 3MTLA 4J53A 2NP8A 3WZDA 3R71A 4GK4A 4XX9A 2JKOA 2WU6A 4ANSA 5CF8A 5A3XA 3LM0A 4YO4A 2ERZE 5LVMA 2XCKA 3OS3A 1J7UA 4YZDA 3R8MA 4FKUA 3QUDA 4RLKA 3PP0A 4BDKA 5IA3A 1OI9A 3BLRA 2YZLA 2GTNA 2JBPA 2ZV8A 2HZIA 5EHLA 4YJVA 4D1ZA 2EB3A 3AXWA 3BV3A 4E73A 3C50A 1ZZ2A 4KIPA 4R3RA 3R1YA 5BX0A 3ODYX 2WELA 3PTGA 3O96A 5L2IA 5AEPA 3PVBA 4NJ3A 4MK0A 3PXFA 3A4OX 2ZB1A 3FHIA 3RWPA 3M1SA 3TM0A 4ACDA 4BDEA 1NA7A 4UZHA 3HUBA 4RGJA 5BVKA 3COKA 3E3BX 3DKCA 2EUFB 3MTFA 2Z8CA 3TZMA 3A8WA 4O2ZA 4DEIA 2J5EA 2FSTX 2VWUA 1JOWB 2YA9A 1XBCA 4AQKA 5HORA 3O71A 3QZFA 3OOMA 3PSCA 4RT7A 1QPEA 4LV8A 1OVEA 3MPTA 3EQPA 2R7IA 4LOQA 4X6QC 5CU2A 1YQJA 3LJ2A 3MESA 1W7HA 4DN5A 4RBLA 2OLCA 5HKMA 3EWHA 5J1VA 2VO7A 4X21A 2XK9A 3CQWA 3R1QA 1LUFA 3DAJA 3EQGA 4DITA 1YHWA 3HVCA 1YVJA 3PXYA 1BL6A 5TF9A 3HA8A 3D7ZA 3U6HA 4O7TA 4O81A 4EOJA 1JKSA 3EQHA 4UXLA 3E62A 5ETFA 3ZUUA 4BN1A 3HV5A 4DA5A 1BUHA 3COIA 4MQ2A 2C6KA 1FMKA 1IRKA 3C0IA 2JAMA 3PSDA 2FH9A 4TWNA 3UOKA 5AAEA 3LHJA 5HBHA 1HCKA 4GK3A 3NR9A 2NYAA 3DY7A 4QMOA 4F9BA 5HCXA 4CFUA 4DLJA 3LMIA 5GHVA 4C4IA 3GGFA 2C3LA 3ITZA 4PY1A 1Y6BA 5TT7A 3FI3A 4I6FA 3DK6A 4XOYA 3QZGA 3RM7A 3W32A 5ETIA 2WMUA 4BCIA 2R0IA 3E63A 3QD4A 4HGTA 4IAZA 4FV6A 3SD0A 4IHPA 3UC4A 4Q5HA 5L2TA 2WU7A 4IAKA 1OIRA 2W96B 1WBSA 3EFJA 3GP0A 4AW2A 3BCEA 2GNIA 3TEIA 4BI1A 4N4SA 1REKA 2QOFA 2VX0A 4JQ7A 4U6RA 1P14A 5E9EA 3SV0A 3W33A 5AV4A 4AGWA 3HDMA 4RX7A 4BTKA 2F9GA 3CY2A 3RALA 2F49A 2PUUA 3TUCA 4R1YA 4G3CA 4L8MA 3TI1A 3V04A 4DF3A 2XAMA 2VNYA 2VUWA 4M12A 3ORXA 3Q6WA 2G01A 2W1HA 3NX8A 3AC8A 4M84A 4XOZA 1XMLA 4RZVA 2W1IA 1PYXA 3KRRA 2O3PA 5ACKA 1IEPA 1Q8UA 2UW5A 4GS6A 3O0GA 4H1MA 2YABA 4NWMA 3POZA 4BF2A 3ETAA 5FEQA 4OTFA 2AUHA 5KMNA 3R8UA 2UZBA 5EQPA 1H00A 3QRTA 5JZJA 5EYDA 1JKLA 2O64A 4FIEA 3CQEA 2J0LA 5KMJA 2Y6MA 1NXKA 4G3FA 4S33A 4BDAA 5BQ0A 2Z2WA 4NW5A 5FTQA 3Q04A 5CANA 2CN8A 3GOKA 4FMQA 4FTLA 5EYKA 2OXYA 3VAPA 3ZXTA 4ANMA 2GQGA 2WTIA 1GZ8A 1CSNA 2X2MA 4L42A 3FZSA 1PRYA 3BBTB 3GCUA 3UVRA 1SM2A 3WYXA 3DLSA 2C5XA 1T45A 2ZM1A 3QHWA 2DWBA 4U81A 4TYJA 2PUNA 3COMA 3DJ6A 3Q9ZA 1PMUA 5FG8A 4CFVA 4QMMA 3I7CA 5D41A 4RC3A 5EI2A 5CNOA 4ZSEA 1U54B 2A0CX 4EOMA 2PULA 5HNIX 2ESMA 3O51A 5AIRA 1QMZA 3WZUA 1MRYA 3A7JA 5CENA 2WMSA 4U40A 3H3CA 3AC1A 2VTIA 2WFYA 3NFGB 4O7RA 5C26A 3C5UA 4ITHA 5HLWA 4ANBA 3LOKA 4W4YA 1F5QA 3MH2A 3TUBA 3TT0A 2CHLA 3SKCA 3FI4A 3T9IA 5TR6A 1G8SA 4FV0A 4ZMEA 2C6EA 4ZTQA 5IQBA 4JAJA 2VTHA 2Q0NA 3TZ7A 4KKEA 5HNBA 2VX3A 2GNJA 3A7IA 5CQUA 4ZTMA 3F3TA 4PTGA 2PE2A 3PY3A 4GUBA 3V51A 3ZZWA 2ETKA 4BHZA 3F69A 1Q99A 3A61A 4JJRA 2X7FA 3LXLA 1ZYLA 4OBQA 4TNDA 5F20A 4AAYA 3ORPA 2HY81 3SXRA 4B99A 5JRQA 2GS7A 1DI9A 1CTPE 3NNXA 3TACA 4OTHA 4R7BA 4X2NA 1G8KA 4GG5A 4IQ6A 3D5VA 3IKAA 3NFFB 4S34A 5D1JA 5AV1A 4E4MA 2ZMCA 4IAAA 5IQDA 5C8MA 3U6JA 3QKMA 1O6YA 3SXSA 4QNYA 4AT5A 3AMAA 4YLKA 2P0CA 4CLJA 1KV1A 5FD2A 4DCAA 3L8SA 4R77A 5HLPA 4QMPA 5I5ZA 4AP7A 2R4BA 4CRSA 3V8WA 2QD9A 4FL3A 1PW2A 4XG8A 4XG2A 2WMWA 3RK7A 1OIYA 4XEYA 3RNIA 5LVLA 1PF8A 2HOGA 3MWUA 3VNTA 4WKQA 3WF8A 1U59A 1R39A 1ZYSA 2W05A 3GUBA 5AX3A 3NDMA 5LXMA 5M56A 2HXLA 1YOLA 4NM7A 4O7WA 4QYYA 4X2KA 4DTKA 4EEVA 4D0XA 2GFCA 4QYHA 3ZTXA 3NAYA 4IB3A 1XH5A 1W8CA 4DBNA 5M06A 5D11A 2OFVA 4XMOA 2ETMA 2VGOA 1AGWA 1UNLA 3FL5A 2GS2A 3FKNA 5JZNA 5J9ZA 4XG3A 4EH7A 5D7AA 2VTPA 2ITXA 3OWKA 1H0WA 3LM5A 3KGAA 3TZ8A 4I0RA 4O38A 4ARKA 4C7TA 3KFAA 3Q6UA 1OM1A 2C5NA 1Q97A 3W55A 4ZZOA 4IZ7A 1OMWA 3KRLA 3IGOA 4U0IA 3JYAA 4PP7A 4AU8A 3DGKA 5CSVA 1XQZA 4YPDA 4DH8A 1OPLA 3AMBA 1JKTA 4QDVA 1CKIA 5E8WA 5AUXA 5C4LA 3EZVA 4EI4A 4G6OA 3MVHA 5I9ZA 4MAOA 4G2FA 4FKGA 4BR3A 4CTBA 4LL0A 3RINA 4RMZA 2PZ5A 3VJNA 5M44A 4C2VA 4DEBA 4ZTSA 4EZ5A 4A9YA 1U4DA 3SGCA 4O7NA 4BKJA 3FLWA 3PXKA 4MQ1A 4MXCA 1B38A 2RFEA 3LKMA 3KMUA 3R1SA 2XIRA 5HG5A 3QCQA 2G2FA 4BHNA 4GV1A 1H0VA 5CEKA 2WTWA 2WMTA 3RAIA 3DNEA 3PVWA 3C51A 3NUUA 2C4GA 1YOJA 2H9VA 3KXNA 4U3ZA 3ZSHA 5KMLA 2PZRA 5CVFA 5HBJA 5DHJA 2PUPA 3OXTA 3VS1A 1U5QA 4FTTA 1H1WA 3DXQA 5F4NA 3QL8A 5I9VA 3UOJA 4EBWA 5KUPA 5DYJA 4AA4A 4QTDA 3B2WA 3UIUA 2WMQA 2X6EA 4ZLZA 4EH3A 4RIOA 4ZAUA 3K5UA 3UPXA 4Y95A 2CKQA 4YNEA 2FGIA 5A6NA 3EFLA 5IA0A 4E6CA 4AA0A 4YJNA 5ANGA 4N0SA 4DFZE 2X8EA 2BZKB 4AN2A 4E93A 2SRCA 5EH0A 3V01A 4M13A 5H8GA 3P7BA 4JQEA 3ZSGA 1O6KA 3EOCA 4CCBA 4FSNA 1U54A 3FDNA 5CS6A 3OVVA 2QCSA 4YC6A 4K11A 5DE2A 2JFLA 3LW0A 4ZEGA 5D9HA 2XYNA 3F9NA 2X39A 2CLXA 2GU8A 4KUJA 4EQCA 2B9HA 3PA4A 2VWVA 1TVOA 3MH1A 4QQCA 4EHEA 2H34A 3C4EA 4O84A 2HELA 1GZOA 3MIYA 3OBGA 2UW7A 5LQFA 4NYEA 3CTQA 3QA0A 5CU3A 2XIYA 2XKFA 3IK3A 3HRCA 3R1NA 4G9RA 1ERKA 4I6LA 3NW6A 4ZLOA 3V6RA 4Z7GA 5K3YA 4CCUA 3VONA 4S30A 3I79A 4NFMA 1UKIA 5M51A