4AQKA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase in complex with adp and ip6
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
437
structure length
414
Chain Sequence
b'MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICREGRPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Apo Form of Insp5 2-K from Arabidopsis Thaliana.
pubmed doi rcsb
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 127
structure length 414
sequence length 437
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aqkA01
4AQKA 2XARA 4AXFA 3UDZA 2XAOA 2XALA 4AXCA 3UDTA 4AXEA 2XAMA 2XANA 4LV7A 3UDSA 4AXDA
chains in the Genus database with same CATH superfamily
1YVJA 4NW5A 2PE2A 3R7YA 2ERZE 1WCCA 5FP5A 4XBUA 3P23A 4IDVA 4IX6A 1YOMA 3PPJA 4RJ7A 3W2QA 4AXEA 1CM8A 1A48A 1OL2A 3QRIA 5FQDC 4RWKA 3NX8A 4YLKA 4C7TA 5CZIA 3KB7A 4FX3A 4E5WA 5F9EA 5ETFA 2RL5A 2IW8A 3A8XA 4EL9A 4PNKA 2IW6A 3ORTA 5CXZA 4R3RA 5DYJA 4WNMA 4R7IA 5HG9A 4DEAA 4W4YA 4FTMA 4HGEA 2YEXA 4BHZA 3EFKA 3L9LA 2XANA 2J2IB 2YZAA 3O71A 2WMQA 4ARKA 4ID7A 5HI2A 2B9IA 4U9AA 4CNHA 2PWLA 2FGIA 2R3RA 5IG1A 4MD7E 3NUXA 2DUVA 3B8RA 4QMMA 3HV7A 4LDTA 4C35A 1YI3A 1GIJA 3KRXA 2OXYA 4IAZA 3W2RA 5KUPA 5HCYA 3U55A 4WNOA 3R6XA 1REJA 3LFQA 3SV0A 3ZXZA 1S9IA 3MPTA 4ASEA 4ZZOA 2BRBA 3BU5A 3ZH8A 5BYLA 5J9YA 1BYGA 2GFSA 2R9SA 2WU7A 3LMIA 4FSMA 4CTCA 4EZ5A 5DEWA 3TZMA 3BHTA 4E73A 5JK3A 3ZLYA 2I0VA 3KXGA 4NJ3A 2OF2A 4H1MA 4QDVA 2VGPA 3LLTA 3W2OA 2WQEA 1ZZ2A 5HEZA 5JRQA 4FE2A 4PMTA 3CJGA 3KRWA 3QZFA 2ITTA 2VGOA 2J5FA 4C4JA 2ZDUA 3NCGA 3ZFMA 2X4FA 3QZHA 4GFOA 5BX0A 4I1ZA 2BRMA 4Y5HA 4M0ZA 2XVDA 3DK3A 3KEXA 1ZYCA 5AFVA 1Q8TA 4FKSA 4YTFA 5E8UA 1DM2A 2P2HA 5FTQA 5HHWA 3C7QA 4V01A 3D5XA 1OKVA 1YHWA 1ZRZA 4HGSA 5IQAA 4CV9A 2QOFA 4EBVA 2W17A 4G6LA 2Y4PA 4BDEA 3IGOA 5AMNA 3PWDA 4ASDA 4FZAB 4IM2A 4FTUA 3UC4A 4O0XA 2IVTA 3K3IA 4O81A 3TACA 4BCNA 5KMNA 4W8DA 2H9VA 4RA5A 4O0YA 3R8VA 3FEGA 3P1AA 1VYWA 3PXQA 2P55A 1DAYA 3TJDA 3W10A 5JFSA 4Q9SA 1IG1A 1LEWA 2XIXA 2NPQA 2O0UA 2EB2A 3TT0A 2J90A 2XBAA 4MEDA 2XIRA 2RFDA 3BV2A 1R3CA 3CTQA 2F2UA 3PIXA 5J87A 2C68A 3ROYA 1VYZA 3O50A 4APPA 5TKDA 4P4CA 4F7NA 2PVHA 4QMOA 5EW8A 3SD0A 4QYFA 3VS7A 2O63A 4AW5A 4XG6A 5GIOE 4XV9A 4GFGA 5BYZA 1XH8A 4A9TA 4IB3A 2PE1A 1SNXA 4MYGA 2CMWA 3ZHPC 3HUBA 4Y5QA 1ZZLA 1PMVA 4HW7A 1U59A 1XO2B 3HKOA 3F69A 4JIKA 4O7SA 1JAMA 4DGLC 2YAKA 3QCXA 2QLQA 3U6JA 2VX1A 2W1EA 4ALUA 2A2AA 4QRCA 3F3VA 2CCHA 2UZNA 2XAMA 4GIIA 3AGLA 4YPSA 5CF4A 4AN2A 1Y6BA 2W1CA 5CSXA 2QU6A 3DQXA 3GUBA 5BMSA 3PJ1A 4YJOA 1ZOEA 3PVBA 5C27A 3D2KA 1YOLA 2BUJA 3TUCA 4F4PA 2XF0A 4HYIA 3V8SA 3ORXA 1J7LA 4NM0A 2OXDA 1OGYA 2CKOA 4L01A 4FI1A 2A0CX 4I0TA 3DJ7A 5EQPA 2OFUA 4G3FA 2YHVA 2XK7A 4I0RA 3CQWA 4KKEA 4IJPA 4N4SA 4DF3A 3JVRA 3CJFA 3OG7A 5GJFA 1O6LA 3Q4CA 1YW2A 2VTPA 4ORKA 4PDSA 4EOMA 3ZMMA 5M55A 3TNWA 2HY0A 4ZSEA 4PMMA 3ZZEA 3ZFYA 1UNHA 3AQVA 4YC8A 3HYHA 4EC9A 5BVFA 5LMKA 3LKMA 4FSTA 3OCGA 2QOCA 4LRMA 4XRJA 4RZVA 1G3NA 3TIZA 1WBVA 2R3HA 4W4WA 4FTTA 4TWPA 3GOPA 2WQMA 2BFXA 4OBOA 1U54B 3GCUA 4JQEA 3EL7A 4MWIA 4W8EA 4O84A 4YLLA 3ETAA 3SOCA 4AN3A 4IACA 4FVPA 3OXTA 3C13A 5JT2A 5K9IA 2OJJA 2XNNA 3DFAA 3SW4A 4E5BA 1RW8A 4I6FA 4UYNA 1YRPA 2QNJA 3VJOA 4QMXA 3BL7A 5CANA 3UP2A 4JG7A 1U54A 2R3GA 2WTIA 4Z55A 3WF5A 2QOHA 2YM7A 5ICPA 4O6LA 4AOTA 2YCQA 4KWPA 4WBOA 3EQRA 3BHUA 5EOBA 4YC3A 4A4OA 5JEBA 3RHKA 3CR0A 3A7FA 1Q62A 4D4SA 2PE0A 4GH2A 4YSMA 4YR8A 4D55A 3ID6C 1J7UA 4L53A 2QKWB 4OTQA 2I40A 2BZJA 3CQUA 1ZOGA 3DBQA 3P7AA 4J1RA 2C5YA 4RFZA 2X2KA 4RVMA 5ANDA 4BCHA 2R3QA 3RAHA 3Q9WA 4MXZA 4O0WA 1P4FA 1U5QA 2H8HA 5CEIA 4Z16A 1VZOA 3LMHA 2UZWE 5IDNA 3ZLXA 5M07A 4FL3A 1T45A 5BUJA 4RFMA 2WQNA 4JDJA 5FRIA 3F3WA 3FQSA 4FEWA 3AKJA 3R1YA 2PSQA 2CNUA 4UZHA 4I6BA 4EHZA 4FV2A 2UZBA 3W0NA 2UVYA 1OVEA 2WTJA 3FY2A 5GIPE 2P3GX 4RJ5A 5CVGA 5LJJA 3BL9A 3DZOA 3S2PA 3V5QA 4H58A 1JKLA 4FK6A 3Q9XA 4XYFA 4BBEA 2R3JA 3VIDA 3VWAA 4RVKA 3DKFA 2WMRA 1BUHA 1M52A 3OY3A 2W1HA 2XNEA 2XUUA 1HCLA 1YQJA 5CF6A 4CEGA 4KB8A 5IQGA 3JS2A 5EK7A 5M09A 1XWSA 2UW5A 1H1QA 4C0TA 3FSFA 4YTCA 5JGDA 1QCFA 4BDJA 3R00A 2CGUA 2VRXA 4DEDA 4E4LA 4OTGA 2R3OA 2PK9A 4DFUA 5HCZA 5IA1A 4ERWA 4UX9A 2VUWA 5HLWA 2XKDA 4YUQA 5HE0A 4EH7A 1Q8WA 3UZRA 3EN7A 1IRKA 2WKMA 3EQIA 3D14A 4JAIA 4C3PA 3R02A 1PXKA 2VN9A 5DOSA 3AC3A 3ZO4A 2V5QA 3T9IA 4MQ2A 4BGHA 4EOQA 1PMUA 5IH4A 4UXLA 2QC6A 2IJMA 3CY3A 4FNWA 3DT1A 5J1VA 3I6UA 3VS2A 3ERKA 2HOGA 2YCFA 1H07A 2BDJA 3MH1A 4FG9A 4OTIA 3BX5A 3KMUA 4P90A 3RZBA 3MFTA 3RTPA 1UKHA 4XOYA 3DPKA 5C03A 4G3EA 4CLIA 5IEYA 2UW9A 3TYKA 4FKUA 4MXOA 1QPEA 4M14A 2XMYA 4ZS4A 2XALA 2YDKA 4BDCA 4RJ3A 4WNKA 5EHYA 4ZTMA 3MTLA 3N4VA 2Z02A 2R5TA 3R22A 5CVHA 3TCPA 4HGLA 3N51A 3DFCB 4LOQA 4O7ZA 5HICA 2QONA 1ZYJA 4JMQA 4TYHB 5EYMA 5F94A 4X6QC 4R1VA 5JGAA 5CF8A 4D58A 4RC2A 2B53A 1IASA 3FLNC 5FGKA 2ETMA 2XCKA 3W0MA 5ETCA 3OEZA 3V8WA 2X8DA 4AA4A 4U40A 2BTRA 3U87A 2Q0BA 1U5RA 4I5HA 4X0MA 3OOMA 5AV1A 4DN5A 2ZVAA 5HBEA 4HZRA 4TYHA 2ITNA 3TTIA 3UJGA 1M7QA 1KUTA 1Q3WA 5BUIA 1KE8A 1ST4A 3F3TA 5CEKA 4MD8E 3FI8A 3IDPA 4BI0A 3JY9A 4GU6A 1OUKA 1XJDA 1YWRA 3FQEA 3HAVA 3ORZA 3QYZA 4FZ6A 4U80A 3PJ3A 3KF7A 4TYEA 4DLIA 3B2TA 3DKGA 4DEIA 5HU3A 5AP7A 2YACA 3DXQA 3OS3A 2XKCA 3NR9A 2HZIA 3OBJA 3ZM9A 4OBQA 3Q5IA 3ROCA 5L6PA 4R78A 4XP2A 5HNGA 3KRLA 5LOHA 4O27B 4KNBA 4LMUA 4KS7A 2J0KA 4D5KA 1H28A 3DTWA 4ALVA 3N9XA 3UZPA 3OCTA 4GEOA 4X7QA 4TY1A 2R3MA 2G1TA 5DT3A 5GINE 2B9FA 4M7IA 2IG7A 1GOLA 2P2IA 5FEEA 4BYIA 1OZ1A 3FC1X 2Y7JA 1AQ1A 2X9FA 4FTRA 4NT4A 3WZJA 4F1TA 3ZRMA 2BIKB 4D1SA 3L8VA 1H1SA 1QPJA 3Q96A 4AAAA 4GJ2A 4GJ3A 3A99A 3LXKA 4F65A 3UYSA 4D0XA 2DQ7X 3GVUA 1GZNA 2OJFE 3A61A 2UVZA 5IQHA 1SVEA 3K5UA 4XV3A 4C3RA 5KMMA 3HRBA 3R30A 3UDZA 4J53A 3TM0A 4B8LA 1FPUA 2IVUA 1CDKA 2JFLA 4QP8A 3EQCA 5DG5A 2W7XA 4E6CA 2VWBA 3NUSA 1PXIA 2J50A 3UOLA 4AZWA 3BV3A 2UZTA 3BLAA 2X81A 1M14A 3BYSA 3ZRLA 3LHJA 3V01A 3W2PA 2RF9A 1J7IA 2BDFA 5JFXA 2WU6A 2R3KA 1X8BA 2VZ6A 3MJ1A 4QNAA 4YLJA 5E7RA 4QMZA 4ZLZA 5LMBA 2G01A 3E63A 3UQGA 4CFMA 1W0XC 4E4MA 3BRBA 3L9MA 3ZFXA 4A4LA 4FVQA 3R8ZA 3HV4A 4WD5A 2C6MA 2Q83A 4I6HA 4C4HA 3R7UA 2PMIA 4K1BA 5TF9A 2NP8A 2WMSA 4EC8A 4GU9A 1MRVA 2X4ZA 3R71A 1M7NA 4NCTC 2Y0AA 4TTHB 4MBJA 2QG5A 3QUDA 4I23A 2CJMA 2Z8CA 5EM5A 3FZOA 4O7RA 3QWJA 2GNGA 2Z60A 3HVCA 3MW1A 2JITA 5GJDA 2ITZA 3QZGA 3S1HA 1UU9A 3R21A 4FV0A 1G8JA 3IDBA 4H3QA 4P7EA 2GDOA 1Q8YA 4JI9A 1J91A 4FSNA 5HG5A 4FKIA 4HCTA 4GK3A 4YSJA 3UGCA 3PRIA 4K11A 4F6UA 4RX7A 5HG8A 4AZSA 1KWPA 4ENXA 2WMTA 3VVHA 3MIYA 4O0RA 3OXZA 1P4OA 3L8SA 4BCPA 3I60A 4XX9A 2PMLX 3CBLA 3POZA 5IUHA 5D1JA 3ZS5A 4TWCA 2G9XA 1NXKA 2IZSA 2HXLA 2JEDA 2ITWA 3ZYAA 4D0WA 4XHKB 4QOXA 4R7BA 3KMWA 3SXRA 5AX3A 4V05A 4WO5A 3OY1A 3GCSA 5KCVA 1SM2A 2YDJA 4XRLA 2BAKA 4B8MA 4JIAA 4E6DA 4HVIA 3D7ZA 4LMNA 2V7AA 2CKQA 3RPRA 3S4QA 5H2UA 3W55A 2UZDA 3P0MA 4UYAA 1K9AA 2OW3A 3LW0A 5ETAA 3FDNA 4KABA 4NM5A 4EHEA 4Y73A 2OLCA 4N70A 3LCKA 1QPCA 2C1BA 3BYMA 2C3JA 4FGRA 4B4LA 3ZU7A 3K5VA 4J7BA 4NM3A 3WIGA 3DLSA 3E88A 1FVRA 1FGIA 3TV4A 5A6OA 2PYWA 3IPHA 4QQJA 1H26A 3GCQA 1WAKA 1Y8YA 3MWUA 3PG1A 4LG4A 4RWJA 2R3LA 4AZFA 4BVUA 3I5NA 4I20A 2HWOA 4YHJA 5C8NA 4AW0A 2XNBA 3CXWA 2GQGA 3CGFA 4TWOA 5CALA 4IWDA 2QVSE 4CFVA 4QPSA 1ERKA 4O22A 4FOBA 1CKJA 5HE2A 4BR3A 4X21A 5B0XA 2V55A 5AP0A 2Y4IC 2C3LA 4R6VA 5HO7A 2XK8A 4FKGA 1JBPE 4DFLA 1XH4A 4U97A 3F7WA 2X8IA 2WB8A 4IB5A 5C8MA 3PXYA 2PMNX 5DI1A 1SVGA 4DFYA 4YU2A 2QOKA 4HCUA 2IO6A 3PZHA 4AQCA 4CZTA 5IQIA 5KMOA 2FSOX 3LFAA 4MVFA 3LLAA 3VUHA 3QLFA 3V5LA 3ZSIA 4G3DA 5HG7A 3FUPA 2OIBA 4F78A 4MXYA 1SZMA 5L8JA 4APCA 3QA8A 3V5PA 3GU8A 3KU2A 5TR6A 1YOJA 3EOCA 3KGAA 4LL5A 3MGYA 1P14A 2F7EE 2UUEA 3ORNA 4FTKA 2UW7A 4NFMA 4RX8A 3FZSA 2FSLX 3A8WA 3P7CA 3SXSA 4DH1A 5BVDA 3L9PA 4WSYA 5CENA 3BGPA 4RWIA 4TWNA 3TKUA 4CT1A 1W82A 1Q24A 2CDZA 1PMNA 1YXXA 2PVJA 3K54A 3FZTA 3LCOA 3QHRA 3PXZA 4JDKA 3F5GA 4QMWA 4QMTA 5D7AA 4DGNA 5I9ZA 4FK3A 2EVAA 4F70A 4A9SA 1H1WA 2JDSA 3FI4A 5CI7A 5LVLA 3SRVB 4AACA 2OF4A 4BN1A 2HENA 3VAPA 3VS5A 5IF1A 2WFYA 4AE6A 3AC1A 3OWKA 3R0TA 5EHOA 4F0GA 5JQ5A 4AF3A 2CSNA 3QC9A 5DR6A 3DA6A 2YA9A 3AC4A 5AWMA 1BL6A 3FXWA 3KK8A 4BRXA 3SRVA 4S2ZA 3UOJA 2PTKA 3C4FA 5ANEA 3IECA 2ZDTA 3RINA 3ALNA 3JYAA 3R2BA 4WIHA 2FO0A 2X7FA 3NFGB 2Z7SA 1JLUE 3PY1A 4WG5A 4TYGA 4FIGA 2WZJA 4AXDA 4P5ZA 1RDQE 4JR3A 4JT3A 5E4HA 4Z7HA 5CSPA 2VWXA 5DRBA 4X3FC 2PZYA 2ZFYA 3Q04A 3W1FA 2GFCA 3PJ2A 4EQCA 3O2MA 4FYNA 3SG9A 3RAIA 3WZUA 3ZC5A 3HNGA 4U45A 3DNEA 3HX4A 4L00A 1PMEA 3OWLA 3CCNA 1OPLA 5EQYA 2E2BA 4U5JA 3H3CA 5HLPA 4NU1A 3MVLA 3OBGA 4CCBA 3CPBA 4ENYA 2J0IA 4QYEA 4OT5A 2YFXA 5KHWA 3KXXA 3NRMA 3UOKA 3OWPA 1CSNA 4JX7A 3UVQA 3BEAA 4MF1A 2FB8A 4Y95A 4FTAA 1PRYA 3FMNA 3SDJA 3O23A 4PDOA 4DLJA 3QU0A 3U6IA 2WIHA 3RHXA 5HE3A 3BU3A 3I0QA 4O7NA 2F9GA 4QMSA 4Y72A 3RCJA 5KHXA 3LCTA 3LFEA 4U3ZA 4OBPA 1ND4A 4UXQA 2QU5A 2EXCX 2WELA 4FZFB 4GS6A 4JDHA 5IDPA 1KE9A 3AC5A 2F57A 4RVTA 2JAMA 2QO9A 2QR7A 3F2NA 3NYVA 4I4FA 3ORPA 2W1IA 4C2WA 1JWHA 4FV9A 4O7VA 3DKOA 3RK5A 1JKKA 1LR4A 2BAJA 3HDMA 2C47A 3UPZA 4DFNA 4A4XA 2BR1A 2WTKB 3NCZA 5EFQA 2Z7LA 4R1YA 4U44A 4TRLA 3D5VA 4DG0E 5KNJA 2WMAA 4YJPA 3W33A 3TV6A 4R7HA 3NWWA 5DPVA 1PW2A 4D1XA 3Q32A 5E8ZA 4AA5A 3EMGA 3QYWA 2XEYA 4QTAA 4BDHA 1V0BA 4J95A 1OL5A 4PL3A 4CRLA 5HGIA 4XV1A 4EJNA 3TI1A 5K3YA 3R9HA 1KV2A 2GNLA 3ZOSA 3DGKA 4EONA 3EZRA 2JBOA 3A2CA 3AOXA 5L6WL 3SG8A 5CY3A 5IISA 4AGDA 3Q2MA 4D4RA 4ANSA 4KIQA 3KA0A 5EW3A 3R04A 4GRBA 4EK8A 5J9LA 2WO6A 3OCBA 4UALA 4FV3A 5LVNA 3BYUA 3ZEWA 3MDYA 3D5WA 1QL6A 5H8EA 3TMOA 4ZK5A 3TUDA 3QRKA 3EYHA 5DR2A 4NUSA 2VTHA 3U8WA 4FTJA 5K4JA 5J95A 4A06A 3PVWA 1LEZA 4KRDA 4D1ZA 3PDTA 3VC4A 3GENA 3H9OA 3AXWA 4UBAA 4D2RA 4TL0A 1ZOHA 4AE9A 4QPAA 3SA0A 1H27A 5KMLA 3KN5A 2EXMA 4EZ7A 4QYYA 3PSBA 4RBLA 5I9UA 1MP8A 2ZYBA 4IVAA 3TKHA 3SOAA 4BCKA 3CPCA 5AAEA 4JS8A 4I92A 1U4DA 4IEBA 5DH3A 3V6SA 5FXRA 4LUDA 1JQHA 2XB7A 3OW3A 4PP7A 5CAVA 4YBKA 2XKFA 5FG8A 3BE2A 3HP5A 3F2AA 3ORMA 2XNMA 3GB2A 3DAKA 5FP6A 1YWNA 3FJQE 4BCFA 4GT5A 4FVRA 4CV8A 2YM3A 4L44A 4PP9A 4MXAA 5E91A 3A60A 4HOKA 4F6WA 3R7VA 1OL6A 2I6LA 5EKNA 5KKRB 2CLXA 4C4GA 2RFNA 4L68A 4AT4A 5J7HA 1WVWA 1DAWA 2CNVA 3F66A 4GVJA 3I1AA 5FTGA 4FTQA 4M13A 4LRKA 1JSVA 3C5IA 5GNKA 4DHZA 2OH4A 5IMEA 2J6MA 3R9DA 4FKRA 2HY81 1MRUA 2PUIA 3P4KA 4IC8A 4ACGA 1L8TA 4BIEA 3EFJA 5D7VA 2JFMA 3P7BA 3R7OA 3BYVA 5D9HA 1UU3A 5IUIA 1OITA 2QI8A 3Q4UA 3VS0A 3MFRA 5EH0A 2NYAA 3TEIA 1IAJA 3NW6A 5EDPA 1O6KA 1URWA 5LVPA 4IZAA 1PXMA 2ZV7A 3AKLA 2G2IA 4FSUA 4NKAA 4YHTA 5JZNA 2VAGA 3VS4A 4O2ZA 2Q0NA 4XG9A 4DHIB 4JDIA 3ATTA 3E8EA 1T46A 2OKRA 4DT8A 2C5OA 3F9NA 4IVBA 4D5HA 3O96A 3UC3A 1XH5A 4B99A 2JIIA 3H30A 2YIWA 4YJVA 4YJSA 3WIKA 2WPAA 3GC0A 1ZWSA 3COMA 2GNFA 4U81A 4YMJA 5CU0A 4M3QA 4O6EA 4OTRA 3FZ1A 4II5A 3PLSA 3A4PA 2GU8A 2VO3A 2X9EA 2VTJA 3WYXA 2VWWA 2J9MA 4AAYA 1URCA 4K77A 4F09A 4EOOA 5CASA 2R3IA 1ZMUA 3CS9A 4MNFA 4ERKA 3H4JA 2C0OA 3GC7A 4GK4A 2XAOA 3COIA 4E5AX 4LYNA 5HD4A 3HLLA 3CE3A 3DS6A 3ITZA 4O0TA 2CN5A 4ITJA 3FLYA 3EQHA 3KC3A 4M97A 5J1WA 2HW7A 3H0ZA 4IWQA 1KE7A 3MH2A 5AUXA 4ZJIA 4BDBA 4DGMA 5CU4A 3QTIA 4CMTA 2F2CB 5ETIA 5HBHA 3FMHA 2BFYA 3N4UA 5LCKA 3OMVA 3D15A 3PE2A 3RNIA 3FMKA 5BVKA 3PVGA 4EWHA 5CX9A 3L9NA 5L8LA 3GI3A 3NPCA 3AG9A 5C4LA 3E3BX 1ZMWA 3DCVA 3IG7A 1PHKA 4G5JA 4TN6A 3QFVA 4FSYA 1R0EA 3MB7A 3WF7A 1WVYA 2R64A 2A19B 4FEVA 4ITIA 4BF2A 1Y57A 4ASZA 5J9ZA 3BLQA 4E1ZA 3Q9YA 3B8QA 2CGXA 3FHIA 4UY9A 3BQCA 2WOUA 3ZBXA 5AP6A 4JQ7A 4ZY5A 3P9JA 2BTSA 5KE0A 3PJ8A 5A4LA 5LQFA 3DJ6A 1I09A 2VV9A 3BLRA 3BU6A 4M0YA 1LP4A 4QP1A 3PSDA 4PY1A 3GU7A 3JVSA 1DI9A 3W32A 3DKCA 1PXPA 2WEIA 3R8UA 3C4XA 3FBVA 3OVVA 3DBCA 4M8TA 5HO8A 4V04A 4EHVA 2VTLA 5JH6A 1YDSE 2BCJA 4QYGA 3ZC6A 1FGKA 3F5PA 4N6YA 2VWUA 3NUPA 3QTZA 3RCDA 4BJJA 3O7LD 3VQHA 2FH9A 4K9YA 4RLKA 3ZM4A 4F6SA 2UZUE 4GG7A 3TZ7A 4ANQA 3S00A 4ACHA 2W96B 1Z5MA 5E8SA 4QTEA 3LQ5A 4I5MA 4MKCA 1NVSA 4I41A 3QGWA 1PJKA 4C33A 2LGCA 1H1RA 1H4LA 1ATPE 2WMBA 3DLZA 3NUAA 3OCSA 3ACKA 4JAJA 4XS2A 3QLGA 3G5DA 4FIJA 3KY2A 5E8WA 4EYJA 4C36A 5CAPA 1WBPA 5EG3A 2REIA 4O0VA 2V0DA 4O7WA 4OW8A 3EJ1A 3U4WA 4CFNA 4DDGA 3P5KA 5M4UA 1IR3A 2R7IA 3PY0A 3F3ZA 5IEXA 3SC1A 4L67A 3RM6A 2OJGA 3NVKI 2W5BA 3DAEA 3EQGA 3R1NA 2ACXA 3WBLA 5IA4A 3BBTB 1B39A 4U41A 5BV3A 3UQCA 3EN5A 3MYGA 3IW4A 3FYJX 3QXOA 5ANOA 4RRVA 4TXCA 1GJOA 4R3CA 3TZ9A 3NIZA 2VTNA 3HV6A 4RA4A 4IQ6A 3WF9A 4BTMA 1IEPA 5B2MA 2YIQA 3AD5A 3EQPA 4L9IA 3TDVA 2VWVA 4FC0A 3KCFA 4IJ9A 4IW0A 4I21A 2ITOA 4FZDB 4L45A 3QX4A 2ITQA 2O65A 3OC1A 4U79A 4LV8A 5AUYA 5C01A 2C69A 3DK6A 4FT9A 3S3IA 3LVPA 3G0EA 3FI2A 4ZSAA 2BAQA 3PFQA 1OIRA 2PUNA 4ZMEA 2W1DA 5HVKA 5IQCA 3R9NA 4PQNA 4TYJA 4BBFA 4GKIA 2QCSA 5C9CA 3Q53A 4M84A 5GHVA 4BTJA 4EKLA 3FPMA 4EWQA 4QP9A 4Y46A 4NM7A 1A9UA 3PE1A 2J7TA 3QKKA 2J0MB 1W84A 4DE4A 2B9JA 4A9YA 4C58A 3ZLSA 5AP4A 4JBOA 4ZLOA 2XRWA 1WMKA 2XJ2A 4QYHA 4EORA 1OIUA 4QQTA 1DS5A 3ALOA 3FXXA 5AAFA 4BDFA 3KQ7A 3FI3A 4E4XA 3RJCA 5CSHA 4EOSA 2ZM1A 5EKOA 4AZVA 2PHKA 2ZMCA 2PUUA 2WMXA 4KIOA 4LOOA 3KXNA 2Y6OA 2HW6A 3Q6UA 3CKWA 3PYYA 4WNPA 4ZTRA 5FXQA 4WA9A 1G8SA 5AUUA 4GK2A 5KO1A 4B7TA 3CSVA 1MRYA 3EKKA 5ACBC 4BC6A 3A7HA 3F2RA 3OTVA 4EK6A 2IZTA 4XG4A 4GYGA 3PSCA 2XYUA 1MUOA 4FL2A 4I3ZA 2BILB 4EHGA 3BI6A 1XKKA 2YABA 5EYDA 4ZJVA 3ZTXA 2X39A 2HZNA 3Q2JA 2GTNA 3F5XA 3BLHA 1XQZA 4C4FA 3M42A 4FSZA 4RPVA 3RKBA 5ANIA 4I93A 3F5UA 1WZYA 4L8MA 4PV0A 4YZDA 5HBJA 3W0RA 2BROA 2KULA 4JG6A 3EN9A 4ANMA 5FLFA 5DT4A 5IQEA 2R7BA 4G6OA 3NNWA 4XBRA 4IDTA 3Q9ZA 4TYIA 2YM6A 5AJQA 4DGOA 4UN0C 1B6CB 4ONAA 3IS5A 5HNIX 2SRCA 4X2KA 3UDTA 3D0EA 3IW5A 5DIAA 3FMJA 5ANJA 3RPSA 3WI6A 3MBLA 3EKNA 3R8LA 3IW7A 3IW6A 5D10A 2WMUA 4P2KA 2PY3A 3LFSA 4QTBA 4JRNA 4QTDA 3UPXA 4DFZE 3NEWA 4E6AA 5ITAA 5AADA 5LWNA 5IH6A 4FIEA 4AA0A 3ORKA 5I5ZA 3BQRA 3IKAA 1V1KA 4RIOA 3W0OA 3EFLA 4RQVA 4U8ZA 2NRUA 2JDOA 3TN8A 3ZCLA 1ZXEA 3GU6A 3DB8A 2W1GA 3CD3A 3NSZA 5IMXA 3KMMA 4FG7A 1JPAA 4ZY6A 2XK3A 1GY3A 4JNWA 4IVCA 4QMUA 3NUNA 4WUAA 3QX2A 4EOLA 1E1XA 4IZ5A 2OJIA 3L8XA 4IAAA 4NFNA 2G2HA 4ALWA 2X2LA 3KXZA 4S33A 4U43A 5M08A 4D4VA 5DE2A 3IOPA 3UVRA 5AA8A 4WG3A 4L7SA 4KBAA 4ZXTA 3C0GA 4L52A 4RWLA 3RNYA 3QD3A 4ZZMA 4MQ1A 4GMYA 5TT7A 3FV8A 3ODYX 2XH5A 2J51A 2C5NA 5CT0A 4CZUA 3Q52A 3V5WA 2PZIA 1FBNA 3E3PA 2HWPA 1H01A 4QO9A 1Q4LA 3ODZX 3WZEA 4C61A 3CIKA 1KE5A 3RWPA 4DFBA 2XS0A 3BBWA 4WHZA 5I9XA 3D4QA 1J1BA 4RIYB 4XCUA 3UVPA 5C8KA 4I6QA 1P5EA 2BHHA 3VQUA 5HIBA 4YNEA 5K5XA 4JBQA 2EUFB 2CNQA 2UW6A 4LFIA 4L42A 2CPKE 1Y6AA 1Z9XA 2GS7A 3I7CA 3SVVA 3BIZA 4AXFA 5CWZA 3I5ZA 2G2FA 3M2WA 2O64A 2OICA 3BGQA 4RIYA 2UV2A 2ZB0A 4G3CA 3E64A 3QTSA 1JNKA 2QR8A 3DOGA 5M44A 5IU2A 3LXNA 2IN6A 4BZOA 1RE8A 1Q61A 4XMOA 2PU8A 3UIXA 4AP7A 1XH9A 2BVAA 4GG5A 5EI8A 3POOA 1Y91A 2VNYA 2W0JA 4EK3A 2V7OA 4L3PA 2JAVA 4JL9A 3RAWA 4ZZNA 4JBPA 2QOBA 2OWBA 4FIHA 3E8DA 4HNFA 1A06A 3ET7A 3WE8A 4CFFA 5JGBA 2PMOX 4FNZA 5L8KA 3HMIA 2Y6MA 4NK9A 4EJ7A 3MV5A 3TNIA 4EOIA 2W5HA 4FTLA 4IAYA 2WMWA 1LUFA 4EH2A 4PRJA 3QHWA 2EB3A 3H9FA 3TNQB 4O82A 3OF0A 2R3FA 4AOIA 2I0YA 1P2AA 4PTEA 2C6OA 2R4BA 2YAAA 1XMLA 3BPRA 2W06A 1G8KA 3MA6A 4ITHA 4AU8A 5A4QA 3ZDUA 3VBTA 3R7IA 3WE4A 4C3FA 3V5TA 2Z7QA 3M1SA 2BPMA 3VHEA 3Q4ZA 4DEBA 2PZ5A 3DTCA 3R1QA 3U9CA 4FT7A 3FHRA 1OKZA 4CG9A 5B2LA 5I9WA 4JRVA 4Z3VA 5LVOA 4LUEA 2R3PA 2XNOA 5CNOA 3KXHA 3VJNA 4GKHA 2DWBA 3OT8A 4FNYA 3MH0A 4FV7A 1SVHA 3PZEA 3NW5A 4BCQA 5M57A 4YZCA 2I0HA 3VULA 3FMDA 1UVRA 2WXVA 4HJOA 4ZSLA 4FKLA 2GS2A 2QHMA 4JVGA 4B6LA 2F49A 3NNVA 4D2SA 1FVVA 5HVYA 3P5JC 5D11A 2YWPA 5C1QB 3E93A 5A3XA 4DCEA 5CLPA 1UU8A 3UYTA 1OI9A 3GC8A 5AM7A 5F20A 4EH5A 1BMKA 5JMSA 5E90A 2PZPA 5EYKA 3CTJA 3P78A 5EQEA 3ORLA 4Z9LA 1H1PA 1ZY5A 3A7JA 4TZRA 3QUPA 1Q5KA 5HIDA 2XM9A 2XJ1A 5IPJA 4YJRA 3FWQA 1MQ4A 1O6YA 4MNEB 3VO3A 5A14A 4R5SA 5H3QA 5ANGA 4BIDA 3JPVA 3GNIB 4JQ8A 3W0QA 3QTWA 4IWOA 4AQKA 4E93A 1YKRA 2B54A 2QO2A 2R0IA 4OUCA 3PPKA 4F0FA 3SKCA 4KAOA 3AT2A 4TKSA 3W0SA 5A6NA 3PA5A 1JOWB 3JR1A 3NYOA 4GV1A 3ENHA 2WTWA 2AEGA 4MNEA 4WT6A 5EYCA 1PXNA 3FAAA 2J4ZA 4FOCA 4GFMA 1HCKA 4W4VA 5BYYA 3QRTA 5HQ0A 3ZBFA 3EFWA 3CP9A 4HCVA 4MXCA 2RFEA 1AGWA 1H24A 3A7GA 3QD2B 4HYUA 5CU6A 2F4JA 4ZTHA 3AT4A 4O96A 4BGQA 3WF6A 5AP5A 4F63A 3LJ0A 2UZOA 3W16A 4YP8A 1HOWA 3EQBA 3G33A 1FINA 2WD1A 3PA4A 2WNTA 3MY1A 4FV8A 5AP3A 2GNJA 5FD2A 5CEQA 2YIYA 4AT5A 4ZMFA 2YISA 3RALA 2W4OA 2ONLA 4RC4A 5CEPA 4LI5A 4ZTQA 4F9CA 3GC9A 2BKKA 3Q5ZA 4F1MA 2GQRA 4L43A 3RPYA 3NIEA 4EH8A 3QCSA 3HMNA 4LV5A 4MXXA 4MD9E 5C4KA 2GNHA 3VW6A 4QQCA 3LCDA 3Q4TA 4H3PA 5E8TA 4USDA 5CVFA 2VO0A 3G15A 3MPAA 5DGZA 2R0UA 4MUQA 2W1ZA 2P33A 3G6GA 3UDBA 1PXJA 3SQQA 4NSTA 4K8AA 4QQ5A 3F82A 4HNIA 2VTAA 5M06A 4U7ZA 3UG2A 1Q41A 4YPDA 3G51A 3RGFA 2HZ4A 4KINA 5DR9A 2E9UA 3DDPA 3VS3A 4HVGA 2YIXA 3FQHA 4ZOGA 3FE3A 2PVFA 4DH8A 3IO7A 1IAHA 1YI6A 2JIVA 3KVWA 1UWHA 3HMMA 2YCRA 3QBNA 3F61A 4NKSA 2VNWA 4PX6A 4FV5A 5L2TA 3CGOA 4HGTA 1KOAA 4X2JA 3R83A 2O3PA 4RVLA 4AGUA 3ZO3A 4IVDA 3FKNA 4GYIA 4E4NA 2OI4X 4FG8A 4DTAA 4G1WA 5IUGA 5JZJA 2ETKA 1GAGA 4FKJA 3QQFA 4EOPA 4BCGA 4H39A 4R77A 5FDPA 2OIQA 4NYEA 3IONA 1L3RE 2BIYA 1F3MC 3LFBA 4Y8DA 3RK7A 4DA5A 1M2QA 4HYSA 3FKOA 3BWJA 5BVNA 2AC5A 4CKIA 2CKPA 3ZUUA 5IA0A 3FSKA 3R8PA 3OUNB 4Z7GA 3QGYA 1NW1A 3RPOA 1YXUA 4EZ3A 2QOQA 3PP0A 4C2VA 3N4TA 3BE9A 3JUHA 2FA2A 3LOKA 3LZBA 3D9VA 4G3GA 3KVXA 1XBBA 4WUNA 2BZKB 3CEKA 3PXRA 4BDGA 2XA4A 4AUAA 4FR4A 2ZAZA 2YERA 3PG3A 5IA3A 2E9NA 3KL8A 2VWZA 3KF4A 4EOJA 4FGBA 2UVXA 4AN9A 4BCJA 5L3AA 5JQ8A 1OUYA 3QQJA 2XIZA 3ZDIA 5CYIA 3QA0A 4KD1A 4E20A 3G6HA 4O2PA 4PMPA 3HDNA 5M51A 2JIUA 2HYYA 2AUHA 3LFDA 4O0UA 3VBQA 5K4IA 4GSBA 4FTCA 4RT7A 4AT3A 2GPHA 2OGVA 1ZY4A 1VJYA 2QOIA 2WQBA 3DY7A 3PIYA 3QQLA 4U3YA 2ITPA 3E8CA 5JRSA 5AAGA 4TW9A 3MI9A 2ETRA 4AX8A 2BZIB 5E1SA 3BCEA 3ULZA 2W9FB 3NVMB 1UV5A 5CTPA 3SHEA 3EZVA 2BKZA 4QMQA 3LM5A 3LPBA 4C34A 3LMGA 3U54A 4IHPA 2CLQA 3O8PA 2GHMA 4UWYA 4AWIA 4Q2AA 4IM3A 3VBYA 2WTCA 4OTHA 5A4TA 1H00A 4QP4A 3V5JA 2QQ7A 3P86A 3UE4A 4HVSA 1J1CA 2QD9A 3O5AA 3TNPC 2H96A 1GIIA 2OSCA 4L6QA 1OBGA 2RFSA 1ST0A 3EQDA 3M11A 1GNGA 3C4CA 3VUDA 4DITA 2W1FA 4ZJJA 4DGGA 3D7TA 3CQEA 4QMPA 2OIDA 3G9LX 4FSQA 4IAFA 3SW7A 1NY3A 3L1SA 3OW4A 3PFYA 1ZYDA 4LOPA 1Z57A 5DVRA 4J52A 3OUKA 3OFMA 1KSWA 3GT8A 4HPUE 2WTDA 3OZ6A 4PL5A 4AZEA 3PXFA 5KMJA 4IANA 5G1XA 1FVTA 4FMQA 4YTIA 3TZ8A 1CKIA 2UW8A 3VHKA 2YITA 4O91A 5AUTA 4DH5A 4BZNA 5BVOA 4FEXA 2XKEA 3DV3A 1H8FA 3DBEA 4IADA 3UODA 4CKRA 2PVYA 4KA3A 4E8AA 2CGWA 4IIRA 2GCDA 2VX3A 3DXPA 4I0SA 5T6KA 1UKIA 4RJ8A 4DFXE 4I94A 4FV1A 2RG5A 4XNEA 3GGFA 4CMOA 1Y8GA 2ZM4A 3TUBA 2YCSA 1XBCA 3F6XA 1QPDA 5E8VA 5HKMA 2XP2A 3Q3BA 2IW9A 3TWJA 2HK5A 3HL7A 3UOHA 3SX9A 5M56A 5DHJA 5CZHA 1YDRE 1PKGA 2XK4A 2VO7A 4L7FA 2YN8A 5AV2A 4X3JA 1M17A 4J98A 3VS6A 3QTXA 5CU3A 3V8TA 2JLDA 4JXFA 3F88A 5A4CA 1PF8A 2X1NA 2XEZA 1BI7A 3C1XA 1UA2A 3DXNA 1XMMA 2GHGA 3QWKA 5CS6A 3S0OA 4LM5A 3NNXA 1ZYSA 4BCMA 2VD5A 5KBRA 4J71A 3REPA 4U0IA 2B0QA 3RMFA 3VUGA 4FKQA 4FKVA 2UZLA 4S30A 4DBNA 5HZNA 2UW3A 2YDIA 5AV0A 2XJ0A 4N0SA 5H8GA 4CG8A 4RMZA 2JKKA 2XK6A 4FYOA 2VWYA 5EM6A 2BRGA 2IVVA 2ZM3A 4FUYA 4YZMA 3P08A 4S32A 2JD5A 4E6QA 2Z2WA 3GCPA 3G0FA 3VONA 2ITYA 2AC3A 4DT9A 5AP1A 4G31A 5FUTA 4AGWA 4BHNA 5JFVA 4KSPA 3A7IA 3SXFA 1TQIA 5A46A 3O51A 5EDRA 4G9RA 3ZSGA 3R73A 5IEVA 5IQBA 4GT4A 5HESA 3BHYA 2GTMA 4PWNA 1OPKA 2C0IA 2LAVA 5AIKA 4FODA 4YO4A 3DDQA 5KBQA 3E7OA 2NNWB 4JOAA 5CXHA 4FBXA 4M15A 4DEEA 2UW4A 3QTRA 4MK0A 1K3AA 2IVSA 1JVPP 2J0JA 4G6NA 5AUWA 3TIYA 4EH6A 4EUTA 5BPYA 3GU5A 4NZWB 4O38A 3WOWA 4MBLA 2VX0A 1Q99A 4C62A 1R78A 4D4YA 4F7LA 2B7AA 4AOJA 2X0GA 4XUFA 2PVKA 2X7OA 4IX3A 1WBWA 2HIWA 4XEYA 4YZ9A 5D12A 1H08A 5LCJA 3F3UA 4ACDA 4G17A 5F95A 5T3QA 4DH7A 1VEBA 1MQBA 4C4EA 4IB1A 3HP2A 1VLRA 1JKSA 4EH4A 2C6IA 3QAME 2JBPA 3VUMA 5E8XA 3OT3A 4XJ0A 5HCXA 4J96A 3ML1A 3C51A 4FIFA 4QNYA 3L8PA 2WTKC 1KV1A 2UW0A 2VTSA 1ZAOA 2VTTA 4JJRA 2QO7A 3FXZA 1BI8A 2O5KA 4HYHA 3TG1A 4YC6A 2XNGA 1TKIA 4BKJA 4YZBA 5G6VA 4FT5A 5C26A 1OKWA 3KULB 4G16A 4IFGA 2E9OA 2ITVA 3C4ZA 2RGPA 3DBDA 3NYXA 4MWHA 5BVWA 1YI4A 3ZUTA 4JBVA 2VTRA 3KREA 5DRDA 3WILA 5HIEA 4F7SA 4IZ7A 3ULIA 4DG2E 4NTTA 4XP0A 3ZO2A 2XIKA 2YJRA 2R2PA 3DBFA 3PPZA 4BDKA 3EYGA 4A9UA 3I81A 4AXCA 3PXKA 4PNIA 3U51A 2B1PA 3KULA 4CGAA 1VR2A 4FA2A 5A4EA 2FYSA 4F08A 3D2IA 3W2SA 1SMHA 5ANKA 1Q3DA 4FV6A 4GVAA 4PUZA 3GFWA 4CD0A 3DK7A 4IMYA 1RJBA 5DT0A 5BVEA 2O8YA 4PMSA 5TO8A 4A9RA 4XLVA 2WQOA 1CTPE 5CI6A 4CFWA 2VTOA 5L2IA 2I7QA 3OD6X 2I0EA 2QOOA 3PJCA 2W5AA 2Z7RA 3H0YA 4W4XA 4BJJB 3PLAE 3KXMA 3HA6A 2HCKA 4GUBA 5E9EA 1OECA 1XH7A 3UNKA 5AUVA 3PUFC 5B2KA 5M4IA 3E7VA 3KIOC 1FMOE 4QMYA 1OBDA 3AMBA 4JG8A 4D9UA 4IBMA 5CU2A 3RK9A 4PDYA 5IQFA 5JFWA 4L46A 2EU9A 3R28A 4BDIA 2XZSA 1TVOA 3DJ5A 4IH8A 2QHNA 1OIQA 3GEQA 4FSWA 3GBZA 4IX4A 1TQPA 2YIRA 3QL8A 2XYNA 1DI8A 2UZEA 4DCAA 4FKTA 4UB7A 4WRSA 1JKTA 4F1OA 2R3NA 4RIWB 3MB6A 4CKJA 4USEA 4NH1A 4BYJA 2VTMA 4IFCA 4F7JA 5KKRC 4FNXA 2OXXA 5LVMA 3D94A 5DN3A 2W05A 3FPQA 2RKUA 1NVQA 4X2GA 5FBNC 3LJ2A 5FM2A 2CKEA 3LM0A 4BGGA 4RLLA 3UP7A 4EUUA 3I0OA 2A1AB 3UIBA 3R1SA 1ZYLA 3DB6A 4EH9A 1G5SA 4ZSGA 5AX9A 2X6DA 5CT7A 1JSUA 2UZVA 1NT2A 2PPQA 1OKYA 4RIWA 2KTYA 3ACJA 3PIZA 3UO6A 4YJUA 3BYOA 4ZS0A 2QLUA 4DC2A 3T9TA 5AIRA 2CGVA 1IA8A 4OGRA 5I9VA 2ZJWA 3UO5A 3QD4A 2PZRA 4GL9A 3HGKA 1APME 4H1JA 3UNZA 1W7HA 2XIYA 4Y85A 3MTFA 3WZKA 2YZLA 3E92A 5J8IA 5CSVA 4ZAUA 5DLSA 3MVMA 4XG7A 4I5CA 4J99A 5HX6A 2BDWA 2C5VA 2ZB1A 3KRRA 3MN3A 2PVRA 3UIUA 5L6OA 4EQMA 1YDTE 2F7XE 3AGMA 4H05A 3HZTA 5AV3A 4EEVA 3QXPA 2PVNA 2WEVA 4DDIA 1OM1A 3LFCA 4UZDA 4BDDA 4FEQA 4BCIA 3UG1A 1TFFA 1W98A 2PUPA 4WKQA 3WF8A 4CCUA 4DBXA 4AGCA 2C6TA 2ITUA 4GW8A 3NLBA 5KX8A 1PYEA 4NL0A 1XHAA 4AG8A 4HVHA 5CAOA 5JN2A 5EW9A 1BKXA 1GZ8A 3C50A 2B52A 4FKOA 2ZV2A 5EOLA 1WVXA 1LPUA 1YXSA 4USFA 4G5PA 4C59A 4EBWA 4XLIA 1SNUA 2W4JA 2DS1A 4YGAA 3O0GA 4E7WA 2C0TA 2WGJA 5GJGA 4BDAA 5K5NA 3NS9A 4B9DA 4PDPA 3RP9A 3FZRA 5HU9A 4M69B 4K2RA 4NJDA 4O0SA 2XCHA 4LL0A 3HV5A 4ZTNA 3ENMA 2YJSA 3NMUF 1W83A 2QG7A 3C5UA 4AZTA 4DAWA 4NW6A 4WOVA 3NUYA 3O17A 5LMKC 1PKDA 2E9PA 1GIHA 3V6RA 1R1WA 4MCVA 3MH3A 3FL5A 3KCKA 3LIJA 4J8MA 3HV3A 3FC2A 3HUCA 2BALA 2PULA 1PYXA 4IZYA 4X6RA 4XOZA 3UMWA 4DINA 3FLQA 3GQIA 3KK9A 4CLJA 4RJ6A 3OHTA 2C4GA 3BHVA 4YJQA 2J0LA 2WTVA 2V62A 4O86A 2GQSA 3HECA 3G9NA 4ZTLA 4FT0A 3W18A 4BY9E 2QODA 2RG6A 4FKWA 4C37A 5A54A 1WBTA 4OTFA 4RC3A 3COHA 3QQGA 1IA9A 4KUJA 5BUEA 2IWIA 3BHHA 3COKA 4Q5HA 3VN9A 4DHJA 3ZLWA 2JKOA 4UWCA 5FTOA 3RVGA 3PA3A 3E5AA 1AD5A 4JX3A 4QDEA 4IB0A 4E26A 5KMIA 3BGZA 4BI1A 4H36A 5E92A 1UNGA 5IA5A 3AC8A 4NCTA 3ZZWA 3VF9A 3LFNA 3ANQA 4UWBA 5DBXA 4TNDA 1FQ1B 4RIXB 4ZP5A 3DU8A 3PP1A 2VU3A 5EI2A 4GUEA 2W99B 3BKBA 2B9HA 2VTIA 3NFFB 3OOGA 4F64A 3VRYA 4NWMA 1V0OA 4U42A 3AT3A 5FM3A 3KRJA 3R01A 5HE1A 3RAKA 2PVMA 4OLIA 2OBJA 4G2FA 4IAIA 4I5PA 4ZSJA 4FTNA 4RIXA 2BMCA 3A4OX 1E9HA 4C02A 4JR7A 1CKPA 1J3HA 1REKA 3UBDA 3VF8A 4ZY4A 4KKHA 2XK9A 3ELJA 3QTUA 3WYYA 4BCOA 2ZV8A 3K3JA 3QRUA 4CFXA 2PL0A 3AC2A 3QALE 4I6LA 3MA3A 3ORIA 1I44A 1Q8UA 4F9AA 4JLCA 1JSTA 3RWQA 4K33A 3RI1A 3LAUA 1UU7A 3LCSA 4XG2A 2XRUA 4O21A 3E62A 3SGCA 3DQWA 4QP7A 4XG3A 3U9NA 5CAQA 4N57A 3NAXA 4S34A 2YM5A 4QEBA 4ZLYA 3ZUVA 1WBOA 3LQ8A 4BB4A 3HRCA 4MH7A 4BBMA 4O7LA 4CTBA 3IOKA 4AFJA 1STCE 3OWJA 5CF5A 4B0GA 5H9BA 1OIYA 4C4IA 2W9ZB 1ZLTA 2DYLA 1OGUA 3I79A 3Q6WA 2OZOA 4MX9A 3AD6A 3QRJA 3ZSHA 4YZNA 3NDMA 2HXQA 2JKMA 3UZTA 3VUIA 2X2MA 3QTQA 1E1VA 3FZPA 4CT2A 2Y8OA 4IM0A 3MVJA 4KIPA 1KOBA 4FJVA 4XG8A 2C6KA 3EB0A 4CXAA 2BHEA 5L2WA 4J97A 4R3PA 3HA8A 2Y4IB 3AD4A 2OO8X 2P0CA 4ZTSA 4DEGA 4I22A 3QZIA 5IQDA 4HZSA 1FMKA 3VBVA 3G90X 3EIDA 3PVUA 3FMLA 1PXLA 3Q60A 3OXIA 5DEYA 2EWAA 4DYMA 5KZ0A 5ACKA 5D41A 4M67A 3QQKA 4QP6A 3FLWA 4LQMA 2XNPA 3VBXA 4RX9A 3VW8A 3DNDA 3EHAA 5J5SA 5FEDA 1TQMA 1RQQA 1ZMVA 4FTIA 5I0BA 4K0YA 3QCQA 2W4KA 3G2FA 3EWHA 3MESA 3OP5A 1YWVA 3QQUA 3FLZA 4FICA 4QP3A 4UV0A 4KRCA 4EYMA 3TL8A 3T3VA 1OL7A 4PTGA 1OMWA 4HVDA 2HZ0A 3MFSA 3U6HA 3T8OA 3TTJA 3ZXTA 3PWYA 3QQHA 3ZEPA 5HTCA 5LARA 2O2UA 3IQ7A 4QMLA 4XP3A 2X7GA 5CAUA 2OFVA 4RFYA 1PY5A 2CN8A 2XBJA 3UIMA 1F0QA 3PY3A 4FV4A 3EH9A 4EK4A 3OEFX 2JKQA 3IDCA 5TOZA 4FZ7A 4RG0A 1WBNA 5LMAA 4MBIA 1K2PA 1GZOA 3R63A 4Q9ZA 3V3VA 2GHLA 2F7ZE 3JXWA 4BZDA 3H9RA 4GT3A 3QF9A 5I4NA 2V22A 3D5UA 3VS1A 2FSMX 2AYPA 4L3LA 4UEUA 5JSMA 3LFFA 4MTAA 3II5A 4F99A 4ZIMA 4ACMA 3ATSA 1WFCA 4QTCA 3MFUA 4XH6A 4AFEA 3NAYA 4DH3A 3ZO1A 1YHVA 1UWJA 3C0IA 4ASXA 3T3UA 4IX5A 4OTDA 3VBWA 1GZKA 1W8CA 4X3FB 5H8BA 2OK1A 2ZOQA 3W2CA 4O83A 4TNBA 3SLSA 5AV4A 1BL7A 4X2NA 2QURA 2C6LA 4RGJA 5HTBA 1SYKA 3TNHA 3WARA 4BI2A 3UQFA 4RZWA 2NO3A 4DHFA 4FKPA 2CCIA 4F0IA 3HMOA 1H25A 3I7BA 3VUKA 3AKKA 2VO6A 3MIAA 4L3JA 1NVRA 4X3FA 1H0VA 3O8UA 4FSRA 3IW8A 5E1EA 3FMMA 4QMNA 4P5QA 2XM8A 3EN6A 3FY0A 2JDVA 3AMYA 5DA3A 3MPMA 3U4UA 4M68A 3CY2A 2H6DA 4OTWA 1G8AA 4CRSA 2JC6A 3NW7A 4N6ZA 4X2FA 4A7CA 4QP2A 5DNRA 4ANBA 4U6RA 5EM8A 4NIFB 4YO6A 4ANLA 5B7VA 2A4LA 3FL4A 4MAOA 1WBSA 3UDSA 4AXAA 4DTKA 2GSFA 4IWPA 2ZV9A 5F1ZA 3R7EA 3EN4A 4PTCA 3TJCA 3PUPA 4CSVA 3ZRKA 1BLXA 2C6DA 4EKKA 2C3IB 4LGGA 3SAYA 3KKVA 5FXSA 3HMPA 4YBJA 4GCJA 4TPTA 5M53A 2XARA 4G9CA 4FIIA 3TXOA 5EI6A 4CVAA 2C1AA 5IA2A 2BRNA 4BTKA 1R0PA 4D28A 3RM7A 3OTUA 5JKGA 2ITXA 2RIOA 5AP2A 3HRFA 4YHFA 1H0WA 2FUMA 4I4EA 5HD7A 3R9RA 2OH0E 4FT3A 2OJ9A 4LRJA 3UMXA 3NNUA 1FOTA 2GNIA 2X8EA 3DAJA 2CHLA 2WOTA 4KBKA 4IC7A 3TKIA 3TV7A 5CEMA 1Q8ZA 4RSSA 2OG8A 5AUZA 3GXLA 3B2WA 3MS9A 2JGZA 3VRZA 2QKRA 3QKMA 4M12A 3GP0A 4R5YA 4Y83A 3IK3A 3GOKA 4F9BA 5LXMA 4CMUA 1KE6A 2BZHB 5EHLA 5HX8A 2OU7A 1F5QA 5EM7A 5KZIA 3E8NA 4AW1A 4OR5A 2GMXA 3LE6A 4MHAA 3BEGA 1QMZA 4D9TA 2WHBA 3QKLA 4EOKA 4LV7A 4F9WA 4YURA 3KFAA 4G34A 3NZ0A 3KN6A 2HELA 2FSTX 4DTBA 3F7ZA 3BELA 5HORA 5FBOA 3CC6A 4FL1A 3THBA 4EQUA 5A9UA 4K18A 4YJTA 3VNTA 3QCYA 3EL8A 1UNLA 4KKGA 4EH3A 4RX5A 5CEOA 2NRYA 4Q5EA 3R8MA 3HAMA 4DG3E 2FVDA 4EI4A 5CQWA 4F9YA 3UNJA 3BWFA 5CQUA 4BTFA 1NA7A 2YWVA 4IE9A 4RJ4A 1EH4A 2C30A 3ZONA 4BICA 3QD0A 3UO4A 2X6EA 5M4FA 4FTOA 1OB3A 3NUUA 2HAKA 4WBBB 1YXVA 4NTSA 1U46A 5LWMA 3NYNA 1R39A 2P4IA 5FEQA 2PVLA 4A07A 2C5XA 2IZRA 3MY5A 4PL4A 3V04A 2YM4A 2G15A 3DZQA 2OZAB 5KMKA 3BZ3A 1OPJA 2WAJA 4K6ZA 3GU4A 1OL1A 2VTQA 5I9YA 3I6WA 3LXPA 4V0GB 4TT7A 3H10A 2QOLA 3CKXA 3PTGA 3MSSA 4WG4A 4QMVA 3C4EA 2E9VA 4KSQA 5AM6A 3S95A 2VWIA 5L2SA 5T68A 2YM8A 1CMKE 3FYKX 3W0PA 2OZAA 1XH6A 5IH5A 2BRHA 4J8NA 4WRGA 4XV2A 3WZDA 2B4SB 3K2LA 5E8YA 2B55A 4YTHA 3HEGA 5HVJA 2JDTA 4V0GA 5IZFA 2J5EA 1XR1A 1B38A 3CD8A 5HNBA 3JY0A 4EK5A 2ERKA 3W8QA 2A27A 3D83A 3O7LB 3A62A 4HPTE 3MJ2A 3V51A 3LQ3A 3R2YA 3ANRA 3W8LA 4FEUA 4CFUA 3O8TA 4LGHA 1PXOA 3C0HA 3AMAA 2I1MA 3D7TB 3FKLA 2ONLC 4O7TA 1YXTA 4RQKA 1XBAA 2GS6A 1V0PA 3FMEA 4AW2A 2ZMDA 4DEHA 5BNJA 5M4CA 3QUEA 5CNNA 4QT1A 5BQ0A 3GFEA 3I4BA 3CTHA 3R9OA 3LXLA 5HLNA 1M2PA 2WMVA 3MY0A 2C6EA 4AS0A 4I24A 4O7YA 4C38A 3C9WA 2IZUA 4KS8A 3LJ1A 3QC4A 4YJNA 4FUXA 2Y9QA 1M2RA 2WIPA 2JDRA 4S31A 3E87A 3GCVA 2ESMA 3IGGA 5AEPA 3C4WA 1BX6A 1ZARA 3MVHA 4H3BA 4CQEA 1S9JA 5BMMA 2C3KA 3TDWA 3RPVA 3P79A 4ZEGA 3GQLA 3EQFA 3NGAA 5DWRA 4IAKA 5AA9A 5CSWA 1O9UA 3PRFA 2H34A 4YNOA 3FLSA 5DFPA 4ACCA 1YHSA 4PF4A 4KBCA 4OT6A 5F4NA 1Q97A 3UTOA 3OROA 4BIBA 5EDQA 3CLYA 2IPXA 4GIHA 5FDXA
chains in the Genus database with same CATH topology
1YVJA 4NW5A 2PE2A 3R7YA 2ERZE 1WCCA 5FP5A 4XBUA 3P23A 4IDVA 4IX6A 1YOMA 3PPJA 4RJ7A 3W2QA 4AXEA 1CM8A 1A48A 1OL2A 3QRIA 5FQDC 4RWKA 3NX8A 4YLKA 4C7TA 5CZIA 3KB7A 4FX3A 4E5WA 5F9EA 5ETFA 2RL5A 2IW8A 3A8XA 4EL9A 4PNKA 2IW6A 3ORTA 5CXZA 4R3RA 5DYJA 4WNMA 4R7IA 5HG9A 4DEAA 4W4YA 4FTMA 4HGEA 2YEXA 4BHZA 3EFKA 3L9LA 2XANA 2J2IB 2YZAA 3O71A 2WMQA 4ARKA 4ID7A 5HI2A 2B9IA 4U9AA 4CNHA 2PWLA 2FGIA 2R3RA 5IG1A 4MD7E 3NUXA 2DUVA 3B8RA 4QMMA 3HV7A 4LDTA 4C35A 1YI3A 1GIJA 3KRXA 2OXYA 4IAZA 3W2RA 5KUPA 5HCYA 3U55A 4WNOA 3R6XA 1REJA 3LFQA 3SV0A 3ZXZA 1S9IA 3MPTA 4ASEA 4ZZOA 2BRBA 3BU5A 3ZH8A 5BYLA 5J9YA 1BYGA 2GFSA 2R9SA 2WU7A 3LMIA 4FSMA 4CTCA 4EZ5A 5DEWA 3TZMA 3BHTA 4E73A 5JK3A 3ZLYA 2I0VA 3KXGA 4NJ3A 2OF2A 4H1MA 4QDVA 2VGPA 3LLTA 3W2OA 2WQEA 1ZZ2A 5HEZA 5JRQA 4FE2A 4PMTA 3CJGA 3KRWA 3QZFA 2ITTA 2VGOA 2J5FA 4C4JA 2ZDUA 3NCGA 3ZFMA 2X4FA 3QZHA 4GFOA 5BX0A 4I1ZA 2BRMA 4Y5HA 4M0ZA 2XVDA 3DK3A 3KEXA 1ZYCA 5AFVA 1Q8TA 4FKSA 4YTFA 5E8UA 1DM2A 2P2HA 5FTQA 5HHWA 3C7QA 4V01A 3D5XA 1OKVA 1YHWA 1ZRZA 4HGSA 5IQAA 4CV9A 2QOFA 4EBVA 2W17A 4G6LA 2Y4PA 4BDEA 3IGOA 5AMNA 3PWDA 4ASDA 4FZAB 4IM2A 4FTUA 3UC4A 4O0XA 2IVTA 3K3IA 4O81A 3TACA 4BCNA 5KMNA 4W8DA 2H9VA 4RA5A 4O0YA 3R8VA 3FEGA 3P1AA 1VYWA 3PXQA 2P55A 1DAYA 3TJDA 3W10A 5JFSA 4Q9SA 1IG1A 1LEWA 2XIXA 2NPQA 2O0UA 2EB2A 3TT0A 2J90A 2XBAA 4MEDA 2XIRA 2RFDA 3BV2A 1R3CA 3CTQA 2F2UA 3PIXA 5J87A 2C68A 3ROYA 1VYZA 3O50A 4APPA 5TKDA 4P4CA 4F7NA 2PVHA 4QMOA 5EW8A 3SD0A 4QYFA 3VS7A 2O63A 4AW5A 4XG6A 5GIOE 4XV9A 4GFGA 5BYZA 1XH8A 4A9TA 4IB3A 2PE1A 1SNXA 4MYGA 2CMWA 3ZHPC 3HUBA 4Y5QA 1ZZLA 1PMVA 4HW7A 1U59A 1XO2B 3HKOA 3F69A 4JIKA 4O7SA 1JAMA 4DGLC 2YAKA 3QCXA 2QLQA 3U6JA 2VX1A 2W1EA 4ALUA 2A2AA 4QRCA 3F3VA 2CCHA 2UZNA 2XAMA 4GIIA 3AGLA 4YPSA 5CF4A 4AN2A 1Y6BA 2W1CA 5CSXA 2QU6A 3DQXA 3GUBA 5BMSA 3PJ1A 4YJOA 1ZOEA 3PVBA 5C27A 3D2KA 1YOLA 2BUJA 3TUCA 4F4PA 2XF0A 4HYIA 3V8SA 3ORXA 1J7LA 4NM0A 2OXDA 1OGYA 2CKOA 4L01A 4FI1A 2A0CX 4I0TA 3DJ7A 5EQPA 2OFUA 4G3FA 2YHVA 2XK7A 4I0RA 3CQWA 4KKEA 4IJPA 4N4SA 4DF3A 3JVRA 3CJFA 3OG7A 5GJFA 1O6LA 3Q4CA 1YW2A 2VTPA 4ORKA 4PDSA 4EOMA 3ZMMA 5M55A 3TNWA 2HY0A 4ZSEA 4PMMA 3ZZEA 3ZFYA 1UNHA 3AQVA 4YC8A 3HYHA 4EC9A 5BVFA 5LMKA 3LKMA 4FSTA 3OCGA 2QOCA 4LRMA 4XRJA 4RZVA 1G3NA 3TIZA 1WBVA 2R3HA 4W4WA 4FTTA 4TWPA 3GOPA 2WQMA 2BFXA 4OBOA 1U54B 3GCUA 4JQEA 3EL7A 4MWIA 4W8EA 4O84A 4YLLA 3ETAA 3SOCA 4AN3A 4IACA 4FVPA 3OXTA 3C13A 5JT2A 5K9IA 2OJJA 2XNNA 3DFAA 3SW4A 4E5BA 1RW8A 4I6FA 4UYNA 1YRPA 2QNJA 3VJOA 4QMXA 3BL7A 5CANA 3UP2A 4JG7A 1U54A 2R3GA 2WTIA 4Z55A 3WF5A 2QOHA 2YM7A 5ICPA 4O6LA 4AOTA 2YCQA 4KWPA 4WBOA 3EQRA 3BHUA 5EOBA 4YC3A 4A4OA 5JEBA 3RHKA 3CR0A 3A7FA 1Q62A 4D4SA 2PE0A 4GH2A 4YSMA 4YR8A 4D55A 3ID6C 1J7UA 4L53A 2QKWB 4OTQA 2I40A 2BZJA 3CQUA 1ZOGA 3DBQA 3P7AA 4J1RA 2C5YA 4RFZA 2X2KA 4RVMA 5ANDA 4BCHA 2R3QA 3RAHA 3Q9WA 4MXZA 4O0WA 1P4FA 1U5QA 2H8HA 5CEIA 4Z16A 1VZOA 3LMHA 2UZWE 5IDNA 3ZLXA 5M07A 4FL3A 1T45A 5BUJA 4RFMA 2WQNA 4JDJA 5FRIA 3F3WA 3FQSA 4FEWA 3AKJA 3R1YA 2PSQA 2CNUA 4UZHA 4I6BA 4EHZA 4FV2A 2UZBA 3W0NA 2UVYA 1OVEA 2WTJA 3FY2A 5GIPE 2P3GX 4RJ5A 5CVGA 5LJJA 3BL9A 3DZOA 3S2PA 3V5QA 4H58A 1JKLA 4FK6A 3Q9XA 4XYFA 4BBEA 2R3JA 3VIDA 3VWAA 4RVKA 3DKFA 2WMRA 1BUHA 1M52A 3OY3A 2W1HA 2XNEA 2XUUA 1HCLA 1YQJA 5CF6A 4CEGA 4KB8A 5IQGA 3JS2A 5EK7A 5M09A 1XWSA 2UW5A 1H1QA 4C0TA 3FSFA 4YTCA 5JGDA 1QCFA 4BDJA 3R00A 2CGUA 2VRXA 4DEDA 4E4LA 4OTGA 2R3OA 2PK9A 4DFUA 5HCZA 5IA1A 4ERWA 4UX9A 2VUWA 5HLWA 2XKDA 4YUQA 5HE0A 4EH7A 1Q8WA 3UZRA 3EN7A 1IRKA 2WKMA 3EQIA 3D14A 4JAIA 4C3PA 3R02A 1PXKA 2VN9A 5DOSA 3AC3A 3ZO4A 2V5QA 3T9IA 4MQ2A 4BGHA 4EOQA 1PMUA 5IH4A 4UXLA 2QC6A 2IJMA 3CY3A 4FNWA 3DT1A 5J1VA 3I6UA 3VS2A 3ERKA 2HOGA 2YCFA 1H07A 2BDJA 3MH1A 4FG9A 4OTIA 3BX5A 3KMUA 4P90A 3RZBA 3MFTA 3RTPA 1UKHA 4XOYA 3DPKA 5C03A 4G3EA 4CLIA 5IEYA 2UW9A 3TYKA 4FKUA 4MXOA 1QPEA 4M14A 2XMYA 4ZS4A 2XALA 2YDKA 4BDCA 4RJ3A 4WNKA 5EHYA 4ZTMA 3MTLA 3N4VA 2Z02A 2R5TA 3R22A 5CVHA 3TCPA 4HGLA 3N51A 3DFCB 4LOQA 4O7ZA 5HICA 2QONA 1ZYJA 4JMQA 4TYHB 5EYMA 5F94A 4X6QC 4R1VA 5JGAA 5CF8A 4D58A 4RC2A 2B53A 1IASA 3FLNC 5FGKA 2ETMA 2XCKA 3W0MA 5ETCA 3OEZA 3V8WA 2X8DA 4AA4A 4U40A 2BTRA 3U87A 2Q0BA 1U5RA 4I5HA 4X0MA 3OOMA 5AV1A 4DN5A 2ZVAA 5HBEA 4HZRA 4TYHA 2ITNA 3TTIA 3UJGA 1M7QA 1KUTA 1Q3WA 5BUIA 1KE8A 1ST4A 3F3TA 5CEKA 4MD8E 3FI8A 3IDPA 4BI0A 3JY9A 4GU6A 1OUKA 1XJDA 1YWRA 3FQEA 3HAVA 3ORZA 3QYZA 4FZ6A 4U80A 3PJ3A 3KF7A 4TYEA 4DLIA 3B2TA 3DKGA 4DEIA 5HU3A 5AP7A 2YACA 3DXQA 3OS3A 2XKCA 3NR9A 2HZIA 3OBJA 3ZM9A 4OBQA 3Q5IA 3ROCA 5L6PA 4R78A 4XP2A 5HNGA 3KRLA 5LOHA 4O27B 4KNBA 4LMUA 4KS7A 2J0KA 4D5KA 1H28A 3DTWA 4ALVA 3N9XA 3UZPA 3OCTA 4GEOA 4X7QA 4TY1A 2R3MA 2G1TA 5DT3A 5GINE 2B9FA 4M7IA 2IG7A 1GOLA 2P2IA 5FEEA 4BYIA 1OZ1A 3FC1X 2Y7JA 1AQ1A 2X9FA 4FTRA 4NT4A 3WZJA 4F1TA 3ZRMA 2BIKB 4D1SA 3L8VA 1H1SA 1QPJA 3Q96A 4AAAA 4GJ2A 4GJ3A 3A99A 3LXKA 4F65A 3UYSA 4D0XA 2DQ7X 3GVUA 1GZNA 2OJFE 3A61A 2UVZA 5IQHA 1SVEA 3K5UA 4XV3A 4C3RA 5KMMA 3HRBA 3R30A 3UDZA 4J53A 3TM0A 4B8LA 1FPUA 2IVUA 1CDKA 2JFLA 4QP8A 3EQCA 5DG5A 2W7XA 4E6CA 2VWBA 3NUSA 1PXIA 2J50A 3UOLA 4AZWA 3BV3A 2UZTA 3BLAA 2X81A 1M14A 3BYSA 3ZRLA 3LHJA 3V01A 3W2PA 2RF9A 1J7IA 2BDFA 5JFXA 2WU6A 2R3KA 1X8BA 2VZ6A 3MJ1A 4QNAA 4YLJA 5E7RA 4QMZA 4ZLZA 5LMBA 2G01A 3E63A 3UQGA 4CFMA 1W0XC 4E4MA 3BRBA 3L9MA 3ZFXA 4A4LA 4FVQA 3R8ZA 3HV4A 4WD5A 2C6MA 2Q83A 4I6HA 4C4HA 3R7UA 2PMIA 4K1BA 5TF9A 2NP8A 2WMSA 4EC8A 4GU9A 1MRVA 2X4ZA 3R71A 1M7NA 4NCTC 2Y0AA 4TTHB 4MBJA 2QG5A 3QUDA 4I23A 2CJMA 2Z8CA 5EM5A 3FZOA 4O7RA 3QWJA 2GNGA 2Z60A 3HVCA 3MW1A 2JITA 5GJDA 2ITZA 3QZGA 3S1HA 1UU9A 3R21A 4FV0A 1G8JA 3IDBA 4H3QA 4P7EA 2GDOA 1Q8YA 4JI9A 1J91A 4FSNA 5HG5A 4FKIA 4HCTA 4GK3A 4YSJA 3UGCA 3PRIA 4K11A 4F6UA 4RX7A 5HG8A 4AZSA 1KWPA 4ENXA 2WMTA 3VVHA 3MIYA 4O0RA 3OXZA 1P4OA 3L8SA 4BCPA 3I60A 4XX9A 2PMLX 3CBLA 3POZA 5IUHA 5D1JA 3ZS5A 4TWCA 2G9XA 1NXKA 2IZSA 2HXLA 2JEDA 2ITWA 3ZYAA 4D0WA 4XHKB 4QOXA 4R7BA 3KMWA 3SXRA 5AX3A 4V05A 4WO5A 3OY1A 3GCSA 5KCVA 1SM2A 2YDJA 4XRLA 2BAKA 4B8MA 4JIAA 4E6DA 4HVIA 3D7ZA 4LMNA 2V7AA 2CKQA 3RPRA 3S4QA 5H2UA 3W55A 2UZDA 3P0MA 4UYAA 1K9AA 2OW3A 3LW0A 5ETAA 3FDNA 4KABA 4NM5A 4EHEA 4Y73A 2OLCA 4N70A 3LCKA 1QPCA 2C1BA 3BYMA 2C3JA 4FGRA 4B4LA 3ZU7A 3K5VA 4J7BA 4NM3A 3WIGA 3DLSA 3E88A 1FVRA 1FGIA 3TV4A 5A6OA 2PYWA 3IPHA 4QQJA 1H26A 3GCQA 1WAKA 1Y8YA 3MWUA 3PG1A 4LG4A 4RWJA 2R3LA 4AZFA 4BVUA 3I5NA 4I20A 2HWOA 4YHJA 5C8NA 4AW0A 2XNBA 3CXWA 2GQGA 3CGFA 4TWOA 5CALA 4IWDA 2QVSE 4CFVA 4QPSA 1ERKA 4O22A 4FOBA 1CKJA 5HE2A 4BR3A 4X21A 5B0XA 2V55A 5AP0A 2Y4IC 2C3LA 4R6VA 5HO7A 2XK8A 4FKGA 1JBPE 4DFLA 1XH4A 4U97A 3F7WA 2X8IA 2WB8A 4IB5A 5C8MA 3PXYA 2PMNX 5DI1A 1SVGA 4DFYA 4YU2A 2QOKA 4HCUA 2IO6A 3PZHA 4AQCA 4CZTA 5IQIA 5KMOA 2FSOX 3LFAA 4MVFA 3LLAA 3VUHA 3QLFA 3V5LA 3ZSIA 4G3DA 5HG7A 3FUPA 2OIBA 4F78A 4MXYA 1SZMA 5L8JA 4APCA 3QA8A 3V5PA 3GU8A 3KU2A 5TR6A 1YOJA 3EOCA 3KGAA 4LL5A 3MGYA 1P14A 2F7EE 2UUEA 3ORNA 4FTKA 2UW7A 4NFMA 4RX8A 3FZSA 2FSLX 3A8WA 3P7CA 3SXSA 4DH1A 5BVDA 3L9PA 4WSYA 5CENA 3BGPA 4RWIA 4TWNA 3TKUA 4CT1A 1W82A 1Q24A 2CDZA 1PMNA 1YXXA 2PVJA 3K54A 3FZTA 3LCOA 3QHRA 3PXZA 4JDKA 3F5GA 4QMWA 4QMTA 5D7AA 4DGNA 5I9ZA 4FK3A 2EVAA 4F70A 4A9SA 1H1WA 2JDSA 3FI4A 5CI7A 5LVLA 3SRVB 4AACA 2OF4A 4BN1A 2HENA 3VAPA 3VS5A 5IF1A 2WFYA 4AE6A 3AC1A 3OWKA 3R0TA 5EHOA 4F0GA 5JQ5A 4AF3A 2CSNA 3QC9A 5DR6A 3DA6A 2YA9A 3AC4A 5AWMA 1BL6A 3FXWA 3KK8A 4BRXA 3SRVA 4S2ZA 3UOJA 2PTKA 3C4FA 5ANEA 3IECA 2ZDTA 3RINA 3ALNA 3JYAA 3R2BA 4WIHA 2FO0A 2X7FA 3NFGB 2Z7SA 1JLUE 3PY1A 4WG5A 4TYGA 4FIGA 2WZJA 4AXDA 4P5ZA 1RDQE 4JR3A 4JT3A 5E4HA 4Z7HA 5CSPA 2VWXA 5DRBA 4X3FC 2PZYA 2ZFYA 3Q04A 3W1FA 2GFCA 3PJ2A 4EQCA 3O2MA 4FYNA 3SG9A 3RAIA 3WZUA 3ZC5A 3HNGA 4U45A 3DNEA 3HX4A 4L00A 1PMEA 3OWLA 3CCNA 1OPLA 5EQYA 2E2BA 4U5JA 3H3CA 5HLPA 4NU1A 3MVLA 3OBGA 4CCBA 3CPBA 4ENYA 2J0IA 4QYEA 4OT5A 2YFXA 5KHWA 3KXXA 3NRMA 3UOKA 3OWPA 1CSNA 4JX7A 3UVQA 3BEAA 4MF1A 2FB8A 4Y95A 4FTAA 1PRYA 3FMNA 3SDJA 3O23A 4PDOA 4DLJA 3QU0A 3U6IA 2WIHA 3RHXA 5HE3A 3BU3A 3I0QA 4O7NA 2F9GA 4QMSA 4Y72A 3RCJA 5KHXA 3LCTA 3LFEA 4U3ZA 4OBPA 1ND4A 4UXQA 2QU5A 2EXCX 2WELA 4FZFB 4GS6A 4JDHA 5IDPA 1KE9A 3AC5A 2F57A 4RVTA 2JAMA 2QO9A 2QR7A 3F2NA 3NYVA 4I4FA 3ORPA 2W1IA 4C2WA 1JWHA 4FV9A 4O7VA 3DKOA 3RK5A 1JKKA 1LR4A 2BAJA 3HDMA 2C47A 3UPZA 4DFNA 4A4XA 2BR1A 2WTKB 3NCZA 5EFQA 2Z7LA 4R1YA 4U44A 4TRLA 3D5VA 4DG0E 5KNJA 2WMAA 4YJPA 3W33A 3TV6A 4R7HA 3NWWA 5DPVA 1PW2A 4D1XA 3Q32A 5E8ZA 4AA5A 3EMGA 3QYWA 2XEYA 4QTAA 4BDHA 1V0BA 4J95A 1OL5A 4PL3A 4CRLA 5HGIA 4XV1A 4EJNA 3TI1A 5K3YA 3R9HA 1KV2A 2GNLA 3ZOSA 3DGKA 4EONA 3EZRA 2JBOA 3A2CA 3AOXA 5L6WL 3SG8A 5CY3A 5IISA 4AGDA 3Q2MA 4D4RA 4ANSA 4KIQA 3KA0A 5EW3A 3R04A 4GRBA 4EK8A 5J9LA 2WO6A 3OCBA 4UALA 4FV3A 5LVNA 3BYUA 3ZEWA 3MDYA 3D5WA 1QL6A 5H8EA 3TMOA 4ZK5A 3TUDA 3QRKA 3EYHA 5DR2A 4NUSA 2VTHA 3U8WA 4FTJA 5K4JA 5J95A 4A06A 3PVWA 1LEZA 4KRDA 4D1ZA 3PDTA 3VC4A 3GENA 3H9OA 3AXWA 4UBAA 4D2RA 4TL0A 1ZOHA 4AE9A 4QPAA 3SA0A 1H27A 5KMLA 3KN5A 2EXMA 4EZ7A 4QYYA 3PSBA 4RBLA 5I9UA 1MP8A 2ZYBA 4IVAA 3TKHA 3SOAA 4BCKA 3CPCA 5AAEA 4JS8A 4I92A 1U4DA 4IEBA 5DH3A 3V6SA 5FXRA 4LUDA 1JQHA 2XB7A 3OW3A 4PP7A 5CAVA 4YBKA 2XKFA 5FG8A 3BE2A 3HP5A 3F2AA 3ORMA 2XNMA 3GB2A 3DAKA 5FP6A 1YWNA 3FJQE 4BCFA 4GT5A 4FVRA 4CV8A 2YM3A 4L44A 4PP9A 4MXAA 5E91A 3A60A 4HOKA 4F6WA 3R7VA 1OL6A 2I6LA 5EKNA 5KKRB 2CLXA 4C4GA 2RFNA 4L68A 4AT4A 5J7HA 1WVWA 1DAWA 2CNVA 3F66A 4GVJA 3I1AA 5FTGA 4FTQA 4M13A 4LRKA 1JSVA 3C5IA 5GNKA 4DHZA 2OH4A 5IMEA 2J6MA 3R9DA 4FKRA 2HY81 1MRUA 2PUIA 3P4KA 4IC8A 4ACGA 1L8TA 4BIEA 3EFJA 5D7VA 2JFMA 3P7BA 3R7OA 3BYVA 5D9HA 1UU3A 5IUIA 1OITA 2QI8A 3Q4UA 3VS0A 3MFRA 5EH0A 2NYAA 3TEIA 1IAJA 3NW6A 5EDPA 1O6KA 1URWA 5LVPA 4IZAA 1PXMA 2ZV7A 3AKLA 2G2IA 4FSUA 4NKAA 4YHTA 5JZNA 2VAGA 3VS4A 4O2ZA 2Q0NA 4XG9A 4DHIB 4JDIA 3ATTA 3E8EA 1T46A 2OKRA 4DT8A 2C5OA 3F9NA 4IVBA 4D5HA 3O96A 3UC3A 1XH5A 4B99A 2JIIA 3H30A 2YIWA 4YJVA 4YJSA 3WIKA 2WPAA 3GC0A 1ZWSA 3COMA 2GNFA 4U81A 4YMJA 5CU0A 4M3QA 4O6EA 4OTRA 3FZ1A 4II5A 3PLSA 3A4PA 2GU8A 2VO3A 2X9EA 2VTJA 3WYXA 2VWWA 2J9MA 4AAYA 1URCA 4K77A 4F09A 4EOOA 5CASA 2R3IA 1ZMUA 3CS9A 4MNFA 4ERKA 3H4JA 2C0OA 3GC7A 4GK4A 2XAOA 3COIA 4E5AX 4LYNA 5HD4A 3HLLA 3CE3A 3DS6A 3ITZA 4O0TA 2CN5A 4ITJA 3FLYA 3EQHA 3KC3A 4M97A 5J1WA 2HW7A 3H0ZA 4IWQA 1KE7A 3MH2A 5AUXA 4ZJIA 4BDBA 4DGMA 5CU4A 3QTIA 4CMTA 2F2CB 5ETIA 5HBHA 3FMHA 2BFYA 3N4UA 5LCKA 3OMVA 3D15A 3PE2A 3RNIA 3FMKA 5BVKA 3PVGA 4EWHA 5CX9A 3L9NA 5L8LA 3GI3A 3NPCA 3AG9A 5C4LA 3E3BX 1ZMWA 3DCVA 3IG7A 1PHKA 4G5JA 4TN6A 3QFVA 4FSYA 1R0EA 3MB7A 3WF7A 1WVYA 2R64A 2A19B 4FEVA 4ITIA 4BF2A 1Y57A 4ASZA 5J9ZA 3BLQA 4E1ZA 3Q9YA 3B8QA 2CGXA 3FHIA 4UY9A 3BQCA 2WOUA 3ZBXA 5AP6A 4JQ7A 4ZY5A 3P9JA 2BTSA 5KE0A 3PJ8A 5A4LA 5LQFA 3DJ6A 1I09A 2VV9A 3BLRA 3BU6A 4M0YA 1LP4A 4QP1A 3PSDA 4PY1A 3GU7A 3JVSA 1DI9A 3W32A 3DKCA 1PXPA 2WEIA 3R8UA 3C4XA 3FBVA 3OVVA 3DBCA 4M8TA 5HO8A 4V04A 4EHVA 2VTLA 5JH6A 1YDSE 2BCJA 4QYGA 3ZC6A 1FGKA 3F5PA 4N6YA 2VWUA 3NUPA 3QTZA 3RCDA 4BJJA 3O7LD 3VQHA 2FH9A 4K9YA 4RLKA 3ZM4A 4F6SA 2UZUE 4GG7A 3TZ7A 4ANQA 3S00A 4ACHA 2W96B 1Z5MA 5E8SA 4QTEA 3LQ5A 4I5MA 4MKCA 1NVSA 4I41A 3QGWA 1PJKA 4C33A 2LGCA 1H1RA 1H4LA 1ATPE 2WMBA 3DLZA 3NUAA 3OCSA 3ACKA 4JAJA 4XS2A 3QLGA 3G5DA 4FIJA 3KY2A 5E8WA 4EYJA 4C36A 5CAPA 1WBPA 5EG3A 2REIA 4O0VA 2V0DA 4O7WA 4OW8A 3EJ1A 3U4WA 4CFNA 4DDGA 3P5KA 5M4UA 1IR3A 2R7IA 3PY0A 3F3ZA 5IEXA 3SC1A 4L67A 3RM6A 2OJGA 3NVKI 2W5BA 3DAEA 3EQGA 3R1NA 2ACXA 3WBLA 5IA4A 3BBTB 1B39A 4U41A 5BV3A 3UQCA 3EN5A 3MYGA 3IW4A 3FYJX 3QXOA 5ANOA 4RRVA 4TXCA 1GJOA 4R3CA 3TZ9A 3NIZA 2VTNA 3HV6A 4RA4A 4IQ6A 3WF9A 4BTMA 1IEPA 5B2MA 2YIQA 3AD5A 3EQPA 4L9IA 3TDVA 2VWVA 4FC0A 3KCFA 4IJ9A 4IW0A 4I21A 2ITOA 4FZDB 4L45A 3QX4A 2ITQA 2O65A 3OC1A 4U79A 4LV8A 5AUYA 5C01A 2C69A 3DK6A 4FT9A 3S3IA 3LVPA 3G0EA 3FI2A 4ZSAA 2BAQA 3PFQA 1OIRA 2PUNA 4ZMEA 2W1DA 5HVKA 5IQCA 3R9NA 4PQNA 4TYJA 4BBFA 4GKIA 2QCSA 5C9CA 3Q53A 4M84A 5GHVA 4BTJA 4EKLA 3FPMA 4EWQA 4QP9A 4Y46A 4NM7A 1A9UA 3PE1A 2J7TA 3QKKA 2J0MB 1W84A 4DE4A 2B9JA 4A9YA 4C58A 3ZLSA 5AP4A 4JBOA 4ZLOA 2XRWA 1WMKA 2XJ2A 4QYHA 4EORA 1OIUA 4QQTA 1DS5A 3ALOA 3FXXA 5AAFA 4BDFA 3KQ7A 3FI3A 4E4XA 3RJCA 5CSHA 4EOSA 2ZM1A 5EKOA 4AZVA 2PHKA 2ZMCA 2PUUA 2WMXA 4KIOA 4LOOA 3KXNA 2Y6OA 2HW6A 3Q6UA 3CKWA 3PYYA 4WNPA 4ZTRA 5FXQA 4WA9A 1G8SA 5AUUA 4GK2A 5KO1A 4B7TA 3CSVA 1MRYA 3EKKA 5ACBC 4BC6A 3A7HA 3F2RA 3OTVA 4EK6A 2IZTA 4XG4A 4GYGA 3PSCA 2XYUA 1MUOA 4FL2A 4I3ZA 2BILB 4EHGA 3BI6A 1XKKA 2YABA 5EYDA 4ZJVA 3ZTXA 2X39A 2HZNA 3Q2JA 2GTNA 3F5XA 3BLHA 1XQZA 4C4FA 3M42A 4FSZA 4RPVA 3RKBA 5ANIA 4I93A 3F5UA 1WZYA 4L8MA 4PV0A 4YZDA 5HBJA 3W0RA 2BROA 2KULA 4JG6A 3EN9A 4ANMA 5FLFA 5DT4A 5IQEA 2R7BA 4G6OA 3NNWA 4XBRA 4IDTA 3Q9ZA 4TYIA 2YM6A 5AJQA 4DGOA 4UN0C 1B6CB 4ONAA 3IS5A 5HNIX 2SRCA 4X2KA 3UDTA 3D0EA 3IW5A 5DIAA 3FMJA 5ANJA 3RPSA 3WI6A 3MBLA 3EKNA 3R8LA 3IW7A 3IW6A 5D10A 2WMUA 4P2KA 2PY3A 3LFSA 4QTBA 4JRNA 4QTDA 3UPXA 4DFZE 3NEWA 4E6AA 5ITAA 5AADA 5LWNA 5IH6A 4FIEA 4AA0A 3ORKA 5I5ZA 3BQRA 3IKAA 1V1KA 4RIOA 3W0OA 3EFLA 4RQVA 4U8ZA 2NRUA 2JDOA 3TN8A 3ZCLA 1ZXEA 3GU6A 3DB8A 2W1GA 3CD3A 3NSZA 5IMXA 3KMMA 4FG7A 1JPAA 4ZY6A 2XK3A 1GY3A 4JNWA 4IVCA 4QMUA 3NUNA 4WUAA 3QX2A 4EOLA 1E1XA 4IZ5A 2OJIA 3L8XA 4IAAA 4NFNA 2G2HA 4ALWA 2X2LA 3KXZA 4S33A 4U43A 5M08A 4D4VA 5DE2A 3IOPA 3UVRA 5AA8A 4WG3A 4L7SA 4KBAA 4ZXTA 3C0GA 4L52A 4RWLA 3RNYA 3QD3A 4ZZMA 4MQ1A 4GMYA 5TT7A 3FV8A 3ODYX 2XH5A 2J51A 2C5NA 5CT0A 4CZUA 3Q52A 3V5WA 2PZIA 1FBNA 3E3PA 2HWPA 1H01A 4QO9A 1Q4LA 3ODZX 3WZEA 4C61A 3CIKA 1KE5A 3RWPA 4DFBA 2XS0A 3BBWA 4WHZA 5I9XA 3D4QA 1J1BA 4RIYB 4XCUA 3UVPA 5C8KA 4I6QA 1P5EA 2BHHA 3VQUA 5HIBA 4YNEA 5K5XA 4JBQA 2EUFB 2CNQA 2UW6A 4LFIA 4L42A 2CPKE 1Y6AA 1Z9XA 2GS7A 3I7CA 3SVVA 3BIZA 4AXFA</