4AQKA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase in complex with adp and ip6
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
437
structure length
414
Chain Sequence
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICREGRPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Expression, Purification, Crystallization and Preliminary X-Ray Diffraction Analysis of the Apo Form of Insp5 2-K from Arabidopsis Thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 127
structure length 414
sequence length 437
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aqkA01
3UDZA 2XAMA 2XAOA 2XARA 4AQKA 2XALA 4AXFA 4AXDA 3UDSA 4AXCA 3UDTA 4LV7A 2XANA 4AXEA
chains in the Genus database with same CATH superfamily
4U3YA 5IQAA 3QD4A 3P0MA 3RCJA 4IFGA 3UBDA 2IN6A 1RDQE 4MNFA 5HG7A 3ZONA 2QOBA 3PY3A 1GJOA 1RW8A 3DDQA 4KINA 4QQ5A 3DXPA 4ZY5A 2WMSA 1GZNA 2PTKA 4KABA 5EQYA 3EQDA 3FLNC 5M4CA 4MTAA 4AGUA 5HBEA 1YQJA 2IW9A 4BCNA 1K3AA 4FKLA 1JKTA 4JL9A 2W05A 3FC2A 5EOLA 4CSVA 5CT0A 1DAWA 4QTEA 3BHVA 4H58A 4FTOA 3FHRA 1ZOGA 5F9EA 4DLJA 4G1WA 1GZ8A 2XVDA 4S33A 3VS0A 4CT1A 5I0BA 5C8NA 2VWWA 3FY2A 4FV5A 4IAAA 4O96A 4J7BA 3BHYA 5F94A 4FE2A 5HD7A 4FA2A 5AP1A 4J1RA 3EQRA 4XG4A 4GYIA 5EW9A 4F4PA 2BZHB 5KE0A 2WPAA 3EN7A 4FKVA 2O64A 4ALWA 3ORNA 4EK6A 3K2LA 1IR3A 1UV5A 4YTFA 5HQ0A 4DDIA 2DYLA 5I9ZA 2OFUA 3GT8A 3VUDA 1UWJA 4XG7A 4RIWA 3VW8A 3UZPA 4FL3A 3UYTA 2XYNA 4O7TA 1WZYA 4M13A 5CI6A 4KSPA 4E6AA 4KA3A 1BMKA 3EL8A 1B38A 4I6LA 3S4QA 3SD0A 4HW7A 2YCQA 3KU2A 4ITHA 4USDA 4AFEA 1QPCA 1OGUA 5CX9A 3QALE 1PXJA 3GU4A 4YJNA 5IUGA 5C4KA 4ZOGA 3W55A 3QRTA 3DTCA 4C61A 1SVGA 2JIVA 5DVRA 1Q3WA 2ZDTA 3PIZA 4R6VA 1Y8GA 3RPYA 4Y5QA 4BI0A 3H4JA 4MH7A 1F5QA 2HZ0A 2OI4X 4IEBA 3VS2A 5KMKA 3HA6A 4RFYA 3T8OA 3FJQE 2E9VA 2QNJA 4XP0A 4C36A 5EW3A 4MK0A 2VTQA 4APCA 1YW2A 5FD2A 3E5AA 5L3AA 4GEOA 3GFEA 2W06A 3FLZA 4JJRA 3C1XA 2WMXA 5K4JA 4RIYA 2YIWA 2CSNA 3PVGA 3A7FA 5IH4A 4FSYA 2XRWA 4BDAA 1VYWA 3KFAA 5K5NA 4A4LA 2NRYA 2A27A 4MXCA 3SXRA 2BAJA 3PUFC 3A7JA 4YTHA 4FIHA 5JN2A 5CEIA 4PMMA 4F7SA 4IAFA 4FYNA 1YWRA 3UQFA 3KXHA 4QRCA 2VO3A 3LXNA 3FWQA 4CRSA 3DCVA 4FV8A 4EEVA 4H05A 1IA9A 4JQ7A 4YJVA 2UW6A 5E90A 1UU8A 2ZDUA 4DEBA 3GXLA 3H9RA 3NX8A 4TXCA 5CAUA 4E8AA 1HCKA 4ZTSA 1R0EA 5JSMA 4UBAA 3A60A 3W1FA 4A9SA 2X8IA 4JBOA 3R22A 5H3QA 4S31A 2X9FA 3UO5A 4KKGA 4FNXA 2R3RA 4ERKA 4APPA 3PPJA 3D7TA 1Z5MA 3POOA 4C34A 3KVWA 3IO7A 1Q5KA 3I4BA 3RHKA 1Y91A 4OBPA 3UPXA 4AAAA 3D2IA 3R63A 4EZ7A 4JG6A 4LOPA 4O0WA 1Q61A 3MI9A 4RG0A 3NRMA 3GOKA 3PPKA 3JXWA 1EH4A 2HY0A 3GB2A 3DNEA 4PMPA 3JPVA 3FY0A 4ZTHA 2PMOX 3SGCA 4EK4A 3SW4A 2C6MA 2J0JA 2Q0BA 3QKLA 3U9NA 4ZSEA 2J9MA 3UOLA 2W1CA 4S30A 5AA9A 5E1EA 5GJDA 5DE2A 3MY5A 4F78A 3LXKA 5EYKA 2JKQA 3F3TA 3FPMA 3HDNA 3MSSA 2BHEA 4FTRA 3UODA 3R30A 4RX5A 3PVBA 2QODA 2CCIA 2YISA 3ATSA 4D2SA 3ACJA 5H8BA 4BDEA 3ZEPA 4ZJIA 5HO8A 1SYKA 4AU8A 1OL6A 1LPUA 2CNVA 4EH8A 3A7GA 3TDWA 4XEYA 3QTWA 2FO0A 4XUFA 4D9TA 2Z7QA 3EZVA 3PWDA 1LEWA 4QEBA 3RK5A 2JBPA 4ID7A 2QOHA 4FL1A 3HMMA 3EQCA 1H8FA 4FV9A 3LCKA 3ZO1A 5C26A 3AD5A 3UDTA 3QFVA 4J71A 2BZIB 3NW7A 4B0GA 5HU3A 2C6IA 2XJ0A 2G2FA 4QMXA 3GBZA 4QMPA 3BYMA 1DI8A 3FKOA 1UNGA 4GH2A 1P2AA 3I0OA 5DA3A 4BDGA 5A6NA 2J6MA 4CFFA 2R3MA 3LJ1A 3PTGA 2PVMA 5JGBA 2O3PA 3H30A 1H08A 2ZJWA 2PSQA 3KREA 2QO7A 2QO9A 4EOJA 4AFJA 4YJQA 4OTDA 4IWPA 4C38A 4RFMA 2QONA 3BHTA 3RKBA 3ORMA 2XALA 4GKIA 5B0XA 3Q52A 1W82A 2PE2A 2BZJA 2R3HA 4PL4A 2JIUA 2UZNA 4E4XA 1WMKA 1WVYA 3HX4A 3P1AA 4E4NA 2WTIA 1OIQA 5CSVA 5LVMA 5AUYA 4R3RA 4F9AA 5IDNA 3NMUF 4IAKA 5BVWA 4RLKA 1HCLA 1OVEA 4ZS4A 3IONA 2ZM3A 3NVKI 4L9IA 2WMQA 4IJPA 2W9ZB 5CEQA 3F6XA 2UW3A 4FSWA 1ERKA 2WU7A 1QPJA 2H8HA 4IZ5A 2I0YA 2RG6A 3KB7A 2JFLA 4FVRA 4DITA 5BVNA 5EOBA 4UXQA 4AX8A 4YJSA 3R28A 2ZOQA 3D7ZA 3ZDUA 2VX0A 3EYGA 4MAOA 4MXZA 4QMOA 3BE9A 3LE6A 1XH5A 4R1VA 3G51A 4C4JA 4BTMA 4EH6A 5CU0A 3N9XA 5A4QA 3BWJA 2R3IA 2I7QA 3F5UA 4EORA 5HLWA 3GOPA 3DBDA 2ZYBA 3C4WA 4ITJA 3FXWA 4L53A 4NCTA 4YTIA 2BFYA 3UDZA 4HVSA 2OXXA 1VR2A 2FVDA 3DU8A 4JR3A 4HGLA 5HVJA 3QX2A 4U42A 4R5YA 4BICA 2ERKA 4MKCA 3FZ1A 3NNUA 3DXNA 4R77A 4J95A 4AACA 4IB5A 4WBBB 2R0UA 2FUMA 2J7TA 3ZO3A 2BALA 5FXRA 4AT4A 1VJYA 4ACMA 4FGBA 1UU7A 3A2CA 4P7EA 3F5XA 4JT3A 3SG8A 3D2KA 3DAJA 3I60A 2R2PA 4R7BA 4WUAA 2WNTA 4HVIA 4CLJA 4QP3A 4MF1A 4EWQA 1PMUA 1JVPP 5AAFA 2BRBA 5LMAA 3D5XA 3KMWA 5FP6A 1CTPE 2BPMA 5LJJA 4NJ3A 3QA0A 2KTYA 4G5JA 5C03A 3OBJA 3PPZA 4K6ZA 4QYFA 4C4FA 5AP5A 2QCSA 3NS9A 5FEQA 3K3JA 5BQ0A 2HYYA 3ZBFA 3KK8A 3MVHA 2PVYA 3MVJA 1O6LA 4BHZA 4EQUA 1DM2A 3VUGA 5FM2A 4EYMA 5CF6A 3VULA 2VNWA 3PJ2A 2OICA 4H3QA 3TV6A 4BR3A 2YFXA 3QWKA 4FKWA 4G6NA 3BEAA 2NPQA 5M4FA 3KXGA 3QZIA 4ASEA 4R3CA 4CFXA 2VO6A 3LM0A 4LM5A 4FKUA 2OKRA 5EH0A 4LG4A 4AA0A 4BDCA 1YDRE 3OHTA 3W0NA 2WQMA 2F57A 5EQEA 3ZH8A 3SRVB 4WG3A 1JAMA 2X81A 3GVUA 2CGWA 5I9XA 4PV0A 3RPOA 4TW9A 3VONA 4EK8A 1OL1A 4G3EA 2GCDA 3VW6A 4YU2A 1REJA 4V0GA 4RIWB 1YRPA 3I0QA 4TZRA 4HYUA 4BBFA 4NW5A 4YBJA 2VTNA 3L8XA 1UKIA 3R02A 4QP6A 1TQIA 5F20A 4CXAA 3L8VA 2IZUA 2VO7A 1KE8A 3MFUA 4CMOA 4CKJA 2QR8A 3WI6A 3SDJA 5DR9A 5E1SA 2BKKA 4IIRA 3VRZA 3ZSHA 4UXLA 5HICA 4EH3A 2DUVA 4BY9E 3PJ8A 1DAYA 4CMTA 4DCAA 2WEVA 4C37A 1KE5A 5HIBA 1YI4A 3MW1A 1P5EA 2AYPA 3DAEA 3U55A 4QMZA 2PL0A 4E4MA 5KMOA 5CSPA 3TZ9A 2J2IB 4KB8A 4RIXB 4HCUA 3WF9A 3A61A 5A3XA 2XBJA 2IW8A 3V04A 2R3GA 3DFAA 3KRLA 3UJGA 2F9GA 2BVAA 2RFDA 5IH6A 4KBCA 3T9IA 3QZHA 5CT7A 5FDXA 5CY3A 4UY9A 4BB4A 2YIRA 2Y0AA 3BBWA 2IPXA 4S32A 4RMZA 4IWQA 3U4WA 3U6IA 3P5JC 3BIZA 2B9HA 4WHZA 4DEEA 2R0IA 3NIEA 3D5WA 4NM5A 1WBPA 5M08A 3UPZA 4FTJA 3HUBA 3QD2B 1PJKA 5M4IA 4BTKA 4E5WA 3DZOA 4EKLA 4YJOA 4FNZA 1ZMUA 4GT4A 4E73A 5L6PA 2ITXA 2WQEA 2PU8A 3E63A 5L2SA 2AC5A 4WD5A 1MQ4A 4PRJA 3ZUTA 4AT3A 3FKLA 3ZLSA 1OBGA 2WEIA 3BGPA 5BUJA 5BVOA 3UTOA 4FUYA 3ZRMA 3BL9A 4A06A 3DKCA 5ETCA 3TJCA 4BIBA 1CDKA 4X2KA 1A48A 2W1DA 4JDHA 4PY1A 3W16A 1BI8A 3D7TB 2YZAA 2W1FA 3GU5A 5FTGA 4E26A 5HKMA 3R9DA 3RAHA 2PVKA 2XS0A 4Q5EA 3TIZA 3BGZA 1WBVA 4CVAA 3AMYA 3SXFA 4EH7A 4F0GA 2F7ZE 4QP8A 3PXQA 4W8DA 4E4LA 2VN9A 4DTAA 4TN6A 5BVFA 3ZZEA 4QTCA 4Q9ZA 5JKGA 3QUEA 1WAKA 2W1ZA 1J3HA 4NT4A 5CALA 5LXMA 5HO7A 4ZTRA 2FSLX 5IA1A 4MXXA 1WBOA 4QTDA 3Q5ZA 4NUSA 3CR0A 2QD9A 3MDYA 4QMWA 1V0OA 3V5PA 4E6QA 3EL7A 4F65A 1YXVA 2C4GA 4I4FA 3SHEA 4MUQA 3TDVA 5LMKC 2ITUA 3IGGA 4DFBA 1L3RE 4ANQA 2JDOA 5J5SA 3EFLA 3ORTA 1IG1A 3F9NA 3OW4A 3WZJA 3LFEA 2P3GX 3V51A 4QO9A 2W1GA 4RJ8A 2ITTA 3ITZA 4QP1A 3GCPA 4U79A 4WG5A 5BVKA 4EZ3A 4AW2A 4DH5A 5M44A 1UNHA 2I40A 5DRBA 5E8UA 4EOOA 2Z2WA 3HMIA 5EI2A 4C33A 3R83A 3MH1A 4K77A 4JAIA 2XF0A 4I6BA 3OMVA 5A14A 5BMMA 4RIOA 2I0EA 2BIKB 2P55A 4LRJA 5CSHA 2RL5A 4FKTA 4MVFA 3KN5A 4PDYA 4X6RA 3NUPA 2QLQA 3PP0A 2XM9A 3ZC5A 4FZAB 4OT5A 4X2JA 4M3QA 4DEHA 4H1JA 4EOMA 4XOYA 4AA5A 4OTRA 4D1SA 4GFGA 3B8QA 4AOTA 5C4LA 2IW6A 3PSCA 5E8VA 3QTXA 5AWMA 4I5CA 3BQRA 3HL7A 2W5AA 3GCQA 4XBUA 3MFRA 4NKSA 3RPSA 4DINA 2Y4IC 4HVGA 4CEGA 5DT4A 4K2RA 4LUDA 4ZSJA 1Q97A 3HVCA 4O21A 1XH6A 4FICA 1YXXA 3QWJA 1ZOHA 4QTBA 2OIDA 3R9OA 5AAGA 3UNKA 1GZKA 3AC8A 1ZZ2A 2X7GA 3KL8A 4GG7A 3CD3A 5EK7A 2ITZA 3UZTA 4NYEA 1ZY5A 1PYXA 2QI8A 4MQ2A 5HVYA 3G90X 4AN2A 3T3UA 3FV8A 5L8JA 5C8KA 1OPLA 3E8NA 5LVPA 2C0IA 4YURA 5KZIA 1H1RA 2CLQA 4L3PA 3RGFA 2AUHA 3DBEA 4AA4A 3PLSA 4I0RA 4FZ7A 4BDHA 4ZSAA 3QTZA 5DR6A 3ZM9A 5JGAA 1NVQA 4IM3A 3UDBA 3ZS5A 3KVXA 4IBMA 3ENHA 1XQZA 4IVBA 4Y83A 4E6CA 1IAJA 5GINE 4JG8A 2HZIA 4CKRA 3MYGA 2OSCA 4DDGA 4O0SA 3BU3A 3C4EA 3CEKA 4CFMA 4FV1A 4P2KA 2J0IA 2GQSA 5BYLA 4BTFA 1CMKE 2WOTA 4Z9LA 5IQEA 2VTRA 4NM0A 3LFNA 4A9UA 3N4TA 3G15A 3VF9A 3KF7A 2XKCA 4I5HA 4QT1A 1XR1A 2BR1A 4JR7A 2XK3A 3K54A 5AP0A 2YACA 3ORZA 2PZPA 1M7QA 2ZV2A 4P5ZA 4BIDA 5CEKA 4M68A 3UO6A 3QKMA 4DEDA 4AZEA 2VGOA 1FGIA 3NSZA 2X4ZA 4IMYA 4FKIA 3W2CA 3ZZWA 2PZYA 4BKJA 2B4SB 3DY7A 3UOHA 3C5IA 4YO4A 3OBGA 3GNIB 4XG2A 2XZSA 1ZARA 5CU3A 3HECA 3WZEA 4DG2E 4WT6A 3KRWA 1XH7A 2CNQA 2PMLX 4ZMEA 2OF2A 3W33A 3LMGA 5IA4A 4K33A 2ETKA 3ODZX 4YZCA 4O7RA 3DBFA 2X7OA 4L45A 2X8EA 4LRMA 1Y6AA 2IVTA 4IAYA 3DB8A 3FZRA 3R1NA 3ULIA 2W1IA 4BDFA 4XG9A 4EQCA 3EJ1A 5EFQA 4WNOA 5HZNA 4XV9A 2GNHA 1G8SA 3EQPA 5FG8A 2H9VA 1M52A 3HV7A 3PZEA 4U0IA 3D14A 4CMUA 3W10A 2W96B 3Q9WA 4FX3A 3S00A 4D5HA 2NP8A 1P4OA 4ZJJA 4G2FA 4F9WA 4GJ3A 1Q41A 2NO3A 4UV0A 4AOIA 3LCTA 3LFAA 2E9PA 4F9CA 4AW0A 2JGZA 5LQFA 2XJ2A 4C35A 4LFIA 4RWJA 1OIYA 4GG5A 5DT3A 3QC4A 3SXSA 2PMNX 2BAKA 2XIZA 3OCSA 4TYJA 4MD7E 1GY3A 2ZV9A 2C6TA 2GTMA 4FOCA 5ANGA 5H2UA 4QDEA 3DT1A 3IDPA 1H4LA 4U45A 4L3LA 3VVHA 3V5WA 3G5DA 3KXMA 4IM0A 5A54A 4V0GB 5HBJA 1OPKA 2B1PA 3KGAA 3FL4A 5B7VA 3AC5A 4JG7A 5CENA 1W8CA 3QZFA 4JI9A 4BGHA 4CFNA 4RFZA 3P23A 4IADA 4BHNA 4BDDA 3C0HA 5DLSA 3KULB 5KMLA 1RJBA 3E64A 4HVDA 4MQ1A 4OTFA 3JR1A 5AUTA 3O96A 2GTNA 4I23A 4ANLA 2ZM4A 4RZVA 5CVGA 4DAWA 4U97A 1X8BA 1J91A 3E92A 2YM6A 4Y46A 3PE1A 2J0MB 1JBPE 2G1TA 3VS4A 3W32A 3W0OA 3EOCA 4EQMA 2FGIA 1PXOA 3EQFA 4D4RA 2NRUA 5J9LA 4XLVA 3VF8A 3ORLA 4QP7A 4O7YA 3R8UA 1U54B 4DFXE 1CKIA 4ANSA 2W1HA 2WOUA 4BDIA 4TKSA 5CEOA 1NVSA 1P4FA 5D11A 2XB7A 3LLTA 3W2PA 5KBQA 3U4UA 3I1AA 3LIJA 3MB7A 4DC2A 4I92A 4FTIA 2GNLA 4IE9A 2WMTA 3EN5A 3IQ7A 1Q8WA 4JQ8A 3TJDA 4D28A 3V8WA 1YWVA 3HUCA 5A4TA 1CKJA 1TVOA 3BV3A 2BAQA 2BROA 2BMCA 3AD6A 4XCUA 5AUWA 4HGTA 5L6OA 3TTJA 3FMMA 4FTMA 5EHYA 4FSZA 4ZSGA 4EOQA 3CKXA 3D0EA 2BTRA 4K0YA 3UG1A 1OPJA 3D9VA 1QPEA 4CGAA 2OWBA 3RAKA 3BU6A 3VJNA 4FIJA 4EH9A 3H0ZA 4UYAA 2IZRA 1H07A 2HW6A 4WBOA 3OXTA 1OM1A 2XP2A 3V5JA 4GFOA 3OT3A 3QRKA 4X3FC 5LOHA 3POZA 3R8LA 2HZ4A 4DH7A 2X6DA 3DGKA 2UZOA 5IF1A 2XM8A 3FYJX 4AE6A 2CKQA 4F1MA 3S3IA 2UZUE 4RGJA 3FSFA 5BUIA 4LMNA 3VQUA 3TV4A 4CV9A 4DHZA 4TWOA 1CSNA 2XH5A 1IAHA 3ZTXA 1OKVA 5FEDA 3SRVA 4AXFA 2YAKA 4C2WA 4NZWB 3UDSA 5A4EA 2C5YA 3TUBA 3IW8A 4IHPA 3ZOSA 3LMIA 2R4BA 2Y6OA 2OG8A 5CAPA 1ZOEA 5CNNA 1YXTA 3FMKA 3PY0A 3TUDA 3IKAA 3LAUA 2WB8A 4U80A 5M09A 4ZLOA 3DZQA 4ZMFA 1GZOA 4FODA 4NJDA 1F3MC 5KBRA 3KRRA 4X2FA 3CTQA 3SQQA 4AG8A 3KXZA 2BTSA 1JPAA 1O6KA 1ZAOA 4GK3A 3TNIA 4RC2A 2HENA 3RALA 1VZOA 3ZSGA 4ZZOA 1OIUA 5CU4A 2EVAA 3H9FA 3Q4TA 3Q53A 1T46A 2R3KA 2UZWE 3VUKA 3EQHA 3NCZA 3FKNA 4RA5A 4DE4A 3GQLA 3GU8A 4O82A 3PP1A 2OU7A 3EYHA 3WF5A 2RFNA 3C7QA 2QOLA 3G2FA 4W8EA 4FGRA 4OTIA 2PVFA 2X4FA 1ST0A 3HV5A 4N57A 3BYVA 4RIXA 4FC0A 4C3FA 3U6JA 3VC4A 3TUCA 2X0GA 3MH2A 4XV1A 1KV1A 4ASZA 3W2SA 4EOIA 2PYWA 5ANKA 2OW3A 4FEQA 4YSMA 5KKRC 5DEWA 1A06A 1S9IA 1PXIA 4O22A 2DWBA 2VTTA 3TT0A 1PF8A 3O17A 5JFWA 3DBQA 3HZTA 1PXNA 2JBOA 1FVVA 2OXYA 3VBTA 4O7LA 4JDJA 3ET7A 3LXPA 4JAJA 4C62A 3R73A 4RZWA 4PDPA 3UIXA 2UZDA 1G5SA 5IH5A 2FH9A 4NTTA 1XH8A 1YWNA 3THBA 4OT6A 3PXZA 1HOWA 2WQOA 3QHWA 4JX7A 3UC4A 5KHWA 4FSUA 5FP5A 3MS9A 3NW6A 4NH1A 4A9RA 2Y7JA 3MB6A 3JVSA 3PJ1A 1JSVA 4L43A 3ROCA 3MFTA 4L52A 1IRKA 3QYZA 1BL6A 5IQGA 3F2RA 3E93A 1SVEA 2Y4PA 3RHXA 1Y8YA 4ITIA 2CCHA 3FHIA 3QKKA 4F9YA 2IVVA 4FV3A 3H0YA 4H36A 4DTBA 5JT2A 2J4ZA 4R5SA 4TNDA 1YI6A 4IM2A 5J9ZA 1H0VA 3RM6A 1MUOA 5AV2A 5K4IA 3CLYA 2G9XA 2QKWB 2YABA 2GQGA 1K9AA 3A62A 3CCNA 3OXZA 4I22A 3R8MA 4FG9A 4Z16A 2A0CX 3QL8A 1UKHA 3FMDA 3FZTA 3IW5A 4IZ7A 4U43A 4RJ4A 5G6VA 5D9HA 3R0TA 3RWPA 1R3CA 3CBLA 3TNPC 3DA6A 3OT8A 3CS9A 2E9NA 2Z7RA 1YHSA 3KK9A 4TY1A 4U9AA 4FV2A 4USFA 3F61A 1ATPE 2UW4A 4H3PA 4D0XA 2H34A 2W5HA 2E9OA 1Q8TA 1KOAA 4GUBA 1Z9XA 4RJ5A 4JXFA 4G3DA 5K9IA 2HWOA 4RC4A 5IA5A 2VWUA 4X21A 2B9JA 4XV2A 5EYMA 1OKZA 4QMVA 3SV0A 3TV7A 3QGWA 3UE4A 2I0HA 3P7AA 4FKQA 4TPTA 4UEUA 2CN5A 5ANEA 2C5OA 2Z60A 4GIHA 1WBTA 4AXCA 1OL7A 4P4CA 4AGWA 3BRBA 3EN9A 3UVRA 2ESMA 4AW1A 4PDSA 4F09A 4FVPA 1J1CA 3RI1A 1TQPA 1ZRZA 4CRLA 3LQ8A 3LPBA 5AX3A 4FKPA 3TTIA 3VS5A 1PXLA 2GS7A 1ZYDA 5HNBA 2UW7A 3PDTA 5E9EA 4IVDA 4FKGA 3OF0A 5T6KA 4KRDA 1KE9A 2XK8A 3E88A 4EUUA 2QOIA 2GSFA 2YAAA 4AZSA 1PMEA 3MJ2A 4YJPA 2B53A 1OL5A 5D7AA 3C9WA 4C0TA 4RVMA 5AAEA 5JQ8A 2JD5A 4W4YA 4FV7A 4G3CA 3AC3A 3IECA 2ITWA 4L42A 1OKWA 3AKKA 3IPHA 4O7SA 3O8UA 3LVPA 5I9WA 5AUZA 2C30A 3UVPA 3G6GA 5D10A 2B52A 3TKUA 3NYXA 2QOQA 3Q96A 2HAKA 5CTPA 1OZ1A 4M97A 4FK6A 4GV1A 5GJGA 2HW7A 4MHAA 4XP2A 4O91A 4JX3A 4GUEA 1UU9A 1FVTA 5FGKA 5H8EA 4U3ZA 1XH9A 1IA8A 5HG5A 3A8WA 3TYKA 1R78A 1ZYJA 3ZLXA 3SVVA 1W7HA 4YZDA 4C3PA 3ZBXA 3MFSA 4YP8A 3DJ7A 3OEFX 3QQHA 4DLIA 4IB0A 5M07A 4F08A 4F7JA 4BTJA 3EFJA 3MA3A 4LV7A 4DA5A 5A46A 4ANMA 4M69B 1K2PA 4JQEA 4RJ3A 3TXOA 2Q83A 3MH0A 4FK3A 5L2IA 3RPVA 3OVVA 1M17A 4BCIA 2VU3A 5ANJA 3VQHA 4BZOA 5FBNC 4A9TA 1H27A 1BUHA 4YNEA 4C58A 5F4NA 4LOQA 5E8TA 5KUPA 3NCGA 3FSKA 4CLIA 4F99A 4EWHA 2GPHA 5LCJA 4CT2A 3RZBA 4ZTLA 5IMEA 5DYJA 1W0XC 3OWPA 4WRSA 4BCFA 5D7VA 2WTWA 3NDMA 3OD6X 3DNDA 4Q2AA 2X1NA 4QYYA 2GDOA 2XNMA 3Q4ZA 3NLBA 4FTLA 1H1QA 4O0YA 4YR8A 3R1SA 4BBEA 3M11A 5M53A 1PW2A 1UNLA 5DNRA 3D94A 2PE0A 4EC8A 2UZTA 1W83A 2PPQA 3FDNA 1Y57A 4O7NA 3ZO2A 4CFWA 5A4CA 4N6ZA 4XP3A 4O83A 2HWPA 4MX9A 4OTWA 4I41A 3TI1A 4A9YA 5KX8A 3G0FA 3NUAA 3NNWA 3PG3A 1PMVA 4FV6A 4F6SA 4OBOA 2XA4A 3QC9A 2VV9A 5FEEA 3H3CA 4CQEA 4FT3A 5IMXA 5CSXA 4PNIA 3B2WA 3COHA 4S34A 4M12A 4FT7A 2J50A 3R9RA 1R1WA 4GL9A 5IA0A 2I1MA 3I5ZA 3MPTA 4YLLA 3DKFA 4ZP5A 4YPSA 5AUUA 3HRFA 4IWDA 2YDKA 4QYHA 5CS6A 5FBOA 5TT7A 3FQEA 3EH9A 3RJCA 3CQUA 4L7SA 3AT3A 3QQLA 4UWYA 3FMJA 2OJIA 2UW5A 4BGGA 3KRJA 3I6UA 2VTIA 2W99B 4K18A 3RWQA 1SZMA 1XKKA 2Z7LA 2G01A 3C4CA 3PE2A 4GMYA 4FTQA 3HRBA 1NVRA 3QUDA 5HIDA 2P4IA 2CGUA 5FRIA 3QCSA 2WGJA 2Z02A 4UALA 4YTCA 3BKBA 3TZ8A 4FBXA 4BCHA 1KOBA 2X39A 3E7OA 3TNWA 4F7NA 4ORKA 1PXKA 3A8XA 2IZTA 4PQNA 1J7LA 4OGRA 4TWCA 4FTCA 3ALNA 3ML1A 1XO2B 4XG8A 3ORPA 3EHAA 4BIEA 3I7BA 5CZIA 3R7VA 3NIZA 2VNYA 3OY1A 3P78A 4EJ7A 4KRCA 3MIAA 3QYWA 4GS6A 5HE2A 4CD0A 3W8QA 3JY0A 3QAME 2UUEA 3E62A 3O8PA 1BI7A 1RQQA 1FINA 1FBNA 2O63A 3FE3A 5AV0A 3IW7A 5JQ5A 2RF9A 3COKA 4YPDA 1JOWB 2HOGA 3KULA 3R2BA 1DS5A 4RWKA 2QOKA 3Q32A 2WTKB 4FR4A 2O65A 3C0IA 3OUNB 1G3NA 3SG9A 3DS6A 5AADA 3UNZA 2H6DA 1ZWSA 3LJ2A 5LARA 3KC3A 3HMNA 3QHRA 2QC6A 4XRJA 2GQRA 4WUNA 3PA3A 3BBTB 4KBAA 3RMFA 5J9YA 4G3FA 2WAJA 4QMMA 5GIPE 3N51A 2OZOA 2R3JA 1QL6A 3EFWA 2XAOA 4RWLA 4BYJA 2JKMA 2OJFE 1U54A 4O2ZA 3GCVA 4D0WA 3MESA 4M7IA 1KSWA 3CY3A 4EK3A 3MTLA 2YEXA 2X2MA 2ZAZA 4DH1A 1U4DA 1ZYCA 2OH0E 2C0OA 4HCTA 4M14A 3O71A 3BQCA 4RJ7A 2OF4A 4GVJA 2PZ5A 2ZB1A 1BKXA 2WO6A 4EUTA 1SM2A 3QTIA 3Q2JA 5J8IA 4EHVA 5E8XA 2VUWA 2WXVA 3AC2A 3BYUA 3ACKA 3DV3A 2C5VA 3OWJA 3VS7A 1OECA 1OGYA 2R3FA 5HLNA 4FKRA 4QMYA 4PP9A 3O50A 2F2CB 4ARKA 2JDVA 2XCKA 2HELA 4GKHA 2JIIA 2O2UA 1PYEA 4QMNA 3AC1A 5EKOA 3PSBA 4FKOA 4RX9A 3DJ5A 3ZUUA 4EZ5A 2GHMA 2QOOA 3NGAA 4TRLA 4AWIA 1G8JA 2R64A 4DFLA 4JNWA 2VGPA 2XNOA 4J53A 3A4OX 3GEQA 3I81A 5IEYA 4PUZA 2R3PA 4E6DA 2UV2A 3LQ3A 3OP5A 4B8MA 4G9CA 2EWAA 3OTUA 4Z55A 4ZJVA 3IS5A 2XKDA 4ACCA 2YWVA 5TF9A 3ALOA 3UZRA 2R3QA 2A4LA 4FSQA 4HOKA 3GQIA 5DR2A 5IQBA 3UP2A 4HNFA 4IDVA 4BGQA 1Q99A 2E2BA 3O5AA 4JBVA 2BRNA 3U54A 4CFVA 3NW5A 3RNYA 2YDIA 4J97A 2XIXA 1VLRA 2G2IA 3Q6UA 4O0VA 2XIRA 5AM6A 3NYVA 2VTHA 4M67A 1Q8UA 4L68A 4LRKA 4CCBA 4BN1A 1YI3A 5LMKA 2V0DA 4BBMA 3OS3A 3L9PA 4F70A 3HRCA 2WMVA 2PUNA 4FSTA 2FYSA 3C50A 3E7VA 5JK3A 4LYNA 4C59A 3LFSA 2ONLC 3M2WA 3MVMA 2WFYA 4HPTE 3QQFA 4EBWA 3O8TA 3OY3A 4NFNA 4DEGA 5IQDA 2OZAA 2BRMA 4I5MA 3R7UA 5AFVA 5HNIX 3SC1A 3TMOA 4QQTA 5AM7A 1OKYA 2A2AA 1MRUA 3DFCB 4AOJA 3WZKA 2ITNA 4WO5A 1OL2A 3NEWA 5TKDA 3KCKA 3QXOA 4L6QA 5IEVA 3SAYA 3HAVA 4C4EA 3II5A 4DG3E 1W84A 1PXMA 3OG7A 4IX3A 5I4NA 5DH3A 4FJVA 4A07A 4UX9A 5DIAA 4F0FA 2CPKE 2Z8CA 4UZDA 4NIFB 4DGOA 5CF8A 4FV4A 3ZRLA 2QHNA 3P7BA 3R1YA 4FNWA 2BRHA 1Q3DA 3LFFA 3OWLA 4GU9A 4MBIA 5DOSA 3GP0A 3SKCA 4L7FA 4EH5A 3W0QA 4P5QA 4FUXA 2WQBA 1URWA 2P0CA 3M42A 2OLCA 4OTQA 3R9NA 4D9UA 5A4LA 2CGVA 4PWNA 3TN8A 1XHAA 3VN9A 4C4GA 4OBQA 4PNKA 4WG4A 3FI3A 2GFCA 5HVKA 2PVNA 5EM8A 3VIDA 2CLXA 3F7ZA 1LR4A 1WVWA 3WZDA 4KS8A 5IA2A 4TNBA 3P9JA 4G17A 3GC8A 4I1ZA 3PJ3A 4AXEA 3JS2A 3OC1A 5LWNA 2WU6A 2OFVA 2XK6A 4CZUA 4B9DA 4I3ZA 4EOPA 3HP2A 3ZDIA 3I79A 3U9CA 3CPCA 3LFDA 4R78A 2C6KA 2P2HA 4BDBA 3DLZA 3EQGA 3F2AA 3RK7A 3BZ3A 5I9YA 3R21A 1AQ1A 2JDRA 4ONAA 4TWPA 5K5XA 4ZIMA 4WSYA 3CC6A 2IG7A 3JYAA 3QCYA 3CGOA 1OI9A 4HYIA 3ZSIA 3DK6A 4YMJA 3PZHA 4ANBA 3GCUA 4WA9A 2BFXA 4XG3A 5KNJA 3KXXA 2GNJA 1YXSA 1OUYA 2C3IB 2BHHA 1GIJA 5AMNA 4IVCA 5DBXA 3V6RA 2JLDA 3IOPA 3KA0A 4IWOA 2VTMA 2ITVA 1YDTE 2IVSA 2X9EA 3QUPA 4CFUA 1JKLA 4DH8A 3HNGA 4V01A 3K3IA 2XUUA 4HYSA 1M14A 5ETFA 4CTCA 3Q9XA 4R7IA 2FSTX 3ZFXA 2GNIA 3R71A 4QYEA 4YC3A 5HG9A 2G2HA 4KNBA 3R8PA 3QTSA 2XBAA 1FMKA 4Y8DA 4PF4A 2YA9A 3FXZA 3FZPA 3PXYA 5FXSA 4HZRA 3WIGA 4BDJA 4O6LA 4Y85A 4KKHA 2E9UA 1H1WA 4PDOA 4AXAA 2OJ9A 3QRJA 4OR5A 3PG1A 5HG8A 5IISA 3A4PA 2B55A 3AGMA 3WF7A 3OOGA 4CG9A 2UZEA 4AZWA 2V7AA 4JDKA 2VAGA 2W0JA 4YJUA 5D1JA 3NYOA 4A4XA 1YOMA 2HY81 4GVAA 4U40A 4M8TA 2VWXA 3BLRA 3ZU7A 3WF6A 1Q24A 4TT7A 4NM7A 3MPMA 4EL9A 4FIEA 3ZM4A 2W17A 3D4QA 3NVMB 4Q5HA 4DFNA 5CF5A 5JZJA 1J7IA 3HMOA 3MGYA 2F7XE 3CTHA 3IGOA 5KZ0A 2RKUA 3LXLA 1OB3A 4GRBA 3SA0A 3FL5A 4FT0A 3EFKA 3SOCA 5IZFA 1R39A 3GC0A 3E87A 3PIYA 4AUAA 3VAPA 2VTAA 3V5LA 2JDTA 1JKKA 2JKOA 3AXWA 3QCQA 4W4VA 1NT2A 4AS0A 4AZVA 5LMBA 3HV4A 5CXZA 3AG9A 3FLWA 4AGCA 4G6LA 4DGLC 1YKRA 4HPUE 3CKWA 4C02A 2BILB 4O38A 3U6HA 4L01A 4OLIA 2UW0A 3LZBA 4ZK5A 4Q9SA 3O7LD 5C27A 4ACHA 4BRXA 3C4FA 3VHEA 3ZFYA 1M2QA 4C2VA 2OXDA 4WNPA 2XMYA 4MNEA 4KKEA 2GNFA 4DYMA 1Q8ZA 1IEPA 3BU5A 2XNBA 5AX9A 5AP7A 2PVHA 1PY5A 4ZEGA 5T3QA 4IC8A 2FB8A 2AEGA 2VZ6A 3FMHA 4P90A 3V6SA 4N70A 2YCFA 3ZEWA 2I0VA 4G34A 4RQKA 4XYFA 5EI8A 4AW5A 2G15A 2GS6A 4AN9A 3QQUA 1J7UA 3FLSA 4BZNA 4MD9E 2CKPA 4QMQA 3OWKA 1V0PA 3TKIA 5CEMA 1YDSE 4FEVA 5EYDA 2QLUA 2VWYA 4AZFA 3F66A 4E5BA 4IH8A 5BUEA 1AGWA 5EKNA 3ZXZA 5CXHA 4J98A 5J87A 4U8ZA 3UIMA 1JWHA 3UQCA 2XJ1A 4KIQA 4JRNA 2HXQA 3PYYA 5DEYA 4AN3A 1XBAA 4FSNA 2F49A 5BVDA 3TZMA 5L2WA 3OW3A 2F7EE 3E8DA 4I21A 4LL0A 3TL8A 4D2RA 1B39A 1YHWA 3ZRKA 5CNOA 4AF3A 4RA4A 4TYHA 4EHEA 3PRFA 4BDKA 4DHJA 4G16A 3GC7A 3GU7A 4AQCA 4AXDA 2PVJA 1GIHA 3PSDA 3BE2A 2V5QA 1XBBA 2X2KA 2YDJA 5HCXA 5DT0A 4JOAA 5LVNA 1AD5A 4GT3A 4LV5A 4DCEA 4O0UA 2VTSA 3HGKA 2YCRA 1H00A 3KRXA 4MXYA 2YJRA 3F3VA 3KY2A 5KHXA 3HA8A 4HCVA 2LGCA 4KWPA 1E1VA 1GAGA 3VUMA 2DQ7X 2KULA 4E93A 3W0RA 1M2PA 2VTJA 5AUXA 4FEXA 3TKHA 5GIOE 3Q9YA 2W4JA 5BV3A 2GU8A 4JDIA 4BZDA 5A9UA 1UU3A 2B54A 2R7BA 4LOOA 2QOFA 3KMMA 3DKOA 4I6QA 1CKPA 3KQ7A 4D58A 3PIXA 2XCHA 4DGMA 5CF4A 1IASA 2IJMA 2VWIA 3I5NA 4J8MA 5B2KA 3F3ZA 4G31A 4FIGA 3QRIA 4H39A 2PY3A 5DFPA 4D1ZA 3QRUA 3NUYA 4C4HA 5FTQA 4MEDA 3AD4A 4RRVA 3I7CA 2IVUA 4DBXA 2GMXA 2XARA 5HBHA 5CSWA 1XMMA 5EHOA 5LWMA 2CJMA 3OXIA 4TWNA 2JFMA 4S2ZA 2WQNA 3AOXA 3HV3A 3TIYA 3ODYX 4IFCA 3NR9A 2Q0NA 3MV5A 5FXQA 5IPJA 4FOBA 3C13A 4BCKA 3V01A 3DXQA 4J99A 4BCQA 3GUBA 4B4LA 3F5GA 4I0TA 4L00A 3L1SA 4ZLZA 5EHLA 4PL5A 5G1XA 3BV2A 5E8SA 5EYCA 4FG7A 5JRQA 1OITA 5KO1A 1E1XA 3PVWA 2H96A 1QPDA 4BCJA 3MY0A 2XAMA 2X7FA 5H8GA 3WE4A 3Q9ZA 3I6WA 4F6UA 1PMNA 3TG1A 5JFXA 2OZAB 2OJGA 2WIHA 3Q3BA 4XOZA 3ROYA 4E7WA 1GNGA 2C6EA 3CY2A 5ANOA 4O86A 2HK5A 2YM7A 3REPA 3UP7A 4EONA 5FM3A 3K5VA 2O8YA 2XANA 4ZTNA 4I20A 3VS3A 4NK9A 1YOJA 2R3LA 1VEBA 2XRUA 3KEXA 4JS8A 2W4KA 3W0MA 5IQFA 4FZ6A 4K8AA 5JZNA 2VWVA 4HJOA 4L3JA 2QURA 4O0XA 4YZBA 1O6YA 3LCOA 2Y4IB 4O0RA 5BYZA 1H28A 3KXNA 5CVFA 5M51A 5FDPA 2WTKC 4NU1A 4RBLA 4ALUA 5HD4A 2ITPA 2OK1A 4X3JA 3RTPA 4DH3A 4UYNA 2F4JA 5M06A 2OIBA 1LEZA 1XBCA 2C68A 2EUFB 1T45A 3BX5A 4K11A 2JC6A 4M15A 4IC7A 5JFSA 2V22A 3BPRA 2WMWA 5E91A 2XNEA 3P7CA 5I9UA 5ACBC 3EKNA 4IJ9A 3C0GA 4ZTQA 4ZY6A 2WELA 3EQIA 3VWAA 2ZM1A 3ANRA 3O2MA 2PMIA 2YCSA 5AUVA 4EC9A 1WVXA 1H26A 3CIKA 3WILA 4IW0A 3FUPA 3UIBA 5AV3A 4J8NA 4D55A 2R7IA 4TYIA 4LGGA 4O7VA 4AZTA 4KS7A 3FLYA 2RIOA 5C8MA 1YOLA 1TFFA 5LVLA 2REIA 4DEAA 3R04A 1UA2A 3RVGA 4FTNA 5IQHA 3RCDA 4RT7A 2WMRA 3CQWA 5HE1A 4PTEA 3UMWA 4Z7HA 5B2MA 2BDJA 3PXRA 5ETIA 5J1VA 4G5PA 3NNVA 4LMUA 3DOGA 3NFFB 3ERKA 5EDPA 3V5TA 1WFCA 3UOKA 3ZLYA 5IU2A 2BIYA 2ZMDA 5E7RA 5HHWA 3W2QA 2GHGA 4XX9A 4ACDA 1FGKA 3JUHA 4H1MA 4EBVA 3CP9A 4GK2A 4I6FA 5AP3A 3EMGA 2WKMA 1UWHA 2J0LA 4U5JA 3BLHA 2EU9A 4NSTA 1NW1A 5H9BA 4ENYA 5CQUA 3UYSA 3LCSA 3ZLWA 2FSMX 4FKSA 5L6WL 3UG2A 4DHFA 2W4OA 5AIRA 3WIKA 4ASDA 5CANA 3Q04A 5KCVA 4IZYA 1KE7A 3RK9A 3F7WA 4K9YA 3ZHPC 2YM8A 2CHLA 2OJJA 4IX5A 3D5VA 3LQ5A 2ZB0A 3WF8A 3W18A 3Q5IA 4XBRA 3W0PA 2ZMCA 4IX6A 5ACKA 5HU9A 4LV8A 4QNYA 3S95A 1DI9A 3QQJA 5LCKA 3MTFA 4QTAA 4HYHA 3TM0A 4D4SA 1ST4A 5CU6A 4OUCA 4F1OA 5HE3A 5L2TA 2PZIA 1ZYSA 4QMTA 3SLSA 4ZTMA 3PA5A 4DTKA 2WIPA 1H0WA 4U6RA 4Y5HA 3CXWA 4GFMA 2R3OA 4U41A 3RPRA 3IW6A 2V55A 3LM5A 3MVLA 3UMXA 5KMNA 3LJ0A 4MYGA 5M4UA 3NUUA 2VWBA 4PX6A 4Y73A 1PRYA 1BX6A 2QU5A 2X8DA 3MBLA 3CJGA 3AMBA 2PUPA 5HE0A 3HDMA 3OOMA 4IDTA 3KCFA 1R0PA 1WBSA 3ZXTA 5C9CA 5ANIA 4ASXA 3E8CA 1WBWA 2OO8X 5EM7A 5HCYA 2QO2A 1PXPA 2RFSA 3IW4A 2WMUA 4DT8A 4BVUA 5M57A 3E8EA 2QR7A 2R9SA 2RFEA 5CWZA 3GGFA 4O6EA 4QQCA 5HCZA 2VX3A 4MNEB 5ICPA 3F5PA 5CU2A 1U5QA 2JAVA 4B99A 4F6WA 1B6CB 1WCCA 3DBCA 3GC9A 5IQIA 5A6OA 4EHGA 5HIEA 3C51A 3PWYA 4YZNA 3ZYAA 3FI4A 4IX4A 3CJFA 4QOXA 3UGCA 4BCOA 4ZLYA 2ETMA 1NXKA 3DK3A 3LMHA 3EZRA 2YIQA 4HGSA 4CZTA 2C1BA 2JAMA 4I94A 5BMSA 4OTHA 2LAVA 1O9UA 4O2PA 3RINA 4CKIA 1URCA 2PHKA 3ZUVA 3PXKA 4IANA 3DPKA 5CQWA 5AP4A 1APME 5D12A 4B8LA 5AV4A 4GT5A 3G6HA 3VUIA 2QG7A 4C3RA 4JIAA 4RVTA 2CNUA 3BL7A 3ZCLA 1W98A 4KD1A 2UVXA 5IUIA 3R8ZA 3R7IA 1P14A 3R7OA 2ERZE 4YLJA 3DQWA 5DGZA 3RAIA 4O7WA 1QCFA 2XKFA 3BHUA 4AP7A 3W2RA 4Z3VA 5IDPA 3ELJA 2C3JA 4W4WA 2JDSA 3KIOC 3VHKA 4DBNA 4WNKA 4M0ZA 1H1SA 2VD5A 3QU0A 4M84A 4NFMA 5AA8A 4RC3A 4W4XA 1YVJA 1JLUE 2FA2A 3LHJA 3O0GA 4O0TA 3V8SA 3OCGA 4RVLA 1ZMWA 3DK7A 5FTOA 4TYHB 2C3KA 5T68A 4A4OA 5E8WA 1Z57A 2XNNA 2BKZA 5J1WA 2JKKA 3DB6A 3G0EA 1TQMA 3MJ1A 5TR6A 1NY3A 2F2UA 4UZHA 4BYIA 1A9UA 1LUFA 1Q8YA 2V7OA 3FEGA 4KUJA 2XEZA 5EM5A 3WOWA 5ETAA 5BX0A 4IAZA 2OGVA 3DAKA 4RX8A 4I93A 4M0YA 4YSJA 4K1BA 4Z7GA 3ORXA 3F88A 4NKAA 1YHVA 4NCTC 4QP2A 4QMLA 3QTUA 4ZAUA 2OBJA 2VO0A 4HGEA 1SMHA 2QKRA 4X3FB 2XK9A 4LGHA 4DEIA 5J7HA 4FEWA 3OUKA 4X6QC 4WNMA 4ZS0A 5HORA 4UB7A 2HCKA 3H9OA 3ORIA 3GCSA 3FMEA 4QYGA 4ZY4A 3O7LB 4R7HA 3UVQA 3QQKA 3W8LA 3ANQA 4JVGA 1BLXA 1F0QA 3AT4A 2C47A 4OW8A 4EOSA 4AQKA 3QZGA 1JSTA 2WMAA 2BUJA 3JVRA 4MWIA 4Y95A 4ZSLA 4PTCA 2IO6A 3AKJA 3WYYA 2B0QA 2PZRA 4BF2A 2RGPA 3P79A 3IDCA 2VTLA 4XHKB 3ATTA 2DS1A 3M1SA 3VBQA 2VWZA 2CN8A 3E3PA 4NTSA 5E92A 3V3VA 4V05A 4FZDB 3VBYA 3Q4CA 4X2GA 2VX1A 3PY1A 5FLFA 3TZ7A 5HX8A 2Y9QA 4EOLA 4HVHA 2ITYA 1ZZLA 5AEPA 1Y6BA 2J90A 4LI5A 4IB3A 4CTBA 4F7LA 4USEA 4QMUA 4BJJA 3OCTA 1G8KA 2O0UA 5D41A 3R01A 5EG3A 3CPBA 4AAYA 1GIIA 2ZV7A 4TYEA 5AP6A 3VS1A 3UC3A 4BC6A 4I4EA 5HESA 2R3NA 2XK7A 2UZBA 4ENXA 3P5KA 3EB0A 1SNXA 3KKVA 4IZAA 1OMWA 2C1AA 2YM4A 3NUXA 4FKJA 4UN0C 3BGQA 4IQ6A 4NL0A 4B6LA 3VO3A 5C1QB 3VRYA 1QMZA 4GJ2A 3HYHA 4KSQA 3ENMA 5E8YA 2BDFA 3GFWA 5JRSA 4EOKA 1MP8A 5F95A 3T3VA 3TWJA 5GJFA 4KIOA 4E20A 4FTAA 3BWFA 4RQVA 2JEDA 3QF9A 5BPYA 2C6OA 3NUNA 1FQ1B 1RE8A 4FIIA 4WIHA 2PULA 3VUHA 5IA3A 5KKRB 2Y8OA 1ZY4A 4EI4A 4EYJA 2VTOA 3LW0A 3NPCA 4D5KA 3FZOA 1V0BA 5CYIA 4DG0E 3HKOA 2ETRA 4H3BA 1PHKA 4JMQA 3ID6C 3F3WA 2GNGA 5JFVA 2WD1A 2QQ7A 2VTPA 4XH6A 3CTJA 3FPQA 5CEPA 3QA8A 4EK5A 3V5QA 1KE6A 2NNWB 3FZSA 3FYKX 4JIKA 3OZ6A 2PUUA 3NYNA 4BI1A 2EXMA 3DQXA 3DTWA 2VRXA 4WKQA 3QTRA 3RM7A 2UW9A 4IAIA 4RSSA 1MQBA 4XJ0A 1OIRA 3N4VA 4FIFA 2W5BA 5M55A 1Q62A 3A7HA 4RIYB 4DGNA 4U81A 3F2NA 2Y6MA 1G8AA 2YM5A 3HLLA 4YUQA 2YJSA 3LFBA 5I5ZA 1ZYLA 2C6DA 2X6EA 4J52A 4FEUA 3S2PA 3COIA 3ZC6A 4DFZE 5IQCA 4GYGA 3RP9A 2CMWA 3VNTA 4JLCA 5DWRA 3L8SA 3AGLA 2ACXA 3F82A 2WMBA 4AT5A 4GW8A 1YXUA 4I24A 2YN8A 4PTGA 3AMAA 4MCVA 3F69A 4DFYA 5JEBA 3FC1X 1PKGA 4LUEA 1FPUA 2YZLA 4XNEA 3EQBA 5AV1A 2PE1A 3HMPA 2GHLA 4KAOA 4QPSA 4YLKA 4RJ6A 4DGGA 3Q60A 3VBWA 4GIIA 2GS2A 1JSUA 3CGFA 2C69A 3QGYA 5BVEA 3SOAA 2OIQA 2SRCA 4ACGA 3HV6A 2BDWA 3F3UA 3MN3A 2UVYA 1I09A 2CKEA 4O84A 1WBNA 3FMLA 4FYOA 4LL5A 2ONLA 3MA6A 3NAYA 5B2LA 3HP5A 4JBQA 2C3LA 4LQMA 3K5UA 4EH2A 3UIUA 5E4HA 1LP4A 4GSBA 4IB1A 3UO4A 4FG8A 2R5TA 2QU6A 4BCMA 5DRDA 2IZSA 3EIDA 4FMQA 3SW7A 3UNJA 3HAMA 1OUKA 3FXXA 2XIKA 4FTKA 2C0TA 4JBPA 3P86A 5ANDA 5EDQA 5J95A 4EJNA 3MIYA 1H1PA 1M7NA 2ITQA 3NFGB 1FMOE 1SNUA 2ZFYA 3CE3A 3OROA 3IG7A 4FTUA 3JY9A 1U59A 2UVZA 5FQDC 2QVSE 4N6YA 4YBKA 1BL7A 2CGXA 4N0SA 2O5KA 3BLQA 3OFMA 3TEIA 4IVAA 3UOJA 5DN3A 5C01A 5GNKA 2A19B 5IUHA 3T9TA 3NUSA 4F63A 4X2NA 3GI3A 5EDRA 4L44A 4KBKA 4X7QA 4DT9A 5JMSA 1KV2A 3WZUA 4F9BA 3ZFMA 1KWPA 2QHMA 5CI7A 2PK9A 2C5NA 3OCBA 3H10A 3KF4A 3OEZA 5HLPA 3BLAA 3ULZA 3VBXA 3TNHA 5KMMA 3GENA 3TACA 4FL2A 2BCJA 5KMJA 3KMUA 5JH6A 1FVRA 2WTDA 1H24A 2HZNA 4YJRA 2XEYA 3U8WA 1ND4A 1I44A 3IK3A 3R1QA 2C5XA 4MBJA 4FVQA 4C7TA 3BELA 3ORKA 4G3GA 3LOKA 4D4VA 5EI6A 5FUTA 1CM8A 2WHBA 2XIYA 3AQVA 1U5RA 2B7AA 1FOTA 2XK4A 3WE8A 3FQHA 3E3BX 4R1YA 3DLSA 2WZJA 4LDTA 4XS2A 3VJOA 5BNJA 3LKMA 3QD0A 1U46A 4HZSA 4EKKA 2I6LA 3FI8A 1ZMVA 2J0KA 4DN5A 3PXFA 2J5FA 4F1TA 1Q4LA 4A7CA 4XG6A 5HX6A 5M56A 5HTBA 3BCEA 3WYXA 2BZKB 4II5A 5DPVA 4ZZMA 2WTCA 4BCGA 1MRVA 4D4YA 2P33A 4XLIA 4R3PA 2PWLA 4U44A 3R8VA 3MWUA 5BYYA 3PRIA 3P4KA 4RVKA 4AE9A 2JITA 2W9FB 4HNIA 3FI2A 1MRYA 4E1ZA 3QLFA 5AP2A 4ERWA 4FTTA 1XH4A 5F1ZA 3VBVA 5L8KA 3IOKA 2WTJA 3FAAA 3P08A 3ZO4A 5LVOA 5CAQA 1M2RA 4ZZNA 2XNPA 3DKGA 1GOLA 3N4UA 3QXPA 4RWIA 1STCE 3AKLA 2CKOA 4FZFB 2IWIA 4KIPA 3RNIA 3PLAE 5EQPA 5TOZA 2WTVA 3QTQA 3TNQB 3U87A 4WRGA 2HIWA 5GHVA 5HNGA 3QD3A 4QPAA 1H01A 3FLQA 4FT5A 4CCUA 4MBLA 3Q4UA 3C4XA 1TKIA 2C6LA 2P2IA 3U51A 1VYZA 1JQHA 3COMA 3A7IA 4YZ9A 2QG5A 5HGIA 2J5EA 3L8PA 2YIYA 3R7EA 3B2TA 2EB2A 3MPAA 3S1HA 5DI1A 4ZXTA 5JGDA 1ZLTA 3FBVA 4YGAA 3DDPA 1J1BA 2YM3A 2Z7SA 3FMNA 3PFQA 5DHJA 4DFUA 5IG1A 4YC6A 2YERA 4UWBA 3AC4A 4YHTA 3R00A 5E8ZA 4NWMA 4BCPA 3BYSA 2J51A 4QQJA 3CSVA 3G33A 1SVHA 3NAXA 3QLGA 4GK4A 2B9IA 3MY1A 1UVRA 3Q6WA 4O7ZA 5CLPA 4GCJA 4QNAA 4X0MA 3RAWA 4C4IA 4EH4A 5HTCA 2QOCA 2GFSA 3LFCA 5EW8A 5CVHA 5CAVA 4FI1A 2A1AB 3R7YA 2XYUA 4YO6A 4GU6A 3IDBA 1XMLA 4QP4A 4YJTA 2ZVAA 4L8MA 1JKSA 1ZXEA 4CV8A 3Q2MA 2ITOA 2PVLA 4TYGA 5CAOA 3CQEA 5EM6A 1PKDA 5K3YA 3G9NA 2PUIA 2NYAA 3C5UA 5CASA 3EKKA 3L9NA 4RPVA 4DF3A 5ITAA 3L9MA 3R2YA 4I0SA 3D5UA 4QP9A 4YHFA 4F0IA 4IACA 5L8LA 4EHZA 4FT9A 3PUPA 4E5AX 3A99A 1KUTA 2RG5A 2FSOX 3NWWA 4TTHB 3O23A 3AT2A 3WBLA 4BJJB 4O81A 4AGDA 3MH3A 3LFQA 1S9JA 2UZLA 4MWHA 4PL3A 4U7ZA 3ZMMA 2XNGA 3UQGA 4MXAA 3EN6A 4CG8A 4YZMA 2YITA 2ZV8A 3KN6A 4YHJA 1OBDA 4QDVA 4WOVA 3PA4A 4NM3A 3G9LX 1XWSA 4QMSA 4PMTA 3DJ6A 4NW6A 4L67A 4CNHA 5I9VA 5HI2A 4L46A 3WARA 1XJDA 4O27B 3L9LA 2HXLA 3BEGA 3D83A 2YHVA 4UWCA 3ETAA 4TL0A 4FSRA 4MXOA 3EWHA 1BYGA 3EN4A 4Y72A 5IEXA 3TCPA 1NA7A 4J96A 3CD8A 1JNKA 3NNXA 5DG5A 3HEGA 3B8RA 2BRGA 3LLAA 4JRVA 4YC8A 3C4ZA 4V04A 1E9HA 3PJCA 2CDZA 3BI6A 3OTVA 3R9HA 2W7XA 3VS6A 3PFYA 4G9RA 3QBNA 4FSMA 3NZ0A 4ALVA 1H25A 4OTGA 4I6HA 5CZHA 3SX9A 2W1EA 4RLLA 3W2OA 3V8TA 3GU6A 4XRLA 2PVRA 4YNOA 2XKEA 4F64A 2UZVA 5TO8A 3R6XA 5AJQA 5HEZA 4B7TA 4XMOA 3FQSA 4I5PA 3BYOA 5KMIA 3O51A 2V62A 3D15A 4DHIB 4X3FA 2UW8A 4D1XA 4FNYA 2EB3A 4MD8E 3W0SA 4PP7A 1REKA 3PVUA 2YWPA 2EXCX 3QX4A 2B9FA 4PMSA 4XV3A 4G6OA 4N4SA 2OH4A 1V1KA 4RX7A 3QCXA 3LCDA 3QQGA 2YIXA 1L8TA 2AC3A 3BHHA 4FV0A 5AIKA 3S0OA 2X2LA 4BI2A
chains in the Genus database with same CATH topology
4U3YA 5IQAA 3QD4A 3P0MA 3RCJA 4IFGA 3UBDA 2IN6A 1RDQE 4MNFA 5HG7A 3ZONA 2QOBA 3PY3A 1GJOA 1RW8A 3DDQA 4KINA 4QQ5A 3DXPA 4ZY5A 2WMSA 1GZNA 2PTKA 4KABA 5EQYA 3EQDA 3FLNC 5M4CA 4MTAA 4AGUA 5HBEA 1YQJA 2IW9A 4BCNA 1K3AA 4FKLA 1JKTA 4JL9A 2W05A 3FC2A 5EOLA 4CSVA 5CT0A 1DAWA 4QTEA 3BHVA 4H58A 4FTOA 3FHRA 1ZOGA 5F9EA 4DLJA 4G1WA 1GZ8A 2XVDA 4S33A 3VS0A 4CT1A 5I0BA 5C8NA 2VWWA 3FY2A 4FV5A 4IAAA 4O96A 4J7BA 3BHYA 5F94A 4FE2A 5HD7A 4FA2A 5AP1A 4J1RA 3EQRA 4XG4A 4GYIA 5EW9A 4F4PA 2BZHB 5KE0A 2WPAA 3EN7A 4FKVA 2O64A 4ALWA 3ORNA 4EK6A 3K2LA 1IR3A 1UV5A 4YTFA 5HQ0A 4DDIA 2DYLA 5I9ZA 2OFUA 3GT8A 3VUDA 1UWJA 4XG7A 4RIWA 3VW8A 3UZPA 4FL3A 3UYTA 2XYNA 4O7TA 1WZYA 4M13A 5CI6A 4KSPA 4E6AA 4KA3A 1BMKA 3EL8A 1B38A 4I6LA 3S4QA 3SD0A 4HW7A 2YCQA 3KU2A 4ITHA 4USDA 4AFEA 1QPCA 1OGUA 5CX9A 3QALE 1PXJA 3GU4A 4YJNA 5IUGA 5C4KA 4ZOGA 3W55A 3QRTA 3DTCA 4C61A 1SVGA 2JIVA 5DVRA 1Q3WA 2ZDTA 3PIZA 4R6VA 1Y8GA 3RPYA 4Y5QA 4BI0A 3H4JA 4MH7A 1F5QA 2HZ0A 2OI4X 4IEBA 3VS2A 5KMKA 3HA6A 4RFYA 3T8OA 3FJQE 2E9VA 2QNJA 4XP0A 4C36A 5EW3A 4MK0A 2VTQA 4APCA 1YW2A 5FD2A 3E5AA 5L3AA 4GEOA 3GFEA 2W06A 3FLZA 4JJRA 3C1XA 2WMXA 5K4JA 4RIYA 2YIWA 2CSNA 3PVGA 3A7FA 5IH4A 4FSYA 2XRWA 4BDAA 1VYWA 3KFAA 5K5NA 4A4LA 2NRYA 2A27A 4MXCA 3SXRA 2BAJA 3PUFC 3A7JA 4YTHA 4FIHA 5JN2A 5CEIA 4PMMA 4F7SA 4IAFA 4FYNA 1YWRA 3UQFA 3KXHA 4QRCA 2VO3A 3LXNA 3FWQA 4CRSA 3DCVA 4FV8A 4EEVA 4H05A 1IA9A 4JQ7A 4YJVA 2UW6A 5E90A 1UU8A 2ZDUA 4DEBA 3GXLA 3H9RA 3NX8A 4TXCA 5CAUA 4E8AA 1HCKA 4ZTSA 1R0EA 5JSMA 4UBAA 3A60A 3W1FA 4A9SA 2X8IA 4JBOA 3R22A 5H3QA 4S31A 2X9FA 3UO5A 4KKGA 4FNXA 2R3RA 4ERKA 4APPA 3PPJA 3D7TA 1Z5MA 3POOA 4C34A 3KVWA 3IO7A 1Q5KA 3I4BA 3RHKA 1Y91A 4OBPA 3UPXA 4AAAA 3D2IA 3R63A 4EZ7A 4JG6A 4LOPA 4O0WA 1Q61A 3MI9A 4RG0A 3NRMA 3GOKA 3PPKA 3JXWA 1EH4A 2HY0A 3GB2A 3DNEA 4PMPA 3JPVA 3FY0A 4ZTHA 2PMOX 3SGCA 4EK4A 3SW4A 2C6MA 2J0JA 2Q0BA 3QKLA 3U9NA 4ZSEA 2J9MA 3UOLA 2W1CA 4S30A 5AA9A 5E1EA 5GJDA 5DE2A 3MY5A 4F78A 3LXKA 5EYKA 2JKQA 3F3TA 3FPMA 3HDNA 3MSSA 2BHEA 4FTRA 3UODA 3R30A 4RX5A 3PVBA 2QODA 2CCIA 2YISA 3ATSA 4D2SA 3ACJA 5H8BA 4BDEA 3ZEPA 4ZJIA 5HO8A 1SYKA 4AU8A 1OL6A 1LPUA 2CNVA 4EH8A 3A7GA 3TDWA 4XEYA 3QTWA 2FO0A 4XUFA 4D9TA 2Z7QA 3EZVA 3PWDA 1LEWA 4QEBA 3RK5A 2JBPA 4ID7A 2QOHA 4FL1A 3HMMA 3EQCA 1H8FA 4FV9A 3LCKA 3ZO1A 5C26A 3AD5A 3UDTA 3QFVA 4J71A 2BZIB 3NW7A 4B0GA 5HU3A 2C6IA 2XJ0A 2G2FA 4QMXA 3GBZA 4QMPA 3BYMA 1DI8A 3FKOA 1UNGA 4GH2A 1P2AA 3I0OA 5DA3A 4BDGA 5A6NA 2J6MA 4CFFA 2R3MA 3LJ1A 3PTGA 2PVMA 5JGBA 2O3PA 3H30A 1H08A 2ZJWA 2PSQA 3KREA 2QO7A 2QO9A 4EOJA 4AFJA 4YJQA 4OTDA 4IWPA 4C38A 4RFMA 2QONA 3BHTA 3RKBA 3ORMA 2XALA 4GKIA 5B0XA 3Q52A 1W82A 2PE2A 2BZJA 2R3HA 4PL4A 2JIUA 2UZNA 4E4XA 1WMKA 1WVYA 3HX4A 3P1AA 4E4NA 2WTIA 1OIQA 5CSVA 5LVMA 5AUYA 4R3RA 4F9AA 5IDNA 3NMUF 4IAKA 5BVWA 4RLKA 1HCLA 1OVEA 4ZS4A 3IONA 2ZM3A 3NVKI 4L9IA 2WMQA 4IJPA 2W9ZB 5CEQA 3F6XA 2UW3A 4FSWA 1ERKA 2WU7A 1QPJA 2H8HA 4IZ5A 2I0YA 2RG6A 3KB7A 2JFLA 4FVRA 4DITA 5BVNA 5EOBA 4UXQA 4AX8A 4YJSA 3R28A 2ZOQA 3D7ZA 3ZDUA 2VX0A 3EYGA 4MAOA 4MXZA 4QMOA 3BE9A 3LE6A 1XH5A 4R1VA 3G51A 4C4JA 4BTMA 4EH6A 5CU0A 3N9XA 5A4QA 3BWJA 2R3IA 2I7QA 3F5UA 4EORA 5HLWA 3GOPA 3DBDA 2ZYBA 3C4WA 4ITJA 3FXWA 4L53A 4NCTA 4YTIA 2BFYA 3UDZA 4HVSA 2OXXA 1VR2A 2FVDA 3DU8A 4JR3A 4HGLA 5HVJA 3QX2A 4U42A 4R5YA 4BICA 2ERKA 4MKCA 3FZ1A 3NNUA 3DXNA 4R77A 4J95A 4AACA 4IB5A 4WBBB 2R0UA 2FUMA 2J7TA 3ZO3A 2BALA 5FXRA 4AT4A 1VJYA 4ACMA 4FGBA 1UU7A 3A2CA 4P7EA 3F5XA 4JT3A 3SG8A 3D2KA 3DAJA 3I60A 2R2PA 4R7BA 4WUAA 2WNTA 4HVIA 4CLJA 4QP3A 4MF1A 4EWQA 1PMUA 1JVPP 5AAFA 2BRBA 5LMAA 3D5XA 3KMWA 5FP6A 1CTPE 2BPMA 5LJJA 4NJ3A 3QA0A 2KTYA 4G5JA 5C03A 3OBJA 3PPZA 4K6ZA 4QYFA 4C4FA 5AP5A 2QCSA 3NS9A 5FEQA 3K3JA 5BQ0A 2HYYA 3ZBFA 3KK8A 3MVHA 2PVYA 3MVJA 1O6LA 4BHZA 4EQUA 1DM2A 3VUGA 5FM2A 4EYMA 5CF6A 3VULA 2VNWA 3PJ2A 2OICA 4H3QA 3TV6A 4BR3A 2YFXA 3QWKA 4FKWA 4G6NA 3BEAA 2NPQA 5M4FA 3KXGA 3QZIA 4ASEA 4R3CA 4CFXA 2VO6A 3LM0A 4LM5A 4FKUA 2OKRA 5EH0A 4LG4A 4AA0A 4BDCA 1YDRE 3OHTA 3W0NA 2WQMA 2F57A 5EQEA 3ZH8A 3SRVB 4WG3A 1JAMA 2X81A 3GVUA 2CGWA 5I9XA 4PV0A 3RPOA 4TW9A 3VONA 4EK8A 1OL1A 4G3EA 2GCDA 3VW6A 4YU2A 1REJA 4V0GA 4RIWB 1YRPA 3I0QA 4TZRA 4HYUA 4BBFA 4NW5A 4YBJA 2VTNA 3L8XA 1UKIA 3R02A 4QP6A 1TQIA 5F20A 4CXAA 3L8VA 2IZUA 2VO7A 1KE8A 3MFUA 4CMOA 4CKJA 2QR8A 3WI6A 3SDJA 5DR9A 5E1SA 2BKKA 4IIRA 3VRZA 3ZSHA 4UXLA 5HICA 4EH3A 2DUVA 4BY9E 3PJ8A 1DAYA 4CMTA 4DCAA 2WEVA 4C37A 1KE5A 5HIBA 1YI4A 3MW1A 1P5EA 2AYPA 3DAEA 3U55A 4QMZA 2PL0A 4E4MA 5KMOA 5CSPA 3TZ9A 2J2IB 4KB8A 4RIXB 4HCUA 3WF9A 3A61A 5A3XA 2XBJA 2IW8A 3V04A 2R3GA 3DFAA 3KRLA 3UJGA 2F9GA 2BVAA 2RFDA 5IH6A 4KBCA 3T9IA 3QZHA 5CT7A 5FDXA 5CY3A 4UY9A 4BB4A 2YIRA 2Y0AA 3BBWA 2IPXA 4S32A 4RMZA 4IWQA 3U4WA 3U6IA 3P5JC 3BIZA 2B9HA 4WHZA 4DEEA 2R0IA 3NIEA 3D5WA 4NM5A 1WBPA 5M08A 3UPZA 4FTJA 3HUBA 3QD2B 1PJKA 5M4IA 4BTKA 4E5WA 3DZOA 4EKLA 4YJOA 4FNZA 1ZMUA 4GT4A 4E73A 5L6PA 2ITXA 2WQEA 2PU8A 3E63A 5L2SA 2AC5A 4WD5A 1MQ4A 4PRJA 3ZUTA 4AT3A 3FKLA 3ZLSA 1OBGA 2WEIA 3BGPA 5BUJA 5BVOA 3UTOA 4FUYA 3ZRMA 3BL9A 4A06A 3DKCA 5ETCA 3TJCA 4BIBA 1CDKA 4X2KA 1A48A 2W1DA 4JDHA 4PY1A 3W16A 1BI8A 3D7TB 2YZAA 2W1FA 3GU5A 5FTGA 4E26A 5HKMA 3R9DA 3RAHA 2PVKA 2XS0A 4Q5EA 3TIZA 3BGZA 1WBVA 4CVAA 3AMYA 3SXFA 4EH7A 4F0GA 2F7ZE 4QP8A 3PXQA 4W8DA 4E4LA 2VN9A 4DTAA 4TN6A 5BVFA 3ZZEA 4QTCA 4Q9ZA 5JKGA 3QUEA 1WAKA 2W1ZA 1J3HA 4NT4A 5CALA 5LXMA 5HO7A 4ZTRA 2FSLX 5IA1A 4MXXA 1WBOA 4QTDA 3Q5ZA 4NUSA 3CR0A 2QD9A 3MDYA 4QMWA 1V0OA 3V5PA 4E6QA 3EL7A 4F65A 1YXVA 2C4GA 4I4FA 3SHEA 4MUQA 3TDVA 5LMKC 2ITUA 3IGGA 4DFBA 1L3RE 4ANQA 2JDOA 5J5SA 3EFLA 3ORTA 1IG1A 3F9NA 3OW4A 3WZJA 3LFEA 2P3GX 3V51A 4QO9A 2W1GA 4RJ8A 2ITTA 3ITZA 4QP1A 3GCPA 4U79A 4WG5A 5BVKA 4EZ3A 4AW2A 4DH5A 5M44A 1UNHA 2I40A 5DRBA 5E8UA 4EOOA 2Z2WA 3HMIA 5EI2A 4C33A 3R83A 3MH1A 4K77A 4JAIA 2XF0A 4I6BA 3OMVA 5A14A 5BMMA 4RIOA 2I0EA 2BIKB 2P55A 4LRJA 5CSHA 2RL5A 4FKTA 4MVFA 3KN5A 4PDYA 4X6RA 3NUPA 2QLQA 3PP0A 2XM9A 3ZC5A 4FZAB 4OT5A 4X2JA 4M3QA 4DEHA 4H1JA 4EOMA 4XOYA 4AA5A 4OTRA 4D1SA 4GFGA 3B8QA 4AOTA 5C4LA 2IW6A 3PSCA 5E8VA 3QTXA 5AWMA 4I5CA 3BQRA 3HL7A 2W5AA 3GCQA 4XBUA 3MFRA 4NKSA 3RPSA 4DINA 2Y4IC 4HVGA 4CEGA 5DT4A 4K2RA 4LUDA 4ZSJA 1Q97A 3HVCA 4O21A 1XH6A 4FICA 1YXXA 3QWJA 1ZOHA 4QTBA 2OIDA 3R9OA 5AAGA 3UNKA 1GZKA 3AC8A 1ZZ2A 2X7GA 3KL8A 4GG7A 3CD3A 5EK7A 2ITZA 3UZTA 4NYEA 1ZY5A 1PYXA 2QI8A 4MQ2A 5HVYA 3G90X 4AN2A 3T3UA 3FV8A 5L8JA 5C8KA 1OPLA 3E8NA 5LVPA 2C0IA 4YURA 5KZIA 1H1RA 2CLQA 4L3PA 3RGFA 2AUHA 3DBEA 4AA4A 3PLSA 4I0RA 4FZ7A 4BDHA 4ZSAA 3QTZA 5DR6A 3ZM9A 5JGAA 1NVQA 4IM3A 3UDBA 3ZS5A 3KVXA 4IBMA 3ENHA 1XQZA 4IVBA 4Y83A 4E6CA 1IAJA 5GINE 4JG8A 2HZIA 4CKRA 3MYGA 2OSCA 4DDGA 4O0SA 3BU3A 3C4EA 3CEKA 4CFMA 4FV1A 4P2KA 2J0IA 2GQSA 5BYLA 4BTFA 1CMKE 2WOTA 4Z9LA 5IQEA 2VTRA 4NM0A 3LFNA 4A9UA 3N4TA 3G15A 3VF9A 3KF7A 2XKCA 4I5HA 4QT1A 1XR1A 2BR1A 4JR7A 2XK3A 3K54A 5AP0A 2YACA 3ORZA 2PZPA 1M7QA 2ZV2A 4P5ZA 4BIDA 5CEKA 4M68A 3UO6A 3QKMA 4DEDA 4AZEA 2VGOA 1FGIA 3NSZA 2X4ZA 4IMYA 4FKIA 3W2CA 3ZZWA 2PZYA 4BKJA 2B4SB 3DY7A 3UOHA 3C5IA 4YO4A 3OBGA 3GNIB 4XG2A 2XZSA 1ZARA 5CU3A 3HECA 3WZEA 4DG2E 4WT6A 3KRWA 1XH7A 2CNQA 2PMLX 4ZMEA 2OF2A 3W33A 3LMGA 5IA4A 4K33A 2ETKA 3ODZX 4YZCA 4O7RA 3DBFA 2X7OA 4L45A 2X8EA 4LRMA 1Y6AA 2IVTA 4IAYA 3DB8A 3FZRA 3R1NA 3ULIA 2W1IA 4BDFA 4XG9A 4EQCA 3EJ1A 5EFQA 4WNOA 5HZNA 4XV9A 2GNHA 1G8SA 3EQPA 5FG8A 2H9VA 1M52A 3HV7A 3PZEA 4U0IA 3D14A 4CMUA 3W10A 2W96B 3Q9WA 4FX3A 3S00A 4D5HA 2NP8A 1P4OA 4ZJJA 4G2FA 4F9WA 4GJ3A 1Q41A 2NO3A 4UV0A 4AOIA 3LCTA 3LFAA 2E9PA 4F9CA 4AW0A 2JGZA 5LQFA 2XJ2A 4C35A 4LFIA 4RWJA 1OIYA 4GG5A 5DT3A 3QC4A 3SXSA 2PMNX 2BAKA 2XIZA 3OCSA 4TYJA 4MD7E 1GY3A 2ZV9A 2C6TA 2GTMA 4FOCA 5ANGA 5H2UA 4QDEA 3DT1A 3IDPA 1H4LA 4U45A 4L3LA 3VVHA 3V5WA 3G5DA 3KXMA 4IM0A 5A54A 4V0GB 5HBJA 1OPKA 2B1PA 3KGAA 3FL4A 5B7VA 3AC5A 4JG7A 5CENA 1W8CA 3QZFA 4JI9A 4BGHA 4CFNA 4RFZA 3P23A 4IADA 4BHNA 4BDDA 3C0HA 5DLSA 3KULB 5KMLA 1RJBA 3E64A 4HVDA 4MQ1A 4OTFA 3JR1A 5AUTA 3O96A 2GTNA 4I23A 4ANLA 2ZM4A 4RZVA 5CVGA 4DAWA 4U97A 1X8BA 1J91A 3E92A 2YM6A 4Y46A 3PE1A 2J0MB 1JBPE 2G1TA 3VS4A 3W32A 3W0OA 3EOCA 4EQMA 2FGIA 1PXOA 3EQFA 4D4RA 2NRUA 5J9LA 4XLVA 3VF8A 3ORLA 4QP7A 4O7YA 3R8UA 1U54B 4DFXE 1CKIA 4ANSA 2W1HA 2WOUA 4BDIA 4TKSA 5CEOA 1NVSA 1P4FA 5D11A 2XB7A 3LLTA 3W2PA 5KBQA 3U4UA 3I1AA 3LIJA 3MB7A 4DC2A 4I92A 4FTIA 2GNLA 4IE9A 2WMTA 3EN5A 3IQ7A 1Q8WA 4JQ8A 3TJDA 4D28A 3V8WA 1YWVA 3HUCA 5A4TA 1CKJA 1TVOA 3BV3A 2BAQA 2BROA 2BMCA 3AD6A 4XCUA 5AUWA 4HGTA 5L6OA 3TTJA 3FMMA 4FTMA 5EHYA 4FSZA 4ZSGA 4EOQA 3CKXA 3D0EA 2BTRA 4K0YA 3UG1A 1OPJA 3D9VA 1QPEA 4CGAA 2OWBA 3RAKA 3BU6A 3VJNA 4FIJA 4EH9A 3H0ZA 4UYAA 2IZRA 1H07A 2HW6A 4WBOA 3OXTA 1OM1A 2XP2A 3V5JA 4GFOA 3OT3A 3QRKA 4X3FC 5LOHA 3POZA 3R8LA 2HZ4A 4DH7A 2X6DA 3DGKA 2UZOA 5IF1A 2XM8A 3FYJX 4AE6A 2CKQA 4F1MA 3S3IA 2UZUE 4RGJA 3FSFA 5BUIA 4LMNA 3VQUA 3TV4A 4CV9A 4DHZA 4TWOA 1CSNA 2XH5A 1IAHA 3ZTXA 1OKVA 5FEDA 3SRVA 4AXFA 2YAKA 4C2WA 4NZWB 3UDSA 5A4EA 2C5YA 3TUBA 3IW8A 4IHPA 3ZOSA 3LMIA 2R4BA 2Y6OA 2OG8A 5CAPA 1ZOEA 5CNNA 1YXTA 3FMKA 3PY0A 3TUDA 3IKAA 3LAUA 2WB8A 4U80A 5M09A 4ZLOA 3DZQA 4ZMFA 1GZOA 4FODA 4NJDA 1F3MC 5KBRA 3KRRA 4X2FA 3CTQA 3SQQA 4AG8A 3KXZA 2BTSA 1JPAA 1O6KA 1ZAOA 4GK3A 3TNIA 4RC2A 2HENA 3RALA 1VZOA 3ZSGA 4ZZOA 1OIUA 5CU4A 2EVAA 3H9FA 3Q4TA 3Q53A 1T46A 2R3KA 2UZWE 3VUKA 3EQHA 3NCZA 3FKNA 4RA5A 4DE4A 3GQLA 3GU8A 4O82A 3PP1A 2OU7A 3EYHA 3WF5A 2RFNA 3C7QA 2QOLA 3G2FA 4W8EA 4FGRA 4OTIA 2PVFA 2X4FA 1ST0A 3HV5A 4N57A 3BYVA 4RIXA 4FC0A 4C3FA 3U6JA 3VC4A 3TUCA 2X0GA 3MH2A 4XV1A 1KV1A 4ASZA 3W2SA 4EOIA 2PYWA 5ANKA 2OW3A 4FEQA 4YSMA 5KKRC 5DEWA 1A06A 1S9IA 1PXIA 4O22A 2DWBA 2VTTA 3TT0A 1PF8A 3O17A 5JFWA 3DBQA 3HZTA 1PXNA 2JBOA 1FVVA 2OXYA 3VBTA 4O7LA 4JDJA 3ET7A 3LXPA 4JAJA 4C62A 3R73A 4RZWA 4PDPA 3UIXA 2UZDA 1G5SA 5IH5A 2FH9A 4NTTA 1XH8A 1YWNA 3THBA 4OT6A 3PXZA 1HOWA 2WQOA 3QHWA 4JX7A 3UC4A 5KHWA 4FSUA 5FP5A 3MS9A 3NW6A 4NH1A 4A9RA 2Y7JA 3MB6A 3JVSA 3PJ1A 1JSVA 4L43A 3ROCA 3MFTA 4L52A 1IRKA 3QYZA 1BL6A 5IQGA 3F2RA 3E93A 1SVEA 2Y4PA 3RHXA 1Y8YA 4ITIA 2CCHA 3FHIA 3QKKA 4F9YA 2IVVA 4FV3A 3H0YA 4H36A 4DTBA 5JT2A 2J4ZA 4R5SA 4TNDA 1YI6A 4IM2A 5J9ZA 1H0VA 3RM6A 1MUOA 5AV2A 5K4IA 3CLYA 2G9XA 2QKWB 2YABA 2GQGA 1K9AA 3A62A 3CCNA 3OXZA 4I22A 3R8MA 4FG9A 4Z16A 2A0CX 3QL8A 1UKHA 3FMDA 3FZTA 3IW5A 4IZ7A 4U43A 4RJ4A 5G6VA 5D9HA 3R0TA 3RWPA 1R3CA 3CBLA 3TNPC 3DA6A 3OT8A 3CS9A 2E9NA 2Z7RA 1YHSA 3KK9A 4TY1A 4U9AA 4FV2A 4USFA 3F61A 1ATPE 2UW4A 4H3PA 4D0XA 2H34A 2W5HA 2E9OA 1Q8TA 1KOAA 4GUBA 1Z9XA 4RJ5A 4JXFA 4G3DA 5K9IA 2HWOA 4RC4A 5IA5A 2VWUA 4X21A 2B9JA 4XV2A 5EYMA 1OKZA 4QMVA 3SV0A 3TV7A 3QGWA 3UE4A 2I0HA 3P7AA 4FKQA 4TPTA 4UEUA 2CN5A 5ANEA 2C5OA 2Z60A 4GIHA 1WBTA 4AXCA 1OL7A 4P4CA 4AGWA 3BRBA 3EN9A 3UVRA 2ESMA 4AW1A 4PDSA 4F09A 4FVPA 1J1CA 3RI1A 1TQPA 1ZRZA 4CRLA 3LQ8A 3LPBA 5AX3A 4FKPA 3TTIA 3VS5A 1PXLA 2GS7A 1ZYDA 5HNBA 2UW7A 3PDTA 5E9EA 4IVDA 4FKGA 3OF0A 5T6KA 4KRDA 1KE9A 2XK8A 3E88A 4EUUA 2QOIA 2GSFA 2YAAA 4AZSA 1PMEA 3MJ2A 4YJPA 2B53A 1OL5A 5D7AA 3C9WA 4C0TA 4RVMA 5AAEA 5JQ8A 2JD5A 4W4YA 4FV7A 4G3CA 3AC3A 3IECA 2ITWA 4L42A 1OKWA 3AKKA 3IPHA 4O7SA 3O8UA 3LVPA 5I9WA 5AUZA 2C30A 3UVPA 3G6GA 5D10A 2B52A 3TKUA 3NYXA 2QOQA 3Q96A 2HAKA 5CTPA 1OZ1A 4M97A 4FK6A 4GV1A 5GJGA 2HW7A 4MHAA 4XP2A 4O91A 4JX3A 4GUEA 1UU9A 1FVTA 5FGKA 5H8EA 4U3ZA 1XH9A 1IA8A 5HG5A 3A8WA 3TYKA 1R78A 1ZYJA 3ZLXA 3SVVA 1W7HA 4YZDA 4C3PA 3ZBXA 3MFSA 4YP8A 3DJ7A 3OEFX 3QQHA 4DLIA 4IB0A 5M07A 4F08A 4F7JA 4BTJA 3EFJA 3MA3A 4LV7A 4DA5A 5A46A 4ANMA 4M69B 1K2PA 4JQEA 4RJ3A 3TXOA 2Q83A 3MH0A 4FK3A 5L2IA 3RPVA 3OVVA 1M17A 4BCIA 2VU3A 5ANJA 3VQHA 4BZOA 5FBNC 4A9TA 1H27A 1BUHA 4YNEA 4C58A 5F4NA 4LOQA 5E8TA 5KUPA 3NCGA 3FSKA 4CLIA 4F99A 4EWHA 2GPHA 5LCJA 4CT2A 3RZBA 4ZTLA 5IMEA 5DYJA 1W0XC 3OWPA 4WRSA 4BCFA 5D7VA 2WTWA 3NDMA 3OD6X 3DNDA 4Q2AA 2X1NA 4QYYA 2GDOA 2XNMA 3Q4ZA 3NLBA 4FTLA 1H1QA 4O0YA 4YR8A 3R1SA 4BBEA 3M11A 5M53A 1PW2A 1UNLA 5DNRA 3D94A 2PE0A 4EC8A 2UZTA 1W83A 2PPQA 3FDNA 1Y57A 4O7NA 3ZO2A 4CFWA 5A4CA 4N6ZA 4XP3A 4O83A 2HWPA 4MX9A 4OTWA 4I41A 3TI1A 4A9YA 5KX8A 3G0FA 3NUAA 3NNWA 3PG3A 1PMVA 4FV6A 4F6SA 4OBOA 2XA4A 3QC9A 2VV9A 5FEEA 3H3CA 4CQEA 4FT3A 5IMXA 5CSXA 4PNIA 3B2WA 3COHA 4S34A 4M12A 4FT7A 2J50A 3R9RA 1R1WA 4GL9A 5IA0A 2I1MA 3I5ZA 3MPTA 4YLLA 3DKFA 4ZP5A 4YPSA 5AUUA 3HRFA 4IWDA 2YDKA 4QYHA 5CS6A 5FBOA 5TT7A 3FQEA 3EH9A 3RJCA 3CQUA 4L7SA 3AT3A 3QQLA 4UWYA 3FMJA 2OJIA 2UW5A 4BGGA 3KRJA 3I6UA 2VTIA 2W99B 4K18A 3RWQA 1SZMA 1XKKA 2Z7LA 2G01A 3C4CA 3PE2A 4GMYA 4FTQA 3HRBA 1NVRA 3QUDA 5HIDA 2P4IA 2CGUA 5FRIA 3QCSA 2WGJA 2Z02A 4UALA 4YTCA 3BKBA 3TZ8A 4FBXA 4BCHA 1KOBA 2X39A 3E7OA 3TNWA 4F7NA 4ORKA 1PXKA 3A8XA 2IZTA 4PQNA 1J7LA 4OGRA 4TWCA 4FTCA 3ALNA 3ML1A 1XO2B 4XG8A 3ORPA 3EHAA 4BIEA 3I7BA 5CZIA 3R7VA 3NIZA 2VNYA 3OY1A 3P78A 4EJ7A 4KRCA 3MIAA 3QYWA 4GS6A 5HE2A 4CD0A 3W8QA 3JY0A 3QAME 2UUEA 3E62A 3O8PA 1BI7A 1RQQA 1FINA 1FBNA 2O63A 3FE3A 5AV0A 3IW7A 5JQ5A 2RF9A 3COKA 4YPDA 1JOWB 2HOGA 3KULA 3R2BA 1DS5A 4RWKA 2QOKA 3Q32A 2WTKB 4FR4A 2O65A 3C0IA 3OUNB 1G3NA 3SG9A 3DS6A 5AADA 3UNZA 2H6DA 1ZWSA 3LJ2A 5LARA 3KC3A 3HMNA 3QHRA 2QC6A 4XRJA 2GQRA 4WUNA 3PA3A 3BBTB 4KBAA 3RMFA 5J9YA 4G3FA 2WAJA 4QMMA 5GIPE 3N51A 2OZOA 2R3JA 1QL6A 3EFWA 2XAOA 4RWLA 4BYJA 2JKMA 2OJFE 1U54A 4O2ZA 3GCVA 4D0WA 3MESA 4M7IA 1KSWA 3CY3A 4EK3A 3MTLA 2YEXA 2X2MA 2ZAZA 4DH1A 1U4DA 1ZYCA 2OH0E 2C0OA 4HCTA 4M14A 3O71A 3BQCA 4RJ7A 2OF4A 4GVJA 2PZ5A 2ZB1A 1BKXA 2WO6A 4EUTA 1SM2A 3QTIA 3Q2JA 5J8IA 4EHVA 5E8XA 2VUWA 2WXVA 3AC2A 3BYUA 3ACKA 3DV3A 2C5VA 3OWJA 3VS7A 1OECA 1OGYA 2R3FA 5HLNA 4FKRA 4QMYA 4PP9A 3O50A 2F2CB 4ARKA 2JDVA 2XCKA 2HELA 4GKHA 2JIIA 2O2UA 1PYEA 4QMNA 3AC1A 5EKOA 3PSBA 4FKOA 4RX9A 3DJ5A 3ZUUA 4EZ5A 2GHMA 2QOOA