5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
3VF8A 2XUUA 5LQNA 4R6WA 2Q0NA 2R3NA 3BRBA 1KR5A 5BVNA 2XYQA 3TNPC 3TIZA 5D7AA 3DP7A 1R3CA 5BYZA 3QA0A 2I6GA 3S0OA 5AV2A 4HCTA 1SVHA 2C0TA 3FPQA 3HGKA 4FX3A 4YNEA 3SSMA 2EFJA 2GHGA 1P39A 3KQMA 4QOXA 4QMLA 2VTQA 2GLUA 2EJTA 1KE5A 3OCGA 4FV9A 4RA4A 3LFBA 4UWCA 4MXXA 4U43A 1PRYA 2IP2A 1RJFA 3IYLW 3UP7A 4M37A 4J98A 2V55A 3SSOA 2W1IA 1IEPA 2QR7A 3PTAA 2E9VA 3MESA 1URWA 2HCKA 2XNOA 3EQPA 4KABA 3Q4UA 4RX9A 3OXTA 3FC2A 2H6DA 5FQOA 4ZLOA 5DVRA 5BNJA 3FUVA 2PZYA 5HX6A 5K5XA 3EFJA 4YU2A 3UQCA 5FADA 4BTKA 3TV4A 3E23A 3RTPA 4KIFA 2Q0BA 5EH0A 2R3LA 5JRSA 4XX9A 1FVRA 5HO7A 5A46A 2WEIA 2PU8A 2WMBA 3ORKA 5GWXA 4AS0A 3LFFA 5IH5A 4I4FA 3VBYA 4FIFA 4AZSA 5A9UA 3TUDA 2EXMA 3OWKA 5E9JA 2PKWA 3WZDA 4Y8DA 2HY0A 4S31A 5ERGB 3G8BA 5KMMA 4N70A 4E73A 2PY3A 4KBCA 3R21A 1XDUA 2OJIA 2JKOA 4GOND 4UEUA 3QYWA 3RAWA 2RF9A 4RTOA 4NT4A 5E90A 3GT8A 4M7IA 2G2FA 3KU1A 3B2TA 3OZRA 4YZNA 3KR9A 3DZOA 5EW3A 5E8XA 1J7UA 1F0QA 1P5EA 3DFAA 3G88A 4UALA 2WOUA 4FZVA 1R1WA 3FEGA 4WVLA 4FOCA 4GFOA 2BFXA 5FTQA 3FY2A 4UYNA 3E88A 5CU3A 2CWWA 4KWPA 2JKQA 2X4ZA 3TQSA 3VUMA 2JDSA 2WZJA 4EOIA 5FUTA 3EL7A 2YZLA 3FBVA 1VIDA 4R3RA 3NVKI 3DXNA 2VWWA 2RG6A 4EKIA 4BHZA 4FNWA 4FV1A 3LCCA 3IGGA 4I22A 1IRKA 5A4CA 2P55A 4PV0A 3RHKA 2GSFA 3RMFA 3ZRLA 2RIOA 2WK1A 3BUSA 3E64A 2E9UA 2GAFA 2QU5A 4QMWA 1ZAOA 4ONAA 2NRYA 2I6LA 4YJRA 2I7QA 3A7DA 2VD5A 4ZTSA 4H1MA 1W83A 1X1BA 3NYVA 3KR1A 1JWHA 3E3PA 5IQFA 2ZV2A 3UVRA 2P3LA 1Q61A 2QG5A 3RK5A 1MP8A 3UE4A 1T43A 3KCFA 2XS0A 4PRJA 5I9UA 3NVMB 1Q8UA 4D0XA 2R6ZA 4D1SA 2QHMA 4M13A 4D4SA 1Z9XA 4IM0A 3NWWA 4F08A 3TKHA 5EKOA 4QMXA 3SX9A 3DKCA 2PZIA 3R28A 4E2YA 3MFTA 3KEXA 1YHVA 1M6YA 5CXHA 4FICA 3MDYA 3UMXA 3B8QA 2W7XA 5M08A 2ETKA 5L2SA 3BPRA 2BAKA 2AVNA 3VBTA 2QKWB 4DN5A 4IH8A 3HCBA 3D5XA 1SZMA 2B54A 2JIIA 3U87A 1LR4A 3OBJA 5CANA 4YJSA 3LMGA 3P97A 2BPMA 4DEIA 4OTIA 2R0UA 1XR1A 1PW2A 2GS6A 5K3YA 4C08A 4EOKA 3LMHA 5KKRB 3T7SA 3FQEA 5KHXA 4OTWA 4QP4A 3KMWA 4D4VA 2X2MA 4JX3A 4LL0A 3DGKA 3MCZA 4PL4A 4EZ3A 3BBTB 3LBYA 3EYHA 4W4YA 4EQMA 1H27A 4W4VA 2FUMA 3R9HA 2WMVA 1QANA 3RPYA 2PZPA 5KNJA 2R4BA 4X7QA 2XCHA 1M2RA 2VTRA 5EG3A 4RFYA 3ZZEA 5EYDA 3KC3A 2OZVA 2PT6A 2XK6A 4CCUA 4ATNA 4QP2A 1PMEA 2OXDA 3KRJA 3FUWA 5EM8A 3HV5A 1GY3A 1WVYA 2HENA 2UYCA 2AOUB 3TZ9A 3ZZWA 4USDA 1WFCA 4IDTA 3PDTA 4QYYA 2XVDA 5LVPA 2PVHA 1A9UA 5AV4A 2R3IA 2P7HA 1UU9A 4K6ZA 3CKWA 4M14A 4RWKA 3OWJA 5IA3A 5CVGA 4ACHA 4EOLA 3V8WA 3QCSA 1JBPE 5M4CA 5HD4A 2GNGA 2VS1A 4E70A 2BDJA 4C03A 2OIDA 2VX3A 4YTFA 1KYWA 4O6LA 3D94A 2WTDA 1FMKA 3HAVA 4K18A 2J0JA 4JR3A 3KFAA 5A54A 3FKLA 4I23A 1WBTA 3FTDA 5DYJA 4IQ6A 5C0OE 3GRYA 2C30A 4M67A 5I9XA 1YRPA 4EJ7A 3NS9A 3C51A 5EVJA 1NE2A 2CMHA 3G33A 3PVWA 3M6XA 5E9WA 4IVAA 5DG5A 5GJFA 3LAUA 4QPSA 1NW6A 4XBRA 3M2WA 2VTJA 4CG9A 2XNEA 3L9NA 4UZDA 4RTJA 4FT9A 2O8YA 4BZDA 3R9XB 2GQRA 5LSAA 4WNPA 3TKIA 3BE2A 3G2MA 2OZAA 3I5ZA 4DGGA 1OB3A 1SMHA 1T45A 4HH4A 5C9CA 4G31A 5JFXA 3MIAA 2GS9A 4HGYA 1YFJA 1KP9A 4CXMA 2REIA 2WQBA 4UWYA 5LQUA 5CT0A 5EDQA 3X0DA 1R74A 3W18A 4FZ7A 5BUIA 1KE9A 2I0VA 3TM4A 5LARA 1PXKA 4O29A 4BDEA 4TTHB 1YB2A 4BCFA 3OU7A 2FGIA 2PUUA 4EHGA 3NLBA 3H0ZA 4P5ZA 4KRCA 3GO4A 3DOUA 2WGJA 3VQHA 4JDIA 3M1SA 3G90X 5CF6A 4PYKA 2XYRA 3CBGA 1QPCA 3DXXA 4KIPA 2JIUA 4W8EA 2WKMA 4PF4A 4GV1A 3BI6A 2NP8A 3R22A 4EK3A 2XEZA 4IX3A 4XG9A 3ZCLA 4CTJA 4FKOA 5D1JA 1MRUA 3QD2B 2W5BA 3OROA 3U8WA 2PZRA 2NPQA 2VGOA 3EN7A 4USFA 1G5SA 3ITZA 3Q5ZA 3OCBA 2CL5A 3PPKA 2JFMA 4E33A 3D2IA 4XP3A 5DI1A 3UZTA 3HA6A 4HCVA 3HYHA 3VS4A 2P3OA 3F3TA 1ATPE 5HHWA 5HORA 2J0IA 3MI9A 3PJ3A 3FLZA 5CNOA 3E8EA 5E8TA 3T8OA 3Q96A 1O54A 5FXRA 5TOZA 5IQBA 1G55A 4NWMA 5EHLA 4JL9A 1RI2A 4DQ0A 1L8TA 3MA3A 3ZEWA 3KVWA 1PXIA 5CENA 3Q9XA 2WB8A 4EH2A 1JG4A 5AJQA 4P58A 4IAFA 4S32A 3LJ1A 4IZ7A 5EKXA 3C9WA 2X7GA 1XVAA 4IKPA 4L01A 3TCPA 3TZMA 4EBWA 4A07A 2J90A 2PVYA 3D0EA 4FMQA 3SOCA 2UZNA 3EQGA 3QCYA 3P9NA 3SX0A 2ZIGA 5C8NA 2FB8A 4IB5A 2WU7A 3HMPA 5CSWA 4X63A 2BZJA 2OICA 5LCJA 2IO6A 3GRZA 5JUWA 3CIKA 1WXXA 4M8TA 5HE2A 2Z8CA 2HWKA 3ZBXA 5AP5A 2X7OA 4AZVA 2UVYA 1RI1A 2NO3A 4RX7A 2VO3A 4YZDA 4YJUA 2QRVA 5F2KA 2I62A 3PTGA 1R0PA 2RFDA 4IVDA 4NL0A 3E8CA 4QTCA 2ITPA 1MUOA 2C1AA 4AGWA 4CKRA 1DM2A 3KL8A 2PXAA 4I1ZA 4Q9ZA 3A27A 4UXQA 2C7OA 4M97A 2JEDA 3E05A 3SG8A 5JH6A 2VNWA 4G9RA 1CDKA 3UC4A 4ITJA 4ZZMA 4XUCA 4IBMA 3I60A 4RWIA 2Z7LA 1PKGA 3RK9A 1NW1A 2HZIA 3UTOA 3Q9ZA 1BI7A 4NKSA 3CY3A 3LVPA 2PXCA 4BGGA 3CP9A 3OS3A 4O0UA 2AOTA 5AIKA 4EI4A 3QCXA 4X1OA 4E5AX 4X60A 4JJRA 4PL5A 4RZWA 1RW8A 4KIQA 4YUZA 3R9NA 1OKWA 1H08A 3HV7A 3VS5A 1YXXA 3BGVA 3QD4A 1ZOGA 3GRUA 4FIGA 4POOA 5A4QA 3A7IA 3F82A 3Q4ZA 4JDJA 4XH6A 2OY0A 5HZMA 3LCDA 1H0WA 4O96A 3BV2A 2FSLX 5TO8A 5HLNA 5FTGA 3L9LA 1IA8A 4FKSA 5HZNA 3UBTA 3P4KA 4HC4A 3REPA 3L8SA 4ACMA 4BN1A 4QYEA 4ORKA 1A48A 2O63A 3G89A 4HNFA 2BZHB 3DU8A 3HMMA 4LRJA 3HZTA 2YR0A 3QLFA 3FLYA 2P1DA 3LCSA 3FMHA 4HGZA 3W10A 1VP9A 4DFLA 2QOHA 3VS0A 3MH1A 4OUCA 4DT9A 3DBDA 3ZC6A 4ISCA 1RDQE 4XV2A 3E7VA 4JI9A 5A6NA 3UPZA 4L52A 3UYSA 3WARA 5H3QA 3SW4A 3B5IA 5BVWA 2P3QA 4XG2A 4UX9A 1FGKA 1PMNA 4IX4A 4BDHA 1UU7A 3QTQA 1FP2A 4MVFA 1P91A 3MCTA 5DR2A 1AGWA 5M5BA 4AG8A 4ZK5A 3FI3A 5LJJA 5CVDA 4DCAA 5HU3A 2UVZA 5ANDA 4FTUA 4AGCA 2H96A 4AZTA 4B99A 3JYAA 3WF9A 4GFMA 4H58A 4PUZA 4A9TA 2ONZA 5ITAA 4P4CA 3HP5A 3AMYA 4WRSA 3LBFA 4M38A 3LFEA 2JKKA 3W16A 4GFGA 2A14A 1KPIA 1OUYA 3OTVA 2W05A 3F69A 2HW7A 2V0DA 5F2NA 3C5IA 4M0ZA 1H28A 3R7OA 5FTOA 2XJ0A 5K01A 2ITUA 5TKDA 5M51A 3UJ8A 4MH7A 4DEHA 2JAMA 4L44A 4MKCA 5FDPA 4C3FA 2QR8A 4L7FA 1EJ0A 3GP0A 3IEIA 4BCIA 3FRIA 2VDUE 4W8DA 5JK3A 4BGHA 2HY81 2UYOA 3V04A 4KD1A 4ZZOA 5EFQA 5BMSA 4FKQA 4PP7A 2ONLC 2VAGA 3AGMA 3A4TA 3DXQA 4GC5A 4FV8A 4I3ZA 5T64A 4MD7E 3RI1A 3C4EA 2ZULA 5AV0A 1U54B 3FMJA 1YFLA 4EYJA 4XOZA 1XO2B 4ACCA 5HVKA 2ITTA 5HCXA 1I9GA 3VHEA 3DBEA 3HV6A 4YHJA 4UZHA 4CGAA 4O7NA 4D5HA 2E9PA 2J51A 5HI2A 3HMNA 4EVIA 5E8YA 3T3UA 5LMKC 4BHNA 4QTDA 5L6OA 5FM3A 2WMQA 5C1IA 1Q8TA 1JTFA 3KR2A 5KS2A 3FUUA 2IZTA 3DH0A 2ZVJA 5LQJA 5M4FA 2B52A 4D28A 3VNTA 3R63A 3PXKA 4ZS4A 5ICFA 1CM8A 4U80A 3IW4A 3OT8A 4E32A 3I4BA 4D1XA 1YXUA 1UFKA 3T7RA 3UA3A 4HVSA 5CEIA 4AF3A 3O7WA 3F3ZA 4M36A 4DHFA 2QODA 1KUTA 4XCUA 4MD9E 1QAQA 2ZZNA 4DH1A 2XNBA 4GCJA 4GEKA 3BGQA 3OW3A 1TKIA 4EZ5A 3MV5A 3KULA 3KXXA 5HCYA 3C5UA 3DXPA 3FAAA 4CKJA 4DEBA 4RLLA 5IH6A 5CAUA 5D10A 2W99B 3V8VA 3EEYA 3FZSA 4QPNA 2AC5A 3SRVA 3LFNA 3MTEA 2BTRA 2BM9A 3UODA 3QXOA 4DKJA 5M06A 3HUCA 1P4FA 3IONA 1QAOA 4O22A 5HGIA 5DRTA 2PVMA 4F4PA 4A9UA 5J1WA 4Z16A 3RIEA 4LV5A 4CG8A 2YAAA 4AOTA 5K4IA 3DY7A 3PFGA 1YKRA 3PPZA 2A2AA 3HV4A 3I64A 4Y85A 2A0CX 3G6HA 3AT2A 2B1PA 3ULZA 2VU3A 4GMYA 2WQNA 3UBDA 4BBMA 4E4NA 5EW9A 1B6CB 5FEDA 3OF0A 5HBEA 4DF3A 1KOBA 4QMMA 2CKQA 5CVHA 1Q0TA 5EG5A 3QTSA 4GS6A 2PXXA 4AX8A 2W4OA 5DRYA 1ORIA 4EOJA 2JC6A 3V3VA 4CRSA 3RPOA 4DFUA 2VWYA 2WMAA 3T9TA 2GNJA 4FTQA 2CGUA 1UIRA 2X6EA 5AV3A 4ASDA 2C7PA 4ALUA 2OFVA 4D58A 4FG7A 3NIZA 1TQIA 2CKDA 3SDJA 1ZG3A 4FTNA 3A25A 4GG5A 4CNHA 2WMUA 2OJJA 4NH1A 5HG8A 4QMUA 3ZMMA 1V0BA 5DXJA 5DOSA 3GB2A 4BCJA 2PZ5A 4GIHA 3GVUA 4IEBA 1GZ8A 5FWAA 3HMOA 1X1DA 3BHYA 3LECA 4EC8A 4FG9A 2PUNA 5EHOA 2J5EA 3SXFA 2XK8A 1JSUA 1MQBA 1SQGA 1W84A 2OSCA 5DPVA 3RPVA 1KE6A 3HVHA 4E20A 4DEDA 3AC5A 4MWZA 2W9FB 2AN4A 3EQCA 3EGIA 1PXOA 4PIMA 1J7IA 5KKRC 3VRYA 3W2CA 4Y2HA 2GFCA 5FEEA 3UQFA 2BDWA 2IWIA 4II5A 5EKUA 3DLZA 1WS6A 2R2PA 1P2AA 5L2TA 2JAVA 4PGGA 3Q32A 4DGNA 5LQCA 3AJDA 1REJA 3TNIA 1WVWA 4OBWA 3EVBA 4TY1A 5CWZA 4G5JA 4L8MA 1H1SA 4NZWB 3FPEA 4OBQA 5CVUA 5AUTA 1Q24A 2J7TA 4ANSA 2A1AB 1DI8A 3O8TA 4IZYA 4N4SA 5DEYA 4S33A 3EB0A 2XKFA 3KY2A 5L2IA 3RNIA 2R3JA 5CIYA 1K3AA 2X2LA 3ALOA 3FY0A 2OLCA 3FJQE 5HE1A 4MBIA 4GOLD 3LHJA 2OBFA 1VE3A 3H0YA 2JDVA 4X3FC 4PP9A 4O7VA 5EDPA 4C4AA 2CCHA 4IE9A 3UZPA 4FKPA 4LOOA 1JSZA 4EOMA 1KIAA 3NCZA 4U0IA 4FNZA 3UA4A 4BCOA 2OW3A 5K4JA 3KPUA 3GCVA 3VAPA 5DRBA 4C36A 2PUPA 4OTHA 5AM6A 5DT2A 5C26A 3GCQA 3D4QA 4IAAA 4FV2A 5CUQA 1SVEA 5FDXA 4O7LA 4QYHA 3PXQA 4RJ5A 3A2CA 2AN3A 5AP6A 3S1HA 5GINE 1NV8A 4QTEA 5DSTA 4KS7A 4RQVA 5FULA 2JDRA 3A4OX 4S30A 2H11A 3C3YA 3PSCA 3IDCA 3IQ7A 2YEXA 3U6HA 4BI1A 3DJ7A 5IA0A 2PJDA 1NVRA 3W2PA 1NVSA 3MS9A 1GZKA 1VJYA 4Q5EA 5ANKA 1YDSE 2CGWA 2J50A 2CGVA 3QQGA 2YIWA 4F6UA 3SQQA 3V8SA 4ASEA 1E9HA 3QQUA 4FSUA 1JSTA 1BC5A 1RI3A 3LKMA 5ETIA 4LRMA 4MAOA 5KMJA 1OL7A 3ZC5A 3BYSA 4QMYA 4RIYB 4FV3A 4JOAA 3G15A 4YURA 2C6MA 4IB3A 3UJAA 4EKGA 5ETCA 4E2WA 4RJ8A 2IDKA 5EQJB 5HOQA 1BLXA 3MGYA 1NBIA 3VBXA 3SR4A 2GS7A 5F94A 4I5HA 2G1PA 4LOPA 3M33A 2FA2A 2PX4A 1A06A 2QG7A 3HUBA 2BZKB 3FLQA 4HGSA 2ZAZA 3DLIA 3JY0A 4R05A 5EHGA 4LUEA 2GPHA 3NUYA 4FTKA 3FKNA 3OZTA 3PVGA 4OTFA 3NZ0A 5AM7A 2VTAA 1H00A 4F86A 4I21A 1ZGJA 3I7CA 4YC3A 5DIAA 3D15A 2JBOA 4FEVA 3W1FA 5A4TA 3CQWA 3RGFA 4FTRA 4O7ZA 4B7TA 3E92A 3KGAA 3HCAA 4AUKA 3F2RA 5HVJA 3ORIA 4BYIA 5HLWA 4QMOA 3NDMA 4BDGA 3FRHA 3A7HA 4P7EA 4J53A 4BCQA 2G71A 2FK7A 4LOQA 4LG1A 2W5HA 2BZIB 4FSZA 1L3BA 2FH9A 2UZOA 2DPMA 4PMTA 3ELDA 4G1WA 2YA9A 4APPA 4IWNA 1FP1D 2RL5A 3QALE 2Y4PA 4F1MA 4JG6A 2X6DA 4I41A 2FSTX 4TRLA 3ZO1A 1BUHA 5KMOA 4GUBA 3RK7A 2IDJA 4NU1A 4DFZE 4GVAA 2JKMA 4FUYA 4F84A 1PMVA 5HNIX 5M53A 4QPPA 4TN6A 4CQEA 3ODYX 4WG5A 3CCFA 4NW5A 3B3JA 3CKXA 4XG4A 3QYZA 4DG2E 3ACKA 3RZBA 4DCMA 3NIEA 2AUHA 4TWPA 3PXYA 4CCBA 5DTMA 3GDHA 1FQ1B 1X8BA 2YX1A 3FTFA 4FSNA 5CU4A 4XOYA 3GWZA 1ZARA 3FWQA 3FSKA 3VULA 4GU6A 5CVFA 3RCJA 2GNHA 5T6KA 3QWKA 4JNWA 4FKJA 4TWCA 2XK4A 1H07A 4KRDA 2O0UA 4RVLA 2PWLA 3SM3A 2P35A 2Y4IB 3CY2A 3ZBFA 3R6TA 5K0NA 4HTFB 1CSNA 3HRCA 4HSGA 1I09A 2B0QA 3C0GA 3KQSA 4D4RA 4PDPA 1M7QA 2W1EA 3QUEA 5KMLA 4NJDA 3P1AA 4AP7A 3ELYA 2Y6OA 2QOLA 4WG3A 4PCAA 1E1VA 4ZTRA 4LUDA 5CSVA 5I9WA 3Q4TA 3UC3A 4TZRA 3WE4A 4DCEA 4ER6A 3FXWA 2WMXA 4WD5A 3WF5A 4E6DA 3UJGA 3O0GA 3GCSA 3G7UA 3CD8A 2W5AA 4MTLA 1HCKA 3NW9A 2JDTA 4I93A 4HVGA 1OI9A 3MY0A 3PRIA 4D2SA 4GKHA 4K33A 4H0NA 2ZIFA 3ZO3A 4XLIA 1R8XA 4FEQA 1VL5A 1J3HA 3CC8A 3QX2A 4TYIA 4C37A 3VBVA 5E8WA 4DFBA 3S4QA 4TT7A 3OTUA 2PVJA 2R7IA 3OY3A 3P78A 4E8AA 3EH9A 1YI6A 4C2WA 5AUYA 5HTCA 3ZEPA 2ERZE 3NJRA 3A7FA 4U3ZA 4DBNA 5I9YA 2IBTA 4MWIA 1EIZA 4F1TA 3ZXTA 2G15A 4QP6A 1BL7A 1PJKA 2GS2A 5JKGA 4V0GB 3BGIA 4R6XA 4U40A 3BYUA 4MNEA 1OL6A 3QKMA 2C3KA 4RVTA 2YISA 3I5UA 3BLHA 2OK1A 4B4LA 3OCSA 3KXHA 3HVIA 1CKJA 5L6PA 2B25A 3LKDA 3V6RA 4ZIMA 3DA6A 2IFTA 2ITQA 4E4MA 1B39A 3CSVA 4PTCA 3QRIA 2GPYA 3I79A 3GFEA 3M11A 4FKTA 3F5GA 4FVQA 4RIOA 2Q83A 1ZYSA 5DHJA 5IH3A 1Y8CA 2VTNA 1UNHA 1YF3A 4MBJA 5CVJA 3PIZA 3UOLA 2P40A 3QQLA 2IZUA 2UW8A 3E7OA 4H1JA 4JG8A 5HIEA 5H8GA 1W98A 3IW6A 3KMUA 3P7CA 5ANIA 3V5PA 2W9ZB 5EM6A 4PDOA 2YXDA 9MHTA 4ER5A 1NA7A 5E1MA 5HU9A 5M09A 4HYSA 4BKJA 3LCTA 4N57A 2NXNA 3D5VA 3EGEA 3MJ1A 2JH9A 5LWNA 5LVNA 3T9IA 3LXPA 4V01A 3C3PA 2R3MA 3ORXA 3OMVA 4B8MA 3GU6A 4RFMA 3E5AA 1GZNA 4CT2A 4AE6A 2WA1A 4FBXA 1UWHA 3MH3A 2UZLA 4WHZA 2QOOA 3MB6A 5D12A 3WZKA 3NYOA 3KXGA 5DX8A 2QURA 4J99A 1L9KA 2PTKA 3KN6A 2OYRA 1UNGA 1YZHA 2O05A 3ZUTA 1R00A 3KQOA 3SA0A 1MRVA 4NM0A 4BTJA 3IECA 1WY7A 1SYKA 1YXTA 3KKVA 4G3CA 3KK9A 4BDDA 2GCDA 4FE2A 1ZZLA 2IW9A 3BQRA 2ZV9A 3QWJA 4O21A 4U7ZA 4F9WA 3UFBA 4N0SA 4LECA 3I7BA 4YJPA 3L9PA 4YO6A 4DG3E 3SD0A 5ICEA 4F63A 1RI4A 2UZUE 4O84A 1VBFA 4A4OA 1UKHA 3NUUA 3V5JA 1QCFA 3O17A 3QQFA 2XK3A 2VUWA 2VTPA 2ITYA 5DXAA 4FTAA 3PX3A 3ME5A 4BC6A 5A3XA 3JS2A 3SC1A 4E5BA 3PJCA 1KV1A 3UOKA 5LQRA 3NUSA 4DGLC 4P2KA 3WF8A 1KE7A 1DAWA 4X2JA 3TXOA 2X8EA 3O4FA 4RIXA 3FLNC 3UVPA 2VZ6A 2BRBA 2QOCA 3IO7A 5FCDA 3TDWA 3BZBA 3ZONA 3OUKA 2VV9A 7MHTA 3FLSA 3B7PA 5CF5A 2CJMA 3I9FA 4C05A 3DS6A 2UZ4A 4RZVA 2BRHA 3P2IA 4RTLA 4BLUA 4E6CA 2QI8A 3ZOSA 1S9JA 3R83A 3LM5A 4HVHA 2JGZA 5LMAA 3GFWA 2IW6A 4YV1A 4ER0A 2G01A 5ANJA 3AMBA 4IANA 4U81A 4XS2A 3JVRA 3UZRA 3VIDA 2RG5A 2ITOA 2FK8A 4MQ1A 1OKYA 4EUUA 1QZZA 2X9FA 4QQJA 5M55A 3EIDA 1XKKA 1H1DA 1OUKA 4FTMA 3MERA 4KDRA 3JR1A 1JPAA 1KXZA 3C0HA 4HVIA 5HIKA 3DLSA 3ZRMA 2XIKA 1Q8ZA 3O96A 2YJSA 1Q3DA 4K11A 2BRMA 3TZ7A 2WIHA 2GMXA 5J87A 2BFYA 3EVGA 2G2HA 4WRGA 3G5LA 4L42A 4RC3A 3DR5A 4L3LA 4O91A 4H39A 4X6QC 4XV9A 2C68A 2PVLA 1OIYA 2PVKA 2PY6A 4LFIA 4YLJA 3KR0A 5G1XA 3V5WA 2XNNA 4L7VA 4ASZA 1MJFA 1AQ1A 3IDBA 3B89A 5HKMA 2ZM4A 2JHPA 3NYNA 2YQZA 2UVXA 3KRXA 3FZTA 5EDRA 4BCHA 4MXZA 4QP3A 3OWLA 3Q53A 4D5KA 2UW7A 4JS8A 2ZLBA 4RTNA 2XIRA 1ZZ2A 4RYLA 2J0LA 4J8NA 4CMUA 4FL3A 3D14A 2W1DA 4YO4A 2NP6A 3BU6A 3K5VA 2WAJA 2YCSA 3Q5IA 5EC8A 4FNYA 3NW5A 3PWDA 4YBJA 3HP2A 3TWJA 4X2FA 3SVZA 4DLJA 3FL4A 5EMKA 1ZOHA 4JBQA 4QRCA 3VYWA 5BQ0A 3DK7A 2DS1A 5U4XA 3A26A 1NW7A 2QVSE 3UO4A 4YV0A 3K5UA 3JXWA 1WBWA 5E8JA 1FVTA 1PXJA 5CQUA 4BRXA 4ACGA 2QC6A 3NGAA 2UYQA 3R9DA 1WBSA 3SXJA 1M52A 1JKSA 3EL8A 3A7GA 3WZUA 4LWPA 3CPCA 2YIRA 2HWOA 2WO6A 3ZSHA 5AUVA 4BYJA 2PSQA 1TQPA 3Q04A 3UNZA 2CCIA 4MHTA 5I4NA 5EI6A 1WCCA 3PSDA 4YHFA 1JKTA 3RW9A 2JITA 4XEYA 4OTQA 5BVOA 3DV3A 2YXLA 5CXZA 1BOOA 3OEZA 3C6KA 1NKVA 4RSSA 2C5YA 5AMNA 3MJ2A 1Y8GA 2QHNA 4GUAA 4R5SA 4QMSA 4IDVA 2Y7JA 3EFLA 4K1BA 4BBFA 4KINA 4O0XA 1RJEA 1E1XA 4P7KA 3EVCA 4IM2A 3C4WA 4ER7A 4OA8A 4U41A 4DH5A 2XMYA 5HTBA 3UIXA 2IVUA 5DA3A 3HCCA 4OGRA 2CGXA 3SMQA 1VLMA 2GA9A 2W0JA 1M2QA 1STCE 5J7HA 4RVGA 5IG1A 1PXMA 2ZB0A 3AC4A 4XP2A 1Z3CA 3CKKA 3WZEA 4JXFA 3QUDA 5CF4A 4TYJA 2X8DA 5E8RA 2E9NA 4NIFB 2I7CA 4YGAA 3QHRA 5C01A 4Z9LA 2PX5A 2PVCA 1UV5A 3K3IA 3FUXA 4JIKA 1RQQA 5M4UA 4D0WA 2ONYA 3PA4A 1H24A 2C1BA 3U54A 2HYYA 3FZRA 1JG1A 5FBOA 4I5CA 4ZEGA 3PUPA 3QBNA 4U7PB 3Q6WA 3Q2MA 1D2HA 2EG5A 1NY3A 2YERA 2IN6A 4E93A 1VP3A 1G60A 2RKUA 1AV6A 1KOAA 5CTPA 2P2HA 3QKLA 4X2NA 1KPHA 5FQNA 3LE6A 4E30A 4MXAA 2OO3A 4FKUA 5D1NA 3WYXA 4IWQA 4PNIA 2UW9A 5CU6A 4GH2A 5DM0A 1ND4A 2BUJA 4R3CA 4RX1A 2FSOX 3UIMA 3DKFA 5KMNA 4JDHA 2LD4A 2X0GA 1YOLA 3R1YA 4RT7A 4RVMA 4D1ZA 4YSMA 4AT3A 4W4WA 5IU2A 3EN9A 3OXZA 4OA5A 2PV0A 3QRKA 4FZDB 2XBMA 2VWIA 1F3LA 3UIUA 2ITNA 2OJGA 4FA2A 5ANEA 2EJUA 4LYNA 5E1DA 2NRUA 4PIPA 2C6IA 4IHPA 2YZAA 3V8TA 4RJ4A 4YC6A 3FTEA 3P9KA 5HQ0A 4F70A 5KZ0A 4EZ7A 4FNXA 5C03A 4RTSA 1EJ6A 3F6XA 3V5LA 4CLJA 2BCJA 5LMBA 4U9AA 3TKAA 4BCMA 4N6YA 3R3HA 2WQMA 3TJDA 3L1SA 3Q52A 3R1SA 4G3GA 4RJ7A 3PJ8A 3ZH8A 1OPLA 5M56A 3ZLSA 4IJ9A 3E63A 4MEDA 1L1EA 3KF7A 3N9XA 3REOA 5EEGA 2W17A 2ZJWA 3F5PA 1G8AA 2ZMCA 2XYNA 3MPMA 4LI5A 3PE2A 2XCKA 3FI2A 5CEQA 3BBWA 2C6OA 3QXPA 3M70A 1ZKDA 4ZY5A 1M0EA 3S2PA 3BGZA 3IHTA 2I0HA 5EZSA 4I92A 3CQUA 3O50A 4ZP5A 5DT0A 2PX8A 3ZYAA 4KA3A 4NUSA 3IV6A 3AGLA 2WQOA 4TYEA 3TV7A 4HPTE 1ZQ9A 4ANQA 3OP5A 3R7VA 2WTJA 5B2KA 1BL6A 2J2IB 2GQGA 4R6VA 4O6EA 3C13A 4XV1A 5E9EA 1V0PA 4IWPA 2Y1XA 2V22A 3Q7EA 3EMBA 1RJGA 3FE3A 2HMYB 2XB7A 2W1ZA 2O0LA 4LWOA 2OBJA 2AC3A 4YJVA 4M68A 3W2SA 5JQ5A 2YIXA 4O38A 3QTUA 1H01A 4FKVA 3ZM9A 4AZWA 3DPKA 3D7TA 4V04A 4PDSA 4XP0A 3M6WA 4L3JA 4PYLA 2YM4A 4MK0A 4C3RA 3BHTA 4YNOA 2GNLA 4LGHA 3R8MA 3Q60A 5H8EA 4AOJA 4E4LA 5JGBA 4FT0A 2H00A 4O0YA 3DUWA 2Y1WA 2J5FA 4PY1A 3LGAA 4GQBA 3PJ1A 4MHAA 3EOCA 5IA5A 2EVAA 5FWDA 2ZBRA 1OL1A 1B42A 2Y4IC 1W8CA 4RIWB 3P7AA 1JVPP 3UOHA 4NFNA 2G72A 4QMZA 5E1EA 2OH0E 4XG3A 4K2RA 5C8MA 3KCKA 1Q3WA 2OGVA 4UXLA 4KWCA 3TNHA 2VO6A 2OXYA 4IIRA 1GIIA 3BWBA 1MRYA 1G3NA 4MBLA 2BRGA 2BDFA 2C5OA 5EM5A 5F20A 3HA3A 4WXHA 3EZVA 3A99A 4I6QA 4E2ZA 5IA1A 5IZFA 5IH4A 1I44A 3N51A 5EEHA 3AC1A 4PX6A 4CZUA 4YBKA 3BWMA 4J1RA 2VWZA 3QQJA 5H2UA 5HNBA 4P90A 2Z7SA 3MVHA 3WBLA 4I24A 5K0GA 5I0BA 3UZUA 3ELUA 4DTBA 3CJFA 3DB6A 3HRBA 2VWUA 2ONLA 4BICA 3AD5A 4RC2A 5T68A 4F7NA 4FV5A 4F99A 2OO8X 1GAGA 1ZWSA 4YJTA 1YDRE 4JXJA 2EUFB 2PUIA 3WZJA 3BXOA 3GC7A 2UUEA 3BZ3A 1FPQA 3KN5A 2BR3A 3MN3A 3ZHPC 2B9HA 3KPVA 1OIUA 3PIYA 4DEAA 3TG1A 3DXYA 3G51A 5M07A 4L7SA 1RE8A 5AUWA 3PP0A 4H3PA 3EGVA 5IEVA 3PIXA 4FYOA 4FP9A 4CTCA 4C35A 3SKCA 4YMJA 2Z7QA 2QLQA 3E3BX 2E2BA 3K6RA 2R3PA 3PFHA 3RM7A 2OH4A 2PX2A 4ZS0A 3I0QA 2UW0A 1VZOA 1EAMA 2YM6A 3D5UA 1Q8YA 4EKLA 3C50A 5KMIA 3AXWA 3IOPA 5AP0A 4GC9A 3LFQA 2IJMA 2UYHA 5LCKA 3DTWA 3OZ6A 3EEOA 2Z2WA 1Q0SA 3ATSA 5E2AA 1BI8A 5FA8A 3LOKA 2E5WA 3P2EA 3CGFA 4FTIA 2C4GA 2BR4A 3Q87B 5BYYA 4LMNA 2P0CA 1BX6A 3F66A 3DKGA 3QC9A 5A4LA 4AGUA 3H10A 5IDNA 4Y72A 1F3MC 3FKOA 4CZTA 3R0QA 4KBKA 4KB8A 4A9YA 3E8DA 3MTFA 3FPJA 5F1ZA 3EVEA 4Q9SA 4JIAA 4JX7A 1Q4LA 4CV8A 3DAJA 3EVZA 4X3FB 5CF8A 3R2BA 4MXCA 1INLA 3BEAA 1NBHA 1J91A 2W1FA 3R8ZA 2ZW9A 10MHA 2V5QA 5JRQA 4D9TA 2QO2A 2YM7A 2A4LA 3DMGA 3R04A 3LIJA 5GM2A 4R1YA 2GNIA 2ZZMA 2WTKC 1IAHA 3BV3A 3NAXA 3HA8A 4QO9A 4KVZA 3PZEA 3BQCA 4IW0A 2O3PA 2YN8A 3NCGA 3ZUVA 3GBZA 1VYZA 5IQCA 1SVGA 5K0CA 2XF0A 4KKHA 3CEKA 3VWAA 3UJBA 2X4FA 5AP7A 4CTBA 5LQFA 3UMWA 1HCLA 3GU7A 5EK7A 4FIEA 4YC8A 2EB3A 4IAKA 3MTLA 5EPEA 1JQHA 2CPKE 2IH4A 3OU6A 4HZSA 1XBCA 3HVKA 4BP1A 3RPSA 3P71T 3F9NA 4KRGA 3GQLA 4XUDA 3PVCA 3ER8A 4NW6A 4A4XA 3AT4A 3MY1A 2P41A 3TMAA 4G17A 3I53A 2VTLA 4RTPA 4RG0A 1KHHA 2PT9A 4QTUB 3OY1A 3U4UA 3NUAA 5LOHA 3NSZA 4U7TB 4TYHB 4AW1A 3FPGA 4CKCA 4YUWA 2OF4A 1QPEA 3E8NA 2G8NA 4OT6A 1O6LA 3ZSIA 4Y95A 3GEQA 3EQBA 5E1BA 3R71A 3ROYA 4L67A 2VGPA 2W1HA 3F88A 3QC4A 3M4XA 4H36A 4GG7A 3CGGA 2QCSA 3ATTA 4EK4A 4C4IA 3SXRA 4FEXA 5KMKA 4A7CA 3VW6A 5AADA 4WOVA 1W7HA 4EHZA 1OBDA 3TL8A 2C6KA 3FPHA 5LR6A 4DH8A 3CBLA 3F7ZA 1YXVA 3R7IA 3VJNA 3P7BA 5KZIA 3LPMA 4ANLA 2H34A 2P2IA 2F7EE 4L43A 2YM8A 1G38A 2FCAA 2HXQA 3BU3A 1LP4A 4IAYA 5F2OA 2FSMX 5DN3A 2QOFA 2ZBPA 4FVRA 3CVOA 2ZIEA 4IVCA 2XK9A 2YWPA 5DLSA 1YQJA 3UJ6A 4J97A 3G8AA 5EW8A 3E7PA 2Y0AA 4GKIA 4YHTA 5EM7A 1OIRA 3P5KA 5J8IA 2AOUA 3WIGA 3WE8A 1JSXA 3O7LD 1U2ZA 3QTRA 5AP1A 1X19A 2FRXA 5HBHA 3VUGA 4TW9A 4ARKA 1NT2A 2VDVE 3QOXA 5G6VA 2F8LA 1AF7A 4UWBA 3VBWA 3KQTA 3OFKA 1RJBA 4E7WA 4QYGA 4IMYA 4C02A 3BIZA 4FI1A 5EYKA 2XRWA 3W8LA 5A6OA 4I6BA 5LQAA 2JDOA 4CT1A 4XYFA 5FHQA 4ASXA 4O0WA 2CNQA 1Z5MA 4L6QA 2PBFA 1R8YA 2BHHA 3KQWA 1R78A 3PY1A 2N47A 5EMLA 4CFVA 5CEKA 3DJ6A 4YR8A 4DYMA 3L8DA 3GI3A 5CU0A 2F7XE 4YPDA 4L3PA 4GRBA 5EOVA 5L8JA 3ID6C 4L00A 2VRXA 4NJ3A 4CKIA 2HW6A 1YWNA 1ZRZA 4QTTB 3LM0A 3L8PA 5CI7A 4EQZA 2BM8A 3OT3A 3BKWA 2C69A 2OJ9A 1WBNA 4O86A 5DH3A 3C0KA 5IKMA 2R3OA 4OT5A 4HG2A 1OM1A 4S2ZA 4AAAA 1XJDA 4P7FA 3QRTA 2BAJA 1TPYA 4USEA 1O6KA 3MIYA 4BCPA 3SW7A 4RC4A 3DTCA 5DNRA 4EHEA 4DAWA 2G1TA 5C27A 2C3LA 1XH9A 5DLYA 3MWUA 4FSWA 3VQUA 4F7SA 4LMUA 3SG9A 4PYJA 4C07A 3FMLA 3P23A 2ACXA 2PE2A 5AAGA 2VZ9A 1CKPA 3AOXA 5KYGA 5EGSA 3ALNA 5HG9A 4GJ3A 2CNUA 2V7EA 3F2AA 4M84A 5K05A 1Y6AA 4ZZNA 4A4LA 2R3SA 4Y5HA 4MTAA 3ODZX 5L8KA 4FR0A 2UW4A 3TLJA 3TJCA 3RJCA 4GU9A 4K0YA 5C9ZA 2BALA 4OR5A 3QZHA 4QP8A 1OZ1A 2OWBA 3FMDA 4ER3A 4YMGA 3B8RA 2QO9A 3C4CA 2OG8A 4QMQA 2HWPA 1XH7A 5ANOA 3HDNA 2W06A 4FSTA 3U6JA 1NW8A 5EIFA 4HCUA 4O0SA 3VO3A 3P79A 2QM3A 4QDKA 4A9RA 5IUGA 2FHPA 2BVAA 4ZSEA 3UJDA 4R1VA 5IISA 5CYIA 5TR6A 3I58A 3A61A 2OB2A 4PWYA 5HD7A 3R24A 5J1VA 4GW8A 2CMGA 3PX2A 5ICGA 4NCTC 4Y5QA 5E7RA 4FUXA 3V51A 1KV2A 5B2LA 4DA4A 1UNLA 2BH2A 2PVNA 4ANMA 1XWSA 5JQ8A 4CD0A 2BAQA 3PXFA 2ITXA 3ANQA 4FSRA 5ANGA 3E62A 1JSVA 4YJQA 3NYXA 2PMIA 5J5SA 4AOIA 2I1MA 3E93A 5D41A 4F0GA 3SVVA 1M6EX 1J7LA 1R0EA 1XBBA 2P3GX 2I0EA 3EZRA 2O06A 5BP7A 4A06A 1O9HA 2DUVA 5CCXA 4Z3VA 1H25A 4BR3A 2W1GA 5K09A 3U51A 2UZDA 2Y6MA 3B3FA 4ZTMA 5JGDA 1K9AA 3MPTA 2WTCA 4QVKA 3LFDA 3MTIA 3RKBA 3HDMA 4UBAA 3NTVA 2CMWA 1SUIA 3BWJA 4BIBA 3A7EA 5IA4A 3KREA 3GC9A 2B7AA 2R7BA 4C62A 2IH5A 1UVRA 1PKDA 5DSXA 3LQ3A 1UU3A 3OD6X 4D9UA 4Z55A 1ORHA 3ETAA 4FIJA 4X2KA 3R8PA 4DE4A 2WU6A 5IQAA 2HK5A 1P4OA 4FKRA 3UPXA 1SUSA 2NNWB 2DULA 5F4NA 2YWVA 4A6EA 3M6VA 3NEWA 5AFVA 1NVQA 2WHBA 2C0IA 3CC6A 2UV2A 5KBQA 5JFWA 2ZDUA 2WPAA 4ZLZA 3MHTA 5ICPA 3DXZA 3TV6A 5K9IA 3QTZA 4KSQA 3TNWA 3MSSA 3A8WA 2B9FA 3HP7A 4WNOA 1BKXA 2GH1A 1KSWA 2AOVA 2EX4A 1JTEA 4JRVA 4MNFA 5DT4A 2JG3A 3HRFA 5F9EA 4I5PA 4BDKA 3F3VA 3HCFA 8MHTA 4O7RA 2BILB 3R7EA 1VEBA 4FT4A 2IBSA 3MVMA 3MVJA 2YDIA 4C38A 1WG8A 1OPJA 3EYGA 5IUIA 3GC0A 5CZIA 3QGYA 1H1QA 2J0KA 4ZTNA 4CMTA 3AMAA 3DOGA 4HGEA 4ERWA 2BIKB 3PXZA 3DB8A 3VUDA 2HIWA 2J4ZA 4O0TA 5AIRA 2IPXA 3DKOA 1IM8A 2C3IB 5LVOA 5B0XA 2XJ2A 4FSQA 3S95A 3EQHA 2XIYA 3SGLA 4V0RA 3R73A 3FQSA 5GJDA 2IZSA 3D2KA 1YW2A 3QAME 3MFSA 2PMLX 5AUZA 3R8VA 2X2KA 1NW5A 1KPGA 4YSJA 2YM5A 4RMZA 4AQCA 3FC1X 5AAFA 3G2FA 4XUFA 2JIVA 3ZUUA 4O2ZA 1PXNA 4YP8A 1F38A 3MQ2A 2QOQA 3A4PA 4AT4A 4E5WA 3H9FA 3T7TA 3CJGA 1Y8YA 1XH5A 3KQVA 2CNVA 4BGQA 1J1CA 4FTCA 3Q4CA 5ETAA 3VRZA 3CD3A 5E8ZA 2B9EA 4FKLA 3EN5A 5BW4A 3HTXA 3GU4A 2LGCA 3FXXA 1JQ3A 1DAYA 5GIOE 4FOBA 2CHLA 5CT7A 4IAIA 2IIPA 3PG1A 4XBUA 2OXTA 3SAYA 2A27A 3NDIA 4RJ6A 5GHVA 4UN0C 4LL5A 4J8MA 2C7QA 3IK3A 4C58A 4QYFA 1Y57A 4TYGA 4TPTA 4IWDA 3BLQA 5HCZA 2YIQA 3POOA 2WTWA 2QO7A 2ZM1A 3DCVA 4BDJA 4AU8A 1QMZA 2B55A 4QMTA 5JFVA 4YUXA 4FSMA 3DBFA 4EWQA 4X2GA 2ERKA 5CU2A 3L8VA 5AA8A 5GJGA 2BZGA 4PYNA 5L2WA 4CKBA 4WKQA 4C4JA 2BR5A 5JGAA 4U44A 1U54A 1YHSA 4D2RA 4F65A 2YABA 2Z02A 3KXNA 3U9NA 3BWFA 4RTKA 4ZTQA 3UJCA 2XP2A 4ZTHA 1L3CA 3PB3A 2O64A 3CJQA 3UP2A 2ITVA 3SXSA 2OZAB 4R3PA 4BIEA 3TPZA 3JUHA 4FL2A 4EK9A 1J1BA 1BHJA 2VTMA 3PLAE 2OKCA 5IQHA 5E91A 3GOPA 4OTGA 3CTQA 4PTEA 2B9IA 2R0IA 2WNTA 3F7WA 4HOKA 3NNXA 4J71A 3GNLA 4BLWA 3HAMA 2NYUA 4EORA 4KAOA 5C1QB 1LEZA 1X1CA 5E1SA 3U55A 3FMNA 3NNUA 5J9ZA 4KUJA 3MFRA 3G9NA 5KQRA 4FODA 1OKVA 2V62A 1PF8A 2H9VA 3C0IA 5E8UA 2VDWA 2VO0A 2OIQA 3KB7A 4CFNA 5T6BA 3ZFYA 3OC1A 4WO5A 5CI6A 1G6Q1 4KW7A 4JBVA 3LXLA 4EOQA 4KKEA 4KNBA 4NM5A 3JPVA 5AV1A 4JQ8A 1QAMA 2VX1A 2R64A 4ZY4A 4PGHA 4DFXE 3DQWA 4EK6A 4BDBA 2G2IA 5LWMA 4DMGA 2YDKA 5IQGA 4DZRA 3UNKA 5CAPA 4F9YA 1XCJA 3P9IA 2OKRA 1OITA 3GCUA 2JH8A 3K54A 2WOTA 3LZBA 2FVDA 3LDGA 3ZDIA 4QQNA 3ORTA 5BPYA 3ROCA 4O7WA 1JOWB 5GP1A 4U6RA 5EI8A 2VTHA 3U9CA 3NWBA 3P0MA 4TWOA 2G9XA 4MIKA 5FRIA 3BE9A 3AC3A 1GJOA 3FMMA 4C4EA 1XH8A 2QNJA 2BR1A 2P7IA 4XG8A 2UZVA 2XM9A 4BDCA 4GVJA 5H8BA 4XHKB 3FLWA 3Q2JA 2VO7A 5TT7A 4XUEA 1APME 4E6QA 4IX5A 5AP4A 3OFJA 5C4KA 2W4JA 3CTJA 4AT5A 1FOTA 4G6OA 1O6YA 1GZOA 3GNIB 4O83A 3LPBA 4ZTLA 5BUJA 1B38A 4G3EA 3K2LA 1V0OA 4R78A 3RINA 4KKGA 3LCVB 4KBAA 4AFEA 1OPKA 5DTQA 2Y9QA 3FZOA 5DBXA 3VS6A 5HIMA 3HEMA 4BP3A 3EQDA 1HNNA 2QRVB 4YZCA 1N7JA 2V74B 4UB7A 2ZSUA 3V6SA 3NUPA 4ZOGA 2O07A 4AA0A 4YTHA 3TZ8A 2NXCA 3IKAA 1M14A 5CEMA 4PL3A 3VC1A 1JKKA 1ZXEA 1JQDA 4AN9A 3MB7A 4C3PA 3GCPA 4GOOD 3VUHA 5E8SA 3CXWA 4NK9A 2XRUA 4FG8A 3HA7A 2ZZKA 1DUSA 3A8XA 3OCTA 3QKKA 3NNWA 5EYCA 4B0GA 4M3QA 3TR6A 4XMOA 3ER9A 3II5A 2AOTB 3EKKA 3LFSA 2QOKA 5DWQA 2ETMA 5CVVA 3I6UA 4B9DA 2C6TA 4B8LA 3WILA 4FV7A 3EVAA 1N7IA 1QPJA 1XH4A 5AUXA 5M57A 2WTIA 5KVAA 1CTPE 3HV3A 4ZJIA 4E6AA 3KA0A 5CZHA 3QHWA 4JT3A 4I0TA 4QMVA 2K4MA 4XCXA 3PLSA 4R7HA 1URCA 4DG0E 2ERCA 1M2PA 1ERKA 3LDFA 4RJ3A 3G0FA 3I5NA 4R7IA 4YZ9A 4CRLA 1U4DA 4CKEA 1ZYCA 4ZY6A 3HM2A 2X39A 1UA2A 2C6EA 4FV0A 5GIPE 4E4XA 3TOSA 1R18A 3UO6A 2X7FA 4KSPA 3PRFA 4UV0A 3QQKA 4EEVA 3MAGA 5AEPA 1AD5A 4F85A 5IUHA 3FL5A 3RWQA 3QUPA 2UZEA 4APCA 3PA3A 3R01A 4PYQA 5EHIA 4UOEA 3VS3A 3THSA 4EH9A 5K0JA 5K0LA 2NXEA 3W2QA 1PYEA 5IDPA 2ZBQA 3ZRKA 1R6AA 4ID7A 4C34A 2X9EA 3NAYA 2CN5A 2J6MA 3LQ8A 4HYHA 2BROA 2XIXA 1TVOA 2WD1A 3AQVA 4XRLA 4R5YA 3H9OA 3QD3A 5HIDA 4F7JA 1GIJA 5K0BA 3WIKA 5BX0A 2VWXA 4FC0A 4ZTBA 5HX8A 5KHWA 3ULIA 1FMOE 3N4TA 5ICCA 1L3RE 4C4GA 4DT8A 5BVDA 2FO0A 3PVBA 3F4KA 3DJ5A 5FTWA 3Q9YA 4TNBA 5D7VA 4J96A 1XH6A 3F5UA 4MD8E 5CCBA 1LEWA 5FD2A 4FT5A 2WELA 3EMDA 4PNEA 3KHKA 4HVDA 5EOBA 4BDAA 4GK2A 4BVUA 5AWMA 4M15A 5AUUA 2PHKA 4RWJA 4Z7HA 4EH6A 4ZXTA 3TFWA 3P86A 2QONA 3DK6A 3WYYA 3LDUA 1VR2A 5FP5A 4RSRA 3TM5A 3TDVA 2CLXA 1XTPA 5EZQA 2YIYA 3GRRA 1WBOA 3UWPA 4DFYA 3CQEA 4RVHA 1JNKA 2XM8A 5HEKA 2WMRA 1AQJA 4YTCA 3ELJA 3SSNA 3FHIA 3COIA 4X0MA 1KE8A 4Z2YA 3KRRA 5DPMA 4IC8A 5HESA 3GENA 2EU9A 3BWCA 5IQDA 4QQ5A 2YCQA 3AD4A 4RIYA 4C4HA 1GOLA 3O51A 1H1WA 2QOBA 3JY9A 4FGZA 5AAEA 2E9OA 1ZGAA 5FXSA 3COMA 4AW5A 4YTIA 4O0RA 1TW2A 5KE0A 1UU8A 1QYRA 4O7SA 5GOZA 3PFQA 3FI8A 3THRA 1YDTE 3WF7A 3O7LB 2OIBA 4OQEA 2ZV7A 5EQYA 2R3KA 4FR4A 4FT3A 3QCQA 1JKLA 2Z7RA 4W4XA 5E2BA 3FMEA 5IMEA 1BKYA 1DL5A 2HZ0A 5FEQA 3GXOA 3CR0A 4X41A 3NRMA 2HR1A 1GIHA 3EQFA 3ZXZA 3IW5A 4G3DA 4EH8A 1TQMA 4TWNA 4IZAA 3S3IA 2C6DA 4ENYA 3BELA 3R1NA 3R02A 3IPHA 4L46A 3KRLA 3NDJA 2XBAA 1JLUE 3PYYA 3R0TA 1CKIA 4HRAA 4GJ2A 4G34A 1UWVA 1P14A 4AACA 3CTHA 1XJ5A 3OBGA 4E1ZA 3ZO2A 1H26A 1IG1A 5DM4A 3KULB 3UJ7A 5IA2A 4QMNA 4ZSJA 2GTMA 3AD6A 4J95A 2ZYBA 3R9OA 5TF9A 4CMOA 3TUBA 2YJRA 2C5NA 4AWIA 3SRVB 4IVBA 2XA4A 3P9JA 4P7GA 1HOWA 1XHAA 2BHEA 3ZS5A 2QYOA 4I4EA 3VUKA 2YTZA 4MQ2A 3PPJA 2XKEA 3O2MA 5EKNA 5HEZA 2RGPA 4RX5A 3G6GA 4QP9A 1EQAA 2ADMA 3PY0A 4PWNA 1YVJA 3FQHA 1YWRA 4O82A 4YJOA 4YZMA 4K9YA 4FL1A 3FTCA 4B6LA 3LJ2A 2O65A 4OBXA 4FT7A 3KPWA 5FM2A 4NKAA 4IWOA 4F64A 5ACKA 1FJXA 3TI1A 1U46A 3RHXA 2YCFA 4RGJA 5IQIA 4R8SA 2PK9A 3H2BA 3U6IA 4PINA 4WNMA 2R5TA 4H3QA 4HTFA 2Q41A 4CXAA 1OBGA 5E8VA 4GUEA 3DDQA 2WXVA 4WT6A 4QQCA 3O8PA 4F6WA 2WTKB 3I81A 4HGTA 5BUEA 2ZTHA 2ORED 4ALWA 1FVVA 3LJ0A 5BVKA 4V05A 4CLIA 3TKYA 4BCGA 4C0TA 2QE6A 2C5XA 4FEWA 4TKSA 3ZTXA 4IZ5A 2OF2A 3LXNA 5ACBC 1GNGA 3GGFA 3JWJA 2ZWVA 5DM2A 1ZYJA 5DX0A 2PLWA 3IGOA 3DFCB 3TEIA 4JQEA 2HNKA 3ZFXA 3GXLA 1JG2A 5J9LA 4BZOA 2P8JA 4U8ZA 4AN3A 3K3JA 3FUTA 2YDJA 4HPUE 3KK8A 4IM3A 3M42A 4QQKA 4A6DA 4ITIA 3PY3A 1JG3A 1HMYA 4GBED 4BLVA 2YCRA 3HEGA 4P5QA 3LL7A 3EMGA 3PG3A 4C06A 1T46A 3UJ9A 4DA5A 1Q41A 4Y73A 2BKZA 5HE3A 1ZYDA 3KU2A 2PVFA 2XYVA 3FDNA 1KWPA 5JEBA 4C4FA 4AW0A 5CAVA 2R3QA 5KO1A 5HNGA 4WUAA 2WFYA 4CTKA 5J9YA 5MHTA 4V0GA 3C4ZA 2JHCA 3F2NA 3IW8A 5HVYA 4IJPA 3POZA 4HW7A 3QLGA 5HLPA 4CFFA 5K03A 3BX5A 3AY0A 3GIWA 2CKOA 4PYIA 3I0OA 4EOSA 3JVSA 2IVVA 4O27B 2XIZA 5IMXA 4BTFA 3GJYA 3RALA 3AC8A 4UY9A 2HV9A 4IAZA 2VTOA 1REKA 5DRDA 5DM1A 4U45A 5CSPA 2P4IA 4HZRA 2XZSA 2QD9A 3IOKA 3LCKA 3NWEA 4ANBA 4JBOA 2AYPA 4AN2A 2F49A 3EN4A 4V0QA 4DCGA 4BDFA 3LFCA 4AUAA 5EOLA 2KTYA 5LVMA 2NP7A 4CFMA 3OFMA 4OTDA 4EQUA 4JBPA 1PMUA 1ZMVA 3ZLXA 4ZAUA 2GHMA 4U42A 5BW5A 1I4WA 3BYMA 3N4VA 1Q62A 3V01A 2WEVA 2YFXA 3UO5A 4YUVA 3NW7A 4CV9A 3COHA 5EYMA 3AXSA 3NW6A 2KW5A 3W55A 3FPMA 2JHAA 3CJRA 2FYSA 3U81A 4DGMA 4GT5A 4IB0A 1Y91A 2IZRA 3FYJX 2HZ4A 5CNNA 1SNUA 4L68A 4F9CA 1W82A 2I9KA 4FKIA 5T3QA 3MFUA 2ITWA 4XRJA 1BMKA 1H4LA 4FZFB 3ZSGA 5F95A 1VPTA 4QMPA 3UYTA 1OR8A 4FGBA 2ETRA 2C0OA 1H1PA 4RLKA 3KF4A 3PJ2A 4DEEA 3KQ7A 3LFAA 2GNFA 4PQNA 4OX9Y 4JQ7A 2ZWAA 3WOWA 3MA6A 4J7BA 5H9BA 1QL6A 5JMSA 3BT7A 1NXKA 5DEWA 4AZFA 1DI9A 2XVMA 3Q6UA 4HGLA 2ZM3A 2VWBA 3TIYA 1OGUA 1YOMA 4RQKA 1BYGA 1XDZA 3H9RA 4G3FA 4AA5A 3R1QA 2GQSA 3PXRA 3DNEA 4RX8A 3GU8A 3AT3A 1EH4A 1AQIA 2UW5A 2VNYA 4FGRA 3D9VA 3EJ1A 2PYWA 2ZDTA 5L8LA 2XKDA 3TRKA 4L45A 1R39A 2AN5A 2NXJA 2EWAA 5IF1A 1JAMA 1PYXA 4WA9A 4FKGA 3TNQB 3HKOA 3HCDA 1D2GA 1MQ4A 2AS0A 2WMSA 3CE3A 3P2KA 3NMUF 4WBOA 4NYEA 2QLUA 3MB5A 2IVSA 4OW8A 3LXKA 3SLSA 2DYLA 3DQXA 4R7BA 4F1OA 3WI6A 3W33A 1I1NA 2R3FA 3O71A 5HG5A 4O7TA 3QTIA 2PGXA 3FZPA 3UIBA 4GT4A 2PWYA 3RAIA 2HELA 3KVXA 2XNGA 4RBLA 2PE1A 2ZVAA 5E9QA 2F9GA 3ENHA 2X81A 4NM7A 4OTRA 1RJDA 1YWVA 4X21A 2ITZA 5I5ZA 2C3JA 4PYOA 5HBJA 4I6FA 3ZLYA 4M12A 2PSSA 3ORLA 4E26A 3R8UA 3MH0A 5FP6A 2XJ1A 3G2OA 1QPDA 3BHUA 4CWAA 4EHVA 2EB2A 5M44A 1F5QA 3C7QA 4PMSA 5CALA 4C7TA 4G5PA 4EUTA 2LAVA 1WVXA 4FZ6A 5DFPA 3A60A 2IGTA 5HO8A 4DC2A 2AVDA 4YJNA 4X6RA 1FGIA 5CVEA 3LHDA 3GGDA 4RRVA 5DR9A 1PHKA 4Q5HA 4RVDA 4IV0A 3ANXA 4CSVA 4HYIA 4DFNA 3GU3A 3BLRA 4XV3A 5CASA 3LQ5A 3IG7A 4PDYA 3ELWA 3LKZA 3ZDUA 3NUNA 1IA9A 4BI0A 2F4JA 2YACA 3TM0A 3OE4A 3RVGA 3GUBA 3AC2A 4XLVA 5JR3A 4JVGA 3GU5A 4C61A 1WAKA 3R2YA 3IDPA 3OG7A 4QVGA 3BGDA 2P33A 3F3WA 3AXTA 1YXSA 1U5RA 3HCEA 4QPAA 4RA5A 3F3UA 3AG9A 4X3JA 4PNKA 3RAHA 4F9AA 4K8AA 4G2FA 2QU6A 5CY3A 1JQEA 4WG4A 2YVLA 4NTSA 1O9UA 4QNYA 3MPAA 5FBNC 1OMWA 3FYDA 2SRCA 4O0VA 2XK7A 3CS9A 2XEYA 4O2PA 1JR4A 4MX9A 1TW3A 4QP7A 2GB4A 3ERKA 2UZWE 3ZFMA 4EL9A 3BYOA 3RWPA 5EMJA 2X1NA 2C47A 1U59A 4L9IA 3HVCA 4YUQA 4AXAA 5EMMA 4NM3A 3VBQA 5BVEA 4RTMA 3ERCA 3EVFA 1K2PA 3A7JA 5JFSA 2CN8A 3CCNA 4YZBA 3FHRA 5D11A 2HOGA 3HNRA 2VP3A 4TXCA 2VX0A 4G6NA 5AP3A 1CMKE 4IACA 3KQYA 3BKBA 1H0VA 5D9HA 4F0IA 3BGPA 3H30A 5E92A 1WMKA 4J52A 1H8FA 1Q8WA 4MNEB 4PTGA 3DT1A 3CPBA 4HNIA 2IVTA 4I0RA 1PJZA 4WSYA 1SQFA 4YMHA 3UGCA 4DINA 3FYKX 4F9BA 2R9SA 2UZBA 3I6WA 5M4IA 5HFJA 4EK8A 4EH4A 5EQEA 4F09A 4XG6A 5LXMA 3LMIA 2PPQA 4RVKA 1IY9A 2G70A 4FIHA 3SHEA 3BHVA 5G02A 4FK3A 4F0FA 4MXOA 1EG2A 3EQIA 3CJTA 1U5QA 2WA2A 2I0YA 4PMPA 5FA5A 3JWIA 4H05A 2PULA 3EFWA 3QU0A 3F61A 4LGGA 5CEPA 3JWGA 5IEXA 4LQMA 4YLLA 3VW8A 1FBNA 2OB1A 4AA4A 3QQHA 4IC7A 3UOJA 3NR9A 4FV6A 1IXKA 1UKIA 4OBOA 3ZLWA 5HILA 5IEYA 2ZOQA 5A14A 5DWRA 4TL0A 3QA8A 4G16A 1OKZA 1L3IA 5A4EA 4O7YA 4HYUA 3DK3A 2IG7A 3KXMA 4FS8A 1FINA 2WMTA 3O31A 1MHTA 2R3HA 4NCTA 4RTRA 2OXXA 1WBVA 2XNPA 4QT1A 3OVVA 2VTTA 1LPUA 4BCKA 2Z6AA 1ZOEA 5KBRA 4E2XA 4HJOA 4CFXA 2HTEA 1ZMUA 3PZHA 5BXYA 4YUYA 2WQEA 5GM1A 5DE2A 4CEGA 4Y30A 3HA5A 3UG1A 4ZSGA 5JN2A 2BKKA 4GK3A 2F2CB 1SG9A 4XNEA 1KYZA 5EQPA 4FKWA 2OPBA 4EK5A 5C4LA 4I6HA 5B7VA 4DTAA 1RI5A 2GU8A 4Y83A 5B2MA 4ERKA 5CLPA 5CQWA 1XDSA 1ZHFA 4NTTA 3VS7A 3OHTA 1OIQA 4MWHA 3R7YA 2B78A 2B53A 2QKRA 4OBPA 1N2XA 2ZCJA 4ZJJA 4EOOA 3HL7A 2CDZA 4JAJA 2XH5A 3THBA 4GEOA 4BCNA 4FTLA 3GOKA 2JLDA 3FI4A 5I9VA 2XBJA 3BWYA 4U5JA 2QQ7A 3N4UA 4BY9E 3DMFA 5BMMA 1WXWA 4KS8A 4MF1A 1M7NA 3ZU7A 5HIIA 3PWYA 3VC2A 4JAIA 2GTNA 1M17A 4EMSA 1OL2A 5IQEA 4RIXB 1DS5A 2PMNX 4GT3A 5BVFA 3WSTA 4RVFA 3PVUA 5LMKA 3DAEA 5EI2A 1VQ1A 1V1KA 4JDKA 1NW3A 5FXQA 2OI4X 3L8XA 3GCZA 3RM6A 5GNKA 1YUBA 3BU5A 2XNMA 2F2UA 4YLKA 4DTKA 4PONA 4FYNA 5AA9A 4JLCA 3ORHA 2PMOX 2UW6A 3B3GA 3R00A 3QOWA 5CAQA 3DAKA 1Q97A 3W2RA 4RWLA 5P8WA 4AZEA 3G9LX 4Q2AA 4D4YA 4PCLA 3VS1A 4MCVA 3QD0A 4BBEA 3QV2A 4BZNA 4F7LA 4NFMA 4ZMEA 3VVHA 4GK4A 2CKPA 2QY6A 3QRUA 3KMMA 2IH2A 3VC4A 5I9ZA 4M7RA 3W32A 2YUIA 5CEOA 2AR0A 2YXEA 1ZMWA 3FSFA 1P1CA 1XBAA 3OE5A 3MVLA 3DDPA 2FYTA 3WF6A 4IFGA 4IX6A 2B4SB 2ZMDA 2Z6QA 3FZGA 4EH3A 4I0SA 3G2PA 3HX4A 1SM2A 3KXZA 4LM5A 3G5TA 3QTWA 3H3CA 2WTVA 3BCEA 3MH2A 3PS9A 5D1HA 4RWZA 3PE1A 3VJOA 3P8ZA 3D7ZA 4RIWA 4I5MA 2HXLA 4CFUA 4ZJVA 1NV9A 4G56A 3DLCA 4MYGA 4EJNA 2YHVA 3KQQA 3LLTA 5DR6A 2BTSA 2AOWA 2Y8OA 4FZAB 3KQPA 4YPSA 4TNDA 3TACA 2J9MA 2R3GA 3D83A 2IW8A 3FMKA 1OL5A 1YZ3A 3G2QA 4FSXA 3ZM4A 3V97A 5JZNA 2XKCA 3OEFX 4OLIA 4GIIA 4DGOA 2ZV8A 3G0EA 5JT2A 1OECA 4FTTA 3ACJA 4GYGA 4ZMFA 3TT0A 2O57A 3FPFA 2RFNA 3TTIA 3DNDA 3ORPA 5HE0A 5K0FA 4X61A 5C8KA 4O81A 1Q5KA 3O23A 5CM2Z 3QRJA 5CSXA 3QFVA 2X8IA 2F7ZE 1O9GA 3EFKA 1PXLA 3EKNA 3OCJA 3UQGA 4A9SA 3C4XA 3HECA 3QZFA 4OQDA 1ZY4A 3RPRA 4WIHA 3B2WA 4QP1A 3TUCA 1SNXA 4DBXA 2Z60A 4B17A 2C5VA 4QTAA 4BB4A 3E87A 1VYWA 5DGZA 3CLYA 3A62A 4S34A 1X1AA 3R6XA 3OUNB 4RPVA 2W4KA 2WMWA 4EBVA 3MGGA 4U3YA 2H8HA 3PT9A 5HIJA 3V5QA 4CFWA 3QZIA 4ENXA 1IR3A 3R7UA 2RFEA 1G8SA 5AP2A 5FHRA 4EH7A 3PSBA 4FT2A 3HNGA 3UDBA 5KCVA 3SV0A 3GRVA 2JJQA 2VTIA 5L6WL 3KKZA 4MQ4A 3D2LA 3C6MA 5DTRA 2EXCX 3QL8A 5AX3A 2AOXA 4M69B 3QZGA 5E1OA 3JWHA 3OZSA 2CSNA 5HG7A 3MBLA 2R3RA 3Q9WA 2ZFUA 2PE0A 3RODA 3FV8A 2YM3A 5J95A 3TKUA 4GOMD 4EC9A 4EONA 3ORMA 3ORNA 3RAKA 2JD5A 2C6LA 2F57A 3NPCA 3NX8A 4G6LA 2GFSA 1P1BA 2VN9A 4WUNA 4QQTA 3COKA 4F6SA 2YAKA 2OZOA 4DH7A 3FUPA 4EKKA 3Q3BA 3LW0A 4H3BA 5KX8A 4K6MA 2QOIA 2V7OA 3W8QA 4DEGA 4FIIA 5JSMA 3DMHA 3ENMA 4ITHA 3FYCA 4FSDA 3HLLA 3SOAA 3EQRA 3R8LA 3P08A 4PMMA 2UZTA 4FV4A 3EPPA 4FEUA 2OU7A 1SVUA 3R9RA 3C1XA 5IPJA 4FK6A 1YHWA 3QF9A 2CKEA 3I1AA 1S9IA 3LX6A 4X3FA 4EOPA 2W96B 3ZO4A 3BKXA 1H1RA 1IASA 2HAKA 3GQIA 3DBQA 2B3TA 4ACDA 1LUFA 3OXIA 3DBCA 2FPOA 3RCDA 3BHHA 4EH5A 5K0EA 4I94A 3S00A 2OFUA 3TN8A 5CAOA 3FZ1A 2RFSA 4DM3A 3DTNA 3EWHA 2BMCA 1V39A 1YOJA 4JRNA 1YI4A 1YI3A 5DX1A 5H02A 2VTSA 4EYMA 1XQZA 1DCTA 2W1CA 5HICA 3D5WA 5CX9A 2PWPA 4XG7A 5FG8A 4BIDA 1W0XC 4RV9A 1D2CA 4LV8A 5LVLA 3TTJA 1ZLTA 3W2OA 4BTMA 3BYVA 4I20A 5HIBA 4GL9A 3PA5A 3T3VA 3MW1A 4L53A 4ZSAA 4KIGA 5KQSA 2B9JA 4GYIA 4QTBA 3OU2A 4EWHA 4DH3A 4MXYA 1WZNA 3P9CA 1ZY5A 4FTOA 4E31A 3EHAA 3G5DA 3NUXA 1Y6BA 5LQKA 5CSHA 4EQCA 4YV2A 4GF5A 3KPJA 2OJFE 5FGKA 4P7JA 1WZYA 2AZTA 4DLIA 3O8UA 2GDOA 4FTJA 2JFLA 3S68A 4AGDA 3EVDA 1OVEA 1WBPA 3E8SA 5AX9A 3HVJA 4XJ0A 3M6UA 5BYLA 5JZJA 2B2CA 5E4HA 4TYHA 4AW2A 4AE9A 4K77A 5CS6A 2V7AA 3UVQA 2PVRA 3NNVA 2O2UA 4D55A 1Z57A 2CLQA 3U4WA 2XYUA 3DULA 4JG7A 5EHYA 4QDJA 4FVPA 1SKMA 3T0IA 2HZNA 4RTQA 3VUIA 3IW7A 4KIOA 3MY5A 3VHKA 1XCLA 3GC8A 4IADA 5K5NA 3LSTA 4WNKA 3KPYA 3VSEA 2GHLA 2BIYA 4KDCA 2JBPA 4BI2A 3SGCA 4IB1A 3UG2A 3VN9A 1Q99A 2J0MB 4IFCA 3ANRA 5B1SA 3LCOA 2DWBA 3R30A 2YITA 4U97A 4UYAA 3OPNA 4R77A 5K8VA 3IS5A 3LCUA 5ETFA 4AFJA 3QGWA 1PY5A 3CGOA 2DQ7X 3KRWA 3QTXA 4LRKA 4JR7A 1XXLA 2XVAA 4Y46A 3ORZA 4RFZA 4N6ZA 4GSBA 4C2VA 4DITA 2BRNA 2UW3A 3L9MA 5KUPA 4ZLYA 3BEGA 3EN6A 5FUBA 3LLAA 2ESRA 3QX4A 4U79A 2H1RA 2O5KA 4M0YA 3V5TA 4IV8A 3D7TB 3AWIA 3DZQA 5DT3A 1UWJA 4ALVA 3ET7A 2ZB1A 4NSTA 2A19B 4C59A 3OW4A 3RP9A 4FSYA 4BF2A 4C04A 3MYGA 2C7RA 4CVAA 1FPUA 1PXPA 5CD1A 3K0BA 4PYMA 4Z7GA 4WBBB 4QNAA 4G9CA 3FXZA 2Z6UA 5FQDC 2I40A 5L3AA 4C33A 2PL0A 2ESMA 3OWPA 3VF9A 4R8RA 3UNJA 4BDIA 5T67A 2WIPA 3OOMA 3F5XA 4ZSLA 2VWVA 3C4FA 5EIWA 1IAJA 4LG4A 3PP1A 3HMIA 2KULA 3OOGA 4NECA 5FLFA 3H4JA 3VS2A
chains in the Genus database with same CATH superfamily
3EQ9A 4HGOA 1G19A 1DOZA 2Q0NA 1BDJA 4IHAA 3BRBA 4WK6A 3PGMA 4IJMA 4GT1A 1C7IA 4QFMA 4J0CA 2JLZA 3CISA 3DDCA 1Y4DE 1C7JA 3O9MA 3O93A 3S0OA 3ROEA 5I48A 1NX9A 1OZ0A 2C0TA 2GDZA 2GHGA 1F8FA 3NIWA 2XXAB 4QOXA 4U2CA 2VTQA 4OH1A 4PW0A 1KE5A 4FV9A 3AUFA 4BTLA 3LZCA 1MZPA 1JTVA 3SYTA 2XB2A 1HE8B 3SSOA 1IEPA 2QR7A 3VH4A 2V7QA 2QLMA 1II0A 1H0SA 3RFUA 5ADWA 2AK3A 2OM2A 2BFDB 3L7AA 3OXTA 3FC2A 2H6DA 4LC0A 2P5TB 1D4ZA 5EE0A 5DVRA 5ALGA 2KQUA 4QPDA 5HJ7A 1U1EA 4KIFA 3ZE0B 3SNKA 3HJHA 3C7AA 3UBMA 2OWDA 4ENQA 4Q7KA 2QUJA 1K9VF 5JRSA 3WTBA 1DAMA 3WP0A 5HO7A 5A46A 4WCVA 5C8DA 2WEIA 2PU8A 2WMBA 8GPBA 4EKDA 2OBMA 3ORKA 5GWXA 3CB4A 4EYQA 4KITB 4HR7A 1RDFA 2VT6A 4L16A 2OQIA 3TUDA 2J3LA 4JJ7A 2V7TA 2HF8A 4MW9A 3E3LA 4L8GA 4JT9A 2PKRA 1DWOA 1RXCA 1DAGA 5E9JA 2CB0A 3NNNA 2PKWA 5A71A 2H1HA 4KOAA 4WL0A 3PHBE 3B1XA 3DDOA 5ERGB 1CBUA 4DA0A 5KMMA 3ROKA 2A67A 4PPNA 4IBOA 1NBAA 4LIPD 1JHDA 2JKOA 4QQRA 4G1MB 3UM9A 3BBLA 4UEUA 4TSRA 1QYVA 4W9MC 4LCBA 2RF9A 3GT8A 3B2TA 4BNUA 1VE5A 1JPVA 4EGQA 5EW3A 4ZCTA 3AEQB 1NBWB 3OBBA 1PNOA 2IXAA 4R7TA 3ZW8A 3GYGA 1SU8A 1DRJA 5AM1A 3NPAA 2OVBA 1J7UA 3RI3A 4G0MA 3SHQA 4YN3A 5K6RA 1BMQA 3RLFA 2Y0EA 1RYDA 3LP8A 5FTQA 2DQKA 2QTTA 4UAGA 3E88A 3RUFA 5CU3A 1W7AA 4TT3D 1DBQA 2JKQA 5C4GB 1PYDA 4K3VA 1U2GA 2C2BA 5EZYF 2YWJA 5I7AA 5DGHA 1YUNA 3KWJA 3AVQA 3OPXA 3C3KA 1QDEA 4O3MA 3DXNA 2YJZA 4PN7A 3OTHA 4BBZA 2RG6A 1W73A 4EKIA 4BHZA 4NFSA 4FV1A 1Y1TA 3LCCA 4HGNA 4BV9A 4ZQCB 5A4CA 1TO2E 3PPYA 1RXIA 4QT0A 1G17A 2WD9A 2V6JA 3LVFO 2CMFA 2RIOA 3E2IA 4BO5A 5J2UB 4QMWA 2BT4A 3A1DA 3DZHA 5EZ5A 1NU6A 5M3BA 4O33A 1H23A 1R37A 1DC7A 4OHPA 1OH8A 2VD5A 1QX3A 1AUPA 1W83A 3SFVA 2X4LA 4ALMA 1X1BA 5CIQA 3B8EA 3KEOA 3ASZA 1PZGA 4IDNA 2QG5A 5EE3A 3RK5A 3TRFA 4A8PA 1MP8A 3UE4A 4JUCA 1A9RA 3B13B 3CWCA 5I9UA 3W05A 3NVMB 2XMGA 2ILTA 4NEQA 2H8KA 4WIAA 5A0FA 4M13A 1IK6A 1Z9XA 4IM0A 3P0RA 4LGVA 1LBEA 4ZVVA 2PZIA 5KSPA 3GEIA 1BD4A 4OYYA 3R28A 2IODA 1LRKA 3B38A 2R8EA 2IT1A 1AZSC 2B92A 3CB2A 1DIHA 4A3SA 1V9CA 1M6YA 5C1OA 2ZG6A 4BVFA 3N2ZB 3KTFA 1UANA 4UEQA 1AC5A 3IS3A 4PVDA 3MDYA 1WPGA 2VEOA 5AVOA 1FQKA 4H7EA 4W9RA 4X3PA 2IOQA 5L2SA 2BAKA 3PE4A 4DN5A 3ZQJA 4IYJA 3U87A 1W88A 1LR4A 3I5MA 4FD3A 1SKAA 5DTIA 2BPMA 4MB0A 4UDYX 4Y6OA 3U17A 1A8QA 3F6EX 2Y1LA 3SWWA 1SXHA 3FQEA 1YH3A 2QWXA 4OTWA 4QP4A 4WV3A 4UMEA 2I55A 1D03A 1VMDA 3DGKA 4EZ3A 3EYHA 3FZEA 4D8YA 4B35A 2FUMA 4LV6A 3QWIA 4CTMA 2IV2X 4UD6A 1QANA 1GFIA 4DMHA 3W8RA 2EP8A 5KNJA 4HADA 2Q3CA 3AR2A 4RFYA 4U9HS 5KAMA 3AGQA 2RBGA 5EYDA 1GPH1 1Z0IA 2XSZA 2OE2A 5E7IA 3I2KA 2GEFA 1ZM7A 4E7PA 3MJ4A 4DR6B 3VR0A 3SJUA 4MWEA 3O1JC 4OIFA 3T3OA 1DKOA 4GRDA 3KRJA 5G4KB 5EM8A 5EQFA 1VMAA 1KETA 3MWLA 2PU7A 3F8SA 2AOUB 4P3NA 3TZ9A 3UKOA 4USDA 4DHEA 4XFDA 3DWEX 2PVHA 1A9UA 5FO0A 1JZTA 2DEUA 5B2EA 1UU9A 1UKAA 4K6ZA 2P2GA 3ZCSA 2P78A 5B58C 3F0TA 1WV0A 5IA3A 4ACHA 5D8DA 2V3VA 3FJOA 5M4CA 5JFTA 3V4VB 5FPSA 1SZCA 2A88A 3D8UA 4YXWA 1RC0A 5BYBA 2BGUA 1GP2A 1FMKA 3JAKB 3HAVA 2FX2A 4GBMA 2DUNA 2J0JA 5L40A 2VCHA 5A54A 3KC2A 2ZJ2A 2A9PA 3LBIA 3PJGA 1FRVA 1DJNA 1F4LA 3ZDDA 3FTDA 5C0OE 5A02A 1HBJA 5JH7F 1KFBB 1KY4A 4DCJA 4M67A 4YUAA 5EMNA 5LZ7A 4YQFA 1RZUA 4ZI7F 4EJ7A 2UUCB 1NE2A 3RTDA 3NYQA 4PZDA 5DG5A 1H22A 3AV0B 2QI9C 1HQDA 2P62A 5SZHB 1XQWA 4XRRA 3C3EA 5I7SA 3M2WA 1KOLA 4N7MA 3EQZA 4MV5A 1MFZA 3X3HA 2XNEA 4OM7A 4UZDA 4FT9A 4O8CA 2I2BA 1OI2A 4WNPA 3TKIA 3BE2A 1HORA 5LIRA 3RV4A 1HLPA 1OB3A 4HH4A 3JQBC 6PFKA 3KALA 4B3MB 3HLTA 4WJLA 3NB0A 1YHZA 2FQWA 4CMKA 1YFJA 1CUBA 1KP9A 4UWYA 5LQUA 3X0DA 3C98A 2NYRA 1Q0HA 2EHDA 4HDCA 4BDEA 4DA8A 4TTHB 3UNXA 3A1NA 2QVYX 3BH6A 3JALA 4MYHA 2DKFA 2PUUA 1B8NA 3Q1LA 1EX9A 3EQ7A 3STTA 4MPTA 4P5ZA 4KRCA 4YH1A 3W79A 3HHPA 4JDIA 4G1VA 1CVRA 1OZHA 4PYKA 4D6XA 3LYLA 2XB8A 4PF4A 5A5VA 3ABRB 2DG2A 3RRNA 4UPDA 1JIXA 4FKOA 4E11A 1MLDA 3E1GA 5H82A 1MRUA 1QZUA 3QD2B 1SCUB 3D5QA 2W5BA 2DUWA 3M0EA 4DNOA 4G1FA 4PHTA 3AESA 2PZRA 2VGOA 4DB2A 2W4MA 1UL1X 5H68A 1L5RA 3ITZA 2XQFA 4IGIA 1VHQA 2CL5A 5KTKA 2WJAA 3PPKA 4Z53A 2ZBUA 3D2IA 5DI1A 3RS5A 3GJSA 1WUYA 3V7NA 4TTQA 1TVKA 1EU1A 3MOSA 3TTWA 3BULA 4I46A 1ATPE 2R6GA 4JU8A 1C1HA 3GFTA 3E8EA 5E8TA 4NCAA 4F3CA 3I6QA 3D3EA 4KV9A 1OIXA 3OWHA 2XYHA 3NIDB 4M86A 4FEYA 1QFMA 1CRZA 1KJZA 5C51B 3Q0EA 1TM1E 4LRTB 4DMLA 2WYWA 4RPHA 1QUFA 3KVWA 3X1WA 2X1HA 3U4GA 3X1ZA 4V1CB 3U4CA 5E7MA 1Y37A 4Z9YA 1YS4A 1G16A 4P5EA 2TS1A 1Z4MA 2PWBA 4L01A 5IH7A 1E4YA 3Q3CA 5I4CA 1R2QA 2C2ZA 4P93A 2JBWA 3E9MA 2PVYA 4G5OA 3NWOA 3UENA 5A6SA 3QCYA 1RKXA 3P9NA 2ZIGA 3T3GA 2E4AA 2FB8A 2WU7A 2PO5A 4G6ZA 1AV7A 3HO1A 4MS4A 1TPZA 2VF8A 5LUBA 5HE2A 3KJEA 2HWKA 4V0OA 1SXQA 3W0SA 1VE7A 1HL7A 1XQYA 5EXXA 3AM4A 1NUTA 2QUHA 2NUAB 2I71A 2I62A 5LCXA 3PTGA 4AURA 3H11B 4US1R 2RFDA 4IVDA 3JATA 1WABA 3E8CA 2AN9A 2ITPA 1KAOA 3EEIA 1QIDA 3ND7A 1Q1BA 2VSYA 1KH1A 2ZJ0A 4Q9ZA 3FB1A 5KSOA 4EA6A 1B76A 2I3DA 3UWKA 1C9DB 4KNYA 4G9RA 1CDKA 3R5FA 4IL5A 3UJNA 2JVKA 1PKGA 3RK9A 2HZIA 2ZB2A 4HN9A 3TIIA 3Q9ZA 2ZUCA 1BI7A 2YFHA 3SOZA 4RK1A 3RS0A 2IZ5A 5JCPA 3OH8A 3IQHX 3MOGA 2R6AA 2HYIC 4PL5A 4RZWA 4KIQA 1NQ5A 4J03A 3QFFA 3R9NA 1OKWA 2VZ0A 2ZETA 1M2HA 1VI5A 3VS5A 1ZXXA 4KK3A 1FFGA 1W30A 3BGVA 3LTEA 3GRUA 3WK5A 1H9CA 2GZHA 3F82A 5HZMA 2OY0A 3LCDA 4O96A 5SZIA 3QNWA 3M4JA 4RQTA 3P19A 5TO8A 3A9CA 5FTGA 1WETA 4LHZA 4HC4A 4OHYA 2ZRAA 3AKLA 5EINA 1C8KA 4MI9A 1L7OA 3ETDA 3G89A 5L6LB 4BPBA 1QO0A 1X7HA 3W0MA 1G20B 3FLYA 4F46A 4JQOA 3LCSA 3W10A 1OXUA 3ZY2A 4CFYA 1E2UA 1FVOA 1T3GA 1QP8A 3BFXA 1AKNA 4NYIR 1A9TA 1BRMA 2XDWA 3TXAA 1RDQE 1GHTA 5A6NA 4L52A 2WKPA 1FMFA 5BVWA 3BCSA 3V7YA 4IX4A 1UU7A 4JP3A 1T2UA 3TMOA 1BWQA 2XYGA 1XJWA 4MVFA 3TBKA 4J8PA 3MCTA 4CV2A 2A1TR 4QEBA 1QGUB 3GN2A 5M5BA 4AG8A 5T8KC 1Y82A 4Y2VA 2QNBA 1OLXB 1HO3A 2H96A 4YAIA 4ZU1X 3F98A 1V1RB 1K98A 2CD9A 4PUZA 4PNHA 1N75A 4P4CA 3LUAA 2JVJA 1TMOA 2JKKA 3HKCB 3WL4A 3MJDA 4JC8A 2W05A 1UKYA 4GOXA 2HW7A 4QRDA 2BF7A 3C3WA 3QPBA 4M0ZA 2MDTA 1K0FA 3QVSA 3QENA 2GLTA 2V96A 2YVQA 1G0OA 2HZBA 1QFYA 5FTOA 3AJ9A 2XJ0A 3QY9A 2EX0A 3H4TA 2ITUA 1HEYA 5I9IA 2G3YA 3NFFB 3S2IA 2CL0X 3CRRA 4DEHA 4MKCA 3UMCA 4C3FA 4H59A 2QSYA 3MCVA 4BCIA 1KZ7B 3E5RA 3FRIA 3P9XA 2W70A 4RMNA 2LVBA 4ZXFA 2HY81 4JFAA 3KZXA 1U9CA 1CY7A 3V04A 4KD1A 4BECA 1IZ7A 2ONLC 1IG0A 2BDUA 4FV8A 1R10A 4MD7E 1MB9A 5ECWA 2PKYX 3AUKA 4O4HA 5AV0A 3FMJA 5IKOA 2B1IA 5HKLA 2R4QA 2NZJA 4EYJA 3PTZA 3F49S 5BV8A 1XO2B 4ZYZA 3EQ2A 2ITTA 2ZIUB 4G25A 5HCXA 3RC7A 2PH3A 1Z0DA 3EG5A 4UZHA 4GOKA 5DH9A 4D5HA 2E9PA 1I33A 4QOJA 3PDIB 2WVGA 5HI2A 1L9XA 1WZ2A 2FZGA 4BHNA 4QTDA 5G2OA 1BN6A 1IXZA 3ZI7A 4EEKA 5C1IA 4S1OA 1Q8TA 2I29A 2JLXA 4LJLA 4DYDA 3DH0A 5M4FA 3OQOA 3Q8WA 4JWTA 3R63A 2CNLA 4YAKA 5EKTA 1EVYA 3F73A 2ATIA 5ICFA 4U80A 4OKNA 2E4XA 3IW4A 1XWIA 3I9V1 4C0JA 2LR0A 4ON9A 1Y4SA 3WLEA 4DAOA 4HVSA 2TMGA 3LOPA 5CEIA 3N7AA 3GK3A 4M36A 4DHFA 4DANA 1WXEA 2QODA 4XCUA 4C2BA 4I7EA 4NU0A 3JU3A 4QM7A 2ZZNA 4K9MA 4QGSA 4RZXA 1TKIA 5ARBA 4OHFA 1Z6TA 2O8EA 1E9DA 3G9XA 3C5UA 4IIJA 4QL3A 2HLDA 1JR3E 3CZRA 4K05A 1Z7EA 2AEMA 3LFNA 2V5UA 3I28A 3ICVA 3MT9A 1JE1A 2BM9A 1TT5B 3UODA 3GH3A 1F4PA 2VJAA 3A14A 5M06A 3HUCA 4ID9A 1P4FA 4Z7NB 1VSBA 5IXJA 1QAOA 4O22A 5DRTA 1FZTA 2I8CA 2QN7A 4Y6LA 1NJSA 2M2IA 4NJMB 1T25A 2X8AA 5J1WA 2BC9A 4EJ0A 4LV5A 3N5KA 5CXQA 2FDXA 5AVQA 4XJXA 3OPYA 2Q5QA 3K15A