5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
1RJFA 4GJ2A 3GOPA 3ENMA 4O0XA 3BLRA 3G33A 2PSQA 5AV3A 2QU5A 5LJJA 4WIHA 2YM8A 3NVKI 5EW3A 4M15A 4BZNA 3F7WA 4YV2A 3QZHA 2YDIA 1Q0SA 4C4GA 3DXZA 2HZ4A 2RIOA 3E05A 5AWMA 2VWYA 1UU8A 3A61A 3CBLA 4DGOA 5H9BA 4P7EA 1Y8YA 4E6DA 1AQ1A 4HSGA 2OW3A 2YTZA 4TY1A 1OGUA 5EEGA 4QP9A 4M7RA 5GWXA 5HBEA 1IXKA 4DZRA 2Y0AA 5JSMA 3FMEA 2W99B 3NW9A 1QPJA 5JQ5A 2X7OA 4R8RA 4HGSA 2WGJA 4PYMA 5EI8A 4FKQA 5HG9A 4L42A 3G8BA 2W5BA 3JPVA 4HCTA 2PZPA 2VX3A 3G5LA 5HX8A 3PVWA 1H00A 4J97A 1H1RA 3FUTA 3BGIA 3OE5A 4NKAA 4FSZA 4EOOA 2C7RA 3G0FA 4F9YA 1VP9A 2YAAA 3HVCA 4I5HA 2AUHA 4Q5HA 4QP8A 4FEQA 3LFQA 3F69A 4P7FA 2JAVA 2Y1WA 4NJDA 2GNJA 4TL0A 1G38A 3UO4A 3GC7A 3HV7A 3GRUA 3KMUA 4GCJA 4I3ZA 5D1JA 2OKCA 2C6TA 2UW6A 3I58A 2RL5A 4WG3A 2PMOX 4RWLA 3CCFA 5IUGA 1VEBA 4IX4A 2IZSA 3X0DA 2FVDA 3CR0A 4FZAB 3DY7A 5K5XA 4DEIA 3BLQA 3FC1X 2F7ZE 2O63A 4RPVA 2CNUA 1X1AA 4AAAA 4DINA 4APPA 4I22A 2KTYA 3E93A 5EGSA 1WBPA 2FRXA 3HV3A 4R7BA 4EC9A 4KBKA 4C4IA 4K9YA 3SAYA 4II5A 3A99A 4PNIA 1EQAA 3E87A 3OUKA 4LL0A 5ICEA 1M7NA 4NW5A 5DOSA 1VL5A 4LMUA 3QTSA 3IS5A 4FGZA 3M70A 1Z5MA 1XDZA 1IAJA 3BU3A 3KQVA 1XXLA 4BBEA 3FXWA 3UPZA 2WIPA 5IF1A 3W10A 1ZYCA 4RTKA 4F9WA 3GRYA 2XVMA 2QOCA 5ICPA 2XBMA 2HYYA 4FTUA 3WZDA 1RJDA 3WE8A 3OOMA 3COMA 4EQCA 3SRVB 5AA8A 4L6QA 3OF0A 3CGGA 1WVWA 4PWYA 4OQDA 4ZP5A 4FV6A 4UOEA 1XVAA 4ER6A 3T7TA 5FCDA 2BDFA 1UWVA 3KXNA 5HG7A 1XH8A 4JQ8A 3EVDA 3ORNA 3V6SA 2PVMA 2C7OA 4IB1A 2XS0A 1O9HA 2WIHA 5BNJA 3TR6A 4A9TA 4LG4A 1PY5A 3NX8A 3CQWA 4EOSA 4DH8A 5HE2A 4HG2A 3E8EA 4NTTA 3AC3A 3W16A 3DKCA 2CJMA 2B52A 4MQ4A 2VO0A 4ZS4A 1VQ1A 2QOKA 3LKMA 3UIMA 4YUWA 4C33A 2GTNA 4IAAA 4O6EA 3S95A 3V5QA 4YZCA 3O7WA 4CV9A 3MA3A 3U4WA 4P4CA 5DE2A 2CCHA 4ZEGA 1FP1D 4AN9A 2RFDA 3CJRA 2IG7A 5DLSA 5LCKA 2G2HA 2VGOA 3PUPA 5J9LA 3S0OA 2JDTA 4FZFB 4MHAA 5EG3A 2AZTA 2JH8A 3MVLA 3PJ3A 2WELA 4PYLA 2PL0A 2HMYB 1JSXA 3R1SA 2IW9A 2A1AB 4HGEA 2XIRA 2GFCA 2HCKA 3LFSA 3A25A 4PDSA 4YJTA 1ZOGA 3VO3A 4ANQA 4U3ZA 4QP7A 4DMGA 4QMYA 4DTKA 4FSUA 4I5MA 2HZ0A 4AT5A 4IV8A 5FQOA 5CF8A 3TG1A 2YM3A 5FM2A 1OL2A 3VN9A 3KK8A 4XG2A 4M69B 2RFSA 3UZRA 1V1KA 4RJ5A 3WYXA 1GOLA 2BMCA 1YKRA 2Y4IC 4UWCA 5ACBC 3DBCA 3O17A 2CHLA 3PZHA 4C0TA 1M0EA 3ZRKA 2OJFE 2XNMA 3KQQA 3P7BA 2ONYA 5IEXA 4KKEA 5J1VA 1OB3A 4C37A 3MH0A 4EOLA 4R3CA 3L1SA 3PXYA 2DWBA 3PP1A 4ALUA 2IVSA 3PG3A 3KB7A 1A48A 4PWNA 2XA4A 1ZKDA 4USDA 3UJ7A 3LJ1A 5AUXA 4CQEA 4I6QA 4QYEA 4FKOA 4XG8A 4G3DA 4QQNA 2ZV7A 2I0HA 2WK1A 4MK0A 3HCAA 3WZUA 4J8MA 2XNPA 4FIEA 2XVAA 2BHEA 2OG8A 3UJDA 3O96A 4PTEA 2REIA 3VBQA 3ZC5A 4CFXA 2XKFA 1W83A 3QU0A 2XK7A 3FZTA 1ZYJA 1KE6A 4CNHA 1X1CA 3UGCA 3G90X 2P7HA 3MQ2A 5FEEA 3VYWA 3F6XA 2UW0A 3EN4A 3G2OA 2Z60A 3PFQA 2LD4A 4JDHA 1OUYA 2P3LA 2JKMA 3G6HA 4U43A 3PTAA 2UW7A 4RQKA 1B42A 3QUEA 4CMTA 1PXJA 3PXFA 4NFMA 2ZDUA 3D5XA 3GBZA 3Q87B 3EEOA 1WBNA 3SRVA 4Y46A 5M44A 3ZDUA 2XYQA 3PVCA 5CEQA 3GB2A 2H1RA 3SA0A 4FT9A 5IQCA 3ODYX 1WZNA 4XOZA 4DG2E 4DLJA 4C2WA 4RVLA 3UWPA 4G31A 5JGDA 1CKPA 1W0XC 1WMKA 1VZOA 5HLNA 2F4JA 5AIKA 2AR0A 4BTJA 2W4KA 3DBFA 3KXMA 4RJ6A 3QRJA 4JR3A 3GUBA 3QKLA 4EHZA 1R0PA 3W8QA 2A19B 3TM0A 4XHKB 5ICGA 2ITPA 2V7EA 3MGGA 1XCJA 5IDPA 3NNXA 1FQ1B 4ZTNA 2WQBA 2XMYA 3RHKA 3QYZA 2QYOA 1XWSA 3NCZA 5LVLA 2BRGA 5CXHA 5HG8A 2Z2WA 3MVHA 3MPTA 4RTNA 4AT4A 3SVZA 3MFSA 1Q62A 3QTQA 3NW6A 3PXZA 2ZYBA 4FBXA 5LVNA 2VWBA 5K01A 4ASEA 3TKYA 4RTOA 4FX3A 2H9VA 3KRXA 3OUNB 2PE2A 3FUPA 5CAPA 5E8VA 3K2LA 3OY1A 2XJ1A 3QZIA 3P97A 2OJJA 1G5SA 3E7PA 1T46A 3Q9ZA 4BCOA 5JN2A 5H3QA 3LQ5A 4ZTHA 4GUEA 4HJOA 3I6UA 3M1SA 2QO7A 5ITAA 3AC2A 3UA4A 3WZKA 5A6NA 4BRXA 3FZ1A 2Z02A 4DCAA 4U41A 4K1BA 3CTJA 1PXMA 4R3RA 3VBXA 3KGAA 5A46A 5LMKC 3P08A 5LSAA 2P2IA 4X3JA 3IGGA 3MN3A 4IWDA 3AXWA 2GB4A 5EDRA 4IC8A 3MIAA 2Y1XA 3TKHA 2AVDA 5C8MA 2BFYA 3WF7A 4I1ZA 3PLAE 5F20A 3UO6A 3TZ7A 3DBEA 4V0GB 4FSYA 2B55A 2Z7SA 1JSVA 5IA5A 3GGFA 4LRMA 5DRBA 3W33A 1BYGA 5DWQA 5JUWA 1JKLA 3Q3BA 3C0GA 4DGMA 3P7CA 2J50A 4OW8A 3LFEA 5FD2A 3GXLA 5DWRA 5L2SA 2XIXA 2H8HA 2UYQA 2C1BA 5E4HA 4QMQA 1H28A 4RX8A 4UV0A 4XUEA 3LM0A 4CZUA 4HPUE 3CLYA 4NSTA 5BW4A 5EDQA 3CS9A 2NXJA 3EL8A 3MW1A 3D2IA 4ACCA 5EHGA 4FIFA 2IH5A 4BYIA 5KHXA 3PYYA 4EOQA 2YAKA 3FI2A 1AF7A 4I5PA 4CFWA 3G6GA 3DLIA 4FV5A 4ZOGA 2JC6A 3D9VA 3NUYA 3VBYA 4BBFA 3P1AA 2YZLA 3IW6A 3UBDA 1YWRA 3C4FA 3C7QA 3EOCA 2OXXA 3KREA 1OMWA 4X3FA 5KKRB 5F2NA 5K8VA 3U51A 4FT0A 2WHBA 4XYFA 1WBOA 2Z7RA 4E4NA 3M6UA 3MWUA 3ER9A 3VJNA 3CEKA 4QMOA 4XUDA 2IFTA 5FTQA 3IOPA 3R01A 2G9XA 3K5UA 3QX2A 4ACHA 5FA5A 2XNEA 1J1CA 3TKIA 3COHA 4C61A 2GS9A 3DNDA 2OYRA 3COKA 3TFWA 3UOLA 3RVGA 4XUCA 2OFUA 3B2WA 1J3HA 4NUSA 1PMNA 3OW3A 1NVQA 4K6ZA 3VUKA 4WG5A 4TWCA 4L3JA 3A7EA 4BLWA 5CSPA 4RJ3A 1PHKA 4MD8E 3C9WA 1REKA 4R5SA 4AN3A 4NK9A 2HV9A 1RJBA 4ZTBA 4CEGA 3ZS5A 3AC1A 5EHYA 5TT7A 4E6QA 4F0IA 3V5WA 2NP8A 2IJMA 3VS3A 5JEBA 1XH5A 1DI8A 3RW9A 4BBMA 5BVFA 4O91A 4RVKA 3EN6A 3ZO1A 3V01A 5T3QA 4OBOA 4DF3A 3UDBA 1FMKA 3FTFA 1PYEA 5KHWA 2VS1A 5CZHA 3DLCA 4BDBA 8MHTA 4DTBA 4DEHA 2JBPA 4ER5A 4J95A 5DA3A 3BV2A 3ZUUA 2G01A 3R04A 4IW0A 1L3IA 2CKDA 1JSZA 5DR9A 4QQJA 4U40A 1XCLA 3PX3A 3Q6UA 4I5CA 2ACXA 3KFAA 3BYUA 4OBXA 5ETIA 4O7WA 2ZIEA 1RI1A 5BUEA 4FSDA 1NT2A 1OL1A 4FK3A 4BCFA 2XK8A 5IKMA 4V0GA 4GBED 4FICA 3LDUA 4P90A 4TWNA 3EIDA 2W1CA 2PYWA 3C3YA 3MBLA 4RX5A 1EG2A 3KR9A 3MA6A 4WUNA 3VVHA 3VRZA 3HMNA 2CMHA 3OFMA 4WNKA 1WS6A 3TKAA 2VTQA 5EM5A 2JLDA 4PGGA 5A4CA 4LRKA 4R6WA 4HZRA 2GDOA 2ITVA 3QL8A 4CD0A 5IA2A 5A4TA 3HCDA 2OICA 3TIZA 4L8MA 5KE0A 1O6YA 2AN3A 4GFOA 3RPSA 5B0XA 5IPJA 4AA0A 3A7GA 5D12A 2RG6A 3NNUA 2F7EE 4KNBA 2PGXA 1SZMA 4ZJVA 4KRCA 2W05A 4D9UA 5K0NA 2PTKA 4W4WA 3NWEA 4E70A 1PRYA 4DEEA 4DA4A 4FKJA 3TACA 3BCEA 3NPCA 3NUSA 3FTDA 3MDYA 5FULA 2IVUA 5E9QA 3A7IA 5EQPA 4FYOA 2VTTA 4OBPA 3LQ8A 4V01A 4W4YA 4ZTQA 1JG4A 1PXPA 4G5JA 2WMTA 4OQEA 4FE2A 1ZXEA 3S00A 3LBYA 5HE0A 1GZOA 3OWKA 4XG7A 5EQEA 4JDIA 2G70A 3IW8A 5AADA 4GEOA 4RZWA 5E91A 3ZH8A 3HLLA 3C0KA 2VWZA 3C4EA 1FOTA 4FIGA 3QTRA 4L7VA 3GCQA 3HDMA 4RQVA 3FHRA 4O7LA 3BWJA 5K0GA 2GH1A 3JWGA 2P4IA 4IB0A 1Y57A 3TPZA 3W32A 2QNJA 2VTLA 5KZ0A 3NIEA 4KUJA 2GSFA 4TNDA 4RWKA 4FSNA 3NUXA 3FYDA 3IV6A 3BU5A 2O3PA 2IBTA 4S33A 1Z3CA 3RK7A 3ER8A 5C01A 3H9RA 2YABA 3QLFA 4TPTA 3IYLW 3CKXA 3DDQA 3FPEA 2YCFA 2XEYA 4YR8A 4PIMA 3L8XA 4XP0A 3DNEA 3LECA 2R3KA 4RIWA 3M42A 4XG9A 1CM8A 3FWQA 3NS9A 2EX4A 3N4TA 4RMZA 5CVFA 3PZEA 5AAFA 1QAOA 3MI9A 1Q3DA 4L53A 2DS1A 4E5BA 3WOWA 3M6WA 3BHVA 3GNLA 4O0WA 2EXCX 2VO3A 5DRDA 2ITNA 4R5YA 4I4EA 2W96B 3ERCA 3MB6A 4R1YA 4RTPA 3TMAA 4RC3A 3ZXZA 3EVGA 3KY2A 3RCJA 4CFNA 5HIKA 4AUKA 3MH3A 2JKKA 3LFNA 2J0MB 1VJYA 3OOGA 4L3PA 5A4EA 2JG3A 2NO3A 2XIYA 2RFEA 3G89A 4UEUA 3THRA 3G5DA 4ZSGA 4EKGA 4PP9A 4X1OA 3LHDA 4NL0A 4YMJA 1KWPA 4X2JA 3R8ZA 2BHHA 4JQEA 3KR2A 4EI4A 5J9ZA 3FMNA 2XUUA 4BCGA 4ERKA 2CWWA 3QGWA 3TOSA 1ZRZA 3NYNA 5EDPA 4UXQA 1ND4A 5DG5A 3SLSA 2ZB1A 3BI6A 3UZTA 3H4JA 4K18A 3R22A 4ONAA 3GU8A 3PTGA 4YBKA 5CLPA 3ITZA 4FIHA 4GK4A 5HLPA 2Y9QA 3KVXA 3G2QA 4PX6A 3CD3A 1V39A 4BICA 2W4JA 3DMFA 3HUCA 2PMIA 2BTRA 5CWZA 2XK9A 5DR2A 3Q2JA 3PIZA 3W2QA 4R77A 4RTMA 4TYEA 3P9KA 1FMOE 2EWAA 2FB8A 4IADA 5HIBA 5M07A 5IMEA 3C5UA 1KUTA 1OM1A 2KW5A 4O86A 4IH8A 4PP7A 1NA7A 4WBBB 5EOLA 1QYRA 3FY2A 3PPZA 4XP2A 3FE3A 3Q32A 2OF2A 3O8UA 3VSEA 4EVIA 3MIYA 5M4CA 3R63A 1U54A 4KD1A 4PNKA 3UNJA 3PA4A 4EONA 4EH4A 5ETCA 3OEFX 3FQSA 3BGPA 4JVGA 3TM4A 4Q5EA 2W1GA 1X1BA 3S4QA 2YM4A 5EW9A 4BTKA 2YFXA 1KPHA 3TRKA 5HU3A 1OR8A 3F5UA 3OWLA 3OFKA 2PZ5A 5E8YA 3A4TA 4E32A 4QP1A 1M6EX 3KC3A 2B0QA 3TNIA 1GIIA 1UNHA 4F9AA 2IVVA 3ANXA 2J2IB 5DFPA 5M51A 3FI3A 5ETFA 3DTNA 3HKOA 4FNWA 4XOYA 4YJPA 3BHUA 5AV1A 4ER0A 1PKDA 1XHAA 2WEVA 4WUAA 3DCVA 1VPTA 3II5A 3MFTA 4BLVA 3Q9WA 3ROCA 5D10A 3A27A 3I1AA 5CEKA 1EAMA 3MVMA 2ZV8A 4N70A 2C6KA 4B99A 3KPVA 3E92A 2OSCA 2UVYA 3REPA 2WU7A 2GQRA 2C6OA 1LPUA 2G71A 4O0VA 4EOIA 4I6HA 4TYHB 5LVOA 2AS0A 4RC4A 5IA4A 2BTSA 5LMBA 4BDDA 4F0FA 2YHVA 4FT4A 1WBSA 2ZV2A 4C35A 2GS2A 5AJQA 2IWIA 2P0CA 4XEYA 4E33A 2QOHA 2A0CX 4EMSA 4YZMA 3EH9A 4JXJA 4DN5A 5KCVA 2WMVA 2ITQA 3BHYA 5K03A 2OXDA 3UODA 5EYDA 1K9AA 3DB6A 4PYQA 2HWPA 5E8ZA 1TW2A 3DDPA 3NGAA 3QD0A 5IG1A 1JOWB 1PW2A 3QX4A 3E7OA 2JJQA 3RHXA 3Q4UA 3FSFA 3H2BA 3EN7A 2DPMA 3TIYA 1YOLA 4OBWA 4MXYA 3HVHA 4EYMA 3KKVA 5F1ZA 2YM5A 1Q61A 2PV0A 3CE3A 4FNYA 5DHJA 2WKMA 2GHLA 5JKGA 4D55A 3T9TA 4JIKA 4NIFB 3DPKA 4FTNA 4FKRA 1ZOEA 4GS6A 3IW4A 3B5IA 5MHTA 1TPYA 4EBVA 3QHWA 3G7UA 10MHA 2XRUA 3OWJA 1BKYA 2VDUE 1JQEA 1APME 4RVTA 1JG3A 3DUWA 3KN5A 2QVSE 2PKWA 3UOKA 4OTDA 2B9FA 4BCMA 4J8NA 5CSVA 1M17A 4CVAA 3BZ3A 4M68A 4AOIA 4TYGA 2CGVA 5G1XA 1BL6A 2VTIA 4F6UA 5GIOE 4FEUA 4I0SA 3QTZA 1OPJA 3SXJA 2C5YA 5IUHA 1IY9A 3LMGA 2QOIA 2B3TA 3JS2A 4IKPA 2WD1A 2FSMX 1SM2A 4E20A 3AMAA 3SM3A 5EKOA 4C08A 3EKKA 2AOTB 1GZ8A 5HZNA 2BZIB 3F82A 2WOTA 3KMMA 4FTRA 4DH7A 5L2WA 4C03A 3CQUA 2BAKA 5DM2A 5FEQA 3Q53A 5GM1A 3UJ6A 4F7LA 1L8TA 4L68A 2PUIA 3MTIA 4M0ZA 2OJ9A 5EMKA 4R8SA 4RJ4A 4U5JA 1OITA 2J9MA 4Z55A 2FHPA 3NSZA 3LFDA 2ZVJA 4JX3A 3AMBA 3EVFA 1FP2A 4S32A 3COIA 3EYGA 4FSTA 4MBLA 3DFCB 1U5RA 4GJ3A 3V8WA 3K6RA 2WFYA 2ITZA 4YV0A 3ZZEA 2YVLA 4U80A 5HIIA 4WO5A 4AW1A 4HVHA 4F70A 4CSVA 2QC6A 5EYCA 4GK3A 3DZQA 3LGAA 4EH5A 4TYHA 4QYHA 1G3NA 3OXZA 3P2IA 2XIZA 1VLMA 3ULZA 3OCTA 3JVRA 2X9EA 5CEOA 2EJTA 3PVBA 3C1XA 3TZMA 1SNUA 3DZOA 4GRBA 3F88A 5AP2A 4FL3A 4DEDA 1YDRE 1STCE 4MEDA 4TKSA 5H8BA 3L9NA 3DMHA 2XZSA 3C51A 1HCLA 3D15A 1JSTA 4HYHA 3OS3A 4AFJA 3R0TA 2UZNA 4MYGA 4G3GA 1XH4A 1ZY5A 3D94A 3RPOA 1WCCA 3HX4A 2J5FA 2GU8A 2BZHB 1NW3A 2HIWA 2G1TA 3LCKA 4JR7A 1MRYA 3OZTA 3EWHA 3DXYA 1U5QA 3OU6A 2Y8OA 3WYYA 1I09A 3NIZA 5HO7A 3R0QA 1TQPA 4CFVA 4I21A 3AJDA 4U81A 4FKSA 4MXZA 2CSNA 3DXQA 4KW7A 5CENA 4QVGA 2CMGA 2IDJA 1H1PA 1FVVA 3ROYA 4MTAA 2ZIGA 4FODA 3IG7A 5TF9A 5CVHA 1OL6A 2X9FA 4MAOA 3RALA 3DOGA 5K05A 1R74A 3QC4A 3R7YA 5BVWA 2VTAA 2ESRA 3IOKA 1LR4A 4YZDA 2YWPA 3C50A 1LUFA 3F4KA 4Y2HA 2XK6A 3MH1A 3R28A 4U42A 5C1IA 4X63A 4DBXA 2F7XE 1R8YA 4BDFA 3MESA 1AQIA 2Y7JA 3ZYAA 5E2AA 3E8CA 4WBOA 4IFGA 4MBIA 3DKGA 3ZO3A 3OT3A 2OO8X 4K8AA 3ZLSA 1FPQA 5M5BA 2HXLA 2W0JA 4WA9A 5J7HA 3UP7A 5IH5A 4QPAA 1XR1A 3QUDA 3RJCA 3UO5A 5LR6A 3L9MA 4W4XA 4E31A 3SW7A 2AN5A 4Z2YA 2OY0A 4QMNA 4AZVA 3L8VA 4WG4A 1QPCA 4WXHA 5IUIA 1R18A 4EH6A 1NW7A 1GZNA 4DA5A 2BRBA 3GU7A 2CPKE 1WFCA 2IBSA 4IE9A 5HCYA 5FTOA 3KN6A 1YI6A 2C68A 4S34A 1J1BA 5AA9A 4XH6A 2ITUA 5F9EA 2QD9A 5BMSA 2B53A 3EKNA 2JFMA 3DQWA 4ACGA 4D4VA 3QXPA 1YXUA 3O51A 4EK9A 3DQXA 4EUTA 4FKTA 1XJ5A 1X1DA 1WVYA 1P1CA 3MS9A 4J96A 2ONLA 2VWWA 4RRVA 1L3CA 2QKWB 4F6WA 5C27A 5BYZA 1F3LA 3VRYA 3LLTA 1DM2A 5FWAA 4I6BA 2G1PA 4BGGA 5FXSA 5K0EA 2BUJA 3MGYA 2W1DA 5KBRA 4YMGA 4FTKA 3QCSA 4EBWA 4NM3A 4PTCA 1N2XA 4POOA 4E73A 3FL5A 3L8SA 2W7XA 4G3FA 2X8DA 4H58A 2CCIA 4USFA 2HY0A 2HR1A 5KX8A 4MF1A 5CF5A 3VULA 5EOVA 1XH7A 4O81A 4KS7A 2WA2A 5L2TA 2IGTA 3W2SA 4TYIA 1O9GA 4ENXA 5CT7A 3FTCA 3JXWA 3MSSA 2XBAA 4GQBA 3NZ0A 5JQ8A 4O96A 3FUXA 4LL5A 3QKKA 4AU8A 3R9XB 4ASXA 3LXNA 5KKRC 4QTUB 1JKKA 4QP3A 3D7ZA 5IEYA 3QOXA 4XV3A 1SVHA 2WO6A 2ZWAA 4Z16A 1XH6A 3C6MA 4O7VA 1M2PA 4Y8DA 2GNFA 4A9SA 4DTAA 5A6OA 2ZVAA 5L6WL 2Q0NA 3FY0A 3N51A 4B17A 5L6OA 1QZZA 4CFUA 4ITIA 5KBQA 1NV9A 3HZTA 2YERA 1ZLTA 2F2UA 4MCVA 4M7IA 4H05A 4TNBA 5CVUA 1W8CA 1L9KA 3HMOA 3ORXA 4U79A 3U6JA 3HA3A 4GFGA 4FL1A 3MY1A 4XJ0A 5EMJA 4Y83A 2C1AA 4DT8A 2WMBA 2W1ZA 5JZNA 4LGHA 3SXFA 1R39A 3CJQA 4O0RA 4D2SA 1OIRA 3G0EA 4FSXA 3SVVA 2YM6A 3KPYA 3E3BX 4RIYB 3CD8A 4QP6A 4IVAA 5K0CA 4IZ7A 4JAJA 2CLQA 2FK7A 3IECA 3U55A 5E8TA 4KA3A 4V05A 2XKEA 4YJQA 4KBCA 4RWIA 4BDKA 3FMLA 3LMIA 3PS9A 3IO7A 4MD7E 4AG8A 4I20A 3R6XA 4MIKA 4G6LA 3PWDA 3KA0A 3NUPA 3ELJA 4Y85A 4L00A 3UVRA 2XKDA 4L3LA 4FR4A 4FS8A 5DT0A 3TUDA 2QONA 5IDNA 3UNZA 4H3QA 3GP0A 2XF0A 1IM8A 3FUUA 3SGCA 5K9IA 2F2CB 3CGFA 3PWYA 5HD7A 4UY9A 5HVYA 3RINA 5E8UA 3IDBA 4A4XA 4RA4A 3EZVA 4LWOA 2Z6QA 4FTJA 2X8EA 3CPCA 4YC6A 3REOA 4DH3A 3R8MA 3TXOA 3BEGA 1B6CB 3PB3A 4RG0A 2JDRA 4BI2A 5LQAA 3VW6A 5FUTA 1P91A 4UYAA 3W8LA 4OLIA 1KPIA 3Q6WA 5T67A 4PMTA 2PK9A 3NLBA 4F7SA 3H0YA 3R9HA 5FDPA 4D4RA 1X19A 4IEBA 2CLXA 3A4OX 1YZ3A 2JHPA 2XRWA 3FLYA 5EM6A 2F49A 3HM2A 4D4SA 3HP7A 4M36A 1DUSA 2E9OA 3HMPA 4TRLA 1YVJA 3IONA 5LWMA 2V74B 4O38A 3DA6A 3BWFA 3HNGA 4FMQA 5EFQA 2IH2A 3JWHA 4R1VA 1JTFA 4RFMA 5FWDA 4O84A 4BCHA 5GOZA 3RKBA 3UG1A 3A60A 3A26A 3TV4A 5JFSA 4BYJA 4DFXE 1Z9XA 2P55A 3R9DA 3VIDA 1RI3A 4PV0A 3ZUTA 4PRJA 1VR2A 4GT4A 1N7JA 3TCPA 4ZAUA 3F5PA 4AQCA 4H36A 4QYGA 4U8ZA 1PXKA 2X7FA 4CT1A 2C47A 4IJPA 3QKMA 1M2QA 4KINA 4J98A 1UWJA 4PY1A 2C7PA 4FV1A 3BQCA 5AP5A 4IAKA 4C2VA 4TXCA 2O05A 4AS0A 1EJ6A 2ZBRA 5IMXA 5E1SA 2WQNA 4P5QA 4ZK5A 4PCLA 5IQHA 4PUZA 3GU4A 5BVDA 3T0IA 4BC6A 2ZULA 4PNEA 2R3OA 4IX6A 2HWKA 4EEVA 4A9UA 3E8DA 2GNLA 4RIYA 3EN5A 5DYJA 4EHGA 3BRBA 2X81A 3LLAA 4QO9A 1WVXA 4NW6A 5JRSA 2GQSA 3RMFA 2C5VA 3RGFA 3TDVA 3A8XA 2PUNA 3PSDA 4C06A 2ITXA 3VS1A 2W5AA 4E2YA 4WOVA 1JVPP 3LE6A 3DLZA 5IA1A 2VU3A 4QMPA 4YTCA 4D1XA 3VBWA 2OI4X 2W4OA 3UFBA 2OIQA 4M97A 4OTGA 3ZCLA 4I41A 1JWHA 2HAKA 2VO7A 1PXOA 1CKIA 4FKPA 3RNIA 3KQOA 4QYFA 5C0OE 5JGAA 4JX7A 1Q8UA 4OBQA 3KEXA 1P2AA 2R7BA 2CN8A 3DV3A 3BELA 3GCPA 2R3PA 3GC9A 3BUSA 3FLSA 3FXZA 2R2PA 3PFHA 1DS5A 3SW4A 5AP6A 4IJ9A 4YGAA 3L9LA 1JKTA 4EOJA 5FP6A 4ZSLA 3ORLA 4QOXA 5CAVA 3GDHA 1JAMA 3EVZA 3LM5A 5ETAA 2JHAA 1NVRA 5HIJA 2PX5A 3R73A 1RI2A 2CNVA 4L7FA 3DBDA 4O0SA 2OB1A 4P58A 3RCDA 4JRVA 3EMGA 1OIQA 4FEVA 4YNEA 4A6EA 2GHMA 4X2NA 1H1QA 3FZGA 4MXCA 3ZHPC 4M37A 4KIFA 5GINE 3QCYA 1FPUA 3MY0A 2A2AA 3ERKA 1ZQ9A 4C07A 3C0IA 4XV2A 4EOKA 2XM8A 4L45A 4G9CA 3R1QA 2GQGA 3QAME 1OKVA 3D7TB 3UIBA 1WZYA 3THBA 4O7ZA 3ORZA 3MY5A 5AAEA 3UOHA 1J7UA 3DR5A 3BWCA 4GT3A 4YZNA 1A9UA 4X2KA 3SV0A 3P8ZA 3R7VA 4LWPA 3TUCA 3EGEA 4JBPA 1UU3A 3V3VA 2ZWVA 5J9YA 4MWIA 4QTCA 4D4YA 5M56A 5GJDA 2C6EA 2IZTA 5HQ0A 3I5NA 3AGMA 4ER3A 2PY6A 1G8SA 3LCTA 4BDJA 3CP9A 3RAWA 3C4WA 4GKIA 4L46A 5EHLA 3I0QA 5F2OA 1GZKA 4QMXA 1H8FA 3LFCA 4DFZE 3DXPA 2Z7QA 1ZMUA 5CVGA 4EK5A 4HYSA 2GNIA 3ZONA 4L67A 4M3QA 4MD9E 4X21A 4GT5A 3PIYA 4LOPA 4FSMA 4HOKA 3CXWA 2JIUA 3U9CA 3ZSHA 4ACMA 1RJEA 2ORED 5DNRA 3LCUA 3ZOSA 2QRVA 5B2MA 3I53A 3ZEWA 4LECA 5HX6A 1T43A 1ZG3A 2PUPA 4ZSEA 2C6DA 3F3ZA 5I9XA 5EVJA 4GV1A 2UV2A 4IBMA 1R8XA 4PDOA 3L8PA 3UP2A 5IQAA 4CV8A 2C5NA 5HD4A 4IC7A 3FLWA 2H6DA 4PYJA 2NP6A 3V5LA 2W1IA 3CSVA 4C36A 4FTOA 1R6AA 4O7RA 2HZIA 3E64A 5I9VA 4IM0A 1G6Q1 4NCTC 4YV1A 4AGCA 3EQFA 3UG2A 5EYMA 3C13A 4NM7A 4AW0A 2UZEA 2UW5A 5L8KA 1H1SA 3ZSIA 2ERZE 3GT8A 2R7IA 5K4IA 2QOLA 1XH9A 1YHSA 4J71A 4ZS0A 1GNGA 3C4XA 4IZAA 3PP0A 4IMYA 3S1HA 4YUZA 1YOJA 2I0YA 2XB7A 1QMZA 4G16A 2ITTA 3RPYA 1ORHA 3ACKA 5FM3A 3UQGA 2UW3A 1NY3A 4G1WA 1EJ0A 4FZ6A 2HWOA 5KMIA 3AC4A 5EHOA 4DCMA 3T3UA 4RX7A 2C7QA 1H1WA 5CAQA 5CSHA 4EH8A 3NDMA 4JG8A 3GFWA 3EVAA 3ID6C 2FGIA 5FQNA 2YCQA 3QRTA 4YJSA 4ISCA 3D5VA 3BIZA 2YJSA 1NKVA 5EZQA 1YOMA 3D7TA 3FI4A 4BCPA 5BVOA 4E6AA 1W84A 5M53A 4YMHA 2XJ2A 4EORA 3T7SA 3OP5A 3HVJA 1PXNA 3P23A 3A7DA 5B7VA 5E1EA 4ERWA 5D7VA 4U97A 3W2RA 3GFEA 3OT8A 4YU2A 5KYGA 3KKZA 2FSTX 4C4FA 2IH4A 4MBJA 3Q5IA 3NCGA 3SSMA 2X1NA 2XYVA 4FEWA 2B7AA 3EQCA 1I9GA 4L9IA 2VGPA 1BHJA 2QY6A 4EK4A 2G2FA 3TZ9A 4IVDA 2OJIA 5C1QB 3UZUA 1SQGA 2ZTHA 3WARA 2ETMA 1ZMVA 3ANQA 2LGCA 5DM0A 1HNNA 3LCVB 4YJOA 1QCFA 4CZTA 4ENYA 1RW8A 3HDNA 3EGVA 4YTHA 5CEIA 1ZYDA 2PWLA 2BAQA 3WF9A 3KF7A 2K4MA 4B8LA 5EK7A 1MQ4A 3NYVA 4FKGA 4DH5A 3HVKA 2PHKA 3CCNA 2ONZA 2ZFUA 3QGYA 5KO1A 5LQJA 2YIRA 3I60A 3O2MA 5KZIA 1ZZLA 2BH2A 4BCIA 1O54A 3QTXA 4C3RA 4BI0A 2HY81 4JRNA 3V5TA 3FRHA 2FYTA 3QYWA 1VP3A 3FUWA 2UUEA 3FYCA 4GMYA 3SDJA 3UA3A 4G2FA 1UU9A 3MPMA 4UXLA 5DH3A 1T45A 5EM8A 1AV6A 2UZDA 4X7QA 4RVFA 4Z9LA 3BGVA 4TWPA 4KWCA 3TWJA 3ELDA 1KV2A 4DKJA 4LOOA 4XLIA 3BGDA 4IZYA 4FT7A 1ZYSA 5DRTA 1JQ3A 3BBTB 2IW6A 2Z6UA 2Y6MA 3SXSA 1Q41A 2PXAA 2VX1A 3EQRA 2AC5A 4BI1A 4QMMA 5IA0A 4QMUA 3MTEA 4RTJA 5C9ZA 4QP4A 1PF8A 1RI5A 2ZBPA 5IH6A 4I24A 2EB3A 2C3KA 3HCBA 5IH3A 3HA7A 3QC9A 4ZSJA 2BIYA 2I6LA 3I5ZA 2ZV9A 2VTJA 1JQHA 3E8SA 3GC8A 1FJXA 3BKXA 2GMXA 5EQYA 4HRAA 4HH4A 4JBVA 4IWNA 2E9VA 4ANBA 1GAGA 4KBAA 3KMWA 3G15A 3MJ2A 2IP2A 1URCA 3R6TA 4OT6A 4JDJA 2NXNA 2EB2A 5KMKA 3PDTA 1P14A 4BTFA 2X6EA 2PVLA 4MHTA 4Q2AA 3ZFYA 4O29A 2QODA 3I0OA 3KXHA 5M4FA 1IASA 2B9JA 4OA8A 5CTPA 1OIUA 2VDVE 4TTHB 3FV8A 3WI6A 4FV4A 4FTMA 2CKEA 3PRFA 4JXFA 5HZMA 4X3FB 2GA9A 5EOBA 3TM5A 3UTOA 2J90A 3SD0A 2OF4A 2C0OA 4X6RA 5CQWA 3Q4TA 2BRNA 5CU3A 4PMPA 3VQUA 1H27A 4I23A 3ORPA 4ZY6A 3EZRA 1OI9A 4AACA 4AUAA 1UFKA 5DT3A 4CG9A 3EFWA 4IWOA 3HRBA 1INLA 4EHVA 5FTWA 1KOAA 1KSWA 1JSUA 3KXGA 1NW1A 1YQJA 4XS2A 4DYMA 2Z6AA 3ZEPA 1UWHA 4X2FA 4QMZA 3B8RA 4BN1A 2ZZKA 3PA3A 3TTJA 2QKRA 5M06A 3CJFA 3BT7A 1M2RA 4L7SA 4QQCA 5CALA 4M67A 4OTFA 4AZFA 2PE0A 2P41A 3LFFA 4FV0A 3OCSA 1P39A 4BDEA 4E7WA 1RE8A 5E8RA 5DT4A 4AT3A 1M52A 2PVYA 4ITJA 4NU1A 2V55A 4IQ6A 3TTIA 2VRXA 5D41A 2UW8A 4YPDA 4NZWB 4QPNA 3GCZA 5I9UA 3CBGA 1BX6A 3ATSA 4N57A 4NFNA 1G55A 1Y6BA 2XNOA 5BW5A 1ZARA 3V97A 4QPPA 5LMKA 1KHHA 4UZHA 5DN3A 4CXMA 5DTRA 3DJ6A 2PXCA 4RIXB 4PYIA 2UYCA 3V5PA 3PX2A 5HILA 4RJ8A 2JDVA 3QRIA 2GPYA 4KIPA 3FEGA 2H96A 5HTBA 3B3FA 3BYVA 5A9UA 3MB5A 4E30A 4GOND 4KIQA 3WZJA 2B9IA 1NV8A 3GU6A 2CDZA 3RK5A 1YI4A 1QPEA 4O7TA 1A06A 4H1MA 1R78A 5HEKA 4XV1A 3GOKA 4FV9A 4I92A 2HW7A 2BZGA 3JWIA 3U8WA 5LVPA 2C6MA 5ANKA 1UNLA 5K0BA 3UMXA 3KRWA 5GJFA 1K2PA 1PKGA 1KYWA 5E1DA 4YZ9A 1RJGA 4IWPA 4ATNA 3LOKA 3CC8A 3R8LA 2XBJA 3WBLA 3B3JA 4KB8A 5TR6A 3H10A 3EQBA 2ZBQA 4RVMA 4GC5A 4GC9A 5IQIA 1NW5A 2PPQA 2QU6A 4RWZA 3ELUA 4QNAA 5EG5A 2PZRA 5I9YA 1SMHA 4IM3A 4FV8A 3DB8A 4A07A 5H8GA 5C8NA 4WNMA 3BV3A 2H11A 4NT4A 3R2BA 4HVGA 2BIKB 3QZGA 5EHIA 4ZLZA 3CKKA 1YRPA 1H07A 1OPLA 4NH1A 2Q41A 4YPSA 4EOMA 5CU6A 5DVRA 2FPOA 2YJRA 3RODA 4DH1A 2PULA 5LQNA 4FK6A 1BUHA 1Y8CA 3SX9A 5AV4A 4DFLA 4EZ7A 5HHWA 2WXVA 1IG1A 2QR7A 3VUIA 3R02A 3C3PA 4RLKA 4GUBA 1F3MC 2NPQA 2YUIA 3MB7A 1RI4A 2HK5A 5KVAA 5DBXA 2BROA 1OVEA 4G56A 5E8XA 4OTRA 4DITA 2QOBA 2WMRA 4D5KA 3KPJA 5M09A 2ITYA 5AFVA 2BR5A 4R3PA 3PY3A 2QURA 4ID7A 3VHEA 3BWBA 5FHRA 1LEWA 4MKCA 4WKQA 3RPVA 3U6IA 3QWKA 4JBQA 3NR9A 5JMSA 3R83A 4J1RA 2VN9A 2J4ZA 3GQIA 3PY1A 1FBNA 3HCFA 1YFJA 4FZVA 3QZFA 3B7PA 4RZVA 2XH5A 4E4XA 4NJ3A 3I7BA 3U6HA 3O0GA 4RIWB 1SQFA 4F84A 2BALA 5HLWA 3D2KA 2WMXA 1Z57A 4NM5A 5CU0A 4RIXA 3S3IA 2JFLA 3JYAA 1OL5A 4QTEA 3TJCA 3DK7A 3MTFA 4MQ2A 5GIPE 2R3FA 2R3SA 4I93A 1FINA 1XQZA 4TW9A 5DGZA 4U3YA 3UQCA 1F38A 5ICCA 2EU9A 4YC3A 3IDCA 3MJ1A 3ANRA 2PU8A 5J95A 2IN6A 2W9FB 4DBNA 1E9HA 4RJ7A 2ITOA 2WTVA 1YWNA 4F85A 5E9JA 3ORTA 4HNFA 5AIRA 1NE2A 1YDSE 4GG7A 4PDPA 2B25A 3G9LX 3IW7A 2DULA 3V51A 4OTIA 2PX2A 4M8TA 5I9ZA 4ZSAA 1H08A 4M14A 5E8JA 3TNWA 2XK4A 4E26A 2O64A 4ACDA 1YB2A 4I4FA 3BE2A 2VAGA 4ZZNA 3HA5A 3OZ6A 5LMAA 3H9FA 2IVTA 3ZLXA 1U59A 4GIHA 4C58A 3PG1A 2O07A 4FV7A 5LCJA 2NXCA 2NXEA 2QOOA 4RFZA 2O8YA 1YHWA 2CGWA 1VIDA 4XCUA 4YUVA 4HYUA 1PMEA 4N6YA 1RQQA 4XG4A 5HI2A 3PXRA 3RZBA 3EQDA 3KU2A 4CRSA 3TV7A 4IDVA 3SR4A 4J7BA 1L1EA 4RVDA 2W5HA 3FJQE 3JUHA 1TKIA 1B38A 4S2ZA 4B4LA 2UZBA 5LQKA 1V0PA 1MJFA 3ZU7A 3R8UA 2Y6OA 5FRIA 4LV8A 4FC0A 4KS8A 2CN5A 3KQYA 4ZTSA 4AZEA 2CGXA 5CNNA 5AV0A 3DFAA 4OT5A 3G88A 2YR0A 4IWQA 1U54B 4BVUA 5DT2A 3R3HA 4RC2A 5F2KA 4MX9A 5K0JA 5HORA 1Y91A 3BQRA 4QMSA 3FPGA 2PWPA 4EOPA 1ZZ2A 2VZ6A 3QXOA 4YJVA 2UZTA 4EZ3A 3OTUA 2R3MA 1Q8ZA 5D7AA 2VWXA 5EQJB 2BRMA 5H2UA 2C4GA 3P71T 3QRKA 3V6RA 5EKUA 4FZ7A 3NJRA 2I0VA 4HVSA 5LQCA 3P86A 4FSWA 3LAUA 3RP9A 1F0QA 4C05A 2RFNA 1H24A 5FHQA 5DR6A 1S9IA 2WTKC 5FGKA 3O71A 3KCFA 4F64A 3FLZA 4O7NA 4F86A 1YI3A 4EH3A 2RGPA 3ORHA 5CZIA 2P33A 3IQ7A 4UWYA 3DKFA 4XV9A 5JGBA 3KR1A 1SUIA 2NP7A 4RT7A 3D83A 5HBHA 3NAXA 4IB3A 3C0HA 4LM5A 5ANOA 4TZRA 4FR0A 3UZPA 3P7AA 4CFFA 5J5SA 3VW8A 2VDWA 5DSTA 5KMMA 2P40A 1ZMWA 3BWYA 3Q2MA 4RSRA 2BKKA 3BYOA 3R7EA 2R64A 2JKQA 4F09A 3CQEA 3O7LB 1MRVA 1H25A 3CIKA 3F5GA 5EM7A 2QLQA 4JOAA 2PZYA 5AM7A 3E8NA 2OXTA 4C38A 3GRZA 4YLLA 4BY9E 2YQZA 5LOHA 3R7UA 2N47A 2YIXA 1TQMA 4PTGA 4G34A 3POZA 1SVEA 2YZAA 3Q7EA 4BKJA 2EJUA 1XDUA 5JFVA 2W17A 4DFBA 4UWBA 5HU9A 3BWMA 5AX9A 5C26A 3NUNA 4D9TA 3V5JA 4YTFA 4JIAA 2OK1A 2VO6A 3LKDA 1YXXA 2P3OA 5IQDA 3WIGA 3MV5A 4EQUA 4CXAA 3F3TA 1SKMA 3FKNA 3NNVA 4B0GA 2QR8A 3BKBA 2CKPA 4IVCA 4JT3A 3RWQA 4FI1A 4CKBA 2UYOA 4F65A 4O2PA 3C6KA 4QMTA 2HZNA 4GSBA 3HCCA 3WZEA 3DT1A 3WF6A 4C62A 1JG1A 1U4DA 3EQIA 3TJDA 3EMDA 3OCJA 4EQZA 3D14A 3KR0A 2A4LA 3UJBA 3HGKA 4HVDA 4PYNA 3MFUA 3ZM9A 1PJKA 4WRGA 2PT9A 2O0LA 3CY2A 3QQUA 2EXMA 5FUBA 2R0UA 1REJA 2RF9A 5CI6A 4BHNA 4CG8A 4YP8A 1SNXA 4PL3A 3OWPA 3AGLA 4DE4A 3B3GA 2BRHA 4IB5A 4KRGA 5FXRA 2WZJA 4PCAA 3JVSA 3R24A 4BTMA 1OPKA 2WA1A 2ADMA 5G02A 2OH0E 4E5AX 3QQGA 3RAKA 4N6ZA 3BXOA 5AUTA 4CKIA 3SHEA 1L3BA 1MQBA 3VC1A 4D0WA 4AOTA 3EQPA 3O23A 3B8QA 3F3UA 3LPMA 4I0RA 2C69A 4K6MA 3FTEA 4JAIA 5DLYA 2PVFA 4IHPA 5A4LA 3TEIA 3SKCA 4G6OA 2AVNA 2ZM4A 4MXXA 3D5UA 1YWVA 4J52A 4F9CA 3QTUA 4C7TA 3AQVA 4ANLA 3GO4A 1W98A 3CTHA 4ASDA 4BLUA 3A2CA 4EHEA 4NECA 4PYOA 4ORKA 4M12A 4CMOA 5IQBA 4DAWA 1H26A 5EH0A 4CTJA 4E2XA 1G60A 3R1NA 3ET7A 4AOJA 3DLSA 4RBLA 3P2KA 3KULB 4GG5A 2F57A 2OZAB 1DAYA 4EH7A 4GEKA 1H4LA 5D11A 2CGUA 4FKWA 2C3LA 3HV6A 3DKOA 2H00A 3VUDA 3TUBA 1CTPE 3FZPA 4ASZA 4HGTA 2OU7A 5BYYA 3TQSA 2YISA 4JS8A 3HECA 5DSXA 4EYJA 4F7JA 1IEPA 3FPJA 2WAJA 4HPTE 4BDIA 4DFYA 4C3FA 3F7ZA 3DXNA 2PZIA 2V7OA 5B2KA 2C0TA 1BC5A 4DEGA 4DG3E 4LRJA 1Q5KA 2YCSA 4UALA 4G17A 1OUKA 2AYPA 4B6LA 3I6WA 2WMSA 2OBFA 1FGKA 3LQ3A 3BGZA 3SSNA 4PONA 3LVPA 4FVRA 4NTSA 3FHIA 3SOAA 3HP2A 3T7RA 2J0JA 2X8IA 5DX1A 2OO3A 5CM2Z 2GFSA 4GOLD 4GKHA 2PWYA 3FC2A 1Q97A 4FL2A 2BR1A 4GK2A 4PYKA 3NWWA 2RKUA 2QE6A 4JG6A 3ORKA 4MXAA 3ZLWA 5E1MA 3QV2A 4W8DA 3FZOA 3EVEA 2QHMA 4O83A 3FYJX 4H39A 3FQHA 3VWAA 2YCRA 3EL7A 1ORIA 2ZZNA 4QTBA 2JGZA 1JKSA 3DULA 3Q60A 3P9JA 3A7FA 3G2PA 4OTWA 4A7CA 2DQ7X 3SMQA 2HOGA 4YHTA 4F1TA 5DTMA 4DFUA 4F99A 3A8WA 3IKAA 3VS0A 4M38A 4OGRA 4RA5A 3PT9A 4BR3A 1YF3A 4ZY4A 4KVZA 2J5EA 4HGLA 5D9HA 5IEVA 3M2WA 4FIIA 4LOQA 4YSMA 3I9FA 3HMMA 2I0EA 5DEWA 1BMKA 4BF2A 3IW5A 3VC2A 2X7GA 4KIOA 1AQJA 3LW0A 1URWA 4AZSA 3AT3A 5BYLA 4LQMA 4J99A 3VNTA 3HEGA 2ZDTA 5AV2A 4HC4A 4YJRA 3K54A 3RIEA 4CTKA 3D4QA 5KMLA 5BVNA 4MNFA 2WMAA 3EVBA 2J6MA 3TT0A 4H3BA 2WTDA 1KXZA 3R9RA 3GC0A 2WQOA 5LQRA 2AOWA 5CEMA 5T6KA 3FXXA 2B78A 3SGLA 3FZSA 4RIOA 1KYZA 5CCBA 5LWNA 5HTCA 1JTEA 2NYUA 3UC3A 3QQFA 2P7IA 4BIEA 3ZC6A 4FA2A 5H8EA 3UNKA 2PMLX 2FO0A 3KULA 3ALOA 1YHVA 7MHTA 4ALVA 3H3CA 4YZBA 1H0VA 3RM6A 2I6GA 2OZAA 3FDNA 3Q4ZA 5BXYA 3ENHA 4FT3A 4L43A 2ERKA 3VS5A 4S30A 1L3RE 2JH9A 3M6XA 4WNPA 1JLUE 3CKWA 4E8AA 4DEAA 5ANJA 2VTNA 2QO9A 3TDWA 3B2TA 3E3PA 3U4UA 5DX8A 5IQEA 4K2RA 4FOCA 2WMWA 3DK3A 3JR1A 2BCJA 1OZ1A 4O0TA 5CQUA 4DLIA 2UZ4A 3P78A 5B2LA 2ZM3A 3PLSA 4LYNA 3GXOA 1Q8TA 3KF4A 3K3JA 1KP9A 2GCDA 3MCTA 2VWUA 2YN8A 3KRRA 1DL5A 4IDTA 3OPNA 3CJGA 3OD6X 1YW2A 3R30A 4EWQA 4QDJA 3HRFA 3SC1A 4O0YA 1ZAOA 2G15A 3G8AA 5ERGB 1O6KA 2VTOA 5JFWA 5I9WA 1BL7A 4IAYA 4DC2A 2GHGA 2CMWA 4O2ZA 2XK3A 2QOQA 4U7TB 4ZZOA 2GNGA 4V0QA 2VWIA 2YA9A 4U6RA 2UW9A 1H1DA 3DTCA 2B9EA 4AA5A 4DCEA 5E1BA 5IQFA 2I62A 9MHTA 3GCVA 4LGGA 5M4IA 2JDOA 3EJ1A 3KQPA 3D0EA 3M11A 3VQHA 5P8WA 3MPAA 4ZJJA 4U44A 3P5KA 5JH6A 4FGBA 4Z7HA 2P35A 5LQUA 3HTXA 3P79A 3Q5ZA 2PVCA 2O0UA 2QM3A 4R6XA 4FV3A 1Q24A 3THSA 4X3FC 4TN6A 3SX0A 3K3IA 4OTQA 4AGUA 3HNRA 1Q3WA 5IISA 3HRCA 1SG9A 3JY0A 4EJNA 4PF4A 2R3GA 4FNXA 2Y4PA 4K0YA 5IA3A 4DEBA 2X2KA 5ANIA 3BU6A 4RTRA 3AXSA 4Y73A 3FYKX 1HOWA 5AP7A 3FI8A 4A6DA 2WMQA 4WHZA 2FA2A 2VZ9A 3DTWA 4YJNA 5EI2A 2FYSA 1CKJA 2X39A 1PMVA 4AW2A 2BM9A 4O7YA 4FG8A 3R1YA 3UBTA 4Z7GA 4D1SA 3TLJA 4LV5A 4K77A 2XYRA 2UYHA 2OLCA 3CC6A 4HVIA 2GS7A 1Y6AA 2BAJA 4AGDA 1WY7A 4YBJA 3HCEA 4X60A 4NWMA 3L8DA 3U9NA 4FP9A 5HICA 5CNOA 1WG8A 3BPRA 4ZIMA 2VNYA 4BZDA 2J51A 4F08A 2GLUA 4X2GA 4A06A 1KPGA 4DG0E 1AGWA 1RDQE 3TNPC 5JRQA 3KU1A 1R0EA 2JAMA 3GCSA 2XEZA 5M55A 1OECA 3L9PA 2IW8A 3BBWA 3ACJA 4U7PB 4QTAA 5K3YA 3LCOA 3NYOA 2XNNA 5JZJA 4FG7A 4V04A 2YEXA 2CL5A 2ZM1A 2CKQA 3FLQA 2AOUB 5CD1A 3GQLA 1TW3A 4BGQA 1BOOA 4U9AA 2W1HA 4BCNA 5AUVA 4CRLA 2R3NA 5LARA 3RAIA 3DAJA 4RTSA 2QI8A 3NDJA 3QA8A 2BPMA 2JHCA 4X61A 2GAFA 5AEPA 5F4NA 4KWPA 4EUUA 4QTTB 2OBJA 3GCUA 1NW6A 2YX1A 4D58A 2NRYA 2X4FA 3AC8A 3VS2A 2R0IA 4CWAA 4IVBA 3PJ2A 2R3JA 4Y30A 4YC8A 3LZBA 2P1DA 2XIKA 3UIUA 5KUPA 4C34A 3UJ9A 3PXKA 3KRLA 3FAAA 5CT0A 2WPAA 3OZSA 4AXAA 4FUXA 3EQGA 3PJ1A 3QRUA 1D2CA 2IIPA 2PUUA 5GJGA 4RYLA 4C4HA 1WAKA 1XBBA 3OBGA 3OE4A 4EJ7A 3PPKA 5EMLA 5HIEA 3Q52A 2B9HA 4FZDB 5EW8A 3E63A 2JD5A 4R78A 2IZUA 4YO6A 2R4BA 5CF4A 5A4QA 2BFXA 4FUYA 2AOVA 1NBHA 2XCHA 1TQIA 5AX3A 1UIRA 5E2BA 1ZGJA 3AT2A 2HELA 4FKUA 1W7HA 2YIWA 2Q83A 4XRJA 3FMDA 3Q9XA 4M0YA 3QALE 5HBJA 3D5WA 5AUYA 3UVQA 4ZJIA 5CSWA 1GJOA 2HXQA 3F3VA 2R3LA 3NW5A 4ER7A 5FADA 2X6DA 3G9NA 2QQ7A 3OEZA 3OHTA 4FKVA 2I40A 3AC5A 5FBNC 3QD4A 4X0MA 2PX8A 3RPRA 3IK3A 2EUFB 2QHNA 4RWJA 2I7CA 2QOFA 1YFLA 5C4LA 1E1VA 2G2IA 3RWPA 5ICFA 2PVKA 4CFMA 1R1WA 4XUFA 3GENA 4GU6A 4F1MA 5EMMA 1FVRA 2BVAA 5JT2A 4FSQA 4FVPA 3ZZWA 5HCXA 3U81A 5ACKA 3EPPA 3ATTA 2P3QA 2WTJA 3KPWA 3ZBXA 2PT6A 4QVKA 3W55A 1NBIA 5AP0A 3DMGA 5BUIA 2FSOX 5T68A 2UZUE 4IX3A 4EH2A 2BR3A 1KE9A 3W2PA 4JQ7A 3ELWA 2DUVA 1ATPE 4M13A 4AP7A 4CKJA 5F94A 5C4KA 4XMOA 3QLGA 2AC3A 4PINA 2OJGA 4O7SA 2VTRA 3NAYA 3OU7A 4DHFA 3F3WA 5FP5A 4B9DA 4UYNA 1J7IA 2VD5A 1HCKA 1UNGA 5HG5A 3OVVA 2EVAA 2AOUA 3R7IA 4ZTMA 4PMSA 3FPFA 4H1JA 1BKXA 2KULA 2P3GX 1MRUA 3DS6A 5F95A 1F5QA 5E92A 2NRUA 3H0ZA 5A14A 4AE6A 3NYXA 4LUDA 4HZSA 4ZY5A 3DOUA 4ANMA 3AY0A 4FEXA 5DPVA 3DU8A 4CKCA 2PVRA 1IRKA 3PJ8A 1MP8A 3R00A 3MFRA 3BZBA 2FSLX 3G5TA 5EYKA 2GS6A 3O50A 1WBWA 3LXLA 2IPXA 4AGWA 4CLJA 5KQRA 2YIQA 5K4JA 4ZLYA 4XX9A 5GHVA 4E4LA 4ALWA 2Q0BA 1TVOA 2V0DA 4CTBA 1XKKA 3IGOA 2CKOA 1DAWA 3PJCA 2ZAZA 5CU4A 1GIJA 2X4ZA 3PE2A 2WOUA 3FSKA 4EKIA 2CNQA 2EFJA 4P2KA 3PVGA 4B8MA 3NDIA 3LMHA 2DYLA 4I94A 3VJOA 4AN2A 2BKZA 4OR5A 1I4WA 1XJDA 3FZRA 1ERKA 1BI8A 2R5TA 4IAFA 5AM6A 2O57A 3P9CA 2HW6A 4GW8A 3GWZA 1H01A 2C3JA 4QYYA 3C4CA 5M4UA 3KHKA 3KK9A 1P1BA 3HAVA 2Z7LA 5B1SA 4UZDA 2G72A 3FUVA 5I5ZA 5AMNA 4E2WA 2OZOA 4GF5A 3QBNA 3KXZA 1QAQA 4M84A 5G6VA 3UYTA 3BYSA 5DXJA 2W1FA 5C03A 1UA2A 4BDHA 4C3PA 5T6BA 4BCQA 3QA0A 3DBQA 4S31A 4QP2A 4ZZMA 4QMVA 1QANA 5L8JA 2YXDA 4UX9A 4FGRA 4IV0A 3T9IA 3N9XA 1QAMA 5AAGA 5FXQA 4PMMA 2R6ZA 2QO2A 1WXXA 5EC8A 3I5UA 2I1MA 2LAVA 4P5ZA 2OXYA 5DRYA 4FIJA 4MVFA 4H0NA 4R7HA 4F0GA 4L44A 4X41A 5IQGA 2VX0A 3OW4A 4KSQA 3C5IA 4HCUA 3QD3A 4UBAA 5HOQA 4HGYA 2XVDA 3P4KA 4NYEA 4YLKA 1YXTA 2ZIFA 4RSSA 2B54A 3ORIA 1XBCA 2FCAA 2VWVA 2QRVB 3BX5A 5AP3A 3EQHA 4IAZA 2BZJA 4RFYA 2C30A 1ZWSA 3Q9YA 3ALNA 3UOJA 4LUEA 3OCGA 3SG8A 4GYIA 2FH9A 1D2HA 4A4OA 1YUBA 5DM4A 3I81A 4BP1A 5FLFA 3IHTA 4PL4A 4R05A 2O2UA 3BYMA 4EK6A 4E93A 4FT2A 1ZGAA 3Q04A 4Z3VA 1J7LA 2J0LA 5EIWA 2VTSA 1SUSA 3GRRA 5CUQA 4AW5A 1IR3A 3IPHA 4DM3A 3KQTA 2XYUA 4XNEA 1IAHA 3GEQA 4AX8A 3WF8A 4J53A 5LVMA 3HV4A 3MYGA 4FNZA 3FMMA 4KIGA 4BZOA 3AD6A 4FTAA 4KABA 3F2AA 4YTIA 4FTIA 3HP5A 4C4JA 4OTHA 3FQEA 4YLJA 3QQKA 3S2PA 3CY3A 3VS6A 4QMWA 3EB0A 3PIXA 3SXRA 3M4XA 3I7CA 3QQJA 4D0XA 5KMJA 2PVHA 3LSTA 2UW4A 2C5XA 2VTPA 4GU9A 3UC4A 3UPXA 3TKUA 1WXWA 3NW7A 1EH4A 1YZHA 3RM7A 4W8EA 4EC8A 4E6CA 3LHJA 3LX6A 2WB8A 1M14A 2IZRA 4CLIA 3TV6A 2UZVA 3E23A 3V8TA 5A54A 4O6LA 5BPYA 1KIAA 2UZOA 3F9NA 4N0SA 4HW7A 3OU2A 3ME5A 2O06A 2JEDA 4KAOA 2PX4A 3HA8A 4A9RA 4BGHA 1IA8A 1CDKA 4P7GA 3KVWA 3LCSA 4FV2A 3A62A 1KV1A 3KQSA 4YUQA 5CF6A 3FPQA 3WF5A 2WTWA 3K5VA 4HTFB 3MH2A 3T3VA 3R9NA 2B1PA 4F1OA 2YM7A 3KXXA 3O8TA 4YO4A 4Y5HA 3AMYA 5BX0A 4EK3A 1KE5A 5CCXA 5FDXA 4N4SA 2WEIA 2R3IA 5M57A 1PXLA 2E2BA 5GM2A 3MHTA 1J91A 2H34A 3UQFA 2C6LA 4QMLA 4Y72A 3VHKA 3R8VA 1FVTA 3P9NA 2JKOA 1BLXA 3CPBA 3DJ5A 2J7TA 3N4VA 4YUYA 3FKOA 3NVMB 5U4XA 2WQEA 4AZTA 3ZO2A 3ETAA 5TO8A 3UJGA 5D1HA 4BDAA 3MCZA 3ELYA 3I64A 4FKIA 3O31A 3ZFMA 1XBAA 4EK8A 3R2YA 2PXXA 4BIDA 3PY0A 5I4NA 3OROA 1UV5A 3LFBA 4GIIA 1PJZA 5T64A 3NRMA 5BVKA 4XG3A 3GRVA 2Y4IB 2UVXA 3B89A 4A9YA 4YURA 1R3CA 3U87A 4G3EA 1K3AA 3AG9A 3GIWA 1CMKE 5KMOA 3P2EA 2UVZA 4FVQA 1I44A 4C4AA 4NCTA 1JBPE 3P9IA 1HMYA 4KDCA 4E2ZA 5KMNA 3W18A 5KNJA 4AA4A 4EL9A 2R3HA 2WTCA 4RTQA 4DCGA 5CIYA 3R21A 3NNWA 3A4PA 1SVGA 5CVEA 4R6VA 4G5PA 3R7OA 3LJ2A 2YDJA 3MAGA 2ZZMA 3T8OA 4RGJA 2WQMA 5HKMA 4BHZA 5BUJA 4TT7A 3KL8A 3FPMA 1UKHA 4C4EA 1AD5A 2ZMDA 2A27A 3ZSGA 2OZVA 2FK8A 5FQDC 4FG9A 3EVCA 4KDRA 1QL6A 3ZUVA 3AD5A 5EZSA 3PSCA 4E4MA 3SQQA 4APCA 3MERA 3LXPA 2PMNX 3OCBA 3LKZA 4GVAA 3LBFA 4WRSA 5HNGA 3AT4A 5IH4A 5HE3A 5L8LA 3G2MA 3VBVA 1S9JA 3KCKA 2ZB0A 4OA5A 1NXKA 2V7AA 3O4FA 2HENA 3QCQA 2YXEA 3BLHA 3KPUA 5J87A 3WILA 4AWIA 4JJRA 5HCZA 2R3RA 5HIDA 5HNIX 3ZLYA 4BB4A 4Y5QA 3JY9A 5KS2A 2JITA 3HVIA 4ARKA 4ZMFA 2C6IA 3V8VA 4JG7A 4UN0C 4WT6A 5K09A 3BHTA 2UZWE 3GI3A 2C5OA 3W2CA 4PIPA 3ZFXA 3GU3A 4Q9ZA 3M33A 4XG6A 3DP7A 2PE1A 4LI5A 3ZXTA 2O65A 4BDCA 2E9PA 5C9CA 1Y8GA 4EKKA 3OG7A 4HTFA 3F2RA 1H0WA 4PL5A 3BHHA 4RVGA 2C0IA 5CYIA 3I79A 5CAOA 2XYNA 4CCBA 3PFGA 4IZ5A 1NVSA 2OIBA 4BCKA 5GP1A 2ITWA 4KKHA 3V04A 4D1ZA 4EWHA 1WBVA 3AWIA 3PE1A 5AUUA 3KQMA 3QQLA 2QCSA 2YACA 3ULIA 2R3QA 3PXQA 4RVHA 3A7HA 3FL4A 5D1NA 2QG7A 4GUAA 3OY3A 1LP4A 1Q0TA 4ZTRA 3ORMA 1U46A 4TWOA 2AOTA 4HYIA 2JDSA 3KQ7A 4I0TA 4O27B 3VF9A 5K0LA 4GYGA 1OKYA 3H9OA 4K11A 3FMKA 3O7LD 1WBTA 1XDSA 5AUZA 1Q4LA 4DGNA 2V5QA 2PSSA 4W4VA 3VS4A 5IU2A 4P7JA 4HGZA 5HVJA 3UJ8A 3UJAA 4XRLA 3RTPA 1E1XA 3QF9A 3EHAA 4IACA 4YJUA 4LMNA 2P8JA 3OFJA 1XTPA 2SRCA 3OXIA 3ODZX 1KOBA 4GL9A 1YXVA 3LDGA 3EMBA 3TL8A 3CTQA 4YNOA 2ZMCA 2PJDA 4XBUA 4XLVA 2R9SA 4AFEA 5ANEA 4FSRA 4DGLC 1IA9A 3POOA 3TNHA 1BI7A 4WSYA 1O6LA 2AN4A 4YHFA 3TN8A 1Q8WA 5A3XA 1UU7A 5CX9A 2G8NA 4UB7A 4D28A 3S68A 3SG9A 3E5AA 1OBDA 2XJ0A 3F2NA 3PRIA 2ONLC 3TI1A 2A14A 3VC4A 4FTTA 3ZBFA 1MHTA 4Q9SA 3QWJA 3HYHA 4H3PA 5CVJA 4X6QC 4U0IA 3ZDIA 2V62A 5CVDA 3CVOA 2ETRA 4JNWA 4WNOA 2HTEA 1JPAA 3DK6A 4QQTA 1CSNA 4E5WA 4C02A 4CKRA 2QG5A 2VV9A 1U2ZA 5CXZA 4XP3A 2EG5A 4BDGA 3NEWA 4USEA 4F7NA 4QQ5A 5BP7A 4R7IA 2OKRA 5FEDA 3VUGA 2VTHA 4GOOD 2ZLBA 4OX9Y 4CMUA 3HL7A 3FMHA 4WVLA 1JQDA 4GVJA 2OH4A 2P2HA 2V22A 4RX1A 3ZO4A 1KE7A 1QPDA 1JNKA 4QNYA 1UVRA 5AP1A 3DXXA 2BDWA 4QDKA 5DPMA 3KQWA 2YWVA 5L2IA 4A4LA 5EIFA 1Q99A 5E90A 5FTGA 3UMWA 4AE9A 1SVUA 3BE9A 4IAIA 2BDJA 5K5NA 5CANA 3DAEA 3LIJA 1G8AA 5JR3A 3GU5A 4OUCA 3ZRLA 2OIDA 2W9ZB 3FBVA 5DXAA 2I9KA 4ZLOA 3LCDA 4DGGA 2VUWA 1SYKA 5BQ0A 4NM0A 5K0FA 3UIXA 1KE8A 1FGIA 3FPHA 4TYJA 3GJYA 1V0OA 2OB2A 5L3AA 3E88A 1M6YA 3G51A 4AF3A 4G9RA 4FYNA 5L6PA 3EN9A 4JI9A 4O82A 2JIVA 4IIRA 2ZCJA 3CJTA 2OFVA 2FUMA 5CY3A 2IDKA 3MVJA 4HNIA 4F63A 4KSPA 4L01A 2YIYA 2BILB 1P4FA 3UE4A 2YITA 3G2FA 1PMUA 2OGVA 2XP2A 4EH9A 3AOXA 2WTIA 3IDPA 4DQ0A 4QPSA 3GNIB 1Q8YA 4ITHA 3AD4A 2OWBA 3Q96A 4MNEB 5EPEA 1D2GA 1KR5A 2ERCA 1P4OA 3FRIA 5DI1A 2VTMA 4BP3A 4MTLA 1N7IA 2WMUA 1YDTE 3EFLA 1JG2A 4IFCA 3LPBA 3BKWA 3Q4CA 1ZOHA 3C4ZA 3LCCA 4O22A 2ZSUA 3F61A 2UZLA 4FOBA 3M6VA 5CVVA 4EKLA 5J1WA 1P5EA 2PBFA 3BGQA 4JBOA 4G6NA 3QD2B 4K33A 5HFJA 5E9WA 3LL7A 4V0RA 5LXMA 4PGHA 2XNBA 3TNQB 4IANA 1O9UA 3HV5A 2YXLA 4MWZA 3VBTA 5JK3A 1GIHA 2BZKB 3ZTXA 3QTIA 4F9BA 2AOXA 2I7QA 4FTLA 4G3CA 3QUPA 5CEPA 3VS7A 4XCXA 4GOMD 4FTCA 4ANSA 3DJ7A 1UKIA 3K0BA 3NUAA 3UVPA 5AP4A 4MH7A 2GPHA 3U54A 3W1FA 2VP3A 4FKLA 1VBFA 1DI9A 1ZY4A 4HCVA 3PVUA 5DM1A 4MXOA 3VUMA 3R8PA 1OBGA 2JBOA 4U45A 4Y95A 5TOZA 3ZRMA 3QFVA 5EEHA 4ZTLA 5LQFA 4F6SA 4JL9A 2BM8A 5CI7A 5KQSA 2YDKA 5EKNA 2X2MA 3VAPA 3EGIA 5FBOA 3UJCA 1VYZA 4O0UA 5BVEA 1GY3A 5EKXA 1M7QA 4CT2A 3EEYA 2X0GA 5E9EA 5HO8A 4ZMEA 3FLNC 4LG1A 4P7KA 2HNKA 4C04A 4RX9A 5E7RA 4U7ZA 1XO2B 4MQ1A 4WD5A 5HIMA 4C59A 3QOWA 4YHJA 3PA5A 3RK9A 2Z8CA 3LFAA 2QLUA 5HNBA 5ANDA 4QRCA 2E9UA 2XNGA 5DIAA 3NMUF 3QQHA 3RAHA 2XKCA 4L52A 4PQNA 5M08A 2J0KA 3DH0A 4IX5A 3SSOA 2B2CA 3E7VA 3WIKA 3BEAA 3A7JA 3PPJA 5CS6A 4XBRA 4BIBA 2GNHA 5CSXA 3GVUA 4YUXA 4GH2A 5E1OA 5AUWA 1VYWA 3PSBA 3I4BA 2ZJWA 2JIIA 1PYXA 2ZOQA 4EQMA 1OKZA 4GFMA 4MWHA 3UYSA 5FA8A 2BR4A 4RLLA 4PDYA 3ZM4A 1OL7A 3DAKA 3TZ8A 3LDFA 2NNWB 3HEMA 3EYHA 2C3IB 3HAMA 3QTWA 4F4PA 2X2LA 3AXTA 3NTVA 4QT1A 3QCXA 4JLCA 5H02A 5BMMA 4MNEA 2ESMA 4RTLA 5C8KA 4D2RA 1OIYA 4KRDA 4CGAA 1DCTA 2WTKB 3HA6A 3P0MA 5HGIA 4JDKA 3OTVA 1MUOA 5I0BA 2J0IA 3GGDA 2GTMA 3SOCA 4DT9A 5DEYA 5IZFA 4E1ZA 2XM9A 2RG5A 3EFJA 3LXKA 5ANGA 4CKEA 2OPBA 2ZW9A 2F8LA 2PLWA 4QTDA 1I1NA 2W06A 3CGOA 4O21A 2PVNA 4CCUA 3HUBA 1PXIA 2VNWA 3LJ0A 3E62A 3DGKA 4QQKA 1B39A 2IO6A 1NW8A 1R00A 3OXTA 3FMJA 5EI6A 5E8WA 5HVKA 5CASA 5DTQA 1JR4A 2ETKA 3IEIA 4YSJA 3FKLA 1YXSA 2XCKA 3NWBA 3HMIA 4LFIA 4D5HA 4IM2A 5TKDA 3WSTA 2WU6A 2F9GA 3F66A 5HESA 4BCJA 2B4SB 4NKSA 4FTQA 4ZXTA 3ZMMA 3OC1A 5J8IA 3H30A 4B7TA 1ZHFA 5GNKA 2WNTA 3KRJA 2PY3A 4KKGA 2O5KA 3W2OA 1X8BA 4FT5A 1LEZA 5CU2A 2PVJA 3OMVA 3VUHA 3EFKA 5FG8A 3D2LA 3OZRA 4CTCA 1EIZA 1VE3A 5CAUA 1OKWA 4AZWA 4RV9A 3V8SA 5E8SA 3OBJA 1V0BA 1W82A 5HE1A 3WE4A 2E5WA 3MTLA 3JWJA 3F5XA 3RI1A 3R9OA 4DFNA 3QHRA 3NUUA 2E9NA 4EZ5A 5JFXA 3VF8A 5DX0A 2W1EA 3O8PA 3R71A 5HEZA 4I6FA 3N4UA
chains in the Genus database with same CATH superfamily
2IHTA 2PZGA 2ORVA 3F3YA 1U0JA 3ENMA 4O0XA 4KI0A 4I7EA 1VFPA 4QUBA 2CNWA 5LJJA 4NR0A 1MO6A 2JRLA 2VT6A 2ZAIA 5HDBB 5CU7A 4YV2A 3MUNA 1Q0SA 2YWXA 2XWQA 2G4VA 2HZ4A 2RIOA 3E05A 3IPXA 1UU8A 3A61A 4W4TA 1FYEA 3I61A 4DIBA 4E6DA 4TY1A 1KKLA 4QP9A 5B4UA 2PRSA 4FCCA 4DZRA 5TT0A 2RARA 1AS2A 3C2QA 1AKWA 3FMEA 7ABPA 1CJUC 2W99B 4L15A 1P9RA 1QPJA 1GXSB 4R8RA 1XDDA 4ALMA 3BQ9A 4UNIA 4F3CA 1GL9B 2YINC 2IUYA 5HG9A 1PTKA 4L42A 1YDEA 5DI3B 4DDMA 4P3YA 2PZPA 4P54A 3IIJA 4ILEA 5HX8A 4AL4A 3HKEB 3FUTA 3OE5A 4NKAA 3BFJA 3HC7A 3KDSE 4FSZA 2ZK7A 4BNHA 3G02A 3G0FA 1W7AA 3A4IA 2A9JA 1VP9A 4B4VA 3G23A 2O8VA 4IEIA 3T4PA 5J4YA 3A4MA 3KOYA 1B4DA 3ETJA 1RT9A 2QN3A 2DP4E 2AUHA 3H6KA 3WB9A 3F71A 4QP8A 4FEQA 2CE7A 1ONOA 4NCAA 2JAVA 2Y1WA 4F5YA 5JVDF 1UZUA 5FBQB 4DC0A 3OMLA 1OYYA 2VVTA 4LF7B 3HV7A 5BR4A 2X23A 4FD3A 5D1JA 4OLJA 1IEQA 2Y92A 1EFPB 2QN2A 2PMOX 2Q4RA 1URPA 3Q1LA 3S2ZA 1M75A 4TVSA 2A30A 3ONVA 1NQXA 1UBMS 4QXRA 4DOMA 1TJPB 4IX4A 4B4KA 3K4HA 1RIIA 3BRWD 3X0DA 3AO0B 1H0KA 2IEZA 1OYOA 2EEPA 3FPAA 2H8GA 4DEIA 2RHWA 2F7ZE 3I73A 4RPVA 4H6PA 1S2OA 1H05A 4BNMA 3M5DA 3O8QB 1XN4A 5EGSA 1H6BA 3WIBA 1DC7A 3JYNA 4WN9B 1GN9A 4IS3A 5DJ5A 4II5A 2C9DA 3PNPA 5DOSA 3I2YX 4RC9A 5JNLA 2P2YA 2QNBA 2QXTA 3ZLTA 3A6GA 4IBOA 1IAJA 3KQVA 4M49A 3AKEA 1JEJA 3GLRA 1C0PA 1E79D 3F73A 3W10A 1ZYCA 4TQUS 5IJ9A 3ZK7A 4RTKA 1Z0IA 1IUOA 3OPVA 2WPDD 1XTTA 3WZDA 1N92A 3WE8A 4EQCA 4XGIA 4YUAA 4MV7A 4ZYYA 3OF0A 3FRJA 3ASUA 2VHJA 4FV6A 2C8VA 4UOEA 5FBKA 2DTXA 1XVAA 4UFOA 4ER6A 1DKRA 4MROA 5FCDA 2BDFA 3K6KA 5HG7A 3VR5D 4JQ8A 1O2DA 5DLEA 2OXEA 2X6QA 3S99A 4R8VA 4KDFA 3ZHUA 2PVMA 3RK0A 2C7OA 4CM9D 4JDPA 3ZBTA 3IXQA 2WIHA 3ZI7A 3NX8A 1TPZA 4WY8A 4EOSA 3AF5A 5HE2A 3F6YA 3W16A 2PH5A 1HA3A 3DKCA 1JIUA 1PJSA 3V42A 4HAIA 2B52A 4MQ4A 1LKZA 2VRWA 2GTNA 1N7GA 4D02A 1VLRA 3S95A 2PQ6A 1RYEA 2ODEA 1S3SA 3U4WA 4P4CA 5DE2A 4ZEGA 1FP1D 2FN4A 1XKXA 4RDHA 2JLSA 2E4VA 5I7EA 5EMHA 5C32A 3S0OA 2JDTA 3H2GA 1U3WA 5DI3A 4MCAA 3NHUA 1N78A 1JSXA 1Z34A 3SICE 2W2QA 4PDSA 2Q0SA 4ABTA 4LWZA 3R9WA 1AQUA 3OSUA 2D74A 5D8DA 4DTKA 4FSUA 1H6DA 3GAAA 3RWMB 4AT5A 4IV8A 3TG1A 1ETHA 2YM3A 4M69B 3U6KA 1GFSA 3WYXA 3WQQA 5JD4A 4BJJB 4J3NA 5ELMA 1G9SA 4KITB 1OLSB 4RESA 4C0TA 3HXTA 3UOGA 5IEXA 5BUZA 4KKEA 2AXNA 2KHZA 3NAZA 1UDRA 1PJ4A 3F46A 1WMSA 2ASVA 1HE8B 3HADA 1W1UA 3VH4A 4BJ6A 2IVSA 2GDJA 2WHPA 3UJHA 1J97A 2XA4A 4PFKA 1RBMA 2WUFA 4C6HA 4DRZA 4EJSB 4IXMA 1KKMA 1WA5A 1J00A 2GD2A 2QN1A 4YQEA 5K3FB 3LNCA 1A95A 2G77B 3HCAA 2CXSA 4PZAA 4RA6B 2WC1A 2COUA 1DKQA 2VHWA 1XZBA 3DDUA 4MLCA 5WRFA 3AB3A 4CFXA 1S7CA 2XK7A 3FZTA 4CNHA 1X1CA 4WN9A 3G90X 1OT3A 3LJKA 3NT2A 4OLHA 5BQOA 3OPYB 2ODBA 3HCNA 5BPFA 1OX6A 3FCAA 1LFAA 1G20E 1E7SA 3EN4A 1NXPA 3DD1A 1P2VA 2LD4A 2P3LA 1CQXA 3ROGA 1EP3B 3LM8A 4KAAA 4RQKA 3M5WA 3VSDA 4CMTA 3AUKA 4KN8A 2DPGA 4L3VA 1IL0A 4WE3A 1T2VA 3MOGA 4DCNA 2GYYA 1Y4AE 2C4TA 2DHEA 3GBZA 3Q87B 1UPTA 1WBNA 5AM2A 1T1SA 3IXLA 4G0WA 3QPAA 3SA0A 4L07A 1K06A 4LJLA 4BX2A 3KZVA 1NVAA 4O4JB 1G5QA 4DLJA 2YN0A 2IYXA 4D97A 3E5RA 4C0XA 3GH3A 3IURA 5KVVA 1CKPA 1CKEA 1VZOA 2AR0A 3ADDA 5I9SA 2W4KA 3R0ZA 3I5XA 2J59A 5B12A 2GBLA 4P31A 2QMUA 1VTKA 2JLAA 3QRJA 4RGYA 4KIUA 5JTTA 3JQAD 3PVSA 2FW9A 1N2JA 4BKRA 5AKJA 2IYEA 4D5GA 1JJIA 2V7EA 3UDSA 4HVLA 1XCJA 4PF1A 3U37A 4IH1A 2WQBA 5DGDA 4OHXA 2XMYA 3AEQB 4GQAA 4RHTA 3RHKA 1JZTA 1THMA 4ZYZA 1RKBA 5FO1A 4D4HA 4DLBA 1XEXB 4PW0A 3MPTA 4LYJA 4RTNA 4AT4A 3EB9A 1EXNA 1F7UA 1Q62A 1L5ZA 3W06A 3N2LA 3QTQA 4I4IA 5LM3A 3PXZA 2R1UA 4DHWA 2F3TA 5LVNA 2J5BA 1DC6A 3ZY4A 3K31A 1PT7A 3MXOA 4LF5B 2GXQA 3TKYA 2FZEA 4WZAE 3QEMB 4FX3A 1ATIA 2H9VA 2W4IA 3NZEA 3S8MA 2PE2A 5GZ6A 3W2GA 5KTKA 4EGAA 1DPGA 3OY1A 2XJ1A 3FSJX 3K5WA 3WYAA 1G5SA 3WB0A 1MXFA 1T46A 1TZMA 3GX1A 2ZWPA 2P9EA 4ZTHA 1KC1A 4HJOA 1Y98A 3I6UA 3UAVA 2WFAA 5LA6F 3ISVA 2E4WA 3LO8A 3A6KA 3AC2A 1DKUA 4KYTA 4H17A 4I5EA 5AHKA 4FEAA 1QV6A 4DCAA 3Q8WA 5KJFA 3WADA 3EX7C 3F6BX 3AY7A 1NP7A 2Y05A 4R3RA 1LQ2A 3V1NA 5LMKC 5LSAA 4X3JA 3KJIA 1CJBA 4EJSA 1IM2A 2V4UA 5K3FA 3TKHA 1AH2A 4K26A 3QA3E 2AVDA 4RA6A 1Q17A 3G5AA 1PZGA 3WF7A 2AE1A 4P83A 2QDXA 4DR1B 2X40A 1XEAA 1SKYB 4UZSA 3DBEA 2Q7XA 3PNMA 3KE9A 1ZMBA 5K20A 1A97A 4D41A 3GGFA 5H3LA 5BRNA 1BS2A 5IHXA 4I6GA 5JUWA 1JKLA 4UMDA 2V97A 5DHRA 4BJ3A 1VPEA 1VA4A 1YQXA 5KNDD 1G0OA 1WV1A 1NSTA 1GCGA 2XIXA 2H8HA 2AQKA 4PZDA 1RBZA 4XUEA 4DLZA 3LM0A 4CZUA 1HQCA 4HPUE 2D59A 3YASA 1P2BA 1N5LA 2QW8A 4R51A 1YL6A 4BE7B 5BW4A 5EDQA 3CS9A 1YDFA 4PO8A 4FIFA 2IH5A 2V7VA 3PHGA 4EOQA 5KJ1A 1L7OA 2YAKA 1WP4A 4GRDA 2AUNA 4L9SA 5GGYA 3G6GA 3ZN2A 1QFZA 3VQTA 4BIMA 3UHAA 2JC6A 2BEJA 1MEEA 3VBYA 5DNVA 2YZLA 4TZTA 1MVLA 3AFIA 3D3QA 4DRXB 1YWRA 2YIJA 4QFBA 5EESA 3WA6A 4PZPA 5LVAA 2CK3A 1I6LA 1JEEA 3OFSA 3U51A 3WRYC 2W2TA 4Y6PA 2FSGA 4E4NA 3MWUA 2HSDA 2PUHA 3MK31 2HEGA 4QMOA 1T9ZA 2NU7A 3H2KA 3UCFA 2AMFA 1UZLA 3IOPA 4NDAA 1UOPA 3O8BA 3PHHA 4K05A 3W5VA 4ACHA 4WI1A 4H08A 2QT1A 1S1MA 3GRKA 2ZTUA 1CD5A 2GCEA 5D2CA 1NL3A 4U2BA 3ZK8A 1WDWB 2EARA 4KNWA 1JEYA 1K9SA 2R8RA 4U2DA 4WT7A 4BFYA 4XUCA 2YASA 3E82A 1BS1A 4J9VA 4EPTA 1GUYA 1NVQA 1C0KA 3HRHA 1DX9A 1Z56C 3Q7TA 1E6WA 2G40A 4B48A 1O7JA 2QY9A 5CSPA 3DKPA 4TKVB 4R5SA 4AN3A 1IRXA 3AETB 3QBVA 5ERXA 2E2WA 4NK9A 4AO7A 2HV9A 3QEMA 4ZTBA 4CEGA 2ZRQA 1ZXXA 3VPGA 4LI0A 3ZBQA 2GRJA 5TT7A 3CLTD 2HBZA 3ZCPA 2XX3A 4QEZA 2XQKA 3RW9A 3KB6A 3V01A 2VHVA 4DF3A 3P0RA 1WMAA 3OEWA 1ODLA 5KHWA 2H1FA 4RJIA 2VS1A 1XX6A 2J7PA 4Q9NA 1OTYA 3DLCA 4DQXA 1E63A 1T0UA 3MMXA 4C0LA 3EUEA 1AQLA 1NJ5A 3VNVA 2JBPA 4LJ5A 1B73A 2G01A 4IM7A 4FNMA 1RZRA 4IW0A 5DR9A 2G5GX 4HQ0A 2V6GA 3KFAA 5EZ5A 5ETIA 3C7DB 4JYZA 3EXAA 2R8BA 1Y33E 5BUEA 2DG2A 1E18A 1OL1A 1H9BA 3QA9A 5H59A 2JIOA 4EW1A 1NUUA 4A8PA 5CEEA 3N8HA 3MBLA 2F2TA 1NMXA 3U7EB 5BSEA 1J24A 3KR9A 4JY7A 4GSKA 2NNLD 4F2DA 2ZI6A 5HF5A 3P52A 4TYMA 1VPWA 4DBVO 1E89A 4F3NA 4FTWA 5EM5A 3L43A 3GFBA 2GDOA 1QIIA 4O4IB 2F1IA 2P6NA 1Z28A 4ZU1X 1WABA 4HT3B 2ZS7A 3WB2A 1YQUA 1JU3A 4M0DA 2J9YB 2AN3A 4R71A 5LMNB 4UUNA 3RVNA 1IH8A 3WLHA 3A7GA 5BNTA 1LLDA 2RG6A 1T3TA 4KNBA 1N6LA 4KRCA 2OE2A 1JEOA 2GWHA 5K0NA 2NWQA 4RGBA 4E70A 1PRYA 3F2VA 5B57C 4FKJA 3TACA 3FTNA 2G3YA 3LCRA 3BZUA 3W0QA 3FTDA 4YXWA 2ST1A 3KOUA 3HACA 2YMMA 5EPUA 3R7WB 2VTTA 4CIDA 4ZHQA 2YXBA 4NBNA 2I5PO 4QLAA 4G5JA 2WMTA 3I9NA 1ZD3A 3HBJA 5THQA 1ZXEA 2ODTX 2QP9X 1GGVA 3OWKA 5AUOB 1N34B 5AADA 4IUDS 4AMGA 6AT1A 3F1KA 4RZWA 1PT5A 1YB7A 2VWZA 3C4EA 3PFKA 3CR7A 3R6DA 1A4UA 4RQVA 4O7LA 1FMJA 1ECBA 3QU2A 2E6KA 4J1TA 5KQPA 2O2CA 3AETA 4O5AA 3INNA 1IHDA 1JMYA 1Y57A 1WAMA 4D4KA 1JJBA 5B1DA 3NX4A 2W83A 3KEOA 3N53A 3NIEA 4TNDA 4RWKA 3G2IA 1XCOA 3UQYS 5HRAA 4FSNA 4UUOA 3BU5A 1HC7A 3SU8A 2RGUA 2R1ZA 1YJ5A 4TPTA 1KQ3A 5EWLB 3CKXA 2ZYTX 1HKHA 1L8LA 4ZO6A 1CNEA 3FPEA 2YCFA 2XEYA 3L7NA 2G1KA 4YJ3B 4XP0A 5EUMA 3DNEA 4DQVA 2CC2A 4UDOA 4XG9A 1M2VA 1R5NA 3NS9A 3N4TA 2J6BA 1Q11A 1FP7A 2Y1GA 3FAKA 1QAOA 3IAFA 2HQBA 1C9MA 3WOWA 2HA3A 3PWSA 4HXGA 5ALKA 4EFNA 2XE6A 3R74A 4O0WA 3GLGB 1J8DA 4KRYA 1ZMTA 5DRDA 3DDOA 2W96B 3MB6A 3DVQX 3ZXZA 3KY2A 2GZSA 1I33A 1MV5A 3U1VA 2OTCA 5A5FA 4NWIA 3TIGA 4IRUB 3LFNA 1VJYA 4URYR 3OOGA 4EA9A 5JS1A 3ZHZA 1RPNA 1JT2A 3L4KA 1NUAA 4ZOEA 4UEUA 2FZKA 3O3NB 4EKGA 4PP9A 3LHDA 2HJSA 2X7JA 2QVLA 1T9AA 2BHHA 5ILQA 3V4VB 3E5NA 3KR2A 3ZIAD 2YJ4A 4ERKA 1KARA