5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
3IGGA 4GIIA 4NKAA 5BVWA 5EEGA 5H3QA 2QKRA 2UZVA 5BVKA 4IMYA 3T0IA 4I0SA 1JPAA 3L1SA 3QRTA 3PY1A 4JX3A 4JG6A 4CRSA 5LJJA 4C3RA 4E7WA 4KUJA 3HYHA 2IPXA 5BMMA 3TV4A 3U4UA 3OZ6A 5CT7A 4F1TA 3UQCA 4KNBA 3OE4A 2Z7LA 1K3AA 3S0OA 2W4OA 3RK9A 4ZJJA 1UVRA 3R7YA 4F70A 3FMKA 4LWOA 4O7RA 4E2ZA 2V0DA 4RVDA 3FTEA 4CFXA 1GZ8A 2OXXA 3BKXA 4Y83A 4IX5A 1AQ1A 4N6ZA 1JG3A 3SW7A 4G6NA 3PE2A 2NXNA 4CFNA 3AQVA 1I44A 4RJ3A 3WF5A 2XK8A 5C03A 5D1NA 4GS6A 2JGZA 2FSOX 2GNIA 5KHXA 5JFWA 5K0GA 5JMSA 4G3FA 4C0TA 4IVDA 5DSTA 3GRZA 3KQSA 4UXQA 3NUYA 1DAWA 4RVLA 5EW9A 4V0RA 1SNXA 1SUIA 2GHLA 4QQKA 4R6WA 1ZQ9A 4FV1A 4CXAA 4GL9A 5ETIA 1ZZ2A 4BBFA 3D5WA 2OICA 5HEKA 4IHPA 3C7QA 5DM0A 1RDQE 3NGAA 3M4XA 4B4LA 3OROA 2B53A 3KCKA 3LCKA 3W33A 3G2MA 5AV3A 2WB8A 4AA0A 3P2KA 2FSTX 4QYHA 3Q60A 4DMGA 1UWJA 4QMSA 3R7UA 4UEUA 5C8KA 2C4GA 3HDMA 4WSYA 3PRIA 1K9AA 3THSA 5EIFA 3U55A 3CIKA 5CVEA 1KOAA 5CVJA 5LCKA 5CVDA 3LL7A 3PSCA 1PXKA 2QC6A 4YTCA 3UOJA 3LHJA 4WOVA 3MAGA 5CI6A 2ZCJA 3VC2A 3DKOA 3PT9A 2QLQA 2OXDA 3NTVA 2JITA 1AD5A 5C1QB 2FO0A 4H0NA 4J52A 3GRVA 3TFWA 3ALOA 3NRMA 2PZRA 5HNBA 5EM6A 3UJ8A 3FXXA 2O65A 3I81A 3P9CA 2ZM1A 4RMZA 5KMKA 4DGNA 4D55A 5KQSA 3JPVA 3S2PA 2P7HA 4XP0A 1MRYA 3E7VA 4U6RA 4CV8A 2PX2A 3CJGA 1R8XA 4R1VA 1Q4LA 3C4XA 2XCKA 2XRUA 4E6AA 4NTSA 4TRLA 2XNOA 4CLJA 4MEDA 4QDKA 2ITYA 5HVYA 2YEXA 4R6XA 1V1KA 3A7DA 5AP0A 2YISA 2FB8A 2QO7A 4DFUA 1QAOA 4Q2AA 3Q6UA 2NO3A 2BUJA 4RWLA 4CKBA 3MH1A 4ISCA 2ZDTA 1T46A 2PYWA 3LKMA 5DM1A 2PUUA 4K2RA 5EI2A 2WD1A 4KIFA 2OXTA 3FSKA 3EEYA 5LVMA 2HELA 4J7BA 3UBDA 1OKWA 1B6CB 3PPZA 4QRCA 2QHNA 1GZOA 2GPHA 5EHLA 3P4KA 3R9DA 3AWIA 7MHTA 3D7ZA 3VS1A 1APME 4WRGA 5ANKA 4GJ2A 4WO5A 5AM7A 4MD9E 4QT1A 2WEIA 2OLCA 3COMA 1GZKA 2LAVA 3AC5A 4RRVA 3DNDA 4ITJA 5HG5A 4YLLA 4RVGA 4X2NA 1PRYA 3DDPA 3F61A 4DFXE 3MS9A 2YIWA 3WOWA 4AW0A 4G16A 3ANQA 1OL2A 5J9ZA 3AJDA 2WHBA 4HGSA 3VQHA 3QC9A 4QQ5A 4E4XA 5FXRA 5A54A 2R0UA 2GLUA 1PMVA 5CU6A 3MGGA 5AIRA 4LL5A 4DN5A 3TV7A 3FMDA 5DTMA 2OIQA 3RPSA 4DCGA 1H00A 4XV3A 2W1FA 3EQIA 4QPAA 3PWYA 4BGHA 1YW2A 4RVFA 5C8MA 4PYQA 3O8UA 2UZLA 3TNPC 2Q0NA 4D4YA 4DH5A 3ANXA 5FA8A 3D5VA 4YP8A 2B9HA 5DE2A 2VNYA 4IM2A 4XLVA 3A7IA 5BYYA 3TZMA 1OBGA 3FXWA 3EWHA 1J7IA 2WGJA 4GUAA 3VS2A 4ORKA 4DA5A 3KKZA 3P7CA 3I79A 3HAVA 4KW7A 2PHKA 4ZZMA 3LXLA 1NVQA 2YM5A 2R5TA 1TPYA 3QQLA 4MXCA 4AGUA 3WYYA 1VL5A 4TY1A 4JAIA 4L43A 3SAYA 5CEKA 4MVFA 3LFAA 3Q7EA 1BI8A 3VUKA 2PX8A 3UJ6A 3LW0A 2YDJA 4QP9A 2HENA 1PXPA 3MFSA 4EJ7A 3VW6A 4IX6A 2XYVA 1UNLA 4OR5A 2QU5A 3DTNA 5D10A 3PX2A 4TWCA 5L8JA 3TI1A 2Z8CA 1FP1D 1WAKA 4ZTLA 4D4SA 3M6WA 1DCTA 4XEYA 1YOMA 1LR4A 3RODA 3QFVA 4L8MA 3VULA 2H11A 4L53A 3W8QA 4BHZA 2YA9A 2YDIA 3KXXA 3ZRKA 2WQEA 1GAGA 1YXXA 3OG7A 5JEBA 4GYGA 1D2CA 1VIDA 5JN2A 2XJ1A 2PVYA 4EONA 3R2YA 1N2XA 2VAGA 4CTCA 1GNGA 3P08A 4BTMA 5EMMA 5L6WL 3ZXZA 4F4PA 3ROYA 3KU1A 3IECA 4A6EA 3KK9A 3UGCA 5CVUA 1JKTA 4BZNA 5I5ZA 2P0CA 5HIIA 3ZC5A 2C30A 2XK7A 2E9OA 1BHJA 3CTJA 4PWNA 2B9FA 4C2VA 2X4FA 4FKUA 4DEAA 4GC9A 1OITA 2VRXA 3O2MA 1JQ3A 2VO3A 3BX5A 3UJ7A 4FV6A 2CPKE 3QALE 5F4NA 3U6HA 4O0YA 5IQHA 2ZV2A 3ORXA 3G15A 2R2PA 2Y6MA 3M1SA 4QTEA 1TVOA 4MD8E 4CWAA 2QM3A 4FIIA 3P7BA 3CGOA 4YPDA 1EAMA 4GVAA 4F9WA 1FGKA 3R9OA 5BW4A 2QCSA 1YF3A 2EB2A 1R6AA 2R3GA 1YXSA 2YIQA 2VTSA 4B8LA 4MWIA 5CI7A 3DULA 1I9GA 3WSTA 4O2ZA 2YM4A 3VYWA 2JG3A 2F7EE 4X7QA 2Z6QA 4QMPA 3R9HA 4GFMA 2J6MA 4O0XA 3BGQA 2JH9A 3NMUF 2ETKA 3AXTA 4L46A 3TDVA 3G9LX 4ZS0A 1IA8A 5C26A 1J7UA 3OCGA 3FTDA 5ANDA 4FKSA 3KPUA 3WZKA 2UYQA 2IVVA 2Z2WA 3RINA 2PJDA 3QD2B 1FMKA 1CKJA 3A60A 4UALA 3EVBA 4X41A 4FX3A 4JOAA 4RTLA 1OPLA 1NW8A 1EIZA 3I0OA 2QOKA 2C7PA 4IACA 3DBQA 2V7OA 3EL7A 2BROA 3FSFA 3PVWA 4H3QA 5EEHA 2RFEA 3C0IA 4TKSA 3CR0A 2E9UA 3WZEA 2UUEA 2WOTA 3QRJA 3DJ7A 3UO5A 2HW6A 3QCSA 1QZZA 3CKKA 5KX8A 4FKGA 2G9XA 3G90X 4NH1A 4NCTA 3FMJA 2BDJA 4BKJA 4QYEA 3PPKA 3S68A 1JBPE 3CCFA 3UJBA 2R3KA 1F38A 5E1EA 1H0WA 5IQFA 3C3YA 2IIPA 3R71A 5CNNA 3IW7A 1AQJA 2QD9A 3ORLA 2RFNA 4R6VA 4O86A 4DCMA 5IZFA 1QPJA 2Y6OA 4FOBA 2WMXA 1RQQA 2GTNA 4PYMA 1ZYJA 2VP3A 3CCNA 1XQZA 4E30A 1XH8A 4HZRA 1Q0SA 3UQFA 4RVTA 4CTJA 4PYKA 4W8EA 4YTIA 2PK9A 2BZIB 4IJ9A 2UW7A 3VS7A 2UW5A 5J1VA 4HGZA 5EOVA 1PXLA 5DRYA 4PCAA 4RX9A 2OKRA 1FVVA 5FEQA 1SVGA 4O0TA 3PWDA 4W8DA 1DI9A 3NUPA 3EQFA 5CVFA 5AP5A 5EPEA 3U9NA 2VX3A 3CGGA 4F9CA 3B3GA 3F3ZA 4FT7A 2JDTA 3P79A 3E05A 5LOHA 4I5CA 3VUMA 2C3JA 3F5PA 1U5QA 5DR2A 3PIZA 3FI3A 5HESA 3AGLA 4QYYA 2C5NA 5GNKA 4HVHA 4GT3A 3UJDA 1JSVA 4M67A 4H3PA 3RPYA 1REKA 4PY1A 4CMTA 4D9TA 3P0MA 4JI9A 5HEZA 3WF8A 3TLJA 3TMAA 4AT3A 5KZ0A 4HRAA 3JUHA 5EHYA 2WMVA 4MIKA 2FK8A 2CCIA 1Q8TA 2H00A 1QAQA 5LWMA 4FSXA 2A0CX 5AAGA 4PYLA 3UG2A 5FA5A 1Q99A 3BWFA 1IASA 2GCDA 4AGDA 1OIQA 2CKDA 2AOVA 3FL5A 4AZWA 4POOA 5CAUA 4TYJA 2ORED 2R3QA 3GWZA 5HZMA 4EQMA 4E5AX 2C68A 3RHKA 2JBPA 4JIAA 2XNGA 1V39A 1PXIA 3Q87B 4DGOA 4F7LA 2FSLX 3IS5A 3FUTA 3FHIA 4LGHA 3FWQA 4GH2A 5HHWA 4ZY4A 4CKJA 2UZOA 4O7VA 2JFMA 2XS0A 2FYTA 1PYXA 3F3UA 5C9ZA 5HG9A 4NZWB 3OHTA 3RCJA 4GFGA 2PWYA 4FTNA 4J53A 2ZMDA 5FHRA 3AMYA 4HSGA 2CMWA 3EL8A 4GUEA 2AOUA 4C4AA 3FLWA 2VTTA 1KPHA 3PFHA 4B99A 1ERKA 1F3MC 5CX9A 3CKWA 4IWQA 4V05A 4Y2HA 3HMNA 3KPJA 1KE8A 4Y46A 5HG7A 3SW4A 5IQGA 4V0QA 2SRCA 4BDEA 5HZNA 1HCLA 3PFGA 1IEPA 5BW5A 5DR9A 2QRVA 1NT2A 3MA6A 1H8FA 2VWVA 3R9RA 3HM2A 4RT7A 2G2FA 3QX4A 2PZPA 2PUNA 5CEQA 1UKHA 4IAKA 1PKGA 4XUEA 4FEXA 4HGYA 4HYSA 3F3TA 1RJDA 3HV7A 4FT5A 2NXCA 3C5IA 3KPWA 4XH6A 5GIOE 4KWCA 4YMGA 1Y57A 5T3QA 2AOUB 5BVOA 5HILA 3UO4A 1YDRE 5IKMA 2Z7SA 2VZ6A 4YHFA 3PYYA 2QHMA 5BUEA 4IM0A 1L9KA 5FD2A 2ZTHA 4AP7A 4EKIA 3CP9A 3G8BA 2BR4A 3N9XA 3RHXA 2V55A 3L8VA 5L2SA 5E7RA 3EVZA 4AE6A 5DLSA 3MH0A 1YWVA 2ITWA 2XF0A 5LMBA 2C5OA 3DJ6A 2QRVB 2AVDA 4YTHA 2YITA 4GT5A 2ZYBA 4AU8A 1ZG3A 3ID6C 3KPVA 4RA4A 2XNPA 3W8LA 4FR0A 1SYKA 4U7PB 2X6DA 2QOFA 2XNBA 3BRBA 4BYIA 5IUGA 3V6SA 1TQMA 4RWZA 2ONLC 2BVAA 2P33A 3KQ7A 1FOTA 1M6YA 5CXHA 3F2AA 4I6BA 5U4XA 1Z3CA 4M8TA 5CCBA 2PT9A 2VWWA 3WZJA 2OBJA 3TT0A 2R3PA 4DGMA 1UU9A 2JLDA 4YV1A 5CSXA 4FUXA 1OUYA 3Q9XA 3MPAA 2W5AA 3TQSA 2BILB 3SMQA 5HU3A 5IQAA 3DZOA 1J1BA 3GJYA 2B9JA 3LE6A 4C08A 4IC7A 4AXAA 4F08A 1CTPE 2XIRA 3ZDIA 4I0TA 4X3JA 2YXDA 3M11A 5L2IA 2A27A 1Q8WA 3FYJX 2NP8A 3K3IA 4AT4A 4EC8A 3GXOA 3F7ZA 4R3PA 3FPFA 3ACKA 5CM2Z 2O63A 2P8JA 4FE2A 4BDHA 4PNEA 3VWAA 2PMLX 3EZVA 5L3AA 1OIUA 3EOCA 4JNWA 1O9UA 1OKVA 2FSMX 2H34A 5AV1A 5GJFA 3HKOA 2QKWB 2PE2A 4FTAA 2AC5A 1WXXA 1MQ4A 3B3JA 2WTVA 3RWQA 3FI2A 4CG8A 2HW7A 2HNKA 1OL6A 1UU3A 3OEFX 3Q52A 4AA4A 5GINE 1WXWA 4ITHA 3RNIA 4I5HA 1PF8A 3G7UA 4YO6A 4EOMA 4LM5A 3M6XA 2G15A 4FZFB 2XNNA 4FV2A 3G2QA 5KYGA 3VBWA 3QX2A 3DS6A 2C6TA 4FKPA 2OF2A 3GXLA 1AV6A 3RAWA 4MXXA 3RAIA 3QV2A 2O07A 4FZ6A 4BI1A 4A4XA 4E2WA 4K0YA 4JVGA 4FKJA 2UVXA 4QMOA 4JDJA 3V8SA 2XNEA 4FT9A 4CT2A 5IEYA 5CEMA 2VU3A 4JDHA 5HLPA 3DFAA 4HZSA 1ZOHA 4O91A 3FKOA 2VTIA 4Q5EA 1ZARA 3WILA 2VD5A 1JVPP 3VUGA 3BHUA 3GQIA 5LVLA 4FZVA 4AUKA 2VTJA 3QRUA 4OBWA 3GDHA 5CVGA 4F0IA 3S4QA 4HNFA 4ZAUA 2I6GA 3UVPA 4DLJA 4DBNA 1YHSA 4S2ZA 5BQ0A 4CKCA 1IM8A 4PQNA 3G89A 1ZYSA 4YLJA 2F9GA 1RI3A 5HIBA 3IKAA 3FPQA 2ITPA 2F7XE 3D2KA 2YX1A 2JBOA 5FULA 1WBVA 2C0TA 3P9JA 4BF2A 5E9JA 3KN5A 4FKIA 3QWKA 3S00A 3TM5A 4CT1A 5DRBA 3IDBA 5FQOA 3ZOSA 5ANJA 5KKRC 5EQYA 4I4EA 4IZ5A 2OYRA 1UIRA 3MPMA 5IPJA 4X63A 5K0BA 3NUAA 5K0CA 1H1WA 3JY0A 1W82A 5HFJA 3OWKA 4YC6A 4Z2YA 4WG3A 2IJMA 3TNHA 3EYHA 4EBWA 3O50A 3BT7A 5M4CA 2F7ZE 5JFVA 4ER5A 3VS4A 3HECA 5DRDA 4IFGA 3CY3A 2OH4A 4FTLA 4IB0A 1SNUA 2CLXA 3CBLA 2OJFE 1KPGA 5BUJA 3HMMA 4IDTA 2W1DA 3PG3A 3A25A 3V5QA 4OTHA 5A4LA 3R7EA 2R3JA 3O7LD 3KY2A 4JAJA 4JBPA 1P14A 4A7CA 1HOWA 4QO9A 4LWPA 3Q32A 3OY3A 3FZPA 4QYGA 3UNKA 1NW5A 5HO8A 2OJJA 3PZHA 3UNJA 4YZBA 2BFYA 2RGPA 2QG7A 5CF8A 4BBEA 4RTOA 2WXVA 4RTNA 3MYGA 2H6DA 3OF0A 3CJFA 4D2RA 1IAJA 3SG9A 4J1RA 4BRXA 5EIWA 1ZY4A 4OQDA 5A3XA 1S9IA 1RW8A 5LSAA 1BKYA 3FPMA 3QTIA 3AC2A 4I6HA 2I0VA 3R73A 2QURA 5TKDA 3F7WA 4XG9A 4Z7GA 1Q61A 2PVKA 3UBTA 4K9YA 4E4MA 3LCTA 4KBCA 5FP5A 3UPXA 2HZ0A 2ITNA 2IDKA 3VJNA 4EK3A 5HD4A 3ERCA 3ODYX 5AUXA 4XX9A 5B1SA 3SC1A 3UE4A 2C7RA 5FEEA 2PY6A 2WMAA 4C36A 4BDIA 4R8SA 1W0XC 4NECA 4EYJA 3OXZA 4IAZA 4O0UA 1CM8A 4X0MA 1RE8A 4C62A 3DKFA 1FVTA 2RL5A 3W18A 3HP2A 3PTGA 4CFUA 2OB2A 2QOQA 3BPRA 3E8DA 3H0ZA 4KIPA 5DM4A 4AS0A 4EMSA 2EJUA 2HZIA 1U2ZA 2AR0A 5DN3A 3DXNA 2VWXA 3REPA 3Q4CA 3EFJA 3PP0A 4FGBA 4MBJA 4C34A 3ELWA 3SHEA 4W4WA 4C4JA 5IEVA 3R8UA 2OO8X 4EH8A 4FVQA 2CLQA 4U41A 4GG7A 3FMLA 2RF9A 3WYXA 2EWAA 4DH8A 3V3VA 5HD7A 1KYWA 3TIYA 3AMAA 4YJNA 5A6NA 4NFMA 3BXOA 3B2TA 3FI4A 1M52A 5I9WA 5M56A 3C6KA 3NSZA 1U4DA 3GCUA 2XK9A 5AUZA 4ENYA 5GM1A 5KMIA 4XOZA 4RX8A 4CSVA 3LFDA 4GOND 1EQAA 3L8SA 4L7FA 5M4FA 4BCIA 4G5PA 2GS9A 4EH4A 4QMNA 3FYCA 3SXJA 4UV0A 1JG1A 3ZSGA 1NW6A 2OZOA 4FIFA 1PMEA 4O6EA 2W1EA 3FRHA 3LFFA 4FL3A 5CAPA 4X60A 2ZBRA 4R1YA 5A6OA 3KQQA 3MTIA 3SGLA 3QKKA 2IWIA 1Q3WA 4HJOA 2CKQA 2ESMA 4FTKA 1JNKA 4OX9Y 2C7QA 1LUFA 3MH2A 3VUDA 2R3LA 1PXJA 5L2WA 1H1DA 4ID7A 1Y8GA 1ZGJA 2IZUA 4QQNA 4IIRA 3L9PA 4DTBA 3F6XA 1W83A 4LUEA 5LXMA 5JSMA 5LQUA 1Q97A 1MRUA 5EQEA 2GNJA 3LM5A 3V04A 2QI8A 3NW7A 2WIPA 4GJ3A 3QQGA 3T3VA 3FPHA 4LUDA 4P2KA 4G1WA 4IZAA 2ITVA 4R7BA 3OVVA 3ME5A 2J0IA 2A14A 3TXOA 4FNYA 2HYYA 5JQ8A 2C1BA 4AOTA 3F66A 3DGKA 4BCMA 5TF9A 3UNZA 5LVOA 2O0UA 3I9FA 3HRBA 3U8WA 4FI1A 4C07A 4DEGA 2HV9A 5CLPA 5I9YA 1M0EA 3D9VA 2QG5A 4TWOA 4FYOA 4ACCA 2J4ZA 3VN9A 3DQXA 5IDPA 4X6RA 4EWQA 2HMYB 4YNEA 4YV0A 5ERGB 2X7FA 3PFQA 4HC4A 3LX6A 1T43A 1Z9XA 1BYGA 4A4OA 4DLIA 3PA4A 3DBDA 4ZOGA 4TYGA 1EH4A 4ASDA 3FBVA 2C6OA 2EU9A 2YZAA 2PUIA 3PE1A 5HE3A 4RLLA 3GRYA 3UJCA 5DA3A 3R8PA 4DEIA 4BDAA 3DUWA 3V8VA 1X1BA 2UYOA 3RKBA 4ATNA 1RJEA 3GRRA 4YMHA 3JVSA 2PZ5A 4C4EA 3A99A 2W7XA 3IPHA 5IUIA 2Q41A 2VDWA 5EOBA 2IH4A 4HOKA 3BE2A 3F82A 2PSQA 4EOKA 2BPMA 2IW8A 3NNWA 5FWDA 3EGVA 2XM8A 1CKPA 4Y72A 2HY0A 3GP0A 2O0LA 3PSDA 5L2TA 4YBJA 2ONLA 4YJPA 4IANA 3QXPA 3OP5A 4RIYA 3K5VA 4LOPA 3QYWA 3II5A 3D7TA 1NVSA 2GTMA 2VO7A 5HLNA 3C4ZA 4ASEA 3SDJA 5CANA 3VC1A 2QNJA 3SX0A 5HI2A 2PUPA 1YZ3A 5CYIA 3OCJA 2X39A 5DR6A 4FMQA 2UW8A 3HEGA 3QUPA 5LQFA 3WARA 4FZAB 2P7IA 3KR1A 4FTRA 5IG1A 4P5QA 5LWNA 3GGDA 1WVYA 5HQ0A 3KRLA 2NNWB 3VHKA 3DAEA 3NEWA 4FV4A 4AACA 3AD6A 4N6YA 4A6DA 4DYMA 1MJFA 5C4LA 3NLBA 3NW5A 3S95A 1A9UA 4EQUA 3N51A 3IGOA 3UA4A 3QTSA 4M0ZA 4IM3A 4FOCA 4WBOA 5E8TA 3H4JA 5LVPA 4RIYB 4K6ZA 4E6DA 3BLHA 3D7TB 1ZRZA 4ZMFA 4UN0C 3DBFA 4FKRA 5KQRA 4EK5A 3TM4A 1K2PA 4I92A 5IH3A 3HTXA 3OU6A 3DTCA 4MWHA 1ZYDA 4UWBA 5HIKA 4MXYA 4IV8A 4E73A 3VS0A 4O0VA 3DZQA 3TTIA 1TW2A 3SV0A 3QCYA 2OBFA 4HTFA 3DBCA 4BZOA 4L44A 2PMOX 4XG8A 3ZLXA 4F09A 3R00A 4LMNA 3MTFA 4M15A 2ERKA 4WG5A 4D0WA 4TXCA 1OL7A 3DT1A 1BKXA 3UYTA 4R05A 3FZGA 4F6SA 3ELDA 3SQQA 1J7LA 3DXQA 3E8EA 3NCZA 5ICPA 5D9HA 4FSQA 1YDSE 3DCVA 5BX0A 4XG6A 1VP9A 3GU3A 5AEPA 4WG4A 3UWPA 4FVPA 3IV6A 3DMHA 3VIDA 4EVIA 4MF1A 5B2LA 4CZTA 5M44A 3ORHA 1SQGA 2GNGA 4U43A 2ITZA 3R28A 1L3IA 2O57A 5A46A 1YI4A 5DTQA 5C27A 3ET7A 5GIPE 2R64A 5ACBC 3RTPA 1G8AA 2XKDA 2CSNA 5DT2A 4CRLA 4L7VA 3QRIA 3AD4A 4HTFB 4H3BA 3E87A 3NWWA 5FQDC 4C4HA 5GOZA 4YBKA 3QTWA 5LR6A 5FUBA 2VZ9A 4YHJA 4L01A 5FTOA 4IBMA 4KAOA 3MJ2A 4FG8A 4KKEA 4A4LA 3G5LA 2WK1A 1VZOA 4X61A 2GNHA 4R7HA 4HPTE 4EEVA 3H9FA 4B6LA 2UW6A 4GOOD 4YU2A 2Z02A 2BFXA 3HP5A 4RBLA 5EDRA 1Y6BA 4C04A 2XBAA 3QL8A 4A06A 1IR3A 3ZO3A 4PWYA 2YWVA 1HCKA 4FSRA 2YVLA 4MBLA 1Y8YA 3A7GA 3DLCA 5AP3A 3ORKA 1XCLA 4E70A 1GIJA 10MHA 3FI8A 3E93A 5C0OE 3ZO4A 2QOCA 4P90A 4FNXA 1F0QA 1YKRA 5FEDA 2GS6A 4JXFA 3ZBFA 4PDSA 2OK1A 1QL6A 3DPKA 2PWPA 2DPMA 3R6TA 4M37A 1M6EX 4GYIA 4YR8A 4HVIA 1YZHA 2UVZA 2AOXA 3QZIA 3K2LA 4X21A 2WTKC 4RX5A 1NW7A 2R3MA 4I6FA 4G2FA 4BBMA 4KKHA 1AF7A 4XHKB 3G2FA 4AZTA 4FZDB 2X9EA 2BHEA 3SOAA 4L45A 2DS1A 5T64A 4NSTA 2PXAA 4CFWA 5KKRB 5HE0A 2CL5A 3R02A 2P3OA 4GOMD 4NL0A 1OIRA 4C2WA 3BKWA 4XG7A 2R7BA 3OT8A 2Y7JA 3QCXA 5JGDA 3QD0A 2JC6A 4FL1A 5DSXA 4OBPA 3HA8A 4JBVA 5BUIA 4DFNA 3SVVA 3BELA 2B9EA 4RVMA 5E8YA 3LHDA 4UZDA 2UVYA 4EORA 2G2IA 3EYGA 1YXVA 4JS8A 4DT8A 1QMZA 5E1DA 4F86A 2UW9A 3WZDA 4FGRA 4KD1A 2W0JA 5IA1A 1JSUA 4G3CA 2BRHA 2ETRA 4HGEA 4H1MA 2YCFA 4IV0A 2PVHA 1BMKA 2IZSA 5J8IA 2YERA 3RPRA 3NS9A 4OA5A 4M12A 3MFUA 1OVEA 4C58A 2FCAA 2GU8A 4OTWA 4RTJA 2ITUA 2J50A 3NAXA 4FTTA 4E26A 3ELUA 1XH9A 5DTRA 3WF6A 4PGHA 4EKGA 1H4LA 2GB4A 4U8ZA 2R3HA 3QGYA 3Q4ZA 5IF1A 3QQFA 3RALA 4F7SA 1ORHA 3QKMA 5K4JA 4GK4A 3W2CA 3O4FA 4KA3A 5HIMA 5CF5A 2JIVA 3E5AA 3EQDA 4BCHA 2ITQA 3OTVA 2Y4IC 2YFXA 2I6LA 3GIWA 3IOKA 1UKIA 4ACHA 1XH5A 3JXWA 4EH2A 4FEVA 1L1EA 1WVXA 5FLFA 3FQSA 4R3CA 3TKUA 4U80A 4GW8A 4XP2A 2P2HA 4G17A 2WA1A 4MNEA 3I5NA 4QTUB 4USFA 4O7ZA 3EKKA 1OR8A 3VVHA 5CALA 1XDUA 3UOKA 3F69A 2ZM3A 3EQHA 4ZLYA 4G3DA 2EXMA 4ZS4A 1OKYA 4P7EA 1Q5KA 4AZSA 5A9UA 1UNGA 4D4VA 1HNNA 5A4TA 2ZW9A 3ZFYA 3ZS5A 2WELA 2BHHA 3UO6A 1S9JA 5AAEA 3IW6A 2ZOQA 4A9YA 4M7IA 5IMXA 2QO2A 4EZ7A 4GCJA 3KCFA 4E4LA 3C4WA 3MY0A 2VWIA 2XKEA 4YTFA 2I0EA 2NPQA 4BB4A 1JG2A 1FJXA 4I21A 3HRCA 5IA3A 2GSFA 3HAMA 5E8VA 4MYGA 3FMHA 3PX3A 5LVNA 3W2QA 4BTFA 2FHPA 4QMMA 1O6YA 3ULIA 4QP8A 4MNEB 4PMMA 3MESA 2IVSA 4JRNA 5MHTA 3ATTA 1FP2A 1SZMA 1VLMA 3KRRA 1PXMA 4YJTA 3KK8A 3QHWA 2J0KA 4O2PA 5EZQA 2PKWA 1KV2A 3R63A 4PDPA 1XH4A 2I9KA 3BU5A 3Q2MA 4MNFA 3ZC6A 5DX0A 3NYNA 3OCBA 3FTCA 4RTKA 2WQMA 5DEYA 4QMXA 4TPTA 4Y8DA 1ZHFA 2OGVA 3ITZA 5HE1A 2J5EA 3UZTA 1DL5A 3OU2A 4G34A 2BRNA 4FG7A 5J9YA 3TKIA 2YJRA 2JDVA 3MPTA 2ITOA 4O7YA 2XUUA 4BHNA 3GOPA 2CGUA 5HCYA 4AOIA 3UIXA 4S34A 5AUWA 3RK7A 1SVUA 3QGWA 2ESRA 3Q04A 2P41A 1YOLA 3OMVA 4APPA 3NVMB 3LPBA 4GVJA 2CGWA 2ZFUA 3PXZA 3ZMMA 4G56A 1NVRA 4QQJA 4CKIA 3P9IA 3FZRA 4GG5A 4C33A 2JHCA 3D0EA 5EMJA 3EVGA 3FE3A 4E8AA 5I4NA 1IXKA 4XYFA 4CVAA 5AAFA 4DT9A 3PRFA 2XKFA 3A62A 3KMMA 2RFSA 3LLTA 4E2YA 3ORNA 3EHAA 1FPUA 5AV0A 3KQOA 2W5HA 1VQ1A 3P97A 4PYIA 3POZA 5K0EA 3R7OA 4RZWA 3Q3BA 2BAJA 3BCEA 3RJCA 4ZY5A 2P3LA 4CLIA 3T9IA 3DOGA 2XA4A 3L9NA 3ZUUA 3RK5A 3PP1A 3ZLYA 3BKBA 2PPQA 3QBNA 3UMXA 3LGAA 4GV1A 3Q4TA 3C51A 3NR9A 4YJRA 3GU6A 2OWBA 3G51A 2B9IA 2UZUE 4I1ZA 4E4NA 3AC4A 4LOOA 3HCAA 4GEOA 3HMIA 1KSWA 4EH6A 4RWIA 4DFBA 4J8NA 2IW9A 2WQBA 1OBDA 4GEKA 4Y73A 4O83A 4FV5A 2RG5A 3ENMA 3HA6A 4RJ5A 3G2OA 2P55A 1MUOA 4BTKA 4L6QA 5HKMA 4K8AA 1ZMVA 5LMKC 3P86A 3MJ1A 3R22A 4O27B 2IVUA 4CGAA 2AS0A 1E9HA 4FTIA 4AN9A 4QPNA 4UWCA 3MVMA 5KZIA 3V5PA 2HZNA 1U5RA 4MXZA 2IN6A 2YAAA 5K0JA 3QD3A 1WS6A 3I5UA 1UU8A 1A48A 3OFMA 3QTRA 3BZBA 2PTKA 4L52A 4ALUA 3LXNA 4HH4A 4TNDA 4AW1A 1BI7A 2YWPA 3TJDA 2PVNA 3KKVA 4F63A 4YJQA 4PTEA 4YZ9A 4WIHA 2ZBQA 3GC9A 1HMYA 4A9UA 2JDRA 3F2NA 4JQEA 3G0EA 3R3HA 4QP3A 5CSPA 4QMVA 2J9MA 4JT3A 4G3EA 3TKAA 5CWZA 4EHEA 4LG1A 2BKKA 5LCJA 5EDQA 3BZ3A 3EB0A 3OD6X 4ANBA 3TKYA 2VTHA 5HX8A 1R8YA 4WRSA 2G1PA 1OB3A 4Z16A 2Z6AA 4TT7A 5IA2A 1KE5A 3BQRA 2C3KA 3TDWA 4P7JA 5ICEA 2OG8A 2CMHA 1MQBA 5HIDA 5HCZA 4F64A 3QOWA 4RJ7A 2EVAA 2PL0A 4TWPA 3R83A 4YC3A 5DIAA 4I23A 3B3FA 5I9XA 1R78A 3MB6A 2VTNA 2QR8A 2KW5A 4F9YA 4P4CA 4J95A 2YM7A 4KSPA 2PVMA 3BYVA 2X9FA 1XH7A 4DEDA 2AN4A 2JKOA 4TL0A 3HNGA 4RG0A 3UJ9A 5GJDA 4X3FC 4YUVA 4XV2A 4BDCA 3V5JA 4CZUA 5E8XA 2ZSUA 4U81A 4JLCA 5FHQA 2PXCA 5B7VA 2F2UA 4O7TA 4EUUA 4HCVA 5AP4A 5BYZA 4QPPA 4Z7HA 2HWKA 3MSSA 1TKIA 3ORZA 3V8TA 3DK7A 3BU6A 1NE2A 4JDKA 4QOXA 4RQKA 3GEQA 5FTWA 3LKZA 3C4CA 4DBXA 3M33A 2ZWVA 2P3QA 4ALVA 3R8VA 4EYMA 3QQUA 4IVAA 3W2OA 4EUTA 4IZ7A 4OLIA 4QTTB 2ZIFA 4FT3A 2X7GA 2XYQA 2GQRA 4JR7A 3V01A 4DTKA 3VF9A 2IO6A 4BY9E 3C1XA 3CJTA 1D2HA 4G31A 3OXTA 3KULA 4GU9A 4PP9A 1UFKA 1G60A 3KXGA 4PDOA 2OB1A 4ZIMA 3EN9A 3EVEA 4ZTBA 5E8UA 5K01A 5AUYA 3VRYA 3OWJA 1KPIA 5ANOA 3HA7A 4D5KA 4AQCA 4ER3A 4OTFA 4HYUA 4PRJA 3BGZA 4BCQA 2CNUA 5IA5A 4ER7A 3ER9A 1ZMUA 3TACA 2VTQA 3DLSA 3PUPA 5DWRA 3SLSA 3ORMA 2FPOA 3BHVA 3LAUA 3OCSA 4YHTA 3O96A 3OT3A 5BPYA 2C3IB 4RVKA 5E1BA 3KULB 2A1AB 4BLUA 2I1MA 4MQ2A 1JR4A 3MERA 4YJUA 5JZJA 2JIUA 5ACKA 5EMLA 5EI6A 2HR1A 3R8MA 3RM6A 4P5ZA 2E9VA 4C03A 2ZAZA 1OL5A 3QUDA 4MWZA 2X8DA 5EC8A 2OIBA 4YZCA 5EFQA 3R9XB 4WNMA 5H8GA 3V97A 4QYFA 4AGWA 2DQ7X 3O7LB 5LMAA 4GBED 3MA3A 2PSSA 4BCGA 2AOWA 3DBEA 5K3YA 4AFEA 3GNLA 3C6MA 2JKKA 4R77A 5H8EA 4QMTA 3ANRA 5AA9A 4IE9A 4HVGA 4TYHA 3SG8A 2WTKB 5CU0A 4FKQA 1XBCA 3ORPA 4FA2A 3CGFA 2ZB1A 4ZEGA 4UY9A 2PBFA 4C3FA 2BRMA 4KS7A 4X2JA 3BGPA 4O38A 3TUBA 4E32A 3PB3A 1EJ6A 3CVOA 3SRVA 3OZRA 5DH3A 5KBQA 4B0GA 2Y8OA 3IK3A 4LECA 1W84A 3GOKA 2QVSE 5FXSA 2EUFB 1JAMA 3KRWA 4QMQA 3ALNA 4FIGA 3UP2A 4BCPA 1H24A 3FMMA 5FP6A 3FRIA 5DPMA 4LFIA 3D5UA 3M70A 2XZSA 3T9TA 4BDBA 2W9FB 2P40A 4RIOA 4ZY6A 5IUHA 1B39A 5AV4A 3SXRA 4USEA 4JXJA 1O6LA 4N0SA 5G02A 4MH7A 5JRQA 3UOHA 3R21A 4CKRA 2HY81 1XBAA 5L6PA 3TPZA 2OSCA 5CXZA 5JUWA 1J3HA 3HVCA 3KA0A 5KE0A 3PDTA 3KVXA 3GU7A 1JKSA 1P1CA 1UV5A 2WMRA 4BDKA 3AG9A 4WKQA 3GFWA 4QTBA 2JEDA 2XH5A 4DFZE 3REOA 4DEHA 5ANIA 2OJIA 5HNGA 3B2WA 4HPUE 3SRVB 5AV2A 4PYNA 4ARKA 4WT6A 4OTQA 1P4OA 4JBOA 4OTRA 2UV2A 4I0RA 2VN9A 4IAFA 2G72A 5FUTA 1WBNA 3AT4A 3FAAA 3ZYAA 3SD0A 1PJZA 1SM2A 4JG8A 4ZZOA 2O05A 3G8AA 5CD1A 1BLXA 4KBAA 3PA5A 5HO7A 2NXEA 4HCTA 3ETAA 3POOA 5EKUA 3MY5A 4WNPA 4IWOA 3C9WA 1JSTA 3THRA 4V04A 5GHVA 5TO8A 3PY0A 2ZLBA 4UBAA 4C02A 5B0XA 4XBUA 2AZTA 4P58A 2XVDA 5C8NA 4IADA 4XG3A 1SVEA 3E7PA 3IW8A 1H1SA 3PPJA 2VNWA 3A8WA 3QTUA 1PMNA 5CCXA 3W10A 4FYNA 2Y4IB 4M69B 1MHTA 3QKLA 3OW4A 5HVJA 5HICA 2GPYA 2QLUA 4QMWA 5AUUA 3KR0A 1OI9A 3KMUA 3V6RA 3KXMA 3MW1A 3OOGA 4YJVA 4YSMA 5CS6A 3KL8A 4FIHA 2F4JA 1YFJA 4EH9A 3KFAA 4ZK5A 3O17A 4U45A 1UU7A 4J96A 5JRSA 2OF4A 1JSXA 2XP2A 1UWVA 3WBLA 1YI3A 3LPMA 4RIXA 3TM0A 3LBFA 3QOXA 4ZJIA 2UW3A 5FADA 5IQEA 4FIEA 3C0GA 2VTPA 2W1CA 4O7NA 4XNEA 3ULZA 2WMQA 5CZHA 3QQHA 5IQDA 3F9NA 4EH7A 1KWPA 3K0BA 2PMIA 2R6ZA 3HGKA 4M97A 2O06A 3IHTA 3BV2A 4BDDA 2O5KA 4J71A 2OFUA 2BM8A 3N4UA 2G2HA 4QP7A 2OI4X 5FDXA 4EHZA 3QA0A 4IW0A 4XCUA 3EQCA 2B0QA 3MQ2A 2A4LA 1WMKA 3OZSA 2GFCA 5E1SA 3SVZA 4IB1A 1JG4A 1V0BA 2W1ZA 4RGJA 2WMWA 2ONZA 1Z57A 5AFVA 5FWAA 3UOLA 4RIXB 5E4HA 4DQ0A 5LQAA 2BIYA 2WZJA 3PIYA 3HCFA 3FKNA 4LOQA 3S1HA 4AG8A 4DCAA 1LP4A 4FSTA 3A8XA 4TYIA 1LPUA 4C06A 3O31A 3E62A 2OZAA 3P2IA 1B42A 4LRKA 4AN2A 4P7KA 4R5SA 4M14A 3HV5A 4FT2A 4QNYA 3FZTA 1ZMWA 4PV0A 4FK3A 2WMUA 4ZMEA 2I0HA 4AW5A 4DKJA 4PP7A 2XK3A 2PE0A 5CSVA 5J9LA 2R0IA 4ONAA 5F95A 4KIOA 1OIYA 1XDSA 3V51A 2QYOA 3LM0A 1VJYA 5HTCA 1H25A 4QVGA 4CQEA 4RIWA 1X1DA 4AGCA 4D0XA 2OZAB 3VRZA 5HBJA 4IC8A 3UMWA 3FPGA 1NA7A 3ACJA 3DLIA 5J87A 4BCFA 4YUWA 1KR5A 1G38A 4B17A 5CAQA 1H28A 3OTUA 5EQPA 2AN5A 4BC6A 5IH6A 3RPVA 3P9NA 4U79A 4XG4A 5IQIA 3VQUA 4DC2A 5LMKA 3C13A 1KIAA 2UW4A 2JKQA 1SMHA 1QANA 5GJGA 2OKCA 3U54A 4BLVA 3JS2A 3U6JA 2EJTA 4NM3A 3FXZA 3ZBXA 4RIWB 1URWA 3HDNA 4BVUA 3I4BA 4TYEA 5FM2A 4O22A 3V5LA 3TZ7A 3K54A 5LARA 4GIHA 5K9IA 4AOJA 2DWBA 3E92A 5F1ZA 2YDKA 1DI8A 3UJAA 3FHRA 5EYMA 3WZUA 1G55A 4XBRA 5AIKA 3PJ1A 4ZTRA 3BWMA 4RX7A 3QZGA 2B3TA 2YCQA 4U3YA 3EJ1A 2ZBPA 2GS7A 2ZV8A 1BL7A 5EVJA 3G5DA 1VPTA 5AADA 4F7NA 3GI3A 3LOKA 2XEYA 3HLLA 3QZHA 5M53A 4E1ZA 4MXAA 4WNKA 4E93A 2EFJA 4AZFA 1QAMA 4D1SA 4C59A 3M6UA 5AUVA 3DR5A 1P5EA 5EYKA 4BDGA 1O54A 5KCVA 2ZDUA 3B8RA 4X6QC 2BTSA 5CQWA 3L9LA 2R3OA 3R2BA 5C01A 3DKCA 4IX3A 5HOQA 3ZLSA 1YDTE 3TUCA 3BGVA 2QY6A 4EI4A 3NUUA 4O81A 3VUIA 4H1JA 5EK7A 3HA3A 3VBYA 4QP1A 3ORIA 3TRKA 1FMOE 2AVNA 2AN3A 5GM2A 4X3FA 4M13A 3W2RA 1OZ1A 3P23A 4FEUA 4D58A 4JL9A 4CMOA 5KS2A 2I40A 3OFKA 2PVFA 4LV8A 4L3JA 3D5XA 3HVKA 4OA8A 2B52A 2YQZA 3NDJA 2ZZKA 4DTAA 2OZVA 3OY1A 2HXQA 2XB7A 1P2AA 2Q0BA 5DT4A 2BR3A 3ZHPC 4GT4A 3TIZA 3NIEA 4FGZA 3HCEA 4FV0A 1FBNA 1Q8UA 5H02A 3ZONA 4D4RA 3R04A 2HAKA 4U7ZA 3TJCA 5CU2A 1O9HA 3GQLA 3G88A 5EYDA 4XCXA 4KVZA 4F99A 4MTAA 4C4FA 4IAIA 3BWYA 1KE9A 2CGXA 4X3FB 3HL7A 3R6XA 2DULA 3D4QA 2W5BA 2UZWE 4PL3A 2B54A 3EKNA 5KMOA 5M4IA 1YXTA 4FKOA 3I1AA 3SKCA 3KXHA 1X19A 4ZZNA 4X1OA 3FUUA 4MX9A 4IVCA 2VWZA 4NFNA 4GK2A 5JQ5A 1WY7A 4X2FA 5EHGA 4W4YA 1QPDA 2CKPA 2B2CA 4B8MA 4RV9A 2V74B 4IKPA 2DUVA 1H27A 1YHVA 3LJ0A 1CSNA 4ANSA 2VWYA 4CKEA 3GU5A 5J7HA 4Z55A 4RVHA 2OPBA 4BCKA 1FQ1B 3E3BX 3MDYA 5CU4A 1GZNA 4JX7A 3BUSA 1FVRA 2BTRA 4ZXTA 2C3LA 5L8KA 3KQMA 2YIYA 2VX0A 3SGCA 3MV5A 3R0QA 1YUBA 2VTRA 5CEIA 2OY0A 3LFEA 3NNUA 4PCLA 2C5YA 3LFCA 1L3BA 4CTBA 5HCXA 2C6MA 4M68A 3UA3A 3V8WA 2BR1A 5LQJA 2Y9QA 5EGSA 3I64A 3DQWA 3TCPA 3FJQE 9MHTA 3UIUA 4S30A 4BN1A 3ZRMA 3VC4A 3NNXA 5L6OA 4RA5A 3UFBA 5EM8A 2PVRA 3CTQA 2H1RA 5FXQA 4OBOA 1H1RA 1D2GA 3VS3A 3UDBA 3PJ3A 5JH6A 4PUZA 2UZDA 4FT0A 2QOHA 3NVKI 4EQCA 3AGMA 1KE7A 2JKMA 4EZ3A 5CNOA 1VR2A 5F2KA 3RCDA 2G71A 2X2LA 1UNHA 5K5XA 2E5WA 3LMIA 1KUTA 2I7CA 3OXIA 4EWHA 3R0TA 4FV8A 3IQ7A 4PTCA 4DEEA 2AOTA 4FEWA 2WMSA 4YZNA 1WBPA 4FTJA 4O84A 4EL9A 3CJQA 3HEMA 5ICCA 5H9BA 1Q3DA 2HZ4A 3H30A 3F3VA 5GP1A 2YM3A 3VS5A 4RC4A 4N4SA 4FL2A 2BR5A 3UPZA 4F7JA 1GY3A 4C7TA 5EM7A 5DI1A 1F3LA 4I20A 4BCOA 4WHZA 3K6RA 1H1QA 2WQOA 1M2RA 5IMEA 3VSEA 4YGAA 2X4ZA 3TZ9A 3DOUA 5EQJB 1X8BA 2YUIA 2FGIA 3GC0A 3LJ1A 2ADMA 4RSSA 1T45A 4W4VA 4OBXA 4BCJA 4KKGA 3KR2A 2I7QA 2AOTB 3GB2A 4EOPA 4M7RA 4ASXA 4XP3A 4Y95A 3H10A 4FC0A 4ZLOA 5F2OA 3KGAA 4LGGA 3FLNC 3MY1A 3I5ZA 2ZB0A 3MCTA 5CSWA 3L8DA 3P71T 2YJSA 2A19B 3IW4A 2X8EA 1ZWSA 1H01A 3ZO2A 3TN8A 1JTEA 5J5SA 3C4EA 4WUAA 3SOCA 2HIWA 4AW2A 4K11A 3ER8A 3DK3A 3Q2JA 2UZNA 3CE3A 4I24A 3UODA 1M7NA 2ZMCA 4HCUA 5EKXA 3LZBA 1BL6A 2P2IA 3E8CA 3CJRA 2CJMA 1WBWA 4UYNA 2BRGA 3E8NA 1ZAOA 5CEPA 2UZEA 3TTJA 3LVPA 4RWKA 3UP7A 1NW1A 2HXLA 4Z9LA 2FA2A 5IH5A 2YXLA 4S33A 4PNIA 4WUNA 1XO2B 5KVAA 4KWPA 4APCA 5E2BA 1INLA 2WNTA 4ZTNA 3JR1A 1NKVA 3LMGA 3ZSIA 3FC2A 3MN3A 3C5UA 3UVQA 5JFSA 2R3SA 1H1PA 3BGIA 3LXPA 5HG8A 3VBTA 4Q5HA 3ODZX 3DTWA 3FUPA 2HK5A 3OCTA 3HA5A 4P7FA 4XLIA 1IRKA 4F84A 2OJ9A 3F2RA 4A9TA 4IWNA 4PNKA 3OU7A 3BLQA 5EKOA 5G1XA 2FYSA 2J2IB 2IW6A 1U54A 4L3LA 3EVFA 3QWJA 2GDOA 5EOLA 4EK8A 3R9NA 2P1DA 2HTEA 4ASZA 1YVJA 4XRJA 3I58A 1GJOA 3R7IA 3I60A 3CTHA 1XJ5A 3ATSA 2WIHA 4I94A 3PVCA 1DS5A 3EVAA 4F9AA 5HX6A 3NWBA 3OWLA 2WTWA 5TOZA 1VEBA 3HNRA 3DK6A 3NJRA 5CTPA 4XJ0A 5HGIA 4GOLD 1VE3A 3HMPA 1RI5A 3EFKA 2QR7A 2Y1WA 5BXYA 1XHAA 5I9UA 3R1SA 3ROCA 4WXHA 1XBBA 5CAOA 4NU1A 2C6KA 2C6LA 1PHKA 2W4KA 2BZHB 2X8IA 3N4VA 4FEQA 3PXKA 3GCPA 3BHTA 3GU8A 4O7WA 2BM9A 4R7IA 3NDIA 1U54B 3C3PA 5DGZA 2BMCA 1YB2A 1Q24A 4D1XA 4XV9A 3CS9A 4CV9A 3NYVA 3R1YA 4WVLA 3PJ8A 2PXXA 5M55A 5LQRA 5B2MA 2VWBA 4FICA 3T8OA 5F20A 3WIKA 5CIYA 1X1CA 2PWLA 3HUBA 3GCZA 4PMPA 2H96A 4ITIA 4DE4A 3NAYA 2WTIA 3QLFA 3PG1A 3CQWA 3W16A 4NUSA 4A07A 4DG2E 3TG1A 3WF9A 3JWJA 3NNVA 5IISA 3UYSA 4BCNA 4F9BA 2PY3A 4EOIA 5AJQA 4M38A 4ACDA 1RJGA 3LLAA 4BGQA 4RC3A 4Y5HA 3MGYA 1Q8YA 4QPSA 5CZIA 3AOXA 3COKA 4MK0A 4JRVA 3PTAA 2BH2A 4PIPA 3E23A 2YABA 5M08A 5FQNA 4TNBA 3BYMA 3DH0A 5A4CA 3AT2A 2B1PA 3GENA 2WOUA 4I4FA 2AC3A 2CN8A 3TR6A 4BZDA 3I53A 3ZM9A 4M36A 5FDPA 3SR4A 1BX6A 3KC3A 1R0EA 3MVJA 2XVMA 3ZSHA 1YI6A 3OW3A 2V22A 2IH5A 4HGLA 3HP7A 4V0GA 3FPJA 3FKLA 3HRFA 3EZRA 4ZLZA 4K1BA 2BIKB 4WNOA 2ONYA 4AX8A 3QLGA 4FV7A 4LL0A 5CF4A 4AFJA 3IYLW 4CCUA 1JQDA 2C69A 1ORIA 4IAAA 3ZRLA 4CFVA 4U42A 2VWUA 5K8VA 1PKDA 3GU4A 5D1HA 2YR0A 3R01A 1SVHA 2PT6A 3MB7A 2Z7QA 4EC9A 4HW7A 3NX8A 3LDFA 4BGGA 4ERWA 4CNHA 3ZXTA 2VDUE 4I93A 3JWIA 3G33A 1AQIA 4F85A 2CNVA 3D83A 2PLWA 2BALA 1OPJA 2BCJA 3R8ZA 3TV6A 3UQGA 5M06A 3W55A 2C6DA 1SKMA 1J91A 3U51A 3ENHA 5M51A 3D14A 3QXOA 3DY7A 4V0GB 2J7TA 4QTDA 4OTIA 3T3UA 2FH9A 3IO7A 3WF7A 3PZEA 1N7JA 4PIMA 1NBHA 2W06A 4M3QA 5EHIA 5DM2A 4KS8A 2BDFA 3ZUTA 4JJRA 2K4MA 3DXYA 4QP2A 2ITXA 1RI2A 4F1MA 2PULA 5LQCA 5F9EA 5ITAA 1SQFA 2C6IA 1IAHA 2E2BA 4C37A 3R1QA 4DEBA 2IH2A 4NJ3A 3DB6A 3UJGA 3LBYA 4D1ZA 3NDMA 3MB5A 4C38A 2OJGA 2G1TA 4DH7A 2Y1XA 1W7HA 3CSVA 2XK4A 3QQJA 5IEXA 4OQEA 5JKGA 2N47A 5EKNA 5DOSA 3D15A 5KHWA 4LYNA 3R24A 5HTBA 3F5GA 5DG5A 1TW3A 2VGOA 3Q5ZA 3BWCA 2Z7RA 3OZTA 2YXEA 3W2PA 4GFOA 2WMBA 3MFRA 2XYRA 3HMOA 4YZDA 3W2SA 4F6UA 1WFCA 2YN8A 1NV8A 3FLZA 3SXFA 2ERCA 4QQTA 3LMHA 4DF3A 1REJA 2JHPA 3MWUA 3P78A 3EN4A 2REIA 4C4GA 3M6VA 2FK7A 2YHVA 3CC8A 1O9GA 3RPOA 4EOQA 3KPYA 2UYCA 3DV3A 4IWPA 3FL4A 5JGBA 4RTSA 4GC5A 3LCSA 2IG7A 4DG0E 3AXSA 4TZRA 3EGEA 5EM5A 5F2NA 4QTCA 5I9ZA 2QOLA 3QZFA 3BEAA 5T6BA 3GVUA 4U5JA 4FTOA 5HIJA 3RGFA 3KB7A 1KV1A 3LDGA 4RTMA 4A9RA 3SSNA 2JFLA 3FMEA 3PS9A 2BRBA 2EG5A 1WZNA 3SM3A 5IQBA 2W05A 5H2UA 2XM9A 4YPSA 3K3JA 4O0RA 3DAKA 3CKXA 4QMLA 1I4WA 4NT4A 1ZXEA 4H58A 4O7LA 4YUQA 3NWEA 2IZRA 3QA8A 1JLUE 3BLRA 5BVNA 4DM3A 3TL8A 3HV3A 5IA0A 3A7EA 2J0JA 4EBVA 3ZCLA 3U6IA 4MTLA 2CKEA 5ETAA 4WBBB 2BAKA 3QYZA 3UZRA 5DRTA 1DUSA 3HVIA 2V5QA 5E9QA 2C5XA 3I6UA 4BI0A 1I1NA 3T7TA 3ZTXA 3EN7A 4KB8A 4FODA 3PIXA 4YURA 4FS8A 1M14A 4QQCA 3LIJA 2YAKA 2GNLA 1P91A 3F88A 5K5NA 3KF4A 1L8TA 2H8HA 4L42A 4ZJVA 4ANLA 2XJ0A 1DM2A 3HV6A 5CENA 5CY3A 4DGGA 5JR3A 3JWGA 4IH8A 1R3CA 4J8MA 3B89A 1IY9A 4OTDA 4EK9A 4BICA 2E9PA 3BYOA 4MQ1A 1RI4A 4AUAA 1PMUA 1Q0TA 2ZVAA 2JDSA 5AUTA 1XWSA 4MCVA 5K0NA 3KXZA 5DPVA 4OW8A 3QF9A 3BQCA 3P1AA 3O23A 3E8SA 2ZZNA 4L68A 2EB3A 1OECA 3LCCA 1JTFA 3E3PA 1G8SA 5K03A 4KDCA 1B38A 1CKIA 4IB3A 4XS2A 1A06A 3WE8A 2WQNA 3PY3A 4BLWA 5HNIX 3P8ZA 2R3IA 5EH0A 4FT4A 3NUNA 4AZEA 2ZIEA 4OGRA 4FVRA 5T68A 4KRDA 4FTUA 1PW2A 1G6Q1 2IBSA 4PDYA 4ZP5A 4E5BA 1ZLTA 3LCUA 3EFLA 3GCSA 3OBJA 4EH3A 3VHEA 2C7OA 3BBWA 2ETMA 2W1GA 3TNQB 2OO3A 3ZO1A 4IJPA 3B5IA 3CD8A 4BP1A 5E92A 5FG8A 4GSBA 2W1IA 2YM8A 3PSBA 2UYHA 2WTJA 5T67A 3V5WA 4USDA 2VO0A 3D2IA 2IVTA 4BI2A 3MBLA 3LKDA 3FQEA 3PJCA 4R3RA 1XTPA 3VUHA 4IEBA 2CGVA 3OFJA 3PJ2A 3A4PA 4ANMA 1IG1A 4V01A 4WA9A 4ZTQA 3NW9A 1UA2A 4OT5A 5K05A 4QDJA 1ZGAA 2YIRA 2C6EA 4YMJA 2IZTA 2XEZA 4KDRA 4HNIA 3W32A 5C1IA 2IP2A 3RWPA 2YTZA 4RJ4A 1Y91A 4BR3A 2XNMA 3QD4A 3GO4A 4JBQA 1FPQA 2LGCA 4DG3E 2YZLA 4YSJA 3W1FA 3JVRA 1KP9A 3E63A 4NM5A 4JIKA 5AP2A 1KHHA 4UOEA 4XUDA 3E7OA 2JDOA 5ICFA 4J97A 5FTQA 2GFSA 2O3PA 4AZVA 2YCRA 2C0IA 1VBFA 5K09A 2WO6A 1N7IA 4FBXA 2GAFA 4G9CA 5CQUA 3EN5A 4OTGA 3DXPA 4AE9A 4NW5A 3CPCA 3GUBA 1ZY5A 4RQVA 2GHMA 4MXOA 2CDZA 4MHTA 2I62A 4FSMA 1EG2A 2RIOA 4PMTA 5CT0A 4BP3A 2V62A 4JDIA 4NTTA 2HOGA 2F8LA 5IH4A 4J98A 3TOSA 4M0YA 3JY9A 4X2KA 2RFDA 5BNJA 4QMZA 3KU2A 4J99A 2V7EA 1PYEA 5DBXA 2WFYA 4C3PA 4NM7A 1NW3A 3EIDA 4MHAA 1OMWA 3ZFMA 3NIZA 3QUEA 3CLYA 3G6GA 1NBIA 1XCJA 4O29A 4S31A 5CU3A 2P35A 5FCDA 1STCE 5D7VA 2F2CB 4OT6A 2ZVJA 4QMYA 2XIXA 1E1XA 4W4XA 4K33A 3KMWA 3TEIA 5EG3A 5EHOA 4D9UA 4EJNA 3MTLA 1YHWA 5F94A 2XIZA 1J1CA 5DXAA 2JJQA 1GIHA 1KOBA 2P4IA 3CQUA 3MIYA 5KUPA 1M7QA 4R78A 3EMDA 1R00A 4TW9A 2CMGA 2KULA 4L00A 2JAVA 4H39A 1RJFA 4G5JA 2OIDA 3CY2A 3DNEA 4ER6A 3L8XA 5AX9A 2ZIGA 4DGLC 3UVRA 3BWJA 3MFTA 5JFXA 4GRBA 3FYKX 2GQGA 3RAKA 5CSHA 3DLZA 3ZU7A 4GK3A 4KINA 3VBQA 3TUDA 4FTMA 1WG8A 3LCVB 1JQHA 4EOJA 2WEVA 4BIEA 4C4IA 4FIJA 5FRIA 4LI5A 4G3GA 3RP9A 1PJKA 4NYEA 5E8WA 3DAJA 1VYZA 5A4QA 4U3ZA 1GIIA 2GH1A 4GMYA 4DHFA 3X0DA 2VS1A 5AMNA 1R18A 2X7OA 1ZYCA 3FUXA 5DEWA 5E1MA 3COHA 5E8SA 4UX9A 5G6VA 3ZUVA 5IDNA 4EOLA 3DMGA 4IAYA 4KBKA 5BVFA 2B78A 2BZGA 1JQEA 5DX8A 4Z3VA 3P2EA 3KR9A 1KE6A 2IGTA 3KF7A 2WKMA 3C50A 5K0FA 2Z6UA 1OUKA 3T7SA 4LQMA 4FKTA 4BTJA 3QQKA 3QAME 4DFYA 4RLKA 2QO9A 5CEOA 5BVDA 3THBA 3PXQA 2G8NA 2W99B 2NP7A 4P7GA 3DKGA 2WMTA 4BDFA 2RG6A 2IDJA 2BAQA 2GHGA 3B7PA 5CVHA 1VYWA 4Y30A 4GQBA 2XYUA 1VP3A 3GC8A 5E2AA 1KXZA 4PF4A 2IBTA 4JG7A 1WZYA 4RSRA 3QU0A 3BE9A 3G6HA 2WA2A 3KRJA 3QTQA 5D7AA 3FPEA 3G0FA 4MAOA 3LQ3A 2R3RA 3DMFA 4O82A 1R39A 5BYLA 3TWJA 3C0KA 3IEIA 3RZBA 3PLAE 3AC1A 1JWHA 4QNAA 4AN3A 5M09A 3KXNA 3CBGA 4ENXA 4Y5QA 3Q53A 1WBTA 1G5SA 1Q8ZA 3D94A 4YJOA 1ND4A 3LQ8A 2R4BA 1LEWA 5E90A 5C9CA 3BV3A 1U46A 1XJDA 3EQGA 3TZ8A 3A61A 2OU7A 4QTAA 3AD5A 4RTPA 5KNJA 5JK3A 5E9WA 3BYSA 3TNIA 4QVKA 4NJDA 3DFCB 5J95A 1QCFA 3QTZA 4IQ6A 3BGDA 4R8RA 1SUSA 3UZPA 3HVHA 5K4IA 4U40A 3UC3A 4LV5A 5FBNC 5K0LA 4FV9A 4EKKA 3R8LA 4UYAA 3ZEWA 3GNIB 2W17A 3UG1A 4TWNA 3EMGA 3U87A 3ELYA 5B2KA 5BP7A 3EEOA 4UB7A 3EPPA 2HCKA 2OH0E 3BWBA 4D5HA 4C61A 5FBOA 4YUZA 2P3GX 4FZ7A 2QONA 5KMNA 4I5PA 2X81A 3AMBA 4ZSEA 4Y85A 3IOPA 2F49A 2WTDA 4E5WA 4U0IA 4ZSGA 1TQPA 1BC5A 1EJ0A 3L9MA 2FVDA 2XIYA 2WPAA 3MVLA 3HCCA 1NY3A 5JGAA 5KMMA 3OUNB 1WVWA 2C47A 4AWIA 3R7VA 4PMSA 4XUFA 4NK9A 3QCQA 1JKKA 3MTEA 4O0SA 3I0QA 3VO3A 3BEGA 1P1BA 2CHLA 2E9NA 1F5QA 2B55A 5DHJA 1PXOA 2KTYA 3HCBA 3LDUA 1AGWA 5E8RA 3M42A 3NUSA 4ZSJA 2VX1A 2EX4A 4MD7E 1Z5MA 4KIQA 3QRKA 2ZJWA 3MIAA 3BU3A 5AWMA 5JZNA 3ZZWA 3S3IA 4B9DA 4I41A 2A2AA 3OOMA 3HX4A 4E6CA 1YWRA 3SX9A 1P4FA 4QMUA 5M07A 4ACMA 4JQ8A 3CEKA 5BMSA 4CFFA 5EW3A 3GCQA 5DVRA 4DFLA 4NIFB 2F57A 5E8JA 3ZEPA 4LMUA 5AP1A 3VS6A 4C35A 4YUXA 3DU8A 2R7IA 4HVSA 2YIXA 2XBMA 1LEZA 2CNQA 4I22A 3PXFA 2Z60A 5CASA 5DT0A 3Q6WA 4IB5A 3H3CA 3OBGA 4UWYA 4PGGA 2DYLA 3KHKA 3ZH8A 5CUQA 4RYLA 3EQBA 3O0GA 4II5A 4E33A 4QP6A 4ACGA 3R1NA 4PL5A 4JR3A 4O96A 1H26A 5D1JA 2VUWA 1OM1A 1M2QA 1ZKDA 5ANGA 3DP7A 5DNRA 1MP8A 2J90A 2XVAA 4PINA 3EMBA 3O71A 4X2GA 3LFSA 1H07A 2PMNX 3K5UA 1SG9A 4XRLA 1RJBA 2JIIA 3G9NA 3FEGA 3FZOA 3OWPA 4ZTMA 5P8WA 5AP6A 4MQ4A 4RJ6A 2QQ7A 3EQRA 2J51A 3HUCA 3OE5A 1W8CA 3HVJA 3EFWA 4ERKA 3RIEA 3O51A 3EVDA 3IG7A 2UZTA 4IZYA 1NV9A 3TNWA 2V7AA 3I6WA 5BVEA 4EHGA 1X1AA 3OC1A 3AXWA 4A9SA 5HIEA 2XCHA 3UZUA 2PZYA 1ZZLA 1XKKA 2X2MA 1V0OA 2WU6A 3IW5A 4FV3A 3KEXA 3Q5IA 4IFCA 3LCOA 2G01A 4BYJA 3L8PA 3UC4A 4G9RA 4K6MA 2O8YA 2AUHA 2XRWA 4U44A 4U97A 4CCBA 3SSOA 4O6LA 4F1OA 3PA3A 2W9ZB 3Q9WA 2XYNA 2CCHA 3FDNA 4FUYA 1I09A 4M84A 3MI9A 3SSMA 2C1AA 4GKIA 2C0OA 4YNOA 1OKZA 1H08A 2XIKA 4GU6A 2C5VA 3FC1X 5I9VA 2ERZE 3WE4A 2BKZA 5M4UA 3JWHA 4ZSAA 3VW8A 3KQPA 3LECA 3MH3A 4F0FA 4DITA 3OS3A 2XJ2A 1XVAA 4EK4A 2FUMA 3JYAA 5HE2A 3KQVA 2H9VA 3LSTA 4OBQA 2PE1A 3AT3A 4JQ7A 2R9SA 3CXWA 3GT8A 4E31A 1W98A 4HGTA 2YACA 3DB8A 2NRUA 1L3CA 4BIBA 4FTCA 2B4SB 3LQ5A 3BYUA 3GFEA 2J0LA 3RVGA 2W1HA 2GNFA 2FRXA 3ZFXA 3RMFA 4D2SA 3DXXA 4UZHA 3P5KA 3GRUA 3A7JA 3VBXA 2QOIA 3CD3A 4F0GA 4IDVA 3Q96A 2NP6A 5CF6A 5M5BA 4WD5A 4YLKA 4ALWA 5AP7A 2X1NA 2O2UA 4FSWA 3BBTB 4D28A 3G2PA 2PU8A 4PL4A 1Q41A 4LG4A 3N4TA 2W4JA 5C4KA 1YXUA 3GGFA 3UTOA 3FZ1A 4RFMA 2BZJA 3E64A 3KVWA 4FSUA 3OUKA 2X0GA 4H05A 4MBIA 3FY0A 1R1WA 3FV8A 4LRJA 4AT5A 3NPCA 4F65A 3KQYA 2QOBA 5JT2A 2B7AA 3KN6A 1E1VA 2X2KA 4DH1A 3FQHA 2ZULA 4YJSA 4YUYA 3DA6A 3PXYA 3LXKA 3CC6A 3H0YA 4I5MA 3KQTA 3WIGA 1R0PA 4ER0A 1XXLA 4IVBA 5HVKA 1U59A 4L9IA 5DX1A 2WAJA 5E1OA 4DH3A 5DT3A 4KABA 4B7TA 3FLQA 2GS2A 3F3WA 3F5XA 4AAAA 5KO1A 5CVVA 4QP4A 5EG5A 4Q9SA 4FP9A 5HLWA 2R3FA 5ANEA 2Y4PA 5A4EA 5GWXA 1URCA 4E20A 2HWPA 1ATPE 5HBHA 3H9RA 4XUCA 1ZOEA 1WBOA 1NXKA 5EI8A 1R74A 4TYHB 2NXJA 4I6QA 3FTFA 4IX4A 1M2PA 5T6KA 1DAYA 4FKVA 3A26A 1OL1A 4CMUA 4ZSLA 1WBSA 3NW6A 3T7RA 1XR1A 1Y8CA 4FK6A 3FUWA 3P9KA 5DFPA 3C4FA 3GCVA 4CTKA 1XDZA 5I0BA 3CPBA 3ZM4A 4GF5A 3AC3A 2ZM4A 4UXLA 3UIBA 4CG9A 2AYPA 2VTMA 4NW6A 1QYRA 4E2XA 4EQZA 1Y6AA 3KRXA 2VTAA 1QPEA 3UIMA 4BIDA 3O8TA 4YV2A 2ZV7A 5EMKA 1GOLA 2UZ4A 1TQIA 4ZTHA 5DYJA 4Q9ZA 4O7SA 4YO4A 4AA5A 4FSDA 3WI6A 4U9AA 4GUBA 2NYUA 2JAMA 3FYDA 3AC8A 1BUHA 3LCDA 4PYJA 5AA8A 3MHTA 1OPKA 3NUXA 3HV4A 5E91A 5M57A 2GMXA 3IDCA 4FSZA 5E9EA 3B8QA 3I7CA 5TT7A 3QHRA 2WU7A 4CFMA 2NRYA 3F5UA 1YQJA 3GC7A 3D2LA 4R5YA 4HYIA 3PXRA 4EK6A 2XKCA 3CQEA 4IWDA 3A4OX 3NYOA 1YOJA 1YWNA 2EXCX 2Q83A 3DJ5A 4FNZA 3F4KA 3LFQA 5ETCA 3FMNA 2OW3A 3SXSA 5D11A 2UW0A 2RKUA 1JKLA 5LQKA 2JHAA 3QTXA 3OPNA 1RI1A 3LFNA 4GKHA 3PVGA 4CD0A 2O64A 5HORA 3EVCA 3BHHA 2W96B 2BZKB 3RW9A 4CXMA 4L67A 3LFBA 1CDKA 2VO6A 3GBZA 3BIZA 3A4TA 2YCSA 2G70A 3TKHA 4N70A 1YRPA 4KIGA 5EZSA 4K18A 3FLSA 3PVUA 3NYXA 3FUVA 5H8BA 2IFTA 4XG2A 4RFZA 3H9OA 4FR4A 2CN5A 5DXJA 2XK6A 3MVHA 3LJ2A 4DINA 4U7TB 4FSYA 8MHTA 2CKOA 4RFYA 3U4WA 3VJOA 1XH6A 1IA9A 1FINA 4BDJA 5CAVA 4EKLA 3E88A 4H36A 4KSQA 3AY0A 3RI1A 3ZDUA 2J5FA 3MCZA 4LRMA 5FTGA 1JSZA 2UZBA 4EH5A 3BHYA 5LQNA 5FGKA 4RTRA 3BI6A 5EW8A 4KRGA 4NM0A 2PGXA 2PX5A 3C0HA 3KQWA 4EZ5A 4MKCA 4E6QA 3I7BA 5DLYA 3DXZA 3FLYA 5KMJA 3A7HA 4YC8A 2JH8A 3RM7A 5AX3A 3O8PA 4EHVA 1BOOA 4FG9A 1L3RE 1ZOGA 3FY2A 1MRVA 1WCCA 4XOYA 4RTQA 4NWMA 3SA0A 3NZ0A 4RX1A 4XV1A 4FSNA 2GQSA 3FZSA 3A7FA 4L3PA 3IONA 2JD5A 3VNTA 4PYOA 5DWQA 3EQPA 1PXNA 1YFLA 5J1WA 2OXYA 4HYHA 3EGIA 3U9CA 2B25A 1H0VA 3PVBA 4O21A 2PVJA 3G5TA 3EN6A 5FM3A 4S32A 2BDWA 3RAHA 2ZV9A 3P7AA 2PV0A 5AM6A 1PY5A 4C05A 1P39A 3H2BA 4FTQA 4XMOA 4KRCA 4HVDA 3Q4UA 1Q62A 3PLSA 4TN6A 2YM6A 2ACXA 4HG2A 3Q9ZA 4N57A 4AF3A 5EYCA 3A27A 2PX4A 4DA4A 3COIA 3ZZEA 5KMLA 4DAWA 2QODA 2VTLA 3ERKA 5E8ZA 1UWHA 3ZLWA 3OEZA 3HZTA 3QC4A 5TR6A 2Y0AA 2PVLA 1G3NA 4RC2A 4G6LA 5KBRA 1O6KA 1JOWB 4YZMA 2ZZMA 4EOOA 2CWWA 3HCDA 2XBJA 4K77A 1CMKE 3R30A 5IA4A 3V5TA 4NCTC 1V0PA 2ITTA 4ZTSA 2VTOA 3VAPA 3ORTA 3VF8A 5L8LA 4DCEA 4PONA 4FKWA 2X6EA 5HU9A 2QOOA 3O7WA 2OFVA 4RZVA 4I3ZA 4O0WA 2GA9A 5EDPA 4DZRA 2VGPA 2QU6A 5ETFA 4F6WA 3KREA 2QE6A 4FNWA 4RPVA 3ELJA 2HWOA 4OUCA 5IQCA 2XMYA 1OGUA 2PZIA 1QPCA 4FKLA 5D41A 4ANQA 2I0YA 2VV9A 3U81A 4NKSA 4RJ8A 4PX6A 2R3NA 5HBEA 3Q9YA 2ZWAA 2J0MB 2LD4A 3NCGA 4L7SA 3EH9A 4CEGA 2VDVE 2PVCA 3M2WA 5A14A 2WTCA 3DDQA 4RWJA 1M17A 1FGIA 3VBVA 4EOSA 1KYZA 3A2CA 5D12A 4TTHB 4PTGA 5ICGA 5IU2A 4G6OA 3IDPA
chains in the Genus database with same CATH superfamily
4UHHA 2ZWPA 4X5OA 3STHA 2CMDA 3L40A 3T0IA 3WSWA 1JPAA 3L1SA 1U2GC 4JX3A 4H08A 3NHJA 1UKYA 2PSEA 5KNBD 4CRSA 2XAUA 4MV7A 3QELA 4E7WA 4XJSA 3AP3A 2IPXA 2NN3C 4UXHA 4DLSA 3KP1A 4OHUA 3TV4A 3U4UA 1OBHA 3UQCA 4GMHA 3CBQA 5EXPA 2DQYA 1TTQB 5ICMA 3OEED 1R8QA 2DETA 2W4OA 4ZJJA 3ZN2A 4BNFA 4F70A 4LWOA 1FS5A 4Y8VA 4IF4A 4E2ZA 1DG9A 1U7XA 2BY4A 1NLFA 5IZCC 4FWBA 2VZLA 2JW5A 3WP0A 4I0WB 3BKXA 4GPAA 1COWD 5E7IA 1AQ1A 3SW7A 3PE2A 1F2UB 1A77A 1QIEA 1RWVA 1QO7A 4RJ3A 1F6DA 4AJ1A 1I0IA 2JGZA 2FSOX 4H35A 1S8NA 1DC4A 3I1YA 4PHGA 3ZI7A 4ENQA 5KHXA 2R8RA 4WH0A 3K9WA 5LM3A 2A0YA 4C0TA 4IVDA 3X2SA 4JITA 4V0RA 2CXTA 2QUHA 5KU1A 4CXAA 4DDUA 5C5CA 1ZZ2A 4HDSB 4L9SA 4M6WB 2OICA 4JJFA 4BZZA 4BMDA 2XIQA 4IHPA 4L8FA 4N9QA 4QULA 4CEIA 3NT4A 3LCKA 1WDLA 4TKMA 3QRWA 4BGEA 3P2KA 3E58A 3B20A 3U9TA 2B4KA 4MYHA 2DPLA 2E21A 5JWRA 4E46A 1XQYA 2JVIA 5EIFA 2Z58A 4U63A 1P1FA 4Q9DA 1RKVA 4XIJA 2H4YA 1OJ7A 3DC2A 3QU4A 5ALOA 3MAGA 5CI6A 5DHRA 4LMBA 1BGWA 4UVIA 3PT9A 4JLUA 1DC3A 2OXDA 2JITA 3CX3A 1A9PA 1T3SA 1USIA 5KTRA 1UH5A 2FO0A 2J3JA 4BIIA 1QIMA 1UT5A 5KX5B 1RRCA 3IAS6 3UJ8A 2VK1A 5FUWA 2ZM1A 5BSWA 4NI5A 4D55A 2XA2A 5JVDB 2CL0X 4U6RA 4CV8A 4FYYA 4Y6OA 2CJPA 2QLNA 1LS1A 2MSDB 3CJGA 4B3CA 3OOJA 4WCVA 5KQLA 3C4XA 1JB9A 3OC6A 2XRUA 1MPTA 4E6AA 1LCIA 1QOPB 4L3VA 1QH8A 4CLJA 5DM60 4J9UE 2ITYA 1V1KA 3A7DA 5CT9A 5HQ3A 3GELA 3ILXA 1QAOA 2EFYA 3FVTA 2GEBA 3Q6UA 2QIPA 4OPMA 4V0NA 4ISCA 3PRYA 4D2IA 1QZTA 1AUQA 2TMGA 1E2EA 4KIFA 1KFBB 1T8WA 3DMRA 5LVMA 3PDIB 1E9VA 4R5HA 1E2QA 3BMOB 1V8ZA 3RROA 1K86A 3F0TA 1JYSA 3VR4D 4IEEA 4QRCA 1GZOA 2WI8A 5IPFA 3S7ZA 3KKLA 2PU7A 4MCAA 2ZSEA 3AWIA 1NXVA 2HKIA 5KJ1A 3L9WA 5ANKA 2GRJA 4Q4DA 4WO5A 4MD9E 1U7DA 1YC2A 2XB2A 4TZ0A 5JDIC 1DFHA 2MTBA 3QEBZ 3OUUA 3W3AH 1GR0A 3FZQA 4RRVA 2PWBA 2Q2NA 4ITJA 3QPBA 4RDCA 1A4XA 3F61A 3INRA 3CLTC 4FHCA 3UT5A 3VSAA 4CKBB 1ESEA 1E59A 2FNAA 1OX4A 3AQ4A 4KDEA 4R01A 1GTMA 1ZGZA 3W04A 4QQ5A 2WJGA 4KYUA 2WG1A 3KE8A 1KYXA 2EBWA 2W43A 3MGGA 5AIRA 4LL5A 2WF5A 2VKTA 2CXPA 2JLRA 4KEAA 1H00A 4ZQCB 4XV3A 3FOEC 4MV9A 4JXXA 4YCDA 2QZ9A 3EQIA 4P86A 1E4YA 1YW2A 5BT9A 4G1EB 2Q0NA 4D4YA 1B74A 3ZR4B 5FA8A 5THKA 1G8FA 3DFMA 4XLVA 4CJXA 5BYYA 4LC9A 3KUCA 3FXWA 3EWHA 4JDPA 2H18A 2ZU0C 5BMVF 2WGJA 2AUTA 5A05A 2WFMA 3VS2A 4HNAA 4ORKA 2V0CA 1MJHA 1MKYA 3TG2A 2DUNA 3N86A 3DV2A 5A3VA 3T5GA 1EYZA 4KG7A 4Y6SA 3S4YA 5JO9A 2WWXA 2WKRA 2FWJA 3QQLA 1K7XB 1QFXA 5K0SA 1VL5A 1PGNA 2I3BA 4L43A 4KO3S 3SAYA 3VZQA 4QDXA 1C9NA 5CEKA 3DYBA 4GECA 4EI8A 1E6EA 1M34E 1EVEA 4J91A 4FBLA 4R1SA 1DBQA 3UJ6A 1NZJA 4MIOA 1N6IA 5LQSA 2RGYA 1SCNE 4RIFA 4B31A 4Q3LA 4NESA 1BU8A 2NU9B 2WAAA 4IQ4A 4XOIA 4OYLA 1CQJA 1ZCAA 1N5LA 3LY8A 2XRMA 3ZQKA 3IMGA 4PY2A 2JLWA 3DTNA 1ISJA 5CDSA 1OWPA 4BP9A 1KJQA 4TWCA 2Z2XA 2PKXA 3TI1A 3H6HA 2ZPAA 4DM7A 1PEAA 4L15A 3I3OA 3IRUA 2O8BB 2WSLA 4LYDA 4C14A 2FPWA 3NM6B 1DCTA 4JAVC 4XEYA 2IUSA 3TGPA 1ST4A 2PGAA 2H11A 1HRKA 4PXSA 4R4JA 2YA9A 1M6VA 1RXSA 5GJWC 1XGKA 1GAGA 1YXXA 3OG7A 5JEBA 1R5OA 4GYGA 2HA5A 2QHXA 4QHSA 3R2YA 3DJYA 5U4QA 4BBJA 4TL9A 2XECA 4DWJA 3HKCB 5ALTA 2JGLA 4BQSA 3T06B 4TV8B 4WCDA 3T4EA 3A6LA 5UKDA 5LMZA 3ZXZA 3B9BA 1DMSA 2C96A 5F77A 1O0SA 4URZR 3KU1A 3IECA 3EISA 2GZDA 2VBGA 1QLJA 1E8DA 3L04A 1L4UA 4BZNA 5HIIA 4WLOA 4CL8A 1NFRA 1H1LA 4HAZA 1E9BA 2E9OA 1DTWB 3AHEA 4NZOA 1BHJA 4MS4B 3CTJA 4V0KA 2WTAA 2HYDA 2OHFA 4FKUA 3WGYA 2PRIA 1OITA 2VRXA 4WFQA 5FI0B 4RY0A 4C2AA 1O87A 5ALGA 2GN9A 2VO3A 1PQPA 2J85A 4PSAA 3QALE 5TS3A 3ROQA 3O47A 2IVFA 4ENPA 5IQHA 3OT1B 4QFCA 2VJKA 4FMDF 2VLBA 2R2PA 5H1YA 3BN3A 4RMGA 5ELXA 1IN6A 3GLIB 1TVOA 4MD8E 4CWAA 1A9SA 2QM3A 4FIIA 3KEFA 3P7BA 3CGOA 4YPDA 4RL4A 1PR0A 3VFDA 3R9OA 1E2LA 3M8KA 4DLTA 1YF3A 2H7CA 4UNSA 1GD1O 2UZ0A 1YXSA 3BK2A 4CE6A 4BU0A 1QDUA 3UC5A 4TKVA 1JEEA 1I9GA 4ZD6A 3WSTA 4O2ZA 1GEGA 2YM4A 1W29A 2F17A 1O2DA 5L3QB 2JG3A 2F7EE 4X7QA 2DFPA 3LC7O 1A7UA 3KCQA 1E1CA 2HA6A 5AK6A 1TZJA 3R9HA 1ECCA 3LT5A 2ZVQX 1E5DA 3JYQA 1TEVA 4WE3A 3H4VA 1DT5A 2D5BA 4H7HA 3AXTA 4L46A 3C7AA 3U6KA 4J1TC 2BKAA 3ODPA 4CDMA 1IA8A 3BQNB 4CIAA 5C26A 3ZHBA 3OQNA 4M8NE 2CNKA 3HJHA 4OJMX 1M5RA 2UYQA 4CF3A 3RINA 3QD2B 1IM5A 2PIAA 4FX3A 3OD1A 1KO7A 3UXEA 4RORA 4HH3C 3WDKA 5C8YB 4FR5A 3AR7A 3TO5A 2QOKA 3WGKA 3DBQA 3EL7A 2EZ9A 2RFLA 2P9GA 1FRZA 2BROA 5FPYA 2O48X 2WTNA 5CX1B 2HJ9A 3PVWA 2JANA 2MR5A 1HE8B 2V54A 2Z04A 1RPTA 2RFEA 3JQAB 2B6NA 3M1LA 2IKQA 1Z2EA 3UNXA 4ZCLA 2E9UA 2J3EA 3H2GA 2UUEA 2O3SA 4L0MA 3ICVA 2P6UA 3HXPA 2OV3A 5G3ZA 3PKZA 5IT5A 4L5AA 3CLKA 2WZCA 2LXNA 5I7VA 5ALWA 3EZLA 4QWMA 4RABA 3PPKA 5FFMA 1JBPE 4W7SA 2B9VA 3SEAA 2OBXA 1ML3A 1M1NA 2YYZA 5E1EA 5BUSA 4RY2A 4K9SA 2VNHA 3C3YA 2X8WA 4YJ3A 1OX5A 4GO1A 2JIPA 1AQJA 2QMHA 3LQRA 2QD9A 3SQNA 3ORLA 4Q66C 3A3OA 3T3DA 4MW1A 4R6VA 3B1VA 4OXXA 4L22A 4DCMA 4GZ3A 1DNPA 2Y0EA 2AI2A 2WMXA 1RQQA 1E1KA 2XLBA 2UXDB 3EVNA 1EU1A 4QG3A 1Q0SA 3SC6A 4N0MA 3UQFA 3I04A 1C1XA 2ECPA 4LDQA 4YTIA 1EFVA 2PK9A 5KYNA 4NX2A 3V34A 3VS7A 1Z06A 1U4OA 3KVRA 3AH8A 4F4FA 4RX9A 1EWTA 4ZHSA 4Q9IA 2OKRA 2H52A 1SHUX 1K7CA 1IUPA 2WSMA 1U1IA 4II2A 4O2BA 3PWDA 3D4BA 4X71A 1NM5A 1JJVA 1RTTA 3VPDA 2WWGA 5CVFA 1ZCFA 4GR5A 4BVLA 2VX3A 1DQSA 4YWHA 3ZHSA 4FT7A 2P3SA 2JDTA 4BTVA 1JDNA 4D80A 4U2BA 2C3JA 1UAYA 3ILHA 3TCNA 2VHQA 1U2GA 2KBFA 2QE7A 2OCDA 5MGNA 3N0XA 1Z8NA 3KEGA 1V6SA 4HVHA 1L8AA 1P31A 1U6KA 4H3PA 4H27A 1REKA 4PY1A 4CMTA 4N8SA 1CUJA 1KH2A 4JI9A 4RVOA 3TZ6A 5BOSB 3NOOA 1W59A 1IBKB 1OTHA 3TLJA 3TMAA 2I4TA 3GLQA 1T9GS 3QE9Y 4TSRA 3MOGA 2O8FA 4FXPA 3OJ0A 2IU0A 3VV2A 3ENQA 1Q8TA 4HS4A 5IZCA 3PFBA 4QNRA 1AV7A 1C30B 5AAGA 2OBBA 2ZE5A 1Q99A 1EX7A 3D5EA 3ZHUA 4N7JA 2JNWA 1BMQA 2CKDA 3BXFA 2FFQA 1RIIA 1GGJA 4QQ8A 4ROTA 3U44B 4KFUA 3GPCA 3K70B 2D2VA 4OJTA 4RF3A 5I7RA 1CUGA 4V0LA 1QFYA 1BMFA 4RS3A 2C68A 4W9MC 9ATCA 4UNPA 3OI7A 1V39A 4F7LA 4PG8A 2FSLX 4GI5A 3FUTA 3FHIA 4CEHB 2YW2A 1NW9B 1UOQA 3ER6A 4LGHA 1Q15A 2UYYA 4BBPA 1UOEA 3CG4A 2ZWMA 4M21A 3MYYA 3VAAA 3PGKA 3F3UA 3BQMB 1OXVA 3RCJA 1VHDA 3OT4A 2ZYWX 5FHRA 4HSGA 2CMWA 2AOUA 3BDVA 5HJ7A 2HCBA 3FLWA 1M6HA 2VTTA 1YIOA 1E58A 1AXGA 3LF1A 5KWEA 1PR9A 3ITEA 1F3MC 5CX9A 3CZ5A 1ZJ6A 4Y2HA 4P4SA 2HK6A 1TT5B 4LYYA 1UINA 2VZEA 5HG7A 1OREA 3DM9B 3SW4A 4A6XA 4EO7A 2W6ID 4M9CA 2AHOA 1UM9A 1IEPA 5BW5A 3M83A 4FGLA 2OM6A 4PFQA 5C7OO 4NQZA 5PGMA 3EZ2A 3HM2A 1AZLA 1VRWA 2V4MA 3DCYA 2PMCA 4DJFC 3OX3A 4AL4A 2DY0A 2OO7A 4HYSA 1CR2A 4GP6A 3F3TA 1RJDA 2NXCA 4MI9A 2GSWA 1JU4A 4EJSC 1OBCA 4KWCA 4YMGA 4CVNA 1FLAA 4ZCRA 2W2LD 4IX1A 4HPXB 1YDRE 3RLFA 3WLEA 5LP6B 5BN4B 2D74A 5BUEA 4BO1A 3T35A 2DQ4A 5FD2A 2ZTHA 4AP7A 4EKIA 1DO8A 4UBKA 1TK9A 4PG7A 2BR4A 4UBIA 5BNZA 2B1RA 4F5WA 4DIMA 2PFGA 1BQ3A 1YWVA 2QRVB 3EC2A 3BEDA 4BFSA 2MINB 1CUFA 1ZG3A 5HE9A 3KPVA 4Z9XA 4RA4A 3G2HA 1GCOA 4Y2YA 2XNPA 3F8SA 3PGXA 2CL7X 5HKBA 1SYKA 2TMKA 4U7PB 3AEUB 2X6DA 721PA 3BRBA 1NXTA 5IUGA 3X1DA 1TQMA 4F71A 5J4HA 2Y05A 2G82A 3UN1A 1PKEA 5JDIA 2BVAA 1VL1A 1D8TA 1ZZGA 1WUYA 4M8TA 3DOEA 1KR2A 2R3PA 4GL2A 1UU9A 3F96A 1OC2A 3UDSA 2V55B 4FUXA 1IBRA 3LUCA 521PA 2HFJA 1AO3A 1N6PA 4OYYA 2W5AA 1Q16A 3PIDA 5IN4A 2AYXA 2VF5X 5HU3A 3ZBQA 1KRXA 4NFHA 2WKQA 1J1BA 2W8BA 1Z0IA 4LISA 3LE6A 4WI1A 3VTKA 4RKFA 5KI6A 4G8JA 3AWDA 3MUOA 2YN4A 2GJAA 5BV2P 2E49A 2YZ7A 2GWHA 1CTPE 1E2DA 2D1YA 1DWPA 4DSOA 5BR1A 4C3OB 1T5HX 2NP8A 1VSQA 3HFS