5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
2G9XA 1MUOA 4OTWA 3FZRA 2R9SA 5BUIA 4L68A 2JDTA 3FPFA 4IB1A 2PPQA 4MD8E 5EK7A 3KF7A 3UO4A 5CF4A 2ZCJA 3GCPA 3DOUA 2JIVA 5FP6A 3UFBA 3V6SA 2IW8A 4JT3A 5BVWA 4R8RA 4CKEA 3U6HA 2G2FA 1GJOA 5CSHA 3DTCA 2PMNX 4OBOA 4JIKA 3QU0A 3FBVA 3QQLA 5AP7A 2C3KA 4EZ7A 1Y8YA 2E9NA 5KMMA 3R73A 4PRJA 3VBWA 3DXQA 3PXZA 3VBYA 2PVCA 1QMZA 2H34A 4F4PA 5IA0A 4FEVA 4PV0A 5CEKA 3UJCA 2OPBA 3ZMMA 5GNKA 4BTFA 4YUQA 4ZY5A 2WIPA 4B9DA 3LX6A 3HECA 2C5XA 4XH6A 5HG9A 2PZ5A 5IH6A 3RPYA 1XBCA 4Y2HA 1UFKA 3I6WA 3NVKI 5BX0A 4DFLA 4PINA 4MH7A 2IO6A 3FI8A 4FZAB 2CLQA 3FQEA 4RA5A 1KE7A 4MXZA 2HZNA 4ACHA 2C6MA 3FRIA 2UYCA 2PVNA 3R2YA 2E9PA 4TPTA 4OTFA 4OTGA 3DQXA 2P8JA 1IA8A 2OI4X 3I0QA 5T64A 1D2CA 5TKDA 4FG8A 3REOA 3R1NA 4DLIA 1ZZ2A 2WQOA 2GU8A 2C7QA 4E32A 3QWJA 4GJ3A 1Z9XA 4B7TA 4X1OA 1CTPE 5EG3A 4RC4A 3EVBA 3EFJA 2NP8A 2A27A 4RJ6A 4R1VA 4BC6A 2R0IA 3LFNA 3EZVA 4PTGA 3NMUF 4NTTA 1ZYDA 3Q96A 5DEWA 2FK7A 3MESA 3G7UA 2WPAA 5KZ0A 4P5QA 4TL0A 2C0OA 4X2GA 4E4XA 3KR0A 2PU8A 3ITZA 5EI6A 4ER6A 5FTGA 4XG6A 4DFUA 3IDBA 3ORLA 4WUAA 3RIEA 3HA5A 4BLWA 2Y4IC 3GVUA 2Y4PA 1JQ3A 3QRUA 1ERKA 5IDPA 5LJJA 4FP9A 3TM4A 3W2CA 5CAPA 5AV0A 1OUKA 3LECA 2F7EE 3NRMA 5K0NA 4FTKA 1YWNA 5EOVA 1BOOA 2W0JA 2UVYA 3UIXA 1ZRZA 1UWHA 2VWWA 2G2HA 3DV3A 4K11A 5DWRA 4R77A 1DM2A 3GDHA 4CTCA 1UU9A 3WE4A 5JFXA 3PA5A 3U6JA 4ZSJA 3GQIA 3QHWA 5B2MA 3FKNA 4ZAUA 3BKWA 4FGRA 3UDBA 3GU6A 4ALWA 3WSTA 1Q8ZA 4FSTA 1MQBA 5J87A 3KULA 5ETFA 1ZOEA 4FKIA 4DGNA 4TTHB 2CSNA 3KCFA 2H1RA 2VTAA 4BN1A 2YITA 4AW0A 2Q41A 2QO2A 4LUEA 2J6MA 3MGYA 4QOXA 1URCA 2VX3A 4E1ZA 5EM7A 5FA5A 4LL0A 3A62A 2OB1A 4GYGA 1WVWA 4FV7A 4C0TA 4P7FA 4L45A 1PKGA 4HC4A 4YV2A 3LFSA 3O7WA 4RJ8A 3D5UA 4BDIA 4I6FA 1WAKA 3BEAA 3DLSA 4BR3A 4U42A 3MPMA 5J9LA 4A9YA 2PVKA 4EHEA 1O9UA 2ZB0A 3JUHA 4A6DA 1STCE 2W99B 4LQMA 3QA0A 3HV5A 2XBJA 4HVIA 3C5UA 5H8GA 3SGLA 4HZSA 3BBTB 3BU6A 4IM2A 3VW8A 5EH0A 2I40A 3E87A 3V5WA 3LFFA 5FTWA 2HOGA 2YJSA 4F6UA 5AUWA 1F5QA 2WTKB 3THSA 3CTQA 2JJQA 5I9UA 1YI6A 4DH1A 3Q6UA 2WTCA 4PP9A 4X2KA 4BGGA 4E93A 5CNOA 3FRHA 4RX7A 4EK4A 2PUUA 2FYSA 5LMBA 2QY6A 3KR9A 3GUBA 3W10A 1OPLA 4TYHB 3D7TA 3VYWA 4HCVA 2E9UA 5GJDA 2OZVA 5BYZA 3KPVA 2WMAA 4L3LA 3HVJA 3KL8A 5CM2Z 3QFVA 4IH8A 4F85A 4J52A 3ROCA 3Q53A 4HSGA 5CU3A 5HCZA 3ZSGA 4M69B 5K9IA 1EQAA 1LUFA 2O07A 3MSSA 4P7JA 3ENMA 3Q6WA 4EHVA 1YXXA 3VBTA 3LDFA 3QRIA 5EDRA 1PXIA 4JLCA 2WMTA 1JQHA 3HCFA 3C4CA 2ESMA 4O0WA 3E3BX 2O0UA 1VPTA 4OQDA 4QYGA 5HVYA 1E9HA 4EH4A 2AOTB 1MRYA 2XNBA 4JOAA 5K05A 4DGMA 5EHYA 4NKAA 3DXXA 1B39A 3DXNA 5FUBA 4GG5A 2R3LA 4KBKA 1I9GA 3ZM9A 4FR0A 5L2IA 1P39A 1YXUA 4ZLYA 3O8UA 4OUCA 2C4GA 4F08A 4C07A 2OGVA 3GGDA 5K3YA 2O06A 4PQNA 5C26A 3KQTA 3VUKA 2AZTA 4GMYA 5FA8A 3EEOA 3L8PA 4RVDA 4ACDA 3HUCA 4X6QC 3ELWA 4LV8A 4F6WA 2VWXA 2R3QA 4J1RA 4OQEA 2WTVA 4XRJA 5CTPA 5E8YA 3ZSHA 4C4AA 3BQCA 4KIOA 2P0CA 4DCGA 4DA4A 1OUYA 1OPJA 2BKKA 4PYKA 2PWPA 2ZSUA 3ATSA 4TWPA 4XP0A 3RVGA 3TKAA 9MHTA 3O0GA 3A99A 3V3VA 2W1GA 3D2KA 4MVFA 2ZMCA 1J7IA 4FKJA 4ITHA 3II5A 2CGXA 3MPAA 3I5NA 4QDKA 3MIYA 5K0BA 3MHTA 3Q04A 4CLIA 3ROYA 2H9VA 2OZAA 4BICA 4NM7A 4EH3A 1H26A 3D9VA 3BPRA 5EYKA 3CC8A 5EHIA 4CMOA 3SXJA 3W2RA 5FEQA 4O0XA 2BRNA 2PUNA 2BZIB 3OZ6A 5AUYA 2CDZA 2UZEA 4I23A 2CN5A 2XNGA 1MHTA 5F4NA 4BYIA 4YJTA 3ID6C 2XVMA 2JG3A 1W7HA 3T8OA 5KX8A 4A6EA 1JKKA 3DK7A 2ITYA 5AFVA 3C6MA 5A14A 4D9UA 5DTRA 1PJZA 3FV8A 3QXOA 1YOMA 3RPSA 5ANOA 2HW7A 4FSZA 4D4RA 3HLLA 5AP5A 4LGGA 4D1ZA 2IVSA 1YW2A 3PJ3A 3LVPA 5AMNA 3P8ZA 3BGIA 4KKEA 2ONZA 1EG2A 1KV2A 4EH8A 3EN9A 4KNBA 2VDVE 2X2KA 3AWIA 4FODA 3AXTA 3ELYA 2XJ0A 4RWIA 3DZQA 3QQGA 4RTSA 3R0TA 5CXZA 1ZYCA 4TYIA 3D4QA 5A46A 3VS1A 5A4LA 2HCKA 4AZFA 4I20A 2IDKA 5C4LA 1KR5A 5CVDA 4G3FA 2X4FA 1Y57A 5K03A 3POZA 3BHTA 3VS2A 3R7UA 1XH5A 2VX1A 3HAMA 3VS3A 1EIZA 4L44A 5CU4A 2XIXA 5BNJA 3M70A 3NTVA 3R9NA 1D2HA 3C0HA 4O7SA 3KK9A 2W9FB 4U3YA 3ZDIA 4XOZA 1PF8A 4YSJA 2X9FA 3LPBA 5IEXA 3PPZA 4W4WA 4DEHA 3ZCLA 1U5QA 3FY2A 1RJDA 3TTIA 1NW6A 1FJXA 3CTHA 4GFGA 3I58A 4PMMA 2F8LA 2XYQA 3T7TA 1EJ6A 3DY7A 3FXZA 2XK4A 4BDFA 3ZUTA 4AA4A 3BYMA 3SV0A 5HI2A 1UNGA 3COHA 3E8EA 3FLNC 4M7RA 5JFWA 5AV3A 4CD0A 5TR6A 5IG1A 5K09A 2IW6A 2V74B 5HBHA 4BDKA 3KMUA 3DJ7A 2PX5A 4FTUA 5KMJA 3WYXA 5AUVA 3PP0A 3UJ8A 3KULB 3TZMA 1P1CA 3K0BA 1PY5A 4CSVA 5L3AA 1MJFA 3EYHA 4DEDA 3TOSA 5D11A 3Q52A 1U46A 4M7IA 5I4NA 3DFCB 2VTQA 4BIEA 4FTRA 4IANA 4CKIA 5TOZA 3O51A 3NVMB 5DM2A 1AV6A 3JS2A 2RIOA 3MA3A 2BRHA 1BL6A 3HCCA 5JRSA 4XV1A 3PX2A 2VTOA 3CEKA 3P78A 4ZTRA 4IWDA 4Y72A 2G1PA 4E5WA 4EH2A 4GH2A 4O2ZA 3GEQA 2I62A 3Q4UA 1G8SA 3VF8A 5FBOA 2QHNA 3OUNB 5E90A 3A26A 2ZWVA 4FV3A 4C02A 3ORZA 2J0MB 1AQ1A 3LM0A 4HGLA 3MYGA 4C33A 4WBBB 2BFYA 3G90X 5DN3A 3RHXA 3ZFMA 4MCVA 2Y0AA 3OZSA 3PY3A 1SKMA 2OB2A 4IVCA 3ANQA 5IA3A 2GCDA 4D0XA 1FVVA 2ZFUA 5CIYA 3MCTA 3SD0A 3C4FA 5TO8A 4YMHA 4RFZA 4BBEA 2Y4IB 4S31A 4MXAA 3PA4A 1M7NA 5AX3A 3GENA 4FICA 2WA1A 5M07A 3PA3A 1UU3A 3QLFA 2YR0A 4P7GA 5FHQA 3TLJA 4D9TA 2PYWA 4IACA 4JQ7A 3CC6A 4J99A 3OY1A 2ONLC 4FZDB 3ELUA 2XKDA 1WVYA 2EVAA 3TZ7A 4AGCA 3FPJA 3QHRA 1TKIA 3QOWA 4PNKA 3PX3A 2P40A 2QRVB 5DRBA 1OIRA 3DR5A 3KQYA 4GOOD 1NBHA 4ZSAA 3F5UA 3V5QA 4G16A 3FZSA 3G2MA 3LMHA 2DS1A 2UW6A 4DH8A 2AOWA 3MTFA 4ZTLA 5IQDA 2Y6MA 2XRWA 5D1JA 2F49A 1NXKA 3UQFA 3OF0A 2ZM1A 5IUHA 4EKKA 2AVNA 1V0PA 4IKPA 1H27A 3LCSA 2YERA 5HU3A 2C5OA 2B25A 1B42A 4QQCA 3E8CA 4IJPA 2QM3A 4DBXA 2XIKA 3BHHA 1R39A 2ZBPA 3UO5A 5EHGA 3PVGA 4V0RA 4A4XA 3EQDA 4ZY6A 5KYGA 4HYHA 4DAWA 1YVJA 4RA4A 3C9WA 1W83A 5DTQA 4FTAA 4ZTMA 2ITTA 4WHZA 1IR3A 3NWEA 4LYNA 5HIDA 2YCSA 4U0IA 4FIHA 3ZUUA 4DEEA 2ITVA 2K4MA 2YFXA 2GB4A 5D9HA 3HMNA 3ZHPC 2ONYA 3QC9A 2FSLX 4HOKA 4ZMFA 1G38A 5EKUA 3EQIA 4X21A 4E4LA 4EQMA 2EU9A 2ZV7A 3UBDA 3GRRA 4FT0A 4IFCA 4YHTA 3H2BA 4ITJA 3BBWA 4OBPA 3TDVA 4HW7A 3LAUA 3LXPA 4YGAA 3BWJA 5CEPA 3ZH8A 1ZQ9A 2J4ZA 2OZAB 3KN5A 1M2PA 4J71A 4RLKA 1Q4LA 2ZV8A 4YUXA 2X39A 4O6LA 5GINE 1RI5A 4C4FA 2VGPA 2ONLA 1WXWA 5CU0A 3GQLA 4U44A 3GFWA 3QF9A 3UQCA 1H28A 1ZMUA 1O54A 2XEZA 3BWFA 2PE2A 4LUDA 3G5LA 3HTXA 3WYYA 4L00A 3B7PA 4I94A 4EKLA 2UZUE 2C69A 1H0WA 4PNIA 3UIMA 3D5WA 4PIMA 2PWYA 5DRYA 4FIJA 4WXHA 2QOFA 4MF1A 4MWIA 4FNXA 5F20A 2ORED 4O7YA 5EW8A 2JLDA 1TQMA 1L3CA 1NW7A 4IM0A 2PZIA 4QTDA 2GQRA 2QOQA 4JBPA 3P9IA 1W0XC 1ZY5A 1G6Q1 4UYNA 4H0NA 4JQ8A 3MV5A 3NR9A 3KQVA 3SX9A 1VQ1A 2Y1WA 4EOOA 5ANIA 2GTMA 1KOBA 4FSUA 4XBUA 3V97A 3GB2A 3MGGA 1TQPA 4RIWA 3RJCA 4ERKA 1OKWA 1N7JA 3KXMA 2BAQA 3V8TA 3M6UA 4U97A 5MHTA 3LHJA 3WF5A 4OT6A 4J97A 4QP6A 3PTAA 4IAIA 4IE9A 2P2HA 2I7QA 3OTVA 1Q97A 3KU2A 3U9CA 2AYPA 5F95A 1M2RA 3ORKA 2ITPA 2R3SA 3P9CA 2VTHA 2YCFA 2XKCA 5LXMA 1KOAA 1PMUA 2BDFA 3BV2A 3ENHA 4O83A 4CV9A 5HVKA 3A8WA 3FMJA 1ZMVA 4X2FA 4GC9A 3UJ7A 2ZB1A 4CVAA 1PW2A 5K5NA 4GT4A 4HPTE 5M56A 2GFCA 1SUSA 3W16A 3SSOA 4O0UA 2BFXA 1JKLA 4YZNA 3EQCA 3U55A 3D14A 4QTBA 5EQJB 2FUMA 4TNDA 2PZRA 5T67A 1JSVA 4CFVA 4FZVA 4F0FA 3CCFA 1RE8A 3COIA 4FK6A 3B3JA 2ZOQA 3EVFA 4EJNA 4LOOA 5BVFA 3NUPA 5KMNA 3QCSA 1H01A 2R3HA 3ET7A 4F84A 5AUTA 5HCYA 2QCSA 1P4FA 3GI3A 3AMBA 2GNLA 3Q2MA 5ETCA 2W1EA 3R7YA 1ZMWA 4AUAA 4EZ5A 3VS7A 4RT7A 3ZZEA 5CF6A 3EMBA 4M3QA 3NIZA 2FHPA 2YM3A 2P7IA 3EH9A 4IZYA 1XH6A 2B53A 2PT9A 1NW5A 2YM5A 3ORIA 4RWZA 3TM0A 3I9FA 4E2YA 4EUTA 4C4EA 4MNEA 3OD6X 1RI3A 3WOWA 4CG8A 4JAIA 5CQUA 4PDOA 3QQKA 3FZTA 4K1BA 4R3CA 3RM7A 3U6IA 4QMVA 2R3FA 4ZSEA 4UX9A 4XCXA 5JKGA 2GHLA 3UJ6A 4UB7A 4WKQA 5KHXA 1SQGA 5BVNA 5K0LA 3FC2A 2I0EA 4ENXA 5AP2A 4J8MA 4FG7A 3DMFA 3R9RA 3HCEA 5K8VA 5E2BA 5LARA 2YIXA 4U40A 2J7TA 3RK9A 3I0OA 3L9LA 1YUBA 3NX8A 5JUWA 3F3WA 3RPRA 4FIIA 4F9AA 5EM5A 5CSPA 5DRDA 4ORKA 1H24A 3MBLA 4GT5A 4X61A 1NW1A 4A9RA 3FTFA 3P9KA 2JBPA 1Q61A 4PTCA 1UVRA 4CKJA 3CJFA 3ERKA 3QWKA 4FT5A 3Q9XA 2PJDA 3GC7A 4EK5A 5KMKA 3LZBA 4APPA 3C7QA 4BCMA 1N7IA 1WCCA 2WELA 4EH7A 5FEDA 3TKUA 3UZRA 1WMKA 1KHHA 3LFEA 1KP9A 4ER5A 1J1BA 3BT7A 4YJNA 3CY3A 1QAOA 3A7IA 5LQCA 1LP4A 2YXDA 3Q9ZA 4IFGA 4YLLA 5L6PA 4DC2A 3SXSA 1FVTA 4NW5A 2V55A 4QTCA 3QBNA 4IAZA 2WOUA 2OLCA 2XK8A 1R8XA 3OCTA 3ZBFA 4KRCA 2VTIA 1JOWB 3KRLA 5HLWA 2ZZMA 3VW6A 3FTDA 1FINA 1YQJA 2NNWB 2XK3A 4F63A 2IBTA 4DFYA 3V51A 5B2LA 3EFLA 4BVUA 1CMKE 5E8JA 3UP7A 4ZXTA 4L52A 5HFJA 4FT9A 4DA5A 1ZWSA 4QMSA 5IH5A 2Z6AA 1UKHA 5CAQA 3CBLA 2B9HA 1OPKA 4YJSA 1XVAA 2WAJA 4ALVA 5I0BA 2YA9A 4RFYA 1HNNA 4JBQA 2IG7A 4YUWA 4RX8A 3L8SA 3R8VA 3UMXA 3PWYA 4BCJA 3PE1A 3FI3A 3E8NA 3OMVA 4NM3A 4IAAA 3C0IA 2ZDUA 5AAFA 4AZWA 2I1MA 2YCRA 3HX4A 3LXKA 5CAOA 5AM6A 1WZYA 3UVPA 4HG2A 3AC4A 5DRTA 1KXZA 3P79A 4R7BA 5EYCA 3OXIA 1VP9A 5CUQA 3LBYA 3M6VA 4O22A 2BR3A 1RJBA 1BI7A 3KRWA 3S95A 3CPCA 3QZGA 2P4IA 4FT4A 5K4JA 4HGYA 2WU7A 3QOXA 3FTCA 5E8VA 4XG3A 3R9HA 4YZCA 4OW8A 5KBQA 3I7CA 4FMQA 3WIKA 5E1OA 1DUSA 1YDTE 2W05A 3RW9A 3Q32A 1IG1A 4E26A 2PMLX 4I3ZA 3E92A 3SW4A 4XG4A 5DXJA 5E1MA 3BGQA 4MBJA 4C7TA 3HP2A 2HWOA 4RQVA 3KGAA 5GWXA 4BHZA 3OZTA 3SSMA 4BCOA 1FVRA 2OXYA 4RTMA 5LCJA 4GYIA 4ZLZA 1SG9A 3NEWA 4LGHA 4L46A 2WO6A 5CWZA 2VZ6A 3BHVA 4RIWB 4DKJA 1R0PA 3CTJA 3L9MA 4QMLA 3TNIA 1XCLA 2FRXA 1NY3A 4UALA 3H0YA 3GU3A 3ZEPA 3R02A 5KUPA 2PVLA 4PYJA 2C5VA 2C6LA 3QQHA 1V1KA 3HMMA 3OCBA 2JDVA 1M52A 3F2NA 5IEYA 5CT0A 3LE6A 5I9WA 2BCJA 4ZLOA 3T7SA 1OR8A 1H1RA 1NW8A 5CEQA 4DM3A 4HVDA 1R3CA 1RJEA 5AV4A 4JXFA 2CKPA 4BRXA 5DLYA 4JR3A 4I0SA 1SUIA 5E2AA 3NAYA 3P23A 2IN6A 4K2RA 2BM9A 2EG5A 1XQZA 2CCHA 5EKXA 4XV3A 3QAME 4IWPA 4CFMA 3BHYA 3CKXA 1ZYJA 2OBFA 5IA2A 1X1CA 2B9IA 3ZRLA 3AXWA 3O23A 2YHVA 4EORA 3UYSA 3LLAA 4U3ZA 3DT1A 2CJMA 4RVLA 4Y95A 3LFAA 3HYHA 4NWMA 1WBTA 4ZZMA 4B0GA 3BU3A 3HEGA 3E23A 2NP7A 1INLA 5HX8A 1AD5A 1OM1A 4RPVA 1HOWA 1SVEA 4JVGA 3QTRA 5K0EA 5E91A 2XEYA 2ZIEA 2IFTA 5E8RA 4PP7A 1XDZA 4G6NA 4CXMA 4V04A 2R3JA 5HCXA 2R7BA 4CLJA 4D55A 5U4XA 4CG9A 1U4DA 3GXOA 5I9VA 4C3RA 3C51A 1PHKA 3UA3A 2GAFA 2C5YA 1H1DA 5JH6A 1VBFA 3KPWA 4CTKA 4H3QA 2LGCA 3D7ZA 5DNRA 2WA2A 5JR3A 2WMVA 1DI9A 5FULA 3OUKA 2UYQA 4ISCA 5FUTA 3KK8A 4YZMA 1PXPA 3RM6A 5LQUA 5AUZA 1I44A 1OZ1A 3RAIA 5C0OE 3TG1A 1YZHA 1G60A 4AOTA 4FIGA 5M55A 3O50A 1PYEA 3I5ZA 5D41A 3O7LD 3DOGA 2PXAA 1RW8A 2ZVAA 5DA3A 1KWPA 4FTNA 4MNEB 4ZSLA 4Q5EA 2XYNA 3UBTA 4IW0A 4C61A 5C27A 3EGVA 4FOBA 3S68A 4GIIA 3NDIA 5LQNA 4GS6A 5KKRC 2OIBA 4R8SA 3RI1A 4YJVA 4YPSA 4Z16A 5DE2A 5FTQA 5EMJA 4IX6A 2B55A 4ACGA 4F7NA 4IAYA 3MJ2A 3U81A 2XNEA 3NPCA 5BUJA 4YV0A 2Y6OA 2VRXA 2GDOA 1OI9A 3BX5A 3UOLA 2AN3A 3KR2A 2JH9A 4ATNA 3KXNA 3UIBA 4X3JA 2FK8A 2VV9A 4GOLD 4DCMA 3GRZA 2PGXA 3DB6A 1WBSA 3OY3A 4BBMA 2JEDA 3FZ1A 2HTEA 2YIRA 2PLWA 1DAWA 4MYGA 4MAOA 3BE2A 2O64A 3CP9A 4MNFA 3PS9A 4YHJA 3OBJA 2Z60A 5EMLA 5HEKA 1OITA 4HGTA 4WO5A 4GEOA 4NZWB 2YXLA 4PDPA 4QP2A 1S9JA 3JY9A 3K3IA 4O86A 3A25A 2VTNA 5KZIA 5GP1A 3HVHA 5CAUA 2WTJA 3HV3A 4UYAA 4Z9LA 3FSFA 5ICPA 3FHIA 5HG5A 4GG7A 1Y6BA 4Z7GA 4E2WA 1HMYA 5LQRA 1EH4A 2P2IA 3W2SA 5LVLA 3VAPA 3RK5A 3UIUA 2UVXA 3B8RA 3VHKA 4Q5HA 4A9UA 3D83A 3UYTA 3OCGA 2KTYA 4DYMA 2WMSA 4JG6A 4DHFA 4KINA 2VDUE 4XP2A 3LMGA 4LWPA 3R63A 4MD9E 3A7JA 2XYVA 1VJYA 3PSDA 3G9LX 4BYJA 2QE6A 4R7HA 3QYWA 5IF1A 4BCFA 5BUEA 2UW5A 1YRPA 4TYEA 4NM5A 4QTEA 2GNJA 5DI1A 3L8XA 2PL0A 4JXJA 4BLUA 2R3RA 4RTJA 5CANA 2VTPA 2HAKA 2QG5A 3AOXA 4L43A 1PXOA 3KVXA 5LVMA 4O0TA 2VZ9A 4ZS4A 1TW3A 4BP1A 3KMMA 1Z3CA 3FI4A 2IBSA 3L8VA 2WTIA 2IP2A 1JSUA 2J0JA 5FRIA 4OT5A 3LFDA 4C4HA 4L01A 3EGIA 2XNPA 3TNPC 4QVGA 4FNWA 3UGCA 4OA5A 3GFEA 3A60A 2GQGA 2XK7A 4WNKA 4QYHA 3QKMA 3V04A 4EQZA 4O6EA 4PYNA 3UZTA 4QTUB 2H11A 3WZUA 4I21A 4RWKA 4U6RA 5EPEA 2HWPA 1KSWA 3UVQA 3QTWA 5E8ZA 1U59A 4JI9A 2AOUB 4DT8A 3MVHA 2EUFB 4WRSA 4AT5A 4C3PA 1G5SA 2C6DA 3HUBA 3MA6A 5HNIX 2IZUA 1QAQA 5CSVA 2C6IA 5E9WA 4EKIA 1M2QA 4DG2E 3GRYA 3I64A 3OG7A 3HCDA 5E7RA 4L7VA 2OWBA 4XX9A 3EVDA 3CR0A 4X3FC 2VU3A 1UNHA 3TDWA 3DMGA 5M57A 4OBWA 1UKIA 2QC6A 5FXSA 3EN6A 5DT0A 1SMHA 3UNKA 3SVZA 5BMMA 2UW3A 3H9RA 5BPYA 4IB5A 4EOQA 2BTSA 3ZBXA 2BZJA 3IECA 4E6AA 4DT9A 2V62A 3CVOA 4EYMA 2XB7A 3ZFYA 4A7CA 3Q5ZA 5E1DA 3CIKA 3FZOA 4L7SA 3R28A 3V8VA 4L8MA 4YO6A 3A4OX 5A4EA 3EIDA 4ASEA 4O29A 1L3IA 1KE6A 5FGKA 3IS5A 4O7TA 2PULA 4EJ7A 4APCA 4ZTSA 1LR4A 3EQHA 5LQKA 1UWJA 1YFJA 3MTLA 3GJYA 4XHKB 4DFZE 5J9YA 4K77A 1FPQA 2BRMA 2F7ZE 3GC0A 4FSDA 2JKQA 3FYCA 1VZOA 1K2PA 1ZGJA 5CAVA 3ORTA 3N51A 2V22A 4EOLA 3BKBA 3NYNA 4IC8A 3RTPA 1UV5A 4U7ZA 1IY9A 4M12A 5FCDA 4G9RA 3TWJA 3RNIA 5EC8A 3OFKA 5EYDA 3R7VA 4A4LA 2W4KA 3AMAA 2B9EA 4DG3E 5K0FA 5AP0A 2RG6A 2XNOA 4ZK5A 3TV4A 2CKOA 1ZYSA 4Q2AA 4AQCA 3NZ0A 4ASZA 1KIAA 4QQTA 4OTHA 2PXXA 2QD9A 2R5TA 1YFLA 3NJRA 4FKLA 3F69A 5DLSA 5BXYA 2GS6A 2I9KA 2ITOA 4FGZA 3FLYA 1L3BA 3O17A 5EDQA 3W18A 4HPUE 4QP7A 3SXRA 4GL9A 1XHAA 4KRGA 2WQEA 4YZ9A 3QQFA 3AC2A 4X3FA 1MRVA 3EN5A 1P91A 4FTOA 1YI4A 5D10A 1U54B 3BQRA 4OTIA 4X7QA 4M67A 2YQZA 3NIEA 1AF7A 2VAGA 2GH1A 4AFJA 3MH2A 4ZJVA 4O27B 4IVDA 2C7RA 3IDPA 2FVDA 4DG0E 4QMTA 3VUGA 2C0TA 4Q9SA 3HM2A 4DFNA 3R1YA 4LI5A 4N57A 1RI4A 4PDYA 4YUVA 3JVSA 3IV6A 3MFUA 3ZRKA 3DTNA 3TZ9A 2E9VA 4C05A 2OJFE 2OH0E 2Q0NA 4IWQA 2W17A 1GIJA 3AD6A 4GKHA 2ZBRA 2ETRA 5HU9A 2ZLBA 2W7XA 5C8KA 4IWOA 5FEEA 4WRGA 2WMBA 3AC5A 4DEAA 2W1FA 5LVNA 4GOMD 3PJ2A 2C6KA 4EL9A 4G3DA 3FPEA 5M09A 5AP4A 3THRA 4S2ZA 3U9NA 3PE2A 2P1DA 5L2WA 2ERKA 3E88A 3KREA 4NH1A 2CHLA 2BRGA 4MIKA 1NBIA 5A6NA 4FV0A 2Y8OA 4QMWA 2OYRA 5DX8A 1SYKA 3Q4TA 5DEYA 1VLMA 3D0EA 2BAJA 4Q9ZA 4PGHA 2UV2A 3R8PA 4FVQA 4F1OA 4BY9E 3VUIA 4XV2A 3FUUA 5AADA 1WXXA 2QKWB 4CKBA 1QCFA 4RIOA 4BCGA 1ZARA 5IH4A 3BZBA 1GZOA 2I7CA 5KVAA 2XM8A 3HVKA 1FPUA 3O4FA 3DULA 2UYOA 5CEOA 2PBFA 2CCIA 1B6CB 2AOTA 5IQIA 4QTTB 5IZFA 3I79A 1H0VA 1DCTA 4MQ2A 5KKRB 1DS5A 5CQWA 1YKRA 4WG3A 1JNKA 2B9JA 4JRNA 4DTAA 2F4JA 3OS3A 3PXRA 3W8QA 1XO2B 1AQIA 2HXLA 3VHEA 2KW5A 4BCHA 3AC1A 5HESA 4A9SA 2OKRA 4EK9A 1PXKA 4W8EA 5I9YA 3P2EA 4E2XA 1REJA 2WMQA 1GIHA 4GK3A 4ZTNA 4FV9A 1A9UA 1U5RA 4WVLA 3CCNA 2UZLA 3Q9WA 2C5NA 4GVJA 2WB8A 2QG7A 4JDJA 3K3JA 2X4ZA 2VNYA 4NFNA 5DPVA 3KEXA 1R18A 2Z6QA 2XF0A 5AA8A 4E31A 1A06A 2FA2A 3UA4A 3TJDA 4FS8A 4YMGA 3C6KA 4BGHA 3G89A 4CKRA 2OICA 2GPHA 3ORPA 1FP2A 3TEIA 2BUJA 5IUIA 1Z5MA 4AZSA 3OC1A 2VTMA 3NNVA 5E1BA 4B99A 4MTLA 3WF8A 4O82A 1R8YA 3GU8A 4BP3A 3Q87B 4FIFA 1QPCA 1FBNA 4TZRA 4U45A 3C0KA 2UW7A 4R6VA 4AS0A 3MY1A 3D2LA 2J0IA 3DJ6A 2VWIA 5FHRA 3OHTA 2PVHA 4KIFA 3MQ2A 4QMNA 2HIWA 2HR1A 1GZNA 2CKEA 4ANMA 1J7LA 2X2LA 3PVUA 4ONAA 5D7VA 4FNYA 5KS2A 3NUAA 1BYGA 5J1WA 3FMDA 3OT8A 4GOND 3Q9YA 3U8WA 3HA6A 4S34A 1EAMA 3IYLW 3ZUVA 4CFNA 2P3OA 2YVLA 5M08A 2JAVA 3O2MA 4TT7A 1R74A 5E8XA 2R3PA 3GCUA 3TRKA 2BZHB 2AUHA 3DKGA 2CLXA 4GUAA 3R00A 1X1AA 5HIBA 3NNWA 4EH5A 3QUPA 4FSMA 2NRYA 3HMIA 1BMKA 3DXYA 3BELA 4E70A 2VX0A 3DAJA 5LQFA 1REKA 3COMA 4DTKA 3OWPA 4O96A 4GU6A 2WMRA 2VWVA 1BI8A 4TY1A 5JT2A 2NP6A 2GSFA 2B9FA 2YAKA 3VWAA 4OGRA 1IA9A 3F9NA 4JRVA 1JVPP 3I60A 1X8BA 2WTWA 4MWZA 4GVAA 3T3VA 4ANBA 3FKLA 2XNNA 4WOVA 2CN8A 5IA4A 5ICEA 5LR6A 4AGWA 2FPOA 3KMWA 3WZDA 3ELDA 5HE0A 3G0EA 4DCEA 2G01A 4PDSA 3IOPA 1NW3A 3ERCA 3EQGA 3KQ7A 1RI2A 1YHSA 5EOBA 4YMJA 3V5TA 3P86A 3VBQA 2AOVA 3OT3A 3TUDA 5HLNA 4EEVA 2E2BA 4ZS0A 4Y30A 3AT2A 4II5A 4MXOA 1ZZLA 2C7PA 4TW9A 3DNEA 3WI6A 3F3ZA 3HP5A 2W96B 3NYXA 4P90A 4BTMA 2LAVA 4RSRA 4QYYA 4PL5A 4QMPA 4U9AA 2C68A 2BR5A 2QONA 4FEQA 5AV2A 4X3FB 5DBXA 1ZOGA 4MQ4A 3LQ3A 2R0UA 3DTWA 4C03A 2OIDA 1Q8TA 1TQIA 4J95A 4FKUA 2OXDA 1PXLA 2YZAA 2VO3A 2C47A 3UG2A 3FL5A 4G3GA 4NCTC 3ETAA 1H07A 2PE0A 4I0TA 1Q3WA 3QTSA 4ITIA 3AT4A 2OZOA 4HNIA 3VIDA 5F9EA 5AUUA 1ORHA 3QX4A 4C37A 4YTCA 2O57A 4FI1A 4QNAA 5F1ZA 2Z7SA 1KYZA 5K0JA 3R9XB 4KBCA 4R78A 4I6BA 2C6TA 2XUUA 3TNHA 4GIHA 2RGPA 3VS6A 4H1MA 1M7QA 4JG8A 3KPYA 2C3LA 1OL5A 4RX1A 3SRVA 5CEIA 4IC7A 4BZOA 3C4ZA 3HL7A 2BAKA 3FE3A 3TIYA 3GCZA 3QLGA 2EXCX 1TW2A 4DLJA 4E6CA 3EMDA 3WZKA 3NLBA 4NK9A 1JG1A 3ZLYA 3BHUA 5C8NA 2ZZKA 1R78A 3OW3A 1XBAA 3DKOA 3ODYX 3IDCA 2X2MA 4XUEA 4EH6A 2W5BA 1CM8A 1BKYA 3SSNA 2XM9A 3UMWA 4FTMA 4BDJA 5E9QA 5K0CA 3CY2A 2NXCA 2O05A 3PIXA 4E30A 3BLRA 4R3RA 3CQEA 4M97A 4MX9A 3PIZA 2F57A 2WQBA 4FGBA 2PX2A 5A4CA 5L2TA 3IW4A 2CPKE 3R1SA 3F4KA 3CGFA 2HK5A 4TYJA 2R3MA 2VWUA 5CI6A 8MHTA 4WNMA 1CKJA 4FZFB 2CKDA 3WF9A 4UOEA 2BR4A 3PJCA 2QRVA 1ORIA 2VS1A 4F7JA 1ATPE 4QP3A 3BYSA 4YV1A 1O9HA 1FGKA 4HCTA 3KA0A 4GQBA 4Y5HA 5A4TA 2F7XE 2GHMA 2W1CA 3KPJA 3F88A 1Y6AA 3JWGA 3PJ8A 5E8SA 4GRBA 5DIAA 3Q2JA 3C4XA 3PG3A 3B3GA 4IVBA 3M1SA 4XMOA 1X1DA 3E64A 3NUYA 3MDYA 1IXKA 3CD3A 4DN5A 1DL5A 2AN4A 2VO0A 2WXVA 3WARA 5IQAA 4NCTA 2WU6A 4KDRA 4HCUA 2YZLA 3GCVA 4F7LA 3VBXA 3QCYA 4QYFA 4GT3A 5L8LA 4U79A 4N4SA 2FO0A 3KQWA 3FYKX 3CS9A 1FP1D 2UZTA 4G1WA 3H4JA 2UW0A 4X6RA 3NUXA 3DLIA 4U8ZA 3KC3A 4U41A 1NV8A 3KPUA 4C38A 3UJAA 2GS2A 3GC9A 4TNBA 3QD4A 4IIRA 3N4UA 4HH4A 3U51A 5ANGA 1MQ4A 4FYNA 5EKOA 3T3UA 1RDQE 4EOJA 1IEPA 4C59A 3H9FA 2UUEA 4UWBA 3F5PA 4CZTA 3P97A 4BBFA 2UW4A 5EQPA 2BIYA 4F99A 2XH5A 1Q24A 4BB4A 3ZYAA 4N70A 5EG5A 1F3LA 3JPVA 5A3XA 2IH2A 3W2OA 1ZKDA 2YWPA 3OOMA 3KQOA 4OBXA 3TMAA 4LL5A 4O0YA 3CGGA 4YPDA 3R24A 3BWBA 2PX8A 5HIKA 4IB0A 3PUPA 2OJJA 3SA0A 4F9CA 5T6BA 4FBXA 4IHPA 5AWMA 2J50A 5K4IA 4RTLA 2EXMA 1J1CA 3FKOA 4EH9A 3CE3A 3VULA 3KR1A 3SM3A 2W1HA 3RK7A 5D1HA 3VJNA 3FMMA 1Q0TA 2WTDA 3T9TA 5KMOA 1OL1A 4WIHA 3BKXA 3LDGA 2AOXA 4I5MA 5JFSA 3D5XA 4JDIA 1RJGA 3UJGA 5GIPE 1QANA 2E9OA 1BKXA 2JC6A 3Q7EA 1GZ8A 1YXTA 4BDAA 3FEGA 3PXYA 3ZOSA 4P7KA 4RX9A 2XS0A 5P8WA 2ZAZA 4WBOA 3MY5A 4FA2A 5TT7A 2JKKA 4IAFA 3OCSA 3F66A 3KFAA 5HGIA 2ZWAA 4IM3A 2BVAA 4I22A 4BDHA 3I7BA 4FKTA 4JIAA 1Q5KA 3BYOA 5LQAA 2A0CX 3NCZA 4FUYA 4NJ3A 3FUWA 4BDBA 2UW8A 4UN0C 5HILA 2J0LA 1YF3A 1R0EA 5AAGA 5B2KA 1JWHA 4DITA 4PGGA 4FSYA 2OSCA 4RTRA 2CNVA 2X8EA 3FSKA 4G2FA 4UEUA 4XG7A 4TN6A 3NUNA 2XJ1A 3HA8A 3RAKA 2R64A 2HZIA 4W4VA 3SOAA 3TCPA 3FMLA 3UPXA 2UVZA 1W98A 4BDEA 3EQFA 4L3JA 1WS6A 4AT3A 2FSMX 4YTFA 4FV4A 3G2FA 5DM0A 3SAYA 3QALE 2X9EA 4I5HA 5D1NA 5IQEA 3ANXA 1JBPE 1KE9A 5CYIA 1V39A 1OMWA 3LCTA 4E5BA 5K01A 1IASA 4F7SA 3NS9A 5CLPA 3T7RA 5LMKC 3TT0A 4ZY4A 5CSWA 2P41A 3VS5A 5IDNA 3LBFA 3HMOA 4AXAA 1H1WA 4YP8A 3QCXA 2XIRA 1H1PA 3PZEA 4I6HA 4NIFB 5DYJA 3DAKA 3QCQA 2UZWE 4OX9Y 4DH5A 4PY1A 2IW9A 2OO3A 4YNOA 3MB6A 4RYLA 1IM8A 4BZNA 2IVUA 1ZY4A 3E3PA 3SW7A 4GUEA 3NNXA 2N47A 1SQFA 4G56A 1CKPA 3A4TA 5ANKA 5AP3A 4BIBA 1L8TA 3LCUA 2RFSA 3RCJA 4FSRA 3LKMA 2ESRA 2B2CA 4DGGA 4YO4A 3LMIA 3TTJA 2XCHA 3JVRA 3UOKA 3DLCA 2DUVA 4AUKA 5HOQA 4F9YA 3MN3A 3VUMA 3GU4A 1SVGA 4I41A 3PRIA 1JTEA 2VP3A 3G15A 4PWNA 4L7FA 3UE4A 4I4EA 4FZ7A 3L8DA 3R8UA 3HMPA 4XCUA 2GLUA 3M2WA 4F0GA 4C36A 2QR8A 3F6XA 3BWYA 3SRVB 2GS9A 1MRUA 3BZ3A 3IO7A 3EVGA 2X1NA 5G1XA 3IW5A 4FTJA 2F9GA 3JWHA 1WBPA 4PMTA 4EC8A 2P7HA 4O7RA 5HX6A 5EIWA 1WBWA 1O6KA 5F2OA 4OA8A 2IGTA 3NW9A 3OXZA 4HYIA 4NT4A 4K0YA 3OBGA 3L9NA 2J0KA 5AIKA 4FNZA 3HA7A 2NYUA 3OCJA 3C13A 3OWLA 4KS7A 4PL4A 1KPGA 4ZZNA 3P0MA 5K0GA 3OWKA 5EQEA 5AX9A 4V01A 2XVAA 4RG0A 3AMYA 4AW1A 4LMNA 3FYDA 3ANRA 3CSVA 4I4FA 1SZMA 5LMKA 2CGWA 2YDKA 4F1TA 2WNTA 3D15A 2VNWA 2QYOA 4IV8A 3ALOA 2HNKA 4O2PA 3UJBA 4FSNA 3VRZA 4B6LA 3I1AA 2X7OA 3QD2B 4QP8A 4EK6A 4NFMA 3GRVA 5J1VA 4QMQA 1SVUA 2CNUA 4EHGA 2QOOA 1WBOA 4QDJA 4J53A 5KCVA 4XV9A 4H3BA 2RFNA 4RWLA 3VS0A 3NW6A 2XIYA 3DUWA 4ZMEA 2HELA 2UZVA 1I09A 4GKIA 4W8DA 1ZHFA 5HE1A 4FEUA 1XJDA 5LMAA 1H4LA 2C1AA 4XEYA 3HNRA 4HGZA 5ITAA 4FG9A 4NYEA 4RZVA 3KCKA 3EPPA 4RTOA 2HXQA 2QOKA 4U43A 4QQ5A 3LJ2A 1E1XA 1S9IA 4YLKA 5E8UA 4ANQA 3KRRA 4ZTBA 2YIQA 2YEXA 3PXKA 4F9WA 4J7BA 5DG5A 2WMXA 3KB7A 4RX5A 2B1PA 4HZRA 1VL5A 3EVAA 1X19A 5BVDA 1BL7A 4EHZA 3ZLWA 3KN6A 4H3PA 4YHFA 4NTSA 1XH4A 4V0GA 5DHJA 1EJ0A 4E4NA 2I6LA 4C4IA 4BF2A 3G33A 4RVGA 1G8AA 4QO9A 3WIGA 1XBBA 1A48A 3BGVA 3NWBA 4YTIA 4G34A 1KV1A 2CKQA 3R71A 4FIEA 4FC0A 2WGJA 4PNEA 5BYYA 1R6AA 3AD4A 2PX4A 3K2LA 4TYGA 2ITZA 2B52A 4B8MA 5EM8A 4RVMA 3OU7A 2IWIA 3TJCA 3OEZA 3QRJA 1I1NA 4EWHA 1RJFA 4G3EA 3NYVA 4EQCA 3EN7A 5CVUA 2PVMA 2EB3A 4BTKA 1OKYA 3KQQA 3TZ8A 3G8AA 4C35A 5A54A 5H9BA 4L42A 4JX7A 4LM5A 3K5UA 2QNJA 3P2KA 3HCAA 5EMMA 3FUPA 4IX4A 2GPYA 3BLQA 4EKGA 4YZBA 4JBOA 5ICFA 4P2KA 1JSZA 3E62A 3P7CA 4GFOA 3N4VA 4QMMA 3KXGA 4AOIA 2JBOA 4FK3A 4NW6A 2YWVA 2NO3A 3S2PA 3NUUA 3MCZA 3DBQA 3TI1A 3TKHA 3DXZA 4DINA 2AN5A 5EKNA 4Z2YA 2V5QA 1H8FA 5H02A 4ZP5A 2ZULA 3PY1A 4QPNA 3QYZA 4FKSA 3UNJA 1FQ1B 3QRTA 5G02A 4XRLA 3UPZA 1H00A 1L3RE 2UZNA 4F70A 5C1IA 5FDXA 1OL2A 1T43A 4PWYA 3VF9A 3EGEA 4C04A 4YUYA 5GM2A 3ZLSA 3LOKA 4F9BA 1RQQA 3DZOA 3P2IA 4QNYA 5HG8A 2I0HA 4IJ9A 1WBVA 2CMHA 5EHLA 3ACJA 2XNMA 2H96A 4ANLA 1IAHA 4FTCA 5IQCA 2X81A 1AQJA 4FKOA 2AR0A 3ATTA 3DB8A 4ID7A 3RWQA 4AE6A 2JDRA 4K9YA 4EYJA 5EMKA 5FTOA 1QPDA 5BVKA 3LJ1A 5FP5A 4ACMA 4M36A 3NDJA 5F2NA 4JDKA 2IVTA 4HVGA 4RJ7A 4PYMA 2BKZA 3FPHA 3R9DA 4CT1A 4DEGA 4MXYA 3DDPA 3H9OA 3NW5A 3DBCA 4AACA 1CDKA 3TV7A 4YJUA 5EIFA 2ETMA 2XKFA 4X63A 3MB5A 4G6OA 3OZRA 4LRMA 4AU8A 2HV9A 3OU6A 3MFTA 4ZOGA 3CBGA 2H00A 4R6WA 3G51A 3DK6A 4G17A 3K54A 3IW6A 4FE2A 3NAXA 2W5AA 1YDSE 4OTRA 2YM7A 4DE4A 3CJQA 3S1HA 4MBIA 4S33A 4IBMA 1U2ZA 3SLSA 3VJOA 5E1EA 3ULIA 4WG4A 3G2OA 2IZSA 2REIA 2PHKA 2E5WA 2WK1A 3GBZA 3K5VA 4HYSA 3TPZA 4ASXA 1PXNA 3E7VA 3IOKA 4PUZA 2CWWA 2H6DA 5CVFA 5H8BA 3UP2A 2GNIA 3EN4A 4RVTA 3G2QA 3BWCA 2B54A 3PZHA 3Q4CA 2HW6A 3ZC6A 4G5JA 3R01A 4RLLA 4A06A 3GNLA 4FTIA 1PYXA 1Q8UA 2ZDTA 4BZDA 4C58A 4QQJA 4ZIMA 3TR6A 2YACA 3A7DA 3PXQA 4BDCA 2GNFA 4YLJA 4YJPA 5CVJA 2BZGA 3KU1A 3I53A 1ZOHA 4M13A 4FSQA 1T46A 1FOTA 2ETKA 4G31A 4EMSA 3RHKA 4P7EA 3G6HA 4U7TB 5GJFA 3PFHA 4B4LA 3C50A 1OL6A 1NVQA 3QXPA 1Z57A 3REPA 3LCVB 4K8AA 1XDUA 4J98A 3L9PA 4L67A 3H10A 3E7PA 2UZDA 3KY2A 1F3MC 2WKMA 4Z7HA 2IPXA 4AZVA 4D2RA 3EVEA 5HORA 2FSOX 3V5JA 3HRCA 2O3PA 3FPGA 4QVKA 4F6SA 1M17A 5ANDA 5LVOA 2BDJA 1YHVA 1QYRA 3EHAA 2XIZA 3QRKA 1QL6A 3P08A 4EOKA 5IQFA 3BU5A 3PSBA 3SG9A 3FTEA 3O8TA 3TKYA 2C3JA 4YJRA 2YCQA 2XP2A 4O38A 4EI4A 5IMXA 3SDJA 2GTNA 4UXQA 3GU7A 2V7AA 5JGDA 3EOCA 5J95A 4PCLA 1BUHA 3EJ1A 1KPHA 3ER8A 2VDWA 2UW9A 3EVZA 1NA7A 2QHMA 2ZZNA 5IUGA 5DTMA 1DAYA 4IVAA 1OIUA 4PX6A 2IZTA 2A1AB 2OJIA 5EYMA 3KQMA 2IVVA 2QOBA 4N6YA 1JSXA 2B4SB 5EQYA 3FPQA 5FQOA 5AA9A 4O7VA 4FT3A 10MHA 3MVLA 4IDTA 4RTQA 1ND4A 1XCJA 3OP5A 4GV1A 5BYLA 3EQBA 4CFWA 5HNBA 2XYRA 3B5IA 4MXCA 1UWVA 5KMIA 2RFEA 1PMEA 4LOQA 5HIEA 3MH3A 2O2UA 5CASA 3PVBA 4NM0A 4V0GB 4CEGA 3UC4A 4DCAA 1LPUA 3AQVA 5HZMA 3ZM4A 3GC8A 4KD1A 3G5DA 4IMYA 2VUWA 4RMZA 4CKCA 3OWJA 3DPKA 2WEIA 3PB3A 5HIIA 2QO7A 3R21A 3KKZA 5HD4A 4JNWA 4DF3A 4J8NA 4NU1A 4CZUA 3F7ZA 2A4LA 2RFDA 3OE5A 3TNWA 2OK1A 3S4QA 1Q62A 3Q60A 3A2CA 5EOLA 4LECA 4I5PA 2QODA 4EONA 3M11A 5BVOA 3OPNA 1XTPA 3MTEA 2QO9A 5ETAA 4I1ZA 3LW0A 5EHOA 4USEA 4D2SA 4ZJIA 3AG9A 4KIQA 4KIGA 4AX8A 4O84A 2PVJA 5AP6A 3ZSIA 2VGOA 2IZRA 4HJOA 1VE3A 2AOUA 5GIOE 2YDIA 3UQGA 4CFUA 1XDSA 1E1VA 2GA9A 5HHWA 4DFBA 2ZMDA 3F2RA 2LD4A 4LRKA 3C4WA 3EQPA 3PLSA 4UXLA 3PP1A 5HBEA 3MERA 1KE5A 1BX6A 1WG8A 2VWBA 3UZPA 1XH7A 3TL8A 5EZQA 2HENA 5F2KA 3EL7A 3SKCA 1CKIA 3MH0A 4EZ3A 2CGVA 4FKPA 4AG8A 5F94A 2PKWA 5DX1A 4XP3A 3VSEA 1WBNA 3EQRA 5JRQA 4IZAA 2VTSA 2YM4A 3W2QA 2ZJWA 1RI1A 3EFWA 3IONA 3MH1A 2ITWA 2G1TA 1XJ5A 3SQQA 2OIQA 3QTUA 5LSAA 3HGKA 2PMOX 2BALA 5L6WL 3HDNA 4CCUA 2DYLA 4QTAA 2PWLA 3RWPA 3RCDA 4M0YA 2GMXA 4KWCA 5C4KA 5GJGA 3RPVA 5DM1A 1FMOE 1YB2A 4HTFA 4G5PA 4EQUA 5KE0A 2A2AA 4C06A 3M6XA 3IKAA 5CNNA 3JWIA 2P35A 4GFMA 2PT6A 3ZZWA 3NCGA 4BCPA 5IU2A 3FUTA 1O6YA 3E8SA 5ACBC 4M84A 2JIIA 3LXNA 4AT4A 5FQDC 3DBDA 4IWNA 1URWA 3A4PA 3GT8A 3VO3A 4MQ1A 4OBQA 3QKKA 2JIUA 2JKMA 4DGLC 3SX0A 4KUJA 4ZJJA 4WA9A 3BGPA 3IGGA 4O7NA 4FL1A 4DQ0A 4L3PA 3HVCA 2B78A 3R7EA 3DKCA 3PPJA 2P3GX 3VC1A 4EOPA 1M6EX 4IZ5A 2YIYA 2BMCA 5K5XA 5GM1A 5HNGA 3R83A 3C3PA 4BIDA 4M38A 3IHTA 4I5CA 5IQHA 2O0LA 1SNXA 4YNEA 2P3LA 3R6TA 5B7VA 3F7WA 5JMSA 2FYTA 2OF2A 4D1XA 1NVRA 5IH3A 3DP7A 2X7GA 1W8CA 3WE8A 2YX1A 3IW7A 3UOHA 3FYJX 1OKVA 2X6EA 4FEWA 2R2PA 2PZYA 3DBFA 3LKDA 4GUBA 4E2ZA 4MHTA 5KBRA 3I6UA 3I81A 3EKKA 3W55A 1YXSA 2OXTA 4RWJA 3F5GA 3BE9A 3QTIA 2QOCA 3C5IA 4RGJA 2GFSA 2Z7RA 3O31A 3A7FA 3Q3BA 3PG1A 1U54A 1OL7A 2XJ2A 4OTDA 1JQDA 2IJMA 3QUEA 4XYFA 3AD5A 4A07A 2ITXA 2EJTA 3A7EA 5I9XA 5KHWA 1T45A 4M14A 2CMGA 2VTRA 3VRYA 3WF7A 4Y8DA 2XKEA 4JL9A 4CV8A 1JG4A 4X60A 5DOSA 1IRKA 3NYOA 3D7TB 3TUCA 5I9ZA 3LFQA 4GU9A 1Y91A 5EDPA 4KW7A 3BXOA 3CGOA 3DCVA 2OO8X 3ME5A 3PFQA 4I0RA 3GO4A 5DT3A 4YURA 3POOA 3LQ8A 4FTLA 1KYWA 1DI8A 3CJTA 4FKRA 3N4TA 2ZYBA 2J5EA 5AAEA 2WQMA 4BLVA 1PXMA 4F1MA 2DULA 1F0QA 2OBJA 3MJ1A 3HVIA 2J90A 3VN9A 5E1SA 3CQUA 2HMYB 2X7FA 1YHWA 4OTQA 4D1SA 1Y8GA 4P58A 2PE1A 3UZUA 3F3TA 5LCKA 1KUTA 1LEZA 2Y1XA 2YABA 3FUXA 4EBWA 3F82A 4UZHA 1PMVA 1ZG3A 3B89A 4N0SA 3FDNA 5JSMA 1WZNA 2OXXA 3QX2A 3LCDA 3HEMA 5HQ0A 4LOPA 5D7AA 4QQKA 3GXLA 1YWVA 5HE2A 3GOPA 3A8XA 4BCKA 3ULZA 3P7AA 4QPAA 3FXWA 4DEIA 2DPMA 2QURA 3ORMA 5KMLA 2PVYA 5HE3A 4Y85A 5FDPA 4BDDA 3DAEA 2YUIA 2WOTA 4MXXA 3UJ9A 3DMHA 3ELJA 4ER0A 3TUBA 4X2JA 3LFCA 1WVXA 3LLTA 2RL5A 3GGFA 3WZJA 5M53A 1V0BA 4AF3A 3PXFA 1NVSA 2ITNA 3KXZA 4D5KA 3U87A 2VWYA 3WZEA 4F0IA 1YI3A 4KAOA 2ACXA 3NUSA 3M4XA 4RTNA 1VP3A 3VUHA 4AZTA 4LWOA 2C0IA 4J96A 3RZBA 3G88A 2PZPA 1YDRE 3R04A 4MKCA 1SVHA 2C6EA 1V0OA 3SMQA 3R3HA 4XUFA 4FKGA 4M8TA 4U80A 5JZJA 1FGIA 5CU6A 1K9AA 2OF4A 3P7BA 3UNZA 3TACA 4FEXA 5JGBA 5M4UA 4YC6A 3F61A 5AIRA 4I24A 3QZIA 2XYUA 4PCAA 4EWQA 5G6VA 5CENA 3FZGA 3BEGA 3OROA 2ZIFA 3GCQA 2ERCA 3LKZA 3B2WA 3AXSA 3TFWA 3DXPA 5KQRA 4UV0A 2JHAA 4CNHA 4EK8A 2BROA 4QQNA 2NXJA 3F3UA 5DR6A 5CEMA 3EVCA 4AN9A 2VO7A 2JH8A 4XOYA 4DH3A 1UA2A 5ICCA 1Q0SA 3HZTA 4WNPA 1OBDA 2YDJA 3CLYA 4FSXA 2JAMA 4QRCA 2PY6A 3ZS5A 5CCBA 5DT4A 4KS8A 3UODA 5CSXA 3IG7A 2QOHA 4PYLA 3VQUA 4C2WA 3NWWA 3AT3A 2HYYA 3TXOA 3HV7A 5BP7A 4XLIA 4O0RA 1Y8CA 2OU7A 2B0QA 5IPJA 4JR7A 4PL3A 5DR9A 5FXQA 1KE8A 4D4YA 3QV2A 3IW8A 4B17A 3LJ0A 3OOGA 1JKSA 3P9NA 2ZV2A 3C0GA 4P5ZA 4EVIA 3ZRMA 3IK3A 5CZIA 5C9ZA 2R7IA 4GF5A 5HLPA 4E20A 4QPPA 5JQ8A 4KRDA 4HTFB 1APME 3H30A 2XBAA 2R3KA 3HAVA 3DU8A 1ZAOA 3PPKA 1P2AA 3QUDA 2PK9A 2IH5A 3W32A 3ORHA 4ANSA 3F3VA 4ASDA 4BCQA 3ZO1A 3PSCA 3VC2A 4EK3A 2GNGA 4AA5A 4F09A 4K6ZA 4L53A 4CTBA 3VS4A 5IMEA 2YXEA 2W9ZB 4AP7A 2VTLA 2G70A 3V5LA 3V6RA 3ORNA 2ZV9A 2I6GA 3ZDUA 1YOJA 1R00A 1VYWA 4XG9A 2WMUA 3MY0A 2UYHA 1VEBA 5LQJA 4KA3A 4PF4A 3X0DA 3DGKA 3GCSA 2W1ZA 1BHJA 1X1BA 2WQNA 4UZDA 4FKQA 4E6QA 5EGSA 3RALA 2QI8A 4AW5A 5CALA 1UNLA 4PYQA 2UZOA 4AOJA 3MIAA 3TNQB 1HCLA 2I0YA 5ANJA 3R1QA 2R3NA 1O9GA 3VBVA 5AM7A 4TWOA 3BCEA 3FY0A 3QQJA 3BWMA 2CMWA 4K18A 3MB7A 1GZKA 3LM5A 4RVKA 4DMGA 2VN9A 5DVRA 2JFLA 4ZZOA 4NL0A 4F64A 5CVGA 3R7IA 4DTBA 2PY3A 4FTTA 3L1SA 4XJ0A 3S0OA 1PXJA 3FQSA 1SNUA 5FBNC 2YN8A 2QOLA 2ITQA 5E4HA 3N9XA 4PMSA 2R6ZA 4QMUA 2W4JA 3FMNA 5IEVA 3M42A 2QLUA 3MS9A 1QPEA 4GCJA 4DBNA 3QQUA 3D94A 4L6QA 3FLQA 5FQNA 3WBLA 1P1BA 4YTHA 2JITA 4FUXA 1XXLA 2NXEA 4NSTA 4BI1A 5M06A 3SG8A 4YR8A 5L6OA 3IQ7A 1XKKA 4JJRA 3OW4A 4UWCA 4NECA 4V0QA 2B3TA 4EBVA 2R3OA 3ALNA 5TF9A 3UTOA 4MEDA 3FWQA 3RGFA 5E8WA 2ERZE 4LV5A 2YIWA 1LEWA 1XWSA 2BZKB 3ER9A 5HTBA 1TVOA 2O63A 4HGEA 5AUXA 5DX0A 2VD5A 4WUNA 2C1BA 5C03A 4ACCA 5BMSA 5AEPA 3EWHA 2RG5A 1QPJA 3I4BA 5FADA 5LVPA 4IEBA 5M44A 5IISA 3O96A 4XLVA 4S30A 5FWDA 5H3QA 2C3IB 5ICGA 4KKGA 4RTKA 1GNGA 4UY9A 2RF9A 3ACKA 3D5VA 4JQEA 3H3CA 2BPMA 3O8PA 4Z55A 2WIHA 3P1AA 2HY81 2F2UA 5GHVA 4QP9A 4GEKA 3PY0A 2P3QA 3GIWA 2QR7A 5M51A 2QOIA 4O21A 3ZXTA 3U54A 4FVPA 3AY0A 2PXCA 2ZM3A 2A19B 4O81A 2NPQA 5C8MA 1L1EA 3QA8A 4H39A 5J5SA 5E9JA 1P14A 4GBED 2PVFA 5IA1A 3G0FA 2ZVJA 5HIJA 4E6DA 4FT7A 4P4CA 4GC5A 2P55A 3HV6A 4BI0A 3Q4ZA 2I0VA 5EI2A 3SVVA 3U4UA 3HV4A 3F2AA 3OFMA 4CGAA 3GWZA 3WF6A 2BM8A 3SOCA 2O65A 4KKHA 4OR5A 4AWIA 4M15A 5EEGA 3BI6A 4RIXA 4E73A 2YJRA 4FKWA 3ZO3A 2WFYA 3V5PA 4C4GA 3T0IA 4FZ6A 5FM2A 5AP1A 3I5UA 4YBKA 3PTGA 3KXXA 4W4XA 1ZGAA 1J91A 1IAJA 3FMKA 4BGQA 3TIZA 2OKCA 4WSYA 2G2IA 1CSNA 3JXWA 3FMHA 1OVEA 5LOHA 1NV9A 4XUDA 4Y5QA 2SRCA 2BILB 3EL8A 4YSMA 4IADA 3JY0A 2FH9A 3RAHA 2G72A 4AGDA 3QKLA 2J5FA 4CWAA 3FUVA 3ZFXA 4GK2A 3KRJA 3R9OA 2YISA 2Z8CA 7MHTA 4LG1A 3CPBA 5J8IA 2IIPA 4E8AA 1Q8YA 4CRLA 4ZEGA 4ENYA 2XMYA 4HNFA 3TQSA 4NUSA 5FLFA 2AS0A 3PVWA 4AZEA 1OIQA 2KULA 4AN2A 1R1WA 2XRUA 1GOLA 1D2GA 4D4VA 3MWUA 2PMIA 2HZ0A 1WFCA 1GY3A 4O7ZA 3PFGA 3CKKA 4MTAA 3ZONA 2W5HA 4FL2A 3EFKA 3PRFA 1WY7A 1AGWA 1XR1A 4IX5A 3IPHA 4RJ3A 5BQ0A 1Q99A 4RIYA 3PJ1A 2BIKB 2ZIGA 1G55A 3VC4A 2Z7LA 4E33A 3FI2A 5CVHA 2G71A 5BVEA 3SHEA 1YWRA 2Q83A 5IQBA 3PYYA 1PRYA 5D12A 5DT2A 4ZTQA 3T9IA 3MFSA 3BUSA 3W1FA 2AC3A 4PYOA 2V7OA 4U7PB 3HA3A 3P71T 4M68A 1UU8A 1OIYA 3E7OA 3FLSA 3RMFA 3KRXA 4LFIA 1JKTA 2XZSA 4D4SA 1P4OA 5M4FA 5JEBA 2Z2WA 4RTPA 3Q5IA 4AA0A 3LQ5A 5T3QA 4I93A 2G8NA 3JYAA 5JZNA 4KSQA 3FMEA 4QP1A 4D58A 2Y7JA 2HZ4A 2J9MA 3C3YA 2YM8A 3BRBA 4JG7A 2HWKA 3SC1A 1BC5A 4FR4A 4IQ6A 3QGWA 4WG5A 4TWNA 3BGDA 4QMYA 5KO1A 3DQWA 4BDGA 5CF5A 3B2TA 3DK3A 4FKVA 3AGLA 4R3PA 3PVCA 5BW4A 4A4OA 4FV2A 4AGUA 4WT6A 4RVFA 3EEYA 3OE4A 3RODA 5CXHA 5EI8A 4I92A 5EVJA 3EMGA 2C30A 5CD1A 5AV1A 3B8QA 5JFVA 4WNOA 1YZ3A 4AE9A 3EZRA 3UC3A 1F38A 4OLIA 3RAWA 5I5ZA 4CTJA 3BGZA 2AC5A 4QP4A 3H0ZA 3R8MA 2X0GA 5CU2A 1O6LA 3LCOA 3QTZA 4BHNA 3UWPA 4QMZA 1BLXA 5HKMA 5IKMA 1OGUA 1OECA 2A14A 4F86A 3R8ZA 4HVHA 2BHHA 4O0VA 4R05A 4RRVA 4FYOA 1VIDA 4D28A 4C3FA 3DLZA 1UIRA 4K33A 3QZHA 4DEBA 3OVVA 3FC1X 3KQPA 1KPIA 3FL4A 3TKIA 5J9ZA 3VUDA 3MPTA 2ZW9A 2V7EA 4FV1A 3OXTA 4JBVA 4BKJA 4EOMA 4ER7A 5M4CA 1M14A 2Z02A 2FGIA 3MI9A 3SXFA 5HTCA 1YXVA 5IQGA 3KF4A 3BLHA 4AAAA 4X2NA 2EWAA 1PKDA 1N2XA 2XK6A 5CS6A 4U5JA 3E93A 3RPOA 1NT2A 3R6XA 5H2UA 4JX3A 2QKRA 4F65A 3THBA 3NNUA 3BIZA 3DFAA 3A7GA 5FM3A 1OBGA 1SM2A 3MFRA 3F5XA 4CCBA 2GNHA 1OB3A 4X0MA 3R2BA 4CT2A 3MVJA 1JG3A 5JK3A 4FSWA 4R5YA 3OFJA 4CFXA 3O71A 2XK9A 2QU6A 2ZTHA 3NGAA 4XUCA 4KSPA 2Z7QA 3CJGA 3KVWA 1PJKA 2JHPA 4KVZA 4Z3VA 4RZWA 4LG4A 4ALUA 4KIPA 3ZTXA 2JDSA 3VVHA 2CL5A 4BI2A 3G6GA 3W33A 2WHBA 2YAAA 4H05A 1J7UA 3AC8A 2X8IA 3COKA 5EZSA 3LGAA 2O5KA 3R8LA 2BRBA 5T6KA 2B7AA 2NXNA 4Y73A 1XH8A 5HG7A 4IX3A 1J3HA 4V05A 1JG2A 2WMWA 3M33A 4HVSA 3AGMA 3LIJA 5LWMA 1ZLTA 3M6WA 4R5SA 4BTJA 3FLZA 5DPMA 4H58A 4FV6A 3VQHA 1GAGA 4TWCA 2FCAA 3OTUA 5HO7A 4QT1A 3HRFA 3V8WA 3PDTA 5DH3A 3QD0A 4RIXB 2QQ7A 2R4BA 3A61A 2V0DA 2WZJA 4RSSA 4HGSA 3UJDA 4FT2A 4W4YA 4AW2A 3ZC5A 4CMTA 3QD3A 3G8BA 4XS2A 3E63A 3DKFA 3FLWA 4YJOA 3A7HA 2ZBQA 4S32A 1NKVA 3KQSA 2W06A 4E5AX 3GOKA 1JSTA 3PWDA 4TXCA 4DFXE 1H25A 2WD1A 3LCCA 4ER3A 5E9EA 4FL3A 3FJQE 4IDVA 5BW5A 2Y9QA 1P5EA 3IGOA 4AFEA 1VR2A 2BTRA 2XA4A 3CXWA 5EEHA 3EYGA 4GSBA 2PUPA 5FD2A 5CZHA 1JAMA 2ZM4A 3NDMA 4GW8A 2FB8A 4G9CA 3W2PA 4EC9A 3BYVA 4KABA 4YC3A 4KB8A 4QMXA 4IV0A 3P9JA 2JD5A 3P4KA 3E8DA 3LDUA 2NRUA 5A4QA 4KWPA 2YM6A 3ZEWA 4PYIA 5L2SA 4M0ZA 3G9NA 1H1QA 2EFJA 4B8LA 3LL7A 3C1XA 2JFMA 4EOIA 3CKWA 1Q8WA 4ERWA 2EX4A 5DXAA 4ZTHA 3E05A 4YBJA 5ETIA 4NKSA 2OJGA 4U81A 2VTJA 3V8SA 1W82A 3GP0A 3AJDA 3UO6A 5JN2A 3NSZA 3TM5A 4K6MA 2AVDA 5HEZA 5CY3A 2HY0A 5DFPA 3S3IA 4RVHA 2VWZA 5E8TA 1UU7A 5CT7A 5EW3A 3EB0A 4CRSA 2H8HA 4RIYB 3AC3A 3DDQA 4G3CA 3QTXA 5J7HA 2P33A 3LFBA 3KKVA 2BR1A 4LRJA 4C4JA 5DWQA 5ACKA 2BH2A 2O8YA 2OY0A 4Y46A 4BCNA 4XBRA 4Y83A 1VYZA 3FPMA 3DNDA 3NW7A 3VNTA 4R7IA 4KBAA 4USDA 4FV8A 3DH0A 4C62A 4QPSA 3P5KA 5H8EA 5HZNA 4GJ2A 5GOZA 1Q3DA 2X6DA 2XBMA 4RJ4A 1W84A 3RINA 5HICA 3FZPA 4CXAA 2OW3A 2Z6UA 4MK0A 5KQSA 3FHRA 1G3NA 4HRAA 1JR4A 4H36A 4PONA 2W4OA 5CVEA 1I4WA 2UZBA 4D0WA 2PV0A 5EM6A 4FVRA 5B0XA 4RJ5A 5HBJA 3HCBA 5CF8A 3ZLXA 3G5TA 4CFFA 4CQEA 5M4IA 2C7OA 1GIIA 1QZZA 2PVRA 4A9TA 3R0QA 4L9IA 2WTKC 2EJUA 4YU2A 3ZO4A 5CX9A 4MD7E 4WD5A 4E7WA 3RP9A 2VO6A 2BHEA 4I6QA 3CD8A 2BDWA 4DZRA 4KDCA 3D2IA 3MTIA 3R7OA 2QVSE 1L9KA 3MW1A 4C2VA 5ERGB 1OKZA 4DH7A 3FXXA 3UVRA 4NJDA 3HKOA 3U4WA 3E5AA 3TN8A 3V01A 2PSQA 2R3IA 3CJRA 3LHDA 2QLQA 4IAKA 3HDMA 4QMOA 4C34A 3DS6A 4RC3A 3CQWA 4YC8A 3QL8A 2FSTX 1JTFA 2C6OA 4UBAA 4FV5A 1NE2A 4HYUA 2VTTA 4AN3A 3FAAA 2JDOA 2WEVA 2J2IB 5B1SA 5EFQA 4PMPA 2ADMA 2JGZA 3TV6A 2EB2A 2GS7A 5L8JA 2YTZA 4O7LA 4PTEA 2DWBA 5M5BA 5KNJA 2QU5A 2RKUA 4FOCA 4MWHA 1MP8A 4R1YA 3SR4A 4YZDA 1HCKA 3DJ5A 3A27A 3RKBA 4EUUA 5HD7A 4LMUA 3SGCA 2F2CB 1B38A 5FWAA 3EKNA 3MAGA 2J51A 5LWNA 4H1JA 5JQ5A 3ODZX 4YJQA 5T68A 3ORXA 4TRLA 4RV9A 3R22A 5HO8A 5DGZA 3OU2A 4MBLA 4FX3A 5A6OA 3JR1A 1K3AA 3BYUA 4QYEA 4CMUA 5FXRA 3MVMA 5C01A 4RQKA 2CNQA 2W1IA 1Q41A 3W8LA 4IZ7A 2Q0BA 2PTKA 3KXHA 1QAMA 3R30A 2CGUA 4D5HA 3C4EA 4E4MA 4JDHA 3BV3A 5E92A 4M37A 3JWJA 5DSTA 4XG8A 5C1QB 1JQEA 2DQ7X 5JGAA 4EOSA 2OG8A 2OFVA 5L8KA 3GU5A 5FG8A 4X41A 3DBEA 3QTQA 3IEIA 3QC4A 1TPYA 3HP7A 4RC2A 4RFMA 4JAJA 1FMKA 5HVJA 3FQHA 2W1DA 4TYHA 3S00A 1ZXEA 3UG1A 4ZSGA 2OFUA 3GNIB 4USFA 3HRBA 4O7WA 4YUZA 2JHCA 3PLAE 2IDJA 5AJQA 4IB3A 2X8DA 3K6RA 5A9UA 1H08A 5ANEA 4R6XA 4C08A 3O7LB 2GQSA 4O0SA 1JPAA 4MHAA 4ARKA 3UOJA 2OJ9A 2GHGA 3G2PA 2JKOA 3B3FA 5DSXA 2R3GA 1XH9A 1M6YA 3WILA 3LPMA 3OEFX 5CI7A 4TKSA 5HIMA 3PT9A 3KHKA 3LCKA 4POOA 2PSSA 2ITUA 3HNGA 3QZFA 2XCKA 1PMNA 4UWYA 4BCIA 4RBLA 4XG2A 5DM4A 1YOLA 3ZXZA 3QGYA 4DGOA 4G6LA 5CCXA 5IA5A 4PIPA 4XNEA 4JS8A 2G15A 1JLUE 4FTQA 3DA6A 2PUIA 2OH4A 4O91A 4N6ZA 2UZ4A 3LXLA 3LSTA 3ZU7A 3PIYA 2IH4A 1M0EA 5C9CA 1H1SA 5EW9A 5CVVA 3ZO2A 5DR2A 2XVDA 4GK4A 3GRUA
chains in the Genus database with same CATH superfamily
1HL7A 4ON9A 2QDXA 3AB7A 1KAQA 3FZRA 4K46A 3FPFA 4LXIA 5A5FA 1BVHA 3I5YA 2PPQA 4MD8E 4IXDA 1XVUA 3KF7A 2AUMA 3TTUA 2BDUA 3T5AA 1NJ6A 5FP6A 1NOKA 3HADA 1CZUA 5IDWA 1EEHA 1NMSA 3WKCA 3MXTA 4XYBA 3KB2A 1VE7A 1DOAA 4NOLA 1N2IA 3H2SA 3FBVA 2BV3A 1VJGA 2E9NA 4PRJA 2AD5A 3PXZA 4RK4A 2PVCA 2WRZA 1E6WA 4F97A 1QQ6A 2J4CA 3R7WA 2W43A 3UJCA 1UBJS 3ZMMA 2GEKA 3HO6A 1ZK3A 4BTFA 4YUQA 3PKJA 5DHFA 2PEYA 3ZYCA 2V6IA 4XH6A 5J5VA 3LQYA 3LQKA 4F60A 4C0HA 1C30B 3DSRA 3E22A 3DE0X 1UFKA 3O8LA 1RBZA 3NVKI 2BTQB 2WAYA 3FI0A 4HCJA 1M10A 4FZAB 4RDHA 3EF0A 4U7HA 3H13A 1LZLA 1QWSA 4ACHA 4MVWA 4FX2A 4XDHA 3FRIA 2PVNA 1AH2A 4CM3A 1VGRA 1H2RS 1LQUA 4OTFA 1N1EA 3T9CA 4HH0A 1IA8A 4ND8B 4WWHA 3IV9A 1ZH4A 5TKDA 1I7NA 2OV1A 3B82A 2FUG6 4AP5A 1Z9XA 3AW8A 1RQ2A 4GXNA 5EG3A 3DS8A 2HIAA 2QXTA 3EVBA 3EFJA 4EUNA 3OPQA 1K2VN 1IDOA 3JZAA 2OENG 4RJ6A 4A6XA 4BC6A 4BX3A 5TY0A 1SFRA 3LFNA 3E7DA 4Y6GB 4MRSA 3MESA 2NU8B 3FOEC 2BZ1A 5HUQA 3GFQA 1VLVA 3QLEA 3TJRA 1K7CA 2Z9BA 4WUAA 4G0ZA 4GI5A 4RD6A 2AZ4A 5AV0A 4FE7A 3D9QX 3EDQA 5EOVA 2YINC 1AKEA 5BV2P 1XRPA 4KWTA 2PWZA 4KVGA 5EIOA 4K88A 2G2HA 1DJQA 1ODJA 4R77A 2O6HA 3BQMB 2G9NA 2HA6A 1VKJA 3VUEA 1FDTA 1D6NA 3GQIA 5B2MA 3BKWA 2I1LA 2CE7A 2FTKE 3NHJA 2IHZA 3RHSA 1XEFA 2WP0A 1T6YA 5ETFA 5HDQA 4FKIA 4DGNA 3O3MB 1DXYA 1XMJA 2CSNA 2YITA 3ET5A 1CEYA 1L5SA 2CZQA 3MGYA 3ZV7A 2HQSA 1URCA 4F3KA 3KWFA 3AI7A 8LDHA 4PTLA 4DEXA 1BIFA 1QHEA 1M54A 5B58C 5FA5A 4UUAA 4J7XA 5B2FA 1LSOA 1NMYA 4GYYA 3W5HA 4JMQA 5CDYA 1PKGA 1EXVA 3G0GA 3LFSA 4Q03A 3D5UA 4BDIA 4ZU6X 5ADUS 1WAKA 1AZLA 3HKEB 4A9YA 4PAMA 1C9NA 1HG0A 4OATA 4YX9A 3C1AA 1FQOA 5LQDA 1SULA 4EHEA 1O9UA 2MMGA 3WK9A 3SPXA 1O5IA 5AW3A 1STCE 2W99B 3QLUC 4LQMA 2W2PA 2BFMA 4EG1A 3HV5A 2C2KA 3SBXA 2XBJA 4JBLA 4FYHA 4HVIA 1AO3A 5H8GA 3RFCA 3SGLA 3MOSA 3BBTB 2R84A 1CHNA 1PAUA 1CQIA 2A59A 3IR5A 5EH0A 2I40A 3B1WA 5L8VA 3E87A 2UXDB 5FTWA 2ZRJA 1B41A 2YJSA 5AUWA 1V35A 5EAIA 1RAFA 2FWPA 5F1KA 1C3OA 3CTQA 2JJQA 4B3CA 1K6IA 2VA8A 4M9UA 1DMSA 1YI6A 3DVLA 5EJIA 4BRSA 4TZ6A 1LRKA 3Q6UA 5KDLA 2Q9UA 3A2NA 1JKJA 4X2KA 4E93A 4BPRA 4CQLB 4RX7A 3HJGA 2ZJ3A 2FYSA 2C9OA 2JJ8A 5LMBA 3KR9A 2YZ7A 1OPLA 4GMGA 1A9TA 3VYWA 2VA9A 1T5TA 1S01A 2E9UA 3PGJA 3T52A 1KJJA 2WTNA 1PZNA 5IXYA 4CLOA 1DG3A 4ABYA 4URVR 1CX9B 4IH8A 4A8TA 2YIVX 5C4MA 3X1MA 1XZIA 4HSGA 3RU9A 5EJ4A 3V7UA 4PSAA 4XDYA 3V9PA 4M69B 1E7RA 2OE2A 5K9IA 3NIBA 4AJ1A 2P75A 2AC2A 3DOJA 3D4PA 1LUFA 2O07A 1N5KA 3MSSA 3ENMA 2WF9A 4EHVA 1FTQA 3QNUA 3M81A 3UMVA 2R8PA 3QRIA 1MBZA 2WMTA 3GMTA 5HK9A 1RQ7A 4EZBA 4O0WA 4OGWA 5CW2A 3PE4A 1E9HA 1M73E 3R0IA 1MRYA 4JGGA 5EJ7A 5K05A 4DGMA 4RC9A 1B3RA 5EHYA 2G0TA 4MWCA 4NKAA 1B39A 3DXNA 5BNIA 2W6QA 4RFLA 4BP8A 3W2FA 1BCRB 2R3LA 1EGMB 1B16A 1N0IA 1NN0A 1E1RA 1SCUA 4Z99A 4H3KB 4PHGA 1EFUA 3ZY3A 4CM5A 1D2MA 4I1UA 5L2IA 3HB0A 1LKZA 1YXUA 5WRFA 1FRFS 1BHO1 4L74A 3MG9A 5DZSA 2C4GA 3WZMA 2OGVA 1M1YB 3GGDA 1ODCA 3EGCA 2O06A 3SBDA 1TC2A 4K1XA 1YAJA 1NOJA 1H9CA 3KQTA 3VUKA 1K27A 4RVDA 4ACDA 1ZI8A 3JSXA 1D04A 1P18A 2PGLA 1ZJ4A 1FC0A 1M6NA 4V2IA 3L7JA 1PJSA 2V98A 3KKLA 5CTPA 1TEXA 3WNBA 1FRVA 1YGPA 4IMPA 1PZFA 4DA4A 1OUYA 4WNYA 3TOXA 5A3SA 2FZCA 5AI5A 3FTNA 2Z5LA 4Z4GA 3KV3O 2XNCA 1E1QA 1K08A 4L8WB 3ZZMA 5THKA 3TKAA 3VPSA 1U6JA 2ZI6A 3O0GA 3A99A 1IM5A 3GVIA 1T1JA 1GJRA 1J7IA 1Y5LA 2P9BA 2ZAYA 4ND7A 3II5A 5F76A 3MIYA 5K0BA 2PVSA 3A1EA 1H6CA 4CLIA 3FDXA 3LZCA 2X7JA 3ROYA 4W1PA 4BICA 4NM7A 4EH3A 1E8NA 1TT7A 3ZVKA 1K3TA 2HKIA 3T1VA 3S5JA 5BSVA 5EHIA 3ECSA 4HAYA 2BRNA 3PX7A 4C78A 4B5LA 4NYIQ 3OZ6A 1G21E 2CDZA 1NRJB 2Y1FA 4EG8A 4WAUA 1JAHA 3TI9A 3BMNB 1QPZA 1NHWA 1XTUA 4HRVA 1RBYA 3V8BA 4A6EA 3ZVNA 1QOZA 3LP6A 4M46A 3C6MA 4D9UA 2MINB 3P2MA 1YOMA 3QG5A 4HVCA 1XX6A 3E22B 5KNCA 4D1ZA 4U2DA 3RAPR 3PJ3A 3LY8A 3HZOA 3BGIA 1KV2A 5HBRA 1RYYA 3EDOA 2O5CA 1ZYUA 3R2JA 3Q8XB 3EN9A 4M88A 3VDXA 4YA6A 4GIBA 3L05A 3GJ7A 4UASA 3AWIA 1PL6A 1YMQA 3U56A 1R6DA 2J46A 4P84A 5SICE 4IVPA 5CXZA 1RHQA 3GNTA 4EYGA 3QPUA 1RMTA 3A1CA 3D1JA 3L0PA 1JJAA 3NBXX 5AXDA 2QX4A 2HCKA 5JYDA 3HS3A 2QIPA 5C4LA 5EE3A 4CG0A 1KR5A 2ZUUA 1F2UA 2X4FA 1Y57A 4R16A 4I1VA 2GFQA 4I1PA 3POZA 3VS2A 4NYMR 3R7UA 2XZTA 2HNBA 1W0JD 4L44A 3VHXB 2XIXA 5BNJA 3L4JA 1BJKA 3ZNNA 3C0HA 1MB9A 4O7SA 4JBWA 1JBEA 2W9FB 1BFUA 1YE3A 4AJNA 2YN2A 1C0KA 3QELA 3E7FA 4YSJA 1SIUA 3D2BA 1VLQA 3TMYA 2X9FA 3LPBA 1M1UA 5SY6A 3PPZA 4W4WA 3LYAA 3IJ5A 2OA0A 4AUNA 1VPLA 2IE0A 3UPDA 3I58A 2QQ5A 4IO0A 3TTXA 4DKXA 2YC2C 1HE2A 2QVGA 4AA4A 5HI2A 1TUBA 3COHA 1NJSA 3E8EA 3GC6A 3AKKA 3PXXA 3LLCA 3HSYA 2OWDA 4CD0A 4ACBA 5TR6A 4RZ2A 5K09A 3DL2A 4WHMA 2IW6A 4KMSA 5B30A 3JQBC 5HBHA 2O4UX 1IMOA 2QRGA 3KMUA 2B5OA 5KMJA 2D5CA 4L15A 2J4FA 5AUVA 3G5UA 2QY9A 3PP0A 2BM1A 2AEGA 1TLTA 3TZMA 2CLFB 3K0BA 2XNSA 4BMDA 5L3AA 1U9IC 3NNDA 4TXJA 4J03A 5IUJC 4M7IA 1A3CA 4CQMA 2VTQA 1Z4IA 4FTRA 2J3KA 4CKIA 4JL5A 3NVMB 2YBEA 1MEEA 2BRHA 1BL6A 3RIHA 1MVNA 1L9XA 3G02A 4UDXX 3BH7A 3CEKA 1WTCA 3GBPA 1XG5A 4RZIA 2V8OA 2YHIA 2G1PA 4E5WA 4EH2A 4Q16A 5D51S 1N1MA 3GEQA 1VZ2A 1I1OA 1RABA 3G9TA 4HDMA 5IC5A 3AUAA 3EQ9A 5FBOA 3OUNB 4LYDA 2G3YA 1DO2A 4EGCB 3W6PA 4MHSA 1DU4A 2J0MB 1GPDG 2EW8A 1SKYB 3UJPA 4XE5A 2G9RA 3FCSB 3ZY2A 4Q00A 1H8ED 3UG6A 3JS5A 1J6UA 1FMLA 3DEHA 3OZSA 1SKMA 2PYDA 2OB2A 4IVCA 4BMZA 1TMYA 5AVVA 5IA3A 1GXSA 2GCDA 4XFKA 3NHYA 3KS9A 1K6JA 1C3OB 1PD1A 3H7AA 1X92A 1RHMA 3KOZA 5FBRB 5TO8A 2FEPA 2X86A 2JVJA 1Q20A 3EVTA 4RFZA 3PXEA 3GFGA 1D6SA 2OVBA 1ZJ5A 2VRWA 4BBEA 1I1QB 1KKUA 2JLUA 1JKJB 4MXAA 2VT3A 3WIVA 3PA4A 1M7NA 5KJFA 5M07A 4OM8A 4LJ9A 3GIDA 3OE7A 2YR0A 4DYVA 3D7SA 3RV4A 4FYPA 5L7TA 4G0OA 4IACA 1QV6A 3PR2B 4JQ7A 2OFPA 3HMQA 4RCZA 4BVAA 2JS7A 1QTRA 2ONLC 3ELUA 3F9RA 2BFCA 3C3BA 3ICOA 3COZA 1ISRA 4GI1A 1XZBA 5IWAB 2EVAA 1LPNA 1WNFA 3QHRA 1KZ9A 2PH7A 4PNKA 3I2KA 5KJEA 1B2RA 1VJ1A 2HQ1A 1S6YA 3CH7A 5I48A 4HLQB 4GOOD 1NBHA 1O96A 1CVRA 1VCHA 2CJXA 4OHPA 1JHZA 2UW6A 5DF1A 1SOWA 2DPYA 3OX3A 1ZD9A 1H9AA 5D1JA 4OLHA 1NXKA 1P7YA 3HZRA 3CB2A 1XRQA 3X1DA 4MUMA 1RBQA 4QQCA 2RBEA 1H94A 5BRJA 3Q3VA 1ISSA 4EBFA 1WXQA 4M7OA 2NQ2C 2XRMA 4IJPA 3ZJVA 2QM3A 2B8NA 4NABA 1OX5A 3RRNA 2C9MA 3PVGA 1D0VA 3HO1A 4A4XA 5BQ5A 3EQDA 3EWAA 1AKYA 4WOJA 3H16A 2VKTA 4KN9S 1O97D 2DR3A 1W83A 2MR5A 5DTQA 4R9NA 1EWKA 3KSRA 1KQOA 1IR3A 2EX0A 4WZBA 2VAVA 5F4ZA 2YCSA 2V1UA 4P0QB 4BEVA 3F8WA 1PVOA 2GB4A 5D9HA 4NG5A 4EY5A 1KJ8A 3OJFA 3NALA 4W1RA 2A0FA 4ZMFA 4EHAA 1TCVA 3PEWA 4ZYLA 3EQIA 4E4LA 1TIPA 2H1VA 4TX1A 3WWPA 4K9PA 4F8JA 1ESCA 1EJ2A 1R4NA 4OBPA 2YN0A 4HW7A 2C5BA 3IRVA 4JLSA 4DMFA 1DADA 4EHNA 1SBNE 3B48A 1ZQ9A 3ZEIA 1MJHA 2J4ZA 1M2PA 4J71A 4YMWA 3N2ZB 3NGMA 3HDQA 4B6SA 5JOQA 4O6LA 1SXJC 2VGPA 1G16A 4UAGA 3BHNA 4UNQA 5HOEA 2XMDA 4U44A 2JKZA 1T91A 2BHRA 1RWMA 1R15A 5IMBA 1LPOA 5EJAA 1O54A 2ZDHA 2PU7A 2XEZA 3BWFA 1UZUA 1QGDA 4ARIA 3G5LA 3QKSA 5CAEA 4EKLA 4PNIA 2FFHA 2RGNA 1OIVA 1CS4C 3G2IA 4AXCA 4FNXA 5F20A 1RZVA 1H8HA 4I5IA 5EW8A 1CBUA 1LGYA 2JLDA 4JJKA 1OZAA 4PZ9A 1CSEE 2RHCA 2GTIA 1V4VA 1W46A 4NPAA 2Y9PB 2ZM6B 3FMPB 3L8HA 5U4QA 4JI5B 4ZZ1A 2VJBA 4M4SA 1CY1A 2IHYA 1T8UA 2QOQA 5KYKA 3BDAA 3LBNA 3P9IA 1WMSA 1HDRA 2O3TA 4PXYA 1W0XC 1SCQA 2WB2A 2PFGA 4JQ8A 3MV5A 2HJHA 3Q0TA 1TECE 4CV0A 3QMMA 1VQ1A 2Y1WA 1T36A 4EOOA 1GG8A 2AR7A 5ANIA 4KO3S 4O08A 1ESMA 1F2UB 2JATA 1TQPA 3W8DA 3WR5A 2WKPA 1OKWA 1N7JA 4MVJ