5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
5EIWA 3COMA 1KP9A 4TYHB 1JKKA 2GLUA 1FGIA 4F9WA 5EFQA 4YSMA 3D2LA 5A4CA 3TZ7A 3GFEA 2VTOA 3TDWA 2IZSA 2W17A 4EQUA 2UYHA 4MXOA 2CCIA 5CM2Z 4IKPA 2PVKA 3BEGA 4M15A 3OZRA 2QC6A 2C6LA 3C6KA 1A9UA 1GZOA 1FP2A 1ZWSA 3EFLA 3EN5A 2R3PA 5IH4A 4YUXA 5KHXA 2J0MB 1YI6A 2VX1A 1WVYA 4EH4A 3BRBA 3CC8A 2ZOQA 3FXZA 2GB4A 5EQJB 3ITZA 4K1BA 5CSHA 3CVOA 2JDSA 5HVYA 2CGUA 1YDRE 5E8UA 5HESA 4BDAA 4R7BA 4Z16A 2QRVA 3OTVA 4QP4A 5I4NA 3G33A 4OTIA 1BKXA 5CSWA 2HW6A 3CC6A 4FOBA 4IWPA 5C9CA 4DBNA 3R0TA 1NXKA 1KYZA 2N47A 3FQEA 3OXIA 4YJPA 2ZM3A 1QPDA 3SG8A 1LEZA 1WBOA 3ZSIA 1ZYCA 5HNIX 3OHTA 4FEVA 1M2QA 4D0WA 3C4EA 4FZAB 4IX5A 4FIEA 4XG2A 3KR9A 4RX1A 1TVOA 5HLPA 3ZLYA 5A4EA 4G5JA 4FKWA 4RFZA 1OKWA 4ZTNA 4ZTMA 3NIZA 3FUWA 4FNYA 2C47A 3JS2A 4QP7A 4QNAA 4UV0A 4I5MA 3ORXA 4MNEA 4FP9A 1A06A 1OKZA 3OUNB 3QKMA 4FTUA 4NTSA 3SOAA 3T9IA 3UMXA 4C2VA 2OB1A 5FULA 3DAJA 2C6OA 5DHJA 5AUWA 1H1QA 3CTJA 5HBHA 3FMJA 3G90X 3V8SA 3PTAA 3OPNA 3ZFYA 4TYGA 4DLJA 3Q7EA 5DTMA 2XKCA 1VP9A 5DI1A 3VHKA 2XBMA 2P3GX 1O54A 1H0WA 3EQBA 3BZBA 3OFKA 5T3QA 2XYRA 3V97A 5IQDA 3ORNA 3VRYA 1K2PA 3QZGA 4EJ7A 2C7QA 1H1SA 2C7OA 3DK3A 2AOTA 3PLAE 1XH7A 4M13A 3H3CA 3IG7A 1KE7A 2UZTA 2UYOA 1P5EA 5K0FA 2W06A 5GIPE 5CVEA 4L3PA 4WRSA 3RK7A 5GM2A 1SUSA 1VJYA 5AJQA 4CNHA 5HIJA 4OQEA 2Y0AA 3CP9A 4RMZA 4TT7A 2UZOA 4FEXA 4YTFA 3MQ2A 2EJTA 1P39A 2VTTA 3UJ9A 3BGQA 2B0QA 3IPHA 3ORPA 3EQRA 4ACCA 4YURA 4CG9A 4TYIA 2Z7RA 5IUHA 4CKJA 4IVDA 3LDFA 3MCTA 2GSFA 3P9JA 2X7GA 1WVXA 2P8JA 5F95A 1MQBA 2XNNA 4LYNA 1OL6A 4AW2A 4UN0C 2G8NA 3PS9A 3PP1A 2E9PA 5HTCA 2P3QA 4ZSJA 2C6IA 3UMWA 4DEGA 1X1DA 2GCDA 2A0CX 1ZY4A 2BM9A 3LCSA 3GU7A 3BGDA 5K0BA 3FSKA 5AV0A 3B8RA 4RJ6A 3W55A 2F2CB 4BKJA 4NU1A 1O6LA 1OECA 2WTCA 3LM5A 3KKZA 3UFBA 3ZFXA 3I79A 3TZ8A 5HE0A 3Q04A 5JRQA 3DTNA 3NJRA 3HNRA 4Y83A 4M14A 4C3PA 1OUKA 4O7WA 2O0UA 4QQ5A 2PBFA 2AOXA 3ER9A 4ID7A 2Z2WA 3UO6A 3FEGA 4M12A 3Q9YA 4F1MA 2XJ1A 2YM8A 4ZLZA 2WOUA 4TWNA 2AC3A 3GC8A 3HA3A 3DJ6A 5T64A 3DGKA 2I7CA 5LR6A 4QPSA 5L8KA 2FK8A 1FVTA 2VTQA 4FSWA 4P5ZA 3P9CA 4FEWA 2X39A 3R8VA 4ZY5A 2ERCA 3GUBA 3PXRA 2G1TA 2G1PA 4DFLA 2X1NA 4W4WA 1W84A 3F7WA 4YV0A 1M7QA 3VS5A 4JS8A 5A46A 5E2BA 2CSNA 5M4CA 1EJ0A 5IH5A 1H1RA 2B4SB 4LGHA 5HOQA 3GNIB 1YWVA 1KUTA 3KN5A 2JHAA 4F0FA 4AAAA 1H8FA 4PYOA 1Q24A 2GDOA 2WQBA 2OO3A 2HZNA 1D2CA 2SRCA 5M56A 1H00A 4AFEA 2ONZA 1KE5A 3LXKA 4ZEGA 5A14A 3G88A 4JIKA 1E1XA 5CT0A 3VJNA 5M5BA 1DS5A 2Z7QA 4O83A 4YZCA 1GY3A 4E26A 4XP3A 4ENXA 2JJQA 4JOAA 4EHGA 4WA9A 4HYSA 2WTDA 5BVWA 4A4OA 4OX9Y 3AXSA 3EGIA 3P7AA 2GQGA 5AA8A 3GQIA 2XYQA 4FV5A 4AA5A 2AUHA 1B38A 3MH0A 3EVBA 2QKWB 3SGCA 5IA2A 4QPPA 3GP0A 4DGLC 3DLSA 3U54A 2QO2A 2YIRA 1HMYA 3RAWA 2XBJA 3M6UA 4H3BA 1NE2A 1VIDA 1SKMA 1OM1A 4RJ3A 5HEZA 5AEPA 2W5HA 2EXCX 4FV1A 3TZMA 5FQNA 4QMMA 5LSAA 2XCHA 4JRVA 2A1AB 2FVDA 3C5UA 2ZV8A 3FDNA 4JXFA 4E4MA 3G2QA 2E9UA 3DNEA 1NW1A 2B54A 2ZDTA 2OZAA 3GQLA 5DNRA 2GS9A 2EG5A 2CNVA 2VD5A 3TNHA 1G3NA 4G9CA 4D4SA 3LGAA 5HIIA 2YX1A 2QLQA 1UKIA 4RVTA 2UVYA 2VTMA 3OF0A 3E7PA 3PFHA 1Q3DA 3NUAA 3OT8A 5A4LA 2X8EA 2P35A 3T7RA 5DLSA 4CRSA 5AUUA 1BHJA 5LVPA 5IUIA 5JKGA 1Q8TA 4TWPA 2BPMA 1F3LA 1XCLA 2AN3A 4DCGA 4X2NA 1PRYA 2OY0A 1W8CA 3V5PA 1D2HA 5E2AA 4XG8A 2W1GA 4FIIA 4WSYA 4XCUA 5L3AA 1JG1A 2BKZA 2WMBA 3HRBA 1Z5MA 4O27B 2UZVA 3UNZA 3NDIA 2WMTA 2ETRA 1UA2A 3GI3A 4FT3A 3MTFA 4YJOA 4O21A 2PVRA 5M51A 1X1CA 3PFGA 3AWIA 4YV1A 5LQKA 4RTSA 4A4XA 3EN6A 4HVGA 5M57A 5CS6A 5BUEA 4YBKA 3FMLA 2ZV9A 4DGOA 3C4WA 1V39A 4QRCA 3PY1A 1UU3A 2RKUA 3NNUA 4PYIA 2PV0A 2YN8A 5DEWA 3MERA 3BE9A 3CTHA 3BHUA 3FLNC 3JY0A 4IB0A 4QP8A 2PMLX 2VO3A 4ZSAA 5EIFA 4AGDA 3SGLA 3MYGA 4A6EA 5GJFA 3S1HA 2PWYA 4AUKA 2ZDUA 3FZPA 2O0LA 2WQNA 5C4LA 5EQYA 4QYFA 5LVMA 3LHDA 1XVAA 3FJQE 2BAQA 3KQ7A 4IWDA 2XRWA 4JDHA 4GEKA 5A4TA 1H27A 4AG8A 3KMMA 5LMKA 3ZUUA 4YSJA 2Y4IB 3BU6A 3KL8A 2B2CA 4DG2E 5ANEA 2CGXA 3R6TA 2YERA 10MHA 3H9FA 4H3PA 3UG1A 3A8XA 4EL9A 1OIUA 3PXQA 4R78A 5CAVA 3GOKA 4FZ7A 1JQDA 5DM4A 4LM5A 4RX8A 3TT0A 5E8JA 3P0MA 3TI1A 4RTKA 4AZVA 4C07A 4P7EA 2B1PA 3I0QA 5BYZA 4EH6A 3DTCA 4X3FB 4C34A 1ZG3A 3F2AA 3HV6A 3KKVA 1OB3A 4NT4A 2QM3A 4HTFA 3FZRA 4NJ3A 3SW4A 4YGAA 4EHEA 1F38A 2PT6A 4F6UA 2UZBA 3F5GA 2FCAA 4O7TA 3HA5A 2PUIA 1P1CA 3HVKA 3R01A 4MHAA 4X60A 2GNIA 1CSNA 2PE2A 3IKAA 4YLKA 3V8WA 4XUFA 3VUKA 3FYCA 2I1MA 2HIWA 3TNQB 5KX8A 1U4DA 5FD2A 4B8LA 2WK1A 2YXEA 4DH7A 5LOHA 5KVAA 2JLDA 4G3DA 4GL9A 2WPAA 3RCJA 2NXNA 4LI5A 3FTEA 3GCVA 5DR2A 4U44A 4WBOA 4YU2A 3I53A 3LL7A 2ITYA 3O51A 3CBLA 4JAIA 5KBRA 3KXHA 2IZTA 3FKLA 2X2KA 3KXXA 1S9JA 1LR4A 1V0PA 3QZIA 4RX5A 3TLJA 4L42A 4CFXA 3MFUA 3OP5A 5E8XA 4CCBA 3KGAA 1P4FA 4FICA 3D7TB 4CZUA 3C0HA 3L9NA 4BC6A 4EORA 5M53A 4J98A 4BCIA 2ZVAA 3P9KA 3MJ2A 3U87A 2VNWA 4PUZA 5F1ZA 4ZTSA 5CF8A 5FXRA 3UWPA 3G7UA 3IYLW 5ICFA 4UOEA 5J87A 4QTDA 3FI2A 2HK5A 2OJGA 4FSNA 4HSGA 3B5IA 2XNGA 3BWBA 3CJFA 4H0NA 2IVUA 3DQWA 3GOPA 2VAGA 2ONYA 3I4BA 4ER3A 4TW9A 2UW6A 3NIEA 4EH9A 4X2GA 4BBMA 1EQAA 4BIDA 1CKIA 8MHTA 4CFUA 3P1AA 4GG5A 3N9XA 2Q0NA 4ORKA 4FA2A 3DOUA 3QUDA 4K6MA 4DFYA 2ERZE 3P7CA 4RVLA 1YXSA 1JLUE 4O22A 5DRBA 4GG7A 5JRSA 2IP2A 5AP4A 5LQCA 3IGOA 4YHTA 4B0GA 2AN5A 1YQJA 4EZ7A 2OKRA 4PWYA 3FY0A 1OKVA 4DLIA 2PU8A 3BCEA 3U55A 4OT5A 3DDPA 3ZBXA 1G60A 4X2FA 5HCZA 5B7VA 3GGFA 4JR3A 2P3OA 5BMMA 1UWJA 3SVZA 2E9VA 2ZM4A 4HOKA 5K0GA 2BDWA 2W5BA 1ZARA 4I93A 4TRLA 4BHNA 2PVMA 4F4PA 5HVKA 4OA8A 4QDKA 5E9JA 4XG9A 3OMVA 1NBHA 4L3LA 1XDZA 3F4KA 4C33A 4O0RA 4XLIA 3ORKA 4A9TA 4E5WA 1B39A 2WEVA 3QWKA 1WCCA 2NPQA 3UJCA 5EKOA 1OIQA 4L8MA 4BN1A 4GYIA 4APCA 3DFCB 3QZHA 4UB7A 3NVMB 1YFJA 4M68A 3D14A 3DMGA 3WILA 4FVPA 5AUVA 5EQPA 4ZXTA 3MVMA 1ZHFA 4R8RA 4RPVA 2Y1WA 4BLVA 3M1SA 1VEBA 3F66A 3POZA 4EOOA 2JKQA 3SSOA 2ITWA 4FL3A 3MI9A 2OJFE 2GH1A 3G9NA 4IM0A 3UGCA 3KCKA 3WSTA 1JSZA 4QPAA 3QC9A 3BHTA 3F3ZA 4WG4A 2A19B 1KPGA 3Q9XA 4G5PA 2OXYA 5L2TA 1P91A 3KRXA 5JSMA 4YJTA 4ACMA 4RLLA 4N70A 2AOTB 4R1YA 3F3TA 3EVGA 4ZTQA 3E23A 4DE4A 4IH8A 2JAMA 3GWZA 4FZVA 4MVFA 3E8DA 3L8XA 3R8LA 1YZ3A 4O0UA 3ZS5A 3WBLA 4MBLA 3E3BX 4R3CA 4DBXA 3FPFA 4BVUA 5KCVA 3R24A 4ZTLA 4NIFB 5KE0A 2Z7LA 4JJRA 4FIGA 3RTPA 1KHHA 3QQKA 5CT7A 3IEIA 5CCXA 3Q4CA 4RTOA 1YOMA 2ZSUA 2ZV2A 4B4LA 2ITTA 4N0SA 4KRGA 3DFAA 1UV5A 2QODA 4GW8A 1Q8YA 3C7QA 5FQDC 4EEVA 4F9CA 4E2YA 2ITOA 5AX9A 4FTLA 1IG1A 4HYHA 2CL5A 3B3FA 3G89A 2OIBA 4WXHA 5E90A 3QU0A 2XK6A 4TNBA 2W4JA 5CX9A 5AV1A 5A9UA 5BVFA 1R8XA 2JAVA 3ENHA 3EZVA 1E1VA 4I6BA 2W1IA 3BWCA 4N57A 4OA5A 2WMQA 3TCPA 2NYUA 3QTXA 2C68A 3AC2A 3HV5A 4GEOA 5AAEA 1BOOA 3MTEA 1JTEA 3TKUA 1SVUA 5EKUA 1YDSE 2AVNA 3FPJA 4RLKA 5DXJA 4UYNA 2BZKB 3RALA 3FXWA 2HOGA 3D2IA 4YC8A 4IJPA 4XV3A 3TFWA 2XIXA 2ZB0A 3OU7A 3MCZA 4IVCA 5LVOA 4X63A 1OGUA 3GU6A 3CCFA 2HY81 4R3PA 4BTMA 1SM2A 1M17A 4J53A 4ITJA 5CQWA 3UZRA 2O2UA 4Y5QA 3GGDA 3Q87B 4QVKA 3NUXA 3O71A 2BIKB 2NRUA 3PDTA 3K3IA 4AZEA 2BR1A 4WNPA 5H2UA 3D83A 3BYUA 2R3RA 3PFQA 4FNXA 5HNBA 4D5KA 5KHWA 2OXTA 1PMNA 3QQUA 5EHOA 4QOXA 3THSA 2ZLBA 2OH0E 5IQCA 3Q2MA 4XG4A 1ORHA 5HCXA 3R7UA 3NVKI 5CD1A 1JG3A 4CTCA 2OZAB 5M06A 2ERKA 5FQOA 3A2CA 3UZTA 1QCFA 3WIKA 3AY0A 1K9AA 4DFZE 1OIRA 3ZM4A 2PZ5A 2BRGA 2RFSA 5KZ0A 2PXCA 4HC4A 5D1NA 5DLYA 3V8VA 2BZHB 4LL0A 1OUYA 3MB6A 4YUZA 1EH4A 2QCSA 4FI1A 4J8MA 9MHTA 4PNEA 4HGLA 1H1PA 3UOHA 2WTWA 3NUNA 3S3IA 1O9HA 2FHPA 3VSEA 4HVHA 2G70A 4ARKA 4EOMA 5M4UA 4PYJA 5AP3A 5ACBC 3HV4A 3SX0A 1KE8A 3EGVA 2WD1A 4GV1A 4PP9A 1U2ZA 1YXTA 4ANMA 2WU6A 4X3JA 1M6YA 1DL5A 3HZTA 4F9BA 4J96A 2EB2A 3KVXA 3VULA 3ZMMA 4S31A 2JKOA 1IA9A 2C3IB 1EG2A 1NV9A 5B2KA 4AE6A 2H11A 4Y2HA 4WBBB 4BDDA 2ZWVA 3QRJA 3LJ2A 3OTUA 4LRMA 4NM0A 4BTJA 4C58A 4RTLA 3MHTA 2GNHA 2WQMA 4AQCA 1YUBA 2HZ4A 5LCJA 3D5WA 2OWBA 3CQUA 4F7LA 4AT3A 4PYLA 3VUHA 3KMWA 2CN5A 3OCTA 3KR0A 3CJGA 1PXPA 2VZ9A 3VBWA 4ASZA 2X0GA 1P2AA 5K4IA 5KMOA 3FTDA 3CCNA 2XJ2A 3AXWA 1WS6A 4YZMA 2G72A 3Q4ZA 2WZJA 1LEWA 1PMEA 3UPXA 5KQRA 4E7WA 2BFXA 3Q5ZA 2P33A 2J90A 2AYPA 3MDYA 3LVPA 4YHJA 4G17A 2V55A 4ZS0A 1U54A 5I9ZA 3R2BA 1X1AA 1Y8CA 5FCDA 1U54B 2ZV7A 5JFXA 4JX3A 5H8EA 5DPMA 3PSDA 4B9DA 5JMSA 4IW0A 4CMTA 2OXDA 3MH3A 3U6IA 3WZEA 1W0XC 2X4FA 4EMSA 4IB5A 3LCVB 2R3OA 4RFMA 3UO4A 3FMKA 2WIHA 5BVKA 2GFSA 1YRPA 2GFCA 1H01A 1ZOHA 5JN2A 1ZRZA 4KSQA 4TPTA 2W1HA 4ACGA 1VQ1A 3E7VA 3QOWA 3RPVA 5ERGB 2IH2A 2WMAA 2XYVA 1FP1D 2IH5A 3ACJA 3UYSA 3O2MA 1NW7A 5KMMA 4NSTA 4LL5A 4U81A 4AT4A 2ZZKA 2JIUA 2OFVA 3G2PA 4F84A 2Q0BA 4YLLA 2P41A 4MWZA 1VR2A 2OLCA 3DXQA 3OFMA 3BWFA 1KE6A 3B8QA 1QAQA 4PL5A 2OIQA 4FEQA 4FG8A 3TKAA 2XKDA 1XCJA 5DM0A 4BCGA 4C36A 4QMVA 2OG8A 3PJ2A 4U9AA 4KSPA 4EC9A 4LUEA 1L9KA 4I5PA 3B3JA 1NW5A 3M6VA 3H9RA 5CXZA 4M97A 4H1MA 3NYXA 3PLSA 4BDFA 4ZS4A 3NW7A 3BIZA 4LMNA 2PY3A 4OBXA 3P2EA 3EEOA 4E2XA 2XKFA 3ZHPC 1DM2A 2Q83A 3EMGA 3HYHA 2W1FA 3HECA 5BP7A 2C5OA 4AOJA 3FV8A 3ZU7A 1VLMA 1O6YA 1PF8A 4NJDA 3GRRA 3ODZX 2VNYA 3QBNA 4F64A 4PY1A 2ZZNA 3HTXA 3BU3A 4ER5A 3A4PA 3R7IA 3UIXA 3CD8A 2W5AA 2HCKA 5E1BA 3A7DA 3BQCA 5JEBA 2XH5A 3OXTA 4L9IA 3H10A 4BTKA 4F9AA 4FSDA 4E31A 2V0DA 4ZOGA 4W8EA 5DR9A 5EG5A 3KCFA 2RGPA 4OTHA 4QQNA 2AOUB 4ITIA 5CVJA 2AOUA 3TOSA 3QQFA 3H0ZA 4EHZA 3FI8A 2XIYA 2O06A 3LE6A 3V8TA 1G38A 2W1CA 2ZWAA 5BYLA 1R0EA 3T7SA 2OK1A 2O3PA 2OJIA 2C3JA 1U46A 2C3LA 2PPQA 3KK8A 3Q4TA 1Q99A 3R63A 3CIKA 1ATPE 4P4CA 4FSUA 2GQSA 4RA5A 2Z6UA 3GC7A 1TQIA 3RJCA 3EGEA 3R28A 3LCCA 2BAJA 4MH7A 5GNKA 5EDQA 3DMHA 4QO9A 3WIGA 3I6UA 4FODA 1PMUA 3V5LA 1SNXA 2WA2A 2C30A 4AGWA 1WVWA 2PE1A 4F09A 2VRXA 1V0OA 4QTUB 2WOTA 4XP2A 2X7OA 3HV7A 4A4LA 4NM7A 1ZLTA 2GA9A 1JQEA 5EVJA 5EPEA 3DBDA 3FMMA 4GU9A 3KMUA 2EJUA 3LCUA 4BBEA 1REKA 2GS7A 3A7HA 4PDOA 3QRUA 3FE3A 3Q6WA 4PMSA 3FHRA 2IZUA 5D41A 3VBXA 3WI6A 5LMKC 1L3IA 3RIEA 3SR4A 4ER7A 5TR6A 5B2LA 2Y6OA 1Q8UA 3ACKA 3S2PA 3K5UA 5CAUA 3CR0A 1URWA 4DN5A 2E5WA 3K2LA 3ORLA 4LWPA 3EVEA 4WOVA 4FTAA 4IAKA 5C9ZA 1M14A 2JH8A 4GCJA 2R3IA 2BALA 4GT3A 1REJA 3VAPA 3FPEA 5T67A 4LOQA 4NFMA 4NM3A 1YFLA 4GJ2A 4EUTA 3BBTB 3MS9A 5IA0A 3WF7A 5BVEA 2OU7A 5ANGA 2C1BA 5K0NA 2OI4X 3OROA 4FKQA 3KF4A 4I4EA 3GT8A 3PPZA 1RI5A 4GKHA 4RJ4A 4DC2A 3PJ1A 1XH5A 3D0EA 3FMNA 3QAME 4I4FA 4KKEA 3TNPC 2XK9A 3LBYA 4DFUA 2VDWA 4R8SA 2WTIA 1FMKA 5B2MA 4BDGA 4FSYA 4O7LA 5CNNA 2GTMA 3SQQA 3UC4A 5IQHA 2W4KA 3QTSA 4MD8E 5I9UA 5TO8A 3KQMA 3LFAA 1HCLA 1B6CB 5AA9A 3IW6A 3MPMA 3PG3A 5DYJA 5FM2A 3DLIA 3DZOA 2NNWB 4DEDA 1ZYJA 3AGMA 4JQEA 1WG8A 4ISCA 4I41A 3FYKX 3KRLA 4JAJA 2Z7SA 2Z02A 4F08A 1NW3A 2ZTHA 4E6AA 3O4FA 3ZXZA 3H0YA 2XNOA 4WT6A 2J5EA 3MIYA 2R64A 4AWIA 3C51A 2W05A 3AMBA 4FT4A 3G2FA 3QTWA 4R5SA 4EK9A 4FV8A 1L3RE 3Q9WA 1SVGA 1EAMA 5HILA 4E6CA 2GPYA 3OEFX 3C13A 4W4VA 3OFJA 5LXMA 1IY9A 3HA6A 2ZM1A 3L8DA 2YDJA 3GRYA 1KPIA 4QTTB 3DJ7A 3RWQA 5FM3A 4HTFB 3ETAA 3QYZA 4F99A 4ZZMA 3DLCA 3KR2A 1DCTA 3OY1A 2V7OA 3HMMA 3R7EA 3IDBA 4KABA 1VL5A 3ZEPA 4RT7A 4Y95A 5GJGA 4EH5A 2P3LA 5LQFA 2UW8A 4LUDA 4U0IA 5IA5A 4K8AA 5C4KA 3GU4A 4ZTHA 2WGJA 5CALA 3BWYA 1TKIA 4DT9A 2GHLA 3B89A 1OIYA 4USDA 3MA6A 4YO4A 1M7NA 2J50A 4USFA 2QURA 2DYLA 5A3XA 5ITAA 3SVVA 3TG1A 3BELA 5E9WA 3P08A 4GSBA 3M4XA 3REOA 1BL6A 3DBFA 4S34A 3W8LA 4CLIA 4DH1A 3EQCA 3UJ8A 4U7PB 5D10A 2HW7A 2QHNA 1PKGA 1PXIA 2JBOA 3OOMA 3R73A 5AV3A 3TNIA 3LPMA 3SM3A 4IFGA 3WF6A 2WMUA 3LAUA 2YJSA 5DT0A 1H08A 4QTAA 5FHRA 5DT4A 3C4ZA 4MCVA 2ESMA 4QMSA 4QTEA 2FK7A 4CFFA 3FYDA 1M0EA 2V62A 4P5QA 4PGHA 2BRNA 1Z9XA 3DZQA 4GUEA 4TKSA 3HVJA 5K4JA 4FKSA 2UW5A 3NMUF 3C5IA 2JD5A 2PULA 5DM2A 4FVQA 4QMTA 4ZSGA 3R8ZA 4EKLA 1R18A 4KKGA 5CCBA 2C5XA 5FXSA 4MHTA 3NAYA 3QV2A 4U97A 2VO6A 3BU5A 5K8VA 4USEA 1M6EX 3GCUA 4QMZA 5F2NA 2ZVJA 3EMDA 2XYNA 2F49A 3COKA 3LFFA 2JH9A 1X8BA 5E8YA 4BI1A 1IM8A 1Z3CA 5AUXA 2PJDA 3ZEWA 2BAKA 4FBXA 4V05A 4EH7A 5HTBA 4FTCA 3MFRA 3R1SA 4Q9ZA 3UZPA 3HMPA 5CVVA 1JSTA 4FKVA 4DTKA 4EKKA 1L8TA 3QALE 2QD9A 3IGGA 4TTHB 3E8CA 3TJDA 3GRVA 4HYUA 3EVFA 2NXEA 4E2ZA 4MTLA 1H26A 1TW2A 2WNTA 5HVJA 2G71A 2B25A 3GCZA 3TV4A 2W7XA 1CMKE 5M44A 3JR1A 3BLHA 4OTFA 3THRA 2YXLA 3DTWA 4OGRA 4I0TA 3OEZA 3R00A 1OL1A 3FAAA 4K33A 5DE2A 4I0RA 4AA4A 2BR5A 3EVDA 3AC5A 3OU6A 4IHPA 5FLFA 3KR1A 2ZFUA 5H9BA 5GHVA 3ZBFA 4Y46A 3RW9A 3HVHA 3HL7A 4UWYA 2DPMA 2R3SA 2PZRA 3EJ1A 3NPCA 3A7IA 4IAFA 4OT6A 5C8MA 4IWNA 1FJXA 2XM8A 3CY3A 3A7JA 3QRIA 5HG7A 4R7HA 3W2SA 3GC9A 5E8ZA 2J0LA 3ZDUA 4E20A 1UKHA 3TL8A 3TIYA 3HMOA 3G15A 5KKRB 3MAGA 4GOMD 1Q97A 4IQ6A 5LVLA 3ZLSA 3C0KA 3OXZA 3C6MA 1BC5A 5HLWA 5CAQA 3NCZA 5EDRA 3GCSA 2BR4A 2OFUA 1Q5KA 4X2KA 2FB8A 1WZYA 4X3FA 3O7WA 3LFNA 3GFWA 3NS9A 4U3ZA 4UZDA 4ASDA 5ICGA 3UQFA 3DAEA 3FUPA 3DXYA 4RTPA 5J1WA 2FH9A 3O8TA 2P40A 4FR0A 5ANOA 4DFNA 4UZHA 3UE4A 3ZYAA 3DH0A 4A9UA 3FUTA 3G5LA 3RAHA 3VUGA 3KPVA 3QTZA 4O0SA 4FTKA 4UWCA 5J9YA 5D12A 2R2PA 4FSMA 5FGKA 2CGWA 3HGKA 3TNWA 4AA0A 3LFDA 4R77A 4F9YA 3UA4A 2QYOA 3Q52A 3ZUVA 2XIZA 3FC1X 4QPNA 4DM3A 3CKWA 3LKMA 2ITXA 1Q62A 3NNXA 3TV7A 3T0IA 2JG3A 5FTQA 4KDRA 4CGAA 4DMGA 2C6MA 2CKOA 2IVTA 3PA5A 4I0SA 2VN9A 3DOGA 3KULB 4V0RA 5K0CA 4IAZA 5LWNA 5KBQA 4M67A 5HHWA 2PVFA 1DAYA 4G6NA 2OKCA 3Q2JA 4ASEA 5FG8A 4U5JA 2FPOA 3KQSA 3D15A 5B0XA 4HH4A 4C7TA 5EYCA 5M4IA 4BY9E 2XK8A 4PONA 3DKOA 1TQMA 4FZFB 4RIOA 4C2WA 3KB7A 4RIXB 4AF3A 1YB2A 1P4OA 4FKRA 2YIWA 4S32A 4WIHA 3AG9A 2C0TA 5FTGA 4ALWA 4E6DA 5M08A 2ITVA 4IX4A 3TM0A 5AUZA 2JBPA 3ANQA 3WF9A 1DAWA 1XBBA 5JUWA 3NUYA 3RVGA 3ZRLA 4X41A 4ANBA 1KPHA 4NH1A 4KIGA 3HEGA 3EPPA 5I0BA 4MNEB 1WY7A 4FG9A 4ZIMA 4C04A 2JFMA 3G2MA 4FIJA 4JBQA 2CKDA 5DX1A 1H24A 3LCKA 5BNJA 3FPGA 2R3QA 2VGPA 2XF0A 2YJRA 3Q6UA 4LV8A 5BVNA 3SD0A 5EHYA 4ZY6A 5IUGA 3GRZA 3A4OX 4XOZA 4DA5A 5CF5A 3U4UA 2OW3A 1OL7A 5AWMA 1JSUA 2J0JA 3TTJA 3BHVA 5ETCA 2PSQA 2R3HA 4ZJVA 5C8KA 2RFNA 3QKKA 2YM7A 4HZRA 2V74B 1YHWA 4X3FC 5DM1A 4M0YA 3L8VA 3QRKA 4MF1A 4S33A 2YCSA 3IW7A 4GJ3A 2YZAA 3SG9A 5DH3A 1RJFA 4MKCA 1IA8A 2IVSA 2WTKB 4GOND 4MNFA 3OU2A 2ORED 5HIDA 3P5KA 4BTFA 3R7OA 3FRIA 2XK3A 1WBPA 4YTHA 1UWHA 3ORIA 1H25A 5C1QB 4GT5A 4C38A 4BLUA 4M7RA 3EVAA 3IW5A 2VTPA 3I6WA 4FKOA 4XEYA 4EI4A 4D4RA 3HCBA 4FEUA 1XH9A 5KMKA 3F82A 4R6XA 4IM3A 4MBIA 4RIYB 1RI3A 4F85A 4E33A 4DCAA 5HZMA 2VZ6A 3HP5A 4YR8A 3SMQA 4IDTA 4ZSEA 2ZMCA 2CMHA 2PSSA 3R8UA 3HRFA 4HW7A 3KQOA 3PJ8A 2UZEA 3EKNA 2XUUA 5EYDA 4PCLA 3W2PA 4K9YA 4QMOA 2PZYA 4NWMA 3AXTA 4NL0A 5H8BA 4RV9A 4YUWA 3VBQA 4MWHA 1TQPA 2R0UA 2XZSA 4FSRA 4F70A 2KW5A 5FDXA 3E3PA 5BVDA 2BRBA 2OYRA 4FKJA 5HE2A 1RI1A 3PX2A 4ANLA 3P23A 5ANDA 2WU7A 3P9IA 3QD4A 4IAIA 1E9HA 4N6YA 4FL1A 4BYJA 3FPMA 3II5A 3AT4A 1P14A 2B9HA 4YC6A 4YZBA 3NNWA 3UPZA 5BPYA 5AM7A 3F7ZA 3B2WA 4FTRA 4EQMA 3NWBA 4CV8A 4J8NA 5JR3A 2AVDA 4H05A 2CNUA 5E9EA 1K3AA 3GRUA 4PINA 4HGSA 5B1SA 2XNEA 1NVSA 3OWKA 5J9LA 4WNMA 1W98A 3FPQA 3MPAA 2ZBQA 3SRVB 3SRVA 4APPA 3TQSA 3OC1A 1OPKA 3FL5A 3CS9A 4C08A 4HGTA 5FP6A 2QR8A 3CJQA 3G6GA 1ORIA 3HCAA 3FUVA 5LQUA 4PL3A 1R78A 1YDTE 1BX6A 2IVVA 4JXJA 1YKRA 3FZ1A 4BICA 4QP1A 4RVHA 2JFLA 1PMVA 1XDSA 4BI0A 4XMOA 2WELA 4PMPA 2OF2A 3VS2A 1J1BA 4L00A 5F9EA 3BHHA 1AQ1A 1DUSA 3A25A 2ESRA 3OG7A 1JWHA 3MJ1A 4IZYA 4B7TA 1BI8A 2XVDA 3C50A 3OCGA 4OTQA 4LECA 3EKKA 3ZONA 3CQWA 4O86A 4XG3A 3WZDA 2JITA 3LLTA 4P90A 4UWBA 2PZIA 5HZNA 3G0EA 5IQEA 4JL9A 2PX5A 4AE9A 2ITPA 3LKZA 4O84A 4J52A 3P97A 3MVLA 4YC3A 5ACKA 5AUYA 4IFCA 4U7TB 3QHRA 4HPTE 5BXYA 3EQPA 4K2RA 3R9OA 4GVJA 3TTIA 4U43A 3SA0A 3DKGA 3AJDA 2VDUE 3R0QA 1MHTA 2YITA 4G6OA 4GT4A 5BW4A 3A7FA 3R8PA 4HVDA 4LG4A 2ZBRA 1BMKA 2WHBA 3FSFA 3C3PA 3KHKA 4AS0A 4C02A 1AD5A 2JDVA 4Q5EA 3KF7A 5HX6A 2IN6A 2ETKA 5D1JA 2GQRA 2VWBA 2P0CA 2Y9QA 3DKCA 5C01A 3SXRA 1YXVA 5KNJA 4CKBA 4GFMA 1QPJA 4OTGA 1NKVA 2OBFA 3C9WA 5IH6A 4EC8A 3QD0A 4LRKA 1STCE 4QNYA 5DWRA 4J95A 1NY3A 5CNOA 3HCCA 1BL7A 2ONLA 3F6XA 2YDIA 4KIOA 5CQUA 3WZKA 5KYGA 3EHAA 2BH2A 5CLPA 2QONA 5FBOA 2C3KA 1VYWA 2VTLA 3QL8A 4Y8DA 4KDCA 1RJBA 2QY6A 5CY3A 4WUNA 2HXQA 2IDKA 3MA3A 4YNOA 2UZWE 4AW0A 3EH9A 5JQ5A 1XJ5A 4JLCA 4LQMA 4EYJA 5HORA 4IC7A 1SMHA 2C6DA 5HE1A 4BP3A 4KRCA 3K3JA 5CZHA 2E9NA 2FSTX 4JQ8A 2J51A 3TV6A 5C8NA 3TKYA 2BHHA 1ZGAA 4YUYA 1IAHA 4OBOA 3LX6A 5IU2A 4QMLA 3Q4UA 3SHEA 4YJRA 3LXLA 3E87A 3ERCA 2GS2A 4ZMFA 1MP8A 2ITUA 4KIFA 2YVLA 3UOJA 4CTKA 2O63A 2O8YA 4O6LA 4BDIA 5JGDA 3F61A 2PMNX 2H00A 3KQPA 1SVEA 5CEMA 4GC5A 3JYAA 3Q5IA 4RWIA 2PXAA 2ZULA 3OZ6A 5BX0A 4C59A 1SNUA 3CKKA 4JR7A 5IH3A 4BI2A 3QX4A 3BYMA 3UJDA 4YV2A 4OTWA 4NCTC 5ETIA 5H3QA 4F86A 3AC8A 3NDJA 4MXCA 2R7BA 1CKJA 1QYRA 3VUIA 2OZOA 5TOZA 3UJ6A 4RQVA 4BYIA 2IW9A 4C35A 4CMOA 3RPSA 2JHPA 3TPZA 2UYCA 4PDSA 4U41A 1JPAA 2WMVA 2R3JA 3H4JA 3NUSA 4AN9A 4EOIA 3RPYA 5J5SA 3DXZA 2WMSA 3P8ZA 1JAMA 2UZUE 3GU5A 4PV0A 5FEDA 3WOWA 4CTJA 3FPHA 4PP7A 3ZC5A 3QA8A 3M6XA 3BQRA 4FR4A 3NZ0A 1OR8A 4GQBA 2I0VA 4QYYA 2W99B 3RNIA 2I62A 3Q96A 4GIIA 4D9TA 2W96B 3QX2A 3MY1A 4O0WA 3PXFA 2RFEA 4HGEA 1YWRA 5K9IA 5IEVA 2NXCA 3BGPA 2YM6A 4C0TA 4FSXA 5C26A 4FL2A 4KS8A 4RG0A 4S30A 2I0EA 4YJNA 4CTBA 4O0XA 4BCOA 4FKIA 4EONA 3DQXA 3BWMA 3GXOA 5EI8A 1FOTA 5L6PA 1JNKA 5IMEA 3FMHA 4RRVA 5DRTA 4FE2A 4ZK5A 3CEKA 4MYGA 2B3TA 3ZLWA 3ALNA 1OBGA 5FWDA 4D2SA 4X0MA 2X4ZA 3SV0A 5A6NA 4Z9LA 3EQIA 4BCHA 2XNPA 3MESA 5FUTA 4C4GA 2PVJA 2R3GA 3BV2A 4TL0A 4GYGA 3R7VA 3IHTA 3RMFA 3BYVA 4GBED 5CU6A 3NNVA 3ELJA 2I6GA 1PXKA 2PVCA 2REIA 4RVKA 3FTFA 4EH8A 5HG5A 1LPUA 3FMEA 4E4NA 3NW9A 3EN7A 1KIAA 2UVZA 4HVSA 1JKTA 1W82A 3IQ7A 3EQGA 3NX8A 5HE3A 3TIZA 1J91A 3FQSA 2XRUA 3VNTA 3ELWA 3PIYA 3LM0A 1VPTA 3OCBA 2WO6A 3EFWA 4KKHA 5E8WA 3R83A 4YO6A 3UG2A 4ZLOA 1UU7A 4ZSLA 5F2OA 5IDNA 5CU3A 4ALUA 5T68A 3WZJA 3I7BA 4BBFA 3FC2A 4GKIA 3DUWA 1Q0TA 3IO7A 4OW8A 2A14A 5E1OA 3NUUA 2EU9A 3AGLA 5E1MA 2DS1A 3V51A 5DSTA 3T7TA 3ENMA 2GTNA 3ANXA 2FSOX 1L1EA 2UW3A 3I5ZA 4GVAA 5DFPA 3W2CA 4PYNA 5EHIA 5FEEA 5M55A 3MGGA 4BZDA 3VN9A 4CKIA 3F3UA 1J3HA 3A62A 5K05A 3CTQA 5I9WA 5DOSA 1L3CA 2XVMA 4LFIA 2ZAZA 4MEDA 4QMYA 3ZOSA 4FSQA 5L2SA 2V22A 3VW8A 3ELUA 4KB8A 4NCTA 5KKRC 4KVZA 3ELDA 2OBJA 3ZM9A 4AN2A 4AUAA 1KR5A 3OW3A 5H8GA 4R1VA 2PLWA 4P7JA 4L44A 5CVDA 5KS2A 1G8SA 4YJSA 5HD7A 1ZZ2A 3ZO1A 4Z3VA 1INLA 2W1EA 2YM3A 2CKQA 4KBCA 3LECA 5HIKA 4GRBA 3IV6A 3EL7A 5CZIA 3ZSHA 3CLYA 1UU9A 2JGZA 1EJ6A 3KQWA 2YABA 3QGWA 3VC1A 4Y85A 4EHVA 4D5HA 1QPCA 4F65A 4D28A 3Q3BA 4M84A 2IW8A 3PPJA 2BDJA 3ZFMA 4BIBA 1WXXA 4TYHA 2VGOA 3R9NA 3F88A 3LXPA 5CENA 2CGVA 2FGIA 4DFXE 3IDPA 1RJDA 3QUEA 3UP2A 3R22A 3LQ8A 4XRJA 3ZTXA 5DA3A 2DQ7X 4YHFA 4LRJA 1W7HA 4OR5A 3TWJA 4G34A 4ZTBA 3BGIA 1CKPA 5IG1A 4FK3A 2FRXA 5I9YA 4RVMA 4JIAA 4B99A 5AV2A 4DEEA 1XKKA 4QTCA 2BFYA 3WZUA 4HNIA 3UVPA 3KQQA 2RIOA 4R7IA 3TKIA 3LSTA 1PW2A 4H36A 4MK0A 4UALA 3SSMA 2C7PA 5CI7A 2WAJA 2ZIFA 1WBVA 4H58A 4WO5A 1WAKA 4XP0A 5AAFA 1HOWA 2Q41A 5AADA 4EWHA 5ETFA 3EVCA 4RC3A 3EFJA 4NYEA 4FUYA 4D55A 1H07A 4C06A 3WF5A 4CCUA 5HX8A 4EKIA 3U9CA 1QPEA 4JDIA 2NP8A 5IDPA 4XCXA 3PY3A 2BM8A 3VS3A 4XUCA 3D7TA 4RTNA 4O91A 2R7IA 5HIEA 1R6AA 3UA3A 2HENA 2O57A 1YOJA 4F7NA 1X1BA 4D58A 2FO0A 4KW7A 4V0QA 3BT7A 3O7LB 3H9OA 4RJ8A 3FKNA 3PXKA 4CFNA 2G01A 3RHXA 4FUXA 4TWCA 4BDKA 4M3QA 3NSZA 3PIXA 4ZZOA 3NYOA 4KIQA 4F0IA 5A54A 4LG1A 1NVRA 5GM1A 3NR9A 4KBKA 3VQHA 3T9TA 4RTMA 4MXZA 5EZSA 1XTPA 3PX3A 4FT9A 4PMMA 4A9RA 3VRZA 1NW8A 4GU6A 2JC6A 3F3VA 3D5UA 2R6ZA 3M2WA 2KTYA 4WD5A 3UOKA 3A99A 3HP7A 4FSZA 2IBSA 4IE9A 4L45A 3OWLA 4L6QA 4NTTA 4LOPA 4OTDA 4JBOA 3S4QA 1PXOA 1NBIA 1FVRA 3DXNA 3O0GA 4Y30A 4B17A 2X2MA 2NP6A 1UWVA 1GIIA 5EHGA 3KRRA 4V0GA 2VTHA 4PIMA 4A07A 3VUMA 1QANA 2VWWA 3FKOA 2XIKA 3FL4A 2QOBA 5JQ8A 5J95A 5FTWA 5LVNA 2VWXA 1OZ1A 1YI3A 2QG5A 1N7JA 1I9GA 5HBEA 4MAOA 2UZLA 4P7GA 4Z7HA 2XMYA 2PE0A 2R0IA 3AT2A 4JQ7A 4NFNA 4DEHA 4RJ7A 5IA3A 3QLFA 3I64A 5KQSA 4F6WA 2VX3A 3NYNA 3FLSA 2CN8A 3D7ZA 2JDRA 1VZOA 2WMXA 4MTAA 4IV8A 4II5A 3U81A 4D1ZA 2VTRA 3C4FA 3PTGA 3F3WA 3KULA 4C4HA 4DITA 4G3FA 1EIZA 3VO3A 3NW6A 2VWVA 2YM4A 3HAMA 4DFBA 4DH5A 3QFVA 1SZMA 1YOLA 2GS6A 4WG5A 2UV2A 4G3CA 5AP7A 2BHEA 2H8HA 4PL4A 4DEIA 5GJDA 5BVOA 3ORZA 4PMTA 5IQFA 2HR1A 3ULZA 4M36A 2R3KA 4O7NA 3W16A 3VS7A 3UTOA 5EMLA 3L1SA 2PVNA 3R21A 3BHYA 3VS6A 4I20A 4FTQA 4QDJA 5HI2A 2PUNA 4BDBA 3E05A 5M09A 1H28A 4RC2A 2PKWA 3DB6A 5AAGA 3SXJA 3QTRA 4M38A 2A27A 4GS6A 3HUCA 4LWOA 2QOHA 4E4XA 3P4KA 3QCQA 4MBJA 2UZDA 4Q5HA 4XX9A 4H39A 1Z57A 5LJJA 3HCFA 4XV9A 3LDUA 4X21A 4FS8A 4P7FA 1XR1A 3AOXA 5CIYA 3JWJA 5EYKA 5DG5A 4WG3A 5HIMA 1J7LA 1AQIA 5K0JA 4RWJA 3LKDA 2ITNA 4R5YA 4BCNA 3FRHA 3UQGA 4JI9A 4PYMA 1D2GA 1MRVA 1XO2B 4QMNA 3D2KA 3M42A 3PXYA 5CVUA 2OJJA 4RIWA 1LUFA 3DY7A 3Q53A 4O7VA 3KK9A 5CWZA 4TNDA 5CU4A 2GNGA 2QG7A 1HNNA 4CV9A 5LMBA 1PKDA 4O2ZA 1KSWA 3OUKA 4UY9A 4RSRA 2OO8X 3EB0A 1KOAA 3EN9A 4G16A 5AP6A 4PNKA 3RODA 4BLWA 2QHMA 4OUCA 5E92A 5EM5A 2PMIA 5K3YA 3I7CA 4L67A 4ALVA 4EOJA 2UW9A 3I81A 3MFSA 4WUAA 3JWIA 3T8OA 2C7RA 4AGUA 3DMFA 3DT1A 3R6XA 4RWZA 3TXOA 3FY2A 3KQTA 3EMBA 3LW0A 3GVUA 2QU6A 3DXPA 3UODA 2J0IA 3KPYA 3O96A 5EI6A 2C6KA 5FBNC 3FXXA 1WMKA 4HZSA 5JFSA 3U6JA 1IASA 1OL2A 1GJOA 3ZRMA 5BYYA 2OPBA 2XK4A 4FVRA 3HMNA 2BRMA 5EW9A 5AX3A 3W8QA 2ITQA 1ZQ9A 4FZ6A 3ULIA 5IEYA 2QR7A 2XKEA 5EDPA 1H1DA 3UVQA 2C5YA 4Q9SA 4WNKA 3F5XA 3QOXA 2I0YA 2R3MA 3PVBA 4F63A 3C0IA 4K77A 2ZMDA 4WHZA 4FV6A 4QQJA 3SXSA 3M33A 2C0IA 3ME5A 3OZTA 4X61A 5EKXA 4RX9A 3F2NA 3BYOA 4I5CA 4QYEA 1S9IA 4O38A 4TYEA 3ZZWA 3KU1A 4XUDA 1ZZLA 1JSXA 3CJTA 5AV4A 4QVGA 2BZIB 4H1JA 5LQAA 3Q32A 4H3QA 3FLYA 1R3CA 1M2RA 2BMCA 5DPVA 1OBDA 4G56A 5K0EA 1V0BA 5CANA 2RG5A 3Q9ZA 3FWQA 4L68A 2X8IA 3I5NA 5GOZA 2VWYA 2PZPA 5K0LA 2VTAA 5CF6A 2FUMA 4C03A 5DTRA 2F57A 1WBNA 3MWUA 4C61A 4GF5A 1NT2A 1G5SA 1SQGA 2GMXA 4IX3A 1N2XA 4FV0A 4FTTA 3QYWA 4RTQA 3ORMA 1ZMVA 1V1KA 2OH4A 3AD5A 5J8IA 3RGFA 3RZBA 1Q41A 4A9YA 1O9UA 4F6SA 4YUQA 1J1CA 2X9EA 3C1XA 4FKTA 4O7SA 5DN3A 1UIRA 1Y91A 4E5BA 4QMXA 4E6QA 3UZUA 4YMJA 3PRFA 5D9HA 3QD2B 5HFJA 2WEIA 3O50A 4EZ3A 3E8SA 3G5TA 3BV3A 3CGFA 4FX3A 4L7VA 2OGVA 4ASXA 5A4QA 4RGJA 3HRCA 4BCQA 1IXKA 3UJAA 4E70A 4BDJA 3R1NA 4WKQA 4JG8A 3E8EA 4KBAA 3PWDA 2B9IA 2O65A 2I9KA 3S95A 2JKMA 3TEIA 1H0VA 2O05A 4C37A 1IAJA 1JQ3A 4R6WA 4OBPA 3ER8A 4HJOA 2VP3A 5IISA 4PTCA 4JNWA 4DTBA 3MY5A 5LARA 3MH1A 2IG7A 3DCVA 4RTRA 1R39A 2R3FA 3O7LD 4W4YA 4CFMA 4AN3A 2IZRA 2V7AA 1M2PA 3LCDA 3DR5A 2C5VA 2F7ZE 2YWPA 5E8RA 4BCMA 5D11A 4O6EA 5E8SA 3VS1A 4YUVA 2IDJA 5ANKA 2PK9A 3L8PA 4E73A 2PVYA 2CKEA 5IQGA 1ZOEA 2PWPA 3HM2A 2VV9A 4Z55A 1PXMA 3OE4A 3UVRA 3LJ0A 3OWPA 4DKJA 2F7XE 3CGOA 3BX5A 3MB7A 3OWJA 4GMYA 4U45A 1NW6A 2YHVA 3T3VA 3DDQA 3VYWA 4N6ZA 3TUCA 3PG1A 2VTJA 2CJMA 5CVFA 3MIAA 3TZ9A 4ANQA 4MXXA 3BBWA 2HYYA 3FZSA 4TY1A 5EQEA 3EQDA 4AACA 4ZZNA 3LBFA 5U4XA 1JG4A 4I94A 3GDHA 1PYEA 3A27A 2Z6QA 4AX8A 4FKUA 5IKMA 4O7RA 5HU3A 3HCEA 4BDEA 2HWOA 4DGGA 2XJ0A 3TKHA 2O5KA 2QI8A 2R3NA 3AMYA 3ATSA 2HXLA 3FLQA 3NLBA 2WTVA 3ZLXA 2UW4A 3EN4A 3IONA 3OY3A 4HGYA 5IZFA 3VS0A 2H9VA 3PA3A 2VS1A 3A7GA 4I92A 3K6RA 3LXNA 3EYHA 2P2IA 4JVGA 4HG2A 2AZTA 3FUXA 2UW7A 4I23A 4U3YA 5AUTA 2NP7A 3VJOA 3TDVA 4MQ1A 1WZNA 1ZMUA 3LMHA 4F7JA 5C03A 2W0JA 4RVFA 4EQCA 4BGQA 1OITA 3DNDA 2YXDA 3R9XB 2YAAA 3PWYA 1YHVA 4B8MA 3EWHA 4OLIA 2VO7A 4ER6A 1R00A 3D5VA 1BYGA 3P86A 4XBRA 5KZIA 2LD4A 3OZSA 2O07A 2XEYA 4IVAA 1XH8A 2AOWA 1XQZA 3PUPA 2EVAA 4XLVA 4C4IA 2BROA 1CTPE 4UYAA 4CFVA 1FBNA 4PWNA 3U4WA 5HBJA 1YI4A 5LQRA 1YHSA 1RJEA 2UZ4A 1OPLA 3CD3A 4FIFA 4KRDA 2HY0A 1W83A 5HO7A 4O7ZA 1X19A 5CI6A 3KY2A 4WNOA 3THBA 1PYXA 3UC3A 1ZMWA 3PY0A 1JVPP 3C0GA 1PJZA 5EI2A 1ZOGA 4YLJA 2BILB 2F2UA 2XK7A 4FKLA 4IDVA 2BTRA 3E62A 4FTOA 4LV5A 4V0GB 3HVCA 1OVEA 5CXHA 3SXFA 4C4EA 4XNEA 2A2AA 4FV3A 4NKSA 2HNKA 4RYLA 2P1DA 1WFCA 4L7SA 1J7UA 1KOBA 3MBLA 4CEGA 4KIPA 2QNJA 4PTGA 3T3UA 4F7SA 4PDYA 3JVRA 5AIRA 3UDBA 4QQTA 2CDZA 2IFTA 2PXXA 3EYGA 5CEQA 4QMPA 4PF4A 3PB3A 4EUUA 2BDFA 3WYYA 3E5AA 4IC8A 1UU8A 3LOKA 3NYVA 4IAAA 5LMAA 3L9MA 4EKGA 4QP6A 1R74A 4MD7E 4YPDA 5AFVA 3DJ5A 4ANSA 3UIBA 2XNMA 4EOKA 3VBTA 3WF8A 4E30A 3UBDA 3NCGA 3W1FA 3V6RA 1JQHA 3HKOA 2G15A 2HELA 3OS3A 5HD4A 3MPTA 2JHCA 2RG6A 3FBVA 3GEQA 3KRWA 3KU2A 3DV3A 2Y4IC 4I21A 2V5QA 2VUWA 3BXOA 5F4NA 3IOKA 3OOGA 4C62A 2YR0A 2A4LA 2IO6A 5AP5A 2YISA 4CT1A 1L3BA 3P2KA 2PTKA 1IEPA 5JK3A 4Y72A 4J97A 3S00A 1KXZA 4C3RA 2UYQA 4QQKA 4QQCA 4E2WA 5G02A 4IAYA 3QWJA 2CCHA 4DEAA 3RI1A 3GU8A 4DYMA 4L52A 5I9VA 4R6VA 1XBCA 4AU8A 3OCSA 5L8LA 4M0ZA 4TZRA 1G55A 3ET7A 3PA4A 4U42A 4ITHA 3HP2A 3BGZA 5BUJA 2P7IA 4M37A 5ICCA 3P7BA 1TW3A 5HG9A 2ITZA 4LMUA 3LMGA 3LFBA 3G8AA 3V01A 3RINA 4U8ZA 5AIKA 1Y8GA 3DBQA 5JGAA 2IJMA 2X81A 3AC4A 3M11A 2J2IB 4CSVA 4EOPA 5L2WA 3L9PA 2RL5A 3I5UA 4WRGA 5FHQA 4ZMEA 1NVQA 3L9LA 4FT7A 4X1OA 3QCSA 4JDJA 5FDPA 1JKSA 2CHLA 5EHLA 3E93A 4Y73A 5E91A 5TKDA 3RK9A 3CPCA 3LDGA 3ORHA 2WIPA 4AZSA 3M70A 5FA8A 4RWKA 2PWLA 4R3RA 4QP2A 4CKCA 3UJ7A 2WTJA 2HAKA 4I22A 4RWLA 2BRHA 3LCTA 4YJQA 4CT2A 2UZNA 4BCFA 5E8VA 4QYHA 4MIKA 4DQ0A 2I7QA 4A9SA 2CKPA 3DB8A 3IW4A 3CGGA 3A26A 5EM6A 2EUFB 3X0DA 3D9VA 1WBTA 2XIRA 2W1ZA 4O2PA 5C27A 5EMJA 1SYKA 3IECA 3EQFA 5JT2A 3VW6A 3KA0A 4RBLA 3RKBA 5TF9A 2Y7JA 2YDKA 3UNJA 2I6LA 2ZZMA 2UVXA 2H34A 3HEMA 3TUBA 1VE3A 4FZDB 4YJVA 3VC2A 4FV7A 4UEUA 2JDTA 4L43A 4BGGA 4S2ZA 1YW2A 4A06A 1ZY5A 4EQZA 4IWOA 2XYUA 4FK6A 4D2RA 3V3VA 1ZGJA 3O8PA 2YCQA 2CMWA 4C3FA 1OKYA 3NEWA 2V7EA 4HCVA 3G9LX 2ZCJA 3KC3A 2PHKA 3BKBA 3LHJA 3DLZA 4JDKA 3LFEA 4O82A 3K0BA 4N4SA 3E7OA 4C05A 4PNIA 4EK3A 5KO1A 1H4LA 2EB3A 2J5FA 4IV0A 1JR4A 2QLUA 3EQHA 3GB2A 4W8DA 5HLNA 2B9FA 2QOLA 4CRLA 3M6WA 4FKPA 3S0OA 1QMZA 3OVVA 3QQHA 4V04A 4U6RA 4DG3E 1WXWA 2PUPA 3JXWA 4IACA 3N4TA 4BIEA 3BEAA 3RAIA 2YM5A 1KV1A 3PRIA 4CVAA 5EEHA 3B3GA 3ANRA 2GU8A 2X6DA 3R71A 1XH4A 4FV9A 2IPXA 3E63A 3VC4A 3LFQA 4CG8A 4IANA 4JBPA 4RTJA 2X9FA 4FNZA 5I5ZA 4CXAA 2WMWA 3G2OA 5DVRA 3HUBA 4FG7A 4O96A 2G2FA 4X6RA 1FGKA 4J1RA 5F20A 3W32A 3PVCA 1RI2A 4JG7A 4XG7A 4K0YA 1DI9A 4L3JA 3UQCA 2PY6A 3HA8A 3GJYA 5P8WA 3TR6A 4IWQA 2XA4A 5K5XA 3K54A 3KXMA 2YZLA 2IWIA 2ZJWA 5HICA 5HQ0A 2PVHA 3CY2A 4OQDA 5HEKA 4RVGA 3V5TA 4CZTA 5ICPA 4ZP5A 1M52A 2PVLA 4ATNA 3DBEA 3R30A 5FP5A 5DRYA 1JSVA 1I09A 4BDHA 4POOA 3QC4A 3GCQA 1WBWA 3UO5A 1I1NA 3B7PA 5KUPA 2FYSA 4BGHA 1Q0SA 4RC4A 5D1HA 3ZDIA 4CLJA 2C1AA 2VU3A 2WKMA 1JTFA 3U8WA 1VBFA 4RZWA 4IB3A 5TT7A 3G51A 2C5NA 2PGXA 3PYYA 5IQIA 5FEQA 5FWAA 2OZVA 2VX0A 1QL6A 3N4VA 4BDCA 2AS0A 2IH4A 5MHTA 4G3EA 3D94A 4DAWA 1BKYA 4GK4A 4X6QC 3W2QA 3ROYA 1OPJA 3HDNA 1PXNA 4DZRA 5HGIA 2G2HA 2GNLA 3FI4A 4FGBA 4GK3A 1KE9A 4IZ5A 5F94A 4GUBA 3TACA 2OIDA 5GINE 4YTCA 4IIRA 5D7VA 4EYMA 4DINA 1R8YA 5JFWA 3PPKA 3CXWA 5FTOA 5AM6A 4NKAA 4YZ9A 3PSCA 4A7CA 4IVBA 2DULA 1GIHA 4J7BA 5HKMA 4JX7A 3AC1A 4NM5A 4O0YA 3PZEA 2F7EE 2I0HA 5FRIA 2WXVA 3VHEA 4MD9E 3COIA 1Y6BA 2C6TA 2HZ0A 3P79A 2BIYA 4FMQA 4RFYA 3QLGA 4EK4A 1U5RA 3P9NA 1ZXEA 3MVJA 3FLWA 2J9MA 5FA5A 2W9ZB 5BW5A 4NUSA 4XHKB 1QZZA 5HG8A 1UNHA 3HAVA 2QVSE 2YQZA 1AV6A 2FSLX 2E2BA 4ZLYA 3VVHA 5KMNA 1Q61A 3KVWA 1GZ8A 3MW1A 4DH3A 2ZIGA 3V5WA 5HO8A 4D4VA 4FT5A 1MJFA 2P7HA 3CKXA 3F69A 2IBTA 1G8AA 3A8WA 3QD3A 4XYFA 4DGNA 5DGZA 4XRLA 2JIVA 1QAOA 2YA9A 2QRVB 3KQVA 5DR6A 3I60A 3PJCA 3QF9A 3UNKA 5M07A 4RIWB 5I9XA 3PXZA 5L2IA 2CWWA 3TM5A 5EYMA 2CNQA 2X8DA 3IS5A 4YMGA 2WMRA 3R2YA 3LCOA 4FYNA 5CASA 4CQEA 3D4QA 3RP9A 4AW1A 4EH2A 3KXNA 1PY5A 4DG0E 1VYZA 3F9NA 4I6FA 3MTIA 3PVGA 3R02A 3WYXA 2NRYA 4XG6A 4PYKA 3HLLA 1ZYDA 3RCDA 4EK6A 3IOPA 1NA7A 2X6EA 5CTPA 2XNBA 3HX4A 4I6HA 4MQ2A 5EK7A 1ZYSA 5CU2A 2Z60A 3NW5A 5G1XA 3F5PA 1MQ4A 2WB8A 5HCYA 2HV9A 3DA6A 4ACDA 4GOLD 4GFGA 5E1SA 5HU9A 2GNFA 1YZHA 3N51A 4YJUA 3EEYA 3TMAA 4E32A 3G6HA 1Y8YA 2E9OA 3FYJX 4JG6A 3U6HA 4BP1A 4ONAA 5DWQA 5EMMA 5EOVA 4YTIA 3G8BA 2P2HA 1A48A 3HA7A 2W9FB 4I3ZA 4UXQA 2WQEA 3QA0A 4E8AA 4JRNA 1XBAA 3OCJA 2GAFA 2RF9A 4TXCA 1XWSA 4FKGA 2KULA 4EBVA 4UBAA 2VTSA 1RI4A 1UNLA 4XBUA 4AZFA 3ORTA 3MSSA 5CEIA 1RE8A 5CSPA 3EIDA 4FV4A 3A4TA 3RAKA 3IDCA 4BHZA 2FA2A 2Z6AA 4V01A 4G9RA 4DA4A 4IZ7A 3DU8A 4EWQA 3OD6X 2F8LA 3WE8A 2GPHA 2ZIEA 3PVWA 1R0PA 4KAOA 3V5QA 5ICEA 4NW6A 1Q3WA 5K09A 1JBPE 3R9DA 4DCEA 4QT1A 3ZC6A 4ZJIA 2Z8CA 2BKKA 4FSTA 4IB1A 4K11A 2GHMA 3RM6A 3GO4A 3PSBA 4MWIA 3RHKA 4BRXA 1Q8WA 1YXXA 4RIXA 3OBJA 5E8TA 5IA4A 1UFKA 3EVZA 5DTQA 4HVIA 4ZY4A 2B52A 5G6VA 3R9HA 3PJ3A 3JWGA 4BF2A 4G31A 3RPRA 5IPJA 4PCAA 4HNFA 3V6SA 2HMYB 3NTVA 2F9GA 3MH2A 4F0GA 3R1QA 4BCJA 3SLSA 4W4XA 5DBXA 4PX6A 4OBQA 4BZOA 5CEKA 3FUUA 5AMNA 5JH6A 4PGGA 3KPUA 4HYIA 3CQEA 4ER0A 2Y6MA 4XH6A 4RZVA 3UIMA 5AP1A 4C4JA 2YCFA 2VWZA 3F5UA 3BYSA 4EH3A 3LFCA 1RW8A 3W10A 4HRAA 1RQQA 3R04A 1FPUA 2BCJA 4TN6A 3F2RA 3PIZA 4Y5HA 1U5QA 2I40A 4G1WA 3W33A 4DTAA 4I24A 4EOLA 4ZAUA 3DK6A 5ETAA 2VDVE 4YBJA 2QOFA 4AOIA 5F2KA 4EK8A 3QQGA 5IA1A 4FGRA 2W1DA 5CSXA 3R8MA 2QO7A 4QYGA 3ZSGA 4XS2A 5K5NA 1XDUA 2G2IA 1F0QA 2HZIA 3BWJA 3U51A 5CEOA 1ERKA 5K01A 5LQNA 3DS6A 4ERWA 4FT0A 5H02A 1MRUA 5CVGA 3JY9A 2H1RA 3U9NA 2VTNA 5EM7A 2WQOA 4Q2AA 4MQ4A 1B42A 4E1ZA 4L7FA 1APME 4KD1A 3QZFA 3GCPA 4J71A 2C0OA 3VBVA 5E9QA 5E7RA 4X7QA 4B6LA 1GZKA 3JPVA 3W2OA 7MHTA 3LIJA 3SW7A 2Y1XA 3R7YA 2XVAA 3FZOA 5CVHA 4CWAA 5DX0A 5C1IA 2DWBA 3UIUA 3REPA 5EOLA 2H6DA 4FC0A 4XV2A 1XJDA 3KEXA 4HGZA 4RA4A 2AOVA 1FVVA 5EW3A 3S68A 3POOA 3AC3A 1IR3A 3SSNA 4PQNA 2XP2A 4C4AA 3GENA 4DF3A 3JWHA 3DULA 3O8UA 3C3YA 5CAOA 3BZ3A 2PX2A 2XM9A 1GAGA 3QCYA 4DGMA 5LWMA 2QE6A 4U80A 4CFWA 5LQJA 1J7IA 1R1WA 2QO9A 3EL8A 2Y4PA 3N4UA 3OBGA 3ZCLA 5T6BA 5JZNA 4KWCA 3RK5A 2AR0A 1O9GA 3CSVA 2FYTA 3L8SA 3KPJA 3MVHA 4IADA 3I9FA 3MB5A 3DXXA 4MX9A 1T45A 5BQ0A 2IGTA 4O29A 1Y57A 1WBSA 4QTBA 3SOCA 1TPYA 1OMWA 3MTLA 3NWWA 3FI3A 1U59A 3A61A 5DEYA 3DBCA 5IQBA 2J6MA 4AT5A 4D9UA 1HCKA 3PE2A 4O0VA 2YCRA 4DCMA 3H2BA 3QRTA 3QTQA 4BR3A 5J1VA 3MN3A 3RM7A 3P2IA 3WE4A 1H1WA 4O0TA 2XS0A 3FZTA 4LGGA 5JFVA 4TYJA 4EK5A 3LPBA 5E4HA 4U79A 1XHAA 2OSCA 4FYOA 3B2TA 1GOLA 3DKFA 2XBAA 2LGCA 2X7FA 2YWVA 5HIBA 1FMOE 1JG2A 2YUIA 2J4ZA 3GU3A 3RPOA 1Q8ZA 4MXYA 4AOTA 5IF1A 2P4IA 3VF8A 1PXJA 2YFXA 3NWEA 1DI8A 3ZUTA 5T6KA 5D7AA 4PYQA 2QOIA 3NRMA 3LQ3A 4GFOA 1YWNA 3KREA 1PXLA 3K5VA 3TRKA 2R9SA 4K6ZA 2B78A 5AP0A 4FTIA 4IJ9A 1PHKA 1F3MC 4EBWA 1JKLA 3QXPA 1SUIA 3HNGA 4QMUA 3MY0A 3W18A 2BR3A 3BKWA 4IX6A 2BUJA 2C69A 3LMIA 3E92A 5L8JA 3W2RA 3TUDA 4FTMA 2H96A 5CUQA 2AN4A 5FUBA 4RVDA 4CKEA 4DT8A 3ATTA 2CMGA 5CEPA 3BUSA 1I4WA 3KFAA 4D4YA 2GHGA 5AP2A 3UYTA 2QOCA 2YIYA 3LLAA 2VO0A 3QHWA 3FLZA 4JT3A 2B7AA 4TWOA 2ACXA 5ANJA 4ACHA 4AP7A 2YEXA 3E64A 4XUEA 5E1DA 4EOSA 3FZGA 2B9JA 4G6LA 3VF9A 5DT3A 3COHA 3JUHA 5CAPA 3TM4A 2YACA 1RDQE 3E88A 1BI7A 2JKKA 2ZB1A 2BVAA 1LP4A 2PL0A 3VQUA 3KRJA 5L6OA 5GP1A 2BTSA 1ZAOA 4EZ5A 5JZJA 2JIIA 3FQHA 4J99A 2WTKC 2PYWA 1GNGA 2ETMA 4L01A 4YZNA 2EFJA 2AC5A 3BGVA 3GNLA 4AXAA 4AGCA 5EKNA 2ZYBA 3HCDA 3FTCA 5EC8A 2IIPA 2UW0A 5DXAA 2XCKA 2ZW9A 3GXLA 3OE5A 4PDPA 2ONLC 2OICA 3GBZA 2LAVA 3SDJA 2QU5A 2HTEA 4GUAA 4GIHA 3VWAA 1GIJA 5EW8A 1QAMA 4P58A 2OXXA 3V5JA 2Y8OA 3AD4A 5GWXA 3EZRA 4BZNA 5EMKA 4ZJJA 3VUDA 3ZO3A 1YXUA 3HMIA 3IK3A 2CPKE 3QGYA 4HCUA 1I44A 3GC0A 1OL5A 4HCTA 2P55A 1KYWA 5EGSA 2WFYA 2XB7A 3NUPA 4WVLA 3G0FA 1P1BA 2JDOA 1ND4A 5DX8A 1FINA 1AQJA 2NO3A 3KPWA 4YPSA 3QUPA 1JOWB 3BI6A 3PP0A 2YAKA 3DAKA 4PRJA 4YNEA 5E1EA 3EOCA 5EH0A 4CMUA 4EOQA 4AFJA 3I58A 1GZNA 1UVRA 4RSSA 4D1SA 3OT3A 1KV2A 4FT2A 1SG9A 2X2LA 2R4BA 3UOLA 1OI9A 3VS4A 3ZO4A 3CJRA 4NZWB 5C0OE 5KMLA 3QQLA 4EVIA 4KNBA 4E5AX 4F1TA 3AD6A 3QCXA 4CD0A 3BKXA 2VTIA 3NGAA 3HVIA 4X2JA 3PT9A 2XEZA 3C4CA 4IZAA 1F5QA 2QKRA 2YIXA 2PT9A 3KQYA 2VWIA 4BCKA 3IW8A 3TJCA 1O6KA 4KINA 2B9EA 5EG3A 1PJKA 3DK7A 4OTRA 2PUUA 4QP3A 5CSVA 4RX7A 4GK2A 4AZTA 1XXLA 2W4OA 3LFSA 4QP9A 2EWAA 3ID6C 4L46A 4LOOA 3ALOA 3R3HA 4MXAA 4DHFA 3CE3A 5DT2A 5J7HA 2QOOA 2BZGA 4KWPA 5IQAA 3V04A 3LJ1A 4FV2A 4F1OA 3BPRA 5DSXA 4HPUE 4A6DA 2VWUA 2G9XA 5CF4A 3KXGA 5KMJA 3GIWA 2UUEA 3MFTA 3ZO2A 3WARA 2CLXA 4KUJA 4NW5A 4R05A 2J0KA 5BUIA 3I1AA 3UJGA 3KN6A 4G3GA 3A7EA 2QQ7A 4KA3A 2CLQA 3MV5A 4K18A 4U40A 4FOCA 4GH2A 5FXQA 5HNGA 4PTEA 3UJBA 3ROCA 3SX9A 4DEBA 3D5XA 2WA1A 4M7IA 3ZXTA 4FNWA 2OJ9A 4KS7A 2DUVA 5CU0A 3VIDA 3SKCA 4UX9A 4OBWA 4ERKA 4AW5A 4IEBA 3ERKA 3VBYA 3LQ5A 3LZBA 4IBMA 2O64A 5LCKA 4GOOD 2YIQA 4XV1A 3A60A 4JBVA 2NXJA 3Q60A 3AT3A 3FMDA 1T46A 2R5TA 3H30A 2K4MA 2OB2A 3CPBA 4RJ5A 2B55A 3O23A 4I5HA 2PMOX 3DP7A 4NECA 5K03A 4CXMA 4G2FA 3ODYX 1T43A 4I6QA 2GNJA 1N7IA 3ZZEA 2EXMA 4D1XA 3QTUA 5IMXA 1YF3A 4UXLA 2QOKA 3C4XA 5EM8A 1RJGA 5GIOE 4P2KA 4C4FA 1NV8A 1XH6A 3NAXA 1BLXA 3BE2A 4PIPA 4IMYA 4DH8A 4Z7GA 3O17A 4XOYA 3NDMA 2B53A 4NK9A 5JGBA 3FHIA 5EZQA 1CM8A 2R3LA 3AMAA 1MRYA 1FQ1B 3E8NA 2PX4A 1KWPA 3CBGA 3P71T 3QKLA 2C6EA 5EOBA 2RFDA 3TN8A 4O81A 5ANIA 4FTJA 1Q4LA 4P7KA 4L53A 3ELYA 1BUHA 4AZWA 3SAYA 1AGWA 3ZRKA 5L6WL 3OW4A 3BLQA 3BLRA 4FGZA 4U7ZA 5DIAA 3R1YA 4Z2YA 4I1ZA 2YTZA 4ZTRA 2BZJA 1YVJA 3JVSA 5BMSA 5KMIA 1ZKDA 1IRKA 1CDKA 3AQVA 2ZBPA 3DPKA 3EFKA 3KXZA 4IM2A 4E93A 3PZHA 1UNGA 3QQJA 4M69B 2HWKA 4YZDA 3HDMA 2QOQA 2C4GA 4FTNA 3R9RA 5A6OA 3PE1A 5J9ZA 4GC9A 3PVUA 2ADMA 3UP7A 1SVHA 5EEGA 4D0XA 4YMHA 3P78A 1URCA 5CYIA 3SC1A 1G6Q1 4FIHA 4O7YA 2PX8A 3UBTA 4M8TA 4RQKA 4CKRA 4E4LA 4BCPA 4BB4A 5DRDA 2JEDA 1VP3A 3G5DA 2OF4A 2FSMX 5M4FA 1FPQA 2F4JA 3O31A 2J7TA 4XJ0A 1SQFA 4ENYA 3MGYA 1MUOA 3QXOA 5IEXA 3RWPA 3HV3A 1AF7A 5FADA 4RIYA 4QMQA 3I0OA 4EJNA 2EX4A 3ZH8A 4YP8A 2HWPA 4QMWA 1Y6AA 2IW6A 3QTIA
chains in the Genus database with same CATH superfamily
3OZIA 4OXKA 4IVQA 2GLUA 3D2LA 2W4MA 3ZE8A 2UYHA 2IZSA 3SF8A 2CCIA 2BFWA 1EK0A 3C6KA 5IH4A 1ZVQA 5KNDD 1YKGA 3TSWA 4INOA 3RHZA 1D07A 2O2XA 4OTIA 3EZ9A 3WKDA 4B47A 4DBNA 2G82A 5TMEA 3H4MA 1LSOA 4IX5A 3CPJB 1NXSA 3IMFA 4G5JA 4PTZA 3WSVA 3SVLA 3ZTTA 4YAIA 4P93A 3B20A 2WUDA 3T12A 1KKMA 4DLJA 3I12A 4HX9A 4IM7A 1CQJB 2FW6A 3G9ZA 4ENVA 4M13A 1P80A 1M33A 5CVEA 3L8FA 4L72A 2P6PA 3OWOA 3I9V1 1NSFA 4TT7A 1R37A 1UKBA 1W4CA 4LYNA 1YDHA 1HURA 1X80A 2D13A 1SMKA 1YONA 3B8RA 2PD4A 1O6LA 3R3YA 1RRCA 3HBNA 4TWNA 2XQFA 2C8VA 3UG6A 1T6ZA 1FJ2A 5A46A 1ZK1A 3GNIB 2XRYA 1L8XA 3PK0A 5SZJA 1XGKA 4WA9A 2JDIA 2WTDA 5IDVA 5AA8A 2DGDA 3EA4A 3F2VA 5IA2A 2XB4A 4QPPA 4YASA 3QBVA 2BGMA 3A9WA 4GP6A 2VO1A 3TJMA 3ZCSA 3MTBA 5FQNA 3TZMA 5AKGA 2ODBA 4Q6WA 3KSZO 4HD8A 4B79A 1ONSA 1T1IA 4DIEA 1YMUA 3DWIA 3BL9A 1RZVA 4S1TA 2Z1NA 1X9GA 5LVPA 1T9GR 2H51A 4DCGA 4X2NA 3V5PA 4XG8A 1FUUA 1JR3D 4AG5A 4YRPA 1SUDA 1NTOA 2HN9A 3FMLA 3C4WA 4ZDKA 3O8OA 4AMBA 5BN5B 5AM3A 1RLJA 1R6TA 1QDLB 2GM5A 2QG4A 1GYPA 3KSMA 1W5TA 3BFVA 4KTVE 2XF2A 2HDNB 3H9FA 3K73O 3A8XA 1HTTA 3F8TA 2FW0A 4YECA 1EIWA 4AZVA 1IG0A 3KTOA 1PJCA 2A0KA 3ZY2A 4KK4A 4EGSA 2C3PA 3H1PA 4B8LA 2C94A 3ZY5A 4O2BF 5LOHA 1H2BA 5DNVA 3KDAA 2OZKA 1ZI6A 2WINI 1E0KA 3D7TB 1A04A 3L0YA 5K3AA 2D2EA 2HGZA 4UOEA 4PVCA 3Q7QA 4ETNA 2ODEA 3K2IA 4TXNA 4KQEA 2A9KA 4ORKA 4QAQA 4B0GA 3K0AB 2OKRA 3FY0A 4DLIA 3PFFA 3STYA 3PHJA 4Q47A 4R1LA 4BV8A 3V1MA 1GL9B 2NT4A 1MDFA 3F5QA 4X20B 3KB8A 4BN5A 3WILA 4PS1A 3WXBA 3LDAA 4BLVA 5LWQA 1PZFA 3POZA 4EOOA 1X1TA 2WSMA 2GHTA 1Z82A 1C9YA 1HE4A 4N47A 1SXHA 4UCWA 1NKTA 4ACMA 1JEEA 2LW7A 4R1YA 3HE3A 3EVGA 5LDGA 3E23A 1RHJA 3VNQA 3L8XA 4NTZA 5C2JB 1JLHA 3NTXA 1FZQA 3OEED 3A4LA 3RTPA 2XZOA 4NENB 2ZITA 3II6X 3T3EA 2C07A 2VTBB 3COYA 3RVRA 2D06A 1WZ2A 3MMNA 4JT8A 2FR1A 1UJCA 2W1IA 2ZE6A 2C68A 1Y1PA 2WTUA 2BKVA 3L7BA 4JBXA 2ZSHA 4B40A 2XIXA 5ANRB 4MPDA 1VYHA 1ESCA 5FOSA 3K3IA 4D5KA 3EA5A 4OHXA 3THSA 3I2YX 3RM3A 5FQOA 4LC0A 1MFPA 5K3CA 2PZ5A 1N2EA 3Q4GA 4HWRA 2BEWA 4OQLA 1YBMA 3CNBA 1P73A 1Z4PX 4HVHA 4DBLC 2Z1DA 4LA4A 2QX6A 1F8YA 3OQMA 4EP1A 1ZXBA 5CLJA 4HJXA 4YRQA 3OTIA 3OT1A 4BTJA 2QUKA 3CQUA 2H1OA 3KR0A 1ZVKA 1LI5A 3U61B 5C8YF 1MO4A 1X1AA 4FYIA 4L75A 1W0XC 4FMPA 4C76A 2PX0A 3MZ0A 3TNYA 3R7NA 1PU2A 4XX0A 4A2QA 4BWVA 2KI5A 3FPCA 1OLSB 1GL6A 1IWPB 4C36A 4ZDWA 3W04A 4QMVA 2R00C 1DCFA 1ST2A 3H9RA 1DJOA 3MWLA 2RAVA 3Q6MA 5AESA 1X7XA 2PY3A 1MIOB 2W11A 2CXTA 3ZGYA 4U6SA 1W8DA 1XXHA 1W0CA 3CD8A 2W5AA 3A7DA 3HJAA 3TMYA 1WOMA 1G38A 3LCJA 1EVLA 4TXMA 1M8PA 5CEFA 2MHCA 4U5XA 1OMOA 1YZLA 2WA2A 4QUIA 1ACLA 2FWMX 4JB8A 4U5QA 1NMQA 3KMUA 4PDOA 1OTXA 2PX4A 3Q6WA 3VBXA 2REOA 2VRBA 1Q8UA 4J0GA 1DB3A 5I7HA 1BVYF 4L08A 2C54A 4KFRA 5BV7A 6GPBA 4C7JA 4CODB 5CX1B 4X62B 2ODAA 1XH5A 1GTJ1 1YGPA 4N4AA 1E3WB 1U3TA 2VDWA 3GARA 5FBRB 3HUDA 3RUDA 5KQSA 2Z7SA 5ICMA 5J43A 5F1PA 2X0DA 3ILVA 3JZMA 1N4AA 3WGOA 4FV8A 3ASVA 1P9LA 4EPRA 3H99A 4PICA 4LXTA 3RABA 4A8HA 1AUPA 2QGZA 1RXUA 1WUIS 4TKLA 3GD5A 1ZGZA 3PTLA 2QYTA 4DT9A 3E5HA 2PV7A 5LUAA 1W0JA 4IY1A 3UXHA 4DBZA 2UXCB 4PBSA 3LPAA 2GKSA 3OPYI 5ENDA 1NWCA 1E94E 2DZDA 1Z34A 3HVJA 1ZD9A 1I3NA 2DUNA 1PFQA 2C1XA 4N5HX 3JY6A 1PIWA 5FPSA 5JD3A 1N8SA 1X8BA 1UMCA 4GEGA 4FBXA 1ESNA 4MUFA 2QTRA 4H60A 1JSTA 5HDBB 4QECA 4HYUA 1DC6A 3TV4A 5M44A 3DTWA 3W2HA 5ESRA 1ZW6A 4EYGA 2ECKA 2PZRA 1QE3A 3DBLB 3GC9A 2BUCA 3KXDA 1Z4QA 5JJLA 5CAQA 5AVJA 2FB8A 1DI0A 5E3JA 1D8AA 3C5VA 2P40A 3C1AA 4DFNA 2VLIA 3W3AD 4NVRA 3LBIA 1I7PA 4R77A 4EG3A 3UWKA 4C3VA 4EEKA 3DEAA 1P2GA 4G6NA 4UJ5A 5IP5A 3OIDA 1K7SN 1CNMA 1EWQA 4AF3A 4S32A 3C8HA 1HLGA 5AUZA 3ANQA 4JC8A 3RRMA 1D1SA 1ETHA 4JBQA 1A9XA 4WBNA 3Q6UA 1QIJA 2J0JA 3IQGX 4PGAA 3PHGA 1JDPA 3AESA 4S35A 3GP8A 4OOEA 5BN3A 4MKCA 2IVSA 4UHBA 2OYSA 1P2SA 1H25A 4C38A 2ZUDA 3IW5A 2IEDA 3HCBA 3N3AC 4MRMB 4F85A 4DCAA 4BX0A 1NULA 2J45A 2XUUA 3W0OA 5IC4A 4NWMA 2QENA 4MWHA 1TQPA 4F70A 5FRDA 4I4CA 2P4SA 1XJQA 2BEUA 3OPXA 2W48A 4QL3A 5F23A 4Q1AA 3EWAA 3W0LB 1F0PA 1W98A 2V98A 2G9RA 5E3HA 2NN3C 3FVWA 4Y0VA 3HKCB 1ORIA 3HY4A 2PZJA 4QBKA 2IVVA 4XIJA 5EUCA 3WDKA 1PMVA 4PMPA 3VS2A 3UK2A 1JWHA 3OCGA 2AMYA 2GHRA 4HDSA 3E5NA 1ZJ5A 3ZE7A 4TT8A 4CLEA 3OTHA 4UWBA 1DBIA 1UEJA 4YC3A 1J2YA 3QHRA 2UUPA 3DKGA 2VDUE 4LG4A 4PGMA 1M7BA 2ETKA 3CWCA 2Y77A 2Y9QA 3ZH2A 1NKVA 3BXEA 3Q3JB 4RH0A 1QK5A 2ZREA 1STCE 2RAPA 4H7EA 3EF1A 5CLPA 3EUFA 1SK8A 1EG7A 2WOOA 2B94A 1G8JA 4LQMA 2BRUA 2VUHB 2JZNA 3QPCA 1PV1A 1UWLA 1YU6A 4YJRA 621PA 4DAEA 1T0HB 4URZR 4BDIA 3DLHA 1XTUA 3ZE9A 4H1TA 3Q5IA 4K05A 5FWXB 2J5BA 4YV2A 4OTWA 1T2CA 1OFGA 1T1GA 1X1SA 4ZAGA 4EYKA 3NUSA 3ZLTA 5FEDA 5JCOC 2OV4A 3ZC5A 4YMWA 4UD6A 4A23A 2O9JA 3QVLA 4TMZA 4D9TA 3LHIA 3ST7A 4HGEA 3RVSA 1PZEA 4YJKA 5L6PA 4P80A 4GE3A 2OOSA 3BTVA 4RVNA 5IKOA 3P4XA 4RKRA 1MIOA 3R7VA 2GF2A 2XD4A 3D7KA 3L1IA 2FSUA 1UM9A 3FMEA 3NAMA 3ZD9A 4C5BA 1OXSC 4RLHA 4CU5A 4ZT2A 4MA0A 1LRKA 1LU9A 3I7BA 1Q0TA 4X5OA 2AB0A 2XT9A 5E95A 4IIEA 4BZQA 4OH1A 4E21A 3IUQA 3PNMA 4MA5A 2JFBA 3K92A 4MEDA 3ZG6A 3T7JA 2HF9A 3MCVA 1QIHA 4HI0E 4PC3A 5KAPA 1T24A 1GGNA 5SYMA 3WJ2A 1TU4A 2W93A 1WVIA 1YIAA 2LNDA 4OHCA 3QUEA 2WF8A 3E82A 1SVNA 1MEJA 1RBMA 2QY9A 4EHNA 4X6YA 4JI0B 4HNIA 3UVPA 1L5VA 3VZPA 4N54A 4ZJYA 1QHYA 1U8EA 4H58A 3WK4A 3Q3EA 2EZ9A 3M3PA 4HUQB 3U9CA 3QI7A 3WNDA 4MV7A 4ZZOA 3NYOA 3T9TA 2CVFA 4FT9A 1H93A 1D1PA 5DZSA 1N3IA 4TRJA 3LCMA 4UEWA 3IKTA 1NBIA 3GUCA 3HR7A 3KRRA 1N25A 5KX5A 1FW6A 4A07A 3O94A 1FLAA 1V1JA 4K40A 3HZOA 1G8PA 4ZIRB 3HG7A 4O2RA 2FMKA 4QQ8A 1VZOA 1TYDE 3EK2A 4GOOD 3ESXA 4C4HA 1EBBA 1WB5A 1NASA 3A3YA 3I39X 3D8TA 4FJ0A 3HK2A 2HSZA 4CMJA 1L9XA 3UXYA 4S0XA 1FXSA 2PA0A 4XX9A 3MF4A 2M1XA 1VPWA 4M83A 4CTNA 2YBDA 4RWJA 3NWPA 4ZVMA 4BCNA 3ZU2A 3UQGA 4PYMA 4HEA1 5CVUA 4LOIA 1VLVA 1QHHB 4PNKA 3LA6A 2C4MA 3Q5DA 4JIMA 1YMQA 1JEAA 3L40A 2F8TA 3SX4A 3W9BA 2CDNA 1IASA 1XLVA 3ICCA 3W8QA 1JLLB 3F6BX 3H0CA 1VJDA 4JI5B 4MQFB 4Q9SA 3F5XA 2I0YA 2KBEA 4D0GA 4GSYA 3B5JA 4PPYA 4MP8A 1EXWA 4Q34A 2OCXA 4ENUA 3I5NA 1ZCBA 1N4DA 4X93A 4DJEC 4N01A 4OQQA 3CH7A 3IP1A 1G66A 2GD6A 2W8BA 3T4XA 3GVCA 2NUTA 1SVLA 4YMJA 1FVHA 2JF0A 2TYSB 3PG5A 5HFJA 3L06A 4KO8A 3G5TA 4WZAE 5JC8A 4IHAA 1F0KA 3VOSA 5JXGA 4Y0NA 1EWVA 1A69A 1N57A 2O05A 4C37A 5I3CA 4PAMA 4JQZA 4M55A 1U2DC 3T35A 2PK9A 1DS6A 2PVYA 4YP9A 2VV9A 4Z55A 1WDTA 3BH0A 5DIZA 3MB7A 1OGJA 1XMXA 2V97A 5JNTA 2VTJA 1O97C 2Q7XA 1JG4A 1ZIPA 5CNJA 3PCRB 3RSOA 2XJ0A 1HYEA 5BVDA 3KJHA 4FMCB 1NVVR 1D5WA 3GI1A 4HP8A 4WNYA 3LOPA 4C4RA 4NBVA 2O8FB 1PG5A 2YAAA 4EX7A 1TK2A 2LD4A 2O07A 1POWA 1VMIA 4G26A 3RSHA 1FBNA 3PJRA 2X86A 5HBJA 1DKQA 4R1SA 1N0UA 4TYQA 1UZLA 4LV5A 1J23A 4V0GB 3E62A 1KOLA 4QEKA 4XNEA 2PXXA 4QMPA 1NYQA 4MUEA 3M6FA 5KJ6A 3WGZA 1GA4A 3E3OA 2RGDA 5FP0A 5GOTA 3WF8A 3W1FA 5AMXA 3OS3A 3N8GA 3KRWA 2YOFA 5HFAA 1NXXA 5AP5A 1XCPA 4QYTA 1WUYA 4IAYA 1FNNA 4DEAA 5FA6A 3R2JA 4YHBA 4R6VA 5HF8A 1TKAA 5ES3A 4U42A 3KXIA 4JNKA 1CQIA 3P7BA 3U9TA 4N5DA 1OXBB 3UTCA 4JVMA 2Y1OA 3DCJA 4P3PA 3UAGA 3UPTA 2GHQA 2WPDD 2UZNA 5E8VA 3VDNB 2QUZA 3DB8A 4JI1B 4XX1A 1A8UA 3OZVA 2OORC 1RAEA 3VNUA 4MW0A 4IZOA 2I6LA 2M2IA 2VXYA 3GDWA 3H5TA 4L43A 3ANMA 4QULA 1N5OX 4NDNE 4EQZA 2GUWA 4F78A 3NRCA 5BORA 4KZKA 1T4GA 4I8IA 5BR4A 3AJRA 1TEXA 1T13A 1U2QA 2QEQA 1LFAA 4CZ2A 1DTWA 2AQ8A 2J33A 1QMZA 3N4TA 3O8BA 1I51A 2VA8A </