5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
1Q61A 4U43A 5E8TA 1OKWA 4ZTBA 3UJDA 4OX9Y 3BUSA 4QRCA 2KULA 2QOLA 4PRJA 1YZ3A 5IQGA 2ZBRA 2VTPA 5IUGA 3BQRA 4QNAA 4L3JA 1ATPE 1CKPA 3JXWA 4NM0A 5E8XA 2R3HA 5F95A 4ER0A 2QOKA 2VZ9A 5M09A 5DXJA 3H0YA 4O0XA 5AFVA 4FZDB 3LDGA 5KBRA 3CGFA 4PNEA 4FUXA 3AOXA 1I9GA 4RIWA 3GGDA 1V0PA 1TQPA 4RX7A 4QTEA 4DEBA 3F3UA 3MV5A 3IECA 3QALE 3SRVA 3U55A 4ANBA 1YOMA 2UVYA 4FL3A 5KO1A 4GOOD 3C50A 2QU6A 3SDJA 1U5RA 2QE6A 4K77A 4BC6A 5DTRA 2X8EA 5BVDA 3G6GA 4MHTA 3WZEA 3OZRA 3FHIA 5A4LA 3ELUA 4JBQA 4C08A 4HYIA 3C4FA 4LYNA 2WMSA 2X7FA 2XF0A 4C4EA 3NNWA 3Q4TA 4ER3A 4FIHA 4Z3VA 2R7BA 4RMZA 4TXCA 5CF6A 1SKMA 1OL7A 3QC4A 4FV6A 5IQDA 3MH1A 4RG0A 1JSVA 1PJZA 1R0PA 4MNEA 4AS0A 4PMTA 4BIBA 1ZXEA 2O2UA 3K5VA 3LM5A 4K0YA 4PDOA 1VQ1A 2PVNA 2BIKB 5HO8A 5TT7A 2E9VA 3BEGA 2CKQA 3R8UA 3WE8A 2YUIA 2JEDA 3DLIA 2R9SA 3FUXA 4FVQA 3FPJA 3DFAA 1GAGA 2ZDUA 3EMGA 4ZSEA 3ZTXA 3NEWA 5ETFA 2HZIA 3O51A 4FK3A 4JL9A 3FL4A 4ZZMA 4G2FA 4U7ZA 4UWBA 4A9RA 2BFYA 3P79A 4RC2A 5JFVA 1YDTE 4FTCA 3FZ1A 5IEXA 1H1WA 1RE8A 4GCJA 2ITNA 3DAJA 4EKGA 2YFXA 5B0XA 2XCHA 3H9FA 2OXTA 4IZ7A 4YV0A 2JGZA 5C8MA 1H0WA 3HECA 2BZGA 5J9LA 4F86A 3NYVA 2OIQA 3LHJA 4XOZA 4M7RA 4XEYA 5DIAA 3P9IA 3HA8A 2ZWVA 3P86A 1YOLA 4IAYA 3VBTA 2YDIA 4KDRA 3R8PA 4Z2YA 2YA9A 2Z8CA 1LPUA 1JQDA 3QQKA 2AOXA 2W99B 4O91A 3ZO2A 3BQCA 3BHTA 3LMGA 3VAPA 1M7NA 4RWKA 4F1MA 5HZNA 2W7XA 4QP8A 4ISCA 1RJFA 3LKMA 4FEXA 2HIWA 4MD9E 2XKFA 2ZJWA 3EEOA 2QOCA 4P90A 4RVKA 4K9YA 5H9BA 1AGWA 4HOKA 1J7LA 3EJ1A 4L6QA 4HW7A 5T64A 3TJDA 3DK6A 4C62A 3IW4A 4BYIA 3ER8A 4QPAA 4HYUA 2WMVA 4YLKA 4BDFA 2UYQA 1YQJA 3DUWA 3UQFA 5K05A 1OECA 3I0QA 2Z60A 3JVSA 3BYOA 3NX8A 3QD3A 4JQ7A 2B3TA 1M7QA 2H9VA 2QRVA 3KR9A 2VNWA 3AQVA 3LCDA 4KDCA 2W1HA 5EHLA 2GSFA 3P2EA 1PMEA 3VUKA 5K0NA 3OBGA 2OICA 4CFMA 2C6EA 3FMEA 4YZDA 3RWQA 4G9CA 4F1OA 3K3IA 5HCYA 4EK4A 1WY7A 4M69B 5JUWA 1Q8WA 3PJCA 3UYTA 4V0GB 1L3IA 5DPMA 3QLFA 1OKYA 2WMQA 4BBEA 2PKWA 7MHTA 4CMTA 1XJ5A 3DLSA 2OIDA 3NRMA 4FSRA 4RIYB 4RX1A 3GCPA 5EI6A 2XNEA 3QD0A 3R1YA 4MF1A 3P4KA 3MS9A 4GT3A 5CI7A 2ZM1A 5TO8A 4D9TA 2ETKA 4FV7A 4ENYA 2AOUB 4U97A 1XDSA 2R4BA 3KL8A 3PY1A 4FSUA 3FXZA 5CVJA 1ZLTA 1AQJA 4QQTA 3TM5A 1IM8A 2ZV8A 4Y73A 2CKEA 4DEDA 4BLUA 2R64A 2IVSA 2YIYA 1FBNA 4H3BA 2XIKA 4NT4A 5AUWA 3V5JA 3NMUF 4L00A 4PTCA 2ZVAA 3GGFA 3PIYA 1R74A 3G8BA 4OTRA 5E91A 2QYOA 5CU6A 4E73A 3FTCA 1IAJA 3DDQA 4E2XA 5CAOA 4I0TA 4P58A 2X9FA 1YWRA 5D10A 2XIZA 2C6DA 1GZNA 4ALVA 4D55A 4EJ7A 5CAUA 4BN1A 3W2SA 4FNXA 1LEZA 2UW9A 4I93A 4O22A 4BLVA 1JQHA 3D7TA 5CSWA 4FYNA 5FRIA 2XK9A 4F9BA 4S32A 4Y5HA 2OXYA 4GF5A 4GT4A 4IADA 3CKKA 1QPJA 3NLBA 4AGCA 4QMMA 4BCPA 5C27A 3CBLA 3LCTA 4E6DA 3M2WA 4LUDA 5EYCA 4RJ4A 4XV3A 2AS0A 4YNOA 2FYTA 5B2KA 2J5EA 3ZDIA 3FBVA 2XVAA 4PX6A 4MD7E 4F6SA 4DM3A 2R3QA 3D5WA 3E7PA 3O31A 3DGKA 5AP4A 2PK9A 4O81A 1PXMA 4I3ZA 1TKIA 1X1BA 3KPJA 4LGHA 2B78A 4EONA 4YURA 3FLQA 4H1MA 4PYOA 3A26A 3EL8A 3C5IA 2IZUA 3TMAA 1PF8A 3A4PA 3NZ0A 3OP5A 3QD4A 1UIRA 4QVKA 3R63A 3BELA 5M4UA 1FMKA 2WFYA 3LFAA 3O50A 1OITA 3S95A 3UZRA 4OTGA 4NH1A 2ONZA 3D5XA 2Y6OA 5AAFA 5A3XA 2P55A 2BRMA 3G6HA 4N0SA 4AA5A 2Q0BA 5FEDA 5CU3A 3V8VA 2BRHA 2F9GA 4IJ9A 5EH0A 1SVUA 1VP9A 3FUTA 5M44A 4R6XA 3SXJA 3D83A 5BP7A 2XIRA 2J4ZA 5LMBA 1NVSA 3U51A 1O9HA 2UW3A 4JDJA 5KS2A 2ONLC 3MB7A 4KWPA 1RI1A 2E9OA 2A14A 2X7GA 3FI3A 3L8XA 5JQ8A 4DEAA 3QCYA 2Y1XA 1SZMA 1WFCA 3R71A 4Y95A 2ETMA 2WTVA 3C4CA 3HYHA 2WAJA 3TNPC 4AP7A 4DH8A 1R6AA 4F6WA 3HEMA 4U7PB 4X0MA 3DDPA 1VL5A 4ACGA 3P97A 1OGUA 2GNIA 1H1SA 4MXCA 4GBED 3MPMA 4C37A 4RTPA 3LPMA 1JKLA 3DMFA 4JIKA 5I9UA 2BHEA 3TV4A 2ACXA 3AGLA 3NUUA 3W1FA 2PSSA 3FTDA 4EC8A 2EG5A 1QMZA 4GRBA 5BVFA 2DPMA 4J99A 3EQPA 1X8BA 2ITYA 3I79A 5FUBA 3LSTA 5C9ZA 1IRKA 2HXLA 2VV9A 1UVRA 3NTVA 1UWHA 3QA8A 5JSMA 1SNUA 4AFEA 1WXWA 3OE4A 3TFWA 2IH2A 4E32A 5T3QA 4Y30A 3PXRA 1VP3A 4E93A 2E9PA 2DUVA 1XBCA 2YWPA 3IS5A 4IX5A 2X6DA 3NUXA 4AT3A 1OKVA 2NXCA 3KR2A 2FSTX 2IBSA 5HIEA 3AC1A 3LFNA 2YQZA 1YKRA 3NUSA 4BI1A 4G1WA 1Q41A 1FGIA 4C33A 4BDBA 4QTUB 2X2KA 5D1JA 1OPLA 4ZY4A 4EH9A 4K11A 3V51A 4YUZA 3W8LA 4O0UA 3TJCA 4EZ3A 2UYHA 1GJOA 2GCDA 4CTJA 3UOLA 1Q4LA 5A6NA 5FWAA 3FTFA 3LQ3A 2HXQA 2Y8OA 3KC3A 5CALA 4DQ0A 3HNRA 4G3DA 3U87A 3QQHA 5BUIA 1PXPA 5BW4A 2OJFE 5L2TA 5T6KA 5ITAA 4C0TA 2OH4A 5ICPA 3COIA 5FXQA 3FMHA 3SOCA 3TKUA 3ZEPA 1YUBA 4BDKA 1NV9A 4U3ZA 1U46A 3DK7A 3ANXA 3GUBA 5H8BA 4BIEA 1YOJA 4RIOA 2GNFA 5CVUA 3THSA 2YERA 3L9MA 3N9XA 5DLSA 1JG3A 4I41A 4MQ1A 3C4ZA 3OWPA 3QWKA 1IASA 4X3FA 4V05A 3F7ZA 5EOBA 3ZUTA 4C7TA 2OGVA 4Y85A 3K2LA 1QANA 1V1KA 2F7EE 3M33A 3QUEA 3V6RA 3UNKA 4ZOGA 4BTJA 2HNKA 3MY1A 4AA4A 3H10A 5EC8A 1Q97A 3PVCA 3NW6A 3KU2A 5E1DA 4IVBA 3UC3A 1OL1A 1P14A 4CLJA 4YMJA 3MY5A 4HSGA 2XUUA 2ITWA 4IBMA 4F08A 5E1MA 5HHWA 3G2QA 4IZYA 3BLHA 5EHOA 3DJ6A 2R2PA 1E9HA 3AMYA 2VDWA 5EMJA 1TQMA 3QXPA 4TWOA 1EJ0A 4MD8E 4FG8A 4U0IA 3R8LA 3FZGA 2JDVA 4ZSJA 2R3LA 4AN3A 5LQUA 1RQQA 3G2FA 4U8ZA 3V5PA 3KULB 4IWOA 4X2KA 3D2KA 3HP7A 3DK3A 2HOGA 3QX2A 5HVYA 5BX0A 3BGVA 4YLJA 1Q8UA 2BTRA 3QTUA 4YJVA 4YC8A 5IA0A 3P78A 4IVAA 5E9EA 4EOKA 4WIHA 2PLWA 5HIJA 2Z6AA 2CJMA 1JSZA 2Z6UA 1UKIA 2JDOA 3I60A 2F7ZE 5HLWA 4Y8DA 2BZHB 2WKMA 3G33A 1J7UA 4RIWB 4EZ5A 5KMNA 4U42A 3P9KA 4KBAA 3AJDA 2XZSA 2C5OA 3Q6UA 1FP1D 5HVJA 4IE9A 4M36A 3GFWA 3HMIA 1R39A 1GZOA 4NFMA 2XH5A 5E4HA 1XDZA 4IM0A 3O71A 3WYYA 1BOOA 2WA2A 2BR1A 5CM2Z 3A8XA 3LJ0A 5IEVA 3TG1A 2JAMA 2AC5A 2CNVA 3NUNA 4QTBA 5CY3A 2VGOA 4AOJA 5L6PA 4L67A 4X3FC 4JVGA 4I21A 4IB3A 3DFCB 2E9NA 3KY2A 4NK9A 4XV2A 5CENA 3U9NA 2IVTA 2QODA 3LLAA 1W84A 3S1HA 4S31A 4FS8A 1QAQA 2PL0A 4FT4A 3FTEA 4O7YA 4JQEA 2IW8A 2PXXA 4DKJA 2WQBA 4R7BA 4GIIA 4M7IA 4U44A 1RJGA 5KZIA 3QCXA 5HU9A 2NRYA 1A48A 3NUAA 4L52A 3MA3A 4H3QA 4KBCA 5TF9A 4ACMA 4Z7HA 1EG2A 3TKAA 4F9WA 1OIYA 5E2AA 5K0JA 1Q5KA 3FMMA 4L42A 3TM0A 3D9VA 2GH1A 4ZIMA 4E6QA 1HOWA 2YM8A 4RLLA 3ZUVA 3SVVA 4KKGA 2I7QA 3FLSA 3VO3A 3PX3A 2YCSA 4W4YA 4JG6A 4RWIA 1XH7A 2J5FA 1UU8A 4XX9A 4EH2A 3SKCA 3IYLW 2AN4A 3OW3A 4MKCA 1FPQA 4MEDA 1RJDA 4FKLA 2PBFA 1BUHA 4WNKA 3AY0A 3EPPA 3UVRA 2I62A 4POOA 3IONA 4X7QA 5ERGB 4I6QA 1DS5A 4RLKA 4QMLA 1XH6A 4BGQA 3P08A 1KPIA 2PY6A 4IB5A 3U81A 2JKKA 2A1AB 2XIXA 3CEKA 4J1RA 3KR1A 5DTMA 4C4AA 4EHVA 2VWXA 3QFVA 2QRVB 1GIHA 3NNVA 4BCKA 3OCSA 5C9CA 2HTEA 2IIPA 4QP2A 4FT0A 4U41A 3CSVA 1X1CA 3BWFA 3DCVA 2J90A 4WRSA 3NNXA 3NYXA 3TKHA 2OKRA 3Q6WA 4JX7A 4DGOA 4YSJA 4UX9A 4MAOA 2A27A 3AD6A 2C3LA 5CS6A 2BM9A 2G8NA 3IPHA 2WA1A 4E30A 4FTKA 3QBNA 4K18A 3RAKA 4TT7A 3WF6A 5IU2A 4HVIA 2AR0A 5EZSA 3VC1A 3TNQB 3TWJA 2VGPA 3MTEA 3EQBA 3PWYA 4RVTA 5E1BA 5FULA 4PF4A 3FLYA 4PYJA 3VHKA 1YZHA 2C1BA 2H6DA 3HUCA 3VBXA 4XRJA 4RVFA 4QYFA 3DP7A 5EQYA 5T68A 3SSMA 4CMUA 4HRAA 4TW9A 5LVMA 4QTTB 4IWQA 3W2QA 4QTDA 1PKDA 3SLSA 3TV6A 3V5TA 3DY7A 4AZFA 5DX8A 4D4RA 1NW5A 2HELA 4NCTA 3MDYA 4C4GA 3AXTA 3CD3A 4PTGA 4QMVA 1XDUA 2C7OA 4GQBA 4O29A 1SYKA 3ORMA 1KPHA 5AP5A 1A06A 5JR3A 3VS5A 5HKMA 1OM1A 2WMWA 5IKMA 4EBWA 1OB3A 5H02A 1JKSA 5AV4A 1PMVA 3L8SA 2WTIA 3TM4A 3OHTA 3NYOA 3PRIA 4JDIA 2B9IA 2W4JA 1YDSE 4L68A 4XH6A 4C4IA 4EJNA 1SQFA 4KIQA 2FK8A 4RTJA 4WXHA 3ERCA 4V01A 4HGSA 3RMFA 1OBDA 2DWBA 3VC4A 5K4IA 3DH0A 5AUUA 3RODA 2JG3A 3C0IA 3FYCA 4JJRA 4GUEA 2A19B 2VWIA 2ERKA 4NZWB 4R7HA 2EU9A 5HD7A 3RKBA 1NBIA 2CCHA 3GJYA 3U6JA 1HMYA 3A7HA 4EHZA 1XWSA 3WZKA 4NW5A 3UIBA 3UJ8A 5HNGA 4YJSA 4PWNA 4D1SA 3FQHA 2K4MA 2BZJA 1B6CB 2XIYA 3FJQE 3KRWA 3P5KA 5F1ZA 3GFEA 3UFBA 3DZQA 1ZYSA 2C6OA 4GSBA 2YITA 1TW3A 4WG3A 1JSUA 1URCA 2O65A 2UVXA 4LOQA 4WSYA 5EM6A 5G02A 5ICGA 3R9OA 2OJIA 2GS9A 3VF9A 4ERWA 4YC6A 4W4VA 2XNGA 3EN4A 4Y46A 3AMAA 3R73A 3BGZA 3QYWA 4AAAA 1ZQ9A 2YISA 2W1CA 4BICA 3ZZWA 2XBAA 4DAWA 4PYNA 3H9OA 3VUHA 1ZZ2A 3FXXA 3QTQA 5LCKA 5L3AA 5LQCA 2VU3A 5A9UA 3CY2A 3HZTA 2W5AA 3R9HA 3AC5A 3QRTA 1BHJA 4AE9A 2P41A 2V55A 3KN6A 2JBPA 1DM2A 4FTTA 4ZTHA 5J95A 4QVGA 2ESMA 2I40A 4C59A 4FIIA 3JPVA 4PCLA 2VTQA 4YUQA 5GINE 5J8IA 3SMQA 4FG9A 4F4PA 3BI6A 2IDJA 4KVZA 4MWHA 2QD9A 4DTKA 3SW7A 1WBTA 5C0OE 3FPHA 4Z16A 3MQ2A 5AX3A 3C3YA 4I4FA 4F85A 3LGAA 5D41A 2G2HA 4EQMA 2BDWA 5E8WA 5CU2A 4F9YA 1XH4A 3TUBA 1N7JA 2N47A 1OL5A 4H1JA 3Q5IA 3WIKA 2OSCA 4LMUA 5HEZA 3MFRA 3B89A 5I9XA 3LLTA 1KE8A 3G5LA 3PYYA 2GMXA 3HAVA 4XLVA 5DT0A 2RGPA 2G70A 2CNQA 3F5GA 4FUYA 4ORKA 2OF2A 4G16A 4P4CA 3LXPA 3SGCA 4A9UA 3GWZA 4KSQA 3CS9A 4JX3A 3SC1A 4RC3A 4FTRA 4R5SA 2REIA 2BIYA 3DULA 5ETAA 4RA4A 4CKRA 1Q8TA 3PFGA 4FR0A 4RV9A 4IJPA 3HM2A 2EUFB 5EYDA 4B6LA 1L3CA 1XTPA 3DKFA 4NW6A 3MFUA 2C7PA 3Q53A 3DA6A 4DH5A 3UMXA 1MUOA 2G71A 5U4XA 5JT2A 3KCKA 4E1ZA 3PXKA 2BFXA 1YXXA 5JRSA 3LPBA 5AP1A 3LCCA 3AWIA 5CVEA 5EK7A 4XUEA 4I5MA 2FVDA 3SAYA 4DG2E 3FZTA 4O0RA 4M38A 1XR1A 2UUEA 1R78A 4LGGA 1NT2A 4BF2A 3POOA 4KSPA 2GPHA 3BE2A 3ENMA 1M17A 4O84A 3R01A 5BVWA 3V8SA 3KRJA 3C5UA 4RX9A 4FK6A 1PW2A 3MIAA 2IP2A 3I9FA 1JLUE 3MTLA 3MERA 3ZU7A 2XYRA 3D15A 1JVPP 3HMOA 3UQGA 3LJ1A 3O96A 3QKKA 2RFDA 3I0OA 3FHRA 5CASA 2VD5A 3BEAA 4L43A 5CAVA 4EKIA 5ANIA 3TZ8A 4M37A 3ZM9A 1NW1A 4A7CA 5F2KA 5HZMA 5EOVA 5DM2A 3GRUA 4BI0A 2UW6A 4Q9ZA 4X2FA 4IAKA 2PVMA 3QF9A 4L9IA 2Z7LA 4O82A 2W9FB 4IEBA 2J2IB 2RIOA 3U8WA 3OTUA 3NUPA 4XRLA 2B52A 2PUIA 5CLPA 2NXNA 4MHAA 1PMNA 3BKXA 3P8ZA 4BY9E 4IAAA 1Q99A 3BHYA 4YJTA 5L2WA 1XHAA 4C34A 1I09A 3BU6A 3VS4A 4E5WA 1KYZA 4LECA 1JG2A 4JIAA 3W8QA 3BCEA 4X41A 4YO4A 2JDRA 1MP8A 2JFMA 5FBNC 3UNJA 5J87A 4B4LA 1F3LA 5M06A 4EKLA 3OS3A 3HMPA 5CIYA 4DEEA 5CANA 4CV8A 1ORHA 1YW2A 4KRCA 2IPXA 2PMNX 3MB5A 4DFXE 2OFVA 3PJ1A 2VP3A 3LFDA 1UU9A 1H1RA 4FTIA 1JR4A 2ITTA 3NW7A 4S33A 2B1PA 5DRBA 2NXEA 1EAMA 4UXQA 1OPJA 5E92A 3TR6A 4C4FA 2VTMA 3HDNA 4HCUA 5E7RA 4G56A 1W82A 4PP9A 4O0SA 3UPXA 4CFUA 3KPYA 2ZV7A 3G5DA 3P23A 3LDUA 4ZTNA 2C69A 4IB0A 4BGHA 2FYSA 2XA4A 2ZAZA 2CMHA 3LE6A 2ZM3A 3BHHA 3EN6A 1UKHA 3K54A 4D58A 5BUEA 1ZGAA 4MQ4A 4YUWA 3KA0A 3REPA 3T7RA 3VUGA 1UFKA 4YR8A 3FL5A 5HLNA 1DAWA 5CNNA 4CFVA 2OF4A 4NM3A 3R7OA 1KR5A 2UZ4A 3QD2B 5DOSA 3I7CA 4G5PA 3MTFA 3PXYA 2PUPA 3Q9WA 4Q9SA 4HC4A 5HLPA 4BVUA 4JT3A 4GUAA 3L8DA 5EMKA 5FBOA 4F6UA 2OJJA 3NR9A 5HCXA 3P2KA 3COHA 4Q2AA 2HR1A 5P8WA 3ORNA 1IAHA 3OW4A 3R1NA 3U4WA 1SMHA 4EOSA 5FGKA 4JG8A 1Z9XA 3FI4A 3VS2A 2W1ZA 5FP6A 3QRKA 4PP7A 3VBYA 5LXMA 4BYJA 3VWAA 2FSMX 5J1VA 2HWKA 2W06A 1GY3A 4ZZOA 1SM2A 1K9AA 2QO9A 5HGIA 2AOTB 4AT5A 2EXCX 2QLQA 4WUNA 3VS6A 4QYYA 1J1CA 4GG7A 4YHJA 3EVGA 3IDBA 3LBYA 1PXLA 3ITZA 3PT9A 3CQEA 3ORZA 2QURA 2OI4X 4PYKA 3CJRA 3OU2A 2W1FA 1YXUA 4Y2HA 3PWDA 3JY0A 4IFCA 3LMHA 3WI6A 3E8EA 3DJ5A 4KIOA 3TDWA 3LCUA 4PWYA 3R9DA 3VW8A 2PX2A 4A4XA 3PPJA 3E3PA 4C06A 3P9JA 3FWQA 4K1BA 5IQAA 4GT5A 1RW8A 1Q8ZA 3OD6X 4GL9A 4IHPA 3PJ3A 1BL6A 4XHKB 3GC0A 3FRIA 3NJRA 2WTKB 3BV2A 4NJ3A 5EKOA 3Q60A 5B1SA 2VRXA 1XH5A 4XS2A 1ZRZA 2HYYA 4CZTA 3A61A 3FSFA 2CGXA 1H01A 3A7GA 5LMKA 4DN5A 3CPBA 2W05A 3Q5ZA 5AEPA 5CI6A 5EM8A 2WZJA 3TZ7A 3NAXA 5K3YA 4R5YA 1QZZA 2AVDA 1YI4A 2W1DA 4M0YA 2GS2A 4RX8A 2PE0A 2C5YA 2YACA 2EVAA 3UO4A 4JG7A 1KE6A 3FI8A 4E33A 2BDFA 4YNEA 1KV1A 3HVHA 3C0KA 4N6YA 3FRHA 3AT4A 2X1NA 3F82A 4ZY5A 3R9NA 5CSPA 4QNYA 1ZY4A 4RTSA 3W33A 3UOJA 4ZLYA 3ORLA 2UZLA 4FT7A 1CSNA 5HESA 1NE2A 3VYWA 4DCEA 3E23A 5HQ0A 3KVWA 4ATNA 1REKA 1RI2A 1CDKA 2A2AA 4FV3A 3II5A 4RJ8A 4AZEA 5CEKA 2YX1A 4MXXA 3KHKA 3KPUA 3EFWA 4R8SA 5FQNA 2WEVA 3SX9A 3CBGA 4AW1A 3EQFA 3GCQA 3PSDA 4YTHA 5CZIA 4ZS4A 2GU8A 3E05A 4O7LA 4E20A 3F69A 3KK9A 2PX8A 3D5UA 3G88A 4BDJA 3R21A 5C01A 3G7UA 4GFOA 3D0EA 4CLIA 4MXOA 3FQEA 5DR6A 5DEWA 5M4CA 1O9GA 2NP6A 2BAQA 2ITQA 3EFKA 4ZTLA 2VO3A 4CXMA 1YHSA 3R7IA 3I5ZA 5K5NA 1SQGA 2YM4A 4FTOA 4R1VA 2YZAA 4I6HA 5GJDA 4IM3A 1QAMA 5JFSA 3R3HA 3RJCA 4EH5A 5KYGA 4FVPA 3Q9YA 3DB6A 5ANOA 1JBPE 3NVMB 1FMOE 2UW7A 2B25A 4U3YA 2ZBPA 3NDJA 4EQUA 2OZAB 3KRRA 4ASDA 3DOUA 4XUFA 3COKA 2VS1A 4LL5A 3ZH8A 4S34A 3PUPA 4GEOA 4E6CA 2F49A 5IA4A 3QQUA 5EW8A 4DBNA 2GHGA 1WBOA 3F5PA 4W8DA 5A4EA 5EVJA 3DKCA 2PE1A 4BI2A 2Z7RA 4FIGA 3EGVA 4GJ3A 3OF0A 3TXOA 4YTFA 4L7VA 3F6XA 4NU1A 3GRRA 4WKQA 5HBHA 5HI2A 2P40A 2YVLA 4O2ZA 4J53A 4OTDA 3DMHA 2WTKC 2CNUA 2RG5A 5KQSA 5ANJA 4QOXA 2E2BA 3LQ8A 3GNIB 4N57A 3R7VA 5DHJA 1U4DA 3HVCA 5C1IA 2OFUA 3LECA 2GHLA 2UZWE 4FE2A 4A9YA 2P0CA 2O0LA 5AP7A 5F2OA 4YZBA 3L8PA 3IGOA 4FTQA 2HWOA 3UZUA 4QPNA 2XS0A 4XMOA 2BRGA 2R7IA 4J8NA 3T3UA 1RI5A 5JZJA 3DXZA 2IFTA 3PJ2A 3UA4A 2HZ0A 3RM7A 1YI6A 3UZTA 1M2QA 3FYJX 2BZIB 5BXYA 2XBMA 3QX4A 3G89A 4YMGA 5IDNA 1ZYDA 3QKMA 2ERZE 3MTIA 4HTFB 1YFLA 2AC3A 3P0MA 3DQXA 2XM9A 2CMWA 3TIZA 3S3IA 1ND4A 2P4IA 2P33A 4WNMA 2BZKB 4HPTE 2AVNA 4ZK5A 3BYSA 3D14A 3HDMA 3C4WA 2YABA 5F94A 1KYWA 2ONYA 1T46A 3LCOA 5IUHA 2IH5A 4RWLA 4AF3A 4B7TA 4FA2A 5BMMA 3BZBA 3UIUA 3AC3A 4R77A 3OT8A 3N51A 3OFMA 2V0DA 4MXZA 4OTQA 5EFQA 3R7EA 3F3ZA 4E6AA 5EKUA 4RTMA 4M3QA 2VTAA 3HA6A 4B8MA 1BC5A 2OLCA 3CGOA 4L3LA 4UBAA 2JHCA 4L46A 4KIGA 5CSVA 2R3NA 4WVLA 5FHRA 2YCFA 1UNLA 2C6KA 3GEQA 3VVHA 2JBOA 5D7VA 3OC1A 3BGDA 4WUAA 5LARA 1JSTA 2J9MA 3R24A 3LAUA 4QMPA 3CCNA 5M57A 3M6WA 3FKOA 5HIMA 1G8SA 3NS9A 1OUKA 1RJBA 2FUMA 2IZTA 2XNBA 5CNOA 4CQEA 3IK3A 5A14A 2XYVA 2H34A 4I4EA 3CJFA 5EDPA 2JAVA 2BKZA 4BCHA 4EOOA 3SG9A 3E63A 5J1WA 4ZTRA 5DH3A 3Q4CA 5I9WA 3VS0A 2YJSA 3UC4A 1IG1A 3ODYX 5CEOA 1WZNA 5EEHA 5EG5A 4PMSA 3EN5A 3ZZEA 4AUAA 4JQ8A 3MGGA 2G1PA 1AD5A 2WQMA 4I24A 3TEIA 1SG9A 4JAJA 4GJ2A 4WRGA 4ZSAA 3JVRA 5C03A 5AV1A 4DBXA 5CVVA 1ZMUA 3FZOA 4NM7A 4LOPA 4KS7A 4YHFA 4OR5A 4WNOA 4XG8A 4YLLA 3T9IA 4E8AA 1DAYA 4FEWA 5L6WL 3H30A 4BKJA 3QTZA 5J9YA 3C9WA 3ZLYA 3WZUA 3CLYA 1H1DA 2I6GA 3BHUA 4CEGA 2OJGA 2A4LA 3QHWA 4O7VA 4FSMA 5HCZA 3V5QA 2WHBA 3UPZA 3RNIA 3GENA 2KW5A 2X2LA 3EN9A 4F64A 5HO7A 4XV9A 3CJQA 5K0GA 3EFJA 5CF8A 2HW7A 4U7TB 4U6RA 4UALA 1H26A 2X8DA 3QLGA 1W98A 2B9FA 1PXIA 2F4JA 4JDKA 5K0FA 3KQOA 4YPDA 3F3VA 4FKJA 5DEYA 3P9CA 2I7CA 4YMHA 5CSHA 4ER6A 1WVWA 1W83A 4GS6A 5LWMA 1IXKA 4MTLA 4R6WA 3TQSA 3DAEA 3JYAA 5CF5A 1S9IA 3PLSA 3OVVA 4H39A 3DBEA 4I5HA 1NW7A 4ZLZA 1R00A 3GRZA 3HCBA 3JWHA 2C6IA 3PE2A 3E8SA 2R3RA 3KXXA 4ITHA 2UZEA 4XG7A 5GP1A 4YUVA 1M14A 2UZTA 3LQ5A 4TZRA 5IH5A 4XYFA 4ASXA 4UYAA 3DOGA 4FNYA 1N2XA 4DHFA 5GJGA 4ZXTA 3WIGA 4DYMA 3FZRA 1ZAOA 1VBFA 4PDYA 4PQNA 3R8VA 1LR4A 1ZGJA 4OQDA 3QU0A 3GU4A 1NY3A 2ZM4A 4P2KA 3TTJA 1W8CA 3ZMMA 3RPVA 4EBVA 1Y8CA 3KQSA 4XBUA 1H1PA 1NVRA 3VBWA 4CT1A 3POZA 2GQGA 5HX8A 4UZHA 4F63A 4JRNA 1YXVA 5AUTA 4MBJA 4JOAA 2ITUA 2BMCA 5H2UA 1UWVA 2B4SB 4BIDA 5CT0A 3LVPA 2PZYA 3W10A 4HVHA 4CG9A 3AG9A 3ZEWA 3LCVB 3CY3A 3CP9A 3BGPA 5CYIA 2GQRA 3S68A 1Q8YA 3A8WA 2CKOA 2XYNA 3KXZA 3NDMA 4IIRA 4FKQA 4AQCA 2W5HA 3P9NA 4ID7A 3HL7A 1YWNA 5HG5A 2NRUA 3WF5A 2V7AA 2OPBA 4FODA 5AIKA 2YR0A 4OTIA 4QMXA 3AT2A 5EIFA 2R3FA 2Y4IC 5HVKA 3MGYA 3W2CA 4LWPA 3JWGA 3I53A 1G5SA 4ZP5A 3QCSA 4YGAA 3PG1A 2XKDA 4TWCA 3TZ9A 5C8NA 4HYHA 1D2HA 2ZYBA 2WXVA 2P3QA 2OBFA 3I7BA 4AG8A 10MHA 4HVSA 1O6YA 2JIVA 2IG7A 3CKXA 3W2OA 4J98A 2ITOA 4U5JA 4N4SA 5IQIA 2QI8A 4DITA 3FI2A 1WBNA 4YJNA 2C47A 3EH9A 3AD5A 4O0YA 2ZZKA 4ZTSA 5H8EA 4JBPA 5ETIA 5IUIA 4X2JA 3PIXA 4BCIA 4QQNA 4KS8A 4PY1A 3AGMA 3VC2A 5IISA 4WBBB 5AV2A 2C4GA 3TNHA 3FMDA 2LD4A 1UNGA 2C5NA 4EMSA 3OT3A 5GOZA 3T0IA 1J7IA 3DTWA 3F3TA 4O96A 3DBFA 5HIDA 3ZXTA 2HK5A 3FPEA 4RFMA 2OO3A 2XYQA 2VTJA 2Q0NA 3LCKA 2UZDA 3C13A 4O6EA 3C6MA 3E88A 4AZVA 3T8OA 3KQYA 5CEPA 4LOOA 4NTSA 5DR9A 3GNLA 3SVZA 2P1DA 3TT0A 2NPQA 1D2GA 3AC2A 1PXOA 3CXWA 3TACA 5L6OA 1NW6A 2PZPA 3L9PA 2E5WA 2PGXA 4RJ7A 4ANQA 2XYUA 3EYHA 2FB8A 5LQNA 2PSQA 3HP5A 4J8MA 4EH6A 4IZ5A 3KU1A 1J3HA 2PVHA 3HLLA 4PYMA 5DX0A 2EB3A 4DZRA 5J5SA 3ID6C 2ZB1A 2EFJA 4XJ0A 4CKCA 4A9SA 5DNRA 2C1AA 5DX1A 1WCCA 2R5TA 1XCLA 3D94A 3FC1X 2WTJA 3DT1A 4M12A 5EDQA 4ALUA 3KQPA 5DSXA 4A07A 3G15A 3E62A 1I4WA 5K0EA 2R0UA 4ANLA 4FL2A 3A7JA 1KXZA 4BDCA 4TL0A 2CN5A 3EEYA 5FADA 1A9UA 4FKSA 5E8YA 4TYIA 1FGKA 3SR4A 4GK4A 2IH4A 3ZLXA 3QOWA 2J6MA 3EN7A 2WQEA 3PY0A 2FRXA 1KOBA 3D2IA 2XK7A 4K33A 5DG5A 5M4FA 4NM5A 4OTFA 4PIPA 4AX8A 3GXOA 5LVOA 1WVXA 1OL6A 1ZARA 4RFZA 2XK3A 1GIJA 3UQCA 2ZCJA 4HGLA 5JGBA 4ALWA 3R6XA 5BVOA 3EKKA 2VN9A 1YWVA 3ORXA 3FUVA 4H0NA 2ZMCA 4CKBA 4LRKA 2JLDA 3DXPA 3O8TA 4AW5A 3LZBA 3GP0A 3KF4A 3KN5A 3ODZX 5IMXA 5JGDA 3ORKA 2R3SA 2J0LA 1UV5A 3TOSA 3HCFA 1MQBA 1IR3A 1Y6BA 5AV3A 3OCGA 4D1XA 3O8PA 3W32A 3FPMA 2C6MA 3ZSIA 2YZLA 4GW8A 5A4TA 2AUHA 3ULIA 4ASZA 3MJ1A 4FKOA 2Y6MA 4O27B 3HCEA 3DZOA 4D0WA 2XK8A 4TRLA 1ZYCA 5ICCA 4KRDA 1DCTA 3R04A 2BILB 4K6ZA 3SG8A 3HV4A 3MBLA 4E31A 5JK3A 3KPWA 2C3JA 5KKRB 4E70A 5CCBA 5ACKA 1EQAA 4X21A 2Z6QA 2HCKA 4Z55A 4XV1A 4W4XA 2YCQA 2R3JA 3LFEA 3WF8A 3KQ7A 2V74B 5CD1A 3PXZA 3WYXA 4ZEGA 3FY2A 4C61A 1SUIA 3W16A 3EVCA 3ERKA 1E1XA 2IVUA 4IZAA 4IMYA 4JBOA 5DM1A 2P2HA 2VZ6A 5B2MA 4BHZA 4RX5A 3IV6A 3GC9A 4PCAA 3ENHA 3JUHA 2PVCA 4FKWA 1FJXA 4PIMA 3RI1A 1H0VA 3FYKX 2UZBA 3D4QA 3BX5A 1XVAA 3QZFA 3EVAA 3LKDA 2VTHA 2ITPA 4TYEA 3M70A 4FGZA 4U40A 2GNGA 1NXKA 4E5AX 3VUIA 4MNFA 3RINA 3F2NA 5IQBA 3PVGA 1VYZA 3HVIA 4RSRA 1S9JA 3ZRLA 2GTNA 4O7ZA 4FNWA 5DT4A 5HIIA 2JDSA 3ORTA 4JI9A 4PINA 2EXMA 1X1AA 4QMQA 3PRFA 3FZPA 4TNDA 4Y83A 2C3KA 2O8YA 4RA5A 5LQJA 2OBJA 3M4XA 2YIXA 3NNUA 3UP2A 2ZZNA 1YDRE 3JS2A 3RALA 3DLCA 1HCLA 4ZAUA 4RQKA 5CAQA 5HBEA 1STCE 3RPSA 4QMYA 5LQKA 5AUXA 3UMWA 3D2LA 1VIDA 3HVJA 1PHKA 5LVPA 3V5LA 4FV5A 4XP3A 3MVJA 2OG8A 4IX4A 3FXWA 3PZHA 4J71A 4L8MA 3IW8A 3DXQA 4LV5A 2EWAA 3KMMA 3RM6A 4A9TA 3PX2A 4D0XA 2Q83A 1H27A 2QONA 4EKKA 2C5XA 1WBWA 3VF8A 3EOCA 4RTLA 4RTKA 2XK4A 3VJNA 5KMLA 5AMNA 3JWJA 4USEA 4TY1A 2UVZA 1J1BA 5A46A 3PXQA 4RVHA 5KE0A 3CR0A 1OBGA 1D2CA 2ZIGA 3F4KA 4XUCA 3ETAA 3Q3BA 4GK3A 3ZHPC 1KE7A 3RAHA 4C3PA 5M51A 5DWRA 3KB7A 1ZYJA 3W18A 1ZY5A 4DCAA 3RPOA 3BT7A 3R9RA 2X2MA 4LM5A 3ZC5A 4BZDA 4MXAA 2O57A 2GLUA 1WG8A 2AOWA 3A60A 3QYZA 5EQJB 4BCNA 1PYEA 3EQIA 3C4XA 3UG1A 4YTCA 3ATTA 2C5VA 2Z02A 1YXTA 3QOXA 5EHGA 2NXJA 2RFNA 3LCSA 3TCPA 4F65A 3OPNA 3OOGA 4QP7A 3VHEA 3PJ8A 5CSXA 4FIEA 3UJCA 4QDKA 4QP1A 4EH3A 2OJ9A 1VE3A 3CVOA 3GI3A 1FQ1B 4FKVA 4HGYA 2FH9A 2JFLA 3QQLA 4U81A 3P7AA 4WOVA 2YAKA 3LOKA 5M56A 3PDTA 5DA3A 3RPRA 4IX6A 2ZULA 3EQDA 2IZRA 3F5UA 3QZIA 2R3OA 2QC6A 4F7JA 1R8YA 4FZVA 5HU3A 4CWAA 2NYUA 4R8RA 5HICA 3O8UA 4GUBA 4I22A 5F4NA 3RVGA 3UVPA 2BRBA 3B2TA 3OXZA 5H8GA 3ZBXA 4LFIA 3ALOA 2AN5A 3FPQA 5BW5A 2C7QA 1WZYA 1BI7A 5KHWA 1OR8A 2X81A 4BR3A 4ZTMA 4PTEA 4C38A 4QMTA 2C0IA 4IC7A 3Q2MA 3E5AA 4FG7A 3GVUA 2JD5A 3QQJA 4AZTA 4LMNA 2HY0A 5KZ0A 3ZFXA 4FT5A 2PV0A 3PSBA 2XK6A 2XKCA 3OWKA 1BX6A 3ROYA 2ZVJA 4FSXA 3Q9XA 4EWQA 4F09A 2QY6A 1VEBA 3G5TA 2XMYA 3CC8A 3OBJA 1QL6A 4CFXA 4YTIA 2HMYB 3ELDA 4IKPA 3PA4A 3PTGA 4QP6A 4XLIA 4TWNA 1T43A 5BPYA 2QKWB 3KKVA 4F0GA 3R00A 1WS6A 2IW9A 3EVEA 3OZSA 1NW3A 4WNPA 2HWPA 3ZRKA 2W0JA 4KKEA 5E8SA 5L8LA 2NP7A 3JR1A 3KMUA 3S4QA 1JTEA 2RKUA 1ZWSA 4D4YA 3JWIA 1YI3A 3QWJA 3M6XA 3NUYA 3KCFA 3O0GA 2V7OA 4AFJA 4ZSLA 4ZMFA 1O54A 3LFBA 1NV8A 2H11A 4IV8A 4L45A 2YIQA 4WA9A 2GS7A 3DS6A 1UU7A 4RVMA 2PXAA 4FTNA 2J0MB 4OBQA 4QYHA 4AUKA 1FOTA 2G2FA 2I0EA 2PVRA 4BDEA 5DSTA 3MVLA 4IH8A 4M68A 4DA5A 2O3PA 2WMTA 1XJDA 4YZMA 5DN3A 3FUPA 3OG7A 5FXSA 3ROCA 3U9CA 4DFBA 3LKZA 3R30A 1YF3A 4XG4A 1OI9A 4RC4A 3ZONA 1R8XA 3GBZA 3HV6A 3TIYA 5IH4A 2ADMA 4O7SA 4X63A 4CKEA 4C04A 5MHTA 2OYRA 3DXXA 3GCUA 4NTTA 3U6IA 3U4UA 1CM8A 4HGEA 2WIPA 3QUDA 4UB7A 3DTNA 4QMNA 3H0ZA 4BBMA 3LFQA 3OFKA 1U59A 2PMLX 3Q9ZA 4M15A 3IG7A 5EW3A 4M8TA 2Z2WA 4WO5A 3VS3A 3ZSGA 5HE3A 2IW6A 4UV0A 2GFCA 5CU4A 4JR3A 4ZMEA 3EQRA 4RGJA 2H96A 3TN8A 4E2YA 1Z57A 3G9NA 3ZXZA 5AAEA 4GKIA 3VSEA 4CCBA 4MVFA 3C0GA 1V39A 4PYIA 4DEGA 2VWZA 5EGSA 3GCVA 4QT1A 1JNKA 3EMBA 4CCUA 4GG5A 3P1AA 3BBWA 4GV1A 4R1YA 5A4QA 3S0OA 2RFEA 4MIKA 4RVGA 1Y57A 1GIIA 2VTOA 3ORIA 3K3JA 3ZOSA 4BTKA 3V01A 3QTRA 3EGIA 4I6BA 4EOMA 1IY9A 2ETRA 3NYNA 3OWJA 3DR5A 5E8JA 4AN2A 3OXTA 3P71T 5ANGA 2VAGA 3T7SA 4CFWA 5DXAA 3V6SA 3FAAA 5LQAA 2YXDA 4BDDA 3EVZA 2QHNA 4V04A 3KFAA 1L3RE 4QMUA 3ANQA 2PZ5A 5C4KA 3FKLA 2YDJA 2CGUA 3CTQA 1H8FA 2PZRA 5ICFA 3RHXA 4WBOA 2WOUA 4E2WA 4BB4A 2HENA 2GFSA 2OW3A 2ITVA 4I20A 3ZO1A 3C1XA 4XCUA 4F7NA 3DJ7A 2QO7A 2VTLA 5FM3A 3O23A 4F99A 2VDVE 3BLQA 3COMA 4NJDA 3UZPA 3VULA 4ARKA 2DULA 1XQZA 2J0IA 2Y9QA 4OTHA 2EJUA 4HZSA 3M42A 4ZS0A 3A99A 4LUEA 2WTDA 3SRVB 1EIZA 4XUDA 4BBFA 4TWPA 3OEFX 2XJ0A 3BE9A 2Y4PA 2PPQA 3BU3A 3KF7A 4IW0A 4XG2A 1PXNA 3RK5A 5CXZA 2UW4A 5LOHA 5LSAA 2WGJA 3SXSA 3VS1A 3UIXA 3A4OX 3EWHA 1RI3A 4DH3A 4PNIA 3ORHA 2QOIA 4D4SA 1NKVA 4ER5A 2DQ7X 5I9YA 2GPYA 5EPEA 4C2VA 3MA6A 4J95A 2VX0A 2PUNA 3KVXA 4NKAA 4R05A 2VX3A 2WU7A 3DU8A 4JXJA 3CC6A 3ORPA 4FL1A 4QQ5A 3DTCA 4E4NA 3HVKA 1QPCA 5DGZA 3LXNA 4RYLA 2CKPA 5IPJA 4JDHA 3W2PA 3DPKA 3MPAA 4IDTA 3OY1A 4C36A 1G38A 3MIYA 2BAKA 5IH6A 4BTMA 4AN9A 4MTAA 5I9VA 4X60A 1WBVA 1PYXA 3G9LX 4BCJA 2CSNA 2R3MA 4KA3A 4H05A 4FTJA 4KWCA 5HIKA 4KAOA 4GC9A 4PDSA 1AQ1A 2JKMA 4FVRA 2FCAA 5A54A 1VR2A 5K0CA 3GU5A 3BBTB 1M2PA 5K0LA 2X0GA 4OT6A 3THBA 5E9JA 2FO0A 3BYVA 5JMSA 2SRCA 4GFMA 4FZAB 1ZOHA 1P2AA 3HAMA 4YBJA 4RTOA 3G0EA 4QTCA 2C30A 2XJ2A 4TYHA 2B53A 4O0VA 4FSZA 1QAOA 4UXLA 4DFLA 5KMMA 2CMGA 3KK8A 2OH0E 5EI2A 1ERKA 3LDFA 4OBPA 2HV9A 5C26A 5KQRA 5FWDA 5CX9A 5M53A 1FINA 4N70A 3FDNA 4UWYA 5JKGA 1NW8A 2OZVA 3A27A 4GEKA 2QG5A 3QA0A 2W1GA 2CHLA 3BKBA 4G31A 4GYIA 4KB8A 4M97A 2H1RA 4YV1A 3OROA 4GFGA 3DKOA 3A7EA 5GM1A 5K09A 2C7RA 3RIEA 4EYJA 1Q0SA 4FOCA 2RFSA 2ZMDA 4ZZNA 1Y6AA 2XNOA 4IB1A 3ZLSA 5FP5A 4APPA 3ALNA 4EHGA 5AA9A 3KR0A 4A4LA 4EK6A 1URWA 4MWIA 3RP9A 5I5ZA 5AM7A 1KHHA 3Q87B 4FGRA 3ULZA 3WZDA 3PIZA 5AX9A 4B99A 1MRYA 1KE5A 4O7NA 3BWYA 4DMGA 3D5VA 4Q5EA 1JG4A 4AACA 3QZGA 3BPRA 4TKSA 5CU0A 2O64A 4NWMA 4C05A 3ACKA 1KV2A 5BYZA 4BDAA 3ACJA 4XG9A 3IOPA 1OIUA 2GDOA 3QCQA 4QDJA 4C3FA 4YC3A 4A6EA 2P3GX 1M2RA 2QR8A 1FP2A 3DKGA 3F9NA 3BWMA 3HMMA 5B7VA 3LHDA 4GIHA 4OBWA 3ZBFA 4Q5HA 5T67A 5JFXA 4OUCA 5DVRA 4E4MA 4GOLD 5DM0A 2BKKA 5HORA 1YFJA 3BYUA 2XNNA 3O4FA 5HE1A 3L9NA 4IVCA 1SVGA 3RAWA 3O17A 4GU9A 3LL7A 2IVVA 5IA1A 4DCMA 1B38A 3LMIA 2JC6A 3I6WA 4NSTA 5EQEA 5FA5A 3QTXA 2XNPA 3BRBA 3QQFA 1XBAA 2BHHA 4RIXA 4APCA 5CEQA 3RAIA 2W1EA 4EYMA 2B0QA 5EOLA 3OWLA 2EX4A 5K8VA 3X0DA 5IDPA 2W17A 2WQOA 4GYGA 2VTSA 4EQCA 2X6EA 2GHMA 5K03A 2ZSUA 1N7IA 4HYSA 3ZFMA 2BPMA 2AN3A 2XRUA 1Q24A 4P5QA 4Z9LA 5JH6A 2PJDA 4DH7A 4DFUA 4CMOA 1O6LA 2PX5A 4X61A 3QUPA 3LJ2A 5HTBA 3E64A 3NWWA 3CPCA 3PPKA 4EOIA 4KUJA 3I1AA 2PX4A 1UWJA 1Y8YA 3HV7A 4FKIA 2Y4IB 4GVJA 4JNWA 3D7TB 3GOPA 4F9AA 1P91A 4C3RA 2F8LA 2G72A 4DEHA 2FHPA 4CNHA 5KMOA 5AA8A 3KQVA 5HX6A 1P4FA 4HH4A 5HBJA 3CE3A 3P7CA 4CXAA 4CVAA 4D9UA 4NYEA 4DGGA 2UYOA 4U79A 4JS8A 4AWIA 5CF4A 3MPTA 4R3RA 4R6VA 1ZMVA 2UW0A 5HG8A 5J7HA 2V7EA 4NIFB 5T6BA 1OMWA 2NNWB 3E7OA 4H36A 4K8AA 5KX8A 1PRYA 4FEQA 1K3AA 2PVJA 5C4LA 3IQ7A 3FEGA 5IQCA 4EH4A 4BP3A 2P3OA 3OZ6A 3P7BA 1E1VA 3HMNA 3OCJA 1LEWA 5TOZA 1F5QA 5CVHA 5F2NA 1KOAA 3E93A 2UZNA 1H1QA 2PULA 5E1OA 3Q2JA 4JRVA 2KTYA 1OPKA 2CCIA 4GK2A 4I5CA 4IWPA 3R7YA 2C3IB 3V8WA 4CSVA 1X1DA 5CXHA 3NIEA 3C7QA 3F2AA 3GO4A 4DGLC 5G6VA 3DBDA 3KXNA 3PZEA 1OZ1A 4FKTA 5HE0A 3SQQA 3K6RA 5FTOA 4DC2A 2ZWAA 4PGGA 4BP1A 3MWUA 5EQPA 1JWHA 4EOQA 3EKNA 4OT5A 5GIOE 2QR7A 1U54A 5IEYA 1B39A 3V04A 3PP0A 4UOEA 3OUNB 4QMWA 2ZFUA 5I9ZA 4TTHB 2G2IA 4FC0A 2X4FA 1CTPE 4PYQA 5ANEA 3FQSA 1L9KA 2PYWA 3H3CA 4AZSA 3LIJA 3DNEA 3L8VA 4G6NA 4XNEA 5EIWA 4FEVA 3HA7A 4GOND 4KABA 2W4KA 4IAFA 2BCJA 4MCVA 4K6MA 5CCXA 5AP3A 3E7VA 5HE2A 4FX3A 2Y0AA 4TNBA 1Y91A 3PVUA 4IWNA 2QOFA 2WOTA 1EH4A 2AOUA 4FYOA 4HPUE 2WTWA 5F20A 4FTLA 4MBIA 3ZO4A 4CG8A 1YB2A 2VUWA 4O7WA 3ZYAA 1PKGA 3F88A 4IAIA 4X3JA 4QP4A 5LJJA 4AXAA 2ZZMA 4EOLA 3ME5A 1QPDA 4L7SA 2QOBA 2QVSE 4DTAA 3O7LD 3QKLA 3TNIA 4BZNA 3B8RA 3N4VA 3DQWA 5DT2A 3ANRA 3UVQA 4CGAA 1OKZA 4WG4A 5FHQA 3RTPA 4PONA 4L3PA 1O9UA 2W9ZB 3C4EA 2VO0A 4W4WA 1VYWA 3UDBA 3C6KA 5KVAA 2QQ7A 3SSNA 3TRKA 5CTPA 3NSZA 2VTNA 1R0EA 4FMQA 4YZNA 2WNTA 4BGGA 4DT9A 2GA9A 3NWEA 4A6DA 4FNZA 2H00A 2P35A 3Q04A 3ZSHA 4C07A 3E8NA 5HOQA 4FKRA 3HX4A 4DT8A 4RWJA 4MBLA 2LAVA 1V0OA 2LGCA 4MNEB 5LQFA 5M07A 3VRYA 2FSLX 1I44A 5DTQA 3RWPA 3FE3A 4G17A 1APME 2BVAA 3R1SA 2P2IA 4N6ZA 4CKJA 5LMKC 4RTQA 5M5BA 2X9EA 4IVDA 5CEIA 4O2PA 3PVBA 5EG3A 2JDTA 4KKHA 3BLRA 2JKOA 5CWZA 5E1EA 4TPTA 3HP2A 5EM7A 3VS7A 4FTMA 5B2LA 4P7JA 3CQUA 4KBKA 2DYLA 4ITIA 3B3FA 5FQOA 2J50A 4KIPA 4QPSA 1XCJA 4U9AA 4O6LA 1U2ZA 2YXEA 2B54A 3G2MA 4FSWA 5IQHA 3IW5A 4HG2A 3AT3A 5FQDC 4KINA 3UG2A 4FSTA 4RTRA 3IHTA 3F5XA 3GIWA 3HNGA 3SX0A 3UODA 2O05A 4ZSGA 2ZW9A 4Y5QA 2PT9A 4ACHA 4QTAA 4EZ7A 5CEMA 4AE6A 3O7WA 4YPSA 5C1QB 3BXOA 4G34A 2PHKA 1OVEA 2BDJA 3G90X 2BR4A 3UJ6A 2G01A 4FI1A 1ZZLA 3NW9A 4CTKA 3CTJA 2O06A 2BR5A 4YU2A 4BLWA 4B0GA 2PT6A 5JZNA 2GTMA 4TYJA 4H3PA 5EI8A 5DE2A 4RSSA 5KCVA 4G3EA 3LW0A 5EEGA 4G5JA 3CGGA 3NWBA 5E90A 4OBOA 2GNHA 3AXWA 3F3WA 5CQWA 3M6VA 1YVJA 4AGWA 5E9QA 2R3IA 4PL4A 4F84A 1QPEA 3F66A 1VJYA 1Z3CA 3PA5A 3N4UA 3TL8A 5A4CA 5E8VA 3GC8A 3VUDA 5KBQA 4GC5A 4KIFA 3DXNA 2WMXA 5ETCA 3A7IA 4CV9A 1NBHA 5HEKA 4KD1A 4I92A 3WF9A 1BKXA 4DCGA 5EKNA 3ZRMA 5GJFA 1AV6A 1GZKA 5L2SA 4HCVA 3KRLA 4QP3A 1ZOEA 4IM2A 5EW9A 4CKIA 1AQIA 5CVDA 3UNZA 4LG1A 4O7RA 2I6LA 1TVOA 1DL5A 1W0XC 5D1HA 2Y7JA 3GU8A 5E8ZA 2V62A 1REJA 4LV8A 5DFPA 3UP7A 5IH3A 4YJUA 2OXXA 4CZUA 1H07A 4C2WA 4QYEA 1I1NA 5FM2A 2JHAA 1Q3DA 3QAME 4ANSA 1L1EA 1J91A 3AC8A 2FSOX 2WU6A 4Y72A 4ZLOA 4DEIA 4FV0A 2P7IA 2CKDA 4HZRA 2EJTA 1FVVA 1P5EA 4BCMA 2GNLA 3MY0A 3KQTA 3TI1A 1MRUA 1M6EX 3CJTA 3I5UA 1UU3A 1OUYA 1PXKA 2VTIA 1BLXA 4UWCA 1H28A 3Q4UA 1BMKA 5AIRA 4CFNA 1Y8GA 5FXRA 2G1TA 3R28A 3FV8A 4C02A 3GU6A 4F0FA 4D5KA 5G1XA 3TUCA 4LRJA 2UYCA 1JAMA 2CGVA 5M55A 1PMUA 2O5KA 3I64A 2NP8A 2XNMA 1KWPA 3B8QA 5IMEA 2YM7A 3I4BA 2VWBA 5DLYA 2PWYA 2JJQA 3UJ9A 3MESA 4CTCA 1MQ4A 2WMAA 3BKWA 3BGIA 2YIWA 3HKOA 4YZ9A 2E9UA 1SUSA 3BWBA 4EOJA 5HG9A 4X6RA 5L8JA 4ZJVA 2ZBQA 1WVYA 5GWXA 1H00A 3PB3A 2J7TA 3FMKA 2OO8X 3WOWA 3UJAA 3EZVA 5HD4A 3QTIA 3PY3A 5C8KA 5LR6A 3MB6A 1WMKA 4FIFA 1R18A 3Q4ZA 4G6LA 5L8KA 2XP2A 3IOKA 4AOIA 3SXRA 3E3BX 4E2ZA 5FTWA 3IKAA 5IF1A 3VBVA 4G6OA 3R22A 2QLUA 4LI5A 4D4VA 5K9IA 4LQMA 5H3QA 3CQWA 4ACCA 4IX3A 3UBDA 5A6OA 2F7XE 3R7UA 2YAAA 4RQVA 3SOAA 2O07A 5DPVA 2B55A 3MCZA 3OZTA 2PXCA 1T45A 4FSQA 2QHMA 3PXFA 4M84A 5J9ZA 1DUSA 5EDRA 5IA2A 5EM5A 3NDIA 5E1SA 4QO9A 2QOOA 1BI8A 4J96A 4O0TA 3RZBA 4DGNA 4L53A 3TPZA 3V8TA 4AGUA 3HCAA 3KKZA 2CLQA 2PZIA 4NECA 1ZMWA 5LVLA 2VWWA 3VW6A 4P7GA 2YEXA 3GXLA 3EQGA 3SD0A 2QU5A 5M4IA 5AWMA 3HCCA 5FEQA 2YN8A 4LG4A 5FCDA 1JKTA 2VDUE 3E8CA 3FY0A 3VNTA 4EK5A 3UA3A 3H4JA 2XM8A 4FIJA 4BZOA 2YXLA 3QZHA 3K0BA 4KRGA 3MFSA 2XJ1A 2OU7A 4AZWA 3E8DA 4J97A 4F70A 5K0BA 2X7OA 3F61A 4YO6A 1R3CA 2RF9A 4LL0A 3K5UA 5ANKA 5AUVA 5JEBA 2F2CB 4QMSA 2YM3A 3I5NA 5D7AA 5FTGA 1XKKA 5JQ5A 3A25A 3SM3A 3MH3A 3FPGA 1OIQA 3EGEA 5JN2A 2HW6A 2WMRA 1KSWA 2PTKA 3LFFA 4MXYA 3HA5A 3A62A 3PLAE 4FV4A 2QCSA 3OY3A 4FT9A 3W2RA 2UZOA 1KE9A 5JRQA 4P7EA 5FDPA 4FR4A 3QL8A 4PL5A 2YWVA 2JIUA 2HAKA 1U5QA 1G3NA 1JOWB 4BDGA 3PTAA 3PVWA 3FUUA 5HG7A 5GIPE 5BVEA 3NGAA 5AV0A 2IBTA 2C0TA 2VWYA 3ZO3A 4OA8A 2RG6A 3ZUUA 3MW1A 4PUZA 1ZKDA 3CTHA 2P8JA 5KHXA 3ELYA 4D2RA 1P39A 4DF3A 3EMDA 4QP9A 4IQ6A 2PVKA 3DAKA 3EIDA 2OZOA 4RBLA 4X2NA 5TR6A 2HY81 3UE4A 4TYHB 3U54A 3VQHA 4QPPA 1KUTA 4IACA 4DE4A 4RVLA 3VN9A 1YHVA 3A4TA 2B9JA 3IGGA 3AXSA 1KIAA 2JKQA 3WZJA 4FV1A 2R3KA 2OWBA 4ZY6A 1OIRA 3RGFA 4CRSA 4EWHA 4YUYA 2B7AA 3HTXA 2JITA 4PV0A 3V3VA 1L3BA 3DBCA 1XBBA 2B9HA 4FBXA 3BHVA 5DR2A 3SHEA 4LRMA 1CKIA 3D7ZA 3V97A 3DV3A 1MJFA 4P7FA 1G60A 4UYNA 1MRVA 1WBSA 3ELJA 2VWVA 4O83A 1TPYA 2YM5A 1Z5MA 3SGLA 5EYKA 1VPTA 2PMOX 3MVHA 5M08A 2ZIEA 3FMJA 1F3MC 3FSKA 4FZ7A 4O21A 3UBTA 4C4HA 4JLCA 1RI4A 4CFFA 2J0KA 4QYGA 4B8LA 2R3GA 4V0QA 3UJ7A 3R0QA 3GCZA 3FUWA 1CMKE 4II5A 5DM4A 3MI9A 3FYDA 4XCXA 1CKJA 2WMBA 1ZHFA 3TDVA 4EK8A 3HCDA 2VO7A 3G51A 3UO5A 5LQRA 1BKYA 5DRDA 2J0JA 3QGWA 4EUUA 2VTRA 2QOQA 3VBQA 4B17A 4JR7A 2W4OA 4A4OA 4G3FA 4EH8A 3Q52A 4FSDA 3H2BA 1SNXA 5DRYA 3REOA 4M67A 1JKKA 4RZVA 1BL7A 3KGAA 3OU6A 4O7TA 3IO7A 5EMLA 3EYGA 5LCJA 4PNKA 2BH2A 4H58A 3NCZA 3BYMA 3GC7A 2OZAA 3W55A 3UTOA 4F1TA 2IN6A 3SXFA 2WTCA 4M0ZA 4NFNA 1YHWA 2W96B 5FUTA 1XXLA 2Q41A 1YXSA 3FC2A 1P1CA 3ZCLA 4D2SA 3GU3A 4F0IA 2ZTHA 3MYGA 3QRJA 1QYRA 4DG3E 3FZSA 2W1IA 4FKUA 3WF7A 1NVQA 2BAJA 2YJRA 2Z7SA 4WT6A 4YBKA 3VIDA 3A7FA 5AP2A 4ASEA 1QCFA 3FMLA 5ACBC 2QOHA 3EQCA 4GVAA 3RW9A 3C0HA 3GU7A 1IEPA 2ZDTA 4GU6A 4L01A 3RK9A 3NIZA 4EOPA 2CL5A 3EVBA 2EB2A 3GRVA 3SSOA 1M52A 4RIYA 4D28A 2WPAA 2PVYA 3VQUA 2F57A 2UW8A 4DLIA 5BYLA 4MWZA 4ZJJA 4V0GA 4YHTA 4P7KA 2YIRA 1BYGA 4NKSA 1PXJA 3OFJA 4O0WA 3HA3A 5LMAA 2XCKA 3OEZA 4DG0E 1O6KA 3QXOA 3ZLWA 2Z7QA 5KUPA 4WD5A 3EVFA 4USDA 2YCRA 1FPUA 3P2IA 4I5PA 3B5IA 8MHTA 1JTFA 5CT7A 2ITZA 2I0HA 3HV3A 2WB8A 3CKWA 3IW6A 4M14A 4J7BA 5IA5A 4ZJIA 4AT4A 4BCGA 2O63A 4C35A 2AOVA 2PE2A 5TKDA 4GOMD 2AOTA 5IG1A 2W5BA 4QQCA 2XBJA 3QTSA 4EVIA 2C68A 3AMBA 4YJOA 3KXHA 3KMWA 3G2OA 1WBPA 2YHVA 4UZDA 3RK7A 3UJGA 2ZV9A 2I9KA 1P1BA 4D5HA 2ESRA 3G8AA 5FEEA 2WQNA 4KW7A 3UWPA 2CDZA 4P5ZA 1JG1A 5IZFA 3U6HA 3OE5A 3M11A 3QV2A 3QGYA 3PPZA 2C6LA 5FLFA 2UV2A 4D1ZA 5AADA 5BNJA 2GAFA 4OBXA 1M0EA 2WMUA 2PY3A 5DBXA 4BHNA 3WSTA 1XH8A 4AW0A 1YRPA 4RZWA 4ER7A 4HGZA 2WEIA 3Q96A 5FA8A 5BVKA 3LBFA 2XB7A 2C0OA 3QC9A 3I6UA 4X3FB 2X8IA 4M13A 4RFYA 1LP4A 2OB1A 4ERKA 4FGBA 4ANMA 3O2MA 3FPFA 2CWWA 4X2GA 3T9TA 3BWCA 2F2UA 3BV3A 3B3GA 4MX9A 4HVDA 4BTFA 4B9DA 1G6Q1 3R2YA 4YZCA 5EYMA 1JSXA 5FG8A 4EQZA 2BUJA 3GT8A 4I6FA 1JQ3A 1RJEA 1SVEA 4CTBA 2UZVA 4QQJA 3HGKA 3GCSA 5L2IA 3SA0A 2BM8A 3B7PA 4FP9A 4RWZA 5EHYA 5AP6A 4DGMA 3MVMA 3TKYA 3KXMA 2ONLA 2FPOA 3R8MA 4DTBA 3NW5A 4E4LA 4WG5A 5CZHA 3IDCA 2GB4A 5HFJA 2PVLA 3OTVA 5FDXA 3LFCA 3OCBA 3QTWA 4L7FA 4QMOA 3G2PA 4MH7A 4JXFA 3TZMA 4DA4A 4ENXA 3JY9A 5K5XA 2VX1A 3R0TA 3THRA 4MYGA 1FVRA 5HNIX 4PMPA 3O7LB 2DS1A 1JQEA 3HRBA 2WIHA 1WAKA 4YJQA 3PP1A 5AUZA 4EUTA 1G55A 4RVDA 4IFGA 5E2BA 3FKNA 4E4XA 4G3GA 4RJ3A 5DWQA 2BTSA 3UIMA 4EH7A 4GH2A 1NA7A 3FMNA 3QRUA 3OU7A 2XKEA 3CIKA 4YUXA 5CUQA 4RJ6A 2BALA 3RHKA 1IA8A 4C4JA 4DFZE 2I0VA 1U54B 2QNJA 2XRWA 3KEXA 3R1QA 4FTAA 5BUJA 2PWLA 3A7DA 4OQEA 4PGHA 4R78A 2IDKA 1KP9A 2AZTA 4AOTA 4FSNA 4EEVA 4KNBA 3ATSA 3LXKA 2PMIA 2ORED 3N4TA 4CD0A 1H4LA 2BROA 2XVDA 3NCGA 1Q0TA 4GMYA 3MN3A 4IANA 4QQKA 3GDHA 2PU8A 3IEIA 2VWUA 3EB0A 4I0SA 2PVFA 3GQLA 4UY9A 1R1WA 2YTZA 4JAIA 3A2CA 4L44A 5BVNA 2GQSA 4DINA 3T3VA 3MHTA 5HNBA 3OOMA 3BU5A 1XO2B 4PMMA 4EC9A 1RDQE 3AD4A 3ET7A 5ICEA 3EZRA 2IJMA 4FICA 4OLIA 1K2PA 3UO6A 5I0BA 2CGWA 4PYLA 1UNHA 1PY5A 4BCFA 4FSYA 2A0CX 2B9EA 2ZOQA 3RCDA 4RRVA 2JH9A 5EZQA 3GOKA 1MHTA 3UOHA 4I23A 5LVNA 3T7TA 4K2RA 3DMGA 4BDHA 5I4NA 3KULA 3TKIA 5E8UA 2ZB0A 2PWPA 2P3LA 3TNWA 4O38A 4FZFB 4AA0A 4XG6A 3EL7A 3GB2A 4HGTA 3S2PA 1DI8A 3C3PA 1DI9A 5DI1A 2VTTA 3PSCA 5KMKA 2JHPA 4XP2A 5JGAA 3MAGA 5D1NA 2OK1A 4MQ2A 3KRXA 3KREA 3UJBA 1H08A 5KKRC 3E92A 3OMVA 2OB2A 2R6ZA 3QHRA 1V0BA 4G9RA 1ZOGA 4EHEA 5D11A 4DH1A 3ZC6A 4RTNA 5JFWA 5AP0A 1ORIA 5D12A 2YDKA 4R7IA 3MSSA 3ZDUA 3SV0A 4AW2A 4ONAA 4FEUA 5GM2A 5LWNA 2QO2A 4EORA 4HVGA 2QKRA 1XH9A 3EQHA 2CPKE 5AJQA 4DFNA 3R02A 3ELWA 3CCFA 5DRTA 4FKGA 4TYGA 3TUDA 5HILA 3I81A 4EK9A 9MHTA 2HZNA 3TV7A 2ITXA 2R3PA 3B2WA 3CD8A 4W8EA 3R6TA 5E8RA 4WHZA 1OL2A 3HEGA 3L9LA 3OXIA 1GNGA 2I0YA 4FT3A 3LFSA 2Y1WA 5AAGA 4OA5A 4IAZA 3Q7EA 3S00A 2B2CA 4C03A 4S30A 4ACDA 3M6UA 2OXDA 3QQGA 1VZOA 4E5BA 3LX6A 4HTFA 3I58A 3PS9A 1F0QA 3TTIA 3GRYA 1KPGA 1M6YA 4YV2A 4ITJA 3FLNC 3BWJA 4R3CA 5GNKA 3ZS5A 1Q62A 4HNFA 4JBVA 2IO6A 4C58A 1GOLA 3ER9A 5EKXA 4X6QC 4EI4A 3G0FA 1X19A 2WO6A 1W7HA 4F7SA 3E87A 2NO3A 5FD2A 3H9RA 3NPCA 3WBLA 4EK3A 4YP8A 4LWOA 2O0UA 3DBQA 3FLWA 1AF7A 3IDPA 2I1MA 3KPVA 4DFYA 4USFA 5KMJA 2XVMA 3F7WA 3PA3A 3KXGA 5K4JA 2QM3A 3PFQA 5KNJA 4HCTA 3KQWA 3R9XB 1G8AA 2ZLBA 5EMMA 4I0RA 4RIXB 4FZ6A 2JIIA 4S2ZA 2X39A 4U80A 2P7HA 2G15A 2IWIA 2HZ4A 2BRNA 4UEUA 2J51A 3QRIA 5CVGA 3MH0A 3IW7A 5BYYA 3L1SA 2FK7A 3LM0A 3EFLA 5CAPA 4J52A 3KQQA 1IA9A 3GQIA 3DNDA 3VJOA 5F9EA 5KMIA 2V5QA 3DLZA 2C6TA 2CN8A 1HCKA 3MJ2A 2IZSA 2QG7A 4HNIA 3RCJA 4FKPA 3R8ZA 2FGIA 1L8TA 4HJOA 3UYSA 3OCTA 3R2BA 3WARA 2VNYA 1TW2A 3NAYA 1FVTA 5DT3A 2WK1A 2WD1A 3EHAA 4TN6A 3SW4A 3VUMA 3CJGA 4G3CA 4I94A 3PFHA 4XG3A 3ZFYA 5IQEA 4CRLA 5AM6A 3NVKI 5E9WA 1P4OA 5CQUA 2OKCA 4UN0C 3BGQA 4YJPA 3UOKA 1H24A 2JH8A 4OW8A 4XBRA 3FLZA 4FV8A 4FT2A 4A06A 4BCQA 3UGCA 1B42A 2OY0A 3HUBA 1INLA 2VO6A 2ZIFA 4IWDA 3HRFA 5EHIA 3RPYA 4BCOA 2R0IA 4MK0A 3HRCA 1LUFA 3VRZA 3AC4A 4ZTQA 4O86A 4AGDA 2WELA 3R83A 4BDIA 5BQ0A 1F38A 1SVHA 5HTCA 5FTQA 3DXYA 1VLMA 5D9HA 2OIBA 2UW5A 4GKHA 4NCTC 4XOYA 3BIZA 3MH2A 3LXLA 5BMSA 5IA3A 4XP0A 1TQIA 3B3JA 4I1ZA 3EVDA 4PL3A 4RJ5A 2GS6A 2RL5A 4YSMA 2ERCA 4R3PA 5DYJA 1Q3WA 3C51A 3BZ3A 2FA2A 4NL0A 1ZG3A 5CVFA 2BR3A 5AUYA 4F9CA 2X4ZA 3MFTA 1WXXA 3F2RA 2AYPA 3TLJA 3WE4A 1UA2A 3OUKA 4CT2A 4DLJA 4V0RA 2XEZA 4IV0A 2CLXA 2YM6A 4IDVA 5K01A 1H25A 3V5WA 4BRXA 3HV5A 4IC8A 4QMZA 4RPVA 4RT7A 4F7LA 2XEYA 3WILA 4E26A 4U45A 2G9XA 4PDPA 4FV9A 1GZ8A 2PUUA 3ZM4A 2GNJA 2ZV2A 4FTUA 3PG3A 5ANDA 4E7WA 5IQFA 2V22A 1HNNA 1JPAA 3PE1A 4FV2A 1EJ6A 3MCTA 4X1OA 4OGRA 4AU8A 2H8HA 4EL9A 3M1SA 1PJKA 4OTWA 4Z7GA 3Q32A 3DB8A 5HIBA 2UZUE 3KQMA 4YJRA 2IGTA 4NUSA 4FOBA 5GHVA
chains in the Genus database with same CATH superfamily
1SNYA 4ZTBA 1EAYA 4IMPA 2ODWA 2R3HA 2WBLC 1GUAA 4I3HA 1ZN2A 1THZA 4IGFA 2R6AA 4RX7A 4C2AA 3VR2A 2NW6A 2YW2A 2XW6A 5KO1A 3PWZA 5DTRA 4D82A 3E5MA 3S1AA 4LYNA 1V1MA 3NNWA 3Q4TA 2DWUA 2ST1A 2BN4A 5CF6A 3T0GA 1D8AA 1KK2A 5EUMA 3SJ7A 4U6NA 4PMTA 4UE3S 3D6VA 2GHIA 4ZZMA 3DCYA 4AWAA 4RC2A 4EQ6A 3N70A 3H5TA 1ZOLA 1CB0A 4Q3AA 1DAPA 3MWGA 1C9JA 4M7RA 3GRKA 4BRWA 2Z83A 4YNBA 3IODA 4PTLA 1DRVA 3ZJUA 1S2LA 5IU6A 1GNVA 3EXG2 1KVTA 1G6OA 4YB8A 6ADHA 2J30A 2AW5A 2QNRA 2R5NA 3DK6A 1RHRA 1O4WA 3WYBA 3BK7A 1NVVQ 3O8NA 2HA6A 3E22B 2B3TA 5A3SA 3LCDA 2W1HA 2GSFA 2BDEA 3VUKA 1ZXLA 1XU9A 4YZDA 4B43A 1Z2NX 1HORA 3F74A 4RIYB 3A25A 5DCUA 3ZH2A 1UP4A 4G5YA 4L74A 3ZQUA 3HADA 1G0NA 1BDBA 4RS3A 1OPRA 3QNWA 3NV7A 4K9LA 4C3UA 1RKVA 3GNTA 4J9UE 3NMUF 5FT9A 4WLVA 2ZVAA 1X77A 4E73A 2FY8A 2X6TA 1XTZA 2C2KA 2WW8A 1BJTA 1GTMA 5MN6A 4FX2A 4DA6A 3AHIA 4LC9A 1PG0A 3BWVA 5FA6A 2YYZA 1EUDB 3JSXA 4TSFA 4UXJA 3WLPA 2FWMX 3HMKA 1P2GA 2CLCX 4F12A 1F6BA 1JXQA 1OZHA 1FMKA 3RF6A 1KH1A 4CEHA 4CQLB 3MF4A 4AA5A 3NBKA 4CCAA 2EFCB 5BP7A 2X15A 2J4ZA 4AXCA 5DGXA 1A82A 4UBJA 3EDRA 3AHEA 4BMZA 1NXPA 4EB8A 4DNQA 2PSSA 1SM4A 1U7OA 4TYQA 3MJFA 3QXXA 3OFNA 3AKDA 3D1LA 4AUMA 1JRLA 4MV8A 4U7HA 2WTUA 2DUVA 3IS5A 4GKJB 3WLEA 3K4HA 1QS0B 2XUPA 3EHDA 1TZMA 1RIFA 1OPLA 4EH9A 4WOPA 5FTKA 3UOLA 5A6NA 5C4IA 1PXPA 4IJQA 4K05A 1R3DA 5FXQA 1CP2A 1UOPA 3MM4A 3L9MA 5DLSA 1MPTA 2OTCA 3NCHA 3OPQA 3N7TA 1QANA 2F7EE 1SULA 2J32A 4IDOA 1K8RA 1T6ZA 3LF1A 4ZZIA 5EMJA 2IODA 1RAAA 4PU0A 4Z9FA 3TCXB 3ICPA 4LY6A 3CR8A 5IYZA 3Q3HA 3IP6A 1T2CA 3STXA 4A2QA 3FR8A 4REQA 1J7UA 5A7GA 4U42A 1PR4A 5LA6B 4YONB 5C5CA 4M36A 4NFMA 4UAVA 4NS4A 2WJ4A 2BR1A 4AICA 2JAMA 1U98A 4AOJA 4DWOA 5K8JB 4I21A 5ALRA 1HL7A 4M7IA 4XYEA 4UUBA 2F64A 2I3BA 3MA3A 5HQJA 1DP4A 4ZIMA 3DONA 1RHJA 4B7XA 5U1PA 2QENA 1NASA 1RJDA 1YJQA 5CFOA 1FTGA 1HR0B 4AKGA 3PIRA 5KYYB 2R44A 3TAUA 4GL2A 1TO1E 1SELA 2DBQA 4MRVA 3X1KA 1GZ6A 4J7UA 3KELA 2WA1A 2PAAA 3MTEA 3BSFA 1E79D 4Y2GA 5JISA 1P5RA 1W48A 2G5PA 5T68A 3LTEA 4PO1A 3GRCA 1SHZA 3LOPA 4D4RA 3VSDA 1VJRA 4HWSA 1R0BA 3MOGA 2ZUFA 1KZGB 5AP5A 2C5GA 3RBXA 4UM9B 3BIOA 3L8SA 3VZDA 3TM4A 2YY7A 3CWQA 2FK8A 4WXHA 5JNVA 2QR2A 4ZANA 2ZVQX 1TM5E 2N1MA 3H86A 1NXVA 1ZYSA 1H6BA 1XMXA 4WSYA 1WBJB 1N2ZA 2OMKA 3H8WA 2D59A 3BGZA 3WK8A 4PYNA 4F3RA 4DCCA 3P7MA 3HZTA 4W7SA 3KJGA 1DM2A 4FIIA 1ZVMA 5IKOA 3NBQA 2G2HA 5AHKA 3K15A 4I4LA 2XUAA 2ZB8A 4ORKA 1XDGA 1BDMA 2Q29A 4RV9A 2GKSA 1D1QA 5EYDA 3VX3A 5EQFA 4Y0AA 3IAEA 1AK9A 5E0OA 3UHAA 1W59A 3UGJA 2VDLB 2XDQA 5FPHA 3SAJA 4B3BA 3D15A 2CMDA 3HMOA 2JEYA 4Q4HB 5CASA 4AP5A 2E9SA 4JJ8A 4JDUA 1G3QA 3GRUA 2GWRA 4XWOA 1GKLA 5FRDA 2LR0A 5CBPA 3ZY4A 4RY9A 4DY6A 4IAAA 4YJTA 1CV2A 3A9SA 5C7LO 3AJAA 4B4LA 3HMPA 5EAIA 4C20A 1J9ZA 3D8RA 1ORHA 5IX8A 3LFDA 2W6ID 2X0IA 1VL0A 2ITTA 7REQA 1R4NB 1JVSA 3VYVA 4ABTA 4C4FA 4HCUA 2XE8A 1K98A 4EY4A 3PDWA 1G3RA 3O2NA 4KAXA 2PX3A 4D58A 5B2ZA 3ROQA 5CNNA 4LF4B 3M5PA 3R7OA 1HDXA 2PUPA 2OJJA 3ORNA 2OFWA 3OW4A 4EOSA 2NTVA 2YWBA 4UBNA 3BULA 1C14A 3FG9A 1DOZA 4HUJA 4X0EA 2QO9A 2OWDA 2I8LA 3ZE0B 4OQLA 3CQEA 1A5AB 2A9KA 4PC3A 4L4SA 3VXKA 2W1FA 4JJ6A 2AUNA 3PPJA 3FWQA 4XVCA 1TA9A 4ZGGA 5EKOA 2EW1A 1XH5A 1E6EA 2HLNA 2RK6A 3T7IA 4R5YA 1KI9A 4CM8B 2EQBA 2XRYA 4KKVA 4YNEA 1S2GA 3VTAA 1ZY4A 3KWJA 2UZLA 5CG1A 2PUFA 3GCQA 3NFYA 4H1WA 5C01A 4I9UA 2ITQA 1NI4B 3M6AA 1YHSA 3JZFA 4B0PA 4LDRA 3CE6A 1Z26A 4FVPA 3DB6A 2BFWA 3MYRA 3NDJA 2HT1A 4AJNA 4GFDA 1Z4NA 3W2IA 4W9RA 3DFZA 3HV2A 3UT6A 4L73A 2RHJA 2P40A 2GCOA 4J53A 2WTKC 1F8FA 4QOXA 2DPXA 3L9XA 1ZFNA 3M4ZA 2OFUA 2HIGA 1IN8A 1Z74A 3HCWA 4KR9A 1OASA 5CT5A 3PJ2A 3UA4A 1YI6A 2HU8A 3JPWA 1QTNA 1YS9A 1YJAA 1ORTA 2P0YA 4WJLA 3JQBC 4F9TA 4YCCA 2XM9A 1JVNA 1C29B 5EFQA 2DXIA 2V0DA 4HAVA 5EMHA 3RSGA 1L5NA 2JHCA 5KU1A 1GARA 3CVWA 4DWWA 2YCBA 2JF0A 4FB4A 4QDTA 1ZJ4A 2ZPTX 1G5FA 3HI4A 5GY7A 2W2TA 4WRGA 2RGNC 4MS4A 4KS7A 1DAYA 1IDOA 1SVOA 4R71A 4QM6A 1N5JA 3QRWA 3QX9A 5L45A 4PRYA 1U0EA 2Z3WA 1L5ZA 2X8DA 3D7NA 5FPQA 1W83A 4DLYA 3REFA 4EPVA 8GPBA 2CDBA 1XROA 1E2QA 3D9QX 4DYMA 1XCBA 2IXGA 1QFXA 3EGWA 3PCTA 8LDHA 4PHFA 4EBVA 4P2KA 4DDMA 1YXVA 1HTBA 3AFIA 3QFTA 1B3RA 2ODBA 2CKOA 4JI4B 2V7AA 1PUXA 5AIKA 4R68A 2C42A 3B6ZA 3H4IA 2P2SA 2VAWA 1BMTA 1AQNA 2MYTA 5IUIA 2QTCA 3NOOA 4O96A 3ZXTA 1NHWA 3DEHA 4MI9A 3LCKA 2ZYTX 5DR9A 3GVHA 3PUJA 4YP7A 3OSUA 3INNA 3HLLA 1N9GA 5FTMA 3P5JC 2C1AA 4IUDS 1E0JA 2FX2A 5MN5A 4C0HA 2VHQA 3A7JA 1W2WB 5E8YA 4Z1MD 2RONA 4Z2AA 3N0VA 2FKAA 1U4SA 1XSEA 2GN6A 1RC8A 4BFLA 2QP9X 1M2KA 1ZIPA 2IH5A 3QUSA 5JGDA 3RS4A 1MQBA 2O0MA 3I0NA 1MGPA 3MPOA 4F45A 4KFTA 4KRDA 2BILB 3PGVA 1B8OA 1EQAA 3KZCA 2HCKA 4XV1A 2R3JA 4TM8A 1HNZB 3KBOA 4PC2A 3L7CA 4PHTA 2DUJA 5B2MA 4DDWA 3ENHA 1H0VA 3CNLA 3LFHA 4U7FA 2PMBA 2I67A 3F47A 3HCPA 2IEAA 4K3VA 2GTNA 4JI9A 3M4XA 3EGCA 5L3VA 5EJ9A 521PA 3HM9A 4AF8A 2CZGA 4M46A 1GYRA 3QXJA 2I03A 4RTLA 5AMNA 1VLQA 1QHIA 4IZOA 1Z3IX 3CF2A 5IT5A 4B48A 3RPOA 5AM3A 4HK4A 1NP6A 4XJTA 3IVGA 1PYEA 4YTCA 3C4XA 1F4VA 1RWOA 3QOXA 3R5SA 2HDOA 4YRFA 2SKCA 2ZSBA 2JHGA 3LQRA 3TVYA 2C9YA 3QZIA 4CWAA 2C2GA 5AHWA 4B82A 3EE6A 3E5AA 1HSZA 4AZTA 3LLSA 3WSWA 2COUA 3V1YA 4EWQA 2V7QD 3G5TA 4A6PA 1LQUA 2WUDA 4F0GA 3R00A 2CJWB 2AC7A 2NP7A 3JWIA 3S4QA 1KNXA 1B41A 4CQMA 3KCFA 2PQ2A 2H11A 1K4MA 3BGSA 4OBQA 1Y4ZA 4GDMA 1SOUA 1MO3A 5JG7A 1OBCA 3HV6A 3BILA 4J07A 3KAPA 4A0RA 4FCTA 2NG1A 5CU4A 3EQRA 2I3ZA 3O1HB 3W0PA 1O95C 1QZTA 2RGGA 3GCVA 1JNKA 1M33A 4YRKA 3DP9A 4QDXA 1QK3A 2SHKA 4BTKA 4E6EA 4UEWA 1G6HA 3HKEA 4CUZA 4CR6A 2JGKA 5ICFA 4UM9D 2IXEA 1A9QA 4ZC1A 5C8DA 4OVKA 4J0CA 1HRDA 5CLIA 4EO9A 1ZX1A 4JVLA 1GEEA 1KRXA 2WF6A 3MD0A 3JAKA 1AQUA 4WZBE 3HXLA 2R1VA 4G65A 4YJFA 1OX6A 3VS1A 3UIXA 3AR9A 4CT0A 1N5DA 2Y1LA 1HYQA 5EJ4A 3COWA 5F7XA 3DPKA 3P20A 1JLKA 5DVZA 5E38A 2DR0A 3BERA 1XKTA 4H05A 1E5LA 4ZDWA 3RYIA 3OKCA 2F7SA 1K88A 3UHJA 1WMEA 4EEXA 3VGPA 1YI1A 4F1JA 3KK8A 3A3OA 3NALA 3VR0A 3T9FA 4M97A 1ODKA 4HHEA 2ZPAA 1NBEA 3AKKA 4F4IA 3QBEA 3V1MA 4NYJQ 4P38A 4Q5EA 5F3WB 4TKSA 5CU0A 1VIVA 2QXUA 1KV2A 2ECOA 1YRQA 3H6GA 4ZVRA 3BYUA 2CFRA 4KZPA 3FOBA 1KDRA 4R1OA 1E3TA 3LPLA 4RKQA 3QPUA 2XNPA 1JSLA 1JR6A 3TLKA 3X0DA 1OYWA 1QGYA 4MYUA 2E21A 2AN3A 3NIDB 2ZT5A 5HTBA 1D8TA 3INRA 1CUGA 3H5IA 1EX7A 1P31A 4C3RA 1IJKA 3KTDA 2F8LA 1OH6A 4CXAA 4CL3A 1OVGA 2FA9A 3MPTA 1M2NA 2CNBA 5HG8A 5C5IA 4MPDA 4XEHA 4CFZA 1HM5A 4Z4FA 4K2AA 5AW0A 4BP3A 3I3SR 1E1VA 1WHSA 4QDVA 1VJ1A 5A6SA 4BB5A 4XWWA 1ODJA 1D6NA 4CSVA 3OCWA 4DB4A 3AF2A 3K6RA 1LJLA 1E3LA 1V4BA 4UW9A 4HNAB 3D3NA 3QWHA 2WUVA 3UGTA 5KTPA 4A7PA 1Z0AA 4Q7EA 3W5BA 1LSUA 3OSZA 1NQWA 1Y82A 5AP3A 1SC4A 3D64A 1GRVA 1F6DA 3UG7A 2PX0A 3N5KA 4B5LA 2DTDA 2AG0A 1BX1A 2XKKA 3N39C 4CKCB 1DFHA 1FYXA 2LV8A 1GN9A 3DV0B 2QQ7A 1CQIA 3FPCA 4FMQA 2G09A 2WNTA 3KP1A 3DNMA 1DRUA 3JASA 5HZKA 4DT8A 5M07A 1P7VA 4ONEA 2WSSA 2VQSA 4RMNA 2HL6A 1KAEA 5KTRA 3PRJA 1D0IA 5FQOA 1XLWA 3B6IA 2P11A 5DFAA 4DBVO 3QE4A 3IHTA 2WDPA 2XRMA 2WWTA 1QH9A 2Q4EA 3P4YA 4QFDA 2ZW9A 2GAJA 3SXPA 5F77A 4MIEA 3RT9A 4QTAA 7AT1A 1WDWB 1NKSA 2BDJA 3T1YB 3VC7A 1DDGA 2O06A 4JLWA 4BCCA 2IGBA 4F9FA 4R7TA 4BE4A 3AIOA 5FEUA 3SVLA 1FMTA 3F66A 5G2OA 3PA5A 4UUNA 1A9OA 1NBHA 2J0SA 5FB3A 1P4GA 2QMZA 1ZOEA 4O4LF 2ZJ1A 3MGBA 3UP7A 5FOQA 2YQ5A 1YKFA 2GNLA 3GXBA 3I5UA 4EG4A 1KKLA 5FBWB 5G1XA 4YGXB 4ZCSA </