5GIPE

Crystal structure of box c/d rnp with 13 nt guide regions and 11 nt substrates
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 68
structure length 227
sequence length 227
chains with identical sequence F, O, P
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gipE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gipE02
2J0JA 4IV8A 5HE2A 5BP7A 1DCTA 4MD8E 3DLIA 4IE9A 5GP1A 2BAKA 4EH9A 1WXWA 4YV1A 5JGDA 4QTAA 5ICFA 3SDJA 1GOLA 4I21A 3C5IA 1BMKA 5ANJA 4HGTA 5FQDC 5IUIA 1XVAA 4D4SA 4BDAA 3PG3A 1XBCA 4LFIA 5LQKA 3LX6A 1XH8A 4TZRA 2PVJA 1SM2A 4D9TA 4O7WA 4YV2A 1PF8A 4H3BA 1H27A 4DEIA 4DH1A 4X6QC 4J8NA 5DT4A 5EW9A 3UBTA 4RJ5A 4AOJA 4EH2A 3Q6WA 4BICA 2ZVJA 4PMMA 2VDUE 2O05A 4U41A 3V8WA 2R3JA 3HDMA 4QT1A 4OX9Y 4Z3VA 1U4DA 1AQIA 2ZIFA 3IHTA 3DJ5A 5M51A 5FD2A 3KXXA 2XK9A 4FTOA 2RFNA 1OITA 1RJDA 1P91A 3OU7A 2GQGA 4BDJA 2DYLA 2VX0A 2YM4A 3PXZA 2PMNX 4V0GB 4CXMA 3R7OA 1DS5A 4MNEB 4I5CA 4FTMA 4KRDA 5E2AA 2VGOA 2AOUB 3R0QA 3NMUF 3A60A 1ERKA 4NTTA 4G6OA 2J0IA 2UZLA 5EFQA 4B8MA 5BMSA 3LGAA 3EYHA 4IEBA 3I58A 2AOXA 3PE2A 4LQMA 4YTCA 3GEQA 1H08A 1J7UA 4GL9A 5BVEA 1PMUA 4E1ZA 5IZFA 2ZMDA 1YDRE 5BUJA 2YQZA 1Q0TA 5AP3A 4D0WA 2WELA 3FY0A 5HIJA 4JG8A 2C3JA 4QMQA 3Q6UA 4FV2A 1IXKA 2YR0A 3DNEA 5EYKA 5K03A 1F0QA 5HQ0A 1KUTA 2BR5A 5HFJA 4ER7A 1UNLA 2G2HA 4G3CA 4O21A 4C3PA 5J9YA 3MFRA 3EVBA 5T6BA 4PNEA 5H2UA 3UIBA 2P3QA 5C9ZA 3HP2A 4R6WA 3ZEPA 4GW8A 4D5HA 2ZFUA 1YHSA 5EDRA 1OL1A 4IJ9A 4IWQA 2PT6A 2X8DA 3C51A 2GDOA 5AUUA 5K0JA 5EH0A 4R05A 4FTRA 3NJRA 3F3ZA 4IJPA 4C4IA 3AC8A 5EM6A 1WMKA 5JFXA 4ZTSA 3MTEA 3VS3A 2X39A 4EMSA 3FZRA 2VWWA 5FA8A 5FTWA 2P7HA 1ZKDA 4PL5A 3H0YA 3M4XA 4EHVA 5C26A 4MBLA 4S34A 4FT5A 5E1EA 3ZXTA 2VUWA 2X2MA 1JQDA 2GLUA 3DBDA 2E5WA 4Z16A 5EKXA 5IQAA 2XVMA 1IA9A 3NYOA 1V0PA 3S3IA 1KPIA 3SSMA 1JTFA 3UPZA 5AP7A 3F5GA 2CMHA 4GOOD 4DHFA 4C4AA 3N4UA 4A07A 2YABA 1J1CA 1KIAA 2ITYA 4LL0A 2UW4A 4M38A 2NXNA 2VD5A 3RM6A 2PZYA 2PKWA 3ELWA 4I0RA 1OIQA 4EQCA 4IIRA 5TOZA 3HNGA 4FZAB 4J98A 3DNDA 5HLPA 2Y6OA 1U5RA 4AACA 3NNUA 4XG6A 3W2PA 3BWMA 2B9HA 4F86A 1KE6A 4BDKA 5C8NA 3PS9A 2IN6A 4Q9SA 4U3ZA 1BL7A 2HIWA 3HMNA 4W4YA 3BU3A 3W33A 5AAEA 3OFMA 3PTGA 3OZTA 4XG4A 4N4SA 2P2IA 3BZBA 5DPMA 5I9VA 2HTEA 4FEVA 3BIZA 4FTUA 2Z60A 3QQUA 4XMOA 3BWFA 5E8ZA 3VWAA 4EOQA 4RX5A 4BDGA 5E7RA 2FPOA 4OT5A 2OGVA 4L01A 3PIXA 1G60A 4FICA 3VJNA 3RNIA 4D28A 1JSXA 4O83A 5CANA 1GIIA 2XYUA 1QPDA 3SRVB 4EEVA 5IA0A 4ZJIA 4DKJA 4DC2A 4CLIA 3A8XA 2VTJA 4FSYA 4ONAA 3NWWA 4UXQA 3L8SA 4YTIA 1JVPP 3QV2A 3T7SA 2H6DA 2XIXA 4QTTB 3FYKX 4FL2A 4FTLA 2FYTA 3THRA 2XBAA 2Q83A 3A7HA 4L53A 4XRLA 5M55A 3WIKA 4AE9A 5JZJA 3P08A 4K6ZA 1Y8GA 3C4WA 4FKVA 5E92A 2OZAB 4AZVA 1A48A 3A7GA 3ZO3A 4R6XA 4ZSGA 5H3QA 4BTMA 2JH9A 1DI9A 3MPAA 4MNEA 3ENMA 3BI6A 4RX1A 4K9YA 2SRCA 3F5UA 2O57A 1IM8A 3N51A 4QDJA 4KNBA 2J9MA 3ZSIA 1A9UA 3VBQA 1EH4A 3NUSA 3MH1A 4BR3A 3GOKA 4ZMFA 3NW5A 2QO7A 1NW7A 2Q41A 1UA2A 3UJ7A 2UZBA 3DK3A 1UU7A 2QNJA 2VTSA 4FKLA 4B8LA 2UZUE 3KXHA 2UW0A 4EJNA 2RFDA 3WI6A 4C4EA 5A14A 4FZ6A 4FTIA 4UXLA 1RJEA 5CEMA 2FCAA 3M6WA 2HYYA 2W7XA 3O2MA 4O0VA 4D2RA 4EZ7A 4F64A 2A14A 2ERCA 2JC6A 1AV6A 3ZC6A 1YB2A 5FDXA 1YI3A 2CGUA 4CGAA 4DCAA 4EC9A 4CTBA 3HMOA 3F5PA 4J97A 3R8LA 3UO5A 5EW8A 5JZNA 1OL2A 4QDKA 4EUTA 1BLXA 4RA5A 1KE9A 3RPVA 3SC1A 5IG1A 3I6WA 3KMMA 4GVAA 4P90A 4AE6A 1ZGJA 4AUKA 2J4ZA 3DBFA 4O7RA 4C34A 4EYMA 3BHUA 5C1IA 3DXZA 3ORXA 4BBMA 3HAMA 3GU6A 3S95A 3QTXA 1U54A 4BVUA 5EYCA 3FHRA 1LPUA 4RZWA 3BGQA 4ZS4A 2F9GA 3ZOSA 4F4PA 1WAKA 3CQWA 2QOBA 4AZEA 2W9ZB 3CPCA 2QURA 5D41A 1OL7A 1YDTE 4PIMA 4O0RA 5AIRA 5EHYA 2ZZNA 2PVHA 2B53A 3TTIA 3RINA 4BDBA 3EFJA 5C4LA 2QE6A 3OY1A 5HEKA 3GXOA 3G6GA 1JSVA 4PYIA 2IP2A 1ZQ9A 2XJ0A 4YLKA 5ANGA 3LJ2A 3PG1A 4PL4A 4IAAA 4OUCA 5AJQA 5DHJA 5J9ZA 2PSSA 1LEWA 2QG5A 3PLSA 4H1MA 3NVKI 2HELA 2XM9A 4LG4A 2ADMA 3QLGA 4PDPA 3CD3A 1LEZA 3LAUA 4DFUA 5IA3A 4YJOA 3JPVA 2FK8A 3SVZA 2ZZMA 2JLDA 3EL7A 5FM3A 3GRUA 4I4FA 2DULA 3EVFA 1WZYA 5HNGA 2WTVA 5H02A 4DMGA 4G17A 4D1SA 5AUYA 3HUCA 2OBJA 4XOYA 3MV5A 2W4JA 5GJFA 4RVTA 2PWLA 4FL3A 4XOZA 3W2QA 1OUYA 2B9FA 2C69A 2CHLA 3IW4A 4IZYA 3V5QA 3WBLA 3PVBA 4ANLA 2CKOA 4P7FA 5I0BA 2OPBA 4UWCA 4BDCA 1W84A 2AUHA 3EEYA 5IH6A 4FT2A 3U81A 2WMTA 3GC0A 4I4EA 3ALOA 2QLUA 4K33A 4LV5A 5H8EA 4ZMEA 2W96B 3LFDA 3R1YA 4FSRA 5K09A 3CY2A 4I92A 4L9IA 4AW0A 2R3SA 2NO3A 4OBWA 4CZTA 3KK8A 3NNXA 3SAYA 1MUOA 4EK5A 2YA9A 4DYMA 2OO8X 4HVIA 3G2OA 3M6XA 2W1EA 2BDFA 2HW7A 2WQMA 3FLWA 5E8UA 1IR3A 3EVGA 2B9EA 3FPEA 4YSJA 4C2VA 3SA0A 2Z6AA 3A27A 4G6NA 3TCPA 3QALE 4R7IA 2R3LA 4JIAA 4X3FC 3FMNA 5FLFA 2OY0A 2UVYA 3HNRA 2PZIA 4PIPA 4TWOA 3W1FA 5JH6A 3N4TA 4I3ZA 4QMOA 4PYQA 5CU0A 2B54A 2PBFA 3O0GA 1BKXA 4Y72A 4ORKA 3A7DA 3FUXA 2UZTA 3UNJA 2BDJA 5D1HA 5HO7A 2HR1A 3BXOA 1JG4A 2Z7QA 3Q32A 3W10A 1YWRA 3MTLA 2BR4A 3KQVA 4C2WA 3EQRA 3QD0A 4L44A 3ZRKA 3QRIA 2AZTA 3A7EA 3ELDA 1R0PA 1NY3A 3FMLA 3SW7A 4HOKA 4X3FA 1QANA 3DXYA 5FADA 4IB0A 1APME 2OXDA 5LMKC 2QYOA 5JR3A 2PUNA 3ORTA 4MD7E 5CTPA 3RWQA 2CMWA 4UN0C 3QZGA 2XA4A 3W2OA 1H1PA 4XV3A 2AOVA 3G7UA 3F2AA 3U6IA 3BKXA 2W1DA 4GUBA 1UV5A 4MEDA 2ETRA 3F3TA 4WG4A 4JG6A 3I7BA 4EZ3A 4QP2A 3GI3A 3C50A 4YC8A 1ZMVA 4FI1A 3PUPA 3QTQA 4JR7A 4QMXA 4XG3A 4E20A 5A4QA 5KMIA 1L1EA 1VE3A 1Q41A 2VDWA 1WVWA 1RE8A 4NM5A 3H10A 4RGJA 4E2WA 3PIYA 1R78A 4F85A 2V7OA 4MBIA 4FT3A 1D2GA 4XH6A 1DUSA 4PYLA 1L8TA 1XTPA 1WBNA 4KWCA 1OZ1A 3OTUA 4IB5A 4QMUA 1KYZA 3R7VA 3SMQA 3NCZA 2EU9A 1TVOA 1X1AA 3P9IA 1U54B 2G01A 4G56A 2J0KA 2YCRA 3THBA 4L52A 3UP7A 5M06A 5IKMA 4PF4A 4AGDA 2XVAA 4FKRA 5HIIA 3LBYA 4R7BA 4DN5A 5IISA 2UVXA 3OCJA 2P55A 4KAOA 4RX8A 4LOPA 2YM3A 4NH1A 4RIXA 3GJYA 5D11A 2YXLA 2PZ5A 4IZ7A 2WFYA 2IJMA 2PPQA 3FLYA 4YU2A 4EK6A 4C0TA 4RQVA 2HY81 1NW3A 4GU6A 4C35A 4DCEA 2C6LA 3SR4A 3TLJA 4F9WA 3FMKA 4APPA 1KR5A 3O7LD 4FG8A 5B2KA 4M7IA 4W8DA 1CKJA 3P1AA 4C3FA 3HVHA 1QCFA 3RJCA 3IKAA 4DTKA 1MRVA 2QG7A 5KNJA 4YLLA 4EOIA 4TNBA 4D1ZA 2PWPA 4RTNA 3HVCA 3TZ8A 2W06A 2H96A 3LLTA 3OW4A 4GH2A 3DAJA 4NJDA 3V5LA 5AV0A 3VNTA 4E2ZA 4YUWA 3FAAA 1DL5A 3I5ZA 4YC3A 3P4KA 4QQNA 3ACKA 1Y91A 3SV0A 3EQHA 4AGCA 4DGOA 3D5XA 5C9CA 3GCVA 1H01A 5GNKA 3GP0A 5HKMA 2FK7A 5FEEA 3THSA 5HCYA 3CJGA 1ZMWA 4A9YA 5DXJA 3R63A 1G38A 4F6UA 2QHNA 2OFVA 2OXYA 3DAKA 5CSXA 3SKCA 3QOXA 4HSGA 2WZJA 2X81A 1YW2A 3UWPA 2C0OA 1HCLA 1KE5A 4E31A 3GDHA 2BZKB 4LMNA 3IECA 1JSUA 4L46A 3FKOA 3OG7A 2PTKA 5H8GA 5IMXA 3KVWA 1FPUA 4GK2A 3F7WA 2UZOA 4QOXA 3RGFA 3DU8A 3GC9A 1ND4A 3OWJA 2RL5A 5DTMA 4RJ8A 1WVYA 3I79A 2YCQA 2ZDUA 4YC6A 3JY0A 2Y6MA 3R2BA 2ZDTA 4M8TA 4RLKA 5M4UA 4P58A 5DTRA 3V6RA 5EG3A 4WOVA 1HMYA 1RI3A 2FHPA 2R7BA 1ZYDA 3QX2A 3W16A 1VP9A 2FUMA 3Q87B 2WTKB 3RI1A 3LLAA 2WTDA 4XRJA 5CX9A 4AA5A 1Z9XA 5KMKA 3BYOA 3PTAA 4C37A 2R3MA 1OI9A 4Z7HA 1O9GA 4N70A 5L8JA 4IHPA 2P3LA 3KQWA 2WMVA 2IPXA 1Q97A 4DG2E 5IH4A 2B4SB 3NUAA 4TWPA 3CEKA 2B55A 3DGKA 4X3FB 5FTGA 3T3VA 3VS4A 3L1SA 5IQIA 4CKRA 3C9WA 3QRKA 4BY9E 3MI9A 4GOND 4TYEA 2G9XA 4GIIA 4RIYB 2DQ7X 3V3VA 2V7AA 4W4XA 5I5ZA 4MH7A 2IW9A 4RRVA 5L3AA 4RVDA 4JDJA 3IEIA 3PPJA 3KRLA 3Q5ZA 4CNHA 1KWPA 2C3IB 4L7FA 4QYFA 4YBJA 2BRMA 5CM2Z 2PVLA 4XUEA 4BTKA 4N57A 5FGKA 4ENXA 1Q8UA 3DK6A 3UFBA 3KEXA 3R8PA 2GHMA 4X6RA 4OA5A 4QMLA 4RFZA 1XH5A 3EQIA 5K0FA 4C59A 1UWVA 2XNMA 2Y4PA 3PJ3A 4RG0A 4V0GA 4AP7A 4F1TA 2WTJA 1GY3A 5CXZA 4GC5A 5HG9A 3R7IA 5ACBC 3OUNB 4QTEA 4NUSA 4DFLA 1K3AA 3BQRA 3AMYA 4HYIA 3GGFA 3AD6A 2R3IA 2X4ZA 4YTHA 3HKOA 5AP2A 2AOUA 3CJQA 2PMLX 2QHMA 4S33A 2BZGA 5IA2A 3LKZA 4AFJA 3VBVA 2V22A 3PPKA 3PVGA 2G8NA 3DFAA 3F3UA 3FSFA 5CXHA 1GZNA 1PMNA 2IVUA 2WU6A 2AN4A 4XX9A 3HYHA 3Q9ZA 3I0OA 3ZEWA 4NT4A 5CVUA 4BZDA 4IV0A 1JSZA 5A46A 1O6LA 3CR0A 3ZBXA 5EDQA 4XP2A 2XZSA 5JEBA 3SLSA 2WQEA 2I40A 3QD4A 3SVVA 4TWCA 3U6JA 3RP9A 1CM8A 2CNQA 4UV0A 5E8VA 4E4NA 2AC3A 2IVVA 2BPMA 2ZSUA 3RAIA 3VS7A 3HCFA 5CVDA 3REPA 3UPXA 5EMMA 2J90A 3GBZA 1H26A 4BCJA 5AA8A 1R74A 3MPTA 2G1TA 3DMHA 4PYOA 4IVCA 2FH9A 2KULA 4O0TA 4I6BA 3GQLA 4YLJA 4ZK5A 3OOGA 4DEBA 2W1CA 1INLA 1FP1D 3CKKA 1I4WA 3EQFA 3PDTA 5HIDA 2WMXA 3KQTA 1JOWB 2V74B 2OO3A 3TFWA 3D9VA 4RVMA 5EZQA 1ZARA 1LR4A 3PSCA 1ZZ2A 1XH7A 2XMYA 2HWOA 4QYHA 4R1VA 4AZFA 4FKOA 3P23A 1L3IA 3R0TA 3C6KA 4EOOA 1M52A 3FI4A 4KWPA 4P7KA 1ZXEA 3EVEA 1URWA 5G1XA 5EHGA 2O65A 2ZZKA 2YERA 4CFNA 3KN5A 4FV6A 4B99A 1BC5A 3AT2A 3BEGA 3OXIA 5DX8A 5EKOA 5FEQA 2WB8A 3ZXZA 5FUBA 4AX8A 1P39A 4QO9A 3VN9A 4WBOA 2WMQA 2ZBPA 3TM4A 4MKCA 4RTKA 1P14A 5FXRA 2AOTB 2ZVAA 1SVEA 1YF3A 5IEVA 4QYYA 3UVRA 1E1VA 5IH3A 2I0EA 2GSFA 3MJ2A 4OBPA 3WZUA 3UOJA 2QCSA 4FV4A 2JFMA 1PY5A 1KYWA 4NK9A 2JBOA 3MY1A 4C62A 1KP9A 1M6YA 4WG5A 3DDQA 4L42A 3UYSA 3UJ8A 5DXAA 1EJ0A 4F1MA 3F66A 2ITNA 4FSDA 2BUJA 4UALA 2G72A 3GU7A 4RWJA 3WF9A 3CTQA 3V5JA 4I6HA 1LP4A 3V51A 3SM3A 5HBHA 2NXEA 4BGGA 3HA3A 1W7HA 2A19B 2ONLC 3P5KA 3L8DA 5J1WA 4U79A 2BROA 4DG0E 3JUHA 1OIRA 3PXRA 3M2WA 3KXNA 3R1QA 4ID7A 4M13A 4NZWB 5CVEA 4PYJA 1OPJA 3C3PA 5K3YA 2PZRA 2VS1A 2ZIEA 5KBRA 4RTRA 5HZMA 2VU3A 3TPZA 3G33A 5EC8A 2PY6A 3DQXA 4OTGA 3V5TA 2O8YA 4C02A 2GNLA 3L9LA 4KB8A 5FP6A 5M4FA 3UQCA 2ERZE 2ZIGA 3TOSA 4H3QA 3GB2A 2BALA 1UU8A 3FZGA 4LMUA 4PUZA 3FQEA 5I9YA 4FIGA 3F3WA 3S0OA 4XCXA 5B7VA 3FRIA 3D14A 3MW1A 2QRVA 1N2XA 3KULA 3F7ZA 5H8BA 2WAJA 4GCJA 1H1RA 4QMMA 5BQ0A 2YVLA 4FT9A 3NUNA 1RJBA 2F57A 3BKWA 3BV2A 4U9AA 2FSTX 3GCUA 4HNIA 5DN3A 3WE8A 4C61A 2JHPA 4FT4A 4OQEA 1QL6A 3IO7A 3ITZA 3UJ9A 5GWXA 1PXKA 4EH4A 4QQJA 4KIFA 2VWIA 3Q9XA 3IW8A 2CGVA 4QYEA 5LARA 4GJ3A 4FK3A 2ZTHA 2C6EA 3BYUA 3PA3A 5BVKA 5LVMA 1K2PA 3FLSA 4RTMA 2BFYA 2WOUA 5HGIA 2HXQA 2QOLA 4EBWA 1QYRA 3BELA 3PLAE 1XO2B 2QVSE 3BGPA 4OA8A 3Q04A 4J71A 3NUYA 4ASXA 3U6HA 4DH3A 1AQ1A 5LWNA 5EPEA 3VBYA 3ZZWA 3PX2A 3UIMA 3A7FA 2C6MA 3JY9A 4GK3A 4PQNA 2BRNA 4A4LA 4L6QA 4B0GA 2ESMA 3UBDA 5CEPA 3WYXA 1EAMA 1KE7A 1JBPE 2FO0A 3MFSA 4R1YA 5CEOA 2OB1A 4UYAA 5M07A 2JIVA 4FIEA 1MQ4A 4C06A 2EWAA 5L2TA 4S30A 3IW6A 4E5BA 4G3GA 5HD7A 5JRSA 5HX6A 3HEMA 3QTZA 4O2PA 5DEWA 4BTJA 4L8MA 3G2MA 2PU8A 2WTIA 5AX3A 1REJA 2YCFA 3PA4A 1PKDA 3OWKA 3R1SA 4BCPA 5IMEA 2PXCA 1H24A 3TIZA 1EJ6A 5KKRC 3CD8A 5E8YA 3RCJA 5EW3A 4YMGA 2RKUA 2G2FA 5B0XA 5CAUA 2FVDA 3MBLA 4Y8DA 3W32A 2FA2A 4XJ0A 5DNRA 4JX3A 3CQUA 5CSWA 1VYWA 3IOPA 3BGVA 1E9HA 4FVPA 4EL9A 1HCKA 3E93A 3ULIA 4M14A 4GRBA 3ZCLA 3EVCA 3UMXA 2AOWA 4FTJA 3Q53A 4A6DA 3EZRA 4K18A 3B89A 3M6UA 1YOMA 3O31A 3VC2A 4N6YA 1VQ1A 4PCAA 2WIPA 1ZY4A 2W17A 4YP8A 4IC8A 2QO2A 5AP6A 5CUQA 5IA4A 3MH0A 1GZOA 2ZM1A 5LMBA 4O0WA 4YJNA 4FTAA 4BBEA 3HV6A 4W4VA 2JG3A 4CKCA 3COIA 5LQUA 3ZC5A 3TRKA 3ZM4A 3ELJA 2IFTA 4LI5A 4TYIA 4E6CA 5K5NA 4RTPA 4GYGA 2R0IA 3BZ3A 3D2LA 3FI3A 5K4JA 5FM2A 5HZNA 3IDPA 3ZYAA 2I7CA 4J52A 4FP9A 3KHKA 3VYWA 2ZULA 1S9IA 3OU6A 5C0OE 3FZTA 3MPMA 2H11A 2WA1A 1RQQA 2YIRA 4N0SA 1G55A 3R04A 3GU5A 4IM2A 5ANEA 4WA9A 3LXPA 1AQJA 1WBTA 1PKGA 4QP9A 1FVVA 3SG9A 3VUIA 1BHJA 2E9OA 4GK4A 3R24A 4QP1A 1CDKA 1DI8A 3ANQA 4FSMA 4IQ6A 4KSQA 1V0OA 4BLUA 3KCFA 2HENA 5CU3A 5L8LA 4EH8A 3FL4A 1SVUA 5E2BA 1OECA 3ZUUA 4ALWA 4BI1A 4MXYA 5EQEA 3HL7A 4O7VA 2DPMA 3OCBA 3IOKA 1QZZA 2BIKB 2Y0AA 1WBPA 2UW9A 4DH7A 2WEIA 1UWHA 2QONA 4G1WA 5E90A 2QU5A 2GQSA 4B17A 4CVAA 5K8VA 2ZB0A 2OH4A 4FKUA 5L2SA 5AEPA 5M08A 4CSVA 1XH4A 2YM6A 3P8ZA 4RVFA 3VS5A 4B6LA 3QC9A 2P2HA 5E1DA 2FSLX 4RIWA 1XJDA 4FIIA 4IMYA 4CFVA 5ERGB 4YJRA 5HTCA 3P79A 1VYZA 1ATPE 5FWAA 5JSMA 4ZP5A 1YI4A 4IZAA 5K01A 5ICPA 4GC9A 2CDZA 2GNJA 5TR6A 2XM8A 4J95A 4QTBA 4CKJA 5I9WA 4USDA 4AOTA 4KIPA 3R7YA 4ZY5A 3G5DA 3K5VA 3ORZA 3DAEA 5EYDA 4POOA 4FT0A 4BF2A 2ZB1A 3QX4A 5CVFA 4IANA 4EH3A 1X1CA 4AU8A 3M33A 3PVCA 3SXRA 4CMTA 1VLMA 5LQNA 2KTYA 4BIBA 3KPWA 4Q5HA 4UYNA 4WUNA 5M57A 3MSSA 1UU9A 2WO6A 3Q7EA 3RW9A 4Y73A 4PRJA 3TM5A 4UB7A 1Z5MA 3G2PA 2EG5A 5IEYA 5IH5A 1MJFA 4RT7A 1KE8A 4IH8A 4RMZA 5HO8A 3P2KA 3VJOA 4YZ9A 3ORHA 5DSTA 4I94A 4FV7A 3ZFXA 3UJ6A 3ZDIA 5F20A 3OCTA 4PTGA 4CRSA 1PXNA 4E8AA 5HORA 1PHKA 3LOKA 4ZSLA 3S00A 5BYLA 2YAAA 1U5QA 3F6XA 4PY1A 2WD1A 3ORKA 3QQKA 4XV1A 1SUIA 4QRCA 2CL5A 5ETAA 3MCTA 4C05A 4Y85A 4KRCA 1R18A 2VDVE 3KXGA 9MHTA 3QA8A 4GYIA 5LQCA 3KF4A 3H9FA 5EGSA 4LUEA 3TNPC 5EMJA 3P7BA 3HEGA 2W0JA 5TKDA 1RI2A 3O8TA 3VS1A 5KE0A 4P5QA 4XEYA 3FPGA 4CFWA 4L45A 2XVDA 3SGLA 5HG7A 5CU4A 3ROCA 3HVJA 3JWIA 3WZDA 4BYIA 5LCJA 4LOQA 1YRPA 2PULA 5GIOE 1D2CA 3UG1A 2UVZA 2XIYA 3R3HA 5EG5A 4QTCA 5AV1A 3UODA 3QXPA 5D1NA 5CQUA 4C4HA 1FMOE 3OBJA 3LMIA 4PP7A 5M5BA 5HG8A 4FK6A 1QPEA 4I23A 4AGWA 3OZ6A 4K1BA 2BVAA 2C1BA 3PRFA 4GS6A 3V5WA 4BCHA 3MH2A 2P4IA 2BHHA 4IFCA 1Q0SA 2UZVA 3W2SA 3PP1A 1XBAA 2NNWB 4A9RA 3B5IA 3DK7A 1XR1A 1ZYJA 1W0XC 1SNXA 3KMWA 4JG7A 4KA3A 4O0UA 3TV7A 5GINE 1Z3CA 2QY6A 4JX7A 4D1XA 4AXAA 3V6SA 3WSTA 1YWVA 1E1XA 2IZSA 2B9IA 2W5BA 4JJRA 5IQFA 3P0MA 2ZM3A 3E23A 2WTKC 3DR5A 5DT3A 2YWPA 3QRTA 5AV3A 1I9GA 4ZAUA 5JMSA 3G90X 4P7GA 2Z6UA 3H2BA 1F3MC 1R3CA 1TKIA 3GWZA 3EVDA 4RSRA 3V04A 1M0EA 3MB5A 3PFHA 1KXZA 3QF9A 5FQNA 4XS2A 4WSYA 4ACHA 5IUGA 2QODA 4TYHA 4EC8A 1YHWA 2BTRA 3L9PA 4RVKA 5F1ZA 4ACMA 4DT9A 4IX6A 4K2RA 5F95A 1VIDA 2XS0A 3EQPA 4R3CA 4BTFA 3FC1X 4IX4A 3EMBA 3AC5A 3ZU7A 3PE1A 2VTMA 1O9UA 4NKAA 5EQYA 3CKWA 4NW5A 2J5EA 2PVYA 2JJQA 5AP0A 3AD5A 3BEAA 1BI7A 3K0BA 3N4VA 4HC4A 4F7JA 4ZTMA 5CVVA 2J6MA 4O22A 3UJAA 3QYZA 1M2RA 1OPLA 2WMRA 3DXNA 4OBOA 3DLCA 4QQTA 1WS6A 4RSSA 3EMDA 4YJSA 2VN9A 2ITZA 4G6LA 2R3NA 2P41A 3O4FA 2IZRA 4X2KA 4LGHA 4QQ5A 4DBNA 1TQPA 3LDUA 4D9UA 4RTSA 4N6ZA 4RFMA 3UYTA 5H9BA 4ZTHA 2H00A 3UC4A 2IVSA 4QMWA 2OICA 3AG9A 4F7LA 1JQ3A 2YEXA 2WPAA 2ZMCA 3OCGA 2EUFB 2EXCX 4CT1A 4M97A 4DFYA 5B2MA 4NFMA 5CALA 3D15A 4G3EA 2ONYA 5DT2A 4BDIA 3E63A 4E26A 4BIEA 5K5XA 3G5TA 3UA3A 4K6MA 4OT6A 5LQAA 2ETMA 4TTHB 4TYJA 2QOFA 3A61A 1EIZA 3B3GA 4HPTE 2JIUA 2V5QA 1YKRA 3NLBA 4FG9A 5JGAA 4CXAA 3PXYA 3VW8A 5I9UA 2ITXA 4BCFA 4C4GA 3ATTA 2Y4IC 4QP3A 4I5MA 3VBXA 1JQHA 3CTJA 4HYHA 3UVQA 4L7SA 3EIDA 3FY2A 3LQ8A 3D7ZA 3TZ7A 3QQGA 2E2BA 2J7TA 3L9MA 5CT0A 2C1AA 3EN7A 1OMWA 3O8UA 4GEOA 2QM3A 2X2KA 4DINA 4MTAA 3G5LA 2AVDA 4ALUA 4RIYA 3GCQA 1JPAA 3QTRA 4WNMA 2X6EA 5F2NA 2A4LA 4PWNA 1GNGA 3LCTA 3OROA 5EQPA 3BE9A 3B8RA 3FKNA 4ITIA 5M4IA 2UUEA 3BHYA 5HILA 3KREA 2GPHA 4OTHA 3ZO4A 5KMNA 2JD5A 5EM5A 3RPYA 3IYLW 2XJ1A 2PVKA 3CSVA 1SNUA 3PXQA 3BLRA 4JBPA 4ANSA 1JKLA 3U9CA 2YISA 3E88A 3G0EA 2X1NA 4ANQA 4F0IA 5E8RA 3K2LA 5CVHA 5DFPA 3ZLSA 4TYHB 3COHA 3QTIA 3E8EA 3TI1A 3UOHA 4XG9A 2CMGA 2DUVA 2VZ6A 4P7JA 2ZM4A 5CVJA 4WUAA 5EVJA 4FEUA 3Q9WA 2P8JA 3I1AA 3R8ZA 5LJJA 1NV9A 3OPNA 2OJFE 1XDUA 3SSOA 5KS2A 4EOLA 3R9RA 3EN9A 3T0IA 5CU2A 4A06A 3RPSA 3KR9A 3QZIA 4II5A 3RALA 5KO1A 1YUBA 4FV1A 4ZZNA 2PXXA 4O7LA 4L7VA 2PUUA 4GU9A 4DA5A 3ZS5A 4H36A 3GO4A 2WQOA 4GJ2A 4ZTNA 4YSMA 2WA2A 2VTNA 2NPQA 3I60A 3QQJA 5D10A 3TWJA 3JWJA 5CVGA 3Q2MA 3KR2A 2F7XE 5BVFA 4HPUE 2BR1A 3UQGA 2R5TA 1PRYA 4JVGA 5EK7A 3M11A 4QPAA 5ANOA 1M2PA 3SQQA 4K8AA 3R22A 3FXWA 3MTIA 4KDCA 4G16A 5AUZA 3WZJA 4YTFA 4GF5A 1KV1A 2A1AB 3ZUTA 3NW7A 3LQ5A 4HYSA 5FG8A 2AOTA 2VTLA 3QD2B 2HXLA 3FZ1A 3QU0A 1J91A 5DEYA 3TNHA 2YXEA 4U7TB 5GM1A 4DCMA 3R00A 1ZLTA 3Q4ZA 1IG1A 1L3RE 2J51A 5DRDA 5DLSA 1O6YA 4L3JA 5L2IA 3TKIA 4P5ZA 3ZO2A 3DBCA 2RG5A 4QVKA 2OW3A 3MY0A 3D83A 5I9ZA 4G5PA 3DTWA 4PDYA 5JQ5A 4ENYA 2P1DA 4USEA 4H39A 5HHWA 2HNKA 4EKLA 2UZNA 2VTRA 4HZSA 3WYYA 2VTOA 4AA4A 3HLLA 5AP4A 3RK9A 4HGLA 3PY0A 5AUVA 1XQZA 1QPCA 3RPRA 3FPHA 1Q62A 3RK7A 5DX0A 3UZUA 3DT1A 3R7EA 1JTEA 3RK5A 5A6OA 1P1BA 2GAFA 3FZOA 3NYVA 3ELYA 5T68A 3R02A 4GEKA 1ZZLA 1RI5A 2XH5A 4PL3A 5LVOA 4FKTA 2YDKA 3MFTA 4PDOA 5HVJA 3A26A 4BLWA 2R3RA 3UO4A 4EOPA 5DGZA 4X60A 5CAVA 5KMLA 2OU7A 4I0SA 5A6NA 5FHQA 4C3RA 1OKVA 4DGLC 2PUIA 5DM0A 3DJ6A 4E30A 1YFLA 3ER8A 2YIWA 4GT5A 3IPHA 4QMYA 3BWJA 3W8QA 3FLZA 5KX8A 5M4CA 1F3LA 3BQCA 4MIKA 1PJZA 2OG8A 2WIHA 4UEUA 2QRVB 2F4JA 1NVRA 4EHEA 4Y83A 1OKZA 1WG8A 4NWMA 3R8VA 3ACJA 4V05A 2XNGA 1N7JA 4UBAA 4IM3A 3ER9A 1PMVA 1Q4LA 3C4XA 3QGYA 2WTCA 3CBGA 3MGGA 2F2UA 4YHTA 5BX0A 3GNIB 1ZY5A 1OBGA 3MIYA 3EFLA 4YZBA 3TM0A 4F65A 2J5FA 5CLPA 2IZTA 3PP0A 3HMPA 2HZIA 3WF7A 3KQQA 2JH8A 4K11A 2FSMX 3OS3A 2PT9A 2BIYA 2GNGA 4JBOA 2R3GA 2G1PA 2R3KA 4XCUA 3L8XA 3NWBA 1ZGAA 4AWIA 4ISCA 3I64A 3NRMA 4CMUA 5HG5A 1WCCA 2C5NA 3UZTA 5HESA 4OLIA 3TKHA 5KCVA 4DE4A 5EZSA 1AGWA 2YCSA 3O17A 4YJUA 3QFVA 4DT8A 4EOJA 5KVAA 5DRTA 4WD5A 3P7CA 1B38A 3FUTA 4EOKA 3KULB 5L8KA 1G8AA 3CBLA 2GFCA 3R01A 3FZPA 3DMFA 2BRGA 2XRWA 3OEZA 3D2KA 3NR9A 2P40A 3KQMA 8MHTA 3EFWA 2PVFA 2ITQA 4DLIA 3LE6A 2NRYA 5HE1A 3BT7A 3OT3A 3MVJA 3X0DA 5HIEA 5C8KA 3C0HA 3QRUA 3BUSA 2BHEA 2BZJA 4FEWA 1LUFA 4IDTA 4RYLA 3O96A 3QCYA 4WNPA 5FTQA 4DAWA 5KMJA 4AT4A 3N9XA 4EOSA 5CAOA 3V8SA 3FMJA 3AMAA 1NW6A 3LECA 2PLWA 5KHXA 4GFGA 1OR8A 1YDSE 3IS5A 4YMHA 3DUWA 4L68A 2JITA 3NEWA 3LZBA 4U40A 4YUYA 5CD1A 1NT2A 5JRQA 1XCLA 1Q61A 3WF6A 5DWRA 1L3BA 3JWHA 5AAFA 1VEBA 3CC8A 1JKTA 2VNYA 4JBQA 3SG8A 5EM7A 1F5QA 4EJ7A 4O0YA 5K9IA 4Y5HA 2F7ZE 4RA4A 2Z2WA 2XIKA 5HTBA 4S31A 3MY5A 1SKMA 3A2CA 2WMSA 3RZBA 3OE4A 4HJOA 4J8MA 4JI9A 2OWBA 3CQEA 3OD6X 4RX9A 3R7UA 3OMVA 3SX9A 2VTAA 5IF1A 5ICCA 2YACA 4NFNA 3NDJA 4DFNA 4FSZA 3DZQA 3F2RA 1QPJA 5K0LA 3EOCA 4CKIA 4EK3A 2CPKE 3KN6A 1CSNA 3MWUA 3A8WA 4ALVA 2O63A 3AGLA 4I6QA 4DGNA 3DXXA 5ETIA 4QYGA 3AJDA 2AS0A 1QMZA 3CCNA 4XBUA 2RIOA 3U55A 1YHVA 3KQPA 5EMLA 3C0IA 3PB3A 3LXKA 4IM0A 2Z7RA 4K0YA 3AXWA 5E9QA 1N7IA 4DH8A 5A54A 4R3PA 2DS1A 4YZDA 1SZMA 3OUKA 3C5UA 2JHAA 3ODYX 2OBFA 3U54A 4FYNA 3ULZA 4RTJA 5MHTA 3SXJA 3ZM9A 1YQJA 1U2ZA 1PYXA 2W4KA 3MDYA 4WO5A 3EN5A 4JT3A 4EORA 3LFEA 5DI1A 5KMMA 5K0BA 2PE2A 2QD9A 5B1SA 1H00A 3DKOA 5JFSA 2WHBA 5FXQA 5EEGA 3RVGA 4EHGA 3K54A 3QCQA 4OTDA 1MQBA 3R71A 4O96A 5AP5A 1P2AA 3FMMA 5J87A 4X2NA 5C27A 1EG2A 1X19A 4A9SA 3HRBA 4KS7A 2X8IA 4NTSA 4F7SA 5LQFA 4I6FA 3RCDA 5IDNA 5KQRA 2Y1WA 3GENA 3QA0A 4O81A 1IASA 2HWPA 4X1OA 1ZAOA 2O06A 4FV5A 2R0UA 3CCFA 4UY9A 3II5A 3LFFA 5KBQA 3WILA 3PSBA 1G6Q1 3GT8A 1H1QA 3E3PA 3OF0A 2PV0A 4CTJA 5FWDA 2QKWB 5C03A 3IG7A 2PGXA 1JR4A 1WBWA 2UZ4A 4JR3A 2OIBA 3V8VA 4XUFA 3FSKA 5E1BA 3HAVA 5E8SA 5HVYA 3QQFA 3CPBA 3LXNA 3TNIA 2O3PA 2YWVA 4D5KA 2OSCA 3NDMA 3OW3A 4XUCA 2PE0A 1FQ1B 1Y8YA 3HX4A 2OB2A 4YJTA 2ZBQA 3FQHA 1BX6A 4FSTA 4NM7A 4E6AA 2HZ4A 1OB3A 2B7AA 5AFVA 1JKSA 3HMMA 2O0LA 4DM3A 3VUGA 2AN3A 3BHTA 5IQGA 1UIRA 1M7QA 5P8WA 5EEHA 3EL8A 4RIWB 4U3YA 1K9AA 2GQRA 3BKBA 1R39A 2G71A 2NP6A 3EPPA 2ONZA 4MTLA 1G5SA 5D7VA 1ORIA 4IC7A 4I22A 2CNVA 4DEDA 1JLUE 1OM1A 2ITUA 1F38A 3S68A 5BVNA 1MHTA 3DBEA 3D94A 1GZ8A 5DPVA 1RJGA 4QMPA 4ZTBA 3I5NA 3R9NA 5AV4A 3U87A 3PT9A 3ERCA 2X7OA 5A4EA 1YOLA 2GS2A 1OVEA 2ITOA 3Q52A 3TV4A 3W55A 4F63A 2LAVA 1XBBA 3CJRA 4EH6A 2E9NA 1SG9A 2OKCA 3HP5A 4IVDA 3VC4A 5LWMA 4KABA 3K6RA 4IKPA 4BN1A 4V01A 4F84A 1KSWA 5HCZA 3DXQA 2AR0A 5DTQA 3G89A 3AD4A 3MN3A 4J1RA 5DR9A 3UTOA 5LVPA 3FRHA 4DQ0A 5L6OA 2OXTA 3FMEA 5C8MA 5FBOA 1SQGA 3QXOA 4E2XA 1W8CA 3QD3A 4FSNA 4M69B 3VVHA 4ASEA 4BCKA 5I4NA 2H34A 2Y1XA 3EGEA 3FDNA 2ZAZA 5KMOA 2YTZA 3OT8A 3A99A 3GC7A 4MF1A 5DR2A 4F6SA 5A9UA 2E9UA 3AC3A 3E64A 3PFQA 3FXZA 2Y8OA 4FG7A 4C07A 1UWJA 4FKJA 3OE5A 2PX5A 1L9KA 4ZZMA 1IA8A 4FIJA 4L00A 2ZV2A 4BCGA 2RFEA 3BYSA 4TL0A 4QPPA 4XP0A 1RW8A 2OJJA 2UW3A 2E9PA 2VWUA 4KIOA 3BPRA 3FMDA 1ZG3A 5T67A 5BVOA 3NCGA 4X21A 2YIQA 4ACGA 3TQSA 3E7OA 1H0VA 4ACCA 4HW7A 4LRKA 2A27A 2QU6A 1OL5A 4R7HA 3W8LA 5CF4A 4HVHA 3LFSA 4DFXE 4EH7A 5BW4A 4M12A 3HCBA 4V0QA 2GA9A 4WVLA 2A2AA 2IG7A 3EKNA 3BCEA 3HA8A 4YZMA 3E8SA 4GMYA 1BYGA 3ZMMA 4XG8A 5KUPA 1XH6A 3Q4CA 4UX9A 1IAJA 3UA4A 3T7TA 1O6KA 3E7VA 3HDNA 2B9JA 1Q8ZA 4RC4A 3R9OA 4Z7GA 4I1ZA 4BB4A 1JG3A 1X1BA 5CCXA 1H07A 2YAKA 3LCKA 4KUJA 2WGJA 3DP7A 5DM2A 3IW5A 2NP8A 3VRYA 1NV8A 1Q8TA 4Y30A 4AZSA 3P9NA 4R78A 2UW8A 4PX6A 3KPVA 2OIQA 3A4OX 2QOHA 5EHLA 4HVGA 1XDSA 4HGZA 2C7RA 4HCTA 1OIUA 2X0GA 2X4FA 3R30A 5FXSA 4USFA 3VUMA 4BYJA 3HA7A 1FINA 4G31A 4I93A 4RC2A 4KW7A 2J50A 5HCXA 5EDPA 2C0TA 5GHVA 4EUUA 5GJDA 3BBTB 1DAYA 1G3NA 3OY3A 4NM0A 5F94A 4YV0A 2XNBA 3CC6A 3EQDA 2XNPA 5TT7A 3NUUA 3Q5IA 4IAZA 4RJ4A 3OFKA 1YXVA 2XIRA 4MAOA 2C30A 5DG5A 3MJ1A 3ZFYA 4YR8A 1GAGA 3Q4UA 4PDSA 3KQYA 4O27B 3E87A 5ANIA 2A0CX 4U8ZA 4BBFA 5DM1A 3VSEA 2XKDA 4FA2A 3FBVA 2Z8CA 5DE2A 5AA9A 1B42A 3I5UA 3NWEA 5F2KA 4F9YA 3GCSA 1PXJA 5HIKA 3DB6A 4KDRA 3AWIA 3OTVA 4E6QA 4QMTA 2ZV7A 3DOGA 4DEGA 4O91A 4OW8A 4AW1A 2IBSA 3SHEA 2F49A 5CS6A 5AV2A 3EQBA 4K77A 2BKZA 1HOWA 4XNEA 3EJ1A 4U45A 5E8WA 4ZSAA 4QP8A 3C0KA 3R9HA 3P71T 2YITA 4QQCA 4Y95A 4D4VA 3DQWA 3LM0A 3ZUVA 2B25A 1JWHA 5C01A 3RAKA 5BYYA 1NKVA 3LPBA 1FMKA 3GOPA 3U9NA 3V01A 3GRVA 3DBQA 4O29A 2Y7JA 2IVTA 2R3QA 3DLZA 4FV3A 4G9CA 3VS2A 4DITA 5IQCA 2F8LA 1MP8A 1J1BA 3MB6A 4JS8A 4MQ4A 5DSXA 3MB7A 3NUPA 2W05A 4WHZA 4AA0A 4CLJA 4EWHA 2OFUA 3KY2A 4I0TA 4PMSA 4F1OA 3FJQE 3AC2A 4C38A 1Q99A 2VRXA 3LJ0A 5CZIA 4BCNA 2CGXA 1XXLA 5LR6A 4ARKA 3MVHA 4F99A 4D2SA 2C5XA 3KMUA 4ZJVA 2UZEA 3R73A 1R00A 4CKEA 2C7QA 2I0YA 3D0EA 2WTWA 3LCVB 2IZUA 2XEZA 4UZHA 5TF9A 5AUWA 3WOWA 3DOUA 5AWMA 3C7QA 3R8MA 5A4TA 4FV9A 3P9KA 4FZ7A 4BGHA 4CFFA 5FEDA 1VJYA 5DR6A 3TG1A 3HUBA 2GHLA 3CE3A 3G2FA 4YHFA 3R1NA 2UW5A 2XJ2A 4M36A 2J0MB 1FGIA 1Y6AA 3C4EA 3OXZA 2ERKA 1JG2A 4R8SA 2CKQA 3G51A 2EX4A 4O0XA 2JAMA 4FNXA 5E9JA 1UNHA 2X9FA 4CFMA 5IQDA 4J7BA 3A4PA 3ENHA 3R28A 1J7IA 2H9VA 4RFYA 3LM5A 4OQDA 2VTTA 4YUXA 2J0LA 3PY1A 5CWZA 3WE4A 5E1MA 3FTFA 1XHAA 4DBXA 3R21A 4RWZA 3KU1A 2OF4A 3HRCA 5TO8A 3OCSA 2VWBA 1P1CA 3ODZX 2IH5A 4IAYA 2HK5A 1EQAA 3PJ8A 4M0ZA 4CD0A 3LCOA 3E7PA 3B2TA 4IDVA 5IPJA 3HV3A 3TKYA 3VW6A 3DV3A 4NCTC 5EIWA 4AN3A 5CIYA 5LOHA 4C4FA 3HV5A 4FE2A 4PYMA 1R8YA 3HP7A 3RWPA 2BH2A 4FSQA 3KGAA 2QKRA 2PVRA 3OC1A 3G15A 4JBVA 3POOA 2VTQA 2ZJWA 3MAGA 5EMKA 4G3FA 5DA3A 3LDFA 3CVOA 3TMAA 3AMBA 2CGWA 4YMJA 5CI7A 3KRXA 2YIYA 5JN2A 5K0CA 4CG8A 4F9AA 1I44A 3H0ZA 3QBNA 4GT4A 2OJ9A 4A6EA 2UZDA 4RVLA 4OTIA 4CRLA 1UKIA 4ZLYA 4CEGA 1QAOA 5J95A 5EI2A 3HCCA 3CJFA 4R77A 3I81A 3MCZA 2EB2A 2O64A 3DLSA 2WMAA 3ZRMA 4O84A 3BU6A 4EBVA 3L8VA 5L6WL 5CASA 3OU2A 4BCMA 3RTPA 3MA6A 3A62A 2GNHA 2G2IA 1KV2A 3QTSA 4FKQA 3FI2A 5ACKA 5HLWA 1VL5A 1WBSA 1VBFA 5JT2A 2XYNA 3JR1A 1SQFA 5DLYA 2ITPA 2I0HA 3MTFA 1CTPE 5LCKA 4D55A 1NW5A 3WARA 4AT3A 3MQ2A 2O2UA 5I9XA 3DXPA 2VGPA 4BP3A 2QOCA 2XNNA 1WFCA 3PY3A 1X8BA 2ZYBA 2X7FA 3EN6A 5M53A 1OKWA 2EFJA 2IGTA 2XYQA 3GU8A 4PYNA 3UJBA 2N47A 4X63A 1P4OA 2ITWA 3KQSA 2EB3A 3B8QA 4PTEA 2OI4X 5CENA 3UIXA 1U59A 5D12A 2OLCA 1TPYA 5E91A 3NNWA 4Q5EA 3KL8A 2DWBA 3QLFA 3A7JA 2HZNA 3W2RA 1P5EA 2XK7A 4NM3A 3TL8A 3O50A 3TUBA 5G6VA 2PK9A 3UC3A 4Z9LA 3VUHA 1I1NA 4KRGA 4B7TA 3PX3A 3BWBA 4EQUA 2C7PA 2PJDA 1PXPA 2CNUA 2W1HA 4RQKA 4IWNA 4X41A 5AM7A 2IW6A 2XP2A 3CP9A 3IGOA 4QMZA 2J2IB 2XKFA 4FNZA 4JLCA 4A4OA 4BLVA 4Q2AA 4HCVA 3GGDA 4NYEA 4BDFA 5EYMA 2I9KA 1WZNA 3ET7A 1JAMA 2PYWA 3OHTA 3OXTA 4E5WA 3EZVA 4TW9A 2I0VA 2PVMA 3BHVA 1I09A 5AUXA 3VS0A 5M56A 3F61A 4YPSA 3NGAA 4BZNA 3AXTA 3NAYA 4AF3A 3U51A 3RM7A 1NBHA 4XYFA 3GNLA 3AXSA 2ZV8A 4HGSA 2V0DA 1PMEA 3LFAA 3VHKA 1BL6A 3GC8A 3QUPA 4FTTA 3NW9A 4HGEA 2C0IA 1TW2A 3BGDA 3QYWA 4RJ7A 5A4LA 2V62A 3ELUA 2OYRA 4A4XA 3EYGA 3HVKA 2BFXA 4WBBB 3ETAA 4IVBA 4CT2A 1ORHA 1XDZA 1S9JA 2YX1A 2O07A 5BUIA 3KRJA 3G9LX 1ZOHA 4IACA 4F6WA 4LM5A 2B1PA 1Q24A 2IBTA 3O7LB 2W5HA 3FUUA 3TNQB 4PWYA 3FXXA 3P78A 5CAPA 3R8UA 3G88A 4GT3A 2O5KA 5JQ8A 2UV2A 4YZNA 2CN5A 3FYDA 1SMHA 2BTSA 2IDJA 2BM8A 4E4LA 4RIOA 4IWOA 4KKEA 1URCA 4XV9A 4I41A 4MX9A 4TXCA 5K4IA 2GB4A 1M6EX 5T64A 4DFBA 4GUEA 2JKQA 4JQEA 4I24A 4Z55A 2YUIA 5LQJA 1SYKA 4OTFA 2PMIA 5L2WA 3EGVA 3KB7A 5GM2A 2W9FB 3FPQA 1Y6BA 3S4QA 5JFVA 3EN4A 3E05A 5FQOA 3T7RA 4ER3A 3HVIA 5F4NA 4ZOGA 5GOZA 4FNWA 1HNNA 2I6GA 3A25A 3VHEA 3C1XA 3OEFX 1IY9A 2PWYA 2VWXA 1KPGA 2PZPA 2W1GA 3OVVA 3BRBA 1GJOA 3GFEA 2HY0A 4KBKA 4O38A 2YM7A 2JIIA 4PNIA 4AG8A 4TY1A 4FUYA 5LXMA 4JAJA 1JQEA 5HOQA 3BV3A 2ZV9A 3KA0A 4KKHA 4NIFB 4QTDA 1KOBA 2IIPA 1J7LA 2BKKA 2ETKA 2CLQA 3FPFA 3WZEA 4FODA 4BCQA 2H8HA 4ERWA 5LQRA 2HZ0A 4MQ1A 4ZTRA 1QAMA 2ZOQA 2JBPA 1WY7A 4RLLA 4YUQA 3ANRA 4LYNA 3KXZA 3VRZA 4OBXA 4MXOA 4W4WA 2C3KA 4ZTQA 5G02A 2GTNA 1RI4A 3Q96A 4EQZA 1H25A 2C4GA 3F3VA 4KSPA 4BC6A 4QMNA 3L9NA 3GU4A 2OF2A 5HNIX 3EMGA 2Y4IB 4QP7A 4P7EA 3FLNC 2XK8A 2C7OA 4PMTA 3FZSA 1H1DA 4YPDA 4JRNA 4FC0A 2YXDA 5IEXA 3TDVA 2GFSA 2UYOA 4M37A 3NDIA 3RPOA 5DBXA 1XWSA 2I1MA 4PP9A 1R8XA 4DG3E 2OZAA 5M09A 4HRAA 5DH3A 4BDDA 4BIDA 3HCDA 2GS7A 3LXLA 2PSQA 3W2CA 4EYJA 3AT4A 1Q3WA 3TUDA 4FOCA 4AAAA 5JUWA 3JYAA 4LWPA 4BCIA 5CYIA 1SVGA 2BZHB 3TN8A 3UZRA 3EB0A 2K4MA 3B2WA 3QTWA 2GS6A 3MS9A 3AC1A 3UO6A 5CF6A 1BKYA 4GOMD 2E9VA 3AGMA 3GVUA 3NYNA 1REKA 4KBAA 5ETCA 4YO4A 3UGCA 5ICGA 3G6HA 3UJGA 1YXSA 2HWKA 4BI2A 2P3OA 1R6AA 3TZ9A 3KCKA 3K3IA 3NS9A 3E3BX 3M1SA 1GIHA 3D7TA 3O51A 4PV0A 3VBWA 4QPNA 4YUVA 1M14A 3M70A 3LCCA 5E1OA 1R0EA 4AQCA 3WF8A 3QZHA 3I9FA 4ZLOA 4Z2YA 3QTUA 2WEVA 3RMFA 2JHCA 2X8EA 4MWHA 3K5UA 5AUTA 1Q8WA 5T3QA 4AUAA 2PXAA 5CQWA 3QL8A 3ZFMA 3KPJA 3NYXA 4GG7A 5KYGA 2JKMA 4YO6A 5HEZA 3HA5A 4LL5A 2WQNA 4LECA 4O86A 3EHAA 3TXOA 4E93A 2PVCA 4YHJA 4FTNA 3UIUA 3FTCA 3QUDA 4E70A 3DJ7A 3NVMB 3ALNA 3KK9A 4U5JA 1FOTA 1PW2A 4DTBA 3KPUA 3VQUA 1J3HA 1KOAA 2WXVA 2XCKA 3NIEA 4NL0A 1H4LA 3G9NA 2O0UA 2OK1A 4JDKA 3LMGA 4XBRA 2V55A 5J7HA 3UE4A 2WMBA 2QR7A 2BAJA 2F7EE 3DS6A 4FR0A 5DX1A 3E62A 3OOMA 3PZHA 3VUKA 2QR8A 2PX2A 3F5XA 1JSTA 4S2ZA 5F2OA 4HZRA 4DF3A 4F9CA 3PFGA 4I5PA 3EKKA 3Q4TA 1YWNA 3IONA 3NSZA 5AP1A 4ZTLA 4DEHA 4FKGA 3KQOA 4AW5A 3EQCA 4OGRA 2W4OA 2R2PA 3D5VA 5CNNA 5CZHA 4YGAA 5FP5A 3KRWA 3FMHA 4IBMA 5CEQA 4NW6A 3TJCA 2IO6A 4NCTA 3ERKA 4FSUA 4RJ3A 1YXUA 3TT0A 5CSPA 2AYPA 4XLVA 5KHWA 4JXJA 4W8EA 3AY0A 3G8BA 3R9XB 3RHKA 4MCVA 4V04A 3MFUA 5K0GA 2HCKA 1T45A 2GCDA 3GXLA 1YZHA 3CS9A 2W1FA 3VULA 4DEAA 5HBEA 2VO3A 3H9RA 3PA5A 3EWHA 4MBJA 3U4WA 4A7CA 5BPYA 2R64A 5CU6A 5EI8A 5E8XA 3PRIA 3ANXA 1OUKA 5EKNA 3FYJX 5U4XA 3CTHA 3RAHA 4AGUA 4D58A 2XKCA 3ME5A 4OTRA 2CLXA 3SD0A 3FPJA 4RBLA 3I53A 2VTHA 4U7ZA 4M7RA 4EK9A 4RTLA 4ANBA 2YZAA 3HV4A 2XK3A 3LQ3A 4FT7A 2XIZA 1JKKA 5ANDA 3VO3A 3P9JA 1NE2A 3L8PA 4HTFA 4GOLD 3MIAA 3QWJA 1BUHA 2GHGA 3CKXA 3BU5A 2XYVA 5FRIA 3M6VA 2WOTA 3DPKA 1V1KA 3D7TB 3F2NA 1H8FA 4A9UA 2W99B 3LFCA 3QHRA 3SXSA 3F82A 5CEIA 3LKMA 5JGBA 3LFBA 4C58A 3G2QA 3HM2A 1A06A 5E8JA 3EEOA 4X0MA 1YZ3A 4WG3A 2C6KA 4RZVA 3UNKA 1Q8YA 3ORNA 5GJGA 2B0QA 5DWQA 4FTQA 5EIFA 2ONLA 4ASDA 3HMIA 3OWLA 3TJDA 3DCVA 1P4FA 1O9HA 3MVLA 3PVWA 2GS9A 2JDRA 5IA5A 1ZRZA 3QAME 3TR6A 4OBQA 2YFXA 3GUBA 3CY3A 3G0FA 4IAIA 4IVAA 4JNWA 2FSOX 5EOVA 1Q3DA 4DA4A 4DLJA 4CCUA 3KKVA 4F08A 4FIFA 2H1RA 2I7QA 4O82A 4E73A 4EKGA 3KRRA 3T3UA 5AX9A 3H3CA 1V39A 4QMSA 2WK1A 2AVNA 1AD5A 4MQ2A 5E9WA 3IV6A 3LBFA 1UKHA 2B2CA 2VO7A 2BRBA 2WKMA 4MXCA 3DKFA 5DIAA 4EONA 4E2YA 2ZWAA 3PPZA 3FV8A 2R4BA 4AN9A 1NXKA 5J1VA 3BYMA 1R1WA 4LUDA 4C4JA 3MESA 3EFKA 3LCSA 3F69A 2Z7SA 3PWYA 4FMQA 4ZS0A 5EM8A 2UW6A 3CXWA 3IK3A 3BGZA 2EVAA 1IRKA 1VZOA 2C6TA 2VWVA 3R9DA 2OJGA 4R3RA 5HU3A 3G8AA 5IQHA 5FULA 4CTCA 2NXCA 4U7PB 5KQSA 2AN5A 3F4KA 3SOCA 1YFJA 3KC3A 4U6RA 4F7NA 4MHTA 5IUHA 3LHDA 3TTJA 3WIGA 4BHZA 1G8SA 2WMUA 5CF5A 3P97A 1V0BA 3UOKA 3ZO1A 4ZSEA 4E6DA 3P9CA 1FP2A 3IDBA 3UQFA 4H1JA 3OWPA 5JFWA 2R6ZA 4D4YA 4GSBA 5J8IA 5AM6A 4IX3A 2BM9A 2ZLBA 2NP7A 3REOA 5E1SA 4ACDA 5CAQA 3GIWA 3DULA 4IAFA 2OKRA 3UDBA 5K0NA 2Q0BA 4Y46A 4IAKA 5GIPE 3DZOA 5LVLA 4IW0A 5BVDA 1FVRA 2C6OA 2GTMA 3Q2JA 3GFWA 4UWYA 4ZIMA 3UG2A 3CGOA 3ZLWA 2BR3A 1ZMUA 1ZYCA 3GCPA 5BXYA 2EXMA 3FTEA 1YXXA 2QC6A 4JIKA 2HMYB 2FGIA 2WNTA 3W18A 3ZDUA 2NRUA 4TT7A 1QAQA 1RJFA 3K3JA 3PSDA 4E32A 4MXXA 3MHTA 2RF9A 3I0QA 3DTNA 2FYSA 4F09A 4O6EA 5AAGA 5L6PA 2PX8A 4X61A 1XKKA 4F9BA 3P2IA 3H4JA 4GFOA 3NZ0A 2CJMA 4FV8A 2R3FA 5IA1A 3U8WA 4Q9ZA 4EWQA 3QCSA 2JDVA 2PMOX 4CMOA 1CKIA 4U81A 4X2FA 1OKYA 1W83A 5DYJA 2R7IA 3FUWA 5FCDA 1PXOA 4O7TA 4KBCA 3C6MA 5K05A 2C5OA 2BZIB 4AOIA 4IADA 2XF0A 3GU3A 3A4TA 4ER5A 1TQIA 3AOXA 2P3GX 2VAGA 3VBTA 3UNZA 3VUDA 1MRUA 4M84A 4IX5A 4CFUA 4QPSA 2W1IA 2G70A 2HV9A 4RWLA 4KIGA 4QQKA 1PYEA 2ITVA 3D5WA 5CEKA 4YUZA 4OTWA 2XYRA 4PGHA 4EZ5A 5DVRA 3DKGA 4J53A 2C68A 2JAVA 3NX8A 4CFXA 3TUCA 2WQBA 4L3PA 4B4LA 4PCLA 3S2PA 3BWYA 3ORMA 2X2LA 2PY3A 4EHZA 1VR2A 4PMPA 7MHTA 5ICEA 4YJQA 4R5SA 2FRXA 3PJCA 2Z6QA 5BNJA 3LIJA 4FVQA 3JXWA 3P86A 1OIYA 4MNFA 5EHOA 5IQBA 2JKKA 5F9EA 3PYYA 4KVZA 3FQSA 3HZTA 4ZJJA 2GPYA 3BX5A 3QCXA 4X2JA 4B9DA 3HCAA 4NECA 1OBDA 4ANMA 5EHIA 1H1WA 2I6LA 2F2CB 2GMXA 3UMWA 1JG1A 5HVKA 3SX0A 3ROYA 4BP1A 4CTKA 4FKIA 3TZMA 4UOEA 2ITTA 4WRGA 4ZY6A 2C5VA 3O8PA 3ZZEA 4AZTA 2ZBRA 3E92A 5CF8A 2XEYA 2CKPA 2JDSA 4XG2A 3KR0A 1FJXA 5FBNC 5B2LA 4U42A 2CWWA 4DCGA 4E33A 4TYGA 3T9IA 4WRSA 4PONA 2OJIA 4EK8A 3GRYA 3D2IA 4KS8A 4GKIA 3C4ZA 3VF8A 3ZHPC 2XUUA 3S1HA 5FTOA 5JK3A 4C08A 5BYZA 4ER0A 4L67A 3EGIA 3ATSA 5HNBA 4QVGA 4YZCA 5BVWA 3QQHA 4TRLA 4MK0A 3GCZA 4WNOA 1WVXA 4P4CA 3QRJA 3ZSHA 1OPKA 3LFQA 4G5JA 3C0GA 4FGZA 3E8CA 4FBXA 4LGGA 4R5YA 5LMKA 4KKGA 2YZLA 3Q3BA 5CNOA 3WZKA 5KKRB 2C6DA 2C5YA 4MXAA 4Y5QA 1SUSA 4FOBA 3P2EA 5FA5A 3NPCA 3ZRLA 3R6TA 4E4XA 3P7AA 3V97A 4IB1A 2CKDA 4F0FA 3OP5A 4GQBA 5LSAA 3HTXA 4FEQA 3FLQA 3ZLXA 4E5AX 3NTVA 3LFNA 4XV2A 5ANKA 2V7EA 2CN8A 1YXTA 2Y9QA 2I62A 2ZW9A 1CKPA 4JDHA 4GUAA 4O0SA 1RDQE 5J5SA 2VX3A 1XH9A 3TIYA 4WNKA 3MERA 4HTFB 3CLYA 4RX7A 1GIJA 3FHIA 3PIZA 1H0WA 3F9NA 2ESRA 4H05A 3FC2A 3SGCA 5IDPA 5CSVA 1W82A 1YVJA 3VC1A 2ZCJA 2LGCA 4RTQA 4IB3A 2C6IA 3KVXA 3QWKA 4HG2A 2UYHA 4BKJA 2Q0NA 4M68A 3FEGA 2QO9A 4WIHA 4AN2A 3POZA 2GNIA 4ER6A 2RG6A 3KF7A 3QZFA 5C1QB 2C3LA 3IQ7A 4FGBA 4YBKA 2P33A 4UWBA 4HVDA 2VNWA 3PXKA 1RI1A 4AT5A 3FUVA 4FYOA 4ZZOA 3PVUA 3IDCA 2XBJA 4HYUA 4FS8A 4RC3A 5DM4A 2R3HA 4ZXTA 2YDJA 5IU2A 4LOOA 4LV8A 4GIHA 3LJ1A 5EOBA 1M17A 2XK4A 3ORPA 4ITJA 4ERKA 2QOKA 3UZPA 1YOJA 4WXHA 4GV1A 1PXMA 2B52A 2ORED 4PNKA 4CKBA 3FKLA 3C4CA 3ORLA 4EH5A 3HA6A 4XP3A 4YJPA 3TV6A 4E4MA 2BILB 4JOAA 5CCBA 4APCA 4FKPA 1TQMA 3IW7A 3QKLA 4ATNA 3JS2A 2VO0A 4FL1A 1ZYSA 3D5UA 5FUTA 5HICA 3NAXA 4MXZA 4KIQA 4M0YA 3QQLA 2QLQA 2Z7LA 4TPTA 5KZIA 2VTIA 3F88A 3V8TA 4DGGA 1YI6A 1Y8CA 3HCEA 4BGQA 1DAWA 2EJUA 4ZLZA 3VQHA 4HH4A 5CSHA 3GRZA 1UNGA 4G9RA 3DA6A 3SXFA 3QKMA 1AF7A 4DEEA 4RVHA 3ZLYA 4L3LA 4DH5A 4X2GA 3CIKA 2ZWVA 5EOLA 1VPTA 4EVIA 1SVHA 2JGZA 4AS0A 4JQ8A 3DH0A 4HVSA 3ZBFA 4FZVA 2XKEA 5M44A 2QOQA 2X7GA 5C4KA 5E9EA 2GNFA 3I7CA 3Q60A 3DDPA 2G15A 4KINA 4PTCA 3JWGA 2BRHA 2XNEA 4QP6A 3DKCA 4QNAA 3ZH8A 2GU8A 4TNDA 5A4CA 3SSNA 2XK6A 4X7QA 1KPHA 2X9EA 2W5AA 4YNOA 4CQEA 2OZVA 2PHKA 4ZY4A 4M15A 4M67A 3E5AA 4IWPA 5E4HA 2YM8A 3MVMA 2XCHA 4D4RA 3V5PA 5HBJA 4JQ7A 1XJ5A 1OL6A 1MRYA 4FV0A 2PUPA 4FX3A 4RWKA 5KZ0A 3T8OA 4F70A 4BI0A 2PE1A 4ZEGA 4FSXA 3QUEA 4QNYA 3TACA 5HI2A 4DZRA 2NYUA 2QI8A 3EVZA 4HGYA 1M2QA 2YJRA 4XLIA 4C04A 2OH0E 1ZOGA 3E8DA 5K0EA 4JDIA 5HU9A 3SOAA 3R2YA 3LVPA 4XUDA 2VWYA 2P7IA 4LRJA 10MHA 3FPMA 4MWIA 3BWCA 3C3YA 2XNOA 3MYGA 1H28A 1GZKA 1ZWSA 1NW8A 3R6XA 1M7NA 3NIZA 1UVRA 4WT6A 3RHXA 4I20A 1X1DA 3BLHA 4U80A 1IEPA 2VO6A 5ETFA 3KQ7A 4BZOA 4EKIA 4ITHA 1O54A 5CI6A 4U0IA 3CGGA 4PINA 4H58A 4MYGA 4FZDB 4J96A 1UU3A 3LCDA 2JDTA 4L43A 4DTAA 2WMWA 2YHVA 2OXXA 2IH2A 4GFMA 4MWZA 2CCHA 2IW8A 2XB7A 3MA3A 4GKHA 3BYVA 1PXIA 5FHRA 3B3JA 4BHNA 2YIXA 4FEXA 4UZDA 4AFEA 5CT7A 3MH3A 4G34A 3UOLA 3VS6A 5BUEA 3HGKA 5BW5A 4QP4A 3QOWA 2FB8A 3VAPA 4FR4A 2YN8A 4OTQA 1NVQA 3COKA 3D4QA 4P2KA 1VP3A 2BCJA 1Z57A 4FIHA 3BBWA 4U97A 3ID6C 3OZRA 4RV9A 3I6UA 1B6CB 1B39A 2R3PA 2UW7A 3AT3A 1NA7A 3LMHA 1PJKA 2WU7A 3OBGA 4HCUA 4U43A 5DT0A 3R83A 1FPQA 4NSTA 3KU2A 4YURA 1NBIA 3JVSA 5AADA 2B78A 3I4BA 1STCE 4JXFA 5EKUA 4RTOA 3JVRA 3DFCB 5HE0A 3TEIA 3ORIA 1BOOA 3FYCA 2KW5A 4X3JA 2C47A 3PXFA 4BRXA 4NJ3A 4DFZE 3LL7A 4RVGA 4F0GA 3LPMA 3T9TA 4C7TA 3M42A 5J9LA 1Q5KA 4FKWA 2BDWA 2EJTA 3LCUA 3WF5A 1CMKE 5T6KA 5E8TA 4C36A 3MGYA 4G2FA 3KXMA 3BHHA 4CV8A 5D9HA 4RIXB 3PJ1A 4CV9A 3U4UA 4H3PA 4TKSA 3FWQA 4PGGA 4FVRA 1TW3A 3PZEA 3QC4A 2R9SA 3GQIA 2UYQA 3OFJA 3HECA 5D1JA 3LW0A 4O7YA 4EKKA 2QQ7A 4EK4A 3C13A 1ZHFA 2REIA 3NW6A 4FTKA 2VWZA 1NVSA 2AC5A 2QOIA 4FNYA 4G3DA 4GG5A 4LRMA 4MVFA 4BDEA 5ITAA 4CCBA 4EOMA 1FVTA 2VX1A 3BGIA 3QHWA 3KFAA 4KD1A 3H9OA 2RGPA 3NUXA 1FGKA 4MHAA 5EI6A 3TNWA 4EI4A 2IH4A 2IWIA 3O23A 3O7WA 3LKDA 1WBVA 4IFGA 4QMVA 4FGRA 5FDPA 4O7ZA 3LHJA 1DM2A 3DTCA 2JEDA 4OR5A 2VP3A 3RIEA 5BMMA 4MD9E 2Z02A 2HAKA 4NKSA 4YNEA 2P0CA 1XCJA 3VIDA 1NW1A 3IGGA 3Q9YA 3QKKA 3UVPA 1D2HA 3ZTXA 3KKZA 4IWDA 3CGFA 1H1SA 4JAIA 4O6LA 2JFLA 4D0XA 4EQMA 4I5HA 4XHKB 2LD4A 2NXJA 4ASZA 2YJSA 4RPVA 3HRFA 3HV7A 2YM5A 3PJ2A 3LSTA 4TN6A 3CJTA 3NNVA 2UYCA 1PXLA 4FKSA 3DY7A 3SRVA 1Y57A 4O7NA 5D7AA 3OZSA 4H0NA 5HIBA 5HIMA 5DRBA 1L3CA 5DOSA 4RJ6A 3GRRA 2PVNA 2VV9A 3C4FA 2R3OA 4HNFA 3TDWA 4LWOA 2CKEA 1BI8A 4V0RA 2CCIA 4E7WA 4FZFB 3COMA 3O71A 2QOOA 4WKQA 3PWDA 4A9TA 2GH1A 1IAHA 3KPYA 3VF9A 1T43A 3RAWA 2IDKA 2XBMA 3AC4A 2OZOA 3A7IA 2PX4A 5HD4A 4JL9A 3QGWA 2ACXA 2W1ZA 3AQVA 4XG7A 3ZSGA 3EH9A 2PL0A 2YDIA 4O7SA 1FBNA 4CG9A 2BAQA 5JKGA 2X6DA 3BLQA 3FUPA 5A3XA 3H30A 4BDHA 4FSWA 1T46A 2JKOA 4S32A 3UP2A 1WXXA 4LG1A 4C03A 1W98A 5CY3A 3B3FA 2P35A 3KR1A 3RKBA 3BE2A 4U44A 5HLNA 3EVAA 1ZOEA 3FL5A 4R8RA 2RFSA 4DGMA 3TKAA 1WBOA 4NU1A 5HX8A 4QTUB 1KHHA 2OIDA 4BCOA 4AW2A 5IQEA 5LMAA 5AMNA 3ZONA 5DRYA 4R6VA 3SW4A 3E8NA 4FTCA 4TWNA 4C33A 2CSNA 2HOGA 1JNKA 4O2ZA 4ZSJA 4IZ5A 3DMGA 3RODA 4GBED 3FI8A 2B3TA 4CZUA 4Y2HA 4AZWA 2UZWE 3FE3A 4RWIA 4YJVA 3B7PA 3FTDA 5EQJB 3UJCA 2JDOA 4JRVA 1U46A 2BMCA 2VTPA 3EQGA 2HW6A 4FUXA 3TKUA 5LVNA 3LDGA 3UJDA 4J99A 4CWAA 2VZ9A 3DB8A 5AIKA 4GVJA 4M3QA 1OGUA 4PYKA 1UFKA 2XRUA 5HE3A
chains in the Genus database with same CATH superfamily
3SLGA 5HE2A 1CZHA 4F4UA 5BP7A 4TWRA 2X4GA 1JU4A 1GOLA 5IN5A 3N07A 1C0IA 3DDHA 5DT4A 1X0XA 4A6PA 2HJRA 1U0JA 3OSZA 5AHKA 2ZIFA 3DJ5A 4L73A 4ZEXA 4X1IB 3VNAA 2AOXA 5BVEA 1PMUA 4IDDA 4D0WA 4QMQA 2Q5JA 1YOVA 2XNJA 1Q7TA 1GNRA 3HUEA 2PH7A 1USUA 1FXWF 1DJOA 1CJTC 1XQYA 3BGSA 2RDMA 4L5IA 1E3WB 2P7HA 4FYHA 4PL5A 3OLYA 5DDIP 2PQ0A 5KYKA 1JQDA 1P9LA 1SB8A 3OHPA 4HLCA 4MX8A 4EFMA 4O2AB 4MVJP 2C8JA 2H4YA 1LDBA 1WWKA 4OQMA 5JSQA 3MMNA 4IIRA 1QSGA 5TOZA 4IVNA 2WJZB 3DNDA 4B80A 1KE6A 2PXCA 3HMNA 1GVNB 5DPMA 1PL7A 2GFHA 1SURA 4EDFA 4BDGA 3NLLA 3BXEA 5ALPA 5IA0A 2V4UA 4IDEA 3JAWB 1Q3TA 4N3GA 4XRLA 3HZRA 1IEQA 2OZAB 1T4MA 3MPAA 1YDMA 4JC0A 4DBLE 5JWOA 2J9MA 1A9UA 5F77A 4Q24A 5LLSA 3EGDA 1GU1A 3UJ7A 4B8LA 1KETA 5HGXA 3FCUB 3H83A 4J91A 2K2WA 2B9VA 3U3ZA 4K6HA 1KC3A 2BEVA 4EGJA 1U1EA 1DTWA 5H5JA 1VHDA 3X2SA 1JIUA 1VG0B 2H2IA 1PZXA 3AP2A 4BBMA 3GU6A 1W1UA 1PKEA 1KI4A 5FWYB 3RFUA 3D0RA 2QOBA 2JDIA 3AEXA 3PJFA 3TTIA 4IXTA 1OWOA 3EFJA 4ILEA 4Z0PA 3AHEA 3KYDA 1CJVC 3F90A 4H1MA 4AUEA 1XIVA 2X2PA 2QLTA 3KQLA 3Q7IA 2QIOA 2HK9A 2JS7A 3QMPA 4EKEA 4D57A 4FL3A 2B9FA 4NBUA 4FGLA 4MCHA 2QTNA 4TKZA 3GX1A 1L7MA 3KK8A 3EDRA 3ETCA 2ZTVA 1TYCA 2W1EA 5E8UA 3PVSA 4H7JA 5FLFA 2UVYA 1M5UA 1YBHA 1C1XA 2VHTA 4ABTA 1TM4E 3SJAA 3UG7A 1R0PA 3QQ5A 3TW4A 1OYVA 3I2FA 1APME 1ONOA 2PUNA 3RWQA 2XUIA 1H1PA 1XTBA 2YXPX 2IBMA 2QTFA 1N7HA 2R1UA 4FI1A 1Q41A 3TQFA 3OZ7A 1AUVA 4L1KA 4OHZA 3ENNA 1L8TA 3AB7A 1N25A 3P9IA 4RGQA 3THBA 1QYIA 2IIVA 5IISA 3CCCA 5KC9A 4NH1A 3D02A 1CEYA 1GCUA 3IMGA 1GG2A 4F9WA 4QPZA 3ZHTA 4FG8A 3RSHA 1CIVA 2ZR0A 3VNTA 2B37A 1A9OA 5C4GB 4AGCA 4ZGWA 5FEEA 5HCYA 3RKRA 1QYVA 2OXYA 4KQFA 4PHCA 2X81A 2O2HA 3I52A 1AB5A 4TSFD 1K2WA 2C0OA 5DNWA 1T0IA 3CRW1 2XMCA 3IQIX 4CCYA 1G6HA 4LKRA 4PAGA 4DDTA 5EG3A 4QX6A 2BGGA 3BYOA 5A5DA 3KQWA 2G4VA 3RTEA 2P9QA 1GQFA 4QECA 2CN1A 2GTHA 3QRKA 4D0NA 1MIOB 3V3VA 1VKHA 3OF2A 1KWPA 2BRMA 2L18A 2ZU0C 3D2CA 3I2IA 4IJUA 2JNWA 4AP7A 3PJ3A 1ZC3A 3EZFA 4NUSA 3H75A 2YS6A 2QHMA 4S33A 1Z4IA 4BNWA 4FZRA 4JUIA 2GZMA 2G8NA 4QE3A 1GZNA 1IBCA 3WK6A 3ZWAA 3U3RA 4U2EA 3SQOA 5EDQA 1R6TA 1VPEA 1J2EA 2BMFA 3ZQ4A 3VS7A 3L7YA 3REPA 5EMMA 2J90A 3WP0A 4CZ2A 4ZK5A 1FP1D 2HWYA 2R9VA 2OO3A 1E2MA 3KTAA 4GPBA 3QHPA 2VNKA 1S3SA 3FI4A 1C8BA 3HWX1 3Q0TA 3I92A 3N8DA 4HY3A 1X1RA 3FYSA 2XZOA 2AOTB 3TMYA 4DYVA 4QFDA 3PITA 4EGAA 4F8YA 3O1LA 3KNZA 1ZYUA 4G9BA 3L8DA 5B6IA 3K35A 4XWAA 2VS1A 1ZOPA 5HZMA 1M8FA 2C54A 3C15C 4GE3A 5JANA 2QU7A 5T4FA 2B2NA 2PUCA 2QLNA 4O0MA 1RJBA 2F57A 1MV8A 1DC8A 3IALA 4YMLA 1V95A 5LARA 3AF6A 2ZTHA 2GFIA 4MYTA 5DNEA 1ZD2P 4RTMA 1DWPA 2ZAOA 4JZYA 4OA8A 4CQLA 4FJVA 4YJ2F 1ECFA 3KV3O 3PPYA 1A7JA 4GK3A 2DXIA 2AXPA 2JIVA 1XNRB 1EUCA 5HX6A 1U7PA 1FDSA 1EJ6A 4YMGA 4D9FA 1OIXA 2PFGA 3NHLA 3TYXA 1VYWA 1E9HA 2ZJ8A 5AM2A 1OI2A 1KKMA 1FFDA 1QB7A 1ZMTA 4IC8A 3PHCA 1HV8A 1FTYA 2AKAB 4HJRA 2X8AA 1XAGA 3HCNA 1N5OX 1RABA 4QQ8A 1F06A 3K9HA 3AVYA 3IDPA 4UD6A 5GONA 4N0SA 2ZJ3A 2KLBA 5BUCA 4QFMA 1STOA 2R8BA 3GAZA 4WA9A 4Q3OA 4IY1A 1FVVA 2VUTA 3R24A 5MFPA 4RVSA 3ANQA 2D4HA 1P4RA 1WF3A 4ZAYA 1U0SY 2PLFA 2ODNA 1UWHA 1H42A 3SBXA 3QC9A 2FSLX 3TQTA 1QZXA 1DC7A 4HRYA 3L7LA 4GDFA 5LM3A 2B6HA 1R0BA 1F5SA 1VHLA 5E2IA 2IHTA 4KAXA 4DR1B 2RGYA 3BRWD 4F1WA 3O91A 2C5AA 3L8YA 5HORA 1W0KD 1A2QA 4E8AA 1W73A 3DD1A 1U5QA 1U11A 1U02A 4GYIA 1KAHA 5EGSA 3BTSA 3WZDA 1WPRA 5LCJA 3DS8A 3O94A 3UODA 2WLSA 4UTXA 1QR2A 2OD7A 3IUYA 4HDSA 3GUUA 3IVGA 4KGZA 3A1WA 2Z8XA 2PT5A 5DBGA 1YRAA 2PFKA 1NR7A 4DUPA 2OUIA 1B73A 3NC1C 1XZPA 3NFYA 4TWZA 5J2UF 5JDCC 4GMKA 3FNGA 4DNPA 1X7HA 3IDZA 4ACHA 4QU0A 3RVBA 1YHWA 1JS1X 4DT9A 3WLNA 2C7BA 2J5EA 3BEAA 4DDIA 4ZTMA 4U2BA 2HMSA 4IFBA 3RTDA 1X2EA 2FR8C 2VK4A 1EP2B 4X2KA 2GJAA 4G1FA 4EKNB 1P7WA 2A3NA 4ZTHA 4OM8A 5K1ZA 2ZMCA 5AKXA 2VP2A 1Z4NA 4EO7A 3PRYA 1P7PA 4DRXA 2BUCA 1Y3IA 2XGMA 4K6MA 3OCWA 1YR8A 3FPAA 2CF5A 1WDTA 4XB1A 1GQYA 3QQGA 4GEOA 3AR4A 1TC1A 4KMRA 4N49A 3G5LA 2AVDA 5CK4A 4JDPA 5J1SB 1GNGA 4Q05A 3WLJA 5HILA 1CWUA 4B85A 4F0IA 4N5IX 2ZM4A 1XMSA 3SD7A 1K4MA 3R9RA 5ARCA 2VTNA 3OA0A 3KR2A 3Q8LA 1PRYA 4XOIA 3CVUA 3RJZA 1HETA 4CCYB 4DUYB 1OFIA 5MN4A 3SLKA 4W5TA 5DEYA 3H4IA 4U9UA 3PGA1 1PJQA 1WVGA 1VCIA 1MIOA 2W6ID 2GAFA 1LPMA 3R02A 1IHXA 1NUHA 1RBYA 2VPYA 4UQOA 1VBMA 3KUXA 4FMPA 4C3RA 4U6QA 1H65A 2A5FA 1SVUA 3GPCA 3P0HA 4G1VA 5JO9A 4G37A 3WYGA 4ZT7A 3ACJA 1Z5VA 1V11B 2JGFA 4TSFA 4O5AA 1YZFA 1A5ZA 5CW2A 2EBFX 5D00A 3DBRB 2DF8A 4G5HA 2GNGA 3IIKA 4RM3A 2R3KA 1ZGAA 6ABPA 1CQJB 4PBTA 4JJIA 1K3FA 3AVQA 3WX0A 5HM8A 1I2AA 1B38A 1OAKA 3FUTA 3KULB 3CBLA 3R01A 4ZDWA 4ITRC 3WC4A 4RHFA 1VYTA 1GUDA 2PZLA 4C3ZA 4DY4A 5EUQB 3A2KA 2XQGA 4FI3C 4MPJA 2O52A 3QXGA 3DEJA 1E62A 3QSYA 4E5VA 1Z7GA 2XMDA 4QYXA 1TZ2A 2NZUG 4WXPA 4ND5A 1JKTA 1PNOA 4F1KA 4Y5HA 5KNDA 4EJSC 1N4AA 2H07A 2C03A 2CPKE 4G0NA 1HG1A 1NIPA 1DRWA 3LVRE 4CPDA 3C0IA 4FPXA 3G6WA 3DXFA 2FMKA 2DS1A 1SZMA 3U54A 2CMKA 4WO5A 4EORA 1SQ0A 4V0ME 3FMMA 1X19A 3JD0A 4RK4A 4F7SA 4F4DA 1QGAA 2PRJA 2FDRA 3HJCA 3WK4A 4CKZA 1FTQA 4HB2A 4KLCA 1WBWA 1AQUA 4G26A 4M8NE 1RS0A 2VSNA 4XUCA 2ZBQA 3OWHA 4LNUA 1JKSA 5CDYA 1Z88A 1G5SA 1MO6A 1X8LA 2VCHA 5DPVA 4QUKA 1YOLA 3GRCA 1AKNA 3WTCA 1SG9A 5LWMA 5HCZA 4DIEA 4AY2A 5FBOA 5JAZA 3IP8A 3VVHA 4M69B 2H34A 1UMCA 3PFQA 4C07A 5BYKA 3TLZA 2CXQA 3AGPA 3QX8A 4FIJA 2ZV2A 1NZDA 4QPPA 4UUAA 1QV6A 1J2TA 3E7OA 4ACCA 821PA 1E1RD 4RPKA 4R7HA 3KJZA 4DFXE 4GXRA 1UMKA 4DJDC 2IG7A 4AJEA 2JBAB 4JN6B 3LP8A 1WUTA 2KX7A 1LQ2A 1CDDA 2CBZA 2JB9A 3SN6A 5CCXA 6PFKA 4LJ9A 2ZRGA 4QXQA 3QE2A 2X8WA 3ZWDA 4JS0A 4BYJA 4YRBA 1CUUA 5F94A 3N0RA 2IUEA 4R2IA 4D74A 5DG5A 2CEKA 5TV2A 3A4MA 2MYUA 5AA9A 3HKBB 4IINA 3UT5B 2WV9A 3H3FA 3ZV3A 4O91A 2JLUA 3B2EA 2XMBA 4FIDA 3C0KA 3P71T 4NJMA 5C01A 1LVHA 5DGDA 1THTA 2NNLD 1CR2A 1QS0B 5THXA 4WHZA 1N0WA 4BCNA 3GEPA 1X7ZA 1C5KA 2FKAA 2P0YA 5HF9A 4GI1A 1R0SA 2QRPA 5A4TA 3P9KA 4BGHA 3GEEA 3VU8A 1FGIA 1A71A 1ZJJA 4YIKA 3ZWNA 3RO7A 1RZRA 2QAJA 1FPMA 3ZZ1A 2CV2A 2QUJA 2BBOA 2IH5A 3PJ8A 3B2TA 5CIYA 1R8YA 1MT3A 1ZUNB 3MAGA 4DLZA 3KUKA 3P2OA 3LBHA 2YIYA 4UKDA 3KV1A 1LPBB 4OTIA 1HDCA 4EW1A 2FETA 4EBVA 3GLHA 1MTZA 4Q15A 4UNQA 4N9WA 4UNRA 4JUAA 2O2UA 3HJNA 5I9XA 1K63A 3CINA 2C0QA 3WMWA 2AF4C 1ZH6A 2P0AA 1OHHA 3UJBA 1NMQA 2IYOA 2EB3A 2IPNA 4QOHA 5CENA 4RCVA 2IDMA 5MF6A 5JAOA 2VYQA 3VPDA 2Q3JA 4WCFA 3BXFA 1NLMA 4EQUA 1RXSA 1KKUA 2BGUA 2D59A 4DSTA 2KI5A 4LK2A 3KFXA 5A4MS 3MTQA 3RM7A 1C41A 2C0IA 3ELUA 3HVKA 4OQFA 1WVMA 4KQXA 3I5MA 1G2OA 2H08A 5F5XA 3RNOA 5IVPA 3EEQA 2O5KA 1U3WA 4YZNA 4A3SA 4MX9A 3IBCA 4GL2A 1M6EX 4UTVA 1JG6A 3MIZA 2VWQA 3T7RA 2GPTA 1FVFA 3FOEC 1DFIA 4O38A 1SB9A 1W8IA 4M9SA 4NIFB 4GKBA 2IIPA 4KXMA 2HHJA 1MFPA 3EBLA 1TVEA 4KPUB 1ODIA 1XZFA 5IAKA 2F8TA 3Q96A 3O38A 4C30A 4P7EA 3FLNC 2PL1A 3NATA 3TIVA 1TECE 4M37A 5DH3A 4C0LA 5EQFA 1TPZA 2QTAA 4AAAA 2QP9X 2CNWD 1J56A 1SVGA 2P6OA 3VR3D 3UO6A 3GJQA 4D4GA 1JT9A 2NTJA 3NYNA 5ETCA 1E77A 4KYVA 3UUFA 4FUTA 1WY5A 3OJLA 3TRJA 3KEOA 4I1IA 1J06A 4X3PA 1QTIA 1I9CA 1NF9A 3E7WA 3ALNA 4YRSA 4DIOA 5FT9A 5CURA 4BQQA 1KMIY 4OO3A 2QR7A 3ACCA 1Y3AA 4C0SA 2NLOA 4FKGA 3QP9A 3TJCA 3HU2A 1GLVA 3ERKA 2QTVB 3IERA 1XN4A 2HQSA 1J5XA 4V04A 2HWUA 4JR2A 3I32A 5BPYA 1M2OA 2DTXA 2VZEA 2XKCA 3CW2A 1PZMA 4LMRA 2WWGA 3C97A 2YHBA 3QHRA 3MJVA 5JGBA 1BXRB 1CPYA 4EHNA 3VKFA 2CJYA 2C95A 3UNKA </