4BJJA

Sfc1-sfc7 dimerization module
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
SLKISDNEYALIEHPGFANNKDAFFQTLGGVQSIQKACQTSFQNPAAALLELNLRPKDKYHHPVQARVQSRNDLLVTIKKMDNSVQNVSRIRQVFLFRDMADFQYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR TAU SUBUNIT SFC1
publication title RNA Polymerase III-Specific General Transcription Factor Iiic Contains a Heterodimer Resembling Tfiif RAP30/RAP74.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17682 Tau95_N Tau95 Triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.160 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bjjA00
4BJJA
chains in the Genus database with same CATH superfamily
1TVOA 2V22A 4LL0A 3HRFA 2VV9A 5AUXA 1OMWA 3DBEA 3P1AA 1OL6A 4MNEB 4A4OA 3WE8A 2C3KA 5C4KA 4G16A 5DG5A 3MH1A 4RLKA 3S2PA 3SRVA 5HU9A 3UOLA 5HE1A 2WTJA 2P3GX 4ID7A 5HVKA 4QTEA 3S0OA 2ITTA 3EKNA 1WCCA 3PRIA 5H8GA 3OROA 4OTWA 4FIEA 4GG5A 3V6SA 3PVGA 4CMTA 4DEEA 2BAKA 4RBLA 3ET7A 4EQCA 3C0IA 2BR1A 4TL0A 4DCEA 3QRKA 2XK8A 4GS6A 2DUVA 1JKTA 2C0OA 1G8SA 4ASEA 3VVHA 2YCSA 3C4EA 4KUJA 4L67A 4WNKA 2I0VA 3LFNA 5HEZA 4C4FA 4RIYB 4MXCA 2XNGA 2CCIA 2XANA 4WUNA 4O6EA 1FINA 5EHLA 3R9RA 2JIVA 3HMIA 3S00A 3EZRA 3SD0A 4KKEA 3EYGA 4WRSA 2V7AA 2PUUA 2I0YA 4Z7GA 4GT4A 4RJ5A 4RX5A 2F57A 2P2IA 4NM3A 2VO7A 2YN8A 4JR3A 3MA3A 4UY9A 3TNHA 3E8CA 4GFMA 4I94A 1IA9A 3KB7A 3F5XA 3DGKA 4L8MA 2X7FA 4JG6A 3ZBXA 5EKNA 4EJ7A 4FT7A 4JJRA 2ITXA 3MV5A 4KBCA 2Z7SA 3BLQA 2OSCA 3CD3A 2OH4A 4E26A 2FH9A 1R3CA 2XBJA 3PXRA 5J95A 3B8RA 3K3IA 2H34A 4QDVA 4APPA 2R0UA 4YTCA 1MRYA 3ZC5A 2HY0A 3ACJA 1Y8GA 2HXQA 3QWJA 4ZTLA 3VS6A 5I9XA 4YBKA 3AG9A 4DEHA 5EK7A 4OBQA 4OBPA 5DLSA 4AXCA 3NUNA 2C68A 4D0WA 4BBMA 3LKMA 3F7ZA 4NU1A 2A2AA 4FNYA 2WQEA 3GXLA 3DDPA 1QPJA 2JBPA 3BKBA 4JIKA 4PP9A 3UC4A 3AC5A 3P7CA 5KO1A 4RJ7A 3MS9A 4QMLA 4G3EA 5DHJA 4JDJA 3DY7A 3QRUA 3ZEPA 4JAJA 4CXAA 5IMXA 3R30A 4PQNA 2G15A 3V5QA 3NUPA 4PTCA 4AT4A 4AAYA 2XB7A 4MD9E 4WNPA 5C26A 4D28A 4DAWA 2WOUA 2XEZA 3TUCA 3MSSA 4E6DA 2YZLA 3KVXA 4U81A 2LAVA 4Z16A 5H9BA 1PY5A 2HWPA 4FV9A 3MJ2A 3V5LA 4AS0A 3MN3A 1DS5A 3C0GA 4YZMA 4GH2A 1VR2A 4O0YA 5AV3A 3PE1A 5CSHA 4PTGA 3KXXA 4ACCA 4EKLA 3FY2A 3CS9A 4I0TA 1BKXA 5BMSA 1O6LA 4MUQA 4B8MA 3FXXA 2WU7A 5AV2A 3RAIA 2CNUA 3FMNA 2Y4IB 3R8ZA 4AN3A 1URCA 3RJCA 4O2PA 4GU9A 3SVVA 3DJ7A 3QLGA 5AP1A 5GHVA 3ZFXA 3ROYA 5K4JA 4M97A 3VO3A 2PE2A 4IX5A 3VUIA 3W0PA 2W9FB 3DTWA 2A4LA 1H00A 2G1TA 1UWHA 4QYYA 4OR5A 4C0TA 2UZOA 4C4GA 4ANLA 1PW2A 1MRUA 3QGWA 5IQDA 3CLYA 3G0FA 4UYNA 2YCQA 1TFFA 3QXOA 3VJOA 4X3FA 4FZAB 4G9CA 4BCNA 4DA5A 3MVJA 2IW9A 3O51A 3KULA 3FLYA 3I0OA 4PDOA 3NR9A 1FVTA 4GW8A 4EI4A 3ZM4A 4LRJA 3NUAA 4IX4A 2YFXA 4NFMA 5M4UA 1KWPA 3IG7A 3R7VA 3ZUUA 4OT6A 4J99A 5EI6A 4MBIA 3GOPA 1JSVA 4IJ9A 5C03A 2QCSA 5AP4A 4DBNA 1YI3A 4ZZMA 5CSXA 3WYYA 3KMUA 4C35A 5JGBA 1A9UA 5CF6A 3KXMA 4PNKA 3CJGA 3UIXA 1PYEA 3I5NA 3ORNA 3ML1A 3U54A 3BL7A 4IADA 3OBJA 3HV4A 2GNFA 2WMXA 4O81A 2OKRA 5M55A 5HE2A 4Q9SA 4MBLA 2JAMA 3O71A 4ANQA 2VWIA 3QRTA 2JDVA 4ZP5A 4AXDA 2OBJA 2Y6MA 3BLAA 4YJUA 5K3YA 4F7NA 4F70A 5LOHA 3JPVA 1W84A 4OTHA 3VS3A 2O8YA 3PRFA 5AAEA 5FXSA 4USFA 4S30A 3FYJX 3ORIA 4MTAA 4DFBA 5CF4A 3ZO4A 4NWMA 5L8KA 4OTRA 4RRVA 5CNOA 3VW8A 3KRLA 5CASA 3MPAA 4YJPA 2XH5A 3DA6A 2HAKA 3F69A 3GC7A 2BILB 4FODA 2ETKA 1G3NA 4NKAA 4EOMA 2OJIA 4ZEGA 3FY0A 2FSTX 3ORPA 5KMKA 2IN6A 4D1ZA 2J5EA 4BHZA 3U6HA 3W8QA 3PFYA 4C3FA 4FSRA 1CKJA 2QO2A 3HV5A 3BLRA 4RIXA 3L9PA 1QPEA 3LFEA 4WSYA 3AMAA 1WBSA 3IONA 4Y73A 5GNKA 4BCJA 3VF9A 4WO5A 4CV8A 4MVFA 4WNOA 2XAMA 5BUEA 2DYLA 3D14A 1BYGA 2BTRA 4FT3A 2QQ7A 5CQWA 1BI7A 4DH1A 4XJ0A 4D4RA 5KE0A 3N4UA 3FMJA 5CANA 5A4LA 2XIKA 3L8SA 4FKWA 2P0CA 2UUEA 1OBGA 3EWHA 4BYJA 5M08A 1R0EA 2YJSA 3QAME 3IGOA 2PZ5A 4RA5A 5LXMA 3Q52A 5DVRA 3JR1A 5IU2A 4O82A 4WT6A 4EK3A 3ZRMA 4EUTA 3EQGA 4BDFA 1JVPP 3MVMA 3W2PA 4DG2E 4YC3A 4JAIA 4QP3A 5AM6A 4JL9A 3HVCA 3EQBA 2WTCA 3JUHA 3IOKA 3PA3A 1RJBA 2I40A 1XH5A 4M8TA 4TWCA 4V0GA 2X8EA 2J0MB 4R5YA 2OF4A 2ZMDA 3UODA 1NVSA 4U7ZA 5CU0A 3PXZA 4FNWA 4ANSA 4BJJB 3ZSIA 3LMGA 2IZUA 2WD1A 2WXVA 2J2IB 4S31A 5CI7A 3NAXA 2CLQA 2IJMA 3EL7A 3GI3A 3PXQA 4G6OA 3B2TA 4XG4A 4H3PA 4DBXA 4BGHA 3C4XA 1VYZA 2FSOX 2F7ZE 4FKSA 5ITAA 4D9TA 4RT7A 3UO5A 3BHVA 3FMMA 3HUBA 2X39A 2BCJA 1EH4A 3KL8A 4IWDA 2F4JA 1PXNA 3CQEA 3BYOA 4IM3A 2WEIA 3NCGA 4R7BA 3ID6C 4C2VA 4BDAA 3DQXA 5I9WA 4M14A 3QUEA 4U8ZA 2XZSA 4YHFA 4FT0A 3D94A 2QKRA 4HNFA 4AT3A 1ZYDA 1Q99A 2R3KA 3DU8A 3HRCA 3RAHA 4U79A 3BIZA 4MXXA 3F3ZA 4FE2A 4JBPA 3VUMA 4AQKA 4K2RA 5IG1A 1P5EA 4K8AA 3OG7A 2V5QA 5DH3A 1PKGA 4RIWB 4O7WA 5ACKA 3TNWA 5AUWA 3OFMA 4TWNA 4D0XA 1LPUA 2BHHA 3COIA 3GT8A 3UVPA 1TQMA 2EVAA 4FSNA 3QU0A 1JQHA 3RCJA 4FEQA 2P4IA 2ZB1A 3AMBA 4Q5HA 2UV2A 2I6LA 1R78A 5L2WA 4F7LA 2XYNA 5JK3A 5IH4A 3TIYA 4KB8A 5KZ0A 2VN9A 5CQUA 5EHOA 2R3FA 2ZOQA 4FEWA 3MTFA 3F5PA 3NUSA 3PLAE 1V0BA 3OY3A 3EFWA 3AGLA 4LG4A 3QL8A 4UZHA 2B1PA 3AC4A 4FTJA 3UMXA 4DFXE 2QO9A 4ENXA 5CAOA 2BPMA 2J0KA 4R78A 3HGKA 1W8CA 4YO6A 2REIA 1XJDA 4EBWA 4IM0A 3S95A 3ITZA 4TYEA 3A7FA 4FUYA 5E8YA 2OJJA 3GCQA 3QF9A 3A7IA 5LMBA 3NYXA 4JX3A 2VO3A 4NH1A 4L00A 2R3RA 1VZOA 3MESA 4PDSA 2YIRA 5M53A 5DGZA 2WELA 4RFZA 1DAWA 2C3JA 4CTBA 1H1PA 1JKKA 4EK8A 4ZY5A 4D2SA 3FMDA 4YZBA 3BYUA 3EQHA 3R21A 4AAAA 4QQJA 5FM3A 1KE7A 4J8NA 2HCKA 4UZDA 4BCKA 3EFKA 4LI5A 3TXOA 3VS7A 5LVMA 4C37A 3IW6A 3E62A 3PWDA 3HV3A 4ZTSA 5AUZA 3QQGA 2UZWE 4C36A 4E93A 2OIBA 2ONLC 1JNKA 3QD3A 4XCUA 1W7HA 4GEOA 4HCUA 3SHEA 4FTQA 4I20A 2E9NA 3QKLA 2CGWA 4LRKA 3SKCA 4QMZA 2VO6A 4DGGA 3KXNA 4XP0A 3ZSHA 1XBBA 3R02A 3Q53A 4ZLOA 4IFCA 5HD4A 4XRJA 2IZSA 4FL3A 4XOZA 4MQ2A 4HW7A 5ANKA 3ZUVA 3MTLA 3PXKA 4D1XA 1PMVA 2PVLA 2YACA 2O64A 2ZMCA 4FG7A 5AUYA 3VULA 4B0GA 3PIZA 3PUFC 4J53A 5CU6A 2RFSA 3DPKA 2O0UA 4KBAA 3IO7A 4MK0A 5DRBA 4LUDA 1ZMUA 4C3PA 3TG1A 2HW7A 5KX8A 1T45A 4FUXA 3TNIA 4EONA 3WF9A 2W7XA 3AKKA 2QG5A 4DGOA 2F2CB 4ITHA 2WZJA 4IVAA 3RALA 5DFPA 1U5QA 3IW4A 3HRBA 2VTMA 2YWVA 4II5A 2FA2A 3D4QA 3D9VA 3QTXA 4U40A 5DRDA 2I0HA 3UZRA 2YCFA 4ASXA 3Q9XA 3CQUA 5FXRA 2HWOA 3VHKA 1PXKA 5FG8A 2HK5A 4AGWA 3TEIA 3R8UA 4O91A 3ZLYA 2QR8A 3KA0A 2RFNA 4P5ZA 3DFCB 4PNIA 5HNIX 4DC2A 4E4NA 5J9ZA 3RCDA 2BMCA 4D55A 1R1WA 4G5PA 4ASDA 5BVKA 3TV4A 3NVKI 1YWNA 3ZC6A 1Q3WA 3UZPA 2ESMA 4UEUA 2E2BA 5AP6A 3FLNC 3ETAA 4DCAA 4CMOA 2X1NA 5T68A 3SOAA 2GQRA 5EW3A 3U55A 2ZV7A 3FC1X 3OXZA 1FBNA 4FIHA 4DN5A 4GMYA 3P86A 3GENA 5EW9A 3BEGA 5IMEA 3R8LA 3P79A 3AOXA 4HNIA 4NIFB 4RVLA 2EU9A 3UYSA 5IPJA 4Y85A 4BZNA 3VS1A 4K6ZA 1QL6A 5CY3A 2J0LA 4MD7E 4JBOA 3QUDA 4HYSA 2HELA 5CNNA 4C2WA 3F5GA 2W1CA 4FKJA 1L3RE 3NNXA 4U42A 4RG0A 3BU6A 3K2LA 1OVEA 5LMKC 2H8HA 5EW8A 1HCLA 1M7NA 4HGSA 4BDHA 1DAYA 4NTTA 3PJ1A 5T6KA 4M13A 4H3QA 2VNYA 1PKDA 2FO0A 2QO7A 3ZOSA 2BRBA 2C6DA 3ZZWA 4UWCA 4CLJA 3LQ5A 4BICA 4E20A 3PIYA 4UB7A 1YHVA 4PX6A 2ETMA 4EYJA 3RPYA 3F2NA 4L3LA 3BGZA 1YHWA 5ETAA 5CYIA 2BUJA 2J90A 1UNLA 3TJDA 2AYPA 3R00A 5ANOA 5CEKA 4FTRA 1M52A 4FT5A 3LVPA 1RE8A 3NCZA 4R3CA 4QO9A 4AZTA 3QTQA 4CRSA 5ETCA 2O2UA 3MA6A 3AD5A 1OPKA 3HV7A 3CY2A 2W1ZA 3EIDA 3HDMA 4KRDA 3PA4A 2BTSA 4U5JA 3OWLA 1J91A 4V01A 2EUFB 2KTYA 3IW8A 3BCEA 1ATPE 5E8XA 4ANBA 4CCUA 4R77A 3HAVA 4QPAA 5BVFA 5B7VA 2R3IA 5HG8A 3UVQA 4G3GA 3VS5A 4IM2A 2J0IA 3H10A 1P4FA 4N70A 2F49A 4TT7A 4YBJA 3CPCA 3HP2A 3WZDA 4OTGA 5HIDA 4TYGA 2BRNA 5CENA 4AOJA 3UOHA 1XH7A 4FVRA 2VD5A 3IW7A 2QKWB 4IZYA 4XLIA 3UJGA 4G34A 3WZEA 4PWNA 1OZ1A 1H1RA 4L7SA 1UU8A 4MNEA 5EHYA 2PZRA 3LXPA 3NUXA 3OT3A 4FKGA 4AQCA 3W0MA 5JGAA 4E1ZA 3F88A 3OEFX 4FYNA 5LARA 2VWXA 3FZRA 2GQSA 5HBEA 4ZLYA 2OH0E 2Y4PA 1TQIA 2X7OA 1ZMVA 3BHUA 3DNEA 4FKVA 4FV7A 2QLUA 4NM0A 5M51A 1H24A 3PJ2A 4PDPA 3DJ6A 4FMQA 5CAQA 2G9XA 2OXYA 2VWUA 4QQTA 2W5BA 3QLFA 4TPTA 4U80A 4IB0A 1KV2A 3RK7A 4NKSA 4LQMA 4G3DA 2GMXA 5DNRA 3W33A 3OEZA 5HI2A 5DPVA 2ITPA 4RIYA 3KN6A 2QC6A 2QLQA 5HVJA 2Q0BA 3ORTA 2OIQA 2QD9A 4IZAA 4EL9A 2YM6A 4Y5HA 4QMNA 4RMZA 1ND4A 4PL4A 2BZJA 2VTOA 4RZVA 2OJFE 3GP0A 3QA0A 3DCVA 4FV2A 4EH3A 3WYXA 5HTBA 1LEWA 4DT8A 3G33A 4HCTA 2R4BA 3OMVA 2PMOX 4S34A 3ZXTA 2WHBA 1PHKA 3G0EA 4WNMA 3UTOA 4GYGA 4XBRA 5BVDA 2W1FA 3QC9A 1TKIA 2QR7A 2XNOA 3VN9A 1YXUA 2VTJA 5KZIA 3WZUA 2UZBA 2PYWA 3SDJA 2PZIA 3EN4A 3UIUA 3TM0A 4EEVA 5CALA 4RC3A 4WA9A 4ZMEA 1ZAOA 4OTQA 5AV0A 4FSMA 4LRMA 3Q04A 4N0SA 5IEYA 2OU7A 3W2OA 4DHFA 1JLUE 4AE9A 3Q4CA 5L8LA 3S1HA 3F3VA 2YDIA 4OLIA 3WBLA 4A9RA 2QURA 4AX8A 2GS7A 3DXNA 2ITZA 4GCJA 2ITOA 1JWHA 3VUDA 4I6HA 4A9YA 1IAHA 3RPVA 2X4ZA 4BCHA 1YOMA 2W4JA 2O63A 2WFYA 4CRLA 4EORA 2XK9A 3PIXA 4YMJA 1KE9A 3CY3A 5BX0A 2DS1A 3BWFA 4CG9A 3H0ZA 3Q5ZA 5H2UA 3ZEWA 3D7ZA 4HGLA 4ONAA 3DXPA 5E7RA 4YJNA 2C5NA 4JBVA 2PSQA 2B9IA 3BX5A 5L6PA 3LHJA 4XV2A 4DFYA 5IUIA 4ERKA 4X2KA 3E8NA 3QCYA 3PXFA 3PE2A 5BYYA 3CIKA 4RWIA 3F82A 3EOCA 3G6HA 3R9DA 3W2CA 2VX0A 5IUHA 3E88A 3I6UA 3NYOA 4FYOA 4GK3A 2GDOA 4XG9A 4CKJA 1ZXEA 4I6LA 3U6JA 2EB3A 1SYKA 3LXNA 3SXFA 3UOKA 4EOSA 2QOKA 2ZV2A 3L8XA 5E4HA 3FL4A 2CGXA 2WIPA 5LJJA 3L9MA 1R39A 4DLJA 2JC6A 5EM8A 4RLLA 3UPZA 5LWMA 2V62A 3O50A 3SW7A 5IDNA 3IW5A 4X3JA 4AW2A 3QQHA 3R8PA 4EH4A 1CKIA 3BYMA 4RGJA 3TT0A 4F0GA 4TN6A 4O83A 3FPQA 3IDPA 4L7FA 4X0MA 2XKFA 3EB0A 1J7UA 1V0PA 3MYGA 3O17A 1RDQE 5D7AA 4EC8A 3GFWA 5GINE 4K18A 3AC3A 1NA7A 5J9YA 5AEPA 5E92A 3ODYX 4RFYA 3ZLXA 4J95A 5E1SA 2PE1A 4JDKA 4M69B 2CDZA 2XKCA 1W98A 3D7TA 4EUUA 3NFFB 2OO8X 3LAUA 3K5VA 4ZJVA 4O96A 3R22A 4R1YA 4HCVA 2YDJA 3MPTA 2GU8A 1W82A 4V05A 1YDRE 3TKUA 5BVNA 1WVXA 1OECA 2Q83A 2GSFA 4FVPA 2X2LA 3OCSA 1G8JA 4PP7A 4I5PA 4BZOA 5DI1A 5AAGA 2OFUA 3FKNA 2UZLA 1J3HA 4HYUA 5IA0A 1H4LA 3PG1A 3MIYA 3VRYA 4NFNA 4J52A 4OT5A 4TTHB 3MFUA 3POZA 2VGPA 3MI9A 3LJ2A 4KIOA 5E8UA 5JFWA 5M44A 2QOOA 3FI4A 4FV1A 2BAJA 3BEAA 2J50A 3PY3A 4IC8A 4L52A 1OKWA 3KF4A 4QMXA 4XOYA 5FBOA 3E63A 2KULA 4O7VA 1PXOA 5J87A 3RP9A 4FSQA 4X21A 2VTIA 3D2KA 3I81A 3QBNA 4DEDA 4F1TA 4BI2A 4EOKA 4BIDA 5BUIA 3EH9A 3O7LB 2XS0A 3QTIA 4BTJA 3NYVA 1NXKA 3O0GA 1KE6A 4F09A 3DQWA 3HEGA 4FIIA 2OI4X 1KE8A 1K9AA 1YXXA 4BCQA 4I5MA 1YDTE 1WAKA 4U3YA 4FV5A 5E8ZA 5EG3A 2ITUA 4DTKA 3UGCA 3VBXA 3OOGA 4OBOA 2E9PA 4MKCA 4MHAA 1BI8A 3U9NA 4GV1A 4X3FC 5KNJA 2DQ7X 4C58A 2ZM4A 2FB8A 4H1MA 3ZRLA 3BPRA 3GBZA 2PHKA 3GVUA 4L42A 4HVHA 2IVTA 4FZDB 2CN5A 1MQBA 3FEGA 3R7EA 1K3AA 4AN2A 4GT3A 5CAPA 4G9RA 5CAVA 4FZ6A 3RNYA 3QQUA 4ZAUA 4YGAA 3W0SA 4QTDA 1XH8A 4TNBA 4YP8A 2C47A 1MUOA 2SRCA 4W4WA 1JSTA 3ZUTA 4BDCA 2R64A 3F66A 5FP5A 4IB5A 4QMYA 4U97A 4IH8A 3EN9A 5M56A 4L3PA 2PMLX 3DBCA 4EH9A 3NVMB 1WBPA 2WQNA 4E73A 5A54A 3PSCA 4FSWA 3RPOA 4CFXA 5IUGA 4IVBA 4FTOA 2XKDA 2C6IA 1H1WA 3KXGA 5HVYA 2RIOA 3O23A 4JRVA 5LVLA 3L8VA 3N4TA 3K54A 3F3WA 5JGDA 2UZTA 2C6EA 3KN5A 2XNNA 3UDTA 4KIPA 2G2IA 3UOJA 2JKKA 4BJJA 2ITYA 2HZ4A 1XH6A 4YC8A 1OGYA 1YOLA 3BBTB 5AX3A 4CT2A 3Q6WA 4FIGA 5HO7A 4TWPA 2YA9A 2UW0A 3W0QA 2IO6A 2RG5A 3DJ5A 4U43A 1AGWA 4K33A 2OWBA 3RVGA 5A46A 3NW6A 5I9VA 1OKZA 4EOPA 3QTWA 4HGEA 3TNQB 4PMTA 3T3VA 3UP7A 3D5UA 1AD5A 4S32A 3II5A 4RWLA 4O38A 4O22A 3F61A 4H3BA 3UIMA 3PY1A 3HECA 5FTQA 3FMKA 4O7RA 3EQCA 3FHIA 4RIWA 1IRKA 3QTSA 3CD8A 4O6LA 1W0XC 3GUBA 2OGVA 3C13A 2WMAA 5F4NA 1ZOHA 5J1WA 4DYMA 4X2GA 3FMHA 3B2WA 4LUEA 4YTFA 3HAMA 3E93A 4TYJA 2IW6A 2H9VA 4FK3A 3QTRA 3CGOA 4NCTC 2UZVA 3H3CA 1GZKA 4GJ3A 5CT7A 4DFLA 4JDHA 3QQLA 3UQCA 1B39A 4BIEA 4YU2A 3VBQA 3R01A 2UW5A 4ZJIA 4YO4A 4E5BA 4RSSA 2W5AA 3BL9A 4FT9A 4LGHA 2PPQA 5CXZA 1Q3DA 3DK3A 3NFGB 4FOBA 5DEYA 4ZJJA 4FA2A 1XMLA 3C4FA 3NX8A 4YZNA 3TTIA 3TTJA 3W2SA 4ALUA 2F7EE 4YZCA 3ANQA 1U4DA 3QQFA 4NT4A 3F5UA 3FI3A 4TYIA 4IVCA 2VTNA 3THBA 3U87A 4AACA 3ENHA 3REPA 4PY1A 3U4UA 3N4VA 5JH6A 3W16A 3FE3A 1AQ1A 3LE6A 4RX7A 1VYWA 3F7WA 5BVWA 3AC2A 4JVGA 5AADA 3GGFA 3A62A 2XAOA 4MWHA 4EH5A 5HQ0A 2ITWA 2UZDA 3A8WA 4RWJA 3UZTA 2G01A 3FV8A 3UE4A 4GVJA 3K3JA 5A4EA 2J7TA 2B0QA 3OC1A 4RJ3A 1GOLA 1UU9A 1Y6BA 3LM0A 4DDGA 4G6LA 5JRQA 1BLXA 4I21A 3NSZA 3FWQA 3A61A 4M67A 4QMWA 3DXQA 4QP6A 3PJ3A 4BR3A 3OS3A 5IDPA 2ITQA 3CXWA 4P90A 3QQJA 4WG4A 4CD0A 4DE4A 3WZKA 5C4LA 3RHXA 3BZ3A 5A6OA 1Q61A 3W8LA 3NS9A 2XF0A 3NZ0A 4I22A 3M11A 3ORXA 3TYKA 4EBVA 2OFVA 5IQIA 3I79A 4JG8A 4EH2A 4TRLA 3TWJA 3TZ9A 5IA1A 2JBOA 4XEYA 2OIDA 4QMQA 5IQHA 1OL7A 3OW3A 3DLSA 4FTLA 4D1SA 2NNWB 4F0IA 5IA4A 4A4XA 2R3JA 4D9UA 4CFWA 3QHRA 2VX3A 3LLAA 2PUNA 4J7BA 2JEDA 2BHEA 4FEUA 3GC0A 5E8VA 3FXWA 4UX9A 5AFVA 4FV4A 3WIGA 2VTSA 4IB3A 4N57A 2UW9A 2FVDA 3CTJA 1OIYA 2GQGA 3PZEA 3MJ1A 5F94A 3SV0A 3H30A 4QMVA 4O7TA 3DLZA 3H9FA 3E7VA 5JT2A 3Q6UA 3PWYA 4EH8A 2C4GA 4JR7A 2CNVA 5CU4A 4FK6A 4BCPA 4GT5A 4N6YA 3E3PA 4OGRA 4ACHA 2GNGA 2VTRA 3TZMA 2B52A 5AV4A 4UWYA 3L8PA 3FI2A 2X8IA 4AXEA 2JDOA 4GFGA 2C1BA 1GJOA 2PUIA 5CAUA 1U54B 4Y5QA 2C5VA 4FTIA 4ALVA 3VF8A 3GU5A 5EI8A 3FKLA 3NDMA 3RAWA 1S9JA 3V6RA 3ZMMA 3Q4ZA 4YZDA 3MWUA 3DK7A 4BDKA 2RL5A 2YDKA 2CKQA 3LFAA 1WVYA 3RZBA 3U51A 1PXIA 2BRMA 5CLPA 2UVZA 2C6MA 3TDWA 1PXLA 3WF5A 2IG7A 5TT7A 4H39A 3VC4A 4XBUA 4C4EA 3BGQA 4DHIB 3F3UA 3S4QA 4RX8A 2R2PA 3T9TA 4DH5A 2ETRA 2UW3A 1BL7A 1LR4A 4PMMA 1T46A 3R7OA 4LGGA 3PFQA 4EYMA 5HX6A 4CFFA 3NIEA 5A9UA 2CNQA 4BKJA 3DFAA 2W06A 4IJPA 3U6IA 1OB3A 4Q2AA 5KMOA 3W18A 2VUWA 4L6QA 3ZO1A 3P78A 4YPDA 2G2FA 3IQ7A 3SG9A 3DDQA 3LJ0A 5DWRA 3QZIA 1NT2A 2W05A 3RTPA 4FL2A 3WF8A 3RAKA 2GNLA 2XK7A 3HV6A 4X3FB 4EHVA 5JFSA 4PMSA 1XH4A 4ACDA 1FMOE 2IWIA 4FTMA 2BDFA 2B9FA 4AN9A 1A06A 4EJNA 1OL1A 4IACA 1K2PA 4F6UA 2VU3A 4BIBA 3VUGA 5JSMA 3PY0A 4ZSLA 4F1MA 3TUBA 3DKFA 3O5AA 4U45A 3ZRKA 3QCSA 3NW7A 5EFQA 4JQEA 5LVPA 3R1NA 2BROA 2GHGA 3KXZA 4YZ9A 3E87A 4GFOA 5FGKA 5L2IA 3QWKA 3EMGA 3GEQA 1IR3A 2JFMA 4UXLA 3R71A 4D2RA 4U41A 3PPJA 5HESA 1JBPE 1A48A 1J1BA 5M06A 3R73A 1WBVA 4AZFA 4KBKA 1JSUA 1PXJA 2UZUE 3FHRA 3QA8A 3LZBA 2VZ6A 1PYXA 4J96A 4D5KA 3TKHA 4I6FA 1ZOEA 4NW5A 3QXPA 4JOAA 1OL2A 4Q9ZA 2PWLA 3Q32A 1OKYA 3RM7A 5IA5A 3TN8A 4CZUA 4IE9A 4TYHA 1V0OA 1YRPA 2VO0A 3PZHA 4WIHA 2ACXA 2BFXA 4XG2A 4J97A 2ZDUA 1ZOGA 4ZY6A 4TNDA 2EXCX 2XA4A 4IZ7A 4MAOA 5AMNA 2QONA 4FZ7A 3HMMA 1CDKA 3OWKA 1G5SA 4E7WA 3PG3A 2C1AA 3EQRA 3FMLA 3UO6A 3OVVA 2BDWA 1DM2A 4QP9A 5LWNA 3PLSA 4YJRA 4GL9A 1FGIA 2BRGA 5HIEA 3V8TA 2VGOA 2Q0NA 4YC6A 5AA8A 1J7IA 4O21A 5LVOA 3GCVA 5JQ8A 2G2HA 4EZ5A 1CSNA 3QRIA 3OP5A 4IC7A 2BZHB 2QOFA 2V0DA 4JI9A 2W1EA 4O0RA 4FG9A 1REKA 4E6QA 2XK6A 1UV5A 1YOJA 4CKIA 3E5AA 2WMRA 3FUPA 4NUSA 3B8QA 5BPYA 1QCFA 1LUFA 2R3QA 2XJ2A 2XP2A 5B2KA 5HBJA 3NMUF 2CSNA 4YJVA 3GU6A 4W8EA 2XBAA 3GFEA 4GUBA 2C69A 1PMUA 2JIIA 4KWPA 5BV3A 5GIOE 3Q4TA 2VTTA 4O84A 5HU3A 4HZRA 4MXOA 2OG8A 3DT1A 3LCKA 2YHVA 3P5KA 1SNXA 2WU6A 3ZO2A 3A60A 1GIJA 1UVRA 3R28A 4MF1A 2CN8A 2PUPA 5JFXA 1Q4LA 3R7IA 3W1FA 4L01A 3FZ1A 5AM7A 5EQYA 3BQRA 5HCZA 3KK9A 4FEVA 1J7LA 5CZHA 2PVMA 5E8TA 4I41A 4CMUA 1LP4A 3V04A 3VBYA 3AT2A 4TY1A 3L1SA 4B9DA 2O3PA 5ETIA 4CNHA 2XJ0A 3NAYA 2QOQA 2QG7A 3OXIA 3WE4A 5GIPE 4G31A 4MQ1A 1QMZA 4QP4A 2GNIA 3AD4A 3N51A 4LMUA 5CXHA 3ZFYA 3QZGA 3LMHA 4EK6A 3KQ7A 2VX1A 4FZFB 4XLVA 3FZPA 2O5KA 1DI9A 3SX9A 2R3HA 1XBCA 2WB8A 4EWHA 2GNHA 2NRUA 3BE9A 3LCTA 3MPMA 3A8XA 5JMSA 3EKKA 3Q5IA 4OTDA 3TCPA 3GOKA 4PL3A 3VS0A 3ORMA 4XG8A 5EOLA 3KIOC 2YERA 5HIBA 4QDEA 3BU5A 3FKOA 1ZYLA 4QMSA 5D1JA 2ONLA 4B8LA 1P2AA 2J6MA 4F9CA 3AC1A 4ZOGA 3I60A 5B2LA 4MNFA 2PZYA 5D12A 3A99A 4Z3VA 2XVDA 2NRYA 4FNXA 5D10A 5A4QA 2Y8OA 2OLCA 3CEKA 2F2UA 4IDTA 1Z57A 4R7IA 3FXZA 2BZKB 5HG7A 3VHEA 4GK2A 2BAQA 4IDVA 3QCXA 3UPXA 3L9NA 3LJ1A 2PVFA 4KIQA 3V8WA 3ZYAA 3E7OA 2P55A 4EHEA 5TKDA 3A7JA 1VLRA 2GFSA 1XH9A 3KCFA 1XQZA 2VTQA 5FUTA 3H4JA 5HO8A 2OK1A 1YQJA 4YURA 4H1JA 4LDTA 3P7AA 4O0TA 3FLZA 4DEGA 2FSMX 4DFNA 2E9VA 4PV0A 3Q9ZA 3AT4A 4QMUA 4D4SA 2GHLA 1OI9A 2HY81 5FTOA 3MY1A 3C5UA 3DBFA 3Q60A 4BI0A 3M1SA 5GJGA 4IIRA 3U8WA 4C7TA 4RFMA 2QU5A 3CR0A 4P4CA 4ZZOA 1PMEA 3OBGA 3VONA 3PJ8A 4QRCA 4QT1A 4UALA 4BCFA 4ENYA 3DZOA 2OZAB 1REJA 3GU7A 2OICA 4USDA 5HNBA 2F9GA 4IVDA 2Z7LA 1FQ1B 1OIRA 4L44A 4IAIA 3DS6A 4LOOA 5ICPA 1GZOA 3VJNA 4AW5A 2HOGA 4LL5A 4O7SA 3R9NA 2VTHA 4IAKA 3FMEA 3LW0A 3OXTA 4CFNA 3P7BA 3A7GA 1OL5A 1IG1A 2A1AB 2IW8A 3W0RA 2WMUA 1FVRA 3D5VA 5FEQA 4CFUA 4IAAA 4QYFA 5AP7A 5L2SA 4FKTA 5CX9A 2R3LA 5ANIA 4NSTA 3TUDA 2PVRA 3V5TA 1FMKA 4KNBA 4LM5A 5BYLA 4XRLA 3VIDA 4I92A 3UP2A 2YITA 2R5TA 3GCPA 3M42A 4Z55A 4M12A 1L8TA 1Q24A 1XO2B 2VWZA 3OF0A 5K4IA 5DA3A 3KEXA 3QKKA 2H6DA 2PK9A 2P2HA 2R0IA 2UW4A 3QRJA 4I4EA 5FRIA 3QYZA 2J9MA 3BYVA 3QKMA 3CTHA 4OTFA 3VAPA 1ZWSA 2B53A 2I7QA 1S9IA 2VTPA 2XNEA 3GC9A 4K11A 4KKGA 4BB4A 5I4NA 1WZYA 4QNAA 2AUHA 3NNWA 4RC4A 2CKOA 2R3PA 5B2MA 2XIYA 3R1YA 1UWJA 3HNGA 4FICA 2W1HA 4KABA 3LLTA 1CTPE 4EH6A 2VWWA 4DHZA 4EOLA 4DEIA 2OF2A 3RNIA 4ZSAA 1CMKE 1OKVA 3HYHA 4GRBA 1Q41A 1SVEA 2PULA 4A07A 4CVAA 3HDNA 4HVIA 1XKKA 2ERKA 1O6YA 4FBXA 1H08A 4C4IA 4GUEA 3E8DA 4U9AA 3VWAA 5C8NA 4N6ZA 1Y57A 5E90A 4YNEA 3DB6A 5FEEA 5FQDC 3CBLA 4FV8A 3FAAA 4HYHA 1M2QA 1ZZLA 4IX6A 4O7NA 5HX8A 5I9ZA 3POOA 3R63A 2GHMA 3ZONA 4FKIA 5C27A 5CSWA 3JXWA 5BMMA 4ZXTA 4CKRA 5CTPA 4Y95A 5AUUA 4HOKA 3NWWA 2WTWA 3MGYA 5DT0A 3QZHA 4JMQA 3ZLWA 3BGPA 3G90X 3BE2A 4ZTMA 2VTLA 1YWVA 5FXQA 3W2RA 4H36A 3KU2A 4RVKA 1XBAA 3ENMA 2W1DA 4QYHA 1PJKA 1YHSA 4FIJA 3T8OA 4O27B 5EM5A 3OUKA 2UW6A 4QP8A 3ZSGA 2C0TA 5FM2A 4FG8A 4C4HA 3QTZA 2R3MA 4NL0A 4BTFA 2WOTA 2B55A 4ZS4A 4IHPA 3TZ7A 4NTSA 2W5HA 3EL8A 4QP7A 5JZNA 4F9WA 1XWSA 4XG3A 3QC4A 3UIBA 3OD6X 3R04A 2C5OA 1QPDA 5L3AA 3HLLA 2X2MA 5EYCA 3R7UA 3ZCLA 1GNGA 1FOTA 1M7QA 3R2BA 4K9YA 3KGAA 4NJ3A 3SAYA 4A4LA 5HORA 4FTUA 1RW8A 3RGFA 4L68A 5AP0A 2XEYA 5AX9A 4DTAA 3WIKA 5H8BA 3ORZA 4AFJA 4EK4A 1WVWA 3E8EA 3QHWA 4DLIA 5HCXA 4F6WA 4HJOA 4MH7A 4ZTNA 2WMTA 2R9SA 2GNJA 4DG3E 3OCGA 4NM7A 3TZ8A 3QD0A 4FKOA 5BVEA 2RG6A 4YR8A 3Q3BA 1E1VA 2JGZA 3I0QA 3DB8A 3D2IA 1XMMA 3CSVA 5DR2A 4K1BA 2E9OA 1M2RA 3R83A 1W83A 2NYAA 3HKOA 1H25A 3ZFMA 5FDPA 1BL6A 1Z5MA 1ST4A 2NPQA 4X2FA 4AA0A 3OY1A 3O8PA 1H07A 2GPHA 4EOJA 4F65A 4LFIA 1APME 4DINA 3KRRA 3MFRA 3I4BA 5HBHA 2W0JA 5AUTA 3C7QA 1STCE 5AP5A 1ZY4A 5LQFA 4RVMA 2GS2A 2QOIA 5D41A 3IKAA 4L53A 4LV8A 2ZYBA 3LFSA 5LVNA 2WGJA 3BELA 3MY5A 4AP7A 3P5JC 3PPZA 2X8DA 3OW4A 2W96B 2JITA 3BBWA 4MBJA 4U3ZA 3RK9A 4DH3A 2A0CX 5TR6A 4FSUA 3C5IA 3BHTA 1WBNA 5B0XA 1UNGA 3HZTA 5EDPA 3KREA 5AUVA 4ANMA 1F3MC 5C01A 3FZSA 4C4JA 3IGGA 1BX6A 3V5PA 2RGPA 4BDIA 4ZTQA 3G51A 5JZJA 4FR4A 4LYNA 3RKBA 2QODA 3MW1A 5AV1A 4A7CA 5M09A 4LV7A 2JD5A 3H9RA 3PJCA 4AG8A 5KUPA 5EH0A 1JAMA 4F0FA 2FYSA 3Q96A 3BLHA 2X6EA 3P08A 4C3RA 1YWRA 4PL5A 5ANEA 1Q97A 2VRXA 1FVVA 2OW3A 3WILA 4KD1A 2DWBA 4BC6A 5I9YA 4MXZA 4S2ZA 4TKSA 5IH6A 3O96A 1OUYA 2ERZE 4IANA 3U9CA 3C50A 2Y7JA 5BQ0A 3QFVA 3KC3A 3V51A 2V7OA 3G15A 4NW6A 1NVQA 2Z60A 2WIHA 4HZSA 1MQ4A 4B6LA 2WAJA 3VBTA 4ZTRA 3DAJA 4M7IA 4QQCA 1Q8WA 4GU6A 4AOIA 2OXDA 5HKMA 4UBAA 3FPMA 2Z02A 4BDBA 4FTAA 3FSKA 2AC5A 2OXXA 3LFDA 4I5CA 3RM6A 1H28A 4H58A 3T3UA 2A19B 4XV1A 3TV6A 3ATTA 5CF8A 4FV6A 3VNTA 3P23A 3CPBA 2XNMA 4DT9A 4P5QA 3LFBA 1QPCA 4BCGA 1RQQA 5FP6A 4ZK5A 5IA2A 5JRSA 5DT4A 3C4CA 3UNJA 3NEWA 5HTCA 5IEXA 2Y6OA 4IW0A 5EDQA 4EZ7A 4H05A 1WBOA 2C3LA 3A2CA 3F2AA 4FKRA 3E3BX 3ZDIA 3ZO3A 4WRGA 1GAGA 2BVAA 4W4YA 2PVNA 2UW7A 1KV1A 2YEXA 1BUHA 3GNIB 2XK4A 3QTUA 4XH6A 5HCYA 3I7BA 3KRXA 3CTQA 4XX9A 4EKKA 2XIZA 5M4CA 3W55A 4O0SA 3GCUA 2LGCA 2PTKA 2BKKA 2W4KA 5EYKA 3VUHA 1PXMA 4AA5A 4E4LA 3EQIA 3LQ8A 2VNWA 5E9EA 3LPBA 4OTIA 3GU4A 1FGKA 3CKWA 3FQEA 4YSMA 5M4FA 5HNGA 4A06A 3FLWA 3JY0A 4GKHA 4RA4A 1LEZA 1MRVA 4LMNA 4X2JA 2V55A 4YJTA 3Q2MA 1U54A 3IECA 3R6XA 4YLKA 3SW4A 2VWYA 4A9TA 4ZY4A 4CZTA 4I1ZA 4CGAA 3VBVA 3E64A 2X2KA 3IDBA 1Q62A 2X9EA 4AOTA 4FI1A 4Y83A 2WMSA 2X4FA 4O0VA 4DFZE 3QX4A 4FTTA 4E5WA 1OIUA 3I6WA 3V5WA 4EQMA 4X2NA 3RPRA 5IQCA 3QX2A 4GG7A 2CPKE 3DKCA 3WF6A 4IFGA 2UZNA 4HVDA 4IBMA 2AEGA 4KINA 1NW1A 2UVXA 3IS5A 1WBWA 4D5HA 1R0PA 3EJ1A 3PVBA 4NJDA 4PUZA 4F99A 3HA8A 2C3IB 3OHTA 1URWA 3PP1A 3AXWA 3MB7A 5JFVA 5TO8A 1H1QA 1SZMA 4ITJA 5IQAA 3R1SA 4GJ2A 2JDRA 3PP0A 4A9SA 2I1MA 1KOAA 1WBTA 3A4OX 2PVJA 4FEXA 3BV3A 1IAJA 2NP8A 3QCQA 3AT3A 2EB2A 3DBDA 4I0SA 4BDDA 3RK5A 4AXFA 3FDNA 2QU6A 5HLNA 1H8FA 4KAOA 5JKGA 3UNZA 4QMTA 1H1SA 1YDSE 4S33A 3ZBFA 2XALA 3KKVA 3MBLA 4FL1A 1H0WA 1O6KA 1F0QA 4V04A 5HE3A 1ZARA 5KBRA 4BGGA 2WMBA 2Z7RA 3D7TB 2BKZA 4G3CA 1JKSA 5DYJA 3RI1A 3SC1A 3H9OA 3ULIA 4ARKA 2XRWA 3OTUA 4X6RA 2HYYA 4XYFA 3LXLA 3SRVB 4FVQA 3HMPA 4FIFA 1OIQA 3SLSA 4QMPA 3WZJA 2BALA 5H3QA 3ZH8A 5LCKA 3GCSA 2PVYA 4C59A 4I0RA 2I0EA 5EQPA 4IX3A 3VW6A 3KFAA 2VAGA 3DAKA 1KUTA 2VWVA 3VRZA 2YM8A 2YIYA 4RPVA 4RJ6A 3CGFA 4YJSA 3HL7A 3R9HA 5IF1A 4FKQA 3NUUA 3PVWA 2C0IA 5DBXA 1KSWA 3V5JA 4RJ8A 1F5QA 1M2PA 4O0XA 3R1QA 3PSDA 2X81A 4O2ZA 2YABA 3Q9YA 2B9HA 3JS2A 2UZEA 4ZSJA 5AP3A 4ZSEA 4J71A 3FJQE 4Y72A 2WMWA 2WTIA 3GQIA 4E4XA 3HA6A 2YM4A 4M0YA 3NYNA 5TF9A 3D83A 3DBQA 3FZTA 4CTCA 3UDSA 2XNBA 3D15A 4IMYA 3CP9A 4I6QA 5E8WA 1OPJA 2F7XE 1VEBA 4JLCA 2PVKA 4AA4A 4MYGA 4MEDA 3ZM9A 3UDBA 5JN2A 3TV7A 4O7YA 1NVRA 2PMNX 5KKRC 5GJDA 1GZ8A 3W2QA 2E9UA 2XIRA 2R7IA 2PZPA 4R7HA 4AF3A 4I5HA 4HYIA 1Y6AA 2JKMA 3DOGA 4ORKA 5AAFA 5BNJA 2IPXA 5LCJA 5IH5A 1UKHA 3PUPA 5CT0A 2ZDTA 4JRNA 5CSVA 2ZM1A 2CGUA 2YIQA 3MH0A 1SM2A 4BDEA 4UXQA 4AZVA 1U46A 4EHZA 2RFEA 3PPKA 3ZLSA 4FTNA 4AGCA 1G8KA 2YWPA 1UU7A 4BTMA 1IA8A 2WQBA 3BHYA 2C6TA 3A4PA 5ANGA 5G1XA 2JKQA 4F9YA 5CSPA 3WOWA 5J8IA 4F7SA 2JDTA 3HMOA 4KS7A 4WG3A 4BF2A 4EK5A 4NYEA 5EQEA 4EOIA 2VWBA 4YJOA 5JEBA 3Q2JA 3MB6A 5FBNC 4NCTA 3D5WA 3T9IA 3CKXA 2HENA 3ERKA 4P2KA 3TIZA 4QMOA 1ZRZA 5EKOA 1H26A 4QTCA 3V01A 3AKLA 4BHNA 2BIYA 5GJFA 3OT8A 2ZB0A 4I24A 1FPUA 2JAVA 2XYUA 3UBDA 5IQEA 3PXYA 3CJFA 4JX7A 4G6NA 2Y9QA 3ACKA 4IWQA 4ZSGA 3TDVA 3W10A 3ODZX 5HZNA 2JDSA 4JXFA 3KRJA 1ST0A 4CLIA 3LM5A 4GVAA 4Y46A 3NNUA 2C30A 4L3JA 2R7BA 4AXAA 4EH7A 3V3VA 3FC2A 4GKIA 3KMMA 4O0WA 5IQGA 3MVHA 3JY9A 3PA5A 4M15A 3G9NA 1GZNA 4F9AA 5CEOA 3KXHA 1GIHA 1YXTA 1Y91A 4K0YA 3EN6A 3KK8A 3OOMA 4FTKA 4CEGA 1I09A 2OJ9A 4MCVA 5DR9A 3AC8A 3EQDA 2XIXA 4YSJA 1PXPA 2HZNA 3DK6A 1VJYA 2ZV8A 3IOPA 3OTVA 3CQWA 2W1GA 4YLJA 4XG6A 2YAKA 2PVHA 3MY0A 2WO6A 5D11A 3L9LA 5T3QA 5JQ5A 4FTCA 5ETFA 2AC3A 4QEBA 3DNDA 4BBFA 4W4XA 3NUYA 3H0YA 2UW8A 5FEDA 5KHWA 2WMQA 3LIJA 4NZWB 2ZVAA 4FSYA 4RQKA 3KULB 4GYIA 5FDXA 2C6OA 3E92A 2QNJA 3JYAA 2J51A 4QTAA 4C02A 4ERWA 2HZ0A 5C8MA 2W17A 2WNTA 3ZZEA 3BU3A 3P4KA 4XMOA 2HZIA 5J5SA 2JLDA 3PYYA 2QVSE 3EFLA 5F95A 4D4YA 3MFTA 4MXYA 4AU8A 2XRUA 5A3XA 4FV3A 1JPAA 3HP5A 3ZS5A 5HGIA 1KE5A 3BV2A 4L43A 4F78A 4AT5A 2HIWA 2JIUA 3G2FA 4WD5A 4JQ7A 4QOXA 5EI2A 5F20A 4DF3A 4W4VA 2XARA 4LOPA 3COMA 4X7QA 3BWJA 3NIZA 3ZU7A 3D5XA 5IEVA 2WMVA 4WG5A 3AD6A 1Y8YA 3UQFA 5F1ZA 5I9UA 5LMAA 2XUUA 1PF8A 3LFQA 4BTKA 3ORKA 5M4IA 4FGBA 1E1XA 3NPCA 4AZWA 5DN3A 4KRCA 5EYDA 3OWJA 1XHAA 5A4CA 3COHA 4MD8E 1YXVA 2Z7QA 2CHLA 3TACA 1JOWB 2OZAA 4ZS0A 4ITIA 3IDCA 4XV9A 4ZZNA 3MFSA 3F2RA 4FKPA 3RPSA 3UYTA 4RWKA 4BYIA 4C38A 4CT1A 2J5FA 3FLQA 5K5XA 1UKIA 3DTCA 4ZLZA 4DH7A 3QALE 2VTAA 3LMIA 5CS6A 4J1RA 4O0UA 3TL8A 1ZYJA 4AZSA 5CI6A 1YKRA 4CV9A 3O8TA 2CLXA 2C5XA 2XNPA 3FI8A 3QD4A 2XCKA 1Z9XA 4UN0C 4FOCA 2R3GA 3NGAA 2GTMA 4RIXB 4RJ4A 5HHWA 4U6RA 5HG5A 4P7EA 1ZLTA 4XG7A 1SMHA 2ZM3A 2BZIB 4BY9E 4BN1A 3C0HA 4JG7A 3F3TA 2H96A 4XHKB 2JFLA 5I5ZA 2YJRA 1MP8A 3P0MA 1GIIA 1SVGA 4IEBA 3ZHPC 2FSLX 4K77A 4M3QA 3C1XA 4ASZA 2W99B 3OCBA 3C4WA 4JS8A 1IEPA 3UO4A 5AA9A 2X6DA 4YTIA 3FSFA 4AGUA 2R3OA 4Y8DA 4DEBA 3AMYA 4HPUE 2WTKC 4NK9A 4I6BA 4DHJA 4FSTA 3W0NA 2IZRA 2X0GA 3F9NA 5ACBC 1OPLA 4F4PA 2XMYA 1DI8A 2WQOA 2X9FA 3MDYA 3RINA 3ALOA 3QQKA 2BRHA 3C51A 4F08A 4QQ5A 3NLBA 4IAYA 3AKJA 4PRJA 1Q5KA 4XNEA 5DOSA 4DITA 5CEIA 3O8UA 4JNWA 4F9BA 4F64A 1WMKA 5CVFA 5AP2A 4FC0A 2C5YA 1B6CB 4OUCA 3TNPC 4ACMA 5A14A 1M17A 3KY2A 3ULZA 4BI1A 4F6SA 5IA3A 1Q8ZA 4KKHA 4V0GB 1E9HA 4WOVA 3SXSA 3VS2A 1CM8A 4HVSA 3SG8A 3ZTXA 3R0TA 3LFFA 4FX3A 3UVRA 4EC9A 2WQMA 4BDJA 4QNYA 4QPSA 4BVUA 3LXKA 2ZJWA 3MH3A 2HXLA 4IQ6A 4RZWA 4TZRA 5L6WL 3VQUA 3FLSA 1ERKA 3KMWA 4O7ZA 4RX9A 2WEVA 4QMMA 4AE6A 2J0JA 2FUMA 3N9XA 4KSQA 3D0EA 2OJGA 4C62A 2C6LA 2HW6A 5HLWA 3IK3A 1YXSA 3JVRA 4G3FA 5J1VA 3ZXZA 4R3RA 5CVGA 4B99A 5E1EA 1O9UA 3OCTA 5CU3A 5DIAA 2GS6A 4FNZA 4AFEA 3R9OA 1OBDA 4JIAA 1J1CA 5CEQA 2UVYA 2Z2WA 2WPAA 5DT3A 3GQLA 2W4OA 4E4MA 5KHXA 2NO3A 3NNVA 2B54A 3CCNA 4QTBA 3UG2A 4L45A 2P33A 3NRMA 4GSBA 4W8DA 4XV3A 2W1IA 4RVTA 5A4TA 5A6NA 3F6XA 3UMWA 3O7LD 3UG1A 2QOCA 1UNHA 1OGUA 1YI6A 2XJ1A 2YISA 4WUAA 5FD2A 4ZIMA 4BDGA 4DGMA 5KBQA 3AQVA 1X8BA 5KKRB 1H0VA 4JDIA 1OITA 4JQ8A 5IISA 5TOZA 4M68A 5DR6A 3MH2A 3G5DA 1P4OA 3BQCA 1HCKA 3C9WA 3S3IA 5KMJA 4F1OA 4X6QC 4B7TA 3O2MA 1Q8YA 3TMOA 1ZZ2A 3IPHA 3Q9WA 3QYWA 3FQSA 3COKA 4QYGA 3SOCA 1P14A 5G6VA 3MVLA 2A27A 5CF5A 3M2WA 4WHZA 3K5UA 4XP3A 4PF4A 3U4WA 1KOBA 4ALWA 3BI6A 1BMKA 1UU3A 5D9HA 4IWOA 1H01A 3HUCA 1UA2A 4YNOA 5H8EA 5FLFA 3MIAA 3FZOA 4Z7HA 3LCOA 4DGNA 4XS2A 2PE0A 4USEA 4BZDA 1G8AA 5DEWA 3LFCA 5IZFA 1SNUA 1GY3A 1WFCA 2YZAA 4WKQA 3EQPA 4C33A 4A9UA 3LQ3A 1YW2A 4QP2A 5F9EA 3UNKA 5AIKA 4LOQA 3W0OA 1OM1A 1B38A 3QZFA 3ZDUA 4FKUA 4PTEA 3VBWA 4EQUA 3NW5A 1M14A 2X7GA 5BYZA 2IVSA 5IQBA 3WI6A 5ANJA 5HE0A 3OZ6A 5I0BA 2RKUA 5CU2A 4CQEA 4OW8A 5ANDA 5KCVA 2JKOA 2IZTA 4BCOA 4EZ3A 3VS4A 4E5AX 3EYHA 4EWQA 5HD7A 4MX9A 1Q8UA 2QHMA 3LCSA 4F63A 5CEPA 5M07A 4YUQA 4UV0A 3QGYA 3ATSA 1NY3A 3PSBA 3GC8A 3UC3A 1ZYCA 3EN7A 2PY3A 5J7HA 4TW9A 4RIOA 5L6OA 4J8MA 4L46A 2GTNA 4TYHB 2YCRA 3AGMA 4AZEA 4CSVA 4LV5A 1Q8TA 1YVJA 4U44A 4GIIA 4QP1A 3RWQA 3G9LX 5AJQA 3UQGA 3VUKA 3P9JA 1XR1A 2WTDA 4IB1A 3W32A 3QUPA 3SXRA 1YI4A 1I44A 4R6VA 1PRYA 3FBVA 3OWPA 4ZTHA 4BBEA 4CCBA 4GK4A 3ORLA 4M84A 2Y4IC 3FL5A 2RF9A 3VQHA 4D4VA 3R2YA 5BVOA 4I23A 5LMKA 3GB2A 4G17A 4N4SA 2CCHA 4RC2A 2QOLA 2QI8A 4KA3A 2CGVA 4G1WA 5K9IA 4GIHA 5C9CA 4DH8A 2OZOA 3GU8A 4BGQA 2C6KA 4ZMFA 3ANRA 3ELJA 3LCDA 4ACGA 3RHKA 4AW1A 4U0IA 5HICA 4B4LA 4HPTE 5BUJA 2B9JA 3SQQA 4PMPA 5KMIA 5KMMA 4BCIA 4MXAA 4IWPA 4O86A 5IQFA 1ZYSA 1OUKA 4CG8A 4AWIA 4R3PA 4C34A 4FSZA 4YTHA 3JVSA 2R3NA 2ZFYA 3EHAA 4G2FA 3KRWA 2PL0A 4DTBA 2PMIA 3I1AA 2Z8CA 3FQHA 5D7VA 3V8SA 2WKMA 4JBQA 2YIXA 2XM9A 3RMFA 2ITNA 2QOHA 4CFVA 4DGLC 4KS8A 4FV0A 4BCMA 2CKEA 5CVHA 4XUFA 4EOQA 3TKIA 2J4ZA 3EN5A 5J9LA 3SGCA 4AGDA 3CC6A 5CZIA 4O7LA 4IAZA 3I5ZA 3Q4UA 5EM6A 4DFUA 1SVHA 3BHHA 5AWMA 4DEAA 5C1QB 4MWIA 4E6CA 1JKLA 5EOBA 3R7YA 2XCHA 4R5SA 4APCA 5CWZA 3G6GA 4Z9LA 2QHNA 3A7HA 4HGTA 4G5JA 4WBOA 3CE3A 4J98A 4UWBA 4WBBB 3HX4A 1U5RA 2WTVA 3EZVA 3TJCA 5E8SA 3RWPA 2Y0AA 3WF7A 5KMLA 5M57A 2YIWA 4EOOA 3QD2B 4JT3A 5L8JA 1HOWA 4TXCA 1H27A 4HVGA 2BDJA 4FJVA 3PVUA 3LOKA 5HG9A 3ROCA 4RQVA 4F7JA 3SA0A 2CJMA 2IVVA 2BIKB 3KVWA 3I7CA 1V1KA 2W9ZB 4IZ5A 4KSPA 2YAAA 5DE2A 3DKGA 4YHTA 4Q5EA 2ZAZA 2EWAA 4TWOA 4AW0A 4YPSA 4FKLA 1IASA 2FGIA 2ZV9A 4I4FA 3FYKX 4YHJA 2PU8A 5E91A 3DZQA 3R8VA 2WTKB 3EQFA 5HLPA 4UYAA 4PDYA 4YLLA 4NM5A 2RFDA 2YM7A 3KF7A 3PDTA 4R1VA 5L2TA 2O65A 5K5NA 3DV3A 1ZMWA 1PMNA 2EXMA 2YM5A 4EHGA 4YJQA 4DG0E 3ALNA 4BRXA 2BFYA 4FGRA 4CFMA 2QOBA 3PTGA 4I93A 4L9IA 5C8KA 2CMWA 4DDIA 4M0ZA 2XKEA 2IVUA 3KCKA 3WARA 5EM7A 3BRBA 4XP2A 2B4SB 5AIRA 3C4ZA 2B7AA 3DKOA 5FTGA 2GFCA 4AUAA 4E8AA 3R8MA 5CEMA 4D58A 1CKPA 4I3ZA 3DAEA 4E6AA 4IAFA 1ZY5A 1TQPA 3HMNA 3OUNB 2XM8A 3EFJA 2YM3A 3TI1A 2XK3A 5KMNA 4C61A 2CKPA 2GCDA 5EDRA 4QYEA 3UDZA 5EYMA 3BYSA 1U59A 2ITVA
chains in the Genus database with same CATH topology
1TVOA 2V22A 4LL0A 3HRFA 2VV9A 5AUXA 1OMWA 3DBEA 3P1AA 1OL6A 4MNEB 4A4OA 3WE8A 2C3KA 5C4KA 4G16A 5DG5A 3MH1A 4RLKA 3S2PA 3SRVA 5HU9A 3UOLA 5HE1A 2WTJA 2P3GX 4ID7A 5HVKA 4QTEA 3S0OA 2ITTA 3EKNA 1WCCA 3PRIA 5H8GA 3OROA 4OTWA 4FIEA 4GG5A 3V6SA 3PVGA 4CMTA 4DEEA 2BAKA 4RBLA 3ET7A 4EQCA 3C0IA 2BR1A 4TL0A 4DCEA 3QRKA 2XK8A 4GS6A 2DUVA 1JKTA 2C0OA 1G8SA 4ASEA 3VVHA 2YCSA 3C4EA 4KUJA 4L67A 4WNKA 2I0VA 3LFNA 5HEZA 4C4FA 4RIYB 4MXCA 2XNGA 2CCIA 2XANA 4WUNA 4O6EA 1FINA 5EHLA 3R9RA 2JIVA 3HMIA 3S00A 3EZRA 3SD0A 4KKEA 3EYGA 4WRSA 2V7AA 2PUUA 2I0YA 4Z7GA 4GT4A 4RJ5A 4RX5A 2F57A 2P2IA 4NM3A 2VO7A 2YN8A 4JR3A 3MA3A 4UY9A 3TNHA 3E8CA 4GFMA 4I94A 1IA9A 3KB7A 3F5XA 3DGKA 4L8MA 2X7FA 4JG6A 3ZBXA 5EKNA 4EJ7A 4FT7A 4JJRA 2ITXA 3MV5A 4KBCA 2Z7SA 3BLQA 2OSCA 3CD3A 2OH4A 4E26A 2FH9A 1R3CA 2XBJA 3PXRA 5J95A 3B8RA 3K3IA 2H34A 4QDVA 4APPA 2R0UA 4YTCA 1MRYA 3ZC5A 2HY0A 3ACJA 1Y8GA 2HXQA 3QWJA 4ZTLA 3VS6A 5I9XA 4YBKA 3AG9A 4DEHA 5EK7A 4OBQA 4OBPA 5DLSA 4AXCA 3NUNA 2C68A 4D0WA 4BBMA 3LKMA 3F7ZA 4NU1A 2A2AA 4FNYA 2WQEA 3GXLA 3DDPA 1QPJA 2JBPA 3BKBA 4JIKA 4PP9A 3UC4A 3AC5A 3P7CA 5KO1A 4RJ7A 3MS9A 4QMLA 4G3EA 5DHJA 4JDJA 3DY7A 3QRUA 3ZEPA 4JAJA 4CXAA 5IMXA 3R30A 4PQNA 2G15A 3V5QA 3NUPA 4PTCA 4AT4A 4AAYA 2XB7A 4MD9E 4WNPA 5C26A 4D28A 4DAWA 2WOUA 2XEZA 3TUCA 3MSSA 4E6DA 2YZLA 3KVXA 4U81A 2LAVA 4Z16A 5H9BA 1PY5A 2HWPA 4FV9A 3MJ2A 3V5LA 4AS0A 3MN3A 1DS5A 3C0GA 4YZMA 4GH2A 1VR2A 4O0YA 5AV3A 3PE1A 5CSHA 4PTGA 3KXXA 4ACCA 4EKLA 3FY2A 3CS9A 4I0TA 1BKXA 5BMSA 1O6LA 4MUQA 4B8MA 3FXXA 2WU7A 5AV2A 3RAIA 2CNUA 3FMNA 2Y4IB 3R8ZA 4AN3A 1URCA 3RJCA 4O2PA 4GU9A 3SVVA 3DJ7A 3QLGA 5AP1A 5GHVA 3ZFXA 3ROYA 5K4JA 4M97A 3VO3A 2PE2A 4IX5A 3VUIA 3W0PA 2W9FB 3DTWA 2A4LA 1H00A 2G1TA 1UWHA 4QYYA 4OR5A 4C0TA 2UZOA 4C4GA 4ANLA 1PW2A 1MRUA 3QGWA 5IQDA 3CLYA 3G0FA 4UYNA 2YCQA 1TFFA 3QXOA 3VJOA 4X3FA 4FZAB 4G9CA 4BCNA 4DA5A 3MVJA 2IW9A 3O51A 3KULA 3FLYA 3I0OA 4PDOA 3NR9A 1FVTA 4GW8A 4EI4A 3ZM4A 4LRJA 3NUAA 4IX4A 2YFXA 4NFMA 5M4UA 1KWPA 3IG7A 3R7VA 3ZUUA 4OT6A 4J99A 5EI6A 4MBIA 3GOPA 1JSVA 4IJ9A 5C03A 2QCSA 5AP4A 4DBNA 1YI3A 4ZZMA 5CSXA 3WYYA 3KMUA 4C35A 5JGBA 1A9UA 5CF6A 3KXMA 4PNKA 3CJGA 3UIXA 1PYEA 3I5NA 3ORNA 3ML1A 3U54A 3BL7A 4IADA 3OBJA 3HV4A 2GNFA 2WMXA 4O81A 2OKRA 5M55A 5HE2A 4Q9SA 4MBLA 2JAMA 3O71A 4ANQA 2VWIA 3QRTA 2JDVA 4ZP5A 4AXDA 2OBJA 2Y6MA 3BLAA 4YJUA 5K3YA 4F7NA 4F70A 5LOHA 3JPVA 1W84A 4OTHA 3VS3A 2O8YA 3PRFA 5AAEA 5FXSA 4USFA 4S30A 3FYJX 3ORIA 4MTAA 4DFBA 5CF4A 3ZO4A 4NWMA 5L8KA 4OTRA 4RRVA 5CNOA 3VW8A 3KRLA 5CASA 3MPAA 4YJPA 2XH5A 3DA6A 2HAKA 3F69A 3GC7A 2BILB 4FODA 2ETKA 1G3NA 4NKAA 4EOMA 2OJIA 4ZEGA 3FY0A 2FSTX 3ORPA 5KMKA 2IN6A 4D1ZA 2J5EA 4BHZA 3U6HA 3W8QA 3PFYA 4C3FA 4FSRA 1CKJA 2QO2A 3HV5A 3BLRA 4RIXA 3L9PA 1QPEA 3LFEA 4WSYA 3AMAA 1WBSA 3IONA 4Y73A 5GNKA 4BCJA 3VF9A 4WO5A 4CV8A 4MVFA 4WNOA 2XAMA 5BUEA 2DYLA 3D14A 1BYGA 2BTRA 4FT3A 2QQ7A 5CQWA 1BI7A 4DH1A 4XJ0A 4D4RA 5KE0A 3N4UA 3FMJA 5CANA 5A4LA 2XIKA 3L8SA 4FKWA 2P0CA 2UUEA 1OBGA 3EWHA 4BYJA 5M08A 1R0EA 2YJSA 3QAME 3IGOA 2PZ5A 4RA5A 5LXMA 3Q52A 5DVRA 3JR1A 5IU2A 4O82A 4WT6A 4EK3A 3ZRMA 4EUTA 3EQGA 4BDFA 1JVPP 3MVMA 3W2PA 4DG2E 4YC3A 4JAIA 4QP3A 5AM6A 4JL9A 3HVCA 3EQBA 2WTCA 3JUHA 3IOKA 3PA3A 1RJBA 2I40A 1XH5A 4M8TA 4TWCA 4V0GA 2X8EA 2J0MB 4R5YA 2OF4A 2ZMDA 3UODA 1NVSA 4U7ZA 5CU0A 3PXZA 4FNWA 4ANSA 4BJJB 3ZSIA 3LMGA 2IZUA 2WD1A 2WXVA 2J2IB 4S31A 5CI7A 3NAXA 2CLQA 2IJMA 3EL7A 3GI3A 3PXQA 4G6OA 3B2TA 4XG4A 4H3PA 4DBXA 4BGHA 3C4XA 1VYZA 2FSOX 2F7ZE 4FKSA 5ITAA 4D9TA 4RT7A 3UO5A 3BHVA 3FMMA 3HUBA 2X39A 2BCJA 1EH4A 3KL8A 4IWDA 2F4JA 1PXNA 3CQEA 3BYOA 4IM3A 2WEIA 3NCGA 4R7BA 3ID6C 4C2VA 4BDAA 3DQXA 5I9WA 4M14A 3QUEA 4U8ZA 2XZSA 4YHFA 4FT0A 3D94A 2QKRA 4HNFA 4AT3A 1ZYDA 1Q99A 2R3KA 3DU8A 3HRCA 3RAHA 4U79A 3BIZA 4MXXA 3F3ZA 4FE2A 4JBPA 3VUMA 4AQKA 4K2RA 5IG1A 1P5EA 4K8AA 3OG7A 2V5QA 5DH3A 1PKGA 4RIWB 4O7WA 5ACKA 3TNWA 5AUWA 3OFMA 4TWNA 4D0XA 1LPUA 2BHHA 3COIA 3GT8A 3UVPA 1TQMA 2EVAA 4FSNA 3QU0A 1JQHA 3RCJA 4FEQA 2P4IA 2ZB1A 3AMBA 4Q5HA 2UV2A 2I6LA 1R78A 5L2WA 4F7LA 2XYNA 5JK3A 5IH4A 3TIYA 4KB8A 5KZ0A 2VN9A 5CQUA 5EHOA 2R3FA 2ZOQA 4FEWA 3MTFA 3F5PA 3NUSA 3PLAE 1V0BA 3OY3A 3EFWA 3AGLA 4LG4A 3QL8A 4UZHA 2B1PA 3AC4A 4FTJA 3UMXA 4DFXE 2QO9A 4ENXA 5CAOA 2BPMA 2J0KA 4R78A 3HGKA 1W8CA 4YO6A 2REIA 1XJDA 4EBWA 4IM0A 3S95A 3ITZA 4TYEA 3A7FA 4FUYA 5E8YA 2OJJA 3GCQA 3QF9A 3A7IA 5LMBA 3NYXA 4JX3A 2VO3A 4NH1A 4L00A 2R3RA 1VZOA 3MESA 4PDSA 2YIRA 5M53A 5DGZA 2WELA 4RFZA 1DAWA 2C3JA 4CTBA 1H1PA 1JKKA 4EK8A 4ZY5A 4D2SA 3FMDA 4YZBA 3BYUA 3EQHA 3R21A 4AAAA 4QQJA 5FM3A 1KE7A 4J8NA 2HCKA 4UZDA 4BCKA 3EFKA 4LI5A 3TXOA 3VS7A 5LVMA 4C37A 3IW6A 3E62A 3PWDA 3HV3A 4ZTSA 5AUZA 3QQGA 2UZWE 4C36A 4E93A 2OIBA 2ONLC 1JNKA 3QD3A 4XCUA 1W7HA 4GEOA 4HCUA 3SHEA 4FTQA 4I20A 2E9NA 3QKLA 2CGWA 4LRKA 3SKCA 4QMZA 2VO6A 4DGGA 3KXNA 4XP0A 3ZSHA 1XBBA 3R02A 3Q53A 4ZLOA 4IFCA 5HD4A 4XRJA 2IZSA 4FL3A 4XOZA 4MQ2A 4HW7A 5ANKA 3ZUVA 3MTLA 3PXKA 4D1XA 1PMVA 2PVLA 2YACA 2O64A 2ZMCA 4FG7A 5AUYA 3VULA 4B0GA 3PIZA 3PUFC 4J53A 5CU6A 2RFSA 3DPKA 2O0UA 4KBAA 3IO7A 4MK0A 5DRBA 4LUDA 1ZMUA 4C3PA 3TG1A 2HW7A 5KX8A 1T45A 4FUXA 3TNIA 4EONA 3WF9A 2W7XA 3AKKA 2QG5A 4DGOA 2F2CB 4ITHA 2WZJA 4IVAA 3RALA 5DFPA 1U5QA 3IW4A 3HRBA 2VTMA 2YWVA 4II5A 2FA2A 3D4QA 3D9VA 3QTXA 4U40A 5DRDA 2I0HA 3UZRA 2YCFA 4ASXA 3Q9XA 3CQUA 5FXRA 2HWOA 3VHKA 1PXKA 5FG8A 2HK5A 4AGWA 3TEIA 3R8UA 4O91A 3ZLYA 2QR8A 3KA0A 2RFNA 4P5ZA 3DFCB 4PNIA 5HNIX 4DC2A 4E4NA 5J9ZA 3RCDA 2BMCA 4D55A 1R1WA 4G5PA 4ASDA 5BVKA 3TV4A 3NVKI 1YWNA 3ZC6A 1Q3WA 3UZPA 2ESMA 4UEUA 2E2BA 5AP6A 3FLNC 3ETAA 4DCAA 4CMOA 2X1NA 5T68A 3SOAA 2GQRA 5EW3A 3U55A 2ZV7A 3FC1X 3OXZA 1FBNA 4FIHA 4DN5A 4GMYA 3P86A 3GENA 5EW9A 3BEGA 5IMEA 3R8LA 3P79A 3AOXA 4HNIA 4NIFB 4RVLA 2EU9A 3UYSA 5IPJA 4Y85A 4BZNA 3VS1A 4K6ZA 1QL6A 5CY3A 2J0LA 4MD7E 4JBOA 3QUDA 4HYSA 2HELA 5CNNA 4C2WA 3F5GA 2W1CA 4FKJA 1L3RE 3NNXA 4U42A 4RG0A 3BU6A 3K2LA 1OVEA 5LMKC 2H8HA 5EW8A 1HCLA 1M7NA 4HGSA 4BDHA 1DAYA 4NTTA 3PJ1A 5T6KA 4M13A 4H3QA 2VNYA 1PKDA 2FO0A 2QO7A 3ZOSA 2BRBA 2C6DA 3ZZWA 4UWCA 4CLJA 3LQ5A 4BICA 4E20A 3PIYA 4UB7A 1YHVA 4PX6A 2ETMA 4EYJA 3RPYA 3F2NA 4L3LA 3BGZA 1YHWA 5ETAA 5CYIA 2BUJA 2J90A 1UNLA 3TJDA 2AYPA 3R00A 5ANOA 5CEKA 4FTRA 1M52A 4FT5A 3LVPA 1RE8A 3NCZA 4R3CA 4QO9A 4AZTA 3QTQA 4CRSA 5ETCA 2O2UA 3MA6A 3AD5A 1OPKA 3HV7A 3CY2A 2W1ZA 3EIDA 3HDMA 4KRDA 3PA4A 2BTSA 4U5JA 3OWLA 1J91A 4V01A 2EUFB 2KTYA 3IW8A 3BCEA 1ATPE 5E8XA 4ANBA 4CCUA 4R77A 3HAVA 4QPAA 5BVFA 5B7VA 2R3IA 5HG8A 3UVQA 4G3GA 3VS5A 4IM2A 2J0IA 3H10A 1P4FA 4N70A 2F49A 4TT7A 4YBJA 3CPCA 3HP2A 3WZDA 4OTGA 5HIDA 4TYGA 2BRNA 5CENA 4AOJA 3UOHA 1XH7A 4FVRA 2VD5A 3IW7A 2QKWB 4IZYA 4XLIA 3UJGA 4G34A 3WZEA 4PWNA 1OZ1A 1H1RA 4L7SA 1UU8A 4MNEA 5EHYA 2PZRA 3LXPA 3NUXA 3OT3A 4FKGA 4AQCA 3W0MA 5JGAA 4E1ZA 3F88A 3OEFX 4FYNA 5LARA 2VWXA 3FZRA 2GQSA 5HBEA 4ZLYA 2OH0E 2Y4PA 1TQIA 2X7OA 1ZMVA 3BHUA 3DNEA 4FKVA 4FV7A 2QLUA 4NM0A 5M51A 1H24A 3PJ2A 4PDPA 3DJ6A 4FMQA 5CAQA 2G9XA 2OXYA 2VWUA 4QQTA 2W5BA 3QLFA 4TPTA 4U80A 4IB0A 1KV2A 3RK7A 4NKSA 4LQMA 4G3DA 2GMXA 5DNRA 3W33A 3OEZA 5HI2A 5DPVA 2ITPA 4RIYA 3KN6A 2QC6A 2QLQA 5HVJA 2Q0BA 3ORTA 2OIQA 2QD9A 4IZAA 4EL9A 2YM6A 4Y5HA 4QMNA 4RMZA 1ND4A 4PL4A 2BZJA 2VTOA 4RZVA 2OJFE 3GP0A 3QA0A 3DCVA 4FV2A 4EH3A 3WYXA 5HTBA 1LEWA 4DT8A 3G33A 4HCTA 2R4BA 3OMVA 2PMOX 4S34A 3ZXTA 2WHBA 1PHKA 3G0EA 4WNMA 3UTOA 4GYGA 4XBRA 5BVDA 2W1FA 3QC9A 1TKIA 2QR7A 2XNOA 3VN9A 1YXUA 2VTJA 5KZIA 3WZUA 2UZBA 2PYWA 3SDJA 2PZIA 3EN4A 3UIUA 3TM0A 4EEVA 5CALA 4RC3A 4WA9A 4ZMEA 1ZAOA 4OTQA 5AV0A 4FSMA 4LRMA 3Q04A 4N0SA 5IEYA 2OU7A 3W2OA 4DHFA 1JLUE 4AE9A 3Q4CA 5L8LA 3S1HA 3F3VA 2YDIA 4OLIA 3WBLA 4A9RA 2QURA 4AX8A 2GS7A 3DXNA 2ITZA 4GCJA 2ITOA 1JWHA 3VUDA 4I6HA 4A9YA 1IAHA 3RPVA 2X4ZA 4BCHA 1YOMA 2W4JA 2O63A 2WFYA 4CRLA 4EORA 2XK9A 3PIXA 4YMJA 1KE9A 3CY3A 5BX0A 2DS1A 3BWFA 4CG9A 3H0ZA 3Q5ZA 5H2UA 3ZEWA 3D7ZA 4HGLA 4ONAA 3DXPA 5E7RA 4YJNA 2C5NA 4JBVA 2PSQA 2B9IA 3BX5A 5L6PA 3LHJA 4XV2A 4DFYA 5IUIA 4ERKA 4X2KA 3E8NA 3QCYA 3PXFA 3PE2A 5BYYA 3CIKA 4RWIA 3F82A 3EOCA 3G6HA 3R9DA 3W2CA 2VX0A 5IUHA 3E88A 3I6UA 3NYOA 4FYOA 4GK3A 2GDOA 4XG9A 4CKJA 1ZXEA 4I6LA 3U6JA 2EB3A 1SYKA 3LXNA 3SXFA 3UOKA 4EOSA 2QOKA 2ZV2A 3L8XA 5E4HA 3FL4A 2CGXA 2WIPA 5LJJA 3L9MA 1R39A 4DLJA 2JC6A 5EM8A 4RLLA 3UPZA 5LWMA 2V62A 3O50A 3SW7A 5IDNA 3IW5A 4X3JA 4AW2A 3QQHA 3R8PA 4EH4A 1CKIA 3BYMA 4RGJA 3TT0A 4F0GA 4TN6A 4O83A 3FPQA 3IDPA 4L7FA 4X0MA 2XKFA 3EB0A 1J7UA 1V0PA 3MYGA 3O17A 1RDQE 5D7AA 4EC8A 3GFWA 5GINE 4K18A 3AC3A 1NA7A 5J9YA 5AEPA 5E92A 3ODYX 4RFYA 3ZLXA 4J95A 5E1SA 2PE1A 4JDKA 4M69B 2CDZA 2XKCA 1W98A 3D7TA 4EUUA 3NFFB 2OO8X 3LAUA 3K5VA 4ZJVA 4O96A 3R22A 4R1YA 4HCVA 2YDJA 3MPTA 2GU8A 1W82A 4V05A 1YDRE 3TKUA 5BVNA 1WVXA 1OECA 2Q83A 2GSFA 4FVPA 2X2LA 3OCSA 1G8JA 4PP7A 4I5PA 4BZOA 5DI1A 5AAGA 2OFUA 3FKNA 2UZLA 1J3HA 4HYUA 5IA0A 1H4LA 3PG1A 3MIYA 3VRYA 4NFNA 4J52A 4OT5A 4TTHB 3MFUA 3POZA 2VGPA 3MI9A 3LJ2A 4KIOA 5E8UA 5JFWA 5M44A 2QOOA 3FI4A 4FV1A 2BAJA 3BEAA 2J50A 3PY3A 4IC8A 4L52A 1OKWA 3KF4A 4QMXA 4XOYA 5FBOA 3E63A 2KULA 4O7VA 1PXOA 5J87A 3RP9A 4FSQA 4X21A 2VTIA 3D2KA 3I81A 3QBNA 4DEDA 4F1TA 4BI2A 4EOKA 4BIDA 5BUIA 3EH9A 3O7LB 2XS0A 3QTIA 4BTJA 3NYVA 1NXKA 3O0GA 1KE6A 4F09A 3DQWA 3HEGA 4FIIA 2OI4X 1KE8A 1K9AA 1YXXA 4BCQA 4I5MA 1YDTE 1WAKA 4U3YA 4FV5A 5E8ZA 5EG3A 2ITUA 4DTKA 3UGCA 3VBXA 3OOGA 4OBOA 2E9PA 4MKCA 4MHAA 1BI8A 3U9NA 4GV1A 4X3FC 5KNJA 2DQ7X 4C58A 2ZM4A 2FB8A 4H1MA 3ZRLA 3BPRA 3GBZA 2PHKA 3GVUA 4L42A 4HVHA 2IVTA 4FZDB 2CN5A 1MQBA 3FEGA 3R7EA 1K3AA 4AN2A 4GT3A 5CAPA 4G9RA 5CAVA 4FZ6A 3RNYA 3QQUA 4ZAUA 4YGAA 3W0SA 4QTDA 1XH8A 4TNBA 4YP8A 2C47A 1MUOA 2SRCA 4W4WA 1JSTA 3ZUTA 4BDCA 2R64A 3F66A 5FP5A 4IB5A 4QMYA 4U97A 4IH8A 3EN9A 5M56A 4L3PA 2PMLX 3DBCA 4EH9A 3NVMB 1WBPA 2WQNA 4E73A 5A54A 3PSCA 4FSWA 3RPOA 4CFXA 5IUGA 4IVBA 4FTOA 2XKDA 2C6IA 1H1WA 3KXGA 5HVYA 2RIOA 3O23A 4JRVA 5LVLA 3L8VA 3N4TA 3K54A 3F3WA 5JGDA 2UZTA 2C6EA 3KN5A 2XNNA 3UDTA 4KIPA 2G2IA 3UOJA 2JKKA 4BJJA 2ITYA 2HZ4A 1XH6A 4YC8A 1OGYA 1YOLA 3BBTB 5AX3A 4CT2A 3Q6WA 4FIGA 5HO7A 4TWPA 2YA9A 2UW0A 3W0QA 2IO6A 2RG5A 3DJ5A 4U43A 1AGWA 4K33A 2OWBA 3RVGA 5A46A 3NW6A 5I9VA 1OKZA 4EOPA 3QTWA 4HGEA 3TNQB 4PMTA 3T3VA 3UP7A 3D5UA 1AD5A 4S32A 3II5A 4RWLA 4O38A 4O22A 3F61A 4H3BA 3UIMA 3PY1A 3HECA 5FTQA 3FMKA 4O7RA 3EQCA 3FHIA 4RIWA 1IRKA 3QTSA 3CD8A 4O6LA 1W0XC 3GUBA 2OGVA 3C13A 2WMAA 5F4NA 1ZOHA 5J1WA 4DYMA 4X2GA 3FMHA 3B2WA 4LUEA 4YTFA 3HAMA 3E93A 4TYJA 2IW6A 2H9VA 4FK3A 3QTRA 3CGOA 4NCTC 2UZVA 3H3CA 1GZKA 4GJ3A 5CT7A 4DFLA 4JDHA 3QQLA 3UQCA 1B39A 4BIEA 4YU2A 3VBQA 3R01A 2UW5A 4ZJIA 4YO4A 4E5BA 4RSSA 2W5AA 3BL9A 4FT9A 4LGHA 2PPQA 5CXZA 1Q3DA 3DK3A 3NFGB 4FOBA 5DEYA 4ZJJA 4FA2A 1XMLA 3C4FA 3NX8A 4YZNA 3TTIA 3TTJA 3W2SA 4ALUA 2F7EE 4YZCA 3ANQA 1U4DA 3QQFA 4NT4A 3F5UA 3FI3A 4TYIA 4IVCA 2VTNA 3THBA 3U87A 4AACA 3ENHA 3REPA 4PY1A 3U4UA 3N4VA 5JH6A 3W16A 3FE3A 1AQ1A 3LE6A 4RX7A 1VYWA 3F7WA 5BVWA 3AC2A 4JVGA 5AADA 3GGFA 3A62A 2XAOA 4MWHA 4EH5A 5HQ0A 2ITWA 2UZDA 3A8WA 4RWJA 3UZTA 2G01A 3FV8A 3UE4A 4GVJA 3K3JA 5A4EA 2J7TA 2B0QA 3OC1A 4RJ3A 1GOLA 1UU9A 1Y6BA 3LM0A 4DDGA 4G6LA 5JRQA 1BLXA 4I21A 3NSZA 3FWQA 3A61A 4M67A 4QMWA 3DXQA 4QP6A 3PJ3A 4BR3A 3OS3A 5IDPA 2ITQA 3CXWA 4P90A 3QQJA 4WG4A 4CD0A 4DE4A 3WZKA 5C4LA 3RHXA 3BZ3A 5A6OA 1Q61A 3W8LA 3NS9A 2XF0A 3NZ0A 4I22A 3M11A 3ORXA 3TYKA 4EBVA 2OFVA 5IQIA 3I79A 4JG8A 4EH2A 4TRLA 3TWJA 3TZ9A 5IA1A 2JBOA 4XEYA 2OIDA 4QMQA 5IQHA 1OL7A 3OW3A 3DLSA 4FTLA 4D1SA 2NNWB 4F0IA 5IA4A 4A4XA 2R3JA 4D9UA 4CFWA 3QHRA 2VX3A 3LLAA 2PUNA 4J7BA 2JEDA 2BHEA 4FEUA 3GC0A 5E8VA 3FXWA 4UX9A 5AFVA 4FV4A 3WIGA 2VTSA 4IB3A 4N57A 2UW9A 2FVDA 3CTJA 1OIYA 2GQGA 3PZEA 3MJ1A 5F94A 3SV0A 3H30A 4QMVA 4O7TA 3DLZA 3H9FA 3E7VA 5JT2A 3Q6UA 3PWYA 4EH8A 2C4GA 4JR7A 2CNVA 5CU4A 4FK6A 4BCPA 4GT5A 4N6YA 3E3PA 4OGRA 4ACHA 2GNGA 2VTRA 3TZMA 2B52A 5AV4A 4UWYA 3L8PA 3FI2A 2X8IA 4AXEA 2JDOA 4GFGA 2C1BA 1GJOA 2PUIA 5CAUA 1U54B 4Y5QA 2C5VA 4FTIA 4ALVA 3VF8A 3GU5A 5EI8A 3FKLA 3NDMA 3RAWA 1S9JA 3V6RA 3ZMMA 3Q4ZA 4YZDA 3MWUA 3DK7A 4BDKA 2RL5A 2YDKA 2CKQA 3LFAA 1WVYA 3RZBA 3U51A 1PXIA 2BRMA 5CLPA 2UVZA 2C6MA 3TDWA 1PXLA 3WF5A 2IG7A 5TT7A 4H39A 3VC4A 4XBUA 4C4EA 3BGQA 4DHIB 3F3UA 3S4QA 4RX8A 2R2PA 3T9TA 4DH5A 2ETRA 2UW3A 1BL7A 1LR4A 4PMMA 1T46A 3R7OA 4LGGA 3PFQA 4EYMA 5HX6A 4CFFA 3NIEA 5A9UA 2CNQA 4BKJA 3DFAA 2W06A 4IJPA 3U6IA 1OB3A 4Q2AA 5KMOA 3W18A 2VUWA 4L6QA 3ZO1A 3P78A 4YPDA 2G2FA 3IQ7A 3SG9A 3DDQA 3LJ0A 5DWRA 3QZIA 1NT2A 2W05A 3RTPA 4FL2A 3WF8A 3RAKA 2GNLA 2XK7A 3HV6A 4X3FB 4EHVA 5JFSA 4PMSA 1XH4A 4ACDA 1FMOE 2IWIA 4FTMA 2BDFA 2B9FA 4AN9A 1A06A 4EJNA 1OL1A 4IACA 1K2PA 4F6UA 2VU3A 4BIBA 3VUGA 5JSMA 3PY0A 4ZSLA 4F1MA 3TUBA 3DKFA 3O5AA 4U45A 3ZRKA 3QCSA 3NW7A 5EFQA 4JQEA 5LVPA 3R1NA 2BROA 2GHGA 3KXZA 4YZ9A 3E87A 4GFOA 5FGKA 5L2IA 3QWKA 3EMGA 3GEQA 1IR3A 2JFMA 4UXLA 3R71A 4D2RA 4U41A 3PPJA 5HESA 1JBPE 1A48A 1J1BA 5M06A 3R73A 1WBVA 4AZFA 4KBKA 1JSUA 1PXJA 2UZUE 3FHRA 3QA8A 3LZBA 2VZ6A 1PYXA 4J96A 4D5KA 3TKHA 4I6FA 1ZOEA 4NW5A 3QXPA 4JOAA 1OL2A 4Q9ZA 2PWLA 3Q32A 1OKYA 3RM7A 5IA5A 3TN8A 4CZUA 4IE9A 4TYHA 1V0OA 1YRPA 2VO0A 3PZHA 4WIHA 2ACXA 2BFXA 4XG2A 4J97A 2ZDUA 1ZOGA 4ZY6A 4TNDA 2EXCX 2XA4A 4IZ7A 4MAOA 5AMNA 2QONA 4FZ7A 3HMMA 1CDKA 3OWKA 1G5SA 4E7WA 3PG3A 2C1AA 3EQRA 3FMLA 3UO6A 3OVVA 2BDWA 1DM2A 4QP9A 5LWNA 3PLSA 4YJRA 4GL9A 1FGIA 2BRGA 5HIEA 3V8TA 2VGOA 2Q0NA 4YC6A 5AA8A 1J7IA 4O21A 5LVOA 3GCVA 5JQ8A 2G2HA 4EZ5A 1CSNA 3QRIA 3OP5A 4IC7A 2BZHB 2QOFA 2V0DA 4JI9A 2W1EA 4O0RA 4FG9A 1REKA 4E6QA 2XK6A 1UV5A 1YOJA 4CKIA 3E5AA 2WMRA 3FUPA 4NUSA 3B8QA 5BPYA 1QCFA 1LUFA 2R3QA 2XJ2A 2XP2A 5B2KA 5HBJA 3NMUF 2CSNA 4YJVA 3GU6A 4W8EA 2XBAA 3GFEA 4GUBA 2C69A 1PMUA 2JIIA 4KWPA 5BV3A 5GIOE 3Q4TA 2VTTA 4O84A 5HU3A 4HZRA 4MXOA 2OG8A 3DT1A 3LCKA 2YHVA 3P5KA 1SNXA 2WU6A 3ZO2A 3A60A 1GIJA 1UVRA 3R28A 4MF1A 2CN8A 2PUPA 5JFXA 1Q4LA 3R7IA