4BJJA

Sfc1-sfc7 dimerization module
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
106
Chain Sequence
SLKISDNEYALIEHPGFANNKDAFFQTLGGVQSIQKACQTSFQNPAAALLELNLRPKDKYHHPVQARVQSRNDLLVTIKKMDNSVQNVSRIRQVFLFRDMADFQYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR TAU SUBUNIT SFC1
publication title RNA Polymerase III-Specific General Transcription Factor Iiic Contains a Heterodimer Resembling Tfiif RAP30/RAP74.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 18
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17682 Tau95_N Tau95 Triple barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.160 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bjjA00
4BJJA
chains in the Genus database with same CATH superfamily
4X3FC 3MS9A 3QQGA 2CKEA 4ARKA 4ENYA 4XRJA 5D7VA 4CMUA 5C1QB 2OICA 3E92A 3R8LA 3F5XA 4J8MA 3E8NA 4PDSA 4JBOA 2YIRA 3CY2A 2UZTA 3BU5A 5LJJA 4FOCA 3IS5A 3QZHA 3PXRA 4LI5A 1URCA 2YDKA 3OUKA 1ZXEA 4IFGA 1PXKA 3E87A 2DS1A 2FYSA 2XA4A 3KMWA 4JJRA 4NU1A 5HD7A 3U54A 4I0SA 4NL0A 2JBPA 4IMYA 4AXCA 2CHLA 4BDHA 3BBTB 3MFRA 4BZOA 3ZO3A 4U8ZA 2FB8A 4FZ7A 4IB0A 2C0TA 3UDTA 2ZB1A 3QZIA 4IAIA 4L43A 4PDPA 4YZCA 4BBEA 2E2BA 4ZIMA 1YDSE 3K54A 3KKVA 4USFA 2R3NA 3MSSA 3BQRA 2FSTX 1RJBA 3F9NA 3QQFA 5CALA 1Q8TA 4BGGA 2OF4A 3D5VA 1XH4A 4JQ8A 3PE1A 2PUUA 4U43A 3DOGA 4ASDA 1GZKA 4MXAA 1UNHA 3ZUUA 4EQMA 3GC8A 4FNWA 3PE2A 5M53A 4EH2A 3GXLA 3QHRA 4RIWB 1H1SA 4DCAA 5C26A 1H0WA 4OTDA 4D0XA 3HRBA 3U51A 3R9HA 2WMWA 2YIQA 2J5EA 2V22A 1W82A 4FKSA 4H05A 5KBRA 4FZFB 3C1XA 3EFLA 4O7VA 5EHLA 2JKMA 1DI8A 4RJ5A 4GV1A 4O22A 2GQSA 3NNWA 2XAOA 4AP7A 3F2RA 3BV3A 4NFNA 1PRYA 2GFCA 4Y83A 4IB3A 5HE3A 3EN6A 2B4SB 3L1SA 3BGQA 5CENA 3VS2A 4YTFA 2J7TA 2GHLA 2PE1A 3OY3A 3AKJA 3LXLA 5HG7A 2GNJA 3WE8A 2O63A 3I60A 3PUPA 4MQ1A 4U45A 1J91A 4I4FA 4P7EA 1AQ1A 3QTWA 4AT3A 4IWDA 4FEVA 4TL0A 1M14A 4IVDA 4ANBA 3SQQA 4GIHA 4FIFA 4TWCA 4ZY4A 2R0UA 3R2YA 3EFJA 4CTCA 4YZ9A 2IZSA 1K2PA 3PSDA 1PXOA 1YDTE 3ZFYA 1E9HA 1JOWB 4O7WA 3S4QA 2W4OA 4G3DA 4YHJA 4D4RA 4OTGA 5HKMA 2BKKA 5CU4A 4DE4A 3M1SA 4PRJA 3L8SA 2F2CB 2UW7A 4QMTA 5CY3A 3WYXA 3PA3A 4EUTA 2J50A 2WQBA 1I44A 2FUMA 4R1VA 3SD0A 4IC7A 4QMPA 3D5WA 3R1QA 3KA0A 4FGBA 1M2QA 5D11A 4Q9SA 2YIYA 4IFCA 4GL9A 4PL3A 3RM7A 3PYYA 2YAAA 3UMXA 3ZMMA 4E6AA 1ZOHA 4FC0A 3O71A 2PVFA 3TUBA 2QC6A 4RJ4A 1SMHA 3DNEA 1G8SA 1YXXA 2HELA 2HY81 1G8KA 1FQ1B 3FUPA 2JDOA 4YJUA 3RALA 2B1PA 3F6XA 2XNEA 3A7IA 4EONA 5M4CA 3BWJA 3C7QA 2C69A 5DPVA 3VBYA 4E5WA 5BVNA 2JLDA 5CEMA 4Y5QA 1B38A 3FJQE 3T3UA 2P55A 5ANDA 1OKWA 2OBJA 1JKTA 2WXVA 2R5TA 4OTIA 3CCNA 1REJA 3MTLA 3TV4A 4YPDA 4ZZOA 5EM7A 1ZMVA 5L8KA 3NIZA 4G3CA 3COHA 3GCVA 1AD5A 1Y57A 1RE8A 1H1PA 3PA5A 3A61A 4FNXA 4MNEB 4RJ8A 4XLIA 2JC6A 4FX3A 5LCJA 4RBLA 2WMAA 3W2CA 1J7UA 2PMIA 5D7AA 3PPZA 3FQHA 3PXYA 2PMNX 3FLWA 1NT2A 2QHNA 4HYUA 5FP6A 4D2SA 4YMJA 3C5UA 3DBEA 3FMMA 3Q9ZA 3ROCA 2OGVA 3ZS5A 3BCEA 4W4WA 4JDKA 5I9XA 2C6KA 3W55A 4DC2A 3CQUA 3VULA 3CTJA 4WRGA 2PK9A 3KN6A 1OL5A 5FUTA 4IJPA 2OXXA 4TYEA 4IZ5A 5EQPA 4ZJJA 3RINA 1IRKA 5HG9A 4ITJA 2QO9A 1Q8WA 5EKNA 5AV0A 1HCKA 5I9UA 3RP9A 3LMIA 4EOKA 4F7SA 4ZS0A 2AUHA 2F2UA 3P1AA 5J1VA 3PPJA 3GB2A 3RK5A 4F1MA 5IPJA 1MRVA 4FV4A 3ZC5A 3R22A 4NFMA 1VYZA 1H8FA 3FHIA 3VS3A 5LXMA 3RPRA 4XJ0A 5DRDA 2WOTA 4U41A 5J5SA 3CQEA 3PA4A 3I1AA 5JSMA 2F7ZE 4ZTLA 3QKMA 3FE3A 2OI4X 4G17A 3EN7A 2BRNA 4OGRA 5AIRA 3BYSA 4FNYA 2WFYA 3V5QA 3OBGA 4DH5A 2GQGA 4RC2A 3RPVA 5FEDA 1Z5MA 3AC4A 5J8IA 4TPTA 4AGWA 3IPHA 3P86A 2FSLX 1KOBA 1H27A 2NO3A 3RVGA 1YXVA 2F7XE 4FEXA 4I6QA 4NT4A 1KE7A 3LFNA 5EI2A 4TNDA 2C6DA 2QOCA 5F1ZA 2BALA 4MXCA 4AGCA 4RIWA 4QMQA 3TNQB 3LE6A 1PMNA 3CKWA 3FAAA 3FQEA 2VTAA 2NP8A 5KHWA 4QP9A 4C4GA 1WBSA 1LPUA 5JGBA 2JKKA 2XK6A 3CPCA 4EOPA 4GUBA 1BL6A 2HW6A 3CJGA 2X9EA 5BV3A 4OBOA 2J90A 5CX9A 1W0XC 2BDJA 4FL1A 1BL7A 3R71A 4EZ3A 5AUWA 3DK3A 3BWFA 4S31A 3E8DA 3ATSA 3NCGA 2C5NA 4H36A 4AUAA 4CQEA 4EKKA 3DK6A 4FV3A 5AUVA 4FSZA 3GC9A 2C0IA 3SA0A 4A7CA 5K3YA 3QTRA 2OH4A 2GDOA 1G3NA 4EK6A 3HZTA 3EOCA 1XH7A 2PSQA 2XKFA 5IA0A 4GH2A 4PMPA 5CSPA 2W4JA 4UX9A 1FVRA 4CV9A 2WGJA 2XB7A 3HV4A 3JYAA 5DFPA 4E6CA 4ZY5A 4KKEA 2Q0BA 4EK8A 3VNTA 5HIBA 4L44A 2C5XA 3N4UA 4FKJA 4PF4A 2BDWA 5G1XA 5HX6A 3DKGA 1A06A 3LPBA 3Q04A 4MWHA 4HNIA 4USDA 4ITIA 2Z2WA 5CU3A 4UWYA 5CXHA 5E1EA 4DG0E 3WZJA 5IH6A 3KB7A 4JRVA 4W8DA 4G5PA 3C50A 1MUOA 4RGJA 5C8NA 2YCFA 3F3UA 3S3IA 2BZJA 1W83A 4Z3VA 1U59A 4D5HA 1ZYSA 5A6OA 3H9RA 3COIA 3RGFA 3E88A 3T9TA 1UNGA 3GC0A 3SXFA 4QMVA 5KX8A 3COKA 4JOAA 4G3EA 1OGYA 3ZSGA 4CFFA 3FZOA 2VTTA 3D2IA 3N4VA 4JT3A 4G2FA 5E7RA 3UZTA 2CGUA 3BHUA 1BUHA 3T8OA 2VWBA 3DT1A 1WFCA 3C4EA 2G2FA 4EC9A 2C5VA 2IWIA 4YUQA 2I40A 1FMKA 4CD0A 4HCVA 3I5ZA 4AFJA 2PZPA 3P78A 1U46A 2C4GA 3DJ5A 3FBVA 4WG5A 3ZXTA 2BAKA 4O0XA 2G2HA 2QONA 3R8PA 3EYHA 3NUUA 3L8XA 4Z9LA 5A46A 5I9VA 4WNPA 2OJJA 2W5BA 4MNEA 3TG1A 4ORKA 5KMIA 4FKTA 1G5SA 2X8IA 3ITZA 5E90A 1H1WA 3QCYA 4H3QA 1R1WA 1V0OA 3ORPA 1ZY4A 3P5KA 4OTFA 3SW7A 4IC8A 4O91A 2W1FA 1PKGA 3OCBA 1ZAOA 4D28A 2YIXA 2DWBA 3AD6A 3KXXA 2OJFE 3MJ2A 5FRIA 3NWWA 4C61A 3QD0A 4O83A 3VBVA 2JAVA 2JD5A 2Z7SA 4L42A 1OKZA 4W4YA 4DTBA 4FZ6A 3QAME 4FIJA 4GG5A 4EWHA 2QNJA 3R02A 3ALNA 4JAJA 3DU8A 3AC3A 4RWIA 4ZJVA 5L8LA 3OW4A 3DGKA 4FG8A 3HVCA 1SZMA 4ANSA 3QQJA 4AE6A 5AA8A 4WD5A 2BPMA 1Q41A 2ITWA 4W4VA 4NK9A 5AP3A 4XUFA 2XBAA 4F9YA 5AFVA 3ZEWA 5I9ZA 2P2IA 4PL5A 3TZMA 4WT6A 2VAGA 4WG4A 4BTKA 2B9JA 4FEQA 4CFUA 1H1QA 1YWRA 3WIGA 4XG8A 4NM5A 2AEGA 3QC9A 3UJGA 2YABA 3VQUA 3T3VA 3UDBA 3KN5A 5M56A 4XBUA 5CVHA 3VC4A 4WBBB 4M15A 3FEGA 3BLAA 5IA3A 5ETIA 5DH3A 2BHHA 4BVUA 4HJOA 4HYHA 4IVBA 4YP8A 3UOLA 4QYEA 3UQCA 4GKHA 3MB7A 4IW0A 3FL5A 2WIHA 1LUFA 3PY1A 5GHVA 4CZUA 4DG2E 4LRMA 5HNGA 3TZ9A 5HZNA 3KVWA 2OXYA 3OT8A 4I92A 1OIYA 2W1EA 3AT4A 3FMNA 2XK9A 3BL7A 3EFKA 2PWLA 4FT9A 4UEUA 4UZHA 2OH0E 1JSVA 1J1CA 4PTGA 3RMFA 4YLKA 1RQQA 3FKOA 1BMKA 5JKGA 3K3JA 4I4EA 2X6DA 4O96A 4CLIA 4O0TA 3ORZA 4IX6A 4L68A 3UNJA 2UW3A 3P08A 3P9JA 4FIGA 5D10A 4IVAA 5JRSA 3WARA 4C3PA 1PW2A 4DHZA 5LVNA 1FGKA 4FKPA 1UKHA 5H2UA 2Y9QA 1SVHA 3KK9A 1JWHA 1AGWA 3V5LA 2I0HA 4NTSA 1CKIA 4X2KA 4R7HA 2QU5A 1ZWSA 1Q99A 1T45A 2C6MA 2QQ7A 3Q2JA 2IW9A 4G3FA 3QKKA 1NXKA 2X6EA 3MW1A 3ULIA 4QQ5A 3FMJA 3OWJA 2BUJA 4MYGA 5A4CA 5M09A 3RHKA 2OKRA 1OMWA 3TDWA 2JIUA 4B7TA 2ZV9A 3P5JC 4AWIA 2CCIA 4GYIA 3TZ8A 2UW5A 4M69B 4MXZA 2CKPA 4ANQA 3OP5A 3UVRA 3VS4A 4M68A 1Y8YA 3NGAA 4C0TA 3UTOA 4G6OA 4IAZA 3RI1A 1R39A 2UW6A 3LM5A 3ERKA 1FVTA 1WMKA 4E73A 1P14A 1ZYDA 5IQFA 2WAJA 2QOLA 5KBQA 2UW8A 4LG4A 3BU3A 3PY3A 4FZAB 5DEYA 4ALUA 3NNXA 2FGIA 5E8XA 3UDZA 5GJDA 3RAKA 4WSYA 4EL9A 4QYFA 3TIYA 2BKZA 5FP5A 2HWPA 4CKIA 4E93A 3Q96A 1UU8A 3KC3A 3KEXA 4H3PA 5JMSA 1JBPE 3ZO1A 5JQ5A 4YURA 3PXQA 3OWKA 2PMOX 3R00A 3SW4A 1S9IA 3EMGA 2XIRA 4QMLA 3R8VA 3OZ6A 5E8VA 4KIQA 3RWPA 4TTHB 4XYFA 2YZAA 3L9LA 4EH9A 5JQ8A 4XG2A 4JI9A 5LVOA 4KSPA 3WF8A 3M2WA 4MVFA 3O8PA 3PUFC 3TCPA 1ND4A 1HCLA 2GNLA 3UMWA 3ZDIA 3DBDA 1IA8A 4FV2A 4K2RA 4PV0A 2XRUA 4C2WA 3G0FA 5FBOA 5HLNA 2Y4IB 4D4VA 5EDPA 4QP1A 3R7YA 5CS6A 5ETFA 2C3LA 3RAHA 3OC1A 1YXTA 5H3QA 3KXMA 4HCTA 3TUDA 3HEGA 3BHYA 4A9YA 4JMQA 3FHRA 4BRXA 2IO6A 2IZRA 3F69A 4B99A 4O6LA 4EYMA 4V0GB 3UIBA 5ANOA 4I20A 3WBLA 2WMXA 2PVLA 3DBCA 2P2HA 1IEPA 4F63A 3C51A 3H0ZA 4RVKA 3F7ZA 5LOHA 4QP3A 5DR2A 1OPKA 3ANQA 3TV6A 4C7TA 1FOTA 5C4KA 5DR9A 3D94A 3W2QA 3TL8A 1GIHA 2X7OA 4ZJIA 2R3OA 4X6RA 4FV8A 1UV5A 4GMYA 4LRJA 3G0EA 5E8WA 4EWQA 5KCVA 3NVKI 3O51A 1M7NA 3FC1X 1MP8A 2XIYA 4GT4A 4QPAA 4RFZA 5CVGA 4F64A 1FPUA 3UG2A 4X7QA 4FR4A 5CQUA 4II5A 2IN6A 4HZRA 2YM4A 4LGGA 5J7HA 5AV2A 3OWLA 4YTHA 2GHGA 3GOKA 5DYJA 5A14A 2JBOA 4UALA 2PE0A 4I5MA 5FEQA 3UO6A 5IA2A 4BYIA 2HY0A 3I0QA 4FJVA 2GNIA 2ZOQA 4O86A 3I79A 5BX0A 4IWOA 3QRIA 4YJTA 3F5UA 4G16A 4V05A 2UVXA 3ALOA 4FK3A 2ITPA 4RLKA 4FT0A 5E8TA 4AAYA 2ITXA 3HV3A 4FG9A 2VN9A 3JXWA 5DHJA 3SX9A 4ASXA 2HXQA 4BI2A 3R63A 3B8QA 2BFYA 1NVQA 3VS0A 4BCMA 2XK8A 1XO2B 1M52A 3FLYA 3DAJA 3Q6UA 1JLUE 3BIZA 4GIIA 5DIAA 4U42A 4R1YA 4BY9E 4QMSA 3BYMA 2ITQA 4A9SA 3QQKA 1Q61A 2ITNA 3SG9A 5J87A 2E9UA 4EHEA 4YHTA 4JG7A 4AOJA 2OU7A 4K11A 2BTSA 3D0EA 4OTWA 2W99B 3UP2A 1JKLA 4EOJA 3R28A 3ET7A 4DH1A 4XLVA 4LM5A 4CLJA 4GEOA 4DH3A 2WMTA 3R6XA 3W16A 2JFMA 4ZAUA 3OF0A 3D2KA 3MIYA 3PJ2A 4F08A 5T68A 4H39A 1OL1A 4OUCA 5IISA 4XOZA 2V7AA 4K8AA 3MA6A 3G51A 3NUSA 3Q53A 2X1NA 2YM3A 3DPKA 3WOWA 4L67A 4H3BA 5M4UA 1KV1A 4MTAA 2W5HA 2Y6MA 3NYNA 3MBLA 3DB6A 1WBTA 4QTAA 5L8JA 4CXAA 5DI1A 2Y4IC 3CTHA 4E4NA 4HVIA 5A9UA 4FTKA 4F70A 3G6GA 5KMKA 3JS2A 4XG6A 3VW6A 3LZBA 2QLQA 2FO0A 3D7TB 3DXNA 4K6ZA 4FTOA 4UB7A 3QC4A 2IW6A 4QMOA 3LFBA 3C0HA 4JR7A 4XS2A 4CNHA 4KUJA 3FXZA 1J3HA 5FTGA 2W1GA 1OL2A 4FL3A 2F7EE 3OFMA 5HVYA 3SXSA 2BZHB 5I9WA 5AADA 5L2WA 2Z8CA 2VZ6A 4C3FA 2C6EA 4FV9A 4PDOA 2WTDA 2X4FA 4ZLYA 2VWIA 3MB6A 5AP0A 2WEVA 5CEIA 4EEVA 3LCKA 4ASEA 4JBPA 5L6OA 2R64A 4M67A 4CTBA 2PYWA 2WTKB 5KNJA 3VS7A 2UW4A 4QMUA 3LCOA 3ZC6A 4EHZA 1VZOA 3PSCA 4NKAA 3W0OA 4O7ZA 4PNKA 4KIPA 4V04A 3U87A 4DFUA 3BYUA 3HUCA 3V01A 1PY5A 2B53A 3G90X 1PXLA 3LW0A 5K5NA 2H6DA 5EOLA 2E9OA 1P4FA 2OZOA 2OO8X 3NW5A 3Q9YA 2B0QA 3MH0A 1M2RA 1WCCA 3A7HA 5HNBA 4CCBA 5E4HA 3DS6A 5T6KA 3UODA 4AZSA 1L3RE 3DY7A 2QD9A 5I9YA 1QPCA 1ZZLA 3GNIB 5CF6A 2I0YA 1WAKA 2XRWA 4EUUA 2UZWE 3WE4A 3PJ8A 4FODA 4UWBA 2QG5A 3P0MA 3WF9A 5E8ZA 5G6VA 2KULA 1O6KA 3OEZA 4ALVA 3LFSA 3KXGA 2X7GA 4NWMA 3H0YA 5F95A 4KKGA 2UVYA 3HMOA 3W32A 4BHNA 1PKDA 2BZIB 2QR7A 4RG0A 2IZUA 4V0GA 4D9UA 3NUYA 3EZVA 4I6HA 2C6LA 2QCSA 2X2LA 3PJCA 4HGLA 1TQIA 4O6EA 4O7SA 1QPDA 3E7OA 4LFIA 3DAKA 5IU2A 5EM5A 3PIYA 4AOIA 2JIVA 1U5RA 5FXSA 5KE0A 5F4NA 1MRYA 2GNHA 4EH8A 3IW6A 3KVXA 1KE5A 3DK7A 3SDJA 4EOLA 4CKRA 3HMMA 3NNUA 4E1ZA 5AAFA 3ZOSA 5IZFA 1M17A 1P2AA 3DCVA 3PDTA 3NSZA 3A8WA 4KRDA 3WZUA 4J99A 5CXZA 4WOVA 3QYZA 4QRCA 1O6LA 3ZTXA 4DEEA 1QPJA 5M08A 2QOKA 1NVRA 3AMBA 3IW8A 2XH5A 2P4IA 4NM3A 2ZV2A 3ZO4A 3NAXA 4TRLA 1Q8UA 2HCKA 3DA6A 2ZDTA 4FYOA 2I7QA 2O8YA 4A9UA 4BDIA 2FH9A 1WBPA 4RC3A 4C4HA 4BGHA 4MEDA 2RG6A 3MVMA 1KSWA 4K33A 5IUIA 3IW4A 2WNTA 3C4CA 4YBKA 5BPYA 3QXPA 2UZBA 3ZLYA 3HYHA 4GK4A 5E8UA 3GOPA 2GHMA 5EOBA 3FZRA 3EL7A 4LGHA 2V5QA 4FTAA 4GCJA 5AP5A 3LLAA 5CT7A 3CR0A 2W06A 2XEZA 3OW3A 2QOQA 4FEWA 5ACBC 4FKWA 4AXEA 1H28A 1OGUA 4PQNA 5FDPA 2XKCA 1U5QA 3GCQA 3U9CA 3R30A 3U55A 4RFYA 4C3RA 1GNGA 4HOKA 1H01A 3R73A 4QP8A 3TKUA 4FSYA 2YIWA 1H0VA 5CSXA 4TNBA 4FOBA 3QD4A 4WHZA 3SHEA 2VTMA 2IJMA 3KRXA 2YM7A 4GVAA 4UZDA 4AZEA 4HVGA 2GU8A 2YISA 1F3MC 3IDCA 3QFVA 4JIKA 4HYIA 1WBVA 5C27A 1H1RA 4YSJA 3W2RA 4TWNA 1W7HA 1UVRA 2O2UA 3DJ6A 4O7TA 2WU7A 4QP4A 4QTCA 5BMSA 2BVAA 4R5YA 3PY0A 2ZDUA 5EFQA 4DHJA 1OUKA 4TWPA 4E5AX 4QTEA 4MXXA 4TKSA 3V6SA 2WHBA 3EQHA 3DTWA 5TT7A 3N4TA 3VF9A 4L53A 3VIDA 2PY3A 2QR8A 1OVEA 3GU7A 5K4IA 5CNOA 2RGPA 2VV9A 2BHEA 4AT4A 4XEYA 3D7TA 3LOKA 4Y73A 3ACJA 4F9WA 3BU6A 4KAOA 3O5AA 2W96B 3HV7A 3QHWA 4I23A 2W1CA 4CKJA 5CI6A 2CDZA 2GFSA 2YAKA 3CIKA 1STCE 1Y8GA 3COMA 4NM7A 4JLCA 3BGZA 4MH7A 2VTQA 2J0KA 4RWJA 3R04A 1QMZA 3PXFA 3MJ1A 3TTIA 2OJ9A 3GCSA 4GT3A 4PMMA 4R3RA 5IQAA 2XALA 1DAWA 5HBJA 4IJ9A 4A4OA 3QRUA 1OECA 3HRFA 1A48A 3QLFA 3W0PA 4DBNA 1OL7A 2YN8A 3ROYA 2LAVA 4IAKA 5CZHA 3HA8A 3RPSA 1U54B 2PZ5A 4BDFA 4RSSA 2X4ZA 3BELA 3ML1A 2PTKA 3LVPA 5CLPA 1YI3A 2VTRA 5CF4A 3AC8A 3ORLA 4FIHA 4MBIA 1XMLA 4D2RA 3I0OA 3PZEA 4ZMEA 4K9YA 3V5TA 4WNMA 3OTVA 2BRMA 3SOAA 1F0QA 3W2SA 4YJPA 5A4LA 4NH1A 3E63A 1W8CA 3LJ0A 2R3JA 4DH8A 4IWPA 3FMDA 3C13A 4BCIA 4U80A 4UBAA 2GTNA 4BDDA 2BIYA 5B2KA 2EB3A 3Q52A 2YACA 4O7LA 2PE2A 4QT1A 3HAVA 4GKIA 4AZTA 5I5ZA 5EQYA 2HW7A 2XM8A 3GFEA 3CC6A 3CD8A 2UZEA 3P23A 4GYGA 4Q5EA 3VBWA 4KD1A 4MBLA 1OZ1A 3QWKA 2YM6A 4CFXA 4DGOA 3AMAA 3Q9WA 4F6WA 5CEPA 1OIQA 5EW3A 3VQHA 4M7IA 4J95A 3PFQA 5K4JA 3IONA 4MKCA 3QLGA 4R7IA 4IDVA 2WQOA 1ZRZA 5TO8A 4EYJA 4JQ7A 5JFVA 3RTPA 3PLSA 5M4IA 3KREA 3UG1A 3NUXA 3QX2A 2PHKA 5C9CA 3RK7A 3SV0A 5AP4A 1JVPP 1WBOA 2EUFB 4KBAA 4TYIA 2XNBA 4ANLA 4BCQA 1ZY5A 3FZSA 4ERWA 4O7RA 4FVPA 4M84A 3R9DA 3VBQA 3VF8A 3HECA 3MI9A 4E26A 4FKLA 5KKRB 4AN9A 3ELJA 4DEBA 3E3BX 3LFCA 4XP0A 2E9NA 4FBXA 4FTLA 3HAMA 3TWJA 3TDVA 5CEQA 4YJRA 4IADA 2HOGA 5CAVA 3AGLA 4O7YA 4ACDA 3LAUA 4IAFA 2W1DA 3V8SA 2QHMA 2VNYA 2PZYA 4XCUA 5ACKA 5ETCA 3CBLA 3KRRA 2BTRA 3ORMA 3QWJA 4YLLA 3VS1A 4C4FA 4TW9A 4PMSA 3D5XA 3GUBA 3AD5A 3LFQA 2QVSE 1CTPE 3R8ZA 3OTUA 3DV3A 4ZLOA 4F4PA 3DZOA 1Q4LA 5GJGA 5C03A 4CT1A 4LRKA 2OJIA 3LXPA 4QP6A 5EI6A 4A9TA 4NKSA 2NPQA 3KRJA 2VRXA 3S0OA 4FKQA 3CEKA 3NIEA 1FMOE 3L9NA 5IA4A 3O0GA 4NM0A 3IGGA 4AGDA 1QPEA 1YI6A 3MH2A 2PMLX 3QL8A 4G5JA 4RMZA 3ZRKA 4AXDA 3R8MA 5E91A 4GG7A 4CFWA 3JPVA 4H1JA 3UGCA 2PUPA 2R3FA 3NNVA 4ZS4A 3BE2A 5J9YA 4IB5A 4D5KA 3UOHA 3OVVA 5L6WL 3EQDA 4FTMA 3ULZA 4QQJA 2CN5A 2P0CA 3QKLA 4RPVA 5J9LA 4QTDA 3ZM9A 3FPMA 2XUUA 4EK4A 3VS5A 5JZNA 4OT6A 5HHWA 4EJNA 5HNIX 4BHZA 3UIXA 4YBJA 4L3LA 3A4OX 1T46A 2QOIA 4HCUA 4F1TA 4UXQA 4BCNA 4XHKB 4XP2A 5JFSA 2Z7QA 3TN8A 3Q60A 3K3IA 3D5UA 4FSRA 3QCQA 4GFGA 5AP7A 3NX8A 4C02A 5F94A 4UN0C 4BI0A 2VWVA 3RCJA 3ZU7A 4ZLZA 3GQLA 5AP1A 5D12A 4UV0A 2VX1A 3PSBA 2XNNA 3UE4A 5B2LA 2WMVA 1TQPA 2HK5A 4OTQA 4XBRA 3ZSHA 3R9NA 4DT9A 5B7VA 5M44A 4AXFA 5HCZA 3F66A 3W0QA 3NUNA 3BHTA 5FGKA 3HMIA 1U54A 4C35A 5D1JA 5AV4A 4F99A 4U44A 4BZNA 1RDQE 2ETRA 2F9GA 5H8BA 4LL5A 3D15A 4CFNA 4F0FA 3V04A 5H8GA 2XKDA 3Q5IA 3EFWA 3Q2MA 4BCJA 2CNVA 4WO5A 4D4YA 3MH1A 2W7XA 2CGXA 3QTSA 5HICA 3FKNA 3RZBA 3VJNA 5EW9A 2BR1A 2QO2A 3F88A 5FXRA 5EM8A 2CKQA 2RG5A 2XK7A 5HORA 4XRLA 2Y8OA 4N6ZA 2YA9A 4E7WA 3FI8A 4EBVA 4FVRA 5LVLA 5HG5A 4DITA 4IH8A 1VYWA 5IEXA 2X8EA 3Q3BA 4GW8A 4O2PA 3UDSA 4A06A 1WVXA 2ITUA 3GCUA 3AD4A 3ENMA 2R3PA 2O0UA 4XV3A 4AA4A 4U97A 4BJJB 5E8SA 1YWVA 3PP1A 5CAPA 3GQIA 4TYGA 5HD4A 4U0IA 3ZFXA 3HUBA 3TT0A 1PJKA 4XX9A 1XQZA 3TACA 4DBXA 5IUGA 3KF7A 5FTOA 4UY9A 5C01A 4DEIA 3UVQA 2C47A 1E1XA 5CEKA 3FY2A 3KMUA 4B4LA 5CF5A 1OKYA 3NS9A 1JSUA 2R3QA 3TXOA 2R3MA 5IQGA 2CLQA 4R5SA 3PXZA 1O6YA 4F6SA 2XMYA 3AKKA 1H25A 3OCGA 3I5NA 3Q4UA 5CZIA 1Q97A 2V7OA 2W9ZB 4DGNA 4I5PA 3UNKA 1XH5A 2X9FA 2WTIA 3VHEA 3LCDA 2PU8A 3ORXA 3QA0A 3F82A 4CV8A 4JDHA 3BZ3A 2RFSA 2ZAZA 4HNFA 4YTIA 3V5JA 5FLFA 1BKXA 5ANEA 4ZSLA 3OMVA 1W98A 5H9BA 2GPHA 2XNMA 5IEVA 2WMRA 2ONLA 4L7FA 4O82A 4A4XA 2B52A 2YCRA 4I6FA 4YZBA 2CJMA 2PVHA 3RNIA 1YI4A 4AF3A 4E4XA 3EH9A 3KQ7A 4JDJA 1GJOA 5IG1A 2XYUA 3MY0A 5IF1A 2HAKA 2J5FA 3UYTA 3ORKA 1XKKA 3ZZEA 5EW8A 3DBFA 4IM3A 3IG7A 4FG7A 5DN3A 3MH3A 3QTUA 1NW1A 4E5BA 2FA2A 4I6LA 4IZAA 4C4IA 1ZYCA 4G3GA 4BCKA 1KV2A 4ZTQA 5FD2A 3UZRA 4FV6A 4R77A 5CVFA 2XBJA 4KS7A 5KMOA 2XNPA 3CE3A 4YO6A 4BTFA 4J53A 4AQKA 4DLJA 5AV3A 3F2AA 5GIPE 3HX4A 4XMOA 3V51A 4FTUA 2FSMX 3HA6A 5DE2A 4QDEA 1XHAA 1IAJA 1A9UA 3FI2A 4EORA 5CSVA 3W8LA 3POOA 3JVSA 4OBPA 2QKWB 3RWQA 3MV5A 1OBGA 3Q4TA 4I3ZA 1KE6A 3VHKA 1OIUA 1B39A 2R4BA 3DJ7A 5E9EA 4DGLC 3E3PA 3KMMA 3DXPA 3FSFA 4M12A 4MUQA 3GCPA 5AX3A 5CEOA 5KMJA 1UA2A 4O38A 2OF2A 2VU3A 4HGSA 5FM2A 3HNGA 3LQ8A 4TYHB 2GCDA 4FT7A 3UYSA 5JEBA 3BLHA 4XP3A 2OIQA 2OWBA 2QKRA 2HWOA 4G6NA 1Z9XA 3HLLA 3U6IA 3FMKA 3LJ1A 4MCVA 4S32A 4GU6A 3LFEA 2QU6A 3UO4A 3C4FA 1OIRA 4JX3A 4YO4A 3RK9A 3KY2A 4JX7A 4BDGA 3D14A 2R3IA 4R78A 3ID6C 5JGAA 1CKJA 5LQFA 5CSWA 3EQGA 5HIDA 3GVUA 4YJVA 5BMMA 4EHVA 1DS5A 3FLZA 3KIOC 4ZSJA 3OOMA 4K18A 1Q3WA 4N6YA 4ZTSA 5AUUA 3W0NA 1YHWA 2YEXA 3EQPA 3PIXA 2XJ0A 2VTOA 4DT8A 1EH4A 3VUGA 2ETKA 3MFTA 5HQ0A 3IECA 2X2KA 2HXLA 4U6RA 2OXDA 3IO7A 5FBNC 4OBQA 3H9OA 4PMTA 3OBJA 3K5VA 4YNEA 4DCEA 3TNIA 5FM3A 3UVPA 5IMEA 2WTCA 4JG8A 3BE9A 3ZFMA 5A4QA 4FTNA 4J98A 3AC5A 3PWDA 2X7FA 5LVPA 4BDJA 2VO3A 5EM6A 2DUVA 3I7BA 3RKBA 4TXCA 2GS2A 4BJJA 4RJ7A 3PP0A 2VWZA 3GU4A 3SLSA 1KE8A 5CANA 2V55A 5HCXA 4BIDA 4ANMA 3GT8A 3RAWA 5ITAA 4FVQA 1VR2A 3LIJA 4N70A 4MD7E 3E7VA 2CLXA 3BBWA 2Y4PA 3IQ7A 4RA5A 2HIWA 3PJ1A 4C37A 3W2PA 2VTSA 3U4UA 1YKRA 3ODZX 3F3VA 1YOMA 3QUPA 3R1SA 4BCOA 2WMQA 3UOKA 1GIJA 5D41A 4DDGA 1PXJA 4GVJA 4ZSEA 3H10A 4LOPA 3E5AA 4I6BA 5CI7A 4BBMA 4D1SA 4E8AA 4AW1A 3CJFA 2R3HA 2GS7A 3HP5A 4UXLA 5C8KA 4MD8E 2IVUA 4IBMA 4I0RA 1IASA 2I0VA 4Y85A 2CGVA 2IPXA 2OLCA 3IW5A 4C2VA 4FKRA 4MAOA 4LV5A 3O17A 3W1FA 1PXMA 3VUMA 4QNAA 4BDBA 4NIFB 2RFDA 2HZ0A 2IG7A 2YWPA 1UNLA 5CQWA 2ZVAA 4FTQA 5KZIA 3OROA 1YW2A 4RWLA 2DYLA 4IANA 3TKIA 3DQWA 1CM8A 1U4DA 2KTYA 4U5JA 4BIEA 5BUEA 4KRCA 2XARA 1XMMA 2ZB0A 3FKLA 3KFAA 3C4XA 4J97A 4LOQA 4RJ3A 3UZPA 1SVEA 2VUWA 3F3WA 4AN2A 4BBFA 3SRVB 2X8DA 3VRZA 3PXKA 5I4NA 4EBWA 3WILA 3FZ1A 2AC5A 4Y95A 3S2PA 3VAPA 4NW6A 4FEUA 4R7BA 4FTTA 4I1ZA 4XH6A 5CWZA 4Q5HA 2WB8A 4ITHA 4ZK5A 2XM9A 1ZZ2A 1R0PA 5FEEA 4D1XA 4DF3A 5IQCA 3ZRLA 4S30A 2UUEA 2GTMA 1PMUA 1YRPA 4M97A 4U7ZA 3VWAA 5A54A 3PG3A 4AW5A 3BYOA 4BCHA 5DVRA 4GS6A 1GZNA 2ZM1A 4DGGA 5LWMA 5E1SA 3AC1A 2CN8A 1PXPA 2QG7A 3RAIA 3LM0A 4L52A 4AZWA 2G1TA 3MFSA 3KCKA 5ANGA 4MK0A 1MQBA 2YITA 3EKKA 3IOPA 4U79A 4ZTHA 3ZLXA 3KXZA 2EB2A 4I0TA 4I5HA 4QEBA 3QALE 3H9FA 4IIRA 5EYMA 5IQDA 4M13A 1Q8YA 3R9OA 4RLLA 4X3FB 3QQHA 4F9CA 1KUTA 1SM2A 1QCFA 2VO7A 3EYGA 3EQIA 2UZOA 5D9HA 3VW8A 5CAUA 3UBDA 3F2NA 4ZXTA 2A2AA 5CU2A 4BB4A 5BNJA 4IM0A 1BLXA 3EQRA 3TTJA 4YU2A 4YHFA 4AN3A 2BAQA 4F9BA 3QF9A 4EZ7A 2W05A 2A4LA 5LMAA 3QRKA 2C0OA 4ZTRA 2F4JA 4YJQA 4TYHA 5AUYA 3SAYA 1TVOA 2IZTA 2JFLA 3ZCLA 4CCUA 4CT2A 4NJDA 4BICA 5HGIA 3RPYA 2JEDA 4KKHA 3RCDA 3HMPA 5LVMA 1E1VA 3HDMA 5DLSA 4IEBA 4CG9A 4E6QA 1YOJA 4OTRA 1LEWA 1PXNA 2FVDA 2IVTA 2VO0A 4G31A 1J7LA 4PDYA 3EL8A 3EIDA 4GJ3A 5M4FA 4KS8A 4C33A 3LLTA 3HV5A 4JVGA 4EI4A 4Z55A 3CKXA 1GZ8A 3ZSIA 1REKA 5M06A 2QOFA 2Z02A 4U40A 1UWHA 2W0JA 4J8NA 4G6LA 5FQDC 2V0DA 1YHSA 2DQ7X 4PTCA 4RQVA 2O64A 4PTEA 2BMCA 4Q2AA 4W4XA 3K5UA 3NCZA 4GK2A 2XJ1A 3F5PA 2CMWA 4XOYA 4YC6A 2GSFA 2XJ2A 4HGEA 3DAEA 3G15A 3OD6X 3UPXA 2VTPA 3Q4ZA 3LQ5A 2WU6A 3W33A 4YR8A 1APME 5LMKA 3UC4A 4DYMA 5C4LA 3O7LD 2XF0A 5KHXA 4L8MA 5L2TA 3BHVA 2V62A 3QUEA 3TV7A 1FVVA 1H26A 2QLUA 3OS3A 4NYEA 5BVDA 5CSHA 5JN2A 4MX9A 3V5PA 1CDKA 1PHKA 2BZKB 3MVJA 3R21A 4ZZNA 3LFFA 2ZJWA 4C4JA 2CGWA 4AZFA 3FLSA 1JKKA 2ITYA 3FI3A 3CQWA 2Z7LA 3G5DA 4YNOA 2C5OA 2WPAA 3GGFA 3VUKA 5IQBA 4FIEA 5DBXA 2F57A 4X0MA 1UU3A 3FQSA 2G01A 4ZY6A 4QYHA 2C3KA 3O23A 1Q8ZA 3D83A 4C59A 2H8HA 4YC8A 4O2ZA 4AQCA 4ZTNA 3ORIA 1TQMA 3FC2A 4PL4A 4F6UA 5C8MA 1WBNA 5IH5A 5DG5A 2WTVA 3SG8A 4L46A 4TYJA 3FV8A 4EH6A 5BYZA 2I6LA 3WF7A 1XBCA 5A6NA 3L8VA 2PULA 3P7CA 4Y8DA 2HZNA 4EK3A 1JNKA 4EH4A 4LMUA 4JL9A 3KULB 3EHAA 4HYSA 5JRQA 2VGOA 5HE2A 3R83A 5HX8A 4DFNA 3ZDUA 2CNQA 4FI1A 5EDRA 3HRCA 2ZFYA 3WI6A 2A0CX 4J71A 2OZAB 5DA3A 3WZKA 3ZLWA 1R0EA 4CRSA 2JITA 5BUJA 4QQTA 4RX5A 2J9MA 3R0TA 2O5KA 2EVAA 1PYEA 3EB0A 3SRVA 2B55A 4KB8A 2BRBA 2ITVA 3FLNC 5EH0A 5FDXA 3EN4A 3WF5A 4OT5A 4FUXA 3EKNA 3TZ7A 3EQCA 2XANA 4F9AA 5DNRA 4FSWA 3LMHA 4I21A 4IX3A 4QMWA 3TYKA 2GMXA 4O0RA 5JZJA 2J2IB 3THBA 3H3CA 4BTMA 2R0IA 2EU9A 1X8BA 3PPKA 3G2FA 3R2BA 4RA4A 3TKHA 2WTKC 3NAYA 1Y6BA 3A8XA 1GY3A 3G6HA 1Q62A 1ZARA 1OM1A 1P4OA 2HZIA 2E9PA 2R7BA 1WBWA 5EYDA 4QTBA 4JDIA 4I22A 5KZ0A 4FA2A 5AAEA 1XJDA 3GENA 3ZH8A 5EHYA 4BDKA 4M3QA 1GZOA 4KNBA 4HPTE 4X3FA 3L9PA 2WKMA 4XG9A 4FKVA 4EOQA 5HBEA 5L2IA 4GK3A 5K5XA 4RC4A 4WG3A 5HCYA 4ZSAA 2WO6A 3TM0A 3AGMA 3R1YA 4FV0A 4RVTA 3VBXA 4DN5A 3O7LB 4E20A 3II5A 2X39A 3ANRA 3NR9A 4OR5A 4AW0A 4C36A 3EWHA 4FICA 2JDTA 4IWQA 4X2FA 3KRWA 5DRBA 4DHIB 2PVKA 5F9EA 5HESA 3VRYA 5BVOA 2UV2A 4PNIA 3O8UA 2UW0A 4E4MA 4CFVA 3FY0A 4FSUA 5CAOA 2CNUA 5EI8A 3U6JA 3KXNA 3A60A 4ZOGA 3VONA 4BTJA 1ZOGA 3ORTA 4DDIA 4KBCA 4FUYA 4KIOA 5BVFA 3LCTA 3L8PA 4WNKA 5T3QA 4D55A 3QD2B 2ITZA 4IB1A 4NW5A 3E93A 2VNWA 3P4KA 3PJ3A 1H24A 4PP9A 2J0MB 4S33A 4IAAA 2Z7RA 5BYLA 4RVMA 2WOUA 4LUEA 5B0XA 3FI4A 4AACA 2R9SA 3QYWA 4FKUA 3IDPA 4CRLA 1XWSA 4IM2A 2G9XA 4MBJA 1KE9A 3N9XA 5E92A 4HW7A 3ETAA 4R6VA 5JFXA 2HZ4A 3MY5A 2EXCX 4FKOA 5AM6A 5CYIA 4JR3A 1ZLTA 4LV8A 4DFYA 4ALWA 5CU0A 3TMOA 5AUTA 1M7QA 2B9IA 3VJOA 4EOSA 4TN6A 5ETAA 4KA3A 2EWAA 3OT3A 1H4LA 4QMMA 3TJCA 5BYYA 1WVYA 3V3VA 1K3AA 3TNPC 3FXXA 3A4PA 3KRLA 2OIDA 4FTRA 4N57A 5M51A 3HL7A 3R7VA 4L00A 3HMNA 4MXOA 1YOLA 3CXWA 3R8UA 4DHFA 3E64A 4CMTA 5J95A 1BI7A 3PFYA 3UPZA 4EKLA 3OCTA 4Y46A 3V6RA 4BN1A 3QX4A 2ITOA 2C6IA 3I6UA 4ENXA 3QUDA 4LDTA 3E8CA 4IACA 2XIZA 2XK4A 4CGAA 2I1MA 4A4LA 3R7UA 3G9LX 4GJ2A 3P79A 3QD3A 4HZSA 1FINA 5TF9A 2C30A 3BEAA 1JQHA 1H08A 5DWRA 4CEGA 3DNDA 2W5AA 3NLBA 1YXSA 4XG7A 3PLAE 3KULA 3QTZA 5AUXA 4I24A 2HYYA 2ZM3A 4L9IA 4IAYA 1OI9A 4MXYA 3W0MA 3TUCA 4FKGA 3DFCB 2OZAA 2FSOX 3OHTA 1UWJA 2LGCA 5HG8A 4X6QC 4O0YA 3HKOA 3FPQA 3RNYA 2ERZE 1ST0A 3W0SA 4F7NA 1VJYA 5CT0A 2OSCA 3AKLA 3MESA 4FMQA 4QPSA 3ZUVA 5JFWA 5JT2A 5L6PA 4F09A 1SNXA 3B2WA 3BGPA 4IZYA 4LYNA 4B9DA 3SGCA 5BUIA 3ZXZA 4IZ7A 4AU8A 3SC1A 4O27B 5HU3A 5KUPA 4AAAA 5TOZA 1MQ4A 3IDBA 2F49A 3DKFA 4S2ZA 2XIKA 3DXQA 3KL8A 4O0UA 5AAGA 2P3GX 3NFFB 1XH6A 4S34A 4WRSA 4BGQA 2R3LA 4RVLA 2RF9A 2I0EA 3FMEA 2REIA 2XCHA 5IQIA 3HV6A 2NNWB 4PY1A 3MDYA 3LJ2A 3NZ0A 3P7AA 2VTIA 4RT7A 2C6OA 2OFVA 4FSMA 4X3JA 3TJDA 2R3RA 3Q9XA 4BDCA 4DFXE 5CU6A 4QMZA 1V0BA 4ID7A 2BFXA 1M2PA 5HVJA 4AE9A 4DAWA 4AS0A 2OK1A 2YDIA 3BYVA 1OL6A 2BILB 3LHJA 2UZDA 5DR6A 4U81A 2ACXA 3WF6A 5B2MA 4AT5A 2OIBA 5IUHA 5M57A 2J0LA 2R2PA 5A4EA 1SYKA 4I94A 2YJRA 4JBVA 4ZEGA 2BRHA 4RX9A 4KINA 4IQ6A 2ESMA 5BVEA 4QP2A 5LCKA 4EH5A 4WUAA 2WQEA 1H07A 4KWPA 5EYKA 3FL4A 1ZYJA 4CMOA 3DKCA 4BI1A 4E4LA 1ST4A 3HDNA 4BCPA 1GAGA 4F7JA 3CGFA 3S00A 3ZYAA 2A19B 2WD1A 3BEGA 3C5IA 4LMNA 5JGDA 5HU9A 5AP2A 1K9AA 2J6MA 2QOHA 2VWYA 1S9JA 3R1NA 3CTQA 3CD3A 2WEIA 2C5YA 2ETMA 2UZVA 4RRVA 4WNOA 2RL5A 4RWKA 3GBZA 5DT4A 2YERA 2ZMCA 5AWMA 2IVVA 4BC6A 3OG7A 2XYNA 4BZDA 4MWIA 4YZDA 4BDEA 1XBAA 4KABA 4RX8A 5AP6A 4AX8A 1V1KA 3AOXA 3LCSA 3U4WA 4FIIA 4GT5A 4V01A 3C0GA 4JXFA 3CPBA 4P5QA 4DFBA 3BPRA 3OEFX 3NUAA 2VWWA 3HGKA 2B9FA 2XP2A 3ORNA 4GU9A 4C58A 3H30A 1YQJA 3UNZA 1OUYA 4NJ3A 2YFXA 2OJGA 3F61A 3CY3A 1FGIA 3AT3A 3Q4CA 4GRBA 5KO1A 2EXMA 3BKBA 4OTHA 4LOOA 2W9FB 2B7AA 5FG8A 1Y6AA 1QL6A 5HTCA 1DAYA 5IA1A 3DDQA 4AFEA 4FV1A 4BCFA 2C68A 5LARA 4FGRA 2NYAA 2CKOA 2XKEA 3QGYA 2W1ZA 2XNOA 4GSBA 3U9NA 3N51A 4DFZE 3I7CA 3OUNB 3A7GA 4I5CA 3E8EA 4IX4A 4NCTC 5KKRC 2JDVA 5EK7A 2W17A 4C34A 5AMNA 3DQXA 3B2TA 2R7IA 3LFAA 5I0BA 3W18A 5KMNA 3BHHA 2G2IA 3MY1A 4I41A 2ZV8A 3LQ3A 4DH7A 3A2CA 3PVUA 2ONLC 4I93A 4WUNA 5E8YA 3UIMA 3NW6A 3ZRMA 2XS0A 3NYXA 1IR3A 2WQNA 4Q9ZA 5ANKA 4PWNA 4QYYA 4JAIA 4U9AA 4RIYB 4F1OA 3QRTA 5DGZA 5DOSA 5J9ZA 1NA7A 4QQCA 2PVRA 5HE0A 5KMMA 3W0RA 2PVMA 4IDTA 4FYNA 4EHGA 4FSTA 3F3ZA 3I4BA 2J0IA 2SRCA 1HOWA 3M42A 1J1BA 2JKOA 2R3KA 4BYJA 3MGYA 5K9IA 5HEZA 3ZBXA 3BI6A 3BLRA 4YGAA 2OG8A 5HI2A 3D9VA 4QYGA 4XG4A 2XZSA 4XNEA 2VWUA 4B8MA 4FNZA 4O0VA 4CSVA 4EQCA 5GINE 2A27A 3DTCA 3PTGA 2VTLA 3FMHA 2O65A 4ACGA 5IMXA 5TKDA 3GU8A 4GFMA 2UZLA 1PMEA 1F5QA 5IA5A 4JBQA 3CGOA 4NCTA 1JAMA 3Q5ZA 4JG6A 3UP7A 1SVGA 2PPQA 3VO3A 4D0WA 5CF8A 4NZWB 5JK3A 3NMUF 2OFUA 5EDQA 2VX3A 3NFGB 2J4ZA 3OWPA 1ZMUA 1PXIA 3WZEA 3UQFA 4P2KA 3SOCA 5BQ0A 1ERKA 1LEZA 4J7BA 2BCJA 3POZA 4L45A 4ERKA 4X2NA 4FTCA 1KOAA 4YZNA 4LQMA 4O21A 2J51A 3MPMA 3C4ZA 5IH4A 5IDPA 5L3AA 1Q5KA 2RFEA 3FSKA 3EN5A 2XAMA 3LMGA 2IVSA 3D7ZA 3QBNA 2PVJA 5HIEA 3KF4A 3CLYA 4FSNA 1W84A 3IKAA 4L3PA 3KK8A 3VUHA 2W4KA 1NY3A 1YDRE 3O50A 2JIIA 3BQCA 2C1BA 3VS6A 2BIKB 4DINA 2YM8A 3G33A 2X81A 3O96A 4BKJA 4PP7A 3B8RA 2PZIA 3QU0A 1OITA 1OPLA 1JKSA 4KBKA 1IG1A 2XEYA 4J96A 3QGWA 2Q83A 4LV7A 5EG3A 2VTHA 4XG3A 4WA9A 3ATTA 3QQUA 4QOXA 4MNFA 4OLIA 2JGZA 4DEHA 4RZVA 3FZPA 3GU5A 4OW8A 4QNYA 4A9RA 2QO7A 3KXHA 5F20A 3TNHA 3KGAA 1ZOEA 1O9UA 3RPOA 3LFDA 1VLRA 3GC7A 4IX5A 4H58A 4UYNA 2GNGA 3QQLA 3ZBFA 3IOKA 1XH8A 2WELA 3UC3A 2X2MA 1GIIA 1TKIA 2H9VA 4NSTA 4P4CA 2OW3A 2XIXA 4ZP5A 4FL2A 2H96A 3TI1A 4ZZMA 4U3YA 3R7EA 2QI8A 2WMUA 3LXKA 1DI9A 2C3IB 2YM5A 4EH3A 2C3JA 4JS8A 2JDRA 4Z7GA 3UOJA 4BIBA 1JSTA 2A1AB 4MHAA 2NRYA 4DG3E 4M0YA 1IA9A 4DEDA 3R7IA 4GUEA 5HTBA 3QZFA 1GOLA 5HLPA 2B54A 2QOOA 4ASZA 5HO8A 5HE1A 4BF2A 2G15A 3QTQA 3IGOA 4J52A 2R3GA 4LUDA 3A7JA 4RIXB 3MYGA 3VUDA 4L6QA 5GJFA 3PZHA 3FXWA 4C38A 3PVBA 3AXWA 2VTJA 4YJNA 2PUIA 5KMLA 2JKQA 3S1HA 2ZMDA 4RJ6A 1ATPE 4AZVA 5ICPA 2ITTA 2WTWA 4F0GA 2WMBA 5DEWA 3FYKX 5GIOE 3RJCA 2WQMA 4FV7A 1R78A 5CNNA 3CSVA 3OXIA 2VWXA 1XBBA 4IE9A 3OXTA 3BX5A 3HP2A 2GNFA 3ZLSA 2ZYBA 3SKCA 3C4WA 2UZNA 1XH9A 1PMVA 2Y7JA 3FLQA 3F5GA 3MWUA 1RW8A 4IVCA 5BVKA 2GQRA 1OBDA 3NVMB 4JQEA 1LP4A 4TT7A 2CSNA 3FDNA 3NW7A 1CMKE 5AUZA 3MTFA 3RM6A 3FZTA 1OPJA 1DM2A 2WMSA 1NVSA 2PVNA 2VO6A 3D4QA 3GEQA 3JY9A 3KCFA 3FYJX 3NPCA 2CCHA 2XK3A 1G8AA 3BV2A 3MIAA 2UW9A 1ZYLA 3QTIA 5GNKA 3WZDA 3OY1A 2UVZA 4RIYA 3VUIA 3PRFA 3W8QA 4P90A 3JVRA 4AOTA 1UU9A 2Y6OA 5DT3A 5M55A 3V5WA 3DBQA 3WYYA 4YLJA 2ERKA 3MA3A 5IQHA 4G9RA 4WIHA 3EN9A 4EQUA 3BRBA 3PG1A 4C4EA 2WIPA 3Q6WA 3TEIA 5DT0A 3DLZA 4EC8A 4FTJA 3O8TA 4CVAA 4FK6A 5H8EA 1Y91A 4A07A 4TWOA 2BAJA 2J0JA 4K0YA 5CTPA 4HVSA 2AYPA 3G9NA 4D9TA 3H4JA 2PZRA 3MVHA 3QCSA 2Q0NA 4PUZA 3AMYA 4FZDB 5AM7A 1Q24A 4RIOA 2PVYA 4F78A 3AC2A 1PF8A 3LXNA 2QOBA 4YC3A 3TNWA 2PL0A 1KWPA 2XCKA 3MN3A 4RZWA 4TZRA 4B0GA 1UU7A 1MRUA 4R3PA 5AJQA 2NRUA 3JY0A 4W8EA 5CAQA 5HLWA 4ACMA 1YHVA 3LKMA 1BX6A 3MPAA 4L7SA 3NDMA 4K1BA 4UYAA 3R9RA 1SNUA 4YJOA 3UQGA 1PYXA 4BDAA 3V8WA 3REPA 1XR1A 3I81A 3M11A 1J7IA 4MD9E 1V0PA 1JPAA 3QRJA 4EOIA 1I09A 3S95A 4XV9A 2CPKE 3R7OA 3AQVA 4GFOA 1VEBA 4M0ZA 2YZLA 3GU6A 4EH7A 2QURA 2O3PA 1G8JA 2YHVA 2P33A 1YXUA 2VD5A 4JRNA 4ACHA 3QCXA 3NEWA 1B6CB 3DDPA 4RQKA 3U6HA 4BCGA 3L9MA 4QO9A 3DLSA 3W2OA 3OOGA 4JNWA 1YVJA 2YDJA 5IEYA 4FV5A 4AG8A 4YPSA 4X2JA 2E9VA 4HPUE 3NYVA 2HENA 3F3TA 1BYGA 4XV2A 4C62A 5HO7A 5AEPA 2XNGA 4FE2A 3ZM4A 3O2MA 4DA5A 3ODYX 3ZUTA 3VBTA 4N4SA 4O0WA 4QMYA 3SXRA 4HVHA 4O7NA 4YSMA 3SVVA 3V8TA 2Y0AA 3IK3A 3ZZWA 2RIOA 4USEA 4F65A 3EQFA 5ANIA 4X2GA 3NUPA 4FTIA 3FWQA 2QODA 3QXOA 3ZHPC 4JIAA 4RX7A 4J1RA 2H34A 5J1WA 2VX0A 4AA0A 4FSQA 5HBHA 4AW2A 3GP0A 5TR6A 3UO5A 4N0SA 4QDVA 5AIKA 2BROA 4EZ5A 5LMKC 2WTJA 1H00A 4FKIA 5L2SA 1TFFA 5EQEA 4U3ZA 4ZTMA 3PIZA 3EQBA 4Y72A 3JUHA 4O0SA 2GS6A 4FT3A 3NYOA 2YCSA 4F0IA 4L01A 3E62A 4K77A 4M14A 5M07A 4E6DA 1ZMWA 1OB3A 4DTAA 4XV1A 4HVDA 5CASA 4DGMA 2JAMA 3AT2A 3GFWA 3MVLA 3F7WA 3U8WA 3ENHA 4R3CA 3VN9A 3DFAA 5JH6A 3I6WA 3NRMA 2WZJA 3PVGA 3QA8A 4D1ZA 1CSNA 4RIXA 3R01A 3A99A 5AA9A 3OCSA 3CP9A 4RFMA 2YJSA 4AXAA 4NTTA 1IAHA 3T9IA 3KU2A 3P7BA 2ZV7A 4AA5A 2X0GA 3Q32A 4CFMA 4ZMFA 4YJSA 3VVHA 3EZRA 4B8LA 4EJ7A 5IQEA 1YWNA 3DB8A 4ZSGA 4ONAA 1WVWA 4HGTA 4G9CA 4WKQA 4Z16A 2UZUE 4KSQA 4PX6A 5FTQA 3MFUA 4M8TA 1Q3DA 5AX9A 2RKUA 4EOOA 1LR4A 3BL9A 4LL0A 3W10A 4DEGA 3OXZA 3PVWA 3UIUA 2BDFA 3PWYA 4O81A 4G34A 3ZONA 3ZO2A 5FXQA 2Z60A 4DLIA 2W1IA 4DTKA 4FT5A 5IDNA 5EYCA 3AG9A 4QMNA 4L3JA 5A3XA 3ZEPA 2IW8A 4APPA 4B6LA 4DFLA 3WIKA 3PRIA 2XVDA 5ANJA 4BR3A 3ACKA 2YCQA 5LMBA 3BLQA 3TIZA 3RHXA 2AC3A 2VGPA 3A7FA 3CS9A 3MPTA 3IW7A 3JR1A 4QP7A 2RFNA 5AV1A 4APCA 2B9HA 4WBOA 4CG8A 2JDSA 1URWA 2C1AA 2ZM4A 4NUSA 5BVWA 2W1HA 2PUNA 3EJ1A 4G1WA 4O84A 4F7LA 3A62A 2C6TA 1WZYA 5EHOA 5A4TA 5LWNA 4YTCA 4TY1A 3DKOA 4P5ZA 4AGUA 4D4SA 2VTNA 4YZMA 4UWCA 4ACCA 4QMXA 1Z57A 4MF1A 3QZGA 4CZTA 4H1MA 1BI8A 1L8TA 1P5EA 3QTXA 4D58A 4EK5A 3DZQA 4EOMA 2YWVA 1R3CA 4Z7HA 1UKIA 5HVKA 3K2LA 5EKOA 4MQ2A 4Y5HA 4IHPA 1CKPA 1FBNA 3C9WA 3FMLA 3GI3A 2BRGA 4DEAA 3C0IA 4X21A 1OKVA
chains in the Genus database with same CATH topology
4X3FC 3MS9A 3QQGA 2CKEA 4ARKA 4ENYA 4XRJA 5D7VA 4CMUA 5C1QB 2OICA 3E92A 3R8LA 3F5XA 4J8MA 3E8NA 4PDSA 4JBOA 2YIRA 3CY2A 2UZTA 3BU5A 5LJJA 4FOCA 3IS5A 3QZHA 3PXRA 4LI5A 1URCA 2YDKA 3OUKA 1ZXEA 4IFGA 1PXKA 3E87A 2DS1A 2FYSA 2XA4A 3KMWA 4JJRA 4NU1A 5HD7A 3U54A 4I0SA 4NL0A 2JBPA 4IMYA 4AXCA 2CHLA 4BDHA 3BBTB 3MFRA 4BZOA 3ZO3A 4U8ZA 2FB8A 4FZ7A 4IB0A 2C0TA 3UDTA 2ZB1A 3QZIA 4IAIA 4L43A 4PDPA 4YZCA 4BBEA 2E2BA 4ZIMA 1YDSE 3K54A 3KKVA 4USFA 2R3NA 3MSSA 3BQRA 2FSTX 1RJBA 3F9NA 3QQFA 5CALA 1Q8TA 4BGGA 2OF4A 3D5VA 1XH4A 4JQ8A 3PE1A 2PUUA 4U43A 3DOGA 4ASDA 1GZKA 4MXAA 1UNHA 3ZUUA 4EQMA 3GC8A 4FNWA 3PE2A 5M53A 4EH2A 3GXLA 3QHRA 4RIWB 1H1SA 4DCAA 5C26A 1H0WA 4OTDA 4D0XA 3HRBA 3U51A 3R9HA 2WMWA 2YIQA 2J5EA 2V22A 1W82A 4FKSA 4H05A 5KBRA 4FZFB 3C1XA 3EFLA 4O7VA 5EHLA 2JKMA 1DI8A 4RJ5A 4GV1A 4O22A 2GQSA 3NNWA 2XAOA 4AP7A 3F2RA 3BV3A 4NFNA 1PRYA 2GFCA 4Y83A 4IB3A 5HE3A 3EN6A 2B4SB 3L1SA 3BGQA 5CENA 3VS2A 4YTFA 2J7TA 2GHLA 2PE1A 3OY3A 3AKJA 3LXLA 5HG7A 2GNJA 3WE8A 2O63A 3I60A 3PUPA 4MQ1A 4U45A 1J91A 4I4FA 4P7EA 1AQ1A 3QTWA 4AT3A 4IWDA 4FEVA 4TL0A 1M14A 4IVDA 4ANBA 3SQQA 4GIHA 4FIFA 4TWCA 4ZY4A 2R0UA 3R2YA 3EFJA 4CTCA 4YZ9A 2IZSA 1K2PA 3PSDA 1PXOA 1YDTE 3ZFYA 1E9HA 1JOWB 4O7WA 3S4QA 2W4OA 4G3DA 4YHJA 4D4RA 4OTGA 5HKMA 2BKKA 5CU4A 4DE4A 3M1SA 4PRJA 3L8SA 2F2CB 2UW7A 4QMTA 5CY3A 3WYXA 3PA3A 4EUTA 2J50A 2WQBA 1I44A 2FUMA 4R1VA 3SD0A 4IC7A 4QMPA 3D5WA 3R1QA 3KA0A 4FGBA 1M2QA 5D11A 4Q9SA 2YIYA 4IFCA 4GL9A 4PL3A 3RM7A 3PYYA 2YAAA 3UMXA 3ZMMA 4E6AA 1ZOHA 4FC0A 3O71A 2PVFA 3TUBA 2QC6A 4RJ4A 1SMHA 3DNEA 1G8SA 1YXXA 2HELA 2HY81 1G8KA 1FQ1B 3FUPA 2JDOA 4YJUA 3RALA 2B1PA 3F6XA 2XNEA 3A7IA 4EONA 5M4CA 3BWJA 3C7QA 2C69A 5DPVA 3VBYA 4E5WA 5BVNA 2JLDA 5CEMA 4Y5QA 1B38A 3FJQE 3T3UA 2P55A 5ANDA 1OKWA 2OBJA 1JKTA 2WXVA 2R5TA 4OTIA 3CCNA 1REJA 3MTLA 3TV4A 4YPDA 4ZZOA 5EM7A 1ZMVA 5L8KA 3NIZA 4G3CA 3COHA 3GCVA 1AD5A 1Y57A 1RE8A 1H1PA 3PA5A 3A61A 4FNXA 4MNEB 4RJ8A 4XLIA 2JC6A 4FX3A 5LCJA 4RBLA 2WMAA 3W2CA 1J7UA 2PMIA 5D7AA 3PPZA 3FQHA 3PXYA 2PMNX 3FLWA 1NT2A 2QHNA 4HYUA 5FP6A 4D2SA 4YMJA 3C5UA 3DBEA 3FMMA 3Q9ZA 3ROCA 2OGVA 3ZS5A 3BCEA 4W4WA 4JDKA 5I9XA 2C6KA 3W55A 4DC2A 3CQUA 3VULA 3CTJA 4WRGA 2PK9A 3KN6A 1OL5A 5FUTA 4IJPA 2OXXA 4TYEA 4IZ5A 5EQPA 4ZJJA 3RINA 1IRKA 5HG9A 4ITJA 2QO9A 1Q8WA 5EKNA 5AV0A 1HCKA 5I9UA 3RP9A 3LMIA 4EOKA 4F7SA 4ZS0A 2AUHA 2F2UA 3P1AA 5J1VA 3PPJA 3GB2A 3RK5A 4F1MA 5IPJA 1MRVA 4FV4A 3ZC5A 3R22A 4NFMA 1VYZA 1H8FA 3FHIA 3VS3A 5LXMA 3RPRA 4XJ0A 5DRDA 2WOTA 4U41A 5J5SA 3CQEA 3PA4A 3I1AA 5JSMA 2F7ZE 4ZTLA 3QKMA 3FE3A 2OI4X 4G17A 3EN7A 2BRNA 4OGRA 5AIRA 3BYSA 4FNYA 2WFYA 3V5QA 3OBGA 4DH5A 2GQGA 4RC2A 3RPVA 5FEDA 1Z5MA 3AC4A 5J8IA 4TPTA 4AGWA 3IPHA 3P86A 2FSLX 1KOBA 1H27A 2NO3A 3RVGA 1YXVA 2F7XE 4FEXA 4I6QA 4NT4A 1KE7A 3LFNA 5EI2A 4TNDA 2C6DA 2QOCA 5F1ZA 2BALA 4MXCA 4AGCA 4RIWA 4QMQA 3TNQB 3LE6A 1PMNA 3CKWA 3FAAA 3FQEA 2VTAA 2NP8A 5KHWA 4QP9A 4C4GA 1WBSA 1LPUA 5JGBA 2JKKA 2XK6A 3CPCA 4EOPA 4GUBA 1BL6A 2HW6A 3CJGA 2X9EA 5BV3A 4OBOA 2J90A 5CX9A 1W0XC 2BDJA 4FL1A 1BL7A 3R71A 4EZ3A 5AUWA 3DK3A 3BWFA 4S31A 3E8DA 3ATSA 3NCGA 2C5NA 4H36A 4AUAA 4CQEA 4EKKA 3DK6A 4FV3A 5AUVA 4FSZA 3GC9A 2C0IA 3SA0A 4A7CA 5K3YA 3QTRA 2OH4A 2GDOA 1G3NA 4EK6A 3HZTA 3EOCA 1XH7A 2PSQA 2XKFA 5IA0A 4GH2A 4PMPA 5CSPA 2W4JA 4UX9A 1FVRA 4CV9A 2WGJA 2XB7A 3HV4A 3JYAA 5DFPA 4E6CA 4ZY5A 4KKEA 2Q0BA 4EK8A 3VNTA 5HIBA 4L44A 2C5XA 3N4UA 4FKJA 4PF4A 2BDWA 5G1XA 5HX6A 3DKGA 1A06A 3LPBA 3Q04A 4MWHA 4HNIA 4USDA 4ITIA 2Z2WA 5CU3A 4UWYA 5CXHA 5E1EA 4DG0E 3WZJA 5IH6A 3KB7A 4JRVA 4W8DA 4G5PA 3C50A 1MUOA 4RGJA 5C8NA 2YCFA 3F3UA 3S3IA 2BZJA 1W83A 4Z3VA 1U59A 4D5HA 1ZYSA 5A6OA 3H9RA 3COIA 3RGFA 3E88A 3T9TA 1UNGA 3GC0A 3SXFA 4QMVA 5KX8A 3COKA 4JOAA 4G3EA 1OGYA 3ZSGA 4CFFA 3FZOA 2VTTA 3D2IA 3N4VA 4JT3A 4G2FA 5E7RA 3UZTA 2CGUA 3BHUA 1BUHA 3T8OA 2VWBA 3DT1A 1WFCA 3C4EA 2G2FA 4EC9A 2C5VA 2IWIA 4YUQA 2I40A 1FMKA 4CD0A 4HCVA 3I5ZA 4AFJA 2PZPA 3P78A 1U46A 2C4GA 3DJ5A 3FBVA 4WG5A 3ZXTA 2BAKA 4O0XA 2G2HA 2QONA 3R8PA 3EYHA 3NUUA 3L8XA 4Z9LA 5A46A 5I9VA 4WNPA 2OJJA 2W5BA 4MNEA 3TG1A 4ORKA 5KMIA 4FKTA 1G5SA 2X8IA 3ITZA 5E90A 1H1WA 3QCYA 4H3QA 1R1WA 1V0OA 3ORPA 1ZY4A 3P5KA 4OTFA 3SW7A 4IC8A 4O91A 2W1FA 1PKGA 3OCBA 1ZAOA 4D28A 2YIXA 2DWBA 3AD6A 3KXXA 2OJFE 3MJ2A 5FRIA 3NWWA 4C61A 3QD0A 4O83A 3VBVA 2JAVA 2JD5A 2Z7SA 4L42A 1OKZA 4W4YA 4DTBA 4FZ6A 3QAME 4FIJA 4GG5A 4EWHA 2QNJA 3R02A 3ALNA 4JAJA 3DU8A 3AC3A 4RWIA 4ZJVA 5L8LA 3OW4A 3DGKA 4FG8A 3HVCA 1SZMA 4ANSA 3QQJA 4AE6A 5AA8A 4WD5A 2BPMA 1Q41A 2ITWA 4W4VA 4NK9A 5AP3A 4XUFA 2XBAA 4F9YA 5AFVA 3ZEWA 5I9ZA 2P2IA 4PL5A 3TZMA 4WT6A 2VAGA 4WG4A 4BTKA 2B9JA 4FEQA 4CFUA 1H1QA 1YWRA 3WIGA 4XG8A 4NM5A 2AEGA 3QC9A 3UJGA 2YABA 3VQUA 3T3VA 3UDBA 3KN5A 5M56A 4XBUA 5CVHA 3VC4A 4WBBB 4M15A 3FEGA 3BLAA 5IA3A 5ETIA 5DH3A 2BHHA 4BVUA 4HJOA 4HYHA 4IVBA 4YP8A 3UOLA 4QYEA 3UQCA 4GKHA 3MB7A 4IW0A 3FL5A 2WIHA 1LUFA 3PY1A 5GHVA 4CZUA 4DG2E 4LRMA 5HNGA 3TZ9A 5HZNA 3KVWA 2OXYA 3OT8A 4I92A 1OIYA 2W1EA 3AT4A 3FMNA 2XK9A 3BL7A 3EFKA 2PWLA 4FT9A 4UEUA 4UZHA 2OH0E 1JSVA 1J1CA 4PTGA 3RMFA 4YLKA 1RQQA 3FKOA 1BMKA 5JKGA 3K3JA 4I4EA 2X6DA 4O96A 4CLIA 4O0TA 3ORZA 4IX6A 4L68A 3UNJA 2UW3A 3P08A 3P9JA 4FIGA 5D10A 4IVAA 5JRSA 3WARA 4C3PA 1PW2A 4DHZA 5LVNA 1FGKA 4FKPA 1UKHA 5H2UA 2Y9QA 1SVHA 3KK9A 1JWHA 1AGWA 3V5LA 2I0HA 4NTSA 1CKIA 4X2KA 4R7HA 2QU5A 1ZWSA 1Q99A 1T45A 2C6MA 2QQ7A 3Q2JA 2IW9A 4G3FA 3QKKA 1NXKA 2X6EA 3MW1A 3ULIA 4QQ5A 3FMJA 3OWJA 2BUJA 4MYGA 5A4CA 5M09A 3RHKA 2OKRA 1OMWA 3TDWA 2JIUA 4B7TA 2ZV9A 3P5JC 4AWIA 2CCIA 4GYIA 3TZ8A 2UW5A 4M69B 4MXZA 2CKPA 4ANQA 3OP5A 3UVRA 3VS4A 4M68A 1Y8YA 3NGAA 4C0TA 3UTOA 4G6OA 4IAZA 3RI1A 1R39A 2UW6A 3LM5A 3ERKA 1FVTA 1WMKA 4E73A 1P14A 1ZYDA 5IQFA 2WAJA 2QOLA 5KBQA 2UW8A 4LG4A 3BU3A 3PY3A 4FZAB 5DEYA 4ALUA 3NNXA 2FGIA 5E8XA 3UDZA 5GJDA 3RAKA 4WSYA 4EL9A 4QYFA 3TIYA 2BKZA 5FP5A 2HWPA 4CKIA 4E93A 3Q96A 1UU8A 3KC3A 3KEXA 4H3PA 5JMSA 1JBPE 3ZO1A 5JQ5A 4YURA 3PXQA 3OWKA 2PMOX 3R00A 3SW4A 1S9IA 3EMGA 2XIRA 4QMLA 3R8VA 3OZ6A 5E8VA 4KIQA 3RWPA 4TTHB 4XYFA 2YZAA 3L9LA 4EH9A 5JQ8A 4XG2A 4JI9A 5LVOA 4KSPA 3WF8A 3M2WA 4MVFA 3O8PA 3PUFC 3TCPA 1ND4A 1HCLA 2GNLA 3UMWA 3ZDIA 3DBDA 1IA8A 4FV2A 4K2RA 4PV0A 2XRUA 4C2WA 3G0FA 5FBOA 5HLNA 2Y4IB 4D4VA 5EDPA 4QP1A 3R7YA 5CS6A 5ETFA 2C3LA 3RAHA 3OC1A 1YXTA 5H3QA 3KXMA 4HCTA 3TUDA 3HEGA 3BHYA 4A9YA 4JMQA 3FHRA 4BRXA 2IO6A 2IZRA 3F69A 4B99A 4O6LA 4EYMA 4V0GB 3UIBA 5ANOA 4I20A 3WBLA 2WMXA 2PVLA 3DBCA 2P2HA 1IEPA 4F63A 3C51A 3H0ZA 4RVKA 3F7ZA 5LOHA 4QP3A 5DR2A 1OPKA 3ANQA 3TV6A 4C7TA 1FOTA 5C4KA 5DR9A 3D94A 3W2QA 3TL8A 1GIHA 2X7OA 4ZJIA 2R3OA 4X6RA 4FV8A 1UV5A 4GMYA 4LRJA 3G0EA 5E8WA 4EWQA 5KCVA 3NVKI 3O51A 1M7NA 3FC1X 1MP8A 2XIYA 4GT4A 4QPAA 4RFZA 5CVGA 4F64A 1FPUA 3UG2A 4X7QA 4FR4A 5CQUA 4II5A 2IN6A 4HZRA 2YM4A 4LGGA 5J7HA 5AV2A 3OWLA 4YTHA 2GHGA 3GOKA 5DYJA 5A14A 2JBOA 4UALA 2PE0A 4I5MA 5FEQA 3UO6A 5IA2A 4BYIA 2HY0A 3I0QA 4FJVA 2GNIA 2ZOQA 4O86A 3I79A 5BX0A 4IWOA 3QRIA 4YJTA 3F5UA 4G16A 4V05A 2UVXA 3ALOA 4FK3A 2ITPA 4RLKA 4FT0A 5E8TA 4AAYA 2ITXA 3HV3A 4FG9A 2VN9A 3JXWA 5DHJA 3SX9A 4ASXA 2HXQA 4BI2A 3R63A 3B8QA 2BFYA 1NVQA 3VS0A 4BCMA 2XK8A 1XO2B 1M52A 3FLYA 3DAJA 3Q6UA 1JLUE 3BIZA 4GIIA 5DIAA 4U42A 4R1YA 4BY9E 4QMSA 3BYMA 2ITQA 4A9SA 3QQKA 1Q61A 2ITNA 3SG9A 5J87A 2E9UA 4EHEA 4YHTA 4JG7A 4AOJA 2OU7A 4K11A 2BTSA 3D0EA 4OTWA 2W99B 3UP2A 1JKLA 4EOJA 3R28A 3ET7A 4DH1A 4XLVA 4LM5A 4CLJA 4GEOA 4DH3A 2WMTA 3R6XA 3W16A 2JFMA 4ZAUA 3OF0A 3D2KA 3MIYA 3PJ2A 4F08A 5T68A 4H39A 1OL1A 4OUCA 5IISA 4XOZA 2V7AA 4K8AA 3MA6A 3G51A 3NUSA 3Q53A 2X1NA 2YM3A 3DPKA 3WOWA 4L67A 4H3BA 5M4UA 1KV1A 4MTAA 2W5HA 2Y6MA 3NYNA 3MBLA 3DB6A 1WBTA 4QTAA 5L8JA 4CXAA 5DI1A 2Y4IC 3CTHA 4E4NA 4HVIA 5A9UA 4FTKA 4F70A 3G6GA 5KMKA 3JS2A 4XG6A 3VW6A 3LZBA 2QLQA 2FO0A 3D7TB 3DXNA 4K6ZA 4FTOA 4UB7A 3QC4A 2IW6A 4QMOA 3LFBA 3C0HA 4JR7A 4XS2A 4CNHA 4KUJA 3FXZA 1J3HA 5FTGA 2W1GA 1OL2A 4FL3A 2F7EE 3OFMA 5HVYA 3SXSA 2BZHB 5I9WA 5AADA 5L2WA 2Z8CA 2VZ6A 4C3FA 2C6EA 4FV9A 4PDOA 2WTDA 2X4FA 4ZLYA 2VWIA 3MB6A 5AP0A 2WEVA 5CEIA 4EEVA 3LCKA 4ASEA 4JBPA 5L6OA 2R64A 4M67A 4CTBA 2PYWA 2WTKB 5KNJA 3VS7A 2UW4A 4QMUA 3LCOA 3ZC6A 4EHZA 1VZOA 3PSCA 4NKAA 3W0OA 4O7ZA 4PNKA 4KIPA 4V04A 3U87A 4DFUA 3BYUA 3HUCA 3V01A 1PY5A 2B53A 3G90X 1PXLA 3LW0A 5K5NA 2H6DA 5EOLA 2E9OA 1P4FA 2OZOA 2OO8X 3NW5A 3Q9YA 2B0QA 3MH0A 1M2RA 1WCCA 3A7HA 5HNBA 4CCBA 5E4HA 3DS6A 5T6KA 3UODA 4AZSA 1L3RE 3DY7A 2QD9A 5I9YA 1QPCA 1ZZLA 3GNIB 5CF6A 2I0YA 1WAKA 2XRWA 4EUUA 2UZWE 3WE4A 3PJ8A 4FODA 4UWBA 2QG5A 3P0MA 3WF9A 5E8ZA 5G6VA 2KULA 1O6KA 3OEZA 4ALVA 3LFSA 3KXGA 2X7GA 4NWMA 3H0YA 5F95A 4KKGA 2UVYA 3HMOA 3W32A 4BHNA 1PKDA 2BZIB 2QR7A 4RG0A 2IZUA 4V0GA 4D9UA 3NUYA 3EZVA 4I6HA 2C6LA 2QCSA 2X2LA 3PJCA 4HGLA 1TQIA 4O6EA 4O7SA 1QPDA 3E7OA 4LFIA 3DAKA 5IU2A 5EM5A 3PIYA 4AOIA 2JIVA 1U5RA 5FXSA 5KE0A 5F4NA 1MRYA 2GNHA 4EH8A 3IW6A 3KVXA 1KE5A 3DK7A 3SDJA 4EOLA 4CKRA 3HMMA 3NNUA 4E1ZA 5AAFA 3ZOSA 5IZFA 1M17A 1P2AA 3DCVA 3PDTA 3NSZA 3A8WA 4KRDA 3WZUA 4J99A 5CXZA 4WOVA 3QYZA 4QRCA 1O6LA 3ZTXA 4DEEA 1QPJA 5M08A 2QOKA 1NVRA 3AMBA 3IW8A 2XH5A 2P4IA 4NM3A 2ZV2A 3ZO4A 3NAXA 4TRLA 1Q8UA 2HCKA 3DA6A 2ZDTA 4FYOA 2I7QA 2O8YA 4A9UA 4BDIA 2FH9A 1WBPA 4RC3A 4C4HA 4BGHA 4MEDA 2RG6A 3MVMA 1KSWA 4K33A 5IUIA 3IW4A 2WNTA 3C4CA 4YBKA 5BPYA 3QXPA 2UZBA 3ZLYA 3HYHA 4GK4A 5E8UA 3GOPA 2GHMA 5EOBA 3FZRA 3EL7A 4LGHA 2V5QA 4FTAA 4GCJA 5AP5A 3LLAA 5CT7A 3CR0A 2W06A 2XEZA 3OW3A 2QOQA 4FEWA 5ACBC 4FKWA 4AXEA 1H28A 1OGUA 4PQNA 5FDPA 2XKCA 1U5QA 3GCQA 3U9CA 3R30A 3U55A 4RFYA 4C3RA 1GNGA 4HOKA 1H01A 3R73A 4QP8A 3TKUA 4FSYA 2YIWA 1H0VA 5CSXA 4TNBA 4FOBA 3QD4A 4WHZA 3SHEA 2VTMA 2IJMA 3KRXA 2YM7A 4GVAA 4UZDA 4AZEA 4HVGA 2GU8A 2YISA 1F3MC 3IDCA 3QFVA 4JIKA 4HYIA 1WBVA 5C27A 1H1RA 4YSJA 3W2RA 4TWNA 1W7HA 1UVRA 2O2UA 3DJ6A 4O7TA 2WU7A 4QP4A 4QTCA 5BMSA 2BVAA 4R5YA 3PY0A 2ZDUA 5EFQA 4DHJA 1OUKA 4TWPA 4E5AX 4QTEA 4MXXA 4TKSA 3V6SA 2WHBA 3EQHA 3DTWA 5TT7A 3N4TA 3VF9A 4L53A 3VIDA 2PY3A 2QR8A 1OVEA 3GU7A 5K4IA 5CNOA 2RGPA 2VV9A 2BHEA 4AT4A 4XEYA 3D7TA 3LOKA 4Y73A 3ACJA 4F9WA 3BU6A 4KAOA 3O5AA 2W96B 3HV7A 3QHWA 4I23A 2W1CA 4CKJA 5CI6A 2CDZA 2GFSA 2YAKA 3CIKA 1STCE 1Y8GA 3COMA 4NM7A 4JLCA 3BGZA 4MH7A 2VTQA 2J0KA 4RWJA 3R04A 1QMZA 3PXFA 3MJ1A 3TTIA 2OJ9A 3GCSA 4GT3A 4PMMA 4R3RA 5IQAA 2XALA 1DAWA 5HBJA 4IJ9A 4A4OA 3QRUA 1OECA 3HRFA 1A48A 3QLFA 3W0PA 4DBNA 1OL7A 2YN8A 3ROYA 2LAVA 4IAKA 5CZHA 3HA8A 3RPSA 1U54B 2PZ5A 4BDFA 4RSSA 2X4ZA 3BELA 3ML1A 2PTKA 3LVPA 5CLPA 1YI3A 2VTRA 5CF4A 3AC8A 3ORLA 4FIHA 4MBIA 1XMLA 4D2RA 3I0OA 3PZEA 4ZMEA 4K9YA 3V5TA 4WNMA 3OTVA 2BRMA 3SOAA 1F0QA 3W2SA 4YJPA 5A4LA 4NH1A 3E63A 1W8CA 3LJ0A 2R3JA 4DH8A 4IWPA 3FMDA 3C13A 4BCIA 4U80A 4UBAA 2GTNA 4BDDA 2BIYA 5B2KA 2EB3A 3Q52A 2YACA 4O7LA 2PE2A 4QT1A 3HAVA 4GKIA 4AZTA 5I5ZA 5EQYA 2HW7A 2XM8A 3GFEA 3CC6A 3CD8A 2UZEA 3P23A 4GYGA 4Q5EA 3VBWA 4KD1A 4MBLA 1OZ1A 3QWKA 2YM6A 4CFXA 4DGOA 3AMAA 3Q9WA 4F6WA 5CEPA 1OIQA 5EW3A 3VQHA 4M7IA 4J95A 3PFQA 5K4JA 3IONA 4MKCA 3QLGA 4R7IA 4IDVA 2WQOA 1ZRZA 5TO8A 4EYJA 4JQ7A 5JFVA 3RTPA 3PLSA 5M4IA 3KREA 3UG1A 3NUXA 3QX2A 2PHKA 5C9CA 3RK7A 3SV0A 5AP4A 1JVPP 1WBOA 2EUFB 4KBAA 4TYIA 2XNBA 4ANLA 4BCQA 1ZY5A 3FZSA 4ERWA 4O7RA 4FVPA 4M84A 3R9DA 3VBQA 3VF8A 3HECA 3MI9A 4E26A 4FKLA 5KKRB 4AN9A 3ELJA 4DEBA 3E3BX 3LFCA 4XP0A 2E9NA 4FBXA 4FTLA 3HAMA 3TWJA 3TDVA 5CEQA 4YJRA 4IADA 2HOGA 5CAVA 3AGLA 4O7YA 4ACDA 3LAUA 4IAFA 2W1DA 3V8SA 2QHMA 2VNYA 2PZYA 4XCUA 5ACKA 5ETCA 3CBLA 3KRRA 2BTRA 3ORMA 3QWJA 4YLLA 3VS1A 4C4FA 4TW9A 4PMSA 3D5XA 3GUBA 3AD5A 3LFQA 2QVSE 1CTPE 3R8ZA 3OTUA 3DV3A 4ZLOA 4F4PA 3DZOA 1Q4LA 5GJGA 5C03A 4CT1A 4LRKA 2OJIA 3LXPA 4QP6A 5EI6A 4A9TA 4NKSA 2NPQA 3KRJA 2VRXA 3S0OA 4FKQA 3CEKA 3NIEA 1FMOE 3L9NA 5IA4A 3O0GA 4NM0A 3IGGA 4AGDA 1QPEA 1YI6A 3MH2A 2PMLX 3QL8A 4G5JA 4RMZA 3ZRKA 4AXDA 3R8MA 5E91A 4GG7A 4CFWA 3JPVA 4H1JA 3UGCA 2PUPA 2R3FA 3NNVA 4ZS4A 3BE2A 5J9YA 4IB5A 4D5KA 3UOHA 3OVVA 5L6WL 3EQDA 4FTMA 3ULZA 4QQJA 2CN5A 2P0CA 3QKLA 4RPVA 5J9LA 4QTDA 3ZM9A 3FPMA 2XUUA 4EK4A 3VS5A 5JZNA 4OT6A 5HHWA 4EJNA 5HNIX 4BHZA 3UIXA 4YBJA 4L3LA 3A4OX 1T46A 2QOIA 4HCUA 4F1TA 4UXQA 4BCNA 4XHKB 4XP2A 5JFSA 2Z7QA 3TN8A 3Q60A 3K3IA 3D5UA 4FSRA 3QCQA 4GFGA 5AP7A 3NX8A 4C02A 5F94A 4UN0C 4BI0A 2VWVA 3RCJA 3ZU7A 4ZLZA 3GQLA 5AP1A 5D12A 4UV0A 2VX1A 3PSBA 2XNNA 3UE4A 5B2LA 2WMVA 1TQPA 2HK5A 4OTQA 4XBRA 3ZSHA 3R9NA 4DT9A 5B7VA 5M44A 4AXFA 5HCZA 3F66A 3W0QA 3NUNA 3BHTA 5FGKA 3HMIA 1U54A 4C35A 5D1JA 5AV4A 4F99A 4U44A 4BZNA 1RDQE 2ETRA 2F9GA 5H8BA 4LL5A 3D15A 4CFNA 4F0FA 3V04A 5H8GA 2XKDA 3Q5IA 3EFWA 3Q2MA 4BCJA 2CNVA 4WO5A 4D4YA 3MH1A 2W7XA 2CGXA 3QTSA 5HICA 3FKNA 3RZBA 3VJNA 5EW9A 2BR1A 2QO2A 3F88A 5FXRA 5EM8A 2CKQA 2RG5A 2XK7A 5HORA 4XRLA 2Y8OA 4N6ZA 2YA9A 4E7WA 3FI8A 4EBVA 4FVRA 5LVLA 5HG5A 4DITA 4IH8A 1VYWA 5IEXA 2X8EA 3Q3BA 4GW8A 4O2PA 3UDSA 4A06A 1WVXA 2ITUA 3GCUA 3AD4A 3ENMA 2R3PA 2O0UA 4XV3A 4AA4A 4U97A 4BJJB 5E8SA 1YWVA 3PP1A 5CAPA 3GQIA 4TYGA 5HD4A 4U0IA 3ZFXA 3HUBA 3TT0A 1PJKA 4XX9A 1XQZA 3TACA 4DBXA 5IUGA 3KF7A 5FTOA 4UY9A 5C01A 4DEIA 3UVQA 2C47A 1E1XA 5CEKA 3FY2A 3KMUA 4B4LA 5CF5A 1OKYA 3NS9A 1JSUA 2R3QA 3TXOA 2R3MA 5IQGA 2CLQA 4R5SA 3PXZA 1O6YA 4F6SA 2XMYA 3AKKA 1H25A 3OCGA 3I5NA 3Q4UA 5CZIA 1Q97A 2V7OA 2W9ZB 4DGNA 4I5PA 3UNKA 1XH5A 2X9FA 2WTIA 3VHEA 3LCDA 2PU8A 3ORXA 3QA0A 3F82A 4CV8A 4JDHA 3BZ3A 2RFSA 2ZAZA 4HNFA 4YTIA 3V5JA 5FLFA 1BKXA 5ANEA 4ZSLA 3OMVA 1W98A 5H9BA 2GPHA 2XNMA 5IEVA 2WMRA 2ONLA 4L7FA 4O82A 4A4XA 2B52A 2YCRA 4I6FA 4YZBA 2CJMA 2PVHA 3RNIA 1YI4A 4AF3A 4E4XA 3EH9A 3KQ7A 4JDJA 1GJOA 5IG1A 2XYUA 3MY0A 5IF1A 2HAKA 2J5FA 3UYTA 3ORKA 1XKKA 3ZZEA 5EW8A 3DBFA 4IM3A 3IG7A 4FG7A 5DN3A 3MH3A 3QTUA 1NW1A 4E5BA 2FA2A 4I6LA 4IZAA 4C4IA 1ZYCA 4G3GA 4BCKA 1KV2A 4ZTQA 5FD2A 3UZRA 4FV6A 4R77A 5CVFA 2XBJA 4KS7A 5KMOA 2XNPA 3CE3A 4YO6A 4BTFA 4J53A 4AQKA 4DLJA 5AV3A 3F2AA 5GIPE 3HX4A 4XMOA 3V51A 4FTUA 2FSMX