4DT9A

Crystal structure of aminoglycoside-2''-phosphotransferase type iva in complex with guanosine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Structural Basis for Dual Nucleotide Selectivity of Aminoglycoside 2''-Phosphotransferase IVa Provides Insight on Determinants of Nucleotide Specificity of Aminoglycoside Kinases.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dt9A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dt9A02
3ORPA 4EBVA 4ZY5A 5KMNA 3MY0A 1XBBA 4X0MA 1U4DA 3FDNA 3HV7A 3L8XA 5HE2A 2RGPA 2YJSA 5HCZA 3Q32A 1YDTE 2H9VA 5DH3A 1Q41A 3ZZEA 3ORIA 4FSRA 3VS5A 3R6XA 3TTJA 4M69B 4IANA 4B7TA 3BI6A 3AC8A 2HZ0A 5FDPA 4JVGA 4M12A 5CI6A 4AZTA 3W10A 4D1ZA 2C3IB 2CKPA 3CSVA 3R9DA 2XKEA 2Y6MA 2DYLA 2HXLA 3DB8A 3EZVA 3NNXA 2C47A 3PJCA 4IB1A 1SNUA 4JAIA 5EW3A 3V8WA 4X3JA 3FMJA 4LYNA 2XP2A 3RK5A 3LMGA 3OCTA 3CD3A 3Q6WA 1XH8A 3R0TA 1W8CA 3EYGA 3LQ5A 3WIKA 4ZMFA 2J50A 3DK7A 3NSZA 4XS2A 1MRUA 5HG5A 2Q0BA 2UW5A 4O6LA 2ZAZA 4FL1A 1SVHA 4HNFA 3ZRLA 4O2ZA 3FYKX 5KZIA 2OW3A 2ZDUA 3S4QA 2B9JA 2YCRA 1JKTA 3LKMA 4RA4A 3AT3A 5GHVA 3ZU7A 5IZFA 3B2WA 5L2IA 3NYOA 2G2HA 1Q8YA 3FLWA 4LRJA 4AGUA 2BVAA 4FSWA 4QMVA 4I3ZA 5ANGA 3UDBA 1BI7A 2YHVA 3F5UA 4YHTA 3OTUA 4RWLA 3OMVA 3PLSA 3R63A 3A8WA 2P33A 2PTKA 3BE9A 3C0HA 3QCQA 5HLWA 2XIYA 3ANRA 1Y6AA 4QYHA 2BIYA 2GPHA 4U44A 3GU4A 4BBMA 1ZARA 1PXOA 5FD2A 3ZLXA 4M0YA 3ID6C 1UNLA 5EM6A 4U97A 5ANEA 4CFXA 4E20A 2G2IA 2ITXA 3W0NA 1GY3A 1J1CA 4LFIA 4RQVA 5FM3A 4CV8A 5ACKA 4QP6A 4F9AA 1M2QA 3PJ1A 4FTQA 4IM0A 5L3AA 3BBTB 5L2WA 2OO8X 1JAMA 4OT5A 5DRBA 4DBNA 4DGGA 3UO4A 4Y73A 3FBVA 4IFCA 5HCXA 2G9XA 1OPLA 2W17A 1OBDA 3C4XA 4F0IA 3RALA 2W4JA 5H9BA 3FI8A 2YFXA 3WI6A 3QTIA 2XBAA 4R1YA 4IWOA 3UPXA 4YR8A 4EK6A 1PXIA 4BIDA 3VULA 2PE1A 5JFXA 2PE0A 4UZHA 2WQEA 3OC1A 4IWPA 1UNGA 2Z8CA 5AM7A 3HRCA 4FTJA 4C3RA 3FMKA 4ASZA 3CBLA 2JDRA 5KMKA 2QHMA 4BICA 3BYSA 4LUDA 3UOLA 5A4LA 2W96B 2YCFA 5IUGA 4PWNA 3PWYA 3QA0A 4I0RA 4J8NA 3A61A 4PMMA 5LVNA 3DDQA 4U3YA 5ACBC 3SHEA 2GFSA 1I44A 2R3JA 1H8FA 4MD7E 5CZIA 4JLCA 2NP8A 4L9IA 5CEPA 4U0IA 5M4IA 3DKCA 1OIYA 3A8XA 4XV2A 2EXMA 5ANDA 4DAWA 2XYUA 1GZKA 1XH9A 3VQUA 4FNYA 4DFLA 3LVPA 4YSMA 4BDDA 4OTQA 3DXNA 2R3GA 3OCGA 4XV9A 3V6SA 4RWKA 4CT2A 4WIHA 3LLTA 1YI4A 2JIUA 3B8QA 4V05A 4YZ9A 1GIIA 5EM8A 4HW7A 4PTEA 4K9YA 4FTIA 2P55A 4I5CA 5D9HA 2CKEA 4M97A 4U43A 4XG7A 3ELJA 4RX7A 3R8ZA 4AZEA 3PZHA 2WQBA 4U41A 5CU3A 2ITYA 4GG5A 1IEPA 4LV8A 5CSPA 3EZRA 4RIXA 4F4PA 4M3QA 5J7HA 4D1SA 5CANA 1RDQE 4RQKA 3QL8A 2C6EA 4U80A 2IG7A 1GIJA 3TXOA 3ZDUA 5BVDA 3HMPA 4AA4A 3BGPA 3OCSA 3H10A 4RJ7A 3B2TA 1XH6A 2QI8A 2UZDA 1R0EA 4ZSGA 1H07A 1PKDA 4LM5A 3MH0A 4ACDA 4Z7GA 1PMNA 4FSYA 5EYMA 4DH1A 1UV5A 3HYHA 3NNUA 1ZLTA 2IPXA 1PXNA 4CT1A 5CU2A 1ZOHA 4C36A 1KWPA 2BAQA 2W4OA 5E8VA 3FZSA 2ZV2A 3T9TA 4H39A 3PWDA 4ZLZA 2F7ZE 4OTRA 2C30A 1TQPA 4RIWA 4E73A 4NIFB 4NTSA 3ORLA 4F7JA 2R4BA 4XP3A 3KXXA 3BV2A 1H01A 3NS9A 5CVFA 3KXHA 5KMLA 4KWPA 2HK5A 5HD4A 4RFMA 4BDJA 4N6YA 4UX9A 4DH5A 3DAEA 3GFEA 3NIZA 3PFQA 4KBKA 5HLPA 1PMVA 2R3PA 5CI7A 4JR3A 4IZAA 2BRMA 1CKJA 3ZLWA 4MXZA 3DB6A 2XNOA 3CY2A 3BYOA 5DR6A 4BZDA 5DNRA 3R30A 4C61A 1WBTA 5BVKA 4XG8A 3MFUA 4HVDA 5AMNA 1T46A 5AX3A 3I0OA 4PP9A 2JKQA 4NW5A 4NW6A 4NZWB 4GVJA 5HG7A 4AE6A 4DCEA 5IEXA 3LPBA 4R1VA 3FMMA 3VUHA 1PXKA 1J7IA 3QTXA 3R8PA 4FL3A 1CDKA 1NVSA 1EH4A 2WU6A 3I4BA 5LVLA 3RK7A 3LXNA 5CAVA 4JX3A 4HZSA 3Q2JA 4GW8A 1OGUA 2PSQA 2E2BA 3PIXA 3ZLSA 3DLZA 2I0HA 3FZPA 3N4VA 4MAOA 2YZLA 5I9WA 3DNDA 4GJ3A 3TJCA 3KK9A 2R2PA 4J52A 3JY0A 4H58A 4WG4A 5EYKA 2XZSA 3UOHA 3TKHA 5D1JA 3EFWA 3P5KA 4FSNA 2NPQA 4FKPA 4JJRA 5IG1A 1FOTA 4HGTA 3QXPA 5CEQA 4WHZA 2C0TA 3PXFA 4TWPA 3UTOA 4CEGA 4YO6A 4F9BA 5LVOA 2A4LA 5A3XA 1SM2A 3WE4A 3BBWA 2X6EA 4NWMA 4FV3A 4I0SA 2G01A 3EN7A 4IIRA 4PY1A 5EDPA 3SRVB 4LRKA 3ULIA 4BYIA 3F2RA 4J71A 3KMWA 3R04A 4O0YA 2BDJA 1P4FA 2ZV9A 2CN8A 2YAKA 3GCSA 4FKLA 1UWHA 4NYEA 1Y6BA 4MXOA 2UUEA 3FKOA 2GDOA 2O5KA 1A06A 4PNIA 4RVLA 2R3IA 2E9VA 1H1SA 1IG1A 4I6FA 4L3PA 4IAAA 4E4XA 3TYKA 3ZO3A 3T8OA 2EXCX 4TTHB 4CG8A 4O0RA 4EOOA 4QQTA 2UV2A 4IAZA 4L01A 2WMSA 4FT0A 4BBEA 4WNPA 1GAGA 2JKKA 3RAHA 3UNZA 3LAUA 4F9WA 2PY3A 4O21A 5M51A 3F88A 4K33A 4EOSA 2F57A 4TWNA 3MVMA 3UC3A 2PVKA 4F7SA 3F5XA 4P4CA 4DGNA 4JNWA 4NKAA 4E4NA 3MW1A 4FV8A 5JRSA 3GCUA 5AA8A 3SOCA 2I0EA 3BEAA 5C26A 2QOOA 1P4OA 5B2KA 2C3KA 5F9EA 5L8KA 3HRBA 2OZAB 4ANBA 3SW4A 3AGLA 3EQBA 1G8AA 4I22A 3GCVA 3ZFMA 3W0QA 1R1WA 2ZVAA 3KFAA 4BZOA 2E9NA 1A9UA 4IWDA 4FV0A 3DNEA 4DINA 3VVHA 5E1EA 4OBOA 4C33A 4OBQA 3TZ8A 3OXIA 4HYSA 3OT8A 5LMAA 1PY5A 4NL0A 4DCAA 2FGIA 3KB7A 3R9HA 4BDGA 3IDCA 3ZSIA 4EL9A 2JAMA 3R73A 2I6LA 3CTHA 3BQCA 3WZEA 1JNKA 1XJDA 2JDSA 3SD0A 4B0GA 1OKWA 5IPJA 2YCQA 3MI9A 2VWUA 2RG5A 2ZYBA 3UODA 4L45A 5DHJA 4C38A 2UW4A 4KNBA 4R5YA 5K9IA 4BTFA 5C01A 4ERKA 3U6JA 3P1AA 4BVUA 2XIRA 5CF6A 2J5EA 2J0IA 2CGVA 3DAJA 3H9FA 3OOMA 4E6AA 4Y5HA 3HVCA 3LFFA 2X9FA 4DG3E 4HNIA 4KS7A 2BZJA 3A7JA 1OM1A 5DR2A 4FEUA 2BRNA 1UA2A 3MIYA 3P9JA 4EZ7A 4FTMA 5KMJA 4G31A 2WMTA 4FKWA 3E8CA 3OWJA 4IX6A 3DQWA 1YWRA 2VNWA 3FKLA 4BTKA 4EYMA 4CKRA 2YITA 4J7BA 3EN6A 4UEUA 4QP1A 4QTEA 4W4XA 4RJ4A 3DBEA 3W2RA 2DUVA 3M42A 4YC3A 3GC0A 2C5OA 3TNWA 2GNLA 1W84A 4FGRA 4JBPA 4BCQA 5CEOA 3I81A 1E1VA 3MSSA 2W1IA 4DBXA 4Z7HA 3CGFA 4IZ7A 4FA2A 2IO6A 2YM5A 4EONA 2OXDA 5LOHA 3AD6A 3LFBA 3P79A 5JK3A 4R3PA 2QOIA 3DBDA 1YXVA 4RIOA 3PXKA 4G34A 4JG7A 5CU6A 5EI2A 3TNHA 4ID7A 2CCHA 1XH4A 2ITOA 3SX9A 4Z16A 5FEEA 3VN9A 4EORA 4YO4A 4YNOA 5AAGA 2F2CB 3QQFA 2YN8A 2BTRA 4S34A 3V5TA 1J91A 5KCVA 1FGKA 2BILB 5J9YA 2IVSA 1V1KA 4MNFA 4RVKA 5FDXA 3ZOSA 5D41A 3KCFA 3KKVA 5AP4A 2NO3A 4FVPA 4YTHA 5AV3A 1S9JA 4L52A 3KRRA 3NCGA 5AP0A 5BYYA 4E5WA 3MDYA 2G1TA 4W4WA 4ZLYA 5CF4A 2YWPA 3QD4A 1Y57A 3TNPC 1OL2A 3BLHA 3DV3A 3PZEA 3Q2MA 3Q9YA 4OTIA 4CCUA 4C4HA 3ZM9A 3FMNA 3RCDA 1XBCA 4FTLA 3IW4A 1ZOEA 4A07A 3P4KA 3FLZA 1H24A 4ZJJA 3QZGA 5A9UA 2Z7LA 3TG1A 5CSHA 1L3RE 3UG2A 5IEYA 4UXLA 4CLIA 5EDQA 1QPEA 3QU0A 2OJFE 2GS2A 3R71A 4TL0A 3ZUVA 4L00A 3C51A 2C3LA 3SLSA 2XK8A 4B6LA 3C0IA 4C4GA 2PYWA 4Q5EA 2VTPA 3L9MA 4NFNA 2YABA 2VTRA 2WMXA 3R00A 5AV2A 4UWCA 2X9EA 4HGLA 2Y6OA 3PVWA 4J96A 3ANQA 4MBIA 4CFWA 3G0FA 1KE8A 2OXYA 4CCBA 2W5HA 1ZYJA 2C68A 2UZOA 2VWWA 3LHJA 4FIHA 1FMOE 4YLLA 1SYKA 5D12A 3F3WA 4AFEA 4CV9A 2ETMA 5JQ5A 4MWIA 5C4KA 2C5XA 4OGRA 4PL5A 3AC3A 3EN5A 4S33A 3PVBA 4QP9A 3QX2A 3BQRA 2GTMA 2XB7A 5AP6A 3SV0A 4YU2A 5C03A 1IRKA 3L9PA 1YXSA 3BLQA 3ORKA 4NM7A 3VQHA 2VX0A 3HP5A 4L43A 5HVYA 1GIHA 4PMSA 4PUZA 5CQUA 4GK3A 3KEXA 2CCIA 5BMMA 3KRXA 3TJDA 4M67A 1ZZLA 2UW7A 3L8VA 3ORXA 4XYFA 3UNKA 5HIDA 1XH5A 2A0CX 3ZC5A 4Y85A 4EJ7A 4GIIA 3NIEA 2CSNA 4WG5A 5ETCA 5FQDC 3ZC6A 1GZ8A 3MY1A 5IQAA 1VR2A 4NJ3A 3BX5A 3FZOA 3K5VA 4I23A 3OG7A 3PIZA 3HKOA 4AT5A 1YHWA 2BMCA 3WZUA 2PULA 3AOXA 3FEGA 3LCKA 3QTRA 2B54A 2QG7A 4WD5A 2WMQA 2W5AA 2WKMA 3POOA 4FEXA 5E9EA 4EHEA 2H34A 4YP8A 2WAJA 3PRFA 4TWOA 2XM8A 3W2SA 4ORKA 3PRIA 3GQIA 3BHUA 2CGUA 4O7NA 4YLJA 1CSNA 3IK3A 4BTMA 4D4SA 3E7OA 4E7WA 2WD1A 3LOKA 4XLVA 2B9HA 2VO0A 1CM8A 1H08A 4JAJA 4BDEA 4I4FA 2IVUA 1QL6A 2HWPA 4AP7A 5CEKA 3UIBA 4CTCA 2XK3A 3OD6X 5EI6A 3VBVA 1J7LA 4B8MA 3KRWA 4PTCA 1WBOA 2BPMA 3W2CA 3SG9A 5DBXA 3W18A 3E8NA 3UC4A 1TVOA 4QMOA 5LVMA 3QRKA 3GGFA 4IW0A 1SVGA 3G0EA 4MD9E 1PXJA 4WZYA 4XG9A 1M17A 4KD1A 3A62A 3EOCA 4FTUA 4L6QA 1W98A 3OP5A 4UALA 4YJSA 3ZBFA 5KBRA 5J87A 3G15A 3V6RA 4L67A 4C58A 3Q5IA 4AW2A 3CTJA 4DEEA 4LG4A 4F1TA 5IQDA 4FZ6A 3RMFA 5CU4A 1LEWA 1IASA 3SC1A 1M2RA 2XEYA 3FLNC 1R3CA 2CGXA 4CFVA 5HX8A 3I5NA 3C4FA 3P7BA 4GKIA 4F70A 3DZQA 4QYGA 5I4NA 4HVSA 1R78A 4IHPA 5I9UA 4DTBA 4ANMA 3TZ7A 3BHHA 4DEAA 5F94A 1GZNA 3P7AA 2DQ7X 3BHVA 4TYIA 3KQ7A 2YIQA 5EYDA 4IBMA 4RMZA 2GFCA 4JDIA 4WNOA 1SZMA 1OL1A 3O7LD 4FSUA 3ZRMA 5IMXA 2F49A 3NCZA 4FBXA 2O64A 2W7XA 3DBCA 1BI8A 2OF2A 4KB8A 4BIBA 2Z7SA 4N0SA 2GNIA 3OZ6A 3UIXA 2YDIA 5JFVA 4FT5A 3COHA 1KUTA 3DGKA 3LXLA 2QKRA 5LMKA 4NM3A 4I4EA 4JQ7A 2C3JA 3OWKA 4OT6A 2R3QA 3R1NA 2AYPA 4D5HA 4S30A 4XG2A 3MPMA 3CIKA 3PA4A 3CLYA 4I21A 4IM3A 3IW7A 3RPRA 3JYAA 5EH0A 4E93A 3BWJA 3JXWA 2XA4A 4FV4A 2W1CA 3A7GA 3QZIA 3V5JA 4OR5A 5K4JA 4MQ1A 1MRYA 1YOMA 4ZJVA 2YJRA 2C69A 3LJ2A 1V0BA 5CSWA 4QOXA 1H25A 2UZVA 4FV5A 3A4OX 1IR3A 2XKCA 1F3MC 2QU6A 4BI0A 2XMYA 2WMWA 1PMUA 2VTMA 2QOHA 2QOFA 4O81A 4D2SA 5EI8A 4IFGA 2BRHA 5HNBA 4RX5A 1XKKA 2JKOA 4FTRA 1OKYA 3DT1A 1ZMWA 3R8MA 4OUCA 4RSSA 4A4LA 2VWBA 4USFA 4RJ3A 1WVWA 2PZ5A 3W32A 2GU8A 4G3FA 2YA9A 3NAXA 2OXXA 4UY9A 3S0OA 3JPVA 4AOTA 3MB6A 4GL9A 3SG8A 4IC8A 3VS1A 4Z55A 4E1ZA 3HMNA 3D2IA 3SXFA 5ITAA 5GINE 2OFVA 1OVEA 4Q5HA 2UZUE 1NY3A 4DA5A 5JN2A 5IA0A 3Q52A 4AFJA 4J1RA 4R77A 4BHZA 3OY1A 4Y83A 4BCOA 4Z3VA 3R7EA 3C50A 3DBFA 3V5WA 3VJNA 3D7ZA 1JSTA 2OK1A 1WBVA 2F9GA 2PE2A 4FSMA 4II5A 4BDHA 3RHKA 4EC9A 2AC3A 4JXFA 2QNJA 4BGHA 3UMXA 3PSBA 5M09A 3EIDA 1YRPA 3BV3A 3QF9A 2HENA 3LFEA 3JR1A 3E62A 2IVVA 2VD5A 3KCKA 3QQGA 4XG4A 2FH9A 3BHTA 5ETAA 3H0ZA 3PJ2A 3DQXA 3D5XA 3KN6A 3BWFA 3O23A 2NRUA 5LMKC 4GT5A 3VC4A 4B9DA 2DWBA 1H27A 2ITQA 3GC7A 2VAGA 3PIYA 5DT0A 4I93A 5E92A 3REPA 1JOWB 3LFSA 5CU0A 3PY1A 2WTJA 3OBGA 2OJIA 1GOLA 5J9ZA 2CMWA 2Y4IC 4PDSA 2P2HA 3TKUA 2AC5A 3K54A 4BDBA 2VTLA 3DLSA 3FY0A 3ZXTA 5M53A 4UXQA 4P5QA 5BUJA 3SVVA 4U42A 3ZEWA 4WBBB 3CP9A 4YUQA 4FTCA 4DEDA 2QR7A 4RZWA 4X2NA 3JUHA 4AN9A 3Q6UA 2C6TA 2BIKB 4FKRA 5FM2A 4O38A 4XBUA 3E3PA 5E8YA 3VW8A 3SXSA 2XCHA 4XMOA 5CY3A 5FRIA 3ZFYA 2OKRA 1E9HA 2RFSA 3F2NA 3H9OA 3HRFA 3TT0A 4D4VA 5GJDA 3HEGA 3KRLA 3S2PA 4EC8A 4AN2A 4RJ6A 5BVEA 3CD8A 3NDMA 3UP2A 5E8WA 4JR7A 3NUYA 3W2PA 1OZ1A 4L44A 2GHGA 4KINA 4K1BA 3I6WA 2ONLA 3AT4A 3O17A 4FTAA 2YM3A 1BUHA 3A7FA 3TWJA 4ALVA 4KA3A 2ETKA 3T3UA 5JFWA 3N9XA 1CKIA 2HW6A 1QPCA 4XV1A 3TKIA 3G6HA 5CX9A 1GZOA 2GQRA 3V8SA 3VUDA 3Q5ZA 4KABA 4GYGA 3IDPA 4E6DA 5J5SA 5IEVA 4P2KA 3MYGA 3HECA 1H1QA 1PRYA 3PE1A 2UZNA 4YJNA 4F08A 5CASA 5DT4A 4O0SA 2OFUA 4FYOA 3WE8A 3NWWA 4ARKA 4DG0E 2C6MA 4QQ5A 4GYIA 3TTIA 3ZCLA 4ZP5A 4ANQA 1KV2A 4PF4A 3PE2A 3VIDA 1JVPP 1H1RA 3ZH8A 4O22A 3E5AA 4RIXB 2XNEA 3JS2A 2J0JA 4JBOA 4Y95A 3QZFA 4ERWA 3SXRA 3KMUA 2OF4A 2XBJA 3R02A 3U54A 3BU3A 4QYFA 1ZOGA 3GI3A 4CMUA 5C1QB 5JT2A 4CNHA 3UPZA 3D7TA 3K3IA 4O7ZA 4RFZA 1OPKA 2O0UA 5J8IA 4EBWA 5HORA 4Y5QA 5AP7A 5M08A 4AUAA 5AJQA 5AFVA 4YJPA 4FSQA 2JDTA 5AIKA 3VBWA 5KHWA 4PMTA 1KSWA 2XUUA 3QUDA 4G9RA 2B0QA 2PVHA 4AOIA 5F1ZA 1V0PA 5JGAA 3RPVA 1CMKE 5I9YA 2J6MA 4JRNA 5E1SA 4QMMA 3PPZA 2VTOA 3R83A 4AT3A 4BR3A 1AQ1A 3BHYA 4D9UA 4USEA 3WF7A 5I9ZA 5A4CA 4KIOA 4L3JA 4BHNA 3KXGA 4E4MA 1KOAA 4FZFB 3KMMA 4ENYA 3QWKA 4ACMA 3GC9A 2FYSA 4ZZOA 4RIWB 1YHSA 3EQFA 4EK5A 3AC5A 5AV4A 4G6LA 3UZTA 3LJ1A 4YTCA 1WBNA 4F6UA 5CT7A 4HGSA 3W55A 4PL3A 2JC6A 3KXNA 4C0TA 2ETRA 3FV8A 2Y4PA 3EMGA 2BROA 4G3DA 4OTFA 4X2JA 4YHJA 1P2AA 5HICA 3UO6A 1A48A 1NA7A 4RFYA 4DC2A 4YTFA 2CKOA 2QO9A 2VO6A 3F2AA 3GOKA 2ZJWA 3RJCA 1YW2A 4JX7A 4BDKA 4BGGA 4C4JA 2F4JA 4IM2A 5IA4A 1IA9A 2GCDA 4JBVA 4HVGA 4GFOA 4FVRA 2ONLC 5KKRB 3Q04A 2H96A 3ALOA 4HCTA 1WBPA 4U3ZA 5DR9A 3WF6A 2YM8A 2PWLA 5TOZA 2JKMA 1PHKA 4FTTA 3LFQA 2C0OA 2OJ9A 3NZ0A 3FAAA 4PTGA 4YSJA 4FICA 3QKKA 5CYIA 2VX1A 5ETFA 1OECA 5FEQA 2OIQA 4QP8A 4LRMA 3TNIA 1PMEA 1REKA 4FNXA 5BUEA 2Q0NA 3FE3A 3PSDA 4EH3A 3PYYA 1JKSA 4AZWA 3KU2A 3DFAA 4JI9A 2VWZA 4Q9ZA 4QNAA 4PNKA 3OCBA 4JS8A 5AUTA 5FG8A 3PTGA 4RPVA 1W7HA 1PXPA 3E3BX 1MUOA 3ZUTA 3CPCA 1J7UA 2PUNA 1VEBA 2I7QA 3VNTA 4KRDA 3RGFA 2PVLA 3W0PA 1SNXA 3L8PA 5L2SA 4FKTA 1Q3WA 3OF0A 4LL5A 3FJQE 4MNEA 5DN3A 2YM4A 4CKIA 3EB0A 5AAEA 3FMHA 2V5QA 3HX4A 4M84A 1DM2A 2VGOA 5D10A 4GK4A 3WZKA 3R7YA 5C8KA 5DEWA 4QP4A 1XH7A 4RC2A 4F7LA 4IADA 4DITA 2BKKA 4X3FA 3HAMA 1Q8TA 3EKNA 3QWJA 4JRVA 5J1WA 3R2YA 5CVGA 1GNGA 1ERKA 3MPTA 3R7OA 4CRSA 1BL6A 4K77A 1JSUA 4KRCA 2BAJA 3L8SA 4ONAA 4KKEA 4D55A 5J1VA 2X8IA 2XM9A 1L8TA 2XNNA 3UZRA 1BYGA 4BCMA 4I24A 4JDHA 4F63A 3F3VA 4JQ8A 3RAIA 1Q3DA 4FG8A 4HPUE 2C5NA 5HU9A 3D83A 2IZRA 5E8ZA 2X4ZA 2QODA 3QTZA 3C4CA 4EQCA 2PVMA 4TRLA 3O0GA 4L46A 5DVRA 4LI5A 2ITUA 3RM6A 3BIZA 2J0MB 2XKDA 2J90A 4GRBA 2V7AA 5F20A 3MY5A 1UNHA 3HMMA 3N4UA 4EQUA 2QC6A 5A4TA 3P7CA 4X2GA 3OWLA 3R2BA 3TIZA 1J3HA 2EVAA 2BRGA 3R9NA 2CNUA 3GB2A 3QRJA 3R21A 5EQYA 1O9UA 5IQFA 5BVNA 3OUKA 4OTGA 5CT0A 2OWBA 3FLQA 2B53A 2IZSA 3BGZA 3O71A 5ANJA 1Y91A 3RTPA 1WCCA 5A54A 4DFUA 2SRCA 2IVTA 4MWHA 4WBOA 4M14A 4F09A 2PMLX 3OBJA 3PA3A 1TKIA 4CRLA 4LL0A 3NNVA 4NCTA 4EQMA 4BIEA 3ZSGA 4XRLA 3R1YA 4NU1A 5L6WL 2W9ZB 3DU8A 3F6XA 4H1JA 5BNJA 1K3AA 4FIFA 4QMUA 3IO7A 5C9CA 2VTIA 3QGYA 3NX8A 4O7PA 2F7EE 3FY2A 4RZVA 4D58A 3F5GA 3AD5A 1Q97A 4K2RA 1OITA 2C1AA 4RT7A 4W8EA 4E5AX 3O8PA 3BRBA 1H26A 2R0UA 3DBQA 4IB3A 4O7LA 4BCIA 2XJ2A 5IDNA 3FPQA 3HAVA 4J95A 1VZOA 4QMYA 4HCVA 1R0PA 4O7WA 5HD7A 5CWZA 5FXRA 1M14A 3D5WA 2WTKB 4P5ZA 3MIAA 2BDFA 4DFYA 2WOUA 2XIKA 1P14A 1ZZ2A 2J7TA 4M15A 4MTAA 2UW3A 4X3FC 5CVHA 2C6OA 3FSFA 3OXZA 4H1MA 2BFXA 3QCXA 5LCKA 4DGMA 1S9IA 3IPHA 2JEDA 5ANIA 4CVAA 5K5NA 2HZ4A 2W1FA 3MH2A 2UW8A 4BC6A 4EH6A 2RKUA 2W1GA 3HGKA 3FZ1A 4ZSLA 3NYVA 2J9MA 4A06A 3CS9A 1O6YA 4G6OA 5F95A 4F0GA 5HEZA 1PYXA 1MQBA 3AG9A 3D5UA 4FIGA 4DLJA 5D7VA 3MVLA 3V5PA 5J9LA 1KE7A 4YJQA 3AD4A 3JVRA 3ULZA 3VBYA 4GS6A 5LQFA 5LXMA 4FV1A 2OJJA 4RRVA 3MJ2A 3H30A 1TQIA 2X2KA 1LPUA 1OIRA 2OSCA 3GENA 3E87A 2J4ZA 3WARA 3RPSA 3D9VA 4CD0A 2BZIB 4XRJA 4XP0A 3VUKA 4XBRA 4ENXA 4G6NA 4MQ2A 3FHRA 1YHVA 4IQ6A 4JIKA 2JIIA 5AP3A 2VWVA 2FUMA 2E9UA 3AQVA 4A9TA 4DGLC 4FKVA 2GHMA 3H3CA 3R1SA 4CFFA 4H05A 1WBWA 3QRTA 5IUIA 4IVDA 3WZJA 4XG3A 4A9RA 3RAWA 4F65A 1XQZA 1YDSE 2OICA 4J53A 4I94A 3DTWA 4TYEA 2PZPA 3I7BA 4J97A 3QKMA 2XK4A 4G17A 4GT4A 3TDWA 4GH2A 4XCUA 2PVJA 3GU5A 2Z7RA 3ZEPA 2JBOA 3UOJA 4USDA 4QNYA 2QOBA 4MH7A 4YJUA 4LQMA 4NCTC 4TYJA 4ZTQA 3TUDA 3U51A 5JMSA 3ORMA 4U9AA 4C62A 2BALA 4DFBA 3G6GA 3ROCA 4G3GA 4ZK5A 4NUSA 3U9NA 3CE3A 3D2KA 2R0IA 2O63A 3PA5A 5BVFA 3LFCA 2IN6A 1UU3A 1YXTA 4K8AA 5IQBA 3HZTA 3IW6A 1G3NA 1HCKA 3G51A 4HJOA 4KBAA 3MTLA 3A7HA 4W4YA 1ZAOA 4MVFA 3PY3A 5IH4A 4QMXA 2VUWA 1NVRA 1H1WA 4G3CA 4GUEA 2BRBA 4KKHA 2A2AA 3E88A 3U8WA 1LP4A 2YZAA 4XJ0A 5LCJA 3ZBXA 4IX3A 3LQ8A 1OKZA 3LM0A 2FSOX 4CMTA 4F7NA 3F3UA 5CZHA 4DFZE 3C5UA 4RG0A 3UYTA 3W2QA 4GSBA 4TKSA 2KTYA 2P2IA 1OL6A 4DH8A 3TUBA 3QXOA 3PXYA 4YNEA 4AW5A 4HVHA 3FQEA 2X39A 3QTQA 2XK9A 2B9IA 4YJOA 3R8LA 4EH7A 3AC4A 2GNJA 4Q2AA 4O0WA 5HBJA 3COIA 3TUCA 4JOAA 4ZSJA 3MGYA 4TNBA 2QLQA 2XRUA 2ITNA 3O2MA 5HQ0A 4GVAA 3UNJA 4E4LA 3CR0A 4TZRA 4NM5A 4IACA 3Q4TA 5AV1A 3DA6A 5H2UA 2YAAA 2OU7A 4LMNA 3WF8A 3CY3A 1FPUA 2Y8OA 3FHIA 1F5QA 1BMKA 1NXKA 3NMUF 3EN4A 3G2FA 4IB5A 4J99A 2REIA 4FG7A 1W83A 2R64A 3UQGA 3QCSA 2QOKA 2WQOA 5HE3A 1PXLA 3DFCB 4KIQA 2WO6A 4R7BA 4MXAA 4YC6A 3BU6A 5CTPA 2RL5A 5B2MA 5LMBA 4EZ5A 3R22A 4EOPA 3PG3A 3UG1A 5HI2A 5CAQA 4BGQA 3O7LB 1Q99A 4Y72A 3H4JA 4N57A 3E92A 4EOLA 5GIOE 1FBNA 3G5DA 3QC9A 5K4IA 1WBSA 3KGAA 3SKCA 2VTHA 2JGZA 2X2MA 3OXTA 5C8NA 3Q9ZA 4HYHA 4G2FA 5DGZA 2XYNA 4MHAA 2ITWA 3NUAA 4D0XA 3MFRA 2IZTA 3U87A 3P0MA 1FMKA 2ACXA 5JGDA 5IQHA 1UVRA 3ZRKA 4XUFA 5GIPE 3KULA 5L8LA 2OIBA 4CKJA 4ZTHA 2UVZA 4I41A 3RPYA 3BYMA 3QUPA 5M4UA 3D14A 3FXXA 1Z9XA 1F0QA 3GFWA 5IA5A 2X1NA 4C34A 3LFNA 1XHAA 3T9IA 3V04A 5LWNA 1KE9A 1OUYA 3MTFA 1XBAA 5HNGA 4FYNA 4F1OA 2VZ6A 4CQEA 3QQUA 2UW9A 5IDPA 4O7YA 4DGOA 4ZTLA 1PYEA 4I20A 5AUWA 1JSVA 5E8XA 3TDVA 2C6IA 2YACA 3SA0A 1YOLA 3F3ZA 2C6DA 1KE5A 2ERKA 5C4LA 4MBJA 4MD8E 2WFYA 4RC4A 1U59A 2WGJA 4ZSAA 4EKLA 5KO1A 4RA5A 3EQHA 3HUCA 3VHKA 4RGJA 5B0XA 3FXZA 2GNFA 2ITZA 3G9LX 4RLKA 3S95A 4RIYA 4XP2A 1OKVA 2HOGA 3QD0A 1Q61A 4IVCA 4MXYA 4O7SA 2VN9A 1UKIA 1G5SA 3FMDA 4QMSA 3NUPA 2YDKA 2X8EA 4WOVA 4BDIA 1H0WA 5I5ZA 3I60A 3DAKA 3C9WA 2BZHB 2QO2A 2RG6A 2V62A 4HZRA 3SAYA 4GK2A 4ALWA 3W1FA 3VF9A 3I7CA 1DS5A 3LCTA 2YIXA 4X6RA 4YJRA 3TZ9A 4GG7A 2CHLA 4L68A 5D11A 2X6DA 3FKNA 4BTJA 3GT8A 3KL8A 4FKOA 3RINA 2HW7A 4IVAA 3IW5A 3K3JA 3BGQA 4ZXTA 4E5BA 4O7RA 2IW6A 2UZWE 3NR9A 3ZO2A 3PUPA 3F9NA 3KC3A 3QD3A 4BI2A 5HHWA 3C13A 5AUVA 4BF2A 2R7BA 5CENA 3DZOA 2PMNX 3IOKA 2ZDTA 2AUHA 2Y4IB 4FKQA 2ZMDA 3LCOA 3KXZA 4AW0A 5T68A 5CAPA 3GU8A 2C4GA 2A27A 3RCJA 3VWAA 4JG6A 1U54B 2GNHA 3K5UA 4OTWA 4PDPA 3QQHA 4C02A 2X81A 4YPDA 5M4FA 5EHOA 5EHYA 4MXCA 4AACA 4EHGA 5AM6A 3SDJA 4EWHA 2WTWA 2C6LA 4GFMA 4M0ZA 4TPTA 3GU6A 4RX8A 4XHKB 5CLPA 3ODZX 3U4WA 2XK7A 1M2PA 1YKRA 3OS3A 4N4SA 5KE0A 5HG9A 3HDMA 4QMZA 4JDKA 3TL8A 3UOKA 4BZNA 4R3CA 4R5SA 3IGOA 4O96A 3NVKI 4BCHA 3QAME 4C3FA 3IW8A 5CNOA 3ETAA 4AA5A 4ACGA 3I1AA 5EQPA 1YXUA 4TNDA 3N51A 4EH5A 3DTCA 5CEIA 4MBLA 1OIUA 2XNBA 2BHHA 4DTAA 4EEVA 5G6VA 3MFSA 2V7OA 4QP7A 2XRWA 5A4EA 2HZNA 5JH6A 5E4HA 1REJA 4JL9A 2DS1A 5EHLA 5CXHA 4FEWA 2R7IA 1OI9A 3BCEA 4S31A 1FVVA 2J2IB 1U54A 1AD5A 4O7VA 2E9PA 2Y0AA 3P23A 2XS0A 3ZMMA 4EOMA 1OL7A 4U98A 4QPSA 1OMWA 2WELA 4YZBA 5A4QA 4BRXA 4I6HA 3GCPA 4E6CA 4QP2A 4C2WA 2NNWB 1B39A 2RFNA 2W99B 5JQ8A 4X2FA 5AX9A 2VRXA 4C3PA 3LXKA 3QQKA 3QBNA 2VTQA 3UMWA 2ITPA 4EK4A 5HE0A 1ND4A 2WPAA 4IWQA 3HMOA 1YOJA 5EM7A 3ZLYA 2WMVA 5IQIA 4TYHB 5EQEA 4AGWA 4NKSA 4JDJA 3NYXA 2FB8A 1M7NA 2VO7A 4U6RA 3TN8A 4A4OA 4B8LA 4F99A 3Q53A 3DXQA 5ETIA 4AE9A 2QURA 1BL7A 2R3MA 4GV1A 3IG7A 1YXXA 2OGVA 4IZYA 3NW6A 1U5RA 4FKGA 3A99A 4XX9A 2CLQA 3L9NA 4FV2A 3RKBA 2PUIA 3FL4A 3TV4A 3ZSHA 4S2ZA 4D0WA 3EFKA 4H36A 4BDFA 3PJ8A 4TYGA 1AGWA 3FYJX 4IAFA 5DIAA 4FSZA 4ANLA 2OIDA 3A60A 3IECA 4DH3A 3H9RA 1YWNA 4V0GA 2GS6A 2W05A 4TT7A 4PL4A 3GEQA 1M52A 4FOCA 4F6WA 5AUZA 1PKGA 5CXZA 3OEFX 2QVSE 3QALE 3PPJA 4FZ7A 3V51A 4ZLOA 1FQ1B 2I0YA 4YBJA 3BE2A 5HKMA 5HO7A 3MPAA 4IAKA 4C4EA 2RF9A 2YDJA 1IAHA 5IUHA 3HA6A 5EOBA 4MX9A 2JITA 1BKXA 4TYHA 5FLFA 4FIJA 4YBKA 4BCPA 4O0VA 4X21A 3G33A 4EKKA 1Q62A 5L8JA 4BI1A 4XV3A 5KMOA 5L6PA 3RNIA 3LCDA 3NUXA 2BDWA 3WZDA 1JBPE 1YI6A 2EWAA 2ZB0A 3OHTA 2QHNA 4GU6A 3W33A 4GCJA 1ZMUA 2O2UA 4CZTA 2Y7JA 5HX6A 3CEKA 4MKCA 3CKXA 2HY0A 3CGOA 4IZ5A 1GJOA 3PXQA 3LJ0A 2UW6A 1Q24A 2VTAA 4FT9A 4M7IA 4ZTNA 2Y9QA 1QPJA 4J98A 3S3IA 4D28A 3M11A 1DAWA 2VGPA 4YGAA 2QD9A 2W4KA 3SGCA 4O0XA 3HV6A 3W8QA 1ZY5A 4FK6A 1ZYSA 4DEGA 1U5QA 3TV7A 4EH8A 2X2LA 3E63A 3Q96A 5AA9A 2CNQA 2FSMX 5IA2A 3PP0A 4N6ZA 3P86A 4BCFA 2WXVA 4I1ZA 2UZBA 3UJGA 2XIXA 3QLGA 4EZ3A 1WFCA 1OL5A 4MYGA 4BKJA 4CFNA 5BX0A 2HXQA 1MP8A 2YISA 3QRIA 5EYCA 3VJOA 4D2RA 4FEQA 5IA1A 4WNKA 5AIRA 5EDRA 4DT9A 4AZVA 1XO2B 2JBPA 3QX4A 5FTOA 4DFXE 3U6HA 1U46A 3W0SA 4U7ZA 5E8UA 4S32A 1MRVA 3HV3A 3LE6A 3D4QA 2YEXA 2OG8A 3O8TA 5TKDA 4AG8A 4A9YA 3D7TB 3ENMA 5LVPA 4IE9A 3QGWA 4QP3A 3EL8A 4RJ5A 5DG5A 3V8TA 3KREA 2PMOX 4JQEA 1OBGA 3EHAA 1IA8A 5DYJA 3W2OA 3HV5A 4G5PA 1FVRA 2ZV8A 3M1SA 4GUBA 4KKGA 3OROA 4KS8A 4WRSA 2OI4X 4DYMA 4JBQA 3MA3A 1V0OA 4ZY4A 4CZUA 1QCFA 3DS6A 3I6UA 3E8DA 5E8SA 2IW9A 3ITZA 2OJGA 3CXWA 2VO3A 2IW8A 1Q4LA 4AGDA 2WHBA 2QLUA 4F64A 3RZBA 5IQGA 2W5BA 3FLSA 3DXPA 4Y46A 4ZSEA 4A9SA 4CFMA 4EH4A 4YURA 5AUYA 3RP9A 3FC2A 4U79A 1WVXA 1PF8A 2CDZA 4NT4A 4LV5A 3W8LA 3IGGA 3QZHA 2LAVA 3VAPA 4CXAA 4CSVA 5I0BA 1STCE 5M56A 5FBOA 4FV7A 1YQJA 2CPKE 4EUTA 4AOJA 4O82A 4QMNA 3V01A 2HCKA 3F7ZA 3ROYA 3DK3A 2PPQA 1B38A 5HCYA 2GTNA 5A46A 1JKLA 2WNTA 2W9FB 3ZFXA 4QT1A 1ATPE 3BPRA 4UBAA 2X7FA 3W0RA 4OLIA 4BCJA 1YWVA 4GEOA 2W1DA 4ZJIA 1O6KA 1RJBA 3ZDIA 2PVNA 4ITIA 3DDPA 3PPKA 3WIGA 3FWQA 3QHWA 4AGCA 3PXZA 3SQQA 4EH9A 1CTPE 2FSTX 4FKIA 4Q9SA 5H8EA 2WEIA 2R3FA 2PMIA 2UZEA 4GKHA 4OTHA 5D7AA 3KF7A 2B1PA 1JQHA 4PRJA 2VWYA 1OB3A 3Q60A 4LUEA 5FEDA 3W0MA 3TCPA 2QONA 4IDVA 4AN3A 1NT2A 2QU5A 2WZJA 3HDNA 3NW5A 2PZIA 2BTSA 1I09A 3JY9A 4AW1A 1RW8A 1YVJA 3EQDA 3NRMA 4ASDA 5AADA 5I9VA 3K2LA 3D15A 3RK9A 3QTSA 3Q4UA 2ZM1A 5LJJA 5HVJA 2ZM4A 3KN5A 4AZFA 5FP6A 1XR1A 3LIJA 1E1XA 5IQEA 2BKZA 4TXCA 4D4YA 4MNEB 3O50A 4CLJA 2JFLA 3TIYA 2EB3A 4DEIA 2O65A 3MH3A 5KHXA 3R8VA 3EWHA 4PX6A 4KBCA 5H8BA 3LCSA 3H0YA 2XEZA 5HTCA 5ANOA 5KMIA 2V55A 4W4VA 3UBDA 2WMAA 4X3FB 4IVBA 3VRYA 2OBJA 3GP0A 2R3RA 1K2PA 2VWXA 3EQIA 3EYHA 3U6IA 4PDOA 5AP1A 4XNEA 4M13A 5HNIX 3R9OA 4QTCA 3FUPA 3C0GA 4BDAA 4KSPA 5KUPA 3OOGA 2B55A 4F0FA 4DH7A 4GFGA 2GNGA 3UVRA 4CGAA 1Q5KA 5DEYA 2WMRA 3MV5A 3Q4ZA 3R01A 5DI1A 3QRUA 3VBXA 4ACCA 4FSTA 2YCSA 4C2VA 5BVOA 4CG9A 5FXSA 5AUUA 3HNGA 4JIAA 4HVIA 5IH6A 4NM0A 4XLIA 1O6LA 1YDRE 4AWIA 2UVXA 1YI3A 4IC7A 1K9AA 1ZMVA 1UU9A 3FQSA 3CTQA 5JZNA 3CQEA 2EU9A 3CQUA 4PP7A 3FI3A 4ZIMA 3A2CA 3ZS5A 4M8TA 4O86A 4ZTRA 2WU7A 4HGEA 3UYSA 2H8HA 4FNWA 4PV0A 5BVWA 3UO5A 2C5YA 2JAVA 4WA9A 4J8MA 3WOWA 4EHZA 5JEBA 2JDVA 2P3GX 2GSFA 2A19B 5A6OA 4IDTA 3QQLA 3Q4CA 4UB7A 1IAJA 4QTAA 4FEVA 4AQCA 2OH0E 4ZS0A 3IDBA 4QPAA 4ALUA 4XH6A 5CF8A 4O7OA 2QOLA 2PK9A 2ITVA 3MVJA 3F3TA 4DE4A 3MN3A 3FC1X 4I5PA 3RPOA 4XOYA 4CFUA 2ITTA 3JVSA 3D5VA 3HUBA 2W1EA 4UYNA 2V22A 4R6VA 1NVQA 3ZO4A 3PG1A 2XIZA 1TQMA 3QA8A 4CTBA 1Z57A 3RVGA 4C59A 4EYJA 3LM5A 2FVDA 3DK6A 3LMIA 3UE4A 5CALA 2JDOA 4KIPA 3WYXA 4FMQA 5KNJA 3BKBA 4R7IA 4W8DA 4EUUA 3KA0A 3WF5A 4FOBA 3VS6A 5DOSA 3DJ7A 4MCVA 4WSYA 1PJKA 5HO8A 3V3VA 2ERZE 3AMBA 3HP2A 3ATSA 3MWUA 5E91A 2XJ0A 3IONA 2UW0A 3MVHA 3CKWA 3DKFA 1FINA 2X7OA 4YC8A 4C7TA 1MQ4A 2R3LA 1P5EA 3QCYA 2J0LA 4FG9A 3LFDA 2CLXA 4FVQA 3OWPA 4ZZNA 2QG5A 5BYLA 3EQPA 5C27A 3PLAE 2CN5A 2EUFB 2PVYA 5HTBA 2Z02A 4F9YA 3C4EA 3AC2A 3C4ZA 3THBA 5KX8A 2CKQA 4FKJA 3EN9A 4UYAA 3CPBA 3RI1A 3MFTA 5HBHA 4PMPA 2RFDA 2HIWA 2YIYA 5E8TA 3LLAA 3PDTA 5CSVA 3ZONA 2ESMA 4JG8A 4O6EA 3EFLA 2OZOA 3TEIA 4DEHA 2VWIA 4G16A 5H8GA 3RM7A 3WILA 3VS4A 1M7QA 2P0CA 4AA0A 4WKQA 3VS2A 1JLUE 1UWJA 1T45A 4U94A 3P78A 3UZPA 1OPJA 5DE2A 2BR1A 3HMIA 1BLXA 3IQ7A 2B9FA 3OVVA 3ORZA 4P90A 4C4IA 5CEMA 4FZDB 3Q3BA 2C1BA 3CJGA 3OFMA 2CJMA 4LGGA 4O83A 4BYJA 4B4LA 2VTTA 3FZRA 3ALNA 3GVUA 3LZBA 5HZNA 2I1MA 4RX9A 2BFYA 3ACJA 4BN1A 2YIRA 3CJFA 4FX3A 3FL5A 2V0DA 4HCUA 1RQQA 4D4RA 2WTDA 2YWVA 3FXWA 3Q9XA 4FIEA 5AUXA 2XVDA 4A4XA 3DKGA 4DF3A 1W82A 3R9RA 4U45A 3SRVA 3FLYA 5A6NA 3LXPA 3UVPA 3GQLA 1R39A 2WTIA 4APCA 3A4PA 1Q8ZA 2BCJA 4O27B 4NFMA 5KKRC 4ASXA 3V5LA 4DTKA 2HWOA 3BLRA 4FKSA 3NLBA 4GT3A 4LGHA 4GU9A 1SVEA 5BPYA 1DAYA 4RBLA 2HAKA 2XK6A 2H6DA 4WO5A 1JKKA 4U5JA 5FP5A 4AXAA 4AX8A 2BHEA 2IJMA 4YZMA 3FZTA 3QD2B 3VF8A 5CS6A 5EKNA 1KOBA 2BUJA 5HLNA 3N4TA 4AU8A 2QOQA 2VV9A 3VHEA 5HGIA 3OUNB 2C0IA 4V04A 3LQ3A 4KAOA 5EFQA 3U9CA 2QR8A 3VUIA 4A9UA 4DEBA 3R28A 1SMHA 3F7WA 3U4UA 4EOIA 2R3HA 1Q8UA 4LOOA 4TN6A 1DI8A 2IZUA 3R1QA 4AS0A 3ZXZA 3F61A 3BYVA 3PVUA 5TF9A 1ZRZA 2X8DA 1HCLA 5IMEA 3AMAA 4FZAB 4E6QA 4WNMA 3HV4A 4NK9A 3UGCA 1LUFA 4ZTSA 1Z5MA 3MBLA 3QFVA 3WBLA 5FTGA 3L9LA 3VUMA 5IISA 3NUSA 3R8UA 2FSLX 4ITHA 2GQGA 4O91A 2Z60A 3VRZA 4F1MA 5K5XA 5EW8A 3R7IA 4FODA 2OZAA 3NUUA 5M44A 3NVMB 4AAAA 2JIVA 5FBNC 4QYEA 5HIBA 4EOJA 5JZJA 1Q8WA 4E8AA 1HOWA 5CNNA 4L3LA 2R3OA 5LARA 5T3QA 3TM0A 4FL2A 1VJYA 1XWSA 3B8RA 5GJFA 2UZLA 4UN0C 5A14A 5JKGA 4RVMA 4ZEGA 5AAFA 2WTVA 2J51A 2VU3A 4KSQA 4R78A 3ZUUA 3KRJA 3F5PA 4EJNA 2FO0A 3NGAA 2JD5A 1H0VA 1ZYCA 5FGKA 3E93A 2YIWA 4YZDA 2X0GA 1J1BA 3QHRA 4BDCA 3CCNA 3U55A 2ZM3A 3UP7A 4FC0A 3C5IA 3PY0A 4FTKA 2QQ7A 3F69A 4KUJA 2VTSA 3QYZA 4U8ZA 5DA3A 4RC3A 4WRGA 3QLFA 3ZYAA 3EKKA 2W06A 2XNPA 4E26A 4XOZA 2J5FA 5DPVA 2ZV7A 1Y8GA 2W1ZA 3VUGA 5BUIA 4XG6A 3DKOA 1X8BA 4RWIA 4EOQA 3VS7A 4O7TA 1JWHA 1KV1A 2Q83A 4FV6A 3DJ6A 4MK0A 3S1HA 3ZZWA 2UVYA 4FNZA 4HOKA 5E90A 5FXQA 2G2FA 3QUEA 2I0VA 4JT3A 2UZTA 4B99A 3SW7A 2BZKB 4BBFA 3II5A 3AXWA 3HA8A 4X7QA 3TACA 3E64A 4LOPA 2GS7A 3NUNA 4X2KA 5GNKA 2J0KA 5EW9A 2KULA 4D9TA 3FI2A 3O8UA 3QTUA 2WQMA 3KULB 3R7VA 4YJVA 2P4IA 4RWJA 5DWRA 5H3QA 4Z9LA 3MA6A 2HYYA 2B52A 3QKLA 3A7IA 4QMPA 5E7RA 3R7UA 3RAKA 5CF5A 2X4FA 3PSCA 4FUYA 2PVFA 5HE1A 1URCA 4N70A 2F2UA 2JLDA 4G3EA 3O51A 3D0EA 2GHLA 4V01A 3EJ1A 1ZXEA 5AP2A 2XF0A 4MEDA 2CNVA 2LGCA 4O0TA 1ZY4A 2C6KA 4AT4A 2R3KA 4Y8DA 2C5VA 4ZMEA 4FK3A 4EOKA 3KK8A 5IH5A 2HELA 4RIYB 2WMUA 2WTKC 2F7XE 2XNMA 2PL0A 4QMTA 4EK8A 2XCKA 2WQNA 3C1XA 3QTWA 2W1HA 3M2WA 3C7QA 1CKPA 4NH1A 3FI4A 3I0QA 3ZHPC 3GU7A 4QMWA 4BCNA 1UU7A 4FI1A 2ZOQA 4FE2A 4ASEA 3KVWA 5AWMA 4U40A 4K11A 5ANKA 4FGBA 4OTDA 1DI9A 3D94A 1OIQA 1VYWA 2WMBA 3IS5A 4PQNA 5EKOA 5IQCA 5AV0A 3EQRA 5L6OA 4DLIA 3UIMA 3VO3A 5T6KA 4QO9A 1LR4A 4G1WA 5AP5A 3UVQA 3NAYA 3KY2A 5FUTA 4I5HA 3HL7A 3DJ5A 4L42A 3PJ3A 3S00A 4K18A 3I79A 4IJPA 3GNIB 3VBTA 5JGBA 4MF1A 1LEZA 2B7AA 4FTNA 3IOPA 2VTNA 4C37A 2YERA 4QYYA 5HU3A 5G1XA 5IU2A 4NTTA 3TNQB 4FT7A 2WEVA 4U81A 3KVXA 2WB8A 3F66A 3NEWA 3QQJA 4BCKA 4GMYA 2NRYA 4QMLA 3VW6A 3PP1A 4IEBA 4UZDA 3TZMA 3Q9WA 2QKWB 1OUKA 2IWIA 3FMEA 3BU5A 4G9CA 3V5QA 5LWMA 4IX5A 5JSMA 3POZA 1H28A 3I5ZA 5HVKA 3LFAA 1ZWSA 2VX3A 4YJTA 4K6ZA 4MXXA 2PUPA 5M55A 4C35A 4F6SA 4UV0A 4EK3A 5EK7A 3COKA 3MS9A 1H1PA 4L7SA 3ZO1A 5KBQA 2O3PA 3P08A 5DRDA 3MJ1A 2RFEA 4GIHA 1WAKA 5TR6A 3G90X 2PU8A 2PHKA 3CQWA 2GQSA 3TI1A 5JRQA 3E7VA 5EM5A 3VBQA 3WYYA 3ERKA 4IB0A 4PDYA 4I92A 1URWA 2R3NA 4OW8A 4QQCA 3VS3A 4FTOA 2WIHA 4TWCA 3ATTA 4ZY6A 4FT3A 3EH9A 3ZM4A 4AF3A 2BAKA 3UQFA 4ITJA 1WVYA 4OBPA 5GJGA 4HYUA 3GUBA 3ORNA 4L8MA 3IKAA 3ORTA 5ICPA 1WZYA 5M4CA 4RLLA 5M06A 2O8YA 4FKUA 4H3QA 4FR4A 2PVRA 2XJ1A 3F82A 4X6QC 3UIUA 3ACKA 5CSXA 5M07A 2PUUA 5HG8A 1UU8A 4BCGA 4R3RA 3MB7A 3AT2A 4YZNA 3O96A 4HYIA 4WUNA 4YHFA 3NNWA 4I6QA 2Z2WA 3KF4A 3PXRA 4H3PA 4O0UA 2G15A 4F9CA 3CC6A 3DOGA 3T3VA 4IJ9A 3QYWA 2ZMCA 4I0TA 3COMA 2HY81 2QO7A 2YM6A 2YM7A 3EQGA 4NSTA 5F4NA 4AZSA 5L2TA 4DN5A 2VNYA 5TT7A 3EQCA 1KE6A 2XNGA 2Z7QA 4R7HA 4QMQA 4ANSA 4UWBA 5I9XA 1VYZA 1FVTA 4ZAUA 1WMKA 3FSKA 1BX6A 4ZS4A 1B6CB 3GBZA 3BZ3A 2OH4A 5EG3A 4IX4A 4WT6A 4L53A 2E9OA 4APPA 4G5JA 4C4FA 3HLLA 5HIEA 4O2PA 4QTBA 2FA2A 4H3BA 5EOLA 5HESA 4DG2E 5BMSA 4LMUA 4RVTA 2HZIA 4GJ2A 5DT3A 5KMMA 3C4WA 3W16A 3ODYX 3OT3A 3QC4A 4YZCA 2WOTA 1UKHA 2QCSA 5CAUA 4QQJA 1JPAA 5K3YA 2W0JA 3NW7A 4FUXA 3PVGA 3RWPA 1NW1A 4IMYA 3SOAA 4V0GB 4BY9E 5TO8A 3DPKA 2PZRA 4K0YA 3GXLA 4XEYA 3OW3A 3UQCA 3MESA 3NYNA 3RWQA 1PXMA 5IA3A 4I5MA 4YLKA 1H00A 4YPSA 2PZYA 2WTCA 4RJ8A 3TV6A 4EHVA 4TW9A 3AGMA 3E8EA 1PW2A 2XH5A 4BB4A 2VTJA 3FQHA 3L1SA 4ACHA 5DLSA 3BELA 4ZOGA 2XKFA 2WIPA 4LOQA 5J95A 3BEGA 3MH1A 1APME 4P7EA 5C8MA 4TY1A 5HBEA 3ET7A 3BYUA 3GOPA 4HPTE 3VS0A 3LMHA 4D5KA 2ZB1A 4IAIA 1H4LA 5CAOA 2A1AB 4IH8A 4O84A 4FV9A 4ZZMA 4DHFA 4A7CA 3EFJA 5DFPA 5B2LA 4L7FA 3OTVA 3ENHA 2R9SA 1FGIA 2GMXA 1G8SA 2R5TA 5KZ0A 3KXMA 5IF1A 4M68A 2JFMA 4WUAA 3ZTXA 4QTDA 5B7VA 3GCQA 3NPCA 4CMOA 4EWQA 4YMJA 2EB2A 4FIIA 2X7GA 4I6BA 1RE8A 4IAYA 3FPMA 5FTQA 4EI4A 4EH2A 4DT8A 2QOCA 3OW4A 4YTIA 3G9NA 3OY3A 3EL7A 4NJDA 5JFSA 3OEZA 4UWYA 5M57A 3LW0A 2I40A 3RHXA 5BYZA 2B4SB 4WG3A 3GC8A 2RIOA 4D1XA 3AC1A 1Y8YA 1ZYDA 2OLCA 3AMYA 4DFNA 5AEPA 1QPDA 4QRCA 3W0OA 4ZTMA 1QMZA 3DY7A 3WF9A 3DCVA 5CQWA 2CGWA 5BQ0A 3FMLA 1W0XC
chains in the Genus database with same CATH superfamily
3ORPA 4EBVA 4ZY5A 5KMNA 3MY0A 1XBBA 4X0MA 1U4DA 3FDNA 3HV7A 3L8XA 5HE2A 2RGPA 2YJSA 5HCZA 3Q32A 1YDTE 2H9VA 5DH3A 1Q41A 3ZZEA 3ORIA 4FSRA 3VS5A 3R6XA 3TTJA 4M69B 4IANA 4B7TA 3BI6A 3AC8A 2HZ0A 5FDPA 4JVGA 4M12A 5CI6A 4AZTA 3W10A 4D1ZA 2C3IB 2CKPA 3CSVA 3R9DA 2XKEA 2Y6MA 2DYLA 2HXLA 3DB8A 3EZVA 3NNXA 2C47A 3PJCA 4IB1A 1SNUA 4JAIA 5EW3A 3V8WA 4X3JA 3FMJA 4LYNA 2XP2A 4BJJB 3RK5A 3LMGA 3OCTA 3CD3A 3Q6WA 1XH8A 3R0TA 1W8CA 3EYGA 3LQ5A 3WIKA 4ZMFA 2J50A 3DK7A 3NSZA 4XS2A 1MRUA 5HG5A 2Q0BA 2UW5A 4O6LA 2ZAZA 4FL1A 1SVHA 4HNFA 3ZRLA 4O2ZA 3FYKX 5KZIA 2OW3A 2ZDUA 3S4QA 1G8JA 2B9JA 2YCRA 1JKTA 3LKMA 4RA4A 3AT3A 5GHVA 3ZU7A 5IZFA 3B2WA 5L2IA 3NYOA 2G2HA 1Q8YA 3FLWA 4LRJA 4AGUA 2BVAA 4FSWA 4QMVA 4I3ZA 5ANGA 1OGYA 1BI7A 2YHVA 3UDBA 3F5UA 4YHTA 3OTUA 4RWLA 3OMVA 3PLSA 3R63A 3A8WA 2P33A 2PTKA 3BE9A 3C0HA 3QCQA 5HLWA 2XIYA 3ANRA 1Y6AA 4QYHA 2BIYA 2GPHA 4U44A 3GU4A 4BBMA 1ZARA 1PXOA 5FD2A 3ZLXA 4M0YA 3ID6C 1UNLA 5EM6A 4U97A 5ANEA 4CFXA 4E20A 2G2IA 2ITXA 3W0NA 1GY3A 1J1CA 4LFIA 4RQVA 5FM3A 4AXCA 5ACKA 4CV8A 4QP6A 4F9AA 1M2QA 3PJ1A 4FTQA 4IM0A 5L3AA 3BBTB 5L2WA 2OO8X 1JAMA 4OT5A 5DRBA 4DBNA 4DGGA 3UO4A 4Y73A 3FBVA 4IFCA 5HCXA 2G9XA 1OPLA 2W17A 1OBDA 3C4XA 4F0IA 3RALA 2W4JA 5H9BA 3FI8A 2YFXA 3WI6A 3QTIA 2XBAA 4R1YA 4IWOA 3UPXA 4YR8A 4EK6A 1PXIA 4BIDA 4QEBA 3VULA 2PE1A 5JFXA 2PE0A 4UZHA 2WQEA 3OC1A 4IWPA 1UNGA 2Z8CA 5AM7A 3HRCA 4FTJA 4C3RA 3FMKA 4ASZA 3CBLA 2JDRA 5KMKA 2QHMA 4BICA 3BYSA 4LUDA 3UOLA 5A4LA 2W96B 2YCFA 5IUGA 4PWNA 3PWYA 3QA0A 4I0RA 4J8NA 3A61A 4F78A 4PMMA 5LVNA 3DDQA 4U3YA 5ACBC 3SHEA 2GFSA 1I44A 2R3JA 1H8FA 4MD7E 5CZIA 4JLCA 2NP8A 4L9IA 5CEPA 4U0IA 5M4IA 3DKCA 1OIYA 3BL9A 3A8XA 4XV2A 2EXMA 5ANDA 4DAWA 2XYUA 1GZKA 1XH9A 3VQUA 4FNYA 4DFLA 3LVPA 4YSMA 4BDDA 3AKLA 4OTQA 3DXNA 2R3GA 3OCGA 2XALA 4XV9A 3V6SA 4RWKA 4CT2A 4WIHA 3LLTA 1YI4A 2JIUA 3B8QA 4V05A 4I6LA 1GIIA 4YZ9A 5EM8A 4HW7A 4PTEA 4K9YA 4FTIA 2P55A 4I5CA 5D9HA 2CKEA 4M97A 4U43A 4XG7A 3ELJA 4RX7A 3R8ZA 4AZEA 3PZHA 2WQBA 4U41A 5CU3A 2ITYA 4GG5A 1IEPA 4LV8A 5CSPA 3EZRA 4RIXA 4F4PA 4M3QA 5J7HA 4D1SA 5CANA 1RDQE 4RQKA 3QL8A 2C6EA 4U80A 2IG7A 1GIJA 3TXOA 3ZDUA 5BVDA 3HMPA 4AA4A 3BGPA 3OCSA 3H10A 4RJ7A 3B2TA 1XH6A 2QI8A 2UZDA 1R0EA 4ZSGA 1H07A 1PKDA 4LM5A 3MH0A 4ACDA 4Z7GA 1PMNA 4FSYA 5EYMA 4DH1A 1UV5A 3HYHA 3NNUA 1ZLTA 2IPXA 1PXNA 4CT1A 5CU2A 1ZOHA 4C36A 1KWPA 2BAQA 2W4OA 5E8VA 3FZSA 2ZV2A 3T9TA 4H39A 3PWDA 4AAYA 4ZLZA 2F7ZE 4OTRA 2C30A 1TQPA 4RIWA 4E73A 4NIFB 4NTSA 3ORLA 4F7JA 2R4BA 4XP3A 3KXXA 3BV2A 1H01A 3NS9A 5CVFA 3KXHA 5KMLA 4KWPA 2HK5A 3TMOA 5HD4A 4RFMA 4BDJA 4N6YA 4UX9A 4DH5A 3DAEA 3GFEA 3NIZA 3PFQA 4KBKA 5HLPA 1PMVA 2R3PA 5CI7A 4JR3A 4IZAA 2BRMA 4MUQA 1CKJA 3ZLWA 4MXZA 3DB6A 2XNOA 3CY2A 3BYOA 5DR6A 4BZDA 5DNRA 3R30A 4C61A 1WBTA 5BVKA 4XG8A 3MFUA 4HVDA 5AMNA 1T46A 5AX3A 3I0OA 4PP9A 2JKQA 4NW5A 4NW6A 4NZWB 4GVJA 5HG7A 4AE6A 4DCEA 5IEXA 3LPBA 4R1VA 3FMMA 3VUHA 4AXEA 4JMQA 1PXKA 1J7IA 3QTXA 3R8PA 4FL3A 1CDKA 1NVSA 1EH4A 2WU6A 3I4BA 5LVLA 3RK7A 3LXNA 5CAVA 4JX3A 4HZSA 3Q2JA 4GW8A 1OGUA 2PSQA 2E2BA 3PIXA 3ZLSA 3DLZA 2I0HA 3FZPA 3N4VA 4MAOA 2YZLA 5I9WA 3DNDA 4GJ3A 3TJCA 3KK9A 2R2PA 4J52A 3JY0A 4H58A 4WG4A 5EYKA 2XZSA 3UOHA 3TKHA 5D1JA 3EFWA 3P5KA 4FSNA 2NPQA 4FKPA 4JJRA 5IG1A 1FOTA 4HGTA 3QXPA 5CEQA 4WHZA 2C0TA 3PXFA 4TWPA 3UTOA 4CEGA 4YO6A 4F9BA 5LVOA 2A4LA 5A3XA 1SM2A 3WE4A 3BBWA 2X6EA 4NWMA 4FV3A 4I0SA 2G01A 3EN7A 4IIRA 4PY1A 5EDPA 3SRVB 4LRKA 3ULIA 4BYIA 3F2RA 4J71A 3KMWA 3R04A 4O0YA 2BDJA 1P4FA 2ZV9A 2CN8A 2YAKA 3GCSA 4FKLA 1UWHA 4NYEA 1Y6BA 4MXOA 2UUEA 3FKOA 2GDOA 2O5KA 1A06A 4FJVA 4PNIA 4RVLA 2R3IA 2E9VA 1H1SA 1IG1A 4I6FA 4DHZA 4L3PA 4IAAA 3TYKA 4E4XA 3ZO3A 3T8OA 2EXCX 4TTHB 4CG8A 4O0RA 4EOOA 4QQTA 2UV2A 4IAZA 4L01A 2WMSA 4FT0A 4BBEA 4WNPA 1GAGA 2JKKA 3RAHA 3UNZA 3LAUA 4F9WA 2PY3A 4O21A 5M51A 3F88A 4K33A 4EOSA 2F57A 4TWNA 3MVMA 3UC3A 2PVKA 4F7SA 3F5XA 4P4CA 4DGNA 4JNWA 4NKAA 4E4NA 3MW1A 4AXFA 4FV8A 5JRSA 3GCUA 5AA8A 3SOCA 2I0EA 3BEAA 5C26A 2QOOA 1P4OA 5B2KA 2C3KA 5F9EA 5L8KA 3HRBA 2OZAB 4ANBA 3SW4A 3AGLA 3EQBA 1G8AA 4I22A 3GCVA 3W0QA 3ZFMA 1R1WA 2ZVAA 3KFAA 4BZOA 2E9NA 1A9UA 4IWDA 4FV0A 3DNEA 4DINA 3VVHA 5E1EA 4OBOA 4C33A 4OBQA 3TZ8A 3OXIA 4HYSA 3OT8A 5LMAA 1PY5A 4NL0A 4DCAA 2FGIA 3KB7A 3R9HA 4BDGA 3IDCA 3ZSIA 4EL9A 2JAMA 3R73A 2I6LA 3CTHA 3BQCA 3WZEA 1JNKA 1XJDA 2JDSA 3SD0A 4B0GA 1OKWA 5IPJA 2YCQA 3MI9A 2VWUA 2RG5A 2ZYBA 3UODA 4L45A 5DHJA 4C38A 2UW4A 4LV7A 4KNBA 4R5YA 5K9IA 4BTFA 5C01A 4ERKA 3U6JA 3P1AA 4BVUA 2XIRA 5CF6A 2J5EA 2J0IA 2CGVA 3DAJA 3H9FA 3OOMA 4E6AA 4Y5HA 3HVCA 3LFFA 2X9FA 4DG3E 4HNIA 4KS7A 2BZJA 3A7JA 1OM1A 5DR2A 4FEUA 2BRNA 1UA2A 3MIYA 3P9JA 4EZ7A 4FTMA 5KMJA 4G31A 2WMTA 4FKWA 3E8CA 3OWJA 4IX6A 3DQWA 1YWRA 2VNWA 3FKLA 4BTKA 4EYMA 4CKRA 2YITA 4J7BA 3EN6A 4UEUA 4QP1A 4QTEA 4W4XA 4RJ4A 3DBEA 3W2RA 2DUVA 3M42A 4YC3A 3GC0A 2C5OA 3TNWA 2GNLA 1W84A 4FGRA 4JBPA 4BCQA 5CEOA 3I81A 1E1VA 3MSSA 2W1IA 4DBXA 4Z7HA 3CGFA 4IZ7A 4FA2A 2IO6A 2YM5A 4EONA 2OXDA 5LOHA 3AD6A 3LFBA 3P79A 5JK3A 4R3PA 2QOIA 3DBDA 1YXVA 4RIOA 3PXKA 4G34A 4JG7A 5CU6A 3UDZA 5EI2A 3TNHA 4ID7A 2CCHA 1XH4A 2ITOA 3SX9A 4Z16A 5FEEA 3VN9A 4EORA 4YO4A 4YNOA 5AAGA 2F2CB 3QQFA 2YN8A 2BTRA 4S34A 3V5TA 1J91A 5KCVA 1FGKA 2BILB 5J9YA 2IVSA 1V1KA 4MNFA 4RVKA 2XAMA 5FDXA 3ZOSA 5D41A 3KCFA 3KKVA 5AP4A 2NO3A 4FVPA 4YTHA 5AV3A 1S9JA 4L52A 3KRRA 3NCGA 5AP0A 5BYYA 4E5WA 3MDYA 2G1TA 4W4WA 4ZLYA 5CF4A 2YWPA 3QD4A 1Y57A 3TNPC 1OL2A 3BLHA 3DV3A 3PZEA 3Q2MA 3Q9YA 4OTIA 4CCUA 4C4HA 3ZM9A 3FMNA 3RCDA 1XBCA 4FTLA 3IW4A 1ZOEA 4A07A 3P4KA 3FLZA 1H24A 4ZJJA 3QZGA 5A9UA 2Z7LA 3TG1A 5CSHA 1L3RE 3UG2A 5IEYA 4UXLA 4CLIA 5EDQA 1QPEA 3QU0A 2OJFE 2GS2A 3R71A 4TL0A 3ZUVA 4L00A 3C51A 2C3LA 3SLSA 2XK8A 4B6LA 3C0IA 4C4GA 2PYWA 4Q5EA 2VTPA 3L9MA 2XARA 4NFNA 2YABA 2VTRA 2WMXA 3R00A 5AV2A 4UWCA 2X9EA 4HGLA 2Y6OA 3PVWA 4J96A 3ANQA 4MBIA 4CFWA 3G0FA 1KE8A 2OXYA 4CCBA 2W5HA 1ZYJA 2C68A 2UZOA 2VWWA 3LHJA 4FIHA 1FMOE 4YLLA 1SYKA 5D12A 3F3WA 4AFEA 4CV9A 2ETMA 5JQ5A 4MWIA 5C4KA 2C5XA 4OGRA 4PL5A 3AC3A 3EN5A 4S33A 3PVBA 4QP9A 3QX2A 3BQRA 2GTMA 2XB7A 5AP6A 3SV0A 4YU2A 5C03A 1IRKA 3L9PA 1YXSA 3BLQA 3ORKA 4NM7A 3VQHA 2VX0A 3HP5A 4L43A 5HVYA 1GIHA 4PMSA 4PUZA 5CQUA 4GK3A 3KEXA 2CCIA 5BMMA 3KRXA 3TJDA 4M67A 1ZZLA 2UW7A 3L8VA 3ORXA 4XYFA 3UNKA 5HIDA 1XH5A 2A0CX 3ZC5A 4Y85A 4EJ7A 4GIIA 3NIEA 2CSNA 4WG5A 5ETCA 5FQDC 3ZC6A 1GZ8A 3MY1A 5IQAA 1VR2A 4NJ3A 3BX5A 3FZOA 3K5VA 4I23A 3OG7A 3PIZA 3HKOA 4AT5A 1YHWA 2BMCA 3WZUA 2PULA 3AOXA 3FEGA 3LCKA 3QTRA 2B54A 2QG7A 4WD5A 2WMQA 2W5AA 2WKMA 3POOA 4FEXA 5E9EA 4EHEA 2H34A 4YP8A 2WAJA 3PRFA 4TWOA 2XM8A 3W2SA 4ORKA 3PRIA 3GQIA 3BHUA 2CGUA 4O7NA 4YLJA 1CSNA 3IK3A 4BTMA 4D4SA 3E7OA 4E7WA 2WD1A 3LOKA 4XLVA 2B9HA 2VO0A 1CM8A 1H08A 4JAJA 4BDEA 4I4FA 2IVUA 1QL6A 2HWPA 4AP7A 5CEKA 3UIBA 4CTCA 2XK3A 3OD6X 5EI6A 3VBVA 1J7LA 4B8MA 3KRWA 4PTCA 1WBOA 2BPMA 3W2CA 3SG9A 5DBXA 3W18A 3E8NA 3UC4A 1TVOA 4QMOA 5LVMA 3QRKA 3GGFA 4IW0A 1SVGA 3G0EA 4MD9E 1PXJA 4WZYA 4XG9A 1M17A 4KD1A 3A62A 3EOCA 4FTUA 4L6QA 1W98A 3OP5A 4UALA 4YJSA 3ZBFA 5KBRA 5J87A 3G15A 3V6RA 4L67A 4C58A 3Q5IA 4AW2A 3CTJA 4DEEA 4LG4A 4F1TA 5IQDA 4FZ6A 3RMFA 5CU4A 1LEWA 1IASA 3SC1A 1M2RA 2XEYA 3FLNC 1R3CA 2CGXA 4CFVA 5HX8A 3I5NA 3C4FA 3P7BA 4GKIA 4F70A 3DZQA 4QYGA 5BNJA 5I4NA 4HVSA 1R78A 4IHPA 5I9UA 4DTBA 4ANMA 3TZ7A 3BHHA 4DEAA 5F94A 1GZNA 3P7AA 2AEGA 2DQ7X 3BHVA 4TYIA 3KQ7A 2YIQA 5EYDA 4IBMA 4RMZA 2GFCA 4JDIA 4WNOA 1SZMA 1OL1A 3O7LD 4FSUA 3ZRMA 5IMXA 2F49A 3NCZA 4FBXA 2O64A 2W7XA 3DBCA 1BI8A 2OF2A 4KB8A 4BIBA 2Z7SA 4N0SA 2GNIA 3OZ6A 3UIXA 2YDIA 5JFVA 4FT5A 3COHA 1KUTA 3DGKA 3LXLA 2QKRA 5LMKA 4NM3A 4I4EA 4JQ7A 2C3JA 3OWKA 4OT6A 2R3QA 3R1NA 2AYPA 4D5HA 4S30A 4XG2A 3MPMA 3CIKA 3PA4A 3CLYA 4I21A 4IM3A 3IW7A 3RPRA 3JYAA 5EH0A 4E93A 3BWJA 3JXWA 2XA4A 4FV4A 2W1CA 3A7GA 3QZIA 3V5JA 4OR5A 5K4JA 1G8KA 4MQ1A 1MRYA 1YOMA 4ZJVA 2YJRA 2C69A 3LJ2A 1V0BA 5CSWA 4QOXA 1H25A 2UZVA 4FV5A 3A4OX 1IR3A 2XKCA 1F3MC 2QU6A 4BI0A 2XMYA 2WMWA 1PMUA 2VTMA 2QOHA 2QOFA 4O81A 4D2SA 3KIOC 5EI8A 4IFGA 2BRHA 5HNBA 4RX5A 1XKKA 2JKOA 4FTRA 1OKYA 3DT1A 1ZMWA 3R8MA 4OUCA 4RSSA 4A4LA 2VWBA 4USFA 4RJ3A 1WVWA 2PZ5A 3W32A 2GU8A 4G3FA 2YA9A 3NAXA 2OXXA 4UY9A 3S0OA 3JPVA 4AOTA 3MB6A 4GL9A 3SG8A 4IC8A 3VS1A 4Z55A 4E1ZA 3HMNA 3D2IA 3SXFA 5ITAA 5GINE 2OFVA 1OVEA 4Q5HA 2UZUE 1NY3A 4DA5A 5JN2A 5IA0A 3Q52A 4AFJA 4J1RA 4R77A 4BHZA 3OY1A 4Y83A 4BCOA 4Z3VA 3R7EA 3C50A 3DBFA 3V5WA 3VJNA 3D7ZA 1JSTA 2OK1A 1WBVA 2F9GA 2PE2A 4FSMA 4II5A 4BDHA 3RHKA 4EC9A 2AC3A 4JXFA 2QNJA 4BGHA 3UMXA 3PSBA 5M09A 3EIDA 1YRPA 3BV3A 3QF9A 2HENA 3LFEA 3JR1A 3E62A 2IVVA 2VD5A 3KCKA 3QQGA 4XG4A 2FH9A 3BHTA 5ETAA 3H0ZA 3PJ2A 3DQXA 3D5XA 3KN6A 3BWFA 1ST4A 3O23A 2NRUA 5LMKC 4GT5A 3VC4A 4B9DA 2DWBA 1H27A 2ITQA 3GC7A 2VAGA 3PIYA 5DT0A 4I93A 5E92A 3REPA 1JOWB 3LFSA 5CU0A 3PY1A 2WTJA 3OBGA 2OJIA 1GOLA 5J9ZA 2CMWA 2Y4IC 4PDSA 2P2HA 3TKUA 2AC5A 3K54A 4BDBA 2VTLA 3DLSA 3FY0A 3ZXTA 5M53A 4UXQA 4P5QA 5BUJA 3SVVA 4U42A 3ZEWA 4WBBB 3CP9A 4YUQA 4FTCA 4DEDA 2QR7A 4RZWA 4X2NA 3JUHA 4AN9A 3Q6UA 2C6TA 2BIKB 4FKRA 5FM2A 4O38A 4XBUA 3E3PA 5E8YA 3VW8A 3SXSA 2XCHA 4XMOA 5CY3A 5FRIA 3ZFYA 2OKRA 1E9HA 2RFSA 3F2NA 3H9OA 3HRFA 3TT0A 4D4VA 5GJDA 3HEGA 3KRLA 3S2PA 4EC8A 4AN2A 4RJ6A 5BVEA 3CD8A 3NDMA 2ZFYA 3UP2A 5E8WA 4JR7A 3NUYA 3W2PA 1OZ1A 4L44A 2GHGA 4KINA 4K1BA 3I6WA 2ONLA 3AT4A 3O17A 4FTAA 2YM3A 1BUHA 3A7FA 3TWJA 4ALVA 4KA3A 2ETKA 3T3UA 5JFWA 3N9XA 1CKIA 2HW6A 1QPCA 4XV1A 3TKIA 3G6HA 5CX9A 1GZOA 2GQRA 3V8SA 3VUDA 3Q5ZA 4KABA 4GYGA 3IDPA 4E6DA 5J5SA 4AXDA 4P2KA 5IEVA 3MYGA 3HECA 1H1QA 1PRYA 3PE1A 2UZNA 4YJNA 4F08A 5CASA 5DT4A 4O0SA 2OFUA 4FYOA 3WE8A 3NWWA 4ARKA 4DG0E 2C6MA 4QQ5A 4GYIA 3TTIA 3ZCLA 4ZP5A 4ANQA 1KV2A 4PF4A 3PE2A 3VIDA 1JVPP 1H1RA 3ZH8A 4O22A 3E5AA 4RIXB 2XNEA 3JS2A 2J0JA 4JBOA 4Y95A 3QZFA 4ERWA 3SXRA 3KMUA 2OF4A 2XBJA 3R02A 3U54A 3BU3A 4QYFA 1ZOGA 3GI3A 4CMUA 5C1QB 5JT2A 4CNHA 3UPZA 3D7TA 3K3IA 4O7ZA 4RFZA 1OPKA 2O0UA 5J8IA 4EBWA 5HORA 4Y5QA 5AP7A 5M08A 4AUAA 5AJQA 5AFVA 4YJPA 4FSQA 2JDTA 5AIKA 3VBWA 5KHWA 4PMTA 1KSWA 2XUUA 3QUDA 4G9RA 2B0QA 2PVHA 4AOIA 5F1ZA 1V0PA 5JGAA 3RPVA 1CMKE 5I9YA 2J6MA 4JRNA 5E1SA 4QMMA 3PPZA 2VTOA 3R83A 4AT3A 4BR3A 1AQ1A 3BHYA 4D9UA 4USEA 3WF7A 5I9ZA 5A4CA 4KIOA 4L3JA 4BHNA 3KXGA 4E4MA 1KOAA 4FZFB 3KMMA 4ENYA 3QWKA 4ACMA 3GC9A 2FYSA 4ZZOA 4RIWB 1YHSA 3EQFA 4EK5A 3AC5A 5AV4A 4G6LA 3UZTA 3LJ1A 4YTCA 1WBNA 4F6UA 5CT7A 4HGSA 3W55A 4PL3A 2JC6A 3KXNA 4C0TA 2ETRA 3FV8A 2Y4PA 3EMGA 2BROA 4G3DA 4OTFA 4X2JA 4YHJA 1P2AA 5HICA 3UO6A 1A48A 1NA7A 4RFYA 4DC2A 4YTFA 2CKOA 2QO9A 2VO6A 3F2AA 3GOKA 2ZJWA 3RJCA 1YW2A 4JX7A 4BDKA 4BGGA 4C4JA 2F4JA 4IM2A 5IA4A 1IA9A 2GCDA 4JBVA 4HVGA 4GFOA 4FVRA 2ONLC 5KKRB 3Q04A 2H96A 3ALOA 4HCTA 1WBPA 4U3ZA 5DR9A 3WF6A 2YM8A 2PWLA 5TOZA 2JKMA 1PHKA 4FTTA 3LFQA 2C0OA 2OJ9A 3NZ0A 3FAAA 4PTGA 4YSJA 4FICA 3QKKA 5CYIA 2VX1A 5ETFA 1OECA 5FEQA 2OIQA 4QP8A 4LRMA 3AKKA 1PMEA 1REKA 1ST0A 4FNXA 3TNIA 5BUEA 2Q0NA 3FE3A 3PSDA 4EH3A 3PYYA 1JKSA 4AZWA 3KU2A 3DFAA 4JI9A 2VWZA 4Q9ZA 4QNAA 4PNKA 3OCBA 4JS8A 5AUTA 5FG8A 3PTGA 4RPVA 1W7HA 1PXPA 3E3BX 1MUOA 3ZUTA 3CPCA 1J7UA 2PUNA 1VEBA 2I7QA 3VNTA 4KRDA 3RGFA 2PVLA 3W0PA 1SNXA 3L8PA 5L2SA 4FKTA 1Q3WA 3OF0A 4LL5A 3FJQE 4MNEA 5DN3A 2YM4A 4CKIA 3EB0A 5AAEA 3FMHA 2V5QA 3HX4A 4M84A 1DM2A 2VGOA 5D10A 4GK4A 3WZKA 3R7YA 5C8KA 5DEWA 4QP4A 1XH7A 4RC2A 4F7LA 4IADA 4DITA 2BKKA 4X3FA 3HAMA 1Q8TA 3EKNA 3QWJA 4JRVA 5J1WA 2NYAA 3R2YA 5CVGA 1GNGA 1ERKA 3MPTA 3R7OA 4CRSA 1BL6A 4K77A 1JSUA 4KRCA 2BAJA 3L8SA 4ONAA 4KKEA 4D55A 5J1VA 2X8IA 2XM9A 1L8TA 2XNNA 3UZRA 1BYGA 4BCMA 4I24A 4JDHA 4F63A 3F3VA 4JQ8A 3RAIA 1Q3DA 4FG8A 4HPUE 2C5NA 5HU9A 3D83A 2IZRA 5E8ZA 2X4ZA 2QODA 4AQKA 3QTZA 3C4CA 4EQCA 2PVMA 4TRLA 3O0GA 4L46A 5DVRA 4LI5A 2ITUA 3RM6A 3BIZA 2J0MB 2XKDA 2J90A 4GRBA 2V7AA 5F20A 3MY5A 1UNHA 3HMMA 3N4UA 4EQUA 2QC6A 5A4TA 3P7CA 4X2GA 3OWLA 3R2BA 3TIZA 1J3HA 2EVAA 2BRGA 3R9NA 2CNUA 3GB2A 3QRJA 3R21A 5EQYA 1O9UA 5IQFA 5BVNA 3OUKA 4OTGA 5CT0A 2OWBA 3FLQA 2B53A 2IZSA 3BGZA 3O71A 5ANJA 1Y91A 3RTPA 1WCCA 5A54A 4DFUA 2SRCA 2IVTA 4MWHA 4WBOA 4M14A 4F09A 2PMLX 3OBJA 3PA3A 1TKIA 4CRLA 4LL0A 3NNVA 4NCTA 4EQMA 4BIEA 1XMMA 4XRLA 3R1YA 4NU1A 5L6WL 2W9ZB 3DU8A 3F6XA 4H1JA 3ZSGA 1K3AA 4FIFA 4QMUA 3IO7A 5C9CA 2VTIA 3QGYA 3BL7A 3NX8A 4O7PA 2F7EE 3FY2A 4RZVA 4D58A 3F5GA 3AD5A 1Q97A 4K2RA 1OITA 2C1AA 4RT7A 4W8EA 4E5AX 3O8PA 3BRBA 1H26A 2R0UA 3DBQA 4IB3A 4O7LA 4BCIA 2XJ2A 5IDNA 3FPQA 3HAVA 4J95A 1VZOA 4QMYA 4HCVA 1R0PA 4O7WA 5HD7A 5CWZA 5FXRA 1M14A 3D5WA 2WTKB 4P5ZA 3MIAA 2BDFA 4DFYA 2WOUA 2XIKA 1P14A 1XMLA 1ZZ2A 2J7TA 4M15A 4MTAA 2UW3A 4X3FC 5CVHA 2C6OA 3FSFA 3OXZA 4H1MA 2BFXA 3QCXA 5LCKA 4DGMA 1S9IA 3IPHA 2JEDA 5ANIA 4CVAA 5K5NA 2HZ4A 2W1FA 3MH2A 2UW8A 4BC6A 4EH6A 2RKUA 2W1GA 3HGKA 3FZ1A 3BLAA 3NYVA 4ZSLA 2J9MA 4A06A 3CS9A 1O6YA 4G6OA 5F95A 4F0GA 5HEZA 1PYXA 1MQBA 3AG9A 3D5UA 4FIGA 4DLJA 5D7VA 3MVLA 3V5PA 5J9LA 1KE7A 4YJQA 3AD4A 3JVRA 3ULZA 3VBYA 4GS6A 5LQFA 5LXMA 4FV1A 2OJJA 4RRVA 3MJ2A 3H30A 1TQIA 2X2KA 1LPUA 1OIRA 2OSCA 3GENA 3E87A 2J4ZA 3WARA 3RPSA 3D9VA 4CD0A 2BZIB 4XRJA 4XP0A 3VUKA 4XBRA 4ENXA 4G6NA 4MQ2A 3FHRA 1YHVA 4IQ6A 4JIKA 2JIIA 5AP3A 2VWVA 2FUMA 2E9UA 3AQVA 4A9TA 4DGLC 4FKVA 2GHMA 3H3CA 3R1SA 4CFFA 4H05A 1WBWA 3QRTA 5IUIA 4IVDA 3WZJA 4XG3A 4A9RA 3RAWA 4F65A 1XQZA 1YDSE 2OICA 4J53A 4I94A 3DTWA 4TYEA 2PZPA 3I7BA 4J97A 3QKMA 2XK4A 4G17A 4GT4A 3TDWA 4GH2A 4XCUA 2PVJA 3GU5A 2Z7RA 3ZEPA 2JBOA 3UOJA 4USDA 4QNYA 2QOBA 4MH7A 4YJUA 4LQMA 4NCTC 4TYJA 4ZTQA 3TUDA 3U51A 5JMSA 3ORMA 4U9AA 4C62A 2BALA 4DDIA 4DFBA 3G6GA 3ROCA 4G3GA 4ZK5A 4NUSA 3U9NA 3CE3A 3D2KA 2R0IA 2O63A 3AKJA 3PA5A 5BVFA 3LFCA 2IN6A 1UU3A 1YXTA 4K8AA 5IQBA 3HZTA 3IW6A 1G3NA 1HCKA 3G51A 4HJOA 4KBAA 3MTLA 3A7HA 4W4YA 1ZAOA 4MVFA 3PY3A 5IH4A 4QMXA 2VUWA 1NVRA 1H1WA 4G3CA 4GUEA 2BRBA 4KKHA 2A2AA 3E88A 3U8WA 1LP4A 2YZAA 4XJ0A 5LCJA 3ZBXA 4IX3A 3LQ8A 1OKZA 3LM0A 2FSOX 4CMTA 4F7NA 3F3UA 5CZHA 4DFZE 3C5UA 4RG0A 3UYTA 3W2QA 4GSBA 4TKSA 2KTYA 2P2IA 1OL6A 4DH8A 3TUBA 3QXOA 3PXYA 4YNEA 4AW5A 4HVHA 3FQEA 2X39A 3QTQA 2XK9A 2B9IA 4YJOA 3R8LA 4EH7A 3AC4A 2GNJA 4Q2AA 4O0WA 5HBJA 3COIA 3TUCA 4JOAA 4ZSJA 3MGYA 4TNBA 2QLQA 2XRUA 2ITNA 3O2MA 5HQ0A 4GVAA 3UNJA 4E4LA 3CR0A 4TZRA 4NM5A 4IACA