3PLAE

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3plaE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3plaE02
4GKHA 1OUKA 3FLYA 3F61A 1APME 2XYRA 3SXFA 3AC4A 2PXCA 3S1HA 3NVMB 3AQVA 2YABA 3SG8A 1X1CA 4QMUA 3SM3A 3GCZA 3W8QA 4WHZA 4C58A 3VAPA 1NBHA 4G5JA 2J0IA 5BX0A 3QRJA 3R00A 3QKKA 5DOSA 2PMNX 4BIBA 3DLSA 3OXTA 4QTUB 2PU8A 4P7JA 1KPIA 1UWHA 1F5QA 4U7TB 4ZAUA 3ATTA 2PE1A 3EVFA 4JDKA 2B2CA 4RTMA 5CF6A 4C35A 5EIWA 4UYAA 2UZDA 4HZRA 4NW5A 4OTHA 4CKIA 4POOA 5TR6A 3OOMA 3O23A 3D9VA 4IB1A 1VEBA 3KR9A 4MTLA 3C6MA 1PMVA 1B38A 4LRKA 5GJDA 4QYYA 5H8BA 3TTJA 3U55A 3BHUA 4FSDA 4EQUA 2CNQA 3FEGA 3W1FA 2R2PA 5IEYA 4OX9Y 3OE4A 3V5QA 3PJ3A 4XOYA 5GINE 3C4ZA 3H0ZA 4EUUA 5EHGA 2QOOA 1YHSA 3QTZA 2RG5A 2E9NA 2C6EA 4KB8A 4PY1A 4QMTA 2ZB1A 4M68A 5CANA 2UW6A 2C5XA 3KA0A 4A4OA 5HZNA 4LRMA 3ZUTA 2DPMA 3W2CA 3R22A 4JI9A 2BCJA 4C37A 4L43A 2OICA 3BQRA 4XG6A 4YSJA 4GCJA 3F2AA 4M7IA 2GSFA 5C03A 5JMSA 2AS0A 1W7HA 2ZDTA 3FLSA 1U2ZA 3REOA 3L8DA 5EHIA 3C0KA 4ONAA 2WK1A 2W0JA 3ERCA 4O7RA 3BZBA 1ZZ2A 4XRLA 2XKFA 3PE1A 2XEYA 3P2KA 3IEIA 3DK3A 1OIRA 2ZV2A 3LCCA 3RK7A 4YTIA 3KPVA 1JLUE 4FUXA 3OP5A 1T46A 3QX4A 1VIDA 3FKLA 4Y72A 2VP3A 2VAGA 3UZUA 3RPSA 5T3QA 4Z7GA 4OLIA 5LARA 3TWJA 2PVCA 2UW9A 5CS6A 3OT3A 3TNIA 5DIAA 5ICCA 3V6RA 4BDJA 1P2AA 2B9IA 2B78A 2Z6QA 3A61A 3LDGA 4O81A 2AOTA 1QPEA 5JZNA 1NT2A 3R8VA 5B7VA 4X0MA 5CVJA 4S34A 3AT2A 3GNLA 4R7BA 3KPYA 5FTGA 3G6GA 3CCNA 4H58A 4RIXB 4ZSAA 3FLWA 2AOXA 5EHLA 4XG2A 4YTFA 4AGUA 1SQGA 5K0FA 3PVWA 2VX1A 3QQHA 2ZFUA 4K6MA 4U5JA 1VQ1A 3E8EA 1WBNA 3SD0A 3UC4A 3P9JA 1UA2A 3V8TA 4LQMA 1G8AA 2YJRA 3ZEWA 3OW4A 3KXXA 2FSOX 4KRCA 4DEBA 2ESMA 2HMYB 4KBCA 3QTSA 2ZWAA 4FODA 2WMAA 4RTLA 3NYOA 3EQCA 4CT2A 3LCSA 3G2OA 4YJVA 2PULA 2X0GA 1O9UA 3TI1A 3C7QA 3B2TA 4FG9A 1VL5A 3JWGA 4FTOA 4BP3A 4U45A 5DE2A 3UC3A 5HFJA 3C13A 2F8LA 4FV4A 4M84A 3CKKA 1DI8A 3ACJA 5E91A 4GK3A 5G6VA 4EMSA 4M0YA 1NW6A 5KMIA 5AUXA 5EKOA 3RPRA 3T7TA 4WG3A 4M0ZA 4BTKA 2IVVA 3MERA 3G7UA 4F1MA 2ZDUA 5BYLA 2JDRA 4Y73A 2HYYA 2OBJA 1BKXA 2XK3A 4IWPA 3DCVA 1WY7A 1M2QA 3QA8A 4UEUA 3FMDA 4AFEA 2EJUA 2VGOA 5E8XA 5DRDA 1DAYA 3H9OA 5IEVA 4ALWA 2HR1A 4BBFA 1H01A 1BLXA 2OKRA 1ORIA 1NW8A 3R1QA 2VD5A 4FKUA 3COIA 3RJCA 4DG2E 4KSQA 3PXKA 5CX9A 3IKAA 4QRCA 2ITTA 3N4VA 3U9NA 4BLVA 2QOCA 4QMPA 3PP0A 5DM4A 1OM1A 3Q04A 5K3YA 2JHAA 4L3LA 3WBLA 5CU4A 4IM2A 1CSNA 4MXXA 3BGVA 4PGHA 4Y30A 3WOWA 5HVKA 4KDRA 4EK8A 4PX6A 2YM4A 4EBVA 5JK3A 3I64A 2XIXA 3TLJA 4DGLC 4LG1A 1Q4LA 5K0JA 3R6TA 2G8NA 3SKCA 3A4PA 4O7TA 3K3IA 4BCGA 3EQHA 2YHVA 1FPUA 5HNIX 3ZSHA 3PY3A 4BIDA 4AW1A 2JGZA 3W32A 2UZNA 2W1FA 4IFGA 2IBSA 1XWSA 1XKKA 4M14A 2LGCA 4KVZA 5AP0A 3FE3A 5CT0A 4FV1A 4UALA 4FEVA 4AZEA 3GGFA 3SDJA 3VUDA 3PXFA 4JDJA 4YJNA 4E4NA 5LQAA 2HWKA 3G33A 5FGKA 3KQSA 4NK9A 5KKRC 1BYGA 2PVRA 4RJ7A 5T67A 4RWZA 1G5SA 3DDPA 4I24A 4E8AA 1A06A 2X4ZA 4MNEA 1S9IA 3Q4ZA 4PCAA 4DEAA 2PL0A 4YBKA 4Z9LA 1RI3A 2QM3A 2PMLX 3MIAA 5EOVA 4PYOA 4R5SA 4RJ4A 3P9NA 4MCVA 1TQPA 4RTJA 2QKWB 4TZRA 2OF2A 1R3CA 4IACA 2WTVA 4FSYA 4U3YA 5JRQA 4RVLA 5D12A 4QDJA 3G2FA 1FVTA 4LI5A 4TYIA 3NAYA 4EH9A 3HV5A 2I0EA 5G02A 4IZAA 5E8SA 4XUEA 1NY3A 3DLCA 3D2LA 2QU6A 3UJAA 1IRKA 4XX9A 4AN2A 4BCHA 3PVGA 3FI3A 5CASA 4C05A 1UU3A 2WEVA 4B8LA 5FTWA 3PXRA 2GNIA 2VNWA 3IV6A 3I0OA 4E93A 4RTKA 3QTUA 2BZJA 3GCVA 2I0VA 4X63A 3TG1A 4FYNA 4AZWA 4S33A 3ZLXA 1WG8A 4BKJA 5HGIA 2X2KA 1IAHA 3NNVA 3V5JA 4QPPA 5EW8A 4IVDA 3C4CA 4FIGA 4ACDA 3KVWA 1TPYA 4IX6A 3O50A 4AA4A 3MH0A 5CENA 5CVVA 3EVGA 3NDIA 5LQJA 3HA6A 1G38A 3NIEA 4FR4A 2OH0E 5GM2A 3P0MA 3HP7A 2YX1A 3PIZA 4YJSA 4Y2HA 5FRIA 3KN5A 3MFSA 5C4LA 5EM5A 1D2GA 5H02A 4QTEA 3WYXA 4ENYA 3TT0A 3NNXA 3VHKA 3BGIA 5DT0A 4TTHB 5HEZA 1O9GA 3AXTA 4KUJA 3QRKA 5C4KA 4G34A 5E8ZA 1X1DA 2IH5A 1R39A 4HVIA 4CT1A 4JIAA 5HG7A 3KR1A 3UP7A 1SM2A 2EWAA 1NA7A 4XOZA 1U5RA 4DH5A 4RBLA 2WNTA 1LR4A 1NV9A 3B3GA 2PT6A 3FHIA 5KHXA 2PMOX 1D2HA 5BPYA 3HV4A 5C8MA 3NPCA 5CSPA 3WE8A 2VDUE 3PA4A 4F0IA 3GCQA 5CEIA 3RCJA 4XG4A 5KMKA 2P4IA 2ITYA 4BLWA 4BDHA 3E88A 3I9FA 4PYJA 3OY3A 1HCLA 3LBFA 3NAXA 1PY5A 4IB5A 4PINA 2V22A 5A54A 4QQNA 2YJSA 2XH5A 4RWLA 2GS2A 3EN7A 3F3ZA 1X8BA 3WZKA 3FI4A 3A8WA 4GF5A 1OECA 2XKEA 4DN5A 2Q83A 1ZMUA 3UE4A 4PDOA 2PKWA 1PMUA 2G2HA 4BDDA 4HSGA 3OZ6A 4KDCA 4V05A 4RFMA 1H1SA 3A27A 3CXWA 3NLBA 4E20A 4E1ZA 4CKJA 2CCIA 2PVLA 2R3GA 2ZBRA 3MESA 4MXCA 3BWMA 2UZVA 3E7VA 2EB2A 4CFWA 4ZP5A 3RVGA 4ASEA 4QP1A 3KCKA 4P90A 5AV3A 3UZRA 5KZIA 4C4HA 4QQCA 3NMUF 2QHNA 4PNIA 3FWQA 2ZIGA 4M13A 1KE9A 3ZMMA 1KE8A 4NWMA 3R2BA 4HPTE 3EVZA 4I6HA 4FT5A 4JT3A 4ZSEA 2XM8A 3JR1A 4GW8A 3UJDA 4CCUA 2PZPA 3QCSA 4C36A 1ZMWA 3BPRA 2VU3A 2VO6A 4FEWA 3H4JA 3IOKA 2WELA 4O7YA 1WBSA 4KBAA 2ZYBA 3RTPA 3TZ7A 3GWZA 4FGZA 4A9RA 4OT5A 3HCEA 2PTKA 2C5YA 4R7HA 4FP9A 5EK7A 3C6KA 3FQHA 1M52A 4CSVA 2WGJA 4YUXA 3L8SA 3DFCB 5ETCA 5K8VA 3OVVA 1DCTA 4YUVA 3TJCA 4FYOA 1DS5A 2OXYA 4F09A 3CPCA 3FSKA 1CMKE 3TUCA 1WVXA 5KMOA 2B0QA 2NO3A 3WF9A 2PVJA 5L8JA 3AC5A 5CVDA 4JAIA 4FIJA 2GNGA 2YCSA 3E7OA 3OWKA 2A1AB 2O05A 4J99A 2CWWA 4W8DA 1YZHA 2I9KA 3POOA 2CGVA 3PE2A 4XJ0A 3Q2JA 2CN5A 3KKVA 3V5PA 3QZGA 2V7AA 3PZEA 5FA5A 4U40A 5DM2A 5CU3A 4RVGA 4EOSA 3G8BA 4OTRA 1VLMA 4GV1A 3WILA 4IV8A 5U4XA 3LJ2A 5E2AA 3HV6A 3GT8A 4WG5A 1W83A 4YMJA 5E8YA 1ZLTA 4WBBB 2ZZMA 1JG1A 5IQFA 3O96A 4U44A 3R8MA 5H9BA 5CQUA 3EHAA 2ITUA 2X1NA 2YXLA 3CTQA 5FEDA 4CKCA 2AOUA 4W4VA 4FSXA 1YXXA 4Z3VA 5HLWA 1X1AA 4W4WA 3AGMA 4BCPA 1M7QA 3SGCA 2OKCA 3RP9A 2QOLA 3PB3A 3AT4A 5LJJA 4JJRA 4JAJA 4RVTA 4D0XA 4IV0A 5JGAA 4FR0A 3R01A 2R3OA 4ZLYA 2DUVA 2ZV8A 4O86A 4CZUA 4QMVA 2O63A 4QQ5A 4ZY4A 3PLAE 2BTRA 3WSTA 4RIWB 2IW6A 4H3BA 1KUTA 3QOWA 2P3OA 4AW0A 1I1NA 4BN1A 3PPKA 4FKQA 4EC8A 3O7WA 1PXMA 1YXSA 2UZEA 3TDWA 2Z6AA 3RGFA 5I5ZA 3TNQB 1NW7A 1V0OA 4M8TA 5AV2A 3QL8A 3KPJA 4X6QC 5FQOA 4CTKA 3U87A 4PL5A 5AUTA 3VW8A 3KQPA 4EWHA 3IDCA 4OBOA 4QMWA 3DKGA 3LKZA 2E5WA 5TT7A 3OY1A 1WS6A 3DUWA 2YN8A 4MF1A 3EGVA 1JG4A 2IVUA 3QALE 4J8NA 3TCPA 3KRRA 4TRLA 4DLIA 4PWYA 3T3UA 1V1KA 3P97A 4F65A 3ANXA 1U46A 1URCA 3MFRA 5EIFA 4DEDA 4EOJA 4BC6A 2O07A 3BLQA 4IJ9A 4XG9A 5M07A 3P71T 5DLSA 5A4LA 2IVSA 2BTSA 3SSOA 4XG3A 4QNAA 5JFVA 1Q8ZA 3OXIA 2I62A 4CFMA 4H05A 3ZS5A 3IO7A 2XVAA 2OFVA 4FGBA 5CZHA 5K5NA 1GIIA 3EVBA 4ER5A 3DLIA 1HOWA 1QANA 3RWPA 5K0LA 5KCVA 3H9FA 4LL0A 1S9JA 1JOWB 2R0IA 2ZW9A 1XH5A 4OBWA 5KQSA 3SMQA 2XB7A 3Q9ZA 2WMXA 1RJBA 4FTQA 4EH2A 1UKHA 4FT2A 3RK9A 3ID6C 2VX0A 3OF0A 1W8CA 2YVLA 4KIGA 3NTVA 1SVEA 4V0QA 4I20A 3VHEA 3DTNA 2IBTA 4DEEA 4YZNA 2FHPA 1OIQA 2QD9A 4F9CA 4FL1A 4UWYA 4G3EA 4FMQA 5E1EA 2PSQA 2GAFA 3KXMA 5K4IA 5LSAA 4PL3A 1KV1A 3W2PA 1WFCA 3M6UA 4GMYA 5HO8A 3GXOA 4K77A 4V04A 4IVBA 3MH3A 3NUYA 3LXLA 2I0YA 2ONZA 4FKJA 3GUBA 4U81A 3OBGA 3MPAA 4E5WA 3SSMA 3VO3A 3E87A 1NW3A 3NGAA 4O83A 2YZLA 3SRVA 4PV0A 3MWUA 4PONA 5F1ZA 2G1TA 1VJYA 4YHJA 3BKBA 3QWJA 1Q3WA 3MI9A 2XBMA 2J51A 1M2PA 5EDRA 4GOLD 4F7SA 1YDSE 3ZDIA 3O71A 4AT3A 4WNKA 4O0UA 1XR1A 2XMYA 3VUKA 3ZO3A 4H36A 4S30A 3VS5A 5JT2A 3BYSA 5EOLA 3PJCA 3BE2A 3F5XA 5C8NA 5EMJA 4EOOA 2J0MB 2IW8A 4A9SA 5JUWA 3C0HA 2HY0A 4ISCA 3TV6A 3ZHPC 4KS8A 4NKAA 4C4JA 3Q3BA 3DY7A 2OPBA 3LCDA 3KQMA 3UMXA 2AZTA 3NYXA 4P58A 4U9AA 3VS3A 2GHMA 3PPJA 2B1PA 3V01A 3ORNA 3SW7A 3HP2A 4BZOA 5J1VA 2HWOA 1L3BA 2CJMA 1M6EX 2CMHA 5A4TA 2OJ9A 5TF9A 4JBPA 5IA3A 1MP8A 3DMFA 1UU8A 3O7LB 2AN5A 1OMWA 4E6QA 2XK8A 3IPHA 3II5A 4LUDA 4MQ4A 3ALOA 2HXQA 2OK1A 4AT5A 2GNFA 5GOZA 3GBZA 5HBJA 4EOPA 5IUIA 4GT5A 3V5WA 3OU6A 1Y57A 4FKGA 3QKLA 4C7TA 5EKNA 4R6WA 3TV4A 5C1IA 2PE0A 3FLNC 2V74B 3ZUVA 2RG6A 3UVPA 4GBED 5KYGA 4FC0A 2V62A 2H96A 5L2WA 4GT4A 2C6MA 4RWIA 1OKYA 2OJIA 5DT2A 1ZOHA 3GEQA 2YDIA 2G15A 3OTVA 4EHVA 3Q87B 4LV5A 4ER3A 2EFJA 4ZOGA 4KIFA 2C3LA 4XLIA 4QOXA 3PX2A 4CRSA 1U59A 1W98A 3OE5A 2XRUA 4FOBA 4O0WA 4AZSA 2IG7A 3KRJA 3T3VA 3G2MA 3Q4TA 2ZMCA 1PXJA 3S00A 4BGHA 4DFXE 1Y91A 3UO6A 4PYNA 2ZM1A 2BM8A 3FI2A 4XCXA 3CKXA 3GCUA 2YR0A 5CAVA 4R05A 1YFJA 1FJXA 3QD2B 5K0EA 1OI9A 3SHEA 3IOPA 1AQJA 4L7VA 2QI8A 4G3GA 2C5OA 4BDGA 1P4FA 1Y8GA 5J7HA 3T7SA 5DR2A 1JTEA 3FUTA 4GYIA 3KF7A 5CI6A 4W8EA 5IF1A 2VWVA 3FZ1A 4XP3A 3R2YA 4FL2A 3OG7A 2KULA 2QRVA 2QO9A 5A46A 4FKOA 4GU6A 3KXGA 3QYZA 3HEGA 2HAKA 4WNPA 4BF2A 5EYCA 1BMKA 3EEYA 4JOAA 5M4FA 4YC3A 4PMTA 4E70A 3GDHA 3R6XA 5HNBA 3T9TA 4M38A 4J96A 4IANA 3HUCA 4DA5A 3L1SA 3C50A 5C27A 2QHMA 5FQNA 4EKKA 5BXYA 4ASZA 1G6Q1 4GFGA 4FIEA 3KQWA 3ANRA 2ZM3A 4LFIA 1DAWA 4PMSA 4BDEA 1KV2A 1Q3DA 4HG2A 4MEDA 3WZEA 3PG3A 3A60A 3E5AA 5HQ0A 2JDTA 2XKCA 4PTCA 2ZB0A 3HEMA 5KVAA 4LM5A 4DCAA 4X1OA 3JWJA 2PVKA 2XNMA 4ANSA 3L9LA 1F3MC 5AV0A 3U4WA 3PIYA 4E5BA 3CEKA 4FZDB 2W96B 3NIZA 1O6YA 4OTIA 2AR0A 4AP7A 2IDJA 4O7ZA 3MCZA 3H0YA 3H3CA 3BV3A 4IAZA 3NWBA 4I5PA 3O2MA 4AGDA 4JQEA 4YNOA 1I4WA 1RJEA 3EWHA 3LKDA 5CI7A 5M4UA 5CU6A 5IMXA 1FP2A 4IVAA 3FPMA 2WQBA 3MVMA 4R8SA 3IK3A 3FMLA 4K2RA 1CKPA 4AZFA 5FXQA 2C1BA 4TYEA 4DA4A 4IC8A 2ZZKA 4KRGA 3UJ9A 2QLUA 2QR8A 2BM9A 4NM5A 2O0UA 4TKSA 1XBBA 4L45A 2CNUA 5IUHA 4AQCA 2RFSA 3T0IA 3OU7A 3GC8A 3PYYA 3FUXA 2P0CA 3LFBA 1TVOA 5ETIA 2PZ5A 2P7HA 2QYOA 3MPMA 2VWUA 3LXNA 4FT3A 1CTPE 3E8NA 5M44A 3FXZA 4GH2A 2PVFA 2F7ZE 1G60A 4UZHA 4RPVA 1XH7A 3UIXA 4LMUA 4Y5QA 3UJ8A 4PDYA 4BI2A 2BKKA 4IH8A 4YPSA 2PSSA 1J1BA 1W0XC 3F3TA 4IX5A 4ER0A 2BDJA 1H00A 1OUYA 5HIMA 3HL7A 3VUMA 3EVCA 1BOOA 3DKCA 4ANBA 5E1DA 4K9YA 4HGYA 3BEGA 1XVAA 4BTMA 2PUUA 3LXPA 4QYGA 3H9RA 1YUBA 3DT1A 3IW8A 1RQQA 4UOEA 4HGSA 4OTGA 3FV8A 1AD5A 4RX8A 3ZBFA 4DG0E 1EIZA 5IMEA 3E7PA 4KIQA 4XEYA 3EFKA 2EU9A 3R0QA 4OQDA 4HGLA 5CXZA 2B7AA 1P39A 4MQ2A 4FT4A 5HG9A 5IQAA 4FTJA 5CAQA 1QMZA 4M15A 4QPAA 4X2NA 4IJPA 4YHFA 2G71A 3EL8A 3ZO4A 1KXZA 5EGSA 4JBOA 2VS1A 3ZZEA 4E4LA 5EW3A 1ZYCA 3GFWA 5CAPA 3I53A 1Y6AA 5FXRA 2FUMA 5ANGA 5DX0A 1OL6A 4B0GA 2OGVA 4L00A 3KL8A 4V0GB 2UW7A 4YO6A 4E30A 3LJ1A 4RIXA 3MSSA 4G31A 3KEXA 2R6ZA 4RVMA 4ZEGA 3BT7A 1V39A 3QWKA 2PPQA 5DNRA 3FXWA 3UOKA 2DULA 3EIDA 4RX9A 3TM0A 1AQIA 1O6KA 3OT8A 3ZXZA 4X6RA 5J5SA 3QU0A 3I5ZA 2CGWA 4TNDA 1BC5A 1M7NA 3EMGA 1XCLA 1GIHA 2B3TA 5AWMA 3UO5A 3F88A 4UZDA 5CD1A 2YTZA 1DM2A 2JAVA 4EKLA 4APPA 5L3AA 4QYEA 4USEA 5J8IA 3VF8A 5D41A 3HMIA 3AT3A 4JLCA 4GKIA 3VS4A 3R63A 3BE9A 3TM4A 4ZTHA 5H3QA 2IFTA 3CD3A 1IM8A 3UJ7A 2XUUA 5AA9A 4EJNA 3RNIA 4TYJA 5L6OA 3QF9A 3UZTA 4EONA 3HGKA 2OZAB 5KHWA 5CU2A 1BL7A 4GFOA 3DK7A 4QP2A 1R8XA 5FEQA 3GIWA 1R0PA 1ATPE 4A4XA 5IQHA 3AMBA 4P4CA 2REIA 4B9DA 5F95A 3ELWA 4M67A 2JHCA 2P33A 4BI1A 2QC6A 2ZIEA 3SAYA 4ANMA 5AAEA 5AP4A 4O2ZA 2PWYA 3DP7A 5CF5A 4YMHA 2GTNA 4O91A 1ZGJA 1ZGAA 3SOAA 4FV9A 4EH3A 5LVLA 1OB3A 1QAOA 4C04A 1Q8TA 2QQ7A 2YWPA 2C6KA 3FPGA 3P23A 1YW2A 3SX9A 3DBFA 5FXSA 5K0GA 2HOGA 4JX3A 2XNPA 1Q0SA 4PNKA 2FCAA 3ZSIA 1JBPE 3NNWA 3IECA 5E4HA 4EHEA 4RG0A 5C0OE 5FHRA 3UWPA 4DM3A 3MW1A 1NW5A 4FTLA 1SUIA 3CIKA 5BUJA 1JQDA 4L01A 1XH8A 3QQLA 3UJGA 3G5DA 4MYGA 2HY81 2QNJA 2W1EA 3K5VA 4F7LA 3TXOA 4X3FC 2B25A 1XJDA 3Q2MA 5HE2A 2PLWA 4H3QA 2HNKA 4CCBA 4DC2A 2X6EA 4EUTA 4E2XA 5HTBA 5GM1A 1M17A 1KP9A 4PTEA 2CHLA 4A06A 4KINA 3OCBA 5HCXA 4F9YA 5T68A 4O0RA 3ZLSA 3G2PA 5ERGB 4JG8A 2BDWA 4ZIMA 4C38A 3QQJA 5M51A 4PIMA 3WI6A 2FSMX 2WU7A 1M2RA 5T6KA 4PYKA 3OCTA 1L1EA 2RF9A 4NJ3A 2C0OA 4U80A 3EVEA 5DXJA 3I5UA 2X39A 3TUBA 3P78A 3E05A 2IWIA 2BKZA 5B0XA 4BCIA 1REKA 3FYKX 3GP0A 5BNJA 3BIZA 3QLGA 2XYVA 2VDWA 2AOUB 5FLFA 1INLA 1YI6A 3BHHA 4IW0A 4EZ5A 2A19B 4FZVA 5T6BA 3A2CA 4XV3A 2J7TA 4EJ7A 5HE3A 1IG1A 1Q8WA 4I21A 3VBXA 3LXKA 3ANQA 2OH4A 4IX4A 2O0LA 4BYIA 5HKMA 4E4MA 3ZH8A 4X2KA 4I23A 1BI8A 3HP5A 2OIBA 5JGBA 5DR9A 3ORMA 5E8TA 1KR5A 4Y83A 3DNEA 5HIKA 3KULB 4RWJA 3VJNA 4FTKA 4PF4A 2PK9A 4QDKA 2W1DA 3KQ7A 2QO7A 2C3IB 4JRVA 3DFAA 2HZNA 3QD0A 2BRGA 3KQYA 5E9WA 5EDPA 5L2TA 4O22A 3LCVB 2XP2A 1YWRA 1TQMA 3LZBA 2PZYA 2HK5A 3F5PA 2X4FA 3OEFX 3N51A 4EOLA 1PHKA 2PVMA 3UVQA 1SQFA 3E8CA 4QMZA 4J71A 5C8KA 1LP4A 3HRCA 1VBFA 2JDVA 3VIDA 3TIZA 3QX2A 5HVJA 5BP7A 1Q8YA 4CD0A 5A4CA 3EKKA 3R28A 3GU3A 3RM7A 3ZM9A 1PYEA 1H1RA 4HW7A 5FA8A 5LR6A 5E8VA 4OT6A 3NX8A 5F20A 3ZCLA 4YLLA 4YGAA 3FUWA 2HW6A 2O64A 1OKZA 1Q62A 2C30A 2WIPA 2YZAA 4K18A 5CSWA 3RPOA 2AC3A 1KE6A 1GOLA 3BGZA 3SSNA 4FV7A 5JZJA 3IW4A 1ND4A 3A8XA 3JY9A 3PSBA 2JITA 1OIYA 3E64A 4RFYA 1GY3A 3MH1A 4O2PA 4WKQA 3ORXA 4ACHA 5DPMA 1D2CA 1JG2A 2G1PA 2X9EA 1JTFA 1KE5A 2WQOA 5DWQA 5FTQA 3BLRA 5E2BA 3PVCA 3OFMA 4O0VA 2AOWA 5L6PA 3EJ1A 2Y4PA 3QTRA 4CXMA 3MYGA 3P9IA 2XYUA 4I5HA 1XTPA 3GFEA 5IQDA 3ZFYA 3I6WA 4OBPA 4HVGA 4UBAA 3E93A 4O29A 2EXMA 4USDA 3LFDA 4I6QA 3OWLA 3GU6A 3TRKA 1H0WA 4II5A 5EC8A 2J5EA 4QTBA 1MQ4A 1JKLA 4ZMEA 3G5TA 5BVDA 2E9UA 4LWPA 3JWIA 2YM7A 4AN9A 4DGMA 2ERZE 4C4GA 1KWPA 4QMLA 2BAJA 3LFNA 3OW3A 1FGIA 3UPXA 4BCQA 2X8IA 3O17A 2VO7A 2WD1A 3QUPA 3E3BX 4MWHA 3H2BA 4QQTA 3RPYA 2P55A 1H1PA 2GS7A 4PQNA 5CT7A 2PUIA 3ZUUA 5DN3A 3FUUA 4YZDA 5G1XA 3ULIA 4IKPA 4HGEA 3GJYA 5CF8A 3SRVB 4XH6A 2OZVA 3UQCA 1B6CB 2JIIA 4YR8A 3OROA 3EKNA 2QURA 3S68A 2CKPA 4MVFA 5E8RA 4WO5A 3UOLA 1FMOE 2JH8A 2YIYA 2J0KA 4D2SA 7MHTA 3ETAA 1XBCA 2J0JA 2G70A 4D2RA 3MTIA 5KBRA 3V04A 2WMSA 4DCEA 4ZSGA 4HYSA 1V0PA 3DA6A 3S2PA 3KMWA 2YCRA 4FEQA 1BHJA 3UP2A 1ZY5A 4TN6A 3KU1A 2W1IA 4O0SA 4NW6A 1WVWA 4B8MA 5CVUA 4TYHB 2AYPA 4EK6A 1H28A 4EHGA 4ZS0A 5HZMA 1L3IA 3ZYAA 4PYQA 2W4KA 4EKGA 4F1TA 1RJFA 3HA3A 4C61A 1MRVA 4MTAA 4IADA 1R18A 1H08A 4K8AA 2Z7QA 2GNLA 4E31A 5K5XA 1I09A 1UV5A 4W4YA 3IS5A 5FTOA 4RSRA 3C0GA 5DLYA 4FV8A 1YWNA 2ZM4A 4HZSA 5HHWA 4DYMA 4CFXA 2BPMA 2LD4A 1G3NA 5CVGA 5JH6A 3R9RA 4NIFB 3QLFA 3CBGA 2XEZA 4WT6A 2PX2A 1IXKA 3FC2A 4PUZA 4XNEA 5FULA 4XRJA 3R8ZA 4M7RA 3HCCA 2DS1A 2XRWA 1N2XA 3NCZA 3PA5A 1OR8A 4XV1A 4ANLA 2EB3A 4FSZA 1WBOA 3FMKA 1FMKA 4CEGA 5D1HA 3R0TA 3MDYA 5J95A 3C4XA 4WXHA 3ORPA 4I4EA 2G01A 4JS8A 3EZVA 3VULA 3FY2A 4GQBA 2XNOA 1PXIA 4I5CA 3CE3A 3EB0A 5ACKA 1GIJA 1NVSA 2HW7A 3LPBA 2VTPA 4DEHA 4XV9A 3EH9A 4LOPA 4X3JA 4L44A 5JFWA 4AE6A 4FSMA 3BBTB 4YZ9A 4WOVA 2HTEA 5E9QA 3O51A 3FSFA 3ZTXA 4KA3A 1H27A 5ANOA 5HESA 4D28A 3ATSA 4AOIA 3EQPA 4BDAA 2V7OA 3RHXA 4HTFB 1H0VA 5DG5A 1GZOA 2I6GA 4WUAA 5M4IA 3KR0A 5BVNA 3MH2A 4Z55A 4FVPA 5AUYA 4D5KA 5IQEA 2Y7JA 4JG6A 3P7BA 3E92A 3I4BA 4QMMA 1JWHA 4NJDA 2ZBPA 4JQ7A 2ACXA 4QYFA 2ZVAA 4AXAA 2PJDA 3OUKA 2YISA 3K5UA 3PRFA 2UZUE 4I22A 3FMMA 5DA3A 2OJJA 5AP7A 3HX4A 2CLXA 3UIBA 2JKQA 3F2NA 2GU8A 2QOBA 1WZYA 4KKHA 5A3XA 2Q41A 1KOAA 5DX8A 3WYYA 5M55A 1FGKA 2WKMA 3I58A 4K1BA 4EKIA 3QRTA 2WAJA 4EC9A 3RHKA 3FKNA 3M6VA 2X8EA 2Z02A 2H34A 2W1HA 2JIVA 5DI1A 3TZMA 4RA4A 4MXZA 4OW8A 4CV9A 5CSVA 3QCYA 4FTNA 2CGXA 3ORIA 1FP1D 3CBLA 4BDKA 4PNEA 5BMMA 4UYNA 2WPAA 2PWLA 5I9VA 4G1WA 3CGOA 3VVHA 3HM2A 5L8LA 4OTWA 4JDIA 1G8SA 3A7IA 2E9PA 4CFUA 3Q32A 4P7GA 1WZNA 3QCQA 5FUBA 3Q52A 3M6XA 4XUDA 2B9FA 3UBTA 2VWXA 3P9KA 4P7KA 1KPGA 4ZMFA 4QMYA 5LVPA 5KZ0A 2OJFE 3GXLA 3AD6A 4A6DA 2CNVA 1J7LA 5DVRA 3LFCA 4XG7A 5HU3A 3N4UA 2YERA 3DZOA 4JIKA 4PYMA 3U6JA 1OITA 3BKWA 2AOVA 3UOJA 3ER8A 3F5UA 4DFZE 2JFMA 4FK6A 2W99B 3RCDA 2PZIA 4FSTA 1QPJA 3DTCA 2OJGA 4GOMD 4ZSLA 3I7BA 3QGYA 4G5PA 5CM2Z 3GRZA 5FDXA 3TEIA 4QTCA 5AM6A 3PWDA 4DHFA 4J1RA 2GS9A 5BVOA 3DKOA 2W5HA 4R7IA 2P3GX 4DFYA 5KMJA 4L9IA 5H8GA 1IY9A 3MBLA 1RDQE 4P5ZA 3U81A 2X8DA 4ZXTA 3IGGA 3VBWA 5EH0A 5CWZA 3IYLW 3ME5A 4HNFA 4CMOA 5AX3A 4ZZOA 1AF7A 2F49A 3SVZA 4BCJA 3R1NA 2VV9A 4L68A 5LMAA 4JR3A 4I41A 2B53A 4O84A 3MFUA 4AA0A 4EORA 3EQFA 3PY1A 4WG4A 5DEWA 3FZRA 1YDRE 4E32A 3DJ6A 4FSWA 1NXKA 3LAUA 3ROYA 3EFWA 4K11A 3Q53A 3LQ5A 3CQWA 1SVGA 2ITQA 2J0LA 4FA2A 5KMMA 5IQGA 2Q0NA 5JFXA 4ZK5A 1RJDA 3CJQA 1KE7A 5ANJA 5IISA 4ATNA 3VF9A 4KWCA 3EFJA 4AG8A 2XVMA 4Q5HA 4WA9A 3BZ3A 3MGYA 2ZJWA 2J9MA 2ITPA 3PT9A 2C6TA 1ZHFA 1YQJA 4RLKA 3C0IA 4O0XA 3OPNA 4LYNA 5I4NA 3HDNA 3BWYA 4HCTA 4I0TA 3PDTA 3G88A 4R1VA 4F7JA 4EQMA 3CJGA 3ELDA 3OU2A 3OZTA 2JKKA 4TNBA 4D1SA 3C1XA 5CSHA 2ONLA 2JFLA 4FKWA 3P2IA 4FGRA 3V8VA 3HYHA 2PXAA 4IZ5A 1OL5A 5AP1A 4CFNA 4ASDA 4MIKA 1JNKA 3K2LA 1YRPA 4FKLA 1YI4A 3ELUA 2WMWA 3TPZA 4ZS4A 5AJQA 2FK8A 5JFSA 5KQRA 1JKKA 4UV0A 5I9YA 1JG3A 4TWNA 3SW4A 2XYQA 2QG7A 1XXLA 2A2AA 3I5NA 3G2QA 4B17A 3R30A 2PY6A 3LBYA 3QRUA 2XA4A 4U0IA 3VS2A 2FVDA 3DH0A 4YJTA 1H1QA 4EH8A 1VPTA 4FV6A 4GU9A 5FWDA 3E8DA 1N7JA 3GRRA 4U7PB 5HILA 5JSMA 4DKJA 4EOMA 5KX8A 3F3WA 3HECA 4RVDA 4GUAA 3ZSGA 2UZ4A 2C7RA 3VS1A 5EKXA 5AP5A 4RVKA 3UA4A 4FNWA 1EQAA 4YJRA 1UKIA 2I0HA 3DBEA 1ZOEA 4AOJA 2XJ1A 4MXOA 1IEPA 5FG8A 3DB6A 4L8MA 4RA5A 3LGAA 3GCSA 3FPFA 3OFJA 4U42A 3FPHA 1YHVA 3LHJA 5HD7A 3KRWA 1YOMA 4KABA 1BX6A 4IX3A 4YUWA 3TIYA 5DTQA 2BRHA 4NTTA 4LOOA 5E9EA 1MQBA 4XCUA 4EBWA 1YFLA 3PVBA 3G0FA 2CCHA 2OBFA 4FTAA 3BXOA 1EJ6A 2PXXA 2O57A 3LDFA 5IPJA 4ZY6A 4L6QA 3O31A 5F2KA 3IDPA 4QYHA 3M6WA 2OO3A 4YZCA 2WTKB 3ORHA 2Y9QA 4R77A 1YOJA 3R9XB 3C5UA 2H9VA 4AACA 4QP4A 5LQUA 2Z8CA 5CVEA 2O3PA 3KXZA 4PMMA 3S0OA 4YC8A 5EEHA 3QBNA 5ACBC 4C34A 4CKEA 3CGGA 4MXAA 3C4WA 4EZ7A 4DG3E 3FYDA 3CQEA 4PWNA 5EMKA 1WMKA 3U6HA 2YAAA 3LX6A 4ITJA 2PHKA 2NRYA 3FZOA 3ELJA 5DWRA 4KWPA 3CJRA 4DT8A 2QLQA 4EI4A 3HVJA 1MUOA 2IDKA 5AFVA 5HBHA 3DBQA 5IQIA 5DTRA 4G16A 2P2HA 2ADMA 2X2LA 3CD8A 1WBPA 2BROA 2UW0A 3EVDA 2QG5A 1YZ3A 2WMQA 4DCGA 2X7FA 1PXOA 3R04A 4TW9A 3WIKA 4IDVA 4MQ1A 2OIQA 5D11A 4R5YA 2P41A 4B99A 4M69B 1E1VA 3R9OA 5EQJB 2HZ4A 2I7QA 5EM8A 1F0QA 4RQVA 2VTSA 3KMMA 2G2IA 3MY0A 4YPDA 2O65A 3ACKA 3IW7A 3FLZA 5CVFA 3BWCA 3BV2A 5EYDA 4KIPA 4RRVA 4BI0A 3I81A 2RFDA 4RTSA 5HU9A 4D1XA 3AC1A 3CCFA 4WRSA 1J91A 4AZVA 2C5VA 2WMTA 5C9ZA 3K0BA 3GRYA 2FSLX 4ZLOA 1JSUA 3DXNA 4N0SA 4AAAA 2WA2A 3EEOA 3CQUA 4AX8A 3BBWA 3B2WA 3QC9A 2Y4IB 2HENA 4XYFA 1W82A 1XDSA 3M42A 4UXLA 3UNZA 3KPUA 4TWPA 3S3IA 1FOTA 3D4QA 3T7RA 3ULZA 3PSCA 5ICPA 3HVHA 2IIPA 3TNHA 3IW6A 2BHEA 3G6HA 3ZDUA 4BCMA 5EQEA 3R7IA 2XVDA 4U3ZA 4D4RA 3AGLA 4IQ6A 4YLJA 1PJKA 2C6LA 3MJ1A 4L67A 4ALVA 2VTNA 2IZTA 3N9XA 5JQ5A 3DOGA 5IDPA 4G3DA 2WU6A 2QCSA 1V0BA 2ZULA 4QP6A 4LRJA 2BUJA 4E6CA 5LMBA 2OU7A 5FM3A 5AP6A 4IAAA 5FWAA 2ESRA 5D7AA 1IAJA 2ZZNA 4QT1A 4CKBA 2GLUA 4QP3A 1GZ8A 3RODA 3Q9XA 4ACCA 10MHA 2NXEA 2R5TA 4CMTA 4F4PA 1UNGA 5K03A 4E2YA 2NP8A 4C3FA 4HYHA 4V0GA 5HIEA 3MY5A 1T43A 5K0CA 2XK4A 3QTXA 4FV2A 3TQSA 1RI4A 4QP7A 2OG8A 1ZMVA 3Q60A 3DQXA 2YITA 5DEYA 4FV0A 3SG9A 4D1ZA 2CLQA 3U51A 5KS2A 5BW5A 2IPXA 5K0NA 4IWNA 4JQ8A 1OBDA 4PRJA 2ZTHA 4FS8A 2XK6A 2PT9A 4YJQA 2QR7A 3ZZWA 1KHHA 2C68A 4F84A 4GEOA 3MQ2A 3G0EA 1P5EA 4FEXA 2IZSA 3I60A 3OZSA 5AADA 3KQTA 2RFNA 5CAOA 3MTLA 1LEZA 4J52A 2Z7SA 5BW4A 2ITOA 4KS7A 3R8PA 3TN8A 4UXQA 5KO1A 3SX0A 4BDBA 4U7ZA 5EYMA 2YQZA 4C0TA 5EPEA 4BTJA 4XP2A 2CKOA 3P8ZA 5AIRA 4ZSJA 2JLDA 4OBQA 2XNEA 1NBIA 4H1JA 2OZAA 3PX3A 4RX1A 3MV5A 4CTCA 2OWBA 5D1JA 2GQRA 2JKMA 2FYTA 2GTMA 2NXCA 1Z3CA 3RWQA 4CGAA 4RVFA 1BI7A 5ETFA 1ZKDA 4HRAA 5HX8A 3HMOA 5FD2A 1PF8A 5LVMA 3U6IA 3R7VA 3ZXTA 4OBXA 4I3ZA 2BAKA 3RMFA 4NL0A 5A4EA 4M37A 5E1SA 5M09A 3M11A 4YHTA 5M53A 4BB4A 3VNTA 4K33A 5IA1A 2WMRA 2Z6UA 4EOKA 3ZM4A 4BDCA 3V3VA 3NW6A 1DL5A 2FK7A 5M4CA 3IW5A 5AMNA 3EGEA 5DX1A 3CGFA 1H07A 4DQ0A 5HVYA 1L9KA 3DNDA 3ORTA 3D2KA 1VYZA 3BGPA 4TXCA 4ID7A 4DT9A 4UX9A 2Z2WA 2C6OA 4QP8A 3OMVA 1H26A 4ER6A 5P8WA 2C47A 2AVNA 4FNYA 2JHPA 1CDKA 3FRHA 2I7CA 4J98A 3AC8A 3MB6A 3F2RA 4ZTQA 2XKDA 4AZTA 1FQ1B 3W18A 3G15A 2PY3A 3A25A 3TV7A 3GENA 3LJ0A 4F9WA 4FKPA 5CU0A 5LVOA 1UNLA 4YZMA 4JXJA 3P2EA 3U4UA 3BCEA 4H1MA 3QHRA 3UNKA 2CKDA 4O0YA 1U4DA 5DPVA 1GJOA 2PUNA 3ZFXA 3P1AA 1YOLA 3R73A 3NUXA 3B89A 4O7WA 4RX7A 2XS0A 3F7WA 3TR6A 3DKFA 3PWYA 4DH1A 3LCKA 2W4OA 2GS6A 4R6XA 1VP9A 3S95A 3F4KA 1OL2A 2PGXA 3THSA 4FI1A 5HG8A 2GPHA 3OUNB 3AMAA 3COMA 2X7GA 2XJ0A 4U97A 5CF4A 2NPQA 3FMEA 5HLNA 2ITXA 4L53A 4EL9A 4IE9A 4QVGA 5EHYA 3V51A 4RJ8A 4U79A 4A9YA 4UY9A 2A4LA 2XBAA 5JRSA 4BICA 5D9HA 3SC1A 2JAMA 3HRFA 2IH4A 4FT9A 3ENMA 5HIIA 1FPQA 2FH9A 4HOKA 2P40A 1PMEA 3P79A 3GQLA 1H1WA 4FNZA 1SYKA 4O7LA 3QA0A 2ZV9A 3M33A 2W5BA 2C0TA 5KBQA 4P2KA 4JVGA 2N47A 2OXDA 3KULA 4MH7A 2WZJA 5FEEA 3DJ5A 3O7LD 2AN4A 2BH2A 4QTDA 1RI1A 3JUHA 3IDBA 4F0FA 3BU5A 5D10A 2PVHA 4I1ZA 3EN4A 3BYVA 2YFXA 1ZAOA 3K54A 2J6MA 4RJ3A 2XF0A 3EN6A 2GPYA 4FZ7A 1P91A 5CNOA 3R7EA 3I6UA 5I9UA 3AD4A 4HC4A 3TKIA 5HTCA 4RTQA 4UN0C 4CWAA 3B8QA 3UQFA 4DGOA 1PYXA 5M08A 3F7ZA 4HH4A 1BKYA 3UQGA 4DFBA 3NDJA 3KCFA 4Y95A 4HVHA 3R9DA 3U54A 2VTAA 5D1NA 3G51A 4BHNA 3E3PA 2CGUA 3GC7A 3G9LX 3K6RA 2GHGA 4BCOA 4KNBA 4R78A 5LQRA 2Y0AA 3R71A 3W16A 3V5TA 2ZLBA 2R3HA 4RTRA 1UU9A 3A4OX 4N4SA 5J1WA 3QKMA 5H2UA 4H0NA 3Q6UA 3DAJA 4C02A 3Q4UA 3BKXA 4FV5A 5CNNA 2VWZA 5IA5A 2HCKA 3FZGA 3BGQA 3P86A 1VE3A 3OD6X 2QVSE 2YEXA 5FP6A 3GU5A 1A48A 3TL8A 3MB5A 4RIOA 2FSTX 3MHTA 5EMLA 5M56A 4G3FA 5CEPA 3MVJA 1Q99A 1Y8CA 1Q97A 2YIXA 3A7DA 5EYKA 3LOKA 4E7WA 4LGGA 2HWPA 1XDUA 2R4BA 2IN6A 4MK0A 4GL9A 4AA5A 4GC5A 4JNWA 4BZDA 4MAOA 3DLZA 4OA8A 4XHKB 1OPJA 1Z5MA 2B9EA 3VC2A 4RLLA 3QFVA 3ORZA 2JG3A 3ELYA 3VRYA 5K09A 2BAQA 3WE4A 2R9SA 3OFKA 3V5LA 4XBUA 4MWZA 4L7SA 4FZ6A 5EOBA 2XNNA 5K9IA 2HIWA 1AQ1A 2XNBA 4FSUA 3C4EA 1E1XA 3P5KA 4FT0A 3CJFA 2IGTA 3TM5A 3OCJA 4TYGA 4BGQA 2VTTA 4IB3A 2UZOA 4CMUA 3VS7A 5I0BA 2X9FA 4GC9A 4C07A 3GGDA 5EI2A 5HNGA 5E1OA 4FX3A 1JSXA 1OIUA 4R1YA 1QAMA 3ZOSA 1R74A 2PX8A 5HCZA 5EM7A 3DOUA 4DMGA 4YUYA 4NKSA 3WF8A 4P5QA 2P1DA 3NS9A 5EI6A 4D4SA 4QTAA 2UUEA 3NWEA 3VN9A 3VWAA 4DH8A 4ANQA 2XYNA 3NWWA 3GI3A 3HCDA 3B8RA 2C69A 3FKOA 2UYQA 3FTCA 3HA8A 2OLCA 5HICA 3I7CA 3OWJA 4TYHA 3RINA 2I40A 4PP9A 5IQBA 5L6WL 5DRYA 2ZOQA 2WTCA 1FVRA 5LQCA 1KYZA 5DSTA 3LSTA 3ET7A 3B3JA 5LXMA 5JEBA 2C5NA 3H30A 4BYJA 3VS6A 4Z16A 5DYJA 2P8JA 2ZVJA 1JQEA 3ZO1A 4WBOA 1DUSA 3KRLA 4U43A 4CZTA 3KQQA 3QV2A 4YNEA 1PKDA 4E6DA 2W4JA 2VWWA 4FSQA 3EQDA 4IZ7A 3FMNA 1XJ5A 4RZVA 2VX3A 4A7CA 1CKIA 3LMIA 4BCNA 3S4QA 2XNGA 2O2UA 4AUAA 4ZJJA 4O6EA 3VSEA 4FTRA 5CLPA 2W7XA 4QMXA 2VZ6A 4E6AA 5FUTA 1H1DA 5A9UA 2VTOA 5CVHA 5HD4A 4PL4A 4D5HA 4J95A 2R3KA 4BZNA 3OS3A 4DFUA 3LECA 5LQNA 1P1BA 4ALUA 5IH3A 3E63A 5DSXA 4N57A 2YAKA 4GVAA 2GH1A 4FTTA 3LVPA 4KW7A 3JWHA 3DXYA 3C51A 4EK9A 4HGTA 3TACA 4L3PA 3BWFA 3KF4A 4FG7A 3ZEPA 3CTJA 5F2NA 4QPSA 5GP1A 5EZQA 3AXSA 3SV0A 4UWCA 3KK8A 3R02A 1JKSA 3MN3A 4RT7A 3LCUA 4BDFA 4X60A 4O21A 4J53A 5GJFA 3R9HA 5CEQA 3VUGA 2F2CB 1KSWA 4NYEA 5CCXA 2AVDA 2YCFA 1UNHA 5A6NA 3V6SA 4YV2A 4HTFA 4HCUA 3BWJA 3D0EA 3EN5A 4PYLA 4X3FB 4DGGA 4CKRA 3D5UA 2AUHA 3TFWA 4RC2A 2V0DA 4LG4A 3UIUA 1PKGA 2VTQA 3UGCA 1B39A 1MRYA 3Q5IA 3TJDA 3F5GA 2BZGA 3UBDA 3KY2A 3R21A 5A4QA 2NP6A 4NTSA 4D4VA 3DXQA 3RI1A 2R7IA 4MBLA 4G9RA 1YKRA 3LM0A 2OZOA 2VNYA 4RX5A 3ZU7A 2BZKB 2WMUA 2CSNA 4F6UA 1YHWA 3DAEA 5AP3A 5LCKA 3EGIA 1EAMA 4G3CA 3BU6A 2W9FB 4AGCA 4D9TA 4DTKA 5E90A 4XLVA 2IP2A 4OTQA 3MB7A 4CG9A 4YUZA 3VYWA 3DXPA 4XP0A 2GNHA 3GRUA 4FOCA 1LPUA 1QPCA 4P7EA 3FYJX 4EYMA 4AFJA 2P7IA 1P1CA 1QL6A 1IA8A 3LL7A 3PG1A 3HNRA 1TW2A 4PTGA 4G2FA 5FADA 3HMPA 3HVIA 3DDQA 4ACMA 3PJ8A 4AOTA 4ZTNA 3MA6A 4QMQA 4BCKA 3ERKA 1Q41A 4QQKA 5JQ8A 4HGZA 3KN6A 5JR3A 2OSCA 3UJBA 1WAKA 2JD5A 3LQ3A 1YDTE 1ZG3A 5L2IA 1HCKA 4O96A 2W1GA 2OXTA 4RJ6A 1H4LA 4IAKA 3IHTA 5DHJA 2ITVA 5HIDA 2WEIA 4D55A 3HTXA 2X2MA 2R7BA 4ITIA 5CALA 3BRBA 1FINA 3TUDA 2YIWA 2H00A 1UFKA 4Z7HA 3FBVA 5AEPA 4BCFA 5F94A 1PXNA 4FKRA 3QXPA 5C01A 3RAKA 3GVUA 4P7FA 4NM0A 3E62A 3SA0A 4LUEA 1O6LA 2J90A 3Q9YA 5AV4A 5KE0A 3R7YA 4DE4A 1OPKA 3G5LA 3R8UA 3UYSA 3ORKA 3IGOA 2HV9A 2YXEA 2QKRA 3SXRA 3QZHA 4NU1A 4RTOA 4B7TA 2W5AA 3FL4A 2XCKA 4JBQA 3NYVA 4CTJA 3F66A 2WFYA 2OIDA 4NZWB 3PTGA 5LQFA 4O7VA 4GG5A 1YF3A 4FTUA 5EW9A 2VWBA 1SVUA 3C3YA 3TZ8A 1E9HA 5E8UA 3R24A 5KMLA 1H8FA 2G9XA 3FTEA 3VJOA 3AC2A 1KIAA 3KGAA 4ITHA 5DR6A 5H8EA 4DH7A 5AM7A 3OHTA 4KAOA 4D0WA 4Y46A 1L3CA 5KMNA 3CTHA 4ARKA 5DRTA 4R3CA 2EXCX 4C08A 1WXXA 3MJ2A 4IM0A 1Q0TA 1R1WA 3LHDA 1STCE 5HEKA 5J87A 4YUQA 5CZIA 1PMNA 3QUDA 3HRBA 4HNIA 2IVTA 3ZLYA 2VTIA 3R1SA 4FVQA 3CC6A 2GDOA 2UYCA 2B55A 3SGLA 3I1AA 2C0IA 4TPTA 4QPNA 3UJ6A 3VC1A 5ICGA 4FZFB 2VUWA 5I9WA 2C7QA 5BVFA 2QY6A 3UVRA 3B5IA 3GOKA 1M0EA 4RIYB 4YTCA 4BLUA 4GSBA 3Q6WA 4WIHA 2IZUA 3D7TB 3SXJA 4QMOA 2P2IA 4YSMA 3FY0A 3T9IA 3CSVA 2C3KA 4C59A 2BRMA 4FZAB 1R0EA 2R3SA 2CDZA 3TDVA 1EH4A 1K3AA 4DBNA 4FK3A 2FB8A 2PX4A 3BWBA 2QO2A 3COKA 1REJA 3AD5A 2BMCA 1QYRA 2EVAA 1YXTA 5ICFA 1NE2A 2P3QA 2YACA 4RJ5A 3JYAA 5F4NA 3QD3A 3BHVA 2V5QA 4ZZNA 1J3HA 1UIRA 5JKGA 5CEOA 2PMIA 5FDPA 4E2WA 2C6DA 5EQPA 4QTTB 4J7BA 1P14A 4HJOA 5EEGA 3HZTA 4PGGA 4HCVA 2GQGA 4NM3A 3AMYA 4FNXA 2XK9A 5HIBA 4HVSA 3BHYA 3X0DA 2WOUA 5M06A 2PVYA 4HPUE 3EYGA 4G9CA 2CMGA 4MD8E 4IBMA 1U5QA 3RPVA 3FJQE 1VR2A 4FG8A 3FQEA 1WBVA 3BYUA 3MA3A 3W10A 3NCGA 2UW3A 3HVKA 3WZDA 5EZSA 3MIYA 5K4JA 4L7FA 3FMHA 4YV0A 2XIKA 3KREA 3KQVA 4F70A 3GNIB 4DH3A 3AXWA 1JPAA 1OGUA 3UODA 1AGWA 2WTKC 1KYWA 4MBIA 3TMAA 4S32A 2F7EE 4A07A 3FPJA 4A6EA 4E4XA 2XIZA 4FICA 5LCJA 3UG2A 2W06A 3SLSA 5DGZA 3PVUA 5K01A 1OVEA 3EVAA 2VO3A 3OTUA 5LQKA 1L3RE 5JGDA 1U54B 1JSTA 3GRVA 4FT7A 5HIJA 4F99A 3CKWA 3RKBA 4PCLA 4YURA 3G9NA 1RI2A 2R3FA 3A7HA 4M36A 3NUAA 3DTWA 4CQEA 3PPZA 2ZSUA 1VYWA 2VO0A 4I6BA 1X19A 2W05A 3LMGA 3R1YA 3B3FA 1WBWA 4WUNA 5LOHA 5CAUA 4PDPA 2R64A 4YC6A 5DH3A 5IH6A 3UMWA 3R7OA 3PTAA 3P7AA 2J50A 4CFFA 4I6FA 5EHOA 1F3LA 5EQYA 4U41A 4JL9A 4FKTA 3W2RA 2OYRA 5DT3A 3POZA 3WZJA 5IA0A 3HMNA 2UVYA 4Q9ZA 4AW5A 2R3IA 5HX6A 5ITAA 4G17A 3O0GA 4FTIA 2PX5A 4Q9SA 3PY0A 3RALA 1MRUA 3KK9A 1I44A 4F6SA 4MNFA 4F86A 5BQ0A 2J4ZA 3NVKI 4C06A 2NP7A 5DXAA 4A4LA 1LEWA 1URWA 3G8AA 3BYOA 5M57A 3JVRA 5AUWA 4RZWA 2YDJA 3HUBA 3FTFA 4X2JA 1M6YA 4OR5A 2IO6A 4IHPA 2JDSA 3VBTA 3SXSA 3FZTA 1JQHA 5CYIA 1WVYA 4NFNA 4G6NA 3SR4A 3A7EA 3A7JA 4GJ2A 4GJ3A 1SG9A 4RVHA 3F9NA 1JAMA 2Y4IC 4C4AA 3QTWA 4ENXA 2YM6A 2YM8A 3TNWA 3BEAA 1R6AA 1ZARA 2QOIA 4I93A 2PYWA 4I94A 4ZTMA 3VBVA 3LFAA 4LV8A 3OCGA 1W84A 3DBDA 3ZONA 4PIPA 3C5IA 3GCPA 2R3NA 5C26A 5JN2A 2RL5A 1NV8A 3A26A 4WNOA 2B52A 3AWIA 5BYYA 1UWVA 4DFLA 4EHZA 2XZSA 1TQIA 5GWXA 1WBTA 2RKUA 3M2WA 5E8JA 3KPWA 4DTBA 2CL5A 2R3JA 2A0CX 1ZYDA 4MKCA 3ZRKA 4MXYA 4ZTRA 1UU7A 4F64A 2OXXA 1OL7A 3MVHA 3D5VA 1CKJA 3GOPA 4BP1A 3L8VA 3GQIA 3UO4A 3FMJA 2UVXA 2YIQA 3B7PA 4AGWA 3RAWA 3KMUA 4KBKA 4BY9E 2OB1A 2O06A 3M1SA 1PW2A 4EK5A 4I4FA 1XH4A 2P3LA 4RYLA 2GCDA 4XUCA 3NW9A 3THBA 3GB2A 3VUIA 2HELA 3G90X 3CJTA 4ORKA 2GFCA 2QU5A 3QYWA 3TOSA 4RGJA 2VTRA 2EX4A 4RC4A 3MPTA 3LLTA 4GG7A 1Q24A 4DCMA 4EH6A 2NNWB 2BIYA 5DM1A 5E7RA 4JG7A 4BR3A 3HLLA 2YDKA 4RTNA 5B2MA 5DTMA 3EL7A 3TKHA 4ZJIA 3NZ0A 5AAGA 4B4LA 3LE6A 3MFTA 2GB4A 3MVLA 4NUSA 2XM9A 4MX9A 3UZPA 4JBVA 3WIGA 4D58A 3LIJA 3KXNA 2FA2A 4F6WA 3BELA 1T45A 1ZYJA 4TWCA 4TWOA 3PLSA 2HZ0A 1R8YA 1YWVA 5IA2A 1L8TA 3HA5A 1WCCA 5B2KA 2ORED 3DB8A 3OOGA 4H3PA 4CNHA 4OA5A 5BYZA 3A7FA 2ZV7A 2AOTB 4KSPA 3MY1A 4YV1A 4RQKA 3REPA 3VUHA 4LWOA 3Q5ZA 2ZCJA 3BQCA 3H10A 3BUSA 3RAHA 2B9JA 2ZIFA 2WA1A 4DBXA 3KHKA 1GNGA 2G2FA 2HZIA 4IC7A 3D83A 3NW7A 5C9CA 4LOQA 3F69A 2A27A 2DYLA 2Y8OA 3DBCA 5BVKA 4GT3A 2QOFA 3NDMA 2ZWVA 3HCAA 4M12A 5IEXA 3QQFA 4BBMA 2YM3A 4ERKA 2H11A 1H24A 3ENHA 5GNKA 5A6OA 1P4OA 3GU8A 3EZRA 4FSRA 4C3PA 1NVQA 3HAVA 5EFQA 5IH4A 4TT7A 3AOXA 5KNJA 4TL0A 2Y1XA 1R78A 1Z57A 2XBJA 4IWDA 4RSSA 4HYUA 4QQJA 4C2VA 3HV7A 3CY2A 4F1OA 3FHRA 4F85A 3HA7A 3I0QA 2GHLA 3A4TA 3ZLWA 4QNYA 4U8ZA 4FKVA 2E9VA 2R3PA 1TW3A 3EPPA 4DLJA 4XV2A 4UWBA 3RK5A 4GK4A 1ZYSA 2OI4X 1XBAA 4F08A 4I5MA 3LFFA 1GZNA 2UW8A 3FI8A 4YMGA 4MWIA 4CV8A 3EOCA 4I0RA 4ZJVA 5HOQA 4FBXA 1SNXA 3QTQA 2I6LA 4A9UA 4Y85A 4ASXA 4FIHA 3M4XA 4YBJA 4D4YA 4DZRA 5ANEA 3QRIA 3DMHA 4RWKA 3QC4A 2E2BA 4YP8A 5BUEA 5EM6A 4QVKA 3W55A 3CP9A 3UJCA 4ZTSA 4IVCA 5M5BA 5AP2A 3TKYA 4YZBA 3ZRLA 5J9ZA 1BL6A 2UW5A 2BFXA 4LECA 1XQZA 4DF3A 4FV3A 1HMYA 2ERCA 4C4IA 2OW3A 4BGGA 2Z7RA 4EEVA 3QCXA 2BALA 3QQGA 2G72A 4YLKA 2Z7LA 2WQMA 5GIPE 3NRMA 5L2SA 3ROCA 3SOCA 4M97A 3FXXA 1XH9A 4OQEA 5BUIA 3UDBA 5FBNC 1PXKA 2BRBA 4CG8A 4AF3A 4O82A 3L8PA 3TKAA 3WARA 4IM3A 2ZBQA 2R3LA 4MD9E 2Z60A 4Q2AA 1BUHA 2UZWE 3CR0A 4F63A 2YA9A 3FL5A 4EVIA 3NJRA 3ORLA 3TZ9A 2W1ZA 3WF7A 1JR4A 3FPEA 3LFQA 3AC3A 3FDNA 3TNPC 3QQUA 3W33A 3LMHA 4E2ZA 4W4XA 1Y8YA 4USFA 3ZC6A 4YU2A 4AN3A 5TOZA 1PXPA 1IA9A 5CY3A 5FBOA 1YXVA 2ITZA 2PVNA 3R3HA 3ITZA 4L46A 3QUEA 5KKRB 5E1MA 3PJ2A 5FP5A 4FVRA 1K9AA 1NVRA 2E9OA 4O0TA 1ZWSA 2GMXA 1ZZLA 2UW4A 2CPKE 4ERWA 2R0UA 3FYCA 5EVJA 2ITNA 2RGPA 2WMVA 5ANDA 4O7NA 4MNEB 3G89A 4UB7A 3F6XA 3PA3A 2WQNA 4X21A 5DFPA 2JKOA 2P35A 1ZQ9A 3LKMA 3M70A 4ACGA 4DEIA 3PUPA 4O27B 3Q7EA 3NR9A 1KPHA 4LGHA 5J9YA 3AY0A 3GU4A 4X61A 3W2SA 2R3RA 5E1BA 3U8WA 1F38A 2JBOA 3DK6A 4JDHA 2ETMA 3DS6A 2W1CA 4R3RA 4FUYA 1YI3A 4WNMA 5IQCA 2IH2A 3D2IA 2C3JA 2R3QA 3PFHA 5CXHA 1X1BA 3HCBA 2WTDA 2UYHA 1JVPP 4FE2A 2XJ2A 5F9EA 2J5FA 3PRIA 2WOTA 3HV3A 3MGGA 1EG2A 2WIHA 4LMNA 4YJPA 4JRNA 4JR7A 4OGRA 5AAFA 4GOOD 2JEDA 1Y6BA 3ZFMA 4ZTLA 3OWPA 5I9XA 3DAKA 4L42A 1OBGA 5HORA 4FEUA 4X2GA 2UVZA 3ALNA 4BIEA 4DTAA 4X41A 3EFLA 3FPQA 5CTPA 5I9ZA 4AWIA 4XUFA 3L8XA 4GOND 4QMSA 5IG1A 4E33A 4EOQA 4FIFA 5TKDA 4DEGA 3KU2A 3GC0A 3NSZA 1SKMA 3VRZA 4GUBA 3FUPA 4JX7A 3AG9A 1HNNA 3UOHA 3SQQA 4PMPA 3QOXA 2AC5A 2WXVA 2FPOA 5FM2A 4OUCA 5FCDA 3RW9A 3BYMA 2DWBA 4IEBA 4AT4A 2X81A 2ETRA 4NECA 3O8UA 1CM8A 4Y5HA 1VP3A 4YJUA 3JVSA 4YO4A 4XMOA 2YM5A 4G6LA 5IH5A 2FGIA 4AW2A 4V0RA 4RV9A 4ZZMA 5BVEA 3IONA 4RMZA 3V97A 2YXDA 2Y6MA 1YB2A 3F82A 4IAFA 4ZY5A 3IQ7A 5MHTA 3OBJA 1IR3A 5FHQA 2JH9A 3WZUA 1Q8UA 3PFGA 4IMYA 1J7UA 4C4FA 3EMBA 4PYIA 3LW0A 1O9HA 3D5XA 3VW6A 3HAMA 4CFVA 3RM6A 3W2OA 3PSDA 2ONLC 5IKMA 3GC9A 3DZQA 3QHWA 4Q5EA 3RAIA 3RIEA 5AX9A 4DFNA 2VWIA 3DV3A 3L9PA 4MD7E 4PP7A 4RC3A 2OY0A 1O54A 1MHTA 4IAIA 2UZBA 2OB2A 1PRYA 2WTJA 5DRBA 2H6DA 5C1QB 1QAQA 4KD1A 3SVVA 2F4JA 4DAWA 1ZOGA 3TTIA 4Z2YA 2QOQA 1J1CA 5IDNA 4L3JA 1QCFA 2XK7A 3QD4A 3U9CA 2ZMDA 4KKGA 2Y1WA 4GVJA 3BLHA 1GAGA 4IWQA 2NYUA 5E92A 4EYJA 3KQOA 4G56A 3DXZA 4E5AX 2C4GA 4L52A 3F3UA 4N70A 5AUVA 5DM0A 4C2WA 2KTYA 3DGKA 3F3VA 3PP1A 4CLIA 3HNGA 2WTWA 4V01A 4C33A 3PS9A 2WTIA 4EK4A 2NRUA 4XG8A 1A9UA 2NXJA 5CCBA 4X3FA 5GJGA 4B6LA 3BGDA 4OTFA 4Y8DA 1GZKA 2ONYA 5HG5A 1ORHA 3HVCA 3DPKA 8MHTA 2H8HA 2WB8A 3V8WA 3OZRA 1Z9XA 2KW5A 3EN9A 4CVAA 4LL5A 5IU2A 3I79A 4NH1A 4GFMA 3Q9WA 3KR2A 4O6LA 3NNUA 2XIRA 4C3RA 3LM5A 3LPMA 1JSZA 3PXQA 4GIIA 5LVNA 3E23A 2EJTA 4APCA 2VRXA 1H25A 3C9WA 4IWOA 4WRGA 3BI6A 3HKOA 4ZTBA 5CSXA 2C1AA 3LFEA 4FIIA 3R83A 5AA8A 4KRDA 1I9GA 2O8YA 2QOHA 2FO0A 2X7OA 4BHZA 2XIYA 3QGWA 3JY0A 5CQWA 3TKUA 1ERKA 4BBEA 3D5WA 3FZPA 1AV6A 3DULA 2BILB 4HVDA 3OCSA 1SMHA 3PJ1A 3GO4A 3W8LA 3GU7A 3JXWA 1ZXEA 5J9LA 2VTHA 5DBXA 4GIHA 2SRCA 2C7PA 4YJOA 3VBYA 3PZHA 3PXYA 2B54A 3K3JA 4JXFA 4O7SA 3RZBA 2B4SB 4F9AA 1OKVA 2F57A 3EQRA 5IZFA 5IA4A 3CVOA 3KKZA 3V8SA 1Q5KA 5K05A 4NFMA 4BVUA 2BZHB 1OKWA 2JJQA 2GNJA 4S31A 4TY1A 3EMDA 4QMNA 2JDOA 1PXLA 2W9ZB 3FTDA 2WHBA 3HDMA 2VZ9A 4IDTA 5BMSA 3A99A 5EG5A 3PFQA 1RE8A 2GFSA 4KIOA 2EUFB 1OPLA 2CMWA 3CPBA 2NXNA 4EOIA 1J7IA 3UTOA 5HLPA 2BIKB 3D94A 1IASA 5GIOE 5CUQA 5EKUA 4KKEA 3D14A 3QAME 3NUSA 3UNJA 5CEMA 5HE1A 2YWVA 4FSNA 2BR1A 5ETAA 3OEZA 5TO8A 3NUPA 1QPDA 5LWMA 4IAYA 5L8KA 3VQHA 2PWPA 2UYOA 3LDUA 3UPZA 1LUFA 3NYNA 1SUSA 2UV2A 3EYHA 4IB0A 3VQUA 3P7CA 5KUPA 2WQEA 4ER7A 4A9TA 5F2OA 5AUUA 4AS0A 1JQ3A 3C4FA 2ITWA 1RI5A 3ZRMA 2ZAZA 1MJFA 2BDFA 2BZIB 5ANKA 2BR3A 2BFYA 2O5KA 4C03A 5K0BA 5HO7A 4F0GA 3CY3A 4GS6A 4GUEA 5B1SA 1VZOA 2F9GA 3MS9A 4H39A 2K4MA 4D9UA 2CKQA 3ODYX 1OL1A 3Q96A 4U6RA 4I92A 4OTDA 1QZZA 1JKTA 1ZRZA 4NCTA 3KRXA 4EWQA 3UA3A 3DXXA 2Y6OA 2X6DA 3O8TA 3AJDA 4GEKA 4NCTC 1XO2B 4MBJA 4WSYA 2WMBA 5DT4A 4O38A 4X7QA 1KOBA 5ICEA 3CLYA 1ZY4A 3O8PA 2B9HA 1B42A 3LFSA 2OF4A 2F7XE 3JPVA 4AUKA 3FC1X 3EQBA 2PZRA 2RFEA 4EH5A 2VDVE 3PXZA 2QOKA 2BHHA 3MTEA 4RIYA 4RTPA 2I1MA 4PDSA 4XBRA 5D7VA 3VS0A 3KB7A 3KFAA 3D7TA 3D7ZA 3DJ7A 2VTJA 3L9NA 2VN9A 5AUZA 1G55A 2V55A 3BX5A 4CXAA 4CTBA 2BR5A 2HXLA 5AV1A 4YTHA 1UVRA 1YVJA 2AN3A 3THRA 2GA9A 2BRNA 2H1RA 4N6YA 3LCTA 4G6OA 1SVHA 3P4KA 3NUUA 3ODZX 3FQSA 4AU8A 5EDQA 4GYGA 3CS9A 4BRXA 1N7IA 4HYIA 3OC1A 4EZ3A 3ZBXA 1PJZA 3L9MA 3NUNA 4FKIA 3NW5A 5EG3A 5A14A 3QZFA 3QTIA 2BR4A 4CLJA 4S2ZA 4NT4A 4EQZA 4BTFA 1XCJA 3UYTA 3DQWA 1FBNA 3HMMA 2VWYA 4IZYA 5AIKA 3LQ8A 5EMMA 3FRIA 2F2UA 4F9BA 1FVVA 2OO8X 1EJ0A 2RIOA 2ERKA 5T64A 3QQKA 5HI2A 4K6ZA 4R6VA 3BHTA 4MHAA 4ZLZA 2YCQA 5FQDC 4FTMA 4AE9A 4J8MA 4E73A 2Q0BA 3A62A 4QO9A 4FKSA 2XCHA 3ZC5A 4QP9A 3WF6A 5E9JA 3FLQA 4EQCA 4C4EA 9MHTA 3T8OA 2ETKA 4DINA 2JBPA 3COHA 4CRLA 1OZ1A 3JS2A 5E8WA 3BU3A 5HBEA 2J2IB 3WF5A 1DI9A 1K2PA 4GRBA 3HCFA 5ANIA 3MCTA 3LCOA 1TKIA 3C3PA 3MTFA 3FAAA 4K0YA 3MAGA 2R3MA 3O4FA 3EQGA 4R3PA 2CN8A 4FTCA 3KVXA 4EH4A 2PBFA 3P08A 2QODA 2UZLA 1U54A 5LWNA 1Q61A 4R8RA 4X2FA 4J97A 4IIRA 2VTLA 2W17A 3A7GA 3DU8A 2DQ7X 4I0SA 4RFZA 3DR5A 4M3QA 5BVWA 3DMGA 2A14A 3ZO2A 3UIMA 5CIYA 4C62A 1YXUA 2IZRA 2BVAA 3KXHA 2V7EA 2QE6A 3R9NA 2YIRA 3W2QA 2QONA 1SZMA 2PUPA 3R8LA 4WVLA 3EQIA 5GHVA 2EG5A 3KC3A 5EI8A 2OFUA 2VGPA 3FUVA 3R7UA 3NEWA 3UG1A 2PE2A 2WO6A 5CEKA 3ER9A 2JIUA 1WXWA 4F7NA 4IFCA 1UWJA 1RW8A 5HCYA 1NW1A 3FZSA 3N4TA 4EK3A 4BDIA 1XDZA 5HE0A 5IUGA 4RIWA 3D15A 3LLAA 3QXOA 1JSVA 3Q4CA 4E26A 4NSTA 2QRVB 1SNUA 3P9CA 3VBQA 2UZTA 2LAVA 2VTMA 1M14A 2PV0A 1RJGA 4FL3A 4DGNA 4N6ZA 4DITA 3QZIA 3OXZA 2C6IA 2CKEA 3UFBA 4GK2A 5LMKA 2IJMA 1R00A 2JC6A 1XHAA 4EH7A 1XH6A 5LMKC 2IW9A 3PIXA 1NKVA 2GQSA 2FRXA 5B2LA 4XS2A 2FYSA 3IG7A 3E8SA 4NM7A 3CC8A 2C7OA 4MHTA 2YUIA 3VC4A 4WD5A
chains in the Genus database with same CATH superfamily
4GKHA 1APME 4NZMA 1QVAA 2XYRA 4DSAA 2Q5LA 3P19A 4D3DA 4MKZA 3AQVA 2FRDC 3EISA 5UKDA 3SG8A 2VJNA 3BC1A 2ZB3A 4GZLA 1K0UA 3ZLBA 2C5BA 4WHZA 1DFIA 3HH8A 4L8LA 3VAPA 4MWBA 1NBHA 1GFZA 4MR7A 2QRPA 3RI3A 4HAYA 1G2IA 3QKKA 5DOSA 3DLSA 1REQA 5FEMA 3TJZA 1QRDA 1ZU4A 2ZKIA 1E2DA 1UWHA 2VJMA 4Q7JB 4U7TB 4ZAUA 3ATTA 3A9WA 4MO2A 3EVFA 2B2CA 4RW0A 4MP6A 3L6RA 5TJ9A 1YTUA 1A72A 3SC2B 1V6AA 4UYAA 4HZRA 3PYMA 1KH1A 4HH0A 2P69A 3Q6NA 1XZQA 4LYYA 3FBWA 4M9UA 5CX1B 4XB1A 1MG0A 2QPAA 4FSDA 3U55A 3KCQA 5H70A 2QJRA 3EULA 1A97A 5IAKA 1HG0A 2CNQA 1U2GC 3U6BA 2P9ZA 3OE4A 2NX2A 1A9TA 4H35A 2RIPA 2WWYA 1A8QA 1L8OA 5JAIA 5EHGA 2QOOA 5I4KA 1IXYA 2Y1LA 2E9NA 4A3SA 4NFSA 2C6EA 4S35A 4OG2A 2ZB1A 5LLSA 1ZFNA 5HZNA 3QI2A 4LRMA 4HMOA 5E6UB 4C6TB 2DKFA 3PWKA 1LB1B 3ISJA 2Z04A 4JYMA 3W2CA 4G63A 1FUUA 4MVJE 4OB6A 5CA0F 2R7AA 4FYHA 4YJDA 3SZ3A 4B3SB 3KWFA 1MJNA 3MCAA 1W7HA 2ZDTA 4W7IA 1N5JA 4NZPA 2FQWA 4G5GA 2HWWA 3FLSA 3UPTA 2APJA 4WK2B 5EHIA 4OHCA 1KBZA 4ONAA 2VJOA 2HEIA 1NZJA 4Q4HA 1YGYA 3BZBA 1J33A 3K92A 3CO0S 1YBHA 4GL4A 3DK3A 3UK6A 1CT9A 3RK7A 2P91A 3TS1A 2HMWA 5BN4A 2NU9A 1B16A 3OP5A 4LRSB 1ZI6A 3HSKA 2OG2A 3K1AA 3KOOA 2QX7A 1ZOOA 4Y72A 2VP3A 1V1MB 2IZZA 4BO9A 5T3QA 3TWJA 2EW8A 5B55A 4ZOLA 5DIAA 2HADA 5SV2A 3HI6A 1KWGA 1YA6A 3PNVA 3WKDA 4KIWA 2RE8A 3CZ4A 4ND2A 5F5XA 2R1ZA 3A61A 3KZKA 4GNKA 3RIHA 2VTVA 5JZNA 4FQ7A 4GRIA 3R8VA 5B7VA 4X0MA 3H5WA 1QV7A 2HLNA 5CEFA 2Q45A 1QR6A 2BGIA 1H4SA 4S1NA 2WJ4A 2GN1A 1CR0A 3CLKA 3TGLA 2XA1A 1RYBA 1CY0A 4IDPA 5FTGA 3KB6A 4DR1B 1O6GA 3CCNA 2I6FA 4G25A 4P80A 1OU0A 3NAGA 3CVUA 1GARA 2AOXA 4XG2A 4BP9A 3PVWA 3CX3A 4PHCA 5LKAA 1SFRA 4WE3A 3P96A 3KIPA 3TQIA 1R5NA 4HR7A 3SD0A 4I4CA 1GD1O 3UC4A 1FE8A 2I80A 1C50A 4YAOA 3OW4A 2GPNA 5G0VA 4LMAA 4KBCA 4C4SA 4XIGS 4RTLA 3K71B 4ZHSA 2JLZA 5M2QA 4LZNA 5C8YF 3COZA 1V8DA 3B2TA 4FG9A 1VL5A 1T6YA 3A14A 4LA4A 3GVHA 1DRKA 1YJXA 2RGGA 1NGSA 5HFJA 1NRIA 4BVEA 2F8LA 4HDMA 4OFZA 1K4MA 4RQBA 3WDKA 3B20A 1XMIA 1DI8A 1PJSA 5E91A 3E2PA 3MJ4A 5G6VA 1JFSA 3W34A 4EFLA 1NW6A 3GFBA 1BX3A 4QFBA 3RPRA 5JADA 1UC4B 4NE9A 2IVVA 2PL1A 3IDFA 3ESAA 1BGVA 4Z4IA 4ENPA 2OBJA 2XK3A 3DCVA 1JQ5A 4I0WB 3JSAA 3WGTA 2FG5A 1NLZA 1U9IA 1A9PA 3U1TA 1N2OA 3QTLA 5E8XA 5CD9A 1NXSA 4PLHA 4JYZA 1DOZA 4ACBA 1NW8A 3MRSA 2VD5A 3RJCA 4DG2E 1ZRMA 1TQ2A 3G9XA 3VDQA 4FCWA 1B2RA 3IKAA 1NZFA 1MT3A 3K3PA 3L82B 3QVOA 2BGWA 4YT8A 2ITTA 5F7OA 4A8TA 2ANCA 3CRNA 5ITZB 1JDZA 2EKLA 4FFSA 4G36A 3V33A 5D5PA 5DM4A 3Q04A 1PS0A 2ORVA 2ECPA 3VHLB 2XMGA 4L3LA 3WBLA 1L4MA 4FQ5A 1Z7EA 5EJ2A 1I7NA 2VP4A 4PGHA 4RDIA 1RYFA 1WCIA 4IZIA 1DOHA 4EK8A 1JLHA 4Q1EA 1OTYA 5KJ1A 2XIXA 3OQIA 1W87A 4N7JA 5F33A 2YVQA 1XA0A 2G8NA 2WKQA 3K3IA 5JZOA 3ROPA 1OPRA 1R4MA 5KWEA 3ZV4A 1X80A 4DDIA 4AW1A 1M8KA 3KZNA 4FR2A 3HE3A 2IBSA 3GP3A 2ZRQA 4BJJA 1P2GA 3EC2A 4YRNA 1XKKA 2WEKA 3HFRA 3HP4A 4FDTA 3FE3A 4KPUA 1TL7C 3PXCX 2FMHA 3WBFA 4UALA 4FEVA 4UE3S 3GGFA 1QE3A 1VC2A 1LS1A 2WZQA 2RJOA 3SKVA 3SDJA 3VUDA 3PXFA 2FPKA 2JKVA 4E4NA 1QPBA 3NOVA 2HWKA 4YJ3F 4X1YA 1A2OA 3G02A 2Y76A 3VPBA 4CGYA 4CW7A 3VR6A 3ZU6A 2QTLA 1BYGA 3TIIA 2F1RA 4X3PA 1XQ9A 2PCJA 4OGKA 4MRMA 1ZK0A 3AKCA 4PVDA 3SX4A 1G5SA 3IP5A 5FUWA 3GGJA 3W0OA 2X4ZA 1XNGA 2ZIZA 4PN3A 3D6HA 1Y6JA 1S9IA 3TSZA 3RRNA 3IUNA 3RJ9A 2P2SA 2XHEA 4QICA 3ZZMA 3ICEA 4YBKA 4YHHB 3QBVA 4Z9LA 1RI3A 2EP5A 1RKQA 4PHFA 5EOVA 5JVDB 4R5SA 1YQEA 3FTNA 1N8NA 2AFHE 2YJTD 5K1ZA 2EBWA 1IDN1 3N58A 1R3CA 1KNQA 4IACA 5I3CA 4FSYA 1QIEA 1IG3A 2B1GA 2CFOA 5D12A 1EKXA 2NUAA 2A7XA 2R8YA 4G86A 4QDJA 5FJIA 4CL0A 2WSIA 4LI5A 4TYIA 3EB9A 2H4WA 3NAYA 2WF5A 4DIOA 5ENZA 2I0EA 1DJLA 1TF2A 4H27A 4BFCA 3UCFA 4TGLA 3DLCA 3UJAA 1IRKA 4MVCA 1PNRA 4MP3A 4BCHA 3PVGA 4JD5A 4RJKA 4RD1A 4I5GA 4C05A 2GK4A 1H3FA 1XJ0A 5C1OA 1G1AA 4F8YA 2C2KA 5BNFA 1QHFA 3LXMA 5E7IA 1I3MA 5FDFA 1RP1A 1XBTA 3IV6A 4E93A 1U3CA 3LP6A 3KEFA 1U7TA 1V9SA 4FGLA 1XD2B 3H0KA 3BXFA 2IS1A 4OHFA 4TYWA 3TG1A 1WDLA 4U39A 5CA1B 3OF2A 5D01A 1NJFA 4Z8YA 1S7GA 4FYMA 5HKLA 2QSYA 3DOHA 1JV2B 2J5BA 4ML3A 4TL8A 3T4XA 3C24A 4BLRA 4FIGA 1W9HA 3G68A 4YFVA 1F2UB 1NJ1A 3Q3EA 4ACDA 1Q0RA 1JKIA 3CTMA 3HNPA 4TYYA 3O50A 3NH6A 3HUFA 2JLQA 3IS3A 2MYNA 1F3OA 5H5JA 2PS3A 2NUTB 3QEMB 2BMJA 4B87A 1G38A 1VJDA 2GHQA 3NIEA 4FR4A 3ZGOA 1EGVB 3OZFA 2HSWA 3HP7A 1FS5A 3QYAA 3PIZA 1GIAA 3V9AA 1GG5A 3MFSA 5C4LA 5EM5A 1HLFA 3FR8A 1HL3A 3Q5GA 5K8JB 4L57A 2VO1A 4RKYA 4ENYA 3VHKA 2FDCA 1P8AA 4TTHB 3RS7A 5EFOA 5HEZA 3BICA 3PUFC 4PS0A 3IQEA 4L2IB 2GEVA 1QSGA 4G34A 3B7GA 1XTSA 4ECEA 2IH5A 2XNJA 3LWNA 2X4IA 2XRFA 5M04A 5HM8A 2CD9A 5A7FA 3NQ41 2DUMA 4EHKA 2LNDA 1ICEA 1L7VC 5AKEA 4JJEA 1AUOA 4GSYA 4ENWA 3FHIA 3KJHA 1L7BA 2RI0A 5KHXA 3UAGA 2PKEA 1D2HA 4AVYA 1OBHA 5CSPA 3WE8A 3BJRA 2QZZA 2FPPA 5CEIA 2A1TR 3UFXB 4ZWNA 5I6DA 2ITYA 4BDHA 3H83A 4D3YA 4CM6A 1GYPA 3GAMA 4LRXA 3A3NA 3EFEA 3FOAA 3JVEA 2V22A 1QLHA 4QQNA 4QOGA 2XH5A 4IUBS 1T4BA 2GS2A 4IEIA 1NI5A 3A8WA 2PFSA 5AYVA 4DN5A 2HZ7A 5KTKA 1ZMUA 3ZHTA 3IT2A 2PKWA 2G2HA 3OZ6A 2IYEA 2JIPA 1H1SA 3A27A 4E09A 4TV8B 4LXTA 4MS3B 4E1ZA 4B3DA 1SBZA 3D5QA 4REQA 2PG3A 3BWMA 4CFWA 1YD7A 2CUNA 4ASEA 4QP1A 3KCKA 1FMFA 4BKMA 1PNOA 5AV3A 4AG6A 3UZRA 5KZIA 1L4GA 4N8SA 4PRYA 4QQCA 4M8IA 2QA5A 3FVRA 4NG4A 1YA8A 1H0SA 3VOTA 1GEEA 1KE9A 5K7SA 1XZFA 3FDXA 4I6HA 1EVEA 4PX3A 4FT5A 4FK8A 4JT3A 1YIDA 3VKVA 6Q21A 4EJMA 1M10A 4O4JB 2CLHB 1MABB 4TWAA 4GS5A 4C36A 2PT5A 1PQ4A 3BPRA 3OSUA 1SOVA 4F6CA 2FFHA 3LW7A 1HZZC 3GYGA 2FWIA 1R5OA 3IH5A 4US0R 3W90A 1OXXK 2BEVA 4FGZA 4H3KB 2G1JA 2Q28A 4RFSB 3HCEA 3L92A 3M9XA 4R7HA 1SHUX 1GSOA 5J5CA 3OCXA 4FP9A 5EK7A 4BQNA 3FQHA 1M52A 4CSVA 3DFCB 4K0RA 2ONKA 5ETCA 2JDID 2W4IA 4IX1A 2WYIA 2FR8C 2H4ZA 1XP8A 3FOEC 2IOFK 3CPCA 4DXDA 3FSKA 1XLWA 4KO3S 1U8CB 1QQ7A 2PVJA 3NHLA 2IYUA 3AC5A 4FIJA 3CPJB 2ET6A 4OO3A 2YCSA 3KWJA 1CFZA 2H5EA 1B6GA 1A7JA 3SEZA 3QNWA 4EB8A 1I3OA 1IUPA 4ENVA 4GM4A 4EKDA 3KZVA 3IP9A 3VYRB 2R6DA 3D8SA 1E7WA 3K72B 4U40A 1VHTA 5CU3A 4R2IA 4EOSA 5J9FA 4B9AA 5ALGA 1FMJA 5AKKA 2BTQA 4G8CA 1DV2A 3LSYA 4EUNA 3AVYA 4HKTA 4ETWA 3VA7A 1HYEA 2GM4A 1CC1S 4WLEA 1MGPA 3OM8A 1Y1SA 4YMJA 5E8YA 4IFBA 4HNAA 1N92A 2Q5FA 4PO3X 4AP6A 1JG1A 5BSMA 5IQFA 4U44A 4N3AA 3T0GA 3BDAA 3R8MA 3HL4A 3UEOA 5IFLA 1SM4A 2GWRA 3AVTA 4JS0A 2AOUA 3MS2A 5BSGA 3MHPA 2C5GA 4J0QA 4Z3VA 5D87A 2IITA 1LDNA 4I4TA 4R2JA 4IGFA 3MTBA 4L5YA 3A1CA 4BASA 2ZRNA 3O92A 1EDZA 2ENUA 3OMWA 1UAAA 2J7PD 3A1DA 1XLVA 4BE7B 2NQTA 3O73A 1E1QA 4JJRA 2VP2A 2Z2JA 2AR7A 4MA5A 4RVTA 3R01A 2R3OA 2QLJA 4QWWA 5JJKA 4ZLYA 1W0JD 5FOTA 4H2DA 3ANSA 1U2DC 4CZUA 3JQBA 4TOIA 2O63A 5HZHA 2DPXA 1BRTA 4B6FA 3CWQA 2IW6A 3GZJA 1VCHA 2Z8YM 3QJGA 2P3OA 1I1NA 4DNOA 4BN1A 4DT1A 2PE5A 3OTGA 1R3UA 4FKQA 1H0RA 3O7WA 3SSAA 3AOEC 1D1SA 1RRCA 3WWCA 3FNBA 1RWWA 2GZRA 3ZGZA 1Y9AA 1V0OA 3UDTA 1L7QA 4G4SP 3TOCA 4CTKA 3U87A 3T34A 3AI7A 5AUTA 4HBZA 1RTTA 1JPVA 3LQYA 1RM3A 1ZP6A 3LKZA 3QXGA 1IK4A 2B34A 4PQFA 3USCS 3RREA 4QQ8A 1JG4A 2IVUA 1XZGA 1GN8A 2O7QA 3PXXA 4U6QA 3KAJA 4TL9A 4QXQA 4UUNA 4X1IA 1GRQA 3T3UA 2IF2A 3QA9A 4F65A 3ANXA 5CXXA 2X58A 1URCA 4UHJA 5EIFA 2IVFA 4JI7B 4DEDA 3R6LA 4KTTE 2XZLA 1U1FA 4BUCA 1VECA 2OQIA 4XG9A 4IJ9A 4JMLA 1KVQA 4UUOA 2AT1A 3BE4A 1JEQB 4O4HA 3SSOA 2AHRA 4XG3A 1QP7A 5A9RA 1Z0IA 4M4SA 2UKDA 5ECWA 3ZS5A 2XVAA 1XZLA 3DPSA 1GIIA 1QIIA 4J76A 4M87A 2JIZA 1AC5A