3PLAE

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3plaE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3plaE02
2VN9A 3RPVA 5BMSA 1XDZA 3F5PA 5BPYA 2Y4PA 3SD0A 1JKSA 4AW1A 2PMOX 3O51A 4HGSA 2R3MA 5EHLA 3UQCA 5M4FA 2BAKA 5AIRA 4I0RA 2BIYA 5J87A 4QMZA 3TMAA 3EFLA 2YDIA 5IDNA 3FSKA 1U5RA 3ORMA 4EUUA 3SX0A 5JGBA 2YACA 1X1BA 4DGNA 1YOLA 2QU5A 4XG3A 4QQNA 4OGRA 3CVOA 2PE0A 4K2RA 4BCGA 1GZNA 2YWPA 5CUQA 5KS2A 1YOJA 3RINA 5F2OA 2BRBA 2XRWA 5EM5A 2JH8A 5LQAA 4GW8A 4EK5A 2XYVA 3GCZA 4CT1A 4NWMA 3C9WA 4F85A 3W8LA 4ZLZA 2BRHA 1G6Q1 3RHKA 1GZKA 5IQAA 3UJ6A 3ER9A 3AD4A 5DG5A 4YLLA 3RHXA 3NPCA 3E92A 4RYLA 4Q2AA 2R0UA 3VBXA 4MH7A 3QYZA 4OT5A 3C1XA 3AWIA 2Z6UA 4QNYA 4EMSA 4IZAA 1E1VA 3LM5A 2REIA 3GU4A 2OH0E 4IM2A 1N7JA 3UJAA 10MHA 1VJYA 5DBXA 2HY81 1DS5A 4YHTA 5IQCA 4MXOA 1FVTA 3FLNC 3K0BA 3FMKA 2B2CA 4ASDA 3ULZA 1WS6A 3OXZA 3OZSA 4QYGA 2WO6A 3DBFA 1M6EX 1EAMA 3BBWA 2ZMCA 2UYCA 1PHKA 4FYNA 4DTKA 1ORIA 5E8SA 4FZVA 4TW9A 1OBDA 4QDJA 1XHAA 2UW3A 3ZEPA 4YUQA 4WHZA 3PYYA 2VDUE 5EKNA 1B6CB 4EOKA 1GNGA 4RMZA 5K3YA 4FR4A 3D2LA 2VWIA 3CE3A 3HAMA 1PW2A 3HRFA 4OUCA 3HTXA 2GLUA 4FTTA 3FI2A 2I9KA 3ORTA 1H1DA 4FV1A 3I81A 2IZSA 3TNHA 4RWJA 4FSRA 5HU9A 4C07A 2BZHB 3FUTA 3UIMA 4Y5QA 2HWOA 5DPMA 4UV0A 5BUJA 5C26A 4O7RA 5CVDA 3TNQB 1KUTA 5IA5A 3LKZA 3MA3A 3P9IA 5IQHA 3PXFA 4D9TA 5CAPA 5I9WA 4CRLA 4WNPA 3IW8A 5EI2A 5EOBA 4LOPA 5J7HA 3TEIA 2WQEA 1CM8A 2GQGA 2QG5A 4APPA 3VS7A 3FLZA 1PMVA 1WBPA 3QTQA 5AP3A 1PXMA 3V3VA 2W5BA 5E9EA 5F2KA 2QURA 5ETFA 2HIWA 3JYAA 2Y8OA 2JHAA 4NJ3A 2YM5A 3EHAA 3ZONA 2GS2A 4XHKB 4HZRA 4RWLA 2GHLA 4GVJA 3SG8A 3P4KA 5E91A 1OIRA 3LJ1A 2X4ZA 1Q5KA 4D0WA 3BRBA 4NCTC 4D9UA 5LVPA 2J0JA 4ZJVA 3BWMA 5GM1A 4D55A 5C27A 3OY3A 3IPHA 4FIHA 4ZTHA 3FEGA 1G8SA 3FMNA 3CS9A 3KCKA 5FEDA 5CNNA 5FP5A 4AGCA 2B54A 5K5XA 5DLYA 3CQWA 4MF1A 3VIDA 2Y1XA 4YMJA 3RALA 2EXMA 4ACCA 2YIWA 5FBOA 4DINA 3RWQA 2XBAA 4DEEA 4CMTA 4BDFA 2UUEA 4E30A 4O7ZA 4XH6A 4QP3A 3SSNA 4HYSA 2OPBA 3SSOA 3KPWA 3A2CA 4LL0A 3OPNA 4HYIA 1BL6A 4OBOA 2ERKA 4O0TA 3PVCA 2O06A 3UIXA 4EOLA 3R02A 5A14A 5FA5A 4EOIA 3BGDA 3C5UA 4BDHA 3T7RA 4RFZA 5K0GA 1XO2B 3ZZWA 3PLAE 3PP1A 4NTSA 3IDBA 1HNNA 4BIBA 3KK8A 2X4FA 2CGVA 4PUZA 4IWOA 3V5JA 5CU3A 4P7JA 3OWLA 3ITZA 4HYUA 2H9VA 3S3IA 2W1FA 3CJFA 3ALNA 5E8WA 3WOWA 4YTIA 4F0IA 5B7VA 4L45A 3HV5A 3QZGA 4QMXA 4MBLA 5ANIA 3BYUA 4PWYA 1VEBA 3D7TB 3UPXA 1SMHA 3IECA 4MNFA 2Z02A 2OGVA 3GB2A 4FSMA 4F9YA 5HGIA 1SQFA 2Q83A 5EK7A 3W8QA 5ANKA 1UNHA 1TQIA 1M17A 4RX9A 3A27A 3D4QA 1DAYA 2P33A 5D7AA 1NW6A 3EN4A 4C4FA 2X7FA 3PIYA 4FTKA 4BDJA 3O96A 4GV1A 2XKCA 5K4IA 2ZM3A 3CY3A 1ZARA 2R7BA 2G1TA 4DH8A 2YCRA 4ZOGA 1PF8A 4HGLA 3KQ7A 3PY1A 4H3PA 4OBQA 4BI1A 2Q0BA 2JFLA 2OO8X 3LBYA 4LG1A 3TLJA 4P5ZA 5HG5A 4FK3A 3PA5A 5M57A 5B2KA 1L3CA 3QOXA 5FHRA 4C04A 2EJTA 3KR1A 2O0UA 5EYDA 4PTEA 3EQFA 2QRVB 1SG9A 1ZY5A 4FNWA 3F66A 4MAOA 4DZRA 1R1WA 4EKGA 5K01A 3COHA 5M44A 5KMJA 4HGEA 4J71A 1Q61A 3PT9A 3AD5A 3OWKA 3DB6A 1O6KA 2CKPA 4CGAA 4ZXTA 3FHIA 4EOSA 3KRWA 4EQUA 4H36A 3RAKA 4IVCA 4CKCA 4M38A 4Y8DA 3TZ7A 4KIPA 3IW5A 3QC9A 4ZP5A 3U4WA 3GO4A 4O7YA 4I6QA 3KXGA 4MX9A 2C7RA 5ACBC 3ZH8A 2IVTA 3BCEA 5DX1A 4CNHA 3KR2A 3KVXA 4CLIA 3QCYA 2ZWVA 5EI8A 3T9IA 4TWPA 3QQUA 3A7HA 4M97A 3MH3A 2PE1A 4IADA 4WUNA 2IPXA 4K1BA 2VO3A 3UZUA 4FL2A 4QRCA 3EN5A 3RCJA 4HVGA 3T7TA 3MAGA 1K2PA 3F2AA 2JAVA 4IX5A 3EZRA 3M70A 5DXJA 1KYWA 3DAJA 2C0OA 3OD6X 4EKKA 4B9DA 3CSVA 4NM0A 3E7PA 2OYRA 3PJ2A 2IWIA 2VWWA 3WYXA 4CCBA 5D1JA 4EH8A 4L68A 4A07A 4C4IA 3HMOA 2GNIA 4AT3A 2RFEA 3IDPA 4PYLA 2AOXA 4PYOA 1H1PA 4BLVA 2PUPA 4DGOA 4MBJA 5BYYA 3RK7A 4X2GA 5CT7A 1NKVA 5F2NA 3K2LA 4NT4A 3UO6A 5AAEA 4IV8A 3GXOA 2X2MA 3P9KA 4DKJA 4Y95A 3QL8A 5DN3A 3FQEA 4N0SA 3ZFXA 2YAKA 3WZEA 3R9HA 1PRYA 5LARA 4U42A 4AT4A 4OLIA 4G1WA 1OR8A 4U80A 3OE5A 3R28A 3AXSA 3UVPA 5FHQA 4KSQA 1JOWB 4RV9A 2UW4A 3B89A 4U7TB 2P3QA 2R3NA 5IF1A 2OF4A 2IBTA 2CLQA 4MWHA 1ZMUA 4QQ5A 3LFEA 3M4XA 1UIRA 3CGOA 3L8PA 1KR5A 4FG9A 3UJ9A 4XUEA 5BVFA 3L8XA 3H9OA 4I41A 2OIDA 2ETKA 2EWAA 2KULA 3OEZA 2XVMA 3IONA 1R8XA 2FUMA 3NIEA 4KDCA 4IFCA 4QMMA 5JGDA 4X60A 3E64A 3FXXA 3BV2A 1H27A 2P2IA 3KMWA 3D94A 3T3VA 4YR8A 1ZOGA 2VTOA 5HVKA 4L67A 1Q8TA 3LFBA 3OS3A 4JX3A 4GJ3A 2PVRA 1H0WA 5D1NA 2VWXA 2PZIA 4IB0A 4CD0A 5AA8A 4IBMA 3MPAA 3TTJA 4F86A 4ZSGA 3G5DA 2R3GA 3Q9YA 3F3TA 4FVPA 5GIPE 2CGWA 5DSTA 3D15A 4FSTA 2V7EA 4LUDA 4G6LA 1BUHA 3LCSA 2OJJA 1RJBA 4JLCA 4HJOA 2ITTA 3QWKA 4IZYA 2BDJA 3LBFA 2NXNA 3O8UA 4Q5EA 3S1HA 4FYOA 4QPSA 4QP7A 3PUPA 2GPYA 4C4HA 3I60A 4E8AA 2XK6A 2JIIA 2FHPA 1PYXA 3SGCA 3MYGA 4GYGA 1OECA 5JKGA 3VAPA 5ANOA 3MS9A 3QRJA 4A9RA 4EORA 3H4JA 1YXTA 4RX1A 4FGZA 3TZ9A 3NJRA 5HIJA 2JC6A 4HGYA 1X1CA 3W1FA 3QQJA 3OZ6A 4EUTA 2Y4IB 1NXKA 4EC9A 1KE8A 4RVKA 1Q62A 3QFVA 1XDSA 3FL4A 4E7WA 4ITIA 2J6MA 2XEZA 3RW9A 4CZTA 4WBOA 4F9WA 1DUSA 4GFMA 4DCMA 4QMNA 5IKMA 3HNGA 3OT3A 5EIFA 3NWWA 5DM0A 3ZLWA 4FSYA 4PYKA 5C4LA 3ZM4A 5EHYA 3BGPA 3BU6A 4X63A 3KQWA 4TYGA 4D2RA 3GOKA 4I22A 4KAOA 3C3YA 4MIKA 1UWJA 3LXLA 2FSLX 3QTIA 5TR6A 2B9IA 4JI9A 4ZLOA 2ZBPA 3R0QA 5KYGA 3S0OA 2YXEA 2XYQA 4PCLA 5KKRC 4V0QA 3KQYA 3C50A 5IQIA 2EVAA 3EPPA 4QP2A 3CP9A 2BR1A 4QYEA 4L53A 4TWOA 5KBRA 4X1OA 4IH8A 4E5WA 4W4YA 1R0PA 4B8LA 4JQ7A 1RI2A 3DCVA 1P39A 2HZ0A 3NWBA 5F20A 4S34A 1GAGA 1OL2A 3RGFA 2KW5A 1WXXA 4YUYA 2QOHA 4M8TA 4DA4A 3UE4A 2BH2A 4V04A 2EG5A 2PE2A 3IOPA 1S9JA 4M84A 3FY2A 3EVCA 5H9BA 2XJ0A 3DK6A 2OJIA 4JIKA 3R83A 3QTSA 2GQRA 4CZUA 3UYTA 4AA0A 2YISA 4CV8A 4BDAA 1FJXA 2OI4X 4EJNA 1P91A 2DYLA 5JEBA 2NP7A 3HVKA 4B6LA 4MNEB 5FADA 1TVOA 2VTNA 4PL5A 2H6DA 4XP3A 3I7BA 3JVSA 4FV0A 2UVYA 3TIZA 2XNOA 2ZWAA 5K4JA 5CU2A 3SAYA 2ZM1A 2HTEA 5AV3A 2YN8A 2CDZA 1JAMA 1GY3A 2F2UA 2ONLA 3P2EA 3ZO3A 4CWAA 5HILA 4QT1A 2VTPA 3FSFA 4FV7A 3KCFA 4ZTNA 5AUVA 1KYZA 3VBWA 4JDKA 2CMHA 2GS6A 3BU5A 2CGUA 1V0BA 3QQLA 2C1BA 1KP9A 5EMLA 3I7CA 2QODA 3R00A 4IKPA 2WPAA 2Z60A 3WIGA 3FXZA 3LCKA 2EFJA 3TACA 4AU8A 4UB7A 5GNKA 4CTJA 5CIYA 3TCPA 4BDGA 5DEWA 4WD5A 1V0OA 2V5QA 3MIAA 3FUUA 3DJ5A 2IDJA 3V5PA 4FKUA 8MHTA 3M6WA 3JXWA 3AT3A 3W2CA 4JS8A 3RP9A 3DAEA 3ZO4A 5AAGA 3CKKA 2WELA 1UNGA 4QQKA 3KN6A 3VS6A 2OBFA 4YMHA 3OF0A 5LQUA 3VUIA 2ZV2A 5GJGA 4DCGA 4E6CA 3BV3A 3Q3BA 2IP2A 2O0LA 1JSUA 3VW6A 3NUYA 4FSUA 2FA2A 3FKNA 5JUWA 2OB1A 2C5XA 2Z6QA 3RODA 5BVDA 3PSDA 2YQZA 1OL5A 4TYHA 3DNDA 5DPVA 2YJRA 2OZOA 2HZNA 3LFSA 2IO6A 3UVRA 2GAFA 1UU3A 4QQJA 4UALA 4GOLD 3VSEA 3FPHA 5JQ8A 1XBCA 2P3GX 4PTGA 3MTLA 5E8TA 4F9AA 3QCQA 1KHHA 2VO7A 4RQKA 3FPJA 3Q4ZA 2WOUA 5IQBA 4ZMFA 3EKKA 3C0IA 2BTRA 2EUFB 2LAVA 4YC3A 2XJ1A 3A26A 3NUXA 5K9IA 1CTPE 4YLJA 3I6WA 4CRSA 2HR1A 3LVPA 1YDSE 4IWPA 3ELDA 3BGZA 3PA4A 3OP5A 5FUTA 4Z9LA 3MSSA 4WXHA 5C03A 2CGXA 3NVMB 3COIA 5LCJA 3IW7A 4KA3A 4EH4A 5DNRA 4RIWB 2OJFE 1IR3A 3BQCA 4FS8A 1Q4LA 4IJ9A 5BXYA 4BHNA 2E9PA 3DJ7A 2YIXA 3KQMA 4QOXA 4JRNA 5AUWA 2QR8A 4X2NA 4YJVA 4YJOA 3NW9A 5EM7A 2JG3A 2B78A 3KRXA 4XP2A 4QP6A 2C5VA 3QTZA 3P5KA 2C1AA 5DIAA 3G2MA 3GFEA 4D1SA 2JD5A 1R18A 5C1IA 4U3ZA 2IH4A 2WXVA 4C05A 4ASXA 2B3TA 2VZ6A 3O31A 4ZTLA 4ZTBA 3DDPA 1D2HA 3CGFA 4FI1A 2UW9A 4BBMA 5K0CA 4FTQA 3R8UA 2RKUA 3LSTA 4XS2A 4NCTA 2ONYA 3PWYA 1Z57A 1YI4A 4RC3A 4HVIA 5KQRA 5CAQA 3QLGA 2OXTA 1YI3A 1KPIA 5HTBA 4GL9A 3C4XA 4EOPA 3RPSA 3OBJA 2PU8A 4ZS4A 3QAME 1WY7A 4EJ7A 4RVMA 4EWHA 2PUIA 1P2AA 5KMKA 3GGFA 2YIQA 4D4RA 5I9YA 3V8VA 2H8HA 3V04A 3T8OA 3KPUA 4DT9A 3HCDA 5LR6A 3DKFA 1BI8A 4DG3E 3UIUA 5CI7A 5IDPA 5C8MA 3A61A 4DFYA 1PJKA 2YX1A 3B2TA 3AY0A 1R00A 5T6BA 1PXIA 4Y2HA 4DAWA 2IH2A 1KOBA 4KIGA 4AF3A 5GOZA 1U59A 4Y73A 4KUJA 4FV5A 5CM2Z 4AZEA 1XH8A 1P14A 2OFUA 4C61A 4RX5A 3OU7A 4ZY4A 5FXRA 5FEQA 3H30A 1XXLA 1HOWA 3Q5IA 4F7SA 3KL8A 4AE6A 1CKPA 4NW5A 4ACDA 3WF5A 2IVSA 5E1SA 1IAHA 1WBTA 2OU7A 4FKIA 5H8GA 3BT7A 2FYTA 4DTAA 4AOIA 3TFWA 3VQHA 5CX9A 4YSMA 3QTUA 3V5TA 2CKOA 5DH3A 4HVDA 3FMEA 5L2WA 5AUXA 3FZRA 3OC1A 3VF9A 3PRFA 3GQIA 3UC4A 5L6WL 4RZVA 4Y85A 4BCPA 3NDMA 3JVRA 2CNQA 3DQXA 4PYQA 3MJ1A 2WQNA 2UZWE 3BGQA 3U8WA 3ANXA 2QU6A 4DH7A 4FBXA 4U9AA 2CCHA 4A4XA 3DTCA 4Z3VA 1U46A 2BFYA 3TKIA 3ERCA 4ENXA 3FE3A 5JGAA 5C0OE 4FZ7A 4GQBA 4ZTRA 4NUSA 3LECA 4AN9A 3GI3A 4G3EA 3AC4A 1ATPE 4V01A 3PDTA 1NVSA 1IY9A 4ZLYA 1ZZ2A 4RTJA 3VF8A 4EOJA 2I62A 3QRUA 5TOZA 5FULA 4EYJA 3PY0A 2UYHA 4I6BA 4RQVA 4FT2A 3U4UA 3P71T 2OW3A 1JG2A 3W2PA 4IX6A 3NYVA 1JG1A 2Y6OA 4O0UA 3EVZA 4I21A 3UYSA 2Z8CA 3VS4A 2OIQA 3FYCA 5EPEA 5DOSA 4FVRA 5DLSA 2YR0A 5LQJA 2QKRA 4IB5A 4FKOA 1FGIA 4OTFA 5CASA 4AG8A 1OKYA 5FQOA 3FUWA 1V39A 1XJ5A 3W16A 2A4LA 2B55A 3TM5A 1TQMA 3AOXA 4DT8A 3CD3A 3MESA 4KDRA 4I0SA 4HCUA 5AUZA 1XQZA 2VO6A 3EKNA 2OXDA 5FTGA 1UU9A 3OCSA 4BDIA 3PLSA 3E8NA 4TKSA 1WZYA 5DVRA 2FSTX 3EEYA 3BGVA 5E1MA 4PINA 2P7HA 3I6UA 5TO8A 5CD1A 5EEHA 4USDA 4YO4A 2WOTA 3TWJA 2WFYA 3FRHA 1X1AA 4FP9A 2WU7A 3NAXA 4O81A 3DXPA 1EIZA 4TYIA 3ZZEA 5IA2A 5HNIX 4IHPA 3FWQA 3G0EA 3ELUA 2WA1A 1M0EA 4YUVA 3O7LB 2J2IB 3RCDA 5EH0A 5KBQA 3F9NA 1Q3DA 3UJGA 4F6UA 3O8TA 1YHVA 2JDRA 1TKIA 1VIDA 5IEVA 5CF8A 4I5CA 4DF3A 1BYGA 3RNIA 4FEWA 4FGRA 2DS1A 2E9VA 2I0EA 3CCNA 5FM2A 5AV4A 5DM2A 3S68A 4HGTA 3NEWA 1PXKA 2PXCA 5GJDA 4JDJA 1Y6AA 3M42A 3U6HA 3FC1X 4MCVA 2XRUA 1ZMVA 4ZTMA 4DLJA 4CFXA 3BYOA 3IV6A 4RRVA 5EW8A 4WKQA 4ALUA 1Z3CA 3ELYA 4P58A 4HG2A 3E62A 5HOQA 4ER6A 3UIBA 4V0GB 2Z7QA 4O83A 3PPZA 2XK8A 2VDVE 3W32A 3OFJA 1BMKA 5CCBA 2C47A 5A4EA 5CS6A 1NV9A 1KSWA 3OCJA 4GJ2A 4PMTA 3TV7A 3WF6A 5FDPA 3Q32A 4GF5A 3I58A 3DXYA 3L1SA 3RPRA 3OCGA 3ROCA 3R8MA 3NR9A 3QXPA 2B9FA 3R9XB 5DR2A 3KVWA 4L6QA 2YVLA 4EOQA 3II5A 3PSCA 3P78A 4DEIA 5T67A 1DI9A 4CTCA 2VTSA 4GEOA 1H1SA 3QKKA 4C34A 3LKMA 3HRCA 3P2KA 4GVAA 4AQCA 4N6ZA 3UA3A 3DBCA 3LXPA 1V1KA 4WBBB 5CXZA 2HCKA 3SA0A 3VO3A 4HCTA 4K6MA 4QTDA 4LWPA 5BP7A 3LKDA 5IPJA 2C3LA 3KRJA 5M06A 3CTJA 1ZHFA 3SC1A 4XUFA 2DPMA 4LQMA 3F3UA 4CXMA 2JKKA 4QMTA 2ETRA 3R7IA 5LCKA 4A4LA 3VBYA 3DKOA 3I4BA 3Q9WA 4X0MA 3MWUA 1SZMA 4FT7A 2R3HA 4O7NA 4P7FA 4O84A 5HNGA 4MD9E 3EQGA 4AZFA 4CTBA 4ZTSA 4AA5A 3RIEA 1QPJA 2ZZMA 3PS9A 2WKMA 2HMYB 1O9UA 1W83A 2VTJA 3QQFA 4MBIA 5EDPA 3G6HA 2VWBA 3QUDA 5E8YA 4FL3A 4BP1A 3WF7A 4KIFA 4IX3A 2YM6A 4FNYA 3VULA 2OSCA 3QLFA 4GFGA 4Z7HA 1ZMWA 4K77A 3KR9A 3R1QA 4I20A 3TPZA 3CGGA 5F95A 5HQ0A 5FBNC 3CKWA 3HYHA 3R30A 3IW4A 1J3HA 1H28A 3KULA 3MW1A 5FP6A 5A6OA 4PX6A 2ESRA 3BHUA 5EZSA 4LYNA 4J8MA 3JUHA 5BYZA 1H08A 2WMBA 5BUEA 2VTTA 2XB7A 3M6VA 2C3IB 3POOA 4IACA 4U7ZA 3D14A 5CF6A 4GUBA 4G6OA 5DGZA 4CFWA 5K03A 5FXSA 3KN5A 1UVRA 4H3BA 5B2LA 3PX2A 2OZAB 4V05A 4M0ZA 3O7WA 2C6TA 4X3FC 3UNKA 3OU2A 5C9ZA 4OQEA 1PXOA 4PL3A 5EI6A 5ETAA 3QWJA 1Z5MA 3MVHA 2LGCA 3AD6A 5IEYA 3N4UA 5K8VA 2VZ9A 3EEOA 2RL5A 3ACJA 3LFDA 4QYYA 3BKWA 3IOKA 5CVUA 4BTJA 4BTKA 3FQSA 4NYEA 4BZNA 1L9KA 2JKOA 3TZ8A 2BM8A 2GA9A 1WG8A 3EFJA 3B3GA 3MCTA 4E4LA 1H00A 4BC6A 2BFXA 3IO7A 1M2QA 4XG6A 1Y8GA 5M56A 2C69A 3LHJA 4F1TA 3CQEA 1R8YA 3BUSA 3IQ7A 2OLCA 2X81A 2IJMA 4BDCA 1Q0TA 3UQGA 3EQRA 3ERKA 3FZTA 1PJZA 3UJ7A 4MYGA 1YI6A 1S9IA 2XNBA 3OW4A 4C4JA 4JR7A 5FTWA 3F61A 2BR4A 1XH5A 3Q60A 3RM6A 2BTSA 5J9LA 4NH1A 1T45A 3UZTA 1RDQE 4FE2A 4WUAA 3HGKA 5HFJA 2C7PA 4O7VA 2F2CB 4B8MA 3MFRA 3L9MA 3HP2A 1BI7A 3EFWA 3EQBA 3A7EA 5LXMA 2GCDA 4FTAA 3TM0A 3DBEA 1O9GA 4WT6A 3N4TA 2XYUA 3NLBA 4KBCA 2CWWA 3R0TA 1OGUA 4RZWA 3I53A 3W18A 5JFSA 2WTWA 4DHFA 3GRYA 2JBPA 3Q4UA 4PYMA 4W4XA 3QRTA 3SRVB 2JIUA 4HTFB 4BLWA 4NL0A 3RAHA 4E73A 4PIMA 4JAJA 4R7BA 4EC8A 4NU1A 3ZXZA 1FQ1B 4RA5A 2BALA 3GNIB 2GS9A 1LPUA 2IDKA 3UO5A 5A4LA 5GHVA 2ZV8A 2FSOX 3R9DA 2ERZE 2YTZA 2QI8A 4ZSJA 4A6EA 5P8WA 3RK5A 1MHTA 5J5SA 4YMGA 3PSBA 2XJ2A 3GCUA 5JFVA 4W4VA 3VWAA 4L8MA 2AZTA 3QC4A 1HCKA 3GGDA 2YDJA 1AQ1A 4F70A 2C30A 2W05A 1WBSA 4WRGA 4K9YA 4IV0A 4AGWA 3UBDA 3H3CA 5HBEA 3IGGA 5AP4A 3I0QA 2W1DA 2QCSA 3LXNA 4M14A 5CQUA 1AV6A 4XEYA 4G16A 4FG7A 1ZYSA 4U3YA 3EVFA 1ZG3A 1MQ4A 2G2FA 3LFFA 1PY5A 3F4KA 4EH3A 2NNWB 3DTWA 2Q0NA 5JN2A 1P4FA 2BZIB 2I6GA 4KWPA 3K54A 2BDFA 4FV2A 1G3NA 5TT7A 3FUXA 2RFNA 4N4SA 2PXAA 5LVNA 4LM5A 2C6IA 4Y72A 1WVYA 3VVHA 4PTCA 3GWZA 1J7LA 2R2PA 3A8WA 3FMMA 5EEGA 3FMDA 4JBPA 4MXAA 4QVKA 4BCQA 3EZVA 4R8RA 2ZV7A 2IG7A 4YTFA 4NFMA 4EZ5A 5CU0A 1UWVA 3PZHA 4R3RA 3QD4A 2XM8A 4RGJA 3UWPA 2WB8A 5LQCA 1UV5A 3QX4A 3JWGA 2VX3A 5HICA 1IG1A 3LZBA 3MA6A 5EMMA 2XZSA 3OWPA 3FKLA 3EL8A 5ICEA 3F2RA 5CSXA 5IA3A 2WGJA 4LUEA 3M6XA 2J0KA 4ZEGA 3F7WA 4GOMD 4S30A 4BHZA 1WBWA 1YRPA 2B53A 4X21A 2X0GA 4FTJA 2OFVA 3QCSA 4DH5A 4FZFB 4MQ1A 4S31A 5IU2A 4B99A 3V51A 4BGGA 4FUXA 3A8XA 4KWCA 1QZZA 3PE1A 4QP4A 3IHTA 5F9EA 4PF4A 1ZKDA 5M09A 4O2PA 2OJ9A 4F4PA 3OOGA 2B9JA 4RJ8A 5KMLA 1GIHA 2AOTB 1JLUE 4WIHA 3PPKA 4O38A 5CALA 2PZ5A 3LQ8A 2C0IA 3EFKA 2PVYA 4IAYA 4PQNA 4YNEA 4IVDA 3IYLW 3LDFA 2PUUA 4E31A 3P7BA 2X2KA 1PKGA 3ME5A 2VGOA 4NZWB 4RIOA 2JEDA 4O21A 4XX9A 3B3FA 3ZFYA 3NUPA 5B2MA 3IG7A 1NT2A 3W33A 2BIKB 3MTIA 2I0YA 4CTKA 3FYJX 3TRKA 3OTUA 5AUYA 3HCCA 2XKFA 2PWPA 4NKAA 3DS6A 1FMOE 5CI6A 4UX9A 2RG5A 2QHNA 3ZC6A 4DH1A 1XR1A 2UZBA 2QOOA 4FV3A 4Y46A 2WMUA 3LDUA 3AMAA 5AV0A 5EW9A 1NV8A 4RT7A 1RW8A 3PXYA 4CKBA 3BU3A 1F0QA 5CVGA 2JDVA 3TV4A 4NFNA 2PVFA 3D2KA 5L2SA 1RJEA 2W5HA 4O7SA 2P35A 2BPMA 1I09A 4AFJA 4E2XA 5CAUA 3OZRA 3VC1A 1R3CA 1WXWA 3MY5A 1ZOEA 1KWPA 3QRKA 4C02A 3P79A 4D4VA 5IISA 2AOWA 4RC4A 5CEIA 5DHJA 4WOVA 3N4VA 1XBBA 4ORKA 4JBVA 2UVXA 4LV5A 3UBTA 4QDKA 3B8QA 5AFVA 1AGWA 2GQSA 3UVQA 3NCZA 1JKTA 4GKIA 1LR4A 3HMNA 3E8CA 3CBLA 4IQ6A 1QYRA 4BBEA 4EQCA 4J1RA 1OM1A 2V62A 4RSSA 4KRGA 5JZJA 2NO3A 5KVAA 2V74B 3VUMA 3R7UA 4A9YA 4BCMA 2B9EA 4EK4A 3KPJA 5A4QA 2YM3A 4IX4A 3ELWA 4C3FA 5LVOA 5IH3A 5BUIA 2X8EA 4DH3A 4YUWA 2PLWA 1YWVA 5HBHA 4U44A 4DG2E 1RQQA 3SW7A 1OL1A 2AVNA 3G9LX 2I40A 2WEIA 2VRXA 3A7GA 2NPQA 2R6ZA 2PZPA 3F82A 4HOKA 3DKGA 4I0TA 1UKIA 4GRBA 3HCAA 3ZRKA 3NTVA 3IW6A 4GKHA 4EHVA 1KE6A 4OTIA 1PXLA 1ZGJA 2ZB1A 1F5QA 3LQ3A 3ULIA 4G3GA 3UP2A 2P2HA 2BRGA 2C6MA 3G8AA 5FUBA 4CKJA 1HMYA 3GCVA 3REPA 3HUCA 1YWNA 4U40A 3NSZA 3PVUA 1P5EA 3SSMA 1SNUA 3PWDA 3KU2A 3DGKA 4ZS0A 5DTRA 2J5EA 1KV1A 2IVVA 3FUVA 4TY1A 4NIFB 3PTAA 3QA0A 2E5WA 5HESA 3RAIA 3TNIA 4K33A 1GZ8A 3PFGA 2ETMA 1H25A 1M2PA 2XNGA 1K9AA 4D2SA 1JQEA 4AWIA 4YTHA 2IZRA 3LIJA 4IAKA 3QKLA 4UYNA 5EQPA 2X9EA 1BC5A 2CLXA 1YXUA 2IW8A 3LDGA 4BCNA 2P4IA 4FTOA 4AW5A 3QA8A 1FVRA 4RA4A 3JWHA 3D7ZA 3C13A 1TPYA 3LJ2A 4YJPA 2YXDA 3B5IA 3GC9A 4X6RA 2BKKA 1U54B 4UZDA 3BHVA 3OFKA 4KRCA 1CSNA 3ZS5A 4IW0A 3F3ZA 2ACXA 3KPVA 4IM0A 4JXJA 3L9PA 3OXTA 3QOWA 1CKJA 4PDPA 3TUBA 4FEXA 2O2UA 5ANGA 2GNGA 5M08A 2O64A 5K5NA 1JTEA 1A48A 2BR3A 3DLIA 2AR0A 4FZ6A 5L6PA 2H00A 4YGAA 2ZDTA 5GINE 3RPYA 5ETIA 5M53A 3H9RA 1MRYA 4JL9A 5JZNA 3LFAA 2VV9A 3EN9A 2ITVA 4ISCA 3FKOA 5HE3A 2VO0A 2E9UA 2CSNA 2IVUA 4BP3A 4HW7A 3OMVA 3NW5A 2QOQA 1B42A 3B7PA 2BHEA 3WIKA 4APCA 3LPMA 3NYOA 3P86A 4RVDA 2YUIA 2QRVA 3V97A 4L3LA 4TPTA 4XV1A 4F64A 2JKMA 4TYJA 5CNOA 3H9FA 3SXRA 1ZGAA 5AWMA 2LD4A 3L8SA 4FSZA 4TL0A 3CR0A 5DR9A 4EKLA 5K0BA 3NVKI 4R05A 4EQZA 4ERKA 4D1ZA 2X9FA 4D5KA 4ANMA 4DFNA 3MQ2A 4D0XA 3KFAA 5BVEA 2XCKA 3UZPA 4AGDA 1W98A 4MK0A 4J52A 4M12A 4UEUA 4RFMA 3UTOA 4DMGA 2EB2A 5A4CA 5LWNA 4XRJA 1QL6A 2UV2A 2XUUA 3W2RA 2CMWA 1KPHA 3DOUA 5K0JA 3OWJA 5HCZA 4U6RA 3CIKA 4YV0A 2F57A 1OL6A 4X7QA 3TDWA 4J98A 1FVVA 4C62A 5JSMA 4PL4A 3ORHA 2WA2A 3VBVA 4ACMA 1QAOA 2DUVA 1PXJA 5F4NA 3QUPA 2XIXA 4GIIA 3JS2A 2W1CA 4O0XA 1F38A 2AN4A 4D28A 5E8ZA 2R64A 4Y30A 4MD8E 4LFIA 4R78A 2UZTA 3C51A 2IZUA 5AM6A 4MTLA 3DH0A 2UZNA 3DK7A 4OTHA 4C0TA 5EKXA 3BQRA 4RLKA 3AC5A 2WIPA 5CVFA 3GRVA 3WF8A 4DCEA 4WVLA 3PRIA 1Q24A 5KZ0A 3VHKA 3CTHA 4CEGA 4GIHA 4RTOA 5GWXA 4O6LA 2VTHA 2Z7SA 4R1YA 4O0VA 1N2XA 2OKCA 4C4AA 4FSXA 2W4KA 5E1DA 3P0MA 2VAGA 2XKEA 1I4WA 3QBNA 2R9SA 2GS7A 3GP0A 4GK3A 4AZVA 3D5VA 1KV2A 4QTBA 1G55A 4PV0A 4XYFA 5AP1A 1EJ6A 3BKXA 4BDDA 1KXZA 3G89A 3PJ1A 2CNVA 1NBHA 4RJ4A 3FYDA 3Q7EA 2XH5A 3GQLA 4HGZA 2X6DA 4G56A 1YXSA 3OTVA 2WMRA 4H39A 3R9RA 4BB4A 3HMPA 5D12A 4E26A 3WZUA 3RWPA 4EONA 3UJ8A 1OL7A 4FKQA 4ZIMA 3EMDA 2GNHA 3QV2A 3CBGA 4NTTA 4CQEA 4DA5A 1FINA 1PXNA 2WTKB 2P8JA 3VJOA 4FTMA 4E2ZA 3FDNA 3AXTA 2FB8A 3H0YA 4TWNA 2X8IA 5C9CA 4AAAA 1QMZA 4R6WA 4H3QA 5HD4A 3D83A 4I24A 3ORPA 3SR4A 2EX4A 2DWBA 5EDQA 2PT6A 4ZY6A 2FVDA 2J0MB 5KUPA 4KIOA 2ZSUA 2F7EE 1DL5A 3K5VA 3EOCA 3NNWA 5I9UA 3R2YA 2BROA 4J97A 2PVNA 1QAMA 3HA5A 1AF7A 4HSGA 4LWOA 4X3FA 3PB3A 2W1ZA 2PX2A 2O65A 1H26A 4YJNA 1AD5A 3MB7A 4DEGA 3TL8A 4RIYB 3ORXA 5E9JA 5EW3A 5IA1A 5CYIA 3R9OA 3KF4A 5DA3A 4R3CA 4R1VA 2ZLBA 5IQGA 1XH4A 4IWNA 4YJTA 4GT5A 3HM2A 1GOLA 3Q9ZA 2QOFA 3GRUA 3FZSA 2PMNX 1M2RA 3R1SA 4R6XA 3G5TA 5LQKA 4XG9A 1LP4A 3BBTB 2ZCJA 2XIKA 5CZHA 3AT2A 4O96A 2VWUA 2QOKA 4PIPA 1KPGA 1JSTA 5E2AA 3UG1A 4BR3A 1QAQA 5L6OA 4R3PA 4EK6A 3OZTA 4FT9A 4BGQA 4LECA 3GBZA 4RWIA 4AX8A 1R0EA 3OUNB 4FODA 4WRSA 1SUIA 4OBWA 3LCCA 2H1RA 4MKCA 5FEEA 1JKLA 3BPRA 4DN5A 4FTCA 4AGUA 4IC8A 4CKEA 5E9QA 5T68A 2YA9A 3LMGA 3BWBA 1YQJA 2AOVA 3N51A 3VUKA 4R7IA 2I0HA 4I23A 4A9UA 2CN5A 3F3VA 4RFYA 3HLLA 2ZMDA 1BOOA 5LQNA 3GCQA 2FK8A 4IANA 4I3ZA 3EYHA 3MTEA 1R6AA 3SDJA 1Z9XA 3H2BA 3TQSA 4Y83A 5HTCA 1SVHA 5HU3A 2QO7A 5CEMA 1KE5A 3RZBA 2WTCA 3K5UA 3L8DA 3B2WA 5DRDA 4F65A 2R3RA 3EQPA 5CSVA 3DQWA 4H05A 4XG7A 4EQMA 5LSAA 4NM7A 2IW9A 4FKGA 5TF9A 2ZULA 4UY9A 3T9TA 4AN3A 4EOOA 3M6UA 4DGGA 3VN9A 1WZNA 4U45A 4G34A 3PY3A 4YP8A 3C4CA 1L3IA 4RVFA 4J7BA 4FKLA 3NS9A 5E8VA 3ZSGA 3A62A 3KQOA 5AMNA 4B7TA 4UN0C 1OBGA 1WFCA 3WYYA 3HV4A 4K8AA 3SM3A 4AS0A 3DZQA 3TT0A 4DQ0A 1IA8A 3SOAA 2E9OA 3OEFX 4O7TA 5CAVA 1Q8WA 1G8AA 2F9GA 4FEUA 1ZQ9A 4R6VA 3GU3A 4QNAA 3LQ5A 4RTLA 2QVSE 4FZDB 4QP1A 2ITQA 2WQOA 2G1PA 4FK6A 2H96A 2OK1A 3RTPA 4DGMA 3LE6A 3KA0A 3HL7A 5LOHA 2ONZA 4NECA 3AJDA 3NNUA 5HZMA 4ZZOA 3P23A 5KMNA 4FIIA 5DWQA 2UW6A 2ZM4A 1ZYJA 4PP9A 5CVEA 2XS0A 3DP7A 4MNEA 3EN7A 1YW2A 2UZUE 3VS5A 1WCCA 2XVDA 3FLQA 4PY1A 4RTSA 4O0YA 3SGLA 3NW7A 4WSYA 2ZAZA 2JKQA 4BCOA 4DBXA 5DEYA 4JG8A 1BL7A 4K11A 2QYOA 1B38A 1QPDA 3CPCA 3KXNA 4WNKA 2GNLA 3E7VA 2XKDA 3EGEA 1E9HA 2C6OA 3A7JA 3SHEA 2QD9A 1VP9A 4AUAA 3LM0A 4MXZA 5HIEA 3G0FA 3HCBA 2JIVA 4FIEA 5EOLA 2QQ7A 3P9CA 1H24A 1SM2A 2ZBQA 4OQDA 2JFMA 3SLSA 3ZMMA 3E63A 3G7UA 5CVJA 4HPUE 1YB2A 2HY0A 4EH9A 2HW6A 4RTNA 5LMAA 5D41A 3BXOA 5JQ5A 1QCFA 2R3IA 3KR0A 3TKAA 3RI1A 3TKYA 1Q8YA 2V22A 3PA3A 3GCPA 3V01A 2UW7A 1CDKA 1ZY4A 3HA3A 1R78A 4XCUA 3TKHA 3HCEA 1SKMA 4QP8A 5JFXA 2ZB0A 4AFEA 4H1MA 4F99A 2W9FB 2P55A 3JWIA 5J1WA 2VDWA 2X6EA 3CEKA 3LLTA 3HMMA 5HE1A 4FIFA 4D4YA 2WIHA 4XOZA 3R7YA 3BYMA 1P4OA 3QX2A 4K18A 3FMJA 1JKKA 2O63A 4TWCA 5AV1A 5C8NA 5D10A 3M2WA 4LV8A 1XKKA 3C0GA 3VNTA 4USFA 3OT8A 4R77A 3R71A 3BZBA 4UWCA 3EMGA 3MB5A 4GG5A 5HZNA 3Q4CA 5DYJA 4EI4A 2P3LA 2ITOA 2EXCX 2J90A 2UZVA 3V8WA 1IRKA 1G38A 3OCTA 2C6KA 2NRUA 3DUWA 1MQBA 3HA8A 3LMHA 3ZOSA 4QYFA 4DFBA 4NJDA 5MHTA 4OR5A 3B3JA 4MXXA 2F7XE 1ZYCA 5LMBA 5JR3A 3NCGA 4FT0A 1JNKA 2XBMA 5HVYA 4LMNA 4F08A 5JMSA 2PV0A 5IMEA 5LVLA 4EBVA 4QVGA 4EH2A 1FBNA 2WAJA 5EIWA 2HAKA 3BHYA 5ETCA 3MHTA 3OBGA 4RIWA 3HEMA 3COKA 4O27B 4X2FA 4YHFA 3Q6WA 3PJCA 2UVZA 4RVGA 2B25A 2QG7A 4YZMA 2RG6A 1W84A 5DM1A 3RAWA 4LGHA 5EOVA 5FQDC 4HYHA 3IEIA 4ER7A 4F9BA 4CG8A 3UOKA 5IH6A 2W06A 4C3RA 4C08A 3KXZA 1U4DA 5HEZA 3VS3A 4GC5A 4NM5A 4L00A 5HHWA 4M36A 3LCTA 2E9NA 1I44A 2O07A 4L3JA 4I5MA 3HVHA 3NYNA 2HWPA 3VS1A 3GU7A 3QQGA 3DNEA 4Z16A 4C2VA 4CFFA 4BYJA 3PPJA 5BVKA 2VWVA 4EHEA 2ITNA 4U79A 3RM7A 1XTPA 5HD7A 5EC8A 1M14A 3QD3A 3P9JA 1O6LA 5IMXA 2WTVA 2W0JA 4BLUA 3BLQA 4CG9A 5ICFA 4QQTA 1NW7A 1OIUA 5GIOE 4M7RA 2A2AA 4FOCA 1Q3WA 5IH4A 2B4SB 4U8ZA 5KHWA 3U6JA 3QYWA 4F63A 4ZZNA 3PVWA 4JJRA 3ZHPC 3E93A 3FZGA 5IA4A 1YXVA 5AP0A 1VLMA 5E8UA 2XBJA 4JQEA 4MD7E 4P7EA 5AP2A 5BYLA 4JOAA 2P3OA 2BKZA 3MY0A 3PFHA 4BN1A 3BIZA 5IUIA 2YM4A 2UW0A 3QKMA 4FTLA 2YIRA 3VBQA 5A54A 2ITPA 3TOSA 1J1BA 3ZYAA 4F1MA 5EMKA 2YXLA 2YM8A 1YKRA 4O91A 1FOTA 4XBRA 4E4MA 3OOMA 3Q87B 9MHTA 2X1NA 4CKIA 1UU8A 4GMYA 3ZCLA 3FL5A 3MN3A 3EIDA 4Q9ZA 4GK4A 3GRRA 2XK9A 2BRNA 5DXAA 3HMIA 4EEVA 3O71A 4IEBA 2W99B 3R73A 5F1ZA 2ZJWA 4IZ7A 5AP7A 3CCFA 1JBPE 4FSDA 4PNIA 1LEZA 1KE9A 5HO8A 2HW7A 4QMSA 3SXJA 2VS1A 2YCFA 5FTOA 3FI3A 2PSQA 3UQFA 3ALOA 4KVZA 4YV1A 3IGOA 5A9UA 4XLVA 3N9XA 3GDHA 2UZDA 1EG2A 2RFDA 4AOTA 3BE2A 3ODYX 3KXXA 3EQIA 4FX3A 1IM8A 5LJJA 4R5SA 3OE4A 3H0ZA 3SXFA 3DFCB 2ZIFA 2W1IA 4FUYA 4C33A 3AQVA 3MBLA 3HAVA 4AW2A 3OHTA 2B0QA 3P08A 2VX0A 4G31A 4RWZA 3HA7A 3NNXA 4L7FA 4YJQA 1IEPA 2QNJA 2GHMA 4U97A 4YLKA 2JDSA 3C7QA 1YZHA 5HIDA 2GPHA 2WQBA 1GZOA 1W0XC 4YBKA 5HLWA 2PX4A 2J0LA 3COMA 4QYHA 2R3KA 4A6DA 3FLYA 5B1SA 3GENA 2Z6AA 4DFXE 3H10A 1ZOHA 2CKQA 4GT3A 1Y8YA 2CKDA 2P41A 2X8DA 3NUAA 3CC8A 5DX0A 3HVCA 4WNOA 5HORA 4YSJA 5CU6A 2JBOA 2PULA 3TZMA 1O54A 3HRBA 2YIYA 4FKWA 3R7EA 1UNLA 4FT5A 4PYJA 5CANA 3SOCA 2V7OA 4W8EA 2WMWA 3KPYA 2DULA 4IB1A 4L43A 2WMQA 1JQ3A 4XLIA 2WTDA 4FL1A 5IA0A 4JVGA 1REJA 2J51A 2PYWA 1WVXA 3FMLA 3ENHA 3OVVA 4LRMA 3LW0A 2BHHA 3A60A 3KKVA 3UGCA 4EKIA 5I9ZA 3EVDA 4I94A 3V8TA 3KQTA 2ITYA 2G8NA 4F7JA 2ZDUA 4QMPA 2JLDA 4DE4A 4DFLA 3BWYA 2QM3A 3TNPC 3BX5A 3EQCA 5CEOA 3GC8A 4I5PA 4D1XA 1XH6A 2HXQA 4S32A 2ITUA 5CU4A 3AT4A 3I79A 3TXOA 3R8PA 1IA9A 5CSWA 3BE9A 4E4NA 1X1DA 4YO6A 3FUPA 4G5JA 3OG7A 1I1NA 3TG1A 1H1QA 3PE2A 4MHAA 5FG8A 4J8NA 3PXKA 2OJGA 4YZDA 5HCYA 3MH2A 2G15A 2AVDA 2ERCA 3TUDA 4XV2A 3ZUTA 3C4EA 2ZIEA 3DAKA 4QPNA 2YDKA 3UDBA 3KEXA 1L1EA 4YUZA 1NY3A 4YC8A 3ELJA 1WBOA 3FPQA 4BCJA 3LFCA 1PYEA 2G72A 3G88A 2QKWB 4DEBA 3JR1A 4X3JA 7MHTA 2BAJA 3VUGA 2PX8A 4CFMA 4WG5A 5M4UA 2V0DA 3K3IA 2UZ4A 4USEA 4O6EA 1G60A 4L46A 4PYNA 1VL5A 3ZO2A 4V0GA 1EJ0A 4OA5A 3CY2A 1SUSA 4EZ3A 3PFQA 3KY2A 3VBTA 4CKRA 3VJNA 4PGHA 4KBKA 2PX5A 3G6GA 1H01A 3R2BA 4GG7A 4DFUA 2VP3A 3R6TA 4P7KA 2ESMA 2CHLA 4EHGA 3HP7A 1NA7A 3O17A 1MJFA 3BEGA 4J96A 3UOJA 4O82A 2UYOA 3MVLA 4YPSA 3FZOA 4GBED 3G2FA 5FLFA 1CKIA 4YPDA 4ANQA 3GOPA 3LX6A 4BDKA 3ZLXA 2XNPA 1G5SA 1JSXA 5IQFA 2JDOA 4C35A 5E8JA 1YDTE 4BICA 4PDYA 4O86A 2XNEA 2UZOA 5FA8A 5G1XA 4P2KA 3FZPA 3GCSA 4D4SA 4A4OA 3QZFA 3R9NA 3THSA 4IDTA 4ZMEA 2B1PA 2F7ZE 5IEXA 2X7OA 3SMQA 4OTQA 3LFQA 4ZSAA 4G3CA 4PMSA 3F2NA 3UOLA 4WNMA 4AZSA 1A06A 2PGXA 3HNRA 3DLSA 4MXCA 5LMKC 2YWVA 2GDOA 3VC2A 5BNJA 3A4TA 3R8VA 2QO2A 4OBXA 3KQVA 2QHMA 2UYQA 3FZ1A 1Y6BA 3Q52A 4FNZA 5EYCA 3EVBA 5L3AA 2AN3A 4L42A 4HC4A 3DXNA 1JR4A 4ACHA 3UMWA 2XA4A 2SRCA 3E5AA 3HUBA 3SKCA 3P97A 3NIZA 2W1GA 3W2OA 3TTIA 3G9NA 5M5BA 5DSXA 2AOUA 4ZZMA 4LG4A 4BYIA 1YHWA 3WZDA 3BHHA 4C03A 3KQPA 4YZCA 5DRTA 2WTKC 4YHJA 3WSTA 4A9TA 3KKZA 5EG3A 4B0GA 3E8SA 4ER0A 3WF9A 4HVSA 2YABA 3O2MA 4RJ6A 4JG7A 3QTWA 5D7VA 5CTPA 4C36A 4KSPA 3PX3A 1QANA 5AEPA 4UZHA 4JNWA 3SG9A 1T43A 4BGHA 3FHRA 3MTFA 2OBJA 1YFJA 4GOND 5KO1A 5L8KA 3F5XA 1YDRE 3U9CA 4BY9E 4QMLA 1UU7A 2XK4A 3RPOA 5HI2A 4AE9A 5CEKA 2OZAA 1YXXA 3EH9A 3G33A 2WTIA 3UPZA 4XUDA 2VNYA 4HZSA 2I6LA 3F5GA 4C58A 4FOBA 4QMYA 2J7TA 5E4HA 2XNNA 4UBAA 3GT8A 3KHKA 4TNDA 3ZRMA 2X7GA 1JPAA 1OKZA 2JDTA 3LHDA 4CCUA 3QCXA 1OPKA 2PMIA 4E2YA 4ANLA 3DXQA 5FXQA 5E9WA 3R8LA 2FRXA 4RWKA 4RC2A 5K05A 3RKBA 3Q4TA 4QQCA 4RVLA 4ALVA 4OX9Y 2BDWA 4L01A 2XK7A 3IDCA 2A14A 1M7NA 4C06A 2YJSA 5E92A 4F09A 3KF7A 4TRLA 3ORIA 3DOGA 1U2ZA 2G71A 1UWHA 3FBVA 5FDXA 2QO9A 1O6YA 3I5UA 1UKHA 3HA6A 1A9UA 3KRLA 4X3FB 5H2UA 1GIIA 5JK3A 3UA4A 2F8LA 3TJCA 4FV4A 2PPQA 1LEWA 2QY6A 4JDHA 3QGYA 2ZFUA 1YHSA 2VUWA 2PKWA 5L8LA 4EH6A 3GUBA 4RIXA 4G5PA 4K6ZA 1V0PA 4GFOA 5CF5A 3DK3A 2O57A 4EK8A 2VTQA 5AP6A 5HLNA 5H3QA 3KMMA 5EKOA 2J50A 2WMTA 2Y9QA 3LFNA 1XH7A 3OUKA 4IAFA 3FTFA 1VPTA 3T0IA 2O3PA 1XJDA 1J7UA 3TJDA 4EHZA 4P7GA 4DYMA 3GNLA 3SRVA 2FGIA 4HTFA 4ZJJA 4AACA 5KMIA 1PKDA 1SVGA 2G01A 3MIYA 4QP9A 3KK9A 3R8ZA 2QC6A 3R22A 2AC5A 4X6QC 1OZ1A 4ID7A 3AGMA 4O0RA 2QOCA 3AC3A 2CJMA 3GU8A 4EWQA 2PVJA 4JDIA 1ZXEA 4J95A 4DEHA 3NDIA 2PMLX 3HEGA 5CY3A 2CMGA 3ZTXA 4GOOD 4E32A 4ERWA 4V0RA 2GTMA 3S4QA 4RVHA 5LQFA 4UYAA 5HIBA 3AC1A 3LXKA 3UC3A 1BKXA 2VD5A 4CSVA 4TN6A 2UZEA 1OUKA 5CT0A 5EHGA 4KS7A 4U7PB 4KB8A 2AS0A 2WNTA 2W17A 1I9GA 2GFCA 1VP3A 3DBDA 3EGIA 2Z2WA 3V8SA 3R7OA 2HNKA 4CVAA 3SQQA 4YC6A 2JGZA 3ZO1A 4U43A 3FXWA 3W2QA 4AOJA 2QOLA 4JR3A 4GH2A 5ITAA 2PY3A 3EWHA 2DQ7X 4C37A 2BZJA 5K0LA 1BHJA 4F1OA 2UZLA 2R3SA 4B4LA 1XCJA 3LOKA 4MQ4A 3OFMA 5AX9A 1TQPA 4KS8A 2W4JA 4CMUA 1VZOA 1KIAA 4RJ7A 5EM8A 4EK3A 2H11A 3JPVA 1RJDA 3DXXA 1NW1A 4BKJA 3KXHA 4LGGA 1XCLA 3V6RA 5DRBA 2BMCA 2VTAA 4E5AX 3P9NA 3QD0A 3W2SA 4IAIA 2JHPA 5CEQA 4DBNA 4L9IA 3UMXA 2GH1A 2C7QA 3VS0A 3DJ6A 4BBFA 4F6WA 4EZ7A 4ITHA 3IKAA 4ZK5A 3A4PA 3U55A 1W8CA 4HPTE 4G17A 1NBIA 1U5QA 3EYGA 3O23A 4EVIA 3LCVB 1NW8A 3NAYA 1OKWA 3C4FA 3LMIA 4ZJIA 3NNVA 4E2WA 2EU9A 4UWYA 2YERA 1CMKE 4PMMA 3UFBA 1J7IA 4E20A 5A6NA 1IAJA 2FK7A 4PONA 3QXOA 5KZIA 1M7QA 3JY9A 1TW2A 3PG1A 4QMVA 5A4TA 4QTTB 3DA6A 4XMOA 3FPMA 3ROYA 3HDNA 5AX3A 2AOTA 4BIDA 5E2BA 3Q6UA 1JTFA 3CKXA 3CJQA 1WBNA 5EQYA 3E23A 2HWKA 3E3BX 2Y4IC 3A25A 3C0HA 3EGVA 2R3LA 1Y8CA 5I9VA 2OXYA 5CEPA 1T46A 4RLLA 1H07A 4I4EA 5ICGA 2I0VA 1Q97A 3PTGA 3QGWA 5IQDA 4FNXA 5AADA 3VHEA 2B52A 2GFSA 3VUHA 2PJDA 3BELA 3WE8A 2Q41A 3NUNA 4M67A 2RIOA 4LRJA 3MB6A 4RBLA 1QPEA 1D2GA 5G6VA 4AW0A 3DY7A 3ZDUA 3C3PA 2W5AA 1F3LA 3HDMA 3ZSIA 3MPTA 4PNKA 4BTMA 1P1CA 4Z55A 3GIWA 3LCDA 1RI4A 3AMYA 4E33A 2W4OA 1H1WA 1RJFA 1NVRA 5H8BA 2C5OA 5EQJB 2ITWA 3TIYA 5HE0A 3HKOA 3DXZA 3AG9A 4KINA 5BQ0A 3FV8A 5HLPA 3VRZA 4E5BA 3QHWA 4W8DA 5EQEA 2ADMA 5CZIA 4BRXA 4QMOA 3OU6A 4RPVA 3VW8A 1WBVA 3ORNA 4ATNA 2IN6A 4YUXA 4KD1A 3PJ3A 4F7NA 2PVCA 1PMNA 2ZW9A 4O2ZA 3I64A 4JBQA 1RI3A 2HV9A 2GTNA 3A99A 3BYVA 3D9VA 4C38A 4MWZA 2EJUA 3ETAA 2C5YA 1AQIA 5AUTA 4S2ZA 1DCTA 3NUUA 2VNWA 4C4EA 5EKUA 5CENA 2QLQA 2OZVA 2BR5A 1VR2A 2Y0AA 3UNJA 3FPGA 2HYYA 3ANRA 4RX7A 4E4XA 5T6KA 3V5WA 4GK2A 4GS6A 4E6AA 4TT7A 3FMHA 4X41A 5AM7A 5C4KA 4OTWA 4FZAB 4ER5A 3UG2A 3WE4A 4DG0E 4M7IA 5ANJA 1MUOA 2C4GA 2A27A 2C6EA 2Y6MA 3ZLSA 2N47A 2YEXA 4C3PA 4MEDA 4ANBA 3VYWA 4F6SA 4F7LA 3K6RA 1XWSA 3FTCA 5BMMA 1VQ1A 4ITJA 3GRZA 3RMFA 5L2TA 3L9NA 2UW5A 4AT5A 2FO0A 5DT3A 2BUJA 1QPCA 4QPPA 4MXYA 5EFQA 3F88A 2V55A 4L3PA 5EG5A 3DZOA 3TUCA 2JAMA 2ZIGA 4GT4A 3E8EA 3PXRA 1REKA 5CVHA 3QHRA 3REOA 2IGTA 4L7VA 2R3OA 1H4LA 3C4WA 1LUFA 4KW7A 4FV8A 3UNZA 3RJCA 3ZEWA 3ZFMA 1R39A 1MP8A 3A7DA 2OKRA 2GU8A 5JH6A 2JHCA 4WG3A 4RTMA 5LVMA 1UA2A 2BAQA 4OTRA 2PZYA 2AUHA 4FEVA 4HNIA 3S95A 4F9CA 4DCAA 5HG8A 2HZIA 3R04A 2GMXA 4G2FA 4OW8A 4ALWA 1L3RE 5KMMA 2J0IA 2IH5A 1XBAA 3ZC5A 4LOOA 5HIKA 4XG2A 2PHKA 4WG4A 3ZBFA 3I5NA 2YHVA 4F0FA 3QD2B 4KABA 4HVHA 5FWAA 5B0XA 3CJRA 4WA9A 1B39A 4BZDA 3WARA 4UOEA 4EYMA 5CF4A 2QR7A 3NZ0A 5BVWA 2CKEA 4U0IA 3MCZA 3FPEA 4MVFA 4A9SA 4LOQA 5BVNA 3VRYA 4BDBA 1U54A 3ZSHA 5IUHA 3RVGA 3O7LD 4QO9A 4ZSLA 4ER3A 2FH9A 5DTQA 4I93A 2VTRA 3P1AA 3GXLA 1NVQA 4PP7A 1ZRZA 3Q04A 1D2CA 3F5UA 1OUYA 3LAUA 4BF2A 4GSBA 4CMOA 1L3BA 5I5ZA 5TKDA 4FG8A 5C01A 2ZTHA 4FSWA 2IIPA 4IVBA 3AXWA 1ORHA 4M13A 2PVMA 4G3FA 3Q9XA 3SVVA 4GU9A 3LCOA 3BKBA 2RGPA 4TYHB 3FLWA 5J1VA 2WMAA 4ENYA 2WMVA 5E8XA 4TXCA 4YJRA 3O0GA 5CAOA 2K4MA 4AA4A 4OA8A 3MH0A 5I0BA 4EK9A 1WMKA 4GYIA 2Y1WA 1WVWA 1RE8A 3QF9A 3U6IA 4YJSA 4PGGA 1YFLA 3F69A 4X61A 4M68A 3D5WA 2VWYA 5J9ZA 4RTQA 3WZKA 4IM3A 4FKJA 4H58A 1FPQA 4F0GA 2OICA 5IUGA 2J5FA 4Z2YA 3HV7A 2XF0A 1KOAA 3LL7A 2BM9A 4JRVA 3TKUA 4FIGA 1WAKA 4RTKA 3MY1A 3UZRA 3A7FA 3G8BA 1JQDA 5E1BA 4OBPA 5BX0A 4CLJA 5M51A 2BZGA 2YZAA 1PMUA 3FY0A 1PMEA 4DEDA 2WQMA 4FV6A 2XIRA 5HX6A 3LLAA 2R3PA 2ITZA 4HH4A 2ZV9A 1H0VA 1Y57A 2A1AB 1H8FA 1STCE 3MDYA 4BZOA 4P90A 1ZZLA 2YITA 3PJ8A 5GM2A 2QOBA 1DAWA 2VGPA 1TW3A 4QTAA 3EVAA 5M4CA 5IG1A 5E1OA 3DULA 2H34A 4P5QA 2X39A 5HKMA 1R74A 1YZ3A 2OB2A 5DR6A 3TM4A 2A19B 3DR5A 1H1RA 4DLIA 4JG6A 3PG3A 3NWEA 3GFWA 4I6HA 2FYSA 2XYRA 4F84A 1ZAOA 4FR0A 3A7IA 5KCVA 4KRDA 4RX8A 2G2HA 3MFTA 4OTGA 3C0KA 2O05A 1SYKA 2FCAA 1P1BA 1SQGA 4K0YA 3M11A 4N57A 2WHBA 4EOMA 3TR6A 5KNJA 2BRMA 3QTXA 2PL0A 1Q0SA 3UJDA 4TTHB 5KMOA 1VYWA 5FCDA 2YFXA 2P40A 4CFNA 4Q5HA 5LMKA 3G15A 5FTQA 3TI1A 3MV5A 1BLXA 1FGKA 3U51A 3EB0A 4ZTQA 3Q53A 5F94A 4G9RA 2XMYA 5KE0A 1YOMA 3NMUF 1ZWSA 1ND4A 4IAZA 4P4CA 2C6LA 5A3XA 4O29A 3ANQA 4LRKA 4NM3A 5G02A 4O22A 3AC2A 3NX8A 2CN8A 5IQEA 4HNFA 4UXQA 3C5IA 5CVVA 3D2IA 4GUEA 4XOYA 4B17A 5HIMA 3D7TA 1URCA 2VTMA 2I7CA 2HENA 3NUSA 5AJQA 2FSMX 2C7OA 3D5XA 2C3JA 2HK5A 3CJTA 3KMUA 3BLHA 3UJCA 2Y7JA 5C1QB 1BKYA 3Q2JA 4L52A 4IB3A 5BVOA 4FT4A 5EZQA 4FTIA 3V6SA 2YAAA 4XNEA 2QE6A 3PVBA 5HX8A 5K0NA 2O5KA 1F3MC 2XEYA 5A46A 5AA9A 5AUUA 4JBOA 2HXLA 2XYNA 2PVKA 2AC3A 5E90A 1JQHA 4IMYA 5EM6A 3KU1A 1Q8ZA 2CPKE 3G2QA 3DTNA 3ENMA 3U81A 3JY0A 3FRIA 3WILA 4QMQA 4E6DA 2WK1A 3MERA 3BWJA 5I9XA 4QMUA 3BI6A 3GC7A 3DB8A 3HVIA 4RIYA 4FT3A 4QMWA 1K3AA 3G51A 4C7TA 3WBLA 4AN2A 5HNBA 3O4FA 4DGLC 4H0NA 2RF9A 3DMFA 3QALE 3ER8A 5BW5A 5LWMA 3QTRA 3ID6C 2PWLA 3FPFA 3MGYA 4I1ZA 2QONA 3HP5A 3MVJA 3MVMA 4YJUA 3O8PA 4RTRA 4M69B 4FTUA 2PXXA 3HZTA 3F3WA 4IZ5A 4C2WA 1OPLA 3NYXA 3ATSA 4KBAA 4CV9A 3GJYA 3E7OA 3G5LA 4D58A 2R3QA 3U54A 1X19A 5EHOA 3V5QA 2O8YA 2ZYBA 4ASEA 3D0EA 4QPAA 3R7VA 2OF2A 3EVEA 4PRJA 5IZFA 3TNWA 3EQHA 1UFKA 3CPBA 2OY0A 4MTAA 4X2KA 1VYZA 4N6YA 4AXAA 1JSZA 4II5A 3KGAA 1OMWA 2ORED 4BCIA 4R7HA 1YVJA 2R3FA 1XVAA 4EH7A 2C5NA 2C6DA 4FTRA 4ONAA 1FP1D 4RTPA 3NDJA 4PCAA 1EH4A 2YZLA 2R4BA 4FKVA 4Q9SA 5DT0A 1W7HA 4XP0A 4U81A 3FTEA 3GU5A 4KIQA 3BWCA 2OWBA 2XM9A 3DMHA 5AAFA 3GEQA 2XP2A 2IW6A 5AP5A 2R5TA 1JG4A 3R63A 4IJPA 4NSTA 3C6MA 1OKVA 2XCHA 4AZTA 3ZXTA 4R5YA 4ZSEA 5J9YA 5HE2A 2PVLA 4A7CA 1ZYDA 4MQ2A 3UO4A 2PWYA 4OTDA 2AOUB 2V7AA 5L8JA 2G70A 5FGKA 2ZVJA 5M07A 3U9NA 2W1HA 4PMPA 4J53A 2VTLA 3BLRA 4FICA 4NW6A 3ORKA 5M55A 1M52A 5J8IA 5DX8A 3MGGA 2IZTA 3FAAA 4IFGA 4IIRA 4KNBA 1APME 3C4ZA 4G6NA 3BGIA 1AQJA 4PDOA 4DC2A 2XIYA 3ZUUA 5EHIA 4PDSA 3GC0A 5FRIA 2C0TA 5H8EA 3ZUVA 2J4ZA 3KB7A 2OIBA 4IE9A 2BCJA 3P2IA 5KX8A 4JXFA 1GIJA 3FYKX 1Q41A 5CLPA 3WI6A 4YZBA 3OW3A 1Q8UA 5HG9A 3K3JA 2BZKB 2G2IA 1L8TA 2J9MA 3P7CA 5FM3A 3KRRA 2R3JA 3VC4A 3QZHA 5ICPA 3T3UA 3ET7A 3PIXA 5JRSA 3M33A 4BIEA 3E88A 5GJFA 1NE2A 3OROA 2ZVAA 3POZA 5CSHA 3E05A 1OITA 3F6XA 1M6YA 4FGBA 4BI0A 3QRIA 4I92A 3QQHA 3QUEA 4CXAA 2VX1A 3BZ3A 3R6XA 4EBWA 2XIZA 4MWIA 4ASZA 2CNUA 3EQDA 4FKRA 2NP6A 4Z7GA 3THRA 2GNFA 3U87A 3ODZX 4IAAA 3LPBA 4RJ5A 4XJ0A 2WTJA 2PY6A 2WZJA 3S2PA 4QTEA 2HELA 3FI8A 5K0FA 4AP7A 1ERKA 3ZRLA 4RG0A 1GJOA 3R3HA 4YV2A 2Z7RA 3MPMA 3DDQA 4XV9A 5K0EA 3CQUA 3ACKA 5CSPA 4FVQA 1VBFA 5CWZA 2AYPA 3M1SA 3KQSA 5HVJA 4YZ9A 5FD2A 4PYIA 3UJBA 2XNMA 3G2PA 5DE2A 2OG8A 4BCFA 5ERGB 4YU2A 2PBFA 3E87A 4DM3A 2W1EA 3VQUA 4GU6A 2WD1A 4EL9A 4E70A 3SV0A 1SNXA 3QZIA 5DFPA 3HECA 2PT9A 3UODA 4RIXB 1OIQA 3R01A 3QQKA 3BHTA 3EN6A 3X0DA 1VE3A 3EL7A 4FKTA 2PZRA 2W7XA 5DM4A 5DTMA 3CC6A 3ZU7A 4AUKA 1JWHA 1RJGA 3NGAA 5CCXA 5JFWA 5EGSA 4NKSA 2W9ZB 3PVGA 3ZDIA 4LI5A 4FEQA 4G9CA 1J91A 5ANEA 2JITA 4M3QA 4IWQA 1URWA 5EDRA 3G90X 2W96B 5D1HA 5AIKA 1IXKA 5EMJA 3ATTA 3NRMA 3JWJA 4M37A 4W4WA 1J1CA 4IDVA 3PP0A 1OIYA 3SXSA 3EMBA 2YM7A 4U5JA 3DU8A 3HCFA 4YBJA 4DTBA 3MFSA 4UWBA 5AV2A 4IVAA 4FSQA 2P7IA 4M15A 2I1MA 3UP7A 3KXMA 3THBA 2IFTA 2FPOA 4FSNA 4BVUA 2IBSA 4WO5A 2HOGA 4DFZE 3E3PA 5E7RA 1IASA 2E2BA 4Y5HA 2BVAA 4GEKA 3SW4A 3BWFA 4LL5A 1Y91A 1OB3A 2R0IA 4O7LA 3W55A 3F7ZA 4FTNA 5HCXA 4AZWA 2KTYA 3CD8A 3LGAA 3QU0A 4IC7A 2ZOQA 4O7WA 3BEAA 4PNEA 1PXPA 2G9XA 1DM2A 2WEVA 3KULB 3ORLA 3IS5A 3HV3A 3P8ZA 2F49A 2GHGA 3CTQA 4BCKA 3DMGA 3T7SA 2BILB 5JRQA 4HCVA 5DT4A 4RSRA 4DITA 2CCIA 1BX6A 4J99A 5FQNA 3W10A 4FMQA 3C6KA 3AMBA 4G3DA 4CFVA 4FC0A 3TDVA 2OH4A 3MI9A 4C59A 3EVGA 1JVPP 3CXWA 1KE7A 3I1AA 4E1ZA 3AGLA 4E93A 5FWDA 1NW5A 2QOIA 4POOA 3L9LA 3KREA 5K09A 5BW4A 5GP1A 4D5HA 4JT3A 4CFUA 3HV6A 4QTUB 4YZNA 1SVEA 4L44A 1FP2A 3EJ1A 5I4NA 5EVJA 3ZM9A 1EQAA 1XH9A 3DPKA 4FA2A 3MH1A 5U4XA 3R1NA 4KKEA 3DT1A 5DWRA 2X2LA 3DBQA 4FKSA 2ZZNA 3DLCA 1XDUA 3FTDA 3R21A 3V5LA 1W82A 4JIAA 4TZRA 5KKRB 2GB4A 5CXHA 5ANDA 4KKGA 3MFUA 1MRVA 4PWNA 2AN5A 4BDEA 4MHTA 3R1YA 4CT2A 5M4IA 3E8DA 2NXEA 5DRYA 3B8RA 2XVAA 3TV6A 1O9HA 3A4OX 4A06A 5DI1A 5HO7A 2PSSA 2NP8A 3O50A 3LJ0A 4BTFA 4GUAA 1OVEA 3OXIA 1JSVA 5T64A 2YCSA 1YF3A 5J95A 5E1EA 2PK9A 4ANSA 2P1DA 2PTKA 2B9HA 4XG4A 4XCXA 1MRUA 3FI4A 4E6QA 3TN8A 3CLYA 5IH5A 1FMKA 3PXQA 2NRYA 3GVUA 1N7IA 3SX9A 4BCHA 1NW3A 2QLUA 3VS2A 3FQHA 2C68A 2NXCA 4FKPA 5HEKA 4EH5A 3BYSA 2OO3A 4JQ8A 5HIIA 3FJQE 4UXLA 4O0SA 5L2IA 4I5HA 3VUDA 3KC3A 1INLA 3DLZA 3GU6A 5D11A 2NYUA 4H1JA 3ZBXA 4BI2A 4HRAA 1RI5A 1X8BA 4GCJA 4XV3A 2WU6A 4O0WA 5ACKA 1Q99A 3MJ2A 4OT6A 4DEAA 4C4GA 3CJGA 4LMUA 4RJ3A 3HX4A 4ACGA 1ZLTA 3I9FA 1OPJA 5EYKA 2ITXA 4S33A 4XRLA 5H02A 4I6FA 4KKHA 2OXXA 4XUCA 1HCLA 4TYEA 2Z7LA 4RVTA 4ZY5A 5D9HA 1FPUA 3FLSA 4FIJA 3S00A 4XG8A 2PVHA 4TNBA 5DT2A 3R24A 3Q96A 5C8KA 3HVJA 2I7QA 3OCBA 2WMXA 3NW6A 2VWZA 5EYMA 2VU3A 2NXJA 2GNJA 3IK3A 1OI9A 3PXZA 3DFAA 3PIZA 5KHXA 4N70A 4YNOA 1YUBA 1YWRA 4FV9A 5T3QA 4U41A 3RK9A 4XBUA 3P7AA 2HZ4A 3KQQA 2B7AA 2A0CX 4QTCA 2VTIA 2WMSA 4ARKA 2R7IA 3LCUA 2PUNA 5ICCA 3I0OA 4GC9A 3Q5ZA 4R8SA 1JG3A 4I4FA 3ZLYA 5HG7A 4M0YA 4L7SA 2ZZKA 3FC2A 1RI1A 4YURA 2YCQA 3I5ZA 3WZJA 3AC8A 4JAIA 3DV3A 4YTCA 2JH9A 4JX7A 4ZAUA 5HBJA 2C3KA 3DKCA 5KQSA 3G2OA 3D5UA 2UW8A 2EB3A 3L8VA 5LQRA 3UOHA 2P0CA 2ONLC 2CL5A 4X2JA 5JT2A 2F4JA 1DI8A 4NK9A 2ZBRA 2XK3A 1E1XA 2JJQA 5CQWA 1SVUA 3PZEA 5E8RA 3SVZA 3ORZA 4IWDA 2GSFA 3Q2MA 3OY1A 2RFSA
chains in the Genus database with same CATH superfamily
5CLGA 5JJ5A 2QJOA 3RPVA 4ALMA 3F5PA 1ESNA 2Y4PA 2AB0A 3SD0A 2IOYA 3ZOKA 1H6DA 2P9QA 3JRWA 2ZWIA 2R3MA 2BAKA 2BIYA 5J87A 2OR3A 3ZWNA 2QGZA 4G4SP 1DEHA 2FPRA 5K2MA 1NM5A 3L49A 1KMNA 4QQNA 1JJAA 3JQBC 4YT8A 1S3SA 1CQIB 5GVSA 1C7IA 2CUKA 2BFEA 4TS1A 5KS2A 1YOJA 1T24A 2RHJA 3RUPA 3OPYB 4EHIA 1MB4A 2XAUA 5F2OA 2BRBA 2IOQA 2ZYTX 3GG9A 5BN5A 2DWOA 4N7MA 1XG5A 4GW8A 3DTVA 2IPLA 3NBAA 2IYQA 4L08A 1F14A 4F85A 2QGNA 4XWGA 4EP1A 4ZLZA 4YP0A 5LN1A 2GJSA 5K3AA 5IQAA 3UJ6A 4QU9A 1QWOA 2DETA 4FU0A 1J2EA 2ZSFA 3TE7A 1LNQA 4XWOA 1SUCA 3NPCA 4ZVLA 4RYLA 4MARA 4Q2AA 4F4FA 5K4GA 4DR3B 1GD1O 4QTXA 3QKRA 1EWTA 2VBCA 3PA8A 3Q3HA 3C6ZA 3QWBA 5E6RB 3VI4B 3C1XA 2G5TA 4JQCA 2YNMA 1N6HA 3V1TC 1TAGA 3O1LA 1N7JA 2CDRA 5JZBA 2XJ9A 4J0EA 1VJYA 1YRWA 2HY81 1A9OA 5IT4A 1RP7A 1DS5A 2DERA 5IQCA 2BGTA 3UKJA 4MXOA 3SR0A 3RUIA 4NBUA 4GAEA 3FMKA 2YXPX 3K20A 4CQMD 5GGXA 3IA7A 4ETMA 3O8CA 1L7PA 1M6EX 2JCBA 4MS3A 3HN2A 4RVUA 3RVOA 1PWZA 3DHNA 1LF5A 3QTBA 1TU3A 2UYCA 1ZH6A 5TPWA 2IXGA 4FZVA 4TW9A 2HTFA 1OBDA 1UZUA 2H0AA 5FPQA 2UW3A 3GT4A 2XYGA 4YUQA 1C4WA 1TADA 5EKNA 4DWWA 4F5DA 3TQTA 4QFBA 5KYYB 3KAPA 3PK0A 5BYKA 1LLQA 1SZJG 4REQB 1N3BA 2AD5A 3HAMA 4WNAB 3QITA 4L8LA 4D02A 1PW2A 3KM0A 3RSLA 3DE1X 1U7TA 3O2NA 5FT9A 4MLDA 3ADOA 3L7NA 4L5IA 1L0BA 1D6NA 2VDKB 1Z4PX 3M34A 3TNHA 4HZUB 4FSRA 1YASA 1LZKA 3WL5A 1I0LA 2RAFA 2BZHB 4R7TA 1NBOA 4Y5QA 2HWOA 2B0JA 4GI1A 5BUJA 2EF0A 4UFPA 5C26A 4O7RA 5CVDA 3TNQB 1KUTA 5AVRA 1B14A 3MA3A 3P9IA 3UWDA 5CAPA 1EEHA 1N2CB 4DIUA 3FGOA 2E4AA 4WNPA 1R0XA 1E9FA 3RTEA 1G2IA 1AU9A 1N5JA 5EOBA 1Q0QA 1ST3A 2Q5CA 3SEZA 2WHPB 1BQ4A 1O94C 2WQEA 1YHZA 4J3JA 2GQGA 4KBFA 3H5OA 3NJ8A 3VS7A 4ZREA 1PMVA 1WBPA 4UU8A 1IMJA 4M2LA 3V3VA 3H5TA 1RLTA 4OFBA 4Q3OA 1FS5A 1QR2A 4E1BA 3FSGD 2CFTA 3JYAA 2Y8OA 5BPFA 3NTRA 5J2TF 3ZONA 2JFNA 2FR0A 4OJQA 3RAPR 4TMXA 2VNSA 3PDHA 1U2RA 2AF3C 1UKEA 3ADDA 4D0WA 2XUOA 3HDYA 4X3CA 5AI4A 4EVQA 1X9GA 3BWMA 5GM1A 4GICA 1IHPA 2AG8A 4K9LA 1FNSA 4J3FA 1GAQA 4FIHA 1G8SA 1WY5A 4YLEA 3HPRA 1OMOA 4FFOA 4YRPA 7REQA 5FEDA 2VR1A 2QGFA 1UBGA 1NUQA 5C8VA 3CQWA 3OUTA 4B84A 4GQAA 4OG2A 4I99A 3RALA 4YYZA 1LLUA 3OM8A 3EQ8A 2YIWA 3QEBZ 3LK7A 1HTTA 4Y98A 3LT5A 3O38A 5B7NA 4F4HA 4BDFA 4ALLA 3NGLA 4IDHA 4F2PA 4WFQA 2XECA 4HYSA 3GOQA 4LL0A 4DLXA 3U1VA 3OPNA 4HYIA 4CHGA 2ERKA 4DRZA 4ENWA 3D4BA 4O0TA 2O06A 1C7ZA 3UIXA 5ESDA 3U7HB 4EOIA 4P4GA 4WY8A 3K53A 3I45A 3THOA 4RSHA 1W73A 2FW0A 3VR4H 4YMSA 2OMKA 3GZTB 3N87A 1PBNA 5CDTA 5JAZA 5BSEA 3K15A 1B0UA 2C04A 1ZD1A 4X5OA 4U7DA 1TC1A 1SU7A 2QS9A 4WUTA 3TVDA 3V5JA 1JEJA 3PI7A 2EVWX 4P7JA 2NO1A 3NV7A 1U6KA 2PJZA 1IFXA 2W1FA 1VG0B 2HRRA 4YTIA 4ZVMA 4DIOA 4F0IA 1MP0A 5B7VA 2FN3A 3HV5A 1TZ2A 1NXQA 4PWYA 2PSEA 2JFGA 2YN0A 1GEGA 3D7TB 1G8FA 3EBLA 4A5OA 5IN5A 1FQJA 3LUFA 4Z1OA 3IO3A 3OIWA 2ARKA 3BB3A 1FSPA 1I2DA 1V26A 5EK7A 3EQ6A 4LXXA 4YDRA 3GPDG 2H7CA 4ZYUA 1DJPA 3D4QA 3LLVA 1P2FA 1E79D 2P6MA 3L8EA 4KMRA 2A0FA 2Q7OE 4FTKA 3ETJA 4BDJA 3HXLA 4BO3A 4GV1A 5K4IA 1T5IA 2WPDD 4DH8A 2C2XA 1GVHA 3WGMA 1L4HA 4HGLA 3KQ7A 4H3PA 3JVUA 4BI1A 2HSDA 3L6DA 2OO8X 4WZAE 4ESOA 4EYOA 3MN1A 4PTYA 3TLJA 4BGDA 5LZ4A 2W6QA 1B8NA 1XZEA 3PA5A 5B2KA 4C7XA 2A5GA 3DT6A 2OUIA 5HJ5A 1XRQA 3RJ9A 1JEQB 1K2VN 2O0UA 3OY2A 4FYMA 3PF9A 2QRVB 4C6HA 1RMQA 4MAOA 3L7IA 2V54A 3A31A 4YJHA 2VUTA 2JLZA 5K01A 4E13A 4DJJA 4F5EA 1KQGA 5M44A 3KUDA 4F71A 2JH3A 2IHTA 3PCXA 4FMDF 1Q61A 3PT9A 1HYHA 3N6VA 1E3WB 5J1SB 3DZHA 3FHIA 3PC8A 2OZLA 4R3WA 4EOSA 2WM8A 1JUDA 1POXA 1E0DA 4Y8DA 3TZ7A 3IW5A 4ZP5A 1FQKA 3X1KA 4WKNA 1UAYA 3LQ1A 3CVXA 2BW0A 1OXKB 3QWFA 3OIVA 4WNIA 2B82A 3KOZA 2Q6TA 4MX9A 2C7RA 3ZH8A 5DX1A 4R31A 1YXMA 1IBSA 1B76A 1XTZA 2C5EA 3KVXA 4R5HA 3HKDB 4JROA 2FLKA 2DQYA 1ZO8A 1ZH8A 2JGAA 2ZS7A 4PPNA 1KZHA 3VSAA 3G1UA 5EIAA 2PE1A 3UMSA 1U1GA 4IADA 2YIMA 1K2WA 4KQ1A 1C9YA 1X8JA 1AMOA 5FBLB 3UJHA 5A7GA 3JARB 3MAGA 4XGNA 1JKMA 4AJOA 1BRMA 3VR0A 2YHSA 1N9KA 1KYWA 4KYUA 4BRUA 4HUTA 3IL2A 3R40A 3IXLA 3OD6X 1UC9A 4BZZA 5LU8A 4IRXA 5DNUA 3K96A 2J0QA 4B9DA 4OQNA 4HN9A 1L8LA 3PEUA 4QDUA 1Z88A 2X0EA 2AW5A 4NM0A 3HGTA 5LFAA 3TFOA 1AUXA 5KYTA 3FB4A 5KTOA 2VWWA 2B2NA 5CYPA 4L68A 2B2XA 5KNDD 3ZTYA 1WF6A 5LOVB 4J1TC 2I80A 4BLVA 1XXHE 3AVXA 4B75A 1KIFA 3J81A 4MBJA 3MRTA 4NDAA 4ZKDA 3IIIA 1PS0A 4KI7A 2NO4A 3GJ3A 5F2NA 2BJVA 5ALLA 4Z54A 1VLHA 4KH0A 1K7CA 2C83A 5G41A 2X2MA 4K05A 4OHPA 1KU6A 1E3QA 1OD6A 1WD5A 3BK2A 4QM7A 1ENZA 2FSVC 4OLIA 1KAEA 3PQ3A 3RUAA 3OE5A 5KOIA 1YS4A 3IKTA 4JLNA 4JIMA 4F60A 4PPQA 3W7AA 3B89A 4ZHSA 4HPXB 3IJPA 5HUJA 2IBTA 3O3CA 2JLSA 2QUJA 5K3FA 2VFAA 5U1PA 1BWRA 1AGPA 4QQ5A 1HFKA 2PUJA 5HUHA 3CGOA 4R2HA 1VLQA 3UJ9A 4XUEA 1JIUA 1BX1A 3H9OA 4I41A 2EWAA 3UNXA 3DKPA 3IJ5A 5EZYF 4A8HA 3IONA 3W0PA 1W1IA 1R8XA 3W9YA 3U40A 1AY0A 1RXCA 3NIEA 4IFCA 3USCS 2OD7A 4KFTA 4A0SA 3IIMA 3A9SA 3SZUA 1BDJA 6CHYA 3T7CA 2ZR9A 2J5BA 3I6IA 2VTOA 5AKXA 2FFJA 3QTLA 3SN6A 3R20A 2IYEA 5ALUA 3UC5A 5F7JA 3TW8B 3MWLA 2YWFA 5L7YA 4AWAA 1IJEA 4KXLA 4YQFA 3ZDBA 2VWXA 2G3YA 5AA8A 1HF3A 4RK1A 3MPAA 4FDAA 3TTJA 4LY6A 1XBTA 2I22A 1KJ8A 2NO0A 3Q9YA 2J5KA 2HFJA 3KU4A 2WLTA 3OAAD 1WB6A 5DSTA 5HS6A 1EFTA 2V7EA 2H4HA 1SXGA 4DOMA 3LCSA 1RJBA 4JLCA 2IS4A 1OZAA 3QWKA 1Z06A 4AO7A 2F43B 1S2DA 2XPCA 3UOAB 4Q5EA 3OBIA 4I1SA 4DA6A 3N2KB 4LA4A 4NXMB 1FF9A 1NW4A 1NYRA 4E8AA 2WD8A 2IVZA 7ADHA 2FHPA 5DCLA 1PYXA 3MYGA 4MUBA 2GZAA 1N6OA 1OECA 4LSWA 1M2HA 1Y8AA 5ANOA 4HXGA 3L4BA 3RKUA 3PC7A 3IP6A 3QRJA 4EORA 1YXTA 4RX1A 3NJRA 1JR3E 1XMVA 1EM8A 1JZQA 4PFQA 1LWOA 1X1CA 4ZRDA 3W1FA 4QUBA 3ZYCA 5IF9A 1A69A 4HNSA 3QVSA 5DHAA 1Q62A 5KKAA 2XEZA 2V7TA 2ZUTA 3QEAZ 4LRSB 1M2VA 5IKMA 3NWWA 5DM0A 3VZCA 2ZUSA 5KYXB 5C4LA 4YRCA 5DI3A 2A0KA 3BCHA 2ZP1A 4I50F 1L8QA 1ZRHA 4D2RA 4XR9A 4FFBA 4B82A 1CXZA 4XVHA 2PS3A 4KAOA 1UEXC 4HGQA 1G8GA 2FPKA 1GPYA 1NBEA 1NBAA 4GPBA 2G83A 1W9MA 2ZBPA 2RHRA 2VDPB 5KYGA 4Q1VA 4RM2A 2WJPA 5JDIA 1WSAA 1JIVA 2XYQA 1K0UA 1N25A 1V1RB 3AZQA 1CUGA 3K2IA 3CP9A 2A9QA 2BRUC 4X9XA 5A62A 1TF5A 2ZTUA 3TG8A 5KBRA 2CXRA 1E1RD 1P6XA 2AZDA 4RF4A 1QB7A 4DILA 3DCVA 5FOSA 1OF1A 1TECE 4Z4IA 1DTWA 5LNK1 4NL4H 4A0QA 3IQZA 1A50B 5MFZA 3V4FA 4WECA 1OL2A 1RKVA 4IIJB 1WXXA 1O5TA 4M8TA 2XTZA 4FYWA 3D02A 1U2GA 3FY2A 1GTJ1 3CPHA 4DLKA 3DK6A 3T7AA 4K6GA 3V1KA 4MR9A 2OJIA 3OZWA 4TSFD 4QOJA 1PFUA 3R83A 1PV2A 4BEWA 4CFSA 3FYUC 5LXTA 5IAKA 3UYTA 4MCIA 2R96A 2OI4X 1TVCA 5C3UA 5IDXA 2ZTLA 4B6LA 1TVOA 4PL5A 4DDUA 3BL6A 3I0NA 3I7BA 3E8XA 4FV0A 2ZWAA 2HTEA 5AV3A 2EFCB 3AJRA 2CDZA 2C97A 2F3RA 4EPWA 3UHFA 4BFCA 2RHOA 3NX4A 2F2UA 2G4CA 5BW6B 4C0LA 2E5LB 4CWAA 5HILA 4QT1A 2VTPA 3FSFA 1RPJA 4UBNA 4FV7A 2P9EA 3VBWA 4LJAA 1X7ZB 3HYLA 4HQ0A 2XH8A 1V0BA 5EE1A 2C1BA 2HX1A 1OXBB 4BAZA 2B94A 5AW1A 5EMLA 1FVXA 4L9RA 4MV3A 2Z60A 3H1PA 1KFJB 1PR5A 1E2IA 2QX9A 3KKLA 4UB7A 1YBVA 1QFXA 4AWXA 1A82A 2V5QA 5TB5A 3NH6A 1DOZA 3FUUA 3V5PA 4PLFA 1NL3A 4RGBA 4WK4B 1NQXA 4N12A 3JQBA 2JARA 3W2CA 2I54A 2P27A 3ZHXA 4QUEA 1UC5B 3RVSA 4KR2A 3ZO4A 2H51A 1FQWA 1N8NA 4QQKA 3ZI4A 4YMHA 1V11B 4YBRA 4MVJE 1C1YA 2PH3A 4E6CA 1Y5MA 3QUCA 3GA0A 2W70A 5LA6F 2ZIUB 2PTGA 2IP2A 2O0LA 4YJGA 3VW6A 3A9UA 3NUYA 2GXAA 3PEEA 2DWPA 1DBWA 2OB1A 3T61A 1R8SA 1P3DA 3VDXA 3EARA 2Z6QA 4H7JA 3N8KA 4FZRA 1SBHA 1OILA 3RODA 1Z8FA 3W4JA 5FJJA 5C53B 3PSDA 4TN1A 1OL5A 4TYHA 1TKCA 2YWDA 3TGWA 2OZOA 2HZNA