3PLAE

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3plaE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3plaE02
3B8QA 4A7CA 3KQWA 2YAAA 4QMPA 4J97A 2W1ZA 4G17A 2QU5A 2I62A 4V01A 3NIZA 5KMNA 4FVQA 4KIQA 4GYGA 2X8EA 5BUIA 3G2FA 4USDA 5DLYA 2QHNA 5HCZA 3FWQA 4DGMA 4GS6A 4G1WA 1FOTA 2VWYA 3TJDA 1GAGA 4YNOA 3FXWA 3G0EA 2J7TA 5L2TA 3JVSA 3KR2A 2NXEA 5L8JA 5M09A 3N9XA 2JD5A 2P3OA 2WMSA 5FDXA 4PNIA 3DUWA 4LOOA 3DULA 5M51A 3IECA 4K33A 3WF6A 5EMKA 4DLJA 3PVBA 3JWHA 2AN3A 4FT0A 2I0VA 2QO7A 3MH1A 4O27B 3I58A 5HE3A 3CY2A 3I81A 4H3BA 5FQNA 3AGLA 5AJQA 4P5QA 2GTNA 1SNXA 2IPXA 5FXQA 2HMYB 3BWBA 5LWMA 3VIDA 4BGGA 2OH0E 4FIFA 2Z7QA 2ZBPA 4OR5A 4A4LA 4C62A 2BIKB 3MA3A 4E5WA 3HZTA 4Y8DA 3G7UA 5DRDA 2VD5A 4AF3A 1WZYA 4U6RA 4KS8A 4G6OA 4FEXA 3H3CA 3UNZA 5AV4A 5IMXA 1NBIA 4IC8A 1QANA 4PL3A 1F38A 3KCKA 4RTKA 4BCMA 3HDNA 4QVKA 4N4SA 4HVGA 4ZZMA 2Z7LA 2C3JA 3WSTA 3UMWA 5AP1A 4H36A 3D5WA 4LECA 3DT1A 3C4FA 1CM8A 2XM8A 3TKIA 5L6OA 4HYHA 5E4HA 2Q41A 4WBBB 2FK7A 5IH5A 5K9IA 2BR1A 3EFWA 2WELA 4ANBA 4IAIA 3PIYA 1Q8ZA 4O2PA 2C7OA 2ZIGA 4HGTA 3RK5A 4KRDA 3LKMA 5DX0A 3MVLA 1ZARA 4ER6A 3BU3A 2FYSA 3DH0A 3NS9A 4DG0E 2V62A 3VRZA 2X6DA 3FQHA 3MVJA 2ZBQA 4HH4A 1JOWB 4AQCA 1FGIA 4D2RA 5CF6A 4CSVA 2P41A 2UYCA 1OUKA 5IQGA 3L8PA 5FUTA 2UVZA 5CSXA 2RFDA 3BPRA 3R2BA 2PZ5A 3I9FA 5TF9A 2BZHB 4R6VA 3SX9A 1FPQA 3MHTA 5IUGA 2GTMA 4FSQA 5AV3A 4TNBA 4AA4A 2AUHA 1R8XA 1ZXEA 1YOMA 3GCUA 2ZSUA 5GIOE 3UIXA 3VUKA 5EDPA 3ZUVA 3GGDA 4QQCA 5EIFA 3BHUA 3EN7A 4FL1A 2R6ZA 3P78A 5AV2A 4WG3A 2BR5A 3S3IA 4JQEA 3FZGA 4KVZA 2H34A 4ZY5A 2JKKA 3O17A 2HW6A 4R7BA 4YPSA 3ORMA 3UC4A 2ZM3A 5E8VA 4AAAA 5GWXA 4G5PA 4K2RA 3Q2JA 4MKCA 5F94A 3ORIA 3BT7A 3A61A 1WBNA 3WBLA 1UIRA 5EDQA 4L7VA 2VTQA 4EZ7A 3EPPA 5C1QB 5LQKA 2QG5A 5HX8A 4DFZE 4CGAA 5LMAA 3R8LA 3WZUA 3QYZA 1XVAA 3VNTA 4YBKA 4FTUA 3A7EA 4TY1A 3U54A 3MFUA 3R6TA 3AD4A 1X8BA 2A0CX 2BZGA 3Q6UA 2W4JA 1URWA 3P2EA 2QOLA 4AW0A 2B53A 1RI3A 4ITHA 3HMNA 5J5SA 4FZFB 3R7VA 3L9NA 5E8XA 4CV8A 4NYEA 3OCTA 3CC8A 4DBXA 5FD2A 2XH5A 4DEHA 4QMQA 3DTCA 4C4GA 3BKBA 4FT7A 1KHHA 1DI8A 4QVGA 3FBVA 5TOZA 5A4QA 3NUAA 5E9JA 1JQ3A 3QWJA 4ER3A 3EEYA 3P9IA 5JFXA 4YJOA 3KQSA 2WTVA 4L8MA 3NTVA 3NYXA 5EYDA 4RTQA 4HCTA 3KFAA 3O4FA 4JR3A 3G8AA 3UPXA 5I9XA 3TI1A 5JUWA 3BELA 1E1VA 2EJTA 2AN4A 4PNKA 2GPHA 1IXKA 5E9WA 2I9KA 5T6KA 4JRVA 5M06A 3TRKA 4TYGA 3CE3A 4ANSA 3QCXA 4NJDA 1RW8A 5E8RA 3EIDA 4E6AA 1NXKA 5EGSA 2R3MA 4YHJA 4FKQA 3LBYA 4S31A 3QGYA 2XM9A 2YXLA 5EI8A 2UYQA 1UV5A 2JLDA 2OJGA 4QPPA 4KBCA 2B55A 4BCNA 4OQDA 4U79A 3QFVA 5L3AA 2IFTA 1XXLA 2CPKE 3NVMB 5JRQA 3PIXA 4XG2A 3RK7A 4NSTA 1YDRE 4JAIA 1ZZLA 3O23A 3WZDA 1FMOE 5FBOA 5A4EA 1H28A 2OJJA 1P14A 2ESRA 5IUHA 1VYZA 5LXMA 1G6Q1 5L2WA 3UJDA 5M57A 4EUTA 4PUZA 1JR4A 5LVMA 3QC4A 4EH6A 4ACDA 5EC8A 4E1ZA 4FTOA 2G72A 5F4NA 2GHMA 2GCDA 3V97A 3QRTA 2YTZA 4GRBA 3ANRA 3R8PA 4RJ3A 4I0SA 3QUEA 4I5CA 4DCEA 2FSMX 2PV0A 4TN6A 4EORA 2QKRA 2ITPA 4ZEGA 2YCQA 4AGUA 4MH7A 2ETMA 5LSAA 4U43A 1PXOA 5DI1A 1BC5A 4J98A 3OU6A 3VS5A 4I20A 4OTWA 4ENYA 4FSDA 2IZUA 1M2PA 3BYMA 5I9ZA 5JKGA 3C13A 4QDKA 4RX8A 1PYEA 5HZMA 4FKIA 3R9OA 4O7ZA 4XOYA 4YZMA 2H00A 3LX6A 5BPYA 3A25A 5E9QA 2GS9A 1Y91A 1KE7A 3FPFA 5FEDA 5EHGA 2JIIA 4U7TB 1W7HA 4QMWA 3X0DA 2B0QA 3QD3A 3R7IA 3EFJA 1TQIA 1W84A 4DM3A 4CLJA 4I6QA 2ZV9A 4C33A 3DNEA 2IDKA 1OBGA 4QTTB 2HY0A 2WA1A 5J1WA 4YUYA 2PWYA 4K8AA 3EVEA 4JBOA 1IR3A 4ZIMA 5EG5A 2VWWA 2O0UA 1H4LA 3S0OA 3HP2A 4K1BA 3GI3A 3NPCA 3R9XB 4YZ9A 3HL7A 4P7KA 2JAMA 4HVHA 2J6MA 5FGKA 5HIKA 3VO3A 4CMOA 2X7GA 5FWAA 3GGFA 5KMOA 1BYGA 3MY0A 5GNKA 1IEPA 5DX8A 1RI4A 3LPBA 3KRWA 1VJYA 4IH8A 4ZSLA 3NNXA 3BYOA 1Q99A 5FWDA 3E3PA 4BCHA 4YC8A 3EVDA 3UWPA 4QQNA 2Q0BA 2O0LA 5AUWA 4FA2A 1R1WA 4GOMD 2P2IA 2PSSA 1SVGA 4IX6A 3HEMA 4MXYA 4ZMEA 4G16A 2YZAA 4C4IA 4LMNA 3DR5A 2WMTA 3QU0A 3QTZA 5G02A 3LCUA 5K0CA 5AUUA 2I7QA 2ZCJA 4B0GA 5HNIX 4MAOA 3QOWA 2BRBA 4K0YA 5FADA 4FSMA 2R3QA 3HV7A 3U6IA 4AZEA 2QNJA 4MNEA 1DL5A 1OL7A 3EYHA 5AP4A 4BYIA 4PQNA 3V8SA 3CQWA 1OKWA 5HIDA 3PXFA 4L9IA 4NM5A 3FLWA 4YO6A 3GRZA 4FBXA 3PZEA 4ANQA 2X2LA 2VTPA 3KPWA 3HYHA 4PP9A 1GZNA 3HLLA 4APCA 4EL9A 4P58A 5DXAA 4BTJA 4TKSA 4XLVA 3HNGA 2V55A 3GUBA 4BBFA 3PY3A 4LOQA 3WILA 5A3XA 1IAJA 3F5XA 2H6DA 4IC7A 1JSTA 5HZNA 4A9RA 4L3JA 4D0WA 3C4EA 2QO9A 5C8NA 3LJ1A 2OWBA 1G55A 5JGBA 2IIPA 3LDUA 4IKPA 4LGGA 5K8VA 1XCJA 1RI5A 3LCTA 4RWKA 3HVJA 3DFAA 5H3QA 3DKCA 2QC6A 2N47A 3UVRA 1UA2A 3EMGA 3AMAA 4XOZA 4FKOA 1GNGA 4B8MA 4F6SA 2PZYA 5CX9A 1X1AA 2O05A 3PP1A 4DGGA 3ACJA 1KE9A 5CVVA 2C3LA 3FPMA 4ANMA 5C8KA 2CGWA 4DLIA 4I1ZA 4WA9A 3SKCA 3VN9A 1O6LA 3GO4A 1SYKA 4IAYA 5EMLA 1PKDA 4U7ZA 4CCBA 4ZS0A 3IOKA 5HEZA 3OVVA 1JSVA 3TJCA 4YBJA 3MFSA 3UJ8A 3LCVB 3WF9A 1MHTA 3FSKA 2CKDA 2HXLA 3FYKX 3QL8A 5IA5A 3ME5A 2EB2A 3OROA 1Q8WA 3QQUA 3C4XA 4O0RA 5EEHA 3C0HA 3NMUF 4XBRA 5B7VA 4EVIA 2WFYA 4YLLA 3HMMA 2HK5A 3M33A 4RZVA 2PVJA 1WVYA 2R9SA 2R7IA 3VYWA 3IEIA 5D1JA 1YXVA 4AZFA 4E4MA 5ICCA 1IG1A 4MTLA 2ITVA 3B2WA 1YUBA 4MNEB 2X1NA 4UXQA 3TZ8A 4ZOGA 3P79A 4EKGA 2RFSA 2F7EE 4M15A 3NYNA 1AQIA 2GNLA 1WBWA 4QMTA 3FSFA 3AJDA 5IA2A 4JR7A 3ROCA 3SRVB 4E70A 2HELA 3DTNA 4EHZA 4JS8A 2JHPA 3O0GA 4BZOA 5DLSA 3BI6A 3A2CA 3POOA 1JQEA 5DPMA 4Z3VA 1R0EA 1WG8A 2O8YA 2P2HA 2QG7A 3FQSA 4NWMA 5ACBC 1BL7A 4DFBA 4HTFA 4A9SA 4GSBA 1ZRZA 4AW1A 4YSJA 2IVUA 3LM5A 3BGIA 2IBTA 4MYGA 3FXZA 4AA0A 3MPAA 4ZTQA 1OKVA 3W2CA 3K5UA 4CKRA 4QPSA 3HVKA 1GIJA 4FTAA 4XJ0A 1NKVA 3KXHA 3SQQA 3GC9A 5J87A 2QOOA 3LHJA 4HZRA 3PA3A 3DJ6A 3FY2A 2GPYA 1XDUA 2EJUA 5EMMA 2GB4A 3EVAA 2GHGA 4GQBA 4O83A 1NW8A 3F5UA 3FPEA 4CXAA 4U81A 3CLYA 4FT3A 5I0BA 1B6CB 1VZOA 3W2SA 3FPGA 4E6QA 3KA0A 3UJ7A 4OTRA 5J9YA 5F20A 3E87A 3TL8A 1XWSA 3UQCA 4FEQA 3OE5A 2JKMA 2UVYA 2ZZMA 2ONLC 5DRYA 5K3YA 2NXNA 4EC9A 2ZAZA 4WT6A 1OB3A 5CAUA 1OKYA 1OM1A 1ZQ9A 5HD4A 2V7EA 2XJ2A 1L1EA 5ITAA 3BE2A 1ZOEA 3BWFA 3TM0A 1Q62A 3HM2A 2VO3A 4AOJA 4AX8A 4I94A 3G88A 3C0GA 4C2VA 2PWPA 3LVPA 1W82A 4II5A 3RAKA 1X1CA 4HZSA 2E9PA 5I9UA 3LSTA 2PXXA 5ICEA 2ZBRA 3OFKA 3CPCA 3FMNA 1OGUA 2CNVA 2A1AB 3MWUA 2I1MA 4XX9A 5IQEA 4R7IA 1QPDA 1H1PA 4Y72A 3IG7A 3NAYA 4L3PA 2WQBA 4PF4A 2W1DA 1JKTA 1SMHA 3BCEA 3OWLA 2I0YA 3DXPA 3VHEA 2VO7A 1EAMA 3PX3A 5BX0A 3UJAA 1H08A 4XNEA 4HGZA 3KEXA 1H25A 5LMKA 3Q5ZA 3O71A 5JEBA 3SHEA 4PDYA 1R00A 1QL6A 3REOA 2CMWA 3P2KA 4BCGA 3TNQB 3C3PA 2OSCA 4JG8A 2ITZA 5H02A 3OE4A 3DAJA 2P7IA 4HYUA 3ZXTA 2NNWB 4L46A 3E8CA 4AP7A 4FT9A 4Y5HA 3VUIA 3QCQA 3E63A 4RIWA 3K5VA 4F64A 4F7JA 1ZLTA 3ACKA 4TYEA 4HGSA 4MBIA 5LQFA 1VP9A 4BDFA 2FB8A 5CU0A 1UWVA 3ZEWA 1Y8CA 3PY1A 2YACA 5DN3A 2XBMA 4QP9A 5JN2A 4UBAA 4AGWA 3MJ1A 4FI1A 3VBYA 4EYJA 1MP8A 3BEGA 3GC0A 1URCA 3UOHA 4S32A 1I1NA 1WXXA 5FULA 3P2IA 5AV1A 4AFJA 2QCSA 2GSFA 1YWNA 3OTUA 1YVJA 1CSNA 3GU7A 4RWLA 3ORZA 2Z6QA 2O06A 2GFCA 1IRKA 3LL7A 5IQFA 4IB3A 5I9YA 4M14A 4C4FA 3FJQE 2OJFE 4BI0A 1OIQA 2FGIA 5E2AA 4KD1A 2J0IA 3DAEA 1D2CA 4FSTA 1VQ1A 3LW0A 4EK4A 4WIHA 4C06A 3R3HA 5T6BA 4BF2A 2HOGA 3B3FA 4BP3A 3LGAA 3TKYA 4ZY6A 1PXLA 2PHKA 2B9JA 2WKMA 5C4LA 4LV8A 1JQHA 3L8XA 3C4CA 5HTCA 4XUEA 4D55A 3S95A 2ONZA 1QAOA 3FLSA 4AOIA 3GQLA 1Y8GA 3QTXA 3CJTA 1AV6A 5H8BA 3ZYAA 5M4IA 2QLQA 3R01A 3TZMA 3TCPA 1RDQE 5AP5A 1EIZA 4EKLA 4YUWA 3OF0A 3A27A 2R64A 2C5OA 1Q8YA 2QODA 3ZH8A 4X7QA 3HMIA 4PNEA 3KREA 4LL0A 4X3FC 5HG8A 2C1AA 2JC6A 3FTFA 3IDPA 3MAGA 3PVCA 4BCQA 1PF8A 3UO4A 1Q4LA 1S9IA 3NX8A 3R04A 2YWVA 3I0QA 3VAPA 3R0TA 2Z2WA 3NIEA 3ZLSA 4ATNA 2XB7A 1NW7A 3C50A 4XRJA 4E5AX 1IAHA 4RLLA 3TKAA 3Q96A 4XMOA 3BYVA 3UZRA 3A62A 3ZHPC 3TN8A 3Q4CA 3HGKA 4IM2A 3CPBA 1NV8A 1JKKA 1SQFA 3ZC6A 4O7TA 5DM1A 3LFFA 5AUVA 2XRWA 4DEAA 4EKKA 2BAQA 5EHYA 3OD6X 3QKKA 3UJGA 4CKIA 3QD4A 2LAVA 3OZSA 3FKLA 1NVRA 5ICPA 4RTJA 4C38A 2XIRA 5IQAA 2O57A 3UA3A 2Z02A 3BZBA 2R5TA 3FQEA 5JGDA 4EJNA 4BDJA 1GIHA 3BGZA 4LWPA 3G6GA 2ZZNA 3MTIA 2BFYA 2F49A 4RA4A 2YM6A 2BTRA 1A9UA 4V0GA 3QKLA 2XYRA 3LKDA 1V1KA 4GIHA 2ZV7A 4DINA 3W2PA 3WE4A 5ANIA 3SXFA 3MVHA 4X63A 2CWWA 5EHOA 1WBOA 1H26A 4LWOA 2CCHA 2CMHA 3FMJA 4CKJA 3IO7A 3C6MA 3O2MA 1J7LA 3PFQA 4UWBA 3KPYA 1RJDA 2EFJA 1J1CA 5EHLA 3ZO4A 4L7FA 5CASA 4L7SA 5DA3A 2QOBA 4CKEA 4L68A 3P9JA 2VDUE 3OZRA 2C30A 1OIYA 4MHTA 4QYYA 4ZLZA 2WU6A 1PYXA 1YI6A 2BALA 2CNUA 1M17A 3G5LA 3KQQA 5KMMA 4P2KA 3EGVA 1AQJA 5C4KA 3U55A 2IWIA 2C7QA 5DGZA 5IA1A 4RLKA 2UZDA 1WBPA 3E3BX 3FZSA 5C9CA 1KOBA 5DHJA 4OX9Y 4RVKA 4IX3A 2DQ7X 5D1HA 2GFSA 3QGWA 2OKCA 3AMBA 3UZUA 2ETRA 4DA5A 3OWJA 2VWUA 4KSQA 2WD1A 4BI2A 3WIGA 5HHWA 2XNNA 5AMNA 3ERCA 2CL5A 1BI8A 3NLBA 2FA2A 1OMWA 3E5AA 5CEIA 2XP2A 1B38A 3EB0A 2UVXA 4AU8A 1X1BA 4JX3A 3A7FA 1KSWA 2V7AA 5BYYA 3HA3A 3DMFA 4YJSA 3QZHA 3DK7A 2WMUA 5JMSA 3V5WA 3DXZA 5HG7A 1U5QA 3A7HA 4I6FA 3B5IA 2O3PA 2WIHA 2PZIA 4G34A 4TYJA 2CGUA 2G9XA 1GZ8A 3EGIA 4X2NA 1NE2A 3P1AA 2R0IA 3C4ZA 2XYVA 5HCXA 3OZTA 3KN6A 4MXXA 4RFYA 2QYOA 3QXOA 4CEGA 2ZVAA 3FE3A 4YR8A 3I53A 4MVFA 2XK4A 4MXCA 3BGQA 10MHA 5IEVA 2GU8A 5L8LA 3PSDA 4PDOA 4DKJA 2VX3A 3EQFA 4FYOA 3GRUA 5B0XA 2ZTHA 4RWZA 2GNJA 5KZ0A 4E4LA 3F5PA 3JY9A 4GG7A 1BOOA 1OKZA 2C6OA 3N4TA 4Y83A 5CANA 1H1RA 4FEVA 4YZBA 5GIPE 5HG9A 4GC5A 3UG1A 1ZGAA 4EJ7A 4MHAA 2PXAA 1JG2A 5IQHA 1O9GA 4IM3A 1Y57A 4PMTA 1T45A 3AC3A 3FUVA 3COIA 3Q6WA 1KIAA 1I44A 4ERKA 3C5IA 1XH7A 2J9MA 1SG9A 3Q4UA 5FEQA 2QR8A 1M0EA 1UU8A 3ZSHA 3H0ZA 2JKQA 4ZTHA 4AG8A 5LOHA 2BDWA 5D9HA 3PY0A 3MYGA 2OFUA 3C5UA 1OL6A 3VS6A 3PB3A 2BZJA 3DXQA 5EQYA 3NW6A 5LWNA 1BLXA 5FHQA 2J0JA 2CJMA 5CCBA 4IMYA 1ZY5A 3FI3A 3FLQA 2O65A 4L3LA 3OWKA 5IA4A 5CVGA 2FSLX 4R1YA 2NP8A 3F7WA 1QZZA 3FUWA 4WVLA 3U9CA 3ER8A 3AXTA 3DLSA 1EG2A 4AN2A 5JK3A 4GT5A 1JNKA 4FMQA 1OZ1A 2PVYA 3C4WA 2UUEA 2R3SA 2YCRA 4EZ5A 3R8ZA 3SXJA 3VUDA 4GYIA 1M7NA 1N2XA 4CD0A 4XUFA 2FCAA 3L8DA 4EK9A 3U51A 4RRVA 3WF8A 4EH7A 1G5SA 2XKFA 4WBOA 2C4GA 5A6NA 2WMAA 4NW6A 1L3IA 1Q24A 4UZDA 2CDZA 2G01A 3A4PA 3KULA 4YMJA 4O7LA 2OG8A 5A4LA 4HGYA 4NECA 4E20A 3VJOA 3QTUA 1UNLA 5K03A 1ZYSA 2HZ0A 2F8LA 2BPMA 1KPHA 2A14A 4CWAA 4RTPA 4MD9E 2J0LA 3GC7A 4FTNA 2VUWA 3UG2A 4XG3A 4E31A 3GT8A 5HBJA 1J91A 5L2IA 2NRUA 3U87A 4CKCA 5CXHA 5M4CA 4YLJA 3VBWA 5CSVA 4KRCA 2BVAA 5M07A 1VLMA 4O86A 3TIYA 1WAKA 4HG2A 2V5QA 3DZOA 3S68A 4IVCA 2PVFA 4TPTA 2ZLBA 5FHRA 4M37A 4W8DA 2HNKA 3DJ7A 3NW9A 3V01A 2UYOA 4OTFA 5JGAA 5DWQA 4HW7A 3PVWA 2ITTA 3BBTB 2W0JA 3PA4A 5E1SA 3E88A 3NUSA 3ODZX 2YVLA 3BBWA 5J1VA 3H9FA 3GU8A 3VF9A 4DF3A 5EEGA 4FOCA 2Y4PA 3FMLA 3BYSA 3Q53A 5GOZA 4FIHA 5K5NA 5CVEA 4RWJA 3HAMA 2R3JA 1XBBA 5CF8A 2WOUA 1QPEA 3TLJA 4QMYA 1LEWA 2QOQA 2VNWA 2BR4A 5KUPA 3DLZA 3I6WA 1XKKA 5BNJA 3EMBA 4WNPA 3MESA 4MQ1A 3KU1A 4RJ5A 1Y6BA 2OZVA 4GOLD 1H01A 2DYLA 4L53A 3EHAA 4QP6A 3N4UA 1Z3CA 3T7SA 3PUPA 5I9WA 4HYSA 2UW6A 2PUPA 4QMXA 3BU5A 4ZTNA 3ZLWA 2V0DA 4LI5A 3EQCA 4CMTA 4FV2A 2YDIA 4R8RA 4EH8A 5J9ZA 5FXSA 4BCOA 2HWPA 3IV6A 3FI2A 3F2RA 3ELJA 5C0OE 4D4YA 2F2UA 4ENXA 2P4IA 3FV8A 3VWAA 1F5QA 1QMZA 4FIIA 3OCSA 4L43A 3DP7A 3QD0A 5KCVA 4BBMA 4J99A 4BDHA 4MXAA 5HVKA 4IB5A 1KPGA 2FSTX 3ZMMA 5JQ8A 4F65A 3LXNA 1REJA 2AOTA 4HC4A 3KRXA 3PS9A 2P3QA 4QP2A 2PULA 2QRVA 5DRTA 4FKGA 4DYMA 4CV9A 4FR4A 3Q04A 3GRYA 2O5KA 5K05A 4PCLA 3THBA 4XYFA 3CD8A 3E7OA 4USFA 3D7TB 3AD6A 2X2MA 3KN5A 5HU3A 2E5WA 4Q9SA 4PIPA 4FNYA 2WTIA 4M84A 5LQUA 4PYMA 5IQCA 4LUEA 5BP7A 4R8SA 4O0YA 1GY3A 1WMKA 4KA3A 3KKZA 4KNBA 5HO7A 4X2GA 3LCOA 4AUKA 3Q9XA 3BWJA 4FK3A 1XJDA 5HORA 5DT0A 3QTQA 4YJNA 2F7ZE 3G51A 5JRSA 2Z7RA 4KB8A 3RIEA 2PKWA 1FVRA 2J4ZA 5CAVA 4NIFB 4X6RA 4P7GA 2XJ1A 4R6XA 4Q2AA 2OGVA 4IWNA 4OTDA 3TEIA 2ZWVA 4KDCA 5JT2A 3R1NA 2I0HA 3EQDA 5HCYA 5KMJA 4AE6A 3K6RA 1XDZA 4FTQA 3SXSA 4MWZA 4BDGA 2GQSA 3ZLXA 4DITA 3UODA 4JQ8A 2BZIB 4AACA 2XBAA 2VGOA 4HGLA 1VEBA 3JWGA 2HENA 3CBGA 5AM6A 2QU6A 5TO8A 3KQOA 2QKWB 5H9BA 5IISA 4R5YA 5HTBA 4FV9A 5HU9A 3TNPC 3G5DA 4TZRA 5CI7A 2WTJA 4AT4A 4IWDA 4U41A 2QVSE 4FC0A 3G15A 4R6WA 3PXQA 4MWHA 2PX4A 4QYFA 2WMRA 3BHVA 1P4OA 4FR0A 5GHVA 1OL2A 4FNXA 1TKIA 3O51A 3SV0A 4QDJA 2AOTB 3F6XA 3NUNA 4AT3A 5A14A 5BW5A 2XIKA 3RODA 4M97A 2QRVB 4M7RA 2WQMA 2XNBA 2ADMA 5AAGA 3ROYA 4CRLA 3FZTA 3GEQA 5GJDA 1XBCA 3ATTA 3DBQA 3WIKA 4RTNA 2ONYA 4EWHA 2OK1A 2VX1A 4RA5A 4PONA 2UZNA 4USEA 4KINA 2EB3A 2YHVA 2PVMA 1MRYA 4CG9A 5EQEA 3G2PA 3W55A 5CS6A 4X6QC 5H8GA 4GU6A 3OCGA 5E7RA 4N57A 5KX8A 2E9OA 4J8MA 3G33A 4UALA 4HYIA 5DT4A 4P7EA 3KQVA 3TIZA 1O9HA 2XJ0A 3TPZA 4IZ5A 4XLIA 3FHIA 5BQ0A 3KXMA 3UGCA 2C6MA 4PMPA 1ND4A 1KPIA 1O6YA 2XYNA 4RIXB 4ZMFA 4YPDA 3T0IA 4EYMA 4K9YA 1A48A 4PV0A 3DA6A 4YTHA 5EHIA 5AM7A 2YIYA 4RSSA 2E2BA 3LOKA 3CKXA 3LFQA 2PVKA 4U44A 4TRLA 1UVRA 1HCKA 3NDJA 2ITYA 3TZ7A 3TV7A 5KHWA 2HW7A 2WO6A 3R7EA 3OFMA 4E2ZA 4PGGA 4QTAA 4PL4A 4GT4A 2GAFA 2WTKC 2OICA 3IKAA 2X9EA 3NYVA 4H3PA 3G9NA 3FEGA 3JXWA 3VQHA 4W8EA 1YXTA 2C3IB 3VUHA 4FV6A 2R7BA 3AC8A 4IWPA 3VS1A 3AY0A 4PMMA 5HBHA 4A6DA 1P5EA 4EH5A 1I4WA 1XCLA 4QRCA 2BRGA 2E9UA 3ZCLA 4JBPA 1UFKA 5I9VA 4LOPA 3OMVA 5AX3A 4OBWA 2CN5A 4EOSA 3ELWA 2I7CA 3TNWA 3DXXA 2VDVE 2WMBA 2Y8OA 4XUCA 5EYKA 4XBUA 4ALVA 3N51A 3ALOA 4FKWA 2C47A 5CCXA 3PDTA 2H96A 5IPJA 2VNYA 4RC2A 2JBPA 3V51A 2ORED 4APPA 2XVAA 5HNBA 4AZSA 3CQEA 4C59A 2QOCA 2XUUA 3CCFA 1GOLA 2BTSA 3SW7A 5HE1A 1R39A 3GBZA 1B42A 5IDPA 2IVTA 1L8TA 5KZIA 4E26A 1FBNA 5JZJA 3FMKA 2VAGA 3V3VA 3QYWA 5LCJA 4ZTRA 4Z2YA 5EVJA 2BHHA 3FYJX 4G3CA 3JYAA 4C02A 5LQRA 4FGBA 2W7XA 4RTOA 1YKRA 1TPYA 4LFIA 2XA4A 2Z8CA 4DTKA 1G60A 3F88A 1DAYA 2AOWA 5CEOA 4EK6A 5HBEA 3HKOA 1P1CA 3MS9A 1N7JA 4RC4A 5BVEA 5IQBA 4RGJA 5DNRA 3ULIA 1OIUA 1T46A 3BUSA 4XV9A 3POZA 3MN3A 4CT2A 4KABA 4BVUA 4IQ6A 4EH2A 4UZHA 2P0CA 2UW7A 4PTEA 3HRFA 4PRJA 3VVHA 1RJFA 4AN3A 4LG4A 4JNWA 1KUTA 2PX5A 2WQNA 4RVFA 3FKNA 3ZUTA 4FV1A 4L6QA 2B9HA 4BDBA 2EVAA 2JDRA 2GNGA 3RAIA 4IAFA 3UA4A 3EEOA 1JG4A 3QRJA 5K0EA 4F7LA 4B99A 5LVOA 3FDNA 4I0TA 5DM0A 1FVVA 3L8VA 2H11A 2IG7A 1WZNA 3OEFX 5A9UA 3AC2A 4X2FA 3NNVA 3AQVA 3QTIA 5CU4A 4BIDA 3IS5A 1ZY4A 4D1ZA 4DG3E 3WF5A 5TT7A 4GH2A 4J53A 1PMNA 2IDJA 2ZDTA 5FBNC 3F3TA 4FS8A 4F9AA 5F2KA 1DM2A 4O7NA 4EONA 5BYLA 3W8LA 3BLQA 2R2PA 1L3CA 5J9LA 4D2SA 3DB8A 2ITUA 3LECA 3E93A 5FTWA 3MV5A 3OHTA 2PE0A 3B8RA 4IVDA 3BE9A 3KQMA 3FUUA 3O7LD 4JXFA 3ZFYA 3VC2A 1PXMA 4BLUA 2BKKA 4FVRA 4JXJA 5GJFA 3H30A 2F7XE 4DFYA 3EVZA 5DWRA 4CTBA 2ACXA 4E93A 3OY1A 4DCMA 2VWZA 4O81A 3MFRA 3M6VA 3EQIA 3BGPA 4F1TA 4JX7A 4FX3A 3KMUA 3WYXA 4GV1A 4O6EA 4RVHA 2XIZA 5FA8A 3R00A 3MQ2A 3GNIB 4GKHA 5AUZA 3HA8A 4RVGA 3C0IA 5EZQA 3AT2A 4F84A 1U5RA 5HE2A 4IV8A 2NYUA 2C5XA 4OBPA 3NEWA 2IN6A 4U80A 1B39A 2ZOQA 1DAWA 2XIYA 4FT4A 3OUKA 3FRIA 2PX8A 2Q83A 3DKGA 3O31A 1F3LA 2PU8A 3QX4A 3NZ0A 1WBSA 3I5NA 5CNNA 2FRXA 3AC1A 3V5TA 4E7WA 5LVPA 1JG3A 2W96B 5DRBA 3EVFA 3NUXA 3ZSGA 3P7CA 2NP6A 1SZMA 3Q5IA 5EOLA 4EQCA 3G6HA 4DA4A 2JJQA 3TFWA 3VRYA 5IU2A 4QMSA 3OXTA 3IK3A 3WZJA 3ZBXA 4ACMA 3K3IA 2BILB 4PDPA 2ITXA 5FA5A 1WVWA 2ZB0A 1H07A 3V8WA 2OH4A 3PRFA 4FKRA 5HO8A 5K0JA 3R9DA 2YCFA 3PRIA 5DSXA 2XEZA 4WXHA 5HVYA 4G6LA 2Z60A 1YWVA 1X1DA 2C6KA 4DGOA 2R3GA 4DT9A 1MUOA 4R7HA 3V6SA 1KE8A 4GL9A 3W2OA 1JG1A 4OT6A 3GC8A 3A4OX 1ZYDA 3DKFA 4M69B 3A8XA 4E2YA 3MY5A 3OBGA 2HCKA 3PJCA 4R1VA 5ANDA 4NZWB 2VWVA 3LMGA 4RTMA 3CJFA 4G9CA 5AFVA 4UYAA 4W4YA 1YZ3A 4U40A 4QMVA 2B52A 4BDKA 4YZDA 1XH9A 2IH2A 3RCJA 2GS7A 4A9YA 3AC5A 4FTMA 3GCSA 2IZTA 4TWPA 4FZAB 3TTJA 3M6XA 1PJKA 4UB7A 2JH9A 3KQPA 2W1FA 4X3FA 3QWKA 5J95A 1WCCA 1NA7A 3QTSA 4F1MA 5DYJA 3KGAA 3MERA 1R0PA 3MGGA 2FH9A 5ETFA 4CNHA 4RIYB 4IM0A 4EMSA 1K3AA 8MHTA 3KXNA 4IAZA 4K11A 2YN8A 2R4BA 4C08A 3FMHA 4AGDA 3BXOA 4YJVA 1OUYA 1OPKA 3C9WA 4XH6A 5AP6A 3LXPA 1AQ1A 2OFVA 3LFAA 2X6EA 4CTCA 5D11A 4WD5A 4BDCA 4MK0A 4IAKA 2Y6MA 4IDVA 1OBDA 3HECA 3ZDIA 2PT9A 5A46A 3IGOA 2OXDA 5DX1A 3CTJA 2XNMA 4FGRA 2JHCA 3TV4A 4XG9A 2OB2A 1RI2A 3QZGA 1QCFA 2AOVA 5B1SA 5C01A 3I5ZA 5KBQA 1QAQA 1PXNA 4IWOA 1KE6A 3PXZA 4J52A 4ZJVA 4JT3A 4LV5A 5K0LA 1M6YA 3TM5A 3SMQA 3QQJA 4F70A 5AP3A 4PDSA 4F1OA 4X60A 1F3MC 4I4EA 5F2NA 1PMEA 5HE0A 3BQRA 2C6LA 3M1SA 4RQVA 3F2NA 3HV6A 3NAXA 5FG8A 4ZJIA 2CNQA 1YZHA 5CI6A 3FC1X 5AV0A 3V5PA 3BGVA 4X1OA 3F61A 3QQHA 2VTJA 4WG5A 4ZZNA 3RK9A 3CR0A 1GZKA 4EH9A 2FVDA 4FKUA 4D4RA 2NO3A 5DG5A 3BWMA 1JTFA 1P1BA 3MIYA 4ER0A 3F9NA 1IM8A 5AUXA 4J1RA 3LAUA 4FV7A 3OC1A 1PXIA 4AZVA 1E1XA 1YFJA 5HVJA 3I6UA 4NM3A 3RGFA 1MQBA 1QYRA 1V0BA 5CLPA 4OTGA 3U81A 3A4TA 3MBLA 1XR1A 4IEBA 3UP2A 4LL5A 2Y4IC 3FZRA 4O0WA 3LZBA 5T64A 2JAVA 1H00A 3Q7EA 4IIRA 4X3FB 2W4KA 4W4WA 3Q9YA 4CFNA 4PYIA 2B7AA 3ZM4A 5DBXA 4ZZOA 2I6GA 2VTMA 2OJIA 3MH2A 2QD9A 4B9DA 3KXXA 5ETCA 3NUPA 1YI3A 4RVMA 5CEMA 3QRKA 4M7IA 4BGQA 3TG1A 1Q8TA 4EOOA 4M0ZA 4OT5A 4QO9A 3KU2A 3K54A 2GNFA 3W1FA 2BRNA 4FUYA 3N4VA 4FG7A 3R1QA 3KVWA 4FYNA 3EZRA 5DOSA 4GIIA 3FY0A 4MIKA 4FTJA 5CEQA 3GOPA 1JAMA 2C0OA 2H8HA 3HTXA 4RFZA 5BMMA 3I1AA 2JBOA 4YJQA 5EYMA 4PYOA 3I5UA 4BCPA 4Y5QA 5EM7A 4BRXA 4GVJA 4FL2A 4O7YA 2YR0A 2EXCX 2W1CA 5D12A 1BMKA 3D15A 5AP0A 2HXQA 1L3RE 3THRA 2F2CB 4JDIA 5M56A 3PFHA 4O7SA 3D7ZA 4YHTA 5CF4A 4FZ6A 4V05A 3P5KA 1PJZA 1J7IA 4EK8A 5DIAA 1PY5A 3CKKA 1JQDA 4U0IA 4KDRA 3TM4A 1GJOA 1ZWSA 1ATPE 4YJUA 3R8MA 3NW7A 4EQUA 3G2QA 1KV2A 1XH8A 3OT3A 1I9GA 2EUFB 3P86A 4RJ4A 2CGXA 2J0MB 4G56A 3QCYA 3QA8A 5J7HA 2P7HA 1JPAA 4FG8A 5M55A 4E2WA 3LCKA 4JDHA 5AAEA 3D2LA 4Q9ZA 5K09A 2PY3A 3QHWA 1WVXA 1Y6AA 3SX0A 4QYHA 4A9TA 3VW8A 3DBEA 2OO8X 4BN1A 2JHAA 1U59A 4XRLA 5EFQA 4C36A 3ULZA 3RNIA 5C8MA 1WXWA 3FMDA 1LP4A 3KK8A 3UPZA 3LCDA 1DS5A 1KP9A 4NJ3A 2RFEA 3VW6A 4KWPA 3ZO1A 2PMLX 2CHLA 3L1SA 2HZIA 2Z6UA 2IO6A 5HX6A 2IW6A 2RF9A 3W32A 1UKHA 4C37A 4F7SA 4MWIA 2XCKA 3BU6A 3DNDA 4RPVA 5HEKA 4GK3A 3L8SA 1PW2A 4PX6A 2QOFA 2UW3A 1XH5A 1O54A 4F99A 1KV1A 4RSRA 2OI4X 4GC9A 3SG9A 4WUNA 5FP5A 1TW3A 4ANLA 5ANEA 3V8TA 2B4SB 3DQWA 3GCPA 3ITZA 3FYDA 3O7WA 3EQRA 4EHGA 4R3CA 3CY3A 4QPNA 3BYUA 3V5JA 4F63A 1VYWA 4C0TA 4RZWA 1ORIA 4QOXA 5D10A 5E9EA 4GUBA 3QA0A 2PVHA 3Q52A 4RX5A 3UJCA 3FLYA 1MRVA 5KYGA 5ERGB 3VULA 3ZUUA 5EYCA 3FZ1A 3EL7A 2W9FB 4ONAA 4ITJA 2JDSA 3TMAA 5LQAA 3KF4A 1LR4A 4JVGA 3D14A 2ZMCA 4I5HA 3EQBA 2XCHA 3SR4A 4E6CA 4O29A 1BKYA 5EKNA 1FP1D 3QUPA 3PLSA 3WZKA 5EKOA 2QM3A 1IA8A 3KR1A 5L6PA 1LPUA 4PYNA 3CJRA 2X8DA 3CKWA 3RPVA 5AX9A 4G3GA 3KKVA 3VQUA 5FM3A 2PUIA 3SD0A 3E8NA 1U46A 4NK9A 5LMKC 3ANXA 3G9LX 4MD8E 4ZS4A 3EQHA 3SRVA 2YM4A 4RG0A 4CLIA 4KSPA 4AUAA 5KQSA 1WFCA 4CQEA 4O2ZA 4X2KA 4D9TA 2R3OA 3LDFA 4NCTA 5CNOA 3FI4A 1ZAOA 4F9CA 4PWNA 4ZSJA 3MB6A 1W0XC 1H24A 3DPKA 3U4UA 3SSMA 3A7JA 5K4IA 4UN0C 4E2XA 3PX2A 4O22A 2OZAB 5HI2A 3VC4A 3H9RA 4GUEA 4IBMA 5DR2A 4UEUA 5HIEA 4Y30A 2UW5A 3QLGA 2DS1A 2YITA 3MPTA 3ZSIA 4FSRA 2W9ZB 1DCTA 2Y6OA 5E1OA 3GP0A 3EVCA 5HIBA 2VZ9A 4RJ6A 4X2JA 2XNGA 4IB1A 1BL6A 4O82A 4X41A 3FL4A 4DG2E 3F3ZA 3HCBA 4YMGA 4YJRA 1PHKA 4WNMA 3ORHA 2W4OA 2CLQA 3G5TA 1QAMA 4BDDA 3FTDA 3VS2A 2YEXA 2RG5A 4NKSA 7MHTA 1BI7A 1PXKA 5BUJA 1JWHA 4U42A 2UYHA 4R05A 3KQYA 3FUTA 2OBFA 4FUXA 2ZVJA 4B6LA 1JSXA 3OY3A 2C0TA 4FODA 2YFXA 4N70A 4PYKA 4C04A 2OIBA 5CSWA 2NP7A 5FDPA 5KVAA 4GBED 2PTKA 1V39A 4DFXE 4FIGA 4PY1A 5DVRA 3GCVA 3B3JA 3Q3BA 2BZKB 4YU2A 2ERKA 2XIXA 2R3NA 4AN9A 4BIBA 2XBJA 4BI1A 5J8IA 3BQCA 4C07A 3TWJA 2UZEA 4BCIA 4IADA 3GU6A 3QRIA 1JBPE 4F6UA 2EU9A 3HEGA 4WSYA 3D0EA 4M8TA 5CWZA 2WHBA 4EHEA 1KYWA 2XYQA 5E8SA 2G2FA 3AXWA 4FSYA 5IA3A 3CVOA 3ZO2A 3GCZA 3F3WA 1UU3A 2QE6A 4IV0A 2YDJA 3EKKA 3TT0A 3SM3A 4MQ4A 4R3RA 4GK4A 3DXNA 4AXAA 4ALWA 4I6HA 2QOKA 1REKA 4OBQA 4H1MA 4D58A 3Q9WA 4DAWA 4GFGA 1XHAA 4ACHA 5LARA 4GVAA 4JRNA 3VS0A 2PVCA 4FIJA 3MB7A 3DK3A 2K4MA 5U4XA 2J2IB 5DT3A 2W5BA 2IBSA 3C3YA 4QTDA 5CT0A 3R30A 4ZLYA 4FKSA 2OIQA 3BWCA 4M36A 4FTTA 2PGXA 3CEKA 4UWYA 3IYLW 4LQMA 4AZWA 2AVNA 4PYJA 5EG3A 3F5GA 3MH0A 3BKXA 4E73A 1NY3A 5HIJA 5EM8A 4PYLA 3LQ8A 4NTSA 4EOJA 3KVXA 1FMKA 2WAJA 3VS3A 4DBNA 2CN8A 4YNEA 3FC2A 4YP8A 3GVUA 5LJJA 3AG9A 4EWQA 4CKBA 3B3GA 2YM5A 2Y0AA 3LCSA 5ACKA 4E5BA 4EOLA 2VN9A 2A27A 3GRVA 3MI9A 2GLUA 4JG6A 2P40A 3SSOA 1RJEA 4QQJA 2QURA 4BCFA 2VTOA 2WTDA 2VU3A 4CMUA 4ZTBA 5EOBA 3AXSA 3DLCA 3IPHA 3F82A 2P35A 4E33A 3SGLA 2QR7A 1H1QA 1APME 3MH3A 3T7RA 4OLIA 2G71A 1J7UA 3DTWA 1DUSA 4JDJA 1M6EX 4QMNA 4DEEA 1FGKA 1TQMA 1XH6A 3R7UA 2OIDA 1R78A 2XK6A 3MTEA 4JI9A 3MW1A 3PJ3A 5E1EA 3Q60A 2AN5A 4AOTA 1YOJA 4F09A 1JTEA 5D1NA 5E2BA 3E8EA 5HOQA 3R1YA 3R21A 5GJGA 9MHTA 4C3FA 4CRSA 5IEXA 3FUPA 2OYRA 2OXXA 1ZZ2A 4I24A 3VUMA 3GJYA 4KIOA 3K0BA 3PXKA 1OECA 4MQ2A 4JIAA 3HUBA 3P4KA 2XS0A 4YJPA 1S9JA 5GM1A 1PRYA 4O84A 3QQKA 3EN4A 3DDQA 4QNAA 3VJNA 4BZDA 4GEOA 5DM4A 3FLNC 2GHLA 4FTKA 4GK2A 4Z7HA 2UZBA 1BHJA 2E9NA 4A06A 3O7LB 4E32A 3VUGA 2XVDA 3MDYA 1SUSA 2YISA 2RGPA 4DE4A 3A26A 4YUZA 2QOHA 4MEDA 2XEYA 3O8PA 4EUUA 3G0FA 4YZCA 4O0VA 4NU1A 5HLPA 3KRRA 4X61A 4FNWA 3HUCA 2JIVA 4WNKA 2ZMDA 1UWHA 4EK5A 2PJDA 1BKXA 5GP1A 2WGJA 2VO0A 3AOXA 4TWNA 4U3YA 5EI6A 4EBWA 1U2ZA 2YQZA 5EKUA 2NXCA 4TT7A 2A19B 4FEUA 4DHFA 4KBKA 4GJ2A 4IB0A 3P23A 3ZU7A 4EH3A 5KBRA 4XUDA 3DV3A 2P55A 4C2WA 4EOPA 5IZFA 3WE8A 3NWBA 5AA9A 3P9CA 2Y7JA 4MBLA 2H9VA 5CENA 4GG5A 4BDAA 5EQPA 3CQUA 5D7VA 4I5PA 2GNIA 3CC6A 3LQ5A 1OIRA 2IJMA 2ZJWA 4MXZA 4RVLA 4IVBA 1UWJA 3E92A 5M08A 2NPQA 2HIWA 1W8CA 3QBNA 4ERWA 3GU3A 2JIUA 2JFMA 1YRPA 5JSMA 2OY0A 1OPLA 3W33A 4MF1A 5JQ5A 3AT3A 5M53A 3R73A 1NT2A 1ZYJA 4WG4A 4LMUA 2X39A 2CKOA 2YM7A 5FEEA 4OUCA 4PTCA 3RAWA 5CSHA 2VWXA 4FZ7A 5DFPA 3QKMA 1YXSA 4XG7A 2WIPA 2HZNA 2BCJA 2R3HA 3A8WA 3WI6A 4L00A 3OT8A 1HNNA 4BHZA 2YWPA 3EJ1A 5CIYA 3QRUA 5IKMA 3VC1A 2P33A 4OA8A 2BHEA 4IX5A 2G1PA 5EW8A 3HVHA 4Y85A 5DTQA 1YWRA 3MB5A 2WTKB 4K6ZA 3THSA 4L42A 5I4NA 3QLFA 2ZFUA 3QF9A 2CCIA 4IACA 2WU7A 5BVOA 3P0MA 4QMLA 4B7TA 2AOUA 3VF8A 1CDKA 2QLUA 3GFEA 3S2PA 2GQRA 3F4KA 3COHA 5K01A 2C6TA 5F95A 3H2BA 4ID7A 2WMXA 4DGLC 4QYGA 5E8UA 4XV3A 5BVKA 4IVAA 1Q61A 5DE2A 4BB4A 4O6LA 3T7TA 1U4DA 2PXCA 4JG7A 1PMVA 4KKEA 4YUQA 4I6BA 4QQTA 3W16A 2IZRA 1H1WA 4D5KA 4TNDA 5HLWA 3LM0A 1JSUA 3RVGA 4XP0A 5EM5A 3LPMA 2B25A 5KMIA 1OL5A 1EH4A 5L6WL 3K3JA 4RX1A 3QQLA 3VBVA 5EI2A 1E9HA 3LXLA 4JBVA 1ERKA 3R9RA 4D28A 3CJGA 2GA9A 3EFLA 2IZSA 3NYOA 3LFDA 4K18A 4BR3A 3CGFA 5CQUA 4GW8A 3D2IA 2XNEA 3IQ7A 3MTFA 3LE6A 3KB7A 1P39A 3CBLA 5G6VA 2VTRA 4FTRA 4BICA 4Y73A 1PXJA 3ORLA 3TNHA 4XHKB 1FP2A 4CFFA 3U6JA 3IGGA 2P3LA 3DGKA 3SLSA 5CEPA 4C34A 3TDWA 3KPJA 2PVNA 4DH7A 3OPNA 4BDIA 3SOAA 4UV0A 2PWLA 3SOCA 2QONA 3MSSA 3DQXA 4FTCA 4Y95A 5DTRA 2VRXA 3SA0A 1L9KA 4MTAA 3KPUA 1Z5MA 4CT1A 2IH4A 4ARKA 3LFEA 4RVTA 3ZZEA 3R8UA 2XKDA 4NW5A 3D83A 3EN5A 3E62A 2XNOA 3RWQA 4FSWA 4Q5HA 1P91A 4RJ8A 4ACCA 3MCZA 4P7FA 3PSCA 3M11A 4L67A 1FQ1B 4F9WA 3NUUA 1GIIA 4YTIA 4RTLA 3R28A 3ORXA 4NL0A 2A4LA 5AIKA 2QO2A 3LKZA 1YDTE 3HRCA 1VL5A 5E1BA 4PL5A 3NR9A 2AOUB 3GRRA 2XYUA 4J95A 1G3NA 3DZQA 3SXRA 4JAJA 5CYIA 4RX9A 4YMHA 2OBJA 1YB2A 1UNHA 3IW6A 3LFBA 3WOWA 1PKGA 4CFXA 4EH4A 4IZAA 3BGDA 3GB2A 3KQTA 3PTAA 4DZRA 1SKMA 3ZM9A 2W17A 3PXYA 4X21A 4ZLOA 5IH6A 3PZHA 1F0QA 3DBCA 2OZOA 3ZRMA 3HCCA 4EQZA 2XKEA 4FZVA 1H0WA 2UW8A 3PE1A 3SVVA 3BLHA 2XK3A 4WRSA 2O07A 1NVQA 1QPJA 3R9HA 4OTIA 2HZ4A 5ANKA 5HICA 1CMKE 3CGOA 4XV2A 3PXRA 2PPQA 5KS2A 4KKHA 5CTPA 4ITIA 2WMWA 5IA0A 3E8SA 5FTGA 3W2RA 1IY9A 5KKRC 4HCVA 4UX9A 3OUNB 4V04A 4KUJA 5JFVA 2BIYA 3TDVA 3EKNA 3PT9A 3A60A 3F2AA 4JQ7A 4O7WA 4QMOA 3DXYA 4L45A 3UOLA 4JL9A 4KRGA 3OS3A 2WPAA 3PPJA 4YURA 5IQIA 3RM7A 1XO2B 4AWIA 3HCAA 2VWBA 2DULA 3LMIA 3MPMA 1KYZA 2C3KA 1LEZA 3ZTXA 3OU2A 4DC2A 2PVLA 4G3DA 3QTRA 5IH4A 2UW0A 2XF0A 5AUYA 2BR3A 4FTLA 4RX7A 3D5UA 2R3LA 4B17A 4HRAA 4LRMA 1ORHA 5G1XA 2HYYA 3JY0A 2IP2A 4DEGA 4F9BA 3I7BA 2ZM1A 1G38A 3GXLA 3ORNA 4O0TA 1NW3A 5KNJA 3PJ8A 2W05A 3HVCA 4I92A 3KRJA 3ZFXA 3K2LA 3RWPA 5CAOA 3G2OA 3PPZA 4BCJA 2Z7SA 2UW9A 3REPA 4WO5A 2VTSA 3PG1A 5AA8A 3HP7A 3UIUA 3LJ2A 3LFCA 5DEWA 3DS6A 3NRMA 5CF5A 4O91A 5JFWA 3R6XA 3KL8A 4HSGA 1D2HA 4M13A 3OU7A 3MCTA 3T3UA 4FIEA 3RPYA 4H3QA 1H0VA 4PWYA 2XK8A 2LGCA 5A4TA 4KS7A 3H9OA 3M70A 3QALE 4OBOA 4ER7A 4BC6A 4BKJA 4X0MA 3UO6A 3R0QA 4CVAA 1TQPA 5FUBA 3LMHA 5CM2Z 4C35A 4YLKA 3IW4A 4Z9LA 4J8NA 4QMUA 5LCKA 3HNRA 4J71A 5BW4A 5HG5A 3D7TA 4U5JA 4FKPA 4HVIA 4A4XA 5M44A 4RFMA 2GQGA 3SGCA 2OJ9A 4QP4A 3V04A 2JH8A 3ODYX 2R3FA 3HCFA 5FTQA 2WNTA 4S30A 3NGAA 5HQ0A 1RE8A 5F1ZA 3TNIA 3UOKA 3WZEA 3IOPA 5AUTA 3KHKA 3Q2MA 4KIGA 5KMKA 2DUVA 1BUHA 4R77A 4FV8A 5E8YA 5T68A 2X9FA 4FOBA 1W83A 3H0YA 4A4OA 3SW4A 2YJRA 5EPEA 2XMYA 2C6DA 3EVGA 2QQ7A 4RC3A 1HCLA 4D1XA 5DTMA 5IQDA 2WEIA 4IDTA 2PT6A 3LQ3A 4DH3A 4R3PA 1STCE 4DTAA 2B9EA 1YF3A 5BVFA 4S2ZA 5C1IA 2ITWA 3TV6A 5F9EA 3LXKA 5K0FA 3FRHA 3ZC5A 3ZEPA 1ZMWA 5HESA 5BUEA 2OW3A 2UZLA 1M2QA 2ERZE 2HWOA 3V6RA 1VP3A 2ZIEA 3GNLA 2JG3A 4C3PA 3ENMA 4QTUB 3HVIA 5FQDC 2HAKA 4DH1A 4DCGA 3OEZA 4CTKA 4UXLA 3C51A 4TYIA 4IX4A 5BVDA 2VTNA 4Y46A 2G2HA 1NW6A 3DCVA 2BAKA 4JBQA 3GQIA 3C1XA 3JWJA 2RG6A 4CFVA 3MJ2A 5L2SA 3LDGA 1NW5A 3SVZA 4D4SA 3FYCA 4LUDA 3FZPA 2JITA 4BTFA 3TQSA 2OXTA 2R3IA 4XV1A 3UDBA 2RIOA 4FNZA 1XJ5A 4CZUA 4D4VA 5EH0A 3NJRA 5CVHA 3PYYA 5AAFA 4H39A 4BHNA 4EEVA 1AF7A 3BX5A 2QOIA 1BX6A 2CKPA 1V0OA 2GS6A 2PE1A 4GMYA 4BLWA 2WMVA 4TXCA 1YXUA 3ORTA 2X4FA 3H4JA 3FKOA 4PINA 4XCXA 2PBFA 2ZYBA 3A7DA 4B4LA 3RP9A 5EKXA 3B7PA 3BV3A 3ER9A 5D41A 5E8JA 3HA6A 4AW2A 5LMBA 4NM0A 4BYJA 1XBAA 3RPOA 5FCDA 3VBTA 2AYPA 4Z7GA 1Q0SA 3LHDA 2YM8A 3PE2A 3CD3A 4LGHA 4A9UA 4FKTA 4I22A 2BM9A 3BHTA 3MFTA 4BTKA 3UQGA 4FL3A 2XVMA 3F3UA 3OG7A 3PWDA 5EMJA 4IFCA 3TXOA 5EDRA 4L01A 3T8OA 5CU3A 4UY9A 2W1IA 2J90A 5ANOA 4RIXA 4DEDA 2C6EA 2YIWA 2CMGA 4DMGA 1YFLA 2FSOX 2AVDA 2Y4IB 4F0FA 3VSEA 1JVPP 2WQOA 2J0KA 1JSZA 2ZW9A 2WA2A 4P90A 3VBXA 4HOKA 4DT8A 5AP2A 2B1PA 4YUXA 5C27A 3I4BA 3COKA 3IW5A 1ZKDA 3SSNA 4PTGA 1EJ6A 3OW4A 4WUAA 3IDCA 1SQGA 5H2UA 3C7QA 4ACGA 4RT7A 5IEYA 3O8TA 1UU7A 3IHTA 5CAQA 3ELUA 2B9IA 3LCCA 3QD2B 3NCGA 3UTOA 3FHRA 1SUIA 3FUXA 3MTLA 5LQCA 5K5XA 3A7GA 3RKBA 4HJOA 3UJBA 4E6DA 3QUDA 3L9LA 2PX2A 3UMXA 2IVSA 5CVFA 4C4HA 2BDJA 5LR6A 2ZIFA 3TUBA 3UYTA 3UZTA 3QTWA 3PA5A 4ASDA 3B89A 3FI8A 4NM7A 2BRHA 1MJFA 3UJ9A 4IW0A 3LBFA 4FICA 1AD5A 2IW8A 3EZVA 4UWCA 3HCDA 2WB8A 4EQMA 1JLUE 5CU6A 1YHSA 2OF2A 2ITQA 1RI1A 3EGEA 3HAVA 5KE0A 4NFMA 2XK9A 2UW4A 2BFXA 2VS1A 4M12A 4C61A 4ZY4A 4QMZA 3R71A 2ZV2A 3E8DA 2OB1A 1M52A 3CSVA 4YHFA 4PIMA 4UYNA 3OBJA 4PMSA 3EH9A 4E8AA 2C0IA 4HTFB 4AZTA 5DR9A 3DOGA 4CXMA 1NV9A 2XKCA 2V22A 4B8LA 4YV2A 2FHPA 4NUSA 5K4JA 3IW7A 4QTEA 4GJ3A 4QNYA 4QPAA 3Q4TA 5FLFA 2PE2A 2BROA 1NVSA 3F66A 3KK9A 3DDPA 4KIPA 2YUIA 3PVUA 2VGPA 5GM2A 3T3VA 4F6WA 4RYLA 4KKGA 3PG3A 2BH2A 3ZLYA 4ZK5A 3QAME 5T67A 1EJ0A 3JS2A 3NWWA 3R02A 5ANGA 4Z55A 3P71T 4G2FA 3AGMA 3I79A 4RMZA 4CG8A 4GF5A 2WQEA 2FUMA 1H1DA 5A6OA 3R8VA 2W99B 3NCZA 3I60A 2I0EA 3BLRA 3BRBA 2EXMA 2J51A 5HD7A 2VTAA 4D0XA 2ITNA 2OU7A 1AGWA 5ETIA 1R18A 5JZNA 3ALNA 3OXZA 3MVMA 3GXOA 4I0RA 3JVRA 4GFMA 4C4EA 1OI9A 1FPUA 4O0UA 2YDKA 1ZG3A 3OCBA 2YIRA 5H8EA 1P4FA 1T43A 3EQPA 2DWBA 2JFLA 4FKLA 5EOVA 5BVNA 2DPMA 2PMNX 2WTCA 5K0BA 4LYNA 3PFGA 3WYYA 3OFJA 4FKJA 1FINA 2X7FA 3EN9A 4KW7A 2PYWA 3UJ6A 3KMMA 2JKOA 3U9NA 4HNIA 4FV5A 5EM6A 3NNUA 4DH8A 3MY1A 3AT4A 4KAOA 2V74B 3EWHA 4NT4A 3VS4A 4HVDA 4MBJA 5HKMA 4N0SA 4ZXTA 4P5ZA 5EQJB 5DT2A 2P3GX 4K6MA 4RTRA 3EN6A 2YIXA 5E8ZA 3WARA 3NW5A 2VWIA 2R3KA 3LFSA 4W4XA 1GZOA 4BCKA 3KC3A 3UVPA 1CTPE 2VTLA 2QY6A 2F57A 2C7PA 5CVJA 2X81A 5LQJA 1H8FA 2HTEA 4CFMA 1YI4A 3L9MA 4NKAA 3DK6A 3FPJA 4P4CA 4HPUE 5FRIA 1V0PA 4YZNA 1H1SA 1UU9A 3UIBA 1OVEA 2O63A 3F3VA 3DKOA 2J5FA 5AIRA 3CTQA 1ZHFA 2UZOA 3R83A 4FGZA 2FYTA 3W10A 3KF7A 4RIWB 4QTBA 4ZJJA 2PY6A 3GU5A 5DH3A 3R2YA 4WKQA 3CIKA 5HGIA 3D94A 4BTMA 1N7IA 4F85A 2Q0NA 1KE5A 3ATSA 5BVWA 4EHVA 4IWQA 3ERKA 4ASEA 2VV9A 3HX4A 2YJSA 1MRUA 3ELYA 1O6KA 2F9GA 1DI9A 1PMUA 1QPCA 3CS9A 3RI1A 2I6LA 4CFUA 4XG8A 4F86A 3P7AA 2VX0A 4F4PA 4E4XA 4ISCA 3E7PA 4ORKA 3HA5A 4KIFA 3NWEA 4RTSA 4D9UA 3GWZA 5DSTA 4IFGA 4FP9A 4C3RA 3HDMA 5IMEA 3OWPA 5IG1A 3I64A 4RQKA 4RVDA 3IONA 4U9AA 3NVKI 3EOCA 4TL0A 5AP7A 4M3QA 3SG8A 5EIWA 4IZ7A 3B2TA 2C5NA 1Q97A 2UZ4A 2XZSA 1SVHA 1KR5A 4IHPA 2ONLA 4HCUA 4RIOA 1U54A 2BMCA 3M42A 3VHKA 4RV9A 4F7NA 3NSZA 1TVOA 4QP1A 4AT5A 3PJ1A 5BMSA 2YERA 5FM2A 3ZOSA 2OPBA 5GINE 1Y8YA 4TWOA 2YIQA 5IH3A 3ENHA 1YOLA 4U3ZA 3RZBA 2KTYA 4Z16A 3OP5A 3IW8A 5LVLA 5C26A 1J1BA 2UZWE 2YCSA 3PPKA 1A06A 4DCAA 3NUYA 4O0SA 2PL0A 2YM3A 2C68A 3JUHA 3O96A 5CXZA 1O9UA 4AFEA 3QXPA 3M2WA 4FSZA 4PGHA 2Z6AA 1VPTA 4YC6A 5B2LA 5IUIA 2GH1A 2GDOA 1Z57A 3QZFA 1YHWA 4EI4A 4RIYA 5KMLA 4OW8A 3RHXA 4LM5A 5ICGA 2G1TA 2Y1WA 5CVUA 1YXXA 1ZOGA 2XK7A 3ZDUA 4NFNA 2B54A 2AOXA 4NTTA 3I0OA 3OW3A 3R9NA 4CCUA 2EX4A 3P9KA 2C1BA 4U8ZA 3E23A 2G70A 2CKQA 2GNHA 2OXYA 4FSNA 3OZ6A 4FTIA 4EKIA 3CP9A 2ERCA 1VIDA 4IZYA 3GENA 1ZGJA 3P97A 4FEWA 4V0GB 5TR6A 4U45A 4A6EA 4NH1A 3RMFA 3D5XA 3OTVA 4ZSAA 3ZFMA 5KHXA 4CZTA 5BYZA 3P7BA 5CUQA 4QP8A 4XP3A 3I7CA 3ID6C 2X8IA 4FV0A 4ZTMA 2OF4A 4H58A 3CJQA 4E4NA 3NNWA 3ORPA 4POOA 4R78A 5E1MA 3SAYA 4M38A 1Q5KA 3ZZWA 4R5SA 2OLCA 4PYQA 2R3RA 3RPSA 4FG9A 2ITOA 4D1SA 2C6IA 1WY7A 2YX1A 4I23A 5CSPA 3FL5A 5CAPA 1U54B 1KWPA 2BKZA 4G31A 2YZLA 2HY81 3ZO3A 3DMHA 5I5ZA 3RALA 5ETAA 4C03A 4W4VA 3GDHA 5P8WA 1I09A 5MHTA 4O96A 3T9IA 3E05A 3D5VA 3S00A 4WNOA 3TUCA 4UOEA 4AE9A 3NDMA 3O8UA 3F7ZA 3EYGA 3PTGA 5T3QA 2QHMA 4ZAUA 3RW9A 3PWYA 3HP5A 4D5HA 3UNJA 4JIKA 4OGRA 4XP2A 5DEYA 3RPRA 5CZHA 3PVGA 4E30A 3UP7A 4FT2A 4EZ3A 4OQEA 2FO0A 1SNUA 4EOKA 3E64A 4YUVA 1YDSE 3R1SA 1WS6A 2YXEA 3QZIA 4CFWA 2JGZA 4QMMA 4EOMA 4I3ZA 5DR6A 2ZV8A 1J3HA 3MIAA 3OXIA 3ZRKA 3KR0A 1W98A 2ZDUA 1M7QA 3FMMA 3S1HA 2ZZKA 5CQWA 2PUNA 2JDOA 5B2KA 1OL1A 2RKUA 2R3PA 2CGVA 1SM2A 3QV2A 5JR3A 3M6UA 5FQOA 3CGGA 3BEAA 2VO6A 4QT1A 2PZRA 5AADA 5BXYA 2VTTA 4IAAA 5HFJA 4PP7A 3CXWA 1EQAA 4OTHA 3VBQA 1FJXA 3MGYA 4G3EA 4GT3A 2ZB1A 3GIWA 4GU9A 4NCTC 5LVNA 2ESMA 3ET7A 2ZULA 3W8QA 3LJ0A 4HGEA 4LG1A 2W1EA 1JKSA 3AC4A 2W5AA 3O50A 2HR1A 3UBDA 4DEBA 2HV9A 2WTWA 3TOSA 3RM6A 2LD4A 3BZ3A 4OBXA 5CY3A 2PSQA 4EC8A 2KW5A 4IJ9A 3VS7A 1M2RA 3V5QA 4EOIA 5FP6A 3OOMA 4RWIA 4S34A 2W1GA 3U8WA 4YV0A 1KOAA 4QQ5A 5DXJA 3HV5A 4M68A 4DFLA 3HMOA 3DFCB 1Q0TA 1G8AA 3ZONA 3EMDA 1OR8A 4OA5A 4XG6A 4XS2A 3TTIA 4GOOD 3DU8A 4JDKA 4XEYA 3KXGA 1IASA 3EVBA 2CKEA 2X0GA 4MNFA 1XTPA 5F2OA 1JKLA 5IDNA 5E90A 4DFUA 4GOND 4H05A 5JH6A 4G5JA 2NXJA 1OPJA 3AWIA 4IJPA 2VZ6A 5CU2A 3KCFA 3PIZA 4MD7E 3GU4A 1NBHA 1PXPA 3H10A 3AD5A 1X19A 2ETKA 2BRMA 3SDJA 4YGAA 3R7YA 4FSUA 1G8SA 5K0NA 3LLAA 3BV2A 4ALUA 3KULB 3TUDA 3DY7A 5E92A 4QP7A 4BGHA 4I21A 3D9VA 3LLTA 2P1DA 3MA6A 2YABA 1YHVA 4YTFA 3HA7A 2ZM4A 2Y9QA 3ZBFA 5CVDA 4HPTE 4G6NA 3V5LA 5M5BA 1RJBA 3UYSA 2J50A 4AW5A 3UO5A 4TTHB 1VR2A 4WRGA 5A54A 1Q8UA 1NW1A 3GFWA 1Z9XA 4N6ZA 1YW2A 4GUAA 2GMXA 3BKWA 3ZXZA 3HRBA 5DM2A 4XCUA 4AGCA 4ASZA 3TZ9A 3QX2A 3AMYA 3BWYA 2AC3A 1R74A 4BP1A 4JOAA 3KMWA 4V0RA 2V7OA 2UV2A 3G2MA 4C4JA 3T9TA 3JWIA 2PZPA 2PMOX 4HNFA 1SVUA 3W18A 2O64A 3A7IA 2FPOA 4J96A 3RJCA 3TACA 3UIMA 2EG5A 1Q3WA 3PLAE 3RAHA 2XRUA 2JDVA 3JR1A 4DEIA 1LUFA 2BUJA 4F0IA 4O21A 4ZTLA 2YAKA 2VDWA 5HLNA 5K0GA 2X2KA 3P8ZA 4O0XA 5C03A 3W2QA 2P8JA 2WEVA 5IF1A 2AZTA 5ANJA 3OOGA 4U7PB 2PMIA 3DBFA 4LRJA 4DTBA 1M14A 2IW9A 2G2IA 1YQJA 3ETAA 3HCEA 5E1DA 3TKHA 2OKRA 3QQGA 3G8BA 3DOUA 4QP3A 2IVVA 5LQNA 2PUUA 1ZMUA 4I5MA 4C05A 3FLZA 4ZSEA 4BDEA 5B2MA 2WZJA 1HMYA 3P9NA 2OZAA 4DGNA 4GCJA 2IH5A 3KY2A 1L3BA 3NDIA 5FXRA 5L8KA 3QHRA 2C7RA 4FZDB 3KR9A 3WF7A 4V0QA 5HILA 4FSXA 1UKIA 3FPQA 1ZOHA 3R22A 4KWCA 4F9YA 2BM8A 2GS2A 4QTCA 3FZOA 3P08A 4LRKA 4AS0A 4O7VA 3LFNA 4RBLA 4P7JA 4I93A 2J5EA 5KO1A 3ORKA 3UBTA 3ZRLA 1CKIA 4RJ7A 4BLVA 2Y1XA 3DBDA 3R63A 3A99A 3M4XA 5M4FA 1Q3DA 4ZTSA 2BAJA 4H1JA 3PJ2A 3E7VA 2KULA 2R0UA 2W06A 3R24A 1SVEA 1Q41A 5TKDA 5ICFA 4FT5A 1P2AA 5A4CA 5AWMA 3R7OA 4YO4A 4YJTA 1H27A 3F69A 3QOXA 4C58A 4BBEA 5EW3A 2PVRA 2REIA 4EOQA 2JEDA 1OITA 2O2UA 3RTPA 3RINA 4M0YA 5HNGA 3KPVA 4L52A 3DMGA 2X4ZA 3U6HA 4F0GA 4C4AA 2VTIA 2AC5A 2JDTA 5FTOA 5DPVA 3CTHA 5EW9A 2YXDA 1K2PA 4BZNA 2CLXA 4YC3A 2XNPA 2G8NA 4HVSA 3Q9ZA 5CALA 5M4UA 2QI8A 4BIEA 1R8YA 3UE4A 4WHZA 5KQRA 4G9RA 1MQ4A 3Q4ZA 1RQQA 1UNGA 1K9AA 3QC9A 2G15A 2ZWAA 3CCNA 2VTHA 4FVPA 3QCSA 1CKJA 5EZSA 5KKRB 4M67A 4TYHA 4J7BA 4ASXA 3KXZA 4FV4A 5E91A 1D2GA 3HV3A 1IA9A 3GOKA 4DQ0A 3HV4A 4U97A 2E9VA 2C69A 2NRYA 3LIJA 4Q5EA 4BY9E 3PSBA 4AA5A 4FK6A 4KBAA 5CZIA 3Q32A 4FKVA 3S4QA 3UFBA 4MCVA 3IDBA 1INLA 2B3TA 2W5HA 5CEKA 2A2AA 3TKUA 3FMEA 3PP0A 4DN5A 4IANA 4A07A 4QQKA 1VE3A 3TR6A 3FPHA 5E8WA 4S33A 5EK7A 5CD1A 3DAKA 5HIIA 4WOVA 3II5A 2YA9A 2PLWA 4MX9A 3M6WA 4H0NA 1FVTA 3C0KA 3QQFA 3FTEA 4I4FA 3HMPA 3EQGA 4G3FA 3V8VA 2WXVA 3GCQA 4GFOA 4DFNA 3KQ7A 1VBFA 5CT7A 2B9FA 2WMQA 4ER5A 2W1HA 3RCDA 4O7RA 3UNKA 4ZSGA 3RHKA 4FV3A 5C9ZA 1KXZA 2IGTA 2H1RA 1XH4A 4O38A 3BHYA 4OTQA 5HIMA 4JJRA 1RJGA 1XDSA 2AS0A 2UZTA 2X7OA 1R3CA 4XG4A 4C7TA 2WOTA 3BHHA 2UZVA 4I41A 2F4JA 1CKPA 4EBVA 4IE9A 3ZS5A 3G89A 2RFNA 4X3JA 3UVQA 5JFSA 5D7AA 4F08A 4TW9A 4JLCA 2OO3A 2WK1A 4PCAA 3ELDA 4YTCA 3UC3A 4K77A 5AEPA 2VP3A 2PK9A 3DJ5A 2EWAA 4FE2A 3FXXA 3DB6A 2C5YA 3L9PA 4TWCA 3DLIA 3Q87B 3FAAA 3FTCA 3OCJA 3KRLA 3G90X 4YV1A 1ZYCA 3EL8A 3SC1A 4Y2HA 1XQZA 4EK3A 2SRCA 4TYHB 1TW2A 3D4QA 4YSMA 3UQFA 1WBTA 4DH5A 1ZMVA 2UZUE 3D2KA 2AR0A 2B78A 1WBVA 4MXOA 4N6YA 3UZPA 1R6AA 3COMA 4QYEA 2B2CA 2FK8A 2I40A 1HOWA 2HWKA 3EFKA 3C6KA 4CTJA 4ZP5A 3JPVA 2C5VA 2BDFA 4GKIA 4GEKA 4L44A 2RL5A 2CSNA 3U4WA 3ANQA 3BIZA 3UOJA 5E8TA
chains in the Genus database with same CATH superfamily
3B8QA 1QGED 4UDXX 1DFIA 1JAXA 4UC0A 3GLIB 4KX5A 5CFQA 3TB4A 4RNCA 1OZGA 4V01A 1LW6E 5KMNA 4FVQA 4KIQA 1ZMTA 3K2EA 3O3MB 1W2GA 3AC0A 2J46A 4TROA 4M89A 4DJDC 3AVXA 2JAQA 4GS6A 3ZD8A 2C2HA 1NSFA 2VWYA 3VKHA 2HSZA 4G36A 1EFCA 1CUUA 1SZCA 1EWYA 1Z0SA 3JVSA 4XD7A 3IP7A 3JQCA 5M09A 3N9XA 1VPLA 3P4XA 1D2MA 1IVNA 4OBBA 4PNIA 1PU2A 3DUWA 4GKJB 1SBHA 2KQUA 4LOOA 1C9KA 2AN3A 2W6CX 2I0VA 3W5SA 3BDVA 4MHSA 3PITA 1L8XA 4CKXA 3UKDA 1A69A 3AGLA 4ETWA 4BEJA 3O8OB 2XSZA 4P8RA 4ZC1A 4P5QA 4NZZA 3JSXA 2MWMA 3B3QA 5KB3A 3OPQA 4G85A 2WLSA 1MU0A 5LWMA 3EDMA 3STTA 1OWMA 4C1BA 4CKWA 3WO0A 5SZHB 4FIFA 3M5CA 4HMOA 1W5BA 1XVLA 2DERA 4OR5A 3BBPA 4A4LA 3WGGA 1BA2A 3RS7A 4G0OA 1EP2B 4IH1A 5DLQC 4JHLA 3HZTA 2K2QB 5HBGA 1Q19A 1NJGA 4RLSA 4HAIA 2VD5A 3LRXA 4U6RA 1H9BA 1OC4A 1NVXQ 3LQ2A 4FEXA 3H3CA 1YB4A 1SKQA 3ZBPA 4IC8A 1QANA 4AS2A 1F38A 3KUXA 2VAPA 1Q7TA 3IVCA 4RTKA 3HUUA 1GZ4A 2XD4A 2PRJA 4EMTA 4JBGA 3Q1LA 1NF3A 4HVGA 3NHBA 4K28A 3UMYA 3IAHA 4A8JC 1Q0LA 3WSTA 1T2CA 5LD2B 4MRMA 1VSQA 2VUIB 1Y98A 4ND7A 1Y6JA 3DT1A 4BQPA 3DMYA 3C4FA 3D6HA 1SHTX 1CIJA 2EX1A 1II8B 4BVKA 5E4HA 2Q41A 5CA1B 3FOEC 1R0KA 2AD5A 5T41A 4ND4A 1M1UA 5K9IA 3U7QB 2BR1A 3EFWA 1N5KA 3PIYA 3NYWA 1Q8ZA 4HGTA 5FPSA 4KRDA 3LKMA 5JE8A 4NCAA 3MVLA 2E0IA 5T7BA 2CDBA 3GJXC 3N0VA 3FWZA 2FYSA 1L7BA 3EEQA 4PZPA 5GPBA 1OLSB 3VRZA 4DM4A 5IBPA 3FQHA 4CFZA 4MPTA 3DGEC 3G8DA 3MVJA 3U16A 2G63A 3CEAA 1GZ5A 4HH4A 4C0XA 3GEHA 1E1DA 5FT9A 1FGIA 4D2RA 5EUQB 6YASA 2UYCA 2IQ5A 1RPAA 3HBNA 2RGUA 4U7HA 5IQGA 3BD6A 3VO2A 4MUFA 2UVZA 2Z95A 3V4LA 3R2BA 4X45A 3SX9A 4DSTA 1QCDA 3Q1KA 5IUGA 2GTMA 5DHQA 5TT1A 1FQWA 3JATA 4WE3A 2IODA 4PLYA 3GRKA 1R8XA 3DTVD 3PWKA 2ZSUA 1KK3A 4U6QA 1YKGA 1CF2O 2O2HA 3I01M 1WXHA 3VISA 4QQCA 1R0ZA 3S6JA 3ED1A 3ZK7A 2P6RA 2MYNA 4OO3A 2VFAA 4QXRA 3E5HA 4WG3A 3S3IA 4JQEA 2JA1A 4KVZA 4YAIA 3W6PA 2YMLA 3UY4A 2JKKA 2WTXA 1I4OA 4AIRA 3O17A 1XRQA 3WWDA 1BNCA 5LWHA 2HW6A 1KMQA 3TSCA 3DE4X 4I3HA 2P68A 3CBQA 3KB8A 2QLNA 3ORMA 421PA 2ZM3A 1QPZA 4AAAA 4E5SA 1IEQA 3GEEA 4MS3A 4G5PA 4P84A 4PG6A 4XQ0A 1C3OB 2VPYA 2ZVDA 4MKCA 5HVNA 4BC0A 2Q4BA 3RASA 2X4GA 1QSGA 4D96A 3BT7A 4RA6B 4WZAA 1D1QA 3AW9A 1D6JA 3WBLA 1UIRA 1DKOA 1PK8A 4JU9A 1YCDA 1R6TA 3RT9A 1Z2PX 5FOWA 4RZXA 3NYRA 1IBRA 5C1QB 1H8HA 3RBZA 2CLKB 4OKIA 4IP0A 5LMAA 1N6IA 3QYZA 1XVAA 4II2A 2PKEA 3A7EA 4EZEA 2SCUA 3MFUA 5KHOC 5CXXA 3HB9A 3EW9A 3FMPB 2LPMA 2PSHA 1PJTA 2BZGA 3O8DA 1AXEA 4Z4FA 3PVSA 4QPJC 2Q9CA 5IH7A 3P2EA 1XXHE 2G76A 3VOTA 3UDZA 5J5SA 1KE2A 3GCGA 5FTJA 2C2MA 4Q00A 4YK7A 4NF2A 3CF2A 3D2CA 4FOLA 1ZNYA 3CISA 3TJMA 1KHHA 1DI8A 1T26A 5E6SB 3ZJ4A 3FBVA 3HVUA 1JQ3A 3QWJA 1FXWF 3W8RA 3EEYA 4HN9A 5JFXA 4BPBA 3H1FA 4BO7A 2VQDA 2OO5C 3R7LA 3UG7A 1F17A 3KFAA 4OHMA 4JASB 5BN3A 1YL5A 1OSNA 1OVMA 1TT5A 3EWSA 4JODA 5K8TA 3O1LA 3AVYA 2O7NA 4JROA 3BJEA 2AL7A 5LVAA 4JT8A 5FPQA 3A0RB 5JJLA 2W2NA 1GUYA 3CE3A 1M2EA 3WJ7A 2IPAB 4ANSA 3CSDA 1NXKA 3DBLB 3IESA 1OLXB 2DT8A 1EH5A 3DEAA 1PG2A 3CLUC 2XM9A 2UYGA 2YXLA 2VH1A 1IUPA 2I7TA 1RLMA 3Q11A 1UV5A 5BN4B 3OBIA 4QPPA 4KBCA 1A2QA 3C1AA 2XMBA 1V3QE 4U79A 4Q93A 4TRJA 4WNIA 5L3AA 2Q4OA 4LJ4A 2Y4OA 2CPKE 3GMIA 5JRQA 3FCXA 3RK7A 1D2RA 3PEVA 1YDRE 4JAIA 3WZDA 1QHHA 3EN0A 1K75A 1H28A 4C4YA 2BJVA 1GAQA 1VYZA 4J3JA 4IZ6A 1BE1A 3OY7A 3DCJA 5M57A 4PUZA 1XCBA 2DFNA 1WUTA 1Z2CA 1NUQA 5LVMA 2PAAA 4WNCA 3DWIA 2FHSA 4ACDA 4DV1B 4QXAA 2FWRA 2DMRA 4FTOA 4KHPB 5F4NA 2GCDA 3A3PA 1PT8A 4KP7A 2WWWA 1E9CA 4GRBA 1FNDA 1G5RA 1L4UA 1SVNA 3AU9A 4RJLA 4EVQA 4LV5B 1I2CA 2PV0A 4FNAA 3V9AA 3G0DA 5JPIA 1M7BA 4FYPA 2VBFA 4R9VA 4EQ6B 1OA0A 3VS5A 2TSYB 3TW8B 1T5HX 1YCFA 3D1VA 4ENYA 4FSDA 1TKRA 2L69A 4ALIA 1OA1A 3K15A 4TVBA 3QEOA 1H0RA 2AC4A 3O83A 2CXRA 3R9OA 1EA5A 2XA9A 4XOYA 1XU4A 1D8AA 1JHZA 3F6CA 3A25A 2JAWA 3FPFA 3E81A 4JWKA 1W7HA 1U3VA 2W8BA 2WZBA 5EZ5A 3DPIA 3EFJA 4K7JA 3LJKA 1ZCZA 4H7FA 2ZV9A 3IPLA 1G59A 2FOXA 1OBGA 1MOZA 1RQXA 5JD3A 2WA1A 1ELOA 1IR3A 4ZIMA 4KAFA 1U5CA 4YB8A 3GLVA 3G23A 4BUZA 2X2OA 1H4LA 2PZAA 3GI3A 1JH8A 2X0DA 3R9XB 4YZ9A 3DO8A 4O8ZA 5A2QA 3REQA 3HL7A 1ABBA 2J9RA 2WUVA 1X13A 1WHTA 4IQ0A 5AM4A 2Q7DA 1DIAA 2ZWMA 4COKA 5FWAA 3GGFA 1PK7A 1BYGA 3MY0A 4C2TA 2YWRA 1RI4A 3HUFA 1P1HA 4LUCA 1NXXA 4IH8A 1JI0A 1O6BA 5BV3A 1C14A 3EGDB 3Q8WA 5FWDA 4WKGA 3HACA 4TMXA 4YC8A 3ZLVA 4QQNA 2Q0BA 4BLRA 2BTQB 1BDHA 2JFWA 2RG1A 3C7KA 5KSZA 1R1WA 4FYIA 4UASA 2EW8A 1SVIA 1SVGA 4J6FA 3C4QA 3HYTA 1FQOA 1RJ9A 2BV3A 4X8MA 2NZ2A 1WSBA 5AUUA 3W2HA 4G84A 1CUWA 4R7ZA 1OFIA 2QTGA 1CTQA 3L6EA 2BRBA 4M76B 1XI2A 4QZVA 4FSMA 3HV7A 4AZEA 4H3SA 1DL5A 4JJ4A 1T8TA 1N1EA 2FPXA 1H3EA 3BFJA 4P5DA 4PQNA 4IIEA 4P3YA 5IT9A 5DYTA 2PMWB 4TVOA 2C2BA 1FF9A 1PV2A 4L9IA 4NM5A 1NBWB 4WT7A 1G8FA 1IB6A 4OQMA 3GRZA 2W4QA 3NBFA 3RVPA 4QYWA 5CFLA 4KCGA 3PEEA 1SCUB 1T3LA 1ISSA 4BVJA 2H6EA 3HYHA 2ZDQA 2A1TR 3HLLA 4APCA 4EL9A 4P58A 3VO1A 3P2JA 3R7WA 4CHTA 4F5YA 4BBFA 3IT3A 2JFGA 4JQZA 3F5XA 1C2YA 1XWFA 2FQQA 4ZVTA 2H6DA 3TG8A 1ZYUA 4URXR 4A9RA 2VXOA 2C54A 1KAMA 5JMWA 2XA2A 4L3JA 4KO2S 4CDMA 4D0WA 5A62A 5D01A 3TEFA 2OWBA 3N5CA 1G55A 2OV3A 4QFMA 2BUCA 1GN9A 2G0NA 2PO5A 5EERA 3F5DA 1TKBA 1YOBA 1QHYA 5FP0A 1XP8A 3RUAA 2X2EA 2HHHB 3FR7A 4UE3S 5H3QA 2RI6A 3PUWA 1XJQA 5AJYA 4JS0A 5KMGB 3U9LA 3HE3A 1YK0A 4DQUA 4OJNA 4XH9B 1U2RA 3V1MA 4AJKA 5JRDS 2R97A 3CZ4A 3HG7A 2O05A 4YO7A 2C3LA 1P1FA 3N8NA 2C3YA 3EPHA 3HDQA 4OAOA 5F9HA 2CGWA 4LC0A 1XLUA 1D5CA 5EWJB 3SEZA 1EFVA 1FS6A 4HQRA 4DLIA 3NHMA 3UAOA 1JDTA 4IOJA 3KFXA 1R4NB 1O6LA 2WSBA 1SYKA 3O4IA 4O63O 4CCBA 1W2WB 3IOKA 2FRVA 1WQ1R 3PXXA 1ECBA 1ISMA 1CQXA 1MHTA 4QO7A 3O8CA 4DHEA 4ZMSA 3QL8A 2VJYA 3OROA 4L4UA 3QQUA 5AP9A 1R5NA 1CUCA 1KI1A 2Z8ZA 3HUEA 5EEHA 3NMUF 5AVUA 1ZK1A 2R1TB 4Q1CA 1KDZA 3I9MA 4KE6A 1R4MA 2QYHA 1NUUA 1V6CA 1FA9A 5EINA 2PVJA 3LVRE 1TDJA 3PJRA 3IR6A 2G28A 2I4NA 3IAM6 4Z7NB 2FSHA 5JTTA 1ISFA 1X14A 3OCUA 3AESA 1IG1A 4MTLA 1BEEA 3CUVA 4P38A 2IZ5A 3E5NA 4MNEB 1E5QA 1P2SA 2X1NA 3NHPA 3ZWWA 4RVSA 1NURA 2M6KA 4PHCA 4EKGA 4U7WA 4BB5A 5TQVA 4GLLA 4YMVA 4O5AA 4M15A 2Z30A 2PKQP 1F0KA 3SC3A 4A3SA 5IA2A 4JB3A 5CK5A 3IO5A 4E70A 1Z2OX 1LC0A 1LEHA 4CZ2A 4JS8A 2HCTA 2IZOA 4BZOA 1FYEA 1L5VA 3I42A 4I6JA 5JZSA 1Q14A 3NP7A 1WG8A 2O8YA 4KWIA 4NWMA 1MAHA 1Q92A 5ACBC 2ORVA 3WLJA 3H11B 4GSBA 3L2OB 1AK9A 1NC1A 1UJ5A 3AI7A 3I45A 3LM5A 4IQ8A 2I76A 2IBTA 3I30X 3FXZA 3V4VB 2PZFA 3K09C 2C4WA 4ZTQA 4PZCA 4TWIA 3W2CA 1OX5A 2HT6A 1NKVA 5KNLA 4UM5A 3LUDA 3GC9A 5A4AA 4HZRA 3DOHA 1ZIDA 3DJ6A 2X8AA 3K8YA 3FY2A 2GPYA 1Z74A 4FUQA 5KOJA 2PRIA 4ZAVA 1EJ2A 1RC1A 2DTDA 5EMMA 1YZNA 2O0MA 1SAYA 2V8OA 3OJWA 5AT1A 2EU8A 4YDSA 1IUNA 4LVOA 4FZ5A 2HD4A 4U3JA 1Y3CE 3ESYA 4O33A 1HE5A 2TMKA 4WBNA 1AGYA 2Q0XA 2YRWA 4B6SA 1FDIA 1U3UA 1N5OX 4I46A 4B2IA 3CMCO 3W2SA 4D92A 2PMBA 2PFKA 2VG8A 3K5HA 2PPLA 1MTZA 2E4VA 4Q24A 1MDBA 1DRKA 4H3VA 5C7OO 4C5CA 5HJ2A 2RGXA 1HXHA 3TL8A 1XWSA 2X0JA 4D4IA 3WIDA 4EDHA 3W78A 1ZWKA 2RHRA 3AL2A 2IWHA 7YASA 5A06A 4I1SA 3GJ4A 2NXNA 3HABA 1YC2A 2FEMA 2RGDA 3E9QA 2DPXA 2ONKA 3G8YA 5EZYB 1XZEA 2D06A 1RXVA 2XJ2A 3EZGA 2HJGA 3BE2A 1KI6A 1ZOEA 1NC3A 3BWFA 4OLFA 1Q62A 3HM2A 4AX8A 3WL8A 5A4FS 2UUOA 1PZHA 3LHKA 4PBSA 2HLDD 4FXPA 3HRHA 3C1TA 4II5A 1BU8A 3GLSA 4Z0NA 1KZYC 4DQVA 1NFQA 2ZBRA 3OFKA 1MW8X 3W9UA 3JQEA 4AWAA 2CNVA 1T3TA 4PAOA 3ZOZA 1BWRA 3JQGB 1QPDA 1DQZA 1ZGHA