3PLAE

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords Pre mRNA splicing protein
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3plaE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3plaE02
4WUNA 1WZYA 5EZSA 4E6QA 2BHHA 4XOZA 4GCJA 4CT2A 2ZZMA 2V5QA 1GIJA 3CKWA 2R2PA 4ZSGA 2AVDA 3LCCA 1ZMWA 3G5DA 3QTRA 4GU6A 3PLSA 3LQ8A 2PYWA 2CN8A 1IG1A 3ORTA 3MA3A 4NW5A 4BBMA 5CEMA 1U2ZA 3WZEA 4YJVA 5HORA 5KKRC 1V39A 3Q04A 4I22A 3EGVA 2XCHA 1APME 3H30A 4Y85A 3KR1A 4D5KA 4WNKA 3OBJA 4DCGA 2GTMA 2HV9A 4Y95A 4L43A 4C08A 4IB0A 4FT4A 1UNLA 3FMHA 5FBNC 3OT8A 2WU6A 4IFCA 2XKFA 2JFLA 2OIDA 3EQHA 3IK3A 3ITZA 3PSDA 2GNFA 4M0ZA 4BTKA 4DF3A 2X8EA 4HGSA 5HLNA 1RJEA 4QPNA 4Q5HA 4C4EA 4FR4A 2H8HA 1O9HA 4QTCA 2UZTA 4FV8A 4PY1A 3GB2A 2EFJA 3LGAA 2ITZA 1PXJA 3C5UA 4O7VA 2XKCA 4E5AX 4R05A 3FI3A 2ITOA 2QI8A 3O51A 4PUZA 4TT7A 4C0TA 3CE3A 4TYEA 3BBWA 4HVHA 2CLXA 2O06A 2F7XE 1NW6A 2HWKA 1YQJA 2B9JA 1OMWA 1QPDA 2UZBA 3WIGA 3AGLA 5CANA 4BI2A 1NW3A 4D5HA 5HG8A 1F5QA 4RMZA 3PFGA 5C8KA 1JKSA 1KE7A 4S32A 3CTJA 3EN5A 3QQUA 3RALA 3HEMA 4QQTA 4KABA 2QR8A 3HMMA 3NUSA 3KHKA 5GWXA 5BYZA 3K5UA 3OCGA 1JQ3A 2AZTA 1J1CA 2VZ9A 4AGUA 2HWPA 3RHKA 1PXNA 3FTCA 3NW6A 1VZOA 4IAKA 5CEPA 1L3RE 3DK6A 3E62A 3FPQA 3ORIA 4EZ5A 3RPYA 3BT7A 3CD3A 5IEXA 3DAKA 1Q0SA 5DT4A 3WF6A 3K3IA 3EZRA 1KIAA 3DFCB 1GIHA 3CQEA 2Y0AA 4AWIA 3ZU7A 2RG5A 3H9OA 5EC8A 4EK8A 1G5SA 3DJ6A 3QV2A 4H1MA 1AD5A 4EOMA 2DQ7X 1XJ5A 5HILA 4FNZA 3OROA 4G3FA 2WMBA 1YI3A 3BE2A 1KE5A 4MHAA 4NKAA 1XH8A 4GSBA 4KSPA 3T8OA 5M4FA 4GW8A 1PXMA 4DH1A 5FHRA 2BHEA 4J7BA 4YGAA 2ITUA 3ALNA 3M1SA 3PPZA 2O0UA 1KYZA 3P79A 4KD1A 3HV7A 1NBIA 5LQUA 4LM5A 5CX9A 1G55A 3QRIA 4GT5A 2Z8CA 1WZNA 4PIMA 4HZRA 5CM2Z 3SGLA 3UJDA 3R01A 3P08A 3V5PA 5DX0A 4EH4A 3IDBA 3QRUA 2HTEA 3DUWA 4DEDA 2WK1A 3FKNA 2PVLA 4E20A 3MB5A 2H11A 4DM3A 3BE9A 3P97A 4FEQA 4UZDA 3IKAA 2YCQA 5DBXA 2P0CA 2ONZA 3QKMA 1MQBA 4IB5A 1M52A 3DQXA 4I24A 4MWIA 5E1EA 4ZJJA 2WA1A 2YX1A 3BKXA 2XEZA 4FEUA 4OTIA 3GNLA 2YIQA 3OF0A 3UOKA 5H3QA 3AOXA 1XCLA 3UIXA 4L67A 1JQDA 2XNBA 4I6QA 5I9WA 4F9YA 3FBVA 4PYMA 4OR5A 2EUFB 3ZH8A 1EG2A 1FVRA 3VUGA 5KNJA 5JQ5A 3FLQA 4GK2A 4EH7A 3E7VA 3LLAA 4M37A 4E4NA 4G6LA 5KMJA 3A62A 3SSMA 3W2SA 2X1NA 3VRZA 2QD9A 3DNDA 1F3LA 3D14A 2GNJA 3ACKA 4FGRA 4FKOA 5E8XA 4BDFA 1ORHA 4YSJA 3IYLW 2C6OA 4C62A 5DR9A 4IVAA 2ZBQA 1UU8A 4ACHA 2ZM4A 4FOBA 2J0IA 3M6VA 4EH8A 3VBTA 2P3OA 2PMIA 2VN9A 2I6LA 4DKJA 3PTAA 3ZLSA 1YHSA 5EGSA 5LWMA 1PKGA 3A60A 5LMKC 2VTMA 4N70A 4F9BA 4TNDA 2J2IB 5D1HA 2NP6A 3QHWA 2G71A 1H27A 5J9YA 4DZRA 3FPHA 3V04A 4DH5A 2BVAA 2JDTA 5KMIA 5CU6A 3SKCA 3C0HA 5AEPA 5CWZA 2QLUA 2RIOA 4FIGA 4FL1A 2X8DA 3NIEA 3KQVA 5CEQA 2FYSA 4MCVA 3UWPA 2PWYA 3LFBA 7MHTA 3RAIA 4F7JA 2GS7A 4FTLA 2GFCA 3TN8A 3VC2A 2XJ0A 3FUPA 1CKPA 2W7XA 1VP9A 3I9FA 3CGOA 1CSNA 3UNZA 4RTPA 4GU9A 4DEAA 2ONLA 4ERWA 4QQJA 4ZZMA 3RK9A 4FP9A 4FTOA 4GOLD 5DOSA 5FLFA 3AMYA 3KQOA 3NDMA 3AMAA 2OF2A 1G38A 3BHTA 4S34A 5ACBC 4L7VA 2NXCA 4AOIA 3MIAA 5CU0A 2W99B 2WA2A 4XLVA 4ZMFA 5EFQA 4K0YA 4D1XA 1L8TA 4CD0A 2OPBA 4H0NA 2IH4A 4I20A 5DTMA 1XJDA 3PRIA 4FV1A 2UZVA 4YU2A 4OBWA 4W4VA 1XQZA 2B52A 3I6UA 2C0IA 2YHVA 3C4EA 4I41A 3O71A 2QVSE 2BIKB 1J91A 3U54A 3ELWA 3ZFXA 3I4BA 4U3ZA 4EBWA 2CNVA 1G3NA 3MDYA 2I7QA 3KN5A 3CC6A 3DKFA 4D4SA 3LDGA 4FTIA 4QDKA 1DL5A 4Y2HA 3Q9XA 3GRVA 3M70A 5E1MA 2VTQA 3FZSA 3EIDA 2R3PA 4FKTA 4FKWA 4KA3A 5CZHA 5FGKA 2XNPA 4EKKA 5FDXA 5EOVA 3UJCA 4OA5A 3GENA 3TKAA 3ORXA 5CXHA 1YZHA 1OKVA 3AGMA 3LOKA 4JBQA 4OTDA 4YHFA 3DK7A 4EOLA 3DXQA 5EDRA 4F63A 4O6EA 1OBGA 3BYMA 2XNNA 4ANLA 3K54A 5EIWA 3B3GA 1N7JA 4G5JA 3VBWA 3G2MA 2WQNA 4TYJA 3TACA 3UOLA 4AZSA 4FKPA 1Q61A 4RX8A 5M55A 2WMRA 3DJ7A 3LKMA 4AZEA 5L3AA 4IV8A 5BXYA 5LVMA 4NUSA 3UYSA 5L8JA 3ORHA 4L3JA 4HCVA 5BW4A 2R3JA 4A9TA 5CSWA 4CNHA 3T3UA 3VJOA 3BU3A 3WBLA 4CQEA 2I6GA 1XKKA 3ZM9A 3KVWA 4FTJA 4Q9ZA 4U81A 2O57A 3M4XA 2VTTA 3BPRA 3OY1A 5EEHA 4FEVA 4WA9A 3O31A 4FTRA 1H26A 5F2NA 2ETRA 4EI4A 3AC2A 3SXJA 3OP5A 4E31A 4IAAA 1IR3A 4FKLA 5HIKA 4RVFA 1Y57A 2ZULA 2PLWA 2ZIGA 4HSGA 2OICA 1F3MC 3LDFA 4E33A 2OFUA 3UNKA 5FHQA 5GM2A 2QHNA 4IWOA 1PXPA 1S9IA 3OD6X 4HVSA 3B7PA 3A7FA 5HVKA 4IKPA 3KC3A 4M84A 3K0BA 4G1WA 4WXHA 5EKNA 3W18A 1Q99A 4HGLA 4E70A 2WIHA 4EKIA 3LFAA 4V05A 3MH0A 1VQ1A 2I0VA 2B53A 3HMIA 1ZKDA 3SV0A 1P1BA 4DTAA 3OFKA 2IVTA 2BKZA 1OUYA 3ER9A 1ND4A 3F3WA 2O05A 2GS6A 3W32A 3UOJA 3MJ2A 3VHEA 2C4GA 2ZAZA 3CJGA 3SOAA 5CASA 4ZSLA 3PUPA 4MIKA 2BAQA 4C03A 3G9NA 1UWJA 4O22A 4U42A 2HW7A 3AT3A 4GMYA 4RJ7A 4ZY5A 5IQEA 2GTNA 4FT7A 4FKUA 4ZZNA 4R6XA 3O7LD 3G88A 3G8BA 4U0IA 4ZJVA 2O3PA 2XS0A 4G2FA 3ID6C 4QQCA 2YAAA 4IZ7A 3PY0A 2E9PA 5AP6A 3HVCA 2HMYB 5DI1A 1JSXA 1LR4A 4PCLA 4V0RA 3LZBA 4S2ZA 2C5NA 3ZZEA 1X1AA 2PBFA 4WO5A 3QYZA 4QMYA 2VTSA 1QPCA 5HVYA 4LOOA 4YJNA 3UDBA 4L68A 4JRVA 5FRIA 5KZIA 3LCKA 3R8VA 3EQCA 4X2FA 3RPSA 3A7EA 4FSTA 2WQMA 3MTEA 1YRPA 5HG9A 4QP6A 3NLBA 2C6LA 1DI8A 5FCDA 2OGVA 4XH6A 4NTSA 1CKIA 3KF4A 2CDZA 5DSXA 4HH4A 4PINA 4E30A 1TVOA 4X2JA 1O6KA 3UNJA 5M09A 5M56A 3ATTA 1AQ1A 5GIOE 4OW8A 1BC5A 2NNWB 4YNEA 2PVFA 3IO7A 3TWJA 2K4MA 3DXYA 1NVQA 4X61A 4EVIA 3OW4A 5D9HA 5L8LA 1NA7A 2ITQA 3FHIA 5D11A 2CGUA 3SDJA 4CRSA 2I7CA 4FSDA 2IGTA 1ZOHA 5HX6A 2R3HA 2UVZA 3T0IA 4RTSA 3DV3A 4PYJA 5A4TA 2PZYA 3FL4A 4F6WA 1ZGAA 1P5EA 2GMXA 4UXLA 2YAKA 3KMMA 5CVVA 4QOXA 5J5SA 4R5YA 4L42A 4DAWA 5E7RA 3WIKA 1H24A 4ZTRA 3W55A 5BUJA 3LECA 2CLQA 4F4PA 3A4TA 3G2OA 5AV2A 2E5WA 5JMSA 5BMSA 3HCEA 3HVIA 4AF3A 4RLKA 4IW0A 2QOIA 5IU2A 5E1BA 3TZ8A 1UWVA 1X1DA 5B2KA 4Q5EA 1XDUA 3MY5A 3LBYA 2XP2A 1Q41A 2OZVA 2ZOQA 3FQHA 3P9NA 1Z9XA 1I44A 2RFNA 4O6LA 3TKHA 5CSVA 5E8RA 4WUAA 1V0PA 3PXZA 5LQFA 4RV9A 3SSOA 1YXTA 4M13A 3HTXA 4L52A 1R0EA 3D0EA 1CMKE 1ZOGA 3W33A 5HBHA 4AA4A 2H96A 3E92A 2E2BA 4YHJA 3RKBA 5LJJA 3OCSA 3P86A 5J95A 5IPJA 3QWJA 4QTBA 5LOHA 1RJFA 4MEDA 2ITNA 3KQPA 2YR0A 5B2LA 3MWUA 2HENA 2QE6A 10MHA 4O7LA 2DUVA 4XP0A 4D58A 2PVKA 1Q3DA 4EHGA 5CF6A 2NPQA 1M2RA 5EI8A 4BZDA 3TQSA 3LQ3A 5FWAA 3DLCA 4YUXA 2NP7A 2WZJA 4E6CA 4A9YA 4XRLA 2OJJA 5KQRA 3KF7A 3BZ3A 3Q2MA 3IW8A 4KS8A 4UYNA 4D55A 2Q83A 4FOCA 2ZWAA 1KP9A 1UV5A 5ANEA 5K9IA 3PG1A 3JR1A 3EFJA 2C6EA 2JDOA 4CCBA 3S68A 3FV8A 1V0OA 2ERKA 5KE0A 3CVOA 2CGWA 4JT3A 3AWIA 2XRUA 4JR7A 5C4KA 4ZLOA 1OR8A 5GP1A 4QO9A 2A1AB 4EH5A 3WOWA 5JGDA 3DKCA 2UVYA 4IM0A 4JJRA 5M4UA 3HKOA 3MV5A 4IM2A 5LMBA 1VYWA 3BWMA 1BI8A 2JKKA 3KRLA 4LRKA 3H9RA 4BCNA 4YTFA 2IVVA 4BLUA 3IW7A 3SLSA 4PMTA 5I9VA 2WTWA 3N4TA 2B9IA 4GYGA 1YWVA 3CPBA 3A26A 5FEEA 5JGBA 2P3LA 4V0QA 1J3HA 2GFSA 5HO7A 1PMVA 3RMFA 3D5WA 4LWPA 4RFMA 4DCEA 4HVGA 5FTOA 5L2SA 2PMOX 4DMGA 2C3IB 1WBSA 5IA3A 2OJGA 5I9YA 4IANA 3EVEA 1OGUA 2ADMA 1ZY4A 3L8DA 4OBPA 3POZA 3FUWA 3HA5A 4XHKB 5CAVA 5AA8A 2B25A 5CF4A 4L3LA 5EOBA 4MXZA 3HMNA 4I6FA 2A0CX 3SA0A 1WG8A 3DTCA 2UW5A 3HV6A 4NM5A 4AW1A 4JXJA 5JFSA 1H1DA 3IOPA 2FO0A 3KR2A 1WXWA 2P40A 1Y6BA 2A27A 4Y73A 1XO2B 2YM7A 3NAXA 4GK4A 2WNTA 2JHCA 3HCDA 4GEKA 5CU2A 3GNIB 4DG3E 2B9FA 3R2YA 2O64A 3BV3A 4QT1A 5EK7A 4PP7A 3U87A 5LWNA 2GQRA 5DNRA 2F9GA 4CMOA 2CWWA 4GFGA 1LP4A 3EQPA 5CT0A 4RGJA 5C27A 2C7QA 4HRAA 5BPYA 4IDVA 1KUTA 3JVSA 3NR9A 1DS5A 1JOWB 2VTPA 2FB8A 3D94A 1YWNA 3GCVA 4FV3A 4ZTSA 4BCHA 3CJQA 4WSYA 3R24A 3ODZX 4GOOD 3E88A 4FTNA 3LXNA 5BVWA 3O2MA 4EC9A 1YXVA 2JD5A 3BX5A 2HY81 4QTEA 4CFFA 3E8SA 2W5HA 4BIDA 4EC8A 2OBFA 3EB0A 2X7FA 2GB4A 1NBHA 4JDKA 3D2KA 4GH2A 3PY1A 2OY0A 3LSTA 3OFJA 5T6BA 4O0YA 5ICEA 1UU9A 4FEWA 5AV0A 3MPTA 3NCZA 2P2HA 4QDJA 2QODA 4ZLZA 4FSZA 4FT9A 4RRVA 2HZ4A 3FEGA 3KU1A 1JQEA 1X19A 5T6KA 3CBGA 1P39A 4K1BA 1PXOA 4MAOA 3KULA 3WZKA 3TJDA 4XX9A 5EI2A 3MSSA 2P8JA 3DP7A 2VV9A 3PIZA 4IEBA 3OMVA 4DLIA 4DFZE 5JT2A 4YSMA 4IQ6A 1U4DA 3QD0A 1HNNA 3HNGA 3Q9ZA 2B9EA 4QVKA 3IEIA 4IC8A 2VDWA 4LL5A 2IZRA 3NS9A 4O7ZA 4ER5A 3W2PA 2XIYA 3QFVA 3CGFA 4F6SA 5EG3A 5AAGA 3EL8A 3ULZA 1FP1D 1SUIA 2HCKA 2QOKA 4QTDA 5GNKA 5HGIA 5IUIA 3DNEA 3CPCA 3P9CA 3T7TA 4MQ4A 3TMAA 4QQKA 4RVDA 4FVQA 4XS2A 3FQSA 2PX5A 1RQQA 1WAKA 2JH9A 5DLYA 4N57A 4O82A 5K8VA 2GS2A 3E63A 3QGYA 4I23A 5KVAA 4LFIA 5E8TA 2PPQA 4BIEA 3AD4A 4IFGA 2PVRA 2UZNA 4RJ3A 2JHAA 4O81A 2PY3A 4CXMA 1WS6A 3AXSA 2IH2A 1YZ3A 3SG8A 4AU8A 4I0SA 1B39A 4AW5A 3M6XA 4K11A 4NM7A 3ZSHA 4Z3VA 3R28A 4PYLA 3CY3A 3NJRA 4V04A 2BZGA 4S33A 1B42A 3CJTA 3HEGA 2QOCA 2ZV7A 4K8AA 4AN9A 4BN1A 1STCE 2UV2A 4KBAA 2JITA 1ZMVA 4MBLA 3ZYAA 3C0KA 4KW7A 4RTNA 1GZKA 4GUBA 4EUUA 3DTNA 2ZM1A 4EOPA 4EQMA 5CCXA 4MD9E 5FA8A 3GFWA 2F49A 2J90A 5LQNA 3FC1X 2FK7A 4NJ3A 4XNEA 3AG9A 3DAEA 2YA9A 3GC7A 4M97A 4NK9A 4RFYA 5ETAA 4EOIA 2E9UA 3S00A 2XF0A 3DZOA 4I6HA 3U81A 2J7TA 4Q2AA 3KL8A 4B99A 4IX5A 2ZZKA 3CLYA 3EYHA 4OUCA 2ZZNA 3AD5A 3GCQA 4BP1A 1T45A 3NUUA 2C3LA 3R1SA 2ETKA 2R3NA 2R0IA 4N6ZA 3GOPA 2YDIA 5BYYA 1VLMA 1R39A 1KOBA 4E26A 4CTJA 5EDPA 2BKKA 2WAJA 2OB2A 4MKCA 2V7EA 1QMZA 1YOLA 4BCQA 3ANXA 5EVJA 4IZYA 3I7CA 4L7FA 4X6QC 4YLLA 1Q8UA 1YW2A 3NW7A 3UO5A 3EVCA 3HA3A 3OY3A 2A2AA 2WB8A 3EMGA 3DLSA 3EQFA 4QP1A 5AM7A 2PT9A 4Y5QA 3HRFA 3KQWA 3TOSA 2PVNA 3PP1A 4W4WA 4LV8A 4EL9A 1CTPE 2OKRA 3QXOA 5A6OA 1YOJA 4OBQA 3R7IA 1XVAA 4O0SA 3O7LB 2G2FA 5F20A 3V97A 2Y4IC 2ZW9A 3P71T 2C0OA 4ENYA 5B2MA 5E1SA 5IA4A 2NRYA 2YDKA 3OBGA 3RAWA 4BR3A 4EMSA 3FKOA 3IPHA 4DITA 5GJGA 4MTAA 4U41A 4F9CA 2G70A 3QCXA 4KKHA 3ZZWA 4XUCA 3NRMA 3PFQA 3QGWA 2OSCA 4UXQA 4RX7A 4MXAA 2X9EA 4V01A 2ZV2A 5CVFA 3R83A 4A7CA 4CZUA 3BGPA 1KE8A 5DWQA 4D9UA 5HNGA 3TNIA 3UTOA 3DK3A 3BWCA 5IQAA 3PSCA 1UFKA 4AOTA 2B2CA 3F5UA 3AXWA 3MERA 5M06A 3AC8A 3QX4A 5DFPA 3E8CA 4C2WA 4RZWA 4MWZA 1GNGA 5HD4A 3ZCLA 4XCXA 5FUBA 4D2RA 3DTWA 3KXZA 5JZJA 4KSQA 5CS6A 4UV0A 5FQNA 5K05A 1KOAA 4PWNA 3EOCA 1PMUA 4DQ0A 3ODYX 5BYLA 5EMJA 4EKLA 3LCUA 2P33A 2PU8A 3E64A 1H25A 4F86A 4LG1A 4I5PA 1R18A 1XBAA 3QTXA 2JDRA 2CMWA 2G9XA 3PJCA 3V8TA 5A54A 1SKMA 1GY3A 2Q0BA 5FADA 4TW9A 3QL8A 4O83A 3F6XA 5G1XA 5E8JA 1KPHA 2PGXA 2BH2A 1GOLA 3UIBA 5KKRB 3EGIA 1IAJA 1IY9A 1FBNA 2HZNA 2YEXA 3RZBA 1F38A 4ARKA 1NV9A 1L3BA 1CKJA 4QMUA 1BL6A 4U7ZA 3GXLA 2YCSA 3C7QA 5EYKA 3KXMA 4JQ7A 4E73A 2ORED 2ZIFA 4JQEA 2E9NA 4RVKA 1DAWA 1RI1A 1U5RA 1HCKA 2IP2A 3FI2A 4IDTA 4GVJA 4WNOA 1BI7A 5T67A 3F2AA 3TTJA 4FE2A 1J1BA 2VWWA 5E4HA 4DEIA 4E4MA 5LMKA 1ZYJA 4O7TA 2X2KA 5ANGA 5M53A 3ZRMA 3OE4A 1QYRA 2GNIA 5LQCA 2PE1A 5F2KA 4BCKA 3BQCA 2V74B 2I0HA 2OJIA 2QOQA 4LUDA 2ONYA 4GIIA 4RX1A 4F09A 3C51A 2ITWA 2ZMCA 4FG8A 2RKUA 4JG7A 3ENHA 2CGVA 1XH9A 3I79A 4NJDA 4EH3A 5CXZA 1XDZA 2G72A 1OL7A 4GUEA 5L6OA 5CVEA 4S30A 5DSTA 3D7TB 3E8EA 4C06A 4M67A 2BRBA 2VO3A 1E1VA 4TNBA 4ZP5A 3F3ZA 4FZVA 5IQGA 2EB3A 4D9TA 1A9UA 2IJMA 3LQ5A 4DGGA 4YURA 1QL6A 2XJ2A 3FLSA 4YUQA 3WZUA 1EAMA 2YM8A 4FNWA 3QD4A 3BGDA 5BP7A 3S4QA 2BIYA 3D5UA 4GF5A 3V01A 3LCSA 3FRIA 2SRCA 3EN7A 4L01A 3SRVB 1OKWA 5EMKA 4C7TA 2C5XA 2VTIA 3TZMA 3VC1A 3QYWA 4LGGA 3DBFA 4YC8A 2GPYA 3V3VA 3A8XA 3FMKA 3ORMA 1NXKA 3PYYA 5C1QB 4A9UA 2WEVA 4O0WA 4YO6A 2QG7A 4G31A 3L9LA 5HU9A 1VE3A 4YNOA 4H36A 3C0GA 3ZO4A 1V1KA 2NXNA 1UU7A 4AX8A 1NW7A 4IIRA 4R77A 2UW7A 3O23A 4QQNA 4NCTA 3R30A 4TWPA 2FCAA 1AV6A 3FPFA 3KQSA 3II5A 2H00A 4YUYA 3LL7A 3UP2A 2V7OA 4D1ZA 2B54A 4DGNA 3EKKA 4XUEA 4DYMA 2FK8A 1WVWA 1KE6A 3MW1A 4XUDA 3GRUA 3MVHA 4NFNA 5GOZA 3VS5A 3KVXA 2GHMA 3OVVA 3FSFA 4RVMA 3E87A 4PYQA 3GUBA 4JS8A 5ANIA 5AAEA 5BVFA 3GU5A 2YM6A 1OL6A 1PXKA 3WE8A 2VD5A 4IAYA 2IN6A 1H4LA 4LG4A 4POOA 1RW8A 5AM6A 5EOLA 5AUXA 3HX4A 2V7AA 3RWQA 2W9ZB 4GT3A 3V8SA 4YTCA 2AR0A 4BDJA 1DM2A 3HV4A 4XG2A 5HX8A 3NYOA 3EPPA 2J9MA 1JKKA 4AGCA 4ER0A 5ICGA 5DEYA 3IQ7A 4HGEA 4F65A 1KPGA 5IQHA 1N7IA 2XCKA 4AW2A 3ALOA 2VWYA 3MH1A 1D2GA 1NT2A 4C4HA 3NW9A 2G2HA 2PZIA 2O0LA 3GIWA 3L9MA 4FKGA 4XG9A 3D15A 4AE6A 4MXOA 4DTBA 3H4JA 3P7BA 3JWGA 5E91A 4YJRA 5ICCA 2OJ9A 2P7IA 2YM3A 4UYAA 2Q0NA 4UBAA 1D2CA 2C5YA 2BTSA 5JKGA 3PRFA 4J71A 4B8MA 5E2BA 5B1SA 5DA3A 2HELA 2Y4IB 3MFUA 5F95A 2QG5A 3W2QA 2Q41A 1YI4A 3O8PA 2BR4A 1XBCA 4HOKA 3MPMA 3TKYA 4FG9A 2RFDA 3WF8A 2YM4A 3GQIA 4EQUA 4Z7HA 4CVAA 1MQ4A 5FDPA 4R6WA 4KNBA 4YR8A 2OXDA 1WBNA 2R3IA 3TXOA 4BLVA 4TYHB 3QQLA 1JBPE 3QA0A 5I9ZA 4MTLA 3BGIA 4LRJA 4LRMA 4YJUA 5AADA 1G6Q1 2PMNX 4PYNA 4K2RA 2AVNA 2YDJA 2XVMA 3ELUA 5FG8A 3QTZA 3WARA 3GU6A 3PJ8A 3PFHA 4P7JA 3CQWA 2PHKA 5AIKA 3NYVA 2AOVA 2VWXA 3FZ1A 4CMUA 4PQNA 4I6BA 1OB3A 1U54B 2UVXA 3HECA 4W4YA 5EQYA 3ZDIA 5EI6A 4MH7A 2HAKA 4PGGA 3F5XA 3MYGA 4RQVA 2YIRA 2P2IA 3PT9A 5DVRA 4FC0A 3UZUA 4WBBB 3UQFA 2I62A 2PUIA 4AACA 3UG2A 4UB7A 4WNMA 3UMWA 4UWBA 4Z55A 3KN6A 1QANA 3PZHA 2QNJA 1RDQE 5BMMA 4BDDA 2VTRA 3F7ZA 3PWDA 4DA5A 2UZOA 2FRXA 3F3UA 4O27B 4U7PB 5HIJA 1PY5A 4YV0A 2FSOX 3LIJA 3VIDA 4M15A 1KYWA 5DE2A 5HZNA 4JLCA 2Y6OA 2P4IA 5IH5A 3UC3A 1TW2A 5K03A 5BUEA 2BDWA 3CCNA 3LCOA 4F9AA 2AN3A 3D2IA 1ERKA 4FSRA 2P3QA 1B38A 5D7VA 3D5XA 2I9KA 2PWPA 4L45A 3D9VA 1EQAA 2W1EA 2WPAA 4IWDA 3W10A 1V0BA 4FTAA 4JBPA 3EGEA 2BAJA 4KDRA 4DGLC 5A9UA 5F9EA 4EKGA 4YZBA 2UYQA 4K18A 3UJAA 5KCVA 1NY3A 3CEKA 3L9PA 5K09A 4M14A 2EJTA 2N47A 4RC2A 4FZDB 2XIRA 1ZHFA 1XR1A 3BYOA 2B0QA 3ZLXA 3E7PA 3P2IA 4O0RA 1ZGJA 3TM4A 4CCUA 3FZPA 4C3RA 5HEZA 3N9XA 4QMPA 1PHKA 2C1BA 2YACA 4PDYA 4QPAA 2PSQA 1CM8A 4R5SA 3TR6A 4G16A 4IVBA 4CLJA 3IW5A 2ZTHA 1XDSA 1WBPA 5FM2A 3R04A 3ZUVA 4DEEA 4R1YA 3ZHPC 2NXEA 1I09A 3OEFX 3DB8A 4EHZA 3HVKA 3ZBFA 5EG5A 2VTLA 4LV5A 3PVGA 3RAKA 2BALA 1RJBA 3ZO1A 4HW7A 5KMNA 3EN9A 2BCJA 2R3KA 3G15A 3KY2A 4FYNA 4L3PA 4PDOA 4DBNA 3CD8A 3S2PA 2XKEA 3FYDA 4M7RA 4RX9A 3FDNA 4EH6A 4XOYA 3JS2A 4KIOA 2GSFA 3B2WA 5EQEA 4L00A 1H1RA 3F9NA 3OG7A 2UW0A 4YTHA 2W1IA 4FKQA 4NM3A 2ZYBA 3KRJA 5CAOA 2QO7A 2WXVA 3MPAA 3NCGA 3L1SA 4N6YA 4JDJA 2EXCX 4MQ1A 3X0DA 3PP0A 4AG8A 4OBXA 1M0EA 4BTFA 3VHKA 2W1HA 1P2AA 2I1MA 2QONA 1KXZA 3M2WA 4AP7A 4X0MA 3QF9A 3SVVA 3TPZA 5DM1A 1FQ1B 2WKMA 4LOQA 4D4YA 4O21A 2O5KA 4KRCA 3U6IA 3ZEWA 1L3CA 2Z6QA 2VTNA 2JKMA 3DMGA 5EW3A 3H3CA 3ME5A 4I0TA 2OH4A 4U80A 3D7ZA 4GV1A 3G6HA 5JFWA 3F66A 4GKHA 4ORKA 1R6AA 2HW6A 3PTGA 3PWYA 4X3JA 1T43A 3LPMA 4F70A 5K0LA 4MD7E 3FAAA 3GU7A 3DBDA 1URCA 4RVGA 3NX8A 2JKOA 4KBCA 3BU6A 4JR3A 4V0GA 5C8NA 4TWCA 3I64A 1O9UA 5HIMA 4ANMA 3ORLA 4K33A 1UU3A 3ZRKA 4U6RA 4H05A 5DR2A 3QLGA 1B6CB 4YZMA 2XB7A 3BKBA 1MUOA 4C58A 5IZFA 1QAOA 3QRKA 3MAGA 1G60A 3SR4A 5HOQA 3IDCA 1R00A 5DPMA 2RL5A 4XYFA 3C6KA 4GUAA 3R02A 3KPUA 3R00A 4U44A 4F1TA 1LEWA 2GU8A 1U59A 3OUKA 3ZUUA 1KPIA 2PY6A 4BGHA 3OU6A 5E2AA 3ENMA 3FY2A 5CQUA 3V6SA 4H3PA 4BIBA 5LARA 2ZBPA 3GDHA 5EM7A 3W8QA 2GAFA 2BRNA 4CKCA 5AX3A 2WMXA 3SC1A 3R73A 4FZ6A 4AZFA 1PJZA 2DPMA 4G5PA 5LVNA 2VTOA 4UEUA 3VF8A 3KXGA 3LXPA 3Q87B 3A2CA 4J1RA 5FTWA 4O0UA 4P5QA 3TV6A 4CFUA 2EXMA 3P7AA 1YFJA 3O7WA 5E8UA 3ROCA 4BLWA 5IH3A 4CKBA 4OBOA 3WF5A 4BDBA 5H9BA 3UPXA 1BKYA 4X1OA 4CTKA 3GCUA 5EKOA 3PB3A 4F7NA 1BHJA 4S31A 3KRRA 4FV5A 3ZFMA 2PVMA 2Y9QA 2W0JA 5CALA 4RWZA 2JAVA 4R8RA 4NH1A 4R3RA 3U9NA 4BCOA 2B7AA 2PE2A 2V62A 4EZ7A 5I4NA 1P91A 5LSAA 3AMBA 4JX3A 3FLWA 4EOJA 2WQBA 4L7SA 5HU3A 2IW8A 4D0WA 4JAIA 2RFEA 3D2LA 4D28A 3N4VA 4DT8A 3BLQA 4EH9A 3O17A 4XG3A 5BVOA 2BR1A 1H1WA 3CTQA 4JQ8A 3TV4A 4E5BA 3UIMA 2GCDA 5L2TA 2PXAA 3HM2A 3EQDA 3BQRA 3TI1A 3Q60A 4PX6A 5E8VA 5J87A 3ETAA 2YCRA 1P14A 3V5JA 3MHTA 5F94A 3H10A 3GOKA 4ZY6A 2XRWA 4NECA 1VEBA 4TN6A 4Y72A 2XNEA 2ERCA 5HFJA 2CCIA 5DN3A 3RPRA 3JWHA 2WMUA 3FI8A 4L46A 4DFNA 2QY6A 5HTBA 2ZCJA 1H28A 3GCSA 1FOTA 1OPLA 3NYNA 3OT3A 4U9AA 5HBEA 4K9YA 3C6MA 3KPJA 2YXLA 3F7WA 4HTFB 3EVZA 3F2RA 3P8ZA 5E8WA 4HVIA 3Q4CA 2FSLX 4DG0E 3LKDA 3PVCA 4C37A 5D1NA 4RIWA 2W1ZA 5LCJA 4EUTA 1Q8YA 1VIDA 2VP3A 3LCTA 5IMEA 3RWPA 1JG1A 3DS6A 3UFBA 4RLLA 5CNOA 5CYIA 3HLLA 4QP4A 3R7UA 1UKIA 3FWQA 5BQ0A 4CKEA 4LMNA 2WMAA 4IB1A 5HNBA 2Y1WA 3G9LX 3R9OA 3NW5A 3OCTA 2FHPA 4O7NA 2XUUA 4OTRA 4B6LA 3EFKA 4ZY4A 4WD5A 3SD0A 3B5IA 5KYGA 3C3YA 2WELA 3G0EA 4EQZA 4QMSA 4P7KA 2VX3A 4HPUE 4WRSA 4H3BA 3GP0A 1PXLA 4YUWA 2JBOA 4FUYA 3UJ7A 3VYWA 3UJBA 3DQWA 3MVMA 4RIXB 2UYOA 5A4EA 2Z7QA 4CG9A 2YCFA 4AZTA 3NVKI 4W8DA 3UG1A 5AFVA 2PVJA 2GPHA 2ITYA 3KU2A 4ITHA 1QCFA 3ZLWA 5ICFA 3DJ5A 5E9EA 4P5ZA 1QAMA 4C02A 2XYRA 4RTOA 5HD7A 5M08A 3ET7A 3HL7A 4JBOA 2AYPA 4P90A 4RWIA 2W9FB 4FTMA 4MK0A 2XYQA 3TFWA 2AUHA 2XYVA 4WG4A 3FMMA 4TY1A 4XV1A 3HVHA 1JVPP 3HZTA 1FJXA 4KIGA 3FPEA 4KIQA 5BVKA 4O7YA 2X4FA 4XRJA 3DY7A 4EONA 2OW3A 3NGAA 4BYJA 1NW5A 2FYTA 5AP5A 4C59A 4PWYA 4B8LA 4LI5A 4XP2A 4G3GA 1SZMA 4ATNA 4QP3A 1ZMUA 3MS9A 4G3EA 4USEA 4ZK5A 4QYFA 1OL1A 2AOTA 3EVFA 5C0OE 3RODA 3PDTA 4RWJA 2BRMA 3WILA 5BNJA 1URWA 2JBPA 5FBOA 3IGOA 5K4JA 3OHTA 3FPJA 3OW3A 5EHIA 3NDIA 2R64A 3LPBA 4HCTA 2QOHA 3TZ7A 5CNNA 3UZTA 5FUTA 5FQDC 4YO4A 5LQKA 3K2LA 1R0PA 4UZHA 3GEQA 3F69A 3PA3A 2IDKA 3R8UA 4BBFA 2GA9A 3TUCA 2CSNA 2PKWA 5JZNA 3QTSA 4FSQA 3GJYA 2Y6MA 5ICPA 3FTEA 3JY9A 3LLTA 4NZWB 4WKQA 1N2XA 3P9IA 2FH9A 4MBIA 3S0OA 3CIKA 2BRHA 3EHAA 5C9ZA 1PW2A 1JSZA 4PL4A 4AN2A 3DXXA 3FJQE 5GJFA 3TDVA 4E6DA 3C4CA 4G17A 4II5A 1FPUA 3S95A 3BEAA 1H00A 3V5TA 4HGZA 3Q5ZA 3MA6A 3TL8A 5TOZA 3OEZA 4QNAA 4FS8A 1MRVA 4QP2A 5BVNA 4W8EA 2XK9A 2QYOA 2DS1A 3MVJA 4GEOA 3EH9A 4D0XA 3O4FA 2HZ0A 3L8XA 1GZ8A 3PX2A 4O2ZA 1SVEA 2UZWE 3QCSA 3CTHA 1FMOE 2JG3A 2BAKA 2KULA 2RF9A 3M6WA 5L6WL 4FV6A 3R7EA 3TV7A 3KQQA 4IBMA 4MF1A 3HMPA 3CS9A 4CTBA 2Z02A 3RW9A 5CVDA 1OIQA 3THBA 3JY0A 3BUSA 3R63A 5JGAA 3VUHA 3NMUF 2W4JA 3ER8A 4N4SA 3QRJA 5GIPE 1SMHA 2OB1A 4F85A 3KR9A 2W4OA 3NWWA 4GYIA 4QMVA 1KWPA 3O96A 4FSUA 4YBKA 3IW4A 1Q97A 4MVFA 1JSVA 3VS1A 5C26A 2O65A 4I4EA 1ZQ9A 3C13A 4R7IA 1YXXA 3ZTXA 1YXSA 2YZAA 4C04A 3H0ZA 5EYMA 2ZMDA 3TZ9A 4CEGA 2P1DA 1M7QA 1SNUA 4FTQA 3PLAE 3UVQA 4MYGA 5KX8A 3BRBA 3RNIA 2JDSA 3DB6A 4QMOA 3NUAA 2GNGA 2C3KA 2YJSA 3O50A 4EEVA 2WTVA 4MWHA 5P8WA 3L8PA 2W17A 4I0RA 5DGZA 3FPGA 2R4BA 3B3JA 4HG2A 2QOFA 2XM9A 3KMUA 4FBXA 4FKRA 3C0IA 4U3YA 1ZY5A 1OL5A 5ANDA 5JFXA 1WXXA 2BM9A 4H3QA 1Q8TA 3BKWA 3NUYA 1HCLA 1ZYCA 3VC4A 3LJ0A 2QU5A 4YUZA 2H34A 5EW9A 4DGOA 4RIYA 2CNUA 2PULA 5CTPA 2WTJA 4DH3A 3GC9A 3TCPA 1JR4A 4AGDA 4IV0A 3UBDA 3FRHA 3PZEA 1BKXA 2ACXA 4FL3A 4Q9SA 1KV1A 4XJ0A 4CRLA 1YVJA 2PX2A 1XWSA 3AT2A 4F0IA 4Y83A 4PTCA 5KUPA 2VTAA 2HWOA 2V22A 2VDVE 3VF9A 4G34A 2YZLA 3CY2A 3MQ2A 4RVHA 2XBMA 2H9VA 4YV1A 4QTAA 2HK5A 5FP6A 4RSSA 2VGPA 2WTIA 5IH6A 3E05A 5HCXA 4MNEB 4DC2A 4XV9A 2IBTA 4PTGA 4FVRA 1SQGA 4RX5A 4GKIA 4IADA 4O0TA 3WYYA 5CD1A 3FXWA 5EHLA 5LCKA 1ZXEA 4A9SA 2F2CB 3G2PA 4G3DA 2X4ZA 4XCUA 4FZ7A 1BL7A 2VU3A 3MTFA 3DDPA 3VNTA 4ACCA 4B9DA 3CBLA 3RCDA 2E9VA 4QP7A 1PF8A 2B4SB 3TDWA 1FPQA 2QRVB 3K5VA 4M7IA 4IVCA 4IWQA 3ANRA 3TKIA 2YIWA 1AGWA 2QO9A 4YLJA 4YZ9A 5IEYA 1SG9A 4YJPA 3V6RA 4AGWA 4ASEA 2YUIA 3ZDUA 3COHA 4PMMA 3FMDA 4HPTE 4CLIA 4RA4A 4O91A 4J8NA 4EYJA 2FGIA 4TKSA 2KTYA 2IWIA 3LDUA 3TNPC 2ZB0A 2C5OA 4FTKA 2LD4A 4FIJA 1R8XA 2IIPA 4AW0A 3O0GA 2OG8A 3PG3A 2EWAA 1RI4A 1X1BA 4AT5A 4AA5A 4J8MA 3IECA 3D5VA 4RFZA 3QZFA 4KBKA 2I0EA 3I6WA 2EU9A 1Q24A 2QHMA 4BCGA 5LQRA 4YBJA 4UWYA 3Q2JA 5JQ8A 2VWZA 3OU7A 2C6KA 1YHWA 4C3PA 2ZIEA 5K01A 3P9JA 4FV4A 4P7GA 2Z6UA 4CKJA 2VDUE 4HJOA 1H0VA 2NP8A 1L1EA 4AUKA 4CFMA 4BB4A 5I9XA 2BFYA 4U43A 3R8PA 4F64A 5EQPA 3Q96A 4OT6A 4RYLA 3MB7A 3V51A 3BGZA 3FPMA 3T9IA 4YZNA 3QUEA 4NWMA 5CSXA 5AP1A 5JUWA 3THRA 3FYJX 3EQBA 3MIYA 4PMPA 1L3IA 4IHPA 3W16A 2HR1A 3BU5A 3VUKA 4E2WA 3DGKA 4BDGA 2HXQA 3FTFA 2X39A 3SXSA 5HE3A 3LCDA 3DKOA 2RG6A 4CTCA 2J5EA 3I58A 2B9HA 4MNEA 1OPKA 2A19B 1XH4A 4FTUA 4TYHA 4ANBA 4IACA 4BCJA 2VZ6A 1JTEA 4AN3A 1JAMA 2X8IA 3A99A 4IAFA 3UQGA 4DFXE 2QQ7A 4E8AA 3OCJA 4KS7A 3G5TA 1BLXA 2FSTX 2WMQA 4PCAA 3BHUA 5IF1A 3O8UA 3R22A 1VJYA 4ZTQA 5EMLA 5IA2A 5K0GA 5L2WA 4I94A 5DM2A 1D2HA 5KMLA 3E23A 2QU6A 5ETFA 3SHEA 4F08A 2GLUA 3TM0A 1JKLA 2F2UA 1R74A 5IQFA 5EPEA 3CGGA 4BDEA 4EJNA 4F7LA 4BTMA 4DINA 1ZWSA 5IDNA 5H02A 1W0XC 4RG0A 4PV0A 1EJ6A 3FUXA 3F5GA 3O8TA 4BC6A 4TYIA 2OLCA 1K2PA 2IH5A 3ORPA 2H6DA 3NWBA 3KCKA 4BZNA 2IDJA 3EEOA 3DBCA 4R8SA 2P41A 3C3PA 3DXZA 5DX1A 1TQPA 4ER3A 5KO1A 4RTJA 5K0NA 4YV2A 3DFAA 3KPVA 3A4OX 3VBYA 2G01A 4PYOA 2B3TA 1MHTA 1FVTA 3QALE 4RTKA 4IB3A 5CCBA 1UA2A 3BWJA 2VNYA 2J0JA 2X9FA 5M4IA 3DKGA 2XK4A 1MJFA 1ZZLA 2W1CA 3DOUA 3G8AA 2ONLC 2YIXA 4FKIA 4WG3A 4BZOA 2EJUA 3LE6A 3FQEA 3IHTA 4R6VA 4L8MA 3SMQA 3FZTA 3ZO3A 1P4FA 2ERZE 4ALWA 1YI6A 3NSZA 3OZRA 3QXPA 5M5BA 4R3CA 3UC4A 2WOUA 2EG5A 1W82A 4FSNA 5DXAA 2C68A 1FVVA 3NUNA 4YJQA 2ITPA 4CFNA 2YTZA 2QM3A 4GBED 5IG1A 3G5LA 2CKPA 2JIUA 3POOA 3HAVA 5HVJA 3RPVA 4RTLA 5LQAA 4MHTA 3C9WA 5AX9A 5L2IA 3MVLA 1ZYSA 1J7IA 1SVHA 1YDSE 2PZPA 4PL5A 3S1HA 4C36A 3C4XA 1YB2A 2VRXA 1S9JA 4IX6A 3PSBA 3UA4A 4LGHA 3DLZA 5C8MA 3OPNA 1EH4A 2VO7A 4FICA 3CC8A 3FLZA 1VL5A 3HUBA 3FXXA 3IGGA 4KAOA 4FNXA 4KKGA 3UVPA 4AT3A 4EORA 3R1YA 4YP8A 4USFA 3QOXA 2GHLA 3C1XA 3EQRA 4NYEA 4EOOA 2R7BA 2X81A 3COKA 2BILB 2BZHB 1JKTA 3M42A 2CNQA 3QUPA 2CHLA 3P7CA 4H39A 4RA5A 4RVTA 2GNLA 2X0GA 4P4CA 4U79A 4HYHA 5HG7A 3VAPA 4N0SA 4YUVA 2UW4A 3B2TA 1Y6AA 3PJ2A 4R78A 3FUTA 1TKIA 4MXYA 1UNHA 2VO0A 3QLFA 5TF9A 4Z2YA 4JX7A 4YZCA 3IONA 5L8KA 5DRBA 5E8YA 4NW6A 5CENA 4BDCA 3KCFA 1FGIA 4ALVA 4J53A 4JOAA 2VWUA 3B8RA 3LW0A 2VX1A 3PIXA 1OI9A 4M68A 3C5IA 3E3BX 2DULA 4E5WA 3ATSA 3BLRA 1MP8A 3EFLA 1ZRZA 2WIPA 3R21A 3FLYA 4ACDA 2LGCA 5J9LA 4KUJA 5CLPA 5FEQA 3NWEA 4X2KA 3GBZA 3U9CA 5AUVA 3NEWA 3ZC6A 3GRZA 2CKDA 1FGKA 5AUWA 2C7OA 4F99A 4ZSEA 3QRTA 3TNHA 4GQBA 1TQMA 2ZB1A 1M2QA 2R3RA 4L6QA 3TM5A 2QLQA 2XM8A 3BHYA 2C7RA 3VBVA 2OJFE 3EQIA 3E93A 4EK4A 2IFTA 1KR5A 2O07A 3FUUA 3R0QA 4RTRA 1JTFA 2BTRA 5FD2A 2C30A 5L6PA 3MTIA 2V55A 2AOTB 4U5JA 4ZIMA 5DT3A 3MCTA 2CMGA 5LXMA 5EHGA 5D41A 3PPJA 4YJTA 3WI6A 1GZNA 2X7OA 4FIHA 1BUHA 1M14A 4IWPA 4A4XA 5IDPA 3GU3A 3UA3A 3U6HA 4O2PA 4FL2A 1ZAOA 3NUXA 3KQYA 2UUEA 4O0XA 5CUQA 3EN6A 4BICA 3R2BA 4QQ5A 3KXXA 3W8LA 3KKZA 4X3FB 4YMGA 2XMYA 2PZ5A 4AT4A 2WQOA 2X6EA 2CKOA 2XH5A 3QQKA 4RVLA 3BV2A 3DDQA 5LR6A 4JDIA 2GQSA 5HE0A 1JG2A 4G56A 5CIYA 1DI9A 4OTHA 4DG2E 2BPMA 3BWYA 2XVDA 2Z60A 3JUHA 3W2OA 2HZIA 3EWHA 4X41A 5K5XA 2XVAA 4UN0C 3FZOA 5AUTA 4UALA 4E7WA 3QTIA 2J5FA 4OTWA 2OXTA 2FVDA 4C35A 4ENXA 4GS6A 3Q3BA 3T7RA 3HP7A 3A61A 4R7HA 5DPVA 1NE2A 1GAGA 5DH3A 4BDHA 5DHJA 4YJSA 4OQEA 1LUFA 4Z9LA 3NVMB 2VUWA 2YM5A 3MN3A 3LBFA 4C4JA 4K6MA 1R78A 2HIWA 3QWKA 3JWJA 2HYYA 5E9QA 2OH0E 3NNXA 4X7QA 3E7OA 3HRBA 3KMWA 3FL5A 4QVGA 2R3OA 2FA2A 1KSWA 2ITVA 3M11A 4EJ7A 5AUUA 3ORZA 4BGQA 4GK3A 4MXCA 3LFCA 1DCTA 3UPZA 1Y8YA 4O7SA 3REPA 5JK3A 3OWPA 4IAZA 4XV3A 1TW3A 2PT6A 5FTGA 2PVHA 3NIZA 3VW6A 1KV2A 1U46A 4I4FA 1QPEA 3IW6A 2JLDA 4FIEA 4ER6A 4RTMA 3KKVA 3L8SA 2P7HA 4C2VA 3KK8A 2IVSA 3D4QA 5JRSA 1M6EX 2QKRA 4Y30A 3A25A 1YUBA 8MHTA 3C4ZA 4BHZA 2PSSA 3TNWA 1Q5KA 2EVAA 3QU0A 4APPA 4EK5A 2AOUA 2ESRA 4XV2A 2VTHA 1YDRE 3A7DA 3I81A 1SM2A 1ZZ2A 2UZUE 1JLUE 2DWBA 2V0DA 3OZTA 1ZARA 3R9RA 2A14A 2BZJA 3OTUA 3QHRA 4LL0A 3MB6A 2VNWA 3QCQA 5IQIA 4QMXA 3WF9A 5JH6A 5M07A 4WIHA 1DAYA 1OM1A 3KFAA 4EK3A 3M6UA 3CP9A 3BWBA 4QPSA 3VS4A 2BR3A 4DBXA 1PKDA 5E9WA 4YMJA 2PUNA 3PXYA 4R1VA 3ULIA 1RI5A 3GRYA 3UJ8A 5DEWA 3R0TA 1R1WA 3AJDA 1RE8A 4NU1A 3QTWA 3VN9A 5DTQA 1Q62A 4X6RA 4FMQA 4FR0A 4QMMA 5KS2A 3VS3A 2OZAA 3AC5A 2OZAB 4F1OA 3ZSGA 1WBOA 5AAFA 2OZOA 5AA9A 4M36A 4J99A 3IV6A 3FTDA 4MNFA 4CT1A 4HYSA 5HESA 4C4GA 5FM3A 4ASXA 4C61A 4BCFA 4GOMD 1NV8A 3R7YA 2JAMA 1OIRA 1H1QA 3ZS5A 5J9ZA 4KVZA 3QX2A 2AC5A 4AE9A 4BCPA 4IZ5A 2WTKB 3MBLA 9MHTA 1YHVA 3PVUA 5I0BA 1OVEA 2W4KA 5JSMA 4G6NA 4EWHA 3ROYA 5J8IA 4FX3A 5IA5A 4FSMA 1NVSA 2C6IA 2ZM3A 2R6ZA 3FZGA 3DPKA 3GGFA 4LUEA 4E93A 2AOUB 1H1SA 2GHGA 1NKVA 3LMGA 3MFSA 2G1TA 4EK9A 3PVBA 3G7UA 4A4OA 4QNYA 3CR0A 3MH3A 4KIPA 5GHVA 4B7TA 5EQJB 3SX0A 2CN5A 3CKXA 4HYIA 4OA8A 5ERGB 5DM0A 3EVGA 3ERCA 4LWOA 4HCUA 5DX8A 3QAME 4FVPA 4TYGA 3REOA 1PJKA 5KBQA 5EKUA 5IA1A 4CSVA 4PP9A 3G89A 3FYKX 4PGHA 3DA6A 3RVGA 3Q32A 4FI1A 3OWLA 5TT7A 4C4FA 3HP2A 4E1ZA 5K4IA 1MRYA 2VS1A 3B3FA 3NNVA 1VYZA 1JG4A 4AUAA 3NAYA 3BYVA 4MX9A 1H0WA 1UIRA 2LAVA 2YVLA 1RJDA 3PXFA 2WQEA 2AN5A 4IX4A 5LVOA 2YITA 3I0OA 4MD8E 4NL0A 2BZIB 3SQQA 3ZM4A 3Q9YA 2ZFUA 3R6XA 4OGRA 4TWNA 5D12A 3RPOA 3GCZA 2WU7A 4ZJIA 5JN2A 3I60A 5CT7A 4FKVA 5GJDA 2PMLX 4QMWA 2BMCA 2C1AA 4DFUA 5BVDA 3L8VA 3QQGA 5CVHA 5F1ZA 5K5NA 4GOND 4QTTB 3EVBA 4O7WA 3GU8A 3I7BA 4PDPA 3ELDA 1ZLTA 3LFEA 1YWRA 5DT0A 1UVRA 4EOQA 4DH8A 4AQCA 4NM0A 4U40A 2CMHA 4UY9A 2GDOA 4NKSA 4R3PA 4W4XA 3Q6UA 4DN5A 3UZPA 3VUMA 4FT0A 2OIBA 3AY0A 4WOVA 4X3FA 2YFXA 1BYGA 2CL5A 2JGZA 3GU4A 4P7EA 2FUMA 2F57A 4QMZA 1WBWA 4FG7A 1Q8WA 5EYCA 3VWAA 3W2RA 3FMEA 4IWNA 4FZAB 3JYAA 4HTFA 5HHWA 4FT5A 4RIOA 3DT1A 3SM3A 5M44A 5A6NA 3SVZA 4LYNA 3L9NA 4TWOA 4WT6A 4JG6A 3V5QA 4ERKA 5J7HA 2R3LA 1XCJA 5GM1A 4WVLA 3DU8A 3THSA 3RM7A 4OTFA 4DFYA 4I93A 3FYCA 4FSYA 4PF4A 1PMEA 1INLA 4PMSA 3LMIA 2ZBRA 3OXTA 3OC1A 1SUSA 4EHVA 2J0MB 3HP5A 3VW8A 4A06A 3UBTA 4EOKA 4QMLA 3I53A 5CEKA 2VTJA 2UZLA 3V5WA 5ETIA 4JRNA 4GFMA 2I0YA 4IJ9A 2X2MA 4K77A 3FE3A 1E9HA 3FI4A 5E1DA 2ZWVA 3G33A 3OS3A 5HNIX 3R8LA 2G2IA 3DLIA 4HVDA 3Q7EA 3DBEA 1H07A 4FEXA 1G8SA 4UWCA 3TIZA 1PYEA 4BCIA 5A4LA 5CAPA 5ITAA 5M51A 3R3HA 2ZVAA 5CI7A 4ZTLA 2B78A 4Y8DA 3SX9A 5EKXA 5AP3A 2QO2A 4MQ2A 2OIQA 3OXIA 1NVRA 1R3CA 3KGAA 3Q4ZA 4HZSA 4ZS4A 4X2GA 3T3VA 5JFVA 2XIKA 1M7NA 3ELYA 1WMKA 2B1PA 3QQJA 4USDA 4YC6A 3R1NA 3KQTA 3E8DA 3EZVA 5FTQA 5LVLA 4TZRA 4A6EA 3VS6A 3MFTA 2IBSA 4JVGA 3VUIA 3C4WA 5EHOA 2RGPA 3KRWA 4ZTMA 1RJGA 4I1ZA 5AMNA 3GVUA 3IG7A 5KMMA 2X6DA 3EJ1A 4XBUA 3SXRA 4ANQA 5CF8A 3SOCA 4R7BA 5I9UA 4YTIA 3PXQA 3ZBXA 3ZC5A 3ZMMA 3C4FA 2J4ZA 1H1PA 4AOJA 4BI0A 4EQCA 4EWQA 1Q4LA 2W06A 4IE9A 1WBVA 2O63A 4QMQA 1VP3A 4DFLA 3NUPA 5ETCA 5HIBA 3UJ9A 4FYOA 5B0XA 4DCAA 5CQWA 3GC8A 3R71A 3MFRA 4JI9A 4RPVA 4KIFA 4KRDA 3P1AA 2EB2A 4J96A 3ZONA 5HO8A 4RWLA 4DLJA 4M0YA 4ZMEA 3RINA 3DMFA 4PL3A 3FXZA 1RI2A 4DEHA 5K3YA 3HNRA 3VBXA 3WE4A 2PWLA 4ZS0A 4BF2A 4BVUA 3HCBA 2IG7A 2ZJWA 1WFCA 3LXKA 2C3JA 3PE2A 4GRBA 4BHNA 3UODA 1O54A 3F88A 1X1CA 2YWPA 4XLIA 3E3PA 3TUBA 1J7LA 3F4KA 3PVWA 1Y91A 4FODA 3AC3A 3A7IA 4RJ6A 3CJFA 3MTLA 3R1QA 4X21A 3DR5A 3R6TA 2E9OA 2P35A 5BX0A 4DFBA 3R7OA 2R3GA 2XJ1A 3PA5A 2ZV9A 3HMOA 4HGTA 5KZ0A 4LMUA 4ASZA 1OUKA 4ZLYA 4IM3A 3BELA 3ZLYA 3KEXA 5LVPA 4EK6A 4OTQA 4F6UA 2P3GX 5KMOA 1QAQA 2J51A 3BHHA 2R3QA 1GZOA 3KRXA 3ORKA 3VULA 4KINA 4TPTA 3PA4A 4M38A 3LHDA 3LFDA 5ANOA 5H8EA 4AA0A 4ZTBA 3TIYA 3UQCA 3VS2A 4F0FA 2CCHA 2OXXA 2G15A 4XG6A 3V8WA 4OX9Y 5A14A 4GL9A 4CMTA 1YXUA 2F7EE 3QBNA 4G9RA 2ETMA 2H1RA 5EYDA 4ITJA 4E32A 5DLSA 4ANSA 5HEKA 2X7GA 3LJ1A 2YQZA 3BGQA 3F2NA 3FHRA 2RFSA 3LFFA 4IC7A 1F0QA 3FUVA 4J97A 5AIRA 5AP0A 5DRYA 5AP7A 2Z2WA 2FPOA 3I5UA 2AOXA 1PMNA 3PY3A 4QRCA 3DULA 1J7UA 1QPJA 5HLWA 3OZSA 2UW6A 1Q8ZA 3COMA 2QKWB 2B55A 4JNWA 3W1FA 3E8NA 1AQJA 2R3SA 4U97A 4RC3A 2UYCA 4C05A 2C6MA 4YJOA 1BOOA 4KWPA 3LFSA 3WSTA 2UW3A 2WOTA 1E1XA 3OTVA 1XH6A 5T64A 4IZAA 2JH8A 3LMHA 4IX3A 3WF7A 5HCYA 3UE4A 2AOWA 5IQDA 1REJA 4PIPA 3DBQA 3HA6A 4FIIA 4JDHA 5AP4A 4NCTC 2R5TA 2W1GA 2OXYA 1W98A 2XA4A 3F3TA 3VQUA 4WBOA 4BI1A 4QYYA 5KHXA 5M57A 2G8NA 2XKDA 1REKA 4CGAA 3FC2A 4YC3A 4CKRA 1IXKA 2JHPA 4EHEA 3Q6WA 2BROA 4ASDA 3QZHA 2JJQA 3Q4UA 4HNFA 2Z7SA 3HA8A 5F4NA 4CZTA 5DTRA 4A07A 5K0CA 5DG5A 3D7TA 4RJ8A 4H58A 2OK1A 3NTVA 3EFWA 3N51A 5J1WA 4C4IA 1YOMA 5CVGA 5EM6A 3RHXA 3QZGA 3HAMA 2PXXA 4KWCA 4FK6A 3P78A 3ZXTA 2C0TA 4E2ZA 2DYLA 1M2PA 5GINE 5I5ZA 1VPTA 1NW1A 3CCFA 1JQHA 5HIIA 5C4LA 3QUDA 4HC4A 4RC4A 5CF5A 2QRVA 3HRCA 5IUHA 2XEYA 1U54A 2CKEA 1SYKA 3KXHA 3NNWA 1NW8A 2PK9A 5K0BA 5AV1A 5E8ZA 4BDKA 3VUDA 5HTCA 2CGXA 4OTGA 1ORIA 2F8LA 5HZMA 4C3FA 4C33A 5LQJA 3VO3A 4RZVA 4ISCA 3UMXA 3GCPA 4DH7A 3LFNA 4M8TA 5EW8A 2CKQA 2F4JA 4ZTNA 3GWZA 4PNIA 2PE0A 1OKYA 4IAIA 5D7AA 4J98A 3I1AA 4YPSA 5IUGA 5DT2A 3SG9A 4ZEGA 3GO4A 3BI6A 3LVPA 4BRXA 3DCVA 2IZSA 2WMVA 2YABA 5HCZA 5E92A 4QTUB 3T9TA 4BYIA 2YJRA 4P58A 5KBRA 3GFEA 1YF3A 2OU7A 3I5ZA 4NFMA 4XG4A 1BMKA 4PYIA 5FWDA 3QZIA 5CU3A 5D1JA 1OL2A 2ZSUA 3QOWA 5G6VA 1ZYDA 2NO3A 3BEGA 4GG7A 3WYXA 4RIYB 1W84A 3H9FA 4BCMA 2WMTA 4EBVA 1W83A 1XH5A 4Z7GA 5HG5A 4JIAA 5CEOA 3GGDA 4TRLA 2UZDA 3K3JA 1OZ1A 4LQMA 4PNEA 2XNMA 5IMXA 4G9CA 4I5CA 3M33A 4DHFA 4D1SA 1M17A 4NSTA 4PDSA 3UIUA 5JEBA 3CJRA 3NYXA 2XK7A 2JIIA 2W1DA 2IW6A 3UO4A 4AFEA 3SW7A 4KKEA 4GVAA 5E1OA 2C7PA 5CAUA 2PZRA 2PUUA 5K0FA 5E8SA 3MH2A 5CU4A 2GS9A 2OO8X 2XZSA 1I9GA 5K0EA 4JG8A 1IASA 2VWVA 4EOSA 2GH1A 2IW9A 3DZQA 3SAYA 3MY1A 4TL0A 1XH7A 3JWIA 4XG7A 1OIUA 2X2LA 3OE5A 4X2NA 2F7ZE 5ANJA 3PS9A 2YERA 2OYRA 5DM4A 5EIFA 4RBLA 4F9WA 5C01A 3MGGA 2J50A 3S3IA 2CPKE 4KB8A 5IQBA 4D2SA 3PE1A 5HIEA 4F1MA 4CFVA 3MESA 4O86A 5HE1A 1FP2A 5FXQA 3ZXZA 4QYEA 4C4AA 1DUSA 4E2XA 4BGGA 3KQMA 4GC5A 2R3MA 4YZDA 3R8MA 3U4UA 4FV9A 4E2YA 1AQIA 3AD6A 2JFMA 1JWHA 2Y8OA 3F82A 1TQIA 3JXWA 2PXCA 1MRUA 4BTJA 3SXFA 3U55A 4KDCA 4U8ZA 3RCJA 5BUIA 1I4WA 5AUYA 3RM6A 2PX4A 3AXTA 5FA5A 4ER7A 4MXXA 4ZAUA 3GRRA 2BZKB 5IA0A 1M6YA 3DMHA 2IPXA 4QYGA 1WVYA 4ITIA 3ZFYA 4FGZA 4HYUA 3F61A 3GC0A 3ZEPA 5IEVA 3EKNA 3FMLA 2XNOA 5EEGA 1LEZA 2YN8A 3TRKA 1UNGA 4EYMA 4DA4A 3NPCA 3LXLA 1WBTA 2R9SA 3NZ0A 3P23A 2I40A 4I5MA 3OUNB 1K3AA 2ITXA 4O0VA 4WNPA 1W8CA 5HBJA 5DXJA 2FSMX 1IA8A 2P55A 3SRVA 3GI3A 5BVEA 4AZVA 3E5AA 2PUPA 4G6OA 1AF7A 1IEPA 3GQLA 3IS5A 4F0GA 5IQCA 3EVAA 4FT2A 3P0MA 2YWVA 3JVRA 2C6DA 2C5VA 3A8WA 4BDIA 5KMKA 5AV3A 3JPVA 4L44A 2OBJA 2VWBA 3DXPA 4RWKA 4QP9A 5DWRA 5CSPA 4DCMA 4QP8A 1SVGA 2QOBA 3TUDA 2BM8A 4DTKA 4J95A 4ZOGA 3EMDA 3BCEA 4A4LA 4Y5HA 3UO6A 4UOEA 3CXWA 4NT4A 3BBTB 4Y46A 1Z5MA 1VBFA 4FTCA 3R9HA 4IMYA 2J0LA 3UJGA 4M12A 5CZIA 4ZSAA 4M69B 4PYKA 3U6JA 4WHZA 1QZZA 1EJ0A 3RIEA 4QYHA 3ACJA 5E9JA 3QKLA 4JIKA 3DH0A 3FMJA 5J1VA 4IVDA 2Y1XA 5IISA 5U4XA 5HE2A 3FKLA 4FGBA 4IJPA 4E6AA 3LCVB 4JAJA 4FSXA 3Q9WA 5EZQA 2C47A 2WTDA 3W2CA 1Y8CA 1YDTE 4O96A 3TJCA 2UYHA 2W96B 3G0FA 4GIHA 3P5KA 2BDJA 4FSWA 1WY7A 3QC9A 3V5LA 2PX8A 3TKUA 4CG8A 4HGYA 1KHHA 2HY0A 3G6GA 1T46A 3IDPA 3IOKA 2IVUA 5A4QA 2WTKC 3A7HA 3HDMA 4RJ4A 4CKIA 3EEYA 3N4UA 4X60A 3EYGA 3QQHA 4U45A 3OWKA 5CAQA 3G90X 2VAGA 4FV2A 3RK5A 4C38A 5B7VA 3P9KA 1RI3A 3QD2B 2XBAA 3F5PA 4L9IA 4XP3A 4K6ZA 2Z7RA 3Q5IA 3RJCA 3UGCA 2VX0A 4FZFB 3HVJA 2Z6AA 4TXCA 4CWAA 1FMKA 2Y7JA 3CSVA 3D83A 2BR5A 4AZWA 4O84A 2ITTA 5E90A 3TLJA 5TO8A 4YMHA 3DXNA 5TR6A 2NYUA 1IM8A 3OOMA 5JR3A 2UZ4A 2ZV8A 2XIZA 2PTKA 3A7GA 4D4RA 2OKCA 3Q4TA 2W1FA 3BXOA 3A4PA 1KE9A 5DIAA 3BZBA 2BRGA 3ZO2A 3UYTA 5CVJA 4RIXA 1IA9A 3A7JA 3QC4A 4FUXA 4DGMA 4AAAA 3I5NA 3P4KA 1A48A 3ANQA 4JL9A 3RI1A 3KR0A 5A4CA 3MJ1A 3HGKA 4I21A 2QC6A 3C50A 2UW8A 3HDNA 3QA8A 4I3ZA 3FSKA 4OT5A 2HNKA 4FT3A 1OPJA 4QMTA 4C07A 3ZUTA 1SQFA 1P4OA 4CFXA 3MI9A 3ZSIA 1W7HA 4LOPA 3P2EA 4XG8A 3TT0A 2PV0A 4ID7A 1YFLA 5A3XA 1Z3CA 5HI2A 5AV4A 5H2UA 1SNXA 5C03A 5FQOA 1Q3WA 3PIYA 2Z7LA 4G3CA 5AUZA 5EH0A 4RIWB 2REIA 3KB7A 5FXSA 1I1NA 2PVCA 5DRTA 4BP3A 1OECA 3UVRA 2OFVA 3VBQA 3WZDA 4Z16A 3BGVA 2QOOA 3QCYA 4EZ3A 1O6LA 2WTCA 4A9RA 5TKDA 1VR2A 4ACMA 1HMYA 2R0UA 5C1IA 3FY0A 4GJ2A 3R9DA 5HLPA 1JNKA 2VGOA 5DRDA 4FK3A 4XEYA 4DT9A 3G2QA 5DYJA 3VJNA 3NDJA 2JKQA 2HOGA 1H01A 1XHAA 4PRJA 2JC6A 3LM5A 3AC4A 5KQSA 1IAHA 5FULA 2ZVJA 1OKZA 5LMAA 3AT4A 4E4XA 4AXAA 4FV7A 3KPYA 2BFXA 3FZRA 4GG5A 2WFYA 4OLIA 1WVXA 5C9CA 2PL0A 3LM0A 3OXZA 3VVHA 2JEDA 3PXKA 1BX6A 3QD3A 2GQGA 2XK8A 3BLHA 3BYSA 3PX3A 4RQKA 5EDQA 5EHYA 4NTTA 4RSRA 4H1JA 4ZZOA 3SW4A 3VRYA 3R9NA 5ANKA 4CXAA 1FINA 2R7IA 1GJOA 1OITA 5H8GA 2YXDA 4RTQA 1IRKA 2BDFA 2J0KA 5HIDA 5KHWA 5T3QA 3MCZA 3HUCA 4YHTA 2AS0A 3ORNA 2O2UA 1K9AA 3G2FA 3FLNC 3UJ6A 3HV3A 2QR7A 4JXFA 1L9KA 4X63A 3ERKA 1EIZA 5CVUA 3TEIA 2WD1A 1ZOEA 3CKKA 4E4LA 1JG3A 2IO6A 3UOHA 3QKKA 4M3QA 3EMBA 3HV5A 2NXJA 2AN4A 3TNQB 3OZ6A 1H8FA 1XBBA 1Z57A 2UW9A 2XNGA 4YPDA 5DR6A 3BHVA 2WEIA 5HICA 2XK3A 4CV8A 2EX4A 2OO3A 3G51A 3ZOSA 3H2BA 4LECA 3OFMA 5BW5A 2W5AA 3EVDA 4I92A 5A46A 4UX9A 3AQVA 1OIYA 2ZDUA 1TPYA 3KQ7A 5HQ0A 1P1CA 1OBDA 1ZG3A 4JBVA 1YKRA 2YISA 4YLKA 4DEBA 5CI6A 3LX6A 3FMNA 4FV0A 3SSNA 1Q0TA 3GXOA 4O29A 4F84A 5G02A 4GT4A 3GT8A 4XMOA 4FKSA 2BUJA 2R3FA 3QTQA 3RTPA 2XYUA 3HCCA 1PYXA 2OWBA 3CQUA 5CY3A 4P2KA 1CDKA 2QURA 4ONAA 3TTIA 3RK7A 4CV9A 2WMWA 3P2KA 5AWMA 5H8BA 2XYNA 3ELJA 4ZTHA 4D4VA 2QOLA 5FEDA 3LHJA 5IH4A 4BDAA 1O9GA 5IKMA 4KRGA 1JSTA 3TG1A 3V8VA 2AC3A 3HYHA 4C34A 3PJ1A 3R8ZA 2G1PA 2ZDTA 4TTHB 3RGFA 1GIIA 3MY0A 1XTPA 4A6DA 4L53A 4V0GB 2XK6A 2QCSA 3NNUA 2WMSA 2OI4X 3Q52A 3QQFA 4IH8A 4FNYA 4GC9A 5ACKA 4O7RA 3PJ3A 4FKJA 3HCAA 3K6RA 4DEGA 4BBEA 3KULB 3KPWA 5EM8A 5MHTA 4ZXTA 2XIXA 1XXLA 3EQGA 2C69A 2JDVA 5EM5A 4MBJA 2YXEA 2Y4PA 2IZUA 1G8AA 3AC1A 5FXRA 2YIYA 2PVYA 3Q53A 2WGJA 3KREA 5CEIA 3OU2A 1LPUA 4X3FC 3OOGA 3H0YA 5T68A 4BY9E 3QTUA 3A27A 4PONA 3KA0A 4U7TB 3VQHA 4XUFA 4GJ3A 5HKMA 3B8QA 1JSUA 4BKJA 1H08A 3HA7A 2XBJA 4PNKA 2CJMA 3VSEA 1ATPE 1UWHA 2KW5A 2VWIA 3EN4A 3KK9A 4NIFB 3BYUA 3PXRA 1X8BA 4FIFA 3UZRA 4OQDA 4P7FA 3WZJA 3T7SA 3R9XB 2OF4A 3SGCA 2C6TA 1A06A 2GNHA 3VS7A 4AS0A 2ZLBA 2A4LA 2ESMA 2UZEA 4GFOA 4O38A 4DE4A 3LFQA 4ZSJA 3U8WA 4XBRA 2J6MA 3EL7A 4F7SA 4PTEA 3BIZA 1WCCA 4ACGA 4RT7A 4CFWA 1U5QA 2WHBA 5CSHA 1O6YA 3ZRLA 3KXNA 2WO6A 4FA2A 5AJQA 2VO6A 3R7VA 3U51A 3HCFA 2IZTA 5F2OA 1R8YA 3PPKA 4APCA 3DOGA 3OWJA 3BWFA 2W05A 3COIA 1Y8GA 3RP9A 4EH2A 2HXLA 4WRGA 5AP2A 5D10A 3RAHA 4RJ5A 4B4LA 4QMNA 5K0JA 4ALUA 3OCBA 2NRUA 1JPAA 1PXIA 4AFJA 1HOWA 1SVUA 5EMMA 2JIVA 4FTTA 4I5HA 4J52A 4HNIA 3UP7A 3VS0A 4B0GA 3LAUA 5JRQA 3F3VA 3LJ2A 5M4CA 4QPPA 2W5BA 4WG5A 3I0QA 4B17A 3MGYA 3LKZA 3B89A 1UKHA 3DAJA 2PJDA 3U4WA 5FP5A 1PRYA 2O8YA
chains in the Genus database with same CATH superfamily
2F3QA 3K16A 1QFXA 3T41A 1IG3A 4I6GA 1JWLA 2VDVE 1WMAA 3IK3A 5EJ7A 1Q16A 2X8EA 2KE5A 5JC8A 4MTCA 2IYOA 4FV8A 3LGAA 2ITZA 2PS9A 2O06A 4HVHA 1WMBA 5A7HA 4KMRA 1Z26A 5L3SB 5JZOA 3VR4A 5F98A 2ACKA 4Q4LA 3VJLA 2QR8A 2ZVQX 1IE3A 3H84A 3ZWDA 1FFYA 1X92A 3ER6A 4NKRA 3FPQA 3ORIA 4N82A 2PWAA 3RS9A 3EZRA 1GIHA 2CUTA 1RWPA 2AYXA 1GHTA 1G5SA 2FSFA 4QARA 2J45A 3PPZA 3L01A 4QQFA 4TVSA 1P60A 2IK8A 2X0IA 5AK0A 3P97A 1D4FA 2V7UA 3IKAA 4J0IA 4MINA 3P27A 5E1EA 5A5DA 3DDCA 4OXXA 2DUMA 2VJNA 3GLIA 4ESVA 2EUFB 4ETIA 1TIBA 3DNDA 4FGRA 5KSPA 2GT1A 4BWGA 4Z51A 1NMZA 1SPXA 2ACVA 2ZI3A 2QR5A 3LQ4A 3QHWA 3NHJA 4C20A 4DZRA 1PWXA 4DLZA 5IK2D 5HKAA 4MCVA 3LFBA 4DLBA 4Z1OA 3D8BA 2H2HA 1NC3A 1E9CA 2AXEA 3OHMA 4ZIRA 1C5KA 2I4LA 1JR3A 4DVGA 1T9GS 4S34A 1HKUA 2WA2A 4QUDA 1C4WA 4CV0A 5JC1A 2GPTA 1XQZA 4B4KA 3WYBA 3WIOA 4GI2A 3C8DA 3W8DA 4U3ZA 3DKFA 3VNSA 4KA3A 5KVQA 1GQYA 3ZWXA 2P9EA 1OKVA 3AINA 1J5PA 3DXQA 3DKIA 4I4NA 2XNNA 5JXWA 3K54A 4G5JA 2C9DA 1XMVA 3KKPA 2AI2A 3LKMA 5JVDF 3KALA 5KTYA 5ES3A 5L8JA 1TT7A 2PBLA 4FGKA 4RHFA 4B3XA 3TAHA 1Q0PA 3RC9A 4BVLA 4Q9ZA 1H8HD 2OV2A 5F2NA 3OP5A 4ASUA 2PLFA 1OXKB 3NM6B 1F3MC 4RIFA 1MHPA 1PK7A 4KLNA 4I19A 1EFKA 4AXXA 1G8JA 1MO5A 1MRSA 4RETA 3MH0A 1L5ZA 3KUKA 3HMIA 2G1AA 4GMKA 2WNIA 2XI4A 3EXG1 3QMVA 3JWPA 1GRCA 5TVGA 3AUKA 3LZBA 1PGPA 2C5NA 3CLUD 4FE7A 4Y2PA 2BKAA 1SKAA 3II6X 3G1UA 2OXEA 3VPDA 2O5RA 1DI8A 2OGVA 2VF5X 3GEHA 3FF4A 1UPCA 4OQNA 4EI2A 4HQFA 3HJAA 3EUFA 4KG7A 4RTSA 1FOEB 1A96A 4ZTRA 4EZBA 1DADA 1K8RA 3R1IA 4MJ7A 5JMSA 3LBYA 3LUCA 2RFNA 4LXGA 2Y6UA 5B2LA 4FFSA 1KI2A 1WTAA 2FXIA 4XVRA 1T5BA 2NP7A 1YIDA 3BZ3A 3PEFA 1QIFA 3ZWKA 5CG1A 1IBKB 3WOWA 3OE1A 3HKOA 5JY1A 1WCYA 4YTFA 5C4GB 4ZOEA 5T8KA 1VPEA 4CM7A 4YJ3F 2ADMA 2I3GA 2ZPUA 5EOBA 4D0RA 1IEVA 3F9IA 3TLXA 1MIHA 2A27A 4Y73A 2JHCA 3GY0A 4LDTA 3KXIA 1NQWA 4IH1A 1U31A 3O4HA 1XLTC 3EQPA 4IOLA 2UZ1A 1KUTA 1FYFA 3JQGA 1VJ1A 1GO2A 3AEUA 5KVCA 3ODZX 3E88A 1ZZEA 1GLNA 4PSKA 4TLMB 1C1HA 4ZLZA 4FSZA 3AB8A 1E5DA 2HK7A 2YVAA 2YHUA 1TEVA 4KK4A 4R81A 4QVKA 4DXDA 4IC8A 4LL5A 1EVIA 5A06A 2BY4A 2QOKA 2V9CA 3DNEA 5DNEA 2QD1A 1HA3A 2IU3A 2XD9A 3QHAA 4RJ3A 4CXMA 1WS6A 2IH2A 4LZZA 3M6XA 3GX1A 1AKQA 3W2IA 3AU8A 5TQ2A 3CB4A 1L5QA 2FEAA 1EJ2A 4RU1A 2VWHA 3V4FA 1CYEA 2IX9A 2XQFA 2BIFA 5A02A 1QG0A 3E5NA 5KDOA 3FJOA 2HFJA 4NK9A 4I6HA 1R5BA 3KL8A 3VNVA 4UD2A 1OBFO 2Y0PA 4BCQA 1XD9A 1N2SA 3AEXA 4TS1A 4QM6A 4LV8A 3VBEA 1JV2B 2BLLA 5AM2A 3V97A 3ABSB 3C43A 3ZU5A 4ARCA 1HTTA 2GLTA 3ZZWA 1YQQA 4RX7A 3BGPA 4BO9A 1SD1A 1YOVA 2J32A 1ZEJA 1DMSA 4GPZA 1CNMA 3BMOB 5FUBA 1IIBA 3DTWA 4UAGA 1DOAA 2QTLA 4CMEC 3RC8A 4L02A 5EMJA 3TR5A 4ILEA 2X6TA 5K45A 4PG6A 1HQYE 3QLUA 4FC6A 2Q0BA 4KQ6A 5G1XA 1WEHA 1QP7A 1IAJA 2DFKB 1ZOOA 2HPZA 5ERXA 4MVJF 1R6VA 4E73A 1ZDMA 1D8AA 1JLSA 2IP2A 2VKQA 5CFRA 4AMBA 4DEIA 4O7TA 2ZU0C 3IT0A 4KHPB 4D8XA 5JPIA 2DBYA 5DMHA 4JT9A 5L6OA 1I2MA 3CURA 4FKZA 4LYAA 1JGTA 1U3WA 4QHTA 2BPOA 5K3EA 4L01A 3SRVB 1FCJA 4BEBA 1MQSA 2JKZA 3C3KA 2WRZA 2FJUA 4MB0A 3JS5A 4R77A 2XNHA 4QQNA 3DEYX 3CG4A 1A2BA 3PFFA 5EXSA 1A1VA 4AZ3A 3UAOA 4D79A 3A9CA 4KMOA 1SCJA 4AM8A 3HV4A 7ADHA 2ZBUA 4YRPA 3MMZA 3KD2A 3H4JA 2CDAA 4YJRA 4WN3A 5AW4A 3HDYA 2IWHA 5CXUA 2C4TA 3PRFA 2WEKA 1UJNA 4OQLA 3U4GA 4DDIA 1Y3HA 1GYRA 3TKYA 4BXOA 5TB5A 2ZUWA 3UK0A 3IC5A 3RTGA 3V8BA 1QB8A 2PMNX 2VT7A 1ZUIA 1NLYA 4RL6A 5G40A 3QVGA 5A6SB 1R2QA 4MARA 3FH0A 2QRJA 4QL3A 4WNMA 2I9KA 3OT4A 5FJIA 3C39A 2IXGA 1A98A 1J70A 2NMVA 1MKYA 1J1UA 4NDNE 2WPAA 1ZK0A 4YFVA 1V0BA 2UYQA 3O92A 1YZVA 5EUMA 5K09A 3DT9A 3H1PA 3U48A 4QPAA 1XAIA 5FM2A 3JQCA 1N9GB 1ZH4A 3ZGNA 4DA6A 4C43A 4KQFA 2BCJA 4M7RA 1V3VA 4HGOA 4XOYA 4LY6A 4KIOA 2EOAA 3V8RA 3CX6A 3B9RA 1TTHA 2QO7A 5DCLA 3L1SA 3N2IA 3GZ4A 4XQEA 3UATA 1E77A 4RORA 5A5FA 1P2GA 3SVVA 5DM1A 1QG4A 4PRZA 2Z6QA 4FBLA 3GR6A 3IKVA 2CF6A 4TRMA 1MEJA 1Y98A 4U80A 5JFWA 3PRKE 2A1TR 4JROA 4I5EA 4UUQA 5KQGA 3W6NA 2OGWA 3PJGA 4JVNA 5FFNA 4EG4A 2E3JA 4C58A 3QRKA 4XTCS 3BXPA 4GWKA 5E2AA 3FY2A 3V6SA 3L7MA 3GDHA 1K4KA 4CKCA 2VTOA 3ZVNA 4J1RA 5TV2A 2EXMA 1JFVA 3FGNA 2FG6C 4F7NA 1YO6A 1ZCZA 2QA5A 3JD1A 4BCOA 1V8PA 4E1AA 3ISVA 4Z99A 4UTRA 2CXRA 4D28A 4E5BA 3R3HA 2PQ0A 4BNMA 3S2UA 1R66A 3Q60A 4PX6A 3GDFA 1DCMA 1T3TA 4AAYA 2YCRA 4MB2A 3U16A 2PUHA 3H2IA 5C8YA 2YJZA 4HATA 2EKDA 4DFNA 3D4OA 4Y1FA 3Q9UA 2QN1A 2ZRFA 1NONA 3V1TC 4RAQA 2YXLA 1YR7A 3R7WA 3CVYA 3P8ZA 5D1NA 3W0OA 2J9FB 3MINB 2V65A 1XIVA 1FDUA 2A6PA 2WTEA 3SYRA 4IB1A 3K8ZA 3HU5A 5BN3B 1OFHA 1AQUA 4IXTA 1I0IA 3FFAA 4WCDA 3MVMA 2WWWA 3ZV4A 3HCOA 4CG9A 2YCFA 3CUVA 2ITYA 3KU2A 2ZRLA 3AT1A 2OCDA 1MAWA 5CDUA 1T2EA 3FPEA 3VNRA 3O38A 1YZNA 1BO6A 3A9SA 1ZK3A 2RI6A 3DGEC 3FSGD 1S01A 3LPBA 4HCTA 2QHXA 3L05A 2R00A 1YL5A 4YO4A 4FILA 3PA3A 4PAGA 3R8UA 4F9EA 2P4HX 2PRIA 4BC0A 2PGAA 4LISA 4YMSA 4R2LA 1GARA 1H00A 1G7RA 4CT5A 3OEZA 3K96A 4IXMA 2XGMA 2VTVA 4D0XA 4UUBA 1CUWA 1OTXA 5FR2A 1SVEA 3DE0X 1GM5A 4RPGA 3W2GA 4IBMA 2Z02A 5I4BA 3VKWA 3ER8A 3FWPA 5BURA 5G0TA 2W4OA 3VS1A 3IAUA 3FYSA 1GTMA 4TSFA 1H6BA 1XMIA 2YZAA 3B12A 3QPBA 5J4LA 3TZ9A 1AZSC 3RYFA 1KC1A 1M7QA 2Q6IA 3RNIA 4MVJA 5ALQA 4EEVA 2HAEA 4M87A 4HG2A 1DCKA 1D4AA 4L4RA 2BJWA 2OGZA 1TVKA 3H8WA 2JCGA 1DT5A 3PZEA 2RMKA 2GXSA 3WOHA 2WTIA 4DPMA 5CDGA 5LUBA 5EHLA 5KIAA 5K1ZA 3TZKA 3GD5A 4D57A 4KXVA 4R0MA 5DCYA 5ER9A 3IOBA 4REQA 3KJGA 1GYQA 4YZ9A 1XF1A 5JU6A 2IW1A 3G2NA 2LD4A 3I62A 2VTDA 5T41A 2N0SA 4F9GA 4WZZA 3KB1A 3AFHA 3LFHA 4CKWA 2EATA 4HNUA 4HI0E 4CKJA 2VDUE 4PAQA 2NP8A 4CFMA 4TN1A 1RAGA 4CGZA 2OK8A 4NWMA 4QXMA 1O8CA 3WVNA 3THRA 4ARUA 3EXEB 1BD3A 2P75A 2FSPA 3LUBA 3ZWOA 2A3NA 4AO8A 3E9DA 4TKVA 1JFLA 4DLSA 1ULAA 2WMQA 2QENA 1EVLA 4NMLA 4I94A 3E23A 3GAZA 4CT0A 3RAFC 4XVUA 2GLUA 3WMGA 5JTUA 5IQFA 1VPLA 4RDIA 1TVKB 1JQKA 1ZWSA 1W0XC 5FLXA 3O8TA 2WJHA 3JZMA 3WLRA 3AVQA 1XFAA 3C3PA 2ATIA 4IB3A 2Q6OA 4EBFA 3BWJA 3WNZA 2O0JA 2XK4A 4L8MA 2PUAA 3FKSD 4OM7A 3VHRA 4P34A 4QELA 1TJYA 4EF6A 2CKPA 2HO5A 2GSWA 5L2IA 2ZCVA 3BFKA 1TC1A 3OPNA 3RREA 1J1ZA 4BQQA 4LC9A 1X7HA 2CEAA 4J3JA 4Z3KA 4BDCA 1FGIA 1BHO1 2PYIA 1J06A 4TMZA 3AR5A 3RU2A 1B0AA 4B3IA 5AUVA 1PW5A 5JZVA 1M2QA 2V6FA 4YMIA 2VTBB 3LX5A 1V25A 4M1WA 5E7JA 3RAPR 2GUGA 1COWD 4KGVA 1AD2A 1H94A 3EN6A 5LA6B 4FN4A 4AT4A 2RHLA 4LXIA 3T95A 4KR6A 2F1OA 1IOWA 3U56A 2Z60A 4D8WA 3OQIA 4NV1A 4OTWA 4F1KA 1NY6A 5AOVA 1FTSA 1GNPA 2CFSA 1DEAA 3LBFA 1YASA 3E7OA 3PNYA 4MXCA 2MSEB 1MBZA 4L0MA 4E94A 3NLLA 3IW6A 3RUCA 4GRIA 4BHZA 2VLIA 3KIPA 1EVEA 3OLQA 4DC1A 4QMXA 4WFJA 1H8ED 2WTAA 4ZRDA 3VS4A 3LDAA 1RBYA 5DEWA 1R1WA 5CEJA 1Q62A 1VJ5A 2OZAA 3UCFA 3CRVA 1UPBA 5DLDA 3RM3A 2JAMA 1L1QA 4JFRA 9MHTA 1S9HA 3R7BA 1RJWA 2A5LA 4A15A 1XPUA 3QAME 3OQ1A 2FETA 2UVPA 3PRYA 3PFIA 2H4WA 5CW2A 3B3FA 1VCOA 4HAUA 4QFCA 3EDQA 3OE7D 5CCEA 2C84A 5LVOA 5D12A 4EMUA 3LRPA 3STYA 4QMWA 1KU0A 4N5IX 4MS4A 3AEYA 4O7WA 1IB6A 3Q6UA 1DTWA 3NBQA 1LY1A 1A7UA 4IAOA 3TXAA 4ERNA 4FT5A 4WT6A 1PEAA 3DU8A 4AIRA 4KQHA 3PEEA 3OTOB 3LMIA 2ATEA 1ZU5A 3FKQA 2DSNA 2UZLA 3V5WA 5JWOA 4YRJA 4NI5A 4JL8A 3ZI7A 2WSBA 4Y8DA 1B6TA 2WV9A 4WBXC 3KGAA 5HPYB 1TADA 4X2GA 3SE0A 4ND7A 2XIKA 5AW5A 2IBSA 3EOBI 2O50A 1DJQA 5FV7A 3GEMA 1UK9A 2W06A 3KFVA 4Z53A 2AWNA 5JO9A 3GCXA 2EFDB 4DLJA 4MMYB 3DMFA 3QUQA 4QPDA 4BQOA 3LXKA 1DC7A 4H6WA 4B0OA 4BXOB 1KFEB 4BNIA 3C8HA 4WW0A 1N36B 3AF2A 3IQGX 3R6TA