3PLAE

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3plaE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3plaE02
3IO7A 2PE2A 2PTKA 4NH1A 4GL9A 3BYSA 1R0EA 3UP7A 3L9PA 5DWRA 2VDUE 3FXWA 1LEZA 1Y6BA 3DZQA 3LW0A 4JIKA 4BKJA 2NRYA 2BM9A 2FGIA 3NZ0A 4X3JA 4DINA 3PLAE 2X9EA 2PSQA 1G60A 3C0KA 5DRDA 3D2KA 1YFJA 4XP0A 5HBHA 4I6QA 3RM6A 1KOAA 2OXXA 2JG3A 4DCGA 3LCTA 3A61A 5CCBA 2GNJA 3CIKA 3DAKA 4X1OA 1SQFA 4LWPA 3MWUA 4O86A 5BP7A 3AC1A 3AJDA 3H0ZA 1QPEA 5IA1A 5KMJA 4YR8A 3WF7A 5IA2A 1W0XC 4C35A 4ERKA 4EKKA 2PZPA 4RQKA 2X7FA 1PMNA 3P2EA 4KKHA 5CSHA 3KHKA 2WMWA 4FKJA 4U44A 5JFVA 2OXDA 3HTXA 5M4IA 1Q8UA 4EH4A 4NJ3A 3ZO3A 3LE6A 3I6WA 2ZJWA 1WG8A 4M69B 2QODA 4OBPA 5HEZA 3JWIA 1ZYSA 4L68A 4U7ZA 2N47A 3R7IA 3RGFA 5LVMA 4EHZA 4WRGA 2PSSA 3CJFA 4FG7A 3LMHA 4K11A 3Q53A 2IVTA 1CKJA 4EK8A 1UU7A 4MBIA 1QPDA 4AT5A 3QQKA 3R8VA 4CTCA 5G02A 3NUUA 3RAWA 2EB3A 1UWJA 4WUNA 5LWMA 1ORIA 4YV2A 3G0FA 4F64A 4DH7A 2R4BA 2PPQA 1L8TA 3G2OA 3WI6A 4FIGA 2I0HA 3UZTA 3GENA 4ALUA 5FTGA 4EUTA 4OQDA 1Y8YA 3MVJA 2J6MA 1SKMA 3P9KA 4ZS4A 5BW5A 2J4ZA 3ORTA 3ZRLA 4GFGA 4XLVA 2NP7A 4Z55A 2CHLA 3BKBA 1XH7A 3OFJA 3B5IA 4WRSA 1OUYA 3D5WA 2UVZA 2P33A 1H28A 1IAHA 3PA5A 1XCJA 5B2LA 2VTAA 5EYCA 5KMKA 3ZM9A 3GOKA 1BOOA 3G88A 2ZBQA 3C4CA 4ZSEA 5HD7A 5FG8A 1YXVA 3O50A 4D9UA 5DA3A 3EVDA 3RK7A 2BRBA 3LCCA 3ZLSA 1Q0TA 3TUDA 1WMKA 3LFNA 5CUQA 2JKMA 1SVEA 1RQQA 3UQGA 1SG9A 4O7WA 4XJ0A 2BTRA 4E26A 3VSEA 4CZUA 5LVLA 5E8YA 4XV9A 5BVWA 2IH4A 2XIRA 1XBAA 2LD4A 4B0GA 3UOJA 1PY5A 4FKQA 4QO9A 5HNGA 4DBNA 3LXNA 1D2GA 3EQRA 2W1IA 4YHFA 3NRMA 4TWNA 2B7AA 3LM5A 4BCQA 3CGGA 5DX0A 4WOVA 5BW4A 4MD8E 2XEYA 3GGFA 3JS2A 4FT2A 2J2IB 5K3YA 3VF9A 1VLMA 5D11A 1JTFA 3OP5A 3EGIA 1SUSA 4J97A 4GUBA 4LL5A 2IW9A 4MQ2A 4AGDA 5FUTA 3FTEA 4D0XA 3PX2A 3BWCA 3R02A 3M33A 2F2CB 4O22A 2Q41A 5FQDC 3KC3A 4QTBA 2JDTA 4K33A 3UIXA 3BQCA 2OJJA 4DM3A 3MJ1A 4PL3A 2B9IA 3VF8A 1JSUA 1WBSA 2Y4PA 3FHIA 2UZEA 3VULA 3A99A 4AZWA 2YX1A 2HR1A 2O5KA 3QXOA 3QLFA 1G8SA 3C5IA 2FVDA 2Y6OA 3OC1A 4XYFA 5DVRA 5D1HA 4PNIA 3RMFA 3BKWA 5DT0A 4KSQA 2P40A 5K4JA 5KZIA 3UP2A 4C4AA 4FV2A 4FTRA 1YVJA 4O21A 2JC6A 4F1MA 1WXXA 2CGWA 3A7GA 4CTKA 1NW7A 3UOHA 3DXYA 3OD6X 2XNEA 1L3RE 4X41A 3SKCA 3RTPA 1IG1A 3SV0A 3DKGA 3BIZA 2OO8X 4EKGA 3V97A 3C6MA 5L8KA 1PKGA 3RPYA 2PE1A 3I81A 4AW2A 5K4IA 5CVEA 1M7QA 2HNKA 1U4DA 5DBXA 4L8MA 4CG8A 4A06A 3E7VA 1NW8A 4PYQA 3D7TB 4C4GA 2O63A 2XCHA 2R3LA 4LGHA 1XKKA 3GOPA 3UC4A 5M4FA 2W1CA 3R1SA 2WIHA 2IN6A 4HGSA 1U2ZA 2GQRA 2NNWB 3FXZA 4CFNA 3ZZWA 5EIFA 4K0YA 2C3LA 3FI2A 3TMAA 1JAMA 3UJBA 2O8YA 4RVTA 1Q61A 4Y2HA 4ZZNA 4O91A 2PVCA 3GRYA 3NNWA 2WA1A 5U4XA 4L42A 5LQFA 4QNAA 3L8SA 4JG6A 3ET7A 5E8TA 5C9ZA 4ACMA 5K0BA 2DWBA 4LOPA 2PVNA 3KQMA 1ZY4A 2ITYA 3EQHA 4YZ9A 3THSA 2Y7JA 1W83A 2XYRA 3BHUA 1YW2A 5CAVA 4ZTBA 3B3FA 4RA4A 3RWQA 3OBGA 1KE5A 3P08A 1OL2A 4IX6A 1UWVA 3CD3A 4IACA 2UW0A 1REJA 5HE0A 3UG1A 4BGGA 4FYOA 5E2BA 2WAJA 4X63A 2QR8A 3UJ6A 2XCKA 4E93A 2YDKA 5BPYA 2C68A 3MTEA 3HP5A 3LFEA 4Y83A 4NFNA 3QX4A 3OE5A 4G3DA 2GHLA 4KUJA 2WNTA 3KQSA 1LP4A 3U9NA 5JFWA 2HZ0A 4I5HA 4AZFA 4ITJA 4DAWA 2ZTHA 3QGWA 3G5LA 3QUDA 4E2YA 4QMMA 1PXLA 4CFVA 5BVKA 1ZHFA 3PIXA 2QONA 5CM2Z 2WA2A 3IDCA 1YXUA 1OB3A 3M6UA 2F8LA 1ZLTA 3K5UA 2DULA 3QALE 3JY0A 2GMXA 2UZBA 5M44A 4PMPA 3UG2A 4CKRA 2OYRA 1IA8A 5I9XA 4D4RA 2J51A 1KOBA 3I1AA 1KIAA 3UJGA 4DH1A 5E90A 2R9SA 4TT7A 3QRJA 2YCFA 3ANRA 4AW5A 3UBDA 4RIXB 3FZ1A 4C3RA 3ZRKA 3P0MA 3ATSA 3RI1A 1GZ8A 4DFUA 2X4ZA 3W2RA 5L8LA 4JRVA 3MFSA 4GK4A 4DMGA 4C06A 2R0UA 2AOUB 2GTMA 1L3IA 5G6VA 3F5PA 4DEAA 4FTKA 5DH3A 4DC2A 3DA6A 3FYKX 3HP7A 5CF8A 4X2JA 4O6LA 1UKIA 2AOXA 2W96B 4PDPA 3FC2A 3NMUF 2HAKA 4YZNA 4RFZA 4RJ5A 1SQGA 4BLUA 2UYCA 4QP3A 3E64A 4IX3A 2VTOA 5M55A 3I64A 1H24A 4YNEA 3NUSA 4TRLA 3DB6A 5LQKA 3P7CA 4ALWA 5C4LA 4HC4A 4GT4A 3S3IA 5GM1A 2C3JA 1R0PA 2P4IA 2JD5A 5C9CA 3BHHA 4WO5A 3UC3A 2QURA 3CEKA 2XKFA 2YCSA 4OR5A 4EK3A 3KMUA 4F0GA 5C03A 4PL4A 2H34A 3PXKA 5E4HA 3O96A 4ZY4A 4W8EA 5AIKA 1H08A 2C1AA 2XB7A 3C7QA 2Q83A 5IU2A 3MS9A 5FQOA 3TTIA 3VW8A 3L9NA 5IQHA 4RFMA 3EGVA 2WIPA 5I9YA 2BR1A 4FNYA 1Y8GA 4BI2A 2PUIA 2UZWE 3NTVA 4CKCA 3NLBA 1WVXA 4EKIA 2EVAA 4R7BA 3D0EA 4WBBB 3TL8A 4FX3A 2XK7A 5A4CA 4YJRA 3VRYA 4IAKA 4Y85A 3FLSA 3EVZA 5HE2A 1F38A 3E5AA 5KKRB 2UZDA 4AE6A 4KD1A 4MWZA 5A4TA 4AZSA 2JAVA 4BTFA 4HRAA 4XG2A 3UZPA 3G2FA 3OUNB 3TCPA 2DYLA 3O8UA 4I6FA 4UOEA 3TZ8A 3R9DA 4IV0A 3DXXA 3QYWA 2RKUA 2XRWA 3UQFA 4FT4A 2W99B 4FA2A 3IW5A 3IS5A 5M4CA 4RC4A 1GIHA 2R7IA 4GW8A 3NX8A 4YMHA 3PXRA 4R3RA 2O64A 3QQGA 5FADA 4B9DA 3PTGA 4KBKA 3ZEPA 5AMNA 1VYZA 2FH9A 4TYGA 3DOUA 2H11A 4XOYA 3ALOA 3ETAA 3C50A 3NYOA 3O7LB 5F9EA 3KPWA 2HOGA 2A2AA 4MTAA 4D2SA 3R0TA 2AC5A 1UNGA 3BWBA 4E5BA 4KB8A 2BFXA 1YQJA 3UVQA 3BYUA 3UA3A 3DQWA 3F5XA 5T67A 4ANQA 2HXLA 3CLYA 5ITAA 4U40A 3FQHA 5DX8A 4N0SA 2QOIA 2E9OA 3VS0A 2J90A 3LMGA 4OTRA 4OUCA 4LWOA 2XM8A 3ME5A 3PFQA 3CTQA 3V5PA 3FL5A 5AX3A 2PX5A 5A46A 2BKKA 4GC9A 4FSZA 2QO2A 4FKWA 3FJQE 3RHXA 3TZ7A 3HCBA 4X3FC 4X3FB 2OIDA 5J95A 3HVIA 5HZNA 3E23A 4OA5A 3AXWA 3KPYA 4M15A 2QRVA 4G1WA 4D28A 4AQCA 2R3JA 2WKMA 4KVZA 4LFIA 3VVHA 4ORKA 3QRUA 4BDCA 3JWHA 3NNXA 3V5JA 2YM4A 5LARA 3DV3A 5C01A 2V55A 5IA5A 1OM1A 3BQRA 3QKLA 3VO3A 2JDVA 4CEGA 3T9TA 2CNUA 4FNZA 3PVCA 3RALA 3VS1A 3FY0A 3BEAA 4BDFA 1JG4A 2Z6UA 2PVLA 3Q4ZA 1FGIA 2BAQA 4BDIA 5CU6A 1QAQA 2PUPA 2H8HA 3WZDA 2R0IA 4AOTA 2ZVAA 2XK3A 2VAGA 1ZG3A 5EG5A 4PDOA 3SOCA 5J9YA 1JNKA 2IGTA 3ITZA 3MFRA 4BYJA 2YIYA 3DLIA 3L1SA 2R6ZA 5B1SA 3QCSA 4XG8A 3OROA 3TNQB 5K03A 2BRHA 2C6MA 2C5VA 4MXOA 4A6EA 2Y4IB 3AMBA 4FSWA 3NJRA 4DYMA 2IZSA 4ZTRA 2RG5A 4IKPA 4FV3A 4F09A 5DM1A 4UWYA 1J7UA 3QCYA 5ANEA 4JBQA 4IQ6A 3OBJA 5IF1A 3CKWA 4CFUA 1NV8A 3Q9WA 2IVUA 4FP9A 3P7BA 4FGRA 1KE7A 4ER7A 1H26A 2VO3A 3AC5A 1FP1D 4E6DA 5JZNA 2B54A 3K5VA 5EGSA 3HKOA 2BZGA 4EHEA 4ASXA 2BR4A 2C69A 2B9EA 3N4VA 2YDJA 5HLNA 3HRBA 1EIZA 3LBYA 2OLCA 4G17A 4OLIA 4QMNA 3FMJA 5E91A 4E30A 3W2QA 4DH3A 3NUYA 4U97A 3BYMA 3H2BA 3PS9A 4F85A 3VBWA 2C6IA 5A4LA 3BWYA 1FJXA 5AA8A 3MHTA 4QNYA 4C58A 3HM2A 4D4YA 4LMUA 4KAOA 3BGQA 3HV5A 3SRVA 3ZSGA 3DU8A 2ERKA 4BBMA 3DFAA 4X61A 2PZIA 4CT2A 1NKVA 4O7SA 4JDHA 5B2MA 1UV5A 3FLWA 3MVLA 1XJDA 2VTLA 4WD5A 4QP9A 3R7VA 4PYKA 3DJ6A 3A4OX 3GQIA 2RG6A 5BX0A 4I1ZA 3CS9A 5A4EA 5HGIA 1F5QA 2XF0A 4YUVA 4GT5A 2QHNA 3DK3A 5EHGA 4A9RA 5BMMA 3SGLA 2JAMA 3MPTA 3FUXA 3KB7A 3IHTA 4A9UA 4I92A 4OTFA 4UYAA 4DT8A 1QANA 2FA2A 4EOJA 3UZUA 2RGPA 4RC3A 3WSTA 4R5YA 5LWNA 4CFMA 4MBJA 3QKKA 3ZDIA 4L3PA 4L00A 5BYLA 2CCIA 3RP9A 1MRYA 3VHKA 2CKQA 3H3CA 5AWMA 4F6SA 1BLXA 4KWCA 4BBEA 3F2AA 3H4JA 4RIWB 2UZOA 4ANBA 4IWPA 3LECA 3SSOA 1YHSA 4HYIA 2VNYA 1P14A 1A06A 5M06A 4FTTA 4RG0A 4EH5A 4N57A 3CBGA 4NYEA 2PVFA 2YUIA 4PTEA 4HOKA 2PHKA 4RJ4A 5J5SA 2H96A 4PCLA 2KTYA 4S30A 3ROYA 3PZEA 1JQHA 4QP7A 1MHTA 3FPJA 5CF5A 3OWPA 4FSNA 3C0IA 2G70A 3FMNA 5CXHA 2JDRA 5K5NA 1X1AA 2JHPA 4GK3A 4XH6A 4LGGA 4O7RA 3COIA 3KK8A 2C0IA 5CVFA 1X19A 2CN5A 2WXVA 4WSYA 2GDOA 1JSVA 1SMHA 5LSAA 4JBPA 3KA0A 3U4UA 4CXAA 3D4QA 3DLSA 2I9KA 2X9FA 3MVMA 4C38A 2AYPA 4CMOA 3OCJA 3PRFA 4JJRA 2CDZA 4Y95A 2P8JA 2XMYA 2HTEA 2H6DA 1BYGA 5JMSA 3UMWA 2AN4A 2WOTA 4AG8A 3H9OA 3MI9A 4IAZA 2OFVA 3G89A 3LJ1A 3OVVA 4M37A 4IZ5A 1QCFA 2V22A 4U81A 5DSXA 2GFCA 3BI6A 4OTWA 1U46A 2QD9A 1SUIA 1F3MC 2QHMA 3F66A 2GQSA 3T7SA 2VZ9A 2IWIA 4NW5A 4NZWB 4MXZA 3A7DA 5K0CA 3U9CA 5AP1A 4P58A 4MYGA 5L2WA 5F94A 2WHBA 3JWGA 5EHIA 4CQEA 2RF9A 3Q2MA 4IANA 2C1BA 3RAHA 4DLIA 3A7JA 4K18A 2PXCA 5JUWA 2XNPA 5F2OA 5ANDA 4ZTHA 3VAPA 2WTDA 4POOA 2DQ7X 4FTIA 5CEIA 1KPGA 2AS0A 2ESRA 3OS3A 4DEGA 1Q8WA 1YXTA 3TJCA 4RBLA 1XXLA 4YJUA 5IKMA 2ONZA 4K6ZA 3TUBA 2ZB0A 2GNFA 4FVPA 3GU7A 3ULIA 4OT6A 4G31A 2ERZE 4DGGA 5KX8A 3UPZA 1I09A 3DPKA 2YIRA 1AV6A 1M2RA 4WG4A 4AZEA 1Q99A 3HMMA 2JKOA 1JBPE 2X8EA 4JR7A 1M14A 3HCCA 3PE2A 3ZO2A 4UXLA 1H1RA 4WNOA 4QDKA 1R8YA 2IZRA 4EK9A 1DL5A 5GJGA 2X7OA 3TV4A 3ZU7A 4H58A 2VX1A 4PINA 1EJ0A 4E4XA 4F7SA 4G56A 4P7KA 4R3CA 3V51A 4OBOA 5IQBA 4O7NA 3R7OA 3KQPA 3QTWA 3GDHA 3E8NA 5HG8A 5KMLA 4IB5A 5EYDA 4G5JA 2CCHA 2ZDTA 1JSZA 4TL0A 3R7YA 4O27B 5CU0A 4R7HA 4XG4A 4IM2A 3HVKA 4IE9A 5L6OA 5E9EA 3CP9A 2VRXA 1BKYA 4IAAA 4JQ8A 5AADA 4BDAA 2UYHA 5HKMA 3NIZA 3ZUUA 1XWSA 3OEZA 4G6OA 3L8DA 3R8LA 3TV7A 1OBGA 5EZQA 3OPNA 2ZM3A 4GU9A 3C3PA 5DR2A 4GVJA 3PVGA 4AA4A 3GQLA 2YAAA 3LCOA 5DWQA 3FPEA 1SVGA 4CCUA 3AMYA 4E20A 5J9ZA 1XH9A 4C33A 4JQEA 2G1PA 5KQSA 3GIWA 5DXAA 2UVXA 3OEFX 3OFKA 4QYGA 3HEMA 4RX1A 1NA7A 2BILB 3NDIA 1I1NA 4KABA 1DI9A 3TPZA 5FULA 2PY3A 4E6CA 4AW0A 3FZPA 3GCZA 3FUTA 4HNFA 1JQDA 3Q5IA 3FI8A 4MHAA 4EONA 2VNWA 2ZCJA 3IOKA 5T68A 5EYMA 3QGYA 3OZSA 4YU2A 2Z7LA 1N2XA 4PX6A 4ZJIA 1M2PA 5FRIA 4C02A 4YMGA 4MXYA 4OTIA 1H00A 1ZMVA 3UJ7A 2HW6A 1Q41A 4O2ZA 1X1CA 4QMWA 5ETCA 4JXJA 1UWHA 5FTQA 3O51A 5J7HA 2AZTA 4DCMA 5CU4A 2R3OA 3HV3A 3GNIB 4RT7A 4AOIA 4FT7A 3NYVA 4HVIA 4BDHA 2NP8A 3EGEA 3NYNA 1G38A 4G3CA 3PE1A 3CBLA 4DG2E 5HU9A 2B9HA 3O0GA 3Q2JA 4ACDA 5J87A 2OU7A 4QQKA 4YO6A 4I5MA 3OW3A 5HLPA 4XOZA 3UFBA 5DN3A 2BRMA 4QP1A 5IH4A 3HRCA 4N6ZA 3G8BA 5LQNA 4H3PA 2R3SA 2YITA 3H0YA 1WZYA 4O7ZA 4PF4A 5IQDA 4QYFA 1IXKA 2O0UA 2PMOX 4EL9A 3PP1A 2B25A 3ZZEA 3OCSA 4DEBA 2UYOA 3CE3A 2VTHA 2ITOA 3G6GA 4M7RA 4L67A 3NNUA 5E8WA 3LM0A 2PXAA 4PMTA 2UW9A 3K6RA 2QOHA 3NW7A 3ER9A 3EN6A 3L8XA 4KS7A 3JR1A 3QA0A 5KHWA 3FHRA 1MP8A 2OB2A 1OPJA 2KW5A 2W7XA 1VE3A 2C5XA 3CKXA 1IAJA 2B53A 4RVHA 3PDTA 4BIEA 3M6WA 5GIOE 4BCHA 4BTKA 5LJJA 4GJ2A 2YWPA 4FV1A 4MWHA 1URCA 1F3LA 3LKZA 5AV0A 4O0WA 4EC8A 3DTNA 2PUUA 4E1ZA 2ZMDA 1JKTA 4I94A 3Q4TA 4DEHA 3E63A 3HNGA 4U8ZA 4FTAA 5T6BA 3GFWA 2BIKB 4YBKA 3VJOA 1VBFA 1AQIA 4NCTC 2XKEA 2QYOA 5CSPA 3CSVA 4FI1A 1JR4A 4HGLA 1P4FA 5JRSA 2C0TA 4I0TA 2UV2A 4V01A 2W5AA 5DPMA 4P7GA 3EFJA 1H4LA 3GC0A 3N9XA 4C0TA 1QPCA 3TDVA 4FL2A 4NSTA 5EQJB 5C8KA 4BVUA 2O06A 1GZNA 3U6IA 4EYMA 2YCQA 1B39A 4YJQA 3R28A 3HP2A 4FBXA 5CEOA 4USDA 1R18A 4YPDA 1P91A 2QI8A 3PJCA 3QUEA 4C08A 2UZ4A 4J8MA 3TQSA 3HGKA 1YI4A 2ITXA 3ULZA 1GZOA 1YOJA 4N4SA 2GB4A 4BBFA 4FV4A 4RIXA 5ANOA 4E70A 3VC1A 1YDRE 4NL0A 3CJTA 2FYSA 2OSCA 1X1DA 3PG1A 4NWMA 3S95A 1IR3A 2X2KA 2XKCA 5IPJA 2AOUA 4FTNA 4YMJA 3FKNA 3ZO1A 4MX9A 4XRJA 3N51A 2BFYA 3DXPA 4I20A 4JNWA 3R9NA 3ZTXA 2ZM4A 4TTHB 4HPUE 2PL0A 3DLCA 1XTPA 4ZJVA 3ANXA 2Z6AA 5K0NA 4UZHA 1J3HA 3HCDA 5I4NA 4QTTB 3QTSA 3FTCA 4MNFA 1NE2A 3UGCA 1P4OA 4O0UA 5HO8A 5LMKC 5DR6A 3HZTA 5FGKA 3E87A 2PX4A 2QR7A 3EWHA 3RAIA 2DUVA 3FL4A 3IOPA 2ONLC 4HGTA 2WPAA 4FL1A 1T46A 4RPVA 2EU9A 2K4MA 5JZJA 2WD1A 3MAGA 4A4OA 2O57A 5H9BA 5A6OA 5JFXA 1BMKA 4KINA 4ATNA 4YZCA 5AFVA 2RIOA 4C34A 1FVTA 5AM6A 3P79A 1OPKA 4MVFA 2XEZA 4F99A 4O29A 4ZSLA 1M52A 4WIHA 4RMZA 4K77A 3ZFMA 3W33A 4NT4A 3FWQA 2XBAA 4EQZA 2OIQA 3HMPA 4IX4A 2GFSA 4WG5A 1H25A 4PIMA 3R8MA 3KQQA 3ZMMA 1OZ1A 3R6TA 5LQUA 3ODYX 4IX5A 1ZMWA 3FV8A 3EMBA 5HNIX 1TQIA 5F95A 3WBLA 3VUMA 4FYNA 2ACXA 4BCFA 5IDNA 3LDGA 3QD4A 1MQ4A 3GU8A 2GS9A 1Q8ZA 3G0EA 2QU6A 3DDQA 3HVJA 4BDGA 5E1SA 2Z8CA 5FCDA 4DEEA 2VP3A 5TOZA 3FRIA 5GWXA 5DT3A 4KRGA 4OBQA 3REOA 4EOMA 4FTUA 4X2GA 3WIGA 2C6OA 2YM3A 4P4CA 4GUAA 4PYMA 5HIDA 4XP2A 3MW1A 4CKJA 3I53A 4NK9A 4BY9E 1AQJA 5BVDA 2OBFA 3EPPA 3UO5A 4RTQA 4L46A 4I21A 4A4LA 3UOKA 5CTPA 2GNLA 4FIJA 3PA4A 3UODA 3W1FA 4GOOD 4AS0A 3TKAA 4EH9A 4DEDA 3HCEA 4EK4A 2NP6A 2IP2A 5EDRA 2P0CA 2XNMA 3BBTB 3DUWA 4P7FA 5DTQA 4MHTA 3QZFA 3AT2A 2P2HA 2EWAA 3TIYA 4CSVA 2NRUA 2YTZA 5EW3A 3ORKA 5C8MA 5CD1A 1YB2A 4F65A 3Q96A 2C5YA 4ITIA 5HICA 1CMKE 2HZ4A 5HLWA 4FL3A 3IGOA 1ZOEA 4EH3A 5IEXA 1OKWA 1OR8A 2OXYA 3I5NA 3I79A 4IEBA 2SRCA 4X3FA 2OZVA 2F4JA 2OJIA 5IMXA 5CCXA 3O17A 1AGWA 4U80A 5DHJA 2BM8A 3WYYA 1UU8A 3Q60A 5H3QA 5BVNA 3GCUA 1STCE 3DKOA 3G2QA 1Y91A 3KPVA 2QQ7A 1KE9A 2P7HA 4LI5A 3EEOA 3RCJA 4S31A 2CKPA 2WQMA 1XBBA 2ZV7A 4CKIA 3BE9A 4IZ7A 3IW4A 4AX8A 4ER3A 5IDPA 4V0QA 4BRXA 3B3JA 3NNVA 4QPNA 3F61A 5AP4A 3UTOA 3HA8A 5JRQA 5IH5A 1HCKA 5IQIA 5EK7A 4JAIA 3QD0A 2Z02A 4JI9A 5EQPA 3EYGA 3BX5A 2VV9A 5CI7A 4QMVA 5FP5A 3OHTA 4DT9A 4DBXA 5JN2A 4X2FA 1LR4A 5AV2A 5E1OA 3IDBA 2CNQA 3NEWA 3ZC5A 4CKBA 2W5BA 5F2KA 4FTLA 4I4EA 2VTMA 2P7IA 3FUWA 1OIQA 5EH0A 3MB5A 4H0NA 4U7PB 1RI3A 4FKRA 4EZ7A 2UW6A 5CASA 1R1WA 1Z3CA 4YUWA 3HMOA 3G90X 3M6XA 1R8XA 4L9IA 4MCVA 2ZZMA 3VW6A 3EFKA 3E7PA 2BDJA 4DKJA 2YJRA 2V62A 3LOKA 4BHNA 4Z16A 2VO0A 4I5PA 3FMKA 4L7VA 3CPBA 4X60A 5DOSA 4APCA 5CU3A 4MD7E 3LFQA 3SXJA 5EOBA 5KHXA 5HIMA 4BCGA 3AG9A 3BRBA 1Q3DA 3Q6WA 4GS6A 4BLWA 1WFCA 3SD0A 1ZMUA 3FTFA 3UJ8A 1PW2A 4ACGA 5H8BA 3W2CA 3C5UA 4IWNA 4A9YA 4J53A 3I7BA 4ZSAA 2UVYA 3BUSA 5CYIA 5BUEA 4CWAA 4U3ZA 4WKQA 2WOUA 4GIHA 5DPVA 1KPHA 3KXGA 2Z2WA 5IQCA 5EQYA 4M8TA 1PXMA 2W1HA 3AWIA 5EOLA 2XJ1A 4BGQA 2ZV2A 2JKKA 3LLTA 4XG9A 3BHYA 5KVAA 3OE4A 4BCNA 2XZSA 4EZ3A 4IWDA 3GI3A 3ATTA 1GIIA 1B38A 1JPAA 4I6HA 4FZFB 4BDEA 3FKLA 1WBPA 5FEQA 4FMQA 2BZIB 3FPFA 3CXWA 3FAAA 5EYKA 5CSXA 5E8XA 2GS6A 4YBJA 4UWBA 3MVHA 3BU5A 4NKSA 2BKZA 2UW3A 4KW7A 5JGDA 4FV9A 5EI6A 4D2RA 3LKDA 2G2HA 3C6KA 1JSTA 3VQHA 3V5TA 2PXXA 3LFAA 2QC6A 1MRVA 4RTSA 5HEKA 3O7WA 2PULA 2J7TA 5FP6A 4Q5EA 4HVDA 5JH6A 4TWOA 4QMTA 4EQCA 3WF8A 5JK3A 4FEUA 4H39A 3BYOA 3LXPA 5EM5A 1Q62A 5LMAA 1H1DA 1YXSA 3AD6A 5IQGA 2JHAA 3ZXTA 3UO4A 1YHVA 1FVRA 2HYYA 5IQEA 4NU1A 4F7JA 3R71A 1H1QA 2YM7A 5C1QB 3BU6A 3HVHA 3FMMA 1KSWA 4RTRA 3FZGA 3P4KA 2OWBA 2OXTA 2R3FA 3UJDA 3KU1A 4RIWA 2C6KA 3VNTA 3U6JA 2J0JA 4CVAA 4XG7A 2NO3A 4G9RA 5A9UA 1KXZA 2C5NA 5AJQA 4FR4A 4XMOA 1YI6A 2IZTA 1CKIA 4Y46A 4Z2YA 3WILA 2WTKC 2WTKB 3LGAA 3W55A 4M14A 2C30A 2V74B 3IYLW 3AC4A 3A7EA 3KN5A 4TNBA 2BZHB 5BMSA 3L9LA 5AUYA 4BHZA 3ERCA 5EHLA 5CALA 4RVFA 5IH6A 1ZOHA 4G3EA 4EH6A 4W4XA 4AGWA 2Z60A 5DFPA 3SSMA 4EORA 4FSDA 3OMVA 4RJ6A 3R2BA 2V7EA 4EH8A 3K54A 3EVEA 1VL5A 4DGNA 1EQAA 2PKWA 3IW6A 4TN6A 3ORNA 1OIYA 4FEQA 1NT2A 3EQPA 3DB8A 2AN5A 4C2VA 3P78A 1BUHA 4O0SA 5B7VA 1JOWB 2ERCA 1WXWA 3U87A 2CLXA 2BALA 5FDXA 2WMRA 1ZGAA 3R0QA 1NW1A 2YVLA 2OGVA 2W4JA 5EVJA 1GNGA 4DFYA 3LCVB 2RFNA 2UZTA 4E7WA 4PIPA 3O7LD 3TKUA 4M12A 4ASEA 1ZYCA 2ZMCA 2IDKA 4MAOA 3RPVA 3S00A 3UWPA 2J5EA 3JWJA 5KMOA 1JSXA 4DEIA 3VC2A 2X2LA 4Z7GA 5EFQA 3SDJA 3G9LX 2YERA 5DEYA 5K0EA 1J7IA 2C47A 3UJCA 3HDNA 1BI7A 4LUEA 3H9FA 1GIJA 1JVPP 1V0OA 2OZOA 4RTLA 4JL9A 5DIAA 3MV5A 2OO3A 4E5AX 5AUZA 3IV6A 2J5FA 3T9IA 2Q0BA 3DBFA 3CGFA 4L3LA 1PRYA 2AVDA 5HG9A 4KRCA 4IM0A 4MIKA 4R5SA 3G7UA 4QT1A 4EOQA 2I0YA 2E9VA 4JDKA 3VBVA 4F7NA 4ZMFA 4KIOA 3BLRA 4O7YA 3DK6A 4YLKA 5ANIA 3FPGA 3IONA 4PTGA 4YJSA 1GAGA 4LG1A 3OZ6A 2OH0E 3OF0A 4X0MA 5CAUA 1O54A 5C27A 4UY9A 4FKOA 3JUHA 1REKA 4GC5A 1G8AA 4ZEGA 5CENA 2V7AA 2XIYA 4KRDA 1ZKDA 4YJPA 2IH5A 2ITTA 2OFUA 3P9JA 5E1MA 4II5A 3U51A 3SAYA 1Q8YA 3MH1A 1PKDA 2JLDA 5P8WA 4ZS0A 2RFSA 2G2IA 4MD9E 3R1QA 5AP3A 3PUPA 4FZ7A 2GHGA 3O2MA 4FNXA 3CC6A 3LSTA 4RX5A 3PG3A 4FICA 4USFA 5GOZA 2F9GA 4C03A 4L6QA 3X0DA 5HZMA 2PK9A 2C6LA 4ARKA 4EK5A 3RK5A 3TT0A 4PYLA 5H8GA 4U9AA 5LXMA 3CVOA 1KV1A 3QTIA 1XH4A 3W2PA 3NCZA 2ITZA 3NW5A 1O9GA 3C4EA 4HJOA 4GIIA 1YDTE 5D41A 3OCTA 3F7ZA 5K05A 4BICA 4UZDA 4DFZE 1B6CB 1AQ1A 2WMUA 4M97A 4BCIA 3U8WA 1PF8A 3OUKA 5HX8A 4GF5A 1UU3A 2YM5A 1OKVA 1N7JA 5I9ZA 5EEGA 3GCQA 3ORMA 1Y8CA 3BELA 3KREA 3PIZA 5C26A 2XS0A 3EKNA 3LXLA 5TT7A 1L3BA 4AW1A 2WMVA 3POZA 3Q4UA 4AN3A 1A48A 2YABA 4G5PA 5IA3A 2NXNA 2EX4A 2BVAA 3L8PA 3MPAA 4Z3VA 3LFCA 1R39A 1WAKA 2FB8A 2OKRA 4RLKA 5ETAA 2GTNA 2XNOA 3FEGA 3ZDUA 4FEWA 3UNJA 4BP3A 3NGAA 5FA8A 4QPPA 3CQEA 4AT3A 5CNNA 3M11A 4TYIA 5CZHA 4U7TB 4J98A 2VTSA 4AZVA 3VUKA 4FV0A 1Q4LA 2UZVA 4QPSA 3ZLWA 1LEWA 2X2MA 3VC4A 1RI4A 3NDJA 5AP2A 1WBNA 5IISA 3PTAA 1XR1A 2OG8A 3EB0A 4KIQA 4J71A 2O0LA 2AOTA 3LJ2A 3LFSA 4FKPA 4XNEA 3WE4A 1XO2B 1Q3WA 3UYSA 2X81A 3R2YA 1MQBA 3CJRA 1H27A 2E5WA 4E8AA 4RC2A 3TNIA 5HO7A 3UBTA 4BDKA 3OZTA 1PMUA 4BP1A 4BZDA 3HA5A 3OG7A 3QCQA 1CDKA 1TQPA 1YDSE 5FLFA 3LBFA 4ANLA 5E8UA 4YTIA 5EM7A 3OWJA 4Y5QA 4MBLA 4M36A 4NM7A 3S2PA 4RX8A 3LAUA 4AUKA 1LPUA 3MJ2A 3DNDA 1Q0SA 4K9YA 3GBZA 3PY0A 3KEXA 3A26A 2OJFE 4EOOA 2PVKA 1NVRA 5F2NA 3ZOSA 3U6HA 4IMYA 1H07A 2XYNA 3QQFA 3ZRMA 3BGVA 2HY0A 1H8FA 4U41A 4HZSA 3WZUA 2R3PA 3MSSA 4EJ7A 2XVMA 4C4HA 5KZ0A 3SW7A 4L7FA 4F08A 2NXJA 4IFGA 2EG5A 3KR9A 4KBAA 4O81A 5HD4A 3F3UA 2Z7QA 3ODZX 2PX8A 2VTNA 5HBJA 4H36A 2ITNA 2PVHA 3I6UA 3QRKA 2B2CA 4LECA 4RZVA 4O2PA 3S0OA 4GK2A 5ETIA 2BR5A 5AP0A 4HYUA 4IC7A 3DT1A 3VUDA 2WTVA 2PWLA 2W06A 3OZRA 3SXSA 1SNUA 3U4WA 3M4XA 4X6QC 5LMBA 5L8JA 2GLUA 4CTJA 1JQ3A 3OWLA 3KQYA 3Q9ZA 1T45A 1SYKA 3QZIA 4M84A 3JVSA 4O0XA 4FSYA 1RI5A 5EMJA 3L8VA 4DZRA 5ICFA 3SR4A 3GVUA 3FE3A 1TPYA 3DULA 3DKCA 3CTHA 4RRVA 5F1ZA 1YF3A 3MCTA 2EXMA 5LQRA 4C07A 4E2ZA 3G2PA 3QQUA 3GGDA 1BKXA 4DN5A 2VWYA 1SVUA 2EUFB 5KNJA 1QAOA 4QQJA 3KXNA 3K0BA 3D14A 5GIPE 3R01A 3KRLA 2QOKA 4M3QA 1BI8A 1NW5A 4RTMA 1V0BA 2NXCA 3SXRA 3RNIA 4OGRA 3RPRA 1PHKA 3PP0A 4YPSA 5K5XA 2IJMA 5GINE 1JKLA 1S9JA 4P2KA 1RDQE 2YISA 4QQNA 4AA0A 3ACKA 2VU3A 1AD5A 4Z9LA 4IWOA 4ZK5A 2PT6A 4J96A 1H1SA 1W84A 4D5HA 3SMQA 4FV6A 3V8VA 2B78A 2C4GA 5F4NA 5J9LA 3EL7A 5K01A 2CKEA 2PVJA 4XUEA 3PXFA 4FT9A 2YXEA 4YJVA 3THRA 3P71T 3SA0A 3PFGA 4U79A 4PP9A 4EHGA 2FCAA 3LFBA 4FKGA 3U54A 3WF5A 4ZZOA 3NR9A 4ISCA 1U5RA 2WMQA 1WCCA 1O9HA 3DNEA 4LYNA 3EN5A 3HA7A 4JAJA 4R78A 2JFMA 2IIPA 2FO0A 4B4LA 3NVMB 3GUBA 4ZJJA 2WEVA 4EK6A 3PJ1A 3TKIA 3MA3A 2DPMA 4R6VA 4X2KA 3QRTA 3QX2A 2FK8A 2B3TA 2X0GA 5LMKA 3ORZA 4V0GB 4DCEA 3MIYA 3JYAA 2CMHA 5EMMA 1OL1A 2PWYA 3V6SA 2ONLA 4DG0E 3RJCA 4F86A 5EKXA 5D1NA 5JGBA 3I60A 4RWJA 2AR0A 2CL5A 1W98A 3F3WA 5IH3A 3TV6A 3R7UA 4IB3A 3KULA 1G55A 2XIXA 3GXOA 1YWRA 4ZZMA 3Q9XA 5I9UA 5HCZA 2G71A 4RTNA 5E9JA 5FA5A 1H1PA 4KIGA 5KQRA 5LVOA 5FQNA 1H0VA 5GJDA 4IAIA 1OIUA 2WTIA 4RTJA 4IVDA 2BRNA 4YP8A 3TN8A 5EI8A 2W4KA 3CD8A 3W32A 2QKRA 4MQ1A 4RTKA 4FKUA 1FBNA 3CJGA 3R6XA 5AAEA 1WBOA 4OTDA 1JG1A 3M70A 2A1AB 3A8WA 3SG9A 4U42A 2YACA 3P1AA 5EHYA 1NVQA 1FVVA 4IJPA 4D1SA 2R3NA 4DA4A 3P2IA 5CSWA 2WQOA 3DY7A 4UALA 4U43A 2BUJA 4KDRA 1EG2A 4B8MA 2QKWB 5HORA 3GRZA 3PVUA 2OZAB 2P3OA 3A8XA 2VTPA 3TIZA 5HHWA 3D2IA 5A4QA 4PWYA 3KF7A 5T6KA 4YTFA 1KYZA 3DTWA 3AQVA 5CS6A 5KMMA 5HU3A 2O3PA 3DP7A 4DFNA 2FHPA 2CWWA 1XH6A 4PNEA 4TXCA 1KE6A 3UVRA 2XNNA 3CR0A 3OCGA 5E1DA 5HBEA 4FIIA 5HG7A 5KMNA 4IIRA 2JHCA 1NBHA 3VUIA 4YTCA 2A19B 1V1KA 3KF4A 3OT3A 3PSCA 2OF4A 3G51A 3F5GA 2HZNA 4W8DA 4YUQA 1ZWSA 3A25A 2XA4A 3F7WA 5HVJA 5DT2A 4H3QA 4UV0A 3C4FA 5CT0A 4EI4A 4BZNA 3QYZA 1E9HA 4GKIA 4G3GA 2G72A 2EJUA 4EJNA 3CY3A 1ZXEA 2QO9A 3PVBA 3QUPA 3WOWA 3E3BX 5HIEA 5IEYA 4NTSA 1UA2A 4XX9A 5AEPA 1TQMA 2BMCA 4YZDA 3IG7A 2JIUA 1FQ1B 1UKHA 2YXLA 3QTUA 4BCJA 1IASA 2XK4A 3A4TA 3RAKA 3UVPA 4GRBA 2LGCA 4PYNA 3KRXA 4AF3A 3ORHA 3C4WA 3ACJA 3A7HA 4ZAUA 4QVGA 3HAMA 2HY81 3BV3A 3EQCA 1OL5A 1V39A 3ORXA 3PJ8A 2YXDA 4P5ZA 5IA0A 5M08A 1VR2A 4RV9A 1JQEA 3V01A 3QKMA 5HFJA 4L01A 3UA4A 3QD3A 3DR5A 1NXKA 5E9WA 4QP2A 3R9RA 1OGUA 3KN6A 5CY3A 3FC1X 4CFXA 3VRZA 4C61A 3RHKA 3MCZA 2I7QA 5ICPA 4QTDA 4Y72A 3VS4A 4DCAA 3E8SA 2W1EA 4FIHA 3AXSA 3EQBA 3D94A 4FOBA 2WGJA 1AF7A 3II5A 3DTCA 1RE8A 4OX9Y 4JLCA 2VDWA 3D5VA 2GCDA 3ZCLA 5HTBA 4HVSA 1GOLA 2JEDA 3LIJA 1WBTA 4KSPA 3AXTA 2C7OA 4UB7A 5HOQA 3Q7EA 4C59A 4XLIA 4X6RA 4ZTMA 3BXOA 1OL7A 2FSLX 2QY6A 3KKZA 3EEYA 2XYVA 2VUWA 5LCKA 5D9HA 4E2WA 3ORIA 3R00A 2VTIA 3HAVA 4FZ6A 1RW8A 3I7CA 4YNOA 3BWMA 2OK1A 3R21A 3FMEA 3MY1A 3FI4A 4ACHA 4GJ3A 2QOCA 4YUXA 1RJBA 3HV6A 7MHTA 3DQXA 1A9UA 4QTEA 2IFTA 1HOWA 9MHTA 4O84A 3MH2A 3MN3A 5L2TA 3VBXA 2JH9A 2WO6A 2C0OA 2B4SB 4XV1A 4AU8A 3RKBA 1O6LA 4GUEA 4AGCA 5FWDA 1OI9A 2YM8A 3P97A 4FTOA 2GNIA 5JR3A 3PXYA 2IVVA 3LX6A 4WXHA 5AX9A 3I4BA 2QO7A 3A60A 4MXAA 1FPQA 2WMSA 3QTQA 3P9NA 1DCTA 2JBOA 2W1DA 1INLA 5E8ZA 3SVVA 4ZLYA 3FYDA 3SOAA 3WYXA 4EMSA 4FTMA 3NW6A 4BR3A 1D2CA 4XUDA 4QMUA 5ACKA 1BL6A 4ALVA 4E2XA 2ZIEA 1ZY5A 4FSUA 4JBOA 3O4FA 5DNRA 1I4WA 1VP9A 4JBVA 4F9BA 4WVLA 4TWCA 3R8UA 3HEGA 1Z9XA 3UNZA 4YURA 4ENXA 2ZWVA 3HMIA 1BX6A 3EHAA 1PXOA 4HGEA 5LQAA 3V8WA 4WNKA 5AV3A 2UW8A 2G8NA 2C6TA 3SC1A 2FRXA 4W4WA 4PMSA 3QHRA 3EJ1A 3EZRA 4BGHA 3P5KA 1OMWA 3UMXA 4WNMA 2P55A 4A9TA 5E92A 3MY5A 3KXMA 4A7CA 5I5ZA 4WG3A 5AIRA 5KBQA 3AY0A 2F49A 3EQFA 5TR6A 5CEQA 3FUPA 4TZRA 2PGXA 5EMLA 1TW3A 2VN9A 4AT4A 3RPSA 2WQNA 3AD5A 3HV7A 4NUSA 3RM7A 4E73A 1ZAOA 2WU6A 4JR3A 2JBPA 3UJ9A 4FKIA 4YHTA 4L7SA 3QTRA 3MTFA 1FMOE 3UJAA 2VTTA 4EOSA 5BVEA 3GC9A 2BAJA 3MTIA 3BCEA 3OU2A 4O82A 3PPZA 4DLJA 2F7EE 5TKDA 5HE3A 4UBAA 1GY3A 3E8DA 5I0BA 5EHOA 1IRKA 3GRRA 1CSNA 4FZVA 2BIYA 2XIZA 3NYXA 5HCXA 4R7IA 4FEVA 5HESA 4MNEA 1I44A 3TZMA 3AGLA 2XVDA 4RVKA 3FY2A 5MHTA 3A62A 3QBNA 4KS8A 4RIYB 1OUKA 1XVAA 1HMYA 1PXPA 3MYGA 2IZUA 2IW6A 2VS1A 5BQ0A 5CAQA 5K9IA 1RJFA 4JG7A 5TF9A 1MUOA 2ZYBA 4HSGA 5I9WA 5D12A 4AOJA 5FEDA 2P1DA 5LR6A 1URWA 5EQEA 2AN3A 4O7TA 2X8DA 5JKGA 3QXPA 3B89A 2UUEA 3IQ7A 2WTJA 1OKYA 4JX3A 3OXTA 1MJFA 4AFJA 2BR3A 5HIIA 3EFWA 4NM5A 2Y0AA 2UZUE 5K09A 4H1MA 4JG8A 2Y9QA 4AAAA 4JX7A 1IEPA 4HNIA 4DQ0A 2HV9A 3W2SA 4G16A 2PBFA 2ZULA 4JS8A 4USEA 4YUZA 4RTOA 3QAME 3ZS5A 2I40A 3MA6A 4BDDA 4BCOA 2BDFA 2FPOA 5CSVA 4PMMA 2CLQA 3HLLA 4XS2A 2B0QA 5DR9A 5M5BA 5FXRA 2VWBA 4YC8A 3RW9A 3EMGA 3FLYA 2UZLA 5A54A 3TNWA 5BUIA 3NUNA 2GS2A 2VO7A 1XQZA 2XKDA 3I0OA 3MQ2A 3G9NA 3KXZA 3SG8A 3LHJA 4A07A 2VTJA 3OXIA 1YUBA 4O6EA 4OTGA 4MKCA 3TM0A 3F4KA 4YJOA 4TYHB 3OTVA 4KKGA 5T3QA 3QF9A 5KMIA 4QP6A 8MHTA 3ZM4A 4KA3A 4KWPA 1W82A 3MB6A 2P35A 3FPQA 2ETKA 3E8CA 4Y8DA 2O05A 4V0RA 4ZTQA 2WQBA 4LMNA 4ER5A 1P1BA 3QQJA 5DSTA 3QZGA 5IUGA 3LCSA 1LUFA 2V0DA 4IH8A 1XHAA 3DAJA 4EKLA 4RJ7A 4U45A 2I0EA 4U0IA 1FMKA 5DT4A 4IJ9A 4CGAA 1R3CA 4CTBA 3O71A 3F3ZA 4ER6A 3V04A 3VUGA 4H05A 4FV7A 2QNJA 4XRLA 2UYQA 3PX3A 1IA9A 3CQUA 4RJ8A 3GCPA 3PRIA 4Q5HA 3UQCA 3ZHPC 3N4TA 5EOVA 1VZOA 2IO6A 4ASZA 3JY9A 4QRCA 5M51A 4G3FA 4EVIA 3CY2A 2P3QA 4YJNA 3Q6UA 5EMKA 3H10A 3C1XA 2C3IB 4RWZA 4LOQA 3IW7A 4GH2A 5EKOA 4I41A 4TWPA 2J0KA 2CKDA 2YCRA 4YC3A 4F1TA 4MK0A 4QMLA 2AOWA 5FTWA 3G33A 2HXQA 3ENHA 2W9FB 4AE9A 3T0IA 4EEVA 2E9NA 2A14A 3ALNA 3DK7A 4K8AA 4OQEA 1FGKA 5HNBA 4F0FA 4RVDA 4WBOA 1N7IA 2OICA 3F3VA 3QC9A 3FMLA 4N6YA 3TG1A 3A2CA 4RWIA 3TUCA 2HW7A 3F82A 3MTLA 1OVEA 2ZSUA 3OXZA 2IVSA 4FE2A 5H2UA 5CWZA 4HGZA 5CEKA 3HNRA 5HVKA 3LQ3A 4HGYA 3PIYA 2RFEA 1PMEA 2IBSA 4EOPA 3GC8A 3CJQA 1XDSA 1BC5A 1DM2A 2XH5A 2WB8A 4D58A 4KDCA 1JG3A 4OBXA 4TW9A 2BHHA 2CGXA 3PWDA 4TY1A 3SSNA 3E88A 4O83A 2F7ZE 4U6RA 3TRKA 4ZTSA 2CJMA 4ZP5A 4UXQA 3TM5A 2CNVA 5IUIA 3D9VA 3Q04A 3CTJA 2E9UA 4AN2A 3BU3A 5L3AA 4GEOA 1ZGJA 4C37A 3KCFA 4PGGA 5M07A 2PZ5A 3ZH8A 1IM8A 3NAYA 3QCXA 3R04A 4QVKA 2CSNA 3MFTA 4RJ3A 4IZAA 4FKSA 1OIRA 4X7QA 4CZTA 4ACCA 3R8ZA 1P1CA 3DMGA 1M6YA 1YZ3A 3T3VA 5M4UA 3FPMA 3ZEWA 4FVRA 2H9VA 3FZSA 4DGMA 4O38A 3MESA 5JSMA 4NFMA 3S68A 2YM6A 2O07A 3C51A 1O6YA 1U59A 3VWAA 3FBVA 3HUBA 2PVMA 3MGGA 4LRKA 3EQIA 1PJKA 4GOMD 4CLJA 5EIWA 1OKZA 4JIAA 3GXLA 2BDWA 3E3PA 2AOTB 4IBMA 3EN9A 2B1PA 3BLHA 1R78A 2OI4X 1GJOA 4J95A 3QWJA 4OTHA 4E31A 5CEMA 3DH0A 1S9IA 1R6AA 5J8IA 2V7OA 3B3GA 4Z7HA 2EFJA 2ZBRA 3EVCA 1YRPA 4L44A 3TM4A 5H02A 4MTLA 2OJ9A 3EL8A 3GWZA 1DAYA 4O7VA 3OT8A 2UW7A 4WUAA 2HWKA 3Q32A 1XH8A 4FSQA 2J0MB 2PMIA 3BV2A 4LRMA 1CKPA 4ASDA 3EH9A 3VIDA 2P3GX 2R3HA 3FMHA 3A7FA 1E1VA 5JQ5A 2WMAA 3SQQA 3PA3A 4L45A 3DBEA 4FIFA 1KV2A 2ITPA 3TKYA 4FK6A 3C4ZA 4I23A 4PDYA 4JQ7A 4NTTA 2UZNA 1UNHA 3U55A 3V8TA 2JKQA 2A0CX 2CGUA 4UEUA 5AP6A 5CVDA 4C62A 3DBCA 2R3MA 5EDPA 2LAVA 4NM3A 5GM2A 4QMXA 5DRTA 3P9CA 1OL6A 3BGIA 1VQ1A 3TOSA 3AT3A 2G01A 2ITVA 1WY7A 2PMLX 5HTCA 2BZJA 3DXQA 1G5SA 5L2SA 3P2KA 4OW8A 4L3JA 5DI1A 2BROA 4BIDA 1OECA 3FXXA 3HCAA 3GT8A 2O2UA 4PWNA 3RIEA 4PY1A 4V05A 4YZMA 3PY3A 4J1RA 4IVCA 4H3BA 5CU2A 2PZRA 4DFLA 1U54B 4G34A 1YWNA 4QQCA 3JPVA 4FK3A 5DXJA 1RI2A 4HG2A 1ZARA 3WARA 4NECA 4WT6A 3VS3A 4IDVA 4YV1A 1PMVA 3TNHA 3ZXZA 2CPKE 1YWVA 3AMAA 3NPCA 3O31A 1R74A 3ANQA 4HCVA 1Q97A 3RINA 5JT2A 4FVQA 5KKRC 4DTKA 2GS7A 4ONAA 4XBRA 4QQTA 2Q0NA 4XG6A 5BVOA 2ONYA 1ZZ2A 2HWPA 2FSTX 5FEEA 4C7TA 4H1JA 4V0GA 2GHMA 4IW0A 4ZLZA 3CCFA 4I5CA 5KCVA 5A3XA 5FUBA 5DRBA 3FYCA 3BGZA 3W10A 2G9XA 2R7BA 3C9WA 5IEVA 1XH5A 4BF2A 5AV4A 4RWLA 4PTCA 3QU0A 4NM0A 4FGZA 3R24A 1KHHA 1NV9A 4AN9A 3SLSA 3NUPA 5FBOA 4I22A 3ENMA 3V5WA 2GA9A 3KK9A 4GMYA 4GVAA 4L43A 3RCDA 4D4VA 4HTFB 5KE0A 1APME 2OBJA 3LKMA 4O96A 2IDJA 3V5QA 2WQEA 3BLQA 4K1BA 5E1EA 3FLZA 4QMYA 4QP8A 1T43A 2GPHA 1M2QA 5K8VA 3UIMA 3K3JA 4YGAA 2W1FA 3M2WA 5FWAA 5DLSA 4IAYA 3NS9A 4D5KA 5FHRA 3Q3BA 3TACA 1OITA 4AXAA 4ERWA 2WZJA 1TKIA 2PU8A 3UIUA 4PGHA 2WK1A 4DGOA 2OZAA 3BEGA 3C4XA 2CGVA 3MGYA 4BDBA 2FK7A 4CKEA 4AUAA 3UPXA 4BCPA 4FTQA 4C36A 1RJEA 4QMOA 3E62A 3UE4A 1JKKA 3F2NA 5D7VA 3D5UA 4ANMA 1YFLA 2WFYA 4YTHA 4F84A 4HCTA 3KULB 3A7IA 3SHEA 5CAPA 2JDOA 4DFBA 5EKUA 4R8RA 3TR6A 3B7PA 1HCLA 1VYWA 4FUYA 3AD4A 3MERA 1PYXA 3P7AA 3E92A 5EI2A 4CD0A 4B17A 3VS7A 3S4QA 2WMXA 2XIKA 4FKVA 2C7QA 2C3KA 3QRIA 5DRYA 3JVRA 3NWBA 1L9KA 3G15A 5CNOA 2I6LA 3B8QA 4IAFA 2YZLA 4RSRA 3ROCA 3G2MA 3R9XB 5L6WL 4F4PA 4O0RA 4G6LA 3QOWA 5LOHA 5ICEA 2JFLA 4AGUA 3FDNA 4AACA 1QL6A 3KVWA 3GJYA 1K2PA 5EW8A 1Z5MA 3PYYA 5EDQA 4RIOA 1G6Q1 3KL8A 3O8PA 4OT5A 3TEIA 3ORLA 1EAMA 4PYIA 4AP7A 4DHFA 2YA9A 5JQ8A 2C6DA 4CMTA 3PFHA 4AZTA 2YWVA 2Y4IC 3LJ0A 2X8IA 5AP5A 2DS1A 4QTCA 2W0JA 4GEKA 4XP3A 1NW6A 5LVNA 4RTPA 3SM3A 4QYEA 4R05A 3BT7A 3R63A 2G15A 5DM0A 1KYWA 2QLQA 3P86A 2FYTA 3UZRA 3LQ8A 4F9WA 2ITQA 2G1TA 5E8RA 2X39A 5HG5A 4I0RA 1ZOGA 2WEIA 4NJDA 4ZOGA 4R6WA 4EBVA 4NW6A 4PYJA 2F57A 4R8SA 3KPUA 3AGMA 2ITWA 4LRJA 5BNJA 3SVZA 3D83A 4W4YA 3RWPA 2R5TA 3LCUA 4ER0A 2CMGA 4RFYA 4E4NA 4FSXA 2ZFUA 5HIBA 1QPJA 3KRWA 4QTAA 4YLLA 3T7TA 3LVPA 3AC8A 4YV0A 3VBTA 1QAMA 1VJYA 4B7TA 3HDMA 2OPBA 3GFEA 3HYHA 3I0QA 2YJSA 3DXZA 3ZBXA 3FYJX 2ZWAA 4IB0A 3ELYA 3KMMA 4LG4A 2P2IA 3BPRA 3LLAA 4OA8A 5K0FA 4HVGA 4GT3A 3L9MA 2ETRA 4KKEA 3DOGA 2XBJA 1YOMA 4LV8A 3C0HA 3EIDA 4P7JA 3BBWA 3PVWA 3GRVA 4B99A 3OY1A 4Y73A 4GG5A 4DITA 2XRUA 4Y5HA 3EVBA 2W1ZA 3EQDA 1RJDA 1JG2A 4ZY5A 4DA5A 3DCVA 3DGKA 2NYUA 5M53A 3ZSIA 3N4UA 3LDFA 4EQUA 3THBA 2OY0A 5CX9A 2F7XE 3R22A 1KWPA 3PZHA 3FLNC 5FM3A 4BB4A 4YZBA 1CM8A 3R3HA 2OIBA 5C1IA 4BIBA 2YIWA 3QQHA 4GCJA 3LMIA 4PCAA 2PWPA 4EOIA 2YIQA 3QA8A 2PT9A 5C8NA 4EZ5A 1K9AA 2HK5A 3SW4A 5B2KA 3VYWA 3BYVA 4FTCA 4DTBA 3KU2A 3QV2A 3W2OA 1PYEA 3ZFXA 4J99A 4WNPA 2Z6QA 4FODA 1UIRA 4CLIA 3ZO4A 3MH0A 4FR0A 4R6XA 3IEIA 3R8PA 4Q2AA 2VGPA 1O9UA 4J8NA 3QTZA 4AFEA 3GU3A 2PY6A 4JRNA 3CC8A 4C4JA 4MF1A 4E6AA 4GFMA 3C0GA 4OBWA 4MEDA 4HCUA 4LQMA 2QOBA 2WMBA 3KFAA 4J7BA 2VD5A 2OH4A 4EYJA 4RA5A 2HCKA 2OW3A 3QLGA 4FKLA 5IQFA 4RYLA 2W9ZB 1NW3A 4BCMA 5DM4A 4C4EA 4QDJA 3NUAA 1ATPE 2XBMA 5CF4A 1SM2A 3V5LA 5KO1A 2PVRA 5HCYA 3ELUA 3EVGA 4R1YA 2CKOA 4FV8A 2JIIA 3KQ7A 1P39A 4P7EA 4I3ZA 4CCBA 3AC3A 5M09A 2OJGA 4ID7A 2C7PA 4J52A 2VTRA 2BZKB 4WA9A 1W8CA 1FINA 1GZKA 4IM3A 3OU7A 4UWCA 3HA6A 5E2AA 4EHVA 1M6EX 5BYYA 4P90A 4B8LA 5HIKA 3KCKA 3VUHA 4F6UA 5JEBA 2PX2A 1W7HA 1XBCA 5E8SA 3ZUTA 1L3CA 3IKAA 3EVFA 4CV8A 2J50A 2E2BA 4A4XA 3V3VA 5CVJA 5BXYA 1ERKA 4RIYA 3KXHA 3OY3A 2JH8A 4RGJA 4PUZA 2NPQA 1NVSA 5E8VA 1FP2A 3HV4A 1UFKA 4EWQA 1WS6A 4XV3A 5HVYA 2ZM1A 2ZAZA 3WE8A 1RJGA 1XCLA 3DFCB 2HIWA 4BTMA 3REPA 2P41A 4F1OA 2UW4A 3LZBA 3B8RA 4X21A 3ZUVA 5KBRA 3HA3A 4DFXE 4MXCA 4GKHA 2C7RA 3K3IA 3SXFA 4YHJA 2A4LA 2ZV9A 2GNGA 4PP7A 4R1VA 4CMUA 3HRFA 4RX7A 3C3YA 4XUCA 4JXFA 3EZVA 1OPLA 1I9GA 3F69A 2YR0A 4M7IA 2QCSA 3KQVA 4MWIA 5GNKA 1JKSA 5B0XA 3KPJA 3A27A 5KS2A 2QM3A 5IA4A 3COMA 3LXKA 2O65A 4F9YA 3ORPA 1H01A 1KR5A 2QOQA 1WVWA 2RFDA 2BRGA 5C4KA 3COKA 2GSFA 3GU5A 5F20A 2YZAA 4MNEB 3KKVA 4I6BA 2JIVA 3FRHA 3ZYAA 3GU4A 4XV2A 5KUPA 4HYSA 4XHKB 2R3KA 4NIFB 1QZZA 3GU6A 2BCJA 3BE2A 2BTSA 3FZTA 5FXQA 1J91A 4QMSA 2E9PA 4ENYA 4TYHA 4BYIA 4C04A 1BL7A 5EZSA 4P5QA 4F6WA 4BI1A 1ND4A 5BVFA 4LM5A 3MFUA 1X1BA 3TWJA 3Q5ZA 1ZYJA 4GBED 5EC8A 1P2AA 2I1MA 4CXMA 2YIXA 2BPMA 2PV0A 4A9SA 2XM9A 3E93A 5E7RA 2QOFA 3G8AA 5AV1A 5IG1A 5LVPA 3SX9A 4K6MA 5CZIA 4MQ4A 5CIYA 3KRJA 5K0GA 4YO4A 5CVVA 2JDSA 3BGDA 3EQGA 5J1WA 2J0IA 3G5TA 2B9JA 3GB2A 3I9FA 3HL7A 3HMNA 4XG3A 4ZTLA 1JTEA 3F3TA 1KP9A 4K2RA 2X6EA 3NCGA 3IK3A 5CQWA 2X4FA 4FNWA 5LQCA 3DMFA 5FM2A 3OFMA 3BGPA 4ZXTA 4CT1A 4IVAA 2NXEA 1RI1A 4CFFA 4FV5A 1ZZLA 2G2FA 4BC6A 3KQOA 3R83A 1WZNA 5HQ0A 5CQUA 2HZIA 3FMDA 5CAOA 4CRSA 3W8QA 5DGZA 5GP1A 1CTPE 4MXXA 3F5UA 4BZOA 2XJ0A 3D7TA 4APPA 4QMQA 2HWOA 1NY3A 1JLUE 1YHWA 5HIJA 4FTJA 5AM7A 2QVSE 3A4PA 4JDJA 2JITA 3JXWA 3LDUA 3EOCA 2R64A 5L2IA 4L52A 3T7RA 4PONA 2C6EA 4PV0A 4E32A 3DBQA 2W4OA 3DS6A 2PVYA 5DTRA 2AOVA 3F88A 3OOGA 2VX3A 5E8JA 4DG3E 5FHQA 5AUXA 3NAXA 4DH8A 1DI8A 3R9HA 2WTWA 3PY1A 1PJZA 4FT0A 2YAKA 4U3YA 2ZLBA 3LL7A 2FUMA 4M0YA 3PT9A 4CG9A 3T8OA 2AUHA 1DUSA 4QMPA 3FUVA 4IHPA 3KVXA 1PXJA 3S1HA 4E33A 4FGBA 3PPKA 1M7NA 3CQWA 4ITHA 4ZY6A 2GU8A 3QZHA 5KYGA 5GJFA 4DTAA 5LCJA 5IZFA 2YEXA 4CV9A 3TLJA 2PE0A 3IPHA 3IGGA 4GOND 3KQTA 4BN1A 3BWJA 4RZWA 2W1GA 3I5UA 2ZB1A 4HPTE 3COHA 2RL5A 4YUYA 10MHA 1J1CA 1UVRA 4GV1A 2H1RA 5EW9A 1M0EA 4IV8A 3OOMA 3BZBA 1UU9A 2ZIFA 3ELDA 2VWZA 3GP0A 3WIKA 3GNLA 4O0VA 2IH2A 1M17A 3MPMA 3GO4A 1Q5KA 3CKKA 1P5EA 3UO6A 3ER8A 3ERKA 4UN0C 4FSRA 4LOOA 2ZZNA 2VX0A 2Z7RA 1XDUA 4Q9ZA 2R3QA 4CNHA 4KIPA 3PPJA 3OU6A 2Z7SA 2OF2A 2X7GA 3F9NA 5CVHA 3UOLA 1XJ5A 2F2UA 3G6HA 3AOXA 4BTJA 4EH7A 4D9TA 3MIAA 5CEPA 5M57A 5J1VA 3FUUA 3KR1A 2WTCA 2PLWA 2WMTA 3CPCA 3DXNA 2YN8A 1KUTA 4S32A 2ORED 4MH7A 3MB7A 4AWIA 4Q9SA 1KE8A 3QWKA 3I58A 5GHVA 4PNKA 3BHVA 2XNGA 4HZRA 4HVHA 3M6VA 5DG5A 5E9QA 4I0SA 3R73A 4O7LA 2ZIGA 3NWWA 5DYJA 1R00A 3MDYA 3POOA 2PUNA 3WF9A 3R1YA 1SZMA 2IBTA 2XNBA 3LFDA 4FC0A 3I5ZA 5FD2A 4FZDB 4D0WA 1H1WA 2W17A 2XK6A 3PB3A 4HH4A 3UIBA 3GEQA 4TPTA 4RVGA 5L6PA 3DBDA 1Q8TA 4I4FA 3IW8A 4FT3A 3QL8A 4S2ZA 4C3FA 4QPAA 1KPIA 3TJDA 3PJ2A 3TFWA 4EOKA 2C5OA 4TYJA 5H8EA 4GYGA 4TNDA 4YJTA 3TKHA 3KRRA 4QMZA 4FS8A 4IVBA 4JDIA 5ETFA 4FZAB 1OBDA 4GYIA 2QOLA 1SVHA 2I7CA 2ESMA 5LQJA 4F70A 5AUVA 3ZSHA 3DKFA 3O23A 3FZOA 4M68A 4OTQA 2ZDUA 3QFVA 4CRLA 2GQGA 3K2LA 3PSBA 3Q87B 3PWYA 3WF6A 3F6XA 5FDPA 1WBWA 2GPYA 4E4LA 4M0ZA 5BUJA 2ADMA 3W16A 2PMNX 4EBWA 3GC7A 4R77A 1BHJA 2VTQA 5FXSA 4RSSA 4XBUA 4IZYA 4DF3A 1WBVA 3WZKA 1U54A 3FPHA 3D7ZA 4ZIMA 4FEXA 3MY0A 4NCTA 5E1BA 2VWIA 4GFOA 4JOAA 1VP3A 3KGAA 4YSMA 4C4IA 3ID6C 3SGCA 2ZVJA 4EUUA 3QD2B 3VS2A 3SX0A 4BLVA 3C13A 2Y1WA 3LPMA 5ANKA 3QOXA 5IQAA 1F0QA 3LQ5A 4DH5A 4IDTA 1YXXA 2AVNA 5CVUA 2HENA 3ELWA 2H00A 2QLUA 3NDMA 3ZLYA 3HUCA 2YFXA 2XK8A 3H30A 3P23A 4BCKA 5DEWA 2XYQA 4M13A 4QQ5A 5ICGA 4F63A 5CLPA 4LV5A 3W8LA 3E8EA 3FSKA 3LFFA 3D15A 4BDJA 4G2FA 4GSBA 1JWHA 1VPTA 3BZ3A 3Q9YA 3TNPC 5CXZA 3FI3A 4RX9A 5AUUA 2YHVA 4ZLOA 3P8ZA 1VIDA 4HTFA 2HELA 4C3PA 3KXXA 4YC6A 3QTXA 3HVCA 3LCDA 3PLSA 4RVMA 5FTOA 4QTUB 4O0TA 4QYHA 5K0JA 4Y30A 3VJNA 2BH2A 2QG7A 1IY9A 3T3UA 1ZRZA 3NSZA 4G9CA 3G5DA 2VWVA 1YI3A 4TYEA 3UDBA 5CANA 5DLYA 5ICCA 4XCXA 5HX6A 1MRUA 4D1ZA 5A14A 4U5JA 3R30A 2JGZA 2R3GA 5G1XA 5C0OE 2J9MA 3DDPA 3ZLXA 1Q24A 3DJ5A 5HI2A 3ZBFA 4FSTA 4RWKA 1D2HA 4PL5A 4V04A 2PZYA 4ANSA 3NIEA 3RK9A 4HW7A 3KY2A 5CT7A 4EQMA 3GCVA 3KR0A 4GOLD 4I93A 5ANJA 3MH3A 3P9IA 1YKRA 3TDWA 4ZMEA 1YZHA 2IW8A 4XEYA 4X2NA 2X1NA 4XCUA 4EWHA 2OKCA 4YSJA 2I62A 2IG7A 3V6RA 4D55A 3QHWA 4ZTNA 4KNBA 1PXNA 4FKTA 3M42A 1PXKA 3FKOA 5EM8A 1DS5A 5BYZA 4BI0A 4F9CA 2OB1A 3FQEA 4IWQA 3EN4A 3DAEA 3EKKA 3IDPA 2ZBPA 2GAFA 2HMYB 1J1BA 2EB2A 2VWUA 5DM2A 4DE4A 3ELJA 5D7AA 4PYOA 1TW2A 3TXOA 1V0PA 2P3LA 3R9OA 2EXCX 3RPOA 2ITUA 5EKNA 5DTMA 3ZONA 2Y8OA 1G3NA 2IPXA 3RVGA 4QYYA 2WU7A 3W18A 5IUHA 5D10A 3EMDA 3U81A 3PXQA 4FIEA 4YLJA 2FSOX 3VS6A 2XK9A 4LL0A 5EG3A 1Y57A 3GRUA 3M1SA 4RVLA 4JVGA 4B6LA 3LCKA 1DAWA 4S34A 3O8TA 2X6DA 4FG9A 4C05A 1NBIA 3DMHA 5DX1A 3FZRA 3QQLA 4ZSGA 4M38A 4XUFA 2I0VA 1HNNA 3ZC6A 3R7EA 2J0LA 3DZOA 4GQBA 5AAGA 2B9FA 4EC9A 2QRVB 1EJ6A 2Y1XA 5CVGA 5A6NA 3TI1A 3QC4A 1PXIA 3VBYA 3BKXA 3Q52A 3H9RA 2QU5A 3V8SA 5AUWA 4FT5A 3EN7A 4IFCA 1SNXA 2R2PA 4IADA 4TKSA 4ZSJA 2JJQA 5K0LA 3VBQA 2QOOA 4QP4A 3VS5A 4AA5A 3LPBA 2EJTA 1FPUA 5AAFA 3VQUA 2W5HA 3PXZA 4E6QA 5EEHA 5DE2A 3FTDA 1O6KA 1XDZA 2VGOA 5EM6A 2YQZA 3D5XA 4GG7A 1FOTA 4RQVA 4W4VA 4NKAA 4G6NA 3UNKA 1UNLA 2W05A 1ZQ9A 5FBNC 3NWEA 5HILA 2FSMX 4PDSA 3VN9A 5TO8A 2AC3A 4F9AA 2GH1A 3D2LA 1H0WA 3KQWA 3CCNA 2REIA 5AP7A 5ERGB 5IMEA 4KBCA 2ETMA 4O0YA 2UW5A 2A27A 2VWWA 3Q4CA 3PJ3A 3RODA 2QE6A 5EPEA 1J7LA 1K3AA 3RZBA 2VO6A 3GCSA 2XJ2A 2BAKA 4F7LA 3EVAA 2ZOQA 4HYHA 1U5QA 5T64A 3EFLA 4WHZA 1QYRA 1ORHA 4EOLA 1Z57A 3KR2A 4PRJA 2XP2A 2VDVE 3DLZA 2CMWA 4KIFA 1QMZA 3EYHA 4E5WA 4EH2A 3HX4A 3NVKI 4IC8A 1X8BA 2CN8A 2V5QA 1Y6AA 5M56A 5AUTA 3FSFA 2ZZKA 2PYWA 3OCBA 3LHDA 4FSMA 3B2WA 3TTJA 1EH4A 2B52A 3UYTA 4N70A 4C4FA 3WZEA 3FQSA 3HECA 3E05A 3OWKA 3BHTA 4E4MA 4FOCA 5D1JA 1ZYDA 4JT3A 2BHEA 2GNHA 3FLQA 2YDIA 4L53A 2VZ6A 1B42A 1E1XA 3MBLA 4C2WA 3E7OA 3NUXA 3SRVB 3OW4A 4FUXA 4M67A 1VEBA 4PQNA 3VHEA 4DGLC 5CI6A 3IECA 4S33A 5AA9A 1L1EA 4CFWA 4F0IA 3DJ7A 2PJDA 4R3PA 2I6GA 4FG8A 2B55A 3F2RA 2WELA 2XYUA 1TVOA 5ANGA 4QOXA 3WZJA 3CGOA 3AC2A 4RLLA 5I9VA 3B2TA 1WVYA 4A6DA 5HE1A 4UX9A 2XVAA 4D4SA 2KULA 4I24A 3AT4A 5CF6A 1YOLA 2VWXA 3OTUA 3R1NA 3ZFYA 4IB1A 5JGAA 3HCFA 2R3RA 3BWFA 2R3IA 3KMWA 5JFSA 4UYNA 2Y6MA 4LUDA 2QG5A 2ZV8A 4GU6A 3PSDA 2XUUA 3TZ9A 2ZW9A 4D1XA 5ACBC 3NW9A
chains in the Genus database with same CATH superfamily
3L7YA 5B7PA 1WSBA 1PJBA 3DBLA 3ZI4A 2BGKA 4NH1A 3LRTA 2BEVA 3BYSA 3TH5A 3UP7A 3K2QA 4CCSA 4YP7A 4LMBA 3W7BA 3EY9A 3W4JA 3ZLVA 2E48A 2IP1A 1Y6BA 3FZYA 2NADA 4DTIA 1AC5A 3BDVA 2FGIA 3PLAE 2X9EA 5JHHB 1GSOA 3SYMA 3SZOA 1V4VA 1DPGA 3PQDA 1KOAA 4MV4A 4X84A 4H6WA 1LK5A 4JMQA 2JG3A 2C2OA 1A71A 1N8KA 2I4LA 3A61A 5CCBA 3CIKA 4CU5A 2Q8NA 1ZSNA 5F2EA 1TJ5A 2H7XA 1JLLB 3HJRA 5BORA 4CLEA 2ZJOA 2N0SA 3P9XA 5E6UB 2DT5A 1PT5A 4EPRA 2A4KA 4MA5A 4PTLA 1ZK4A 4MS1B 4RZ3A 4E1AA 3E4CA 4DYDA 3DZDA 4GECA 4FKJA 5ANRB 3HTXA 5M4IA 5AVUA 3NM6B 3ESRA 2WKSA 1L5KA 4QHSA 4GM4A 2ZJWA 1RE1A 3G17A 4M69B 1XBTA 3WDKA 4F8YA 2ZI9A 2Z9DA 4U7ZA 1HTBA 1XTSA 2WPDD 2N47A 3DLTA 4KQ9A 3R7IA 3F2IA 5DMHA 1MFZA 5ULLA 3OTWA 3ZDAA 1PYDA 3CSDA 2H48A 3H8JA 4WRGA 4JQSA 4K8RB 1Q6YA 4U6NA 1AGYA 3LMHA 1U31A 1PDWA 3BGOS 4YRFA 2IBMA 2IVTA 1IJFA 2OWEA 5TB5A 4EIWA 1QIDA 3FGPA 5GVSA 1CKJA 4A9AA 4PN3A 4UUAA 4W5JA 4XWWA 1SELA 3DBOB 3U7RA 4CTCA 3RAWA 1E2HA 3WNVA 1KFJB 3EEBA 5ERXA 3E8MA 5I51A 1XZFA 2FPIB 1LSSA 4YV2A 4FNAA 2XQJA 2PPQA 3WI6A 1MJ5A 1FDVA 1K7YA 2NVBA 1S01A 2V5AA 1KFEB 4EUTA 3EG9B 3I01A 2J6MA 3NV9A 4ZS4A 9ATCA 1E0AA 4KR0A 3H42B 3DMDA 4OHFA 5KIAA 4GFGA 1DX6A 3P52A 1ZU4A 3O7MA 2C5GA 5LB4A 2CHLA 4BNMA 4CMGA 4UNNA 4IZIA 1T0UA 4OSPA 1OUYA 3D5WA 3QOFA 2G76A 4PE5B 2P33A 4B09A 3PC8A 2ON6A 1A9PA 3R5HA 3EZ9A 3EFEA 2HD4A 1E9DA 1BOOA 4W5RA 3AVPA 3G88A 4Y6PA 2QGZA 2YWCA 2VWPA 4M89A 1OHHD 5DA3A 2PMEA 5GPBA 4PVCA 2C2KA 3ZLSA 4Q9HA 1Q0TA 3TUDA 1WMKA 2JKMA 1TUIA 2HMUA 4AN4A 2PUVA 3U4IA 1OLXB 4O7WA 2FFAA 2GVZC 3VMMA 2CL7X 1C8LA 1RXWA 1JKIA 1LSOA 2FMFA 3UG7A 2VSQA 1Z7WA 3C70A 2CJFA 4IR7A 3SLGA 3CZ4A 4WOVA 1NVMB 4REQA 4V03A 2B61A 5KUTA 4PR0A 3PRHA 4NZPA 2H06A 3HZRA 1VLMA 1QYVA 5CNKA 4L5IA 1E4VA 3OOWA 1W75A 2XX3A 3KX2A 2F1OA 1I3MA 2JATA 1ODIA 5BW6B 1U0OC 3E0QA 1QKKA 5FUTA 1T8PA 2YW9A 3VX3A 3FTEA 3ZIUA 4IIJB 3NT4A 2BTEA 3C48A 2A0FA 3AB7A 2F2CB 1Z13A 5CFMA 3QKRA 2VRNA 2JDTA 4D99A 3UIXA 2OJJA 3PNMA 1DT5A 4BAGA 4DM3A 3PHGA 4PL3A 1X2EA 5F5LA 4DWOA 2B9IA 5FAKA 2M9MA 4H7EA 3MIZA 3TZBA 5EJ8A 2HR1A 2AFIE 3SZMA 1FVXA 1Y37A 2NW6A 1C3LA 1FNNA 4XYFA 1Y8ZA 2VF2A 1E1NA 1M2WA 3L6OO 4NICA 2YWBA 3RMFA 4DBZA 3ZZNA 5I9IA 2J9YB 5HJEA 2CKMA 1VKNA 3UP2A 4FV2A 3QE0A 1GLGA 4BNKA 4O21A 4F1MA 3HWSA 3A7GA 4OQNA 1IHDA 3TSCA 5HTKA 4YRQA 2FZWA 1GCAA 1DC3A 1ZI9A 4ZO8A 4A8JA 1S2MA 3DXYA 4PC1A 4HAYA 3K9WA 4JB2A 2MSCB 1P7ZA 2JJ2A 1RAIA 2X42A 3OQIB 1GL9B 3F4LA 2OO8X 3PUXA 2IIBA 3V97A 1U7TA 3C6MA 5DHSA 3WLLA 2PRYA 5IZCA 3K4PA 4DLAA 4U8GA 4WCFC 2PE1A 4P80A 1TT7A 3VU8A 5I7AA 2CE7A 5GZ3A 3UWMA 5IX8A 2QRZA 4CQJA 1NW8A 3I83A 4CF6A 5CDGA 1UQUA 1XKKA 1XDDA 2W1CA 4HNRA 4JI1B 3AHFA 5INTA 1U7UA 2XRYA 2VF7A 4HGSA 3O5AA 4UZSA 2R00A 2P62A 1CQXA 2F55A 3FXZA 5DSZA 4CF5A 3RQIA 3C6XA 1KDOA 3GVXA 3ZZWA 2C3LA 3SEFA 1AKRA 2Q5HA 3TK1A 1PS0A 4NZMA 4P4GA 3L8EA 4BNJA 4RVTA 1Q61A 3U62A 4F72A 3OX2A 4ZZNA 1RJWA 5B30A 3QUCA 4HJXA 4JP8A 3RU9A 2PVCA 3WK6A 5EE0A 3VR4D 3GRYA 3AGPA 3G2LA 4L8FA 3NNWA 4RSGA 4CEHB 4L42A 4QNAA 2OLEA 1UQRA 3GNQA 3B9RA 3I37X 4ACMA 1MAWA 2R7NA 4JEMA 1KL7A 2HWYA 2WFZA 1TCBA 3I04A 3LX5A 1ZY4A 3THSA 1W83A 4ZGWA 3CG0A 3ZQKA 2D62A 1S3FA 2V5VA 1YW2A 1E2LA 1YJXA 3T1VA 1KE5A 1UWVA 4U4AA 3TOCA 4Q7LA 4HQKA 5TQ2B 5DCUA 3N8DA 4L78A 3QKSA 4FYOA 1N2GA 2WAJA 4X63A 3KT8A 2YDKA 1MEEA 3DHNA 4C0XA 3LFEA 3ZXYA 3OA0A 4GQAA 4KK3A 3RKRA 3JAMA 3VPFA 2J5RA 4YQYA 3QQPA 4A27A 1M0TA 4KUJA 2VVTA 3KQSA 3WRXA 2Q1SA 2QOEA 3DMYA 1KTIA 3QENA 4I5HA 2OUIA 4AZFA 4RHCA 5AVYA 2AMJA 4EHJA 5A9SB 3H19A 1Z28A 4M0CA 4E4TA 2B21A 3H3FA 1WX1A 3WGLA 3L93A 4XQ9A 2C4MA 1JW9B 3G5LA 4HDSB 3NIWA 2CC2A 3HDYA 4NU0A 1W48A 4QMMA 4EX6A 1ST0A 5FPPA 4PRLA 4G09A 1N8SA 1R0KA 5CM2Z 1IZ7A 2GRUA 1YBFA 1UJ4A 2DKNA 3PQ8A 3IQWA 1JFFA 1W4CA 1OB3A 2PZGA 3GAMA 5K0TA 2PQ6A 2Q5JA 4Q15A 3VGJA 3WK5A 1JX6A 5AI5A 3MG9A 4DSTA 3BFXA 4DJDC 1IA8A 4KEAA 2XMSA 2P1RA 3HCPA 2J51A 1KOBA 4ACAA 3VR2D 4B3RB 3HHPA 4F3KA 1HOXA 1I10A 1KIAA 1OROA 5BSTA 1ZOLA 5DLPA 4B75A 1VKRA 1T5DX 3D6UA 3ZJVA 4P84A 3QRJA 2X9QA 3SCZA 1QK4A 2GN1A 3FZ1A 5F7XA 2Y9PB 1CS0A 5LP1A 4C3RA 4ZVVA 2HAEA 3AU8A 3ZRKA 1BVYF 3QE9Y 2WFLA 3MSCA 1GZ8A 2X4ZA 4GLFA 4O2BA 4JRVA 3DFMA 5KYVA 3MFSA 5AW1A 2RK3A 2Q8QA 2RGCA 4M9UA 1AX9A 4N4AA 1SR8A 2X6RA 3FYKX 3RSOA 1PJLA 3AOGA 3S1LA 5JMWA 1ZJZA 2NVWA 1N2OA 5LB2A 4BLUA 2UYCA 4LJ4A 4RDCA 3RVNA 4IX3A 2HRQA 1BMFD 3U3DA 1D2RA 4G0NA 4YNEA 4IG9A 3JASA 4R68A 4TRLA 4HC4A 2W2PA 5B5SA 3LPAA 4EMBA 5GM1A 1R0PA 2P4IA 2JD5A 3X1YA 2FPGB 5A4JA 1ESZA 1V4BA 5C9CA 2VTDA 3O4GA 1BQ3A 2V7BA 2QURA 3CEKA 4MI3A 2DCMA 3X2FA 3T9FA 5JPDA 4KNYA 4FEEA 1XTJA 4EK3A 1PL8A 5C03A 5CK5A 4XJVA 4BKQA 3VRHA 3PXKA 3O96A 1Z6TA 3CVYA 4W8EA 4YNBA 1O97C 2Q3DA 5AIKA 1ZMRA 5HF6A 3WFZA 2C1AA 2XB7A 1PR6A 2Q83A 3UAXA 1GNQA 3MS9A 4B1FA 3TTIA 3WMFA 2VDLB 5AW5A 2W0SA 5CH3A 3VMFA 3U44A 5AKEA 1QVRA 3EGVA 3AVOA 2YVQA 2WIPA 4R3WA 4XIGS 2ATEA 1WVXA 1M34A 2EVAA 4KRXA 2V4UA 3D8SA 5B12A 2W00A 4CKZA 2XK7A 1CQIB 1C9YA 4AY2A 3VRYA 2VNJA 3BRWD 4C5BA 1OI2A 4LCJA 2QN1A 1NJ8A 2JIMA 4HB4A 4KD1A 2OK8A 1KH3A 4IGFA 3P4YA 5IPFA 1PJ8A 3WISA 4QJ4A 4IDHA 4B6EA 1UBNA 1C7FA 3IULA 4NCBA 5LIRA 1QX4A 2PS3A 2WTXA 1I0IA 4O2AB 1Z4JA 4JDPA 2UUBB 5A03A 3NHAA 4S1TA 5SZIA 4FA2A 3IW5A 4YRGA 3KJXA 4LE1A 1MC8A 3JTMA 1K08A 1G16A 1ECBA 2XWSA 4P4UA 1BVRA 3RYIA 5FADA 4KO4S 4K9PA 1RQ7A 4V0OA 2FH9A 1FRNA 2IE0A 4TYGA 1GRCA 3MJ4A 2QA5A 4BZZA 3ALOA 1GL6A 3VO8A 3ETAA 3C7AA 3QYFA 1V47A 2HGSA 2JGMA 1HDEA 2HOGA 3R0TA 1B3BA 1GCUA 4INZA 4EHFA 2Q3MA 3V8RA 3BYUA 3DQWA 3L6DA 1E7MA 2IWRA 4Y1RB 4RK7A 4XYLA 3IE0A 3T7EA 4OHOA 4R7TA 4FD3A 3M6MD 3VS0A 2KE5A 2J90A 2XCOA 4OUCA 1YS7A 2BM0A 1ZFNA 4LWOA 3WE7A 2PKXA 3A6FA 2C3OA 3CTQA 1YK1A 3RFVA 2YS7A 2HU8A 4Z4FA 2PX5A 1GTRA 3A1TA 1VL1A 3FJQE 4UAUA 3HCBA 3OIGA 2RHCA 4X3FC 3IERA 3HVIA 2OO7A 4OA5A 2DQYA 4WESA 1I4DD 3W1EA 5FLYA 3G68A 3P4UA 1VE9A 4AQCA 1XD8A 5DJ5A 1JUDA 4YRJA 3VVHA 2G77B 2C03A 2YM4A 4FK8A 2VJKA 1IN1A 2V55A 1NDHA 4TXLA 1BE8A 2VQDA 3IR5A 1XQ1A 3BQRA 4IZ6A 2JDVA 3QBJA 1P2FA 2GEJA 2XPCA 4MVXA 3O8LA 1WPGA 1PLKA 3L8HA 3F6BX 1NSTA 4I0WB 2R85A 3BEAA 4MUEA 4H7DA 4KUGA 2PVLA 2G1AA 5EYPA 3IQFA 1FGIA 3EZYA 4FUTA 2BP7B 2R0IA 2JIZD 2GM5A 2ZVAA 3CW8X 3M6AA 4W1SA 4BU1A 4PDOA 2AHOA 5H4HA 4F2HA 2PEYA 2HPVA 2XGGA 1O8BA 2P5SA 3RC8A 4GPBA 1QG6A 3RVLA 3H0KA 3IT0A 3OROA 3QITA 3R76A 5AM2A 2VH2A 2BRHA 4EDHA 1HGXA 4MXOA 4A6EA 4W7SA 2YW2A 4HUQB 1KRWA 3OMLA 4ZTRA 4IKPA 1YFZA 3I4CA 2ZE5A 2NXWA 5DM1A 5GQSA 3ICCA 3IRUA 2IEGA 3GFFA 3HRKA 3T3EA 1VLJA 4G9BA 2JD0A 2O2ZA 2V4ZA 2IVUA 3H2HA 1JIIA 5D3ZA 2XWJI 2Y6UA 3AC5A 1ACJA 2XMBA 1FYWA 1DBIA 4ZAFA 4A8TA 1I01A 2B54A 4AJOA 3HKOA 4EHEA 2EFCB 2AUMA 4MYSA 1DG9A 5T4BA 3VH4A 3V3TA 4MQEA 4B33A 3SKXA 4NLLA 1EIZA 1BE0A 1UXGA 3LBYA 4EG6A 3I2IA 3JQFA 1FTSA 4G17A 1ZXBA 4QMNA 3NUYA 3BS4A 1CKEA 4U97A 1DIOB 1RLJA 1NBME 4F85A 4K03A 2JLVA 1E3JA 2C6IA 3TOVA 3ER6A 5AA8A 4ZZIA 2H29A 2AMFA 3TW0A 3HM2A 4JBLA 5BR4A 3C3JA 1XIVA 2B1IA 3SRVA 2MSEB 2VXCA 4FE4A 3QTBA 5FF9A 4JDHA 4L3WA 1EVQA 1UV5A 3FLWA 4EKEA 2H3EA 3JAWB 1XJDA 1DKOA 4WD5A 3DAGA 3CS9A 3LHFA 1P7YA 1WB5A 1FSFA 4DREA 3K09C 4TPKA 5JV5A 2IX3A 2I80A 1HL3A 4DIOA 2MOKA 2ZRNA 1A4UA 3QVUA 2I2DA 4C0AC 5EHGA 2A67A 4A9RA 3OJEA 2JAMA 3FUXA 5DNUA 4DT8A 4BPBA 1H1TA 1SBNE 1UJ6A 4EOJA 4RC3A 2QUZA 5LWNA 1AG9A 3DYVA 3QKKA 1W8DA 4GE3A 4L3PA