3TDWA

The gdp complex of the aminoglycoside 2'-phosphotransfere-iiia f108l mutant
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
302
structure length
302
Chain Sequence
NKLHYTTMIMTQFPDISIQSVESLGEGFRNYAILVNGDWVFRFPKSQQGADELNKEIQLLPLLVGCVKVNIPQYVYIGKRSDGNPFVGYRKVQGQILGEDGMAVLPDDAKDRLALQLAEFMNELSAFPVETAISAGVPVTNLKNKILLLSEAVEDQVFPLLDESLRDYLTLRFQSYMTHPVYTRYTPRLIHGDLSPDHFLTNLNSRQTPLTGIIDFGDAAISDPDYDYVYLLEDCGELFTRQVMAYRGEVDLDTHIRKVSLFVTFDQVSYLLEGLRARDQDWISEGLELLEEDKANNFGANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Gentamicin resistance protein
publication title Aminoglycoside 2''-Phosphotransferase IIIa (APH(2'')-IIIa) Prefers GTP over ATP: STRUCTURAL TEMPLATES FOR NUCLEOTIDE RECOGNITION IN THE BACTERIAL AMINOGLYCOSIDE-2'' KINASES.
pubmed doi rcsb
source organism Enterococcus gallinarum
total genus 104
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tdwA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3tdwA02
3TZ8A 3DKCA 1J7LA 1VR2A 1VYZA 2JDSA 3H9OA 3C1XA 4YLKA 1H0VA 2B0QA 2BR1A 4FEXA 4IZ7A 4ALUA 1XBAA 4R77A 3PTGA 1U4DA 2BDWA 1WCCA 4N70A 4NIFB 5E4HA 4Z9LA 3UZTA 1ERKA 5M51A 1YOMA 2WKMA 4C62A 4FV4A 4EHGA 4GKHA 3EHAA 4I21A 3RHXA 2XJ0A 1H27A 1UVRA 3FI8A 2ITWA 4WA9A 2OFUA 4MWIA 2GNLA 2QONA 3TV4A 3CR0A 4ZY5A 3BPRA 5ANKA 5IZFA 2QLQA 2OJGA 5BX0A 4RWKA 2PTKA 4AZTA 1NVQA 3KULB 2QODA 3E93A 4BBMA 2JC6A 2ACXA 3DNDA 3NYVA 2PVJA 4RJ7A 2F7EE 4RZWA 2O65A 4YJPA 4F70A 5DLSA 4L3PA 4RLLA 3ALOA 4NM5A 3ZRKA 4I5CA 1YXVA 5LWMA 4D4YA 4ZS0A 4HGEA 2QOOA 5EKOA 4ZTSA 5FBOA 2Y0AA 3FKLA 1OECA 4IX5A 5HIEA 4ACDA 4AN9A 3OXZA 4IB3A 2RIOA 3NW5A 3LMIA 4R7IA 4WOVA 2IVSA 3EN4A 4GIHA 4K2RA 4RQKA 1G3NA 1XHAA 3ORZA 4CTBA 1M17A 2IWIA 3UE4A 4IZYA 3QC9A 4KB8A 5LMBA 4O7SA 4W4YA 5EHYA 2C3IB 4GT5A 4RT7A 2O2UA 4KKHA 3DTCA 4CFMA 2B9IA 2UZWE 2JBPA 4FTJA 1KWPA 4IB0A 3NUAA 5EW3A 2YJSA 2WD1A 4O0TA 4AGDA 2DUVA 4V05A 3UBDA 1Z9XA 3P7CA 3PIZA 3U9NA 4ANMA 5KMNA 5HNIX 4CZUA 4IFCA 4BDKA 3DB8A 2BRHA 4CLJA 2FH9A 4P2KA 1X8BA 3LXNA 4OTRA 1H1QA 5HLPA 1Q41A 1H0WA 2XNBA 5DT4A 2YDJA 3CJGA 5M56A 3GCQA 4I6QA 4JBPA 4K9YA 2AC5A 4U7ZA 2HK5A 5AA9A 5I9WA 3L1SA 3BLHA 2X8IA 3DBEA 3SQQA 4FIGA 2PSQA 3ZLWA 3KCFA 3MV5A 3EL7A 3KULA 3TTIA 4RJ4A 2XBJA 5HO7A 3PVWA 3OWLA 2OKRA 2QOLA 3TNQB 3UIMA 3LCTA 3CPBA 2HZ0A 3BBTB 3OT8A 3QQLA 4D2SA 2VTPA 3VBTA 4F9BA 5C8KA 3EH9A 3FLNC 3IKAA 4KBAA 5DPVA 2V5QA 4E73A 4XV1A 1U59A 2H34A 4ZIMA 5AP7A 4QT1A 5L2SA 1Y8GA 3U55A 4F4PA 3Q4TA 2IW9A 1Z57A 4FV8A 3AXWA 1OL7A 3MW1A 3RM7A 4BI1A 3H4JA 3PJ8A 1W7HA 5CANA 5F94A 1QL6A 2EXMA 3VF9A 4B6LA 4B9DA 4YUQA 2WQNA 3REPA 3QAME 3MFRA 3JR1A 4M0ZA 2EU9A 4OTGA 2F4JA 4U0IA 3EFJA 5B2KA 3IG7A 4HVDA 4YLJA 2CGUA 4USFA 1LEWA 2XF0A 3N9XA 4IACA 4QP2A 5CU4A 5A9UA 5CEOA 3FC1X 3MBLA 2NRYA 1GIIA 3PIYA 3R83A 5HX8A 4YZMA 3DLSA 3OCBA 1P2AA 3LJ1A 3NZ0A 3TI1A 2J0JA 2R0UA 3ATTA 4X2GA 1PXIA 3MPTA 5F4NA 4WIHA 3U87A 5IH4A 1UU8A 5HI2A 3IW6A 1NVSA 4E4XA 4IE9A 5CYIA 2CMWA 2YISA 3FQSA 4OTWA 3DPKA 2ZV7A 3GU5A 3UOHA 4DCAA 4DH3A 1WBOA 3TIYA 5HG7A 3VRYA 2VO3A 3OFMA 3LW0A 4I6BA 1UU9A 4HYHA 4FZDB 1XO2B 3QCYA 4CG8A 3Q52A 3LXLA 2X4FA 3AC4A 3D83A 1K9AA 4DEDA 4Y5QA 4TT7A 4EOIA 3P7BA 4IVCA 3W0SA 4I22A 3BU6A 4QTEA 3IDCA 3LMHA 3VUMA 3OP5A 5JT2A 5I5ZA 1PXLA 4EYJA 1WBTA 1H25A 2GU8A 1I09A 4XV3A 4QTBA 5D7VA 3WYXA 4EK4A 4YJVA 3A7FA 2NRUA 1OIRA 3IK3A 4W8DA 3GUBA 4WO5A 1ZOHA 1XR1A 3RK9A 3HMPA 4KS7A 3RAHA 2C5XA 3SKCA 4M12A 4QYGA 3VS0A 4CNHA 5A4LA 3TUCA 1FBNA 1ZYDA 2YZLA 2DQ7X 3EKKA 3NIEA 5D10A 4E8AA 3CCNA 4D5HA 5KCVA 1W82A 2YM5A 2QLUA 4FV9A 4D4SA 5L8LA 4CZTA 4FT9A 5J1VA 4JDIA 4DFYA 4G6NA 4NYEA 3U6IA 5EW8A 4BCJA 2BCJA 1CKPA 1YWVA 5FEEA 4XBRA 3B8QA 2ZDTA 1K2PA 4O7YA 4IADA 5KNJA 3IOKA 3KXHA 4TWPA 3MB6A 1FQ1B 5HE3A 1JKSA 2JITA 4A4XA 3ALNA 4MH7A 1BUHA 4EK5A 5T3QA 2PULA 3JYAA 4LOOA 2HW7A 4TTHB 4KNBA 5E8WA 4RA5A 5AP3A 4E93A 4TKSA 1M52A 3PPKA 3FMLA 4UWBA 4WT6A 4DGGA 1R1WA 2ZM1A 1KOAA 3D15A 4YJUA 2JGZA 3PVBA 3D2IA 4O0XA 5EHOA 4EKKA 3W33A 5LXMA 5M09A 4QP3A 4UWCA 2R64A 4J99A 3R8MA 1XH5A 4XG7A 3LM0A 3V3VA 4EHZA 3G90X 3DBQA 4PL4A 4F09A 3R22A 5FLFA 2XZSA 5M4CA 2OXXA 4P7EA 2WMTA 4RG0A 3WILA 1KE6A 5FTOA 4GU9A 1UV5A 4FG9A 1YXXA 3TKUA 2P0CA 2WMSA 4JLCA 4ZTHA 1WBWA 4FSQA 3S1HA 1B6CB 1QPDA 2OH0E 3W18A 3SA0A 2YIXA 5L8JA 3FLYA 3UTOA 2PVRA 2P33A 3MPAA 4LGHA 3G15A 5KKRC 2Z7RA 2CCHA 3P7AA 3V5QA 3NMUF 4NCTC 5F95A 3UVPA 4PMMA 4ALVA 4C4HA 4MQ1A 4PL5A 3NAYA 2ITUA 2QHNA 2W1DA 3P79A 4MXAA 3AT3A 5KO1A 1JWHA 4NT4A 2WNTA 5M55A 2R4BA 5DGZA 4ZSAA 2JDRA 3MWUA 2GHLA 3ZHPC 4H1MA 4BDJA 4TWCA 2OXDA 3R7EA 2BFXA 3H30A 4ZXTA 3RAIA 2YDIA 1KUTA 3DK6A 5ACBC 3MY0A 5AP5A 5EKNA 5AADA 2CGXA 3N4UA 2UVXA 1OZ1A 5CVFA 1OBGA 4DAWA 4R3PA 5D41A 4H58A 4IFGA 3E87A 5IQBA 4C36A 4RSSA 3A7JA 3VUIA 3EYHA 4DF3A 3O2MA 2W7XA 4X21A 4PMPA 5KX8A 1GJOA 3FUPA 5AP2A 2QOIA 4UZDA 3PY0A 3F88A 4FKVA 1H26A 5DR2A 4JBVA 1L3RE 2PUIA 4FSZA 4W4VA 5BQ0A 4J8MA 5AP6A 4ZEGA 2F9GA 3R8ZA 5HBHA 3O8UA 3AC1A 1OUKA 3GT8A 3EIDA 2O5KA 1Q8WA 3U6JA 3TT0A 3EOCA 3NUXA 3QQKA 4RWLA 2R3FA 3OTUA 1R0PA 3LKMA 2CN8A 4ERKA 3PFQA 1WVWA 5CF6A 4LL5A 3BIZA 3NUPA 3HP5A 3Q9YA 4IM0A 3LXKA 5EI2A 3RPRA 2QKWB 4EBVA 3TYKA 4FKGA 2XMYA 5FGKA 3A4PA 3N4VA 2UW9A 2OICA 4K6ZA 3BYMA 2J0KA 2UZEA 4FKUA 1M2RA 2QHMA 4X2FA 1ZMUA 5ANOA 4O83A 4E7WA 5CAOA 4TY1A 4DA5A 3VN9A 2FSLX 3D5WA 2YA9A 4FTLA 3CY2A 1Q3WA 4TN6A 3VBVA 4YTCA 2ETMA 2OWBA 4ASDA 4KBKA 2Q0BA 3OF0A 4EC9A 4UN0C 4J97A 1DAWA 5FEQA 2VGOA 2VTSA 3ORLA 1YXUA 4WUNA 4QP8A 2X9EA 3AC3A 3OW4A 3B8RA 3WZJA 1G5SA 4ZTRA 3S3IA 4B7TA 2OGVA 2HWOA 1REJA 3R71A 2VTJA 3QA0A 1JOWB 1XKKA 4O7OA 3WZUA 3E7OA 3NUYA 5AUVA 4LRJA 5LMKC 4N4SA 4RIOA 3NR9A 4NM0A 3I0QA 4U44A 4XG8A 4E6AA 4M0YA 4A9YA 4Y72A 2QG7A 4XX9A 4YR8A 3UOKA 1PW2A 4E5AX 4FSNA 4MD9E 1ZY4A 5C27A 4RJ6A 1VYWA 5GJDA 1ZRZA 4ZSEA 4IH8A 3P5KA 5HICA 4E6CA 4UV0A 4GFOA 4LG4A 4EQMA 3LFBA 3MTFA 3IW4A 4YZCA 4AXAA 1FMKA 4C3PA 1PXMA 2G1TA 4M97A 4APCA 2E9UA 2HIWA 4HNIA 3AT2A 4A4OA 2JAVA 5CQUA 4IJ9A 3NCGA 2GQSA 3HNGA 2R3NA 4I5MA 4JRNA 4XV2A 3VS1A 2QOHA 3VC4A 2HW6A 3CPCA 3K5UA 4FIHA 4RIXB 4BBEA 4KRDA 2OXYA 4F9YA 5HD4A 3GOPA 2B9HA 3Q2JA 1STCE 3VO3A 2W17A 2WU7A 5CWZA 1IG1A 3D0EA 5CY3A 2UZOA 4UYAA 3R7OA 2O3PA 5CAQA 3NW6A 4WRGA 4Y8DA 2QC6A 2PYWA 3DAJA 3GCPA 3GCSA 1LEZA 1BX6A 4FZ6A 5AX9A 5IDPA 2VTHA 4RX8A 4G3DA 4XNEA 3S0OA 4J8NA 4YU2A 2O64A 4JAIA 3F7ZA 4QNAA 2YM4A 3QTWA 4JJRA 3F2NA 2HAKA 4D4RA 4CGAA 3PDTA 3PPJA 3MVMA 3G33A 3A61A 4L3JA 4LMNA 3AGMA 4R5SA 5DVRA 2HELA 3SAYA 3OBGA 3PRIA 5IH5A 5A14A 4FOCA 3V5JA 3EQDA 3MH1A 4FK6A 4ACCA 5CNNA 4F9CA 2B53A 2YIWA 3NCZA 2Z02A 3HYHA 2OIDA 4FKWA 3T3UA 3RP9A 4DFLA 5HLNA 3TNIA 4BCHA 2WO6A 4S30A 1JBPE 3C4CA 2E9PA 2GNIA 2VO7A 2Y4PA 3D5VA 5H2UA 4C35A 3PA5A 3JVRA 3WZEA 4WKQA 1Q8TA 2RG5A 4Y95A 3BRBA 4RMZA 1Y91A 4ZLYA 1MQ4A 2G2FA 4RLKA 3Q32A 4BDFA 3I5ZA 4DT9A 4WZYA 3NUNA 3FZRA 4F7NA 3DU8A 3DKFA 4AW2A 2GCDA 2PZYA 3EN9A 5IEYA 5C1QB 1S9IA 3DK3A 1NXKA 3BV2A 4AW1A 4CMOA 2WQEA 3DTWA 5JMSA 4I1ZA 4YTFA 3E3BX 4FICA 2UW8A 4BBFA 2GTMA 3DS6A 3QTIA 5DEYA 3R9RA 2CKEA 2B1PA 4GKIA 3UGCA 2JDOA 1OIUA 2OG8A 5CS6A 3JS2A 3OC1A 4K11A 4ACHA 4GMYA 4MD8E 3TDWA 4AW0A 1U54B 1PRYA 4FEWA 4U9AA 5DE2A 5TOZA 2EWAA 4B8MA 3AG9A 2WTKC 2VV9A 2YIRA 4MYGA 3QA8A 4DH7A 4Y46A 4FKIA 4BYIA 3KREA 4DG2E 4BTJA 3PXFA 4FK3A 3QD3A 3BELA 5BVDA 2X4ZA 4GJ2A 2ZYBA 4KIPA 3OVVA 4I0TA 4R6VA 2I0HA 3PWYA 3QRJA 4GW8A 1CTPE 3HV3A 4XG2A 4FYNA 2EVAA 4HCUA 2XK3A 3QC4A 3LFEA 4QMXA 1SZMA 1YDSE 5BVFA 3BE2A 2W05A 5CU3A 2BIYA 3I0OA 3CP9A 2BHHA 4RQVA 1TKIA 4I93A 4EK3A 3IGGA 2WEVA 3FKOA 4G1WA 1J91A 2XP2A 3P9JA 5CVHA 4IW0A 2JBOA 4DGMA 5IA2A 3FI4A 4WG3A 2C5VA 3LQ5A 2ITYA 2ZB0A 4IVDA 3SOCA 3LFSA 4MNFA 4EH7A 3QQGA 4MWHA 5HLWA 3AD6A 3R02A 2VX0A 1G8SA 4PTCA 5KMIA 2XK8A 3ZEWA 1SVHA 2XEZA 1YI4A 3QBNA 3KC3A 4CFWA 4WNKA 3ANQA 4FEQA 3HVCA 5EH0A 5IF1A 4AUAA 4O7RA 1OVEA 1ZMVA 4JG6A 4OT6A 3FXZA 4QP1A 2CSNA 4GK3A 2QR7A 3ZMMA 4QQJA 4IX4A 4E4NA 5LWNA 3C13A 2XKCA 3DV3A 3PZHA 3SV0A 4QP6A 1J1BA 4L45A 5DEWA 3F5XA 3LCOA 3GQLA 3I81A 1OKVA 4ZSLA 4IWDA 4Y73A 3MI9A 4DT8A 4FT0A 4AOIA 4BF2A 4NUSA 2C6DA 3HP2A 2C4GA 1U54A 3HX4A 4GS6A 3OEZA 4LQMA 4XJ0A 3GEQA 2PE1A 3AD4A 4AS0A 2F7XE 3R63A 4DEEA 2W4KA 4YLLA 3KXXA 1NY3A 4X6QC 2WMUA 3TIZA 2ZV2A 4E26A 4FIFA 4BCNA 4KKGA 4GIIA 3BYOA 1OL6A 3G9NA 3EWHA 3QTUA 1UWHA 4IDVA 1YVJA 1KOBA 3OEFX 4V0GB 2R3JA 4CQEA 1HOWA 3MJ1A 2X0GA 4ZAUA 4BDEA 5I0BA 1KE7A 4X2JA 3FPQA 4USEA 2CHLA 3DZQA 4JBOA 3HGKA 4GCJA 2JKQA 4E5BA 5LVOA 4FNXA 4NFMA 2BFYA 1YOLA 2GQRA 4Y5HA 4C33A 3QLFA 2IJMA 3PY3A 1FPUA 4XLIA 3GNIB 4C4FA 3GFEA 3ZU7A 2YCFA 4G5PA 3F3ZA 4EORA 5BNJA 3R0TA 4A9TA 1Q8ZA 3DBFA 4FT5A 5IQAA 3GVUA 4C3FA 4LGGA 4AGUA 3VUGA 4XUFA 3QWJA 3O50A 3IECA 4QTCA 5HE2A 3JY0A 3ZTXA 4ZK5A 3SRVB 2C1BA 3NUSA 3KVWA 4RIWB 2WQOA 4JAJA 5CF5A 3TUBA 5E1SA 3TCPA 5CZIA 5CT7A 2WTWA 4GT4A 4KRCA 2VTIA 4FTIA 2BRBA 4WRSA 3QCQA 3QRTA 4YZNA 3R7IA 2BAQA 4PDYA 4ZTNA 1IRKA 3GC8A 3RCJA 4JIAA 4L8MA 4U45A 3BKBA 2F7ZE 3GP0A 1H1PA 3KGAA 4JRVA 4L7FA 4KAOA 4O84A 4PRJA 5CAVA 3FLSA 2WGJA 3QRKA 4F64A 3CS9A 4MBJA 3RM6A 3FWQA 2WMAA 4L01A 2J4ZA 1OITA 2ITZA 5EHLA 3NLBA 3JXWA 4NM3A 3UVQA 4EI4A 2WAJA 4NSTA 1LPUA 4ZJIA 4C0TA 1IAHA 4DEBA 2ONLA 1O6KA 5I9UA 4C61A 4FI1A 3RVGA 2FO0A 2RG6A 3GC0A 1JKTA 4FEVA 5LVLA 3F3WA 3D94A 3R01A 5CEMA 3E8EA 4D0WA 3JY9A 4ZZMA 3HMMA 3ROCA 2ITPA 4MAOA 4XCUA 4YPSA 5AUZA 2YACA 3DBDA 2OFVA 5AV1A 5A3XA 4C3RA 5JK3A 3A8XA 4G31A 4LRKA 2C0IA 2R3LA 2C5OA 3HRBA 4PMTA 4QMSA 2W1HA 2YM7A 1OB3A 3PE2A 3PP1A 4FT3A 4MKCA 2WTVA 2X2MA 5HBJA 3AC5A 3PY1A 3NNXA 4YHJA 4ZY6A 2C5NA 4M7IA 5IEXA 1J7IA 2C5YA 4JX7A 1SNUA 3LJ0A 2GNGA 3NNUA 4IJPA 1G8AA 1OI9A 2UZTA 3FI2A 4J95A 3PLSA 4OR5A 3T9IA 4UYNA 4M13A 4HVGA 3OWPA 3TEIA 4C59A 5LCJA 5JQ5A 4EOPA 3QHRA 5DN3A 3FY0A 3SRVA 4JS8A 1ZOEA 4KABA 2QOQA 1Q61A 4RIWA 5ACKA 3V6RA 3LHJA 4GYGA 5AP4A 3P4KA 2OBJA 2CJMA 4EHEA 3HMNA 3VHEA 1AGWA 3MN3A 5AAFA 4FTCA 2J7TA 4IC7A 4IWPA 4MHAA 5CXZA 5LVMA 2EB2A 1CMKE 3QTXA 4L9IA 4IWOA 3OT3A 3QUDA 2W5AA 4JI9A 3PG3A 4O7NA 1PKGA 2IZUA 2WFYA 4YMJA 2VTTA 4L68A 2J90A 3VBXA 3UOLA 4KSQA 3V8TA 5FQDC 4FKSA 4D5KA 3KXGA 4TNBA 4HYIA 3ZDIA 3OCTA 5KMLA 4BY9E 3THBA 4MXXA 3Q9WA 2Y4IB 2W4OA 1T46A 2BZKB 1JLUE 1U5QA 1YXTA 2X7FA 1Y6AA 3ZYAA 3UYSA 5EM5A 2YCQA 4ERWA 4F0GA 2PZPA 4EH5A 5JFXA 3D4QA 4H3PA 2AUHA 4LMUA 5AM7A 5IUIA 5CTPA 2ZOQA 2JKMA 5BYYA 5IA4A 3KCKA 2X7OA 4FZ7A 4F9AA 2XK7A 1T45A 5E8ZA 5J87A 2WHBA 3EQBA 2OJ9A 3VNTA 5CSPA 1FVTA 4NW5A 1E1VA 4KS8A 5DFPA 5CASA 5JFWA 1DI8A 3DKOA 5BMSA 2W9ZB 4QMOA 3WF6A 2QG5A 4HNFA 4BIEA 3MYGA 3VBQA 1OL5A 3S2PA 5ETAA 3F5GA 3UP7A 4EK8A 1ZARA 4ZMEA 3VQUA 5TF9A 3OTVA 1OKYA 1K3AA 2C6MA 2J9MA 4OTFA 3WI6A 5FUTA 4TNDA 1UNHA 3UC4A 3ORMA 4BGGA 1WVXA 3E3PA 4XV9A 5I9XA 2XJ2A 4KUJA 5AJQA 4D58A 3LFFA 4PDPA 3QGYA 5M44A 3PP0A 4QP7A 5HCYA 4FKRA 3W8QA 2GFSA 5DG5A 4BGQA 2KTYA 1Q8YA 5KUPA 3QD0A 4U97A 3TTJA 3POZA 1L8TA 4ZS4A 2H9VA 2BAKA 5EK7A 2R7BA 5A4TA 3R28A 3SW7A 4A9SA 2OF2A 5CEQA 4MK0A 4HGTA 1M2QA 4KKEA 3QALE 3CTJA 1AD5A 1CDKA 4X3FC 1I44A 4XHKB 5HKMA 3WF9A 2ERKA 3HZTA 4Z7GA 1EH4A 2PY3A 3F7WA 5D11A 3WF7A 4E6DA 1E1XA 5GINE 3FHIA 1VJYA 4G34A 4YJNA 3GOKA 3NW7A 3AOXA 4WD5A 3L9MA 4CFUA 3B2WA 4BCKA 5LVPA 4XG3A 2P55A 4TW9A 4BTMA 4FTOA 2G9XA 3OWKA 4O38A 3RWQA 3GCVA 5J9ZA 1QPCA 4II5A 4K0YA 2J0IA 3ZXTA 3KRWA 3OUKA 3W2OA 2WOTA 3F3TA 4HGLA 2YAAA 5CSWA 5J8IA 3PXRA 3FPMA 3DFCB 3HL7A 3PXYA 4O91A 3QTSA 4TXCA 1GZNA 1ZZLA 3NDMA 5AUYA 2C69A 3BHUA 3A60A 4FSRA 4D2RA 1B39A 4BCIA 2UW7A 4DEHA 4O81A 2I7QA 5HORA 4Y85A 3G51A 4X7QA 4AN3A 1BYGA 5L8KA 4GSBA 4WG5A 3UDBA 5HHWA 2C6TA 2WXVA 2ZM4A 2IW8A 3C0GA 3BEGA 4HW7A 2R3GA 4IAFA 2CCIA 4AA5A 1XH6A 1J3HA 4FA2A 4BIDA 5LCKA 3HKOA 4CFNA 5EW9A 5CZHA 4EYMA 5AUTA 2JKOA 4FTTA 3ZUVA 4RIYA 4FOBA 4FL3A 4X3JA 1W8CA 1MRYA 3ZZEA 3BYVA 4FGRA 2C0OA 2X1NA 4O21A 3KA0A 3ZC5A 4PDOA 5CF4A 1FOTA 3R30A 2CGVA 3PVUA 1TQIA 2YIQA 5EYKA 3ZRMA 3FMKA 3DJ7A 5HVYA 4W4XA 2IPXA 5BMMA 2PVMA 4U81A 3ZLSA 2XRUA 2BROA 2VWUA 3LMGA 3SXFA 4CT2A 4FZFB 3GXLA 5IQDA 2BDFA 3PZEA 3DK7A 3F2RA 4BN1A 5G1XA 4R1VA 3OUNB 1YWRA 4ITHA 2ERZE 3BGQA 3KB7A 2C3KA 3EKNA 3I4BA 2FSOX 3LXPA 3PJ1A 3TV6A 3UODA 4O6EA 4EH9A 2FSTX 4QMQA 4HYUA 3W0MA 5CT0A 2W1FA 4PY1A 5HO8A 2XRWA 3Q2MA 1Y57A 5TT7A 4ALWA 4OBOA 4FTMA 4FIJA 1ZAOA 2C0TA 2JDVA 3VRZA 5J95A 2GHMA 2I0EA 4Q9SA 3PPZA 2PMNX 4EJNA 4MCVA 3W0PA 4UX9A 2C6LA 2QOCA 3FC2A 3P1AA 2QO7A 3QFVA 4OW8A 3RI1A 3TDVA 3BLQA 3TV7A 3ZBXA 5AAGA 3VULA 2VWXA 4H36A 3A8WA 1MRVA 2WMXA 4OTQA 3TG1A 4GG7A 4OLIA 4QQCA 1R3CA 5DNRA 3UO4A 3DA6A 3VAPA 4BC6A 4Z16A 2CNUA 3S4QA 2V7AA 4AOJA 5KZ0A 3UVRA 1GNGA 1WBNA 2F57A 2VD5A 4AX8A 3R8UA 4EZ3A 1Q62A 2R3OA 3FMHA 3NEWA 3OY3A 1KV2A 3R1NA 3R2BA 4E1ZA 4EC8A 3V8SA 5LVNA 5EG3A 2HXLA 5HNBA 4LOQA 2IVTA 4EH4A 5AFVA 3W2RA 2WZJA 5DT0A 3VS2A 4ZSGA 3NNWA 3SLSA 3BHHA 2PZRA 1S9JA 4XOZA 3DNEA 5D9HA 4NW6A 5EOLA 2YWPA 5TR6A 3SD0A 3WIGA 5K4IA 3NVKI 2JFMA 5FDXA 3MSSA 3NAXA 4D9TA 1PMEA 3EFKA 5FM2A 5BYZA 4IQ6A 1YQJA 4FSTA 1NT2A 3CQEA 5HCZA 3SG8A 4YURA 4CKJA 2YIYA 2ITXA 4JQ7A 4ANBA 3L8SA 5IQEA 3OWJA 3TNPC 5BUJA 4GJ3A 4U3YA 1ND4A 5AUWA 4DFZE 4F6WA 4FTQA 4O22A 4FTRA 4YNEA 2V7OA 3K3IA 2OIQA 3PSCA 5KHXA 4EH3A 3HV4A 4XH6A 4W4WA 3ANRA 4GK4A 1IEPA 5FRIA 4K8AA 3VW6A 3V04A 4JQ8A 4QMTA 2WOUA 2NPQA 5KKRB 4JR3A 2ZV9A 3R7UA 2OJFE 5L6PA 3ZFYA 2ZVAA 3HA6A 4XG4A 2RFDA 3PE1A 5CEIA 5L3AA 5IA1A 4I6FA 1JNKA 4RWIA 2G2HA 3QYZA 4LL0A 4J1RA 4LYNA 5HNGA 2X6DA 1PMUA 5EDQA 5CAUA 5IDNA 3VBWA 4EEVA 3QUEA 5EM6A 3PJ2A 1LUFA 4FODA 4MBIA 3MH0A 4IAIA 3ZM4A 1Z5MA 5CI7A 5L2IA 3GB2A 1BL6A 1OUYA 4KSPA 4YPDA 1BI8A 4IAKA 5LJJA 3JPVA 1HCKA 3QQHA 4J7BA 3COHA 2J50A 3KRXA 3RALA 5BVKA 3QCXA 5CAPA 3IPHA 1PXNA 3MFUA 2J5EA 2A19B 1H08A 3O0GA 4GG5A 2UV2A 4U43A 5LARA 3V5PA 1YHWA 2BZIB 3OY1A 3WF8A 3LJ2A 1WBPA 4X0MA 3EQFA 4ZLZA 5I9VA 1OL2A 2QURA 3DJ6A 4QMWA 1PXKA 3NUUA 1WBSA 4ZJJA 4O82A 1JSVA 1UNGA 3NYOA 4BCQA 5K5NA 2GS6A 4FEUA 5AIRA 4FIEA 4MEDA 2OO8X 3DXNA 1UKHA 2SRCA 4YBKA 3U51A 5HG8A 5HE1A 3KK8A 3KFAA 4FNYA 1KV1A 3DXQA 5EM8A 3PA4A 4EBWA 3ORTA 3ENHA 3FHRA 3BZ3A 3BE9A 3I6UA 4R3RA 4C2VA 3ITZA 3K2LA 4FIIA 3EQGA 4XP3A 4FT7A 4NCTA 3TNWA 3F5UA 4CSVA 2ZMDA 4QP9A 2PVNA 4FVRA 3IDBA 3KRLA 4FZAB 2JIIA 3VUHA 1XWSA 3ORNA 4FTAA 3WF5A 1UNLA 4HPTE 5CQWA 4ITIA 4TRLA 5L6WL 5J9YA 2VX1A 3TJDA 5HX6A 5JQ8A 3QL8A 2YCRA 5KMKA 4CKIA 3GC9A 4QMMA 3CQUA 3Q9XA 3SXSA 5I4NA 4MXOA 4OUCA 4RC3A 5C03A 3DZOA 2NNWB 2IW6A 4PF4A 1A9UA 1WMKA 3F3UA 4BYJA 2C1AA 1OKWA 2IG7A 3ENMA 4AT4A 2Y9QA 3ATSA 4RVMA 1J7UA 2UZUE 4S31A 3V6SA 3EFLA 3QQJA 1Q99A 3ZO4A 1V0BA 4JVGA 3ZDUA 2BMCA 2XYUA 3GI3A 2ITVA 4ZMFA 2XKFA 5A4QA 3H9FA 5IQHA 1WBVA 1V1KA 3FXWA 3KRJA 5HU3A 3AC8A 4GUBA 5BVEA 3FMMA 4RWJA 4I20A 5CU2A 3CGOA 4EWHA 4FSUA 3KF7A 2VWZA 2YITA 3MGYA 2XEYA 3TZMA 1A06A 4AQCA 4UZHA 4ACGA 3FLWA 4F1MA 2VRXA 4WBBB 3Q5ZA 3VIDA 1RJBA 4IZAA 4DLIA 2B52A 1F5QA 4CFXA 1UU3A 3BCEA 3PJ3A 3EQHA 1W0XC 4BKJA 1JSUA 3KQ7A 4GK2A 5HTBA 1WAKA 5EYMA 4AW5A 2XH5A 3ROYA 5C26A 4K77A 2R3KA 4RA4A 4MF1A 3VF8A 2Z7SA 2BVAA 2HWPA 2PE2A 2C68A 1OPKA 2RGPA 2Y8OA 1W84A 4RVKA 4YTIA 5A6OA 4EH2A 3CD8A 3COKA 2OF4A 3F2AA 5K3YA 1CM8A 3E88A 3LFCA 3WBLA 1GAGA 2VX3A 4N57A 5E9EA 4F08A 3TNHA 3D7TA 3BGZA 1RE8A 5ETIA 2R9SA 4GRBA 3OD6X 5IMXA 4D9UA 3ULIA 2VU3A 4AZVA 2XK6A 5CENA 2ZDUA 4Z7HA 4F7LA 4G9RA 5CLPA 4BDBA 2BAJA 1SYKA 3QX2A 3S00A 3UNKA 4L46A 5EYDA 4C4JA 2PPQA 4HPUE 2YN8A 4LV8A 2YM3A 2V0DA 3QTQA 4QMNA 1SNXA 3LLTA 3EQPA 5ETFA 5C8MA 5LMKA 1YHVA 3OMVA 3U9CA 4IDTA 3MA6A 4JBQA 4F0IA 4FG7A 1NW1A 4GVAA 4BTFA 4APPA 2B4SB 4CV9A 2WTDA 4C2WA 2PZ5A 3MFTA 3ZH8A 3HRCA 3RNIA 1ZLTA 4YJOA 5D7AA 5CSHA 4R5YA 4AT3A 2IVUA 3ELJA 2JIUA 4TYEA 4XG9A 2VN9A 2XNOA 3CE3A 4KA3A 1ZMWA 2UUEA 3W10A 4F99A 4ENXA 2WQBA 2VAGA 2B9FA 2IVVA 4ZTLA 3SW4A 2X6EA 3C0HA 4S32A 1JPAA 4RJ8A 5DR9A 4ZZOA 3L9PA 4FKJA 4USDA 2A27A 3QTRA 2WTIA 3V5LA 5JGAA 3EZVA 1YW2A 5ETCA 2F2CB 2YDKA 4F1OA 3SC1A 4C4EA 2RKUA 2QVSE 3P23A 4KINA 4HGSA 4IWQA 4IX3A 3UQFA 2OIBA 1RW8A 2W9FB 4M84A 2WTKB 4GT3A 4DGOA 2P3GX 1Y6BA 3FV8A 2QU5A 3IW8A 4NWMA 5AV0A 4EUUA 1PMNA 3C51A 1PF8A 3WIKA 3RK5A 4I24A 2CLXA 2XIRA 3AMBA 4N6YA 4G3CA 5GJGA 3QCSA 4TYHA 3MTLA 4FKOA 3OZ6A 1KSWA 5FXSA 4QRCA 3DKGA 4C02A 2ITOA 3KK9A 4AA4A 3O51A 3UIXA 5HU9A 2BKZA 5JSMA 3ULZA 5H3QA 2WEIA 2GPHA 4U80A 4X2KA 3VVHA 2PVHA 4L42A 4HCVA 2ZV8A 4FKPA 4RX5A 1BI7A 1RDQE 2WTJA 3E92A 4UXQA 5HVJA 4L7SA 4CD0A 4D1SA 4FUXA 4IIRA 4A06A 1GZ8A 3EYGA 1UWJA 4Q5HA 4FTKA 3LQ3A 3G0EA 3BI6A 3FMNA 1HCLA 1H4LA 2XJ1A 2REIA 3F9NA 3ZUTA 4TWNA 1AQ1A 2CPKE 4DH8A 5ANIA 2W96B 4LUEA 3MPMA 5C4LA 5ANJA 5L2WA 5FG8A 5IA0A 3CC6A 4WNOA 3QKMA 5HBEA 4AGCA 5IQGA 5IUHA 3QF9A 2QCSA 5GIPE 5IU2A 5JEBA 2WMVA 2XA4A 1H07A 5C4KA 3BYUA 2XIKA 3QUPA 4FBXA 3FI3A 4JG8A 3MH2A 4GU6A 2RL5A 2PE0A 4FSMA 4BCFA 4FV1A 5HCXA 1PJKA 3O17A 5M07A 4CMTA 4R78A 2XBAA 3ODZX 4P90A 3UO6A 5BPYA 4JT3A 4GFGA 1ZYSA 3ACKA 4BZOA 3AMYA 4AOTA 2JDTA 1XH4A 2XNEA 3I79A 4XYFA 4FV2A 4ANLA 3RPYA 3W0QA 4M14A 3FYJX 3JUHA 2Q83A 5A4CA 3E8CA 1WFCA 5DR6A 3TM0A 5E8YA 4DEGA 4G17A 1H01A 4B0GA 1FINA 4NKAA 4IX6A 4C7TA 2X8EA 3A99A 4TYIA 2WMQA 3LFQA 3O96A 5E1EA 4QMLA 3DDPA 3R8LA 1Q97A 3WARA 2G01A 4QQ5A 3CEKA 4U3ZA 1OIYA 2J2IB 5DH3A 2QR8A 1O6LA 3H3CA 3E64A 3LCKA 1H24A 4B4LA 3UMXA 1BL7A 2WPAA 3AD5A 2J0LA 4FMQA 5AP1A 3ZM9A 5EM7A 3UYTA 3NYXA 2Y6MA 4WHZA 3R1SA 5IISA 3TZ7A 4AACA 4I4EA 4BHNA 4D4VA 5BVNA 5ITAA 4OBQA 4U8ZA 4QYFA 1LP4A 2PVFA 1H1RA 3ORIA 5EOBA 4EONA 1OPJA 1P14A 3RGFA 4QMZA 2P2HA 3FXXA 3H0ZA 3VS5A 3QKKA 4I6HA 2O0UA 4LV5A 5ANGA 3PYYA 3V01A 3HMOA 5CU0A 4G3GA 2A2AA 5H9BA 5FDPA 4RX9A 1IA9A 3W2QA 4BI0A 4PDSA 3FMJA 3KXNA 4BR3A 4DE4A 2VTAA 3MS9A 2CNVA 1FVVA 2B9JA 3QQFA 3Q4ZA 5CEPA 5HIBA 3R73A 5K4JA 1CSNA 3VW8A 3FKNA 2BDJA 5G6VA 1P4OA 4F7SA 2BKKA 4BVUA 4EKLA 3QRUA 1XQZA 1OIQA 3BU3A 4QMYA 3O8TA 2PMLX 1PY5A 1QPEA 3SVVA 5HD7A 4IM2A 4RVTA 2ZJWA 1WZYA 3I60A 3BEAA 3GFWA 3MIYA 4TZRA 2I0VA 2R3PA 2VTRA 2QOKA 3RJCA 5F1ZA 5L2TA 4FYOA 4XRLA 2BZHB 3Q6WA 2E9VA 4P5ZA 4QYYA 4ZTMA 3HRFA 2R0IA 2J0MB 4M69B 3A7GA 4DFUA 4EOJA 1W98A 3QZGA 3ET7A 3EN5A 1U46A 1PYEA 3WZKA 4BZNA 5CXHA 4O7TA 3LIJA 4S34A 4H3QA 4C58A 3AC2A 2CKOA 3KN6A 4A4LA 4TL0A 2PMIA 3W2CA 5B0XA 2JEDA 3PVGA 2GNJA 2V22A 3FL5A 2CNQA 4K18A 4MNEA 5FP5A 2YM6A 5CNOA 4U41A 3OBJA 5KZIA 3U8WA 4DN5A 4E4LA 4EQUA 3UJGA 4CCUA 2OW3A 5E90A 1BLXA 2B55A 3MVLA 4FTNA 3FSKA 2YCSA 3C4WA 3HUBA 3C50A 4FC0A 4E20A 5A4EA 4N0SA 3A62A 4M67A 3RAWA 2YM8A 1H28A 1ATPE 2XNMA 5AAEA 5IG1A 2C3LA 4TYJA 3LM5A 3IS5A 3HAVA 3RPVA 3RPOA 4X6RA 3W0OA 4JXFA 4UB7A 1B38A 1OMWA 3OOGA 4G5JA 4AZWA 2W5BA 4N6ZA 4BCOA 1WVYA 3PUPA 2C30A 2WQMA 2YFXA 3PA3A 3QD4A 5D1JA 4BCMA 3MY1A 3RKBA 4FGBA 3TACA 3E8DA 5AIKA 4GYIA 3ZOSA 4Y83A 2XVDA 4A9RA 4WG4A 3R1QA 5F20A 3GU7A 3I1AA 2GQGA 4RFMA 4CMUA 4DLJA 1FVRA 3CKXA 5GHVA 2F2UA 4QOXA 4RPVA 4WNMA 5EDRA 5M4UA 1ZY5A 1YWNA 4DFBA 4L52A 3MA3A 4BDIA 3QTZA 4FR4A 3F5PA 5IQCA 2JLDA 3SX9A 3K54A 1YHSA 2BUJA 2Y4IC 4PL3A 4FTUA 3R6XA 3L8VA 2QD9A 2ITNA 4B99A 3FE3A 4I0SA 3HDMA 3FY2A 4O7VA 4CRSA 5HZNA 1TVOA 3E8NA 3N51A 4C34A 4Q2AA 5DHJA 5KHWA 5C9CA 3W16A 4PTGA 3VJOA 3KMWA 4AFJA 3KRRA 2YERA 2VWYA 3LZBA 3BLRA 3FBVA 4MD7E 2PK9A 3ZFXA 3E7VA 2YAKA 3GU8A 1UA2A 5IA3A 2HXQA 4HCTA 2X39A 3MDYA 3OXTA 3WZDA 3DAEA 3KY2A 3UMWA 3KMMA 3QKLA 3VS7A 2GTNA 4RIYB 3EQRA 3CLYA 3ZFMA 2UVYA 1YRPA 2QNJA 2BZJA 2VNWA 5DI1A 2VWIA 1PMVA 3ORXA 2Y6OA 4PNIA 3BQRA 5EDPA 3W32A 1E9HA 3F3VA 4O7ZA 2HCKA 2VTLA 5IPJA 4D1XA 1P4FA 3NVMB 2HOGA 4X3FB 3G2FA 4EZ7A 3DQXA 4I5PA 4M15A 4RGJA 4FSWA 4K1BA 3R9OA 4AA0A 2HZIA 4BIBA 3ZO2A 1OBDA 4O27B 2UW0A 4U6RA 3SHEA 4F7JA 4FE2A 2PVLA 2FB8A 4XG6A 1GZOA 5DT3A 4FL1A 4AFEA 1YOJA 4G6OA 2GNFA 3QLGA 4RZVA 3R8VA 3TKIA 2VTNA 3PSBA 3V5TA 2IO6A 3DBCA 3ODYX 1QCFA 3CTHA 5AMNA 4YP8A 2GSFA 5JZNA 3VS4A 3M42A 2VTQA 4ENYA 3W2PA 2R2PA 2VWVA 4M3QA 3LCSA 3I7CA 1Q8UA 4EOMA 2LAVA 2PVYA 4AP7A 5GJFA 4R1YA 2WU6A 3OOMA 4DEIA 1PXOA 5CX9A 2ITQA 3QXOA 4GFMA 2Z7QA 3M11A 2DYLA 3NNVA 1XH9A 2WMBA 2FGIA 3O8PA 4BCPA 4BDCA 2EXCX 3MH3A 2VUWA 1XBBA 2G15A 2HENA 4EHVA 4L3LA 4O6LA 1APME 4PTEA 4CTCA 4LFIA 4MVFA 5EI6A 3BV3A 4ONAA 2UZLA 2YJRA 4NTTA 3CJFA 5I9YA 2R5TA 2W1EA 4RC2A 3LCDA 1V0PA 3RK7A 4R7HA 3NX8A 4U42A 3HMIA 3UNJA 4ASZA 4JQEA 3G6GA 5KMOA 4JDJA 3RWPA 2YZAA 3MVJA 4PUZA 4UEUA 4O7PA 4WBOA 1DAYA 4OTHA 2X7GA 4NL0A 4OTDA 2BIKB 4FKTA 5EI8A 2C6OA 4MXCA 3GENA 3W2SA 3AGLA 2XNGA 3KMUA 4TPTA 4X3FA 3C9WA 4YC8A 2GFCA 4EH8A 2CKPA 3P0MA 2R3RA 4DHFA 1ZOGA 4RJ5A 2JFLA 5AA8A 3D14A 2E9OA 4G3FA 5KBQA 1BMKA 3QYWA 2WIPA 3Q5IA 4PWNA 5CSXA 4YHTA 5AWMA 5M53A 3F61A 1MRUA 5CF8A 3UPZA 5T68A 5HIDA 4ASEA 4O0VA 3VQHA 3FAAA 2HZ4A 4AGWA 1DI9A 4YO6A 3V51A 4IAZA 2ESMA 3EQCA 5JN2A 2XM8A 5LQFA 2A0CX 3ZSGA 3GGFA 3TZ9A 4XS2A 2NP8A 4EJ7A 1XH7A 4ZZNA 2JD5A 4TYGA 4J71A 3ZS5A 4DBNA 2IZTA 3MVHA 2QI8A 4PNKA 2RFSA 1M2PA 4AWIA 2R3MA 3QRIA 1MQBA 4YC6A 4DBXA 3CIKA 4L43A 3JVSA 2W99B 3PG1A 3KL8A 2W06A 1TQPA 4ZP5A 3WYYA 3I5NA 4MTAA 3DT1A 3FLZA 4EOSA 3FMEA 2XK4A 3FZOA 4IAYA 3OCGA 4E4MA 3HA8A 3QU0A 4IZ5A 4OTIA 4YZBA 5JRQA 3NSZA 4YJSA 2WIHA 3ZEPA 4C37A 2B54A 2XKEA 5AV3A 5J1WA 3UO5A 1JKKA 1GOLA 3PXQA 5AUUA 5AEPA 4CFVA 3QHWA 3ZO1A 1FMOE 3R1YA 3NWWA 1BKXA 2C6EA 3DQWA 3OHTA 4NU1A 4GUEA 1W83A 4MXYA 5IQIA 1Y8YA 4BCGA 1M14A 4IMYA 5K9IA 4DC2A 4G16A 3HLLA 4G9CA 4U40A 3R8PA 2VNYA 2FVDA 3CGFA 3NS9A 4OT5A 2BHEA 2C3JA 5K5XA 2E2BA 4PQNA 3ERKA 2W5HA 2H8HA 4ITJA 4I0RA 4DTKA 3M1SA 4DG0E 2UZNA 4EWQA 3F82A 4FX3A 3HV6A 4CRLA 3HEGA 3G9LX 3K5VA 3LFAA 5E91A 1TQMA 4F1TA 4QTAA 2YWVA 3VUDA 3ZXZA 4YNOA 4LOPA 3Q4CA 3Q96A 5FTGA 5E8UA 4AZSA 4RC4A 4CCBA 4ORKA 2VGPA 2WMWA 3PWDA 4BB4A 3BHTA 2BILB 2C6IA 3IONA 2BALA 1M7NA 3FZ1A 3AQVA 4ZJVA 2CN5A 2VTOA 4H39A 1OPLA 4IBMA 4RVLA 3U4WA 3Q6UA 4U98A 4AE6A 3AMAA 3FYKX 3CBLA 3COMA 3ETAA 3ZONA 4D1ZA 5EYCA 3Q53A 3QD2B 3QX4A 2AYPA 1OKZA 2QU6A 3HECA 3QGWA 4UWYA 4XLVA 4M68A 2GS2A 3LAUA 5HG9A 5M06A 2P4IA 4DEAA 1F0QA 4ANSA 3U6HA 2BRGA 2XNPA 3T8OA 4KIQA 3HUCA 1PXJA 3VUKA 4FG8A 4HVSA 2X81A 3PIXA 3LQ8A 3BGPA 3EZRA 5ANDA 3CQWA 3PSDA 1KE8A 3C4XA 4IANA 2GNHA 3QQUA 4FL2A 4JG7A 3RINA 4IM3A 3RZBA 2UW4A 4QTDA 4LRMA 3BWFA 2XCHA 4FV5A 3HDNA 3V5WA 3LPBA 4DGLC 2UW5A 4BRXA 1PXPA 3KU2A 4BDAA 3IW7A 3F66A 3KXMA 4HVHA 5KMMA 2X2KA 4AN2A 4EOQA 4JNWA 4H3BA 3E63A 4NKSA 5E92A 4PP7A 4CG9A 4DTAA 4ZLOA 2XIXA 2G2IA 2W0JA 4DG3E 5IH6A 5DBXA 4R3CA 5JH6A 4FUYA 5HGIA 2OZOA 1DM2A 1UU7A 2UVZA 3COIA 4WSYA 3ZLYA 3IW5A 3DFAA 4L53A 2UW6A 4Q5EA 4WUAA 3RTPA 3NIZA 3UPXA 3EFWA 5M4FA 5CSVA 1SM2A 3C5UA 1GIJA 3PXKA 2BTSA 5BYLA 5IQFA 3BQCA 4G2FA 5ICPA 3FZSA 5TO8A 4EK6A 3HV7A 2KULA 5GIOE 2W1CA 3K3JA 4GVJA 4GV1A 3LVPA 1MUOA 3FDNA 2QO9A 2IZSA 3A7IA 5FTQA 3SOAA 5H8GA 3W8LA 4AT5A 1YXSA 2W1GA 3C4ZA 3D7TB 4IEBA 5B2MA 1YDTE 2A1AB 1R0EA 3ACJA 3I6WA 5DOSA 3DDQA 3P08A 3KEXA 4RBLA 3VHKA 5JZJA 3EL8A 4F6UA 3DCVA 3UIUA 1FGIA 3U4UA 3Q60A 3B2TA 2WMRA 4OBPA 4FKQA 2BRMA 4UBAA 4DGNA 1Q4LA 1URCA 4QPSA 4DFNA 2VZ6A 4Z55A 2JKKA 4NZWB 4XP2A 5DRBA 4KD1A 4YJQA 4GL9A 3GBZA 4QMPA 1REKA 5AV2A 1URWA 4K33A 3IO7A 2CLQA 2JAMA 3R2YA 1JAMA 5IEVA 3EN7A 4J53A 3QZFA 1SVEA 4HOKA 4CKRA 1OM1A 3RAKA 4DH5A 4FV0A 3QWKA 3ZRLA 2XCKA 4F0FA 3QXPA 4GH2A 3MFSA 2OLCA 4IB5A 4O0YA 5DWRA 5JGBA 3MB7A 2IZRA 3W0RA 3RPSA 4AE9A 5JRSA 4QYHA 2XS0A 1NA7A 3CXWA 4FVQA 3R9HA 4A7CA 3BYSA 4FV7A 5AX3A 3ZLXA 3BWJA 3WOWA 3IGOA 4DFXE 4AZFA 2Z8CA 3V8WA 2JIVA 5H8EA 2ETKA 2OSCA 4BZDA 1YDRE 4ANQA 1NVRA 1ZYCA 5E7RA 2UZDA 2F49A 4I4FA 1IR3A 2W1IA 3SG9A 5A46A 4O7WA 2UW3A 4UY9A 4ASXA 3GQIA 4I94A 4S33A 1IAJA 3FEGA 3HAMA 2VWWA 4L6QA 2VTMA 5DA3A 4XBUA 3Q4UA 5JFVA 2YABA 1PHKA 2PUNA 2HY81 4PMSA 4YBJA 1JKLA 4BDHA 4BHZA 5KMJA 2GHGA 4FKLA 5AP0A 3PLAE 2HZNA 3EJ1A 2PU8A 4RFYA 5BVOA 4PP9A 4O0RA 4V01A 1PYXA 3R7YA 4TYHB 3G6HA 3OCSA 3VBYA 5LOHA 1R78A 4JL9A 4C4IA 4DYMA 5IMEA 3ZBFA 1H1WA 1ZXEA 2EUFB 2ZB1A 4EZ5A 2ETRA 4NK9A 3FLQA 2Y7JA 3L8XA 2OJIA 4DINA 5EQYA 1UKIA 2C47A 4MX9A 2XM9A 3E62A 3IDPA 3LE6A 3EB0A 4JR7A 4QP4A 4AG8A 3UC3A 1Q5KA 3FZTA 3R04A 3G0FA 3KVXA 2AC3A 3NPCA 2O8YA 5I9ZA 1VZOA 5F9EA 1QMZA 3DOGA 4ZOGA 4L44A 4D0XA 1MP8A 1SVGA 4PV0A 4S2ZA 3UQCA 1J1CA 2NO3A 2QOFA 3NGAA 4MQ2A 4U5JA 3ZZWA 2XB7A 3TXOA 4CV8A 4BI2A 1GY3A 3NYNA 5B2LA 4LI5A 4WNPA 2EB3A 4LM5A 4YZDA 4ZY4A 4CVAA 3BX5A 4HJOA 4MBLA 2RFEA 3VS6A 2V62A 2CDZA 1OGUA 4FV3A 4PX6A 4I41A 4R7BA 3TUDA 4BICA 3DJ5A 4J98A 2DS1A 2J51A 3BBWA 3FJQE 4J52A 2C6KA 4AZEA 4BDGA 5JKGA 4XEYA 2FA2A 1OL1A 3FQEA 3FZPA 3RMFA 5M4IA 1DS5A 3O23A 3UIBA 5C01A 3POOA 4F63A 4BTKA 3W55A 3CY3A 4F9WA 3C4EA 3R00A 3DAKA 3L9LA 4D55A 3KXZA 4EQCA 5AM6A 4KBCA 5DRDA 2PMOX 4YJRA 5FM3A 4NM7A 1ZWSA 3FL4A 1ZZ2A 3LOKA 3H0YA 4I92A 3UQGA 4C38A 5CEKA 4A9UA 2ITTA 5HEZA 4CLIA 3N4TA 4RJ3A 3MIAA 3DY7A 3BHVA 3LFNA 3KN5A 3Q9ZA 4RIXA 3CSVA 2R3QA 5EQPA 3U54A 5AV4A 4XRJA 3MESA 4I3ZA 4RX7A 3BU5A 4O2ZA 3UP2A 5IUGA 2OZAB 3GU6A 1RQQA 2X9FA 4JDKA 2WELA 4P5QA 3D5XA 3P86A 4C4GA 2YHVA 5A6NA 2XNNA 3A4OX 4NH1A 4A07A 3IOPA 2FSMX 4I23A 5T6KA 1YI3A 3O71A 1F3MC 3PXZA 1KE5A 2H6DA 4OGRA 4I5HA 1FGKA 4O96A 4O7LA 3UNZA 2GMXA 3ORKA 3CTQA 1U5RA 5L6OA 2ZMCA 2R3HA 2OK1A 1JQHA 1XH8A 1QPJA 4YJTA 3OXIA 3G5DA 2QO2A 4NJ3A 5IA5A 4IAAA 4EOOA 3LLAA 4P4CA 4QQTA 3D7ZA 4YGAA 2WTCA 4EUTA 2QQ7A 2H96A 4LUDA 4JX3A 4H1JA 4EL9A 4FSYA 3C0IA 2UZVA 4E5WA 2I6LA 5BUEA 3M2WA 5A54A 4FNWA 3FSFA 4TWOA 4Z3VA 5DIAA 2R3IA 2WB8A 1LR4A 5HTCA 3C7QA 1H1SA 3QZIA 2XUUA 5BUIA 3D2KA 1VEBA 4KWPA 3C4FA 3I7BA 4ZTQA 5FXRA 4ZSJA 4L00A 3RCDA 3L8PA 3WE8A 2R7IA 2UZBA 4X2NA 1Q3DA 4O0SA 2PVKA 1M7QA 3H10A 3TN8A 4DCEA 2J6MA 4NJDA 5FEDA 3VJNA 4DH1A 5E8TA 1GIHA 2A4LA 2XKDA 3DGKA 3LFDA 2HYYA 4FV6A 4GEOA 4QPAA 2OZAA 3BHYA 3L9NA 4YTHA 3H9RA 3ZO3A 2XYNA 4L67A 3OS3A 3WE4A 3UOJA 3FQHA 2ZM3A 5CALA 3OG7A 2B7AA 3HV5A 3ZCLA 2HY0A 3F69A 4IC8A 5HE0A 3ID6C 3O7LD 2PUUA 2ONLC 1JSTA 4HVIA 1JVPP 3GCUA 5AUXA 4HZSA 3ZUUA 3W0NA 1P5EA 4CEGA 3SGCA 1IA8A 3GU4A 4MNEB 3R7VA 4CFFA 3IQ7A 4F65A 3W1FA 2X2LA 4EOKA 4ARKA 3Q04A 5M08A 2Z60A 4DTBA 3O7LB 4G3EA 1A48A 5ANEA 4AAAA 3EQIA 5FBNC 4EOLA 1KE9A 4F6SA 1SMHA 4J96A 4E6QA 3UG2A 3EMGA 3MJ2A 2ZAZA 3UG1A 3DB6A 2W1ZA 2PL0A 5FXQA 5J9LA 4YC3A 2FYSA 2QKRA 4CXAA 5GNKA 2P2IA 2QOBA 5CU6A 5J5SA 2OU7A 4JDHA 1H8FA 2OI4X 2BPMA 5E8SA 2Z2WA 2LGCA 3EN6A 5D12A 3KKVA 1H00A 3TKHA 2I40A 2V55A 2OH4A 3TJCA 1R39A 4AF3A 4B8LA 4G6LA 5CVGA 1YKRA 3A2CA 4IVBA 5KE0A 2RF9A 4U94A 3SDJA 3Q3BA 3D5UA 4O0WA 4QMVA 3FMDA 1PKDA 2RFNA 3C5IA 4UALA 5EQEA 3CKWA 3ZSIA 4FVPA 2VWBA 4QMUA 3UZRA 2VO0A 3DLZA 2BTRA 1XJDA 4NFNA 3RHKA 4Q9ZA 4JIKA 4IB1A 2I1MA 4V04A 3QZHA 4XP0A 3TL8A 2PZIA 1GZKA 2PUPA 3II5A 1ZYJA 2IN6A 5HESA 2VO6A 2PWLA 3T3VA 2XK9A 4NTSA 4QYEA 4YZ9A 4HZRA 3TWJA 3UZPA 1O9UA 3S95A 4UXLA 4MXZA 5C8NA 2I0YA 1XBCA 2GS7A 1CKIA 4W8EA 4EH6A 1V0OA 5JGDA 5FP6A 3OROA 4AU8A 2CGWA 3PJCA 4ACMA 4ID7A 4QNYA 5H8BA 3T9TA 4BDDA 3VWAA 2BRNA 5EFQA 4IVAA 3DXPA 4HYSA 4V0GA 4DITA 3A7HA 3CD3A 2OJJA 2XIZA 4QO9A 4U79A 5LMAA 2Q0NA 2O63A 4O0UA 5HG5A 3R9NA 2CKQA 3NRMA 4O2PA 5HVKA 5TKDA 4RRVA 3D9VA 3KF4A 3P78A 2PHKA 2XIYA 3GC7A 5BVWA 3SXRA 4YHFA 5E8VA 3ZC6A 3E5AA 4O86A 4JOAA 2FUMA 5J7HA 3ZSHA 3R9DA 2YEXA 3R21A 4XMOA 5B7VA 4XOYA 4CT1A 3F6XA 4IHPA 1Q24A 1CKJA 3PRFA 4BGHA 4YSJA 2J5FA 4H05A 2W4JA 5FD2A 3VS3A 4FNZA 2DWBA 4KIOA 5DYJA 2Z7LA 4RFZA 5JFSA 5KBRA 5M57A 1IASA 4D28A 5E8XA 4YSMA 3AT4A 3MY5A 2E9NA 2GDOA 5CI6A 1O6YA 2X8DA 1YI6A 3OW3A 4M8TA 4YO4A 5HQ0A 3ORPA
chains in the Genus database with same CATH superfamily
3UDTA 3TZ8A 3DKCA 1J7LA 1VR2A 1VYZA 2JDSA 3H9OA 3C1XA 4YLKA 1H0VA 2B0QA 2BR1A 4FEXA 4IZ7A 4ALUA 1XBAA 4R77A 3PTGA 1U4DA 2BDWA 1WCCA 4N70A 4NIFB 5E4HA 4Z9LA 3UZTA 1ERKA 5M51A 1YOMA 2WKMA 4C62A 4FV4A 4EHGA 4GKHA 3EHAA 4I21A 3RHXA 2XJ0A 1H27A 1UVRA 3FI8A 2ITWA 4WA9A 2OFUA 4MWIA 2GNLA 2QONA 3TV4A 3CR0A 4ZY5A 3BPRA 5ANKA 5IZFA 2QLQA 2OJGA 5BX0A 4RWKA 2PTKA 4AZTA 1NVQA 3KULB 2QODA 3E93A 4BBMA 2JC6A 2ACXA 3DNDA 3NYVA 2PVJA 4RJ7A 2F7EE 4RZWA 2O65A 4YJPA 4F70A 5DLSA 4L3PA 4RLLA 3ALOA 4NM5A 3ZRKA 4I5CA 1YXVA 5LWMA 4D4YA 4ZS0A 4HGEA 2QOOA 5EKOA 4ZTSA 5FBOA 2Y0AA 3FKLA 1OECA 4IX5A 5HIEA 4ACDA 4AN9A 3OXZA 4IB3A 2RIOA 3NW5A 3LMIA 4R7IA 4WOVA 2IVSA 3EN4A 4GIHA 4K2RA 4RQKA 1G3NA 1XHAA 3ORZA 4CTBA 1M17A 2IWIA 3UE4A 4IZYA 3QC9A 4KB8A 5LMBA 4O7SA 4W4YA 5EHYA 2C3IB 4GT5A 4RT7A 2O2UA 4KKHA 3DTCA 4CFMA 2B9IA 2UZWE 2JBPA 4FTJA 1KWPA 4IB0A 3NUAA 5EW3A 2YJSA 2WD1A 4O0TA 4AGDA 2DUVA 4V05A 3UBDA 1Z9XA 3P7CA 3PIZA 3U9NA 4ANMA 5KMNA 5HNIX 4CZUA 4IFCA 4BDKA 3DB8A 2BRHA 4CLJA 2FH9A 4P2KA 1X8BA 3LXNA 4OTRA 1H1QA 5HLPA 1Q41A 1H0WA 2XNBA 5DT4A 2YDJA 3CJGA 5M56A 3GCQA 4I6QA 4JBPA 4K9YA 2AC5A 4U7ZA 2HK5A 5AA9A 5I9WA 3L1SA 1XMLA 3BLHA 2X8IA 3DBEA 3SQQA 4FIGA 2PSQA 3ZLWA 3KCFA 3MV5A 3EL7A 3KULA 3TTIA 4RJ4A 2XBJA 5HO7A 3PVWA 3OWLA 2OKRA 2QOLA 3TNQB 3UIMA 3LCTA 3CPBA 2HZ0A 3BBTB 3OT8A 3QQLA 4D2SA 2VTPA 3VBTA 4F9BA 5C8KA 3EH9A 3FLNC 3IKAA 4KBAA 5DPVA 2V5QA 4E73A 4XV1A 1U59A 2H34A 4ZIMA 5AP7A 4QT1A 5L2SA 1Y8GA 3U55A 4F4PA 3Q4TA 2IW9A 1Z57A 4FV8A 3AXWA 1OL7A 3MW1A 3RM7A 4BI1A 3H4JA 3PJ8A 1W7HA 5CANA 5F94A 1QL6A 2EXMA 3VF9A 4B6LA 4B9DA 4YUQA 2WQNA 3REPA 3QAME 3MFRA 3JR1A 4M0ZA 2EU9A 4OTGA 2F4JA 4U0IA 3EFJA 5B2KA 3IG7A 4HVDA 4YLJA 2CGUA 4USFA 1LEWA 2XF0A 3N9XA 4IACA 4QP2A 5CU4A 5A9UA 5CEOA 3FC1X 3MBLA 2NRYA 1GIIA 3PIYA 3R83A 5HX8A 4YZMA 3DLSA 3OCBA 1P2AA 3LJ1A 3NZ0A 3TI1A 2J0JA 2R0UA 3ATTA 4X2GA 1PXIA 3MPTA 5F4NA 4WIHA 3U87A 5IH4A 1UU8A 5HI2A 3IW6A 1NVSA 4E4XA 4IE9A 5CYIA 2CMWA 2YISA 3FQSA 4OTWA 3DPKA 2ZV7A 3GU5A 3UOHA 4DCAA 4DH3A 1WBOA 3TIYA 5HG7A 3VRYA 2VO3A 3OFMA 3LW0A 4I6BA 1UU9A 4HYHA 4FZDB 1XO2B 3QCYA 4CG8A 3Q52A 3LXLA 2X4FA 3AC4A 3D83A 1K9AA 4DEDA 4Y5QA 4TT7A 4EOIA 3P7BA 4IVCA 3W0SA 4I22A 3BU6A 4QTEA 3IDCA 3LMHA 3VUMA 3OP5A 5JT2A 5I5ZA 1PXLA 3PFYA 4EYJA 1WBTA 1H25A 2GU8A 1I09A 4XV3A 4QTBA 5D7VA 3WYXA 4EK4A 4YJVA 3A7FA 2NRUA 1OIRA 3IK3A 4W8DA 3GUBA 4WO5A 1ZOHA 1XR1A 3RK9A 3HMPA 4KS7A 3RAHA 2C5XA 3SKCA 4M12A 4QYGA 3VS0A 4CNHA 5A4LA 3TUCA 1FBNA 1ZYDA 2YZLA 2DQ7X 3EKKA 3NIEA 5D10A 4E8AA 3CCNA 4D5HA 5KCVA 1W82A 2YM5A 2QLUA 4FV9A 4D4SA 4DDIA 5L8LA 4CZTA 4FT9A 5J1VA 2ZFYA 4JDIA 4DFYA 4G6NA 4NYEA 3U6IA 5EW8A 4BCJA 2BCJA 1CKPA 1YWVA 5FEEA 4XBRA 3B8QA 2ZDTA 1K2PA 4O7YA 4IADA 5KNJA 3IOKA 3KXHA 4TWPA 3MB6A 1FQ1B 5HE3A 1JKSA 2JITA 4A4XA 3ALNA 4MH7A 1BUHA 4EK5A 5T3QA 2PULA 3JYAA 4LOOA 2HW7A 4TTHB 4KNBA 5E8WA 4RA5A 5AP3A 4E93A 4TKSA 1M52A 3PPKA 3FMLA 4UWBA 4WT6A 4DGGA 1R1WA 2ZM1A 1KOAA 3D15A 4YJUA 2JGZA 3PVBA 3D2IA 4O0XA 5EHOA 4EKKA 3W33A 5LXMA 5M09A 4QP3A 4UWCA 2R64A 4J99A 3R8MA 1XH5A 4XG7A 3LM0A 3V3VA 4EHZA 3G90X 3DBQA 4PL4A 4F09A 3R22A 5FLFA 2XZSA 5M4CA 2OXXA 4P7EA 2WMTA 4RG0A 3WILA 1KE6A 5FTOA 4GU9A 1UV5A 4FG9A 1YXXA 3TKUA 4AAYA 2P0CA 2WMSA 4JLCA 4ZTHA 1WBWA 4FSQA 3S1HA 1B6CB 1QPDA 2OH0E 3W18A 3SA0A 2YIXA 5L8JA 3FLYA 3UTOA 2PVRA 2P33A 3MPAA 4LGHA 3G15A 5KKRC 2Z7RA 2CCHA 3P7AA 4I6LA 3V5QA 3NMUF 4NCTC 5F95A 3UVPA 4PMMA 4ALVA 4C4HA 4MQ1A 4PL5A 3NAYA 2ITUA 2QHNA 2W1DA 3P79A 4MXAA 3AT3A 5KO1A 1JWHA 4NT4A 2WNTA 5M55A 2R4BA 5DGZA 4ZSAA 2JDRA 3MWUA 2GHLA 3ZHPC 4H1MA 4BDJA 4TWCA 2OXDA 3R7EA 2BFXA 3H30A 4ZXTA 3RAIA 2YDIA 1KUTA 3DK6A 5ACBC 3MY0A 5AP5A 5EKNA 5AADA 2CGXA 3N4UA 2UVXA 1OZ1A 5CVFA 1OBGA 4DAWA 4R3PA 5D41A 4H58A 4IFGA 3E87A 5IQBA 4C36A 4RSSA 3A7JA 3VUIA 3EYHA 4DF3A 3O2MA 2W7XA 4X21A 4PMPA 5KX8A 1GJOA 3FUPA 5AP2A 2QOIA 4UZDA 3PY0A 3F88A 4FKVA 1H26A 5DR2A 4JBVA 3PUFC 1L3RE 2PUIA 4FSZA 4W4VA 4DHZA 5BQ0A 4J8MA 5AP6A 4ZEGA 2F9GA 3R8ZA 5HBHA 3O8UA 3AC1A 3UDSA 1OUKA 3GT8A 3EIDA 2O5KA 1Q8WA 3U6JA 3TT0A 3EOCA 3NUXA 3QQKA 4RWLA 2R3FA 3OTUA 1R0PA 3LKMA 2CN8A 4ERKA 3PFQA 1WVWA 5CF6A 4LL5A 3BIZA 3NUPA 3HP5A 3Q9YA 4IM0A 3LXKA 5EI2A 3RPRA 2QKWB 4EBVA 3TYKA 4FKGA 2XMYA 5FGKA 3A4PA 3N4VA 2UW9A 2OICA 4K6ZA 3BYMA 2J0KA 2UZEA 4FKUA 1M2RA 2QHMA 4X2FA 1ZMUA 5ANOA 4O83A 4E7WA 5CAOA 4TY1A 4DA5A 3VN9A 2FSLX 3D5WA 2XAMA 2YA9A 4FTLA 3CY2A 1Q3WA 4TN6A 3VBVA 4YTCA 2ETMA 2OWBA 4ASDA 4KBKA 2Q0BA 3OF0A 4EC9A 4UN0C 4J97A 1DAWA 5FEQA 2VGOA 2VTSA 3ORLA 1YXUA 4WUNA 4QP8A 2X9EA 3AC3A 3OW4A 3B8RA 3WZJA 1G5SA 4ZTRA 3S3IA 4B7TA 2OGVA 2HWOA 1REJA 3R71A 2VTJA 3QA0A 1JOWB 1XKKA 4O7OA 3WZUA 3E7OA 3NUYA 5AUVA 4LRJA 5LMKC 4N4SA 4RIOA 3NR9A 4NM0A 3I0QA 4U44A 4XG8A 4E6AA 4M0YA 4A9YA 4Y72A 2QG7A 4XX9A 4YR8A 3UOKA 1PW2A 4E5AX 4FSNA 4MD9E 1ZY4A 5C27A 4RJ6A 1VYWA 5GJDA 1ZRZA 4ZSEA 4IH8A 3P5KA 5HICA 4E6CA 4UV0A 4GFOA 4LG4A 4EQMA 3LFBA 3MTFA 3IW4A 4YZCA 4AXAA 1FMKA 4C3PA 1PXMA 2G1TA 4M97A 4APCA 2E9UA 2HIWA 4HNIA 3AT2A 4A4OA 2JAVA 5CQUA 4IJ9A 3NCGA 2GQSA 3HNGA 2R3NA 4I5MA 4JRNA 4XV2A 3VS1A 2QOHA 3VC4A 2HW6A 3CPCA 3K5UA 4FIHA 4RIXB 4BBEA 4KRDA 2OXYA 4F9YA 5HD4A 3GOPA 2B9HA 3Q2JA 1STCE 3VO3A 2W17A 2WU7A 5CWZA 1IG1A 3D0EA 5CY3A 2UZOA 4UYAA 3R7OA 2O3PA 5CAQA 3NW6A 4WRGA 4Y8DA 2QC6A 2PYWA 3DAJA 3GCPA 3GCSA 1LEZA 1BX6A 4FZ6A 5AX9A 5IDPA 2VTHA 4RX8A 4G3DA 4XNEA 3S0OA 4J8NA 4YU2A 2O64A 4JAIA 3F7ZA 4QNAA 2YM4A 3QTWA 4JJRA 3F2NA 2HAKA 4D4RA 4CGAA 3PDTA 3PPJA 3MVMA 3G33A 3A61A 4L3JA 4LMNA 3AGMA 4R5SA 5DVRA 2HELA 3SAYA 3OBGA 3PRIA 5IH5A 5A14A 4FOCA 3V5JA 3EQDA 3MH1A 4FK6A 4ACCA 5CNNA 3KIOC 4F9CA 2B53A 2YIWA 3NCZA 2Z02A 3HYHA 2OIDA 4FKWA 3T3UA 3RP9A 4DFLA 3AKJA 3TNIA 5HLNA 4BCHA 2WO6A 4S30A 1JBPE 3C4CA 2E9PA 2GNIA 2VO7A 2Y4PA 3D5VA 5H2UA 4C35A 3PA5A 3JVRA 3WZEA 4WKQA 1Q8TA 2RG5A 4Y95A 3BRBA 4RMZA 1Y91A 4ZLYA 1MQ4A 2G2FA 4RLKA 3Q32A 4BDFA 3I5ZA 4DT9A 4WZYA 3NUNA 3FZRA 4F7NA 3DU8A 3DKFA 4AW2A 2GCDA 2PZYA 3EN9A 5IEYA 5C1QB 1S9IA 3DK3A 1NXKA 3BV2A 4AW1A 4CMOA 2WQEA 3DTWA 5JMSA 4I1ZA 4YTFA 3E3BX 1ZYLA 4FICA 2UW8A 4BBFA 2GTMA 3DS6A 3QTIA 5DEYA 3R9RA 2CKEA 2B1PA 4GKIA 3UGCA 2JDOA 1OIUA 2OG8A 5CS6A 3JS2A 3OC1A 4K11A 4ACHA 4GMYA 4MD8E 3TDWA 4AW0A 1U54B 1PRYA 4FEWA 4U9AA 5DE2A 5TOZA 2EWAA 4B8MA 3AG9A 2WTKC 4JMQA 2VV9A 2YIRA 4MYGA 3QA8A 4DH7A 4Y46A 4FKIA 4BYIA 3KREA 4DG2E 4BTJA 3PXFA 4FK3A 3QD3A 3BELA 5BVDA 2X4ZA 4GJ2A 2ZYBA 4KIPA 3OVVA 4I0TA 4R6VA 2I0HA 3PWYA 3QRJA 4GW8A 1CTPE 3HV3A 4XG2A 4FYNA 2EVAA 2XAOA 4HCUA 2XK3A 3QC4A 3LFEA 4QMXA 1SZMA 1YDSE 5BVFA 3BE2A 2W05A 5CU3A 2BIYA 3I0OA 3CP9A 2BHHA 4RQVA 1TKIA 4I93A 4EK3A 3IGGA 2WEVA 3FKOA 4G1WA 1J91A 2XP2A 3P9JA 5CVHA 4IW0A 2JBOA 4DGMA 5IA2A 3FI4A 4WG3A 2C5VA 3LQ5A 2ITYA 2ZB0A 4IVDA 3SOCA 3LFSA 4MNFA 4EH7A 3QQGA 4MWHA 5HLWA 3AD6A 3R02A 2VX0A 1G8SA 4PTCA 5KMIA 2XK8A 3ZEWA 1SVHA 2XEZA 1YI4A 3QBNA 3KC3A 4CFWA 2XALA 4WNKA 3ANQA 4FEQA 3HVCA 5EH0A 5IF1A 4AUAA 4O7RA 1OVEA 1ZMVA 4JG6A 4OT6A 3FXZA 4QP1A 2CSNA 4GK3A 2QR7A 3ZMMA 4QQJA 4IX4A 4E4NA 5LWNA 3C13A 2XKCA 3DV3A 3PZHA 3SV0A 4QP6A 1J1BA 4L45A 1TFFA 5DEWA 3F5XA 3LCOA 3GQLA 3I81A 1OKVA 4ZSLA 4IWDA 4Y73A 3MI9A 4DT8A 4FT0A 4AOIA 4BF2A 4NUSA 2C6DA 3HP2A 2C4GA 1U54A 3HX4A 4GS6A 3OEZA 4LQMA 4XJ0A 3GEQA 2PE1A 3AD4A 4AS0A 2F7XE 3R63A 4DEEA 2W4KA 4YLLA 3KXXA 1NY3A 4X6QC 2WMUA 3TIZA 2ZV2A 4E26A 4FIFA 4BCNA 4KKGA 4GIIA 3BYOA 1OL6A 3G9NA 3EWHA 3QTUA 1UWHA 4IDVA 1YVJA 1KOBA 3OEFX 4V0GB 2R3JA 4CQEA 1HOWA 3MJ1A 2X0GA 4ZAUA 4BDEA 5I0BA 1KE7A 4X2JA 3FPQA 4AXEA 4USEA 2CHLA 3DZQA 4JBOA 3HGKA 4GCJA 2JKQA 4E5BA 5LVOA 4FNXA 4NFMA 2BFYA 1YOLA 2GQRA 4Y5HA 4C33A 3QLFA 2IJMA 3PY3A 1FPUA 4XLIA 5BV3A 3GNIB 4C4FA 3GFEA 3ZU7A 2YCFA 4G5PA 3F3ZA 4EORA 5BNJA 3R0TA 4A9TA 1Q8ZA 3DBFA 4FT5A 5IQAA 3GVUA 4C3FA 4LGGA 4AGUA 3VUGA 4XUFA 3QWJA 3O50A 3IECA 4QTCA 5HE2A 3JY0A 3ZTXA 4ZK5A 3SRVB 2C1BA 3NUSA 3KVWA 4RIWB 2WQOA 4JAJA 4AXFA 5CF5A 5E1SA 3TUBA 3TCPA 5CZIA 5CT7A 2WTWA 4GT4A 4KRCA 2VTIA 4FTIA 2BRBA 4WRSA 3AKKA 3QCQA 3QRTA 4LDTA 4YZNA 3R7IA 2BAQA 4PDYA 4ZTNA 1IRKA 3GC8A 3RCJA 4JIAA 4L8MA 4U45A 3BKBA 2F7ZE 3GP0A 1H1PA 3KGAA 4JRVA 4L7FA 4KAOA 4O84A 4PRJA 5CAVA 3FLSA 2WGJA 3QRKA 4F64A 3CS9A 4MBJA 3RM6A 3FWQA 2WMAA 4L01A 2J4ZA 1OITA 2ITZA 5EHLA 3NLBA 3JXWA 4NM3A 3UVQA 4EI4A 2WAJA 4NSTA 1LPUA 4ZJIA 4C0TA 1IAHA 4DEBA 2ONLA 1O6KA 5I9UA 4C61A 4FI1A 3RVGA 2FO0A 2RG6A 3GC0A 1JKTA 4FEVA 5LVLA 4AQKA 3F3WA 3D94A 3R01A 5CEMA 3E8EA 4D0WA 3JY9A 4ZZMA 3HMMA 3ROCA 2ITPA 4MAOA 4XCUA 4YPSA 5AUZA 2YACA 3DBDA 2OFVA 5AV1A 5A3XA 4C3RA 5JK3A 3A8XA 4G31A 4LRKA 2C0IA 2R3LA 2C5OA 3HRBA 4PMTA 4QMSA 2W1HA 2YM7A 1OB3A 3PE2A 3PP1A 4FT3A 4MKCA 2WTVA 4AXCA 2X2MA 5HBJA 3AC5A 3PY1A 3NNXA 4YHJA 4ZY6A 2C5NA 4M7IA 5IEXA 1J7IA 2C5YA 4JX7A 1SNUA 3LJ0A 2GNGA 3NNUA 4IJPA 1G8AA 1OI9A 2UZTA 3FI2A 4J95A 3PLSA 4OR5A 3T9IA 4UYNA 4M13A 4HVGA 3OWPA 3TEIA 4C59A 5LCJA 5JQ5A 4EOPA 3QHRA 5DN3A 3FY0A 3SRVA 4JS8A 1ZOEA 4KABA 2QOQA 1Q61A 4RIWA 5ACKA 3V6RA 3LHJA 4GYGA 5AP4A 3P4KA 2OBJA 2CJMA 4EHEA 3HMNA 3VHEA 1AGWA 3MN3A 5AAFA 4FTCA 2J7TA 4IC7A 4IWPA 4MHAA 5CXZA 5LVMA 2EB2A 1CMKE 3QTXA 4L9IA 4IWOA 3OT3A 3QUDA 2W5AA 4JI9A 3PG3A 4O7NA 4F78A 1PKGA 2IZUA 2WFYA 4YMJA 2VTTA 4L68A 2J90A 4DHIB 3VBXA 3UOLA 4KSQA 3V8TA 5FQDC 4FKSA 4D5KA 3KXGA 4TNBA 4HYIA 3ZDIA 3OCTA 5KMLA 4BY9E 3THBA 4MXXA 3Q9WA 2Y4IB 2W4OA 1T46A 2BZKB 1JLUE 1U5QA 1YXTA 2X7FA 1Y6AA 3ZYAA 3UYSA 5EM5A 2YCQA 4ERWA 4F0GA 2PZPA 4EH5A 5JFXA 3D4QA 4H3PA 2AUHA 3BLAA 4LMUA 5AM7A 5IUIA 5CTPA 2ZOQA 2JKMA 5BYYA 5IA4A 3KCKA 2X7OA 4FZ7A 4F9AA 2XK7A 1T45A 5E8ZA 5J87A 2WHBA 3EQBA 2OJ9A 3VNTA 5CSPA 1FVTA 4NW5A 1E1VA 4KS8A 5DFPA 5CASA 5JFWA 1DI8A 3DKOA 5BMSA 2W9ZB 1VLRA 4QMOA 3WF6A 2QG5A 4HNFA 4BIEA 3MYGA 3VBQA 1OL5A 3S2PA 5ETAA 3F5GA 3UP7A 4EK8A 1ZARA 4ZMEA 3VQUA 5TF9A 3OTVA 1OKYA 1K3AA 2C6MA 2J9MA 4OTFA 3WI6A 5FUTA 4TNDA 1UNHA 3UC4A 3ORMA 4BGGA 4DDGA 1WVXA 3E3PA 4XV9A 5I9XA 2XJ2A 4KUJA 5AJQA 4D58A 3LFFA 4PDPA 3QGYA 5M44A 3PP0A 4QP7A 5HCYA 4FKRA 3W8QA 2GFSA 5DG5A 4BGQA 2KTYA 1Q8YA 5KUPA 3QD0A 4U97A 3TTJA 3POZA 1L8TA 4ZS4A 2H9VA 2BAKA 5EK7A 2R7BA 5A4TA 3R28A 3SW7A 4A9SA 2OF2A 5CEQA 4MK0A 4HGTA 1M2QA 4KKEA 3QALE 3CTJA 1AD5A 1CDKA 4X3FC 1I44A 4XHKB 5HKMA 3WF9A 2ERKA 3HZTA 4Z7GA 1EH4A 2PY3A 3F7WA 5D11A 3WF7A 4E6DA 1E1XA 5GINE 3FHIA 1VJYA 4G34A 4YJNA 3GOKA 3NW7A 3AOXA 4WD5A 3L9MA 4CFUA 3B2WA 4BCKA 5LVPA 4XG3A 2P55A 4TW9A 4BTMA 4FTOA 2G9XA 3OWKA 4O38A 3RWQA 3GCVA 5J9ZA 1QPCA 4II5A 4K0YA 2J0IA 3ZXTA 3KRWA 3OUKA 3W2OA 2WOTA 3F3TA 4HGLA 2YAAA 5CSWA 5J8IA 3PXRA 3FPMA 3DFCB 3HL7A 3PXYA 4O91A 3QTSA 4TXCA 1GZNA 1ZZLA 3NDMA 5AUYA 2C69A 3BHUA 3A60A 4FSRA 4D2RA 1B39A 4BCIA 2UW7A 4DEHA 4O81A 2I7QA 5HORA 4Y85A 3G51A 4X7QA 4AN3A 1BYGA 5L8KA 3UDZA 4GSBA 4WG5A 3UDBA 5HHWA 2C6TA 2WXVA 2ZM4A 2IW8A 3C0GA 3BEGA 4HW7A 2R3GA 2XARA 4IAFA 2CCIA 4AA5A 1XH6A 1J3HA 4FA2A 4BIDA 5LCKA 3HKOA 4CFNA 5EW9A 5CZHA 4EYMA 5AUTA 2JKOA 4FTTA 3ZUVA 4RIYA 4FOBA 4FL3A 4X3JA 1W8CA 1MRYA 3ZZEA 3BYVA 4FGRA 2C0OA 2X1NA 4O21A 3KA0A 3ZC5A 4PDOA 5CF4A 1FOTA 3R30A 2CGVA 3PVUA 1G8KA 1TQIA 2YIQA 5EYKA 3ZRMA 3FMKA 3DJ7A 5HVYA 4W4XA 2IPXA 5BMMA 2PVMA 4U81A 3ZLSA 2XRUA 2BROA 2VWUA 3LMGA 3SXFA 4CT2A 4FZFB 3GXLA 5IQDA 2BDFA 3PZEA 3DK7A 3F2RA 4BN1A 5G1XA 4R1VA 3OUNB 1YWRA 4ITHA 2ERZE 3BGQA 3KB7A 2C3KA 3EKNA 3I4BA 2FSOX 3LXPA 3PJ1A 3TV6A 3UODA 4O6EA 4EH9A 2FSTX 4QMQA 4HYUA 3W0MA 5CT0A 2W1FA 4PY1A 5HO8A 2XRWA 3Q2MA 3VONA 1Y57A 5TT7A 4ALWA 4OBOA 4FTMA 4FIJA 1ZAOA 2C0TA 2JDVA 3VRZA 5J95A 2GHMA 2I0EA 4Q9SA 3PPZA 2PMNX 3W0PA 4MCVA 4EJNA 4UX9A 2C6LA 2QOCA 3FC2A 3P1AA 2QO7A 3QFVA 4OW8A 3RI1A 3TDVA 3BLQA 3TV7A 3ZBXA 5AAGA 3VULA 2VWXA 4H36A 3A8WA 1MRVA 2WMXA 4OTQA 3TG1A 4GG7A 4OLIA 4QQCA 1R3CA 5DNRA 3UO4A 3DA6A 3VAPA 4BC6A 4Z16A 2CNUA 3S4QA 2V7AA 4AOJA 5KZ0A 3UVRA 1GNGA 1WBNA 2F57A 2VD5A 4AX8A 3R8UA 4EZ3A 1Q62A 2R3OA 3FMHA 3NEWA 3OY3A 1KV2A 3R1NA 3R2BA 4E1ZA 4EC8A 3V8SA 5LVNA 5EG3A 2HXLA 5HNBA 4LOQA 2IVTA 4EH4A 5AFVA 3W2RA 2WZJA 5DT0A 3VS2A 4ZSGA 3NNWA 3SLSA 3BHHA 2PZRA 1S9JA 4XOZA 3DNEA 5D9HA 4NW6A 5EOLA 2YWPA 5TR6A 3SD0A 3WIGA 5K4IA 3NVKI 2JFMA 5FDXA 3MSSA 3NAXA 4D9TA 1PMEA 3EFKA 5FM2A 5BYZA 4IQ6A 1YQJA 4FSTA 1NT2A 3CQEA 5HCZA 3SG8A 4YURA 4CKJA 2YIYA 2ITXA 4JQ7A 4ANBA 3L8SA 5IQEA 3OWJA 3TNPC 5BUJA 4GJ3A 4U3YA 1ND4A 5AUWA 4DFZE 4F6WA 4FTQA 4O22A 4FTRA 4YNEA 2V7OA 3K3IA 2OIQA 3PSCA 5KHXA 4EH3A 3HV4A 4XH6A 4W4WA 3ANRA 4GK4A 1IEPA 5FRIA 4K8AA 3VW6A 3V04A 4JQ8A 4QMTA 2WOUA 2NPQA 5KKRB 4JR3A 2ZV9A 3R7UA 2OJFE 5L6PA 3ZFYA 2ZVAA 3HA6A 4XG4A 2RFDA 3PE1A 5CEIA 5L3AA 5IA1A 4I6FA 1JNKA 4RWIA 2G2HA 3QYZA 4LL0A 4J1RA 4LYNA 5HNGA 2X6DA 1PMUA 5EDQA 5CAUA 5IDNA 3VBWA 4EEVA 3QUEA 5EM6A 3PJ2A 1LUFA 4FODA 4MBIA 3MH0A 4IAIA 3ZM4A 1Z5MA 1XMMA 5CI7A 5L2IA 3GB2A 1BL6A 1OUYA 4KSPA 4YPDA 1BI8A 4IAKA 5LJJA 3JPVA 1HCKA 3QQHA 4J7BA 3COHA 2J50A 3KRXA 3RALA 5BVKA 3QCXA 5CAPA 3IPHA 1PXNA 3MFUA 2J5EA 2A19B 1H08A 3O0GA 4GG5A 2UV2A 4U43A 5LARA 3V5PA 1YHWA 2BZIB 3OY1A 3WF8A 3P5JC 3LJ2A 1WBPA 4X0MA 3EQFA 4ZLZA 5I9VA 1OL2A 2QURA 3DJ6A 4QMWA 1PXKA 3NUUA 1WBSA 4ZJJA 4O82A 1JSVA 1UNGA 3NYOA 4BCQA 5K5NA 2GS6A 4FEUA 5AIRA 4FIEA 4MEDA 2OO8X 3DXNA 1UKHA 2SRCA 4YBKA 3U51A 5HG8A 5HE1A 3KK8A 3KFAA 4FNYA 1KV1A 3DXQA 5EM8A 3PA4A 4EBWA 3ORTA 3ENHA 3FHRA 3BZ3A 3BE9A 3I6UA 4R3RA 4C2VA 3ITZA 3K2LA 4FIIA 3EQGA 4XP3A 4FT7A 4NCTA 3TNWA 3F5UA 4CSVA 2ZMDA 4QP9A 2PVNA 4FVRA 3IDBA 3KRLA 4FZAB 2JIIA 3VUHA 1XWSA 3ORNA 4FTAA 3WF5A 1UNLA 4HPTE 5CQWA 4ITIA 4TRLA 5L6WL 5J9YA 2VX1A 3TJDA 5HX6A 5JQ8A 3QL8A 2YCRA 5KMKA 4CKIA 3GC9A 4QMMA 3CQUA 3Q9XA 3SXSA 5I4NA 4MXOA 4OUCA 4RC3A 5C03A 3DZOA 2NNWB 2IW6A 4PF4A 1A9UA 1WMKA 3F3UA 4BYJA 2C1AA 1OKWA 2IG7A 3ENMA 4QEBA 2Y9QA 4AT4A 3ATSA 4RVMA 1J7UA 2UZUE 4S31A 3V6SA 3EFLA 3QQJA 1Q99A 3ZO4A 1V0BA 4JVGA 3ZDUA 2BMCA 2XYUA 3GI3A 2ITVA 4ZMFA 2XKFA 5A4QA 3H9FA 5IQHA 1WBVA 1V1KA 3FXWA 3KRJA 5HU3A 3AC8A 4GUBA 5BVEA 3FMMA 4RWJA 4I20A 5CU2A 3CGOA 4EWHA 4FSUA 3KF7A 2VWZA 2YITA 3MGYA 2XEYA 3TZMA 1A06A 4AQCA 4UZHA 4ACGA 3FLWA 4F1MA 2VRXA 4WBBB 3Q5ZA 3VIDA 1RJBA 4IZAA 4DLIA 2B52A 1F5QA 4CFXA 1UU3A 3BCEA 3PJ3A 3EQHA 1W0XC 4BKJA 1JSUA 3KQ7A 4GK2A 5HTBA 1WAKA 5EYMA 4AW5A 2XH5A 3ROYA 5C26A 4K77A 2R3KA 4RA4A 4MF1A 3VF8A 2Z7SA 2BVAA 2HWPA 2PE2A 2C68A 1OPKA 2RGPA 2Y8OA 1W84A 4RVKA 4YTIA 5A6OA 4EH2A 3CD8A 3COKA 2OF4A 3F2AA 5K3YA 1CM8A 3E88