4DE4A

Crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with hepes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
molecule keywords APH(2")-Id
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4de4A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4de4A02
1PXPA 2EXMA 4KA3A 1BKXA 3MN3A 5HO8A 3TJCA 2PHKA 3R7OA 2ACXA 3SGCA 2J4ZA 2ZM4A 5A4QA 1Q8YA 5BVOA 3HYHA 4HZRA 4BI2A 5J5SA 3SQQA 5EDPA 4Q9ZA 3AC2A 3RAIA 5F20A 4C58A 3BWFA 3HMOA 2H6DA 2WMWA 3ZRKA 2ZDUA 2RKUA 3MH0A 4E6AA 5ICPA 4B7TA 3MGYA 2YM7A 5IEVA 5JGAA 5CSHA 1Y6BA 2YEXA 3COMA 5B2KA 3BE2A 4G3FA 3VF8A 4IAFA 3OWJA 1KUTA 1MP8A 3QQKA 4ZK5A 1OECA 3JY9A 5HNGA 3VW6A 2GHGA 2UZTA 4C3RA 2WTJA 4FV6A 2R3MA 3U8WA 2G2IA 3VHKA 3E64A 3LPBA 1BL7A 4CRLA 1WBPA 3H9OA 3L1SA 2WPAA 4KS7A 3R8MA 3R0TA 4TWNA 3KVWA 4JNWA 2X81A 3NSZA 4DEBA 2QC6A 2V7AA 3KEXA 5M57A 3JY0A 3OG7A 4OTWA 3CR0A 5FEDA 2PVKA 4L8MA 5M56A 4A9UA 5HE0A 1NVSA 4FIFA 2C30A 4F7SA 1R0PA 4YP8A 3CPBA 5AX9A 3LCKA 5CF4A 4FGRA 4AE6A 1JNKA 4DFNA 3BV3A 3GCUA 3PZEA 4Y8DA 2JEDA 4GIIA 4F0FA 1PJKA 2XCHA 3UQFA 3W2OA 1UVRA 4LMNA 3TNWA 4QTEA 5E8UA 3R04A 2R3JA 4GT3A 4FKRA 2YDJA 4XOZA 4BI1A 1W82A 3SKCA 3W0PA 2QONA 4NM3A 4O7TA 3OMVA 3GXLA 4OTIA 5A9UA 1PF8A 1XH4A 1UNLA 2HENA 5AV3A 3R8ZA 2UZEA 3H4JA 5AP5A 3E7VA 4BDGA 4DITA 4DT8A 2IVUA 4H3QA 2IWIA 2AC5A 4F7LA 3A7JA 5T6KA 5F95A 3W2RA 4JLCA 4U97A 4YZDA 5HZNA 3V8SA 2XRWA 3Q53A 3LQ8A 3TUBA 2I7QA 4KSPA 5CT0A 3O23A 4HOKA 4U3ZA 3VC4A 3PA5A 1K2PA 3W0MA 3ZMMA 3IOPA 5K4JA 3BYMA 3UYSA 1OB3A 5DR2A 3AC8A 4UWYA 3FLSA 3NYNA 4O22A 3IS5A 3KGAA 3Q4ZA 3QQJA 2X2LA 4CMOA 5IPJA 2R3RA 5DRBA 2WFYA 5KUPA 1PXMA 4OR5A 4LGGA 4E20A 3SXSA 5IA2A 2E2BA 3E88A 3RI1A 3QCQA 4IAAA 4NKAA 3P4KA 4FNXA 3TKUA 2Z8CA 3DPKA 3OY1A 3QUDA 1LPUA 3IW5A 2X7FA 2J0KA 4RLKA 2BCJA 3D5WA 2QURA 4I4EA 2PMOX 4LL5A 5HCZA 5BUEA 1XBAA 1YXSA 2ZB1A 1H27A 4RZWA 4ZZNA 2C3LA 2OIQA 3DKCA 4HCTA 2QKRA 4EYMA 3GENA 3O7LB 4IMYA 3OS3A 3SVVA 2X4FA 3RJCA 3BGQA 3VUGA 3DBDA 4L43A 5JMSA 4IWQA 3JVSA 4WUAA 2WIPA 3H0ZA 2BRNA 2QOIA 3O8PA 3WF6A 3LJ2A 4USEA 4C37A 2GS7A 2Y6OA 3BLRA 2FSOX 4W4YA 5AIRA 3Q2MA 2P2HA 3FZ1A 4QPAA 4RFMA 5CZIA 2JKKA 2OXYA 3CBLA 4AQCA 2X9EA 4ASXA 5IA1A 3GC9A 5LMAA 3IW6A 4TY1A 3KXGA 4FTOA 4MWIA 4HVIA 4FR4A 4BYIA 4DGOA 4PNKA 3EQFA 3OVVA 1FVVA 3VS1A 5TOZA 5EDRA 3RCDA 3ULIA 3PY0A 4JRVA 3KCFA 3DU8A 3GU8A 3NR9A 4OGRA 4BGHA 1GJOA 3DXNA 1YWVA 2XNMA 4WA9A 3AMBA 3JUHA 3FBVA 5CEQA 3Q4CA 5FTQA 4EOIA 5CU4A 2G2FA 4ZTNA 5IQCA 4NM7A 4OTRA 2WD1A 4U80A 4YU2A 1LP4A 4RA4A 2J0IA 2VV9A 3LXNA 4YC8A 5JGBA 2GNFA 3F3TA 1YHVA 2UVZA 4AW2A 4CQEA 3MS9A 4DEGA 3OCTA 4BCHA 4U3YA 4X2KA 4YO4A 2IW9A 4PMSA 4QP1A 3FUPA 2W7XA 3DFAA 4OW8A 2C1AA 2VX1A 2Q83A 2YISA 4DGNA 1Q24A 4ZTMA 2BZKB 2B55A 3HV4A 5HTCA 5JK3A 4G16A 4ZS0A 2PE2A 5E8WA 4JJRA 1W7HA 4RWKA 5CTPA 4P4CA 4TPTA 4F9AA 5EYMA 1G5SA 1Q3DA 3GCPA 4E73A 4FOCA 3FMDA 1KE6A 4QRCA 4AW0A 4GT4A 4MHAA 5F94A 4PX6A 3UPXA 2XYUA 3KQ7A 4IDTA 2YJRA 4IAIA 2W17A 3WF5A 2C6KA 2REIA 2W05A 3TNQB 2XIXA 4EHVA 3I0OA 5AA8A 4IM3A 4I5PA 2GMXA 4RJ4A 4Y72A 4O0UA 4CCBA 1WAKA 3IQ7A 4RQKA 3R9OA 4A9SA 5IZFA 3R00A 4H58A 2VWIA 5HVYA 4TRLA 2OICA 2E9UA 3SV0A 3KY2A 4CNHA 1SVGA 4IB0A 4QYYA 1PMVA 5HG8A 3U87A 2Z7QA 4MBLA 5IQDA 4IJ9A 3RZBA 4E6CA 4HVDA 1U46A 1XH9A 2PUUA 3F69A 3R71A 4WZYA 1YI4A 3OD6X 3C7QA 4RGJA 4UYNA 4CZTA 4TKSA 3DBQA 3DBEA 5IA5A 1FOTA 3FLNC 2JIVA 3RALA 2BIYA 2OIBA 3HDNA 4KIQA 4ZAUA 2HW6A 4QTCA 5TO8A 4DLIA 2B54A 3OUKA 2ZB0A 2QQ7A 1UU8A 2Z7RA 1PKDA 3F3UA 3CLYA 4NIFB 3KF7A 4WKQA 4DBXA 4H3PA 1OMWA 3T9IA 4ANQA 3CXWA 4IZ5A 2JBPA 4F0GA 4MXXA 1YRPA 3RTPA 3SHEA 4EOMA 4RC2A 2CSNA 2UVYA 4R7HA 3MIAA 4RIOA 2UZUE 3EFWA 3KRRA 3LHJA 3VBXA 4PDSA 3M42A 1FBNA 4QMZA 4XJ0A 5ANKA 3WILA 2V62A 4IVBA 4EK5A 2DWBA 4IB3A 4O7NA 4PY1A 5IDPA 3Q32A 3TV7A 2XNPA 4J98A 3QHRA 4UBAA 4FKPA 2J50A 2UW4A 4O6EA 2X39A 3ALNA 3U9CA 3EH9A 3CC6A 3R2BA 3CJGA 4KUJA 4RIYB 3BHVA 1S9JA 3SAYA 3VUDA 4L7FA 4B9DA 4QQTA 3QD3A 4NZWB 3HKOA 4ZY4A 1Q62A 3LVPA 4JQ8A 1E9HA 4GK2A 4O82A 4XG2A 3UOHA 4IM0A 4TL0A 3RK9A 3VS0A 4C33A 2I0VA 5LWNA 3EQDA 4YSMA 5J95A 3EQPA 1KV1A 5JRQA 1J7LA 1NW1A 2NRUA 5HTBA 4IAKA 5IQEA 4O0VA 4E93A 3FI2A 3D15A 4ZP5A 5CEKA 3MV5A 4X2NA 3D0EA 1LUFA 2FSMX 2R3LA 4XG7A 3NUYA 3QF9A 4XLIA 2Z60A 4OTGA 4JG8A 4J99A 4FTJA 3UVQA 4O6LA 4RQVA 3F5UA 2BAQA 2PZPA 3LXKA 4IC8A 4YJSA 2WMRA 2QU5A 3GU6A 4C34A 4D58A 4IFGA 3FLQA 3PIZA 5M08A 3K5VA 4ZTQA 2YJSA 3MH2A 3DJ5A 3OY3A 5DT4A 5M4FA 4I6BA 3FXXA 2HY81 3NYOA 5DIAA 3DY7A 3P08A 3QUPA 2B9JA 3FYKX 3IDBA 3DZQA 2P33A 2Y4IB 3G90X 2IZUA 3F5XA 3PG1A 3R6XA 4B8MA 2WOUA 3ACJA 3BU5A 3WOWA 3OWLA 2CCIA 3TTIA 3DQXA 4EUUA 3FZOA 1W8CA 4QP8A 1RDQE 4WIHA 2G9XA 4FKWA 5IA0A 4NSTA 3AD4A 4FA2A 4MNEA 2ZM3A 4O7RA 1OKWA 4RA5A 3F88A 4MKCA 2OI4X 5HQ0A 3PRIA 4GW8A 4EH3A 3SA0A 3NZ0A 3KL8A 3KRLA 5HE1A 5FGKA 2XEZA 3R1SA 1OIQA 4RX9A 4U45A 4ASZA 3IK3A 2CKOA 4RWJA 2FSLX 3I5NA 1NVRA 2XJ2A 3VUKA 2W96B 4AXAA 5KKRC 4WNPA 4AGWA 3JYAA 1U5QA 3D14A 5L2TA 3R7VA 3KRXA 3FWQA 2BZHB 2UVXA 3EFJA 5C8KA 4AX8A 5H8GA 5EQYA 2R0IA 5ETAA 3NWWA 5LCJA 4ACDA 2OJ9A 4X3JA 3ZOSA 4OBQA 5BYLA 3RKBA 3QTIA 1CDKA 2GTMA 4PL3A 2W1DA 3TZ7A 1IAJA 3ZBXA 3FI8A 5HCYA 4BHNA 3EB0A 3ZSHA 3NUXA 4AZFA 4F7JA 5IH5A 2PMLX 1IR3A 2VWVA 3V5PA 5G1XA 3EQHA 5CASA 3DXQA 4PRJA 2WEIA 3EYGA 3GP0A 2JLDA 4CMUA 4RT7A 2EB3A 5AUTA 4YLLA 1ATPE 1UKIA 1H1PA 3POOA 4CT2A 2PMIA 1WCCA 3OT8A 4M14A 5FBOA 3W0OA 5H9BA 5HLNA 3AMYA 2O0UA 4FT5A 3VWAA 2XJ0A 4H1JA 3ID6C 4PP7A 5EOBA 4O7OA 3P7BA 4O84A 2Q0NA 3UQCA 5CNNA 2RFNA 5EHOA 3F3WA 3L8PA 4FEVA 5CU6A 4BDEA 4J8MA 5EYKA 2XK8A 3RMFA 3LMHA 4WRGA 5DLSA 5CEOA 3QLFA 3EQRA 2QLQA 4LM5A 4YGAA 4DGGA 3BGZA 4O38A 3KREA 3V5JA 3NNVA 4LQMA 2JIUA 4TYJA 4R3CA 4JOAA 5I9VA 4LRMA 4G2FA 4JX3A 4ARKA 2CPKE 2PVYA 2OK1A 2F2CB 1YI6A 3HEGA 3Q6WA 2OIDA 5FEEA 3RK5A 4L46A 1OUKA 3EJ1A 4M12A 4I93A 1Q4LA 5AV1A 4IX6A 3HA6A 4FKTA 2OF2A 1ZMUA 4QMLA 1WBOA 4BICA 4P5ZA 4ACCA 2Q0BA 3EN5A 4H36A 3D7TB 3BU6A 4KKGA 5CVGA 2P4IA 4UX9A 2HIWA 4JAIA 5AAFA 4XHKB 5K5XA 5EW8A 2F4JA 3V5WA 3DK6A 3OF0A 4ZY5A 3RK7A 5KMNA 1Y6AA 4FTCA 3HUCA 5L6WL 3HNGA 4ITIA 4ZOGA 5EI2A 4N4SA 4PDOA 3UTOA 2GS2A 2OBJA 4OLIA 4J1RA 3VBYA 5IQHA 3F5GA 4FT7A 4QMYA 2R3NA 3FMNA 3GOKA 3N4UA 5KZ0A 4RX5A 4UYAA 2PVRA 3LLTA 3WZKA 4CEGA 3IGOA 1UU3A 2XCKA 3FPMA 3NNUA 4DBNA 1ZXEA 3Q4UA 3E5AA 5GJFA 5M51A 1H00A 4L42A 5LMKC 1YXVA 2R3GA 4TWOA 3ZBFA 3N9XA 2KTYA 2VWYA 4FI1A 4MXOA 4RX8A 1PW2A 3F5PA 5FQDC 4EOPA 5L2IA 3A4OX 3NW7A 4OTQA 3VS4A 1URCA 1Q61A 4IZYA 4NU1A 3CKXA 3CEKA 4I22A 4QNAA 4RMZA 3UMXA 4CLIA 5JFXA 1NXKA 2QCSA 4M67A 4UWCA 4YPDA 4Z3VA 2I1MA 4P7EA 3KN6A 3HRCA 4KNBA 3QZIA 4NT4A 5IA3A 2ONLC 3BWJA 2XK6A 3GFWA 1PHKA 2WHBA 3UZRA 3EL7A 4XYFA 4WG5A 3W32A 1H25A 3WF8A 4DTKA 4KS8A 4IVAA 3BEAA 3NCGA 3TT0A 5HGIA 4WOVA 1ZYDA 4F6WA 1G8SA 2C5YA 3DB6A 4QYHA 4XX9A 3GNIB 2XP2A 5HIBA 3RP9A 1TQMA 2IG7A 3NIZA 1B38A 1PXIA 3NGAA 4FTMA 4FIEA 2BDFA 3E8CA 2WTVA 2YITA 4YURA 3M11A 2FGIA 1APME 5TKDA 3HMNA 3G0FA 3F66A 3R7EA 2PZ5A 4BZNA 5AUVA 4CFMA 3QBNA 3KRWA 5IG1A 4I5HA 3LFCA 2BR1A 3IW4A 3UZTA 4RX7A 5DEWA 3VO3A 3W1FA 3MJ2A 1YVJA 5CT7A 4KBAA 1YOMA 1SVEA 2FYSA 3FHIA 4FSWA 4K6ZA 4BF2A 5AM6A 4D0WA 4ITJA 4CKJA 2GHLA 3I6WA 2W5AA 4GIHA 5FRIA 4ACHA 1RE8A 3BZ3A 4O0TA 1H1WA 3PJ3A 2H8HA 3BHHA 3SW4A 4S33A 5LJJA 4O21A 2G1TA 3AT3A 4IWOA 2AC3A 2FVDA 2R0UA 4G17A 4D4VA 3UNKA 5C27A 5C4KA 4OTDA 3A7GA 3H10A 5G6VA 4QOXA 1S9IA 3F3ZA 1OPLA 2WTKB 4Q9SA 1YDSE 4ZTLA 3E63A 4LG4A 4C4FA 5J7HA 2ZM1A 2DS1A 1QMZA 2GQGA 3G0EA 4YZ9A 5ANIA 4BCKA 3BELA 1CKPA 2CDZA 2V55A 3BV2A 4JBVA 5DA3A 3DQWA 1P4FA 2EWAA 2GHMA 3CTJA 3G2FA 5I9UA 3SX9A 4BVUA 5J8IA 4L00A 4CD0A 3WZDA 5CXZA 2WMBA 4FSYA 5AV2A 1AQ1A 3UZPA 3DLSA 5EQEA 3KK9A 5IA4A 2BTRA 3D5VA 4V05A 2XB7A 4R5YA 2HXLA 5EM8A 3TV4A 3W10A 3IO7A 4NJDA 1WVWA 2FO0A 4FUXA 3W18A 1ZZLA 4CFVA 1URWA 5FM2A 5AP3A 4BHZA 3QD0A 3ZS5A 2QOHA 4GG5A 1P2AA 3NIEA 4CKRA 5HVJA 2IZTA 2W5BA 5E8XA 1IASA 1Q41A 3QX4A 5D1JA 4PWNA 5I4NA 2ITXA 4FC0A 4QMVA 4L6QA 3D83A 5HBHA 4V0GB 4S2ZA 3DJ6A 2OU7A 2C47A 3O71A 3PLSA 3RPRA 5DNRA 3COKA 4IM2A 1GNGA 2CNVA 2OW3A 3QQFA 2B0QA 3HX4A 3T9TA 4FX3A 3UBDA 5BNJA 3DGKA 2BKKA 1B39A 4RG0A 2ZV7A 3QKMA 5CQUA 5IEYA 3I7BA 3NCZA 4ANLA 5M55A 2X7GA 2HWOA 3PPJA 4D5KA 1FGIA 3BGPA 2BUJA 2OJGA 3KULA 3PIYA 4FVPA 4AZVA 5IH6A 4G6NA 2QO9A 2XKDA 4GEOA 4P2KA 1BUHA 3ZU7A 2WQNA 5HIDA 5M07A 3CGOA 3VJOA 4MF1A 3OEFX 3T3VA 3WI6A 4O96A 4JQEA 3V51A 3ZM4A 5DT0A 4HZSA 2JKOA 4NW5A 5GNKA 4D0XA 1GZ8A 1QPDA 3DAEA 4A4OA 4AFEA 1VZOA 5E90A 3NAXA 4AG8A 5DYJA 1OZ1A 2YWPA 3LFNA 2I0HA 5AP0A 4XP3A 5CQWA 1OL7A 5B0XA 2XUUA 4DFXE 5TR6A 3ZFMA 4KAOA 3A99A 1PXJA 1YKRA 3LFFA 5JKGA 4DG3E 3FMHA 4B6LA 4FKQA 5AJQA 2Z2WA 3F61A 1IG1A 1XH6A 3ORMA 4P90A 2UW6A 1NT2A 2CGVA 5CX9A 4YHFA 3NVMB 4G3CA 4FTQA 3PA4A 5E9EA 2B4SB 2GS6A 5C8NA 3BI6A 4WUNA 4PP9A 3GGFA 2JDVA 2UV2A 2E9OA 3GQLA 3N51A 2B7AA 3ENHA 1U54B 5CS6A 4E4MA 3QQUA 4EOOA 1YXTA 4IBMA 3HV3A 4O83A 4RC4A 1PRYA 2QODA 2VAGA 2VWXA 2JDRA 4G9RA 1YHWA 4YTIA 4DG2E 4HYHA 5K3YA 2ESMA 4IB1A 2I0EA 3VIDA 1PXNA 4W4WA 5GINE 4G1WA 3ZLYA 2IO6A 3IPHA 4FKUA 4E6DA 3SXFA 4W4VA 5HG7A 3S0OA 3LZBA 4LRJA 3NUSA 3FZSA 4NJ3A 2XF0A 4PL4A 3OFMA 2JAMA 4KIPA 5BMSA 4DFUA 5LVMA 5KBRA 2IVVA 3NUAA 2QNJA 2YA9A 2NPQA 4U7ZA 4XG8A 2DUVA 4NFMA 2CGUA 3F7ZA 3QRJA 3RM6A 5IEXA 1YXUA 4WBOA 5IISA 5ANOA 4ALVA 2ZV9A 4TWPA 5IQGA 3FMMA 2ZOQA 5HKMA 1T45A 4CRSA 4R6VA 2QOLA 2G2HA 4FGBA 5T3QA 2PVNA 2BMCA 5BVDA 2VTRA 4AA4A 4U0IA 3P79A 4IZ7A 2WELA 5AAGA 3W16A 4NCTA 3QZHA 3ORTA 4XH6A 3U51A 4KB8A 4M7IA 4WNMA 2VTMA 3D7ZA 3DOGA 2YN8A 4XV1A 4D1ZA 2VWUA 4KBKA 5IMEA 2V0DA 4AT5A 4KD1A 3O8TA 2PMNX 4H3BA 4AF3A 4UB7A 4ANBA 3AQVA 4BTJA 2C0IA 3NDMA 4A07A 1UWHA 1H4LA 3FQSA 4LGHA 3MB7A 5ANGA 3WF7A 3SLSA 2AUHA 5H8BA 3W2CA 2ITUA 4S32A 4F6UA 5J1VA 3OWPA 1LEWA 3BBTB 4MNEB 5AM7A 3VBVA 4BDCA 3CS9A 2HZ4A 3MFTA 3C4XA 4PNIA 3ZC5A 3PVWA 3AG9A 2OSCA 3ZLXA 3AXWA 1FPUA 3VF9A 1R78A 4OBPA 3C5UA 2B53A 1JQHA 1R1WA 3EWHA 3C4FA 4EZ7A 3PVBA 4NFNA 1OBDA 2W1EA 3ZONA 4EHGA 3TUDA 1HCKA 1XBBA 4F65A 3ATTA 4X21A 5CEIA 4O7PA 4GS6A 4GV1A 4GH2A 5I0BA 2RFSA 2J6MA 4ERKA 4RC3A 3R30A 1H1QA 4IC7A 5HO7A 4ZZOA 3HV6A 2Z7LA 2OJIA 3WIKA 3MVJA 5A6OA 4IADA 3QKLA 2UW8A 5E1EA 2O5KA 3UO4A 3TZ9A 3UVRA 3QGWA 4JBQA 3COHA 3FSKA 3EHAA 3NYVA 1P5EA 2ITZA 4XCUA 4RIWA 3ZRLA 4YTCA 3FMEA 3EL8A 2CGXA 2R64A 1X8BA 5IUIA 3QCSA 3RWQA 2CGWA 3M1SA 3VQUA 2YM8A 1JLUE 3UIXA 3S00A 3KXHA 2HY0A 2OO8X 1M2RA 2O63A 3E87A 4MQ2A 4FT9A 3DDQA 2WNTA 3BYUA 4BDKA 4EUTA 2YM5A 3FKNA 4FK6A 2J51A 3BE9A 4FV4A 4ONAA 1WVYA 1YI3A 4IANA 3FY0A 2UW5A 5M4IA 1SNXA 1E1XA 1W83A 5CAOA 2IW8A 3OW3A 2RG5A 4PUZA 3GCVA 3FZPA 2C69A 4M97A 3OC1A 1QPJA 4Q5EA 2GNLA 3OCGA 2BFYA 2ITOA 3KC3A 3U6JA 1G8AA 1PYXA 3GUBA 4O81A 1SM2A 5HBJA 4AUAA 5AMNA 4FTUA 4U81A 4G5JA 3QWKA 2PUIA 4FG8A 4QTDA 3MVHA 3TTJA 2VTQA 5A3XA 3LFQA 2VTIA 4IB5A 4HVSA 3DTWA 3LKMA 2P2IA 3HGKA 2YZLA 2UUEA 2J0LA 4HGLA 4E4NA 3PXKA 4NKSA 3CTQA 2HAKA 2E9VA 3GC8A 3K54A 4JXFA 3PXQA 3RPSA 3IW8A 3D4QA 1W98A 2PWLA 4TYHB 1UWJA 1FVRA 3Q5IA 3ORIA 2V22A 3I60A 4ZMEA 4WRSA 4RVLA 3G6HA 3Q5ZA 2PU8A 4GKIA 3ZO3A 3Q96A 1GZOA 4EK4A 4CMTA 2C6LA 4IEBA 4DH8A 3G15A 3SG9A 4EHEA 3FY2A 4ZLOA 3LMIA 3B2TA 4O2ZA 4QMOA 3KF4A 3HRBA 5L3AA 4EKKA 5HU3A 2X2MA 4UXQA 2QR8A 4YMJA 4AOJA 3O8UA 4L53A 4LUDA 2C5NA 3DBFA 3PSCA 4AAAA 4LRKA 4MYGA 1H26A 2W9ZB 5LVPA 3ZHPC 2PVFA 4BDJA 4IWDA 1M17A 4IAYA 5L6PA 4I21A 3K3JA 4BCFA 5LARA 4JS8A 1XBCA 4TWCA 3QRTA 1JBPE 3DK3A 5F4NA 3V3VA 4OTFA 3ZSGA 3LJ0A 4O7WA 1IEPA 2WMTA 1F3MC 3RHXA 2V7OA 4O91A 3TG1A 4LV8A 4CGAA 1STCE 2OWBA 3E92A 2UZDA 4KIOA 3RWPA 5EYDA 3OW4A 4N6YA 4APCA 2XEYA 2JKMA 3R1YA 4DE4A 4R78A 3KFAA 2QKWB 3DS6A 4FT0A 2VX0A 4BBEA 3O2MA 3HRFA 3NAYA 1ZMVA 2WOTA 3W2SA 3WF9A 1WBNA 4FKGA 3N4TA 4JT3A 3UO6A 4C2VA 2B9IA 4EBVA 4IDVA 2QO2A 3DCVA 4BIBA 4USDA 2XNBA 3U9NA 4A9RA 4E5WA 4KBCA 2OXDA 3PXFA 3BHTA 2CN8A 1YXXA 3BHYA 4I5CA 1YOLA 5D11A 3Q9XA 2DYLA 2YFXA 3OXTA 4G3GA 5A14A 4RIYA 5CAUA 3V6RA 3ZXTA 5HCXA 2OZOA 3EN7A 2XNOA 2F7EE 3V5QA 4BCGA 3MW1A 4RVMA 4ERWA 3ORKA 3PA3A 1TQIA 4QP9A 4EL9A 4FT3A 4QTAA 5K9IA 1P14A 2BILB 3C4ZA 3TYKA 1JPAA 2JFLA 3OBJA 4FSTA 4AOTA 3D5UA 4ASEA 2GDOA 3FZTA 2XKFA 5D7AA 4Z7GA 1Z5MA 4RJ7A 3SOCA 4FTRA 4MQ1A 2WAJA 3M2WA 3BHUA 2C6MA 1BMKA 4O7VA 3R8PA 2FA2A 3S1HA 2OFVA 1JSTA 4PMMA 4JI9A 5DOSA 1Q3WA 4R77A 3S95A 3BX5A 1KE7A 3IKAA 3MVLA 4FEUA 1ZYSA 3T8OA 5LXMA 1IRKA 4O0YA 4IX4A 4FZ6A 4YHTA 4QMNA 3FC2A 3GU4A 3WBLA 5CSPA 4X0MA 2R9SA 2W1ZA 1QCFA 3HL7A 3NW6A 4FTTA 4BBMA 3K3IA 5DEYA 2ETKA 5E91A 4F4PA 3V8TA 3EKNA 1KOBA 3PSDA 4FMQA 3DK7A 1UA2A 2CN5A 3MH1A 4YJRA 3LW0A 2QOOA 1H8FA 4XEYA 4X2JA 5CF6A 3KXNA 3GC7A 5HLPA 1SYKA 2ETMA 4BY9E 1KV2A 3SG8A 4J8NA 3UP7A 4D1XA 3W0RA 2CLQA 1G3NA 3P9JA 1SVHA 4XRLA 4YZCA 4ZSGA 5BUIA 2XBAA 4FSQA 1VR2A 3HZTA 4FV2A 2XKCA 2WGJA 3HV7A 3F2RA 2VD5A 4S30A 1KE5A 3R73A 5JFWA 5EI6A 1ZYJA 3QLGA 4B8LA 1FVTA 3VUIA 3ZTXA 1KSWA 3UDBA 3ZCLA 4IFCA 4RJ5A 4DFLA 3DZOA 2IW6A 4K1BA 5J9YA 2UZOA 5EDQA 4MCVA 4RZVA 4CKIA 3KRJA 4N57A 2BDJA 4TN6A 3G51A 2IVTA 1JKKA 1PXLA 2VTLA 3B8RA 3CP9A 4FVQA 3TEIA 4AZTA 5C4LA 5I9YA 3MPAA 5IMXA 3TDVA 3VAPA 3G33A 2O65A 3P23A 1Y57A 3C50A 3MTLA 2G01A 1KOAA 5C8MA 4OBOA 4AN3A 1Q97A 2C0TA 3WZUA 3KMWA 3UQGA 5HE3A 4YTHA 3R01A 4EOLA 4F9CA 1Y8GA 3TIYA 5A46A 3E62A 2C3IB 2PL0A 3QA8A 2EVAA 2X8EA 2VRXA 4HGSA 5DT3A 2XS0A 4FYOA 5DN3A 5JGDA 3UOJA 1JVPP 1DI8A 4JQ7A 2HWPA 4BYJA 3F82A 2CHLA 4DA5A 5DR9A 4GK3A 3FE3A 1UNGA 4U41A 5BYZA 2LAVA 5FLFA 4BGGA 4KRCA 1KWPA 4JG7A 3I5ZA 3W2PA 4O7YA 4LYNA 3QRIA 4OT5A 4V04A 3R7UA 3LFEA 3LMGA 2UZNA 2HXQA 1F5QA 4D28A 4NW6A 4F70A 4DF3A 3DNEA 4FV9A 4MBJA 5H3QA 2ZV8A 4C61A 2PE1A 3H9RA 2WXVA 3UIBA 1TKIA 4Y5QA 3AGLA 4HGEA 5IUGA 2Y6MA 2Y7JA 4UV0A 5CAVA 5ANEA 3NNXA 4J52A 4QTBA 3VW8A 4RRVA 4APPA 5C03A 3FXWA 5I9ZA 1AGWA 4I23A 2C1BA 3R8LA 4RWLA 4U5JA 4EORA 4KINA 5HNIX 3D2IA 4I0SA 4OT6A 2YHVA 1YDTE 1Q99A 4IH8A 3VUMA 3FZRA 3ZO4A 2JDOA 3WZJA 3FAAA 3I81A 1A9UA 3O7LD 4LV5A 5JSMA 3ELJA 1JKLA 4UY9A 1Q8TA 2Y4PA 2WTCA 3ZZWA 3FYJX 3FQHA 4MXAA 4FKSA 5L8LA 3AD5A 5HEZA 4R7BA 3V5LA 3R9NA 1PY5A 3NNWA 2XRUA 3ZC6A 4CFWA 4MK0A 5AP6A 3HUBA 4ZTSA 5CU3A 5HBEA 4JDIA 3P5KA 3ZZEA 3OCSA 4GYIA 3I79A 3DAJA 5CLPA 5AUXA 3UNJA 1MQ4A 4F9YA 4FIIA 4J96A 4EBWA 3MY1A 5AADA 2YZAA 3GEQA 4K77A 4EONA 3P7CA 4MXCA 4D55A 4B4LA 5FDPA 4U94A 3LJ1A 4DINA 5E1SA 5KKRB 2KULA 1K9AA 1H07A 4XV9A 4BDIA 4L3PA 3ORLA 4LUEA 4XOYA 5KO1A 5ACKA 4FV3A 4E1ZA 4EJNA 4PQNA 4QMSA 5EFQA 4U42A 4DYMA 3ORNA 1R39A 2XNNA 4Q2AA 4FG7A 5TT7A 3UE4A 4RJ8A 2XIZA 3ZO2A 4E4LA 3UP2A 1XQZA 3W0QA 4F7NA 2VU3A 2X0GA 3VULA 4C7TA 4ZSAA 2Y9QA 3LXLA 3MB6A 2W5HA 3QYWA 3THBA 4CXAA 4A9YA 5EI8A 2HZIA 1XR1A 2ZAZA 4R7IA 5FEQA 2FB8A 4ZTRA 3UVPA 4F1TA 3RNIA 1F0QA 3EIDA 2ZMDA 1M2PA 1WBTA 2ETRA 2UZWE 3R02A 4FKVA 4M0ZA 5GJDA 2QOCA 5D9HA 1XKKA 4NK9A 1B6CB 2G15A 3EKKA 3MSSA 5JZJA 3MY5A 1J91A 3HMPA 3ZH8A 2UZLA 4GU9A 3PWDA 5L6OA 3W55A 5BQ0A 4PL5A 3AC5A 3NEWA 1PMUA 1KE8A 1FINA 4FTNA 4Y5HA 4C3PA 4UXLA 5AUUA 5LQFA 2W0JA 3EZRA 5BVWA 1J7UA 3S2PA 2YIRA 3LQ5A 3LFAA 4FKOA 4JG6A 4MXYA 2VWWA 2GNGA 2XK4A 1WBVA 4M68A 3U6IA 3PLAE 3GVUA 2A4LA 3BKBA 3HA8A 4LFIA 4TNDA 2IZRA 3LCTA 4DG0E 2CMWA 2C3JA 3DDPA 4QP4A 2WU6A 2JFMA 3E7OA 3GU7A 4BDBA 5AAEA 3B8QA 4YJTA 3NUUA 5FM3A 4J71A 3R9RA 1CM8A 3QHWA 3UG2A 5HX6A 3QALE 3GC0A 4G5PA 4D9UA 4HPUE 4JAJA 1OIUA 1YOJA 3PDTA 4HCUA 5FG8A 4Z16A 5JEBA 2OGVA 3ALOA 4FIGA 4X3FA 5D7VA 1ZYCA 3L8XA 1Y91A 1DI9A 3CD3A 3QA0A 4AW1A 4ENXA 4DTAA 3NPCA 5C01A 4GL9A 4XG4A 3S3IA 2XJ1A 4HW7A 5FDXA 3NVKI 3BLHA 1I44A 2RL5A 1JKTA 3G6GA 4J53A 4D2RA 2F2UA 4L3JA 2X6DA 4USFA 2PTKA 4Z9LA 2WMUA 4W8EA 4TTHB 2J0MB 2ITYA 3KXZA 4FG9A 4B0GA 4BDAA 2GFCA 4BR3A 3LCSA 3OXIA 5ETIA 4AACA 2QI8A 2Y4IC 4FBXA 4AW5A 4NM5A 2YM3A 3PVGA 5DHJA 3POZA 4JR7A 4YZMA 5CWZA 3ORPA 4G3EA 3TM0A 3AD6A 5IDNA 4WBBB 4JBOA 5KZIA 4EQCA 3VVHA 4DH7A 3VUHA 1ND4A 5HG5A 4GJ2A 4LOOA 3EYHA 2ITTA 4O7LA 4K9YA 4ZMFA 4C4GA 4EZ3A 4S31A 3ODYX 3OROA 1VYZA 5AP2A 4D5HA 4XG3A 2VO3A 1REKA 2P0CA 2BRMA 4FYNA 3ORZA 4Y73A 3BRBA 3VS7A 3UIUA 4DC2A 4RIWB 3UJGA 4ZSJA 5M44A 4CTCA 5E8VA 4IW0A 4JBPA 4M0YA 3C51A 3O96A 3RGFA 4WHZA 2ZVAA 3ZUTA 4QYGA 3ZEWA 5KX8A 4XS2A 3QRUA 1O6LA 1O9UA 2WQBA 3FC1X 4U6RA 4GCJA 4XRJA 1O6KA 3EOCA 2VNYA 2EUFB 3L8VA 2W4JA 3BU3A 2C6DA 4FK3A 5M4CA 4QP6A 4NL0A 4YSJA 5JH6A 3PE1A 3TWJA 4S34A 4BIEA 4FL1A 1IA9A 3SOAA 4L45A 4BDDA 4GVJA 3R7YA 2O2UA 1CKIA 2X8IA 3HMMA 3ROCA 4C4EA 5KHXA 2QHMA 2W06A 4RBLA 3I1AA 1ZZ2A 2OJFE 2X8DA 3K5UA 1JOWB 1I09A 4II5A 3FI4A 1DM2A 4U40A 1ZY4A 4FICA 3BIZA 3NRMA 2VO6A 4O2PA 4X3FC 2W1GA 4ZY6A 3UG1A 4C4JA 3V8WA 4K18A 4YLKA 5AP1A 2VO7A 3SRVA 4CLJA 1XO2B 3ZFXA 1FMOE 3C1XA 3HLLA 4FEQA 2X1NA 4E5AX 5IQFA 5JFSA 4ALUA 2BRBA 4AGDA 5BVFA 4UEUA 5KMIA 2XKEA 5DBXA 5BVEA 3WIGA 1OVEA 3P86A 5BVKA 2W9FB 4FEXA 2Z02A 5CXHA 3I7CA 4MAOA 3PJ8A 5M09A 3A8WA 4R3PA 3WE4A 3QXPA 5EM6A 4EQMA 5KHWA 3R8UA 3ITZA 2BAKA 3PY3A 2ZV2A 3QX2A 3TIZA 3KMUA 2C6TA 4YC6A 3ODZX 2GQSA 4GRBA 5T68A 2W99B 3TL8A 5CALA 5CVFA 4R5SA 3E8DA 3MY0A 4C4IA 4D9TA 4WSYA 3R7IA 2I6LA 3ZSIA 4DH5A 2A0CX 3R1NA 5E7RA 4K33A 4I41A 1GAGA 1GIIA 3ZYAA 5JQ8A 3UNZA 4FODA 5CSWA 1UV5A 4UALA 3OXZA 1PKGA 2YIQA 5HG9A 2PVMA 2YCFA 2R2PA 3O0GA 3OWKA 3Q4TA 4RVKA 4EWQA 1J1CA 4FL3A 3DFCB 5EG3A 1WFCA 4ID7A 5CVHA 4ZS4A 5CAPA 2GSFA 1JAMA 2P55A 1J7IA 2ITWA 3GT8A 3SC1A 4FTKA 4ZLYA 2VTJA 1Q8WA 2VGPA 2WKMA 2ZJWA 2XVDA 5JQ5A 4BDFA 4C0TA 2A27A 2C5VA 4F9WA 5LCKA 3OOMA 4PV0A 5TF9A 3E3BX 3C0HA 2Y0AA 5FD2A 3HP5A 5CENA 4IJPA 4JDHA 4EH4A 3MDYA 4JRNA 5CANA 3EQBA 5AUZA 4GFOA 3QTWA 4E8AA 2B9HA 2BTSA 3ROYA 2AYPA 2O64A 3FI3A 1EH4A 2WIHA 4IIRA 4F9BA 4ITHA 4GYGA 1K3AA 4BI0A 4IQ6A 3AT2A 4HCVA 1E1VA 3LIJA 3RVGA 5LMKA 1A06A 2ERZE 5EH0A 4UZHA 2JGZA 1MRUA 4IAZA 1CTPE 2VZ6A 4JR3A 4AT4A 2VTOA 1ZMWA 3GOPA 4YBKA 1H0WA 5AX3A 4MEDA 3MA6A 4JDJA 4A9TA 5HVKA 4I1ZA 4Y95A 3IECA 2NO3A 3HAVA 1CSNA 2C6EA 4P5QA 4HVHA 4W4XA 3UOKA 2VWBA 2EU9A 2F49A 2GPHA 4GVAA 2OF4A 5ETFA 2C3KA 4ANMA 2VO0A 5KMOA 4YUQA 4XG9A 4QYFA 5E8TA 4BDHA 1XH5A 4IX5A 3C9WA 4I6FA 3PXYA 4EZ5A 2BFXA 2BIKB 2HELA 3KU2A 4YJVA 3FKOA 5JT2A 2J90A 5CAQA 2QD9A 2IJMA 3ZLSA 3QQGA 4F99A 2WTDA 4Y83A 4R1YA 5CYIA 3IG7A 3CY2A 4NWMA 3MPTA 4YJPA 5HORA 5FXRA 2F57A 4EOSA 5L8KA 3Q9ZA 4WNOA 2ZYBA 5AV4A 3NMUF 3Q6UA 3COIA 2RFEA 1IA8A 2A19B 4JX7A 5M53A 4EOJA 1U59A 4MD9E 3FHRA 3HVCA 1ERKA 2YERA 3NUPA 3MFRA 4MXZA 1T46A 2C5OA 1GZNA 3ORXA 4BCOA 4PMPA 4DTBA 2QOQA 4K0YA 5IQAA 2FSTX 3UOLA 2VNWA 4H05A 2BPMA 3IGGA 3PVUA 3ZDIA 3HMIA 3NS9A 3FMJA 2QO7A 3FXZA 1GIHA 3UMWA 2X2KA 4R3RA 2XM9A 3PWYA 3W33A 4CVAA 2JC6A 2JDTA 5AWMA 1BI7A 2VX3A 3WYXA 5A4EA 5CU0A 4JIKA 1V0BA 4BTMA 1W84A 4A4XA 5J9LA 2UW7A 3RAWA 4IVDA 3AC4A 3RPOA 1PMEA 1YQJA 2GTNA 4HVGA 4RPVA 5AA9A 4JL9A 3R9HA 3BQCA 2X4ZA 3QQHA 1QPCA 5KMKA 3BBWA 5CZHA 3BPRA 4Y85A 3FJQE 4YR8A 2BHHA 4I0TA 5FXSA 1OI9A 3LAUA 4I6QA 4H39A 4AS0A 2PUNA 1L3RE 3FEGA 3R21A 4BCQA 4L68A 4KRDA 2J5FA 2GCDA 3DTCA 3QZGA 5A6NA 2BAJA 3I6UA 4U98A 4PDYA 5B2MA 2IVSA 2OH0E 3KCKA 4PTGA 1U4DA 3KB7A 3DXPA 2BZIB 1OKYA 4DHFA 3CKWA 3JXWA 3AT4A 4O7SA 4ZSEA 4C38A 2XZSA 3R28A 4ALWA 3CQWA 1V0OA 4DEAA 4CG9A 4FSUA 4YC3A 1OITA 3EN9A 1OIYA 1L8TA 3TUCA 2R7IA 3RPYA 5A4TA 3D7TA 3LFDA 1H24A 3A62A 2J7TA 4YNEA 3S4QA 4E5BA 4MVFA 2E9PA 3F3VA 2YWVA 3F6XA 4BN1A 2XIKA 3BQRA 3QTQA 4GUBA 3PP0A 4WNKA 2YAAA 4RIXB 3R83A 1QL6A 4O0SA 3CCNA 3CQEA 5J87A 1PYEA 4GSBA 3H3CA 4K2RA 4QO9A 4QNYA 2FH9A 1XWSA 4WD5A 4XUFA 4YNOA 2XA4A 3P7AA 2F9GA 4AOIA 3UC4A 2XK9A 4M84A 3LQ3A 3R22A 2RFDA 4AA0A 3C0GA 1WBSA 1O6YA 4D4RA 3ZO1A 4RVTA 2R3FA 4FV5A 3I0QA 2JD5A 2QHNA 5AP7A 4U79A 5L2WA 2R3QA 1OPJA 2PVJA 3C4WA 3OTVA 5C1QB 5CEMA 3TV6A 1R0EA 4HNIA 3JS2A 5K5NA 4I92A 4ANSA 5CF8A 2YM4A 1GZKA 5DPVA 2QOKA 4QQJA 3W8QA 2R4BA 4OTHA 4E26A 4QMPA 2I0YA 2ERKA 2O3PA 3PUPA 2BVAA 3L8SA 2WMXA 4I3ZA 3EQCA 3P0MA 4YJUA 2W4OA 2O8YA 4G6OA 3PFQA 5CY3A 5BVNA 4BC6A 3BLQA 2WQMA 4HYIA 4F1MA 2ITVA 3CTHA 5AUYA 2NRYA 3MBLA 2VTAA 5C26A 1OL1A 3EMGA 1OGUA 3R63A 2YCSA 3PXZA 5D10A 1BI8A 1VJYA 3P1AA 3QD2B 4CFNA 5HI2A 4GJ3A 2FUMA 4EJ7A 1IAHA 4FE2A 4AFJA 5DFPA 4V01A 2YM6A 3DJ7A 4DFYA 1ZARA 2EXCX 1DAYA 4FSMA 3LM5A 4F64A 3TNPC 5KMJA 3JPVA 4BCJA 1GIJA 2PY3A 5KE0A 4JIAA 4QYEA 4ASDA 2B9FA 1Q8ZA 4EC9A 2HW7A 4FKJA 1NA7A 3ZEPA 5M4UA 4X2FA 1PMNA 5EHLA 4C59A 5E4HA 1ZWSA 4AGUA 3PSBA 1VEBA 2H9VA 2VTPA 3A7FA 5DRDA 4DCEA 3D5XA 3FSFA 2BRHA 5AFVA 2X7OA 4YJQA 2PZRA 5BPYA 2R7BA 3CPCA 3JVRA 5KBQA 3DT1A 4EQUA 3RINA 4NCTC 3DAKA 5F1ZA 4E7WA 1NY3A 1WMKA 5LVOA 3KULB 5ACBC 4I6HA 4WG4A 5H2UA 4D4YA 2PVLA 3D9VA 4HGTA 5JN2A 1HOWA 2PZIA 2GQRA 2PUPA 3MYGA 2BZJA 5A54A 3RCJA 1BX6A 3QFVA 4ZJIA 2WO6A 4FTAA 3VQHA 4ACMA 4QMXA 4QPSA 4EOKA 3D94A 4X7QA 3AC1A 1H08A 4PDPA 4YLJA 3O50A 5J9ZA 3UYTA 2C4GA 3QC4A 5LVNA 4O0WA 4OUCA 4QQ5A 3GB2A 4YO6A 5IF1A 2JKQA 4TZRA 4QQCA 4BZDA 3UO5A 3QZFA 4AE9A 3ERKA 4MTAA 3SD0A 4BCIA 2RF9A 4FZDB 2IZSA 2W1CA 5E8YA 1BYGA 5DR6A 4C4HA 1UU7A 3ZRMA 4FKIA 5KMMA 5DGZA 4LOQA 2A1AB 2XIRA 4FNZA 3SRVB 3V04A 3VN9A 1GOLA 3DKOA 1WZYA 1JSUA 4L67A 1OL5A 2YDKA 4GKHA 4IZAA 5CEPA 3E8EA 3FLZA 3DKGA 3TN8A 4NH1A 3NUNA 2UZVA 3BYSA 1FMKA 2R3KA 2XNEA 4ZLZA 2XNGA 4QP7A 1OL2A 4EWHA 3O51A 2YACA 5EQPA 3Q60A 4NYEA 3C13A 4FEWA 1LEZA 2BHEA 4UZDA 5D12A 3L9MA 4RWIA 3TXOA 4PTCA 2XBJA 1OIRA 3KXXA 5HHWA 3EFKA 4AP7A 5E92A 3GI3A 4YPSA 5I5ZA 4LOPA 3AOXA 3GQIA 5FP5A 2OZAB 5DH3A 3U6HA 5L2SA 3L9PA 3TNIA 4QMMA 2WMAA 4KWPA 1SNUA 4FV8A 1J1BA 3D2KA 4IWPA 3EQGA 3ZM9A 5ETCA 2YCRA 2V5QA 4ZZMA 5A4LA 4HPTE 2ITPA 5D41A 1KE9A 1XJDA 4K8AA 3QTXA 5H8EA 3E8NA 2ZDTA 2R3HA 3PY1A 5FUTA 4CCUA 2HOGA 3Q3BA 3PRFA 3NW5A 5FBNC 2PVHA 2UW0A 1SMHA 4IX3A 4NM0A 4M13A 3VRZA 3PTGA 4EC8A 3GBZA 3H0YA 3C5IA 5CU2A 4BZOA 4G3DA 4MD7E 1A48A 4FZAB 3PZHA 4XP0A 1CMKE 1FQ1B 5E8ZA 5CF5A 3FDNA 2RG6A 2GFSA 2PSQA 4G9CA 3Q9YA 5DVRA 4NTSA 4RJ3A 4V0GA 3EQIA 5JFVA 4TW9A 2C5XA 5EK7A 3IDCA 3Q52A 2WTIA 4F08A 5J1WA 3UIMA 5I9WA 2QG7A 2PK9A 3KK8A 4MNFA 4U9AA 1XH7A 3QWJA 3MH3A 4WG3A 3CIKA 5CSVA 3TACA 4MWHA 4F1OA 4F63A 2C6OA 3OUNB 3F2NA 3QXOA 3W0NA 3CY3A 1YWNA 1V1KA 2BRGA 3VS3A 3V5TA 2WZJA 3NX8A 1J3HA 4TYEA 3OOGA 1CKJA 4UN0C 3GCQA 4ZIMA 3TJDA 4Z7HA 3WYYA 4DGLC 5K4IA 4O7ZA 2PYWA 2RGPA 4CFXA 4F09A 3RM7A 2UW9A 4O0RA 4UWBA 3A61A 4FNYA 3BEGA 3V01A 3R1QA 4PTEA 5F9EA 4K11A 3Q04A 4ZJVA 3RHKA 2X9FA 3DB8A 3VBTA 5AP4A 2CKQA 1RJBA 3ENMA 3NLBA 4I0RA 3TCPA 2ITQA 4GG7A 3TZ8A 2J5EA 4I4FA 3RPVA 1GY3A 4WT6A 1XH8A 3QRKA 4MBIA 2XMYA 3PIXA 1H1SA 1Q8UA 2X6EA 3ZLWA 5EKNA 5HLWA 5IU2A 4KABA 3EFLA 1OUYA 5I9XA 3FLYA 2OFUA 4Z55A 3AMAA 4TYHA 4BIDA 4N0SA 3QUEA 4EK3A 3N4VA 2J0JA 5KCVA 1Q5KA 2YIXA 1HCLA 1PXOA 4QMTA 3VS5A 3A7HA 1ZLTA 3R9DA 2CKPA 1U5RA 2QU6A 1JSVA 4JVGA 4QP2A 4BTKA 4G31A 4E6QA 4A4LA 4EK8A 4EYJA 5FTOA 4U44A 3SW7A 3UGCA 5CNOA 4I5MA 4EH6A 3LCDA 3QTSA 1MUOA 2HZNA 3PPZA 4C35A 2R3IA 3TKHA 4EHZA 1ZY5A 5GJGA 2YAKA 3B2WA 3GFEA 2VTTA 2E9NA 3OP5A 2WMSA 2W1IA 3ET7A 4GUEA 5ANDA 4DT9A 3JR1A 3QD4A 1WVXA 1MQBA 2SRCA 4QT1A 5EM5A 3HAMA 2J9MA 2QR7A 3OT3A 5BX0A 2A2AA 3OCBA 5KMLA 1P4OA 3F7WA 3FMLA 4IE9A 4RIXA 3MPMA 3FPQA 4J97A 4EH9A 2XM8A 3QQLA 4L3LA 1OBGA 2OLCA 4MH7A 2VTSA 1YHSA 3HECA 3ACKA 2NNWB 3O17A 4FKLA 5GHVA 5BYYA 5L8JA 5EYCA 3W2QA 4TXCA 3ATSA 3DKFA 3QU0A 3IONA 4RJ6A 2WQOA 3RAHA 3UODA 4D1SA 3KKVA 2JIIA 3VRYA 3ANRA 4DN5A 3DA6A 4EK6A 3Q9WA 4HNFA 2LGCA 4L9IA 4LMUA 4O27B 4GMYA 3FLWA 5EW3A 4FUYA 1V0PA 5HESA 4EKLA 2WU7A 5DI1A 1LR4A 2W4KA 4AT3A 3ZXZA 2OKRA 4M15A 4PMTA 4BCNA 4C2WA 2DQ7X 3ZFYA 3VJNA 2BDWA 3G9LX 1OM1A 2C6IA 3KN5A 4FZFB 4L52A 4RFYA 2B52A 5IQIA 4EH2A 3CD8A 1BL6A 3FL4A 4N6ZA 4I24A 2WTWA 2H96A 2OG8A 4Y46A 5CSXA 4FSZA 3LE6A 4QP3A 3WARA 3QCYA 2I40A 3A7IA 1OKVA 4LI5A 4FVRA 4QMQA 5B7VA 3OTUA 2C68A 3VBWA 3U4UA 1JKSA 3UPZA 4DH3A 4FL2A 1MRVA 5AV0A 2WEVA 3A8XA 3E93A 4EH8A 3A4PA 4ZJJA 4L01A 4ZSLA 4BCPA 4C36A 1M2QA 4U8ZA 1ZOGA 1M7QA 4AZWA 3ZDUA 4AWIA 4DEDA 2GNJA 4GK4A 3VHEA 3FKLA 5IQBA 4FZ7A 4DLJA 3R8VA 5GIPE 3QKKA 4W8DA 4C02A 2GU8A 3C0IA 3ZUUA 3PYYA 2F7ZE 3A60A 4AGCA 2Y8OA 4FTIA 3R2YA 5BUJA 1Z57A 2PE0A 5AEPA 3TI1A 3ETAA 3OZ6A 4DCAA 2JBOA 5A4CA 2OXXA 1UNHA 2CCHA 5C9CA 2BKZA 4ENYA 3TZMA 2P3GX 3EZVA 4XLVA 5EHYA 4M3QA 5ITAA 3L9NA 3GCSA 1MRYA 5JZNA 3DLZA 4BGQA 1ZAOA 2XIYA 3VS2A 3LFSA 4CSVA 1UKHA 3LFBA 1ZOHA 2VUWA 4NUSA 5CI6A 3PPKA 4A7CA 3DBCA 5LMBA 1ZOEA 4GFMA 2GNIA 1QPEA 1U54A 3MFUA 3OBGA 1H0VA 3QAME 5JRSA 4YJNA 2CKEA 4AZSA 1DAWA 2JITA 2VTHA 4TYIA 2ITNA 4R1VA 3MVMA 1H28A 3FV8A 1WBWA 3AGMA 2CNUA 4WO5A 3HV5A 1BLXA 2HYYA 3LCOA 4GU6A 4FV1A 4DH1A 3REPA 3G9NA 1RW8A 2HK5A 2QOFA 2WB8A 3WZEA 3QYZA 3MESA 4DEHA 4J95A 5FTGA 2GNHA 4QMWA 3HDMA 4G6LA 2UW3A 4JDKA 4FNWA 5HE2A 5EW9A 2YABA 3W0SA 2VWZA 2QG5A 4AN9A 4DFZE 3AC3A 3KVXA 2CNQA 2QLUA 2HCKA 3MI9A 4X2GA 1TQPA 2VTNA 5HD7A 3LOKA 4XMOA 2BALA 1OL6A 1M52A 2EB2A 3ANQA 4FSRA 4N70A 4G34A 2QOBA 3LM0A 4AN2A 5HU9A 3IW7A 5EM7A 5GIOE 1YDRE 1AD5A 1JWHA 3CJFA 3MTFA 5KNJA 3BCEA 3I4BA 4IACA 1DS5A 4U43A 4KSQA 3IOKA 2H34A 2YIWA 3MJ1A 4QMUA 1YW2A 3QGYA 2NP8A 3FMKA 3VNTA 3IDPA 3ULZA 2C0OA 2XK3A 2WTKC 2WMQA 1R3CA 3F9NA 3CE3A 5DWRA 4EH7A 4GFGA 2JDSA 4CZUA 3EN6A 2VGOA 4XNEA 2F7XE 5E8SA 1Y8YA 4CFFA 4HYSA 2YIYA 3QL8A 4J7BA 5B2LA 3RAKA 2WQEA 3H30A 3PG3A 4XV2A 3QC9A 2CJMA 1OPKA 3GU5A 3F2AA 4O86A 4DFBA 4DAWA 5EKOA 5HIEA 3A2CA 2PPQA 3OEZA 4PF4A 3KXMA 4BRXA 3G5DA 3TDWA 4BBFA 1H1RA 5CI7A 3WE8A 4YHJA 2XH5A 5ANJA 1YWRA 4XV3A 4IHPA 4KKEA 3FQEA 3PJ2A 3BYVA 3VS6A 2BROA 4X6QC 4M8TA 5AUWA 4C3FA 4HJOA 1NVQA 4YJOA 5HNBA 4BKJA 3PXRA 2R5TA 5FXQA 3Q2JA 2OH4A 2VN9A 3KA0A 3U4WA 3DV3A 2CLXA 2HZ0A 1M7NA 3PJ1A 5AIKA 2R3OA 2PULA 2YDIA 2XK7A 4BCMA 4TYGA 4E4XA 3II5A 4XP2A 4FV0A 3SXRA 3TNHA 3V6SA 4Q5HA 3ZUVA 2ZMCA 3HP2A 4LL0A 4A06A 3TKIA 3CQUA 4D4SA 4B99A 3MFSA 4CFUA 4D2SA 3SDJA 4GT5A 3NYXA 4I20A 4FTLA 4CV8A 2OJJA 4F0IA 1REJA 2W1FA 2WMVA 4ORKA 4I94A 4XBUA 5EOLA 3PE2A 4YZNA 4TT7A 1RQQA 1W0XC 3QTRA 4EOQA 2YCQA 1VYWA 3LXPA 2XYNA 4X3FB 3QTUA 4BB4A 4EI4A 5HD4A 3DNDA 3C4EA 1M14A 5FP6A 5IUHA 1ZRZA 4BTFA 3MIYA 4FOBA 1PXKA 1UU9A 2IPXA 2PZYA 3CGFA 3OHTA 3L9LA 3QTZA 3PP1A 4FIJA 4HYUA 4O0XA 4CG8A 2OZAA 4YBJA 4MD8E 4FV7A 5M06A 4X6RA 4EEVA 4DEIA 3H9FA 1SZMA 5LOHA 5HICA 1XHAA 3U55A 3KMMA 4CTBA 3W8LA 3FL5A 3VBQA 5LVLA 5DG5A 3LLAA 3BYOA 4FIHA 4H1MA 4ZEGA 3K2LA 4L7SA 1OKZA 3EN4A 3UC3A 4CT1A 2ONLA 4DGMA 4ACGA 3MA3A 2Z7SA 2J2IB 3C4CA 4M69B 4NTTA 4ZXTA 4RSSA 5HX8A 2RIOA 4C62A 2R3PA 3P78A 2UZBA 3E3PA 3CSVA 3QCXA 3MWUA 4YTFA 5BMMA 2QVSE 1H01A 4AA5A 1TVOA 1Z9XA 4MX9A 3U54A 4AU8A 1FGKA 4TNBA 2W1HA 4IVCA 4ZTHA 5LWMA 4KKHA 2B1PA 3PJCA 4XG6A 4F6SA 5IH4A 4DEEA 4CV9A 2JAVA 4RFZA 4FSNA 4XBRA 2IN6A 4EH5A 4AZEA 4L44A 4RLLA 5DE2A 3T3UA 4YZBA
chains in the Genus database with same CATH superfamily
1PXPA 2EXMA 4KA3A 1BKXA 3MN3A 5HO8A 3TJCA 2PHKA 3R7OA 2ACXA 3SGCA 2J4ZA 2ZM4A 5A4QA 1ST0A 1Q8YA 5BVOA 3HYHA 4HZRA 4BI2A 5J5SA 3SQQA 5EDPA 4Q9ZA 3AC2A 3RAIA 5F20A 4C58A 3BWFA 3HMOA 2H6DA 2WMWA 3ZRKA 2ZDUA 2RKUA 3MH0A 4E6AA 5ICPA 4B7TA 3MGYA 2YM7A 5IEVA 5JGAA 5CSHA 1Y6BA 2YEXA 3COMA 5B2KA 3BE2A 4G3FA 3VF8A 4IAFA 3OWJA 1KUTA 1MP8A 3QQKA 4ZK5A 1OECA 3JY9A 5HNGA 3VW6A 2GHGA 2UZTA 4C3RA 2WTJA 4FV6A 2R3MA 3U8WA 2G2IA 3VHKA 3E64A 3LPBA 1BL7A 4CRLA 1WBPA 3H9OA 3L1SA 4LDTA 2WPAA 4KS7A 3R8MA 3R0TA 4TWNA 3KVWA 4JNWA 2X81A 3NSZA 4DEBA 2QC6A 2V7AA 3KEXA 5M57A 3JY0A 3OG7A 4OTWA 3CR0A 5FEDA 2PVKA 4L8MA 5M56A 4A9UA 5HE0A 1NVSA 4FIFA 2C30A 4F7SA 1R0PA 4YP8A 3CPBA 5AX9A 3LCKA 5CF4A 4FGRA 4AE6A 1JNKA 4DFNA 3BV3A 3GCUA 3PZEA 4Y8DA 2JEDA 4GIIA 4F0FA 1PJKA 2XCHA 3UQFA 3W2OA 1UVRA 4LMNA 3TNWA 4QTEA 5E8UA 3UDSA 3R04A 2R3JA 4GT3A 4FKRA 2YDJA 4XOZA 4BI1A 1W82A 3SKCA 3W0PA 2QONA 4NM3A 4O7TA 3OMVA 3GXLA 4OTIA 4BY9E 5A9UA 1PF8A 1XH4A 1UNLA 2HENA 5AV3A 3R8ZA 2UZEA 3H4JA 5AP5A 3E7VA 4BDGA 4DITA 4DT8A 2IVUA 4H3QA 2IWIA 2AC5A 4F7LA 3A7JA 5T6KA 5F95A 3W2RA 4JLCA 4U97A 4YZDA 5HZNA 3V8SA 2XRWA 3Q53A 3LQ8A 3TUBA 2I7QA 4KSPA 5CT0A 3O23A 4HOKA 4U3ZA 3VC4A 3PA5A 1K2PA 3W0MA 3ZMMA 3IOPA 5K4JA 3BYMA 3UYSA 1OB3A 5DR2A 3AC8A 4UWYA 3FLSA 3NYNA 4O22A 3IS5A 3KGAA 3Q4ZA 3QQJA 2X2LA 4CMOA 5IPJA 2R3RA 5DRBA 2WFYA 5KUPA 1PXMA 4OR5A 4LGGA 4E20A 3SXSA 5IA2A 2E2BA 3E88A 3RI1A 3AKLA 3QCQA 4IAAA 4NKAA 3P4KA 4FNXA 3TKUA 2Z8CA 3DPKA 3OY1A 3QUDA 1LPUA 3IW5A 2X7FA 2J0KA 4RLKA 2BCJA 3D5WA 2QURA 4I4EA 2PMOX 4LL5A 5HCZA 5BUEA 1XBAA 1YXSA 2ZB1A 1H27A 4RZWA 4ZZNA 2C3LA 2OIQA 3DKCA 4HCTA 2QKRA 4EYMA 3GENA 3O7LB 4IMYA 3OS3A 3SVVA 2X4FA 3RJCA 3BGQA 3VUGA 3DBDA 4L43A 5JMSA 4IWQA 3JVSA 4WUAA 2WIPA 3H0ZA 2BRNA 2QOIA 3O8PA 3WF6A 3LJ2A 4USEA 4C37A 2GS7A 2Y6OA 3BLRA 2FSOX 4W4YA 5AIRA 3Q2MA 2P2HA 3FZ1A 4QPAA 4RFMA 5CZIA 2JKKA 2OXYA 3CBLA 4AQCA 2X9EA 4ASXA 5IA1A 3GC9A 5LMAA 3IW6A 4TY1A 3KXGA 4FTOA 4MWIA 4HVIA 4FR4A 4BYIA 4DGOA 4PNKA 3EQFA 3OVVA 1FVVA 3VS1A 5TOZA 5EDRA 3RCDA 3ULIA 3PFYA 3PY0A 4JRVA 3KCFA 3DU8A 3GU8A 3NR9A 4OGRA 4BGHA 1GJOA 3DXNA 1YWVA 2XNMA 4WA9A 3AMBA 3JUHA 3FBVA 5CEQA 3Q4CA 5FTQA 4EOIA 5CU4A 2G2FA 4ZTNA 5IQCA 4NM7A 4OTRA 2WD1A 4U80A 4YU2A 1LP4A 4RA4A 2J0IA 2VV9A 3LXNA 4YC8A 5JGBA 2GNFA 3F3TA 1YHVA 2UVZA 4AW2A 4CQEA 3MS9A 4DHIB 4DEGA 3OCTA 4BCHA 4U3YA 4X2KA 4YO4A 2IW9A 4PMSA 4QP1A 3FUPA 2W7XA 3DFAA 4OW8A 2C1AA 2VX1A 2Q83A 2YISA 4DGNA 1Q24A 4ZTMA 2BZKB 2B55A 3HV4A 5HTCA 5JK3A 4G16A 4ZS0A 2PE2A 5E8WA 4JJRA 1W7HA 4RWKA 5CTPA 4P4CA 4TPTA 4F9AA 5EYMA 1G5SA 1Q3DA 3GCPA 4E73A 4FOCA 3FMDA 1KE6A 4QRCA 4AW0A 4GT4A 4MHAA 5F94A 4PX6A 3UPXA 2XYUA 3KQ7A 4IDTA 2YJRA 4IAIA 2W17A 3WF5A 2C6KA 2REIA 2W05A 3TNQB 2XIXA 4EHVA 3I0OA 5AA8A 4IM3A 4I5PA 2GMXA 4RJ4A 4Y72A 4O0UA 4CCBA 1WAKA 3IQ7A 4RQKA 3R9OA 4A9SA 5IZFA 3R00A 4H58A 2VWIA 5HVYA 4TRLA 2OICA 2E9UA 3SV0A 3KY2A 4CNHA 1SVGA 4IB0A 4QYYA 1PMVA 5HG8A 3U87A 2Z7QA 4MBLA 5IQDA 4IJ9A 3RZBA 4E6CA 4HVDA 1U46A 1XH9A 2PUUA 3F69A 3R71A 4WZYA 2ZFYA 1YI4A 3OD6X 3C7QA 4RGJA 4UYNA 4CZTA 4TKSA 3DBQA 3DBEA 5IA5A 1FOTA 3FLNC 2JIVA 3RALA 2BIYA 2OIBA 3HDNA 4KIQA 4ZAUA 2HW6A 4QTCA 4QDVA 5TO8A 2B54A 4DLIA 3OUKA 2ZB0A 3TMOA 2QQ7A 1UU8A 2Z7RA 1PKDA 3F3UA 3CLYA 4NIFB 3KF7A 4WKQA 4DBXA 4H3PA 1OMWA 3T9IA 4ANQA 3CXWA 4IZ5A 2JBPA 4F0GA 4MXXA 1YRPA 3RTPA 3SHEA 4EOMA 4RC2A 2CSNA 2UVYA 4R7HA 3MIAA 4RIOA 2UZUE 3EFWA 3KRRA 3LHJA 3VBXA 4PDSA 3M42A 1FBNA 4QMZA 4XJ0A 5ANKA 3WILA 2V62A 4IVBA 4EK5A 2DWBA 4IB3A 4O7NA 4PY1A 5IDPA 3Q32A 3TV7A 2XNPA 1XMMA 3QHRA 4J98A 4UBAA 4FKPA 2J50A 2UW4A 4O6EA 2X39A 3ALNA 3U9CA 3EH9A 3CC6A 3R2BA 3CJGA 4KUJA 4RIYB 3BHVA 1S9JA 3SAYA 3VUDA 4L7FA 4B9DA 4QQTA 3QD3A 4NZWB 3HKOA 4ZY4A 1Q62A 3LVPA 4JQ8A 1E9HA 4GK2A 4O82A 4XG2A 3UOHA 4IM0A 4TL0A 3RK9A 3VS0A 4C33A 2I0VA 5LWNA 3EQDA 4YSMA 5J95A 3EQPA 1KV1A 5JRQA 1J7LA 1NW1A 2NRUA 5HTBA 4IAKA 5IQEA 4O0VA 4E93A 3FI2A 3D15A 4ZP5A 5CEKA 3MV5A 4X2NA 3D0EA 1LUFA 2FSMX 2R3LA 4XG7A 3NUYA 3QF9A 4XLIA 2Z60A 4OTGA 4JG8A 4J99A 4FTJA 3UVQA 4O6LA 4RQVA 3F5UA 2BAQA 2PZPA 3LXKA 4IC8A 4YJSA 2WMRA 2QU5A 3GU6A 4C34A 4D58A 4IFGA 3FLQA 3PIZA 5M08A 3K5VA 4ZTQA 2YJSA 3MH2A 3DJ5A 3OY3A 5DT4A 5M4FA 4I6BA 3FXXA 2HY81 3NYOA 5DIAA 3DY7A 3P08A 3QUPA 2B9JA 3FYKX 3IDBA 3DZQA 2P33A 2Y4IB 3G90X 2IZUA 3F5XA 3PG1A 3R6XA 4B8MA 2WOUA 3ACJA 3BU5A 3WOWA 3OWLA 2CCIA 3TTIA 3DQXA 4EUUA 3FZOA 1W8CA 4QP8A 1RDQE 4WIHA 2G9XA 4FKWA 5IA0A 4NSTA 3AD4A 4FA2A 4MNEA 2ZM3A 4O7RA 1OKWA 4RA5A 3F88A 4MKCA 2OI4X 5HQ0A 3PRIA 4GW8A 4EH3A 3SA0A 3NZ0A 3KL8A 3KRLA 5HE1A 5FGKA 2XEZA 3R1SA 1OIQA 4RX9A 4U45A 4ASZA 3IK3A 2CKOA 4RWJA 2FSLX 3I5NA 1NVRA 2XJ2A 3VUKA 2W96B 4AXAA 5KKRC 4WNPA 4AGWA 3JYAA 1U5QA 3D14A 5L2TA 3R7VA 3KRXA 3FWQA 2BZHB 2UVXA 3EFJA 5C8KA 4AX8A 5H8GA 5EQYA 2R0IA 5ETAA 3NWWA 5LCJA 4ACDA 2OJ9A 4X3JA 3ZOSA 4OBQA 5BYLA 3RKBA 3QTIA 1CDKA 2GTMA 4PL3A 2W1DA 3TZ7A 1IAJA 3ZBXA 3FI8A 5HCYA 4BHNA 3EB0A 3ZSHA 3NUXA 4AZFA 4F7JA 5IH5A 2PMLX 1IR3A 2VWVA 3V5PA 5G1XA 3EQHA 5CASA 3DXQA 4PRJA 2WEIA 3EYGA 3GP0A 2JLDA 4CMUA 4RT7A 2EB3A 5AUTA 4YLLA 1ATPE 1UKIA 1H1PA 3POOA 4CT2A 2PMIA 1WCCA 3OT8A 4M14A 5FBOA 3W0OA 5H9BA 5HLNA 3AMYA 2O0UA 4FT5A 3VWAA 2XJ0A 4H1JA 4AXFA 3ID6C 4PP7A 5EOBA 4O7OA 3P7BA 4O84A 2Q0NA 3UQCA 5CNNA 2RFNA 5EHOA 3F3WA 3L8PA 4FEVA 5CU6A 4BDEA 4J8MA 5EYKA 2XK8A 3RMFA 3LMHA 4WRGA 5DLSA 5CEOA 3QLFA 3EQRA 2QLQA 4LM5A 4YGAA 4DGGA 3BGZA 4O38A 3KREA 3V5JA 3NNVA 4LQMA 2JIUA 4TYJA 4R3CA 4JOAA 5I9VA 4LRMA 4G2FA 4JX3A 4ARKA 2CPKE 2PVYA 4DDGA 2OK1A 2F2CB 1YI6A 3HEGA 3Q6WA 2OIDA 5FEEA 3RK5A 4L46A 1OUKA 3EJ1A 4M12A 4I6LA 4I93A 1Q4LA 5AV1A 4IX6A 3HA6A 4FKTA 2OF2A 1ZMUA 4QMLA 1WBOA 4BICA 4P5ZA 4ACCA 2Q0BA 3EN5A 4H36A 3D7TB 3BU6A 4KKGA 5CVGA 2P4IA 4UX9A 2HIWA 4JAIA 5AAFA 4XHKB 5K5XA 5EW8A 2F4JA 3V5WA 3DK6A 3OF0A 4ZY5A 3RK7A 5KMNA 1Y6AA 4FTCA 3HUCA 5L6WL 3HNGA 4ITIA 4ZOGA 5EI2A 4N4SA 4PDOA 3UTOA 2GS2A 2OBJA 4OLIA 4J1RA 3VBYA 5IQHA 3F5GA 4FT7A 4QMYA 2R3NA 3FMNA 3GOKA 3N4UA 5KZ0A 4RX5A 1TFFA 4UYAA 2PVRA 3LLTA 3WZKA 4CEGA 3IGOA 1UU3A 2XCKA 3FPMA 3NNUA 4DBNA 1ZXEA 3Q4UA 3E5AA 5GJFA 5M51A 1H00A 4L42A 5LMKC 1YXVA 2R3GA 4TWOA 3ZBFA 3N9XA 2KTYA 2VWYA 4FI1A 4MXOA 4RX8A 1PW2A 3F5PA 3UDZA 5FQDC 4EOPA 5L2IA 3A4OX 3NW7A 4OTQA 3RNYA 3VS4A 1URCA 1Q61A 4IZYA 4NU1A 3CKXA 3CEKA 4I22A 4QNAA 4RMZA 3UMXA 4CLIA 5JFXA 1NXKA 2QCSA 4M67A 4UWCA 4YPDA 4Z3VA 2I1MA 4P7EA 3KN6A 3HRCA 4KNBA 3QZIA 4NT4A 5IA3A 2ONLC 3BWJA 2XK6A 3GFWA 1PHKA 2WHBA 3UZRA 3EL7A 4XYFA 4WG5A 3W32A 1H25A 3WF8A 4DTKA 4KS8A 4IVAA 3BEAA 3NCGA 3TT0A 5HGIA 4WOVA 1ZYDA 4F6WA 1G8SA 2C5YA 3DB6A 4QYHA 4XX9A 3GNIB 2XP2A 5HIBA 3RP9A 1TQMA 2IG7A 1G8KA 1B38A 1PXIA 3NGAA 3NIZA 4FTMA 4FIEA 2BDFA 2YITA 2WTVA 3E8CA 4YURA 3M11A 2FGIA 1APME 5TKDA 3HMNA 3G0FA 3F66A 3R7EA 2PZ5A 4BZNA 5AUVA 4CFMA 3QBNA 3KRWA 5IG1A 4I5HA 3LFCA 2BR1A 3IW4A 3UZTA 4RX7A 5DEWA 3VO3A 3W1FA 3MJ2A 1YVJA 5CT7A 4KBAA 1YOMA 1SVEA 2FYSA 3FHIA 4FSWA 4K6ZA 4BF2A 5AM6A 4D0WA 4ITJA 4CKJA 2GHLA 3I6WA 2W5AA 4GIHA 5FRIA 4ACHA 1RE8A 3BZ3A 4O0TA 1H1WA 3PJ3A 2H8HA 3BHHA 3SW4A 4S33A 5LJJA 4O21A 2G1TA 3AT3A 4IWOA 2AC3A 2FVDA 2R0UA 4G17A 4D4VA 3UNKA 5C27A 5C4KA 4OTDA 3A7GA 3H10A 5G6VA 4QOXA 1S9IA 3F3ZA 1OPLA 2WTKB 4Q9SA 1YDSE 4ZTLA 3E63A 4LG4A 4C4FA 5J7HA 2ZM1A 2DS1A 1QMZA 2GQGA 3G0EA 4YZ9A 5ANIA 4BCKA 3BELA 1CKPA 2CDZA 2V55A 3BV2A 4JBVA 5DA3A 3DQWA 1P4FA 2EWAA 2GHMA 3CTJA 3G2FA 5I9UA 3SX9A 4BVUA 5J8IA 4L00A 4CD0A 3WZDA 5CXZA 2WMBA 4FSYA 5AV2A 1AQ1A 3UZPA 3DLSA 5EQEA 3KK9A 5IA4A 2BTRA 3D5VA 2XAMA 2XB7A 4V05A 4R5YA 2HXLA 5EM8A 3TV4A 3W10A 3IO7A 4NJDA 1WVWA 2FO0A 4FUXA 3W18A 1ZZLA 4CFVA 1URWA 5FM2A 5AP3A 4BHZA 3QD0A 3ZS5A 2QOHA 4GG5A 1P2AA 3NIEA 4CKRA 5HVJA 2IZTA 2W5BA 5E8XA 1IASA 1Q41A 3QX4A 5D1JA 4PWNA 5I4NA 2ITXA 4FC0A 4QMVA 4L6QA 3D83A 5HBHA 4V0GB 4S2ZA 3DJ6A 2OU7A 2C47A 3O71A 3PLSA 3RPRA 5DNRA 3COKA 4IM2A 1GNGA 2CNVA 2OW3A 3QQFA 2B0QA 3HX4A 3T9TA 4FX3A 3UBDA 5BNJA 3DGKA 2BKKA 1B39A 4RG0A 2ZV7A 3QKMA 5CQUA 5IEYA 3I7BA 3NCZA 4ANLA 5M55A 2X7GA 2HWOA 3PPJA 4D5KA 1FGIA 3BGPA 2BUJA 2OJGA 3KULA 3PIYA 4FVPA 4AZVA 5IH6A 4G6NA 2QO9A 2XKDA 4GEOA 4P2KA 1BUHA 3ZU7A 2WQNA 5HIDA 5M07A 3CGOA 3VJOA 4MF1A 3OEFX 3T3VA 3WI6A 4O96A 4JQEA 3V51A 3ZM4A 5DT0A 4HZSA 2JKOA 4NW5A 5GNKA 4D0XA 1GZ8A 1QPDA 3DAEA 4A4OA 4AFEA 1VZOA 5E90A 3NAXA 4AG8A 5DYJA 1OZ1A 2YWPA 3LFNA 2I0HA 5AP0A 4XP3A 5CQWA 1OL7A 5B0XA 2XUUA 4DFXE 5TR6A 3ZFMA 4KAOA 3A99A 1PXJA 1YKRA 3LFFA 5JKGA 4DG3E 3FMHA 4B6LA 4FKQA 5AJQA 2Z2WA 3F61A 1IG1A 1XH6A 3ORMA 4P90A 2UW6A 1NT2A 2CGVA 5CX9A 4YHFA 3NVMB 4G3CA 4FTQA 3PA4A 5E9EA 2B4SB 2GS6A 5C8NA 3BI6A 4WUNA 4PP9A 3GGFA 2NYAA 2JDVA 2UV2A 2E9OA 3GQLA 3N51A 2B7AA 3ENHA 1U54B 5CS6A 4E4MA 3QQUA 4EOOA 1YXTA 4IBMA 3HV3A 4O83A 4RC4A 1PRYA 2QODA 2VAGA 2VWXA 2JDRA 4G9RA 1YHWA 4YTIA 4DG2E 4QEBA 4HYHA 5K3YA 2ESMA 4IB1A 2I0EA 3O5AA 3VIDA 1PXNA 4W4WA 5GINE 4G1WA 3ZLYA 2IO6A 3IPHA 4FKUA 4E6DA 3SXFA 4W4VA 5HG7A 3S0OA 3LZBA 4LRJA 3NUSA 3FZSA 4NJ3A 2XF0A 4PL4A 3OFMA 2JAMA 4KIPA 5BMSA 4DFUA 5LVMA 5KBRA 2IVVA 3NUAA 2QNJA 2YA9A 2NPQA 4U7ZA 4XG8A 2DUVA 4NFMA 2CGUA 3F7ZA 3QRJA 3RM6A 5IEXA 1YXUA 4WBOA 5IISA 5ANOA 4ALVA 2ZV9A 4TWPA 5IQGA 3FMMA 2ZOQA 5HKMA 1T45A 4CRSA 4R6VA 2QOLA 2G2HA 4FGBA 5T3QA 2PVNA 2BMCA 5BVDA 1ZYLA 2VTRA 4AA4A 4U0IA 3P79A 4IZ7A 2WELA 5AAGA 3W16A 4NCTA 3QZHA 3ORTA 4XH6A 3U51A 4KB8A 4M7IA 4WNMA 2VTMA 3D7ZA 3DOGA 2YN8A 4XV1A 4D1ZA 2VWUA 4KBKA 5IMEA 2V0DA 4AT5A 4KD1A 3O8TA 2PMNX 4H3BA 4AF3A 4UB7A 4ANBA 3AQVA 4BTJA 2C0IA 3NDMA 4A07A 1UWHA 1H4LA 3FQSA 4LGHA 4AXDA 3MB7A 5ANGA 3WF7A 3SLSA 2AUHA 5H8BA 3W2CA 2ITUA 4S32A 4F6UA 5J1VA 3OWPA 1LEWA 3BBTB 4MNEB 5AM7A 3VBVA 4BDCA 3CS9A 2HZ4A 3MFTA 3C4XA 4PNIA 3ZC5A 3PVWA 3AG9A 2OSCA 3ZLXA 3AXWA 1FPUA 3VF9A 1R78A 4OBPA 3C5UA 2B53A 1JQHA 1R1WA 3EWHA 3C4FA 4EZ7A 3PVBA 4NFNA 1OBDA 2W1EA 3ZONA 4EHGA 3TUDA 1HCKA 1XBBA 4F65A 3ATTA 4X21A 5CEIA 4O7PA 4GS6A 4GV1A 4GH2A 5I0BA 2RFSA 2J6MA 4ERKA 4RC3A 3R30A 1H1QA 4IC7A 5HO7A 4ZZOA 3HV6A 2Z7LA 2OJIA 3WIKA 3MVJA 5A6OA 4IADA 3QKLA 2UW8A 5E1EA 2O5KA 3UO4A 3TZ9A 3UVRA 3QGWA 4JBQA 3COHA 3FSKA 3EHAA 3NYVA 1P5EA 2ITZA 4XCUA 4RIWA 3ZRLA 4YTCA 3FMEA 3EL8A 2CGXA 2R64A 1X8BA 5IUIA 3QCSA 3P5JC 2CGWA 3M1SA 3RWQA 3VQUA 2YM8A 1JLUE 3UIXA 3S00A 3KXHA 2HY0A 2OO8X 1M2RA 2O63A 3E87A 4MQ2A 4FT9A 3DDQA 2WNTA 3BYUA 4BDKA 4EUTA 2YM5A 3FKNA 4FK6A 2J51A 3BE9A 4FV4A 4ONAA 1WVYA 1YI3A 4IANA 3FY0A 2UW5A 5M4IA 1SNXA 1E1XA 1W83A 5CAOA 2IW8A 3OW3A 2RG5A 4PUZA 3GCVA 3FZPA 2C69A 4M97A 3OC1A 1QPJA 4Q5EA 2GNLA 3OCGA 2BFYA 2ITOA 3KC3A 3U6JA 1G8AA 1PYXA 3GUBA 4O81A 1SM2A 5HBJA 4AUAA 5AMNA 4FTUA 4U81A 4G5JA 3QWKA 2PUIA 4FG8A 4QTDA 3MVHA 3TTJA 2VTQA 5A3XA 3LFQA 2VTIA 4IB5A 4HVSA 3DTWA 3LKMA 2P2IA 3HGKA 2YZLA 2UUEA 2J0LA 4HGLA 4E4NA 3PXKA 4NKSA 3CTQA 2HAKA 2E9VA 3GC8A 3K54A 4JXFA 3PXQA 3RPSA 3IW8A 3D4QA 1W98A 2PWLA 4TYHB 1UWJA 1FVRA 3Q5IA 3ORIA 2V22A 3I60A 4ZMEA 4WRSA 4RVLA 3G6HA 3Q5ZA 2PU8A 4GKIA 3ZO3A 3Q96A 1GZOA 4EK4A 4CMTA 2C6LA 4IEBA 4DH8A 3G15A 3SG9A 4EHEA 3FY2A 4ZLOA 3LMIA 3B2TA 4O2ZA 4QMOA 3KF4A 3HRBA 5L3AA 4EKKA 5HU3A 2X2MA 4UXQA 2QR8A 4YMJA 4AOJA 3O8UA 4L53A 4LUDA 2C5NA 3DBFA 3PSCA 4AAAA 4LRKA 4MYGA 1H26A 2W9ZB 5LVPA 3ZHPC 2PVFA 4BDJA 4IWDA 1M17A 4IAYA 5L6PA 4I21A 3K3JA 4BCFA 5LARA 4JS8A 1XBCA 4TWCA 3QRTA 1JBPE 3DK3A 5F4NA 3V3VA 4OTFA 3ZSGA 3LJ0A 1OGYA 4O7WA 1IEPA 2WMTA 1F3MC 3RHXA 2V7OA 4O91A 3TG1A 4LV8A 4CGAA 1STCE 2OWBA 3E92A 2UZDA 4KIOA 3RWPA 5EYDA 3OW4A 4N6YA 4APCA 2XEYA 2JKMA 3R1YA 4DE4A 4R78A 3KFAA 2QKWB 3DS6A 4FT0A 2VX0A 4BBEA 3O2MA 3HRFA 3NAYA 1ZMVA 2WOTA 3W2SA 3WF9A 1WBNA 4FKGA 3N4TA 4JT3A 3UO6A 4C2VA 2B9IA 4EBVA 4IDVA 2QO2A 3DCVA 4BIBA 4USDA 2XNBA 3U9NA 4A9RA 4E5WA 4KBCA 2OXDA 3PXFA 3BHTA 2CN8A 1YXXA 3BHYA 4I5CA 1YOLA 5D11A 3PUFC 2DYLA 2YFXA 3OXTA 3Q9XA 4G3GA 5A14A 4RIYA 5CAUA 3V6RA 3ZXTA 5HCXA 2XAOA 2OZOA 3EN7A 2XNOA 2F7EE 3V5QA 4BCGA 3MW1A 4RVMA 4ERWA 3ORKA 3PA3A 1TQIA 4QP9A 4EL9A 4FT3A 4QTAA 5K9IA 3BL7A 1P14A 2BILB 3C4ZA 3TYKA 1JPAA 2JFLA 3OBJA 4FSTA 4AOTA 3D5UA 4ASEA 2GDOA 3FZTA 2XKFA 5D7AA 4Z7GA 1Z5MA 4RJ7A 3SOCA 4FTRA 4MQ1A 2WAJA 3AKJA 3M2WA 3BHUA 2C6MA 1BMKA 4O7VA 3R8PA 2FA2A 3S1HA 2OFVA 1JSTA 4PMMA 4JI9A 5DOSA 1Q3WA 4R77A 3S95A 3BX5A 1KE7A 3IKAA 3MVLA 4FEUA 1ZYSA 3T8OA 5LXMA 1IRKA 4O0YA 4IX4A 4FZ6A 4YHTA 4QMNA 3FC2A 3GU4A 3WBLA 5CSPA 4X0MA 2R9SA 2W1ZA 1QCFA 3HL7A 3NW6A 4FTTA 4BBMA 3K3IA 5DEYA 2ETKA 5E91A 4F4PA 3V8TA 3EKNA 1KOBA 3PSDA 4FMQA 3DK7A 1UA2A 2CN5A 3MH1A 4YJRA 3LW0A 2QOOA 1H8FA 4XEYA 4X2JA 5CF6A 3KXNA 3GC7A 5HLPA 1G8JA 1SYKA 2ETMA 1KV2A 3SG8A 4J8NA 3UP7A 3W0RA 4D1XA 2CLQA 1G3NA 3P9JA 1SVHA 4XRLA 4YZCA 4ZSGA 5BUIA 2XBAA 4FSQA 1VR2A 3HZTA 4FV2A 2XKCA 2WGJA 3HV7A 3F2RA 2VD5A 4S30A 1KE5A 3R73A 5JFWA 5EI6A 1ZYJA 3QLGA 4B8LA 1FVTA 3VUIA 3ZTXA 1KSWA 3UDBA 3ZCLA 4IFCA 4RJ5A 4AXCA 4DFLA 3DZOA 2IW6A 4K1BA 5J9YA 2UZOA 5EDQA 4MCVA 4RZVA 4CKIA 3KRJA 4N57A 2BDJA 4TN6A 3G51A 2IVTA 1JKKA 1PXLA 2VTLA 3B8RA 3CP9A 4FVQA 3TEIA 4AZTA 5C4LA 5I9YA 3MPAA 5IMXA 3TDVA 3VAPA 3G33A 2O65A 3P23A 1Y57A 3C50A 3MTLA 2G01A 1KOAA 5C8MA 4OBOA 4AN3A 1Q97A 2C0TA 3WZUA 3KMWA 3UQGA 5HE3A 4YTHA 3R01A 4EOLA 4F9CA 1Y8GA 3TIYA 5A46A 3E62A 2C3IB 2PL0A 3QA8A 2EVAA 2X8EA 2VRXA 4HGSA 5DT3A 2XS0A 4FYOA 5DN3A 5JGDA 3UOJA 1JVPP 1DI8A 4JQ7A 2HWPA 4BYJA 3F82A 2CHLA 4DA5A 5DR9A 4GK3A 3FE3A 1UNGA 4U41A 5BYZA 2LAVA 5FLFA 4BGGA 4KRCA 1KWPA 4JG7A 3I5ZA 3W2PA 4O7YA 4LYNA 3QRIA 4OT5A 4V04A 3R7UA 3LFEA 3LMGA 2UZNA 2HXQA 4BJJB 1F5QA 4D28A 4NW6A 4F70A 4DF3A 3DNEA 4FV9A 4MBJA 5H3QA 2ZV8A 4C61A 2PE1A 2XALA 2WXVA 3H9RA 1TKIA 4Y5QA 3AGLA 4HGEA 3UIBA 2Y6MA 5IUGA 2Y7JA 4UV0A 3NFGB 5ANEA 5CAVA 3NNXA 4J52A 2XARA 4QTBA 3VW8A 4RRVA 4APPA 5C03A 3FXWA 5I9ZA 1AGWA 4I23A 2C1BA 3R8LA 4RWLA 4U5JA 4EORA 4KINA 5HNIX 3D2IA 4I0SA 4OT6A 2YHVA 1YDTE 1Q99A 4IH8A 3VUMA 3FZRA 3ZO4A 2JDOA 3WZJA 3FAAA 3I81A 1A9UA 3O7LD 4LV5A 5JSMA 3ELJA 1JKLA 4UY9A 1Q8TA 2Y4PA 2WTCA 3ZZWA 3FYJX 3FQHA 4MXAA 4FKSA 5L8LA 3AD5A 5HEZA 4R7BA 3V5LA 3R9NA 1PY5A 3NNWA 2XRUA 3ZC6A 4CFWA 4MK0A 5AP6A 3HUBA 4ZTSA 5CU3A 5HBEA 4JDIA 3P5KA 3ZZEA 3OCSA 4GYIA 3I79A 3DAJA 5CLPA 5AUXA 3UNJA 1MQ4A 4F9YA 4FIIA 4J96A 4EBWA 3MY1A 5AADA 2YZAA 3GEQA 4K77A 4EONA 3P7CA 4MXCA 4D55A 4B4LA 5FDPA 4U94A 3LJ1A 4DINA 5E1SA 5KKRB 2KULA 1K9AA 1H07A 4XV9A 4BDIA 4L3PA 3ORLA 4LUEA 4XOYA 5KO1A 5ACKA