4DE4A

Crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with hepes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
molecule keywords APH(2")-Id
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4de4A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4de4A02
3L8XA 2OJFE 3KULB 4X3FB 4XG9A 4E73A 2I0HA 1P14A 2OLCA 5CENA 3PPJA 1XJDA 1R3CA 3JY9A 3FY0A 2CNQA 4MXYA 4XG4A 2WOUA 4GT4A 1OKZA 2YABA 4FEWA 3SW7A 5FDXA 1UKIA 1W83A 4ACCA 3ATSA 3FBVA 1PY5A 3C4WA 4GK2A 4YJUA 1CTPE 4BYIA 4Z16A 2A0CX 5LMAA 3TKHA 4CLJA 2QQ7A 3V04A 4D4YA 4IQ6A 1CKJA 2VWUA 3WARA 4LG4A 3PXQA 5K3YA 5IDPA 2WEVA 3BWJA 3QHRA 3O7LD 3LPBA 3NPCA 4QYFA 4WG3A 4G3GA 3KXHA 2QVSE 3UODA 3W32A 2PVJA 3A8XA 4XBRA 5TR6A 4FKIA 4YJNA 3TNIA 3TNHA 3UZTA 4RVMA 4IJPA 5CU2A 3UVRA 4YMJA 5L3AA 2PY3A 4CEGA 3UIBA 3I60A 5BUEA 1UNLA 3T3VA 4K11A 1NT2A 3EQFA 3FMMA 3PZEA 3FKLA 1H27A 3O8PA 4RJ3A 3UGCA 3ZDIA 5I4NA 5BQ0A 4UXQA 1J7IA 2YM5A 3PE2A 1SZMA 3HZTA 4TRLA 3GQLA 4TTHB 2XEZA 4DEBA 3Q32A 3UIXA 3MB6A 4MQ1A 3VBWA 1FMOE 4BDCA 2R3JA 4C34A 1IA9A 2OJJA 2ZJWA 1OL6A 3TI1A 4BDJA 5DT3A 3MW1A 3I79A 1OKVA 2WTDA 5DFPA 4CRLA 3BX5A 5JN2A 1BX6A 3FHRA 5AAEA 2PU8A 4F7SA 4EKLA 2VX1A 3MH0A 4RFMA 3O71A 3BKBA 3TJCA 4FSYA 3ZFYA 4M0YA 4D0WA 5BVWA 2XIZA 5I5ZA 4GUBA 1Q41A 2BDFA 4GS6A 1WVYA 3F66A 3M1SA 5CT0A 3RMFA 4X2GA 4I5MA 4O7LA 3OVVA 3W2QA 3GCPA 2ZV9A 3O0GA 4YLJA 4O0SA 3UVQA 3T9TA 2I6LA 4UEUA 3HYHA 4FIFA 3T8OA 2OZAB 3QXOA 3OTUA 4E4MA 4ANLA 2YIRA 4USDA 2RG5A 4YZMA 2X4ZA 4EOMA 5C4LA 1YVJA 3O8UA 5HD4A 4HVIA 2GDOA 1G8AA 5FTQA 4D4RA 4M68A 4FC0A 2QI8A 4ZP5A 4J95A 1IG1A 3U55A 1YRPA 1UU3A 3WZKA 2OU7A 4HCTA 3NEWA 4U7ZA 1TKIA 4DHFA 1FGKA 2OG8A 4EQUA 2B9HA 4I0TA 1YXSA 2XRUA 4YLKA 5M56A 2W4KA 5DR2A 4P2KA 3FC2A 3HLLA 3OXIA 4APCA 4CKIA 5AJQA 3BLQA 4IAKA 3V8WA 3BYUA 4OBOA 2C6LA 3LHJA 4IIRA 4HCVA 4HJOA 4DCEA 5KBRA 2O63A 5KCVA 3V6SA 3QX2A 4PL5A 3I6WA 2NPQA 3E7OA 3GI3A 4I24A 3QQLA 4GYGA 3DXPA 4S2ZA 1REKA 3TACA 2XZSA 3QQUA 4FKUA 4FZDB 3WIGA 4AAAA 2CKOA 2OF4A 4QMYA 3D2KA 2HXLA 4GFGA 4LYNA 1IRKA 2ESMA 2OZAA 4GK3A 3VF9A 3AD4A 4QMWA 3MVJA 5EKOA 2VNYA 2F9GA 5CVHA 4F9CA 4MBIA 3MI9A 4QP6A 5BX0A 1P5EA 2VTSA 2Y6MA 3P23A 3UQGA 5AP5A 1H8FA 1R0PA 2WU6A 4GCJA 5FRIA 3PJ3A 4AFJA 3DA6A 5J9LA 4I4FA 4QP3A 2CCIA 5BMSA 2A19B 1J91A 1IA8A 3PIYA 3UQCA 4QP2A 3V5PA 3DDQA 5EM6A 3R71A 4C36A 4WRSA 3RPOA 4CMOA 3BE2A 3BE9A 3ORKA 4FKJA 4J8NA 4YZNA 4ZS0A 4BCHA 4O0XA 4O22A 5DLSA 5DR6A 2QOKA 3DBDA 5E9EA 3BV3A 3ZXZA 4FV5A 3H9OA 5A4TA 3TNPC 4Q9SA 2W99B 4IB1A 3ORNA 2QO7A 3OHTA 3UOKA 4NSTA 2V0DA 3MY1A 3E8EA 3ZFMA 5BVEA 2XH5A 4M8TA 2JBOA 2YITA 3CSVA 1T46A 3K3IA 3WYYA 3UE4A 1OECA 1H01A 1OIYA 2JDTA 5ANKA 5I9WA 4FV8A 3HDMA 1JKSA 5AP3A 2BR1A 4M13A 3R9DA 1IASA 4FGRA 4CCBA 3OZ6A 2QKRA 5BVDA 4TYEA 1T45A 4RJ4A 2YDKA 4C02A 3R2BA 3KU2A 3GFWA 5D9HA 2J0IA 4DAWA 3B8RA 4Y5QA 2OW3A 2XBAA 2YA9A 2PSQA 3P7AA 4QQCA 4ZAUA 5CAVA 2ZAZA 1STCE 3KEXA 2VD5A 4RX8A 1PXPA 3S2PA 3C51A 3VUGA 4EL9A 2W05A 4YJVA 5CU3A 1XH9A 4C4EA 4OT5A 4AN9A 4L7FA 1JVPP 2VTTA 2XB7A 1VZOA 5CSVA 4B6LA 3MY5A 3QTSA 2YDIA 2V55A 1QPCA 1MRYA 1YOJA 3HECA 2G01A 3FY2A 4AP7A 1OIUA 4U97A 2WTVA 2W7XA 3LQ8A 3Q9WA 5IMEA 3OUNB 2OJ9A 3C5UA 3R8LA 3ZCLA 4GU6A 2J0MB 3FV8A 4NW5A 4S31A 4O86A 2E9UA 2JDOA 4GT5A 3A60A 3HP2A 3VBVA 4DTBA 5DE2A 4O0UA 2YIQA 3E92A 3A99A 1NA7A 1JKLA 4XCUA 3EQGA 3FZRA 5ANIA 3RPRA 3S1HA 5E8UA 3WBLA 1M7QA 5F4NA 4RT7A 4FMQA 5KMNA 5DRDA 2V62A 5KO1A 3TUCA 1Z57A 3UMWA 3POOA 1JQHA 4DH3A 4DGOA 5H8EA 2QOBA 4A9YA 3HV7A 2J5FA 2JKKA 3LAUA 4FKOA 1OB3A 3MJ1A 1OBDA 3OWKA 4FZFB 4TL0A 2ZOQA 2YJRA 3HGKA 4QMNA 3CQWA 4G5PA 4KWPA 4L45A 3U9CA 1APME 3SXRA 3WF6A 3TXOA 4RVLA 1VYWA 2HAKA 3ERKA 2ZV8A 2PULA 4R78A 4TNDA 5HX6A 3A2CA 3P7BA 4AW5A 5IUHA 5LVNA 2G1TA 2W96B 2C6IA 4ZSJA 3QALE 4IC7A 1KSWA 5FP5A 4ACMA 2BTSA 2ITQA 5I9VA 4A4LA 1FVRA 2QLQA 3JY0A 5DVRA 4RWLA 4ALVA 4AOTA 3MFRA 2PUNA 2UV2A 5IQFA 3OFMA 3AD6A 3POZA 4NTTA 5F1ZA 1M14A 5DWRA 3KMMA 2XIRA 1QPEA 3RWQA 5J1VA 1L3RE 5T3QA 4G1WA 4BBEA 3C4EA 4EQMA 4ZJJA 3RJCA 2P0CA 1RJBA 4USEA 4W4XA 4NM7A 2ITXA 4EWHA 2OFUA 5CF8A 5J1WA 4FL1A 3P9JA 3TIZA 4ZIMA 2VAGA 2IW6A 3ZC6A 4L8MA 2AC3A 2OSCA 3MPMA 3CIKA 3Q04A 2C1BA 5KBQA 5EM7A 3DKGA 4O2PA 2EVAA 3TV4A 4EHVA 2BFXA 3LQ5A 4AOIA 4AW2A 1TQIA 1WVXA 2UZUE 4AZFA 2PHKA 1BI7A 2BTRA 3P7CA 5ANEA 5AUYA 1OBGA 5C8MA 3WIKA 4IX5A 4OTGA 3AMYA 2R3OA 4QTDA 4D28A 5FUTA 2XJ1A 4E4XA 3TV6A 4Z55A 2UZOA 1L8TA 4AT5A 2PE1A 3MN3A 2PE2A 3P5KA 4FL2A 4QP1A 4AXAA 3VUKA 4MCVA 4O81A 3PRIA 3QQGA 4CFWA 4CLIA 3U9NA 4QP4A 4RQKA 2FH9A 1F5QA 4DGMA 3FHIA 2PMOX 3C4ZA 3EFWA 5HNIX 3OCTA 4L67A 1TVOA 2F7ZE 4X3JA 4RIYA 3ZO2A 1GZNA 1R1WA 4BIEA 3FJQE 2RFEA 2XKEA 4I0RA 3ZLWA 3LJ2A 3KRJA 3NSZA 3LCSA 4DFXE 3UVPA 4G2FA 5HD7A 4YR8A 3VS6A 4ENXA 3H9FA 5J8IA 2XP2A 3NMUF 3E8DA 4IANA 1XH7A 3ZTXA 3TIYA 4IWOA 4EOLA 2OF2A 1NVQA 4IB5A 2ZMCA 3DKFA 3IW5A 4O21A 3UC4A 3W0PA 3CTJA 2XIYA 4OTHA 5DHJA 2PUPA 4HVHA 4R6VA 3ID6C 5HIEA 4CTBA 5J7HA 4F0FA 4YZBA 1IAJA 4LQMA 3NX8A 5CI6A 4FYNA 3SLSA 4C4HA 4R77A 3CE3A 4ITHA 4E5BA 3ORIA 4DFLA 4F7NA 3SQQA 1ZZ2A 2Y4IB 2GS6A 4DGGA 1ZARA 4MHAA 5KMIA 4U6RA 2W17A 4LGGA 5T6KA 3D0EA 3LXNA 4TYGA 4JDIA 4E26A 5GJDA 1PF8A 4U79A 1O6KA 3DB8A 4IDTA 3LFCA 4RIYB 4FEQA 5IZFA 1JSVA 4FIJA 2WMTA 2FGIA 3HMMA 4FKSA 3UNZA 1WAKA 2FUMA 3EQHA 3TDVA 3NNXA 4Z9LA 4DT9A 4I93A 1H1QA 3UG1A 4UN0C 1SVEA 4RFYA 4RWIA 2IN6A 1F0QA 2VTLA 3FPQA 2IZTA 3NCGA 3ZC5A 3EL8A 5IEYA 3FMDA 4GH2A 3MPAA 4J71A 2ERKA 5KZIA 4ZJIA 3PWDA 4F6SA 4WNOA 3HA8A 4Y8DA 3VO3A 3P08A 2JFMA 2CKQA 5CXZA 3DQXA 1SNXA 2WFYA 5IQCA 2ITZA 4L00A 5GHVA 5EHLA 2YN8A 3OCGA 4CFVA 1JSUA 3I1AA 5F9EA 2EXCX 3FXWA 4QP9A 4DGNA 2BRHA 3BRBA 2XK8A 2YDJA 4C38A 3PPKA 3D2IA 2EU9A 4LFIA 3RHXA 5FM2A 3VS4A 5I9YA 2Y4IC 3EYHA 4JG6A 3FWQA 3WF8A 3H0YA 2Y8OA 4PV0A 4BCQA 4I6FA 4L9IA 4JDJA 4CNHA 4AE9A 5IA0A 2XIKA 4QP8A 3EH9A 5AAFA 3N51A 4MXXA 4CSVA 3RCJA 2XRWA 4EKKA 2X8DA 2EB2A 5B2LA 3F2NA 3Q9XA 4GFMA 2IW9A 3RM7A 4RC2A 2OH0E 4W4YA 3QGYA 5EW8A 4EZ3A 4FSTA 5JRSA 1VR2A 2X81A 4X2NA 3WZEA 3QL8A 2H9VA 1ZWSA 3R00A 4EOKA 4XG2A 1DI8A 5HX8A 3GGFA 1V0BA 3ANRA 2RGPA 4O7RA 2I0EA 1H26A 3KMWA 3P78A 3ORLA 3D7TA 3K54A 4U40A 4DEHA 2YCFA 4PUZA 4I94A 3R28A 4O7NA 3ZUTA 3DQWA 3IW6A 3Q4CA 5G6VA 1NXKA 5T68A 2J6MA 3PJ8A 3R7IA 4AGWA 2CCHA 3V8TA 2HWOA 3HP5A 5CU4A 1B6CB 5CYIA 2O64A 3PSBA 3UO5A 3QAME 5KKRC 4CKJA 1XH4A 4DN5A 4MNFA 4I5PA 2W1IA 3ACKA 3Q52A 3ATTA 3DBQA 5CY3A 4BCFA 3LZBA 4NT4A 4CT2A 1YXXA 2R9SA 4O0WA 3E5AA 5CALA 5CU6A 2B7AA 5GINE 5HO8A 4IX6A 4PMMA 4U8ZA 4FTMA 5EYKA 3MFSA 2BPMA 4AWIA 4BYJA 3IGOA 4HZSA 2XJ2A 3SDJA 2GNFA 4EONA 3ZUUA 4WUAA 2LAVA 4H3PA 5GJFA 2QNJA 3MH2A 3NAXA 4FKRA 4JVGA 5CX9A 1U59A 3JYAA 4ALWA 3D7ZA 4Q2AA 4ACDA 4V01A 3OEZA 4ASXA 3LE6A 5CAOA 1O6YA 4QMOA 2IZRA 4JBQA 1J3HA 4XV2A 3A7IA 3UDBA 2CMWA 4L43A 1PXLA 4C2WA 2Z2WA 5C4KA 3HRCA 3BU5A 4AS0A 3BEAA 5ANGA 3V8SA 5IUGA 3RGFA 5KZ0A 4TY1A 1H1RA 5K5XA 3AC8A 2ZV7A 5JZNA 4IZYA 3ZEPA 3V01A 4IADA 3EN9A 5KHXA 3AMBA 5D11A 1WFCA 4EH7A 3ORPA 5AADA 5DEYA 1O9UA 3PA4A 3Q5IA 3Q96A 3GCUA 2FSTX 3HX4A 5JSMA 2Y4PA 3R7OA 2BAKA 2WTIA 1H00A 4AW1A 3LJ1A 4DH1A 1OL2A 4GSBA 3BQRA 4KKGA 5D41A 3ORXA 3C7QA 4AA4A 4QMLA 4AZVA 4FZAB 5JEBA 2VTIA 1YW2A 5HCXA 5M4FA 3W0OA 5ETIA 3NUPA 5KMOA 4JQ7A 3QCQA 2NRYA 1Y6AA 2WQNA 2OWBA 2GHLA 2QOLA 2YJSA 3LFQA 3D94A 3NW6A 3OXTA 1CKPA 5CXHA 4DFNA 1FQ1B 5E8XA 1BYGA 3BYMA 2BIKB 2GNGA 3GCSA 3LFBA 4ZLOA 4XLVA 1OUKA 1SVHA 3F3TA 5JQ8A 1SMHA 2W1EA 3WZJA 3E7VA 1ZLTA 3ZZWA 5EKNA 5LMKA 4E7WA 5IDNA 3PIXA 4J53A 1FBNA 1M2RA 1UA2A 4TYIA 3KC3A 1Q3DA 3PSCA 3F7WA 4XG6A 4BY9E 5AV0A 1UNGA 2QHMA 3KXMA 1ZZLA 3PE1A 4FTJA 4ZSAA 5A4CA 3R8VA 3E3BX 2XYUA 3MB7A 5CSXA 3Q2MA 2PVHA 5CS6A 3RWPA 3SOAA 4PNIA 4OLIA 4EJ7A 4GKHA 3NDMA 5K4IA 4HVSA 5HE0A 3QRUA 5HG7A 3EQCA 3R04A 1GZKA 3HV4A 4JBPA 4FL3A 2VWVA 1PMUA 5DPVA 3D5XA 5EDPA 5ETCA 4QP7A 4CFNA 5IEVA 3CQUA 4FTUA 4FODA 4PMTA 4IAIA 2V7OA 4PWNA 4RX7A 3LMHA 3H10A 5JFXA 4LRJA 2PMIA 4DTKA 4P5ZA 1P4OA 4YPDA 1XH5A 3D7TB 3EIDA 3GENA 4UWYA 4EH5A 3EQPA 3O23A 3AG9A 3QD4A 3ET7A 4ZTMA 4B8LA 2R3FA 4E6QA 2HW7A 2O8YA 4L46A 4I92A 4BCGA 5A4LA 5IA4A 1J1BA 2XCKA 4FV4A 5HZNA 5GIPE 4LL0A 2A1AB 2NNWB 2J9MA 5AP1A 1M52A 2I40A 2WMBA 3JPVA 4GVJA 4CMTA 4FKLA 2CGVA 4PP9A 5FG8A 4QTAA 4X0MA 2YEXA 1DI9A 1CMKE 1F3MC 4JRVA 4YLLA 2ETRA 2X7GA 4BTMA 1PXKA 4IH8A 4GU9A 4AA5A 4ASEA 2PE0A 5AIKA 2BDWA 4XEYA 1CSNA 4JS8A 1RE8A 3O51A 5I9XA 1MRVA 3IW8A 4M14A 4S33A 3BYOA 5CQWA 3KCKA 4DFZE 3VAPA 2VN9A 1WBNA 3P1AA 4GKIA 5AV2A 1A9UA 4ANBA 5AUZA 3HVCA 3O7LB 4HCUA 4EYJA 4ZTHA 2C3LA 4JBOA 1MQBA 2W0JA 5BUJA 5IU2A 3R7UA 2O2UA 4YSMA 3DBFA 5FEDA 2Y7JA 5AV4A 3U4WA 3C0GA 2A2AA 3AT4A 4JX7A 3IO7A 5I9UA 4WG4A 2QOOA 2I7QA 4QMUA 4BC6A 3A4OX 3NAYA 3QBNA 2CNUA 3A7HA 4U3YA 3NLBA 2UZDA 2W1CA 4I22A 4EQCA 2JIIA 1PKDA 1Q24A 1JPAA 3OG7A 5A4QA 2DYLA 4FGBA 4WNPA 3CD3A 4PTEA 2XYNA 3PZHA 1I09A 3IONA 1OIQA 1UKHA 2BZKB 1S9IA 2CKPA 4R3RA 4BIDA 3CBLA 4CFUA 3KVXA 3QTXA 4FV1A 4DH7A 2FSOX 2GNJA 4RSSA 2ITYA 4U81A 4DH5A 1OL7A 4FV6A 3BHVA 1E1XA 4FT7A 1PMEA 2JIVA 2R3GA 3FPMA 4F99A 2P4IA 3KK8A 2C69A 4I5HA 2ONLA 5ACBC 3OT8A 2C3KA 4IWPA 3D5UA 4YNEA 4EH8A 3F5PA 3F9NA 4QO9A 5H3QA 5ITAA 3IK3A 3QZGA 2FYSA 2NP8A 4RBLA 1YDSE 4FKWA 4XH6A 4ZSGA 3BBWA 4YTIA 3FLNC 3NNWA 2WXVA 3DY7A 5M06A 5LWNA 4D1XA 4LUDA 2GFSA 4UY9A 4E8AA 2JITA 4OW8A 2QR7A 5AP4A 3ZMMA 2XMYA 2C6TA 2JC6A 4MYGA 4YTFA 4HVGA 5JZJA 1OPLA 1QMZA 2WTKC 3OY3A 2ITWA 4IMYA 4A9SA 3D14A 4FV9A 5CNOA 4O91A 3MYGA 2QR8A 5L2SA 3A7FA 2PZIA 5HE3A 3ZUVA 3GT8A 3EN6A 2VTJA 4FG7A 4BIBA 2C6KA 4LRMA 4AN3A 1YHWA 3MFTA 3QQJA 4R7HA 3WI6A 4U98A 2ETKA 3QD2B 2XNMA 4FV3A 3GVUA 3R01A 2BHHA 3OWLA 4QMXA 4IAFA 2GS7A 3KXZA 3FLSA 5BPYA 3R1SA 3ZDUA 3OEFX 3OBJA 4MD9E 3TJDA 4C61A 2CN8A 2JLDA 4YU2A 5CAPA 3KRLA 4GJ3A 4MAOA 3FL5A 4KBCA 2PVRA 3UPXA 3QQFA 5L8LA 4ZMFA 1E9HA 1B39A 1H08A 2PVMA 4QTBA 3CGFA 2PMLX 4QMVA 1QPJA 3OXZA 4DINA 2OXDA 2PTKA 4L42A 5B2MA 5LMBA 1GIIA 2GTNA 4U44A 4UWCA 3O50A 5DT4A 4ACHA 3QKKA 3KGAA 3FQHA 3GUBA 3E3PA 2UVYA 1R39A 3MS9A 3UZRA 4B7TA 5KMKA 3MESA 2JDRA 2ZDUA 4YJOA 3G9LX 2W1ZA 2C5YA 4N57A 4CFXA 4MD8E 2BALA 3TCPA 1VJYA 2ITPA 4IWQA 4ONAA 4DFBA 1X8BA 2UW3A 3B2WA 3F2AA 3P4KA 3DJ6A 4YZ9A 2R3KA 4C59A 4PP7A 3UOJA 3ORTA 3IG7A 4CMUA 1WVWA 3NUUA 5AUWA 1LPUA 4QYYA 4F6WA 1ATPE 2X7FA 3ZRKA 3UO4A 5M4CA 4EHEA 3OF0A 4FTQA 4HGLA 3QU0A 2B54A 3PJCA 5M53A 3JXWA 2VTRA 3QQHA 5AUXA 4DFUA 3KN6A 3QKLA 4BBMA 2XKFA 4IVAA 5FTGA 2UW7A 4KNBA 4G5JA 5HKMA 2VX3A 1G8SA 1PMNA 5CWZA 3EZRA 3SHEA 2JDVA 3IECA 2OBJA 5DI1A 1TQPA 4NW6A 4C7TA 3WOWA 4H58A 1GAGA 2QURA 2H34A 3Q2JA 3DAJA 1W98A 3NS9A 2QOIA 3U6IA 4S32A 3IW4A 2XVDA 3O17A 3ORZA 4BTJA 2I0YA 4C62A 5L6OA 2UZTA 2WMWA 3COMA 3HRBA 4B4LA 4IX4A 2GPHA 3O8TA 4G3EA 4L68A 4PL4A 4CD0A 1CM8A 3EQBA 4ITJA 5HTCA 3S0OA 3GC7A 4P90A 3MA6A 3PXKA 1H4LA 5I0BA 2YM6A 4JRNA 1OM1A 2HY81 4RIXB 3W0MA 5EW3A 4AZWA 1FMKA 3IW7A 2FVDA 2VZ6A 2W9FB 4PX6A 5BVKA 4YPSA 4AA0A 4BGQA 3UPZA 3UG2A 4PDSA 3HMNA 5L2IA 3QUEA 4FSZA 2WIPA 4RZWA 2CJMA 3RINA 4GMYA 5A6NA 1W82A 4DH8A 3DS6A 2WTWA 3GU4A 4YBKA 3U6HA 1M2PA 2GHMA 3DFCB 3QWJA 3C0IA 3E63A 3F61A 4I1ZA 4JG8A 4AFEA 3UOLA 3MPTA 2UW8A 4C35A 5K9IA 3Q4TA 4Q5EA 4AUAA 4GRBA 2Z7RA 4XG8A 2ZVAA 2OZOA 3RP9A 1JWHA 4FTNA 1E1VA 3Q3BA 1J7LA 4AZEA 2BVAA 4BKJA 4D55A 4FTAA 4K1BA 5E8YA 4KABA 4AOJA 4KRDA 5IA3A 4QTEA 2VNWA 1XWSA 4O2ZA 5EG3A 3LIJA 4RIOA 4OBQA 5KE0A 2R5TA 4HYUA 4U41A 1SVGA 5JFVA 3W0NA 3MVMA 4CGAA 2YIXA 3L1SA 4C3RA 2IG7A 1DM2A 4MWHA 1Q3WA 5AP7A 3P79A 3E93A 3F3VA 3NW5A 3MGYA 1ERKA 4I21A 4O84A 2B52A 3SA0A 1I44A 2WNTA 2C5NA 4E20A 2VTOA 4JI9A 5HE2A 2C3IB 2ONLC 4USFA 4GT3A 5E4HA 5AM6A 2VWZA 4JIKA 4E5WA 5IEXA 5FDPA 2C47A 5GNKA 5HG5A 4K2RA 4N4SA 3HMPA 3AMAA 1BKXA 4O0YA 3FI3A 2XK7A 3OOMA 3MY0A 4XOYA 3I5ZA 3W8QA 3PG3A 2XK9A 4OT6A 5IQDA 4XP2A 4BTKA 4IC8A 3ELJA 2B9JA 3A7GA 4KBAA 4OTQA 3HA6A 3LMGA 2QOHA 3R8UA 2R3NA 4PTCA 1Y8GA 3UTOA 4NH1A 4ENYA 3I0QA 1YXUA 5HBHA 5HQ0A 2C6DA 1H24A 1Q8WA 3MIAA 3VS3A 4APPA 4BDDA 4PMSA 1IEPA 2G2FA 4YTCA 4TPTA 2E9NA 3CR0A 2VWWA 3A7JA 3FXZA 3JR1A 4NJDA 2WMSA 2G2HA 2RL5A 3EKKA 3O2MA 4X2KA 3Q9ZA 2W1HA 3CJFA 2WB8A 3TTJA 2GQGA 3COHA 3Q5ZA 4RJ7A 1WCCA 2CGUA 4IJ9A 3A61A 3DOGA 3TYKA 2BHEA 2BRBA 1JSTA 2YM3A 3KCFA 3ODYX 4U9AA 4C4IA 4ZZNA 4WO5A 4EWQA 4O7TA 4YJTA 1OL5A 4IM0A 4OBPA 2C0IA 3ZRLA 4QPSA 4FNXA 2B0QA 2HCKA 5FXRA 4BI2A 3HUCA 5A46A 1HOWA 2ZB1A 1XBAA 2VTMA 4KIPA 4K77A 4F9WA 2Y9QA 1UWJA 3KRRA 3PY3A 5LVPA 3AQVA 4Z7GA 3FI2A 3PLSA 4EK8A 3UBDA 4FEVA 4HGTA 4O6LA 4QNAA 4CG9A 1KE7A 2J0JA 3EOCA 3OOGA 4R7IA 4EUTA 4MH7A 4EH6A 3QLGA 4FBXA 4EH2A 3D9VA 1VEBA 3R63A 2B9IA 4LMNA 4O96A 4JL9A 2YAKA 3FI8A 3NIZA 3LMIA 3PA3A 4JG7A 5AWMA 5LVMA 4L52A 2OH4A 4LI5A 1WBWA 1ZYCA 1ZYSA 5EW9A 3DJ5A 4O7SA 5LXMA 2Y6OA 4H3BA 2F7EE 4G6NA 4QNYA 2EUFB 4BR3A 1BI8A 1H25A 3DKCA 4WA9A 4ZZOA 3KF7A 2VX0A 5KKRB 2F49A 3II5A 5M08A 3OWJA 4FTTA 3MTFA 3V6RA 2XM9A 2C30A 4QMQA 3KL8A 3MVHA 4W4WA 3DT1A 3R1NA 3R9NA 2J4ZA 3H4JA 3PFQA 3KRXA 3F6XA 4FTKA 1EH4A 4ZY6A 4YC6A 1IR3A 2IW8A 2GMXA 4CV9A 4DEDA 4EH4A 3ALNA 2CGXA 3HNGA 3MFUA 2W06A 5CASA 4MQ2A 4K9YA 4FSWA 2F2UA 1J1CA 2ETMA 2AC5A 2RFSA 2VTNA 5JGAA 4RA5A 4GJ2A 3KXXA 2CKEA 5CEOA 3GC8A 2X4FA 4RX9A 4BZDA 3QD3A 4Y46A 1Q5KA 3GCQA 2VO0A 4X2JA 4BGHA 2VTAA 5JKGA 1QCFA 4BBFA 3BGZA 5ICPA 1P4FA 2I0VA 3VS7A 2E9OA 1PXOA 3KK9A 3W2OA 3RPSA 4RWKA 3ZS5A 3ZLYA 5IQHA 3RZBA 2IVVA 3ZEWA 4RJ8A 3ZM9A 1MP8A 3IQ7A 2F2CB 4F1MA 4QMPA 2QO2A 3R8MA 4D9UA 4FG8A 3SW4A 3VC4A 4I0SA 1V1KA 2XF0A 3LXLA 4BZNA 3PVGA 4OTDA 2GNLA 4N6YA 3NYNA 4NU1A 2UW0A 4ZOGA 2X6EA 3VRZA 4WRGA 1A06A 4QQJA 4EBVA 4MXOA 4DBXA 1UWHA 3KY2A 1MUOA 4KRCA 3CC6A 4S30A 4H3QA 5HEZA 3ZOSA 3TZMA 3DNEA 3RVGA 4KA3A 3ORMA 2GS2A 2PVYA 5E1EA 4FVQA 4CFFA 2XNEA 2YISA 5J95A 4LOOA 4HNIA 2PK9A 4ERKA 3CKWA 2GQSA 3LKMA 1REJA 5J87A 3W0SA 2UZWE 5EDRA 4ZTNA 2PWLA 4F6UA 2I1MA 1JKTA 3K3JA 2FO0A 4O0TA 4WHZA 3IDCA 3OROA 4EI4A 4F1TA 2R0UA 3ZXTA 4NZWB 3VIDA 4RQVA 3MJ2A 4X2FA 2P2IA 3KVWA 2P3GX 3QZIA 3BGQA 4IAZA 4D1ZA 5M51A 4DF3A 4L53A 4QMTA 3WYXA 3FMHA 4L3PA 5DYJA 3IS5A 2QKWB 3LCOA 3LOKA 2OI4X 1FGIA 2IVTA 1B38A 2XKDA 4NCTA 3QKMA 5DGZA 3SV0A 3NYOA 3LCKA 4DEGA 4EHZA 4Y73A 4NKSA 4BHZA 4RVKA 1W84A 3FI4A 4RIWB 1FVVA 4E6AA 3NUYA 4M97A 1Q62A 2WMQA 4KIQA 4TW9A 1HCKA 4XG7A 5FXQA 4AN2A 3EFKA 2W9ZB 5EQEA 3ROYA 5HVKA 5HE1A 3QXPA 4D4VA 3MDYA 4B0GA 4IW0A 5EYDA 4BCOA 4G3CA 4XV9A 4FOBA 2WQMA 5JQ5A 4JBVA 4ORKA 3Q4ZA 3SXFA 5CEIA 4C4GA 2WPAA 2Q0NA 2IVUA 4JR3A 4H1JA 4IAAA 4DG3E 3WE4A 2P2HA 4BCNA 5EOLA 4F64A 4F9YA 4UWBA 5A4EA 4FUXA 1JBPE 3PLAE 3EKNA 2IZUA 3QTZA 4UV0A 2ZM1A 4NKAA 4B99A 2GFCA 1K9AA 4YJPA 5KNJA 3DXQA 4FX3A 4E5AX 2CN5A 3OUKA 3BHUA 2QU5A 5DG5A 1WBSA 1HCLA 3HMOA 2EB3A 1BUHA 4BRXA 4I23A 5BYLA 3RPVA 4C37A 2BZJA 5HLWA 3ZSIA 4CRSA 1OI9A 3PVUA 4V0GB 3TUBA 1M7NA 3WF5A 1W8CA 4GYIA 4N0SA 4DEIA 3GXLA 3JVRA 2B53A 2VWXA 1UU8A 3N4UA 4L44A 2JDSA 4K18A 3FLWA 3FZOA 4FEXA 4AU8A 3PUPA 4GFOA 4ZTSA 4L7SA 5CSHA 4YO4A 2OK1A 4ASZA 5GJGA 3ZLSA 2VTPA 4YGAA 4O6EA 4NCTC 4D2RA 5BYYA 2C68A 4JOAA 4OTRA 4WBOA 3COKA 2R4BA 5LQFA 4I20A 3LM5A 3E62A 3G33A 2X6DA 4C33A 3CQEA 3GOPA 4FT3A 4XG3A 5F20A 4YHJA 3GU6A 4BGGA 5EH0A 3V5WA 2J90A 2QHNA 1OIRA 3G2FA 3QWKA 3F2RA 4M12A 4Y85A 1YI4A 5LVLA 5CAQA 5IH4A 5TO8A 4ZS4A 3PYYA 5EQYA 2PMNX 2VUWA 4F0GA 4MK0A 4AT3A 1PHKA 2W5BA 2J5EA 5E92A 2HZ0A 3RAIA 3DCVA 5TOZA 4V0GA 3SVVA 3EYGA 3QRJA 1R78A 3DK3A 2E9PA 1OPKA 3L9PA 3E8NA 2BIYA 4DT8A 3OC1A 3HMIA 4WT6A 5EHOA 3TUDA 4HGEA 5FP6A 2OJIA 2C5OA 3NVMB 4FR4A 4ZTRA 3EN5A 4EHGA 1IAHA 5HCZA 1OZ1A 2G15A 2VTHA 1Q97A 2R3IA 4UYAA 4EH9A 2WZJA 2YCSA 5BMMA 3VS2A 3EB0A 4L3JA 1GNGA 1Q8TA 3S3IA 3AXWA 4FIIA 2HWPA 4H1MA 4DBNA 5KMMA 3KN5A 3RAWA 5HGIA 5CSPA 4HNFA 2RFNA 4C58A 3G0FA 2V22A 5B2KA 4W8DA 3R1YA 3F7ZA 3WF7A 4FKGA 4YHTA 2PZRA 5JT2A 4IHPA 3UNKA 4JQ8A 3W10A 1SYKA 3SKCA 3PJ1A 3PSDA 5BVFA 3GU7A 1OKYA 1KOAA 3DGKA 2YIWA 3VQHA 2PZPA 3EQDA 2YM8A 1SM2A 2J0KA 4ALUA 4ITIA 4BTFA 5IQBA 3LLTA 3G9NA 4FIGA 3EJ1A 5HG8A 2JD5A 5E8SA 1KE6A 4FKVA 3ANQA 4QRCA 2HYYA 2YACA 4U3ZA 5EI8A 4A4OA 2BCJA 3MV5A 4EOOA 1XBBA 3BELA 4A06A 5M44A 3CXWA 1LP4A 4FT5A 2W1GA 2R2PA 5DBXA 3FZSA 1H0WA 2WQOA 4FTOA 5CLPA 5HBEA 3DNDA 3R22A 3I4BA 4UZHA 2PPQA 4Q5HA 4A9TA 3E64A 5EYCA 4FKQA 3BYSA 1GY3A 4RG0A 2VO3A 1OL1A 3FYKX 4JDKA 4R7BA 5J5SA 3RK7A 1PMVA 2QOQA 4O7ZA 2HOGA 3AC2A 3PXYA 3CKXA 4RC3A 4EYMA 3BEGA 4BZOA 5H9BA 3Q4UA 3GOKA 1OGUA 3DPKA 3B2TA 5DT0A 3IKAA 3VJOA 4ZJVA 4M15A 3LLAA 4U43A 3NUXA 2ZM3A 4ARKA 3NZ0A 4IBMA 4E6DA 3P0MA 4RPVA 2JEDA 1UV5A 3CTHA 4H05A 2VU3A 5CI7A 5D10A 4F9BA 5IA2A 5L6PA 3V51A 1UU9A 2PVFA 4O83A 2Z7QA 2X2KA 4I6HA 2XNNA 4KKHA 2R7BA 3FMEA 3NNVA 3PWYA 4Z7HA 3LVPA 4FSNA 2ZMDA 1Z9XA 4GUEA 4RRVA 4L6QA 4RX5A 4N70A 2C4GA 2UW6A 4XOZA 3AC1A 1NVSA 4JAJA 4YBJA 3ZO3A 2UZVA 4WIHA 4F7JA 4TXCA 2B1PA 4R1YA 3PPZA 4RJ6A 3TL8A 5KMLA 4QYEA 1H1WA 4DITA 3QYZA 2O5KA 3VJNA 2BFYA 2E2BA 3FLYA 3A62A 3G90X 4KS7A 2J51A 2HELA 3RCDA 3T9IA 2JAVA 4PDYA 4QMMA 4MNEA 2UVZA 4FICA 5EM5A 4C4FA 5EFQA 1JAMA 3R9OA 4FUYA 4J8MA 2OJGA 3CS9A 3DU8A 5D7VA 3RALA 1OMWA 2QODA 1K3AA 4PNKA 1YWVA 3Q6WA 4FK6A 4GL9A 4TWPA 5ETFA 5FD2A 3W2PA 3QX4A 4A07A 3QUDA 4CG8A 2EWAA 4EZ5A 5A54A 1O6LA 3MA3A 3PY1A 4OTWA 2J7TA 4UZDA 5CEKA 3U87A 4KAOA 3ENHA 3GEQA 2QONA 2XM8A 5LCJA 4EEVA 4D2SA 5CVFA 1LEWA 3UIMA 1KE8A 4MD7E 4FKPA 2A4LA 4NM0A 3UZPA 1KWPA 2XNPA 1UU7A 5BUIA 3U8WA 2DS1A 3R21A 3DAKA 4FZ6A 3F3ZA 4G9CA 5CF5A 2CNVA 5JMSA 4BF2A 4DG0E 5I9ZA 3AD5A 4ID7A 2BZHB 4MVFA 1KE9A 2WGJA 2R3PA 3NGAA 3IOPA 4C0TA 2NRUA 1Q61A 2XBJA 4ZSEA 5FQDC 4U80A 4XS2A 1M17A 4FE2A 4AACA 3CD8A 2OIBA 5AP0A 1YXVA 4CKRA 4AGUA 2ITVA 4DFYA 3BGPA 2YAAA 3R1QA 4NK9A 5HICA 5JFSA 4TWOA 5M57A 2QO9A 4AQCA 2ZB0A 5A6OA 3I81A 1FPUA 2NO3A 4K6ZA 4KSQA 2G9XA 2JKQA 3VHEA 4DCAA 2H8HA 3DAEA 5CTPA 4RC4A 4YTHA 4IX3A 5TF9A 2IPXA 1XHAA 2IZSA 4CV8A 5GIOE 3NIEA 2CPKE 2LGCA 5HCYA 4YC8A 4O7PA 5HIDA 4O7WA 3QFVA 4Y72A 4G6OA 3QTIA 1PJKA 2XUUA 3HUBA 3LCTA 2UW5A 4RA4A 4MXZA 1PXIA 3L8VA 4I5CA 3VRYA 1ND4A 3C0HA 3FDNA 3QA0A 2BRMA 2FB8A 4J98A 4NM5A 4XBUA 4IFCA 4FOCA 4M67A 4WNMA 3K5VA 4BICA 5CZIA 3ALOA 4CCUA 5JGBA 5D1JA 3W0RA 4LV8A 2JIUA 3UO6A 4BDIA 5AX9A 4EBWA 4EK4A 5KUPA 2GCDA 4NIFB 4ZY4A 1QPDA 4G9RA 3Q60A 3Q9YA 3UOHA 5EYMA 3UP7A 4IWDA 3H0ZA 2BRGA 4JX3A 3Q6UA 4DYMA 4YURA 3EN7A 3U6JA 1PXMA 3VUHA 2XNGA 1RDQE 3DV3A 3W8LA 4FIHA 4CTCA 5M07A 2R7IA 4BDFA 4EOSA 4BCJA 5C1QB 5BYZA 4O7VA 2UZLA 3OW4A 4GIIA 3S00A 3O96A 1RW8A 2VTQA 1Q8YA 2C6MA 3NYVA 4NFMA 4EOQA 3FAAA 3KMUA 3ZU7A 1ZOHA 4UALA 5EK7A 2VWBA 1R0EA 3W55A 1YWNA 4O0VA 1U5RA 5HG9A 2GHGA 3PXZA 5EI6A 4MTAA 4V04A 1DAWA 3QUPA 5FTOA 3IDBA 1AD5A 3MH3A 4ACGA 3OMVA 2J0LA 3ZM4A 5EQPA 3WE8A 2Z7SA 4B9DA 3QZHA 3U4UA 3DK6A 5CANA 2RFDA 5ANJA 4AGCA 5F95A 4D4SA 4I3ZA 3EN4A 1YHSA 2R3HA 3SRVB 4WUNA 4BI1A 2Z60A 3CY3A 1A48A 2PVNA 3L8SA 3R02A 1Y57A 5CSWA 4MNEB 4RWJA 3PG1A 3LW0A 5IA5A 4ZLZA 3PXRA 3NW7A 1XR1A 3TG1A 1VYZA 3QCXA 4YJRA 3U51A 5HNBA 3JUHA 3BHYA 2BRNA 2WMVA 1H1SA 3TZ8A 4BB4A 4P7EA 4GEOA 2XJ0A 3AC3A 4EOIA 4XP3A 3GQIA 1GZ8A 5A9UA 3SAYA 3BYVA 5IMXA 2HW6A 3HDNA 4D0XA 4FA2A 3BHTA 4R1VA 4AZSA 3QC4A 4X6RA 4FVPA 3FMJA 2YM7A 5E8TA 3FC1X 5LOHA 3NVKI 5IUIA 4IVDA 3CCNA 2R3MA 3ZRMA 4OTFA 3M42A 3QTQA 4YHFA 3VS0A 4F9AA 3SRVA 2WU7A 4YSJA 2VV9A 1U5QA 4FK3A 2YCRA 3HL7A 4L01A 2GNIA 3ZO4A 5AFVA 5IH5A 5EDQA 4E4NA 5IQIA 5HVYA 2ACXA 4PQNA 5DN3A 4EK3A 3AT2A 5LMKC 1YQJA 2VGPA 3A4PA 2GSFA 5LWMA 3G15A 5LARA 4QYHA 3OS3A 2ITNA 5B7VA 1ZMVA 3PP1A 1AGWA 3ROCA 4U94A 4RJ5A 3VW8A 2F4JA 4XV3A 3IOKA 2HZNA 1JNKA 4EC9A 5CT7A 4H36A 4F08A 3QA8A 2JKOA 3ZLXA 3MTLA 4P4CA 3VUIA 3ZONA 3DXNA 4GIHA 2RIOA 5HVJA 3OP5A 3QCSA 4UBAA 2VWYA 1DAYA 3N4VA 3D15A 5DOSA 5AP6A 4AW0A 2BZIB 2X8EA 4WG5A 3FLZA 3I7BA 4I41A 3M11A 5HU3A 3ZFXA 3NR9A 2CLQA 2KULA 1ZYDA 2R3RA 3FEGA 1MQ4A 3FUPA 3LXPA 3OCSA 4GW8A 4TN6A 5AEPA 4BDGA 3QRKA 5G1XA 4IM2A 2WMAA 3K5UA 2O0UA 2AUHA 4WBBB 5CEPA 2UZBA 1PW2A 5HHWA 1UVRA 4PDOA 5AMNA 1G5SA 2B4SB 5AAGA 2WELA 3PIZA 5IISA 4FT0A 1U54A 5BNJA 4C3FA 4DG2E 2YZAA 4RIXA 3MBLA 2JKMA 1OKWA 3FMLA 4D1SA 1XO2B 3AT3A 4FTCA 4BCMA 5HBJA 3PRFA 4FSQA 2OIDA 4QMZA 4R5SA 4I4EA 3V5LA 4M69B 3U54A 4XNEA 3ZYAA 2BKKA 1H07A 4DEEA 4F63A 3ETAA 2UZNA 3HV5A 4MKCA 4TYJA 4EK6A 5M09A 5AIRA 2KTYA 3VS1A 2BROA 2UUEA 2V5QA 3VUMA 3QZFA 1ZY5A 3NUSA 4IEBA 4YNOA 4LOPA 3OT3A 2WHBA 4XP0A 4M3QA 3R73A 1J7UA 1YI3A 4HPTE 5BVOA 2RG6A 4PMPA 3PDTA 3MH1A 3ZH8A 5E8WA 4R3CA 3DK7A 4JJRA 2YCQA 4I6QA 4A9RA 3QRIA 4HOKA 4LMUA 4IVCA 3MSSA 4TNBA 1FINA 3QYWA 4ANSA 4ANMA 1V0OA 1PRYA 5EHYA 4FZ7A 4BCPA 3F3WA 1U54B 1NY3A 5CEQA 1XBCA 3VWAA 5EM8A 4E93A 4YJQA 3LXKA 3F82A 2QG7A 2PVKA 3D5WA 4ZTQA 3RHKA 2C1AA 3UP2A 1PYEA 4Y5HA 4BVUA 4EOPA 2J50A 1Q8UA 1YOLA 3FSKA 2WAJA 4CZTA 2ZDTA 2FA2A 4G6LA 3DDPA 3UYSA 3V5JA 4M84A 5HORA 5HO7A 1GIHA 4JIAA 3FKNA 4FSRA 3PTGA 4FVRA 2W5AA 5EOBA 4BDBA 2IJMA 2P55A 4XLIA 4ZXTA 3R6XA 2C6OA 3ULIA 2XNBA 3KA0A 3RK5A 5LVOA 5IQGA 3COIA 2YWVA 3NYXA 4JR7A 1H28A 3QC9A 5ANDA 1YXTA 4YO6A 3MWUA 4XRLA 2OICA 3FMKA 3Q53A 5B0XA 5M4IA 3WF9A 5K4JA 2GQRA 4IVBA 4G31A 3TN8A 4UB7A 5FLFA 2QLUA 3KRWA 4FYOA 1H0VA 4L3LA 4A4XA 3N4TA 5H8BA 3EL7A 3BLHA 3I7CA 2WMUA 2R0IA 4A9UA 3L9NA 4N6ZA 4P5QA 2GU8A 3TZ9A 4XJ0A 3BU6A 5DR9A 2OFVA 3R30A 1Q8ZA 5AP2A 3R9HA 4IACA 3UYTA 3CPBA 3RPYA 3GB2A 3W18A 4JXFA 1Q4LA 4LOQA 2QU6A 2C0OA 3OD6X 4FKTA 5K5NA 1ZY4A 4Q9ZA 1WBPA 3ACJA 1YKRA 1OUYA 3TTIA 3ZZEA 2YHVA 1BL7A 4XYFA 2UZEA 3QHWA 2H6DA 2QG5A 5CF6A 5JGDA 4RGJA 4RZVA 1ZRZA 4EH3A 2H96A 1LR4A 3DLZA 1KV1A 1TQMA 3FLQA 4XHKB 5CNNA 3SG8A 5AA9A 4F0IA 3RI1A 2ITTA 4FV0A 4DTAA 4EC8A 3FL4A 1GIJA 4NM3A 4FNYA 3REPA 4ZZMA 5HIBA 3HV6A 3BV2A 3KB7A 5D7AA 2CDZA 3EFJA 3C4XA 1KV2A 4AG8A 5HLPA 4MF1A 3PP0A 5JH6A 2Z8CA 1KOBA 3R0TA 4UX9A 3DLSA 2QCSA 2ZV2A 4F65A 4WSYA 5L6WL 2X9FA 3BWFA 4FNZA 2EXMA 3F88A 1XQZA 3FE3A 1OITA 3FQEA 4K8AA 3SGCA 3UQFA 4YUQA 4AX8A 4ZMEA 3BHHA 2VO6A 3UNJA 5AUVA 5E7RA 5C26A 3AOXA 3I5NA 4G3DA 4QTCA 1XKKA 4CXAA 3C5IA 5KX8A 3NUAA 2FSLX 5CAUA 4W8EA 2X8IA 1ZMWA 2ITOA 3KKVA 4EK5A 3ENMA 5C9CA 2X2LA 3CJGA 1WZYA 2R3LA 5CVGA 4KD1A 4TWNA 5CQUA 4HYSA 3H3CA 3C4CA 1LUFA 3PXFA 2XCHA 5IQEA 4ANQA 5FBOA 2B9FA 4YZCA 4A7CA 2XKCA 3QTWA 3QTUA 3DFAA 3ZBXA 5L2WA 2BUJA 4KKEA 3JS2A 4ASDA 2WQEA 3KQ7A 2C0TA 2UW9A 2WMRA 4KUJA 4F1OA 1RQQA 4M0ZA 2OKRA 1CDKA 4R5YA 4LL5A 4U0IA 5E90A 2Y0AA 2A27A 3HRFA 4G17A 2ITUA 2WIHA 5CEMA 3UIUA 1WBVA 2J2IB 4MEDA 4QOXA 5ACKA 4X21A 3F5UA 3SD0A 5HTBA 4KINA 3TV7A 1BLXA 2Q0BA 3TM0A 2HXQA 3BCEA 3W0QA 3PVBA 3RKBA 3SC1A 3D4QA 2YFXA 3FQSA 3NUNA 5J9ZA 4KS8A 1V0PA 5DRBA 3W2RA 2XEYA 4FEUA 1ZAOA 3RNIA 4EOJA 3QQKA 3LJ0A 4MX9A 4PY1A 4CT1A 4FSUA 5M55A 1OVEA 2VRXA 3TT0A 3DBEA 4ZK5A 3CTQA 4NTSA 3C9WA 4J52A 3CGOA 3VBXA 3SX9A 3VBTA 3GU8A 5F94A 1FOTA 2HY0A 2WEIA 4II5A 2HK5A 4FSMA 2JGZA 4FTRA 2WTJA 5ANOA 4XRJA 3ZO1A 3R8ZA 4K0YA 2C6EA 5J9YA 1WBOA 2WKMA 5C01A 2BAJA 2ERZE 2Z02A 1NW1A 4MXCA 2VGOA 3JVSA 5E8VA 3VN9A 4BDEA 4RVTA 1H1PA 1W7HA 3WZDA 2HZIA 2XIXA 3TDWA 2WD1A 3AGMA 1SNUA 4I6BA 2Z7LA 4RLLA 2O65A 1WBTA 2X1NA 3LM0A 4IAYA 5AM7A 3ZSHA 5L2TA 2WQBA 3VUDA 2JFLA 2OO8X 5HI2A 3TNQB 4MXAA 4FT9A 2REIA 4QQ5A 1URCA 3RAHA 2XS0A 3OCBA 3W2CA 2YM4A 4E1ZA 3L8PA 3LFSA 5AA8A 5H8GA 5HU9A 4FV7A 4EJNA 4NYEA 1P2AA 4W4VA 3HAVA 4DGLC 3KF4A 5CU0A 4V05A 3BIZA 4XMOA 2QOCA 3DZQA 3QF9A 4M7IA 4LGHA 4O7YA 3TKUA 3GC9A 2W5HA 3PA5A 5DH3A 3QGWA 3SOCA 2C5XA 3V3VA 3WILA 1URWA 2WTKB 3BLRA 5EI2A 3K2LA 2JBPA 2WTCA 4PDPA 3NNUA 3TEIA 3WZUA 5DIAA 4AF3A 4D58A 3BU3A 3TNWA 1U4DA 3BBTB 2R64A 2XA4A 2BKZA 3PJ2A 4OGRA 4DLJA 5AUUA 5IH6A 5AUTA 3GBZA 4RLKA 3ODZX 5IA1A 5JRQA 5C27A 2G2IA 2CSNA 4ZY5A 4JQEA 5IPJA 2BAQA 3KFAA 3R2YA 4GV1A 2HENA 3F5GA 4HYIA 5H2UA 3V5QA 5FGKA 3R83A 4FTIA 4U42A 4C4JA 4JDHA 3LQ3A 5HLNA 2PL0A 4QT1A 4UXLA 1Y6BA 3OY1A 4PTGA 4DEAA 5A3XA 1BL6A 2BILB 2YZLA 3OTVA 2CGWA 2PZ5A 5FEEA 2CHLA 4BI0A 3VBYA 4OR5A 3VS5A 1ZOEA 2CLXA 2X2MA 2F7XE 2OXXA 4JNWA 3E88A 1GOLA 4PL3A 3ZSGA 5IQAA 4J97A 3EMGA 4OUCA 3V5TA 3AC4A 4GG7A 4U5JA 5D12A 1KE5A 4AGDA 4PRJA 3G51A 4JLCA 2X39A 1LEZA 3THBA 3R7EA 1ZXEA 1BMKA 5L8KA 2GNHA 4JAIA 4YJSA 3W33A 4X7QA 2OXYA 5ETAA 4HVDA 2HZ4A 1ZMUA 5IF1A 4ZEGA 1NVRA 2Q83A 3I6UA 3F69A 3AC5A 3C4FA 4LM5A 3EQRA 2XK6A 3DZOA 3HEGA 4WOVA 4XX9A 5LCKA 1ZYJA 1JOWB 1Y91A 2RF9A 2O3PA 2WOTA 2W4OA 2BMCA 2DWBA 2GTMA 3DTCA 3I0OA 3TKIA 4HGSA 1OPJA 3MIYA 4IZ7A 4X6QC 2IVSA 3FMNA 4WKQA 3VVHA 3E8CA 3RAKA 3S95A 2OGVA 2UW4A 1YWRA 5JFWA 4O82A 4TWCA 3HV3A 5JK3A 2W1DA 4O38A 3B8QA 4FTLA 3L9LA 1CKIA 3GC0A 2IWIA 5DEWA 3VULA 4OTIA 1Z5MA 4NJ3A 5E8ZA 4G3FA 4J1RA 1PXNA 4DLIA 4O7OA 3DTWA 4MBJA 3FYJX 4BCKA 1KUTA 4NUSA 3KULA 2DUVA 4X3FA 4ZLYA 1WMKA 3H30A 3VW6A 3DB6A 2YERA 4G34A 4BDAA 3IDPA 3FZTA 1YHVA 2ZM4A 3EWHA 4DA5A 1PKGA 3C1XA 1UNHA 3GNIB 3LFFA 4KIOA 4TZRA 3TWJA 4AT4A 5BVNA 2VWIA 3OW3A 3QTRA 2PYWA 3NCZA 4NFNA 3VBQA 4GVAA 3VNTA 5C8NA 4WNKA 3VHKA 2RKUA 4LV5A 3UJGA 4KSPA 3E87A 1Q99A 3CLYA 5CZHA 4BDHA 1PXJA 4EZ7A 3IPHA 4QPAA 2WO6A 2QD9A 5DNRA 4ERWA 4NL0A 2PUIA 4D5HA 4GG5A 2AYPA 4HW7A 4E6CA 3HKOA 1YI6A 2PZYA 4XUFA 4PF4A 3ITZA 5FBNC 5M4UA 3QCYA 4HPUE 4GK4A 3LFNA 4IDVA 3LFDA 2X0GA 4NWMA 3ULZA 1JLUE 2QC6A 4IFGA 4DE4A 4FIEA 5FXSA 3HAMA 2XNOA 5FM3A 2JAMA 3PVWA 4IZAA 4X3FC 5CF4A 3R9RA 1YOMA 2XK3A 2X9EA 1XH8A 1ZOGA 2C3JA 2F57A 2P33A 3FSFA 3KXNA 4S34A 4YP8A 4O0RA 3G5DA 4Y95A 4F09A 4F7LA 4G16A 3T3UA 2HIWA 4IZ5A 3QD0A 2SRCA 3LFEA 5L8JA 3RK9A 5KHWA 4MBLA 3FKOA 4FI1A 4B8MA 4FNWA 4Y83A 2FSMX 4YZDA 1QL6A 2OIQA 5AV3A 4C2VA 4IB0A 2W4JA 2XK4A 2E9VA 4UYNA 3EFLA 1JKKA 3EZVA 3CP9A 3R7VA 4C3PA 2C5VA 3MVLA 3NWWA 3L9MA 3LCDA 4CFMA 5A14A 4RIWA 3CY2A 3FXXA 3C50A 4KBKA 4TYHB 1AQ1A 3UC3A 5DA3A 4CZUA 2VO7A 3BI6A 3F3UA 2ZYBA 3TZ7A 4XV1A 4AZTA 2YWPA 4H39A 4KB8A 4AE6A 1PYXA 3DKOA 3ZHPC 3W2SA 4Z3VA 3OBGA 3W1FA 3D83A 3FZPA 3R8PA 3RTPA 4CQEA 4LUEA 3D5VA 4IB3A 2W1FA 4BDKA 1YDTE 3W16A 1U46A 5TT7A 3QRTA 2PUUA 1G3NA 3GFEA 3IGGA 3SXSA 5IG1A 2QOFA 5AX3A 3VF8A 3DJ7A 1Y8YA 3DBCA 4WD5A 3BZ3A 5KMJA 1W0XC 4BHNA 1FVTA 4BCIA 5LJJA 5FEQA 3UMXA 3C13A 1MRUA 3GP0A 3N9XA 4F4PA 2IO6A 3SG9A 4YC3A 4D9TA 1XH6A 4TKSA 5HESA 4K33A 5HNGA 3G0EA 3GU5A 3M2WA 4TT7A 5AV1A 4E4LA 3LFAA 4RFZA 3EHAA 3RM6A 1YDRE 3NRMA 4IM3A 4QYGA 2V7AA 2PVLA 3AGLA 3BQCA 4DC2A 4CVAA 2BDJA 3CEKA 2R3QA 4R3PA 4F70A 4EUUA 4TYHA 2B55A 4QQTA 1M2QA 4D5KA 4MWIA 3R7YA 2WMXA 3H9RA 3G6HA 2X7OA 4FG9A 4HYHA 4HZRA 4IE9A 3S4QA 4EORA 3GCVA 2YIYA 3VQUA 4LRKA 1GJOA 3QLFA 3CPCA 3BPRA 3F5XA 3OWPA 3P86A 5E91A 3FZ1A 1K2PA 5C03A 5C8KA 3KREA 4J99A 4QMSA 4U45A 4J7BA 1DS5A 2UVXA 4FV2A 3KXGA 5E1SA 3A8WA 3ZBFA 4J96A 2DQ7X 3EQIA 4ZTLA 4ZSLA 4WZYA 4RMZA 1GZOA 1S9JA 5TKDA 4O27B 4JT3A 3G6GA 3PY0A 4BN1A
chains in the Genus database with same CATH superfamily
3L8XA 2OJFE 3KULB 4X3FB 4XG9A 4E73A 2I0HA 1P14A 2OLCA 5CENA 3PPJA 1XJDA 1R3CA 3JY9A 3FY0A 2CNQA 4MXYA 4XG4A 2WOUA 4GT4A 1OKZA 2YABA 4FEWA 3SW7A 5FDXA 1UKIA 1W83A 4ACCA 3ATSA 3FBVA 1PY5A 3C4WA 4GK2A 4YJUA 1CTPE 4BYIA 4Z16A 3O5AA 2A0CX 1ST0A 5LMAA 3TKHA 4CLJA 2QQ7A 3V04A 4D4YA 4IQ6A 1CKJA 2VWUA 3WARA 4LG4A 3PXQA 5K3YA 5IDPA 2WEVA 3BWJA 3QHRA 3O7LD 3LPBA 3NPCA 4QYFA 4WG3A 4G3GA 3KXHA 2QVSE 3UODA 3W32A 2PVJA 3A8XA 4XBRA 5TR6A 4FKIA 4YJNA 3TNIA 3TNHA 3UZTA 4RVMA 4IJPA 5CU2A 3UVRA 4YMJA 5L3AA 2PY3A 4CEGA 3UIBA 3I60A 5BUEA 1UNLA 3T3VA 4K11A 1NT2A 3EQFA 3FMMA 3PZEA 3FKLA 1H27A 3O8PA 4RJ3A 3UGCA 3ZDIA 5I4NA 5BQ0A 4UXQA 1J7IA 2YM5A 3PE2A 1SZMA 3HZTA 4TRLA 3GQLA 4TTHB 2XEZA 4DEBA 3Q32A 3UIXA 3MB6A 4MQ1A 3VBWA 1FMOE 4BDCA 2R3JA 4C34A 1IA9A 2OJJA 2ZJWA 1OL6A 3TI1A 4BDJA 5DT3A 3MW1A 3I79A 1OKVA 2WTDA 5DFPA 4CRLA 3BX5A 5JN2A 1BX6A 3FHRA 5AAEA 2PU8A 4F7SA 4EKLA 2VX1A 3MH0A 4RFMA 3O71A 3BKBA 3TJCA 4FSYA 3ZFYA 4M0YA 4D0WA 5BVWA 2XIZA 5I5ZA 4GUBA 1Q41A 2BDFA 4GS6A 1WVYA 3F66A 3M1SA 5CT0A 3RMFA 4X2GA 4I5MA 4O7LA 3OVVA 3W2QA 3GCPA 2ZV9A 3O0GA 4YLJA 4O0SA 3UVQA 3T9TA 2I6LA 4UEUA 3HYHA 4FIFA 3T8OA 2OZAB 3QXOA 3OTUA 4E4MA 4E4LA 4ANLA 2YIRA 4USDA 2RG5A 4YZMA 2X4ZA 3AKJA 4EOMA 1YVJA 3O8UA 5C4LA 4HVIA 2GDOA 1G8AA 5FTQA 4D4RA 4M68A 4FC0A 2QI8A 4ZP5A 4J95A 1IG1A 3U55A 1YRPA 1UU3A 3WZKA 2OU7A 4HCTA 3NEWA 4U7ZA 1TKIA 4DHFA 1FGKA 2OG8A 4EQUA 2B9HA 4I0TA 1YXSA 2XRUA 4YLKA 5M56A 2W4KA 5DR2A 4P2KA 3FC2A 3HLLA 3OXIA 4APCA 4CKIA 5AJQA 3BLQA 4IAKA 3V8WA 3BYUA 4OBOA 2C6LA 3LHJA 4IIRA 4HCVA 4HJOA 4DCEA 5KBRA 2O63A 5KCVA 3V6SA 3QX2A 4PL5A 3I6WA 2NPQA 3E7OA 3GI3A 4I24A 3QQLA 4GYGA 3DXPA 4S2ZA 1REKA 3TACA 2XZSA 3QQUA 4FKUA 4FZDB 3WIGA 4AAAA 2CKOA 2OF4A 4QMYA 3D2KA 2HXLA 4GFGA 4LYNA 1IRKA 2ESMA 2OZAA 4GK3A 3VF9A 3AD4A 4QMWA 3MVJA 5EKOA 2VNYA 2F9GA 5CVHA 4F9CA 4MBIA 3MI9A 4QP6A 5BX0A 1P5EA 2VTSA 2Y6MA 3P23A 3UQGA 5AP5A 1H8FA 1R0PA 2WU6A 4GCJA 5FRIA 3PJ3A 4AFJA 3DA6A 5J9LA 4I4FA 4QP3A 2CCIA 5BMSA 2A19B 1J91A 1IA8A 3PIYA 3UQCA 4QP2A 3V5PA 3DDQA 5EM6A 3R71A 4C36A 4WRSA 3RPOA 4CMOA 3BE2A 3BE9A 3ORKA 4FKJA 4J8NA 4YZNA 4ZS0A 4BCHA 4O0XA 4O22A 5DLSA 5DR6A 2QOKA 3DBDA 5E9EA 3BV3A 3ZXZA 4FV5A 3H9OA 5A4TA 3TNPC 4Q9SA 2W99B 4IB1A 3ORNA 2QO7A 3OHTA 3UOKA 4NSTA 2V0DA 3MY1A 3E8EA 3ZFMA 5BVEA 2XH5A 4M8TA 2JBOA 2YITA 3CSVA 1T46A 3K3IA 3WYYA 3UE4A 1OECA 1H01A 1OIYA 2JDTA 5ANKA 5I9WA 4FV8A 3HDMA 1JKSA 5AP3A 2BR1A 4M13A 3R9DA 1IASA 4FGRA 4CCBA 3OZ6A 2QKRA 5BVDA 4TYEA 4AXCA 1T45A 4RJ4A 2YDKA 4C02A 3R2BA 3KU2A 3GFWA 5D9HA 2J0IA 4DAWA 3B8RA 4Y5QA 2OW3A 2XBAA 2YA9A 2PSQA 3P7AA 4QQCA 4ZAUA 5CAVA 2ZAZA 1STCE 3KEXA 2VD5A 4RX8A 1PXPA 3S2PA 3C51A 3VUGA 4EL9A 2W05A 4YJVA 5CU3A 1XH9A 4C4EA 4OT5A 4AN9A 4L7FA 1JVPP 2VTTA 2XB7A 1VZOA 5CSVA 4B6LA 3MY5A 3QTSA 2YDIA 2V55A 1QPCA 1MRYA 1YOJA 3HECA 2G01A 3FY2A 4AP7A 1OIUA 4U97A 2WTVA 2W7XA 3LQ8A 3Q9WA 5IMEA 3OUNB 2OJ9A 3C5UA 3R8LA 3ZCLA 4GU6A 2J0MB 3FV8A 3NFGB 4NW5A 4S31A 4O86A 2E9UA 2JDOA 4GT5A 3A60A 3HP2A 3VBVA 4DTBA 5DE2A 4O0UA 2YIQA 3E92A 3A99A 1NA7A 4I6LA 1JKLA 4XCUA 3EQGA 3FZRA 5ANIA 3RPRA 3S1HA 5E8UA 3WBLA 1M7QA 5F4NA 4RT7A 4FMQA 5KMNA 5DRDA 2V62A 5KO1A 3TUCA 1Z57A 3UMWA 3POOA 1JQHA 4DH3A 4DGOA 5H8EA 2QOBA 4A9YA 3HV7A 2J5FA 2JKKA 3LAUA 4FKOA 1OB3A 3MJ1A 1OBDA 3OWKA 4FZFB 4TL0A 2ZOQA 2YJRA 3HGKA 4QMNA 3CQWA 4G5PA 4AXDA 4KWPA 4L45A 3U9CA 1APME 3SXRA 3WF6A 3TXOA 4RVLA 1VYWA 2HAKA 3ERKA 2ZV8A 2PULA 4R78A 4TNDA 5HX6A 3A2CA 3P7BA 4AW5A 5IUHA 5LVNA 2G1TA 2W96B 2C6IA 4ZSJA 3QALE 4IC7A 1KSWA 5FP5A 4ACMA 2BTSA 2ITQA 5I9VA 4A4LA 1FVRA 2QLQA 3JY0A 5DVRA 4RWLA 4ALVA 4AOTA 3MFRA 2PUNA 2UV2A 5IQFA 3OFMA 3AD6A 3POZA 4NTTA 5F1ZA 1M14A 5DWRA 3KMMA 2XIRA 1QPEA 3RWQA 5J1VA 1L3RE 5T3QA 4G1WA 4BBEA 3C4EA 4EQMA 4ZJJA 3RJCA 2P0CA 1RJBA 4USEA 4W4XA 4NM7A 2ITXA 4EWHA 2OFUA 5CF8A 5J1WA 4FL1A 3P9JA 3TIZA 4ZIMA 2VAGA 2IW6A 3ZC6A 4L8MA 2AC3A 2OSCA 3MPMA 3CIKA 3Q04A 2C1BA 5KBQA 5EM7A 3DKGA 4O2PA 2EVAA 3TV4A 4EHVA 2BFXA 3LQ5A 4AOIA 4AW2A 1TQIA 1WVXA 2UZUE 4AZFA 2PHKA 1BI7A 2BTRA 3P7CA 5ANEA 5AUYA 1OBGA 5C8MA 3WIKA 4IX5A 4OTGA 3AMYA 2R3OA 4QTDA 4D28A 5FUTA 2XJ1A 4E4XA 3TV6A 4Z55A 2UZOA 1L8TA 4AT5A 2PE1A 3MN3A 2PE2A 3P5KA 4FL2A 4QP1A 4AXAA 3VUKA 4MCVA 4O81A 3PRIA 3QQGA 4CFWA 4CLIA 3U9NA 4QP4A 4RQKA 2FH9A 1F5QA 4DGMA 3FHIA 2PMOX 3C4ZA 3EFWA 5HNIX 3OCTA 4L67A 1TVOA 2F7ZE 4X3JA 4RIYA 3ZO2A 1GZNA 1R1WA 4BIEA 3FJQE 2RFEA 2XKEA 4I0RA 3ZLWA 3LJ2A 3KRJA 3NSZA 3LCSA 2XANA 4DFXE 3UVPA 4G2FA 5HD7A 4YR8A 3VS6A 4ENXA 3H9FA 5J8IA 2XP2A 3NMUF 3E8DA 4IANA 1XH7A 3ZTXA 3TIYA 4IWOA 4EOLA 2OF2A 1NVQA 4IB5A 1XMMA 2ZMCA 3DKFA 3IW5A 4O21A 3UC4A 3W0PA 3CTJA 2XIYA 4OTHA 5DHJA 2PUPA 4HVHA 4R6VA 3ID6C 5HIEA 4CTBA 1OGYA 5J7HA 4F0FA 4YZBA 1IAJA 4LQMA 3NX8A 5CI6A 4FYNA 3SLSA 4C4HA 4R77A 3CE3A 4ITHA 4E5BA 3ORIA 4DFLA 4F7NA 3SQQA 1ZZ2A 2Y4IB 2GS6A 4DGGA 1ZARA 4MHAA 5KMIA 4U6RA 2W17A 4LGGA 5T6KA 3D0EA 3LXNA 4TYGA 4JDIA 4E26A 5GJDA 1PF8A 4U79A 1O6KA 3DB8A 4IDTA 3LFCA 4RIYB 4FEQA 5IZFA 1JSVA 4FIJA 2WMTA 2FGIA 3HMMA 4FKSA 3UNZA 1WAKA 2FUMA 3EQHA 3TDVA 3NNXA 4Z9LA 4DT9A 4I93A 1H1QA 3UG1A 4UN0C 1SVEA 4RFYA 4RWIA 2IN6A 1F0QA 2VTLA 3FPQA 2IZTA 3NCGA 3ZC5A 3EL8A 5IEYA 3FMDA 4GH2A 3MPAA 4J71A 2ERKA 5KZIA 4ZJIA 3PWDA 4F6SA 4WNOA 3HA8A 4Y8DA 3VO3A 3P08A 2JFMA 2CKQA 5CXZA 3DQXA 1SNXA 2WFYA 5IQCA 2ITZA 4L00A 5GHVA 5EHLA 2YN8A 3OCGA 4CFVA 1JSUA 3I1AA 5F9EA 2EXCX 3FXWA 4QP9A 4DGNA 2BRHA 3BRBA 2XK8A 2YDJA 4C38A 3PPKA 3D2IA 2EU9A 4LFIA 3RHXA 5FM2A 3VS4A 5I9YA 2Y4IC 3EYHA 4JG6A 3FWQA 3WF8A 3H0YA 2Y8OA 4PV0A 4BCQA 4I6FA 4L9IA 4JDJA 4CNHA 4AE9A 5IA0A 2XIKA 4QP8A 3EH9A 5AAFA 3N51A 4MXXA 4CSVA 3RCJA 2XRWA 4EKKA 2X8DA 2EB2A 5B2LA 3F2NA 3Q9XA 4GFMA 2IW9A 3RM7A 4RC2A 2OH0E 4W4YA 3QGYA 5EW8A 4EZ3A 4FSTA 5JRSA 1VR2A 2X81A 4X2NA 3WZEA 3QL8A 2H9VA 1ZWSA 3R00A 4EOKA 4XG2A 1DI8A 5HX8A 3GGFA 1V0BA 3ANRA 2RGPA 4O7RA 2I0EA 1H26A 3KMWA 3P78A 3ORLA 3D7TA 3K54A 4U40A 4DEHA 2YCFA 4PUZA 4I94A 3R28A 4O7NA 3ZUTA 3DQWA 3IW6A 3Q4CA 5G6VA 1NXKA 5T68A 2J6MA 3PJ8A 3R7IA 4AGWA 2CCHA 3V8TA 2HWOA 3HP5A 5CU4A 1B6CB 5CYIA 2O64A 3PSBA 3UO5A 3QAME 5KKRC 4CKJA 1XH4A 4DN5A 4MNFA 4I5PA 2W1IA 3ACKA 3Q52A 3ATTA 3DBQA 5CY3A 4BCFA 3LZBA 4NT4A 4CT2A 1YXXA 2R9SA 4O0WA 3E5AA 5CALA 5CU6A 2B7AA 5GINE 5HO8A 4IX6A 4PMMA 4U8ZA 4FTMA 5EYKA 3MFSA 2BPMA 4AWIA 4BYJA 3IGOA 4HZSA 2XJ2A 3SDJA 2GNFA 4EONA 3ZUUA 4WUAA 2LAVA 4H3PA 5GJFA 2QNJA 3MH2A 3NAXA 4FKRA 4JVGA 5CX9A 1U59A 3JYAA 4ALWA 3D7ZA 4Q2AA 4ACDA 4V01A 3OEZA 4ASXA 3LE6A 5CAOA 1O6YA 4QMOA 2IZRA 4JBQA 1J3HA 4XV2A 3A7IA 3UDBA 2CMWA 4L43A 1PXLA 4C2WA 2Z2WA 5C4KA 3HRCA 3BU5A 4AS0A 3BEAA 5ANGA 3V8SA 5IUGA 3RGFA 5KZ0A 4DDIA 4TY1A 1H1RA 5K5XA 3AC8A 2ZV7A 5JZNA 4IZYA 3ZEPA 3V01A 4IADA 3EN9A 5KHXA 3AMBA 5D11A 1WFCA 4EH7A 3ORPA 5AADA 5DEYA 1O9UA 3PA4A 3Q5IA 3Q96A 3GCUA 2FSTX 3HX4A 5JSMA 2Y4PA 3R7OA 2BAKA 2WTIA 1H00A 4AW1A 3LJ1A 4DH1A 1OL2A 4GSBA 3BQRA 4KKGA 5D41A 3ORXA 3C7QA 4AA4A 4QMLA 4AZVA 4FZAB 5JEBA 2VTIA 4QDVA 1YW2A 5HCXA 5M4FA 3W0OA 5ETIA 3NUPA 5KMOA 4JQ7A 3QCQA 2NRYA 1Y6AA 2WQNA 2OWBA 2GHLA 2QOLA 2YJSA 3LFQA 3D94A 3NW6A 3OXTA 1CKPA 5CXHA 4DFNA 1FQ1B 5E8XA 1BYGA 3BYMA 2BIKB 2GNGA 3GCSA 3LFBA 4ZLOA 4XLVA 1OUKA 1SVHA 3F3TA 5JQ8A 1SMHA 2W1EA 3WZJA 3E7VA 1ZLTA 3ZZWA 5EKNA 5LMKA 4E7WA 5IDNA 3PIXA 4J53A 1FBNA 1M2RA 1UA2A 4TYIA 3KC3A 1Q3DA 3PSCA 3F7WA 4XG6A 4BY9E 5AV0A 1UNGA 2QHMA 3KXMA 1ZZLA 3PE1A 4FTJA 4ZSAA 5A4CA 3R8VA 3E3BX 2XYUA 3MB7A 5CSXA 3Q2MA 2PVHA 5CS6A 3RWPA 3SOAA 4PNIA 4OLIA 4EJ7A 4GKHA 3NDMA 5K4IA 4HVSA 5HE0A 3QRUA 5HG7A 3EQCA 3R04A 1GZKA 3HV4A 4JBPA 4FL3A 2VWVA 1PMUA 5DPVA 3D5XA 5EDPA 5ETCA 4QP7A 4CFNA 5IEVA 3CQUA 4FTUA 4FODA 4PMTA 4IAIA 2V7OA 4PWNA 4RX7A 3LMHA 3H10A 5JFXA 4LRJA 2PMIA 4DTKA 4P5ZA 1P4OA 4YPDA 1XH5A 3D7TB 3EIDA 3GENA 4UWYA 4EH5A 3EQPA 3O23A 3AG9A 3QD4A 3ET7A 4ZTMA 4B8LA 2R3FA 4E6QA 2HW7A 2O8YA 4L46A 4I92A 4BCGA 5A4LA 5IA4A 1J1BA 2XCKA 4FV4A 5HZNA 5GIPE 4LL0A 2A1AB 2NNWB 2J9MA 5AP1A 1M52A 2I40A 2WMBA 3JPVA 4GVJA 4CMTA 4FKLA 2CGVA 4PP9A 5FG8A 4QTAA 4X0MA 2YEXA 1DI9A 1CMKE 1F3MC 4JRVA 4YLLA 2ETRA 2X7GA 4BTMA 1PXKA 4IH8A 4GU9A 4AA5A 4ASEA 2PE0A 5AIKA 2BDWA 4XEYA 1CSNA 4JS8A 1RE8A 3O51A 5I9XA 1MRVA 3IW8A 4M14A 4S33A 3BYOA 5CQWA 3KCKA 4DFZE 3VAPA 2VN9A 1WBNA 3P1AA 4GKIA 5AV2A 1A9UA 4ANBA 5AUZA 3HVCA 1VLRA 3O7LB 4HCUA 4EYJA 4ZTHA 2C3LA 4JBOA 1MQBA 2W0JA 5BUJA 5IU2A 3R7UA 2O2UA 4YSMA 3DBFA 5FEDA 2Y7JA 5AV4A 3U4WA 3C0GA 2A2AA 3AT4A 4JX7A 3IO7A 5I9UA 4WG4A 2QOOA 2I7QA 4QMUA 4BC6A 3A4OX 3NAYA 3QBNA 2CNUA 3A7HA 4U3YA 3NLBA 2UZDA 2W1CA 4I22A 4EQCA 2JIIA 1PKDA 1Q24A 1JPAA 3OG7A 5A4QA 2DYLA 4FGBA 4WNPA 3CD3A 4PTEA 2XYNA 3PZHA 3TMOA 1I09A 3IONA 1OIQA 1UKHA 2BZKB 1S9IA 2CKPA 4R3RA 4BIDA 3CBLA 4CFUA 3KVXA 3QTXA 4FV1A 4DH7A 2FSOX 2GNJA 4RSSA 2ITYA 4U81A 4DH5A 1OL7A 4FV6A 3BHVA 1E1XA 4FT7A 1PMEA 2JIVA 2R3GA 3FPMA 4F99A 2P4IA 3KK8A 2C69A 4I5HA 2ONLA 5ACBC 3OT8A 2C3KA 4IWPA 3D5UA 3PUFC 4YNEA 4EH8A 3F5PA 3F9NA 4QO9A 5H3QA 5ITAA 3IK3A 3QZGA 2FYSA 2NP8A 4RBLA 5HD4A 1YDSE 4FKWA 4XH6A 4ZSGA 3BBWA 4YTIA 3FLNC 1G8JA 3NNWA 2WXVA 3DY7A 5M06A 5LWNA 4D1XA 4LUDA 2GFSA 4UY9A 4E8AA 2JITA 4OW8A 2QR7A 5AP4A 3ZMMA 2XMYA 2C6TA 2JC6A 4MYGA 4YTFA 4HVGA 5JZJA 1OPLA 1QMZA 2WTKC 3OY3A 2ITWA 4IMYA 4A9SA 3D14A 4FV9A 5CNOA 4O91A 3MYGA 2QR8A 2XARA 5L2SA 3A7FA 2PZIA 5HE3A 3ZUVA 3GT8A 3EN6A 2VTJA 4FG7A 4BIBA 2C6KA 4LRMA 4AN3A 1YHWA 3MFTA 3QQJA 4R7HA 3WI6A 4U98A 2ETKA 3QD2B 2XNMA 4FV3A 3GVUA 3R01A 4DHZA 2BHHA 3OWLA 4QMXA 4IAFA 2GS7A 3KXZA 3FLSA 5BPYA 3R1SA 3ZDUA 3OEFX 3OBJA 4MD9E 3TJDA 3NFFB 4C61A 2CN8A 2JLDA 4YU2A 5CAPA 3KRLA 4GJ3A 4MAOA 3FL5A 4KBCA 2PVRA 3UPXA 3QQFA 5L8LA 4ZMFA 1E9HA 1B39A 1H08A 2PVMA 4QTBA 3CGFA 2PMLX 4QMVA 1QPJA 3OXZA 4DINA 4AAYA 2OXDA 2PTKA 4L42A 5B2MA 5LMBA 1GIIA 2GTNA 4U44A 4UWCA 3O50A 5DT4A 4ACHA 3QKKA 3KGAA 3FQHA 3GUBA 3E3PA 2UVYA 1R39A 3MS9A 3UZRA 4B7TA 5KMKA 3MESA 2JDRA 2ZDUA 4YJOA 3G9LX 2W1ZA 2C5YA 4N57A 4CFXA 4MD8E 2BALA 3TCPA 1VJYA 2ITPA 4IWQA 4ONAA 4DFBA 1X8BA 2UW3A 3B2WA 3F2AA 3P4KA 3DJ6A 4YZ9A 2R3KA 4C59A 4PP7A 3UOJA 3ORTA 3IG7A 4CMUA 1WVWA 3NUUA 5AUWA 1LPUA 4QYYA 4F6WA 1ATPE 2X7FA 3RNYA 3UO4A 3ZRKA 5M4CA 4EHEA 3OF0A 4FTQA 4HGLA 3QU0A 2B54A 3PJCA 5M53A 3JXWA 2VTRA 3QQHA 5AUXA 4DFUA 3KN6A 3QKLA 4BBMA 2XKFA 4IVAA 5FTGA 2UW7A 4KNBA 4G5JA 5HKMA 2VX3A 1G8SA 1PMNA 5CWZA 3EZRA 3SHEA 2JDVA 3IECA 2OBJA 5DI1A 1TQPA 4NW6A 4C7TA 3WOWA 4H58A 1GAGA 2QURA 2H34A 3Q2JA 3DAJA 1W98A 3NS9A 2QOIA 3U6IA 4S32A 3IW4A 4BJJB 2XVDA 3O17A 3ORZA 4BTJA 2I0YA 4C62A 5L6OA 2UZTA 2WMWA 3COMA 3HRBA 4B4LA 4IX4A 2GPHA 3O8TA 4G3EA 4L68A 4PL4A 4CD0A 1CM8A 3EQBA 4ITJA 5HTCA 3S0OA 3GC7A 4P90A 3MA6A 3PXKA 1H4LA 5I0BA 2YM6A 4JRNA 1OM1A 2HY81 4RIXB 3W0MA 5EW3A 4AZWA 1FMKA 3IW7A 2FVDA 2VZ6A 2W9FB 4PX6A 5BVKA 4YPSA 4AA0A 4BGQA 3UPZA 3UG2A 4PDSA 3HMNA 5L2IA 3QUEA 4FSZA 2WIPA 4RZWA 2CJMA 3RINA 4GMYA 5A6NA 1W82A 4DH8A 3DS6A 2WTWA 3GU4A 4YBKA 3U6HA 1M2PA 2GHMA 3DFCB 3QWJA 3C0IA 3E63A 3F61A 4I1ZA 4JG8A 4AFEA 3UOLA 3MPTA 2UW8A 4C35A 5K9IA 3Q4TA 4Q5EA 4AUAA 4GRBA 2Z7RA 4XG8A 2ZVAA 2OZOA 3RP9A 1JWHA 4FTNA 1E1VA 3Q3BA 1J7LA 4AZEA 2BVAA 4BKJA 4D55A 4FTAA 4K1BA 5E8YA 4KABA 4AOJA 4KRDA 5IA3A 4QTEA 2VNWA 1XWSA 4O2ZA 5EG3A 4AXEA 3LIJA 4RIOA 4OBQA 5KE0A 2R5TA 4HYUA 4U41A 1SVGA 3W0NA 5JFVA 3MVMA 4CGAA 2YIXA 3L1SA 4C3RA 2IG7A 1DM2A 4MWHA 1Q3WA 5AP7A 3P79A 3E93A 3F3VA 3NW5A 3MGYA 1ERKA 4I21A 4O84A 2B52A 3SA0A 1I44A 2WNTA 2C5NA 4E20A 2VTOA 4JI9A 5HE2A 2C3IB 2ONLC 4USFA 4GT3A 5E4HA 5AM6A 2VWZA 4JIKA 4E5WA 5IEXA 5FDPA 2C47A 5GNKA 5HG5A 4K2RA 4N4SA 3HMPA 3AMAA 1BKXA 4O0YA 3FI3A 2XK7A 3OOMA 3MY0A 4XOYA 3I5ZA 3W8QA 3PG3A 2XK9A 4OT6A 5IQDA 4XP2A 4BTKA 4IC8A 3ELJA 2B9JA 3A7GA 4KBAA 4OTQA 3HA6A 3LMGA 2QOHA 3R8UA 2R3NA 4PTCA 1Y8GA 3UTOA 4NH1A 4ENYA 3I0QA 1YXUA 5HBHA 5HQ0A 2C6DA 1H24A 1Q8WA 3MIAA 3VS3A 4APPA 4BDDA 4PMSA 1IEPA 2G2FA 4YTCA 4TPTA 2E9NA 3CR0A 2VWWA 3A7JA 3FXZA 3JR1A 4NJDA 2WMSA 2G2HA 2RL5A 3EKKA 3O2MA 4X2KA 3Q9ZA 2W1HA 3CJFA 2WB8A 3TTJA 2GQGA 3COHA 3Q5ZA 4RJ7A 1WCCA 2CGUA 4IJ9A 3A61A 3DOGA 3TYKA 2BHEA 2BRBA 1JSTA 2YM3A 3KCFA 3ODYX 4U9AA 4C4IA 4ZZNA 4WO5A 4EWQA 4O7TA 4YJTA 1OL5A 4IM0A 4OBPA 2C0IA 3ZRLA 4QEBA 4QPSA 4FNXA 2B0QA 2HCKA 5FXRA 4BI2A 3HUCA 5A46A 1HOWA 2ZB1A 1XBAA 2VTMA 4KIPA 4K77A 4F9WA 2Y9QA 1UWJA 3KRRA 3PY3A 5LVPA 3AQVA 4Z7GA 3FI2A 3PLSA 4EK8A 3UBDA 4FEVA 4HGTA 4O6LA 4QNAA 4CG9A 1KE7A 2J0JA 3EOCA 3OOGA 4R7IA 4EUTA 4MH7A 4EH6A 3QLGA 4FBXA 4EH2A 3D9VA 1VEBA 3R63A 2B9IA 4LMNA 4O96A 4JL9A 2YAKA 3FI8A 3NIZA 3LMIA 3PA3A 4JG7A 5AWMA 5LVMA 4L52A 2OH4A 4LI5A 1WBWA 1ZYCA 1ZYSA 5EW9A 3DJ5A 4O7SA 5LXMA 2Y6OA 4H3BA 2F7EE 4G6NA 4QNYA 2EUFB 4BR3A 1BI8A 1H25A 3DKCA 4WA9A 4ZZOA 3KF7A 2VX0A 5KKRB 2F49A 3II5A 5M08A 3OWJA 4FTTA 3MTFA 3V6RA 2XM9A 2C30A 4QMQA 3KL8A 3MVHA 4W4WA 3DT1A 3R1NA 3R9NA 2J4ZA 3H4JA 3PFQA 3KRXA 3F6XA 4FTKA 1EH4A 4ZY6A 4YC6A 1IR3A 2IW8A 2GMXA 4CV9A 4DEDA 4EH4A 3ALNA 2CGXA 3HNGA 3MFUA 2W06A 5CASA 4MQ2A 4K9YA 4FSWA 2F2UA 1J1CA 2ETMA 2AC5A 2RFSA 2VTNA 5JGAA 4RA5A 4GJ2A 3KXXA 2CKEA 5CEOA 3GC8A 2X4FA 4RX9A 4BZDA 3QD3A 4Y46A 1Q5KA 3GCQA 2VO0A 4X2JA 4BGHA 2VTAA 5JKGA 1QCFA 4BBFA 3KIOC 3BGZA 5ICPA 1P4FA 2I0VA 3VS7A 2E9OA 1PXOA 3KK9A 3W2OA 3RPSA 2XAMA 4RWKA 3ZLYA 3ZS5A 5IQHA 3RZBA 2IVVA 3ZEWA 4RJ8A 3ZM9A 4DHIB 1MP8A 3IQ7A 2F2CB 4F1MA 4QMPA 2QO2A 3R8MA 4MUQA 4FG8A 3SW4A 4D9UA 3VC4A 4I0SA 1V1KA 2XF0A 3LXLA 4BZNA 3PVGA 4OTDA 2GNLA 4N6YA 3NYNA 4NU1A 2UW0A 4ZOGA 2X6EA 3VRZA 4WRGA 1A06A 4QQJA 4EBVA 4MXOA 4DBXA 1UWHA 3KY2A 1MUOA 4KRCA 3CC6A 4S30A 4H3QA 5HEZA 3ZOSA 3TZMA 3DNEA 3RVGA 4KA3A 3ORMA 2GS2A 2PVYA 5E1EA 4FVQA 4CFFA 2XNEA 2YISA 5J95A 4LOOA 4HNIA 2PK9A 4ERKA 3CKWA 2GQSA 3LKMA 1REJA 5J87A 3W0SA 2UZWE 5EDRA 4ZTNA 2PWLA 4F6UA 2I1MA 1JKTA 3K3JA 2FO0A 4O0TA 4WHZA 3IDCA 3OROA 4EI4A 4F1TA 2R0UA 3ZXTA 4NZWB 3VIDA 4RQVA 3MJ2A 4X2FA 2P2IA 3KVWA 2P3GX 3QZIA 3BGQA 4IAZA 4D1ZA 5M51A 4DF3A 4L53A 4QMTA 3WYXA 3FMHA 4L3PA 5DYJA 3IS5A 2QKWB 3LCOA 3LOKA 2OI4X 1FGIA 2IVTA 1B38A 2XKDA 4NCTA 3QKMA 5DGZA 3SV0A 3NYOA 3LCKA 4DEGA 4EHZA 4Y73A 4NKSA 4BHZA 4RVKA 1W84A 3FI4A 4RIWB 1FVVA 4E6AA 3NUYA 4M97A 1Q62A 2WMQA 4KIQA 4TW9A 1HCKA 4XG7A 5FXQA 4AN2A 3EFKA 2W9ZB 5EQEA 3ROYA 5HVKA 5HE1A 3QXPA 4D4VA 3MDYA 4B0GA 4IW0A 5EYDA 4BCOA 4G3CA 4XV9A 4FOBA 2WQMA 5JQ5A 4JBVA 4ORKA 3Q4ZA 3SXFA 5CEIA 4C4GA 2WPAA 2Q0NA 2IVUA 4JR3A