4DE4A

Crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with hepes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
b'MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2")-Id
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4de4A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4de4A02
1ZXEA 5AX9A 4QP6A 2PWLA 4UX9A 3R71A 2XM8A 3PIZA 4FSNA 4OLIA 5DOSA 5AM7A 4D1XA 4JG8A 5HNGA 5DA3A 3PY0A 4FV7A 4RIOA 4C35A 3DJ7A 4O7OA 2VGPA 4AQCA 2X1NA 2W4OA 2WMWA 3G2FA 2QVSE 4H3QA 4NT4A 1FVRA 3R9OA 4CFMA 5IA3A 3DNDA 4UXLA 4NKAA 3CTJA 2CPKE 4HCTA 4NW6A 5IMXA 1H07A 3VQUA 4FZ7A 4U43A 1QPCA 1Q8WA 3COMA 4HVGA 4D5HA 3U9NA 2IW6A 1J1CA 3SA0A 2IVTA 1ZZ2A 4O0XA 5EYDA 5HE2A 4FYOA 2W9ZB 4LMNA 4EOLA 2C1AA 4ASEA 5EOLA 3FPMA 2YCQA 4FICA 3SXRA 4LI5A 3QC4A 3NGAA 4WG5A 4D2SA 3EYHA 3OVVA 4FIGA 3P7AA 1CMKE 3MTLA 4FTLA 1SNUA 4FL2A 3HMIA 3HUCA 4LV8A 5DEWA 4A4LA 4DTAA 2BILB 3AD4A 3DK6A 2C3LA 3PJCA 4LGGA 3S4QA 3QXOA 3TZ7A 4YUQA 3BKBA 4EQMA 3UNKA 2CCIA 3R1YA 3R1QA 2GTMA 4E6CA 4F9AA 3HZTA 2PTKA 3R04A 4O81A 3ZEWA 4KIOA 3BWFA 4LRJA 5IUGA 3AOXA 2VNYA 2YERA 2XF0A 3G6HA 2Y9QA 4GKHA 4AG8A 3TUCA 4FV0A 4IX3A 2XNBA 4IZAA 5B0XA 4BZDA 4DGLC 3LFBA 2UW3A 1G8AA 4XUFA 1XO2B 4FKJA 3RPSA 3W8QA 4PV0A 5I0BA 2DQ7X 2XH5A 2Y0AA 4GU6A 4AZFA 3KXXA 1A06A 4LQMA 3D7TB 1VR2A 3WF5A 4CCBA 5AA8A 4DLIA 5BVFA 3D9VA 3VWAA 4A9RA 1J91A 3I1AA 3EQHA 1Q8TA 2X2LA 3FI4A 3QXPA 2A27A 3MVJA 4OTGA 2QG7A 2I40A 1YHVA 4C3RA 4WRSA 3R6XA 5IA5A 5HNBA 3SXSA 3N4TA 4IC8A 3QD4A 4J95A 3OD6X 2P55A 4FSRA 1IR3A 1OL7A 2C6KA 3G9NA 4JX3A 5HIDA 3SRVA 1UU9A 4ALUA 2PPQA 4ZLZA 5HX8A 3E8DA 5J5SA 5GIPE 3FEGA 2CCHA 2WKMA 4MCVA 4C0TA 3LMGA 4YTCA 3ZFYA 1NXKA 3UPZA 5BYYA 3ZUTA 2C6DA 3DXNA 1CKJA 2ZV7A 5FM3A 2O65A 2UZWE 3V8SA 4E93A 4ZLOA 3ZHPC 3L9PA 4EUTA 4CTCA 4D4YA 5KMIA 3KL8A 3NYVA 3W1FA 1V0OA 2ITTA 3GU8A 4GL9A 4FT0A 4RGJA 5E8ZA 4FI1A 4LM5A 1AGWA 4PRJA 4PWNA 3TKUA 4AZVA 4K18A 4BHNA 4KKEA 5FP5A 2Z02A 2UZBA 2VO6A 3LQ8A 4IVBA 4ZK5A 4F9YA 3CIKA 3BRBA 5ETIA 4XG3A 4F6WA 5F9EA 3F5XA 3HAVA 3E63A 3R9NA 3NR9A 5A6NA 3WF9A 3C0IA 3F3TA 4J8NA 4K0YA 4ZXTA 5JRSA 3ZFMA 4CZTA 4RQVA 4FSYA 5F1ZA 3DAKA 3UIMA 4QMXA 4HOKA 1IAHA 3LCOA 4PTEA 1YOMA 5BYZA 4D4VA 5HD4A 1VYWA 3FC2A 1YW2A 4IVAA 5L2SA 4UZHA 4JQEA 4L46A 1ZLTA 3VUDA 3D94A 5CS6A 2ZB0A 2XNMA 5L2TA 2VX0A 2XS0A 3DS6A 3MGYA 2WTCA 3E62A 2WPAA 4OTDA 2OXDA 2X8IA 4I6FA 3ZM9A 2PZRA 1F3MC 4EBVA 1YI4A 3I6WA 4JX7A 3ZDUA 5AV2A 1PMNA 3PXRA 3SKCA 3VVHA 3ORLA 4IB5A 4U97A 1H1SA 3UTOA 5CAUA 5FDPA 3IDPA 2W1IA 1URCA 2W5AA 3KMMA 3RNIA 3MPTA 4IB0A 4W8DA 4G9RA 4WNMA 2UW0A 3RTPA 5CVHA 4M13A 4LOPA 2GDOA 4HGTA 1ZMVA 2VO0A 3BYSA 4YBKA 1M2RA 1PKGA 3GEQA 4OGRA 4QMSA 4I5CA 2BHHA 4YNOA 3ZC6A 4ASXA 3U6JA 1LP4A 4PX6A 3O0GA 5AV4A 5LVOA 3ANQA 3G0EA 4XHKB 2QOBA 5ETFA 2BRHA 2C0OA 4R78A 4GIIA 5DT3A 4TT7A 1V0BA 3T8OA 1L8TA 1FBNA 2VTSA 1T45A 3RVGA 4H05A 4I20A 2PVRA 1H08A 1QPEA 4G17A 3TM0A 3NW7A 3R7VA 2HY0A 4C34A 2JDSA 2HIWA 2YCRA 4RIWA 1F0QA 1PRYA 2OO8X 2KULA 2R0IA 4XCUA 4EK6A 4NL0A 3GT8A 4A9TA 2RF9A 4Q9ZA 2XZSA 4FSWA 3A62A 3PJ8A 4QP1A 4R7IA 4U81A 4C4GA 2ERKA 4M67A 4BCJA 2IW9A 4XX9A 4RMZA 3AC5A 4Y72A 4Y83A 1X8BA 3JVRA 4FKVA 3T3UA 4ACGA 3I6UA 2WQEA 3F3ZA 3NNVA 4AE9A 1Y6BA 4TZRA 4OBQA 3HECA 4IADA 3WOWA 5HVYA 3SD0A 4FUXA 1Q99A 3ITZA 3NUAA 2HELA 5CYIA 5DYJA 4ACMA 4FGRA 4QTDA 1M2PA 3R2YA 4Z16A 2JITA 3S3IA 1BI7A 3HNGA 3OHTA 4U7ZA 3DNEA 2O64A 4C33A 4QYGA 3R9RA 2X9EA 4FSTA 4GT4A 4Y46A 5C4KA 3VF8A 3UZRA 4FL1A 4XOYA 4JG7A 4GVJA 4AA5A 4ASZA 4ZY4A 3IO7A 3QGYA 4WA9A 1SMHA 3IG7A 2J2IB 2OW3A 5J95A 3FI3A 1GIJA 2JAMA 2Z2WA 3HMMA 3I5NA 3RCJA 3F88A 3LFDA 1JBPE 4WOVA 4WUNA 3OT3A 4RRVA 5DNRA 5EDQA 2R7IA 3BBTB 2W0JA 1W83A 2W99B 3BQRA 5T3QA 3F5UA 2UW5A 5E8SA 1ZY5A 3ZONA 5AP3A 2PVHA 2UVXA 2G2FA 5EDRA 3UO4A 3NPCA 2X7OA 3OY1A 4IB3A 4WHZA 4M12A 4RJ6A 4GH2A 4GJ2A 5LWMA 4GIHA 2R5TA 2XB7A 1PHKA 4RX9A 4DEGA 5DH3A 3PXZA 5EM6A 3E8EA 3W16A 3Q9XA 2QC6A 2R2PA 2AC3A 3ORXA 5A9UA 3PVWA 3PP0A 4TRLA 4OR5A 4KA3A 4H3BA 3ZS5A 4RIYB 3BEAA 1OUKA 3BE9A 3MFTA 4B4LA 4MNEB 3UOKA 2FSLX 2R7BA 5JGDA 4BTJA 2JDVA 1H27A 3BQCA 4NJDA 2WIHA 4O0VA 4L52A 3I0QA 3Q52A 5IEVA 4DFNA 3I60A 4JS8A 3BLRA 2CNQA 3FC1X 3LCSA 3MY5A 3KK8A 4NCTA 1WAKA 5L8KA 1RE8A 4G6LA 4A9SA 1ZY4A 5DT0A 1R0EA 3Q4TA 4BCPA 3TI1A 1M14A 4L3LA 4XEYA 3K5VA 3LFAA 5LVPA 3CP9A 3BHYA 4BI0A 2HZ0A 4ZZNA 5AV1A 4BR3A 4G3CA 4U42A 4D2RA 1FGKA 4RC3A 2ZMDA 5I9UA 4N6YA 4TW9A 2QOHA 4QMTA 3TIYA 4P4CA 1PXLA 3BHTA 2NO3A 3ORKA 2QOCA 3D5VA 5BX0A 4FEQA 3POZA 1WBOA 3EYGA 4PUZA 4F0GA 2GHGA 5EI2A 3BLHA 3F5PA 4BRXA 5HZNA 4TYJA 2QR7A 3W2SA 3GXLA 4FX3A 3KULA 5C8MA 3ZDIA 3EN9A 2FA2A 1URWA 2WQOA 4KS8A 3RK5A 5GIOE 3CSVA 1OKVA 3HLLA 4FE2A 4GYGA 2R4BA 5FQDC 2PK9A 4FV5A 3W2PA 2J0MB 4RA4A 4AZTA 4C61A 2Z60A 3RJCA 1RJBA 3MY0A 4C37A 4R7BA 3OBJA 3R83A 3DKFA 5CY3A 5M53A 1WBSA 1RDQE 5IEXA 2RFNA 4M68A 2JD5A 5HI2A 2G15A 3ETAA 2UW4A 3DDPA 3Q53A 4BBMA 5IA1A 2QODA 2C3IB 4I6QA 5DFPA 5HE0A 3ZLXA 3KK9A 4IB1A 4BI1A 4IX5A 4FVPA 3Q60A 4UWBA 2HENA 4FNWA 5I9VA 2ZDTA 3QTUA 2O2UA 4BKJA 5AEPA 2CGXA 3OZ6A 5LCJA 3NVKI 3CCNA 3DKCA 4PMPA 3L8SA 1U5RA 5HQ0A 3D0EA 4NU1A 5CEMA 5L2WA 1SVHA 3QX2A 1PMVA 3P9JA 1JKLA 2B7AA 4I5HA 3IS5A 4YO6A 2QQ7A 2Z8CA 4HYIA 3PSDA 2F49A 4FG8A 4CFFA 4TTHB 5HORA 4BIEA 3VQHA 3VS6A 3R21A 5FTQA 1MRYA 4MH7A 4MXXA 5EK7A 3PPKA 1H24A 2J0KA 4OTFA 3R7EA 4L45A 2R3KA 1YXSA 3PLSA 3TTIA 1JNKA 2F2CB 4F0IA 2UZVA 3A4PA 4FKRA 3QAME 3OC1A 5KE0A 1JSTA 4TYEA 5KKRC 1XJDA 2WAJA 1M17A 3OT8A 2XCKA 1PF8A 3NAYA 5KCVA 3OCBA 5C27A 4WUAA 4O22A 3QZGA 4WBBB 4E8AA 5A6OA 2A0CX 3MVMA 4BVUA 2OH4A 3TJDA 3HA6A 4RVMA 4EONA 3GU4A 4YLJA 4CD0A 5AP6A 3EZVA 4D9UA 3RALA 3QLFA 4ERKA 2WMBA 3ZUVA 4WT6A 1IEPA 5E7RA 5CSPA 3KA0A 3ODYX 4I5MA 4JQ7A 4YZ9A 4L6QA 3LMIA 2YZAA 4F7NA 4NW5A 2R3RA 1H1RA 1IA9A 4XG9A 4EWQA 4PY1A 2OFVA 2YISA 4EWHA 4O7YA 1REKA 1WBPA 3NNXA 4QRCA 3RINA 4AN9A 1EH4A 4WG3A 3QA0A 4D1ZA 3F3WA 4FV9A 2Y8OA 4A06A 2JBPA 3DB6A 2OJ9A 1MRVA 4KWPA 4L7FA 3RCDA 3DFCB 3UG1A 4MXCA 3H9RA 3AMAA 3MA6A 4L44A 2AYPA 4O7RA 5LJJA 3O2MA 3DXQA 3EIDA 2YIRA 2O8YA 5CAPA 1R1WA 3TZ9A 3DT1A 4BDDA 3CGOA 1OITA 2CLQA 3TWJA 3W2CA 4FODA 4AP7A 2R3OA 3CKXA 4IAIA 4IZ5A 4CT1A 4XYFA 4DGMA 3NX8A 2HZIA 3VUHA 4DHFA 3IQ7A 3FLYA 2C6IA 2YIYA 4PDOA 4AFJA 4HPUE 4ASDA 2X7GA 5CF4A 5BVOA 4PNKA 3O50A 3QD2B 4IH8A 1YI6A 4ZTHA 5HIEA 4FZFB 5E92A 3C51A 3LCKA 4F1OA 4KAOA 4RZWA 3VBTA 5DBXA 1JQHA 3IGOA 2C1BA 2EWAA 2OJJA 3BYOA 2ITOA 4N4SA 4BDHA 2O0UA 1PMEA 4MD8E 4L9IA 4KRDA 5GJDA 5FXSA 4RFZA 3F2AA 3M11A 1Z9XA 2ITZA 3HYHA 1UU3A 3FZRA 4E4NA 3VBXA 2Y7JA 2ZDUA 3QL8A 3EN5A 2FYSA 3U54A 2PZPA 2A4LA 3WYYA 4FSZA 4AT5A 4DYMA 5I9XA 2VWXA 2UUEA 2ZB1A 3Q3BA 3W2RA 4OBPA 3NCZA 4GKIA 2PMIA 4ZTRA 2B55A 5JQ5A 5HD7A 2WQMA 3NUXA 3ODZX 4FTCA 4O7ZA 5EDPA 2CGUA 3SW7A 3GC7A 3NUPA 4M84A 2BR1A 4K77A 4O7NA 2BTRA 4FTNA 1JWHA 2PSQA 1UVRA 4IFCA 4MBLA 1G8SA 5DGZA 2NNWB 4EZ5A 4FNZA 5BMMA 5M07A 4GEOA 4NTSA 3NNWA 5E8WA 4PMMA 4FTKA 5HVKA 5KBRA 5E8YA 4FK3A 2OWBA 2VX3A 4XP3A 3W8LA 4BDCA 2IG7A 4BY9E 3PXFA 2R3NA 2JKMA 3KEXA 3RHXA 1W98A 3HAMA 1UNLA 2XRUA 3OWPA 1ZAOA 2NRYA 1XHAA 3CPCA 3QRUA 3OCTA 4YSJA 4BF2A 3RWPA 4WNPA 2CGVA 3LFFA 4AU8A 1MUOA 4DBXA 3PZEA 1H1WA 4DC2A 5K4IA 3TUBA 3OTVA 3EL8A 3O8UA 4OTQA 1OGUA 1T46A 1B6CB 3IKAA 4U44A 3VS5A 4M7IA 5JRQA 4EZ3A 2J5EA 3F82A 2E9OA 2HZNA 2WTDA 2XIZA 3PA4A 4UB7A 1CDKA 3TV7A 4E5BA 3TNPC 3PXQA 3VHEA 4DT9A 1YQJA 3MS9A 1PXKA 1YDTE 4XBUA 1NVSA 5AAFA 4FT5A 4NCTC 4NM5A 4C59A 3PE2A 3AG9A 2BAJA 5A4QA 3UZPA 4WG4A 4AXAA 4GRBA 2OF2A 2X2MA 4R3CA 1H01A 2JKQA 2LGCA 4GMYA 3K3JA 2ZM1A 2PUUA 2J6MA 4X7QA 5IG1A 3FMMA 4FEUA 5AM6A 4C3FA 4QMYA 3OY3A 3DLZA 1P14A 1L3RE 5B2LA 2UW7A 3F6XA 3HV4A 2HWOA 3OP5A 3BPRA 3KRJA 3FYKX 3QQUA 4QYYA 2OFUA 4Y85A 4M8TA 4D9TA 5DR9A 1OPLA 3NYXA 1ATPE 1PJKA 1WCCA 3QQGA 2OJGA 3HRBA 4X21A 5A14A 5L6OA 1WVXA 1W8CA 3DKOA 4XS2A 5HLPA 3VF9A 3U8WA 2Y6MA 2XKCA 4AOTA 4EJNA 2Y4PA 1ZYDA 2ZV8A 4AZSA 2YABA 4B7TA 2CLXA 2PY3A 3EN4A 4EQCA 3LVPA 5M06A 4QYFA 4E73A 4YZCA 3OW3A 2VTIA 1Q24A 3QTXA 1U54A 4FG9A 4YJUA 5AUVA 5CEQA 4O7PA 4XG8A 3V5JA 4C2WA 4C7TA 4FOCA 5B7VA 3NAXA 3SW4A 3EWHA 5B2MA 5HCZA 3EQGA 2VUWA 3D5XA 5CU4A 2R3IA 2V0DA 5LMBA 5AUXA 5CEKA 3KN6A 4IHPA 3RAIA 3RMFA 3FLNC 5IQIA 2GQGA 2G2HA 3ATSA 4AX8A 3ATTA 3GFWA 4GJ3A 4BCIA 4RQKA 4EK5A 2I6LA 4FSUA 4HGLA 3QWKA 1OIUA 4NK9A 1J7UA 3OXTA 4MF1A 4O84A 4QT1A 2YJRA 4NJ3A 4R7HA 4X2JA 2XJ1A 4FV3A 3SV0A 4AFEA 2PVJA 2Z7RA 4WD5A 1YXUA 4L42A 5JFSA 3NW5A 4O7VA 5M08A 4BN1A 3LJ0A 3QZHA 3FKLA 4Y5HA 2P4IA 4FV6A 2XNOA 4D58A 4QP7A 1BKXA 3A4OX 4PDSA 2BAQA 2GS7A 3T9IA 5A54A 1IRKA 2C6EA 3V6SA 4E4LA 5JQ8A 3DOGA 4YP8A 3LJ1A 5M44A 2C3KA 4S32A 4KB8A 2XCHA 4GT5A 4W4WA 3CKWA 4JDJA 1DI9A 3S2PA 2UZOA 3UE4A 4FNXA 2JFMA 3UP7A 4JBQA 1A9UA 2B9FA 2W9FB 3R73A 3MPAA 2Y4IC 3PWYA 4O83A 1ZMUA 3KC3A 1Y57A 5ANGA 2VWBA 4BZOA 2BTSA 3UPXA 2FSTX 4OUCA 3KXHA 3MBLA 4DH1A 1OKYA 4HNFA 4DGOA 5AA9A 4X2FA 2VTQA 4UBAA 4EH6A 3U9CA 4QP8A 2J0IA 3OWJA 2P3GX 4JI9A 4CFWA 3SGCA 2W7XA 3RM6A 3A8WA 5BVWA 5HBJA 5M4IA 5M57A 2ZV9A 3LM5A 3FKNA 1ZYJA 5CU0A 2WTVA 2YCSA 4QP3A 3FLZA 4MNFA 3WZJA 4CKJA 4BDIA 3IPHA 3PLAE 5KKRB 3GCQA 4DAWA 3BYVA 2PZYA 4F9CA 1YWVA 4F7SA 4O96A 2W5BA 4JBOA 3DPKA 2R3MA 3MVHA 3ZSGA 2VTHA 2GNHA 5FRIA 4ZSJA 2PVLA 5CANA 1BMKA 4UV0A 3ORMA 4TYHA 1BI8A 1S9IA 4EOOA 2HY81 2VX1A 3KKVA 4RC4A 4F6SA 3HUBA 2BRNA 2XJ0A 3DBDA 3TNQB 3NSZA 4EQUA 2W1HA 3FQHA 4N70A 4O2ZA 3H0ZA 2X8DA 3PJ1A 4E4XA 3A7HA 1ZOGA 5CLPA 3W0RA 1GOLA 3QTIA 3WZDA 3UNJA 4RA5A 4PP9A 2EXCX 1JOWB 5F94A 2BZIB 2PULA 4B99A 2H34A 3JS2A 4EH4A 4YJQA 4ZLYA 2OICA 3R2BA 3RKBA 5E91A 4G2FA 5AP4A 4LFIA 3L9NA 4FKPA 4C4FA 2XRWA 5E1SA 4HYHA 3O96A 4ANQA 3WF8A 3O8PA 2C5YA 1R3CA 4GK4A 5ANIA 3UO5A 4FVQA 4RFMA 5C9CA 4BIBA 2XK4A 3OUNB 3V5PA 3LQ3A 4UEUA 3M42A 4FT3A 5IDPA 5CZHA 3AC3A 4V0GA 1FPUA 4BCNA 3A8XA 5EYCA 4AF3A 4CTBA 2C0IA 3KVWA 4K8AA 2YM7A 3R28A 3FHRA 1YHWA 4D4SA 4YJVA 3KREA 4NM3A 4C4IA 2GFSA 4J53A 5IA4A 5BUEA 5L2IA 2GTNA 2J0JA 3KXGA 4TN6A 5K4JA 5CI7A 1YXTA 4ALWA 3VUKA 5EHYA 5A4LA 4MWIA 2V55A 4ZSAA 3CXWA 1IG1A 3KRRA 2BKZA 4YPDA 3W0PA 5T68A 4P2KA 1OIQA 2QU6A 4I1ZA 4FTIA 1BUHA 5DPVA 2GNLA 4QMUA 1U59A 2XYNA 3DBCA 4H36A 4JT3A 4CVAA 4UXQA 5I9WA 3QTRA 2QHMA 4RWKA 3E7OA 4HVSA 5I5ZA 3G5DA 2GQSA 1XH4A 4WBOA 2ETKA 3KB7A 4KNBA 5CEPA 3LZBA 2FO0A 3NNUA 4U98A 3ERKA 3U55A 3C1XA 1OL1A 4MD7E 2IVUA 5CT7A 2BZHB 4ZSLA 1GNGA 5D10A 4OBOA 1OB3A 5IEYA 3I7CA 2XBJA 2B54A 3JUHA 3ULIA 3UC4A 3UNZA 5HVJA 4ANLA 3S0OA 2YM5A 4AACA 3GCPA 3O17A 4XV2A 4GS6A 4IWDA 5B2KA 2IW8A 2OK1A 3KCFA 2GSFA 3RI1A 4BDEA 2QOKA 2J4ZA 3C0GA 3DBEA 3MH1A 3QUPA 4M97A 5C03A 2OXXA 3ZO4A 3Q5ZA 4TXCA 5HE1A 4FTMA 5C8NA 4LUEA 3ELJA 2OIBA 2IZTA 2ITYA 2HXLA 3MYGA 4Q5HA 3TN8A 4U80A 3RGFA 4DEHA 3GU5A 4QQ5A 3UVRA 4GFGA 3ID6C 3P4KA 4UZDA 3AD6A 4CV9A 4X0MA 4ZAUA 4BI2A 4MYGA 2IWIA 2QG5A 4EHVA 2BFXA 2HOGA 2XKDA 3FMKA 5LQFA 1GAGA 4K11A 2WTKC 5CF8A 2HCKA 2X0GA 3G33A 3A60A 3U4WA 2WTWA 3D5WA 5AADA 1H1PA 4BCFA 4E6QA 4DFYA 2JDTA 3RPOA 2F7ZE 4EOJA 4ZSEA 2VD5A 3KY2A 5TF9A 1P5EA 2ZM3A 3OWLA 4DT8A 2UVZA 4RWIA 2C30A 3F7WA 1PXIA 3Q6UA 4XLVA 3ZU7A 4A7CA 4Q9SA 4HZSA 4IACA 2RFSA 2UW9A 5EQEA 1OKZA 2ITQA 3FLQA 2W1GA 4BCHA 4DTKA 2I0YA 3D5UA 2VWUA 3WZEA 5JKGA 5EKNA 5CSWA 3G6GA 2UVYA 1YOLA 2VO3A 4FIEA 3WBLA 2BAKA 4FZ6A 2BMCA 4UYNA 4I21A 5HCYA 4B9DA 5DI1A 3O23A 4D4RA 4C4JA 1ZOEA 4EHZA 2XK7A 4EH2A 4F08A 2O3PA 2OG8A 4FKLA 5J9YA 1I44A 3M1SA 2X6DA 3OMVA 2BPMA 4J1RA 4ZJVA 3BGZA 4DINA 3EB0A 2HAKA 3VJNA 3VN9A 2OZAB 2YZLA 4IAZA 5KMLA 3TIZA 2QOFA 2C6OA 4FTQA 4IJ9A 3ZO1A 5I9YA 2WGJA 1OL5A 4V01A 2CMWA 2PU8A 3KULB 4CMOA 1MQBA 4QO9A 2BZJA 2WQNA 3IOPA 5IQDA 3V6RA 2ZJWA 3TKIA 2GNGA 5CSXA 3BV3A 3HMOA 3VRZA 2WOUA 2HW7A 5AWMA 1Y8YA 2W06A 5DRBA 4NWMA 3OG7A 2UZEA 3LLAA 4U6RA 5JFXA 3N4UA 4XV1A 5FBNC 4DFLA 5HU9A 2QI8A 3R8ZA 4XLIA 4CKRA 2OI4X 4FKSA 3C4CA 4EEVA 4DH3A 5IPJA 3E92A 3V5QA 1Q3WA 1XQZA 2F4JA 3UMWA 3UOLA 3DY7A 3ZCLA 4ANMA 4BTMA 5AP5A 1K3AA 3DQWA 4QP2A 1YVJA 3A7FA 2XK6A 2CNUA 3NUNA 1NT2A 1AQ1A 2XNNA 1P4OA 2VWWA 3NUUA 4RIXB 4RX5A 2VTOA 3GC0A 4RPVA 4XP0A 3ZUUA 5HX6A 3DFAA 1ZOHA 1J1BA 5JFWA 3DU8A 4BTFA 2R3QA 2YM6A 4L53A 4E7WA 3C7QA 2BIYA 2Z7SA 3H3CA 3LCTA 3FAAA 4QP9A 1GZKA 3TNWA 4CZUA 3GCUA 3RWQA 3VW6A 1VYZA 2YFXA 3PVGA 4AOJA 4Z55A 5EOBA 1XH7A 3QHRA 4F7LA 2JIIA 3MWUA 4MKCA 5M4UA 3NUSA 5DE2A 3WYXA 2ZM4A 5BQ0A 1GY3A 3QTZA 2QKRA 3D7TA 2PMOX 3CQWA 4PF4A 3R7IA 1OBGA 1DI8A 2OF4A 4IFGA 5EKOA 4FIJA 2X7FA 5IISA 3ENMA 1KE7A 1XH6A 2BCJA 2G9XA 4O0WA 2Y4IB 3FDNA 1UWHA 3HVCA 3AT3A 1YXXA 4QNYA 5ANOA 4UWYA 4F9BA 2C6LA 4U41A 1B39A 5HO8A 1Q4LA 3SXFA 2UZLA 3NIZA 3ZM4A 4KD1A 4DH7A 3AC2A 3ALOA 5E90A 5CTPA 5HICA 3MTFA 4ITIA 2ZV2A 1STCE 1OECA 3E8NA 3R01A 5ETAA 2C3JA 4F4PA 5LXMA 1DS5A 3ZLSA 1PY5A 1H25A 3EQCA 3Q96A 2GHLA 4RWLA 5FTGA 2PVMA 3FYJX 4J96A 1Z57A 2IZRA 3RK9A 3R1NA 2XK3A 5E8VA 5FBOA 4PMTA 1CKIA 3ZH8A 3PIXA 2CGWA 2BRGA 3R8LA 5JZNA 1FMKA 5LMAA 5EW3A 3OOMA 4CCUA 3F5GA 2I1MA 2X8EA 3CJFA 3LM0A 3EZRA 3FQEA 3UODA 1HCKA 1OIYA 4DLJA 4RJ3A 4BGGA 4EUUA 2VTJA 4RJ5A 4RJ8A 5AP2A 2WFYA 3TZ8A 1PXNA 3GGFA 4YJOA 3PVBA 4MVFA 2OU7A 4W8EA 4E5AX 3HL7A 1LUFA 3LFQA 3AMYA 4G5JA 3GU6A 3UYTA 3LFSA 3LXPA 4EH7A 5IQGA 4XRJA 4HGEA 4EYJA 2PMLX 5JZJA 1KV2A 5J1VA 4TY1A 3PVUA 4O7SA 4BYJA 3Q32A 4FKUA 4MXYA 4PQNA 3QTSA 4IVCA 5ICPA 5FD2A 3LE6A 4XMOA 2BFYA 1XBBA 2YAKA 2W5HA 3ORNA 1BL7A 4FKIA 3UP2A 3UO6A 4O0TA 4EK4A 1Q5KA 3WILA 2B4SB 3HEGA 5GJFA 2R3HA 2WTJA 5F20A 3W18A 4JQ8A 5EYMA 1U46A 3CC6A 2OXYA 3O7LB 2RG6A 3BHVA 3UYSA 3ZFXA 4I94A 4IJPA 3UVPA 3ULZA 1M7NA 3NLBA 3V8WA 4AOIA 4F63A 4HVHA 3BX5A 2OGVA 4RVTA 3CGFA 5IQCA 2VWZA 2XP2A 3CJGA 3QRJA 3LFCA 3FPQA 3UQFA 3ORZA 2QU5A 5HTBA 4AE6A 3FJQE 1Y91A 3R30A 5EM8A 4DN5A 4FYNA 4APCA 2CKEA 3N51A 4D0XA 4EOSA 3DK3A 3ORIA 3QC9A 5HO7A 3FV8A 4O0YA 4YNEA 4YJSA 3QALE 4RZVA 3FMDA 3MV5A 2ONLA 5M55A 4JIAA 3QKKA 2AC5A 4NM0A 1ZYSA 1NA7A 1H26A 4AZEA 4GCJA 4GFOA 4LV5A 4NH1A 4LGHA 3MH0A 1V0PA 2WQBA 4YO4A 4Y73A 3F2NA 4XG6A 2Q0BA 2ZOQA 4F70A 1OIRA 3ZSHA 4AS0A 5CZIA 4MX9A 3P78A 4QMWA 2RL5A 4AW0A 4IWQA 4YJRA 5IUIA 4RG0A 4CQEA 1YWRA 1WBWA 3HKOA 4HYUA 2IVSA 1Q8UA 3Q9ZA 3QU0A 5KHWA 3U4UA 2PHKA 2R0UA 2A1AB 4L68A 4V04A 4EI4A 3M2WA 3PWDA 2XK9A 3SG8A 4ZZOA 3E3BX 4ERWA 5AAEA 4OTWA 5JGBA 5IDNA 5C26A 5C1QB 3BGQA 3GB2A 1BX6A 1H1QA 3OEFX 4TYGA 4C3PA 3E8CA 3V04A 2XK8A 2OIQA 3PY1A 4JBVA 4RLLA 1WMKA 3BYMA 1PXOA 5D9HA 1NVRA 3EOCA 4USFA 3R02A 4ANBA 3AT2A 5HG9A 3E93A 3PYYA 3FI8A 5DT4A 1LEWA 4YJTA 4R1VA 1WFCA 2C5VA 4X3FA 3FXZA 2B0QA 1SNXA 3HRFA 4GVAA 4E1ZA 4IDVA 1TQMA 5H3QA 4FTAA 2BDJA 4YZNA 4FUYA 5ETCA 3TDWA 4DE4A 2GMXA 2PUPA 4LYNA 2F9GA 3DXPA 2HYYA 2CJMA 4WZYA 3I4BA 3JR1A 3WZUA 3FQSA 4L8MA 2F57A 3MIAA 4NM7A 3TV4A 4MQ2A 4DA5A 2YAAA 4M0ZA 1Q97A 4MXAA 2OJIA 4RIYA 3OXIA 2BVAA 3RAKA 1U54B 3HA8A 2OSCA 2UZTA 4QMOA 3KXNA 5DHJA 3GP0A 4WNOA 2C47A 2RKUA 3V01A 1Q8YA 3VO3A 2W1DA 4AT3A 4IWOA 3AQVA 2B9IA 3QTQA 4Y95A 3EQIA 3QWJA 3AD5A 3ZBFA 5BPYA 4FV4A 4FK6A 5DVRA 2V7AA 2C6MA 3CTQA 3D7ZA 2VN9A 4FKTA 3C9WA 3R9DA 4HCUA 4N0SA 4KKGA 2CNVA 3ZXZA 3ZOSA 3SQQA 4XH6A 3WE4A 2C5OA 5KBQA 4J98A 5CNNA 4PP7A 2I0EA 4C2VA 5J9LA 4JG6A 3LKMA 5IA2A 3MFSA 3QGWA 5IA0A 1WBNA 2YITA 3MPMA 4G3GA 4TKSA 5AUYA 1B38A 4ID7A 3A99A 3KXZA 3JPVA 5AP1A 5M51A 2ZYBA 3E7VA 2HWPA 2PE1A 2YDIA 4YBJA 1WVWA 3QZFA 2IO6A 4IANA 4L7SA 3HV6A 3H9OA 4AA4A 1DAWA 1TKIA 3R7UA 3FLWA 4PL3A 3H10A 3A7IA 5CALA 3DAJA 2V5QA 4UWCA 5L8LA 1WBTA 3G9LX 5CQUA 1OPJA 5JFVA 1YDSE 4M3QA 3WIKA 4YR8A 5CAOA 3MY1A 3DB8A 3COIA 4D28A 3LIJA 4O0SA 2OJFE 3L8VA 4RC2A 3CLYA 4FZDB 4FKQA 5HNIX 5EI6A 5AUUA 4YZMA 3F66A 3G51A 1FVVA 2WEIA 1KE8A 4M15A 5IQAA 1ZZLA 4FOBA 5IQHA 1U5QA 2JDRA 3TUDA 3QQLA 4IX4A 4BBEA 1APME 4IZYA 4GUEA 4HGSA 3NVMB 2JLDA 3TG1A 1IAJA 2P2HA 3BE2A 3ZZEA 3Q04A 3QD3A 4KABA 4QTBA 1ZARA 3VAPA 1PMUA 3DBQA 2A2AA 4IC7A 4NFNA 5KUPA 4U94A 2PVKA 3IW5A 4RFYA 4GUBA 3NYOA 3D2KA 3PTGA 3K2LA 1OPKA 2WO6A 2IPXA 3VBWA 4CFUA 3P08A 5AUWA 2GNJA 2XIKA 2CKQA 1O6YA 2WTIA 4OTIA 4K9YA 3KRLA 3FI2A 5H2UA 5AUZA 1SVGA 2QLQA 4CLIA 3QRKA 3TEIA 2H9VA 1A48A 2QO9A 2VU3A 2J90A 2PZIA 3LXLA 1WZYA 5HIBA 5BUJA 3TACA 1ZWSA 3PXYA 3QQHA 3T3VA 2BDWA 1UV5A 1NY3A 3A7JA 5KMJA 3TDVA 2VGOA 3AT4A 5CWZA 1ND4A 2WMTA 3JXWA 4G6NA 3QZIA 3UGCA 1O6LA 1VEBA 5LMKA 1HCLA 2FVDA 2EB2A 4X2GA 3OXZA 1H0VA 4ZMEA 4JJRA 4I23A 3RAHA 3BGPA 2VWYA 4ZMFA 5E8XA 3GFEA 2XNEA 3FZSA 3NCGA 1S9JA 5DLSA 4RT7A 3ZLYA 3B2TA 4MBIA 4YC8A 4G9CA 4AW5A 4FT9A 4LUDA 5TKDA 4CGAA 3QTWA 4S33A 4AN2A 2WNTA 4MBJA 4YSMA 2ACXA 1PYXA 2FUMA 2VTRA 2VNWA 3C4WA 3P7BA 5JN2A 3OCGA 4EOMA 2RFEA 3I81A 3Q2JA 1QPJA 4LRMA 3BBWA 3ZSIA 1XR1A 4CXAA 1E9HA 4KRCA 3Q2MA 2V22A 1TVOA 2E9VA 4NIFB 3EFJA 5G1XA 4FMQA 3DV3A 4A9UA 2ITUA 2EU9A 3C13A 3VS2A 3PG1A 2WMRA 4QYHA 3KVXA 4IM2A 4Q2AA 4X3JA 5D41A 2WMVA 1J7IA 4J52A 4ORKA 3BU6A 2GPHA 3Q4CA 4WO5A 2QNJA 5EG3A 2XMYA 5BVDA 2VWIA 4A9YA 2OLCA 1J3HA 1R0PA 3BHUA 2ONLC 3WF6A 3HMNA 5DRDA 1PXJA 2UZDA 3TCPA 3AC4A 3W0MA 4O86A 1TQPA 5J9ZA 2VV9A 4EZ7A 2WOTA 5A4TA 2W17A 1FOTA 4J99A 4F6UA 3IDCA 3QKLA 3UIBA 3TJCA 3CPBA 1JAMA 4MXOA 3LXNA 5CU2A 5E1EA 1XBAA 4P90A 3VS7A 3ZZWA 2Z7LA 4JAIA 5M4CA 2XNGA 3SRVB 4CRSA 3KCKA 3TNIA 3CY2A 3KF4A 4GG7A 1BL6A 4JL9A 3R1SA 2YN8A 4U8ZA 2CN8A 3PA3A 4MEDA 3QHWA 3QYZA 4O6LA 4AW1A 1MQ4A 2E9NA 2QOQA 1KWPA 2R3LA 3QCXA 4OT6A 5E8UA 3GENA 3PPJA 4E6DA 3DLSA 2DWBA 4I93A 3RP9A 3A7GA 1Q61A 4I6HA 3TNHA 4BHZA 2QR8A 3LMHA 3QRIA 3UDBA 3FZ1A 3R7YA 4CFXA 5IH6A 3VS4A 4U3YA 3QUEA 4H39A 3PUPA 5BYLA 5JSMA 3TL8A 4D0WA 4X3FC 4L3JA 4DFBA 4FEXA 1Y6AA 4IM3A 4BDGA 4QPSA 2XJ2A 4DG3E 2HZ4A 5KZIA 3ZYAA 4N57A 4EOIA 4O7LA 3DZQA 3FMLA 1NW1A 3MH3A 2PVNA 4QMZA 5KZ0A 1I09A 5DN3A 4KS7A 2R9SA 2VAGA 4HCVA 5KX8A 1GIHA 1JSVA 2WMXA 4GW8A 3V8TA 4EYMA 2X6EA 2XKFA 4F99A 2WU7A 3GQLA 1E1XA 2KTYA 1QMZA 2PYWA 4FL3A 5FXRA 3VNTA 3BIZA 3IOKA 2BHEA 2VTNA 1F5QA 1KSWA 2X39A 3H4JA 3QA8A 5T6KA 3KQ7A 4O82A 4BGQA 4YTFA 5A46A 3UQCA 5IH4A 4TWNA 5HG5A 2VTTA 3TTJA 4FKWA 1AD5A 1XBCA 3QCSA 4IM0A 4USEA 1UNHA 4PNIA 3ROCA 4YLLA 4KSPA 1G5SA 2XBAA 5DEYA 2YIWA 5EQYA 5H8EA 3LXKA 3GI3A 3ZLWA 3MSSA 4F9WA 1CM8A 3MVLA 2FB8A 1YRPA 4U40A 4JBPA 3MB6A 4YHFA 3GC9A 1OBDA 3W2QA 4A4XA 3B2WA 3F61A 3FUPA 3G90X 4ZEGA 4OTRA 4ZJJA 3W0OA 3BI6A 1K2PA 1IASA 4DFZE 4D1SA 2YEXA 3R7OA 2E9PA 1PKDA 2EVAA 4IDTA 3IW4A 4DEEA 2CN5A 3E3PA 4L67A 4EC9A 3SLSA 3VUIA 4ARKA 3KN5A 1DAYA 4CLJA 4JOAA 3SVVA 3HP2A 4RIWB 1CSNA 1W7HA 5K9IA 3TZMA 4QMNA 1PW2A 4YPSA 4G6OA 5ANKA 1XWSA 4QTCA 1MP8A 5GJGA 3Q6WA 3QBNA 1NVQA 4CRLA 5K5XA 2PL0A 3HX4A 2XEYA 2YWVA 3ZO2A 3CY3A 1W82A 3ZC5A 4FT7A 3VJOA 5HLNA 5IQFA 5TO8A 3L8XA 3MH2A 3DKGA 3GOKA 4DCEA 4OT5A 3BLQA 3T9TA 2ITWA 3H0YA 5H9BA 2WZJA 3VS0A 2WMAA 2NRUA 4KSQA 4DG0E 1YOJA 2BROA 2WMUA 3C5UA 3E88A 4TNBA 5CAVA 3P1AA 2BALA 5FTOA 2XKEA 4ACCA 5LVNA 4PTCA 4UYAA 4J7BA 3QQFA 2ZMCA 1Y8GA 4G3FA 4GV1A 4G5PA 2X4FA 2ITNA 3OFMA 5ANJA 5KHXA 4CSVA 4BYIA 2DUVA 5BNJA 3R8UA 2H6DA 3TYKA 4AA0A 4DG2E 2WEVA 1JKKA 4BB4A 4ZTLA 4O6EA 4W4XA 3MFRA 5JEBA 3FMEA 3LFNA 5F4NA 4GT3A 4IAYA 4QQTA 5IQBA 1FINA 4R1YA 4QTAA 4ITHA 1PYEA 2R3JA 2PZ5A 5AV3A 2OH0E 4C4EA 4RVKA 3AMBA 5AAGA 5H8BA 4H58A 3ORPA 5EI8A 4FGBA 5GHVA 5LMKC 4EC8A 5HCXA 2ZVAA 3JVSA 3VULA 2REIA 2GNIA 4FR4A 4BCMA 2F7EE 3PA5A 3MJ2A 5TR6A 4ZTQA 3UIXA 1SYKA 4QOXA 3FWQA 4MQ1A 5ANEA 5HBHA 5K5NA 3E64A 5H8GA 4OW8A 3BEGA 4O0UA 5CSVA 4TWPA 5ACBC 4O7TA 3F3UA 3P0MA 4MTAA 4IBMA 2XVDA 3CE3A 4ACHA 1Q8ZA 5BMSA 2AUHA 2PVYA 4FTRA 3Q4ZA 4ZS0A 3DAEA 4P7EA 5K3YA 3HDNA 4YC3A 4I92A 3GCSA 4EHGA 4EORA 2JIUA 4H3PA 4NTTA 4AGDA 3OS3A 2RFDA 2E9UA 3DJ6A 4B8MA 5D1JA 4DEAA 3BU3A 3SOCA 2B1PA 4GSBA 3UQGA 3QUDA 3R63A 5GINE 1XKKA 4MD9E 5HTCA 4BZNA 3FZPA 2BRMA 5HG7A 5CF5A 4TL0A 3MB7A 4I0TA 4JVGA 3TXOA 2Q0NA 3VW8A 4ZY5A 2P33A 3R9HA 3UOHA 2C68A 4A4OA 5I9ZA 3MESA 3VC4A 5JMSA 5KMOA 3W0NA 3MN3A 4FV8A 3NMUF 3ZRLA 2OKRA 4XV9A 3POOA 3LPBA 1RW8A 4APPA 3FY0A 4FC0A 3LOKA 4RBLA 5JH6A 3NRMA 4DCAA 3W0SA 4EOPA 4FSMA 3H9FA 2C0TA 5J7HA 5CT0A 2IVVA 4FV2A 4GG5A 2R64A 2A19B 2CSNA 2VTLA 4D5KA 1REJA 4E20A 5JK3A 3C4XA 2IZUA 5ANDA 2EUFB 3IW6A 3QCQA 4LG4A 5FDXA 3LLTA 1MRUA 5FM2A 2CKPA 2QURA 1FMOE 3B8QA 5AV0A 1E1VA 3UOJA 4C4HA 5CX9A 4UY9A 3PG3A 2W4KA 4O0RA 4PL5A 1CTPE 1KE9A 5DR2A 3DTCA 4JRVA 4L01A 4K1BA 3UVQA 3V5WA 1K9AA 1UKHA 3V5LA 3CBLA 4YU2A 4IAFA 3EFWA 3EKKA 4JNWA 5AP7A 4AGUA 2JFLA 5L8JA 1JSUA 3RPYA 4EH3A 2ERZE 3VRYA 4KINA 4MWHA 1KOAA 4E26A 2JEDA 5DR6A 2X2KA 1JKSA 3CQEA 5CNOA 3S1HA 3N4VA 2WMQA 2X81A 4Q5EA 3COKA 3EFLA 4LOQA 5E4HA 3NEWA 3WZKA 4ANSA 1G3NA 1H8FA 4IE9A 4X6QC 4IAKA 3MIYA 4EJ7A 3IDBA 3KMWA 1LPUA 2QCSA 4WNKA 3CTHA 2X4ZA 3QX4A 4ZTMA 1Q41A 2B9HA 4IWPA 4WIHA 2WELA 2O5KA 3UBDA 1SZMA 4AGCA 5E8TA 4U0IA 3D83A 3MFUA 2YM4A 1QPDA 3L9LA 3HRCA 4YHTA 4F1MA 3BCEA 1IA8A 1QCFA 3QLGA 3W0QA 4CT2A 2Z7QA 4EKKA 4Z7GA 1BYGA 3DQXA 5DG5A 3LQ5A 4O21A 3F7ZA 3FHIA 3GNIB 2W1FA 3QFVA 4IX6A 4CFNA 3FL4A 5FP6A 4IQ6A 4ACDA 3CR0A 4DGNA 1YXVA 2ITVA 3DZOA 2BIKB 3HV5A 3THBA 4DH8A 5BUIA 4KBKA 3A61A 1OL2A 2JC6A 2W1CA 4RJ4A 4WKQA 4O27B 4HNIA 5CXHA 3U87A 2P2IA 3PIYA 2BZKB 4RX7A 4YZBA 3MA3A 4NSTA 2XIRA 4I41A 4X3FB 4P5ZA 4YC6A 4G3DA 2FGIA 4BTKA 1O9UA 5CXZA 4FIFA 5JGAA 3PPZA 3GBZA 4JDKA 4ZOGA 5HHWA 1YI3A 2WD1A 1Z5MA 4FTJA 1M2QA 3FZOA 5EHOA 3C4FA 4G1WA 1TQIA 3D15A 3FXWA 3QCYA 3ENHA 5DIAA 3NIEA 2J9MA 4NKSA 3REPA 3TV6A 5CF6A 4TYIA 4RJ7A 3D2IA 4PMSA 5A4EA 4JRNA 4U79A 5AUTA 2BDFA 2YDKA 4YTHA 4YLKA 4C58A 4DFUA 5HU3A 2C6TA 2B53A 4ALVA 3NZ0A 4BGHA 3ZRKA 4B6LA 3ZRMA 5KNJA 4UN0C 4W4VA 2P0CA 3O8TA 1XH9A 2EB3A 3OROA 2LAVA 3VUGA 3Q5IA 2OIDA 4XJ0A 5J1WA 3W55A 4AUAA 1O6KA 4X2KA 2XUUA 3W2OA 1HOWA 1ZMWA 4QTEA 3EHAA 4CG8A 3SOAA 2YM3A 4HVDA 5KMKA 1Q62A 4F64A 2GQRA 2BRBA 3V3VA 4BDKA 3QF9A 3LAUA 3UIUA 4J97A 3DCVA 5BVNA 3F9NA 1GJOA 4FZAB 3U51A 3G15A 4EH5A 4XV3A 2FSOX 2OZAA 2WMSA 5A3XA 2PUIA 4EKLA 4YMJA 1YKRA 4DITA 2EXMA 3EQRA 5EW8A 3OF0A 4X6RA 3VBYA 3FZTA 5KMMA 3EQFA 3FE3A 5ITAA 2ITXA 2B9JA 1KE5A 4FIHA 5EQPA 3K3IA 4RVLA 3C0HA 2CKOA 1ZRZA 4LL5A 3I5ZA 3V51A 3EQBA 4AN3A 1RQQA 3ACKA 4FKOA 2BUJA 3VBQA 4TPTA 2SRCA 3W33A 3OWKA 2HK5A 4V05A 2QOOA 4NFMA 2NPQA 4ZSGA 4F1TA 5GNKA 3PP1A 4KKHA 4J8MA 5L6PA 3R22A 1GIIA 2UV2A 3CD8A 5EFQA 3D14A 2GFCA 3P7CA 4DEBA 4G31A 2QLUA 3PZHA 4R6VA 2BKKA 3RAWA 2JAVA 1LR4A 3IW8A 5HEZA 3PSBA 3U6IA 1JPAA 1OM1A 3C4ZA 3UJGA 2F7XE 3SAYA 2I0HA 3NUYA 4GU9A 4KBCA 4CNHA 2I0VA 4RIXA 5L3AA 4MK0A 4ONAA 5D12A 4CFVA 5JT2A 4KBAA 5A4CA 4JXFA 5LCKA 2CHLA 2ZAZA 2GNFA 2OZOA 4XRLA 3BYUA 3RM7A 1KOBA 1UNGA 3TT0A 3ZBXA 3ROYA 5AIRA 2YIXA 3MW1A 4I24A 1YDRE 4EL9A 3VHKA 4K6ZA 1JLUE 4HPTE 4FA2A 3KGAA 5CU3A 3R0TA 4J71A 3HGKA 3EN6A 3PFQA 3B8RA 3CEKA 3NW6A 3FKOA 2UW6A 1H4LA 4FG7A 3NDMA 1UU7A 3IW7A 2R3FA 1H00A 4S30A 2WTKB 3P86A 4W4YA 1J7LA 4IW0A 2JKKA 3O71A 4YJPA 5G6VA 4ENYA 1ZYCA 4R3PA 4RWJA 4EOKA 4AGWA 3OTUA 3IGGA 4R3RA 3AGLA 2VZ6A 3AXWA 3MJ1A 2IJMA 4IMYA 3E87A 4H1MA 3RHKA 2VWVA 3JY0A 4I4FA 4IVDA 4AT4A 4BIDA 1WBVA 3DJ5A 3EH9A 2OBJA 3FY2A 1M7QA 4DH5A 3FMNA 3CD3A 1GZ8A 4G34A 4H1JA 2VTAA 3EJ1A 1M52A 2PVFA 3AC8A 4M69B 4PDPA 4MAOA 3FXXA 3G0FA 4C62A 4MXZA 5CQWA 2UW8A 3KXMA 3LJ2A 3TKHA 4EK8A 4D55A 3KU2A 4O7WA 2GCDA 4KUJA 4JR7A 4MNEA 4U9AA 3MI9A 4K2RA 4QMPA 5IH5A 4BDJA 4USDA 3R8PA 4S34A 3II5A 4G3EA 1OL6A 3HV7A 5EH0A 4FEWA 3E5AA 4II5A 4AZWA 1CKPA 2X9FA 4EBWA 1OZ1A 3IK3A 5HBEA 1ERKA 3VUMA 4O38A 5FEQA 4Y8DA 1BLXA 2WHBA 4P5QA 3VBVA 3BELA 3U6HA 1SVEA 2J51A 3O51A 4S31A 3UC3A 2CDZA 4DEIA 4EH9A 4YGAA 5IZFA 5EHLA 3QD0A 3GCVA 3VS1A 2Y6OA 5CAQA 4QMVA 4K33A 3QKMA 4NZWB 4JAJA 4F7JA 4B0GA 2PMNX 2WU6A 4JDIA 5HE3A 4LRKA 5FUTA 5CVGA 3SDJA 5FXQA 5AFVA 5BVKA 3DDQA 4DF3A 2J0LA 2YACA 2C69A 3NWWA 3UMXA 3ZXTA 1OKWA 4IEBA 4OTHA 1W0XC 3L8PA 2YDJA 4AWIA 4GK3A 3Q9WA 2YHVA 2QONA 2DS1A 2GS2A 4O91A 2C4GA 3OW4A 4U5JA 3SG9A 1KE6A 2YM8A 3OEZA 3IONA 4CMTA 5M56A 3GQIA 5HLWA 5LVMA 4XNEA 4XG4A 3V5TA 3PXKA 2PUNA 2I7QA 4M0YA 3BZ3A 3ZO3A 3QQKA 3ALNA 5AJQA 4JIKA 4WSYA 3GC8A 3K54A 4AAAA 4BBFA 3HV3A 4ITJA 4QQJA 4LOOA 5C01A 3I0OA 4FVRA 4YURA 5C8KA 1UU8A 4QYEA 5HESA 2VTMA 1UWJA 3F2RA 4GYIA 1UA2A 3N9XA 3P79A 4BC6A 3PY3A 5FEDA 2GHMA 3CQUA 1LEZA 4IAAA 3K5UA 3P23A 4JR3A 4M14A 3ZMMA 4R77A 2XA4A 5J8IA 2JBOA 4NYEA 5L6WL 5LARA 4Z3VA 2QD9A 2YA9A 1VZOA 3EFKA 5AMNA 2W05A 2JKOA 2H8HA 4I3ZA 4RSSA 1W84A 3H30A 3EQDA 2YJSA 3KF7A 3PSCA 5D7VA 4ENXA 4I22A 4PDYA 4FBXA 3W32A 4B8LA 3PJ3A 4HW7A 4TYHB 2XEZA 3EL7A 3AC1A 4CMUA 3RPVA 4FSQA 4LMUA 4MHAA 2PE0A 3I79A 2JDOA 2XNPA 4F09A 3PE1A 4TWCA 5HGIA 5IU2A 4FTOA 4XBRA 1GZNA 1PXMA 1SM2A 3O7LD 4L43A 3PRIA 4WRGA 3GOPA 4RX8A 4E6AA 2QOLA 5ACKA 5CASA 4DFXE 1JVPP 1WVYA 4YTIA 3QRTA 3SX9A 4CEGA 2QHNA 1U4DA 4AW2A 5HKMA 4FV1A 4Y5QA 2ITPA 2JGZA 4UALA 4BDFA 5FG8A 4BDAA 4G16A 4C38A 1OUYA 2R3GA 3ET7A 3NYNA 3DA6A 4ZS4A 4PL4A 4TNDA 3RZBA 4R5YA 4EK3A 4CV8A 2O63A 4KIPA 5J87A 3COHA 3BU5A 4V0GB 3DGKA 4HVIA 3L9MA 3FMJA 4XG7A 5CSHA 3LW0A 2YWPA 3WIGA 3SHEA 1FGIA 2QKWB 2B52A 3DTWA 3HDMA 3LCDA 3VS3A 2J7TA 2VTPA 2HW6A 5CVFA 4NUSA 4DTBA 1H28A 3FMHA 3LFEA 5HG8A 4CKIA 1KV1A 5IF1A 4HJOA 2G01A 2C5NA 3R00A 4JLCA 3BV2A 1DM2A 3F3VA 2XYUA 3FSKA 2IN6A 4XG2A 1GZOA 3Q9YA 2QOIA 4L00A 3GUBA 1UKIA 3C5IA 5EW9A 3R8MA 3RK7A 4BCKA 2J5FA 1R39A 2RIOA 3CS9A 4O2PA 3DK7A 4F65A 4X2NA 1P2AA 3D4QA 3GVUA 4BCGA 4JDHA 2W96B 4DGGA 3ORTA 4S2ZA 2WB8A 4YZDA 3QQJA 1YHSA 3JYAA 3NS9A 3OUKA 4ZTSA 3ZEPA 1YWNA 4C36A 5M09A 2F2UA 2W1EA 3OBGA 4RLKA 4F0FA 3WE8A 4R5SA 4FKGA 4ZIMA 3WI6A 4U3ZA 1FQ1B 2JIVA 4TWOA 4BICA 3I7BA 1XH8A 2FSMX 3L1SA 5FLFA 5LVLA 4ZZMA 1R78A 2W4JA 3JY9A 5CU6A 5FGKA 5M4FA 3S95A 4EOQA 5I4NA 5IQEA 3HP5A 4KIQA 3QYWA 2UZUE 1VJYA 2J50A 2C5XA 4ZTNA 1OMWA 2V7OA 4QP4A 5EM7A 4I0RA 3WF7A 2DYLA 3Q4UA 2VO7A 3RPRA 4FIIA 3W10A 2G2IA 5CEOA 5TOZA 4FTTA 2YCFA 1OVEA 4GK2A 1PXPA 4QNAA 2GS6A 4QPAA 4U45A 1FVTA 2G1TA 3KRXA 4YJNA 3PDTA 5F95A 2RGPA 4ZY6A 4ZJIA 2UZNA 1H0WA 3HMPA 3VIDA 4C02A 4QMQA 5AX3A 2ETRA 3GU7A 2XIXA 5IMEA 3IECA 5CI6A 1V1KA 4N6ZA 5EYKA 4BCOA 5E9EA 5DWRA 2H96A 3S00A 3FL5A 4I6BA 5D7AA 3KRWA 4EH8A 4BCQA 2WXVA 2WIPA 1P4FA 3P5KA 4ZP5A 2VRXA 3DBFA 3EN7A 5D11A 2Q83A 4CG9A 5AIKA 4BDBA 5C4LA 4Z9LA 4IZ7A 4QQCA 1Q3DA 3EQPA 3SC1A 3C50A 3BWJA 2XIYA 4I5PA 4E4MA 2V62A 4Z7HA 3KFAA 3FBVA 3ZTXA 3ACJA 3PJ2A 3BHHA 3F69A 3FLSA 1XH5A 3AGMA 3EMGA 2QO7A 3OCSA 3OOGA 5LOHA 3PRFA 5FEEA 4PTGA 5TT7A 3R8VA 4XP2A 3UG2A 3WARA 2R3PA 4I0SA 4HYSA 5CENA 4GFMA 4HZRA 5IUHA 4E5WA 2YIQA 5AP0A 4QMLA 4EHEA 2QO2A 2E2BA 4XOZA 2ETMA 5KO1A 2PE2A 3FSFA 1QL6A 1KUTA 1OI9A 1JKTA 2W1ZA 3C4EA 3KMUA 3MDYA 4A07A 4DBNA 3UZTA 4QMMA 4I4EA 4FTUA 2ESMA 4IIRA 4LL0A 4YHJA 2RG5A 5CEIA 4FNYA 2GU8A 4L3PA 3EKNA 2NP8A 3LHJA 5LWNA 2XM9A 5EM5A 3ANRA 4DEDA 5KMNA 4FEVA 2IZSA 3A2CA 5BVEA 2FH9A 2HXQA
chains in the Genus database with same CATH superfamily
1ZXEA 5AX9A 4QP6A 2PWLA 4UX9A 3R71A 2XM8A 3PIZA 4FSNA 4OLIA 5DOSA 5AM7A 4D1XA 4JG8A 5HNGA 5DA3A 3PY0A 4FV7A 4RIOA 4C35A 3DJ7A 4O7OA 2VGPA 4AQCA 2X1NA 2W4OA 2WMWA 3G2FA 2QVSE 4H3QA 4NT4A 1FVRA 3R9OA 4CFMA 5IA3A 3DNDA 4UXLA 4NKAA 3CTJA 2CPKE 4HCTA 4NW6A 5IMXA 1H07A 3VQUA 4FZ7A 4U43A 1QPCA 1Q8WA 2XAOA 3COMA 4HVGA 4D5HA 3U9NA 2IW6A 1J1CA 3SA0A 2IVTA 1ZZ2A 4O0XA 5EYDA 5HE2A 4FYOA 2W9ZB 4LMNA 4EOLA 2C1AA 4ASEA 5EOLA 3FPMA 2YCQA 4FICA 3SXRA 4LI5A 3QC4A 3NGAA 4WG5A 4D2SA 3EYHA 3OVVA 4FIGA 3P7AA 1CMKE 3MTLA 4FTLA 1SNUA 4FL2A 3HMIA 3HUCA 4LV8A 5DEWA 4A4LA 4BJJB 4DTAA 2BILB 3AD4A 3DK6A 2C3LA 3PJCA 4LGGA 3S4QA 3QXOA 3TZ7A 4YUQA 3BKBA 4EQMA 3UNKA 2CCIA 3R1YA 3R1QA 2GTMA 4E6CA 4F9AA 3HZTA 2PTKA 3R04A 4O81A 3ZEWA 4KIOA 3BWFA 4LRJA 5IUGA 3AOXA 2VNYA 2YERA 2XF0A 3G6HA 2Y9QA 4GKHA 4AG8A 3TUCA 4FV0A 4IX3A 2XNBA 4IZAA 5B0XA 4BZDA 4DGLC 3LFBA 2UW3A 1G8AA 4XUFA 1XO2B 4FKJA 3RPSA 3W8QA 4PV0A 5I0BA 2DQ7X 2XH5A 2Y0AA 4GU6A 4AZFA 3KXXA 1A06A 4LQMA 3D7TB 1VR2A 3WF5A 4CCBA 5AA8A 4DLIA 5BVFA 3D9VA 3VWAA 4A9RA 1J91A 3I1AA 3EQHA 1Q8TA 2X2LA 3FI4A 3QXPA 2A27A 3MVJA 4OTGA 2QG7A 2I40A 1YHVA 4C3RA 4WRSA 3R6XA 5IA5A 5HNBA 3SXSA 3N4TA 4IC8A 3QD4A 4J95A 3OD6X 2P55A 4FSRA 1IR3A 1OL7A 2C6KA 3G9NA 4JX3A 5HIDA 3SRVA 1UU9A 4ALUA 2PPQA 4ZLZA 5HX8A 3E8DA 5J5SA 5GIPE 3FEGA 2CCHA 2WKMA 4MCVA 4C0TA 3LMGA 4YTCA 3ZFYA 1NXKA 3UPZA 5BYYA 3ZUTA 2C6DA 3DXNA 1CKJA 2ZV7A 5FM3A 2O65A 2UZWE 3V8SA 4E93A 4ZLOA 3TMOA 3ZHPC 3L9PA 4EUTA 4CTCA 4D4YA 5KMIA 3KL8A 3NYVA 3W1FA 1V0OA 2ITTA 3GU8A 4GL9A 4FT0A 4RGJA 5E8ZA 4FI1A 4LM5A 1AGWA 4PRJA 4PWNA 3TKUA 4AZVA 4K18A 4BHNA 4KKEA 5FP5A 2Z02A 2UZBA 2VO6A 3LQ8A 4IVBA 4ZK5A 4F9YA 3CIKA 3BRBA 5ETIA 4XG3A 4F6WA 5F9EA 3F5XA 3HAVA 3E63A 3R9NA 3NR9A 5A6NA 3WF9A 3C0IA 3F3TA 4J8NA 4K0YA 4ZXTA 5JRSA 3ZFMA 4CZTA 4RQVA 4FSYA 5F1ZA 3DAKA 3UIMA 4QMXA 4HOKA 1IAHA 3LCOA 4PTEA 1YOMA 5BYZA 4D4VA 5HD4A 1VYWA 3FC2A 1YW2A 4IVAA 5L2SA 4DHZA 4UZHA 4JQEA 4L46A 1ZLTA 3VUDA 3D94A 5CS6A 2ZB0A 2XNMA 5L2TA 2VX0A 2XS0A 3DS6A 3MGYA 2WTCA 3E62A 2WPAA 4LV7A 2OXDA 2X8IA 4I6FA 4OTDA 3ZM9A 2PZRA 1F3MC 4EBVA 1YI4A 3I6WA 4JX7A 3ZDUA 5AV2A 1PMNA 3PXRA 3SKCA 3VVHA 3ORLA 4IB5A 4U97A 1H1SA 3UTOA 5CAUA 5FDPA 3IDPA 2W1IA 1URCA 2W5AA 3KMMA 3RNIA 3MPTA 4IB0A 4W8DA 4G9RA 4WNMA 2UW0A 3RTPA 5CVHA 4M13A 4LOPA 2GDOA 4HGTA 1ZMVA 2VO0A 3BYSA 4YBKA 1M2RA 1PKGA 3GEQA 4OGRA 4QMSA 4I5CA 2BHHA 4YNOA 3ZC6A 4ASXA 3U6JA 1LP4A 4PX6A 3O0GA 5AV4A 5LVOA 3ANQA 3G0EA 4XHKB 2QOBA 5ETFA 2BRHA 2C0OA 4R78A 4GIIA 5DT3A 4TT7A 1V0BA 3T8OA 1L8TA 1FBNA 2VTSA 1T45A 3RVGA 4H05A 4I20A 2PVRA 1H08A 1QPEA 4G17A 3TM0A 3NW7A 3R7VA 2HY0A 4C34A 2JDSA 2HIWA 2YCRA 4DDIA 4RIWA 1F0QA 1PRYA 2OO8X 2KULA 2R0IA 4XCUA 4EK6A 4NL0A 3GT8A 4A9TA 2RF9A 4Q9ZA 2XZSA 4FSWA 3A62A 3PJ8A 4QP1A 4R7IA 4U81A 4C4GA 2ERKA 4M67A 4BCJA 2IW9A 4XX9A 4RMZA 3AC5A 4Y72A 4Y83A 1X8BA 3JVRA 4FKVA 3T3UA 4ACGA 3I6UA 2WQEA 3F3ZA 3NNVA 4AE9A 1Y6BA 4TZRA 4OBQA 3HECA 4IADA 3WOWA 5HVYA 3SD0A 4FUXA 1Q99A 3ITZA 3NUAA 2HELA 5CYIA 5DYJA 4ACMA 4FGRA 4QTDA 1M2PA 3R2YA 4Z16A 2JITA 3S3IA 1BI7A 3HNGA 3OHTA 4U7ZA 3DNEA 2O64A 5KKRC 4C33A 4QYGA 3R9RA 2X9EA 4FSTA 4GT4A 4Y46A 5C4KA 3VF8A 3UZRA 4FL1A 4XOYA 4JG7A 4GVJA 4AA5A 4ASZA 4ZY4A 3IO7A 3QGYA 4WA9A 1SMHA 3IG7A 2J2IB 2OW3A 5J95A 3FI3A 1GIJA 2JAMA 2Z2WA 3HMMA 3I5NA 3RCJA 3F88A 3LFDA 1JBPE 3ML1A 4WOVA 4WUNA 3OT3A 4RRVA 5DNRA 5EDQA 2R7IA 3BBTB 2W0JA 1W83A 2W99B 3NFFB 3BQRA 5T3QA 3F5UA 2UW5A 5E8SA 1ZY5A 3ZONA 5AP3A 2PVHA 2UVXA 2G2FA 5EDRA 3UO4A 3NPCA 2X7OA 3OY1A 4IB3A 4WHZA 4M12A 4RJ6A 4GH2A 4GJ2A 5LWMA 4GIHA 2R5TA 2XB7A 1PHKA 4RX9A 4DEGA 5DH3A 3PXZA 5EM6A 3E8EA 3W16A 3Q9XA 2QC6A 2R2PA 2AC3A 3ORXA 5A9UA 3PVWA 3PP0A 4TRLA 4AXCA 4OR5A 4KA3A 4H3BA 3ZS5A 4RIYB 3BEAA 1OUKA 3BE9A 3MFTA 4B4LA 4MNEB 3UOKA 2FSLX 2R7BA 5JGDA 4BTJA 2JDVA 1H27A 3BQCA 4NJDA 2WIHA 4O0VA 4L52A 3I0QA 3Q52A 5IEVA 4DFNA 3I60A 4JS8A 3BLRA 2CNQA 3FC1X 3LCSA 3MY5A 3KK8A 4NCTA 4DHIB 1WAKA 5L8KA 1RE8A 4G6LA 4A9SA 1ZY4A 5DT0A 1R0EA 3Q4TA 4BCPA 3TI1A 1M14A 4L3LA 4XEYA 3K5VA 3LFAA 5LVPA 3CP9A 3BHYA 4BI0A 2HZ0A 4ZZNA 5AV1A 4BR3A 4G3CA 4U42A 4D2RA 1FGKA 4RC3A 2ZMDA 5I9UA 4N6YA 4TW9A 2QOHA 4QMTA 3TIYA 4P4CA 1PXLA 3BHTA 2NO3A 3ORKA 2QOCA 3D5VA 5BX0A 4FEQA 3POZA 1WBOA 3EYGA 4PUZA 4F0GA 2GHGA 5EI2A 3BLHA 3F5PA 4BRXA 5HZNA 4TYJA 2QR7A 3W2SA 3GXLA 4FX3A 3KULA 5C8MA 3ZDIA 3EN9A 2FA2A 1URWA 2WQOA 4KS8A 3RK5A 5GIOE 3CSVA 1OKVA 3HLLA 4FE2A 4GYGA 2R4BA 5FQDC 2PK9A 4FV5A 3W2PA 2J0MB 4RA4A 4AZTA 4C61A 2Z60A 3RJCA 1RJBA 3MY0A 4C37A 4R7BA 3OBJA 3R83A 3DKFA 5CY3A 5M53A 1WBSA 1RDQE 5IEXA 2RFNA 4M68A 2JD5A 5HI2A 2G15A 3ETAA 2UW4A 3DDPA 3Q53A 4BBMA 5IA1A 2QODA 2C3IB 4I6QA 5DFPA 5HE0A 3ZLXA 3KK9A 4IB1A 4BI1A 4IX5A 4FVPA 3Q60A 4UWBA 2HENA 4FNWA 5I9VA 2ZDTA 3QTUA 2O2UA 4BKJA 5AEPA 2CGXA 3OZ6A 5LCJA 3NVKI 3CCNA 3DKCA 4PMPA 3L8SA 1U5RA 5HQ0A 3D0EA 4NU1A 5CEMA 5L2WA 1SVHA 3QX2A 1PMVA 3P9JA 1JKLA 2B7AA 4I5HA 3IS5A 4YO6A 2QQ7A 2Z8CA 4HYIA 3PSDA 2F49A 4FG8A 4CFFA 4TTHB 5HORA 4BIEA 3VQHA 3VS6A 3R21A 5FTQA 1MRYA 4MH7A 4MXXA 5EK7A 3PPKA 1H24A 2J0KA 4OTFA 3R7EA 4L45A 2R3KA 1YXSA 3PLSA 3TTIA 1JNKA 2F2CB 4F0IA 2UZVA 3A4PA 4FKRA 3QAME 3OC1A 5KE0A 1JSTA 4TYEA 2ZFYA 1XJDA 2WAJA 1M17A 3OT8A 2XCKA 1PF8A 3NAYA 5KCVA 3OCBA 5C27A 4WUAA 4O22A 3QZGA 4WBBB 4E8AA 5A6OA 2A0CX 3MVMA 4BVUA 2OH4A 3TJDA 3AKKA 3HA6A 4RVMA 4EONA 3GU4A 4YLJA 4CD0A 5AP6A 3EZVA 4D9UA 3RALA 3QLFA 4ERKA 2WMBA 3ZUVA 4WT6A 1IEPA 5E7RA 5CSPA 3KA0A 3ODYX 4I5MA 4JQ7A 4YZ9A 4L6QA 3LMIA 2YZAA 4F7NA 4NW5A 2R3RA 1H1RA 1IA9A 4XG9A 4EWQA 4PY1A 2OFVA 2YISA 4EWHA 4O7YA 1REKA 1WBPA 3NNXA 4QRCA 3RINA 4AN9A 1EH4A 4WG3A 1OGYA 3QA0A 4D1ZA 3F3WA 4FV9A 2Y8OA 4A06A 2JBPA 3DB6A 2OJ9A 1MRVA 4KWPA 4L7FA 3RCDA 3DFCB 3UG1A 4MXCA 3H9RA 3AMAA 3MA6A 4L44A 2AYPA 4O7RA 5LJJA 3O2MA 3DXQA 3EIDA 2YIRA 2O8YA 5CAPA 1R1WA 3TZ9A 3DT1A 4BDDA 3CGOA 1OITA 2CLQA 3TWJA 3W2CA 4FODA 4AP7A 2R3OA 3CKXA 4IAIA 4IZ5A 4CT1A 4XYFA 4DGMA 3NX8A 2HZIA 3VUHA 4DHFA 3IQ7A 3FLYA 2C6IA 2YIYA 4PDOA 4AFJA 4HPUE 4ASDA 2X7GA 5CF4A 5BVOA 4PNKA 3O50A 3QD2B 4IH8A 1YI6A 4ZTHA 5HIEA 4FZFB 5E92A 3C51A 3LCKA 4F1OA 4KAOA 4RZWA 3VBTA 5DBXA 1JQHA 3IGOA 2C1BA 2EWAA 2OJJA 3BYOA 2ITOA 4N4SA 4BDHA 2O0UA 1PMEA 4MD8E 4L9IA 4KRDA 5GJDA 5FXSA 4RFZA 3F2AA 3M11A 1Z9XA 2ITZA 3HYHA 1UU3A 3FZRA 4E4NA 3VBXA 2Y7JA 2ZDUA 3QL8A 3EN5A 2FYSA 3U54A 2PZPA 2A4LA 3WYYA 4FSZA 4AT5A 4DYMA 5I9XA 2VWXA 2UUEA 2ZB1A 3Q3BA 3W2RA 4OBPA 3NCZA 4GKIA 2PMIA 4ZTRA 2B55A 5JQ5A 5HD7A 2WQMA 3NUXA 3ODZX 4FTCA 4O7ZA 5EDPA 2CGUA 3SW7A 3GC7A 3NUPA 4M84A 2BR1A 4K77A 4O7NA 2BTRA 4FTNA 1JWHA 2PSQA 1UVRA 4IFCA 4MBLA 1G8SA 5DGZA 2NNWB 4EZ5A 4FNZA 5BMMA 5M07A 4GEOA 4NTSA 3NNWA 5E8WA 4PMMA 4FTKA 5HVKA 5KBRA 5E8YA 4FK3A 2OWBA 2VX3A 3AKLA 4XP3A 3W8LA 4BDCA 2IG7A 4BY9E 3PXFA 2R3NA 2JKMA 3KEXA 3RHXA 1W98A 3HAMA 1UNLA 2XRUA 3OWPA 1ZAOA 2NRYA 1XHAA 3CPCA 3QRUA 3OCTA 4YSJA 4BF2A 3RWPA 4WNPA 2CGVA 3LFFA 4AU8A 1MUOA 4DBXA 3PZEA 1H1WA 4DC2A 5K4IA 3TUBA 3OTVA 3EL8A 3O8UA 4OTQA 1OGUA 1T46A 1B6CB 3IKAA 4U44A 3VS5A 4M7IA 5JRQA 4EZ3A 2J5EA 3F82A 2E9OA 2HZNA 2WTDA 2XIZA 3PA4A 4UB7A 1CDKA 3TV7A 4E5BA 3TNPC 3PXQA 3VHEA 4DT9A 1YQJA 3MS9A 1PXKA 1YDTE 4XBUA 1NVSA 5AAFA 4FT5A 4NCTC 4NM5A 4C59A 3PE2A 3AG9A 2BAJA 5A4QA 3UZPA 4WG4A 4AXAA 4GRBA 2OF2A 2X2MA 4R3CA 1H01A 2JKQA 2LGCA 4GMYA 3K3JA 2ZM1A 2PUUA 2J6MA 4X7QA 5IG1A 3FMMA 4FEUA 5AM6A 4I6LA 4C3FA 4QMYA 3OY3A 3DLZA 1P14A 1L3RE 5B2LA 2UW7A 3F6XA 3HV4A 2XANA 2HWOA 3OP5A 3BPRA 3KRJA 3FYKX 3QQUA 4QYYA 2OFUA 4Y85A 4M8TA 4D9TA 5DR9A 1OPLA 3NYXA 1ATPE 1PJKA 1WCCA 3QQGA 2OJGA 3HRBA 4X21A 5A14A 5L6OA 1WVXA 1W8CA 3DKOA 4XS2A 5HLPA 3VF9A 3U8WA 2Y6MA 2XKCA 4AOTA 4EJNA 2Y4PA 1ZYDA 2ZV8A 4AZSA 2YABA 4B7TA 2CLXA 2PY3A 3EN4A 4EQCA 3LVPA 5M06A 4QYFA 4E73A 4YZCA 3OW3A 2VTIA 1Q24A 3QTXA 1U54A 4FG9A 4YJUA 5AUVA 5CEQA 4O7PA 4XG8A 3V5JA 4C2WA 4C7TA 4FOCA 5B7VA 3NAXA 3SW4A 3EWHA 5B2MA 5HCZA 3EQGA 2VUWA 3D5XA 5CU4A 2R3IA 2V0DA 5LMBA 5AUXA 5CEKA 3KN6A 4IHPA 3RAIA 3RMFA 3FLNC 5IQIA 2GQGA 2G2HA 3ATSA 4AXEA 4AX8A 3ATTA 3GFWA 4GJ3A 4BCIA 4RQKA 4EK5A 2I6LA 4FSUA 4HGLA 3QWKA 1OIUA 4NK9A 1J7UA 3OXTA 4MF1A 4O84A 4QT1A 2YJRA 4NJ3A 4R7HA 4X2JA 2XJ1A 3AKJA 4FV3A 3SV0A 4AFEA 2PVJA 2Z7RA 4WD5A 1YXUA 4L42A 5JFSA 3NW5A 4O7VA 5M08A 4BN1A 3LJ0A 3QZHA 3FKLA 4Y5HA 2P4IA 4FV6A 2XNOA 4D58A 1G8JA 4QP7A 1BKXA 3A4OX 4PDSA 2BAQA 2GS7A 3T9IA 5A54A 1IRKA 2C6EA 3V6SA 4E4LA 5JQ8A 3DOGA 4YP8A 3LJ1A 5M44A 2C3KA 4S32A 4KB8A 2XCHA 4GT5A 4W4WA 3CKWA 4JDJA 1DI9A 3S2PA 2UZOA 3UE4A 4FNXA 2JFMA 3UP7A 4JBQA 1A9UA 2B9FA 2W9FB 3R73A 3MPAA 2Y4IC 3PWYA 4O83A 1ZMUA 3KC3A 1Y57A 5ANGA 2VWBA 4BZOA 2BTSA 3UPXA 2FSTX 4OUCA 3KXHA 3MBLA 4DH1A 1OKYA 4HNFA 4DGOA 5AA9A 4X2FA 2VTQA 4UBAA 4EH6A 3U9CA 4QP8A 2J0IA 3OWJA 2P3GX 4JI9A 4CFWA 4FJVA 3SGCA 2W7XA 3RM6A 3A8WA 5BVWA 5HBJA 5M4IA 5M57A 2ZV9A 3LM5A 3FKNA 1ZYJA 5CU0A 2WTVA 2YCSA 4QP3A 3FLZA 4MNFA 3WZJA 4CKJA 4BDIA 3IPHA 3PLAE 5KKRB 3GCQA 4DAWA 3BYVA 2PZYA 4F9CA 1YWVA 4F7SA 4O96A 2W5BA 4JBOA 3DPKA 2R3MA 3MVHA 3ZSGA 2VTHA 2GNHA 5FRIA 4ZSJA 2PVLA 5CANA 1BMKA 4UV0A 3ORMA 4TYHA 1BI8A 1S9IA 4EOOA 1VLRA 2HY81 2VX1A 3KKVA 4RC4A 4F6SA 3HUBA 2BRNA 2XJ0A 3DBDA 3TNQB 3NSZA 4EQUA 2W1HA 3FQHA 4N70A 4O2ZA 3H0ZA 2X8DA 3PJ1A 4E4XA 3A7HA 1ZOGA 5CLPA 3W0RA 1GOLA 3QTIA 3WZDA 3UNJA 4RA5A 4PP9A 2EXCX 1JOWB 5F94A 2BZIB 2PULA 4B99A 2H34A 3JS2A 4EH4A 4YJQA 4ZLYA 2OICA 3R2BA 3RKBA 5E91A 4G2FA 1ST4A 5AP4A 4LFIA 3L9NA 4FKPA 4C4FA 2XRWA 5E1SA 4HYHA 3O96A 4ANQA 3WF8A 3O8PA 2C5YA 1R3CA 4GK4A 5ANIA 3UO5A 4FVQA 4RFMA 5C9CA 4BIBA 2XK4A 3OUNB 3V5PA 3LQ3A 4UEUA 2AEGA 3M42A 4FT3A 5IDPA 5CZHA 3AC3A 4V0GA 1FPUA 4BCNA 3A8XA 5EYCA 4AF3A 4CTBA 2C0IA 3KVWA 4K8AA 2YM7A 3R28A 3FHRA 1YHWA 4D4SA 4YJVA 3KREA 4NM3A 4C4IA 2GFSA 4J53A 5IA4A 5BUEA 5L2IA 2GTNA 2J0JA 3BL7A 3KXGA 4TN6A 5K4JA 5CI7A 1YXTA 4ALWA 3VUKA 5EHYA 5A4LA 4MWIA 2V55A 4ZSAA 3CXWA 1IG1A 3KRRA 2BKZA 4YPDA 3W0PA 5T68A 4P2KA 1OIQA 2QU6A 4I1ZA 4FTIA 1BUHA 5DPVA 3UDSA 2GNLA 4QMUA 1U59A 2XYNA 3DBCA 4H36A 4JT3A 4AXDA 4UXQA 4CVAA 3QTRA 2QHMA 5I9WA 4RWKA 3E7OA 4HVSA 5I5ZA 3G5DA 2GQSA 1XH4A 4WBOA 2ETKA 3KB7A 4KNBA 3O5AA 5CEPA 3LZBA 2FO0A 3NNUA 4U98A 3ERKA 3U55A 1OL1A 3C1XA 4MD7E 2IVUA 5CT7A 2BZHB 4ZSLA 1GNGA 5D10A 4OBOA 1OB3A 5IEYA 3I7CA 2XBJA 2B54A 3JUHA 3ULIA 3UC4A 3UNZA 5HVJA 4ANLA 3S0OA 2YM5A 4AACA 3GCPA 3O17A 4XV2A 4GS6A 4IWDA 5B2KA 2IW8A 2OK1A 3KCFA 2GSFA 3RI1A 4BDEA 2QOKA 2J4ZA 3C0GA 3DBEA 3MH1A 3QUPA 4M97A 5C03A 2OXXA 3ZO4A 3Q5ZA 4TXCA 5HE1A 4FTMA 5C8NA 4LUEA 3ELJA 2OIBA 2IZTA 2ITYA 2HXLA 3MYGA 4Q5HA 3TN8A 4U80A 3RGFA 4DEHA 3GU5A 4QQ5A 3UVRA 4GFGA 3ID6C 3P4KA 4UZDA 3AD6A 4CV9A 4X0MA 4ZAUA 4BI2A 4MYGA 2IWIA 2QG5A 4EHVA 2BFXA 2HOGA 2XKDA 3FMKA 5LQFA 1GAGA 4K11A 2WTKC 5CF8A 2HCKA 2X0GA 3G33A 3A60A 3RNYA 3U4WA 2WTWA 3D5WA 5AADA 1H1PA 4BCFA 4E6QA 4DFYA 2JDTA 3RPOA 2F7ZE 4EOJA 4ZSEA 2VD5A 3KY2A 5TF9A 1P5EA 2ZM3A 3OWLA 4DT8A 2UVZA 3PFYA 2C30A 3F7WA 1PXIA 3Q6UA 4RWIA 4XLVA 3ZU7A 4A7CA 4Q9SA 4HZSA 4IACA 2RFSA 2UW9A 5EQEA 1OKZA 2ITQA 3FLQA 2W1GA 4BCHA 4DTKA 2I0YA 3D5UA 2VWUA 3WZEA 5JKGA 5EKNA 5CSWA 3G6GA 2UVYA 1YOLA 2VO3A 4FIEA 3WBLA 2BAKA 4FZ6A 2BMCA 4UYNA 4I21A 5HCYA 4B9DA 5DI1A 3O23A 4D4RA 4C4JA 1ZOEA 4EHZA 2XK7A 4EH2A 4F08A 2O3PA 2OG8A 4FKLA 5J9YA 1I44A 3M1SA 2X6DA 3OMVA 3VONA 2BPMA 4J1RA 4ZJVA 3BGZA 4DINA 3EB0A 2HAKA 3VJNA 3VN9A 2OZAB 2YZLA 4IAZA 5KMLA 3TIZA 2QOFA 2C6OA 4FTQA 4IJ9A 3ZO1A 5I9YA 2WGJA 1OL5A 4V01A 2CMWA 2PU8A 3KULB 4CMOA 1MQBA 4QO9A 2BZJA 2WQNA 3IOPA 5IQDA 3V6RA 2ZJWA 3TKIA 2GNGA 5CSXA 3BV3A 3HMOA 3VRZA 2WOUA 2HW7A 5AWMA 1Y8YA 2W06A 5DRBA 4NWMA 3OG7A 2UZEA 3LLAA 4U6RA 5JFXA 3N4UA 4XV1A 5FBNC 4DFLA 5HU9A 2QI8A 3R8ZA 4XLIA 1XMLA 2OI4X 4CKRA 4FKSA 3C4CA 4EEVA 4DH3A 5IPJA 3E92A 3V5QA 1Q3WA 1XQZA 2F4JA 3UMWA 3UOLA 3DY7A 3ZCLA 4ANMA 4BTMA 5AP5A 1K3AA 3DQWA 4QP2A 1YVJA 3A7FA 2XK6A 2CNUA 4BJJA 3NUNA 1NT2A 1AQ1A 2XNNA 1P4OA 2VWWA 3NUUA 4RIXB 4RX5A 2VTOA 3GC0A 4RPVA 4XP0A 3ZUUA 5HX6A 3DFAA 1ZOHA 1J1BA 5JFWA 3DU8A 4BTFA 2R3QA 2YM6A 4L53A 4E7WA 3C7QA 2BIYA 2Z7SA 3H3CA 3LCTA 3FAAA 4QP9A 1GZKA 3TNWA 4CZUA 3GCUA 3RWQA 3VW6A 1VYZA 2YFXA 3PVGA 4AOJA 4Z55A 5EOBA 1XH7A 3QHRA 4F7LA 2JIIA 3MWUA 4MKCA 5M4UA 3NUSA 5DE2A 3WYXA 2ZM4A 5BQ0A 1GY3A 3QTZA 2QKRA 3D7TA 2PMOX 3CQWA 4PF4A 3R7IA 1OBGA 1DI8A 2OF4A 4IFGA 5EKOA 4FIJA 2X7FA 5IISA 3ENMA 1KE7A 1XH6A 2BCJA 2G9XA 4O0WA 2Y4IB 3FDNA 1UWHA 3HVCA 3AT3A 1YXXA 4QNYA 5ANOA 4UWYA 4F9BA 2C6LA 4U41A 1B39A 5HO8A 1Q4LA 3SXFA 2UZLA 3NIZA 3ZM4A 4KD1A 4DH7A 3AC2A 3ALOA 5E90A 5CTPA 5HICA 3MTFA 4ITIA 2ZV2A 1STCE 1OECA 3E8NA 3R01A 5ETAA 2C3JA 4F4PA 5LXMA 1DS5A 3ZLSA 1PY5A 1H25A 3EQCA 3Q96A 2GHLA 4RWLA 5FTGA 2PVMA 3FYJX 4J96A 1Z57A 2IZRA 3RK9A 3R1NA 2XK3A 5E8VA 5FBOA 4PMTA 1CKIA 3ZH8A 3PIXA 2CGWA 2BRGA 3R8LA 5JZNA 1FMKA 5LMAA 5EW3A 3OOMA 4CCUA 3F5GA 2I1MA 2X8EA 3CJFA 3LM0A 3EZRA 3FQEA 3UODA 1HCKA 1OIYA 4DLJA 4RJ3A 4BGGA 4EUUA 2VTJA 4RJ5A 4RJ8A 5AP2A 2WFYA 3TZ8A 1PXNA 3GGFA 4YJOA 3PVBA 4MVFA 2OU7A 4W8EA 4E5AX 3HL7A 1LUFA 3LFQA 3AMYA 4G5JA 3GU6A 3UYTA 3LFSA 3LXPA 4EH7A 5IQGA 4XRJA 4HGEA 4EYJA 2PMLX 5JZJA 1KV2A 5J1VA 4TY1A 3PVUA 4O7SA 4BYJA 3Q32A 1G8KA 4FKUA 4MXYA 4PQNA 1XMMA 3QTSA 4IVCA 5ICPA 5FD2A 3LE6A 4XMOA 2BFYA 1XBBA 2YAKA 2W5HA 3ORNA 1BL7A 4FKIA 3UP2A 3UO6A 4O0TA 4EK4A 1Q5KA 3WILA 2B4SB 3HEGA 5GJFA 2R3HA 2WTJA 5F20A 3W18A 4JQ8A 5EYMA 1U46A 3CC6A 2OXYA 3O7LB 2RG6A 3BHVA 3UYSA 3ZFXA 4I94A 4IJPA 3UVPA 3ULZA 1M7NA 3NLBA 3V8WA 4AOIA 4F63A 4HVHA 3BX5A 2OGVA 4RVTA 3CGFA 5IQCA 2VWZA 2XP2A 3CJGA 3QRJA 3LFCA 4AXFA 3FPQA 3UQFA 3ORZA 2QU5A 5HTBA 4AE6A 3FJQE 1Y91A 3R30A 5EM8A 4DN5A 4FYNA 4APCA 2CKEA 3N51A 4D0XA 4EOSA 3DK3A 3ORIA 3QC9A 5HO7A 3FV8A 4O0YA 4YNEA 4YJSA 3QALE 4RZVA 3FMDA 3MV5A 2ONLA 5M55A 4JIAA 3QKKA 2AC5A 4NM0A 1ZYSA 3UDZA 1NA7A 1H26A 4AZEA 4GCJA 4GFOA 4LV5A 4NH1A 4LGHA 3MH0A 1V0PA 2WQBA 4YO4A 4Y73A 3F2NA 4XG6A 2Q0BA 2ZOQA 4F70A 1OIRA 3ZSHA 4AS0A 5CZIA 4MX9A 3P78A 4QMWA 2RL5A 4AW0A 4IWQA 4YJRA 5IUIA 4RG0A 4CQEA 1YWRA 1WBWA 3HKOA 4HYUA 2IVSA 1Q8UA 3Q9ZA 3QU0A 4JMQA 3U4UA 5KHWA 2PHKA 2R0UA 2A1AB 4L68A 4V04A 4EI4A 3M2WA 3PWDA 2XK9A 3SG8A 4ZZOA 3E3BX 4ERWA 5AAEA 4OTWA 5JGBA 5IDNA 5C26A 5C1QB 3BGQA 3GB2A 1BX6A 1H1QA 3OEFX 4TYGA 4C3PA 2XALA 3E8CA 3V04A 2XK8A 2OIQA 3PY1A 4JBVA 4RLLA 1WMKA 3BYMA 1PXOA 5D9HA 1NVRA 3EOCA 4USFA 3R02A 4ANBA 3AT2A