4DE4A

Crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with hepes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords APH(2")-Id
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4de4A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4de4A02
1ZYJA 4OTQA 4PMSA 4PMPA 4NT4A 3KVWA 4I23A 2XS0A 5HX8A 3OUKA 5KKRC 1ZLTA 3I6WA 4R3PA 4RX9A 4D1SA 2V0DA 2F49A 3PIXA 4AFJA 4YGAA 3GVUA 1JPAA 3VUKA 3QKLA 4ENYA 3QD2B 4IE9A 3DXQA 4JG7A 4O84A 5CI6A 3LPBA 3PWDA 4A7CA 4ZTLA 5BUEA 3FMMA 4EH7A 4PNKA 4MCVA 2F2UA 5ANIA 4C4HA 2BR1A 3HDMA 3B2TA 5AX9A 3P7AA 4UWYA 4Y46A 1WZYA 3BEAA 1G8SA 2WMVA 3MFTA 3OY1A 5CEQA 2BHHA 4FTJA 4J71A 2F9GA 3K5UA 5BVEA 1KE9A 3DFAA 3HEGA 4NSTA 2JKQA 2R7IA 3FZSA 4UWCA 4MXYA 1UNGA 4W4VA 4DFBA 2HZ0A 4IMYA 1JBPE 2WMBA 3BCEA 4O38A 4GRBA 1Y6BA 2YDKA 3KREA 4AU8A 4BHZA 3ORZA 1H1PA 1RDQE 2B9FA 3KRLA 3ORNA 3NVMB 4RQVA 4CCUA 3DAJA 5HD4A 3MIAA 2QU5A 2YWPA 3TKHA 3WF7A 4BDKA 4I21A 4FIIA 3A60A 4CNHA 3QA8A 2YABA 4AT5A 5JGAA 5IH5A 3CIKA 1UVRA 3TNHA 5LVMA 5HVJA 2VX1A 3Q2MA 5FEDA 4E73A 3ZU7A 4GT4A 1H25A 4XS2A 4ACHA 2FGIA 3V04A 3ZS5A 4K9YA 4GT5A 5CAUA 2IW9A 3Q9XA 4MAOA 4NCTC 2ZJWA 2NP8A 2YIRA 5IQBA 2HELA 3UYSA 4PUZA 5EYMA 3H3CA 3Q4TA 4J98A 4C3PA 1YWVA 4GUBA 5HEZA 3KQ7A 4CFNA 4BY9E 3MN3A 3AGLA 2O0UA 2QR8A 4FIFA 2BIKB 3ZO2A 3SW7A 1WVWA 2E9NA 3II5A 3SRVA 2WHBA 1G3NA 4DFLA 3NUNA 2WQEA 4FTNA 4U9AA 3W0PA 2CN5A 4YBKA 4BCPA 5M53A 3HLLA 3JY9A 4ZZMA 2FA2A 3GU7A 3O7LB 4LRKA 4CGAA 5EK7A 2JKMA 2R3MA 3F66A 2W5HA 3QGWA 3TN8A 4D4SA 4WUAA 4XG4A 3DGKA 3PVWA 4BRXA 3F5PA 2VO0A 1H4LA 3DBDA 4FKSA 4JT3A 4BCHA 2C47A 5J5SA 5LWMA 4LM5A 4IB1A 5IH4A 2FO0A 3E87A 2UZWE 4QQTA 3R7YA 4KRCA 3ATSA 4I5MA 1IA8A 2G01A 2PWLA 3O0GA 1IG1A 3FZPA 3ZO3A 4BDAA 5FQDC 4G9CA 3RAKA 4ZY4A 3KRWA 3IOKA 4X2GA 4FV6A 5CF4A 3OBJA 5FEQA 4QQJA 4BBMA 3FQSA 3TACA 2JDVA 1UKHA 2VTHA 3L1SA 4Q5EA 5EKNA 1RE8A 5HG8A 5HTBA 1U59A 2GNFA 4XJ0A 4O86A 4RIYB 2IPXA 2XIKA 1J91A 2UZBA 1U5QA 3F82A 1U54B 4RFZA 3DY7A 1JLUE 5B2KA 4AZTA 5JMSA 3P08A 3Q52A 5BVNA 3WZEA 2HIWA 2QO7A 2JFLA 3CGFA 3ZUUA 3R9RA 1GZOA 2H8HA 3LXLA 4QP3A 5IZFA 2QOIA 2X7OA 4FE2A 4NUSA 3O7LD 2XVDA 3PJ8A 5K4JA 3BGZA 4YTIA 5DVRA 2A1AB 4NM7A 1BUHA 2PZ5A 3GFWA 3MYGA 3R1YA 4OTFA 3GT8A 5EW3A 5FTGA 3VN9A 4OT6A 2OF4A 3TZ7A 3BU6A 5KX8A 3KK9A 2WMAA 2KULA 5EM7A 3T3UA 2IVTA 3MY5A 5T68A 5DH3A 1Q62A 3ROYA 2WD1A 2XM8A 1DI9A 3FHIA 4HZSA 4X6QC 4I20A 4KNBA 5HE1A 4BIBA 1O9UA 4OBOA 4FGBA 4L43A 5J7HA 2YDJA 3RPVA 3R6XA 3ZXTA 5IQEA 3OWKA 3TT0A 2I0HA 2XKDA 2G2HA 3BIZA 1LPUA 5EHOA 2J51A 3VUGA 4ZJVA 3V5TA 5BMMA 4FZ6A 4JDIA 3R0TA 5FD2A 5LQFA 4TWOA 4X3FC 2GFCA 2BCJA 3F2RA 1YOLA 5KNJA 1GJOA 3BYOA 2Z02A 3OEZA 4JNWA 3VHKA 3FJQE 1J7IA 1Z9XA 2E9OA 2Z2WA 1A06A 5DT0A 3U87A 4ZZOA 3PTGA 2ZV8A 4DLIA 4FNXA 5L2TA 5CAQA 1BMKA 3RK5A 4G9RA 2Y0AA 2WMRA 2BHEA 3FY2A 4IEBA 2XK4A 2WQNA 2BROA 3CTJA 4Y85A 4TZRA 2QODA 5LWNA 3QTIA 2IO6A 2VU3A 2VTAA 3ZTXA 1CSNA 3K3IA 4RWLA 5JRSA 2OJJA 1YRPA 3VIDA 3PJ1A 5C03A 5A9UA 1PRYA 2GMXA 3QFVA 4TWNA 2R3HA 4JDKA 2GS2A 2PL0A 2R3KA 3P9JA 4HCVA 4TNDA 4FTUA 4KIOA 3GU5A 4U3ZA 2WEVA 2UW8A 4PX6A 3REPA 4BCIA 2BMCA 1PXKA 2C30A 2BTSA 4R1VA 5CU0A 1DAYA 5EFQA 1X8BA 4RJ7A 4P7EA 5GNKA 4EH3A 2HK5A 2VD5A 4AN3A 1H28A 3HKOA 4YZCA 2P33A 2ACXA 5HX6A 2JDTA 1F3MC 3UMWA 4X0MA 1PHKA 4KIPA 4O96A 3IDBA 1H1WA 2YCFA 1XJDA 1QL6A 2RL5A 3E93A 4NTTA 4YC8A 3G0EA 4XOYA 2YEXA 4MNEA 4TYEA 4FTIA 3OTUA 3GI3A 4BKJA 3QTQA 4OBPA 4WRSA 3VS3A 2IWIA 5CANA 5IQDA 2F2CB 5TR6A 4F1TA 4B8MA 3F5GA 4D9UA 2OJFE 2CGVA 4CKIA 1H0WA 3FKLA 4FKOA 3CSVA 3UYTA 4ACMA 4MXAA 4J99A 2R3RA 4D0WA 2VWBA 4F70A 4TT7A 4EH4A 2I0EA 2QOKA 5FDXA 3TV4A 4KD1A 5A4CA 4C4EA 1XH8A 4YJTA 4HCUA 4GEOA 5JN2A 4EHGA 1OI9A 3CE3A 4EWQA 2OH0E 4RJ4A 2FUMA 2QD9A 4FL2A 4ZY6A 4KBKA 3UE4A 4WHZA 3P79A 2IZRA 4PTEA 5DGZA 4L7SA 1LEZA 3WZJA 1IAHA 3BHYA 4IIRA 5DEYA 4CD0A 4LOOA 4J95A 3UG1A 2W4KA 3RMFA 4BCJA 4R3CA 5IISA 5M44A 2ITWA 2ITXA 2J5FA 4BZNA 2BAKA 4UX9A 3QRTA 1G8AA 2R3IA 3QZIA 4BHNA 3P23A 4FKWA 2JD5A 2OSCA 4BGQA 3QWJA 2OO8X 2HYYA 1T45A 5C9CA 4OTGA 3Q6WA 3BWFA 4DEAA 5EI8A 3VS5A 4V01A 3E8DA 3EZRA 3IW7A 3QA0A 5JFVA 1Q3DA 2ERKA 3F61A 4R5YA 4JX7A 1OKYA 3LCKA 4WNOA 3W8QA 2BUJA 3KCFA 1F5QA 1Q8WA 4NK9A 3OCTA 3UOLA 4IBMA 3DOGA 2SRCA 3FBVA 2ITTA 4AW0A 1WBVA 1YXXA 3LVPA 4LL5A 3WF9A 4FZFB 4XUFA 4ZSJA 4RC2A 4AG8A 4B4LA 4D2RA 3Q5IA 3BGPA 1GZ8A 1MUOA 3FLQA 2H9VA 5HLWA 4ZS0A 4FYNA 3QRIA 5KBRA 4QMVA 4UYAA 4BDGA 1WCCA 2B54A 5ANDA 1RW8A 4UV0A 3NCZA 3UBDA 2GNIA 5EH0A 3BQCA 2QC6A 2VTNA 4ITHA 2AUHA 3DBQA 4JL9A 2ETKA 2QG7A 4RWIA 1YXVA 4OLIA 3O8PA 4GK4A 4EK8A 4LV5A 2J90A 5CI7A 1ZWSA 2JAMA 4FSTA 5A6OA 4IFGA 2BZIB 2BKZA 5L8JA 4C4GA 3L9NA 3UVQA 3IW6A 2CSNA 4BZDA 3LFSA 5HG7A 4EZ3A 3ELJA 4AZEA 3QCYA 2A4LA 3ZRKA 5DBXA 4EOJA 1AGWA 3EHAA 5A4QA 4NTSA 4ZS4A 5E8WA 5H2UA 2LGCA 4M69B 2IN6A 2X6EA 2VV9A 4EH2A 3BHTA 3MA6A 5J9LA 1XQZA 1Q24A 2GQRA 2VNWA 3DLSA 4AW2A 2JBOA 2XCHA 5KHWA 1Z5MA 3A8XA 3AD5A 4FKJA 4Q5HA 4TYHB 5E1EA 3VS4A 3H30A 4DHFA 3NW7A 3UIMA 2GHLA 1OL6A 4FTRA 5FGKA 3ZUTA 1ZYSA 1ZMUA 3EQDA 4AS0A 2W1CA 3GP0A 4DG2E 2OZAA 4FKUA 4EH8A 5EYDA 3MV5A 4M12A 3RCJA 2WIHA 3NNXA 3HX4A 1OM1A 3KXGA 3SXFA 3ZYAA 2A27A 2BILB 2PUIA 3OZ6A 2KTYA 5AAGA 5JRQA 4P5QA 3NUXA 3TL8A 5CASA 2BFXA 3HRFA 4MBIA 5FXRA 2RIOA 4HPTE 5L2IA 2R3PA 2C4GA 4FKPA 2QCSA 1RJBA 3HNGA 5CXHA 3KULA 1PXMA 3QAME 3GCUA 3TG1A 3K54A 2UZOA 4X2KA 5BMSA 3DCVA 2W06A 2WTCA 5G1XA 4QMQA 3NPCA 4I0RA 4BTMA 4CMUA 1E9HA 3W33A 4FKTA 1TVOA 2PUNA 3DAKA 4GIIA 4LFIA 3SX9A 3BU5A 5EG3A 1VEBA 2B9IA 3TTIA 4W8DA 5A6NA 5HBJA 1YVJA 1Q41A 3R1QA 4UBAA 4C4FA 3NDMA 3F5XA 4GKHA 1W0XC 1U5RA 4I93A 3CS9A 3EYGA 3VS2A 2XUUA 2C6IA 4BDBA 1R0PA 2Z8CA 3AC8A 4UWBA 4EOPA 3GU4A 4O0WA 2XNOA 1H26A 3MBLA 4JIAA 4QTAA 4PMTA 5L8LA 3KC3A 5EOBA 1FPUA 3ZEPA 4QP9A 4RX5A 3R1NA 3FQEA 4S30A 5TO8A 3QBNA 4NKAA 2YM4A 3SOAA 3KRRA 4RJ5A 3E8EA 4PDSA 4ZMFA 2J50A 1YQJA 2YAAA 1UU8A 1V0BA 2BPMA 4I4FA 3ZUVA 5ETCA 2VGPA 5J87A 4MWIA 4I41A 3IONA 4RFMA 2VGOA 1XR1A 4EHEA 5HLPA 1JSVA 2EUFB 5CVHA 2AYPA 5HI2A 3HAVA 2YAKA 3AC4A 4IAFA 2QR7A 3DV3A 4C7TA 5BYYA 2J0LA 5GJGA 3P0MA 4LV8A 3N51A 3OD6X 5H8BA 5HGIA 5BYZA 4AACA 4PL5A 4V04A 3C50A 5L8KA 3NIZA 4I22A 4F7JA 3U55A 3M1SA 4J52A 2I1MA 5DLSA 3D0EA 1LP4A 3AC5A 3LFNA 4GS6A 4HPUE 4MK0A 4YC6A 3ENHA 4TRLA 1YDTE 3V01A 1OIQA 2P3GX 4A4XA 4AW1A 1UWJA 2W1IA 2FVDA 2OFUA 4I5CA 4RVMA 3ZFYA 5CYIA 4TL0A 4EBVA 3DXPA 3N9XA 5DRDA 2HWPA 2WFYA 3ODZX 4KA3A 4YHJA 3UO6A 4D4YA 3DKGA 4O7NA 1GIJA 2R3NA 4IAYA 4NW6A 3LCOA 1TQPA 4YSMA 2GNHA 2P2HA 1DAWA 5AAEA 3R02A 4RA4A 3VUMA 5HU3A 4L53A 4XBRA 3MSSA 4PDOA 3TV7A 3KKVA 3W32A 1ZAOA 5KMOA 1W82A 3JY0A 4ASZA 4XV9A 3CR0A 2EU9A 2X2LA 3DLZA 5FLFA 5HE2A 3VS6A 3VNTA 4JS8A 4X21A 4JJRA 3PJ2A 1NVQA 3LFBA 4BGHA 4XP3A 1PY5A 3E8NA 4ITIA 5FXSA 4EI4A 1OIYA 1XBBA 4B7TA 3BKBA 4G3FA 4YO6A 2OU7A 3G0FA 2Z60A 2XRUA 5F9EA 4CFMA 3FQHA 3UIUA 4JLCA 2CNQA 3LZBA 2VTPA 2RFSA 1P2AA 3UTOA 3LE6A 3D15A 2PMIA 3TYKA 3EL7A 3PPKA 3AT3A 1Q3WA 4XCUA 5E8SA 4ZY5A 1WBPA 3QRKA 4EQCA 5CU3A 3HV5A 3QZFA 3TZMA 4FEUA 2OICA 1OUKA 4IM2A 4PP7A 4JG8A 2JDSA 2G2FA 1DS5A 3AC2A 2XNEA 1XH6A 5DR9A 4FKGA 4L9IA 3QQLA 1SVGA 5D7AA 4BICA 5AP2A 2Z7QA 3LQ5A 2XJ1A 3MJ2A 2VAGA 3E92A 1OKZA 2Y7JA 2WTKB 3BBWA 4UXQA 4GMYA 5CAOA 4YNOA 1KOBA 4MH7A 3NEWA 3C0HA 4OBQA 1XH9A 2RKUA 3RM6A 4C2VA 3SVVA 4H3QA 3D14A 5A4LA 4H3BA 3EJ1A 4FT9A 4EUUA 5AV2A 2OW3A 4HYUA 1OL7A 3C1XA 4RIXB 3R7VA 2JDRA 2JITA 5EI6A 3VAPA 3W2SA 3SQQA 3G90X 4Z7HA 2C6KA 2CJMA 2PVHA 2B0QA 2X8IA 4G5PA 4G6LA 4WKQA 4G3GA 5CX9A 5AP4A 4D5KA 4YHFA 3OCSA 5DA3A 3FWQA 3V8TA 3QQGA 3FMHA 1H24A 2ZM1A 5FRIA 3FMNA 4IWPA 4F08A 5BUJA 1FINA 5HE3A 2BAQA 3AGMA 3KXZA 4GL9A 4FZDB 2FSLX 3MPMA 3I7CA 3VBXA 4FTQA 4YHTA 1YHVA 3BX5A 3R01A 5KKRB 3EB0A 4F99A 1ZMVA 4U45A 5M4FA 4CV8A 3NCGA 2UVXA 3KMUA 2WXVA 3AOXA 1Q97A 4RA5A 4F65A 5I9ZA 3BPRA 3MVHA 4CKRA 2QQ7A 4FZ7A 4F9BA 4RRVA 4FGRA 4HJOA 3O8UA 3TNWA 4NU1A 3LMIA 3QX2A 4BCMA 3DA6A 1KV1A 4M3QA 5JEBA 1G5SA 3R30A 3EZVA 2JEDA 4GYIA 4APCA 4EYJA 4IAIA 2PVKA 2GNLA 3TKIA 2J2IB 1IR3A 4E4NA 1IA9A 5M51A 3S00A 3E8CA 3QQUA 3D5XA 5EYCA 4L46A 3RGFA 5AV3A 3VQHA 2BRHA 3HV6A 4IX5A 3FEGA 2XYNA 5CZIA 3MTFA 4RJ3A 5A3XA 3W55A 4AGUA 4IB5A 4ANLA 5IA1A 3CP9A 3V5JA 3PLSA 5H3QA 4R7BA 2OZOA 3TZ8A 4Z16A 5CZHA 3CPBA 4X2NA 5ACKA 3RPRA 4ZTNA 2W05A 5CNOA 3UP2A 5E8UA 3PIZA 3ORTA 1ZOEA 3LXPA 2VX0A 2WQMA 4DEDA 2GSFA 2JAVA 2X8EA 1JKTA 3FSKA 4YJQA 2G2IA 4G3CA 2XIRA 3V5QA 3VUDA 4QMSA 4I92A 3RAIA 4IVBA 3QALE 1NVSA 4XV2A 4Y72A 3TIZA 2WOUA 3E7VA 1PXLA 5AP1A 3RPOA 1O6YA 3UMXA 2WMTA 3IW4A 5HCXA 4DBNA 3VBWA 4DH1A 2GCDA 3FC2A 1DI8A 3C7QA 5E4HA 3PXFA 1PKDA 1H1QA 3P5KA 2XK8A 5HORA 2UW7A 5AV4A 3SAYA 4DF3A 2J7TA 2HW7A 3AMBA 3ZBFA 3KRJA 3VUIA 4ZP5A 5C01A 3VRZA 4DBXA 4S33A 4D28A 1FBNA 4RZWA 1OL5A 3BYUA 2ZDUA 3CD8A 4NFMA 4O81A 4RIWB 3U6JA 4FEQA 3W10A 4K0YA 5DPVA 3EN5A 5AP5A 2F7ZE 3UC4A 4IZYA 3Q3BA 3EL8A 2JIVA 4FG8A 5HVKA 3I4BA 3OG7A 2DUVA 5ANJA 3FMLA 3ZHPC 4YSJA 3O51A 2PMNX 3DKFA 2QKWB 3UIXA 4F9AA 3PSCA 5HCYA 4E6AA 1Q8TA 2PHKA 1XBCA 3MPTA 4Z7GA 4Y83A 3MGYA 5AAFA 4A4LA 4BCQA 3OOGA 4JAJA 2PE2A 4EHVA 1OBDA 2HXQA 3DNEA 3EYHA 4NM3A 5T6KA 1PMVA 2I0YA 3KFAA 2B4SB 4IM3A 4LGGA 3ZO4A 4AN9A 5M4CA 5DRBA 3ZSIA 2X8DA 5IU2A 4S32A 5KE0A 5IEVA 1P5EA 3QCSA 2I7QA 4IAAA 3KF7A 3VQUA 4I1ZA 3VS0A 3A61A 4QMMA 4A4OA 5CALA 1WBNA 4F0GA 3WARA 2J5EA 2F7XE 2UZDA 2RF9A 3LAUA 5LARA 2XA4A 3NIEA 2OK1A 2R2PA 4EK6A 5AIRA 2O8YA 3FLYA 4ARKA 1FQ1B 3DK6A 1XH7A 4F7SA 4DH3A 3UC3A 1PXJA 3RNIA 3ULZA 3MIYA 3WF8A 3C4CA 4Z3VA 3IECA 3P78A 4JDHA 4F6SA 5C26A 3KEXA 4FEVA 4AOIA 4KUJA 4EEVA 4O7SA 2GFSA 2X81A 3A7JA 1M7NA 2J0JA 4X6RA 5CEKA 3FLZA 5CSPA 3HRBA 4QMPA 4Y5QA 3V6SA 5CU4A 2FYSA 2W1DA 3DB8A 3DKCA 4BDCA 3R8PA 4J53A 3NAXA 1JSUA 3RCDA 4D4VA 5T3QA 3RKBA 3Q2JA 4RX7A 4UZHA 3RAHA 4EZ7A 3LFQA 2J4ZA 3QHRA 4E8AA 4AGWA 2V5QA 5C8NA 4YC3A 5ETFA 2NO3A 3MH0A 4TPTA 3UDBA 4O0YA 4X3FB 3UQCA 1WAKA 3MH2A 4LYNA 3TCPA 3QYZA 1SVEA 2XKEA 2Z7SA 3LMGA 2XNNA 4IACA 3IGGA 5L2SA 2NRUA 3D94A 4PMMA 4J1RA 1APME 4G34A 2E9UA 4XV3A 5ITAA 4YTCA 4CFXA 3R7EA 2YIWA 4WUNA 2ITNA 4AZVA 4IX3A 2UZUE 3NSZA 2UVYA 2ITYA 2PVFA 4I6BA 2HOGA 3RHKA 5IMEA 4JBVA 4B6LA 3CEKA 4L68A 4U40A 3IW5A 1LR4A 4G3EA 4YJRA 4G31A 3D83A 1R78A 4GYGA 3UIBA 2UW3A 1WVXA 5EM8A 4C33A 1Q8ZA 4IH8A 1H01A 4MF1A 2VX3A 2XNPA 4XG9A 2VN9A 2XP2A 4QT1A 3UJGA 2C1AA 2X4FA 3A4OX 3UZTA 2QOBA 4CTCA 5D1JA 3R83A 5J95A 4G5JA 1TQMA 4F7NA 3Q9WA 1IEPA 4XRLA 4JX3A 1ZMWA 3VJNA 3DTWA 5DNRA 4QTDA 2GTNA 4ID7A 3VJOA 4DE4A 3VULA 5HNGA 4FTCA 1W7HA 1UV5A 5AUUA 2OG8A 3KXXA 2Y4IC 4HYHA 5G6VA 3L9PA 4J8MA 3H0ZA 4BCOA 3W0OA 2OWBA 4CZUA 1PXOA 1M2RA 2CDZA 4O7TA 1YDRE 4XG6A 5AFVA 2NPQA 2XNGA 3GCSA 1YWRA 4PDYA 4U97A 3RALA 3COHA 3WE8A 3IS5A 5JGDA 4FTOA 2VTRA 4YPSA 4YZNA 3VW8A 3Q60A 4HCTA 3VVHA 4EOOA 5IMXA 3NR9A 3W16A 5IQHA 3HMPA 3RWQA 3R8VA 3AD4A 4V0GB 2R4BA 3PG1A 4E5WA 1OVEA 2C3IB 1FOTA 3PA3A 3Q4CA 4TWCA 3R9DA 4FUXA 1I09A 5E8VA 4CVAA 5J9ZA 2UVZA 2CCIA 2C5XA 2R3FA 5CT0A 1M17A 2VTLA 4GVJA 2YCQA 2YM7A 4FV0A 1BKXA 2XBAA 3U4WA 2X7GA 4I3ZA 2RG6A 4EH6A 4C0TA 3MFRA 5EOLA 3QZGA 5AP0A 4RIYA 2C0TA 3UVRA 2ITUA 1ZOGA 4G2FA 2XK6A 1U54A 4O2ZA 4HVDA 4B99A 4DG3E 1FGKA 1URWA 3DZQA 3IGOA 1Q99A 3PZHA 3G9LX 4LRJA 4AOTA 4MVFA 4ZSLA 5LVLA 4AE6A 3OC1A 5CWZA 3DK3A 4GW8A 5K9IA 2EXMA 5F94A 1ND4A 2I40A 3I1AA 1VYZA 5HD7A 3UO4A 3WZKA 2ZAZA 3FLWA 5HQ0A 4BDFA 2YWVA 1HCLA 2GU8A 2W1ZA 3Q96A 3GC8A 3ACKA 2XK7A 2X6DA 5HIDA 1T46A 2FSMX 3MESA 2DQ7X 3BV3A 4USEA 3E88A 4IVDA 5JGBA 4CG9A 5IA2A 2ITVA 2ONLA 1NT2A 3L8VA 3G51A 4WBOA 4TW9A 3UOHA 3VC4A 5EQYA 3F5UA 1UU3A 1BI8A 2VWVA 4BI2A 3ENMA 4WBBB 3C4EA 5JT2A 1IRKA 3G2FA 2B7AA 5HCZA 2C0IA 4QYEA 4AXAA 4U81A 5M08A 4KAOA 2GHGA 3ZRLA 3BV2A 3W0QA 4AQCA 3SKCA 4P4CA 4EH9A 4EORA 4KKGA 4DFXE 5EDPA 4O0UA 5AM7A 1NXKA 1YOMA 4AW5A 3CY2A 3AT2A 4WZYA 2BRNA 3GC9A 3OW3A 3EKNA 3RP9A 2V22A 3H0YA 4BCGA 3C51A 2VTQA 5H9BA 4QTEA 2PK9A 2BZJA 3R2BA 1A48A 1IAJA 1YHWA 3PIYA 1L3RE 1OZ1A 3NYOA 1SNUA 2UV2A 3R2YA 1Q61A 3ZDIA 3BHUA 4DH8A 4CLJA 5HG5A 2WMSA 2WMUA 3COMA 3MB6A 5KZIA 4Z55A 2BAJA 1XH5A 1R39A 3PFQA 4F6UA 5AADA 4MNEB 2J0MB 4IW0A 2C69A 5CQUA 3PA5A 3QTXA 4O7OA 1XBAA 5HICA 5IH6A 3VBTA 2FB8A 3A7FA 2VWZA 4IAZA 2PZYA 2YN8A 5IF1A 3QC9A 3QX4A 1BL7A 5EQPA 5CENA 5IUGA 3LJ1A 2PVRA 1O6KA 4RQKA 4HVGA 2IVVA 2CLQA 3LXKA 4P5ZA 4OTRA 4FKLA 2ZB1A 4UZDA 2XM9A 4OUCA 2C6OA 3QTWA 5CU2A 3E64A 4FBXA 4FSNA 4FV1A 4C59A 4UY9A 3MWUA 1CDKA 3GQIA 4DFUA 3P4KA 3SLSA 2XIXA 3ZXZA 4JVGA 3JYAA 3VUHA 2PE1A 5ACBC 4EOKA 4BBEA 4EYMA 5LCKA 2EXCX 3MDYA 3GU6A 4FIEA 3EN4A 3MA3A 4WA9A 3DQXA 3BZ3A 4DLJA 5I9VA 3PP1A 3PG3A 3UOJA 3OY3A 3TM0A 2JKOA 3UNKA 2ZVAA 4GJ3A 4LOPA 1ZARA 5CAVA 3H10A 3F3TA 3HV7A 3NYNA 3R21A 3DXNA 2BZKB 5JSMA 3TDWA 2CMWA 4YZBA 4QNAA 4L3PA 4FTTA 1CKJA 3PE2A 3T9IA 5BVKA 3K2LA 3DQWA 2HY81 2WTDA 3HDNA 3ALNA 4GK2A 4EONA 2YITA 2XK3A 3R63A 4C58A 3R1SA 2R3GA 3EWHA 2JDOA 4LUEA 2X9EA 2ONLC 2JBPA 3C4WA 4XLVA 4DFYA 4TYGA 1H1RA 1GY3A 2YZAA 3ZLXA 1WVYA 2IJMA 2C6LA 2OXXA 2IZTA 3EFWA 1VYWA 3QUEA 3IDPA 3JUHA 2O2UA 5ETIA 5AP6A 3LCSA 4EQMA 1OPKA 3EMGA 5CXZA 5BX0A 5JQ8A 4ERKA 3WIGA 4ZJIA 4F9CA 2XCKA 4U80A 4RWJA 2GNJA 2V7AA 3PXKA 3MVJA 3UVPA 3S1HA 4FX3A 5A46A 4J96A 2ITQA 2QONA 3MY0A 4KKHA 3P86A 2B53A 3A7GA 5HNBA 5L6OA 1K9AA 3COIA 1PW2A 2XK9A 3LW0A 3HZTA 4RJ6A 5E90A 3R8ZA 5EM5A 2R0IA 2UW4A 4P2KA 3G15A 3D7TB 4I5HA 4BTKA 2Q83A 1SM2A 5HBHA 1Y6AA 4CG8A 2REIA 1KOAA 4FIHA 2IZUA 4M0YA 1GZNA 4CLIA 2QOCA 5HZNA 4U8ZA 4Y5HA 4DGGA 5E92A 2R7BA 3PDTA 5EHLA 2CCHA 3R8LA 2GPHA 4FSWA 4YLKA 2C6DA 4XG8A 3DNDA 3M42A 3C4XA 1XO2B 3IPHA 3OCBA 1EH4A 5FBOA 4ZEGA 3TKUA 4AOJA 5BPYA 3H9FA 3ZFXA 4PWNA 3Q9YA 3DTCA 5HU9A 3LFCA 3ETAA 4O0SA 5M55A 5IG1A 5M07A 4UYNA 2CLXA 3ZC6A 4DH7A 5I9WA 3R22A 3EIDA 3LXNA 3L8PA 1K2PA 4KRDA 4KS8A 3U6HA 3OWLA 3FDNA 3MI9A 3ODYX 4D4RA 4GUEA 4QP8A 4FEWA 4G3DA 5J1WA 2OZAB 3T9TA 2XKFA 2YIXA 3AQVA 2YM6A 3I0QA 2VTJA 2W5BA 4MHAA 3B8RA 5CU6A 3S4QA 1BI7A 5D11A 4H39A 3CCNA 5LOHA 3C9WA 3PRFA 1PMNA 2C5YA 2QU6A 2XNMA 5KMLA 2VWYA 3R7OA 4G6OA 2CKQA 3TUDA 5HVYA 4I0SA 3FV8A 2LAVA 5DFPA 4USDA 3WOWA 3I0OA 4DN5A 5E8YA 1M7QA 5K5NA 2QOFA 2P0CA 1U4DA 1YXUA 3POZA 4RLKA 3ZSGA 4CQEA 3UOKA 3VF9A 2WO6A 4ACGA 5KMKA 4TYHA 4C34A 1OECA 2R9SA 2WU7A 4A07A 2RGPA 3LJ2A 4O6EA 3E63A 3NUAA 4CSVA 5E8ZA 4C36A 4E93A 4QYYA 4G1WA 4D1ZA 2PSQA 2XEZA 4O7VA 2BRMA 4RC3A 4AA5A 3OFMA 5CS6A 4DEHA 5LMKA 4QQCA 2I6LA 4O21A 5FP6A 4ZTRA 3RM7A 4EC8A 3SG9A 3THBA 2PVJA 4K6ZA 3A99A 4YBJA 1XKKA 2OH4A 4E5BA 4XLIA 4RC4A 4B0GA 3O50A 4D5HA 4OTHA 2WQOA 1CMKE 2GDOA 2PMLX 3W18A 1RQQA 3R9HA 3RI1A 5GINE 3MW1A 4FSYA 1Y8YA 2WMXA 5GHVA 2G9XA 2JC6A 3EFJA 3DAEA 3EFLA 3EOCA 3ID6C 2CKPA 2PZRA 4FTAA 4HYIA 4I6HA 2W1GA 3NYXA 4FL1A 3MVMA 4OTDA 4UN0C 5IQFA 1J7LA 3I6UA 4C3RA 2W1FA 2J9MA 3ANQA 2XMYA 3TDVA 5DE2A 3RPSA 2HW6A 4M8TA 4RMZA 5BVWA 3U4UA 1H27A 3RINA 5LCJA 4MXXA 4WOVA 3CPCA 4RBLA 2W0JA 3C5UA 4ZTHA 2RFDA 4BDEA 4FVPA 3AT4A 3IG7A 3QQHA 1JAMA 1PMEA 1E1XA 3IKAA 4JBOA 3Q5ZA 4FVRA 4EJ7A 2YACA 2X2MA 3QRUA 3NX8A 3QF9A 1OIUA 2JLDA 3BU3A 4S34A 3OF0A 4AX8A 3F7WA 3KXMA 3TI1A 5IUHA 3OXZA 4O0TA 4FK6A 3QL8A 4JRNA 3CD3A 4U3YA 3P7CA 2V62A 4ERWA 1YI6A 3ORPA 4F63A 4FNWA 3CQWA 3PY1A 5M4UA 3RK9A 3KCKA 1UNLA 3L8SA 4AGDA 2UW5A 2PTKA 4XMOA 2JIIA 2OXDA 5H8GA 4JBPA 5CLPA 5AP3A 5AUVA 4DCEA 4WD5A 4WNMA 3R8MA 4RWKA 3UGCA 2HAKA 4FTLA 3DZOA 5CT7A 4ZK5A 4D58A 3F7ZA 5IDPA 2YM8A 3OMVA 4FEXA 2WKMA 2PZIA 5AV0A 2CN8A 1KUTA 3Q6UA 3ZLSA 2ITZA 1VZOA 2RG5A 5DYJA 3E62A 1B39A 5IPJA 4S2ZA 2C5VA 3ULIA 3BRBA 3ORLA 4MBLA 5HESA 3TNPC 4FI1A 4L8MA 4X2JA 4IQ6A 4FV9A 4HGEA 3I79A 3FZTA 4R7IA 4FIJA 3TV6A 3I81A 2BFYA 2GS7A 4GG7A 4W4WA 4XV1A 2R3QA 2Z7LA 4ANBA 2O64A 1H0VA 3MTLA 3GBZA 3GC0A 4PL4A 1QPCA 1OPJA 4QPSA 4XG2A 2QKRA 3EQGA 3UPXA 2XZSA 3ZEWA 4OGRA 2IVUA 4QRCA 4ZLOA 2XIYA 5K4IA 5LMKC 2UZTA 4IADA 4APPA 4R1YA 4EOSA 2ZV2A 4QOXA 5E9EA 4F6WA 4CKJA 5JK3A 4WG5A 1KWPA 3PP0A 3DDQA 4YJSA 4ZTMA 5CSWA 2VTSA 5GJDA 2A19B 4FODA 1OIRA 4RFYA 3FI8A 3V5WA 5F4NA 4C61A 3PXRA 4XNEA 2X2KA 1OB3A 3JR1A 3MFSA 4A9RA 1PMUA 2XNBA 4U6RA 2PU8A 4I94A 3QLFA 4YTHA 5HO7A 4RGJA 4W8EA 4Y73A 1UKIA 3ZMMA 4L45A 1JSTA 4O22A 5CEMA 5LVNA 4WG3A 4NM0A 2WTIA 3C0IA 1M2QA 4DCAA 4ZAUA 5IQCA 1P4OA 2WU6A 2BDJA 2X1NA 4E26A 3SHEA 3Q9ZA 3PVGA 3BHHA 2XJ2A 2Z7RA 5HG9A 4EOMA 4QNYA 3IW8A 3NLBA 4USFA 4RX8A 3T8OA 5J9YA 4C35A 4ZXTA 3SG8A 1P4FA 4A9UA 4BDHA 3R28A 5FBNC 3VF8A 2ZYBA 4XEYA 2OXYA 4BCKA 1WFCA 5IA3A 1FGIA 4AT3A 4DT9A 1NW1A 3KMMA 5CF8A 3D5UA 3A8WA 5FM2A 1PXIA 4CFVA 1O6LA 3KY2A 3F6XA 1SMHA 3PZEA 5E91A 3BLHA 3VBYA 4CRSA 4K2RA 5EI2A 4DGOA 2QURA 4E4MA 4IB0A 3ZRMA 4BVUA 4AAAA 3FL5A 4L42A 4EKKA 2CPKE 5KMIA 4XBUA 4MQ1A 4BN1A 5KZ0A 4F9YA 4QMWA 4O0RA 3D2KA 4J8NA 2F7EE 2CGWA 4I4EA 4C62A 2IW8A 3BE9A 3MY1A 5E8XA 4BB4A 4E6DA 4TTHB 4GU9A 4ACDA 4MNFA 3NUPA 2P55A 3DBEA 3SW4A 3MVLA 4KB8A 3R04A 1H08A 3OS3A 2XIZA 3DJ7A 4AT4A 3HMMA 4DG0E 2P2IA 4WIHA 1WBOA 3LKMA 4E6CA 4A06A 4YURA 3O96A 2X4ZA 3GFEA 4GCJA 4ITJA 5JH6A 3ZZWA 2PYWA 4XRJA 4G17A 4H05A 1W84A 5BNJA 3E3PA 2E2BA 3QLGA 5D41A 5CEOA 3NVKI 4XHKB 4BCFA 4CXAA 2HCKA 1JOWB 4QYHA 1UA2A 3OXIA 5CNNA 4RIOA 3NUSA 4KWPA 3LFDA 2OGVA 4C2WA 4ZLYA 2OI4X 2R0UA 1BX6A 3BEGA 4FSMA 5DN3A 3BELA 3WI6A 4BZOA 1J1BA 4BI1A 3BWJA 5FM3A 5FTQA 3AMAA 3KXNA 3W2QA 3MFUA 4XH6A 2O5KA 2ZM4A 3SOCA 4C38A 4L7FA 4GKIA 3QQFA 1R0EA 3ORMA 5IA0A 4YLJA 2A2AA 1WBWA 2XKCA 2VWUA 3DPKA 4MTAA 2YHVA 3F2AA 3VS7A 2YISA 5ANOA 2Q0BA 3D9VA 3KK8A 4FL3A 4M7IA 5CQWA 3ERKA 4O0VA 3FC1X 4Y8DA 3UNJA 3QD3A 4L67A 4IVAA 4FG9A 4MYGA 3DDPA 3GOPA 2EWAA 3H9RA 4E4LA 2YDIA 4GSBA 1ZY4A 4FSUA 4M68A 4O82A 4RPVA 2GHMA 4ZOGA 3PWYA 4B8LA 4QP4A 5D12A 2Y6MA 4IVCA 5CEIA 2QOOA 1H00A 2YZLA 3QCQA 1GZKA 4D2SA 1B6CB 5A54A 2ZV7A 1KSWA 3OUNB 3FKNA 4IJ9A 4N70A 3SA0A 2VRXA 4OW8A 3BLRA 3KL8A 4FC0A 4IWDA 3DBCA 4U42A 4HVHA 1JKLA 2P4IA 2WTKC 5K3YA 1Y91A 2Y4IB 3VBVA 5DR6A 4EQUA 1YWNA 2HXLA 3LFAA 2QO2A 2IVSA 3OW4A 4YJOA 5ANGA 3TEIA 5KBQA 2PPQA 4NH1A 4DINA 3POOA 4M15A 5ANKA 5CSXA 3DKOA 5J8IA 3L9LA 1ATPE 1NY3A 4R7HA 3UNZA 3F2NA 2OJIA 3W0MA 3EKKA 4BGGA 3WZUA 4LUDA 1GOLA 2G15A 4GFOA 5CSVA 4F7LA 2Y6OA 2OIQA 3C4FA 1U46A 1H8FA 2PUPA 4BI0A 3FPMA 4TN6A 3GCPA 2PVMA 3TWJA 2PULA 4FZAB 3E3BX 3RTPA 4U44A 3HUBA 3FI2A 3WZDA 3F88A 3O71A 4N0SA 4II5A 3SC1A 4YMJA 5EW8A 2OIBA 4QMUA 4K11A 4MXZA 3AC3A 4M13A 4S31A 5AMNA 4IHPA 4EKLA 5IA4A 1Q8YA 4FV2A 2C6EA 4JAIA 4QYFA 5CVFA 3QUPA 4IDVA 4RVTA 2O3PA 3ZH8A 4DITA 4IM0A 4ZSAA 2YA9A 1OITA 4MKCA 3EFKA 2R3LA 1UU7A 4KSPA 3OROA 5L3AA 4K1BA 4GG5A 4RVKA 1YHSA 3NS9A 4FNYA 4FV3A 1WBTA 5LVOA 3ZM9A 4TYJA 4CFFA 1REKA 3SRVB 4OTIA 4D1XA 3KGAA 2UW6A 1V0PA 3HP5A 4CMOA 4PTGA 2W96B 3SXRA 1GNGA 4EC9A 5EDQA 3D5VA 5CSHA 1GIIA 3ORIA 5FDPA 4QMOA 4X2FA 3Q32A 3KU2A 5I0BA 3HV3A 2QLQA 4AA0A 4BCNA 4BTFA 2VWIA 3PVUA 3LLTA 4NL0A 4XX9A 3HA8A 3Q53A 3ROCA 1CM8A 4ASDA 4AWIA 2QO9A 4K18A 4ENXA 4F0FA 4W4XA 4O7YA 2YM3A 3QTSA 5DR2A 4L00A 4EL9A 3MH3A 1S9JA 1W83A 4PTCA 4X3FA 4YJUA 4YLLA 4FIGA 4QP6A 2OFVA 3DK7A 3LHJA 3R8UA 3GCQA 5M57A 2X7FA 2UUEA 2CKOA 4ALVA 4MQ2A 3UO5A 3O8TA 4EOIA 4PF4A 2BTRA 5AUWA 5GJFA 3CGOA 4WG4A 4XOZA 2X39A 3EH9A 5IQAA 1M14A 4YUQA 1FVVA 2WOTA 5FEEA 4EH5A 1VR2A 4O91A 4WO5A 1PF8A 2HY0A 5M4IA 3OWJA 4O7PA 3I5NA 4FVQA 2EB2A 2QG5A 2ZOQA 3QCXA 2DS1A 3W2CA 5JFSA 1REJA 2VUWA 4AZFA 4NJ3A 3FSFA 1A9UA 3BQRA 2PE0A 3LQ3A 4KIQA 3FXZA 3WYXA 2IZSA 2X9FA 3GB2A 5EYKA 3RWPA 4QQ5A 4E4XA 4O27B 4HNIA 3HRCA 4QMXA 4LGHA 3GXLA 1SYKA 4CRLA 3EN6A 1R1WA 2W17A 3HECA 2CHLA 4E7WA 3GENA 5GIOE 4CFUA 4FKIA 3IOPA 3S2PA 4N57A 4LMNA 4GV1A 2CGXA 4BTJA 2ZMCA 1QMZA 3ZFMA 4HGLA 2OKRA 2YJRA 3MJ1A 3BYMA 3FKOA 3UG2A 2AC5A 5KCVA 2QI8A 4DTAA 2WTVA 4HVSA 3W1FA 3AC1A 2UZEA 3GEQA 2ZB0A 4IC8A 3OEFX 3WILA 1WBSA 4EWHA 4H58A 1YXSA 2GNGA 3AMYA 3F3WA 2A0CX 1PKGA 3Q4ZA 3HA6A 2GTMA 4KINA 3ZC5A 2CNUA 4DGLC 5JQ5A 4V0GA 4ZSGA 4QMNA 4LL0A 2QLUA 3MS9A 4ANQA 3COKA 5F1ZA 2E9VA 1B38A 4NYEA 4GU6A 1OKVA 5DT3A 3A7HA 3M2WA 4NM5A 4J7BA 4I5PA 5EW9A 4H36A 4HVIA 1I44A 3QTUA 4FV7A 3OVVA 4FTMA 2EVAA 3TNQB 4O6LA 2O63A 3V51A 5C1QB 1QPEA 4Q9ZA 1YI3A 3FMJA 1OL2A 2Y9QA 2JFMA 4DH5A 3W2PA 2WZJA 3KXHA 2FSOX 5I9XA 1PXPA 4EK4A 3R9OA 4CV9A 4KABA 1XWSA 5TT7A 3R9NA 5JFWA 5AUTA 5BUIA 2Y8OA 2WPAA 3OOMA 3QGYA 3FMDA 3ORKA 2ZV9A 4FT7A 1JKKA 5HKMA 3KRXA 3T3VA 2NRYA 2RFNA 3ANRA 3BYVA 3LFFA 3FZ1A 3HP2A 5IEXA 1NVRA 4ZTSA 1WMKA 1PYEA 3QD4A 1UU9A 4IDTA 4KKEA 4C02A 2QHMA 4IX4A 1E1VA 1ZYCA 2WEIA 5IQIA 3OT8A 1Y57A 4WT6A 4PDPA 3RVGA 5BQ0A 2JGZA 2QOLA 3LIJA 5CF6A 4XP2A 4B9DA 4U43A 4Q2AA 3NZ0A 3D4QA 5KMJA 5AEPA 2YERA 4LOQA 1Q5KA 4MXOA 2VTMA 3DT1A 3FXXA 3FMKA 2VWXA 5CY3A 3F9NA 1HOWA 4M97A 4EBWA 4IAKA 3NGAA 4JI9A 1BL6A 3GC7A 3QXOA 1ZZLA 4QMTA 4ORKA 4UB7A 3DS6A 3V3VA 1L8TA 3U9CA 4R78A 2BALA 4DAWA 5K5XA 4DFNA 4LRMA 4XYFA 3FZRA 2YIYA 4L3JA 5EKOA 4KBCA 3Q04A 4AZSA 2WMQA 3U8WA 2QNJA 4YZDA 5DT4A 4DGMA 4GFGA 1GAGA 2PVLA 3RK7A 3ZOSA 1FMKA 3UZPA 1GIHA 4BBFA 2XB7A 4JQ8A 4AF3A 2VNYA 4IZ7A 1QPJA 3PE1A 4PNIA 2BRGA 1MQBA 2OJGA 3QU0A 4UEUA 1URCA 1YXTA 4E1ZA 1OUYA 2CGUA 4OR5A 4BDDA 4F09A 1W8CA 4EUTA 3HMOA 3R00A 2W4JA 5IUIA 1XHAA 4ZSEA 5AWMA 4GH2A 2C3LA 4CMTA 4DEIA 1H07A 5CF5A 3NUUA 2H96A 4GT3A 4JG6A 3RHXA 2IG7A 3D2IA 3SGCA 3QTZA 5TF9A 2W9ZB 4M0ZA 4FA2A 4BIEA 3S3IA 5B2MA 2ITOA 4KSQA 4NWMA 3UP7A 2UZLA 4DEBA 4CZTA 3KN6A 3QUDA 2H6DA 4JDJA 2W9FB 2PMOX 3P1AA 4JXFA 3I60A 4E5AX 4TNBA 4CEGA 3BYSA 5LMBA 3NW6A 4G16A 1OBGA 4UALA 5M09A 1QPDA 1FVRA 4Y95A 4GVAA 1CKPA 4HGTA 3U51A 5LVPA 3RJCA 2YCRA 2E9PA 5BVDA 5EHYA 2J0KA 2WB8A 4FKQA 3MPAA 4DTKA 2YM5A 4UXLA 2JIUA 3F3ZA 4DT8A 3CLYA 4D9TA 2VTOA 3PVBA 5AM6A 5AX3A 4HOKA 1SZMA 4ALUA 5BVFA 5GIPE 5L2WA 4JIKA 4TY1A 4X3JA 3K3JA 4CCBA 3KN5A 3NWWA 1QCFA 3EQHA 3V6RA 4AUAA 4DA5A 3O17A 3B2WA 3KMWA 4KS7A 3U6IA 3QXPA 3G33A 4FK3A 4AFEA 5I5ZA 3EQIA 4FG7A 4FT5A 5C8MA 3VS1A 2ETMA 2HZ4A 3ZDUA 4XP0A 3EQPA 3QQKA 2VO3A 2C6MA 3QD0A 3IQ7A 4C3FA 2VTIA 4EK5A 3NUYA 4ONAA 4YZ9A 4F0IA 4NKSA 4YO4A 3V5LA 3OT3A 5B0XA 1S9IA 4C37A 4KBAA 4QO9A 2WQBA 3PSBA 4MWHA 5M06A 1SNXA 3D7ZA 3E7OA 4FNZA 4QP1A 4E6QA 5ANEA 4GIHA 3EQCA 3ZBXA 3FLSA 1CTPE 3LCTA 4R3RA 3I7BA 1MRUA 3ZZEA 1OKWA 2R64A 3PSDA 4D55A 4EK3A 5CAPA 3N4TA 3VWAA 4EZ5A 4U98A 5IQGA 4RVLA 4PV0A 4ALWA 4ZLZA 3D7TA 3ACJA 3NW5A 4XG3A 3LMHA 3TNIA 4LQMA 4BYJA 4R5SA 5FG8A 2OBJA 1OL1A 2C5NA 4QMLA 3A62A 3PXZA 3VRYA 4I6FA 2J0IA 3SV0A 1XH4A 4MD8E 4BDIA 3R71A 3TTJA 4L01A 4IJPA 1Z57A 3GQLA 1JQHA 4TYIA 3WF6A 4HZRA 3E5AA 4DFZE 4WNPA 5DI1A 1JVPP 2JKKA 4JBQA 3WF5A 2CNVA 4I6QA 5D9HA 2DWBA 3KULB 4JRVA 4QP2A 3AD6A 3FMEA 5AIKA 4RT7A 4ZMEA 3Q4UA 4K8AA 2I0VA 4IFCA 4L6QA 2C68A 4ANMA 1MRYA 4EHZA 3C5IA 4J97A 4BYIA 2QOHA 3PJ3A 3QZHA 3HMNA 4DEGA 4O83A 4W4YA 1H1SA 3D5WA 1M52A 3FXWA 5AUZA 3FYJX 1OMWA 4PRJA 2EB3A 4FKVA 3DU8A 5DEWA 3UZRA 2ITPA 3G9NA 1PXNA 3OWPA 3JVSA 4JR7A 3FZOA 5FP5A 4CFWA 5BYLA 5F95A 2BKKA 5B7VA 4L52A 3B8QA 1V1KA 2OF2A 2VO7A 3V8WA 4D0XA 5HNIX 5F20A 4JOAA 5JFXA 2J6MA 3LM5A 4PL3A 1BLXA 1TQIA 3BGQA 3BBTB 4DTBA 3C0GA 5A4EA 2WTJA 3PYYA 3CY3A 5KMNA 1ZRZA 2XYUA 4MD7E 4YZMA 3IDCA 5KO1A 1VJYA 1PJKA 2R5TA 4QTCA 4FSZA 4O7RA 4K33A 3ZONA 3TUBA 4BF2A 3KVXA 5JZNA 4BDJA 5C27A 3LCDA 2C6TA 5ICPA 4L44A 3PPJA 4MXCA 3EN7A 3DJ6A 2B9JA 4F1OA 2BZHB 2XRWA 1OPLA 1R3CA 2FH9A 4FT3A 4ANSA 4IZAA 2IW6A 3RAWA 3IO7A 1J3HA 4QTBA 3OTVA 3BI6A 3EQBA 5KUPA 3QKMA 3HVCA 4N6ZA 3PY0A 4O2PA 3ZLWA 5E7RA 4A9TA 2YCSA 4FSQA 2PUUA 3KB7A 3HYHA 3JS2A 4G6NA 5CTPA 1JKSA 3TJCA 3NMUF 3H9OA 3HAMA 4NZWB 4H1JA 2ESMA 2B9HA 1Q8UA 5LJJA 2V7OA 3PRIA 4YU2A 5LXMA 4QPAA 4DC2A 3VBQA 3QKKA 3VW6A 3GOKA 3V5PA 4LMUA 5IA5A 4MD9E 4F64A 3ATTA 2ERZE 4GFMA 2W99B 2BIYA 1FVTA 4M84A 5DIAA 3W2RA 4HNFA 4ACCA 2DYLA 4IWQA 4U79A 3QQJA 4TXCA 5EM6A 5DHJA 1V0OA 5FUTA 4AN2A 5IEYA 3UODA 5JZJA 4U94A 5KMMA 4Z9LA 2WELA 1KE8A 3F3UA 2OIDA 3FAAA 3N4VA 4ZIMA 4WNKA 3U54A 4U0IA 2ZMDA 3L9MA 3R73A 3QHWA 1STCE 2W7XA 3WYYA 5C4LA 5AUYA 3TJDA 1LUFA 4Q9SA 4C4IA 1YW2A 2C3KA 4RLLA 2FSTX 4TWPA 3CJFA 2XF0A 3WE4A 2OLCA 3WBLA 3NRMA 3LJ0A 4ASXA 5AJQA 5HIEA 3PY3A 3OXTA 2BDFA 2BVAA 2YJSA 3CTQA 4PP9A 4DEEA 4LG4A 3RZBA 4A9SA 1ZY5A 3ZO1A 3KA0A 4K77A 2WTWA 3FYKX 4V05A 1ZZ2A 5E1SA 4U41A 4ZJJA 2W4OA 5DWRA 4A9YA 2C0OA 5AP7A 5H8EA 4F4PA 1KV2A 1MP8A 3NNUA 4IX6A 1JWHA 2G1TA 3BHVA 1KE7A 5C8KA 2WIPA 4BIDA 2ZM3A 4BC6A 4C4JA 3M11A 1IASA 3BLQA 3FI4A 2HENA 2GQSA 1ZXEA 2W1HA 3CXWA 4NIFB 4HW7A 1KE6A 3W8LA 2V55A 1YDSE 3QRJA 3CBLA 5D7VA 5E8TA 5I4NA 1Q4LA 2GQGA 3ET7A 3R7IA 4RSSA 4MEDA 1ZYDA 3NYVA 4CTBA 5AA8A 5JKGA 2WGJA 3GU8A 3DB6A 3ZM4A 1ZOHA 4XG7A 4FMQA 3V8SA 2QVSE 5CEPA 3MH1A 4U5JA 4QP7A 3R7UA 2BRBA 3EQRA 3FPQA 3UPZA 2HWOA 3LM0A 4IC7A 3FY0A 2YFXA 4FV8A 1UNHA 3C13A 2AC3A 4X7QA 3AXWA 2O65A 5HTCA 4R6VA 3G6GA 5A4TA 4QMZA 3W0RA 4FOCA 1J1CA 4F1MA 3GGFA 1UWHA 3W2OA 4RZVA 3DJ5A 4FYOA 2HZNA 3JVRA 4ZTQA 4MBJA 3L8XA 3GCVA 2XBJA 2ZDTA 4O7ZA 3PXYA 4FV5A 3O23A 3JXWA 5HBEA 3TXOA 4QMYA 4YR8A 4AP7A 1YOJA 4FOBA 3KF4A 2RFEA 3PUPA 4NJDA 3W0SA 3OHTA 5CVGA 4YP8A 4PQNA 2QOQA 4RIXA 2BDWA 4WSYA 3OCGA 2HZIA 4JR3A 3HGKA 2F4JA 5FTOA 4FSRA 2UW0A 4HGSA 4N4SA 3HV4A 1OGUA 4L3LA 2UZNA 3P7BA 4EJNA 3UQFA 2W5AA 3QWKA 1CKIA 4TKSA 5LMAA 3SDJA 5HHWA 4ZZNA 3TIYA 4AZWA 3G6HA 5ETAA 5L6WL 2H34A 4JQEA 4ASEA 3N4UA 2UW9A 4H3PA 4H1MA 3EN9A 4QYGA 2CKEA 5M56A 3MB7A 3ORXA 3A7IA 4O0XA 3NAYA 3ITZA 3CKWA 3NNVA 3DBFA 4OT5A 5EDRA 4YTFA 2Q0NA 4M67A 2Y4PA 3LQ8A 1Y8GA 3CJGA 3O2MA 3PJCA 3F3VA 1J7UA 4FKRA 4FTKA 3PLAE 2F57A 1BYGA 3H4JA 4BR3A 4MX9A 4U7ZA 3LLAA 2B55A 1K3AA 1JNKA 3OP5A 5HO8A 5KHXA 3HUCA 2XEYA 2VWWA 3C4ZA 3CQEA 3EQFA 4IWOA 1YI4A 3G5DA 4R77A 4FUYA 2C5OA 3F69A 3OBGA 2R3JA 3PXQA 4NFNA 3VO3A 5HLNA 3QYWA 4HYSA 4CT1A 3DFCB 3S0OA 4IANA 5A14A 5IDNA 2VO6A 2WMWA 3FUPA 4LI5A 3ZSHA 5I9YA 3VHEA 4N6YA 5D10A 1FMOE 1PYXA 3CKXA 3LOKA 3FE3A 2PVNA 3PA4A 3U9NA 4WRGA 2ETRA 4NW5A 5TKDA 1ERKA 4FT0A 4PY1A 3RPYA 5L6PA 4O7WA 1DM2A 3BE2A 4YJPA 4JQ7A 3FL4A 1AD5A 3LFEA 4GK3A 2XH5A 3GNIB 1KE5A 4OTWA 1LEWA 4RG0A 5HIBA 3SD0A 1TKIA 3CQUA 3ZCLA 4YNEA 3AG9A 4YJVA 2WAJA 4AA4A 2PVYA 3A4PA 3SXSA 3FI3A 4O7LA 2C3JA 2QHNA 4NCTA 3GUBA 4FV4A 5DG5A 3W0NA 4DGNA 4EOQA 2PY3A 5J1VA 1MQ4A 5FXQA 5AV1A 1P14A 2XJ0A 4YPDA 2X0GA 2UZVA 3FLNC 3TUCA 1YKRA 3A2CA 5TOZA 4DYMA 3S95A 4EOLA 5BVOA 4F9WA 3QC4A 4FR4A 4I0TA 5AUXA 3I5ZA 3WIKA 3FHRA 3PPZA 4GJ2A 4IB3A 4E20A 5AA9A 3ALOA 4AE9A 2B1PA 1W98A 3CTHA 5I9UA 5B2LA 3IK3A 1MRVA 2VTTA 1AQ1A 3TZ9A 2GS6A 4IZ5A 2PZPA 3K5VA 2W1EA 4P90A 4FICA 2R3OA 3UQGA 2NNWB 2WNTA 3CC6A 1NA7A 3HL7A 3JPVA 2B52A 4RIWA 1F0QA 5HE0A 2VZ6A 4RJ8A 4CT2A 1HCKA 3HMIA 5DOSA 2OJ9A 2C1BA 1M2PA 1SVHA 4YJNA 4M14A 2YIQA 3QTRA 4I24A 5EQEA 3ZLYA 5C4KA 4AGCA 3NNWA
chains in the Genus database with same CATH superfamily
1ZYJA 4OTQA 4PMSA 4PMPA 4NT4A 3KVWA 4I23A 2XS0A 5HX8A 3OUKA 5KKRC 1ZLTA 3I6WA 4R3PA 4RX9A 4D1SA 2V0DA 2F49A 3PIXA 4AFJA 4YGAA 3GVUA 1JPAA 3VUKA 3QKLA 4ENYA 3QD2B 4IE9A 3DXQA 4JG7A 4O84A 5CI6A 3LPBA 3PWDA 4A7CA 4ZTLA 5BUEA 4AXEA 3FMMA 4EH7A 4PNKA 4MCVA 2F2UA 5ANIA 4C4HA 2BR1A 3HDMA 3B2TA 5AX9A 3P7AA 4UWYA 4Y46A 1WZYA 3BEAA 1G8SA 2WMVA 3MFTA 3OY1A 5CEQA 2BHHA 4FTJA 4J71A 2F9GA 3K5UA 5BVEA 1KE9A 3DFAA 3HEGA 4NSTA 2JKQA 2R7IA 3FZSA 4UWCA 4MXYA 1UNGA 4W4VA 4DFBA 2HZ0A 4IMYA 1JBPE 2WMBA 3BCEA 4O38A 4GRBA 1Y6BA 2YDKA 3KREA 4AU8A 4BHZA 3ORZA 1H1PA 1RDQE 2B9FA 3KRLA 3ORNA 3NVMB 4RQVA 4BJJA 3DAJA 4CCUA 3MIAA 5HD4A 2QU5A 2YWPA 3TKHA 3WF7A 4BDKA 4I21A 4FIIA 3A60A 4CNHA 3QA8A 2YABA 4AT5A 5JGAA 5IH5A 3CIKA 1UVRA 3TNHA 5LVMA 5HVJA 2VX1A 3Q2MA 5FEDA 4E73A 3ZU7A 4GT4A 1H25A 4XS2A 4ACHA 2FGIA 3V04A 3ZS5A 4K9YA 4GT5A 5CAUA 2IW9A 3Q9XA 4MAOA 4NCTC 2ZJWA 2NP8A 2YIRA 5IQBA 2HELA 3UYSA 4PUZA 5EYMA 3H3CA 3Q4TA 4J98A 4C3PA 1YWVA 4GUBA 5HEZA 3KQ7A 4CFNA 4BY9E 3MN3A 3AGLA 2O0UA 2QR8A 4FIFA 2BIKB 3ZO2A 3SW7A 1WVWA 2E9NA 3II5A 3SRVA 2WHBA 1G3NA 4DFLA 3NUNA 2WQEA 4FTNA 4U9AA 3W0PA 2CN5A 4YBKA 4BCPA 5M53A 3HLLA 3JY9A 4ZZMA 2FA2A 3GU7A 3O7LB 4LRKA 4CGAA 5EK7A 2JKMA 2R3MA 3F66A 2W5HA 3QGWA 3TN8A 4D4SA 4WUAA 4XG4A 3DGKA 3PVWA 4BRXA 3F5PA 2VO0A 1H4LA 3DBDA 4FKSA 4JT3A 4BCHA 2C47A 5J5SA 5LWMA 4LM5A 4IB1A 5IH4A 2FO0A 3E87A 2UZWE 4QQTA 3R7YA 4KRCA 3ATSA 4I5MA 1IA8A 2G01A 2PWLA 3O0GA 1IG1A 3FZPA 3ZO3A 4BDAA 5FQDC 4G9CA 3RAKA 4ZY4A 3KRWA 3IOKA 4X2GA 4FV6A 5CF4A 3OBJA 5FEQA 4QQJA 4BBMA 3FQSA 3TACA 2JDVA 1UKHA 2VTHA 3L1SA 4Q5EA 4DHZA 1RE8A 5HG8A 5EKNA 5HTBA 1U59A 2GNFA 4XJ0A 4O86A 4RIYB 2IPXA 2XIKA 1J91A 2UZBA 1U5QA 3F82A 1U54B 4RFZA 3DY7A 1JLUE 5B2KA 4AZTA 5JMSA 3P08A 3Q52A 5BVNA 3WZEA 2HIWA 2QO7A 2JFLA 3CGFA 3ZUUA 3R9RA 1GZOA 2H8HA 3LXLA 4QP3A 5IZFA 2QOIA 2X7OA 4FE2A 4NUSA 3O7LD 2XVDA 3PJ8A 5K4JA 3BGZA 4YTIA 5DVRA 2A1AB 4NM7A 1BUHA 2PZ5A 3GFWA 3MYGA 3R1YA 4OTFA 3GT8A 5EW3A 5FTGA 3VN9A 4OT6A 2OF4A 3TZ7A 3BU6A 5KX8A 3KK9A 2WMAA 2KULA 5EM7A 3T3UA 2IVTA 3MY5A 5T68A 5DH3A 1Q62A 3UDZA 3ROYA 2WD1A 2XM8A 1DI9A 3FHIA 4HZSA 4X6QC 4I20A 4KNBA 5HE1A 4BIBA 1O9UA 4OBOA 4FGBA 4L43A 5J7HA 2YDJA 3RPVA 3R6XA 3ZXTA 5IQEA 3OWKA 3TT0A 2I0HA 2XKDA 2G2HA 3BIZA 1LPUA 5EHOA 2J51A 3VUGA 4ZJVA 3V5TA 5BMMA 4FZ6A 4JDIA 3R0TA 5FD2A 5LQFA 4TWOA 4X3FC 2GFCA 2BCJA 3F2RA 1YOLA 5KNJA 1GJOA 3BYOA 2Z02A 3OEZA 4JNWA 3VHKA 3FJQE 1J7IA 1Z9XA 2E9OA 2Z2WA 1A06A 5DT0A 3U87A 4ZZOA 3PTGA 2ZV8A 4DLIA 4FNXA 5L2TA 5CAQA 1BMKA 3RK5A 4G9RA 2Y0AA 2WMRA 2BHEA 3FY2A 4IEBA 2XK4A 2WQNA 2BROA 3CTJA 4Y85A 4TZRA 1VLRA 3UDSA 2QODA 5LWNA 3QTIA 2IO6A 2VU3A 2VTAA 3ZTXA 1CSNA 3K3IA 4RWLA 5JRSA 2OJJA 1YRPA 3VIDA 3PJ1A 5C03A 5A9UA 1PRYA 2GMXA 3QFVA 4TWNA 2R3HA 4JDKA 2GS2A 2PL0A 2R3KA 3P9JA 4HCVA 4TNDA 4FTUA 4KIOA 3GU5A 4U3ZA 2WEVA 2UW8A 4PX6A 3REPA 4BCIA 2BMCA 1PXKA 2C30A 2BTSA 4R1VA 5CU0A 1DAYA 5EFQA 1X8BA 4RJ7A 4P7EA 5GNKA 4EH3A 2HK5A 2VD5A 4AN3A 1H28A 3HKOA 4YZCA 2P33A 2ACXA 5HX6A 2JDTA 1F3MC 3UMWA 4X0MA 1PHKA 4KIPA 4O96A 3IDBA 1H1WA 2YCFA 1XJDA 1QL6A 2RL5A 3E93A 4NTTA 4YC8A 3G0EA 4XOYA 2YEXA 4MNEA 4TYEA 4FTIA 3OTUA 3GI3A 4BKJA 3QTQA 4OBPA 4WRSA 3VS3A 2IWIA 5CANA 5IQDA 2F2CB 5TR6A 4F1TA 4B8MA 3F5GA 4D9UA 2OJFE 2CGVA 4CKIA 1H0WA 3FKLA 4FKOA 3CSVA 3UYTA 4ACMA 4MXAA 4J99A 2R3RA 4D0WA 2VWBA 4F70A 4TT7A 4EH4A 2I0EA 2QOKA 5FDXA 3TV4A 4KD1A 5A4CA 4C4EA 1XH8A 4YJTA 4HCUA 4GEOA 5JN2A 4EHGA 1OI9A 3CE3A 4EWQA 2OH0E 4RJ4A 2FUMA 2QD9A 4FL2A 4ZY6A 4KBKA 3UE4A 4WHZA 3P79A 2IZRA 4PTEA 5DGZA 4L7SA 1LEZA 2ZFYA 3WZJA 1IAHA 3BHYA 4IIRA 5DEYA 4CD0A 4LOOA 4J95A 3UG1A 2W4KA 3RMFA 4BCJA 4R3CA 5IISA 5M44A 2ITWA 2ITXA 2J5FA 4BZNA 2BAKA 4UX9A 3QRTA 1G8AA 2R3IA 3QZIA 4BHNA 3P23A 4FKWA 2JD5A 2OSCA 4BGQA 3QWJA 2OO8X 2HYYA 1T45A 5C9CA 4OTGA 3Q6WA 3BWFA 4DEAA 5EI8A 3VS5A 4V01A 3E8DA 3EZRA 3IW7A 3QA0A 5JFVA 1Q3DA 2ERKA 3F61A 4R5YA 4JX7A 1OKYA 3LCKA 4WNOA 3W8QA 2BUJA 3KCFA 1F5QA 1Q8WA 4NK9A 3OCTA 3UOLA 4IBMA 3DOGA 2SRCA 3FBVA 2ITTA 4AW0A 1WBVA 1YXXA 3LVPA 4LL5A 3WF9A 1OGYA 4FZFB 4XUFA 4RC2A 4ZSJA 4AG8A 4B4LA 4D2RA 3Q5IA 3AKKA 1GZ8A 1MUOA 3BGPA 2H9VA 3FLQA 5HLWA 4ZS0A 4FYNA 3QRIA 5KBRA 4QMVA 4UYAA 4BDGA 1WCCA 2B54A 5ANDA 1RW8A 4UV0A 3NCZA 3UBDA 2GNIA 5EH0A 3BQCA 2QC6A 2VTNA 4ITHA 2AUHA 3DBQA 4JL9A 2ETKA 2QG7A 4RWIA 1YXVA 4OLIA 3O8PA 4GK4A 4EK8A 4LV5A 2J90A 5CI7A 1ZWSA 2JAMA 4FSTA 5A6OA 4IFGA 2BZIB 2BKZA 5L8JA 4C4GA 3L9NA 3UVQA 3IW6A 2CSNA 4BZDA 3LFSA 5HG7A 4EZ3A 3ELJA 4AZEA 3QCYA 2A4LA 3ZRKA 5DBXA 4EOJA 1AGWA 3EHAA 5A4QA 4NTSA 4ZS4A 5E8WA 5H2UA 2LGCA 4M69B 2IN6A 2X6EA 2VV9A 4EH2A 3BHTA 3MA6A 5J9LA 1XQZA 1Q24A 2GQRA 2VNWA 3DLSA 4AW2A 2JBOA 2XCHA 5KHWA 1Z5MA 3A8XA 3AD5A 4FKJA 4Q5HA 4TYHB 5E1EA 3VS4A 3H30A 4DHFA 3NW7A 3UIMA 2GHLA 1OL6A 4FTRA 5FGKA 3ZUTA 1ZYSA 1ZMUA 3EQDA 4AS0A 2W1CA 3GP0A 4DG2E 2OZAA 4FKUA 4EH8A 5EYDA 3MV5A 4M12A 3RCJA 2WIHA 3NNXA 3HX4A 1OM1A 3KXGA 3SXFA 3ZYAA 2A27A 2BILB 2PUIA 3OZ6A 2KTYA 5AAGA 5JRQA 4P5QA 3NUXA 3TL8A 5CASA 2BFXA 3HRFA 4MBIA 5FXRA 2RIOA 4HPTE 5L2IA 2R3PA 2C4GA 4FKPA 2QCSA 1RJBA 3HNGA 5CXHA 3KULA 1PXMA 3QAME 3GCUA 3TG1A 3K54A 2UZOA 4X2KA 5BMSA 3DCVA 2W06A 2WTCA 5G1XA 4QMQA 3NPCA 4I0RA 4BTMA 4CMUA 1E9HA 3W33A 4FKTA 1TVOA 2PUNA 3DAKA 4GIIA 4LFIA 4MUQA 3BU5A 3SX9A 5EG3A 1VEBA 2B9IA 3TTIA 4W8DA 5A6NA 5HBJA 1YVJA 1Q41A 3R1QA 4UBAA 4C4FA 3NDMA 3F5XA 4GKHA 1W0XC 1U5RA 4I93A 3CS9A 3EYGA 3VS2A 2XUUA 2C6IA 4BDBA 1R0PA 2Z8CA 3AC8A 4UWBA 4EOPA 3GU4A 4O0WA 2XNOA 1H26A 3MBLA 4JIAA 4QTAA 4PMTA 5L8LA 3KC3A 5EOBA 1FPUA 3ZEPA 4QP9A 4RX5A 3R1NA 3FQEA 4S30A 5TO8A 3QBNA 4NKAA 2YM4A 3SOAA 3KRRA 4RJ5A 3E8EA 4PDSA 4ZMFA 2J50A 1YQJA 2YAAA 1UU8A 1V0BA 2BPMA 4I4FA 3ZUVA 5ETCA 2VGPA 5J87A 4MWIA 4I41A 3IONA 4RFMA 2VGOA 1XR1A 4EHEA 5HLPA 1JSVA 2EUFB 5CVHA 2AYPA 5HI2A 3HAVA 2YAKA 3AC4A 4IAFA 2QR7A 3DV3A 4C7TA 5BYYA 2J0LA 5GJGA 3P0MA 4LV8A 3N51A 3OD6X 5H8BA 5HGIA 5BYZA 4AACA 4PL5A 4V04A 3C50A 5L8KA 3NIZA 4I22A 4F7JA 3U55A 3M1SA 4J52A 2I1MA 4QDEA 5DLSA 3D0EA 1LP4A 3AC5A 3LFNA 4GS6A 1XMMA 4HPUE 4MK0A 3ENHA 4TRLA 1YDTE 4YC6A 1OIQA 2P3GX 3V01A 4AW1A 1UWJA 2W1IA 2FVDA 2OFUA 4I5CA 4RVMA 3ZFYA 5CYIA 4TL0A 4EBVA 3DXPA 1ST0A 3N9XA 5DRDA 2HWPA 2WFYA 3ODZX 4KA3A 4YHJA 3UO6A 4D4YA 3DKGA 4O7NA 1GIJA 2R3NA 4IAYA 4NW6A 3LCOA 1TQPA 4YSMA 2GNHA 2P2HA 1DAWA 5AAEA 3R02A 4RA4A 3VUMA 5HU3A 4L53A 4XBRA 3MSSA 4PDOA 3TV7A 3KKVA 3W32A 1ZAOA 5KMOA 1W82A 3JY0A 4ASZA 4XV9A 3CR0A 2EU9A 2X2LA 3DLZA 5FLFA 5HE2A 3VS6A 3VNTA 4JS8A 4X21A 4JJRA 3PJ2A 1NVQA 3LFBA 4BGHA 4XP3A 1PY5A 3E8NA 4ITIA 5FXSA 4EI4A 1OIYA 1XBBA 4B7TA 3BKBA 4G3FA 4YO6A 2OU7A 3G0FA 2Z60A 2XRUA 5F9EA 4CFMA 3FQHA 3UIUA 4JLCA 2CNQA 3LZBA 2VTPA 2RFSA 1P2AA 3UTOA 3LE6A 3D15A 2PMIA 3TYKA 3EL7A 3PPKA 3AT3A 1Q3WA 4XCUA 5E8SA 4ZY5A 1WBPA 3QRKA 4EQCA 5CU3A 3HV5A 3QZFA 3TZMA 4FEUA 2OICA 1OUKA 4IM2A 3VONA 4PP7A 4JG8A 2JDSA 2G2FA 1DS5A 3AC2A 2XNEA 1XH6A 5DR9A 4FKGA 4L9IA 3QQLA 1SVGA 5D7AA 4BICA 5AP2A 2Z7QA 3LQ5A 2XJ1A 3MJ2A 2VAGA 3E92A 1OKZA 2Y7JA 2WTKB 3BBWA 4UXQA 4GMYA 5CAOA 4YNOA 1KOBA 4MH7A 3NEWA 3C0HA 4OBQA 1XH9A 2RKUA 3RM6A 4C2VA 3SVVA 4H3QA 3D14A 5A4LA 4H3BA 3EJ1A 4FT9A 4EUUA 5AV2A 2OW3A 4HYUA 1OL7A 3C1XA 4RIXB 3R7VA 2JDRA 2JITA 5EI6A 3VAPA 3W2SA 3SQQA 3G90X 4Z7HA 2C6KA 2CJMA 2PVHA 2B0QA 2X8IA 4G5PA 4G6LA 4WKQA 4G3GA 5CX9A 5AP4A 4D5KA 4YHFA 3OCSA 5DA3A 3FWQA 3V8TA 3QQGA 3FMHA 1H24A 2ZM1A 5FRIA 3FMNA 4IWPA 4F08A 5BUJA 1FINA 5HE3A 2BAQA 3AGMA 3KXZA 4GL9A 4FZDB 2FSLX 3MPMA 3I7CA 3VBXA 4FTQA 4YHTA 1YHVA 3BX5A 3R01A 5KKRB 3EB0A 4F99A 1ZMVA 4U45A 5M4FA 4CV8A 1ST4A 3NCGA 2UVXA 3KMUA 2WXVA 3AOXA 1Q97A 4RA5A 4F65A 5I9ZA 3BPRA 3MVHA 4CKRA 2QQ7A 4FZ7A 4F9BA 4RRVA 4FGRA 4HJOA 2AEGA 3O8UA 3TNWA 4NU1A 3LMIA 3QX2A 4BCMA 3DA6A 1KV1A 4M3QA 5JEBA 1G5SA 3R30A 3EZVA 2JEDA 4GYIA 4APCA 4EYJA 4IAIA 2PVKA 2GNLA 3TKIA 2J2IB 1IR3A 4E4NA 1IA9A 5M51A 3S00A 3E8CA 3QQUA 3D5XA 5EYCA 4L46A 3RGFA 5AV3A 3AKJA 3VQHA 2BRHA 3HV6A 4IX5A 3FEGA 2XYNA 5CZIA 3MTFA 4RJ3A 5A3XA 3W55A 4AGUA 4IB5A 4ANLA 5IA1A 3CP9A 3V5JA 3PLSA 5H3QA 4R7BA 2OZOA 3TZ8A 4Z16A 5CZHA 3CPBA 4X2NA 5ACKA 3RPRA 4ZTNA 2W05A 5CNOA 3UP2A 5E8UA 3PIZA 3ORTA 1ZOEA 3LXPA 2VX0A 2WQMA 4DEDA 2GSFA 2JAVA 2X8EA 1JKTA 3FSKA 4YJQA 2G2IA 4G3CA 2XIRA 3V5QA 3VUDA 4QMSA 4I92A 3RAIA 4IVBA 3QALE 1NVSA 4XV2A 4Y72A 3TIZA 2WOUA 3E7VA 1PXLA 5AP1A 3RPOA 1O6YA 3UMXA 2WMTA 3IW4A 5HCXA 4DBNA 3VBWA 4DH1A 2GCDA 3FC2A 1DI8A 3C7QA 5E4HA 3PXFA 1PKDA 1H1QA 3P5KA 2XK8A 5HORA 2UW7A 5AV4A 3SAYA 4DF3A 3NFFB 2J7TA 2HW7A 3AMBA 3ZBFA 3KRJA 3VUIA 4ZP5A 5C01A 3VRZA 4DBXA 4S33A 4D28A 1FBNA 4RZWA 1OL5A 3BYUA 2ZDUA 3CD8A 4NFMA 4O81A 4RIWB 3U6JA 4FEQA 3W10A 4K0YA 5DPVA 3EN5A 5AP5A 2F7ZE 3UC4A 4IZYA 3Q3BA 3EL8A 2JIVA 4AXDA 4FG8A 5HVKA 3I4BA 3OG7A 2DUVA 5ANJA 3FMLA 3ZHPC 4YSJA 3O51A 2PMNX 3DKFA 2QKWB 3UIXA 4F9AA 3PSCA 5HCYA 4E6AA 1Q8TA 2PHKA 1XBCA 3MPTA 4Z7GA 4Y83A 3MGYA 5AAFA 4A4LA 4BCQA 3OOGA 4JAJA 2PE2A 4EHVA 1OBDA 2HXQA 3DNEA 3EYHA 4NM3A 5T6KA 1PMVA 2I0YA 3KFAA 2B4SB 4IM3A 4LGGA 3ZO4A 4AN9A 5M4CA 5DRBA 3ZSIA 2X8DA 5IU2A 4S32A 5KE0A 5IEVA 1P5EA 3QCSA 2I7QA 4IAAA 3KF7A 3VQUA 4I1ZA 3VS0A 4AAYA 3A61A 4QMMA 4A4OA 5CALA 1WBNA 4F0GA 3WARA 2J5EA 2F7XE 2UZDA 2RF9A 3LAUA 5LARA 2XA4A 3NIEA 2OK1A 2R2PA 4EK6A 5AIRA 2O8YA 3FLYA 4ARKA 1FQ1B 3DK6A 1XH7A 4F7SA 3BL7A 4DH3A 3UC3A 1PXJA 3RNIA 3ULZA 3MIYA 3WF8A 3C4CA 4Z3VA 3IECA 3P78A 4JMQA 4JDHA 4F6SA 5C26A 3KEXA 4FEVA 4AOIA 4KUJA 4EEVA 4O7SA 2GFSA 2X81A 3A7JA 1M7NA 2J0JA 4X6RA 5CEKA 3FLZA 5CSPA 3HRBA 4QMPA 4Y5QA 3V6SA 5CU4A 2FYSA 2W1DA 3DB8A 3DKCA 4BDCA 3R8PA 4J53A 3NAXA 1JSUA 3RCDA 4D4VA 5T3QA 3RKBA 3Q2JA 4RX7A 4UZHA 3RAHA 4EZ7A 3LFQA 2J4ZA 3QHRA 4E8AA 4AGWA 2V5QA 5C8NA 4YC3A 5ETFA 2NO3A 3MH0A 4TPTA 3UDBA 4O0YA 4X3FB 3UQCA 1WAKA 3MH2A 4LYNA 3TCPA 3QYZA 1SVEA 2XKEA 2Z7SA 3LMGA 2XNNA 4IACA 3IGGA 5L2SA 2NRUA 3D94A 4PMMA 4J1RA 1APME 4G34A 2E9UA 4XV3A 5ITAA 4YTCA 4CFXA 3R7EA 2YIWA 4WUNA 2ITNA 4AZVA 4IX3A 2UZUE 3NSZA 2UVYA 2ITYA 2PVFA 2XAMA 4I6BA 2HOGA 3RHKA 5IMEA 4JBVA 4B6LA 3CEKA 4L68A 4U40A 3IW5A 1LR4A 4G3EA 4YJRA 4G31A 3D83A 1R78A 4GYGA 3UIBA 2UW3A 1WVXA 5EM8A 4C33A 1Q8ZA 4IH8A 1H01A 4MF1A 2VX3A 2XNPA 4XG9A 2VN9A 2XP2A 4QT1A 3UJGA 2C1AA 2X4FA 3A4OX 3UZTA 2QOBA 4CTCA 5D1JA 3R83A 5J95A 4G5JA 1TQMA 4F7NA 3Q9WA 1IEPA 4XRLA 4JX3A 1ZMWA 3VJNA 3DTWA 5DNRA 4QTDA 2GTNA 4ID7A 3VJOA 4DE4A 3VULA 5HNGA 4FTCA 1W7HA 1UV5A 5AUUA 2OG8A 3KXXA 2Y4IC 4HYHA 5G6VA 3L9PA 4J8MA 3H0ZA 3W0OA 4BCOA 2OWBA 4CZUA 1PXOA 1M2RA 2XAOA 2CDZA 4O7TA 1YDRE 4XG6A 5AFVA 2NPQA 2XNGA 3GCSA 1YWRA 4PDYA 4U97A 3RALA 3COHA 3WE8A 3IS5A 5JGDA 4FTOA 3UDTA 2VTRA 4YPSA 4YZNA 3VW8A 3Q60A 4HCTA 3VVHA 4EOOA 5IMXA 3NR9A 3W16A 5IQHA 3HMPA 3RWQA 3R8VA 3AD4A 4V0GB 2R4BA 3PG1A 4E5WA 1OVEA 2C3IB 1FOTA 3PA3A 3Q4CA 4TWCA 3R9DA 4FUXA 1I09A 5E8VA 4CVAA 5J9ZA 2UVZA 2CCIA 2C5XA 2R3FA 5CT0A 1M17A 2VTLA 4GVJA 2YCQA 2YM7A 4FV0A 1BKXA 2XBAA 3U4WA 2X7GA 4I3ZA 2RG6A 4EH6A 4C0TA 3MFRA 5EOLA 3QZGA 5AP0A 4RIYA 2C0TA 3UVRA 2ITUA 1ZOGA 4G2FA 2XK6A 1U54A 4O2ZA 4HVDA 4B99A 4DG3E 1FGKA 1URWA 3DZQA 3IGOA 1Q99A 3PZHA 3G9LX 4LRJA 4AOTA 4MVFA 4ZSLA 5LVLA 4AE6A 3OC1A 5CWZA 3DK3A 4GW8A 5K9IA 2EXMA 5F94A 1ND4A 2I40A 3I1AA 1VYZA 5HD7A 3UO4A 3WZKA 2ZAZA 3FLWA 1G8KA 5HQ0A 4BDFA 2YWVA 1HCLA 2GU8A 2W1ZA 3Q96A 4A4XA 3GC8A 3ACKA 2XK7A 2X6DA 5HIDA 1T46A 2FSMX 3MESA 2DQ7X 3BV3A 4USEA 3E88A 4IVDA 5JGBA 4CG9A 5IA2A 2ITVA 2ONLA 1NT2A 3L8VA 3G51A 4WBOA 4TW9A 3ML1A 3UOHA 3VC4A 5EQYA 3F5UA 1UU3A 1BI8A 2VWVA 4BI2A 3ENMA 4WBBB 3C4EA 5JT2A 1IRKA 3G2FA 2B7AA 5HCZA 2C0IA 4QYEA 4AXAA 4U81A 3W0QA 4KAOA 2GHGA 3ZRLA 3BV2A 5M08A 4AQCA 3SKCA 4P4CA 4EH9A 4EORA 4KKGA 4DFXE 5EDPA 4O0UA 5AM7A 1NXKA 1YOMA 4AW5A 3CY2A 3AT2A 4WZYA 2BRNA 3GC9A 3OW3A 3EKNA 3RP9A 2V22A 3H0YA 4BCGA 3C51A 2VTQA 5H9BA 4QTEA 2PK9A 2BZJA 3R2BA 1A48A 1IAJA 1YHWA 3PIYA 1L3RE 1OZ1A 3NYOA 1SNUA 2UV2A 3R2YA 1Q61A 3ZDIA 3BHUA 4DH8A 4CLJA 5HG5A 2WMSA 2WMUA 3COMA 3MB6A 5KZIA 4Z55A 2BAJA 1XH5A 1R39A 3PFQA 4F6UA 5AADA 4MNEB 2J0MB 4IW0A 2C69A 5CQUA 3PA5A 3QTXA 4O7OA 1XBAA 5HICA 5IH6A 3VBTA 2FB8A 3A7FA 2VWZA 4IAZA 2PZYA 2YN8A 5IF1A 3QC9A 3QX4A 1BL7A 5EQPA 5CENA 5IUGA 3LJ1A 2PVRA 1O6KA 4RQKA 4HVGA 2IVVA 2CLQA 3LXKA 4P5ZA 4OTRA 4FKLA 2ZB1A 4UZDA 2XM9A 4OUCA 2C6OA 3QTWA 5CU2A 3E64A 4FBXA 4FSNA 4FV1A 4C59A 4UY9A 3MWUA 1CDKA 3GQIA 4DFUA 3P4KA 3SLSA 2XIXA 3ZXZA 4JVGA 3JYAA 3VUHA 2PE1A 5ACBC 4EOKA 4BBEA 4EYMA 5LCKA 2EXCX 3MDYA 3GU6A 4FIEA 3EN4A 3MA3A 4WA9A 3DQXA 3BZ3A 4DLJA 5I9VA 3PP1A 3PG3A 3UOJA 3OY3A 3TM0A 2JKOA 3UNKA 2ZVAA 4GJ3A 4LOPA 1ZARA 5CAVA 3H10A 3F3TA 3HV7A 3NYNA 3R21A 3DXNA 2BZKB 5JSMA 3TDWA 2CMWA 4YZBA 4QNAA 4L3PA 3RNYA 4FTTA 1CKJA 3PE2A 3T9IA 5BVKA 3K2LA 3DQWA 2HY81 2WTDA 3HDNA 3ALNA 4GK2A 4EONA 2YITA 2XK3A 3R63A 4C58A 3R1SA 2R3GA 3EWHA 2JDOA 4LUEA 2X9EA 2ONLC 2JBPA 3C4WA 4XLVA 4DFYA 4TYGA 1H1RA 1GY3A 2YZAA 3ZLXA 1WVYA 2IJMA 2C6LA 2OXXA 2IZTA 3EFWA 1VYWA 3QUEA 3IDPA 3JUHA 2O2UA 5ETIA 5AP6A 3LCSA 4EQMA 1OPKA 3EMGA 5CXZA 5BX0A 5JQ8A 4ERKA 3WIGA 4ZJIA 4F9CA 2XCKA 4U80A 4RWJA 2GNJA 2V7AA 3PXKA 3MVJA 3UVPA 3S1HA 4FX3A 5A46A 4J96A 2ITQA 2QONA 3MY0A 4KKHA 3P86A 2B53A 3A7GA 5HNBA 5L6OA 1K9AA 3COIA 1PW2A 2XK9A 3LW0A 3HZTA 4RJ6A 5E90A 3R8ZA 2XANA 5EM5A 2R0IA 2UW4A 4P2KA 3G15A 3D7TB 4I5HA 4BTKA 2Q83A 1SM2A 5HBHA 1Y6AA 4CG8A 2REIA 1KOAA 4FIHA 2IZUA 4M0YA 1GZNA 4CLIA 2QOCA 5HZNA 4U8ZA 4Y5HA 4DGGA 5E92A 2R7BA 3PDTA 5EHLA 2CCHA 3R8LA 2GPHA 4FSWA 4YLKA 2C6DA 4XG8A 3DNDA 3M42A 3C4XA 1XO2B 3IPHA 3OCBA 1EH4A 5FBOA 4ZEGA 3TKUA 4AOJA 3PUFC 5BPYA 3H9FA 3ZFXA 4PWNA 3Q9YA 3DTCA 5HU9A 3LFCA 3ETAA 4O0SA 4QDVA 5M55A 5IG1A 5M07A 4UYNA 2CLXA 3ZC6A 4DH7A 5I9WA 3R22A 3EIDA 3LXNA 3L8PA 1K2PA 4KRDA 4KS8A 4AXFA 3U6HA 3OWLA 3FDNA 3MI9A 3ODYX 4D4RA 4GUEA 4QP8A 4FEWA 4G3DA 5J1WA 2OZAB 3T9TA 2XKFA 2YIXA 3AQVA 2YM6A 3I0QA 2VTJA 2W5BA 4MHAA 3B8RA 5CU6A 3S4QA 1BI7A 5D11A 4H39A 3P5JC 3CCNA 5LOHA 3C9WA 3PRFA 1PMNA 2C5YA 2QU6A 2XNMA 5KMLA 2VWYA 3R7OA 4G6OA 2CKQA 3TUDA 5HVYA 4I0SA 3FV8A 2LAVA 5DFPA 4USDA 3WOWA 3I0OA 4DN5A 5E8YA 1M7QA 5K5NA 2QOFA 2P0CA 1U4DA 1YXUA 3POZA 4RLKA 3ZSGA 4CQEA 3UOKA 3VF9A 2WO6A 4ACGA 5KMKA 4TYHA 4C34A 1OECA 2R9SA 2WU7A 4A07A 2RGPA 3LJ2A 4O6EA 3E63A 3NUAA 4CSVA 5E8ZA 4C36A 4E93A 4QYYA 4G1WA 4D1ZA 2PSQA 2XEZA 4O7VA 2BRMA 4RC3A 4AA5A 3OFMA 5CS6A 4DEHA 5LMKA 4LDTA 4QQCA 2I6LA