4DE4A

Crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with hepes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2")-Id
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4de4A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4de4A02
4FOCA 3BEAA 4XG2A 2BRGA 2UZOA 5HESA 3ZEWA 4YJPA 3WZKA 3AC3A 3AT2A 4QYGA 2YISA 3QD2B 3BHTA 3FZSA 3Q9WA 4IB1A 5M4CA 2IZUA 4RJ7A 3C7QA 5JZJA 3LQ5A 4QMYA 3TDWA 3DQWA 3ZCLA 3WZJA 5A4TA 1YXSA 4KUJA 5HCZA 3CPCA 3SV0A 4C2WA 2JKMA 2XNEA 3MVHA 3OS3A 1JSTA 3R00A 1VYZA 3MH3A 4MH7A 4YBKA 4F65A 4E4NA 3GB2A 4LI5A 3W1FA 1UNGA 2C3KA 3EN5A 5GJGA 2W5BA 4ZJVA 1H1SA 3MBLA 4X2KA 2JGZA 4X2GA 5IQEA 1M14A 2JITA 4DINA 4Y46A 2IZRA 5BUJA 5DT3A 3KRRA 4FKIA 2CGUA 4TWPA 4WT6A 1JKLA 1CSNA 1WBNA 2ITXA 3FJQE 4XNEA 3VJOA 5CF4A 4KBCA 2W4JA 3HLLA 4XLVA 3JUHA 4WKQA 2Z02A 3WF5A 4RIXA 3F2RA 2WOTA 4FIEA 4HYIA 3DLSA 1ZWSA 4DAWA 2J0JA 5L2TA 2X8IA 2PMIA 3JVSA 3O23A 3LHJA 2C0TA 1UA2A 4HPTE 4ALUA 4A9YA 2P2IA 3F5GA 2R7BA 2XK3A 3A7FA 5BNJA 2XVDA 3CKXA 4ZTSA 2C6MA 4FKSA 2X9EA 2PVNA 4O0VA 2C30A 2BROA 3LJ2A 5EQYA 4AZVA 3O17A 3W8LA 4G6OA 2Y0AA 4FZ6A 4AX8A 5LMKA 4Y5QA 3Q4CA 3G6HA 3ZRKA 3ZU7A 4J96A 2IG7A 4K77A 5FQDC 3PY3A 5CI7A 4IAZA 3E8NA 2C6OA 3CY3A 4OTRA 3R9DA 3VNTA 3VQUA 4UN0C 3H4JA 4TTHB 3WZDA 4NT4A 3DBQA 3TUCA 3PSCA 3VRZA 3SQQA 4BTFA 3CCNA 2BAQA 2HENA 3BPRA 3G5DA 2GNGA 2V7AA 5CXZA 5E92A 4QTBA 5HLNA 1LEZA 5LOHA 4ACGA 2ZMCA 2BAKA 3UG1A 5CQUA 4BGQA 1JLUE 4DGOA 2NNWB 1OM1A 4L3PA 5BUIA 2VV9A 3GI3A 4AGUA 2AYPA 4I0SA 5JGAA 2BDWA 4AN3A 2XZSA 3TCPA 2E9PA 3HYHA 4MTAA 3SC1A 5DRDA 5IQDA 4NKSA 5J7HA 1B39A 1KOBA 3MESA 4FA2A 3TDVA 1OMWA 3EYGA 4EH4A 3SXSA 1J91A 4O86A 5AP3A 3W2PA 2XUUA 3E93A 3PSDA 4ANQA 4DFNA 5DOSA 3ZUUA 3D0EA 4MBJA 1JKKA 1NXKA 2G2HA 4QP8A 3UP2A 4USDA 4RA4A 3BI6A 5CSVA 4GFGA 3V51A 5A4LA 5KMKA 3OTVA 4S31A 3QA0A 4I41A 3E63A 4QMZA 4BCFA 3LXPA 3I5ZA 4IIRA 3PXFA 5IQBA 1ZYSA 2FA2A 1R0PA 2Y9QA 3EZVA 3R9RA 3KY2A 5JRSA 2J2IB 3CD3A 4FSRA 4BDJA 4DFYA 4O7LA 4B8MA 2UVXA 2CCIA 3LZBA 4U43A 4ZTRA 1UU9A 2XYUA 4D4RA 3RTPA 5L6PA 4X21A 2JIVA 4S2ZA 1FVTA 2X4FA 4W4YA 4AA4A 5JFVA 4XS2A 3V8WA 4AT5A 3NUUA 2YM3A 5BVOA 4XRLA 4M8TA 2RFSA 4JI9A 5CX9A 4U5JA 3F66A 1JOWB 4IWDA 5FD2A 2G1TA 3FKLA 1J7IA 1HCLA 3FZPA 5DYJA 1YXTA 5ANEA 4IDTA 5KMIA 3DTCA 5AIRA 4YPSA 5FEQA 1H01A 2WEIA 4F7JA 4GK2A 1ZOGA 3I60A 3D2KA 2CKQA 1W8CA 4QYHA 3T3VA 3QTQA 3VUKA 4DEEA 2YAKA 3DXNA 3R21A 3KK8A 2QG7A 5EYMA 3U51A 4LV5A 3KRLA 1KE7A 4RT7A 1GAGA 3HMNA 1PMUA 2A4LA 4YZBA 3ZBXA 2JDOA 4V0GB 3DBDA 4R78A 4RQKA 3AMBA 3EYHA 5HCYA 4GUBA 3UC3A 4NFNA 2VO7A 3P7CA 5M55A 2XNBA 1W98A 1H1RA 2WTWA 4NJ3A 4RIWA 4D1SA 2I7QA 4UXQA 3PIYA 3LFNA 4GK3A 5HBEA 4DEHA 2XM9A 1IAJA 2B9JA 2W05A 2XNGA 4RBLA 3LFEA 3TIYA 4GK4A 5IMEA 5HE3A 3LFBA 1NY3A 3BRBA 2WMRA 4D2SA 4FUYA 4FEWA 3KRWA 3QTIA 3QZGA 3UZRA 4FTAA 4EHEA 1RQQA 3NR9A 4ANSA 5JQ8A 2F9GA 3QRTA 4QMLA 4NSTA 4L68A 3Q9XA 3TUBA 3BU5A 5HCXA 3DZOA 4YMJA 5AUUA 4F63A 1DM2A 4K9YA 3NLBA 4JQEA 3S00A 3SGCA 2JD5A 4ASDA 3DBEA 1IA8A 2W7XA 1PXIA 5HTBA 3QL8A 5C26A 2UW0A 3CEKA 3HA8A 4MVFA 3VHKA 2HWOA 3QRIA 1M2RA 4YUQA 5CAUA 5FTOA 4PDSA 3UVPA 4H1MA 3VBVA 4KRDA 4U8ZA 4R7HA 2RL5A 4CT2A 5CASA 4MEDA 2FVDA 3GT8A 5IU2A 3DKGA 4FK6A 4I5CA 3QAME 4BCMA 3QD0A 4C0TA 2YDJA 1XH5A 1XBCA 3ZXTA 5I0BA 1Y6BA 2QKWB 1OKYA 3RHKA 3COIA 3KXMA 4AW0A 1JKSA 3LW0A 2IPXA 2PULA 4FNYA 4H3PA 1OIQA 3VULA 2OG8A 3MFTA 2ZVAA 3KB7A 3KQ7A 2E9VA 4CQEA 3NCZA 4UALA 4WNKA 3ELJA 5KMJA 4IACA 5CU2A 2CKEA 3MFRA 4O7YA 3IONA 4ASZA 2W06A 3RCJA 5KO1A 4QTDA 4EHVA 5JMSA 5BVFA 2P33A 3CLYA 4TXCA 1VEBA 4QQTA 2BIKB 3IDPA 2JEDA 3KFAA 4FTOA 4GRBA 4PV0A 4L46A 4JLCA 3D14A 2DWBA 2C6TA 5BYLA 4AGDA 4TPTA 4FOBA 1YDSE 3G6GA 4XP3A 2C3LA 2YDKA 4FIJA 4CRLA 4AN9A 4F9YA 2G01A 3IO7A 4KIOA 4F6SA 1BI7A 4KS8A 2R3MA 4USEA 3D9VA 3FMEA 3Q6UA 5A54A 4JJRA 3KULA 2ONLC 3CKWA 3F5XA 2OLCA 2BIYA 4HGEA 4NYEA 2OJGA 4RJ3A 3FYKX 4IEBA 3EWHA 2X2MA 5BVNA 5IPJA 3FLQA 4MBLA 5FXRA 5F95A 3O8UA 2VTMA 3N4UA 4R5SA 4IAFA 5AP6A 4AA0A 3QUDA 1E9HA 4QYYA 3IECA 4AF3A 4BCJA 3D5XA 3UIMA 3JYAA 1V1KA 3UZPA 3ZLXA 2OXYA 5HO7A 3KEXA 1YI6A 3OXIA 3LPBA 5J95A 4OT5A 2QO9A 4F4PA 3O50A 4D4VA 1AQ1A 2OXDA 4O7NA 3HMOA 4FKOA 3GOPA 4OTGA 5F94A 2BZJA 3SA0A 4YNEA 4HYUA 2LAVA 3F9NA 4KNBA 1Q8ZA 3U4WA 3BV2A 3R73A 3D5WA 4C38A 1BX6A 2WPAA 4FTIA 1MQBA 4J8MA 4FT0A 1H0VA 4F7SA 4CKRA 5LXMA 1VYWA 4E4LA 5DFPA 1H07A 4ZJJA 3C51A 3PRFA 5FTQA 3HDNA 4XEYA 3AQVA 1GOLA 5C8NA 2F2UA 5M09A 2YCFA 1WVWA 3D94A 1OKWA 4DLJA 4FL2A 3UIBA 4J8NA 3G0FA 3A4OX 4JDKA 2ITTA 5AUZA 4LUEA 2IZSA 2XRUA 4QNYA 3FI3A 4EJNA 2PVMA 2XMYA 1W84A 3TWJA 4CV9A 5DVRA 2OJ9A 5E9EA 5HKMA 3QBNA 4DFZE 4YJNA 4RLLA 5BQ0A 4FKRA 5M08A 2I6LA 2Z60A 5L6WL 5IA3A 5IDNA 2CCHA 4MYGA 4QQ5A 4XG4A 5HLWA 3NSZA 4ZTNA 3VBWA 3ODZX 3UE4A 2GNIA 2Z7QA 3TL8A 3ZMMA 5HNGA 5EW8A 1IR3A 3DK3A 4FNWA 3OWJA 1PW2A 5AP1A 5IZFA 3P4KA 2VWVA 3QCQA 4M97A 2ETKA 4EH3A 2VX0A 4KBKA 2WMTA 2OXXA 3SRVA 3FY2A 4FE2A 5JGBA 3PJCA 2YERA 4JAJA 4BZOA 3HAMA 1SM2A 5HORA 1UU7A 2O5KA 3FMLA 3WE4A 3RK9A 3LQ3A 4O81A 2IVUA 2GPHA 2Y8OA 3EMGA 4IE9A 4XYFA 4AFEA 4LMNA 5KZ0A 3L9LA 3VS3A 5EKNA 4BVUA 4RJ8A 2PL0A 2OIDA 4YLJA 3ULZA 4DGNA 4G16A 3OCTA 1RE8A 3MPMA 4CLJA 2V55A 4O0RA 1TQPA 4NTTA 5CF8A 4TYHB 3COHA 3R71A 2XIXA 3PP0A 3FQSA 2ERZE 2QOLA 3SKCA 3TACA 3GGFA 4YTCA 2PTKA 3G9NA 5LVLA 4JBOA 4YU2A 4FODA 3BLRA 3W0MA 4BCOA 3PY1A 2A0CX 3Q32A 3V5PA 3PFQA 2IW8A 3HX4A 5D9HA 1ZZLA 4UV0A 2VTOA 2GQGA 4C3RA 2WNTA 3LMGA 2I1MA 3P23A 3DKFA 4CFNA 2J0IA 5H2UA 5ANOA 2CLXA 4W8DA 3VUHA 5A14A 2QVSE 2B55A 3Q2JA 3KXZA 1GNGA 4BBEA 2J0MB 1OI9A 2OWBA 2PUIA 4QMOA 5CZHA 1U4DA 2X7GA 1A06A 1PKDA 2Y4IC 2OI4X 1WBSA 4O82A 4M15A 2O2UA 4BDCA 5A9UA 2PVHA 3IW8A 4MD7E 4AG8A 2LGCA 5DI1A 3Q04A 5CSXA 5ACBC 3HV7A 4BDEA 3VJNA 3EQCA 4U44A 4HW7A 5LVNA 3TUDA 3W16A 3OCBA 3I0OA 3UYSA 3ZM9A 3VS0A 1VR2A 4DEDA 3QF9A 5L8KA 4NL0A 5DPVA 3FUPA 3COMA 3NYXA 3UO6A 3RGFA 4BB4A 3R8VA 2XCKA 4K8AA 4ZP5A 4HVDA 3BEGA 3CR0A 4QP4A 3GU4A 3BWFA 2Z7SA 3W55A 4EONA 4DEAA 4LFIA 4HVGA 2Y6MA 4V04A 5M44A 3M42A 4YTHA 1MP8A 4G3EA 2PMLX 3OBGA 1QPCA 4N0SA 4C34A 3BLQA 3CIKA 4GS6A 1OUYA 2WIPA 4TWNA 4DBNA 4JIAA 5DRBA 3U9NA 3PRIA 3VC4A 4MXYA 4O96A 4B7TA 4YURA 4CFMA 2QR8A 3GNIB 5CF5A 1OL1A 5I5ZA 3DV3A 3F7WA 3R2YA 4FTMA 5BVDA 2Z7LA 3KVWA 4E8AA 3ANRA 4EHGA 4BTJA 3BBTB 2X6DA 1JQHA 3MY1A 5LMBA 2F7XE 4E20A 4QTEA 3FMKA 4NZWB 4XJ0A 3GU7A 4FV6A 4IVAA 4ZTMA 4C3PA 4R3PA 4TN6A 3PA4A 4NTSA 4MQ1A 5HU9A 1SYKA 2WTCA 3TNIA 1PYXA 3W2CA 3MTLA 4O0UA 4Y83A 1KSWA 4V0GA 4FV4A 3POOA 3BHUA 2R0UA 5E8YA 5M06A 4O0XA 3QKMA 3GC9A 1U54B 1GZKA 3ETAA 3IGOA 1P2AA 5EM5A 3UQGA 5DT0A 5GHVA 3W2SA 3ZEPA 3C4EA 2PSQA 2VD5A 2VNYA 4Z55A 3OT3A 1OL6A 3FMDA 4GYIA 4RWJA 3ULIA 4KD1A 5HTCA 3QQLA 2PE1A 4ZSEA 1DI8A 1WMKA 5FDXA 3CSVA 3FZTA 5TT7A 1WBWA 4FL3A 4KSPA 4QMQA 2B52A 1XBAA 1GIHA 4K11A 3PA5A 4A7CA 1REKA 5FEEA 3VUMA 4UZDA 2YIYA 5DA3A 5AUVA 4AGCA 3UOJA 1P4FA 2J7TA 1ZYJA 3D83A 4JG8A 3IW4A 3ZS5A 3LXKA 2VNWA 2A27A 3GENA 1O6KA 4O22A 5HD7A 3NAYA 3TV4A 4BDIA 4C33A 1UVRA 3UOKA 2XNOA 4XH6A 3RAHA 3I1AA 5JSMA 5J87A 3TNHA 4X6QC 3UMXA 3P7BA 4KKHA 3AT3A 3LXLA 4E7WA 4RSSA 4DITA 1JAMA 1QCFA 3OY1A 4EK6A 4BICA 2QU5A 3PXYA 4R5YA 3C4CA 2VWYA 2ZM3A 5HX6A 1WBVA 2P0CA 3I6UA 2QOOA 3O2MA 2XIKA 4WNMA 4F1OA 3FLYA 5J5SA 4BBFA 3P5KA 5KMMA 3DA6A 3UP7A 3HVCA 2C1BA 2XKDA 3EFWA 4DH3A 4I6QA 2FB8A 4G5JA 4D28A 3OUNB 3C0GA 4ZXTA 5IQCA 2DUVA 4BN1A 2P55A 4N57A 1SZMA 4U7ZA 3S3IA 2ZV8A 3G2FA 2YDIA 3JVRA 3PE1A 4IWPA 3MB6A 2EXMA 1R78A 4DGLC 4XG9A 4ZK5A 2IWIA 3HP5A 5FDPA 2WU7A 4H3QA 4GIHA 4PL3A 1KE8A 2JFMA 4PMTA 4C2VA 4IM0A 4P7EA 3OOMA 4WNOA 2FSOX 3UMWA 1HOWA 3FI8A 3FZ1A 5AUXA 2F57A 3BLHA 1IASA 3MVMA 2WELA 2QLQA 1F0QA 4ENYA 2C0OA 4ZTQA 3RHXA 3S4QA 4CD0A 2B53A 2EVAA 3K5VA 3MFUA 3UNKA 1YQJA 1TQIA 5HIEA 5M56A 2ITWA 2YABA 4U97A 4HJOA 3R7YA 4JBPA 2UZVA 3KC3A 4TYIA 2W1FA 2QC6A 1DS5A 1DI9A 4QMWA 3QRUA 3QQFA 3MN3A 4R7IA 2WMBA 3R28A 4FTLA 4L42A 3R9HA 4CFUA 3NYVA 3ALNA 3ACKA 5E8UA 5CENA 3TNWA 4FSWA 3ZFYA 4GUEA 4F0GA 2YA9A 3CPBA 5FTGA 3RINA 4U3ZA 2CDZA 5E8WA 5I9VA 5KE0A 4MCVA 5B2KA 3OROA 4R6VA 2WTJA 4OUCA 1PRYA 3JY0A 1QPEA 4UWBA 4JQ8A 1URCA 4XV1A 4TYGA 3UO4A 5A6OA 5CEOA 1ERKA 3E62A 3REPA 2XCHA 4HZSA 4AZTA 1CM8A 4FV5A 4CFWA 3OC1A 5IQAA 3EH9A 5ETCA 4QP6A 4FI1A 3RPVA 3WIGA 5AM7A 5IUGA 3EKKA 1OL5A 2BDJA 1GZOA 4GYGA 4YJVA 3KXHA 3LIJA 2B9IA 2OJIA 1J7UA 2ZJWA 3IOPA 1OVEA 5K4JA 4E4XA 1YRPA 3ORKA 2YM7A 2ZM1A 4RIYA 3RPOA 2YFXA 2J5FA 5CF6A 3AMYA 4RWLA 3BELA 4CMTA 2WMUA 4IZYA 1H24A 2YCRA 2X1NA 1YDRE 1YI4A 2JKQA 4ACCA 3QU0A 2GHMA 3AD6A 1H8FA 2O64A 1G3NA 2XF0A 4FC0A 1STCE 3PG1A 3ZSGA 5CAOA 3W32A 4EYJA 2WHBA 5C4KA 4RC3A 3I7BA 3NGAA 3SD0A 1U59A 1ZARA 3LCTA 3MYGA 4O7ZA 2ZDUA 4PTEA 4IZ7A 3DGKA 3W0NA 2YACA 4YC3A 5HE1A 4MAOA 4ZSJA 4PTCA 4BIBA 4RJ4A 4DG3E 4B99A 4FT5A 5AA8A 2GS7A 4KIQA 3R2BA 2ITPA 3LE6A 5AADA 3VS7A 3RAKA 1YXVA 2HW7A 5KNJA 3BBWA 3DOGA 3R9OA 4MD8E 2O3PA 5B2LA 5I9ZA 4M14A 3UIUA 2GMXA 2Y4PA 4LV8A 2GQSA 3POZA 4QNAA 2W4KA 3HUCA 3OWLA 4E5WA 3F82A 3Q52A 1Z57A 5HU3A 2W0JA 1FOTA 3E3BX 2CKPA 2VGOA 5C8MA 1YWRA 4Z7GA 3ROYA 4CEGA 5HGIA 4EKKA 2YHVA 3C0IA 5HO8A 4MXAA 1OUKA 4I6BA 1XO2B 4FKPA 3N4TA 2QLUA 4PL5A 4EZ7A 5KX8A 4EZ5A 4FTNA 5AEPA 5EI8A 4E5AX 2OJFE 3M1SA 2WGJA 4NCTC 5EW9A 3NVMB 4F7LA 3COKA 1KE5A 3AGLA 3DBCA 3GU6A 4E6AA 3VAPA 2GU8A 3KK9A 4FYOA 5M4IA 1APME 1ZOHA 4FEVA 4I0TA 4WNPA 3UVRA 4PDOA 4ASEA 1OBGA 3MI9A 3A62A 4U40A 2NP8A 4BBMA 2HZIA 2Y4IB 3A60A 4TYHA 4W4XA 5CEIA 2QI8A 4EI4A 4ZAUA 2R3NA 1OECA 2X0GA 3TKHA 2GNLA 3MB7A 1M52A 4UBAA 1YHWA 4C4HA 4QP1A 3NW5A 4IW0A 5EDQA 4L43A 4RJ6A 3EL8A 4DN5A 3Q5IA 3EQDA 1K9AA 5FP6A 2H96A 3CJGA 3H10A 4TKSA 4M3QA 1CKIA 5AP0A 3F3UA 3JY9A 3ZZEA 2Q83A 3VUDA 1OPJA 2EXCX 3R0TA 4HGSA 4P5ZA 1XWSA 4WRSA 1ZYCA 3LMHA 3P0MA 4QO9A 2HAKA 2BZIB 4DHFA 4IC7A 4BY9E 4HCUA 4NWMA 1U5RA 4C3FA 4QTCA 5HQ0A 5I4NA 4C7TA 4X0MA 4J53A 2XB7A 5JZNA 4D0XA 2YN8A 3LQ8A 3PDTA 5E8VA 3GU8A 2WAJA 3LCKA 3OHTA 3T9TA 1Q5KA 5KMOA 4ENXA 2J5EA 4NIFB 3ATTA 3MIYA 2VO3A 4BDKA 3QC4A 5EQPA 4DF3A 3R63A 5JGDA 4EOQA 1UU3A 5ANIA 2BRHA 4BCKA 3UDBA 2BHHA 3FEGA 3DFAA 4DE4A 4CV8A 4JS8A 2RF9A 5T6KA 2EB2A 3C50A 4CTBA 5AAFA 4HCTA 3F6XA 1Q62A 4DCEA 2EUFB 4TWCA 5K3YA 3AT4A 1PXOA 2X81A 2R9SA 3BKBA 3CE3A 3EFJA 1H26A 2G9XA 3KXXA 3MPAA 3ORTA 3PVBA 1PY5A 4I24A 2PPQA 4N70A 5AX3A 4FEUA 2R3JA 3CQWA 3BGQA 3KMMA 3CY2A 4J99A 4F1TA 4OT6A 2UUEA 4GL9A 5T3QA 3ZO3A 3ORIA 4CRSA 2VO6A 5DWRA 4QP3A 3ZBFA 3S2PA 1ZLTA 1REJA 2R3PA 4M13A 3A7JA 5LMAA 4EKLA 2HXQA 4I5HA 1Q8WA 5HEZA 3FWQA 3BGPA 4TYEA 3W0RA 4GVJA 3A61A 3HRBA 3LVPA 3TV6A 5DNRA 2BRMA 3A7GA 3W8QA 2YEXA 3LJ1A 2CLQA 4I6FA 5M4FA 5AAEA 3QFVA 2GCDA 2X9FA 4IX5A 4C36A 4Y8DA 4MWHA 4YGAA 4H3BA 3U8WA 1YKRA 3M11A 3EN6A 3QYZA 4BC6A 2W1EA 4R7BA 4DFBA 3OD6X 4P4CA 3F3TA 4TT7A 3TTJA 3DBFA 3U6JA 3RAWA 5F1ZA 4ZY5A 3PVWA 4EH7A 5LMKC 4USFA 2CGVA 2OICA 4FIHA 3I0QA 3ZO2A 2BHEA 3I4BA 1Y6AA 2R3GA 5L8LA 5JFXA 5EDPA 2SRCA 5C1QB 2Q0BA 2X7OA 3O0GA 3PXQA 2GHLA 3R02A 4HCVA 3D2IA 3UO5A 2VX3A 2XNPA 1PXNA 4GT3A 1ZY4A 2ZMDA 4YC6A 4ZZOA 4M67A 4G6NA 4IM2A 3W0OA 4YO4A 2J51A 4FZDB 4XV2A 5L6OA 2J6MA 2X4ZA 4BGHA 3Q4UA 4RX5A 4EL9A 3CQEA 1T46A 3IW7A 3PVGA 4DBXA 4Q9ZA 4QQCA 2YIWA 2OZOA 1VZOA 3PPJA 4F9BA 4WD5A 4O7PA 4FV3A 2A19B 5AUWA 4DH1A 5L2IA 2WB8A 2UW6A 1E1XA 2W1GA 4MF1A 4TY1A 2AC3A 1BKXA 3BWJA 3OWKA 4GKHA 4S34A 3W2QA 4U81A 3HNGA 4PMMA 5L2SA 3BU3A 3FHRA 3N51A 4UYNA 1XH4A 5CNNA 4O0SA 3OVVA 3TXOA 4QYEA 4ORKA 1IEPA 1PXPA 4M0ZA 3UPZA 2ONLA 5CEQA 3P9JA 3B8RA 3LM5A 3RCDA 2WU6A 2YIXA 4EC8A 2R5TA 4U45A 5D10A 3SAYA 4Y73A 4O0YA 2QOFA 2XP2A 3DDQA 3G0EA 2VWXA 2J50A 3ID6C 1YWVA 3C0HA 4OW8A 1GY3A 2BUJA 2BR1A 4J1RA 1M7NA 4GFMA 2QHNA 4U6RA 4D2RA 5J8IA 3HECA 2C6KA 3ERKA 5M4UA 5A4EA 4MK0A 4IAAA 2RG6A 4HNIA 4N4SA 4RVKA 4CKIA 5LQFA 5FGKA 1JSVA 1R1WA 3ROCA 2OH4A 2CPKE 4PX6A 1HCKA 2BMCA 5EKOA 4GG7A 3TV7A 3U6HA 2C3JA 4CZUA 4LOQA 4HVIA 4FZ7A 5A6NA 3GFEA 5AA9A 4X2JA 3FC1X 3PIZA 2VU3A 1JPAA 3LKMA 2ITUA 3T8OA 2YM8A 3FYJX 2ZV9A 5J9ZA 3AC2A 5DEWA 2JKKA 4L45A 2B0QA 4UX9A 2IVVA 1FBNA 2WQEA 4XOYA 3R8LA 3WIKA 5BVKA 3OW4A 2PZRA 4BI1A 2HELA 2VTPA 4CCBA 4JR7A 4BTKA 4QMPA 3LFFA 5DE2A 5IQIA 2PMOX 5JH6A 3KL8A 2UVYA 3TI1A 4MX9A 3C9WA 2WFYA 4EH2A 2VTLA 2PHKA 2YITA 3I7CA 3OXTA 2PU8A 2YM4A 4FEQA 4I5PA 3EQHA 2HOGA 4OR5A 2PWLA 3RWPA 1BUHA 3KRJA 2W96B 1L8TA 3HRFA 3OBJA 4RJ5A 3TZ9A 1F5QA 1U5QA 1QMZA 3ZC5A 4ZOGA 4S30A 3A7HA 4O38A 4IWOA 5AV1A 3FLNC 5HE2A 3WF8A 5TR6A 3S0OA 2PYWA 4EUTA 5E7RA 4GFOA 4ASXA 5DBXA 4I23A 3R01A 3FBVA 4U41A 4U98A 5CU4A 4ERWA 2R0IA 2XRWA 2Y7JA 3QRKA 3V6SA 4CMUA 1NVRA 4EOPA 5BPYA 5CVHA 3Q6WA 4KBAA 3QTZA 2GNHA 1DAWA 3W18A 2C6IA 4G6LA 3KCKA 4XBUA 4YSMA 2C47A 3EFLA 3EQRA 4DG0E 4MNEA 1LR4A 2V7OA 3K5UA 4X3FC 2X8DA 3WZEA 5L8JA 3R83A 3W10A 1J7LA 4YTFA 3QHWA 2NO3A 5EOLA 3G33A 4FV7A 4UZHA 2A2AA 4KSQA 4TWOA 5ANDA 3II5A 2VWBA 5HBJA 2CSNA 4J98A 4NM3A 2YIQA 1J1BA 1WAKA 3R7OA 4E4MA 3NZ0A 4Y95A 2JLDA 2C5OA 2ITOA 4FVRA 4KS7A 2C5YA 4AWIA 4I1ZA 5CT7A 3PVUA 4U94A 1JKTA 2PE2A 3MJ2A 1BI8A 2EB3A 4FZAB 3QD4A 1GZNA 5DEYA 5HI2A 4BDHA 3F3VA 4EOMA 3LMIA 4IX3A 3L9MA 4XBRA 4EYMA 4EJ7A 4ZY6A 4AE6A 5BX0A 3HP2A 3WBLA 4IVBA 2UZDA 3KRXA 3QWKA 4KKEA 1FGIA 3SG9A 2WTDA 4H36A 4JRNA 3GQIA 4FKLA 3A8XA 2W1CA 4BYIA 4DT9A 3V6RA 2GHGA 5AV0A 4CSVA 3C1XA 5AWMA 4ZLOA 4G2FA 2E9OA 5GIPE 4JXFA 3ZUTA 5AP2A 5CS6A 2QU6A 3KREA 5BYYA 3BCEA 3LLTA 4ZY4A 3LFAA 4F99A 4BGGA 3NUYA 2O0UA 3PWYA 4EOJA 3BYVA 4Y5HA 3QQKA 3R7VA 5L2WA 4APPA 5E90A 4EHZA 3NNUA 3FHIA 1KV1A 4O7SA 3OEZA 4JX7A 2IJMA 4RWKA 4FSUA 2X39A 2GFCA 4YJSA 5TF9A 2DYLA 4FT3A 4IVCA 3PXZA 3EQIA 4II5A 4FNXA 5CEKA 2C5XA 3NW6A 4FTCA 3EJ1A 4G3GA 4I21A 4YPDA 5D7AA 3E7VA 5LCJA 4UY9A 4R1VA 4R1YA 2GNJA 3NDMA 2YCSA 5E8TA 1W7HA 3TM0A 3BHYA 2HYYA 2R3LA 4NM7A 2VWUA 5EM6A 5EI2A 3OXZA 3NIEA 4DC2A 4GIIA 3CTQA 2OU7A 2QG5A 3JXWA 2ETRA 3NPCA 4IMYA 3DDPA 3HV6A 4W4WA 5I9UA 5LWNA 1UU8A 1P4OA 4Y85A 4BTMA 4LL0A 2OF4A 4F64A 3MY5A 3UNZA 3SW7A 5ETFA 3QRJA 3OFMA 2UW7A 3HKOA 4I0RA 2WTKC 4D1ZA 1H28A 3Q60A 3U87A 5EDRA 4O7RA 2WMVA 4J52A 4L00A 2JIIA 3H0ZA 3ZLWA 4O83A 5E8XA 2JDTA 3UVQA 3ZOSA 5HG7A 3CBLA 3HRCA 4TZRA 2EWAA 5EM8A 1Q8TA 3Q3BA 5E1EA 2JC6A 3K54A 4GT5A 5FUTA 4XG6A 4E5BA 2OKRA 3K3JA 4S32A 4RIXB 3AMAA 5IA0A 4O0TA 4RC4A 4XG8A 1RW8A 3VF9A 2PZIA 4PWNA 4EOOA 3BGZA 4A4LA 5LVPA 3ORMA 2QR7A 4EOKA 4ITIA 5IQHA 4CG8A 4M7IA 2YM5A 1V0OA 3U54A 4M84A 4L44A 4FSTA 4FYNA 2ZV7A 4G3DA 5AV2A 1U46A 3WF7A 5BVWA 4FKJA 2C5VA 3MWUA 4I93A 3F3WA 2UW3A 4G17A 4I5MA 1OIRA 4LGHA 3FXWA 5H8GA 4FIIA 5CYIA 5JT2A 2YZAA 4RG0A 3FMMA 2R3HA 3F2NA 4QP9A 5D7VA 4IZ5A 5LARA 2R2PA 3O7LB 1AGWA 2WO6A 3QALE 4JX3A 3GCVA 3H9OA 4L52A 3HZTA 4MWIA 5D41A 3THBA 4C4GA 4G1WA 2WOUA 3F69A 1LUFA 4O0WA 3FQEA 4OTWA 2WIHA 2FSTX 2P2HA 4DA5A 4DEGA 5K4IA 5CQWA 4BZDA 4ZS0A 2VTNA 2R3OA 4XHKB 3OY3A 2I0HA 2JDVA 1Q4LA 2PUUA 1WVYA 3PWDA 3Q96A 3ACJA 4KRCA 5DLSA 5KHWA 2R7IA 3GBZA 4BRXA 1YI3A 1BMKA 3BHVA 4O84A 4F70A 1OL2A 2WMWA 5A4CA 3PP1A 2UW9A 3NNXA 5IF1A 5F20A 3C13A 1NW1A 1SVHA 3ZC6A 3ZXZA 4JBQA 2CGXA 2ZOQA 3MH0A 4QT1A 2VTRA 5KKRC 2XJ1A 2J0LA 3DK6A 3EHAA 3FLZA 1I44A 2WMQA 4IB0A 4JDHA 1FMKA 3FPMA 4FVPA 3E87A 5CXHA 1P5EA 4R3CA 3A4PA 4RVLA 3DJ5A 2W1IA 2FSMX 4XV9A 5LVMA 5K5XA 4FG9A 3V3VA 1CTPE 2BRNA 5C01A 3SG8A 4JDIA 4X3JA 2OSCA 4D58A 4FTJA 4FKTA 2W9ZB 3ZO1A 1ZMVA 5KBRA 3NVKI 4PF4A 4GU6A 3FL4A 3R8UA 4QMNA 1UWJA 3PXRA 4ZSGA 3WF9A 3ZO4A 1WZYA 1MUOA 4YNOA 4NJDA 5GJFA 3F61A 2VTQA 2QONA 4CTCA 4ZZMA 5AV3A 4DH8A 4WG3A 4WOVA 3U6IA 3D7ZA 3DNEA 3SXFA 2OZAB 2V22A 4EEVA 1OBDA 4M69B 5AP7A 4HNFA 3SVVA 3QUEA 4L53A 5FG8A 3GCSA 3C4ZA 1EH4A 1QPDA 2ZB1A 4IVDA 2F7ZE 2Z8CA 4L6QA 4M12A 3DPKA 2G2IA 4Q5HA 3PPZA 3V8SA 4WO5A 4FICA 3A99A 3GC7A 4AZWA 5HG8A 4AXAA 1PXLA 2CN5A 3B2WA 5HIBA 2VZ6A 4L7FA 4HVHA 5KHXA 3UQFA 4DGGA 2R3QA 1W83A 2HZ0A 1UKIA 4IAIA 2XNNA 2NRUA 2JKOA 3KMWA 2ZV2A 3VIDA 4YO6A 2G15A 4A06A 2UW5A 3ANQA 3PZEA 4TNDA 4EH5A 3DB6A 2O63A 2W1HA 4D5KA 4I92A 3Q53A 3MSSA 5IEYA 3RPRA 3DS6A 4XRJA 5IG1A 4K0YA 5KUPA 2C6LA 3QCSA 4BDGA 4F0FA 5G1XA 3RKBA 2RGPA 4XMOA 3ZLYA 4PP7A 5TOZA 3R1YA 1H1WA 2C6DA 4QMUA 4EOLA 4FSZA 3Q9ZA 4OTFA 2FO0A 1CKPA 4IANA 5FRIA 4FKGA 4V01A 5GINE 2H34A 3BYSA 5E4HA 3H9FA 4I20A 3A7IA 4OBOA 3NW7A 3A2CA 4P90A 3RNIA 1ZYDA 4Z16A 2PVFA 5AUYA 4D5HA 4DFLA 1M7QA 2OW3A 1ATPE 2F4JA 3T9IA 5B2MA 4GKIA 3MVJA 1Q41A 2IW9A 2OIQA 5K5NA 3FDNA 4XCUA 5DH3A 3HA6A 3QXOA 3HMPA 3KU2A 3PJ3A 1TKIA 2GNFA 3P1AA 4HVSA 3GCUA 4A9RA 3FL5A 5I9XA 4KINA 3LOKA 4DTAA 4MXCA 5FEDA 4O7TA 3LM0A 3HGKA 4X3FB 4EWHA 3LXNA 5HD4A 4G34A 3GP0A 4AA5A 3R30A 5TO8A 3NAXA 3R7UA 2B7AA 2VTSA 2QD9A 1TQMA 2HXLA 3PJ8A 5C4LA 3UJGA 3QCXA 5KZIA 3VBTA 4IBMA 3UQCA 4O7OA 3SW4A 3PZHA 2ERKA 2UVZA 4HZRA 1FGKA 1CMKE 2CHLA 4I4FA 5CU6A 4PDYA 4AOIA 4IHPA 4KIPA 4PRJA 3CD8A 5BMSA 4ACMA 2IO6A 4G31A 2QCSA 5CZIA 2B9HA 3FXZA 5I9WA 5CANA 1UV5A 5DIAA 4G5PA 2VWZA 4PNIA 4ZTLA 2ZB0A 3DAJA 5AIKA 1WCCA 4RZVA 3F7ZA 4FGRA 5CEPA 1IAHA 2ZYBA 4JG7A 4YP8A 1FVRA 3O96A 4TW9A 1H25A 4EBWA 3BX5A 4RX8A 5EH0A 3SLSA 5FLFA 4JR3A 2FUMA 4BF2A 3V5TA 1Y91A 2C5NA 3HDMA 4IADA 4WSYA 5CVFA 3VF8A 3AC8A 3UNJA 5D1JA 5M57A 5KMNA 4RFZA 1Q3DA 1ZAOA 5CNOA 2W4OA 3R9NA 2VO0A 3RJCA 3BHHA 3ZDUA 4ACDA 4CNHA 4DGMA 3MTFA 5H8BA 3UBDA 4OBPA 3IDBA 4U42A 4YJRA 2O8YA 4NW6A 3Q4ZA 5D12A 3FSKA 3O71A 4A9UA 3F3ZA 3QLGA 4JOAA 5F4NA 5J9YA 3I6WA 1YW2A 2Q0NA 4AW1A 3W2RA 1PMEA 2B4SB 1J1CA 2AUHA 3OUKA 3CC6A 1Q3WA 2X8EA 3LJ0A 4NCTA 5ITAA 5CEMA 3TZ8A 2XJ2A 3HEGA 2XYNA 1QPJA 5G6VA 1LP4A 4AS0A 4EK8A 3R6XA 2ITZA 2GS6A 5A46A 1JNKA 3DY7A 3OWPA 2XIRA 2BRBA 2CNVA 4C4IA 4QMSA 4UB7A 4QMMA 3PJ1A 5DG5A 2B9FA 3OT8A 4UWYA 4ZMEA 4TL0A 3EQBA 4ERKA 4QMVA 3WILA 3ZM4A 3FXXA 3QTWA 2GS2A 2BTSA 1Q8YA 3DKOA 4C35A 4KKGA 3RI1A 2WTKB 3RVGA 2B54A 4FSYA 2XH5A 3QTRA 2ACXA 4RFYA 4XP2A 4AZEA 4C4FA 4CGAA 3EZRA 4DLIA 5ETIA 4PDPA 1V0PA 2ZAZA 2QKRA 5CVGA 4JNWA 3VN9A 3FSFA 2BZHB 1ZRZA 4C02A 3G90X 1PJKA 4PP9A 4QP7A 2OO8X 3EIDA 3OMVA 5IA2A 3BYOA 2VTTA 3O8TA 2I0YA 4F0IA 4AGWA 3FMNA 3W0PA 5B0XA 3D7TB 4L67A 4PL4A 4GG5A 2GQRA 3P79A 4OTDA 3FKNA 5EI6A 2XJ0A 5EQEA 2BFXA 4PY1A 1XKKA 4H39A 2RG5A 4APCA 2HW6A 4NKAA 3VWAA 2IZTA 4JG6A 5BVEA 2WMXA 3JS2A 3EN9A 4FUXA 2H6DA 3NUXA 4FIFA 4FSQA 2QOBA 3QTUA 1UNLA 2BFYA 4FSMA 1Q61A 3W0SA 5CSHA 3PG3A 1ZOEA 3FAAA 4LQMA 3DB8A 3M2WA 3IPHA 5FP5A 4D4SA 3LLAA 4KA3A 2HWPA 2YJSA 5HG9A 4JQ7A 1BLXA 1O6YA 4A9TA 5HZNA 3SRVB 5DR6A 3W2OA 4X7QA 1FINA 3D5VA 3MH2A 2CGWA 2QOKA 3QCYA 3CQUA 3MA6A 4IJPA 3VW8A 1OKVA 3E8CA 3L1SA 3QGWA 4IFGA 4EQCA 3TYKA 4PUZA 1MRUA 4L8MA 5AP4A 4S33A 4J71A 5HVJA 4IM3A 5IUIA 4QTAA 3MGYA 4WRGA 2PVLA 3BQCA 3CTJA 3OP5A 1IRKA 3QTXA 3TZMA 1YOMA 2YM6A 3MJ1A 3QTSA 3FQHA 3D5UA 2QO2A 4I3ZA 4PMSA 2XBAA 5DR2A 3TNPC 4EORA 3OF0A 4GVAA 3GEQA 4AAAA 2R64A 4AU8A 2XK7A 4ANBA 3AD5A 5K9IA 3KVXA 5HG5A 3RMFA 4ZS4A 1K2PA 4M68A 4KWPA 3H9RA 1WVXA 4YHTA 1UWHA 3OEFX 2PZYA 4B4LA 3NIZA 3QZIA 4MBIA 5CSWA 1CDKA 2ESMA 5KKRB 4RGJA 3VUGA 4CVAA 1Q24A 1GZ8A 3ENHA 4FKUA 4KAOA 4L7SA 4RMZA 3KN6A 1LPUA 2OBJA 2JBPA 2GSFA 3MDYA 4KB8A 3DJ7A 1G8SA 2H8HA 3C4FA 3AGMA 4AOTA 1YWNA 1OITA 5EHLA 4CZTA 1GJOA 4LRJA 2XK6A 2BALA 3PIXA 2QOQA 4DH5A 2E9NA 4E1ZA 5JK3A 3R7EA 4AFJA 4BCIA 3KMUA 2GTNA 4IFCA 3ZFMA 1KE9A 4FEXA 2J90A 3E3PA 2UZBA 4CXAA 3EN4A 2JIUA 4F09A 4EH6A 2PVKA 5J9LA 2FSLX 2WQOA 5IA1A 4FTUA 3NRMA 2RFEA 4DFUA 3C4WA 3I81A 1M2QA 4G9RA 5FXQA 1PKGA 4FX3A 3I5NA 5AM6A 4RX9A 4F9WA 3VQHA 3VBQA 4NUSA 3FMHA 5HX8A 1PMNA 3QLFA 2O65A 2OFVA 4LMUA 2WQNA 5T68A 4ALWA 1XJDA 4O6EA 1ZZ2A 3NNVA 3GQLA 2C1AA 5IA4A 2JDRA 4YHFA 4BCPA 3QGYA 2PE0A 4ZEGA 4IB5A 4C4EA 4CCUA 3OG7A 4K18A 4UXLA 4WUAA 5AMNA 4EK3A 4ZLYA 1BYGA 2DQ7X 2UW8A 4FTRA 3IOKA 1GIJA 5C8KA 3F88A 4TYJA 3TTIA 1XH9A 4L01A 2XK4A 2H9VA 4X2FA 1U54A 3QX2A 4XX9A 1ND4A 4BDBA 1IG1A 3DCVA 2QOHA 3NUAA 3O8PA 4X6RA 5C27A 2VUWA 4U0IA 3F2AA 3WYXA 1KWPA 3B8QA 1AD5A 2VWIA 3ZRLA 5GIOE 1YXXA 3CTHA 4OTIA 5FM2A 3U9CA 3ZUVA 5EHOA 5CU0A 2OZAA 4O91A 2V0DA 5LCKA 1F3MC 2CNUA 1OGUA 1A9UA 4EQUA 3BQRA 3VS6A 4UYAA 5IQFA 4AW2A 3WZUA 2PY3A 3F5UA 4JAIA 2W1ZA 4Z7HA 4WBBB 3E5AA 2I0VA 4QP2A 4OTHA 3KCFA 4BI2A 3DLZA 2WMAA 4BCQA 1OB3A 2R3RA 3DTWA 3ENMA 1H00A 1WBPA 4ZSAA 1PHKA 3FV8A 3GVUA 3B2TA 4HGTA 4ONAA 1MQ4A 4Q2AA 3VBXA 3VS4A 4G3FA 4BDAA 4EZ3A 1CKJA 4G3CA 3WF6A 5EOBA 4ZIMA 3QQGA 4AE9A 5A4QA 5LWMA 4DEIA 5EK7A 1SVGA 4WG5A 2OIBA 4EK5A 4YZ9A 5ANKA 4B9DA 3EQPA 3GC8A 4MXOA 4RLKA 3E8EA 2F49A 2X2LA 3EL7A 3VW6A 3G9LX 4BIEA 2HZNA 4O7WA 3ZFXA 2BKZA 4RA5A 3DNDA 3PJ2A 3R8PA 2FGIA 3IW6A 3LCOA 4I4EA 4LOPA 1OL7A 5EW3A 4E26A 4NU1A 2KTYA 4WBOA 2J9MA 4R77A 2WKMA 3W0QA 3U4UA 3TT0A 4BCHA 5IH5A 4WHZA 3ZDIA 4HOKA 3EOCA 1K3AA 5IA5A 2YIRA 3BU6A 4XLIA 4NM0A 5HVKA 2VWWA 5CAPA 2YAAA 2OGVA 1SMHA 1H08A 2AC5A 2GFSA 3CS9A 3IS5A 5CI6A 3VS1A 4FGBA 1OIYA 3E64A 2Z7RA 1UKHA 2GDOA 2XIZA 3EB0A 3AXWA 2ITYA 3GU5A 5FXSA 4ARKA 4AQCA 5JQ5A 3DKCA 4YLLA 2PVRA 2VX1A 1ZY5A 5IH4A 4FTTA 2BDFA 4X3FA 3PXKA 3RAIA 4DTKA 1H27A 3PTGA 3WYYA 4Z3VA 4DT8A 1JSUA 3KKVA 3P08A 1PXKA 3P7AA 3V5QA 4OGRA 5JFWA 3PY0A 2XK9A 3R1SA 4BDFA 1TVOA 4J95A 2ITVA 3R22A 2QO7A 3WE8A 3E92A 1ZMUA 3RALA 2WTIA 3L9PA 2XBJA 2QODA 4I22A 3SDJA 3RK5A 3BYUA 3TEIA 3V5JA 4PQNA 1T45A 3S1HA 2W9FB 3SXRA 4K1BA 2P4IA 5C9CA 1RDQE 4F7NA 4G9CA 5HICA 2JAVA 2QOIA 3AG9A 3BZ3A 3PSBA 4RWIA 5JRQA 2YWVA 3H30A 3LAUA 4MD9E 2UZEA 3R1NA 2W99B 2UZTA 2FH9A 3GCPA 4FK3A 2XKFA 3Q2MA 4HYHA 5I9YA 5IDPA 4GV1A 3QUPA 1RJBA 2BCJA 2X2KA 3V01A 5ICPA 4D9TA 3ORPA 3NUSA 3QZFA 4GH2A 4BZNA 4XUFA 2X7FA 4RVTA 3UOHA 4IZAA 3V04A 4GSBA 3TZ7A 1PYEA 1P14A 4JRVA 3KA0A 2HIWA 4QRCA 3RWQA 4LYNA 4LGGA 2XKEA 4U79A 5DR9A 4FT9A 3C5IA 2YWPA 1YOLA 3UOLA 4YTIA 5CAVA 3D15A 3QC9A 4GMYA 3MFSA 2JDSA 3UTOA 2BVAA 4C4JA 5CLPA 4TRLA 3UZTA 3G51A 5BMMA 1BL6A 4ZSLA 2ITNA 4YZCA 3MA3A 4DFXE 1OPLA 2WTVA 3SOAA 3ORLA 4QMTA 4F6UA 2JBOA 2VAGA 3DXQA 3V5WA 5LJJA 4DYMA 4UWCA 4J97A 5H3QA 4C58A 4YJTA 3E8DA 1X8BA 3AOXA 2R3FA 3DZQA 4YC8A 3UG2A 4GEOA 5M53A 4IQ6A 5ETAA 4YBJA 4FV9A 4JL9A 1R0EA 4PNKA 1PXMA 4Z9LA 3GC0A 3IGGA 2XS0A 1XH7A 2Z2WA 3NS9A 5EM7A 4IDVA 4L3JA 1WBTA 4F9AA 4DG2E 3MPTA 1YXUA 3JPVA 4RIYB 4LG4A 5FM3A 3ZLSA 2R4BA 4DEBA 5J1VA 4FKQA 1SNXA 3RM6A 3NYOA 3H3CA 4FV0A 2B1PA 2XM8A 3ORNA 2FYSA 3RK7A 4BYJA 3WI6A 4FG7A 4IAKA 5GJDA 3RZBA 2BPMA 3ITZA 3KF4A 2HY81 2VTJA 4OTQA 4F9CA 2QURA 4ITHA 3ALOA 4P5QA 2NPQA 3MH1A 5IH6A 3NUPA 2OFUA 5HLPA 4A4OA 4U80A 5DGZA 5IEXA 3D7TA 4BCGA 3BIZA 5AJQA 1XQZA 2PUNA 2VTAA 3KF7A 4FSNA 2ITQA 4AACA 4XG3A 3R7IA 3R04A 2QNJA 2BZKB 2BILB 2A1AB 1JVPP 3ORZA 2PK9A 2IVSA 4JT3A 5EYDA 3ZHPC 3FI4A 2C69A 3SX9A 1YVJA 3HMMA 2WD1A 5FBOA 3NWWA 3NNWA 5IQGA 4O6LA 2OK1A 3R8ZA 4RQVA 3IQ7A 1JWHA 3R1QA 3UODA 3WARA 3PLSA 4BHZA 3NX8A 3MS9A 2OF2A 4C62A 3DQXA 5HVYA 1KE6A 1QL6A 3DT1A 4L3LA 2VN9A 3EN7A 4QYFA 1Y57A 2WMSA 4FIGA 2PVJA 3GXLA 3KGAA 3RPSA 1O9UA 4OLIA 4D4YA 3TN8A 3MW1A 2UV2A 4ZZNA 3S95A 3WOWA 5DHJA 3TKUA 4FV2A 4D1XA 5EG3A 4ID7A 3PA3A 1XHAA 3P78A 4EC9A 1PF8A 2NRYA 3VS2A 3A8WA 3I79A 2W5HA 1Q99A 3L8SA 4BR3A 5KMLA 4CLIA 3MV5A 2P3GX 2F7EE 4AT4A 3LFCA 2YCQA 4L9IA 2XA4A 3KXGA 1NA7A 3ZTXA 3UPXA 3EQGA 3RM7A 4AOJA 2CNQA 3AC1A 1Q97A 2PVYA 4ZMFA 2ZDTA 4WUNA 4AT3A 1I09A 3IG7A 3DK7A 2WZJA 3DXPA 3LFQA 1ZMWA 4O7VA 3OW3A 2PUPA 3MY0A 2BTRA 3OCSA 3GUBA 1Z5MA 3FI2A 4IWQA 3HUBA 4FZFB 1ZXEA 5AV4A 1Q8UA 1NT2A 2QQ7A 2VTHA 3BYMA 5AP5A 4B6LA 3CXWA 3GOKA 1GIIA 5DT4A 4EBVA 2XEZA 4HPUE 4FMQA 3DAKA 3QXPA 3TIZA 4A07A 3CP9A 4K6ZA 5CY3A 2XK8A 3VBYA 5JFSA 3PPKA 5KBQA 3KXNA 5LVOA 3LFSA 2QOCA 1KV2A 4DCAA 3HL7A 5EYKA 1W82A 1V0BA 1WBOA 4ALVA 4YZNA 2CJMA 2IW6A 4BKJA 3QKKA 1L3RE 3PUPA 4GW8A 3LCDA 4F6WA 2E9UA 2OJJA 1W0XC 4GT4A 2IN6A 2ETMA 2HY0A 2VRXA 3ET7A 3Q5ZA 4O2PA 4RIOA 4FG8A 4ACHA 4AZSA 4IB3A 4MXZA 3GFWA 1WFCA 5EYCA 5AAGA 4IAYA 1NVSA 2WQMA 2W5AA 4B0GA 4BHNA 3SHEA 2C4GA 4MNFA 4FTKA 4MHAA 2V62A 1FQ1B 5A3XA 4FR4A 4YZDA 1XH6A 4CFXA 3FC2A 5AUTA 4D0WA 4E6QA 4NM5A 3R8MA 3TNQB 2CMWA 4EQMA 1OPKA 3QWJA 3UIXA 4NW5A 4I6HA 3FZRA 5FBNC 3O51A 3L8PA 1S9IA 3TJCA 4MQ2A 2CN8A 4IX4A 3HV5A 5JKGA 4FL1A 2C3IB 1H1PA 3G15A 1DAYA 4UEUA 4QPSA 3CGOA 5GNKA 3LFDA 3BV3A 4GJ2A 1M2PA 3FE3A 5AFVA 2E2BA 3FY0A 1NVQA 5H9BA 2J4ZA 4C37A 2PZPA 5H8EA 3T3UA 4WZYA 4NFMA 5BYZA 4DTBA 4E6DA 4FBXA 2R3KA 5D11A 3K3IA 4FV8A 4LM5A 2BKKA 2JFLA 3HAVA 4ANLA 3UGCA 3NYNA 1J3HA 4AW5A 3PLAE 4YSJA 3Q4TA 4H1JA 5TKDA 4J7BA 4C59A 3E7OA 4YJUA 2VGPA 1OKZA 3VVHA 4N6YA 4AUAA 3Q9YA 3OTUA 5JEBA 2XEYA 3ZSHA 3KN5A 3OCGA 4LOOA 2IVTA 3QQJA 3OZ6A 4O21A 2X6EA 4RZWA 4U3YA 1MRVA 2QHMA 3PYYA 3LCSA 4HGLA 4P2KA 4XV3A 4YHJA 1KUTA 3FKOA 4M0YA 1B6CB 4XP0A 1XR1A 4AP7A 1H4LA 2UZWE 4QPAA 5F9EA 2HCKA 4WIHA 4CT1A 1YHVA 4BIDA 5CTPA 5HHWA 3TJDA 5ANJA 4IH8A 2WEVA 1OZ1A 1YOJA 3DAEA 4ZTHA 5HIDA 1B38A 1XBBA 3FPQA 3N4VA 4PMPA 4YLKA 4LUDA 3DU8A 3RP9A 2W17A 4MKCA 4E6CA 4RIWB 4EOIA 5E1SA 1URWA 1SVEA 3IDCA 3ODYX 2VTIA 4EUUA 4RC2A 4W8EA 4BDDA 4ITJA 5JN2A 5M51A 4YJOA 2JAMA 3ZZWA 2YJRA 1O6LA 3V8TA 4U9AA 4H05A 4EOSA 3D4QA 1IA9A 4Q5EA 3N9XA 4K33A 4CFFA 3VHEA 2HZ4A 3ZONA 1PMVA 3ZSIA 4RRVA 5CT0A 1BL7A 3MVLA 3JR1A 2RKUA 3E88A 2XKCA 3QYWA 3QQUA 4D55A 1KOAA 1FPUA 3QX4A 3RPYA 3HMIA 3H0YA 2UZNA 4KABA 4MXXA 4JBVA 1M17A 3NMUF 4RFMA 2J0KA 4RPVA 4A9SA 4FTQA 1YDTE 3IKAA 1LEWA 3QZHA 4BI0A 4D9UA 1R3CA 5ACKA 3L8VA 4GJ3A 3FLWA 1H1QA 4TNBA 3PE2A 3VO3A 5ANGA 5IUHA 5E91A 4NH1A 2YZLA 4I94A 4LL5A 2I0EA 4OBQA 3NUNA 2DS1A 4HYSA 4IC8A 4Q9SA 3CGFA 3QHRA 3ORXA 2RFDA 2Y6OA 1S9JA 3BE2A 4AZFA 4Y72A 4JVGA 4FT7A 5C03A 3ZRMA 3CJFA 3SOCA 5M07A 4BCNA 4QQJA 4N6ZA 3U55A 3UYTA 2ZM4A 4K2RA 4E93A 1JBPE 5DN3A 3GCQA 3P86A 4B8LA 5KCVA 5AX9A 4ZLZA 4AN2A 2BAJA 4XOZA 4WA9A 2RIOA 3EKNA 3FZOA 1Z9XA 5CWZA 4X2NA 1OIUA 2V5QA 5E8ZA 4FV1A 3O7LD 4GCJA 3HV3A 2UZLA 5CALA 4LRKA 2C6EA 3VS5A 3L9NA 2EU9A 4FVQA 4YR8A 2OH0E 4EH9A 4E73A 3K2LA 4PTGA 5E8SA 5CU3A 4R3RA 1YHSA 5HE0A 1H0WA 5HBHA 1PXJA 1XH8A 2WQBA 4CKJA 2PMNX 3IW5A 3C5UA 1SNUA 2XIYA 3TKIA 1FMOE 3KULB 3V5LA 3AC5A 5CSPA 3VUIA 4F1MA 2W1DA 3AC4A 4FKWA 2KULA 3EQFA 4RVMA 5IISA 3UC4A 4EWQA 2C0IA 2C68A 3VRYA 4V05A 4O2ZA 3IK3A 3ZYAA 3ZH8A 5B7VA 3QKLA 5L3AA 5HNIX 4CMOA 2PZ5A 3EFKA 4A4XA 2I40A 4LRMA 1Y8YA 3OOGA 2R3IA 2CKOA 1VJYA 4ANMA 2UZUE 4IJ9A 4YZMA 4WG4A 4JIKA 4RX7A 4H58A 2GTMA 1R39A 4QOXA 4XG7A 4GU9A 4CFVA 4F08A 2RFNA 5J1WA 1MRYA 3AD4A 4C61A 4O27B 5EFQA 3FLSA 3NCGA 3DFCB 3W33A 4FKVA 4MNEB 3BE9A 3MIAA 5EHYA 4CG9A 5CAQA 4ZJIA 2G2FA 1Y8GA 1UNHA 4IX6A 4EK4A 5IMXA 3QQHA 4NK9A 2HK5A 2F2CB 1G8AA 2REIA 4QMXA 1A48A 4DH7A 3QA8A 1E1VA 4JDJA 4EH8A 5IEVA 3C4XA 3L8XA 1G5SA 3FMJA 4FNZA 3TG1A 5HNBA 3HV4A 3ATSA 3F5PA 2UW4A 4W4VA 5BUEA 2WXVA 3DJ6A 4YJQA 1FVVA 3NEWA 3QD3A 2XNMA
chains in the Genus database with same CATH superfamily
4FOCA 3BEAA 4XG2A 2BRGA 2UZOA 5HESA 3ZEWA 4YJPA 3WZKA 3AC3A 3AT2A 4QYGA 2YISA 3QD2B 3BHTA 3FZSA 3Q9WA 4IB1A 5M4CA 2IZUA 4RJ7A 3C7QA 5JZJA 3LQ5A 4QMYA 3TDWA 3DQWA 3ZCLA 3WZJA 5A4TA 1YXSA 4KUJA 5HCZA 3CPCA 3SV0A 4C2WA 2JKMA 2XNEA 3MVHA 3OS3A 1JSTA 3R00A 1VYZA 3MH3A 4MH7A 4YBKA 4F65A 4I6LA 4E4NA 3GB2A 4LI5A 3W1FA 1UNGA 2C3KA 3EN5A 5GJGA 2W5BA 3AKLA 4ZJVA 1H1SA 3MBLA 4X2KA 2JGZA 4X2GA 5IQEA 1M14A 2JITA 4DINA 4Y46A 2IZRA 5BUJA 4AW0A 5DT3A 3KRRA 4FKIA 2CGUA 4TWPA 4WT6A 1JKLA 1CSNA 1WBNA 2ITXA 3FJQE 4XNEA 3VJOA 5CF4A 4KBCA 2W4JA 3HLLA 4XLVA 3JUHA 4WKQA 2Z02A 3WF5A 4RIXA 3F2RA 2WOTA 4FIEA 4HYIA 3DLSA 1ZWSA 4DAWA 2J0JA 5L2TA 2X8IA 2PMIA 3JVSA 3O23A 3LHJA 2C0TA 1UA2A 4HPTE 4ALUA 4A9YA 2P2IA 3F5GA 2R7BA 2XK3A 3A7FA 5BNJA 2XVDA 3CKXA 4ZTSA 2C6MA 4FKSA 2X9EA 2PVNA 4O0VA 2C30A 2BROA 3LJ2A 5EQYA 4AZVA 3O17A 3W8LA 4G6OA 2Y0AA 4FZ6A 4AX8A 5LMKA 4Y5QA 3Q4CA 3G6HA 3ZRKA 3ZU7A 4J96A 2IG7A 4K77A 5FQDC 3PY3A 5CI7A 4IAZA 3E8NA 2C6OA 3CY3A 4OTRA 3R9DA 3VNTA 3VQUA 4UN0C 3H4JA 4TTHB 3WZDA 4NT4A 3DBQA 3TUCA 3PSCA 3VRZA 3SQQA 4BTFA 3CCNA 4AAYA 2BAQA 2HENA 3BPRA 3G5DA 2GNGA 2V7AA 5CXZA 5E92A 4QTBA 5HLNA 1LEZA 5LOHA 4ACGA 2ZMCA 2BAKA 3UG1A 5CQUA 4BGQA 1JLUE 4DGOA 2NNWB 1OM1A 4L3PA 5BUIA 2VV9A 3GI3A 4AGUA 2AYPA 4I0SA 5JGAA 2BDWA 4AN3A 2XZSA 3TCPA 2E9PA 3HYHA 4MTAA 3SC1A 5DRDA 5IQDA 4NKSA 5J7HA 1B39A 1KOBA 3MESA 4FA2A 3TDVA 1OMWA 3EYGA 1ST4A 4EH4A 3SXSA 1J91A 4O86A 5AP3A 3W2PA 2XUUA 3E93A 3PSDA 4ANQA 4DFNA 5DOSA 3ZUUA 3D0EA 4MBJA 1JKKA 1NXKA 2G2HA 4QP8A 3UP2A 4USDA 4RA4A 3BI6A 3KIOC 5CSVA 4GFGA 3V51A 5A4LA 5KMKA 3OTVA 4S31A 3QA0A 4I41A 3E63A 4QMZA 4BCFA 3LXPA 3I5ZA 4IIRA 3PXFA 5IQBA 1ZYSA 2FA2A 1R0PA 2Y9QA 3EZVA 3R9RA 3KY2A 5JRSA 2J2IB 3CD3A 4FSRA 4BDJA 4DFYA 4O7LA 4B8MA 2UVXA 2CCIA 3LZBA 4U43A 4ZTRA 1UU9A 2XYUA 4D4RA 3RTPA 5L6PA 4X21A 2JIVA 4S2ZA 1FVTA 2X4FA 4W4YA 4AA4A 5JFVA 4XS2A 3V8WA 4AT5A 3NUUA 2YM3A 5BVOA 4XRLA 4M8TA 2RFSA 4JI9A 5CX9A 4U5JA 3F66A 1JOWB 4IWDA 5FD2A 2G1TA 3FKLA 1J7IA 1HCLA 3FZPA 5DYJA 1YXTA 5ANEA 4IDTA 5KMIA 3DTCA 5AIRA 4YPSA 5FEQA 1H01A 2WEIA 4F7JA 4GK2A 1ZOGA 3I60A 3D2KA 2CKQA 1W8CA 4QYHA 3T3VA 3QTQA 3VUKA 4DEEA 2YAKA 3DXNA 3R21A 3KK8A 2QG7A 5EYMA 3U51A 4LV5A 3KRLA 1KE7A 4RT7A 1GAGA 3HMNA 1PMUA 2A4LA 3AKKA 4YZBA 3ZBXA 2JDOA 1TFFA 4V0GB 3DBDA 4R78A 4RQKA 3AMBA 3EYHA 5HCYA 4GUBA 3UC3A 4NFNA 2VO7A 3P7CA 5M55A 5BV3A 2XNBA 1W98A 1H1RA 2WTWA 4NJ3A 4RIWA 4D1SA 2I7QA 4UXQA 3PIYA 3LFNA 4GK3A 5HBEA 4DEHA 2XM9A 1IAJA 2B9JA 2W05A 2XNGA 4RBLA 3LFEA 3TIYA 4GK4A 5IMEA 5HE3A 3LFBA 1NY3A 3BRBA 2WMRA 4D2SA 4FUYA 4FEWA 3KRWA 3QTIA 3QZGA 3UZRA 4FTAA 4EHEA 1RQQA 3NR9A 4ANSA 5JQ8A 2F9GA 3QRTA 4QMLA 4NSTA 4L68A 3Q9XA 3TUBA 3BU5A 5HCXA 3DZOA 4YMJA 5AUUA 4F63A 1DM2A 4K9YA 3NLBA 4JQEA 3S00A 3SGCA 2JD5A 4ASDA 3DBEA 1IA8A 2W7XA 1PXIA 5HTBA 3QL8A 5C26A 2UW0A 3CEKA 3HA8A 4MVFA 3VHKA 2HWOA 3QRIA 1M2RA 2XANA 4YUQA 5CAUA 5FTOA 4PDSA 3UVPA 4H1MA 3VBVA 4KRDA 4U8ZA 4R7HA 2RL5A 4CT2A 5CASA 4MEDA 2FVDA 3GT8A 5IU2A 3DKGA 4FK6A 4I5CA 3QAME 4BCMA 3QD0A 4C0TA 2YDJA 1XH5A 1XBCA 3ZXTA 5I0BA 1Y6BA 2QKWB 1OKYA 3RHKA 3COIA 3KXMA 3TMOA 1JKSA 3LW0A 2IPXA 2PULA 4FNYA 4H3PA 1OIQA 3VULA 2OG8A 3MFTA 2ZVAA 3KB7A 3KQ7A 2E9VA 4CQEA 3NCZA 4UALA 4WNKA 3ELJA 5KMJA 4IACA 5CU2A 2CKEA 3MFRA 4O7YA 3IONA 4ASZA 2W06A 3RCJA 5KO1A 4QTDA 4EHVA 5JMSA 5BVFA 2P33A 3CLYA 4TXCA 1VEBA 4QQTA 2BIKB 3IDPA 2JEDA 3KFAA 4FTOA 4GRBA 4PV0A 4L46A 4JLCA 3D14A 2DWBA 2C6TA 5BYLA 4AGDA 4TPTA 4FOBA 1YDSE 3G6GA 4XP3A 2C3LA 2YDKA 4FIJA 4CRLA 4AN9A 4F9YA 2G01A 3IO7A 4KIOA 4F6SA 1BI7A 4KS8A 2R3MA 4USEA 3D9VA 3FMEA 3Q6UA 5A54A 4JJRA 3KULA 2ONLC 3CKWA 3F5XA 2OLCA 2BIYA 4HGEA 4NYEA 4BJJB 2OJGA 4RJ3A 3FYKX 4IEBA 3EWHA 2X2MA 5BVNA 5IPJA 3FLQA 4MBLA 5FXRA 5F95A 3O8UA 2VTMA 3N4UA 4R5SA 4IAFA 5AP6A 4AA0A 3QUDA 1E9HA 4QYYA 3IECA 4AF3A 4BCJA 3D5XA 3UIMA 3JYAA 1V1KA 3UZPA 3ZLXA 2OXYA 5HO7A 3KEXA 1YI6A 3OXIA 3LPBA 5J95A 3UDZA 4OT5A 2QO9A 4F4PA 3O50A 4D4VA 1AQ1A 2OXDA 4O7NA 3HMOA 4FKOA 3GOPA 4OTGA 5F94A 2BZJA 3SA0A 4YNEA 4HYUA 2LAVA 3F9NA 4KNBA 1Q8ZA 3U4WA 3BV2A 3R73A 3D5WA 4C38A 1BX6A 2WPAA 4FTIA 1MQBA 4J8MA 4FT0A 1H0VA 4F7SA 4CKRA 2AEGA 5LXMA 1VYWA 4E4LA 5DFPA 1H07A 4ZJJA 3C51A 3PRFA 5FTQA 3HDNA 4XEYA 3AQVA 1GOLA 5C8NA 2F2UA 5M09A 2YCFA 1WVWA 3D94A 1OKWA 4DLJA 4FL2A 3UIBA 4J8NA 3G0FA 3A4OX 4JDKA 2ITTA 5AUZA 4LUEA 2IZSA 2XRUA 4QNYA 3FI3A 4EJNA 2PVMA 2XMYA 1W84A 3TWJA 4CV9A 5DVRA 2OJ9A 5E9EA 5HKMA 3QBNA 4DFZE 4YJNA 4RLLA 5BQ0A 4FKRA 5M08A 2I6LA 2Z60A 5L6WL 5IA3A 5IDNA 2CCHA 4MYGA 4QQ5A 4XG4A 5HLWA 3NSZA 4ZTNA 3VBWA 3ODZX 3UE4A 2GNIA 2Z7QA 3TL8A 3ZMMA 5HNGA 5EW8A 1IR3A 3DK3A 4FNWA 3OWJA 1PW2A 5AP1A 5IZFA 3P4KA 2VWVA 3QCQA 4M97A 2ETKA 4EH3A 2VX0A 4KBKA 2WMTA 2OXXA 3SRVA 3FY2A 4FE2A 5JGBA 3PJCA 2YERA 4JAJA 4BZOA 3HAMA 1SM2A 5HORA 1UU7A 2O5KA 3FMLA 3WE4A 3RK9A 3LQ3A 4O81A 2IVUA 2GPHA 2Y8OA 3EMGA 4IE9A 4XYFA 4AFEA 4LMNA 5KZ0A 3L9LA 3VS3A 5EKNA 4BVUA 4RJ8A 2PL0A 2OIDA 4YLJA 3ULZA 4DGNA 4G16A 3OCTA 1RE8A 3MPMA 4CLJA 2V55A 4O0RA 1TQPA 4NTTA 5CF8A 4TYHB 3COHA 3R71A 2XIXA 3PP0A 3FQSA 2ERZE 2QOLA 3SKCA 3TACA 3GGFA 4YTCA 2PTKA 3G9NA 5LVLA 4JBOA 4YU2A 4FODA 3BLRA 3W0MA 4BCOA 3PY1A 2A0CX 3Q32A 3V5PA 3PFQA 2IW8A 3HX4A 5D9HA 1ZZLA 4UV0A 2VTOA 2GQGA 4C3RA 2WNTA 3LMGA 2I1MA 3P23A 3DKFA 4CFNA 2J0IA 5H2UA 5ANOA 2CLXA 4W8DA 3VUHA 5A14A 2QVSE 2B55A 3Q2JA 3KXZA 1GNGA 4BBEA 2J0MB 1OI9A 2OWBA 2PUIA 4QMOA 5CZHA 1U4DA 2X7GA 1A06A 1PKDA 2Y4IC 2OI4X 1WBSA 4O82A 4M15A 2O2UA 4BDCA 5A9UA 2PVHA 3IW8A 4MD7E 4AG8A 2LGCA 5DI1A 3Q04A 5CSXA 5ACBC 3HV7A 4BDEA 3VJNA 3EQCA 4U44A 4HW7A 5LVNA 3TUDA 3W16A 3OCBA 3I0OA 3UYSA 3ZM9A 3VS0A 1VR2A 4DEDA 3QF9A 5L8KA 4NL0A 5DPVA 3FUPA 3COMA 3NYXA 3UO6A 3RGFA 4BB4A 3R8VA 2XCKA 4K8AA 4ZP5A 4HVDA 3BEGA 3CR0A 4QP4A 3GU4A 3BWFA 2Z7SA 3W55A 4EONA 4DEAA 4LFIA 4HVGA 2Y6MA 4V04A 5M44A 3M42A 4YTHA 1MP8A 4G3EA 2PMLX 3OBGA 1QPCA 4N0SA 4C34A 3BLQA 3CIKA 4GS6A 1OUYA 2WIPA 4TWNA 4DBNA 4JIAA 5DRBA 3U9NA 3PRIA 3VC4A 4MXYA 4O96A 4B7TA 4YURA 4CFMA 2QR8A 3GNIB 5CF5A 1OL1A 5I5ZA 3DV3A 3F7WA 3R2YA 4FTMA 5BVDA 2Z7LA 3KVWA 4E8AA 3ANRA 4EHGA 4BTJA 3BBTB 2X6DA 1JQHA 3MY1A 5LMBA 2F7XE 4E20A 4QTEA 3FMKA 4NZWB 4XJ0A 3GU7A 4FV6A 4IVAA 4ZTMA 4C3PA 4R3PA 4TN6A 3PA4A 4NTSA 4MQ1A 5HU9A 1SYKA 2WTCA 3TNIA 1PYXA 3W2CA 3MTLA 4O0UA 4Y83A 1KSWA 4V0GA 4FV4A 3POOA 3BHUA 2R0UA 5E8YA 5M06A 4O0XA 3QKMA 3GC9A 1U54B 1GZKA 3ETAA 3IGOA 1P2AA 5EM5A 3UQGA 5DT0A 5GHVA 3W2SA 3ZEPA 3C4EA 2PSQA 2VD5A 2VNYA 4Z55A 3OT3A 1OL6A 3FMDA 4GYIA 4RWJA 3ULIA 4KD1A 5HTCA 3QQLA 2PE1A 4ZSEA 1DI8A 1WMKA 5FDXA 3CSVA 3FZTA 5TT7A 1WBWA 4FL3A 4KSPA 4QMQA 2B52A 1XBAA 1GIHA 4K11A 3PA5A 4A7CA 1REKA 5FEEA 3VUMA 4UZDA 2YIYA 5DA3A 5AUVA 4AGCA 3UOJA 1XMLA 1P4FA 2J7TA 1ZYJA 3D83A 4JG8A 3IW4A 3ZS5A 3LXKA 2VNWA 2A27A 3GENA 1O6KA 4O22A 5HD7A 3NAYA 3TV4A 4BDIA 4C33A 1UVRA 3UOKA 2XNOA 4XH6A 3AKJA 3RAHA 3I1AA 5JSMA 5J87A 3TNHA 4X6QC 3UMXA 3P7BA 4KKHA 3AT3A 3LXLA 4E7WA 4RSSA 4DITA 1JAMA 1QCFA 3OY1A 4EK6A 4BICA 2QU5A 3PXYA 4R5YA 3C4CA 2VWYA 2ZM3A 5HX6A 1WBVA 2P0CA 3I6UA 2QOOA 3O2MA 2XIKA 4WNMA 4F1OA 3FLYA 5J5SA 4BBFA 3P5KA 5KMMA 3DA6A 3UP7A 3HVCA 2C1BA 2XKDA 3EFWA 4DH3A 4I6QA 2FB8A 4G5JA 4D28A 3OUNB 3C0GA 4ZXTA 5IQCA 2DUVA 4BN1A 2P55A 4N57A 1SZMA 4U7ZA 3S3IA 2ZV8A 3G2FA 2YDIA 3JVRA 3PE1A 4IWPA 3MB6A 2EXMA 1R78A 4DGLC 1VLRA 4XG9A 4ZK5A 2IWIA 3HP5A 5FDPA 2WU7A 4H3QA 4GIHA 4PL3A 1KE8A 2JFMA 4PMTA 4C2VA 4IM0A 4P7EA 3OOMA 4WNOA 2FSOX 3UMWA 1HOWA 3FI8A 3FZ1A 5AUXA 2F57A 3BLHA 1IASA 3MVMA 2WELA 2QLQA 1F0QA 4ENYA 2C0OA 4ZTQA 3RHXA 3S4QA 4CD0A 2B53A 2EVAA 3K5VA 3VONA 3MFUA 3UNKA 1YQJA 1TQIA 5HIEA 5M56A 2ITWA 2YABA 4U97A 4HJOA 3R7YA 4JBPA 2UZVA 3KC3A 4BJJA 4TYIA 2W1FA 2QC6A 1DS5A 1DI9A 4QMWA 3QRUA 3QQFA 3MN3A 4R7IA 2WMBA 3R28A 4FTLA 4L42A 3R9HA 4CFUA 3NYVA 3ALNA 3ACKA 5E8UA 5CENA 3TNWA 4FSWA 3ZFYA 4GUEA 4F0GA 2YA9A 3CPBA 5FTGA 3RINA 4U3ZA 2CDZA 5E8WA 5I9VA 5KE0A 4MCVA 5B2KA 3OROA 4R6VA 2WTJA 4OUCA 1PRYA 3JY0A 1QPEA 4UWBA 4JQ8A 1URCA 4XV1A 4TYGA 3UO4A 5A6OA 5CEOA 1ERKA 3E62A 3REPA 2XCHA 4HZSA 4AZTA 1CM8A 4FV5A 4CFWA 3OC1A 5IQAA 3EH9A 5ETCA 4QP6A 4FI1A 3RPVA 3WIGA 5AM7A 5IUGA 3EKKA 1OL5A 2BDJA 1GZOA 4GYGA 4YJVA 3KXHA 3LIJA 2B9IA 2OJIA 1J7UA 2ZJWA 3IOPA 1OVEA 5K4JA 4E4XA 1YRPA 3ORKA 2YM7A 2ZM1A 4RIYA 3RPOA 2YFXA 2J5FA 5CF6A 3AMYA 1G8KA 4RWLA 3BELA 4CMTA 2WMUA 4IZYA 1H24A 2YCRA 2X1NA 1YDRE 1YI4A 2JKQA 4ACCA 3QU0A 2GHMA 3AD6A 1H8FA 2O64A 1G3NA 2XF0A 4FC0A 1STCE 3PG1A 3ZSGA 5CAOA 3W32A 4EYJA 2WHBA 5C4KA 4RC3A 3I7BA 3NGAA 3SD0A 1U59A 1ZARA 3LCTA 3MYGA 4O7ZA 2ZDUA 4PTEA 4IZ7A 3DGKA 3W0NA 2YACA 4YC3A 5HE1A 4MAOA 4ZSJA 4PTCA 4BIBA 4RJ4A 4DG3E 4B99A 4FT5A 5AA8A 2GS7A 4KIQA 3R2BA 2ITPA 3LE6A 5AADA 3VS7A 3RAKA 1YXVA 2HW7A 5KNJA 3BBWA 3DOGA 3R9OA 4MD8E 2O3PA 5B2LA 5I9ZA 4M14A 3UIUA 2GMXA 2Y4PA 4LV8A 2GQSA 3POZA 4QNAA 2W4KA 3HUCA 3OWLA 4E5WA 3F82A 3Q52A 1Z57A 5HU3A 2W0JA 1FOTA 3E3BX 2CKPA 2VGOA 5C8MA 1YWRA 4Z7GA 3ROYA 4CEGA 5HGIA 4EKKA 2YHVA 3C0IA 5HO8A 4MXAA 1OUKA 4I6BA 1XO2B 4FKPA 3N4TA 2QLUA 4PL5A 4EZ7A 5KX8A 4EZ5A 4FTNA 5AEPA 5EI8A 4E5AX 2OJFE 3M1SA 2WGJA 3BL9A 4NCTC 5EW9A 3NVMB 4F7LA 3COKA 1KE5A 3AGLA 3DBCA 3GU6A 4E6AA 3VAPA 2GU8A 3KK9A 4FYOA 5M4IA 1APME 1ZOHA 4FEVA 4I0TA 4WNPA 3UVRA 4PDOA 4ASEA 1OBGA 3MI9A 3A62A 4U40A 2NP8A 4BBMA 2HZIA 2Y4IB 3A60A 4TYHA 4W4XA 5CEIA 2QI8A 4EI4A 4ZAUA 2R3NA 1OECA 2X0GA 3TKHA 2GNLA 3MB7A 1M52A 4UBAA 1YHWA 4C4HA 4QP1A 3NW5A 4IW0A 5EDQA 4L43A 4RJ6A 3EL8A 4DN5A 3Q5IA 3EQDA 1K9AA 5FP6A 2H96A 3CJGA 3H10A 4TKSA 4M3QA 1CKIA 5AP0A 3F3UA 3JY9A 3ZZEA 2Q83A 3VUDA 1OPJA 2EXCX 3R0TA 4HGSA 4P5ZA 1XWSA 4WRSA 1ZYCA 3LMHA 3P0MA 4QO9A 2HAKA 2BZIB 4DHFA 4IC7A 4BY9E 4HCUA 4NWMA 1U5RA 4C3FA 3PFYA 4QTCA 5HQ0A 4C7TA 4X0MA 5I4NA 4J53A 2XB7A 5JZNA 4D0XA 2YN8A 3LQ8A 3PDTA 5E8VA 3GU8A 2WAJA 3LCKA 3OHTA 3T9TA 1Q5KA 5KMOA 4ENXA 2J5EA 4NIFB 3ATTA 3MIYA 2VO3A 4BDKA 3QC4A 5EQPA 4DF3A 3R63A 5JGDA 4EOQA 1UU3A 5ANIA 2BRHA 4BCKA 3UDBA 2BHHA 3FEGA 3DFAA 4DE4A 4CV8A 4JS8A 2RF9A 5T6KA 2EB2A 3C50A 4CTBA 5AAFA 4HCTA 3F6XA 1Q62A 4DCEA 2EUFB 4TWCA 5K3YA 3AT4A 1PXOA 2X81A 2R9SA 3BKBA 3CE3A 3EFJA 1H26A 2G9XA 3KXXA 3MPAA 3ORTA 3PVBA 1PY5A 4I24A 2PPQA 4N70A 5AX3A 4FEUA 2R3JA 3CQWA 3BGQA 3KMMA 3CY2A 4J99A 4F1TA 4OT6A 2UUEA 4GL9A 5T3QA 3ZO3A 3ORIA 4CRSA 2VO6A 3BL7A 5DWRA 4QP3A 3ZBFA 3S2PA 1ZLTA 1REJA 2R3PA 4M13A 3A7JA 5LMAA 3W0RA 2HXQA 4I5HA 1Q8WA 5HEZA 3FWQA 3BGPA 4TYEA 4EKLA 4GVJA 3A61A 3HRBA 3LVPA 3TV6A 5DNRA 2BRMA 3A7GA 3W8QA 2YEXA 3LJ1A 2CLQA 4I6FA 5M4FA 5AAEA 1ST0A 3QFVA 3ML1A 2GCDA 2X9FA 4IX5A 4C36A 4Y8DA 4MWHA 4YGAA 4H3BA 3U8WA 1YKRA 3M11A 3EN6A 3QYZA 4BC6A 2W1EA 4R7BA 4DFBA 3OD6X 4P4CA 3F3TA 4TT7A 3TTJA 3DBFA 3U6JA 3RAWA 5F1ZA 4ZY5A 3PVWA 4EH7A 5LMKC 4USFA 2CGVA 2OICA 4FIHA 3I0QA 3ZO2A 2BHEA 3I4BA 1Y6AA 2R3GA 5L8LA 5JFXA 5EDPA 2SRCA 5C1QB 2Q0BA 2X7OA 3O0GA 3PXQA 4QDEA 2GHLA 3R02A 4HCVA 3D2IA 3UO5A 2VX3A 2XNPA 1PXNA 4GT3A 1ZY4A 2ZMDA 4YC6A 4ZZOA 4M67A 4G6NA 4IM2A 3W0OA 4YO4A 2J51A 4FZDB 4XV2A 5L6OA 2J6MA 2X4ZA 4BGHA 3Q4UA 4RX5A 4EL9A 3CQEA 1T46A 3IW7A 3PVGA 4DBXA 4Q9ZA 4QQCA 2YIWA 2OZOA 1VZOA 3NFFB 3PPJA 4F9BA 4WD5A 4O7PA 4FV3A 2A19B 5AUWA 4DH1A 5L2IA 2WB8A 2UW6A 1E1XA 2W1GA 4MF1A 4TY1A 2AC3A 1BKXA 3BWJA 3OWKA 4GKHA 4S34A 3W2QA 4U81A 3HNGA 4PMMA 5L2SA 3BU3A 3FHRA 3N51A 4UYNA 1XH4A 5CNNA 4O0SA 3OVVA 3TXOA 4QYEA 4ORKA 1IEPA 1PXPA 4M0ZA 3UPZA 2ONLA 5CEQA 3P9JA 3B8RA 3LM5A 3RCDA 2WU6A 2YIXA 4EC8A 2R5TA 4U45A 5D10A 3SAYA 4Y73A 4O0YA 2QOFA 2XP2A 3DDQA 3G0EA 2VWXA 2J50A 3ID6C 1YWVA 3C0HA 4OW8A 1GY3A 2BUJA 2BR1A 4J1RA 1M7NA 4GFMA 2QHNA 4U6RA 4D2RA 5J8IA 3HECA 2C6KA 3ERKA 5M4UA 5A4EA 4MK0A 4IAAA 2RG6A 4HNIA 4N4SA 4RVKA 4CKIA 5LQFA 5FGKA 1JSVA 1R1WA 3ROCA 2OH4A 2CPKE 4PX6A 1HCKA 2BMCA 5EKOA 4GG7A 3TV7A 3U6HA 2C3JA 4CZUA 4LOQA 4HVIA 4FZ7A 5A6NA 3GFEA 3O5AA 4X2JA 3FC1X 3PIZA 2VU3A 1JPAA 2NYAA 2ITUA 3LKMA 3T8OA 2YM8A 3FYJX 2ZV9A 5J9ZA 3AC2A 5DEWA 2JKKA 4L45A 2B0QA 4UX9A 2IVVA 1FBNA 2WQEA 4XOYA 3R8LA 3WIKA 5BVKA 3OW4A 2PZRA 4BI1A 2HELA 2VTPA 4CCBA 4JR7A 4BTKA 4QMPA 3LFFA 5DE2A 5IQIA 2PMOX 5JH6A 3KL8A 2UVYA 3TI1A 4MX9A 3C9WA 2WFYA 4EH2A 2VTLA 2PHKA 2YITA 3I7CA 3OXTA 2PU8A 2YM4A 4FEQA 4I5PA 3EQHA 2HOGA 4OR5A 2PWLA 3RWPA 1BUHA 3KRJA 2W96B 1L8TA 3HRFA 3OBJA 4RJ5A 3TZ9A 1F5QA 1U5QA 1QMZA 3ZC5A 4ZOGA 4S30A 3A7HA 4O38A 4IWOA 5AV1A 3FLNC 5HE2A 3WF8A 5TR6A 3S0OA 2PYWA 4EUTA 5E7RA 4GFOA 4ASXA 5DBXA 4I23A 3R01A 3FBVA 4U41A 4U98A 5CU4A 4ERWA 2R0IA 2XRWA 2Y7JA 3QRKA 3V6SA 4CMUA 1NVRA 4EOPA 5BPYA 5CVHA 3Q6WA 4KBAA 3QTZA 2GNHA 1DAWA 3W18A 2C6IA 4G6LA 3KCKA 4XBUA 4YSMA 2C47A 3EFLA 3EQRA 4DG0E 4MNEA 1LR4A 2V7OA 3K5UA 4X3FC 2X8DA 3WZEA 5L8JA 3R83A 3W10A 1J7LA 4YTFA 3QHWA 2NO3A 5EOLA 3G33A 4FV7A 4UZHA 2A2AA 4KSQA 4TWOA 5ANDA 3II5A 2VWBA 5HBJA 2CSNA 4J98A 4NM3A 2YIQA 1J1BA 1WAKA 3R7OA 4E4MA 3NZ0A 4Y95A 2JLDA 2C5OA 2ITOA 4FVRA 4KS7A 2C5YA 4AWIA 4I1ZA 5CT7A 3PVUA 4U94A 1JKTA 2PE2A 3MJ2A 1BI8A 2EB3A 4FZAB 3QD4A 1GZNA 5DEYA 5HI2A 4BDHA 3F3VA 4EOMA 3LMIA 4IX3A 3L9MA 4XBRA 4EYMA 4EJ7A 4ZY6A 4AE6A 5BX0A 3HP2A 3WBLA 4IVBA 2UZDA 3KRXA 3QWKA 4KKEA 1FGIA 1ZYLA 2WTDA 3SG9A 4H36A 4JRNA 3GQIA 4FKLA 3A8XA 2W1CA 3NFGB 4BYIA 4DT9A 3V6RA 2GHGA 5AV0A 4CSVA 3C1XA 5AWMA 4ZLOA 4G2FA 2E9OA 5GIPE 4JXFA 3ZUTA 5AP2A 5CS6A 2QU6A 3KREA 5BYYA 3BCEA 3LLTA 4ZY4A 3LFAA 4LV7A 4F99A 4BGGA 3NUYA 2O0UA 3PWYA 4EOJA 3BYVA 4Y5HA 3QQKA 3R7VA 5L2WA 4APPA 5E90A 4EHZA 3NNUA 4QEBA 3FHIA 1KV1A 4O7SA 3OEZA 4JX7A 2IJMA 4RWKA 4FSUA 2X39A 2GFCA 4YJSA 5TF9A 2DYLA 4FT3A 4IVCA 3PXZA 3EQIA 4II5A 4FNXA 5CEKA 2C5XA 3NW6A 4FTCA 3EJ1A 4G3GA 4I21A 4YPDA 5D7AA 3E7VA 5LCJA 4UY9A 4R1VA 4R1YA 2GNJA 3NDMA 2YCSA 5E8TA 1W7HA 3TM0A 3BHYA 2HYYA 2R3LA 4NM7A 2VWUA 5EM6A 5EI2A 3OXZA 3NIEA 4DC2A 4GIIA 3CTQA 2OU7A 2QG5A 3JXWA 2ETRA 3NPCA 4IMYA 3DDPA 3HV6A 4W4WA 5I9UA 5LWNA 1UU8A 1P4OA 4Y85A 4BTMA 4LL0A 2OF4A 4F64A 3MY5A 3UNZA 3SW7A 5ETFA 3QRJA 3OFMA 2UW7A 3HKOA 4I0RA 2WTKC 4D1ZA 1H28A 3Q60A 3U87A 5EDRA 4O7RA 2WMVA 4J52A 4L00A 2JIIA 3BLAA 3H0ZA 3ZLWA 4O83A 5E8XA 2JDTA 3UVQA 3ZOSA 5HG7A 3CBLA 3HRCA 4TZRA 2EWAA 5EM8A 1Q8TA 3Q3BA 5E1EA 2JC6A 3K54A 4GT5A 5FUTA 4XG6A 4E5BA 2OKRA 3K3JA 4S32A 4RIXB 2XARA 3AMAA 5IA0A 4O0TA 4RC4A 4XG8A 1RW8A 3VF9A 2PZIA 4PWNA 4EOOA 3BGZA 4A4LA 5LVPA 3ORMA 2QR7A 4EOKA 4ITIA 5IQHA 4CG8A 4M7IA 2YM5A 1V0OA 3U54A 4M84A 4L44A 4FSTA