4DE4A

Crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with hepes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2")-Id
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4de4A01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4de4A02
4BDAA 1OUKA 3UE4A 3LIJA 4JDIA 4EI4A 3EN4A 5KCVA 4KSQA 3BRBA 5ANKA 1V0BA 3BBTB 4GFMA 4DN5A 3SHEA 3P79A 3SW7A 1JKTA 4GYGA 3B2WA 3OT8A 5HG7A 4HW7A 2I0VA 3G2FA 4NW6A 4D58A 1ZYSA 4B8LA 4F7JA 5D9HA 3HKOA 5B2LA 5CALA 3R6XA 3JPVA 3DCVA 2EXCX 4FL2A 2QHNA 2RKUA 2XK3A 5E9EA 3R1QA 4DGNA 4FA2A 4MXOA 2X2KA 5KMKA 4YNEA 3E63A 1GZKA 4XP3A 3TV7A 4F64A 1DI8A 4BDIA 4CCUA 2C6DA 4M97A 3G0EA 3KXHA 4AA4A 4C58A 5EYCA 4A4XA 4FBXA 2UVYA 2E9VA 4OBOA 4EWHA 5BVOA 3POOA 2BFXA 2HXQA 4FZFB 3NDMA 4DAWA 4TRLA 5KMIA 5KNJA 4XHKB 3HMNA 3E3PA 4BBFA 5IDPA 4FIGA 4ZTQA 3G6GA 4RSSA 2FUMA 2BTSA 2PHKA 4HYHA 4P7EA 4RGJA 3IG7A 4D55A 3ZDUA 4OTQA 3P7CA 4U41A 1ZAOA 5DT3A 3R9DA 2VRXA 1SYKA 3BKBA 4G2FA 3SXRA 2QOLA 4E26A 4G5PA 4CFVA 3HP2A 3TCPA 2CPKE 3VBWA 3SC1A 1H28A 4N70A 4EH9A 3BQRA 1U5RA 5D7AA 3OOMA 3MFTA 3Q4CA 4FKIA 1OIYA 3OVVA 4F9YA 4RFYA 1FBNA 2R3FA 3RK9A 4ZJVA 4HPTE 1OPJA 2AC3A 4HZRA 4J53A 5EYKA 4BCQA 3KGAA 4EOIA 3BLHA 5H2UA 5CWZA 3QZGA 4EK6A 4RJ5A 2F7ZE 3KB7A 3VULA 4GUEA 3QHWA 4FYOA 4RJ3A 1YWNA 5AFVA 4ZTHA 3MVJA 3R7IA 1Y91A 2RFDA 3C50A 4BTMA 4KINA 4YO4A 3UP2A 5L6PA 4XH6A 3C9WA 5DEWA 4L52A 3E5AA 4N57A 3W8LA 3EHAA 4QMNA 2W0JA 5CAUA 5IH5A 4M0YA 2X8IA 3BE2A 4HGLA 4FSQA 5K5XA 4AQCA 3RM6A 5EYDA 1A9UA 1H07A 3S2PA 3OWKA 3IQ7A 1UU3A 2R3NA 3BYOA 2HENA 3WF8A 3MPTA 2NNWB 2NRYA 4HZSA 3DZQA 4MXYA 1HCKA 3FHIA 4J99A 3QZHA 3UIMA 5HVKA 2E9NA 3KF4A 5IUIA 3ZFMA 4AOIA 4E5WA 3S0OA 3WF9A 2UZBA 5JKGA 2YIQA 1YDTE 3TL8A 1IG1A 2C6TA 2UZEA 4UY9A 3TUDA 3BGQA 5HIBA 3C0IA 5CTPA 5CT0A 4XP0A 1LEWA 4R1VA 5EQPA 3V6SA 3KCKA 2X1NA 3NWWA 1H4LA 5I9ZA 3HZTA 4IVAA 2YCQA 4YC8A 2XNBA 4FUXA 1NVQA 3Q6WA 4KS7A 3C4FA 4M13A 5CLPA 4PMPA 3ORNA 3TKHA 5CSWA 5HBJA 4I94A 2JGZA 2WELA 4ASZA 4FV9A 1H08A 2QODA 5EM6A 3ZLSA 5H8EA 4RPVA 3SAYA 4ARKA 4G6OA 4BTKA 2Q0NA 4JNWA 3PZEA 4ITJA 2Y9QA 3E93A 4ALUA 4E8AA 1E1XA 4X3FA 3O23A 4DCAA 1ZZ2A 4BVUA 2C6MA 2UVXA 2J50A 2YM7A 3OHTA 3CY2A 3FEGA 4FNXA 4O82A 4DH3A 4XG3A 4S30A 4W4WA 3WZUA 3CC6A 4WUNA 3KREA 4IB5A 3ORXA 4ENXA 5HU9A 3R04A 4S2ZA 3V01A 4FSWA 4LMNA 5J9LA 3OW3A 2PVNA 3OWPA 4D4SA 2WTIA 3NUUA 2WNTA 4K77A 3LXKA 4EHVA 4IBMA 4CT2A 1J91A 2YZLA 4LOOA 1XQZA 4Y72A 5E8WA 5C8MA 2QD9A 5HD4A 5A46A 1CKJA 2X4ZA 1Y8YA 1Y6AA 1PMVA 3TZ9A 4E4XA 3I1AA 2OICA 2BFYA 4ANMA 2P2IA 3PLSA 4HVGA 2BAQA 4FKPA 5HZNA 4O22A 2V5QA 2CHLA 2QU5A 4MD7E 2H8HA 5FBNC 4UXQA 3CR0A 3QQLA 4OLIA 3WF7A 3G90X 4PL5A 3ZH8A 1Q8UA 3TNWA 3EQDA 1YI3A 4RJ7A 2PE1A 4TYHB 1YVJA 1OB3A 5CAQA 4IDTA 3R2YA 3HA8A 2UZDA 1ZLTA 1OL2A 2C6OA 4RJ8A 4IWDA 1R39A 3VUGA 5JFXA 3FMEA 4FV5A 1NXKA 5E8XA 3Q32A 3JYAA 3UBDA 4D5KA 3ZCLA 5HORA 2ITOA 1STCE 4FUYA 2FO0A 3IW6A 4ZZNA 1PF8A 3PFQA 1KE6A 3NX8A 2V55A 3KMMA 1ZYDA 3KEXA 3VBTA 4D1ZA 3R8VA 5DR6A 3PG3A 1PYEA 4MNFA 3IDBA 2REIA 2UW0A 3KXNA 2I1MA 2C5NA 3VRZA 3EN7A 4EOKA 4EZ5A 3U6IA 4I92A 3BEAA 4A06A 4XBRA 5LJJA 4G3DA 3MPMA 3K5VA 4E5BA 4EOPA 4I24A 4D28A 4I6BA 3OEZA 4PTEA 4GT5A 2OKRA 5DOSA 4AAAA 2JIVA 3QRIA 1ZMWA 4MH7A 5IPJA 3UIBA 2XK9A 2NRUA 2QI8A 3OWLA 2V7AA 3R8UA 3UYSA 4RZWA 4Z16A 1G3NA 4IM3A 3AD5A 4FKOA 4RX8A 2W1GA 3O71A 5CEQA 3WZKA 4ZSAA 2XKDA 5B7VA 5BPYA 2QCSA 3CKXA 3UNZA 3FLZA 2NPQA 4O6EA 3GU8A 4YPSA 1JOWB 1SVGA 5ETAA 4EH7A 4M7IA 4BDHA 3POZA 2PZIA 3F9NA 4FKRA 4BYJA 2HOGA 4JJRA 3OZ6A 2I0EA 1OZ1A 3P1AA 5JT2A 1IRKA 1W0XC 3LE6A 2VTAA 3F2AA 2OIDA 5DWRA 2X7OA 3ORLA 4LQMA 4Z7HA 3UO6A 4M14A 2VX0A 3DLSA 3FMHA 5LCKA 5EW9A 4BYIA 3PE2A 1AQ1A 4JOAA 4PF4A 3UP7A 3CSVA 4AW1A 3DNDA 3PJ3A 3UNJA 3DTCA 1JKKA 4Q9SA 5D10A 2VO7A 3N4UA 3ZYAA 5J8IA 5E7RA 3O17A 5DRDA 5EOBA 4ASEA 1KUTA 3LM5A 2GU8A 3DK6A 4IB3A 4ZEGA 4DBNA 5EDRA 4Q5HA 2V7OA 2PU8A 4ANQA 4WG5A 3E64A 1T46A 5CX9A 5EHOA 3QCXA 3MY0A 2OO8X 5ETIA 5ACKA 5CENA 1U46A 3WF5A 4ZZOA 5JFWA 2Z8CA 3BBWA 2WMWA 4AZSA 4LUDA 5JZJA 2YITA 5HQ0A 5FLFA 2P3GX 4AN2A 4FC0A 3MYGA 2CGXA 2GS6A 3QFVA 4JG7A 5C01A 2J6MA 2J5FA 2O2UA 2CGWA 1ZOEA 1WBSA 4YMJA 4FX3A 5BVEA 3UVQA 3R73A 2XBAA 2WU7A 3DB6A 2E9UA 4F1MA 3D94A 3BYUA 1AGWA 4FIFA 3TUBA 3PY1A 4YTCA 3HMIA 5IQBA 2BKZA 2BHEA 3IW8A 4C3FA 3SRVB 3UIUA 1WBWA 2C3JA 3ZZWA 4MEDA 3COIA 3N51A 5ANIA 5HBEA 5DIAA 4GH2A 2UUEA 4FSRA 4F7SA 4YZDA 2PY3A 1JPAA 3NVMB 3FMLA 3TNQB 4APCA 1P14A 5H3QA 3W2RA 5IQDA 3ULIA 4DFLA 3AC8A 4F0GA 5J95A 5BVWA 3R1SA 4PRJA 1YW2A 4DTBA 4QQJA 2E2BA 2ZDTA 4PDPA 1PXMA 4GS6A 2OI4X 2PZRA 5EG3A 2Z7LA 3PYYA 4YHFA 4R5YA 4S33A 2Q0BA 2V62A 1VZOA 3R0TA 5T6KA 5BVDA 4CVAA 4FV3A 3WE4A 3WE8A 2DUVA 5M4UA 2OSCA 2P55A 1IA8A 3Q60A 4B0GA 2XIZA 3R1YA 4GKIA 4KRDA 4ZXTA 3UJGA 3W0RA 5K3YA 2OIQA 4FSUA 1XBAA 4J1RA 3ORMA 4UWYA 1GIJA 3TIYA 4H39A 3O96A 3ZXZA 5FXSA 3EZVA 4BCNA 4YTFA 3G6HA 4G5JA 4RX9A 3NW6A 4XV9A 5EDPA 4G6NA 4EOJA 2ITXA 2VGOA 5I9WA 4TNDA 4ZJIA 1Q3WA 4YJVA 3DKCA 2YEXA 5DI1A 4IB0A 4EQCA 4ZTSA 2X6EA 4IZYA 4RQKA 3EH9A 2C3LA 3FC1X 5E8ZA 3SKCA 3MV5A 1M7NA 3FPMA 3QTQA 4KIQA 1DM2A 2OZAB 5J1VA 2R7BA 4Q2AA 2YDIA 3GQIA 2BCJA 4NZWB 3RAHA 1P4FA 3NUYA 3NYNA 3F5XA 3PDTA 4BIBA 2YHVA 3KXMA 1PXLA 3SX9A 1OKVA 5IQEA 2ETRA 4O6LA 3UIXA 4XG2A 4YHTA 4AXAA 4EK8A 5M4CA 3SLSA 1XH7A 3ID6C 4ZSEA 2GQSA 2O63A 5E8VA 3TKUA 3KF7A 4IWPA 4O7VA 4UWCA 3D7TB 4MKCA 4EZ7A 4O7LA 2F49A 4W8DA 4AT3A 2EUFB 2YFXA 3CGOA 3NR9A 5AAEA 5E8TA 5HX6A 3I5ZA 3RWQA 2GPHA 3C5IA 3FQSA 3NNUA 3GFEA 1UU8A 3C4WA 3EN6A 4IWOA 2UZWE 2VO0A 4LG4A 4U9AA 5D12A 4CZUA 2B1PA 2QOFA 3OCBA 5EI8A 3BELA 4C02A 2XIRA 3P4KA 5BNJA 3FI2A 3TTJA 4OBPA 2C0TA 1OGUA 4XUFA 4O0VA 2VTRA 4DFNA 5CS6A 3UO5A 3TZ7A 4MXXA 4QP7A 2R9SA 3EZRA 3LFSA 4NKAA 1X8BA 5B2KA 1AD5A 5EHLA 1BI7A 5M56A 1ZYCA 4DEIA 4Y5QA 2X7FA 4V04A 4QMWA 4EC9A 1WVWA 3QZFA 2JBOA 1QL6A 4QMXA 3W10A 2ITYA 4C0TA 3I7CA 1YDSE 3KVXA 4IFGA 3E87A 2WXVA 4J71A 4RT7A 4QQ5A 1A06A 1K9AA 4OR5A 2XKFA 1P2AA 3AOXA 4MF1A 3JUHA 4JT3A 4YTHA 5TT7A 4CRLA 4D1XA 4E4NA 5L8LA 3FI3A 4CG9A 3EQBA 1Y8GA 3BHYA 2XCHA 1LEZA 3O50A 1K3AA 3A7FA 4LMUA 4NK9A 2BPMA 3UGCA 5AP1A 4DGGA 4IIRA 3F3UA 5L2IA 5CF8A 5JMSA 4DINA 2WTJA 3W33A 1APME 3NNVA 2QKWB 4FKQA 4YJRA 3NUXA 1ZYJA 4PP9A 2PVLA 3DB8A 4LI5A 2R2PA 3LKMA 1LPUA 3GU7A 2QONA 4AT5A 3D83A 2O3PA 4I22A 4NL0A 3ZUUA 3Q4UA 3T3VA 3MVMA 4CFNA 2I0YA 3I81A 3PXFA 4PY1A 4HGTA 3AT2A 3NIZA 3FY2A 4I6FA 2XM9A 1CKIA 2YM5A 3PRFA 5KMLA 4F99A 4A9SA 2P0CA 5HCXA 2VX1A 2OBJA 2QO9A 4KKHA 4ENYA 4F9WA 5A9UA 4H3PA 4Y73A 3GC7A 1OECA 3MDYA 4F9CA 1WFCA 3U54A 3VJNA 4USFA 3D4QA 5F94A 3R02A 1FINA 2VWZA 2W1FA 4G9RA 5HE0A 1WBPA 4A4OA 4E6CA 5CF6A 2JFMA 5CEOA 4CLJA 3FZPA 1I09A 4QMPA 3BCEA 2ZV8A 1CMKE 4FEWA 4KBCA 5J87A 2R4BA 2WGJA 2W5BA 4K11A 4DLIA 5CEPA 2WMXA 4QTCA 4EK4A 3QXPA 4FKUA 5AWMA 2QLQA 5DVRA 2GNGA 3EYGA 5E8SA 4J97A 2WOUA 4D0XA 4U45A 3TWJA 1NVRA 4IE9A 4C4FA 5HNIX 4DCEA 3DBCA 4QP4A 2OU7A 4WG4A 4XV1A 4C2WA 3U87A 2J0MB 4EYMA 1PRYA 4FV0A 4IM0A 4U5JA 4KKGA 3OD6X 4ZY5A 4TTHB 3U8WA 3W2PA 1PXKA 2CMWA 3TV4A 4AGWA 4CXAA 4FKLA 2O0UA 4UXLA 5JQ5A 5BMSA 4BDEA 3GUBA 4RFMA 3TIZA 4EUTA 4ASDA 3MVLA 2JBPA 4FL3A 4FSYA 3FYJX 4D4VA 5BUIA 1S9JA 3ETAA 4GV1A 1MRVA 2B53A 2ZAZA 3HV5A 3WIGA 5M51A 3QA8A 2B55A 3KL8A 1PW2A 4M69B 3UOKA 2WMQA 3WBLA 5IUGA 1RDQE 3G33A 2CLQA 4I6HA 3RJCA 4CD0A 1PY5A 4XLVA 4F6WA 5FRIA 1CM8A 4J95A 2XK7A 2VTPA 3H10A 5IDNA 2BAJA 3TUCA 3C51A 1J1BA 4RG0A 4DTKA 2XH5A 3VC4A 2W9ZB 4XCUA 2HWPA 4O0XA 3R7VA 1OIQA 3MI9A 3DLZA 2UZLA 3LFBA 3ZHPC 4YLJA 2C4GA 4HVIA 2HW7A 3GC8A 3FBVA 3PXZA 1F3MC 3PZHA 5EI2A 3ZO3A 5KBQA 4TWCA 2WO6A 3F3WA 4GVJA 5LMBA 2JEDA 2OJGA 5IA1A 3OW4A 2QLUA 2BALA 5HBHA 4UBAA 3LLTA 2VWIA 5L6OA 4QMVA 4G3FA 2XNGA 2YWPA 3Q6UA 4E6AA 2ESMA 3HECA 3QAME 2IW6A 4Z3VA 5LVMA 4XG6A 3VUDA 3TACA 4BCJA 2WQBA 5JRSA 5AP4A 5FBOA 3WARA 1H8FA 2WTKB 3DQWA 4HGSA 4QRCA 4TT7A 2VNYA 2R7IA 3E88A 4GK4A 5AUUA 4M15A 4YJSA 1Q62A 4KIOA 5FM2A 4GCJA 1DS5A 3ANQA 2YABA 3RGFA 3DJ6A 2P2HA 3HV3A 5A4CA 3QQKA 3BLQA 1OPLA 3VVHA 5A4LA 4FZ6A 3CBLA 4IW0A 2P4IA 3V8WA 4AGUA 4AZFA 1U5QA 1YHSA 3ROYA 3IECA 3COHA 3EKKA 1Y6BA 4JAIA 5J5SA 3SOAA 3RINA 5KE0A 3QC9A 3DAKA 3DJ7A 4QP6A 5K5NA 4B7TA 4XG4A 2I40A 1GAGA 4YZNA 1WZYA 4JS8A 2ITPA 3WZDA 4R6VA 5AUZA 4V0GB 5I9XA 1O6YA 4HPUE 4OTGA 3BIZA 5HU3A 3S95A 2YM8A 3P0MA 3QX4A 4I4FA 1GZOA 3GCQA 2GMXA 2Z02A 3NCZA 1JSTA 4S31A 5KHWA 3ACKA 4A4LA 1IASA 1ZWSA 3GU6A 3DDPA 5LVPA 2C0IA 4CT1A 3SOCA 3TEIA 4USDA 3ZRMA 3U4UA 5CF4A 2WTKC 3DDQA 4OTHA 1Q8TA 4Y95A 2B9JA 3PRIA 4OW8A 2WQMA 5AADA 5GJGA 2YERA 4K6ZA 4HOKA 4F1OA 4RWIA 3QL8A 3C0GA 4LV8A 4C3PA 1JQHA 4EHZA 3DA6A 3GOKA 2ZB1A 4IM2A 2CNQA 2W4KA 2XJ2A 4RWLA 2HELA 4MK0A 3KRJA 5A14A 2XM8A 2C6IA 5BYZA 2HY0A 4HYIA 5E92A 4GT3A 3W1FA 5CASA 4AP7A 5LQFA 2PWLA 3ERKA 2W4JA 4NCTA 3V5JA 3VS5A 3FUPA 4RIXB 2CKEA 4FTJA 4ALVA 4GJ2A 3R8ZA 3V8TA 4AUAA 1OL5A 4QP9A 5D11A 5AP7A 4ZMEA 4XP2A 2RF9A 3PXQA 3K54A 1NY3A 3VBQA 4DGOA 3BU6A 4DYMA 1O6LA 1GIIA 3A4PA 5HCYA 3SDJA 4AGCA 2OJFE 3BWFA 2QOOA 4XV3A 2QOHA 1R1WA 4NTTA 1TQIA 3EFKA 4G3CA 4I0TA 4O86A 4BI0A 3SG8A 3HAVA 2YM4A 3EQCA 4E6DA 3BYVA 3HEGA 1M17A 2XK4A 3UYTA 4LOPA 4JDKA 1J3HA 2IZSA 2VTJA 4IAFA 4IMYA 2IVVA 3FLYA 4FIIA 4BCPA 2XF0A 5C4KA 5FGKA 3RHKA 4WNPA 2Y7JA 2YJRA 5AP3A 4Z55A 4ZLZA 4JAJA 1SZMA 3RAWA 5AP6A 1H0VA 2XIYA 3ORPA 4O7WA 4BGQA 5CI7A 4FIJA 2ZB0A 3JR1A 4F0IA 2C6EA 3DOGA 1YOLA 4TY1A 1ZXEA 3NCGA 5HO8A 3CQUA 2CNVA 4RIOA 4UYAA 5CYIA 5DEYA 1VEBA 4XV2A 4JQEA 5LXMA 5HX8A 3F7ZA 4HCUA 4EJ7A 1LP4A 4I41A 3VNTA 3FXXA 4D4YA 4EOOA 4FT3A 5BQ0A 4GUBA 2G2IA 2FSMX 3D2KA 4MD9E 2CKPA 5DLSA 4O21A 3TM0A 4EQMA 4C59A 4GK2A 1WBTA 1BMKA 5E4HA 3VUHA 1V1KA 2VAGA 3NW5A 2X39A 3PPZA 4L68A 4U7ZA 5DNRA 3VQHA 3PVBA 1YOMA 4QYYA 4RBLA 4AA5A 2LGCA 3DS6A 3NRMA 5AM7A 4EK5A 2IZRA 3QQJA 2EVAA 4FZAB 3ZBFA 5CXHA 1ZY4A 4AW2A 3DXNA 5AIKA 4IC7A 5HE3A 3QWJA 5CEKA 4YLKA 1YXVA 4L44A 1XJDA 4YGAA 2EU9A 3NNXA 4MD8E 5FEDA 3QYZA 4AU8A 4MXCA 1M52A 4C62A 2H9VA 3FV8A 3KMWA 3KXGA 3UO4A 5FXRA 4QO9A 5M55A 4C4JA 3OMVA 2OZAA 4RJ4A 2BVAA 4YURA 3MH0A 3DKGA 4ASXA 1KV1A 3AT4A 3I60A 4KAOA 4DLJA 2VTNA 4QMLA 3W0NA 4RC2A 5HLPA 2B52A 2PL0A 3DQXA 4CKJA 4BCOA 4YC3A 3E62A 4BC6A 3BI6A 4I20A 3DFCB 3A4OX 4AT4A 1H1PA 1PXOA 3CS9A 2JDRA 5I5ZA 3DJ5A 3HLLA 5DN3A 2R3RA 5DYJA 4FOCA 4PDOA 2XRUA 3EFJA 4LV5A 5I9YA 3CTHA 3PA4A 5EKOA 4TWPA 2ZDUA 5AV1A 3A60A 4K9YA 4EEVA 3BGPA 4XRJA 3C4CA 4RRVA 4ACMA 1BYGA 4RWJA 3CJFA 3Q9ZA 4ZTRA 5AA8A 5L8JA 5I4NA 3VS2A 3I6WA 3NZ0A 3QD2B 3F7WA 3ZZEA 4F9BA 2I0HA 2VWWA 3LVPA 2PYWA 5AMNA 1J7UA 4EHGA 3GCSA 5DT4A 4PDSA 3LJ1A 3O7LD 5I0BA 2PZYA 4CLIA 3FLNC 3BYSA 2ZMDA 1OUYA 1Q41A 2IVTA 2EWAA 3H30A 4GFGA 4HNIA 4NWMA 4V05A 5ANGA 1PMEA 2JKOA 3PWDA 3D5UA 4IVCA 3KKVA 5JN2A 4BCGA 3D5WA 4BKJA 3AGLA 4GFOA 5AP0A 4OTRA 1TVOA 4JG8A 3RHXA 4WRGA 4F7LA 1UKHA 3MESA 2O8YA 4DE4A 5EM7A 2B0QA 3ATSA 3U6HA 4CMOA 5ETFA 5FP6A 3GFWA 4TWNA 2GNIA 3VIDA 4CEGA 1RQQA 2RFSA 1Q61A 4K0YA 3VS1A 1H1RA 2HAKA 3BV2A 3QUEA 3MSSA 4IB1A 3VF9A 3CLYA 4FTUA 4O96A 2XEZA 2WTCA 1OITA 1U59A 4O0YA 5HE2A 2CNUA 3QALE 4TPTA 3ZEPA 3DTWA 4CV9A 5H9BA 3NMUF 4I5HA 4JDJA 4OGRA 3SGCA 3KVWA 4WO5A 3RMFA 3D14A 4GSBA 4I93A 4U8ZA 3DNEA 3TJDA 2XNEA 4G3GA 4AW5A 2OFUA 4I5MA 2B9FA 2W1IA 2GHGA 3N4TA 1CSNA 1FVTA 3AD6A 2RG5A 2VTHA 4FTCA 4LRMA 4AF3A 2YACA 5DBXA 1UV5A 3FMMA 1RE8A 2UVZA 3BHHA 3GU5A 3PJ2A 5TF9A 2WB8A 4U94A 5GNKA 4BIDA 3PA3A 1SNUA 4EH3A 4FTMA 4USEA 3VS4A 5IH4A 3KY2A 4QTBA 3AC4A 3BPRA 5C8NA 5IMEA 3FXZA 5A54A 3HUBA 3R9RA 3RNIA 4DEAA 2UW3A 3HAMA 3Q9WA 4RIYB 3DV3A 4O0UA 3MH1A 4B4LA 2HXLA 2YZAA 1J7IA 2G2HA 4OTIA 4DG2E 3GU4A 3HDMA 3QCSA 3QTWA 3MB7A 2YWVA 2XK6A 3HGKA 3OCGA 3P08A 4II5A 4CFWA 5LWMA 3H0ZA 3FI4A 2GTMA 3IW5A 2A4LA 3FQEA 4TWOA 3DBQA 3F3TA 3QTSA 5AX3A 4FTTA 4Y83A 3SQQA 3NAXA 3IGOA 1Q5KA 3A8WA 3E3BX 4TYEA 5A3XA 3V3VA 2UW7A 4D2RA 3LHJA 2R3IA 1XWSA 4EBWA 2E9OA 3QUPA 5F1ZA 2QHMA 3UC3A 2FSOX 4Y46A 4D0WA 3FL5A 3IS5A 1W7HA 3DBDA 4M3QA 4W8EA 4YBKA 4MNEB 2J9MA 1XH6A 4PL4A 3LMIA 1BX6A 4CFMA 4NUSA 4FE2A 3G15A 1O9UA 4O91A 5KMOA 4FVRA 4U3YA 5K4JA 4YO6A 2FA2A 4BGGA 3RPYA 2WTVA 4CGAA 3ODZX 2R3LA 5GJDA 4JRVA 1FGIA 1IEPA 2ITUA 2OXDA 3OROA 4W4XA 5HIEA 3IOPA 1JBPE 2IW8A 2C5VA 3LCSA 2JITA 5FP5A 3R9NA 2PVJA 2CGUA 2WHBA 5HG8A 5IQAA 1XR1A 5AP2A 4BTFA 1Q8WA 5M57A 3BGZA 4XJ0A 4D5HA 4C33A 2R3KA 4K33A 2YISA 3NSZA 3TNHA 1W83A 3BU5A 1ZOHA 5CQWA 4CFFA 5AP5A 2XKEA 4F4PA 3FL4A 2ETKA 1REKA 3MH3A 4MX9A 3NYXA 4YJTA 1JVPP 1JWHA 5I9UA 5IMXA 2GHMA 2OK1A 3GEQA 3RK7A 3GB2A 3ZS5A 2R3PA 4FKTA 4DT8A 4IDVA 3GT8A 2H6DA 2VTTA 4FZDB 3R83A 3VS7A 5L2WA 4I0SA 1GNGA 1YDRE 4X6RA 2UV2A 4IAKA 2ONLA 3IW7A 2XMYA 3P78A 5JGAA 5CF5A 2F7EE 2RGPA 4BY9E 1VJYA 2XRWA 2FYSA 4PWNA 3VS0A 2PVRA 3JY0A 4FK3A 3WOWA 1MRUA 4XLIA 5TR6A 4K2RA 1B6CB 2CLXA 5CSXA 4JR3A 5FDXA 1BKXA 3F6XA 4FV1A 4TW9A 4X0MA 3AMYA 2GNJA 2WPAA 4H58A 5LVLA 3W0QA 4WBBB 2JAVA 3WZEA 4FODA 2OXYA 2YIXA 4QMTA 2ZVAA 5T3QA 5KMJA 3VHKA 2B9HA 4KD1A 2DS1A 1UWHA 4O27B 4TKSA 1G5SA 3BWJA 4PQNA 1QPJA 3F69A 4DFBA 1UVRA 4DFUA 3P23A 2CSNA 2IZUA 4FTNA 2R0UA 5CNOA 2PZPA 4V0GA 2ZV7A 1XO2B 4ACHA 3PE1A 4TNBA 3LJ2A 5CAPA 3C4EA 3EJ1A 4U81A 3PSCA 3AC1A 4IVDA 4U3ZA 2A27A 4OTWA 4JL9A 4TYGA 5G1XA 4BBMA 5KMNA 5K9IA 1WMKA 4DT9A 4F65A 4WRSA 2F7XE 3N4VA 2X0GA 4FIHA 2ITQA 3KFAA 2IZTA 4RX7A 3TV6A 3PIYA 2EB2A 4GJ3A 5CY3A 4AFJA 1XH4A 4EUUA 1DAWA 4U97A 2XJ0A 3IK3A 1XH9A 3OP5A 4GW8A 3A61A 3VBXA 4FNZA 4FV7A 5HESA 4LL0A 4NFMA 3VS6A 2RG6A 3QTRA 3OFMA 4IJPA 3KXZA 3DGKA 1JSVA 1W98A 5L2TA 4ZSJA 4R78A 3UG2A 2PULA 1H00A 3FZOA 4X21A 5KO1A 5DG5A 2OH0E 4YJUA 3TTIA 2VTMA 3RVGA 5GINE 4F08A 2BDFA 2QNJA 2CN8A 3I4BA 2Y4PA 2OW3A 4ZTNA 4C7TA 2PPQA 4JBPA 3ZUTA 1BUHA 3GC0A 3QXOA 2WMAA 3CQWA 3NPCA 3MIAA 5HE1A 2RFNA 2H34A 5FEQA 4GIHA 4IAAA 4EOLA 3OC1A 1DI9A 2BZJA 4NM7A 4ZIMA 5KKRB 4X2FA 4L7FA 5EHYA 5ANJA 4CFUA 1OMWA 2C5YA 3EQIA 4JQ8A 4W4VA 2X8DA 2XKCA 2HZ4A 3ALNA 3HP5A 4RWKA 4Z9LA 1F5QA 5HTCA 3W32A 5K4IA 4FYNA 5JH6A 4N0SA 3AC2A 5CU0A 1H1SA 4W4YA 3TYKA 1P5EA 2HK5A 3MJ2A 2WMRA 4YUQA 3BQCA 2IVUA 3ENMA 1H1QA 2W5AA 3FE3A 4F63A 1P4OA 1XBCA 5LWNA 2GHLA 1OIRA 3DBEA 1OBGA 3G5DA 3KC3A 2XIKA 4FV4A 4YZMA 5EQEA 1Q8ZA 4A9RA 4YTIA 2Z2WA 4UYNA 3R7UA 5IISA 4JBOA 4F7NA 1B39A 1YXXA 4ORKA 3UZPA 5EDQA 5KZ0A 3MA6A 4CTBA 4L45A 3ZM4A 4AN9A 3C4ZA 3F2RA 1MP8A 5T68A 4ZLYA 4D4RA 4E20A 3FC2A 4K18A 3LFQA 2YCRA 3D0EA 4EJNA 1ZOGA 4X2GA 4WG3A 2X2LA 3EQHA 1CKPA 5ITAA 1Z57A 3R7YA 1I44A 4FTAA 3JVSA 3OUKA 1IAJA 5FTOA 2W9FB 5C8KA 3OY3A 3FQHA 3NNWA 4GVAA 3V04A 3VW8A 4NFNA 3HRFA 1QCFA 4WHZA 4LM5A 3FMJA 2IN6A 5DR9A 1T45A 1Z9XA 2C6KA 3EYHA 5JRQA 5DT0A 5KKRC 5BVKA 1FPUA 5AUVA 3G9NA 4NM5A 2ITTA 5E91A 2OH4A 3ORKA 2J0KA 4BDDA 2J0LA 3MWUA 3RKBA 3HYHA 3U9CA 1Q4LA 4PV0A 2IG7A 2J90A 2W1ZA 2R3OA 3T3UA 2WAJA 2YM6A 1YXUA 4KS8A 2WIHA 4UB7A 4HVSA 2NP8A 3ZDIA 4YJQA 2WU6A 2KULA 5L8KA 1MUOA 5AV4A 3EWHA 3ATTA 3DKFA 2ZM1A 2XBJA 3Q04A 4UX9A 3LPBA 3R01A 2OJ9A 3QUDA 1U54B 3ZFYA 3KMUA 4FV2A 4M67A 4YC6A 3F66A 4L9IA 4ZZMA 5GIOE 4FKGA 2ERZE 3R8MA 4AX8A 1XH8A 4PTCA 2AUHA 4X3FB 4C38A 3TJCA 2CDZA 5AUWA 2VUWA 2F4JA 3ZRLA 4R7BA 2ACXA 4YZ9A 3F61A 2Z7QA 3MFSA 3TN8A 4RIWB 3DFAA 4X2JA 2XEYA 3MJ1A 3UC4A 1PXPA 1W8CA 1GOLA 3A7IA 5ETCA 3QCQA 4ZMFA 5AAFA 4F6SA 4FSMA 5AUTA 2VWVA 2QO2A 4RVTA 5HICA 2Q83A 3EOCA 1PMNA 3VWAA 3GNIB 3F3ZA 5HD7A 4AZVA 4DG3E 3UQCA 5HG5A 5LARA 1YXSA 2QOKA 1BL7A 2WQNA 2ZV2A 3A2CA 4Y5HA 2PMIA 2RIOA 4GK3A 4BB4A 2PVFA 5IA2A 2C47A 3DBFA 1JAMA 4GRBA 1OKZA 1UNLA 3FZTA 3UMXA 1FVRA 5CT7A 1FOTA 3OXTA 5CSHA 3UPXA 4QMSA 4YR8A 5LVNA 3EN5A 2VGPA 4MTAA 3G51A 3QD4A 2GSFA 3TI1A 3FMNA 5ACBC 4XG9A 4C61A 5BX0A 4EKLA 3MB6A 4NTSA 4QYEA 5TKDA 3WZJA 2JLDA 3QZIA 4BCMA 2CKQA 4MYGA 5J9ZA 2BHHA 2P33A 3SXFA 4HCTA 3FPQA 3QKKA 4J96A 3AMBA 4FMQA 4X6QC 5IQFA 2J5EA 4CSVA 4X3FC 2CCIA 2QKRA 4WA9A 2XNNA 3DXQA 5CSVA 2W17A 2QR8A 3W2SA 4YBJA 2B54A 2BUJA 5B0XA 5LCJA 2JKMA 5IZFA 2FSLX 5CAVA 1SNXA 4EOQA 5EQYA 4EONA 2OG8A 3OBJA 4EORA 5AJQA 4C36A 3RM7A 3P5KA 2YM3A 5JQ8A 4FGBA 3H3CA 1CTPE 1VYZA 3MGYA 4Q5EA 4XOZA 3R30A 4PNIA 1KE7A 5IF1A 3ZC5A 2C1AA 3U9NA 4AOTA 2UZNA 2XYNA 2PUPA 5E1SA 4X2KA 2IW9A 3QA0A 2AC5A 4AS0A 2BRNA 4C34A 3R8PA 1R0PA 2GQGA 2XS0A 2A0CX 2IJMA 3F5GA 3R1NA 5HTBA 4MXZA 3QYWA 4IH8A 3F82A 4QQCA 2LAVA 2QOQA 4N4SA 5HIDA 4JBQA 2VTIA 3ODYX 1H1WA 2OFVA 5EOLA 3IONA 4ACDA 4FSNA 4XMOA 5JFVA 4TYHA 1OVEA 4KKEA 4WNMA 5HNBA 5IQGA 3QLGA 2R3HA 4RVKA 5IH6A 2C30A 4AW0A 1J1CA 5BUEA 3BLRA 4EH8A 4YSJA 2PZ5A 1PXNA 3C7QA 4DGMA 3PJCA 4L43A 4HNFA 4RJ6A 3S1HA 1B38A 1UNHA 1OIUA 1ERKA 3FMDA 3ZLWA 5L2SA 3HA6A 3QTUA 1YHWA 2WMUA 4R7HA 3HRCA 2XP2A 3ANRA 2W1HA 2G15A 4I3ZA 2YAKA 3QHRA 4LYNA 4RZVA 5ANOA 4RIYA 2R3GA 3PXRA 4PP7A 4ZLOA 3GQLA 5IU2A 4XS2A 3C1XA 3ZSGA 5KMMA 4O0RA 3C4XA 5IQCA 5ANEA 1SMHA 3ALOA 3NUNA 4WUAA 4CCBA 1PYXA 3CE3A 2BZHB 1NW1A 3HMPA 4EH5A 4QP3A 2HZ0A 2OJJA 1VYWA 3DY7A 3LCDA 3QLFA 3V5WA 4DH7A 3OUNB 4J98A 4QT1A 5CZHA 4CNHA 1JLUE 4EL9A 3WI6A 4B9DA 5JEBA 2QVSE 3LZBA 4IZ7A 2I7QA 5F95A 4DEHA 4WD5A 4JIAA 2J2IB 4U43A 2PK9A 5KUPA 2UZUE 4YPDA 1OKWA 3VBYA 4DA5A 2YDKA 1ZMUA 3KCFA 3NIEA 1Q24A 2XNOA 4MNEA 4ZK5A 4E5AX 5C26A 3UQFA 2OGVA 4ZS4A 4QYFA 2ZJWA 4L46A 4LRJA 4NH1A 4D2SA 4L6QA 4MAOA 5M4IA 2X4FA 5AAGA 2VWYA 4C35A 5JZNA 2UW4A 5C27A 3IDPA 2O65A 4CKIA 2X7GA 1Q3DA 1M14A 2UW5A 3COKA 1NT2A 3O2MA 3PWYA 4YP8A 1U4DA 4CZTA 2Y0AA 3IPHA 3VHEA 3KRRA 4GMYA 1KOAA 3PVWA 4P4CA 5CI6A 4G6LA 5G6VA 3TG1A 1RW8A 3OY1A 3QBNA 2ITWA 3LXPA 2YIYA 4H3QA 4X2NA 5CANA 3BV3A 5LVOA 1HCLA 5HCZA 3UOHA 2PVYA 4E73A 1YI6A 3R00A 4FIEA 3T9TA 3VO3A 5IUHA 2XUUA 3U4WA 4MCVA 1XBBA 2XIXA 2OWBA 2YN8A 3D2IA 4QOXA 1JKLA 5E90A 5FQDC 2GNLA 4MBIA 5LOHA 2HZNA 5FM3A 4U40A 1FQ1B 4FT5A 3V6RA 3H0YA 4OTFA 2RFEA 2YDJA 4ACCA 4M84A 4DGLC 1WBVA 3CKWA 4IHPA 4M8TA 4O0TA 3CJGA 2UW8A 2W05A 3VAPA 3PIZA 5M4FA 2X9EA 3PPJA 4FTOA 3UPZA 2PMOX 3W0PA 4QNYA 3TT0A 3TXOA 2YCFA 2GNHA 3LFFA 3MIYA 2HWOA 2PSQA 3FWQA 5HO7A 5M09A 2RL5A 3W0MA 3NUPA 5D1JA 4O81A 1Z5MA 4TYIA 3THBA 2WEVA 2Z60A 4BDJA 3L9PA 2R3MA 3K3IA 3EQPA 4H1MA 2X2MA 3EFLA 4FVPA 4BCHA 2W06A 3BHTA 5JGBA 4R3CA 3WF6A 1R0EA 2C68A 3FKNA 2WOTA 3ZSIA 3KRLA 3FSKA 5KX8A 4P5ZA 3PTGA 3SRVA 2CN5A 4FKSA 2F57A 4WZYA 1KE8A 4H1JA 4RVLA 3LCOA 3EMGA 4FEUA 4OBQA 2J4ZA 3QC4A 3DT1A 4BIEA 3LW0A 1JKSA 4N6ZA 4LUEA 2PVHA 3L8VA 5FXQA 3VW6A 3VRYA 2HCKA 3PUPA 4ALWA 2BR1A 1OKYA 4DTAA 3G9LX 3A62A 2XYUA 2EXMA 2VWUA 3PVUA 4QYHA 1YQJA 3HRBA 3QX2A 4BR3A 4JXFA 3D5XA 4O0WA 3ROCA 3FXWA 5DPVA 4MQ1A 5HKMA 5HI2A 2WQOA 2H96A 1UU9A 4FSTA 2FB8A 3ZC6A 4C2VA 1SVEA 3GGFA 4JX7A 4S34A 4BBEA 3PSBA 4QYGA 3IW4A 3ZMMA 2ITVA 2IPXA 4R7IA 4NW5A 3Q96A 4LL5A 1OBDA 3CGFA 4FT7A 3AMAA 3GXLA 3LQ5A 4FR4A 2PUNA 1L8TA 4IZAA 3EQFA 4FG9A 4HGEA 4LRKA 3EQGA 3Q4ZA 4X7QA 5EW8A 5DR2A 1YWRA 2VTLA 4IJ9A 1URCA 1WAKA 3A99A 2VV9A 5CU2A 2OIBA 4IX3A 4DFZE 3TZMA 4H36A 1TQMA 2IO6A 3FDNA 3K2LA 4UV0A 4PTGA 2WMBA 5AX9A 3SW4A 3F5PA 1FMKA 1H27A 2O5KA 3KU2A 3IO7A 1ZMVA 3FKOA 3ZEWA 4AFEA 2BILB 4O83A 4ZP5A 4OUCA 4FKVA 5HEZA 5CXZA 3VN9A 4FTKA 5FUTA 5JGDA 3QTIA 4EZ3A 1IA9A 3R22A 4O2PA 3WILA 2WEIA 1KWPA 4DH1A 2GFSA 3BYMA 5FG8A 3RCDA 1TQPA 3O8PA 3GOPA 5BVFA 3TZ8A 3RPRA 4GKHA 4WIHA 2Z7SA 4B6LA 1QPEA 4DEGA 3GC9A 4I5CA 5AIRA 3D7TA 3LCKA 3OEFX 4ZAUA 1H0WA 4MWHA 5I9VA 5LMKC 3ZFXA 3UQGA 5BVNA 2JAMA 5CU4A 1DAYA 4PMSA 2CCHA 4UZHA 1YHVA 4OT5A 5C03A 3PVGA 3RWPA 3NVKI 3RI1A 3ZO1A 3NGAA 1ZRZA 5GHVA 3FSFA 3MA3A 1Q99A 3QU0A 3QF9A 3MTLA 3QKLA 4EH6A 5KHXA 3Q53A 1PKGA 4XG8A 3UDBA 1J7LA 4JG6A 4F9AA 1LR4A 3I0OA 3LM0A 4M68A 3CP9A 4PMMA 4YSMA 5AM6A 3BEGA 2W99B 3A7HA 3ENHA 4BI1A 3EIDA 1BI8A 2J51A 4FGRA 4B99A 3OF0A 3OT3A 3NS9A 3GP0A 4KBAA 3W0OA 3I79A 4A9UA 4DH8A 5TO8A 1Q8YA 2XVDA 4P5QA 3W18A 1A48A 4WOVA 3MW1A 3KRXA 4IC8A 3C13A 2JDSA 3DAEA 3PY3A 4G31A 4ONAA 3L9MA 4BTJA 5DHJA 1WCCA 5DA3A 2VWXA 3B8QA 5DE2A 4DEEA 2GS7A 4Y8DA 2Y6MA 4FTQA 3JXWA 4QP1A 4TYJA 4L67A 2EB3A 3FLSA 3HV7A 2GS2A 4CMTA 1GY3A 4JIKA 2ERKA 3UTOA 3OWJA 1U54A 3MN3A 1ZZLA 5E8YA 3KK8A 2CJMA 3N9XA 4XG7A 2VWBA 1UU7A 2B7AA 3LFCA 4BRXA 4DEBA 1S9IA 3A7JA 2CGVA 4GT4A 3ZLXA 3SA0A 3BHVA 3COMA 4JR7A 2QOIA 4FV6A 4L8MA 4RIWA 4AN3A 1M7QA 3FY0A 4FTLA 4E93A 4IX6A 2GFCA 3KN6A 5FDPA 5IA0A 1GJOA 4J7BA 3D5VA 2ITZA 4AGDA 2I6LA 4MXAA 4CG8A 4ITHA 5HG9A 4WNOA 2JDTA 3VUIA 2PUUA 3Q52A 4NT4A 4I23A 3EKNA 1YKRA 1WVXA 4FI1A 4TZRA 4U98A 2JD5A 3QQGA 4WNKA 1SVHA 4ITIA 4JBVA 4PNKA 3LFNA 5CU6A 3KQ7A 5J9YA 2YIWA 4L00A 4C4IA 3WIKA 1MQ4A 4RC3A 3O7LB 5F9EA 4AA0A 4AZEA 2QG5A 1W84A 4RVMA 4I1ZA 3PXKA 2W4OA 4A9YA 4FEXA 2R5TA 3P7BA 3W2CA 3O51A 4EKKA 4QP2A 3ITZA 4U42A 4ID7A 4XRLA 3L9LA 3V8SA 3V5QA 4D9TA 4FV8A 4DC2A 3AC5A 3R9OA 3P9JA 4APPA 5EKNA 3FZSA 5CZIA 4AG8A 3UZRA 4YU2A 4JRNA 4H3BA 5M08A 5IA4A 3D9VA 3W2OA 2XCKA 2YAAA 2JDOA 4C4GA 2X9FA 3MH2A 3PP0A 5FTQA 2QU6A 3PLAE 5CSPA 2Z7RA 3C0HA 1R3CA 3ORZA 3EL8A 3CY3A 2QQ7A 2JFLA 4BZOA 2JIUA 4EH2A 2C69A 3PSDA 5BYYA 5M53A 4IFCA 1WVYA 3IOKA 4DBXA 2VX3A 3BU3A 4KRCA 4IEBA 4QP8A 3QD3A 3RAIA 1YOJA 3QQHA 4FSZA 3U55A 5M07A 3ACJA 3RZBA 5M44A 3SVVA 2XNPA 3FZRA 4IQ6A 4S32A 4C4HA 5IA3A 5IEYA 4MWIA 1M2RA 2Y8OA 3GI3A 2C3KA 3TDVA 4AZWA 1PXJA 2W7XA 4FK6A 4ZJJA 3F2NA 3NUAA 4L3PA 3NW7A 3MTFA 3NLBA 5J1WA 1ZARA 1G8AA 5CVHA 5AUYA 4O7OA 3S3IA 2HIWA 3DKOA 3PP1A 4I4EA 4IX5A 2BMCA 3MY1A 4FT9A 3GCVA 5EYMA 3TNPC 3HNGA 4ANBA 3ZU7A 4EHEA 3HV6A 2ZM4A 2BTRA 5EI6A 3R7EA 5JFSA 5A6NA 5IEXA 3ZO2A 4FKJA 4WT6A 3Q2JA 4GIIA 4V01A 2A1AB 5F20A 5FEEA 5C1QB 5CNNA 3HX4A 3E8EA 3M42A 4B8MA 3U6JA 3T8OA 4KB8A 2BRBA 1H24A 4EOMA 1FVVA 3FLWA 3SG9A 4TN6A 4U80A 3B2TA 4G1WA 3EB0A 2XB7A 2C3IB 4O7SA 1ZY5A 2FH9A 3II5A 5H8GA 4I0RA 5EFQA 3FHRA 4L42A 4BDFA 4PL3A 4MHAA 3PY0A 3G0FA 2DQ7X 3KULB 2V22A 4BDKA 1CDKA 3H9OA 1GIHA 2R64A 1M2QA 4R1YA 4TL0A 5IQHA 2WD1A 4IACA 4QTEA 5DH3A 4QMMA 3UODA 3FAAA 2QR7A 3QCYA 5HGIA 3ZLYA 3H9RA 1G8SA 5C4LA 2GTNA 2VD5A 3QGWA 2OJIA 4JLCA 3F3VA 3PXYA 3VF8A 2JIIA 1UA2A 2UW9A 4ZS0A 2FGIA 4FT0A 4QQTA 3KK9A 4KA3A 2JKQA 4MQ2A 3ZBXA 3PJ8A 1LUFA 4PMTA 2J0JA 4XBUA 4ZY6A 4M12A 1R78A 1IR3A 1FMOE 1FGKA 2HY81 3P86A 4DF3A 4E6QA 3KXXA 2J7TA 4NIFB 2ITNA 4HVDA 4JX3A 2BDJA 2XNMA 3AD4A 2HW6A 3F5UA 5D41A 4F09A 5A6OA 4NU1A 2A2AA 3HDNA 4EWQA 4D9UA 2G9XA 2QO7A 4NSTA 4J52A 3PPKA 4PX6A 5GIPE 3MFUA 3BHUA 3RTPA 5L6WL 4NCTC 3V5LA 4A7CA 2R3QA 3UVRA 1V0PA 3L9NA 1GZNA 3AQVA 3OOGA 3QRJA 3DZOA 3KRWA 3OS3A 1L3RE 4BCIA 4ANLA 3L8SA 1XHAA 2YA9A 5AUXA 5CVFA 4RIXA 5M06A 3LQ3A 3D15A 1OL1A 4K1BA 3Q5ZA 2WMSA 4YJPA 1BLXA 3R63A 4RMZA 2PVKA 2IWIA 3RK5A 4QNAA 4FKWA 4JVGA 5B2MA 4FG8A 5HLNA 4QMUA 2F9GA 3CQEA 4IANA 4C3RA 4N6YA 5AV0A 4GG7A 5HLWA 1Q97A 3Q4TA 4OTDA 3OG7A 1PKDA 2ZM3A 4CTCA 3OXIA 3M2WA 3PG1A 1JNKA 2X8EA 4WKQA 4CRSA 4ZSLA 5BYLA 3O0GA 4DH5A 2UZTA 5KZIA 4BI2A 3AG9A 3CPCA 3B8RA 4L3JA 4Y85A 5AA9A 2XJ1A 1KSWA 4I5PA 5A4TA 4KUJA 4ACGA 4P2KA 3QTZA 2W1CA 3AXWA 4LGGA 4CQEA 1WBOA 4XYFA 2NO3A 2QOCA 3V5TA 3FYKX 1REJA 3KN5A 3VS3A 2R0IA 5CEIA 2YIRA 3W0SA 3K5UA 4QTDA 4CFXA 4UN0C 4QMOA 3JY9A 3MFRA 4F6UA 5HVYA 2VTOA 3LFAA 4XOYA 4BN1A 2BZKB 2Y4IB 4DFYA 5LMKA 2PE2A 3RPVA 3E92A 2J0IA 5GJFA 4ZTMA 3I7BA 1UWJA 3FJQE 3I5NA 3L8XA 4YJNA 3CPBA 5EM5A 4CMUA 3GCUA 4YZBA 2GNFA 4KNBA 1V0OA 5E8UA 4EC8A 5CEMA 3MPAA 3NUSA 1NA7A 3L8PA 2QURA 1XH5A 5AV2A 1YXTA 4FEVA 2G2FA 3OBGA 1M2PA 3MVHA 4L3LA 2C5XA 4LGHA 5EM8A 3Q2MA 4F0FA 4UWBA 2A19B 2BIYA 3E8DA 3LCTA 4O84A 5ANDA 3R2BA 4IWQA 2GDOA 4UEUA 5EK7A 4CV8A 1JSUA 4TXCA 3S4QA 3CD3A 5HHWA 3SXSA 4BGHA 2BKKA 2QG7A 4HVHA 3DPKA 4I21A 2BRGA 1ATPE 4LFIA 3H9FA 4IVBA 4HJOA 3QD0A 2WIPA 2V0DA 1GZ8A 4RA4A 3OXZA 3QQUA 4FICA 2SRCA 4ZSGA 3S00A 3ELJA 2B9IA 1KOBA 2XK8A 5CVGA 2W96B 2W5HA 2BRMA 2BAKA 5DFPA 2DYLA 4E1ZA 2YJSA 4C37A 3HV4A 3FZ1A 4RQVA 2JDVA 1QPCA 2BDWA 2OXXA 4G9CA 4F70A 2O64A 4J8NA 4YHJA 3ZSHA 1H26A 4R77A 2Y4IC 4L7SA 2GQRA 4EYJA 4IAZA 2W1DA 3CTJA 3ZO4A 3QQFA 3LMGA 4E4LA 3E8NA 4FOBA 3CCNA 4KBKA 4NM0A 1BL6A 2DWBA 4LOQA 3R21A 4O7RA 2UW6A 4RLKA 3TKIA 3QRUA 2PTKA 4JDHA 5CQUA 3O8UA 3IDCA 5E1EA 2VNWA 2W1EA 3GVUA 5FD2A 3ZOSA 5ICPA 1RJBA 3QRTA 4R3RA 1YRPA 4J8MA 3ZM9A 4GYIA 4BF2A 3UOLA 3CD8A 4BDBA 5A4QA 4DITA 2Y6OA 3PIXA 2JC6A 2XA4A 4FNYA 2WTDA 4M0ZA 4PUZA 5AEPA 4I6QA 2VTQA 1WBNA 3FLQA 5IA5A 2PUIA 3FMKA 4FEQA 3TNIA 4BCKA 4ERKA 3BZ3A 4O7TA 4YJOA 3GBZA 4H05A 3VJOA 3OTVA 3WYXA 4L53A 4EQUA 5J7HA 1HOWA 2OLCA 4AOJA 3DK7A 4ANSA 3LXLA 4G3EA 4DFXE 3BE9A 3P7AA 4G16A 1K2PA 1MQBA 4QMQA 1QMZA 4BZDA 3AT3A 1H01A 3QKMA 4IAYA 4BZNA 2E9PA 3L1SA 2UZOA 4G17A 4GG5A 4NJDA 2R3JA 4O2ZA 2X6DA 3RCJA 3ZRKA 3HMOA 4NM3A 1F0QA 3CEKA 4EK3A 3OTUA 1NVSA 1PHKA 3LFDA 5IQIA 4AE6A 3ZUVA 4A07A 5AV3A 4MBLA 4A9TA 4RFZA 4FTIA 3R8LA 4L01A 4E7WA 2VTSA 4WSYA 4YNOA 2VU3A 2WKMA 4GL9A 3Q3BA 1EH4A 1ND4A 3EL7A 3KA0A 3MS9A 3CIKA 2UZVA 1OL6A 4FNWA 3MBLA 4MBJA 3M11A 3LFEA 3VBVA 3ORIA 1OI9A 1URWA 4O7YA 5HNGA 2OF4A 3NYVA 2FVDA 5LMAA 2QC6A 4GEOA 3PA5A 3HUCA 4O7NA 4XNEA 4GU6A 4BDGA 4U6RA 3LLAA 3UZTA 3R7OA 5EW3A 4EH4A 3QRKA 4ERWA 3E7OA 2BRHA 4BCFA 1H25A 1PMUA 3A7GA 4AACA 1XKKA 4D1SA 3LOKA 2WMTA 5JK3A 2BZIB 3R71A 3NEWA 3DK3A 3W16A 4DHFA 3QGYA 4QTAA 4U79A 4DEDA 2ETMA 1YWVA 3ORTA 1PJKA 3UOJA 1PXIA 5A4EA 3UNKA 4G34A 3IKAA 3E7VA 3DAJA 3QWKA 2AYPA 4P90A 1OL7A 4WBOA 2C6LA 3ET7A 3GENA 3FI8A 2FSTX 4NKSA 4RLLA 4IADA 3VUMA 4KWPA 5C9CA 4FL1A 4OT6A 3OCSA 4AWIA 3RALA 4R3PA 2VO3A 3NYOA 3VUKA 2G1TA 5DGZA 5CAOA 2WQEA 3F88A 3VQUA 3M1SA 4YLLA 2F2UA 2CKOA 3SD0A 4NJ3A 3C5UA 3LQ8A 4AE9A 3ZONA 2OF2A 5BMMA 1OM1A 3PJ1A 4IAIA 1OPKA 4FVQA 3RP9A 4ZTLA 1IAHA 3FKLA 3MY5A 5EH0A 4Z7GA 2BIKB 4CKRA 5IG1A 2IVSA 2GCDA 1UNGA 3Q5IA 3V5PA 4RA5A 3HL7A 2VO6A 4O0SA 4PDYA 3W8QA 4BDCA 5IEVA 5KBRA 4FZ7A 4O38A 5HVJA 2VN9A 3CTQA 2ZOQA 5FTGA 2HZIA 4HCVA 3GCPA 3I6UA 4IX4A 1QPDA 2B4SB 4IZ5A 4BHZA 3REPA 5TOZA 2YCSA 1KE9A 1MRYA 3CXWA 5F4NA 3WYYA 2HYYA 3TDWA 4KABA 2C5OA 2PE0A 2C0OA 2PMLX 3JS2A 3O8TA 3ZXTA 2BROA 2X81A 3RPOA 4HYUA 4QPAA 3LJ0A 4HYSA 4KSPA 2VZ6A 3OCTA 3BX5A 2XZSA 4F1TA 4QPSA 2JKKA 4E4MA 2WTWA 3JVRA 1O6KA 3R28A 4R5SA 4ZY4A 5BUJA 1SM2A 2ZMCA 3AGMA 4Q9ZA 4FTRA 3SV0A 2PMNX 4XEYA 2WFYA 4ZOGA 5H8BA 1W82A 2QOBA 3T9IA 4EBVA 3D7ZA 3UG1A 4QMYA 1KV2A 3DU8A 5L3AA 2KTYA 1UKIA 3EQRA 5JSMA 3RAKA 4DG0E 3A8XA 4FG7A 3UVPA 1KE5A 4GU9A 4UALA 1E9HA 4XX9A 4YZCA 4K8AA 2ONLC 2ZYBA 3K3JA 4KIPA 5D7VA 4EOSA 1E1VA 3R9HA 3W55A 1Y57A 4JQ7A 3RPSA 3H4JA 3HVCA 4BHNA 3LXNA 3HMMA 2ZV9A 4O7ZA 3LMHA 3I0QA 2G01A 3UMWA 1TKIA 3ULZA 4U44A 3W2QA 3DXPA 4RX5A 2C1BA 3EN9A 3NAYA 2F2CB 3EFWA 3V51A 4MVFA 4QMZA 3E8CA 1YI4A 3QTXA 4C4EA 2PVMA 4JI9A 1VR2A 2WMVA 5DRBA 4O7PA 4BICA 2WZJA 3ZTXA 3IGGA 4UZDA 5CU3A 3Q9YA 4U0IA 2OZOA 3KULA 3LAUA 3AC3A 3Q9XA 4NYEA 4X3JA 3U51A 4AZTA 4RC4A
chains in the Genus database with same CATH superfamily
4BDAA 1OUKA 3UE4A 3LIJA 4JDIA 4EI4A 3EN4A 5KCVA 4KSQA 3BRBA 5ANKA 1V0BA 3BBTB 4GFMA 4DN5A 3SHEA 3P79A 3SW7A 1JKTA 4GYGA 3B2WA 3OT8A 5HG7A 4HW7A 2I0VA 3G2FA 4NW6A 4D58A 1ZYSA 4B8LA 4F7JA 5D9HA 3HKOA 5B2LA 5CALA 3R6XA 3JPVA 3DCVA 2EXCX 4FL2A 2QHNA 2RKUA 2XK3A 5E9EA 3R1QA 4DGNA 4FA2A 4MXOA 2X2KA 5KMKA 4YNEA 3E63A 1GZKA 4XP3A 3TV7A 4F64A 1DI8A 4BDIA 4CCUA 2C6DA 4M97A 3G0EA 3KXHA 4AA4A 4C58A 5EYCA 4A4XA 4FBXA 2UVYA 2E9VA 4OBOA 4EWHA 5BVOA 3POOA 2BFXA 2HXQA 4FZFB 3NDMA 4DAWA 4TRLA 5KMIA 5KNJA 4XHKB 3HMNA 3E3PA 4BBFA 5IDPA 4FIGA 4ZTQA 3G6GA 4RSSA 2FUMA 2BTSA 2PHKA 4HYHA 4P7EA 4RGJA 3IG7A 4D55A 3ZDUA 4OTQA 3P7CA 4U41A 1ZAOA 5DT3A 3R9DA 2VRXA 1SYKA 3BKBA 4G2FA 3SXRA 2QOLA 4E26A 4G5PA 4CFVA 3HP2A 3TCPA 2CPKE 3VBWA 3SC1A 1H28A 4N70A 4EH9A 3BQRA 1U5RA 5D7AA 3OOMA 3MFTA 3Q4CA 4FKIA 1OIYA 3OVVA 4F9YA 4RFYA 1FBNA 2R3FA 3RK9A 4ZJVA 4HPTE 1OPJA 2AC3A 4HZRA 4J53A 5EYKA 4BCQA 3KGAA 4EOIA 3BLHA 5H2UA 5CWZA 3QZGA 4EK6A 4RJ5A 2F7ZE 3KB7A 3VULA 4GUEA 3QHWA 4FYOA 4RJ3A 1YWNA 5AFVA 4ZTHA 3MVJA 3R7IA 1Y91A 2RFDA 3C50A 4BTMA 4KINA 4YO4A 3UP2A 5L6PA 4XH6A 3C9WA 5DEWA 4L52A 3E5AA 4N57A 3W8LA 3EHAA 4QMNA 2W0JA 5CAUA 5IH5A 4M0YA 2X8IA 3BE2A 4HGLA 4FSQA 5K5XA 4AQCA 3RM6A 5EYDA 1A9UA 1H07A 3S2PA 3OWKA 3IQ7A 1UU3A 2R3NA 3BYOA 2HENA 3WF8A 3MPTA 2NNWB 2NRYA 4HZSA 3DZQA 4MXYA 1HCKA 3FHIA 4J99A 3QZHA 3UIMA 5HVKA 2E9NA 3KF4A 5IUIA 3ZFMA 4AOIA 4E5WA 3S0OA 3WF9A 2UZBA 5JKGA 2YIQA 1YDTE 4BJJB 3TL8A 1IG1A 2C6TA 2UZEA 4UY9A 3TUDA 3BGQA 5HIBA 3C0IA 5CTPA 5CT0A 4XP0A 1LEWA 4R1VA 5EQPA 3V6SA 3KCKA 2X1NA 3NWWA 1H4LA 5I9ZA 3HZTA 4IVAA 2YCQA 4YC8A 2XNBA 4FUXA 1NVQA 3Q6WA 4KS7A 3C4FA 4M13A 5CLPA 4PMPA 3ORNA 3TKHA 5CSWA 5HBJA 4I94A 2JGZA 2WELA 4ASZA 4FV9A 1H08A 2QODA 5EM6A 3ZLSA 5H8EA 4RPVA 3SAYA 4ARKA 4G6OA 4BTKA 2Q0NA 4JNWA 3PZEA 4ITJA 2Y9QA 3E93A 4ALUA 4E8AA 1E1XA 4X3FA 3O23A 4DCAA 1ZZ2A 4BVUA 3O5AA 2C6MA 2UVXA 2J50A 2YM7A 3OHTA 3CY2A 3FEGA 4FNXA 4O82A 4DH3A 4XG3A 4S30A 4W4WA 3WZUA 3CC6A 4WUNA 3KREA 4IB5A 3ORXA 4ENXA 5HU9A 3R04A 4S2ZA 3V01A 4FSWA 4LMNA 5J9LA 3OW3A 2PVNA 3OWPA 4D4SA 2WTIA 3NUUA 2WNTA 4K77A 3LXKA 4EHVA 4IBMA 4CT2A 1J91A 2YZLA 4LOOA 1XQZA 4Y72A 5E8WA 5C8MA 2QD9A 5HD4A 5A46A 1CKJA 2X4ZA 1Y8YA 1Y6AA 1PMVA 3TZ9A 4E4XA 3I1AA 2OICA 2BFYA 4ANMA 2P2IA 3PLSA 4HVGA 2BAQA 4FKPA 5HZNA 4O22A 2V5QA 2CHLA 2QU5A 4MD7E 2H8HA 5FBNC 4UXQA 3CR0A 3QQLA 4OLIA 3WF7A 3G90X 4PL5A 3ZH8A 1Q8UA 3TNWA 3EQDA 1YI3A 4RJ7A 2PE1A 4TYHB 1YVJA 1OB3A 5CAQA 4IDTA 3R2YA 3HA8A 2UZDA 1ZLTA 1OL2A 2C6OA 4RJ8A 4IWDA 1R39A 3VUGA 5JFXA 3FMEA 4FV5A 1NXKA 5E8XA 3Q32A 3JYAA 3UBDA 4D5KA 3ZCLA 5HORA 2ITOA 1STCE 4FUYA 2FO0A 3IW6A 4ZZNA 1PF8A 3PFQA 1KE6A 3NX8A 2V55A 3KMMA 1ZYDA 3KEXA 3VBTA 4D1ZA 3R8VA 5DR6A 1G8JA 3PG3A 1PYEA 4MNFA 3IDBA 2REIA 2UW0A 3KXNA 2I1MA 2C5NA 3VRZA 3EN7A 4EOKA 4EZ5A 3U6IA 3BLAA 4I92A 3BEAA 4A06A 4XBRA 5LJJA 4G3DA 3MPMA 3K5VA 4E5BA 4EOPA 4I24A 4D28A 4I6BA 3OEZA 4PTEA 4GT5A 2OKRA 5DOSA 4AAAA 2JIVA 3QRIA 1ZMWA 4MH7A 5IPJA 3UIBA 2XK9A 2NRUA 2QI8A 3OWLA 2V7AA 4AXDA 3R8UA 3UYSA 4RZWA 4Z16A 1G3NA 4IM3A 3AD5A 4FKOA 4RX8A 2W1GA 3O71A 5CEQA 3WZKA 4ZSAA 2XKDA 5B7VA 5BPYA 2QCSA 3CKXA 3UNZA 3FLZA 2NPQA 4O6EA 3GU8A 4YPSA 1JOWB 1SVGA 5ETAA 4EH7A 4M7IA 4BDHA 3POZA 2PZIA 3F9NA 4FKRA 4BYJA 2HOGA 4JJRA 3OZ6A 4MUQA 2I0EA 1OZ1A 3P1AA 5JT2A 1IRKA 1W0XC 3LE6A 2VTAA 3F2AA 2OIDA 5DWRA 2X7OA 3ORLA 4LQMA 4Z7HA 3UO6A 4M14A 2VX0A 3DLSA 3FMHA 5LCKA 5EW9A 4BYIA 3PE2A 1AQ1A 4JOAA 4PF4A 3UP7A 3CSVA 4AW1A 3DNDA 3PJ3A 3UNJA 3DTCA 1JKKA 4Q9SA 5D10A 2VO7A 3N4UA 3ZYAA 5J8IA 5E7RA 3O17A 5DRDA 5EOBA 4ASEA 1KUTA 3LM5A 2GU8A 3DK6A 4IB3A 4LDTA 4ZEGA 4DBNA 5EDRA 4Q5HA 2V7OA 2PU8A 4ANQA 4WG5A 3E64A 1T46A 5CX9A 5EHOA 3QCXA 3MY0A 2OO8X 5ETIA 5ACKA 5CENA 1U46A 3WF5A 4ZZOA 5JFWA 2Z8CA 3BBWA 2WMWA 4AZSA 4LUDA 3PUFC 5JZJA 2YITA 5HQ0A 5FLFA 2P3GX 4AN2A 4FC0A 3MYGA 2CGXA 2GS6A 3QFVA 4JG7A 5C01A 2J6MA 2J5FA 2O2UA 2CGWA 1ZOEA 1WBSA 4YMJA 4FX3A 5BVEA 3UVQA 3R73A 2XBAA 2WU7A 3DB6A 2E9UA 4F1MA 3D94A 3BYUA 1AGWA 4FIFA 3TUBA 3PY1A 4YTCA 3HMIA 5IQBA 2BKZA 2BHEA 3IW8A 4C3FA 3SRVB 3UIUA 1WBWA 2C3JA 3ZZWA 4MEDA 3COIA 3N51A 5ANIA 5HBEA 5DIAA 4GH2A 2UUEA 4FSRA 4F7SA 4YZDA 2PY3A 1JPAA 3NVMB 3FMLA 3TNQB 4APCA 1P14A 5H3QA 3W2RA 5IQDA 3ULIA 4DFLA 3AC8A 4F0GA 3PFYA 5J95A 5BVWA 3R1SA 4PRJA 1YW2A 4DTBA 4QQJA 2E2BA 2ZDTA 4PDPA 1PXMA 4GS6A 2OI4X 2PZRA 5EG3A 2Z7LA 3PYYA 4YHFA 4R5YA 4S33A 2Q0BA 2V62A 1VZOA 3R0TA 5T6KA 5BVDA 4CVAA 4FV3A 3WE4A 3WE8A 2DUVA 5M4UA 2OSCA 2P55A 1IA8A 3Q60A 4B0GA 2XIZA 3R1YA 4GKIA 4KRDA 4ZXTA 3UJGA 3W0RA 5K3YA 2OIQA 4FSUA 1XBAA 4J1RA 3ORMA 4UWYA 1GIJA 3TIYA 4H39A 3O96A 3ZXZA 5FXSA 3EZVA 4BCNA 4YTFA 3G6HA 4G5JA 4RX9A 3NW6A 4XV9A 5EDPA 4G6NA 4EOJA 2ITXA 2VGOA 5I9WA 4TNDA 4ZJIA 1Q3WA 4YJVA 3DKCA 2YEXA 5DI1A 4IB0A 4EQCA 4ZTSA 2X6EA 4IZYA 4QDEA 4RQKA 3EH9A 2C3LA 3FC1X 5E8ZA 3SKCA 1ST0A 3MV5A 1M7NA 3FPMA 3QTQA 4KIQA 1DM2A 2OZAB 5J1VA 2R7BA 4Q2AA 2YDIA 3GQIA 2BCJA 4NZWB 3RAHA 1P4FA 3NUYA 3NYNA 3F5XA 3PDTA 4BIBA 2YHVA 3KXMA 1PXLA 3SX9A 1OKVA 5IQEA 2ETRA 4O6LA 3UIXA 4XG2A 4YHTA 4AXAA 4EK8A 5M4CA 3SLSA 1XH7A 3ID6C 4ZSEA 2GQSA 2O63A 5E8VA 3TKUA 3KF7A 4IWPA 4O7VA 4UWCA 3D7TB 4MKCA 4EZ7A 4O7LA 2F49A 4W8DA 4AT3A 2EUFB 2YFXA 3CGOA 3NR9A 5AAEA 5E8TA 5HX6A 3I5ZA 3RWQA 2GPHA 3C5IA 3FQSA 3NNUA 3GFEA 1UU8A 3C4WA 3EN6A 4IWOA 2UZWE 2VO0A 4LG4A 4U9AA 5D12A 4CZUA 2B1PA 2QOFA 3OCBA 5EI8A 3BELA 4C02A 2XIRA 3P4KA 5BNJA 3FI2A 3TTJA 4OBPA 2C0TA 1OGUA 4XUFA 4O0VA 2VTRA 4DFNA 5CS6A 3UO5A 3TZ7A 4MXXA 4QP7A 2R9SA 3EZRA 3LFSA 4NKAA 1X8BA 5B2KA 1AD5A 5EHLA 1BI7A 5M56A 1ZYCA 4DEIA 4Y5QA 2X7FA 4V04A 4QMWA 4EC9A 1WVWA 3QZFA 2JBOA 1QL6A 4QMXA 3W10A 2ITYA 4C0TA 3I7CA 1YDSE 3KVXA 4IFGA 3E87A 2WXVA 4J71A 4RT7A 4QQ5A 1A06A 1K9AA 4OR5A 2XKFA 1P2AA 3AOXA 4MF1A 3JUHA 4JT3A 4YTHA 5TT7A 4CRLA 4D1XA 4E4NA 5L8LA 3FI3A 4CG9A 3EQBA 1Y8GA 3BHYA 2XCHA 1LEZA 3O50A 1K3AA 3A7FA 4LMUA 4NK9A 2BPMA 3UGCA 5AP1A 4DGGA 4IIRA 3F3UA 5L2IA 5CF8A 5JMSA 4DINA 2WTJA 3W33A 1APME 3NNVA 2QKWB 4FKQA 4YJRA 3NUXA 1ZYJA 4PP9A 2PVLA 3DB8A 4LI5A 2R2PA 4DDIA 3LKMA 1LPUA 3GU7A 2QONA 4AT5A 3D83A 2O3PA 4I22A 4NL0A 3ZUUA 3Q4UA 3T3VA 3MVMA 4CFNA 3KIOC 2I0YA 3I81A 3PXFA 4PY1A 4HGTA 3AT2A 3NIZA 3FY2A 4I6FA 2XM9A 1CKIA 2YM5A 3PRFA 5KMLA 4F99A 4A9SA 2P0CA 5HCXA 2VX1A 2OBJA 2QO9A 4KKHA 4ENYA 4F9WA 5A9UA 4H3PA 4Y73A 3GC7A 1OECA 3MDYA 4F9CA 1WFCA 3U54A 3VJNA 4USFA 3D4QA 5F94A 3R02A 1FINA 2VWZA 2W1FA 4G9RA 5HE0A 1WBPA 4A4OA 4E6CA 5CF6A 2JFMA 5CEOA 4CLJA 3FZPA 1I09A 4QMPA 3BCEA 2ZV8A 1CMKE 4FEWA 4KBCA 2XANA 5J87A 2R4BA 2WGJA 2W5BA 4K11A 4DLIA 5CEPA 2WMXA 4QTCA 4EK4A 3QXPA 4FKUA 5AWMA 2QLQA 5DVRA 2GNGA 3EYGA 5E8SA 4J97A 2WOUA 4D0XA 4U45A 3TWJA 1NVRA 4IE9A 4C4FA 5HNIX 4DCEA 3DBCA 4QP4A 2OU7A 4WG4A 4XV1A 4C2WA 3U87A 2J0MB 4EYMA 1PRYA 4FV0A 4IM0A 4U5JA 4KKGA 3OD6X 4ZY5A 4TTHB 3U8WA 3W2PA 4DDGA 1PXKA 2CMWA 3TV4A 4AGWA 4CXAA 4FKLA 2O0UA 4UXLA 5JQ5A 5BMSA 4BDEA 3GUBA 4RFMA 3TIZA 4EUTA 4ASDA 3MVLA 2JBPA 4FL3A 4FSYA 3FYJX 4D4VA 5BUIA 1S9JA 3ETAA 4GV1A 1MRVA 2B53A 2ZAZA 3HV5A 3WIGA 5M51A 3QA8A 2B55A 4AQKA 3KL8A 1PW2A 4M69B 3UOKA 4AXCA 2WMQA 3WBLA 5IUGA 1RDQE 3G33A 2CLQA 4I6HA 3RJCA 4CD0A 1PY5A 4XLVA 4F6WA 5FRIA 1CM8A 4J95A 2XK7A 2VTPA 3H10A 5IDNA 2BAJA 3TUCA 3C51A 1J1BA 4RG0A 4DTKA 2XH5A 3VC4A 2W9ZB 4XCUA 2HWPA 4O0XA 3R7VA 1OIQA 3MI9A 3DLZA 2UZLA 3LFBA 3ZHPC 4YLJA 2C4GA 4HVIA 2HW7A 3GC8A 3FBVA 3PXZA 1F3MC 3PZHA 5EI2A 3ZO3A 5KBQA 4TWCA 2WO6A 3F3WA 4GVJA 5LMBA 2JEDA 2OJGA 5IA1A 3OW4A 2QLUA 2BALA 5HBHA 4UBAA 3LLTA 2VWIA 5L6OA 4QMVA 4G3FA 2XNGA 2YWPA 3Q6UA 4E6AA 2ESMA 3HECA 3QAME 2IW6A 4Z3VA 5LVMA 4XG6A 3VUDA 3TACA 4BCJA 2WQBA 5JRSA 5AP4A 5FBOA 3WARA 1H8FA 2WTKB 3DQWA 4HGSA 4QRCA 4TT7A 2VNYA 2R7IA 3E88A 4GK4A 5AUUA 4M15A 4YJSA 1Q62A 4KIOA 5FM2A 4GCJA 1DS5A 3ANQA 2YABA 3RGFA 3DJ6A 2P2HA 3HV3A 5A4CA 3QQKA 3BLQA 1OPLA 3VVHA 5A4LA 4FZ6A 3CBLA 4IW0A 2P4IA 3V8WA 4AGUA 4AZFA 1U5QA 1YHSA 3ROYA 3IECA 3COHA 3EKKA 1Y6BA 4JAIA 5J5SA 3SOAA 3RINA 5KE0A 3QC9A 3DAKA 3DJ7A 4QP6A 5K5NA 4B7TA 4XG4A 2I40A 1GAGA 4YZNA 1WZYA 4JS8A 2ITPA 3WZDA 4R6VA 5AUZA 4V0GB 5I9XA 1O6YA 4HPUE 4OTGA 3BIZA 5HU3A 1ZYLA 2YM8A 3P0MA 1ST4A 3QX4A 3S95A 4I4FA 1GZOA 3GCQA 2GMXA 2Z02A 3NCZA 1JSTA 4S31A 5KHWA 3ACKA 4A4LA 1IASA 1ZWSA 3GU6A 3DDPA 5LVPA 2C0IA 4CT1A 3SOCA 3TEIA 4USDA 3ZRMA 4DHIB 3U4UA 5CF4A 2WTKC 3DDQA 4OTHA 1Q8TA 4Y95A 2B9JA 3PRIA 4OW8A 2WQMA 5AADA 5GJGA 2YERA 4K6ZA 4HOKA 4F1OA 4RWIA 3QL8A 3C0GA 4LV8A 4C3PA 1JQHA 4EHZA 3DA6A 3GOKA 2ZB1A 4IM2A 2CNQA 2W4KA 2XJ2A 4RWLA 2HELA 4MK0A 3KRJA 5A14A 2XM8A 2C6IA 5BYZA 2HY0A 4HYIA 5E92A 4GT3A 3W1FA 5CASA 4AP7A 5LQFA 2PWLA 3ERKA 2W4JA 4NCTA 3V5JA 3VS5A 3FUPA 4RIXB 2CKEA 4FTJA 4ALVA 4GJ2A 3R8ZA 3V8TA 4AUAA 1OL5A 4QP9A 5D11A 5AP7A 4ZMEA 4XP2A 2RF9A 3PXQA 3K54A 1NY3A 3VBQA 4DGOA 3BU6A 4DYMA 1O6LA 1GIIA 3A4PA 5HCYA 3SDJA 4AGCA 2OJFE 3BWFA 2QOOA 4XV3A 2QOHA 1R1WA 4NTTA 1TQIA 3EFKA 4G3CA 4I0TA 4O86A 4BI0A 3SG8A 3HAVA 2YM4A 3EQCA 4E6DA 3BYVA 3HEGA 1M17A 2XK4A 3UYTA 4LOPA 4JDKA 1J3HA 2IZSA 2VTJA 4IAFA 4IMYA 2IVVA 3FLYA 4FIIA 4BCPA 2XF0A 5C4KA 5FGKA 3RHKA 4WNPA 2Y7JA 2YJRA 5AP3A 4Z55A 4ZLZA 4JAJA 1SZMA 3RAWA 5AP6A 1H0VA 2XIYA 3ORPA 4O7WA 4BGQA 5CI7A 4FIJA 2ZB0A 3JR1A 4F0IA 2C6EA 3DOGA 1YOLA 4TY1A 1ZXEA 3NCGA 5HO8A 3CQUA 2CNVA 4RIOA 5BV3A 4UYAA 5CYIA 5DEYA 1VEBA 4XV2A 4JQEA 5LXMA 5HX8A 3F7ZA 4HCUA 4EJ7A 1LP4A 4I41A 4QEBA 3VNTA 3FXXA 4D4YA 4EOOA 4FT3A 5BQ0A 4GUBA 2G2IA 2FSMX 3D2KA 4MD9E 2CKPA 5DLSA 4O21A 3TM0A 4EQMA 4C59A 4GK2A 1WBTA 1BMKA 5E4HA 3VUHA 1V1KA 2VAGA 3NW5A 2X39A 3PPZA 4L68A 4U7ZA 5DNRA 3VQHA 3PVBA 1YOMA 4QYYA 4RBLA 4AA5A 2LGCA 3DS6A 3NRMA 5AM7A 4EK5A 2IZRA 3QQJA 2EVAA 4FZAB 3ZBFA 5CXHA 1ZY4A 4AW2A 3DXNA 5AIKA 4IC7A 5HE3A 3QWJA 5CEKA 4YLKA 1YXVA 4L44A 1XJDA 2XAOA 4YGAA 2EU9A 3NNXA 4MD8E 5FEDA 3QYZA 4AU8A 4MXCA 1M52A 4C62A 2H9VA 3FV8A 3KMWA 3KXGA 3UO4A 5FXRA 4QO9A 5M55A 4C4JA 3OMVA 2OZAA 4RJ4A 2BVAA 4YURA 3MH0A 3DKGA 4ASXA 1KV1A 3AT4A 3I60A 4KAOA 3W0NA 2VTNA 4QMLA 4DLJA 4RC2A 5HLPA 2B52A 2PL0A 3DQXA 4CKJA 4BCOA 4YC3A 3E62A 4BC6A 3BI6A 4I20A 3DFCB 3A4OX 4AT4A 1H1PA 1PXOA 3CS9A 2JDRA 5I5ZA 3DJ5A 3HLLA 5DN3A 2R3RA 5DYJA 4FOCA 4PDOA 2XRUA 3EFJA 4LV5A 5I9YA 3CTHA 3PA4A 5EKOA 4TWPA 2ZDUA 5AV1A 3A60A 4K9YA 4EEVA 3BGPA 4XRJA 3C4CA 4RRVA 4ACMA 1BYGA 4RWJA 3CJFA 3Q9ZA 4ZTRA 5AA8A 5L8JA 5I4NA 3VS2A 3I6WA 3NZ0A 3QD2B 3F7WA 3ZZEA 4F9BA 2I0HA 2VWWA 3LVPA 2PYWA 5AMNA 1J7UA 4EHGA 3GCSA 5DT4A 4PDSA 3LJ1A 3O7LD 4AXFA 5I0BA 2PZYA 4CLIA 3FLNC 2ZMDA 1OUYA 1Q41A 3BYSA 2IVTA 2EWAA 3H30A 4GFGA 4HNIA 4NWMA 4V05A 5ANGA 1PMEA 2JKOA 3PWDA 3D5UA 4IVCA 3KKVA 5JN2A 4BCGA 3D5WA 4BKJA 3AGLA 4GFOA 5AP0A 4OTRA 1TVOA 4JG8A 3RHXA 4WRGA 4F7LA 1UKHA 3MESA 2O8YA 4DE4A 5EM7A 2B0QA 3ATSA 3U6HA 4CMOA 5ETFA 5FP6A 3GFWA 4TWNA 2GNIA 3VIDA 4CEGA 1RQQA 2RFSA 1Q61A 4K0YA 3VS1A 1H1RA 2HAKA 3BV2A 3QUEA 3MSSA 4IB1A 3VF9A 3CLYA 4FTUA 4O96A 2XEZA 2WTCA 1OITA 1U59A 4O0YA 5HE2A 2CNUA 3QALE 4TPTA 3ZEPA 3DTWA 4CV9A 5H9BA 4D0WA 3NMUF 4I5HA 4JDJA 4OGRA 3SGCA 3KVWA 4WO5A 3RMFA 3D14A 4GSBA 4I93A 4U8ZA 3DNEA 3TJDA 2XNEA 4G3GA 4AW5A 2OFUA 4I5MA 2B9FA 2W1IA 2GHGA 3N4TA 1CSNA 1FVTA 3AD6A 2RG5A 2VTHA 4FTCA 4LRMA 4AF3A 2YACA 5DBXA 1UV5A 3FMMA 1RE8A 2UVZA 3BHHA 3GU5A 3PJ2A 5TF9A 2WB8A 4U94A 5GNKA 4BIDA 3PA3A 1SNUA 4EH3A 4FTMA 4USEA 3UDSA 3VS4A 5IH4A 3KY2A 4QTBA 3AC4A 3BPRA 5C8NA 5IMEA 3FXZA 5A54A 3HUBA 3R9RA 3RNIA 4DEAA 2UW3A 3HAMA 3Q9WA 4RIYB 3DV3A 4O0UA 3MH1A 4B4LA 2HXLA 2YZAA 1J7IA 2G2HA 4OTIA 4DG2E 3GU4A 3HDMA 3QCSA 3QTWA 3MB7A 2YWVA 2XK6A 3HGKA 3OCGA 3P08A 4II5A 4CFWA 5LWMA 3H0ZA 3BL7A 3FI4A 2GTMA 3IW5A 2A4LA 3FQEA 4TWOA 3DBQA 3F3TA 3QTSA 5AX3A 4FTTA 4Y83A 3SQQA 3NAXA 3IGOA 1Q5KA 3A8WA 3P5JC 3E3BX 4TYEA 5A3XA 3V3VA 2UW7A 4D2RA 3LHJA 2R3IA 1XWSA 4EBWA 3VONA 2E9OA 3QUPA 5F1ZA 2QHMA 3UC3A 2FSOX 1XMMA 4Y46A 3FL5A 3IS5A 1W7HA 3DBDA 4M3QA 4W8EA 4YBKA 4MNEB 2J9MA 1XH6A 4PL4A 3LMIA 1BX6A 4CFMA 4NUSA 4FE2A 3G15A 1O9UA 4O91A 5KMOA 4FVRA 4U3YA 5K4JA 4YO6A 2FA2A 4BGGA 3RPYA 2WTVA 4CGAA 3ODZX 2R3LA 5GJDA 4JRVA 1FGIA 1IEPA 2ITUA 2OXDA 3OROA 4W4XA 5HIEA 3IOPA 1JBPE 2IW8A 2C5VA 3LCSA 2JITA 5FP5A 3R9NA 2PVJA 2CGUA 2WHBA 5HG8A 5IQAA 4DHZA 1XR1A 5AP2A 4BTFA 1Q8WA 5M57A 3BGZA 4XJ0A 4D5HA 4C33A 2R3KA 4K33A 2YISA 3NSZA 3TNHA 1W83A 3BU5A 1ZOHA 5CQWA 4CFFA 5AP5A 2XKEA 4F4PA 3FL4A 2ETKA 1REKA 3MH3A 4MX9A 3NYXA 4YJTA 1JVPP 1JWHA 5I9UA 5IMXA 2GHMA 2OK1A 3GEQA 3RK7A 3GB2A 3ZS5A 2R3PA 4FKTA 4DT8A 4IDVA 3GT8A 2H6DA 2VTTA 4FZDB 3R83A 3VS7A 5L2WA 4I0SA 1GNGA 1YDRE 4X6RA 2UV2A 4IAKA 2ONLA 3IW7A 2XMYA 3P78A 5JGAA 5CF5A 2F7EE 2RGPA 4BY9E 1VJYA 2XRWA 2FYSA 4PWNA 3VS0A 2PVRA 3JY0A 4FK3A 3WOWA 1MRUA 4XLIA 5TR6A 4K2RA 1B6CB 2CLXA 5CSXA 4JR3A 5FDXA 1BKXA 3F6XA 4FV1A 4TW9A 4X0MA 3AMYA 2GNJA 2WPAA 4H58A 5LVLA 3W0QA 4WBBB 2JAVA 3WZEA 4FODA 2OXYA 2YIXA 4QMTA 2ZVAA 5T3QA 5KMJA 3VHKA 2B9HA 4KD1A 2DS1A 1UWHA 4O27B 4TKSA 1G5SA 3BWJA 4PQNA 1QPJA 3F69A 4DFBA 1UVRA 4DFUA 3P23A 2CSNA 2IZUA 4FTNA 2R0UA 5CNOA 2PZPA 4V0GA 2ZV7A 1XO2B 4ACHA 3PE1A 4TNBA 3LJ2A 5CAPA 3C4EA 3EJ1A 4U81A 3PSCA 3AC1A 4IVDA 4U3ZA 2A27A 4OTWA 4JL9A 4TYGA 5G1XA 4BBMA 5KMNA 5K9IA 1WMKA 4DT9A 4F65A 4WRSA 2F7XE 3N4VA 2X0GA 4FIHA 2ITQA 3KFAA 2IZTA 4RX7A 3TV6A 3PIYA 2EB2A 4GJ3A 5CY3A 4AFJA 1XH4A 4EUUA 1DAWA 4U97A 2XJ0A 3IK3A 1XH9A 3OP5A 4GW8A 3A61A 3VBXA 4FNZA 4FV7A 5HESA 4LL0A 4NFMA 3VS6A 2RG6A 3QTRA 3OFMA 4IJPA 3KXZA 3DGKA 1JSVA 1W98A 5L2TA 4ZSJA 4R78A 3UG2A 2PULA 1H00A 3FZOA 4X21A 5KO1A 5DG5A 2OH0E 4YJUA 3TTIA 2VTMA 3RVGA 5GINE 4F08A 2BDFA 2QNJA 3BL9A 2CN8A 3I4BA 2Y4PA 2OW3A 4ZTNA 4C7TA 2PPQA 4JBPA 3ZUTA 1BUHA 3GC0A 3QXOA 2WMAA 3CQWA 3NPCA 3MIAA 5HE1A 2RFNA 2H34A 5FEQA 4GIHA 3NFFB 4IAAA 4EOLA 3OC1A 1DI9A 2BZJA 4NM7A 4ZIMA 5KKRB 4X2FA 4L7FA 5EHYA 5ANJA 4CFUA 1OMWA 2C5YA 3EQIA 4JQ8A 4W4VA 2X8DA 2XKCA 2AEGA 4LV7A 2HZ4A 3ALNA 3HP5A 4RWKA 4Z9LA 3TMOA 1F5QA 5HTCA 3W32A 5K4IA 4FYNA 5JH6A 4N0SA 3AC2A 5CU0A 1H1SA 4W4YA 3TYKA 1P5EA 2HK5A 3MJ2A 2WMRA 4YUQA 3BQCA 2IVUA 3ENMA 1H1QA 2W5AA 3FE3A 4F63A 1P4OA 1XBCA 5LWNA 2GHLA 1OIRA 3DBEA 1OBGA 3G5DA 3KC3A 2XIKA 4FV4A 4YZMA 5EQEA 1Q8ZA 4A9RA 4YTIA 2Z2WA 4UYNA 3R7UA 5IISA 4JBOA 4F7NA 1B39A 1YXXA 4ORKA 3UZPA 5EDQA 5KZ0A 3MA6A 4CTBA 4L45A 3ZM4A 4AN9A 3C4ZA 3F2RA 1MP8A 5T68A 4ZLYA 4D4RA 4E20A 3FC2A 4K18A 3LFQA 2YCRA 3D0EA 4EJNA 1ZOGA 4X2GA 4WG3A