4DCAA

Crystal structure of aminoglycoside phosphotransferase aph(2'')-ib, adp-bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
LDAEIYEHLNKQIKINELRYLSSGDDSDTFLCNEQYVVKVPKRDSVRISQKRELELYRFLENCKLSYQIPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKELHSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENILSNAVLFKYTPCLVHNDFSANNMIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGRKVLKYYQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKDVSELLQTQAEMFIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-Ib, ADP-bound
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 105
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dcaA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dcaA02
2OJFE 4DG2E 2R0IA 3DKFA 2I40A 1JKSA 1Z57A 4FV5A 4B99A 2B9FA 5EK7A 4FKRA 3O96A 4DTBA 4DITA 2W17A 2Y4IB 4YNOA 3W32A 5M51A 5CX9A 3O8TA 1SM2A 3A99A 3E3PA 3MPAA 2WMTA 4N6YA 4X2JA 3EQBA 4IANA 4TPTA 4MXXA 3P79A 2JIIA 2VWZA 3VAPA 2B54A 4JBQA 5A3XA 4EOSA 3Q96A 2XCKA 1V0OA 2BHEA 5AIRA 3O17A 5I9XA 3MY0A 4AN2A 1XBCA 5DLSA 4AZSA 4JOAA 5JQ8A 4M13A 5AAEA 3CGOA 2XKCA 3EWHA 3NIZA 2BDJA 4UYNA 2JKMA 5A4EA 1W84A 5E8SA 2OG8A 3LIJA 5BVOA 1DM2A 4V01A 4U0IA 3C50A 5AMNA 4G3EA 4TW9A 4HZRA 2VGPA 2VTMA 3ZM4A 2WFYA 5ACBC 1K9AA 1OKVA 2GNLA 4FC0A 4H36A 4I92A 2QO2A 4TXCA 4XBUA 3TNWA 5F9EA 1G8AA 4TYHB 2X8EA 3H0ZA 4PDYA 3GI3A 4ZSEA 4MX9A 3NX8A 1WBNA 2X8IA 3EL8A 2IPXA 3W0OA 3GU7A 4HVHA 1MRUA 4ERKA 3DBFA 2YM7A 4RC4A 4JDIA 4U45A 1WBWA 2OU7A 2REIA 3ROYA 5BVNA 3PVGA 3OC1A 4R7BA 1ZOHA 1L8TA 2C30A 2VO6A 3DY7A 3QHWA 4G5PA 4NUSA 5TKDA 3AGMA 4WG5A 3DB6A 2VO0A 3HECA 5LMKA 4DCAA 2W5AA 3QKMA 2W1FA 4ZOGA 2UW5A 4BCPA 3IGOA 4FNXA 3QC9A 5I9WA 2OZAB 3OOMA 4LUEA 4CKJA 5HD7A 3P4KA 2R3JA 2ZM3A 1FMKA 2UZVA 5DGZA 3UG1A 4D2RA 4K6ZA 3SC1A 4AT5A 3MDYA 5ANDA 2ZM4A 5BYZA 2QLQA 3ODYX 2R0UA 4CGAA 4AN9A 5JFVA 5LQFA 3K5UA 2BROA 5DBXA 3AMAA 2Y6MA 3R1QA 1PYXA 5LXMA 3DTWA 4CRSA 3FUPA 1W82A 4D4VA 3FMDA 2BTRA 3O8UA 3OHTA 1Q3DA 3DBEA 4P90A 2VWUA 3TIZA 3U4WA 1PXOA 3R7VA 4O91A 5I0BA 2YM8A 1BMKA 3D2KA 5BX0A 3LCTA 4I4FA 1TQIA 2PSQA 4BR3A 3EB0A 1RE8A 2VTAA 2WGJA 2J6MA 2ITYA 4C35A 4V04A 3C9WA 5CZHA 1NY3A 4GK4A 3HRFA 5EDRA 5J87A 3QHRA 4N4SA 3BYVA 2OGVA 3CTJA 2QG7A 4FKTA 3LCKA 4MXOA 5DYJA 3KK9A 4FL1A 3NUNA 3MJ1A 3A61A 3QWKA 4UZHA 1UU8A 2PU8A 4NW5A 3PVWA 4EK6A 2H9VA 2R3LA 3MS9A 3ZRMA 3R9RA 3QGWA 3G51A 3PJ3A 1V0BA 3QCSA 4O27B 3ZSIA 1UNGA 3B2WA 4AX8A 3EN4A 3W8LA 5M57A 3TUCA 1IR3A 2FUMA 5HLWA 4I22A 4ALWA 3VJNA 1PMUA 3R21A 3F3UA 2UW9A 5TT7A 5EOLA 3PFQA 2QOLA 3DBQA 3PP0A 4GEOA 3QYWA 3VRYA 3ZSHA 2PVMA 4CV8A 3QQJA 4DFYA 2VO7A 3AG9A 5CTPA 3PXRA 3U9CA 3U6IA 4ZTRA 4FVRA 4TWPA 5KMNA 1OPJA 4V05A 4EZ7A 3F5PA 1W0XC 3LFAA 4KKEA 3AXWA 3PE2A 4USFA 4O7PA 3UNKA 4F0IA 3MV5A 5JH6A 2ITQA 4RQVA 4YZNA 3SQQA 4R5SA 2WPAA 4GYIA 3ZRLA 4HYSA 2ETKA 3V5WA 4BN1A 1OIYA 2H96A 4QTAA 4ACMA 3R9DA 2X9EA 3QF9A 3EFLA 4A7CA 3FI4A 4FTMA 1FGKA 4GYGA 3S1HA 4L43A 4DG3E 2O3PA 2PUUA 4MK0A 4DH7A 4EKKA 4B7TA 4Q5HA 4OUCA 4D0XA 5LWMA 2AYPA 4P5QA 4CV9A 5B7VA 2C68A 4JRVA 5K9IA 3MI9A 1Z5MA 4IVAA 4AWIA 2Y4PA 2QOIA 3C0GA 1SYKA 4ZTQA 2OJGA 2XRWA 1LPUA 3OCGA 4CCBA 4QTCA 3TJCA 3VO3A 2YM5A 4BDFA 3DLSA 1OIUA 1PXPA 4RWLA 4CKRA 2X7GA 3OY1A 3TZMA 4QMPA 2R3KA 1YHSA 4BCFA 4IX3A 4PL5A 2CHLA 4Y85A 2CKOA 4PP9A 3ALNA 4ZMFA 3LXNA 5ETAA 2QKRA 4F6SA 2X9FA 5LWNA 4YHFA 5KZIA 4M8TA 3T8OA 4DLIA 3RAKA 5CWZA 5M56A 2X2KA 3PG1A 2ERZE 4YLJA 3Q5ZA 4BKJA 3NUXA 3GT8A 2GFCA 4O0WA 4MD9E 4HVDA 4ZSGA 2QOFA 4AUAA 5KCVA 4P4CA 2VTPA 4NM7A 4MXAA 3TJDA 3BHTA 3OXZA 2XNOA 3A8XA 2X0GA 4ZAUA 3FKNA 4BIBA 2EB3A 4QMOA 4HYHA 1E9HA 3DK7A 4NWMA 2OLCA 2WTKB 4S32A 3DAEA 5I4NA 3EHAA 5H8EA 3DAKA 5H8BA 4RIYA 4JX3A 1YDTE 4N6ZA 4FYOA 2YABA 3DA6A 2BZJA 5HIDA 4RJ3A 4FSZA 3QTIA 3HLLA 3ZXTA 2X7FA 4FIIA 4Y73A 1NXKA 4E6CA 4UN0C 1PW2A 2HW6A 1XQZA 2XM8A 3EJ1A 4QNAA 2C5NA 1SVEA 4GT5A 2B9JA 5AP3A 4ZXTA 4WRGA 3CS9A 1V0PA 3H0YA 5CLPA 4C7TA 5D9HA 5E8XA 3R8MA 3TZ7A 2XK7A 3SOAA 4L42A 4D9TA 1OKZA 4ZK5A 1H0WA 1OGUA 4QYGA 4WIHA 4IWOA 4QMVA 3IW6A 4F1MA 2CN5A 3IDBA 3LE6A 3ZBFA 3R1SA 4FKWA 3UBDA 4XNEA 3UTOA 4WD5A 3WI6A 4FUYA 3ZUTA 4BDJA 3FLYA 4EUUA 4EORA 3KC3A 4AW5A 4PTEA 3C7QA 3R1NA 4X3FA 3L8VA 3ORNA 3C0IA 5DOSA 2JGZA 5CU4A 3FPQA 4TL0A 5EM6A 4M12A 5LMAA 3IOKA 4F1TA 5HTBA 3W0SA 3ET7A 4JDHA 3BWJA 2YITA 3BHUA 5K4IA 4N70A 2UUEA 1CKJA 3QZIA 2GHMA 4E7WA 3G9NA 3U51A 4JRNA 3UJGA 5IA0A 1H1QA 3GU6A 1TKIA 4L52A 2IG7A 4D4SA 4IX5A 3COKA 5ANEA 4JR7A 3VUDA 3UP2A 2VWXA 2IVTA 1YXSA 2WQOA 1J1CA 3R1YA 4CFXA 4ALVA 4IWQA 2JFLA 4AGDA 4DFNA 3ETAA 4M14A 4FTIA 4RFMA 5HZNA 4RSSA 4YSMA 3VF8A 1H1PA 3G0EA 2R3QA 4OTFA 5FXRA 5EYDA 1OBDA 2F2CB 2UW3A 3C5UA 3BBWA 4I20A 1KUTA 3R7OA 5IQBA 5LVMA 1E1XA 4D4RA 3R9HA 3W10A 3IW7A 5CI6A 5B2KA 4J53A 5HNGA 3RCDA 5AV0A 3UC4A 3LPBA 4BCNA 4O96A 5M07A 4BTMA 4LL0A 5J95A 4XG9A 2XKDA 3FL5A 4A9YA 4FKSA 4Y5QA 5HHWA 5AP6A 2Y8OA 4FSUA 4C33A 3ZBXA 5K5NA 1J91A 3OG7A 1YWVA 4UB7A 4JQ8A 4QO9A 1H28A 5AP7A 2BFXA 4XBRA 5CF6A 1P4FA 2DWBA 4EQMA 5CNOA 3RWQA 4YZ9A 4YUQA 2VGOA 4Z7GA 4LV5A 5CF4A 4AAAA 2PZIA 1MUOA 4U80A 4AN3A 4I41A 4PMMA 4F70A 1ND4A 5L3AA 4NCTC 1WBSA 4FTTA 4DEBA 1LP4A 1XH9A 3KY2A 4C59A 3KMMA 2ESMA 1YKRA 3BGZA 3F82A 4QP1A 1Y91A 3V6SA 4L6QA 5LCJA 5IQGA 2JBPA 4YJRA 3QUEA 3UOLA 3ZO4A 5AA8A 4KIOA 1ZXEA 3EN9A 4ZTSA 5IQFA 2NO3A 5CXZA 2WD1A 2NRYA 3H9RA 5IU2A 2C3JA 2WMVA 2WTWA 3KXMA 3PVUA 2ETRA 1JSUA 4G1WA 4JDJA 4Z9LA 3MW1A 5CANA 4O6EA 3QRUA 3EFWA 3SAYA 3BYSA 3HAVA 5H2UA 3S3IA 3CGFA 3MESA 3UMXA 4MF1A 1U46A 2QOOA 3KA0A 2GTMA 3R83A 4RJ8A 4QMTA 1H08A 2B52A 3BIZA 5FXSA 4R5YA 4UBAA 1H1RA 1MQ4A 2BR1A 2ITWA 3E8EA 4WKQA 4XV3A 1U4DA 2R3GA 3QX4A 2WTVA 3SV0A 2XYNA 1FGIA 3OUKA 3I4BA 5FQDC 5HI2A 2RL5A 4O83A 2Z7QA 2VWYA 2HYYA 2IZUA 4PDOA 4QMXA 5BMMA 2JFMA 2X6DA 3TV6A 2R4BA 4A06A 1YXXA 3O71A 1GZ8A 3PLAE 3TG1A 5HIEA 3II5A 2WOUA 4NU1A 5J5SA 3RALA 2OJJA 3WIGA 4BRXA 3PIYA 4EH6A 5CS6A 3VHKA 2X6EA 3LM0A 4EJNA 2PUIA 4JIAA 1HOWA 4MQ1A 5EYCA 2YCQA 1NVSA 2W4JA 4MD7E 4CNHA 4GS6A 3LMGA 2CCHA 2XCHA 3BEGA 3NVMB 4BIEA 2C0TA 1CTPE 2E9UA 3FZOA 2C0OA 2ZV8A 3D4QA 1W7HA 4F65A 1NT2A 3QQUA 3ZFYA 5I9ZA 3AD4A 5CF5A 1KV1A 2RG5A 2QO9A 5IG1A 3DT1A 3BEAA 4RBLA 4FV6A 4BGQA 3ATTA 3FZRA 3QWJA 4UV0A 4ZIMA 3DDQA 4IJPA 5ANGA 1U5QA 3OD6X 3OOGA 3QL8A 1H00A 4Y5HA 4S30A 4BB4A 3A60A 4PWNA 3W0PA 1WBVA 3F2AA 1R0PA 4HOKA 4BDDA 3ORIA 4RIYB 3P08A 4EH2A 4CTCA 3LJ2A 3F7ZA 4YJTA 5BMSA 3WE8A 3G6HA 2XUUA 3GB2A 4FEQA 3HMMA 4ZS4A 2PVRA 4BBEA 1WBOA 2Q0BA 3E7VA 5FXQA 4EH8A 2YHVA 4MCVA 4G17A 2ZOQA 5IQHA 4QMUA 3TNHA 5JEBA 3EIDA 4R1YA 4RX9A 2HENA 4YLKA 2VTLA 4DA5A 3FMMA 3I0QA 3MBLA 2QI8A 4PDSA 4MBLA 3ZXZA 4FBXA 4OGRA 3OUNB 4H05A 4YC8A 2GTNA 3SA0A 4S33A 4EH3A 3DKOA 3Q6UA 4O7RA 4R3PA 2YA9A 4ANSA 5HTCA 4E6DA 3ZU7A 4RFZA 4EC9A 3AC4A 4C3RA 2BDFA 2YAKA 3HRCA 3QXPA 4KBAA 3ZC6A 2KTYA 3PA4A 5G1XA 4CG9A 2X81A 3OWKA 5JFWA 4DGGA 1J3HA 5FDPA 4ZSLA 4BCKA 5KBRA 3BU3A 5JRSA 5I9YA 2XS0A 3POZA 4XX9A 5E4HA 3HMNA 2QCSA 2HWOA 3JVSA 3VS2A 3EQIA 3ZLYA 4D58A 3FL4A 4JIKA 5CNNA 4RIOA 5IA3A 4I93A 2Z7SA 5AADA 5ANOA 5GJDA 5HE1A 3W55A 5CEPA 3KGAA 2CGVA 4YJSA 4GVJA 4EOJA 5HORA 4FSTA 3IONA 3TYKA 4GH2A 3IECA 3QZHA 3GXLA 3MGYA 4JX7A 2RFDA 3W16A 3ZO3A 4CFMA 3VJOA 1PXIA 2X4ZA 3T3VA 4AT4A 3QC4A 3QRJA 4FR4A 3CY3A 3P9JA 2FGIA 3GU5A 3R7EA 2UW4A 4YZDA 2W99B 4G5JA 3H10A 4D1ZA 4BY9E 3ZFXA 2QOKA 2VRXA 5HCZA 4F6UA 3BU5A 3SW4A 1H27A 3MB6A 3CD3A 3NSZA 3OVVA 4ID7A 1M52A 4PF4A 5D7AA 3MY1A 4QP8A 4DAWA 5CASA 2VU3A 5AEPA 3RPYA 4BZNA 2QONA 3HA8A 2FH9A 4PP7A 3ORKA 4DG0E 3QGYA 3RJCA 4IZYA 3JY0A 3GENA 4TT7A 3Q9YA 4H3PA 1UV5A 2FSLX 4PDPA 1UU3A 4PNIA 3KCKA 4MVFA 3EKKA 4UWBA 3VN9A 1XH5A 3RHXA 3BHHA 1U54B 3A7JA 3DNDA 3CSVA 1ZY4A 3EQRA 3C4EA 3NLBA 2SRCA 1T45A 3EYHA 2F4JA 2JDRA 4AOTA 4QP7A 4E73A 1Q8WA 4XG6A 3KKVA 2ZM1A 4FV8A 5IDNA 2CN8A 3KXZA 4GFMA 5AUVA 1WVWA 5JRQA 3Q2JA 4BDEA 4E8AA 1UKHA 4Y83A 5IEXA 4AXAA 4MNEA 4FV2A 5B0XA 3KVWA 3MH0A 3ELJA 2XK8A 3FI3A 3HMIA 1WZYA 1KE6A 1A9UA 2JEDA 4FKUA 1JQHA 3MA3A 2XNMA 2R3HA 4USDA 3C4WA 5KMOA 1MRVA 3TV4A 4GVAA 4YPDA 4D9UA 1PMVA 5KKRC 2UZUE 4E4MA 4HCTA 4DN5A 3FKLA 1XWSA 3FC1X 4O0VA 4K77A 2HY81 4BDKA 3QUDA 4RVKA 3IW8A 3U6JA 4EK5A 4RWKA 1DI8A 3WE4A 1KV2A 4ANQA 5KKRB 1YWRA 1B39A 3UVPA 5M4CA 2PZPA 3E7OA 4MBIA 4H39A 5DR9A 5HGIA 5AUTA 3DU8A 4O7WA 4OTGA 2BRHA 2J0JA 2XRUA 3FQHA 4U79A 3QBNA 3NS9A 4NFNA 4DH8A 3DKCA 3G0FA 2UZBA 3HP2A 5DNRA 4ARKA 5CSVA 3A4OX 3FLNC 3LFCA 4ACGA 4IC7A 3FHRA 3KRRA 5BVWA 3PSDA 2RF9A 5J7HA 1BKXA 2EWAA 1OM1A 1JNKA 5CZIA 1ZRZA 3RWPA 4AZTA 1TQPA 3PPJA 1ZZ2A 4AE9A 3RVGA 4ACHA 1LUFA 4PL3A 4FZFB 4Q9ZA 2GQSA 2VX3A 3P7BA 2QOCA 2H8HA 4K0YA 3D2IA 3Q9ZA 4GJ3A 4PY1A 4TNBA 4HNIA 1PHKA 3E88A 1OVEA 5AUWA 5HCXA 4II5A 3UIXA 3VBYA 4F0FA 2ITPA 4DEHA 4IVCA 3QX2A 4JQ7A 1WVYA 5A4QA 5E8ZA 4HPUE 4E4LA 2PZYA 2BRNA 3K5VA 4AG8A 4LRJA 2VTSA 3NVKI 1K3AA 4HVGA 3ROCA 5L2TA 4BYJA 4XV9A 4XOYA 3S95A 5KUPA 5CXHA 1Q8YA 2C6OA 4QYYA 3QFVA 5L6WL 3RAWA 3V8TA 3RK9A 3FSKA 3FEGA 4FK6A 4D5KA 5CQUA 2ITXA 4A07A 4C34A 5C26A 5ETIA 2ZB1A 2R2PA 1W83A 2I7QA 2W7XA 1SNUA 4R7IA 3NMUF 1R78A 3D15A 3PA5A 4Y72A 1XO2B 1Q24A 2PMNX 2VUWA 1RDQE 3H9OA 4RLKA 4YJUA 5EI8A 4N0SA 3LFBA 3AMBA 4FKPA 5ANJA 3G5DA 2ONLA 3A8WA 3NW6A 4X2GA 4LGGA 4XLVA 4X3JA 5ANKA 3WZUA 3D5XA 3EQDA 5IA5A 4WZYA 1GNGA 2VX0A 1REJA 4JJRA 4WBBB 4F7JA 1I09A 2P33A 2VX1A 3C13A 4XV2A 4BF2A 4HCVA 5CENA 4RC2A 5FEEA 4A4OA 2BRGA 3NYVA 4FSRA 1VJYA 2OBJA 2UZDA 3EQGA 2P2HA 3DBCA 3UNJA 4CFFA 4B4LA 5J9YA 4GFOA 4W4XA 2PZRA 4OTQA 4JVGA 4RIXB 4YC6A 4PL4A 4QTBA 2JC6A 2PL0A 3OCTA 4C4JA 5FBOA 2XKFA 4O7NA 4LMUA 4EYMA 3FYKX 3TWJA 4AZFA 1LEZA 4NKSA 1Q61A 1WMKA 4EH7A 4XOZA 3D5UA 2O2UA 5JQ5A 3IDCA 3EQHA 2EUFB 4MBJA 4EOKA 5A4LA 3FSFA 5DR6A 4K11A 5FTOA 4B0GA 1GZNA 2RFNA 4LRKA 4Z55A 2C3IB 2YIQA 1YXVA 4FTRA 4YJVA 4E93A 2JDOA 2HZ4A 5F20A 5HU9A 5EHOA 4NTTA 5IEVA 2C1BA 3ATSA 2PTKA 2JIVA 2XIRA 4WNMA 2JDSA 2X2MA 3VQHA 3U6HA 4C4FA 5CF8A 1JPAA 3QD0A 2VWIA 5FM2A 4CZUA 5DRBA 3KXXA 5E8TA 3V01A 4B8MA 2QOQA 3Q9XA 3QAME 5CU3A 5DI1A 4BHZA 4C38A 5C4KA 3CPBA 4AA4A 5AFVA 2BZIB 2XNEA 5FLFA 1YI4A 3R7IA 4RWJA 3FXZA 4GKIA 3UIMA 4I3ZA 4EUTA 5BQ0A 2JAVA 2JDVA 3KMUA 3O0GA 3E8NA 4EH9A 3VBXA 4UEUA 4K33A 1OBGA 3T3UA 4IDTA 4FTNA 3EKNA 3FXWA 4ZZOA 5M09A 4IC8A 3C0HA 4F9CA 3QLFA 1H01A 4W4VA 4EBWA 1S9JA 5H9BA 1VZOA 3R30A 5JZNA 2QOBA 1QMZA 2B0QA 3GCSA 4AP7A 3TEIA 2EVAA 2BPMA 4FSMA 4GU9A 4LG4A 4FOBA 4BDAA 3F3TA 4IZAA 1TQMA 2NNWB 2JIUA 3QQHA 3KRLA 4B6LA 3H30A 5E8WA 2XZSA 3E93A 3OW4A 3QA8A 2HY0A 4QMMA 5L2SA 4TN6A 4XV1A 4KA3A 3AC2A 4O7TA 4IX4A 4AOIA 3UQCA 5DIAA 5GJFA 4FKVA 3D7TB 4YHTA 3L9LA 4S34A 4JBOA 3WZDA 4XP2A 5EI2A 3R73A 5L8JA 3CPCA 3TT0A 3SHEA 4D0WA 2YACA 4I6FA 3MH1A 4QMNA 3U87A 1SNXA 4I21A 5C8MA 3GCVA 4YURA 3ID6C 2JKOA 3M1SA 2J5EA 4ERWA 4WBOA 3EFJA 4H1JA 2LAVA 5ETFA 4F63A 2PWLA 3DLZA 3HNGA 3EFKA 5C8KA 4OBPA 2ZMCA 3C5IA 1UA2A 4HGSA 3AT3A 4TWNA 1J7LA 3UYSA 4FKGA 1H0VA 3W2QA 1KE7A 4BIDA 3Q2MA 2CMWA 3BHYA 4TY1A 5CU2A 3RM7A 1RJBA 2J0KA 3DS6A 1R0EA 3MIYA 4IAFA 5AV2A 1WVXA 1RQQA 2CLXA 3BQRA 1LEWA 2FSOX 4QT1A 4IW0A 4TYEA 3LZBA 4IFCA 2C69A 3GQLA 2WU6A 3OW3A 4GT4A 2WZJA 4RA4A 5EHYA 4CXAA 4C4EA 5GIPE 4D55A 4L46A 4MXYA 1OZ1A 4YNEA 5CVGA 3AMYA 3T9TA 2VD5A 4ZJJA 2RFEA 3TDWA 3WOWA 4DGNA 5BUIA 3MIAA 4HZSA 3F3VA 4MEDA 3MH2A 4YJPA 2HZ0A 4Z7HA 2W05A 3DNEA 2VTOA 4U97A 2XJ1A 4BCIA 3QXOA 3MTLA 4QQJA 2QKWB 4DBXA 3S2PA 1AD5A 3ORLA 2IO6A 3FMNA 2XA4A 3MWUA 3QRKA 4OBOA 4FMQA 4CLJA 2YDKA 4U42A 2WMRA 3QZFA 3DXQA 4UWCA 4BGGA 5HBHA 4F9WA 5AM6A 1IAHA 3FWQA 3B8QA 4BICA 5AV4A 4OTWA 2YJRA 3E8DA 2VTNA 4TWOA 3VULA 2WNTA 4OLIA 5LVLA 1XH7A 4F7LA 4U3ZA 2FSMX 2YWPA 2IN6A 1UU7A 2EU9A 2HK5A 4ONAA 4MQ2A 2WIPA 4AQCA 4IACA 4RLLA 3QCQA 3TDVA 5H8GA 3V5PA 1P14A 3QU0A 3ZLSA 1PXNA 4CMOA 3O7LB 1A48A 4FTOA 4G34A 1YQJA 2PVYA 2BTSA 3ZMMA 4FKOA 2QR8A 2UW6A 2XK6A 2YIRA 3SLSA 4CZTA 5IH6A 4DLJA 5JT2A 1CKPA 4BTJA 2UW8A 4FL3A 3UO6A 5T68A 4ZMEA 4I23A 5HVJA 1ZMVA 2B9HA 4U40A 4Z16A 1P2AA 3LFNA 3PZEA 1IG1A 4U98A 1GY3A 2ZMDA 4ANMA 2HXLA 3PJ1A 1URCA 5IQIA 4XH6A 5BPYA 1JSTA 4FKJA 4IX6A 1XJDA 2WTKC 4ZSJA 4O38A 1XBAA 1MQBA 3BCEA 3HDMA 1JKTA 4PTGA 4A4XA 2EXMA 3IG7A 3GEQA 3FBVA 5BYYA 5GINE 3COHA 4G16A 4RX7A 1Y57A 4BCGA 4DEGA 2W4OA 5LOHA 2BRMA 3TUBA 2GNJA 2VWWA 3BX5A 3K3IA 3CKWA 4TKSA 4U3YA 1IA9A 3LHJA 2OZOA 3O23A 4PUZA 4R1VA 4Q9SA 4KRDA 2WKMA 4JS8A 3WZKA 4CMTA 2C4GA 4ZJVA 1O6YA 1EH4A 3LKMA 4I5PA 4NK9A 3NGAA 4Y8DA 2QOHA 4QTDA 5DT0A 3CKXA 3THBA 3JPVA 4W8EA 4D2SA 5IMEA 5HO8A 2CNVA 2IZTA 3EYGA 2WELA 2PYWA 1FVVA 3QKLA 2IW6A 3V3VA 2W1IA 4AZVA 3FMJA 2CGWA 4LOOA 4YTIA 4O22A 4D1XA 4CT2A 3W0QA 1S9IA 1VYZA 3C4XA 5FM3A 2NP8A 4XYFA 3UPXA 5CVFA 3A7IA 1PKDA 4ZY4A 2EB2A 1PYEA 3DJ6A 4IE9A 4M15A 3FI8A 1ZYJA 3CTQA 2XEYA 2H34A 4ZZMA 5JN2A 3CQEA 3KXGA 3TNPC 1YRPA 4ZTMA 4G6OA 1P4OA 5HVYA 3A2CA 2AC5A 5IPJA 4DYMA 2CNUA 3ITZA 3MTFA 3WF9A 2VNYA 4CRLA 4E1ZA 4HW7A 2J5FA 4ENYA 5JFXA 3RMFA 5LMKC 5KNJA 3R7YA 4FV9A 2DS1A 2ITTA 3UQFA 4DINA 3FQSA 3FYJX 3R8LA 2Z7RA 4OR5A 1PXMA 5HLPA 5JGBA 4TYGA 4R7HA 4CTBA 3KXNA 3BV2A 3MFTA 3EQPA 4GK3A 4KBKA 5FUTA 5M53A 2PE2A 5TF9A 4AZWA 2UW7A 3OROA 2PUPA 3QQFA 4U6RA 3V8WA 3WF7A 4XG2A 4DEDA 3NNUA 4M3QA 3GQIA 4RVTA 3NDMA 2BIYA 3LCOA 4HYUA 3LLAA 2HZIA 3ALOA 4QQ5A 5KMKA 3NR9A 3R8PA 3NUPA 5C8NA 4AGCA 4DGMA 3Q3BA 2I6LA 2J51A 5E8UA 3S0OA 4FVPA 3KF4A 3G9LX 4A9RA 3R71A 4WG3A 4PX6A 4JI9A 5DG5A 4EL9A 2CKQA 3ZCLA 3ZH8A 4EWQA 3HX4A 5AUXA 3OXTA 1M7QA 2J0IA 2XK4A 3G2FA 1WBPA 4XG8A 3ZFMA 4C2WA 3IQ7A 4GG7A 3OF0A 3ZUVA 3KU2A 4J71A 3FZPA 5E9EA 2GSFA 3FHIA 2WQEA 4FG8A 1OL1A 4KSQA 1PXKA 4EI4A 4AW1A 1YXUA 3PA3A 3I60A 3P86A 4KD1A 4IZ5A 2BAQA 3E62A 3FZ1A 2ITVA 1PXLA 4K1BA 4AFJA 2V7AA 4BBFA 2R3OA 4FV3A 4IAAA 2F7ZE 1ZOGA 5I5ZA 3D5WA 3PG3A 4YO6A 2YM3A 3CY2A 4KNBA 3LLTA 3BLHA 3LQ8A 4FT9A 5E7RA 5EH0A 2IVUA 3MVHA 5HU3A 5LMBA 2CGXA 2IW9A 3RPRA 3MA6A 1FOTA 3PXZA 5HKMA 5HNBA 5HIBA 4EJ7A 3W0NA 4BGHA 2R5TA 3DK3A 5IQAA 4HJOA 3LQ5A 5EI6A 4FGRA 2JKKA 3DOGA 4EWHA 5JGDA 2XYUA 3PY1A 3QTQA 2RIOA 2XIKA 1YOMA 5I9UA 3P7AA 3PIZA 2Q83A 4QRCA 4Z3VA 2ITOA 1RW8A 3M42A 4P5ZA 5ACKA 3Q4TA 1W8CA 4A9UA 1I44A 2OFVA 2KULA 2OJ9A 2OK1A 2ZDTA 4FEVA 4QP3A 4C37A 4CKIA 3NUUA 1O6LA 4JAJA 3FDNA 2HIWA 5TR6A 5DFPA 2GCDA 4IM3A 4BI2A 4KIQA 4AE6A 3TKHA 1CMKE 2ERKA 3P0MA 4F08A 4QP6A 3OT3A 2XIZA 5HG9A 3UODA 5M06A 2FVDA 2E9NA 5JK3A 3RKBA 1Z9XA 4JT3A 2UZOA 4DT8A 1QCFA 3DTCA 4QPAA 3GCUA 4O0SA 2W5BA 2GNGA 2WMSA 4MTAA 5CEMA 4R3CA 4QMWA 5E8YA 3REPA 5IH5A 4FT3A 4JG8A 2V5QA 3NWWA 4FZDB 4U81A 3BYUA 3W2PA 3CQWA 1DAWA 5JKGA 4BBMA 3GBZA 4ZS0A 4H3QA 3K3JA 2W06A 2BHHA 3D0EA 3O2MA 1H07A 4F64A 5J9ZA 3R04A 5HICA 2XH5A 1JBPE 1H26A 3P1AA 3ZDIA 3I5NA 4LMNA 1XKKA 3UMWA 3W2OA 3S00A 2IJMA 3FAAA 3Q60A 2GFSA 4IAZA 3ZOSA 4WNOA 4DEEA 4F4PA 2BRBA 4TNDA 5EKOA 5LCKA 4X7QA 3WZJA 4XUFA 3ZHPC 3NYXA 4PTCA 3VF9A 2BZKB 3R22A 2XJ2A 3CJGA 2WQBA 3EL7A 3CXWA 3IW5A 5IDPA 3OP5A 3OY3A 3PY0A 3HL7A 3OCBA 2UVXA 4LRMA 3PY3A 2PVKA 5G6VA 2EXCX 4NH1A 4GU6A 2QURA 3GGFA 3CR0A 3KULA 4WNPA 3SXFA 3ENHA 3VUIA 3NPCA 3OWLA 5KMIA 3I6WA 5L8LA 3TACA 3DBDA 4C02A 3VW8A 2GNHA 1B38A 4QOXA 1FBNA 2X2LA 4XG4A 4XLIA 4AZEA 5CQWA 4UX9A 2HXQA 3CD8A 3HA6A 3QRIA 5HEZA 4JDKA 2G01A 4L01A 4EOLA 2F49A 2C5OA 2HW7A 3JY9A 3F3WA 5FGKA 2V62A 3OWPA 4AACA 3KREA 4FX3A 3F6XA 4AOJA 1UNHA 3PXFA 3V04A 3AC1A 3RAIA 2WMXA 1OPLA 4JXFA 3ULIA 5C1QB 4FV7A 3A62A 3DQXA 2Z60A 5CT0A 3N4VA 5HESA 3PLSA 5A6NA 5HQ0A 3JVRA 4XRJA 3TXOA 4EZ5A 3EZVA 2J4ZA 4QMQA 4HVIA 5DT3A 5KMMA 5FTQA 4AT3A 4NKAA 4M7IA 3SG8A 3I81A 3MVMA 3HEGA 5BVDA 2E2BA 1YXTA 2B53A 4TZRA 2R3RA 4IM0A 3G15A 3A4PA 3V5JA 5CAOA 2CCIA 2UZNA 5DWRA 5CEKA 4S2ZA 4C4HA 4DH5A 2QU5A 4FA2A 4X3FC 3CQUA 3GOKA 5D12A 1XH6A 4O84A 3D14A 5A6OA 3R28A 3H9FA 3SXSA 3Q4ZA 2PMIA 2X39A 3RZBA 1NA7A 3FV8A 2WTIA 2RG6A 3KB7A 2BKZA 3ORTA 4NM5A 3MB7A 4K9YA 4LYNA 4X3FB 5DEWA 3W0MA 4I0TA 3V5QA 3ZSGA 3LOKA 3NNXA 3IW4A 3FY2A 1JWHA 3MJ2A 3QTSA 5J9LA 3LJ1A 4YLLA 3O7LD 2W1GA 5KHWA 3UPZA 4KSPA 4U44A 4OT6A 4TWCA 1U5RA 2A2AA 1DAYA 3OMVA 4G3DA 4O0UA 4WUAA 5CAVA 3E64A 2XK9A 5EOBA 5BVEA 5AA9A 5A9UA 1JVPP 3MY5A 1B6CB 4PMSA 3N9XA 5ANIA 3NYOA 2ITUA 2C6IA 3TNQB 3W0RA 2ITNA 3UE4A 5FEQA 2WTJA 3OBJA 1JOWB 4RVLA 4FSYA 3BRBA 3I0OA 4B8LA 3GU8A 1BL6A 2FA2A 1LR4A 3MVJA 5GHVA 3VUGA 3CBLA 4FKQA 4OBQA 3VBVA 3KN6A 4P2KA 2J0MB 3QQKA 4H1MA 5A14A 2DQ7X 3DPKA 4J8NA 4NSTA 4YBKA 2RFSA 3LFQA 3QRTA 3SXRA 5KMJA 3PSCA 2B1PA 3HUBA 4MAOA 4CCUA 3UVQA 5AX3A 4J7BA 4N57A 4B9DA 2YFXA 2YIXA 4JG7A 2PVHA 1R1WA 4EK4A 4EHZA 3W2SA 4D1SA 3VS4A 3D94A 3ORXA 5IUHA 4F9BA 3RTPA 2XBJA 2R3IA 2E9VA 4PNKA 4JBVA 4YMJA 2UZWE 4CLIA 4FICA 2R7IA 4LL5A 5C4LA 1YI3A 3Q4UA 1Q62A 3NYNA 1ZARA 1TVOA 3LFDA 3RCJA 3R8UA 3VWAA 4KBCA 1Q8TA 4IQ6A 3FMLA 4UWYA 5E1SA 3R7UA 3BELA 1PRYA 3U55A 2DYLA 3L1SA 3LQ3A 2P55A 3TNIA 4EKLA 3NIEA 3IPHA 2YCRA 3UOJA 2A4LA 1F0QA 4GUEA 2QHMA 2XMYA 2GHLA 1STCE 5D1JA 2BIKB 2QNJA 3PXQA 3FJQE 4KS7A 3VBWA 2C0IA 4RGJA 1FQ1B 3U54A 3TM0A 2J0LA 4J98A 4L45A 4RC3A 4CFVA 2PVFA 4NM3A 3AD6A 3BHVA 3OEZA 3TL8A 3UQGA 3AC3A 4RJ4A 3HV3A 3IS5A 4I0RA 4NIFB 3AOXA 3KF7A 2O65A 5F4NA 4KRCA 1H24A 2XB7A 4F0GA 1FINA 3IOPA 4FTUA 1Q5KA 4Y95A 4C58A 3S4QA 3FE3A 1GZOA 4X2KA 1KOAA 2J2IB 4YTFA 4NYEA 1GIIA 2IW8A 1JKKA 3DCVA 3IKAA 4YPSA 4QTEA 2R7BA 3C4FA 3R8VA 4HYIA 4NW6A 3DV3A 3OFMA 4YU2A 4U41A 3AC8A 2YM6A 5KHXA 2C6DA 4RJ5A 4RJ7A 1Q8UA 2R3PA 4IBMA 3I1AA 3LMHA 1MRYA 1OKWA 4DTKA 2YIWA 4YO4A 5JZJA 4X0MA 4RX5A 3ACKA 2WB8A 2BILB 4L7FA 3WIKA 3VS7A 2HAKA 2XNNA 3OS3A 4EEVA 4L68A 3KULB 4J1RA 4YGAA 4FOCA 2GQGA 4E5AX 2ZYBA 1O6KA 3GC8A 2R64A 4ITIA 4IAKA 4MHAA 4AGWA 3L8XA 3VHEA 2O0UA 4C0TA 3KRWA 4O82A 5AP1A 5BUJA 3VIDA 2IZRA 2BALA 2C1AA 3NUSA 3VUHA 4WUNA 1IRKA 2UVZA 4YZMA 4EZ3A 3GOPA 3OZ6A 3QQGA 2GS7A 3JYAA 5CSXA 4I5MA 4J97A 4WHZA 2R3MA 4XEYA 4BCMA 5IA4A 5F95A 2G2IA 5BVFA 4DFBA 3Q32A 5H3QA 5AWMA 1NVRA 2YWVA 5CEQA 4FTJA 5CSPA 3HVCA 3M11A 3F66A 4XCUA 1CM8A 3MFSA 4FIHA 4ASEA 4C62A 4EK3A 1DI9A 5EW9A 1YVJA 2C5XA 5CEIA 3ZLWA 5FRIA 4TTHB 4C4IA 5TOZA 3ZDUA 1FVRA 4MWHA 1HCKA 3LMIA 4MXCA 5E8VA 3TTJA 5M4FA 2W96B 2WMBA 2ZVAA 3QQLA 3VBQA 4DE4A 4AFEA 2XBAA 4JNWA 4GUBA 1J7IA 4APPA 3OEFX 2CSNA 3UVRA 5J1VA 4DT9A 4KB8A 3O50A 3FQEA 4IZ7A 4MXZA 2I1MA 3TCPA 3VS5A 3D9VA 4LI5A 2ZJWA 2W4KA 2QLUA 3MH3A 3QA0A 3LCSA 5A4CA 4QMYA 3T9IA 3ODZX 2X1NA 4WOVA 2V0DA 4M69B 4IIRA 5B2MA 3F2NA 4U94A 2XNPA 3ZZEA 2PMOX 3O8PA 2A1AB 4W4WA 4C36A 1CSNA 3LM5A 4YJNA 2JBOA 1G8SA 3BQCA 5M4IA 4ZY6A 4NL0A 3U9NA 4FT0A 2GDOA 2OH0E 4QMSA 3GVUA 3N51A 4OTIA 2B9IA 4YSJA 4AA5A 2W1DA 4AF3A 2WMWA 1Y6AA 2JAMA 3PE1A 4A9TA 2WEVA 2OJIA 3FPMA 3UZTA 5DA3A 5HX8A 1VR2A 4U9AA 5D11A 4WRSA 5AUYA 2OI4X 4ALUA 3COIA 5EW3A 4M0YA 3EH9A 4IB1A 1XH4A 4GFGA 4HGTA 3NAXA 4QMZA 5C27A 2JKQA 4GIHA 1IEPA 3Q04A 4XJ0A 4Y46A 5J8IA 3ZZWA 5K3YA 4I4EA 4Q5EA 4IMYA 2YCFA 2BMCA 3NNVA 3BI6A 4WO5A 4FIEA 5AV1A 4BTFA 1PMNA 2R9SA 5B2LA 3F61A 4BHNA 4FNZA 4IB0A 4YJOA 1UWHA 4W4YA 5ITAA 4QP4A 4KUJA 4LOQA 3DFAA 3WF5A 3DJ7A 2GS2A 2VTJA 2QHNA 4FSNA 4APCA 2F57A 4MNFA 4QQCA 5HG5A 4O7ZA 5AUUA 4G9RA 4A9SA 1F3MC 2CJMA 4FKLA 2GPHA 5HVKA 5EQEA 2Z02A 4H58A 5AP0A 3HGKA 1OPKA 5EG3A 1ZAOA 5EFQA 3GC9A 5K4JA 5L8KA 5FTGA 2XKEA 3F5GA 4EH4A 3UIBA 1UWJA 3ZS5A 3UNZA 3LXKA 4FK3A 4IB3A 1PJKA 3FLZA 4E20A 1ZWSA 4RT7A 3I7CA 4MYGA 3ANRA 3AT2A 5HG7A 3UYTA 3IDPA 4XP0A 5JFSA 2I0EA 3F3ZA 3QALE 2PE0A 3EN5A 4R6VA 4MNEB 3BU6A 3Q6WA 3LJ0A 4KKHA 5AP4A 1V1KA 4L3LA 3QTRA 3PJ2A 4ASDA 1H25A 2PULA 4PMPA 4TYIA 3G90X 4S31A 4YTCA 2YERA 5AIKA 4QNYA 4J8MA 3MPTA 4UY9A 5CY3A 3H3CA 2BCJA 1H1SA 3MVLA 4LOPA 4LUDA 1OB3A 4DGOA 3DGKA 4IAYA 3R8ZA 3BWFA 2Z8CA 4IWDA 3PUPA 4RWIA 3ZEPA 2PVNA 4CSVA 5IUGA 5K5XA 3PPZA 2YDJA 5HE3A 5DVRA 5JSMA 4BC6A 2C6LA 2QU6A 4BDBA 2E9OA 5BNJA 5CSWA 3UP7A 4M68A 4JR3A 4ZTLA 4FNWA 2FB8A 3F9NA 5EM5A 5HNIX 1FPUA 1J7UA 5KE0A 3ENMA 3VVHA 3NRMA 4EOMA 3PTGA 3ORPA 3PWYA 1O9UA 5C01A 1M2PA 1YWNA 5HLNA 1M2QA 4EOPA 4HGEA 3W2CA 4OTHA 2WMUA 5AV3A 2X7OA 5AX9A 4PQNA 5L2IA 4FODA 5L6OA 2ZB0A 3HV5A 1M7NA 2YISA 2BZHB 2G2FA 3HKOA 4O21A 3QD4A 4H3BA 2ETMA 3M2WA 2PVJA 3RGFA 3D83A 3R01A 3PRIA 2OWBA 2HCKA 4YBJA 2BFYA 3PDTA 1KSWA 3FC2A 3L8SA 2B7AA 4O7LA 3MFUA 4NCTA 1M2RA 4WNKA 1JSVA 5DHJA 3EQCA 3F5XA 5AM7A 3TKUA 4O7SA 3HAMA 3ZLXA 4BCJA 4F09A 3KK8A 3MYGA 4FIJA 4WG4A 4J96A 4YZBA 3VS3A 2ONLC 3JR1A 4LV8A 1Q3WA 4FV4A 3TI1A 2GU8A 3HRBA 3SGCA 4JL9A 3WBLA 3KCFA 2J90A 1W98A 1IASA 3Q4CA 5GJGA 4ACDA 4CEGA 5I9VA 2HZNA 4USEA 1PY5A 2AUHA 1Q97A 1KWPA 5M44A 4IVDA 4XP3A 3P7CA 2WIHA 1WBTA 4DH3A 5FDXA 1PF8A 1UNLA 2JD5A 1YI6A 2YZAA 4FZ7A 4G6NA 5EQYA 3R9NA 4ACCA 4BTKA 1PKGA 1K2PA 4E26A 5A54A 4E4XA 1ZYDA 4F7NA 4NT4A 1U59A 2JITA 4G3CA 1Y6BA 5IQEA 3P23A 1DS5A 1FVTA 5EQPA 2GQRA 3JUHA 5HBJA 4NM0A 3GUBA 4QMLA 3SOCA 4RPVA 2YEXA 3RNIA 1BYGA 3UZRA 3PJ8A 1PMEA 3LW0A 3PZHA 4U5JA 4ZLYA 3DFCB 4FZAB 2DUVA 5KMLA 1M14A 1UKIA 2WTCA 5IEYA 3GU4A 3QTZA 1XH8A 4LQMA 1QPCA 3D7ZA 4IEBA 5EW8A 4YHJA 3RK5A 4BDIA 3TUDA 3GFEA 2GNIA 2I0HA 3PXKA 3R2BA 2FYSA 3ANQA 3Q9WA 5L6PA 2V7OA 3DQWA 2BKKA 4L67A 5IQCA 5EYKA 3V51A 4DBNA 3ORZA 1QPJA 2BDWA 4F7SA 1YHVA 1OUYA 3P78A 2QD9A 5LARA 5BUEA 4M97A 1Q41A 3HZTA 3VQUA 3IO7A 3B2TA 4BVUA 3IGGA 2A27A 3R2YA 4ASZA 3NUYA 3SVVA 4AGUA 3QCYA 1BLXA 3CJFA 5EYMA 2ZDUA 2HELA 3FY0A 5IF1A 2R3FA 4GKHA 4QP9A 5KO1A 3E5AA 5C03A 3WZEA 4DH1A 4U43A 3VNTA 5EDQA 1OUKA 3KFAA 2C6MA 5ETCA 5IZFA 1ZLTA 1UU9A 3PVBA 4FI1A 4E4NA 2AC3A 3RPSA 3POOA 1OKYA 4EC8A 2ZV2A 2Q0NA 2IVSA 5T6KA 2IVVA 3TN8A 4O2ZA 3QLGA 3R9OA 2C6KA 3COMA 4FNYA 5HE0A 4UALA 2WXVA 2OXYA 3V6RA 4CFNA 4O0RA 4I6BA 2PK9A 2XNBA 4MWIA 2VV9A 1BUHA 5HCYA 3PSBA 5CT7A 2O64A 4G2FA 1ZMUA 3KRXA 4IDVA 4KABA 4G3FA 4KWPA 2BAKA 4IJ9A 2P2IA 2B4SB 3QTUA 1JLUE 2NPQA 4MD8E 2VWVA 4FT7A 3VS0A 4L3PA 1F5QA 4R78A 4EOIA 4ZZNA 3PJCA 2PY3A 1KOBA 3HDNA 3HV4A 5EM7A 4G6LA 2YM4A 3DAJA 3WF8A 3A7GA 4ANBA 3F88A 2GHGA 2W0JA 3WILA 4JQEA 4WSYA 5DT4A 4O7YA 1H1WA 3LXLA 3BKBA 4GSBA 4WT6A 2VNWA 3V5LA 1ZZLA 4GG5A 3VC4A 4LGHA 3LAUA 1WFCA 5L2WA 4A4LA 1SVGA 4L8MA 3ERKA 4GL9A 4PRJA 3QZGA 4FZ6A 3SG9A 4FL2A 3UOKA 5IA1A 4PMTA 3KVXA 4IHPA 3MN3A 2O8YA 1UVRA 5CALA 1REKA 3L9NA 2W5HA 2OFUA 3EOCA 3PYYA 4KAOA 3VW6A 4HNFA 3WYYA 3ZC5A 2F9GA 4BI1A 1X8BA 3ZO1A 2RKUA 2QO7A 2YJSA 4FIGA 3ZM9A 4E6QA 4F6WA 2BUJA 2CKPA 2OO8X 5LVNA 2BVAA 5JMSA 3UIUA 3BGQA 3OTUA 2CLQA 3VS1A 3F2RA 3QCXA 3A7HA 4O81A 3AGLA 3UDBA 1J1BA 4ZLOA 3F5UA 3RPVA 5KX8A 3ZUUA 2NRUA 5E92A 2RGPA 1U54A 4DCEA 3W8QA 3VRZA 2W1EA 4X6QC 2XVDA 4FSQA 4P7EA 4BCHA 1Q8ZA 3FLWA 3KEXA 4AA0A 3CP9A 3FMKA 1BX6A 1ERKA 1OL5A 4O7VA 3DJ5A 3OT8A 3FZSA 2IZSA 3PIXA 3K54A 2UW0A 1Y8YA 5IH4A 1KE5A 4QYFA 3KXHA 2WAJA 5CVHA 5HE2A 4U8ZA 4DFLA 3TZ9A 4DEAA 4EBVA 4X6RA 4HVSA 2IWIA 3OXIA 2Y9QA 3KN5A 4XHKB 3BGPA 1T46A 2YAAA 5HG8A 3TIYA 4HGLA 2A19B 1GJOA 2FSTX 4IM2A 1CDKA 1SMHA 4IVBA 4ZTHA 1VEBA 4RMZA 2C5YA 4MKCA 4O86A 4HCUA 3WARA 4FIFA 2F2UA 4YC3A 1WCCA 3QD2B 4CD0A 4RZWA 2VWBA 2OXDA 2VTHA 2Z7LA 3QKKA 4RRVA 1NW1A 3EN7A 5EDPA 3ACJA 3C1XA 1AGWA 2J50A 3E87A 1OECA 3N4TA 5AJQA 4AW2A 3CTHA 3RP9A 3BYMA 4C4GA 3FMHA 5DRDA 1G5SA 3ZYAA 4FTKA 3NCZA 5GNKA 4C2VA 1E1VA 2VTTA 4GT3A 3W2RA 4I6QA 2Y0AA 3KRJA 5FEDA 3CIKA 3E63A 1YOJA 5DR2A 3UZPA 4C3PA 3R02A 5CU0A 4I6HA 4D5HA 1JKLA 4G31A 2YCSA 1GAGA 1FMOE 3JS2A 1KE8A 1GOLA 4HPTE 3AT4A 1SZMA 3DB8A 2OIQA 4FGBA 4FG7A 4RFYA 3RHKA 4EQUA 2YDIA 1NVQA 2OW3A 5AP5A 3SKCA 4FEXA 2QC6A 3OBGA 4GRBA 3I6UA 3NCGA 4K2RA 1JAMA 3U4UA 1YHWA 3NW7A 3Q5IA 3BYOA 4XG3A 4RIWA 3O51A 4BYIA 3NNWA 3MFRA 3DKGA 3SRVA 2W9ZB 4ZJIA 5DH3A 4AS0A 3F7WA 2UZLA 2GNFA 3FMEA 4V0GA 1IA8A 2G15A 3BZ3A 5AP2A 3FLQA 4D28A 3I7BA 3CE3A 4DTAA 2QVSE 1ZMWA 4O7OA 1M17A 3GNIB 2B55A 5IISA 3UG2A 4YJQA 3HP5A 4C3FA 4ORKA 3PP1A 3DZQA 3UC3A 3UOHA 5CU6A 3E8CA 1Q4LA 2H6DA 2WMAA 4GK2A 1MP8A 3CCNA 3DXNA 3HMPA 5T3QA 2LGCA 4E5BA 2PPQA 1R39A 3L9MA 3ZONA 4G9CA 1BL7A 4QPSA 2ZV7A 4F9YA 4G3GA 5FP5A 4BCQA 1AQ1A 3KMWA 4CMUA 1H8FA 4R3RA 1APME 4OT5A 2XP2A 1OL7A 3EQFA 5LVOA 3NAYA 1Q99A 4EONA 3LVPA 2PUNA 2W1HA 2OIBA 3FKOA 4FTCA 4FTQA 3RPOA 1ZY5A 3V8SA 3VBTA 4ANLA 4QQTA 2BAJA 2XNGA 2JDTA 3LXPA 3GP0A 3F69A 4I5HA 4M67A 5F94A 3BLRA 2GS6A 4XMOA 4YR8A 3N4UA 3BE2A 3OCSA 4RIXA 2OH4A 4FT5A 4WA9A 4DFXE 5EKNA 3AC5A 2PVLA 5DPVA 1GIHA 4CT1A 3RAHA 2W9FB 4FEUA 2E9PA 3NW5A 2X4FA 3W1FA 2W1CA 5CSHA 2PE1A 2J7TA 3EZRA 4BZDA 3DDPA 5BVKA 3R0TA 3NZ0A 2F7XE 3WYXA 3BLQA 4X2FA 1OITA 4RVMA 2PHKA 4I94A 1A06A 3LFEA 2FO0A 2C47A 2P0CA 3CEKA 4YP8A 4NJDA 4F1OA 4I0SA 4QYHA 5M55A 2UVYA 3BV3A 4BDGA 4AW0A 3R6XA 3SDJA 4FKIA 4M84A 4FTAA 2J9MA 4IH8A 4TYHA 4BI0A 3NEWA 3VUMA 4TYJA 2WHBA 2C3LA 3MPMA 2HWPA 3CLYA 2G2HA 3H4JA 2QQ7A 4DFUA 4DHFA 5A46A 2GMXA 4GW8A 4I1ZA 2W1ZA 3E3BX 4LM5A 5C9CA 4UYAA 5D10A 3UGCA 4ENXA 5IQDA 2CKEA 2XM9A 3G6GA 4MH7A 1L3RE 1URWA 2OF2A 3CC6A 4J95A 4EOOA 4DF3A 5DE2A 3GC7A 2PZ5A 4W8DA 2XIYA 4K18A 3ULZA 4DC2A 2OICA 4L3JA 4EHGA 4EQCA 2WTDA 4ZEGA 3QUPA 5FG8A 3DK6A 1QPEA 3G33A 3GCQA 1XBBA 3HV7A 4FV0A 4NFMA 4EHEA 3OTVA 4L44A 5AUZA 4IFGA 4FSWA 5CAPA 3TTIA 2XJ0A 2R3NA 2OZAA 4EH5A 3ORMA 2CGUA 5LVPA 1XHAA 5E90A 2XF0A 4JAIA 2A0CX 3ZEWA 3PRFA 1YDSE 3E92A 4YTHA 3ZRKA 1R3CA 3C51A 4O0YA 3GC0A 4OTDA 4BZOA 4GIIA 4UXLA 4KINA 3Q53A 4IB5A 5E1EA 3BE9A 1OL6A 4TRLA 4X21A 3HMOA 4J99A 5EM8A 2OF4A 3HUCA 4KS8A 4ZY5A 4FUXA 2UZEA 4L7SA 1QL6A 3LFSA 4BDCA 1P5EA 3DXPA 4O0TA 5HD4A 3QTXA 4O2PA 2P4IA 3QD3A 2YIYA 1ZYCA 3SW7A 2Y7JA 3A7FA 4FEWA 5FP6A 3SD0A 4X2NA 4ITJA 3EN6A 5HX6A 5J1WA 4QYEA 2XIXA 3D7TA 2OSCA 4FV1A 3V5TA 4ASXA 5M08A 4CFUA 4KIPA 2OIDA 2X8DA 4L53A 5CAUA 5LJJA 5EHLA 4NZWB 1H4LA 2ITZA 5D41A 2QG5A 2UV2A 3TZ8A 3B8RA 3TKIA 3PWDA 3MSSA 4ZLZA 1OIQA 3SX9A 4FVQA 3W33A 2XK3A 1VYWA 3VS6A 3I5ZA 5JGAA 4CFWA 3AD5A 1SVHA 3FI2A 4FYNA 3AQVA 4J52A 4I24A 4U7ZA 4ZP5A 5E91A 4RZVA 2WMQA 3BBTB 4AU8A 3NUAA 4L00A 1OIRA 2G1TA 1YW2A 1PXJA 2QR7A 3BPRA 3WF6A 3ZO2A 2JLDA 3GCPA 4ZTNA 1OL2A 4RA5A 1ZYSA 4CG8A 3K2LA 1BI8A 2OXXA 2UZTA 3C4CA 3RINA 3RM6A 2VAGA 5FD2A 5HBEA 4IWPA 3VUKA 2V55A 2VO3A 4QP2A 5M4UA 4EOQA 4O6LA 2WOTA 5IA2A 2CDZA 5CEOA 4GCJA 2CNQA 4D4YA 4DEIA 2ZAZA 3UO5A 2QODA 2C6TA 2V22A 3W18A 4IAIA 3FXXA 4JG6A 1G3NA 2O63A 2WQNA 4UZDA 1ZOEA 5IUIA 4I5CA 1YDRE 2VTIA 4GMYA 4OTRA 4YZCA 3R63A 4K8AA 4Q2AA 4XG7A 2G9XA 2XEZA 5CAQA 4R77A 4UXQA 5DEYA 3IK3A 1OI9A 3RK7A 4PV0A 1KE9A 4XRLA 4BCOA 4F99A 2C6EA 4O0XA 4RIWB 4RX8A 4E6AA 5IMXA 2CPKE 1BI7A 1Y8GA 3KL8A 4LFIA 4E5WA 5AAGA 3SRVB 2P3GX 4EYJA 3HYHA 3R00A 3L8PA 4OW8A 2C5VA 4JLCA 4DFZE 3UO4A 4CQEA 3LFFA 2WU7A 4V0GB 3FZTA 5BYLA 1WAKA 5A4TA 3LCDA 2HOGA 2Z2WA 3P5KA 1CKIA 3Q52A 4EHVA 2VTRA 3L9PA 5FBNC 4GV1A 2O5KA 3KQ7A 5CI7A 3OWJA 2YZLA 1XR1A 4BDHA 1OMWA 4GJ2A 4IADA 4M0ZA 4KKGA 3U8WA 4FG9A 4ITHA 5DN3A 2I0YA 2WO6A 4RQKA 4FE2A 2VTQA 4DGLC 4ZSAA 3PXYA 1YOLA 2I0VA 5GIOE 3I79A 2VN9A 5KBQA 2WQMA 4RG0A 1QPDA 1GZKA 1GIJA 2Y6OA 2VZ6A 4XS2A 3GFWA 3D5VA 2F7EE 2YN8A 2WEIA 4RJ6A 5KZ0A 5D7VA 3TV7A 3PPKA 3ZTXA 4JBPA 5CYIA 4NTSA 4C61A 2OKRA 2ACXA 5AAFA 1IAJA 4EK8A 3C4ZA 3JXWA 3QYZA 1HCLA 4NJ3A 3EMGA 4L9IA 5HO7A 3QTWA 4CVAA 5F1ZA 5TO8A 3RI1A 4F9AA 2ZV9A 1ATPE 5ICPA 2Y4IC 3FLSA 3HV6A 3DZOA 4FTLA 2PMLX 2C3KA
chains in the Genus database with same CATH superfamily
2OJFE 4DG2E 2R0IA 3DKFA 2I40A 1JKSA 1Z57A 4FV5A 4B99A 2B9FA 5EK7A 4FKRA 3O96A 4DTBA 4DITA 2W17A 2Y4IB 4YNOA 3W32A 5M51A 5CX9A 3O8TA 1SM2A 4AAYA 3A99A 3E3PA 3MPAA 2WMTA 4N6YA 4X2JA 3EQBA 4IANA 4TPTA 4MXXA 3P79A 2JIIA 2VWZA 3VAPA 2B54A 4JBQA 5A3XA 4EOSA 3Q96A 2XCKA 1V0OA 2BHEA 5AIRA 3O17A 5I9XA 3MY0A 4AN2A 1XBCA 5DLSA 4AZSA 4JOAA 5JQ8A 4M13A 5AAEA 3CGOA 2XKCA 3EWHA 3NIZA 2BDJA 4UYNA 2JKMA 5A4EA 1W84A 5E8SA 2OG8A 3LIJA 5BVOA 1DM2A 4V01A 4U0IA 3C50A 5AMNA 4G3EA 4TW9A 4HZRA 2VGPA 2VTMA 3ZM4A 2WFYA 5ACBC 1K9AA 1OKVA 2GNLA 4FC0A 4H36A 4I92A 2QO2A 4TXCA 4XBUA 3TNWA 5F9EA 1G8AA 4TYHB 2X8EA 3H0ZA 4PDYA 3GI3A 4ZSEA 4MX9A 3NX8A 1WBNA 2X8IA 3EL8A 2IPXA 3W0OA 3GU7A 4HVHA 1MRUA 4ERKA 3DBFA 2YM7A 4RC4A 4JDIA 4U45A 1WBWA 2OU7A 2REIA 3ROYA 5BVNA 3PVGA 3OC1A 4R7BA 1ZOHA 1L8TA 2C30A 2VO6A 3DY7A 3QHWA 4G5PA 4NUSA 2ZFYA 5TKDA 3AGMA 4WG5A 3DB6A 2VO0A 3HECA 5LMKA 4DCAA 2W5AA 3QKMA 2W1FA 4ZOGA 2UW5A 4BCPA 2AEGA 3IGOA 3QC9A 4FNXA 5I9WA 2OZAB 3OOMA 4LUEA 4CKJA 5HD7A 3P4KA 2R3JA 2ZM3A 1FMKA 2UZVA 5DGZA 3UG1A 4D2RA 4K6ZA 3SC1A 4AT5A 3MDYA 5ANDA 2ZM4A 5BYZA 2QLQA 3ODYX 2R0UA 4CGAA 4AN9A 5JFVA 5LQFA 3K5UA 2BROA 5DBXA 3AMAA 2Y6MA 3R1QA 1PYXA 5LXMA 3DTWA 4CRSA 3FUPA 1W82A 4D4VA 3FMDA 2BTRA 3O8UA 3OHTA 1Q3DA 3DBEA 3P5JC 4P90A 2VWUA 3TIZA 3U4WA 1PXOA 3R7VA 4O91A 5I0BA 2YM8A 1BMKA 3D2KA 5BX0A 3LCTA 4I4FA 1TQIA 2PSQA 4BR3A 3EB0A 1RE8A 2VTAA 2WGJA 2J6MA 2ITYA 4C35A 4V04A 3C9WA 5CZHA 1NY3A 4GK4A 3HRFA 5EDRA 5J87A 3QHRA 4N4SA 3BYVA 2OGVA 3CTJA 2QG7A 4FKTA 3LCKA 4MXOA 5DYJA 3KK9A 4FL1A 3NUNA 3MJ1A 3A61A 3QWKA 4UZHA 1UU8A 2PU8A 4NW5A 3PVWA 3BL7A 4EK6A 2H9VA 2R3LA 3MS9A 3ZRMA 3R9RA 3QGWA 3G51A 3PJ3A 1V0BA 3QCSA 4O27B 3ZSIA 1UNGA 3B2WA 4AX8A 3EN4A 3W8LA 5M57A 3TUCA 1IR3A 2FUMA 5HLWA 4I22A 4ALWA 3VJNA 1PMUA 3R21A 3F3UA 2UW9A 5TT7A 5EOLA 3PFQA 2QOLA 3DBQA 3PP0A 4GEOA 3QYWA 3VRYA 3ZSHA 2PVMA 4CV8A 3QQJA 4DFYA 2VO7A 3AG9A 5CTPA 3PXRA 3U9CA 3U6IA 4ZTRA 4FVRA 4TWPA 5KMNA 1OPJA 4V05A 4EZ7A 3F5PA 1W0XC 3LFAA 4KKEA 3AXWA 3PE2A 4USFA 4O7PA 3UNKA 4F0IA 3MV5A 5JH6A 2ITQA 4RQVA 4YZNA 3SQQA 4R5SA 2WPAA 4GYIA 3ZRLA 4HYSA 2ETKA 3V5WA 4BN1A 1OIYA 2H96A 4QTAA 4ACMA 3R9DA 2X9EA 3QF9A 3EFLA 4A7CA 3FI4A 4FTMA 4AXEA 1FGKA 4GYGA 3S1HA 4L43A 4DG3E 2O3PA 2PUUA 4MK0A 4DH7A 4EKKA 4B7TA 4Q5HA 4OUCA 4D0XA 5LWMA 2AYPA 4P5QA 4CV9A 5B7VA 2C68A 4JRVA 5K9IA 3MI9A 1Z5MA 4IVAA 4AWIA 2Y4PA 2QOIA 3C0GA 1SYKA 4ZTQA 2OJGA 2XRWA 1LPUA 3OCGA 4CCBA 4QTCA 3TJCA 3VO3A 2YM5A 4BDFA 3DLSA 1OIUA 1PXPA 4RWLA 4CKRA 2X7GA 3OY1A 3TZMA 4QMPA 2R3KA 1YHSA 4BCFA 4IX3A 4PL5A 2CHLA 4Y85A 2CKOA 4PP9A 3ALNA 4ZMFA 3LXNA 5ETAA 2QKRA 4F6SA 2X9FA 5LWNA 4YHFA 5KZIA 4M8TA 3T8OA 4DLIA 3RAKA 5CWZA 5M56A 2X2KA 3PG1A 2ERZE 4YLJA 3Q5ZA 3VONA 4BKJA 3NUXA 3GT8A 2GFCA 4O0WA 4MD9E 4HVDA 4ZSGA 2QOFA 4AUAA 5KCVA 4P4CA 2VTPA 4NM7A 4MXAA 3TJDA 3BHTA 3OXZA 2XNOA 3A8XA 2X0GA 4ZAUA 3FKNA 4BIBA 2EB3A 4QMOA 4HYHA 1E9HA 3DK7A 4NWMA 2OLCA 2WTKB 4FJVA 4S32A 3DAEA 5I4NA 3EHAA 5H8EA 3DAKA 5H8BA 4RIYA 4JX3A 1YDTE 4N6ZA 4FYOA 2YABA 3DA6A 2BZJA 5HIDA 4DHZA 4RJ3A 4FSZA 3QTIA 3HLLA 3ZXTA 2X7FA 4FIIA 4Y73A 1NXKA 4E6CA 4UN0C 1PW2A 2HW6A 1XQZA 2XM8A 3EJ1A 4QNAA 2C5NA 1SVEA 4GT5A 2B9JA 5AP3A 4ZXTA 4WRGA 3CS9A 1V0PA 3H0YA 5CLPA 4C7TA 5D9HA 5E8XA 3R8MA 3TZ7A 2XK7A 3SOAA 4L42A 4D9TA 1OKZA 4ZK5A 1H0WA 1OGUA 4QYGA 4WIHA 4IWOA 4QMVA 4DHJA 3IW6A 4F1MA 2CN5A 3IDBA 3LE6A 3ZBFA 3R1SA 4FKWA 3UBDA 4XNEA 3UTOA 4WD5A 3WI6A 4FUYA 3ZUTA 4BDJA 3FLYA 4EUUA 4EORA 3KC3A 4AW5A 3UDZA 4PTEA 3C7QA 3R1NA 4X3FA 3L8VA 3ORNA 3C0IA 5DOSA 2JGZA 5CU4A 3FPQA 4TL0A 5EM6A 4M12A 5LMAA 3IOKA 4F1TA 5HTBA 3W0SA 3ET7A 4JDHA 3BWJA 2YITA 3BHUA 5K4IA 4N70A 2UUEA 1CKJA 3QZIA 2GHMA 4E7WA 3G9NA 3U51A 4JRNA 3UJGA 5IA0A 1H1QA 1G8KA 3GU6A 1TKIA 4L52A 2IG7A 4D4SA 4IX5A 3COKA 5ANEA 4JR7A 3VUDA 4QDEA 3UP2A 2VWXA 2IVTA 1YXSA 2WQOA 1J1CA 3R1YA 4CFXA 4ALVA 4IWQA 2JFLA 4AGDA 4DFNA 3ETAA 4M14A 4FTIA 4RFMA 5HZNA 4RSSA 4YSMA 3VF8A 1H1PA 3G0EA 2R3QA 4OTFA 5FXRA 5EYDA 1OBDA 2F2CB 2UW3A 3C5UA 3BBWA 4I20A 1KUTA 3R7OA 5IQBA 5LVMA 1E1XA 4D4RA 3R9HA 3W10A 3IW7A 5CI6A 5B2KA 4J53A 5HNGA 3RCDA 5AV0A 3UC4A 3UDSA 3LPBA 4BCNA 4O96A 5M07A 4BTMA 4LL0A 5J95A 4XG9A 2XKDA 3FL5A 4A9YA 4FKSA 4Y5QA 5HHWA 5AP6A 2Y8OA 4FSUA 4C33A 3ZBXA 5K5NA 1J91A 3OG7A 1YWVA 4UB7A 4JQ8A 4QO9A 1H28A 5AP7A 2BFXA 4XBRA 5CF6A 1P4FA 2DWBA 4EQMA 5CNOA 3RWQA 4YZ9A 4YUQA 2VGOA 4Z7GA 4LV5A 5CF4A 4AAAA 2PZIA 1MUOA 4U80A 4AN3A 4I41A 3NFGB 4PMMA 4F70A 1ND4A 5L3AA 4NCTC 1WBSA 4FTTA 4DEBA 1LP4A 1XH9A 3KY2A 4C59A 3KMMA 2ESMA 1YKRA 3BGZA 1G8JA 3F82A 4QP1A 1Y91A 3V6SA 4L6QA 5LCJA 5IQGA 2JBPA 4YJRA 3QUEA 3UOLA 3ZO4A 5AA8A 4KIOA 1ZXEA 3EN9A 4ZTSA 5IQFA 2NO3A 5CXZA 2WD1A 2NRYA 3H9RA 5IU2A 2C3JA 2WMVA 2WTWA 3KXMA 3PVUA 3AKJA 2ETRA 1JSUA 4G1WA 4JDJA 4Z9LA 3MW1A 5CANA 4O6EA 3QRUA 3EFWA 3SAYA 3BYSA 3HAVA 5H2UA 3S3IA 3CGFA 3MESA 3UMXA 4MF1A 1U46A 2QOOA 3KA0A 2GTMA 3R83A 4RJ8A 4QMTA 1H08A 2B52A 3BIZA 5FXSA 4R5YA 4UBAA 1H1RA 1MQ4A 2BR1A 2ITWA 3E8EA 4WKQA 4XV3A 1U4DA 2R3GA 3QX4A 2WTVA 3SV0A 2XYNA 1FGIA 3OUKA 3I4BA 5FQDC 5HI2A 2RL5A 4O83A 2Z7QA 2VWYA 2HYYA 2IZUA 4PDOA 4QMXA 5BMMA 2JFMA 2X6DA 3TV6A 2R4BA 4A06A 1YXXA 3O71A 1GZ8A 3PLAE 3TG1A 5HIEA 3II5A 2WOUA 4NU1A 5J5SA 3RALA 2OJJA 3WIGA 4BRXA 3PIYA 4EH6A 5CS6A 3VHKA 4DHIB 2X6EA 3LM0A 4EJNA 2PUIA 4JIAA 1HOWA 4MQ1A 5EYCA 2YCQA 1NVSA 2W4JA 4MD7E 4CNHA 4GS6A 3LMGA 2CCHA 2XCHA 3BEGA 3NVMB 4BIEA 2C0TA 1CTPE 2E9UA 3FZOA 2C0OA 2ZV8A 3D4QA 1W7HA 4F65A 1NT2A 3QQUA 3ZFYA 5I9ZA 3AD4A 5CF5A 1KV1A 2RG5A 2QO9A 5IG1A 3DT1A 3BEAA 4RBLA 4FV6A 4BGQA 3ATTA 3FZRA 3QWJA 4UV0A 4ZIMA 3DDQA 4IJPA 5ANGA 1U5QA 3OD6X 3OOGA 3QL8A 1H00A 4Y5HA 4S30A 4BB4A 3A60A 4PWNA 3W0PA 1WBVA 3F2AA 1R0PA 4HOKA 4BDDA 3ORIA 4RIYB 3P08A 4EH2A 4CTCA 3LJ2A 3F7ZA 4YJTA 5BMSA 3WE8A 3G6HA 2XUUA 3GB2A 4FEQA 3HMMA 4ZS4A 2PVRA 4BBEA 1WBOA 2Q0BA 3E7VA 5FXQA 4EH8A 2YHVA 4MCVA 4G17A 2ZOQA 5IQHA 4QMUA 3TNHA 5JEBA 3EIDA 4R1YA 4RX9A 2HENA 4YLKA 2VTLA 4DA5A 3FMMA 3I0QA 3MBLA 2QI8A 4PDSA 4MBLA 3ZXZA 4FBXA 4OGRA 3OUNB 4H05A 4YC8A 2GTNA 3SA0A 4S33A 4EH3A 4MUQA 3DKOA 3Q6UA 4O7RA 4R3PA 2YA9A 4ANSA 5HTCA 4E6DA 3ZU7A 4RFZA 4EC9A 3AC4A 4C3RA 2BDFA 2YAKA 3HRCA 3QXPA 4KBAA 3ZC6A 2KTYA 3PA4A 5G1XA 4CG9A 2X81A 3OWKA 5JFWA 4DGGA 1J3HA 5FDPA 4ZSLA 4BCKA 5KBRA 3BU3A 5JRSA 5I9YA 2XS0A 3POZA 4XX9A 5E4HA 3HMNA 2QCSA 2HWOA 3JVSA 1VLRA 3EQIA 3VS2A 3ZLYA 4D58A 3FL4A 4JIKA 5CNNA 4RIOA 5IA3A 4I93A 2Z7SA 5AADA 5ANOA 5GJDA 5HE1A 3W55A 5CEPA 3KGAA 2CGVA 4YJSA 4GVJA 4EOJA 5HORA 4FSTA 3IONA 3TYKA 4GH2A 3IECA 3QZHA 3GXLA 3MGYA 4JX7A 2RFDA 3W16A 3ZO3A 4CFMA 3VJOA 1PXIA 2X4ZA 3T3VA 4AT4A 3QC4A 3QRJA 4FR4A 3CY3A 3P9JA 2FGIA 3GU5A 3R7EA 2UW4A 4YZDA 2W99B 4G5JA 3H10A 4D1ZA 4BY9E 3ZFXA 2QOKA 2VRXA 5HCZA 4F6UA 3BU5A 3SW4A 1H27A 3MB6A 3CD3A 3NSZA 3OVVA 3PUFC 4ID7A 1M52A 4PF4A 5D7AA 3MY1A 4QP8A 4DAWA 5CASA 2VU3A 5AEPA 3RPYA 4BZNA 2QONA 3HA8A 2FH9A 4PP7A 3ORKA 4DG0E 3QGYA 3RJCA 4IZYA 3JY0A 3GENA 4TT7A 3Q9YA 4H3PA 1UV5A 2FSLX 4PDPA 1UU3A 4PNIA 3KCKA 4MVFA 3EKKA 4UWBA 3VN9A 1XH5A 3RHXA 4ZJVA 3BHHA 1U54B 3A7JA 3DNDA 3CSVA 1ZY4A 3EQRA 3C4EA 3NLBA 2SRCA 1T45A 3EYHA 2F4JA 2JDRA 4AOTA 4QP7A 4E73A 1Q8WA 4XG6A 3KKVA 2ZM1A 4FV8A 5IDNA 2CN8A 3KXZA 4GFMA 5AUVA 1WVWA 5JRQA 3Q2JA 4BDEA 4E8AA 1UKHA 4Y83A 5IEXA 4AXAA 4MNEA 4FV2A 5B0XA 3KVWA 3MH0A 3ELJA 2XK8A 3FI3A 3HMIA 1WZYA 1KE6A 1A9UA 2JEDA 4FKUA 1JQHA 3MA3A 2XNMA 2R3HA 4USDA 3C4WA 5KMOA 1MRVA 3TV4A 4GVAA 4YPDA 4D9UA 1PMVA 5KKRC 2UZUE 4E4MA 4HCTA 4DN5A 3FKLA 1XWSA 3FC1X 4O0VA 4K77A 2HY81 4BDKA 3QUDA 4RVKA 3IW8A 3U6JA 4EK5A 4RWKA 1DI8A 3WE4A 1KV2A 4ANQA 5KKRB 1YWRA 1B39A 3UVPA 5M4CA 2PZPA 3E7OA 4MBIA 4H39A 5DR9A 5HGIA 5AUTA 3DU8A 4O7WA 4OTGA 2BRHA 2J0JA 2XRUA 3FQHA 4U79A 3QBNA 3NS9A 4NFNA 4DH8A 3DKCA 3G0FA 2UZBA 3HP2A 5DNRA 4ARKA 5CSVA 3A4OX 3FLNC 3LFCA 4ACGA 4IC7A 3FHRA 3KRRA 5BVWA 3PSDA 2RF9A 5J7HA 1BKXA 2EWAA 1OM1A 1JNKA 5CZIA 1ZRZA 3ML1A 3RWPA 4AZTA 1TQPA 3PPJA 1ZZ2A 4AE9A 3RVGA 4ACHA 1LUFA 4PL3A 4FZFB 4Q9ZA 2GQSA 2VX3A 3P7BA 2QOCA 2H8HA 4K0YA 3D2IA 3Q9ZA 4GJ3A 4PY1A 4TNBA 4HNIA 1PHKA 3E88A 1OVEA 5AUWA 5HCXA 4II5A 3UIXA 3VBYA 4F0FA 2ITPA 4DEHA 4IVCA 3QX2A 4JQ7A 1WVYA 5A4QA 5E8ZA 4HPUE 4E4LA 2PZYA 2BRNA 3K5VA 4AG8A 4LRJA 2VTSA 3NVKI 1K3AA 4HVGA 3ROCA 5L2TA 4BYJA 4XV9A 4XOYA 3S95A 5KUPA 5CXHA 1Q8YA 2C6OA 4QYYA 3QFVA 5L6WL 3RAWA 3V8TA 3RK9A 3FSKA 3FEGA 4FK6A 4D5KA 5CQUA 2ITXA 4A07A 4C34A 5C26A 5ETIA 2ZB1A 2R2PA 1W83A 2I7QA 2W7XA 1SNUA 4R7IA 3NMUF 1R78A 3D15A 3PA5A 4Y72A 1XO2B 1Q24A 2PMNX 2VUWA 1RDQE 3H9OA 4RLKA 4YJUA 5EI8A 4N0SA 3LFBA 3AMBA 4FKPA 5ANJA 3G5DA 2ONLA 3A8WA 3NW6A 4X2GA 4LGGA 4XLVA 4X3JA 5ANKA 3WZUA 3D5XA 3EQDA 5IA5A 4WZYA 1GNGA 2VX0A 1REJA 4JJRA 4WBBB 4F7JA 1I09A 2P33A 2VX1A 3C13A 4XV2A 4BF2A 4HCVA 5CENA 4RC2A 5FEEA 4A4OA 2BRGA 3NYVA 4FSRA 1VJYA 2OBJA 2UZDA 3EQGA 2P2HA 3DBCA 3UNJA 4CFFA 4B4LA 5J9YA 4GFOA 4W4XA 2PZRA 4OTQA 4JVGA 4RIXB 4YC6A 4PL4A 4QTBA 4BJJB 2JC6A 2PL0A 3OCTA 4C4JA 5FBOA 2XKFA 4O7NA 4LMUA 4EYMA 3FYKX 3TWJA 4AZFA 1LEZA 4NKSA 1Q61A 1WMKA 4EH7A 4XOZA 3D5UA 2O2UA 5JQ5A 3IDCA 3EQHA 2EUFB 4MBJA 4EOKA 5A4LA 3FSFA 5DR6A 4K11A 5FTOA 4B0GA 1GZNA 2RFNA 4LRKA 4Z55A 2C3IB 2YIQA 1YXVA 4FTRA 4YJVA 4E93A 2JDOA 2HZ4A 5F20A 5HU9A 5EHOA 4NTTA 3AKKA 5IEVA 2C1BA 3ATSA 2PTKA 2JIVA 2XIRA 4WNMA 2JDSA 2X2MA 3VQHA 3U6HA 4C4FA 5CF8A 1JPAA 3QD0A 2VWIA 5FM2A 4CZUA 5DRBA 3KXXA 5E8TA 3V01A 4B8MA 2QOQA 3Q9XA 3QAME 5CU3A 5DI1A 4BHZA 4C38A 5C4KA 3CPBA 4AA4A 5AFVA 2BZIB 2XNEA 5FLFA 1YI4A 3R7IA 4RWJA 3FXZA 4GKIA 3UIMA 4I3ZA 4EUTA 5BQ0A 2JAVA 2JDVA 3KMUA 3O0GA 3E8NA 4EH9A 3VBXA 4UEUA 4K33A 1OBGA 3T3UA 4IDTA 4FTNA 3EKNA 3FXWA 4ZZOA 5M09A 4IC8A 3C0HA 4F9CA 3QLFA 1H01A 4W4VA 4EBWA 1S9JA 5H9BA 1VZOA 3R30A 5JZNA 2QOBA 4I6LA 1QMZA 2B0QA 3GCSA 4AP7A 2NYAA 3TEIA 2EVAA 2BPMA 4FSMA 4GU9A 4LG4A 4FOBA 4BDAA 3F3TA 4IZAA 1TQMA 2NNWB 2JIUA 3QQHA 3KRLA 4B6LA 3H30A 5E8WA 2XZSA 3E93A 3OW4A 3QA8A 2HY0A 4QMMA 5L2SA 4TN6A 4XV1A 4KA3A 3AC2A 4O7TA 4IX4A 4AOIA 3UQCA 5DIAA 5GJFA 4FKVA 3D7TB 4YHTA 3L9LA 4S34A 4JBOA 3WZDA 4XP2A 5EI2A 3R73A 5L8JA 3CPCA 3TT0A 3SHEA 4D0WA 2YACA 4I6FA 3MH1A 4QMNA 3U87A 1SNXA 4I21A 5C8MA 3GCVA 4YURA 3ID6C 2JKOA 3M1SA 2J5EA 4ERWA 4WBOA 3EFJA 4H1JA 2LAVA 5ETFA 4F63A 2PWLA 3DLZA 3HNGA 3EFKA 5C8KA 4OBPA 2ZMCA 3C5IA 1UA2A 4HGSA 3AT3A 4TWNA 1J7LA 3UYSA 4FKGA 1H0VA 3W2QA 1KE7A 4BIDA 3Q2MA 2CMWA 3BHYA 4TY1A 5CU2A 3RM7A 1RJBA 2J0KA 3DS6A 1R0EA 3MIYA 4IAFA 5AV2A 1WVXA 1RQQA 2CLXA 3BQRA 1LEWA 2FSOX 4QT1A 4IW0A 4TYEA 3LZBA 4IFCA 2C69A 3GQLA 2WU6A 3OW3A 4GT4A 2WZJA 4RA4A 5EHYA 4CXAA 4C4EA 5GIPE 4D55A 4L46A 4MXYA 1OZ1A 4YNEA 5CVGA 3AMYA 3T9TA 2VD5A 4ZJJA 2RFEA 3TDWA 3WOWA 4DGNA 5BUIA 3MIAA 4HZSA 3F3VA 4MEDA 3MH2A 4YJPA 2HZ0A 4Z7HA 2W05A 3DNEA 2VTOA 4U97A 2XJ1A 4BCIA 3QXOA 3MTLA 4QQJA 2QKWB 4DBXA 3S2PA 1AD5A 3ORLA 2IO6A 3FMNA 2XA4A 3MWUA 2XAMA 3QRKA 4FMQA 4OBOA 4CLJA 2YDKA 4U42A 2WMRA 3QZFA 3DXQA 4UWCA 4BGGA 5HBHA 4F9WA 5AM6A 1IAHA 3FWQA 3B8QA 4BICA 5AV4A 4OTWA 2YJRA 3E8DA 2VTNA 4TWOA 3VULA 2WNTA 4OLIA 5LVLA 1XH7A 4F7LA 4U3ZA 2FSMX 2YWPA 2IN6A 1UU7A 3UDTA 2EU9A 2HK5A 4ONAA 4MQ2A 2WIPA 4AQCA 4IACA 4RLLA 3QCQA 3TDVA 5H8GA 3V5PA 1P14A 3QU0A 4QEBA 3ZLSA 1PXNA 4CMOA 3O7LB 1A48A 4FTOA 4G34A 1YQJA 2PVYA 2BTSA 3ZMMA 4FKOA 2QR8A 2UW6A 2XK6A 2YIRA 3SLSA 4AQKA 4CZTA 4DLJA 5IH6A 1CKPA 5JT2A 4BTJA 2UW8A 4FL3A 3UO6A 5T68A 4ZMEA 4I23A 5HVJA 1ZMVA 2B9HA 4U40A 4Z16A 1P2AA 3LFNA 3PZEA 1IG1A 4U98A 1GY3A 2ZMDA 4ANMA 2HXLA 3PJ1A 1URCA 5IQIA 4XH6A 5BPYA 1JSTA 4FKJA 4IX6A 1XJDA 2WTKC 4ZSJA 4O38A 1XBAA 1MQBA 3BCEA 3HDMA 1JKTA 4PTGA 4A4XA 2EXMA 3IG7A 3GEQA 3FBVA 5BYYA 5GINE 3COHA 4G16A 4RX7A 1Y57A 4BCGA 4DEGA 2W4OA 5LOHA 2BRMA 3TUBA 2GNJA 2VWWA 3BX5A 3K3IA 3CKWA 4TKSA 4U3YA 1IA9A 3LHJA 2OZOA 3O23A 4PUZA 4R1VA 4Q9SA 4KRDA 2WKMA 4JS8A 3WZKA 4CMTA 2C4GA 1ST4A 1O6YA 1EH4A 3LKMA 4I5PA 4NK9A 3NGAA 4Y8DA 2QOHA 4QTDA 5DT0A 3CKXA 3THBA 3JPVA 4W8EA 4D2SA 3BLAA 5HO8A 5IMEA 2CNVA 2IZTA 3EYGA 2WELA 2PYWA 1FVVA 3QKLA 2IW6A 3V3VA 2W1IA 4AZVA 3FMJA 2CGWA 4LOOA 4YTIA 4O22A 3W0QA 4CT2A 4D1XA 1S9IA 1VYZA 3C4XA 5FM3A 2NP8A 4XYFA 3UPXA 5CVFA 3A7IA 1PKDA 4ZY4A 2EB2A 1PYEA 3DJ6A 4IE9A 4M15A 3FI8A 1ZYJA 3CTQA 2XEYA 2H34A 4ZZMA 5JN2A 3CQEA 3KXGA 3TNPC 1YRPA 4ZTMA 4G6OA 1P4OA 5HVYA 3A2CA 4QDVA 2AC5A 5IPJA 4DYMA 2CNUA 3ITZA 3MTFA 3WF9A 2VNYA 4CRLA 4E1ZA 4HW7A 2J5FA 2XARA 4ENYA 3RMFA 5JFXA 5LMKC 5KNJA 3R7YA 4FV9A 2DS1A 2ITTA 3UQFA 4DINA 3FQSA 3FYJX 3R8LA 2Z7RA 4OR5A 1PXMA 5HLPA 5JGBA 4TYGA 4R7HA 4CTBA 3KXNA 3BV2A 3MFTA 3EQPA 3PFYA 4GK3A 4KBKA 5FUTA 5M53A 2PE2A 5TF9A 4AZWA 2UW7A 3OROA 2PUPA 3QQFA 4U6RA 3V8WA 3WF7A 4XG2A 4DEDA 3NNUA 4M3QA 3GQIA 4RVTA 3NDMA 2BIYA 3LCOA 4HYUA 3LLAA 2HZIA 3ALOA 4QQ5A 5KMKA 3NR9A 3R8PA 3NUPA 5C8NA 4AGCA 4DGMA 3Q3BA 2I6LA 2J51A 5E8UA 3S0OA 4FVPA 3KF4A 3G9LX 4A9RA 3R71A 4WG3A 4PX6A 4JI9A 5DG5A 4EL9A 2CKQA 3ZCLA 3ZH8A 4EWQA 3HX4A 5AUXA 3OXTA 1M7QA 2J0IA 2XK4A 3G2FA 1WBPA 4XG8A 3ZFMA 4C2WA 3IQ7A 4GG7A 3OF0A 3ZUVA 3KU2A 4J71A 3FZPA 5E9EA 2GSFA 3FHIA 2WQEA 4FG8A 1OL1A 4KSQA 1PXKA 4EI4A 4AW1A 1YXUA 3PA3A 3I60A 3P86A 4KD1A 4IZ5A 2BAQA 3E62A 3FZ1A 2ITVA 1PXLA 4K1BA 4AFJA 2V7AA 4BBFA 2R3OA 4FV3A 4IAAA 2F7ZE 1ZOGA 5I5ZA 3D5WA 3PG3A 4YO6A 2YM3A 3CY2A 4KNBA 3LLTA 3BLHA 3LQ8A 4FT9A 5E7RA 5EH0A 2IVUA 3MVHA 5HU3A 5LMBA 2CGXA 2IW9A 3RPRA 3MA6A 1FOTA 3PXZA 5HKMA 5HNBA 5HIBA 3W0NA 4EJ7A 4BGHA 2R5TA 3DK3A 5IQAA 4HJOA 3LQ5A 5EI6A 4FGRA 2JKKA 3DOGA 4EWHA 5JGDA 2XYUA 3PY1A 3QTQA 2RIOA 2XIKA 1YOMA 5I9UA 3P7AA 3PIZA 2Q83A 4QRCA 4Z3VA 2ITOA 1RW8A 3M42A 4P5ZA 5ACKA 3Q4TA 1W8CA 4A9UA 1I44A 2OFVA 2KULA 2OJ9A 2OK1A 2ZDTA 4FEVA 4QP3A 4C37A 4CKIA 3NUUA 1O6LA 4JAJA 3FDNA 2HIWA 5TR6A 5DFPA 2GCDA 4IM3A 4BI2A 4KIQA 4AE6A 3TKHA 1CMKE 2ERKA 3P0MA 4F08A 4QP6A 3OT3A 2XIZA 5HG9A 3UODA 5M06A 2FVDA 2E9NA 5JK3A 3RKBA 1Z9XA 4JT3A 2UZOA 4DT8A 1QCFA 3DTCA 4QPAA 3GCUA 4O0SA 2W5BA 2GNGA 2WMSA 4MTAA 3BL9A 5CEMA 4R3CA 4QMWA 5E8YA 3REPA 5IH5A 4FT3A 4JG8A 2V5QA 3NWWA 4FZDB 4U81A 3BYUA 3W2PA 3CQWA 1DAWA 5JKGA 4BBMA 3GBZA 4ZS0A 4H3QA 3K3JA 2W06A 2BHHA 3D0EA 3O2MA 1H07A 4F64A 5J9ZA 3R04A 5HICA 2XH5A 1JBPE 1H26A 3P1AA 3ZDIA 3I5NA 4LMNA 1XKKA 3UMWA 3W2OA 3S00A 2IJMA 3FAAA 3Q60A 2GFSA 4IAZA 3ZOSA 4WNOA 4DEEA 4F4PA 2BRBA 4TNDA 5EKOA 5LCKA 4X7QA 3WZJA 4XUFA 3ZHPC 3NYXA 4PTCA 3VF9A 2BZKB 3R22A 2XJ2A 3CJGA 2WQBA 3EL7A 3CXWA 3IW5A 5IDPA