4DCAA

Crystal structure of aminoglycoside phosphotransferase aph(2'')-ib, adp-bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
LDAEIYEHLNKQIKINELRYLSSGDDSDTFLCNEQYVVKVPKRDSVRISQKRELELYRFLENCKLSYQIPAVVYQSDRFNIMKYIKGERITYEQYHKLSEKEKDALAYDEATFLKELHSIEIDCSVSLFSDALVNKKDKFLQDKKLLISILEKEQLLTDEMLEHIETIYENILSNAVLFKYTPCLVHNDFSANNMIFRNNRLFGVIDFGDFNVGDPDNDFLCLLDCSTDDFGKEFGRKVLKYYQHKAPEVAERKAELNDVYWSIDQIIYGYERKDREMLIKDVSELLQTQAEMFIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase APH(2'')-Ib, ADP-bound
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 105
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dcaA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dcaA02
3U8WA 2H9VA 2WQOA 4E5BA 5C27A 2CCIA 2QNJA 4F08A 5C01A 3HP5A 4O0UA 4Y5QA 5CZIA 2WQEA 3LJ0A 3IECA 3ZO3A 4BBMA 4IB5A 3W0NA 2BMCA 2WQMA 4QOXA 3QX2A 1U4DA 2CDZA 2R3HA 3NX8A 4BTJA 1JAMA 3A7IA 5AM6A 5T3QA 2XNNA 2B9JA 5DA3A 3NCZA 1PXMA 3TEIA 2CN5A 4FEQA 4L7SA 4BGQA 3FLSA 3LLTA 3OT3A 5JT2A 5KHWA 1VEBA 3CPBA 4YJSA 5IUGA 2PMLX 3EQRA 3TT0A 3A7JA 3MFSA 4TT7A 3EJ1A 5J7HA 1ZMWA 4YU2A 1WMKA 3KXMA 4BICA 4F9AA 3ZUVA 3NR9A 4G5JA 4I6FA 3IO7A 4FV9A 4FSZA 4XP3A 4U6RA 3BGZA 4FZAB 4PTGA 1OUKA 1WBPA 2AC3A 3GC8A 4XYFA 5DI1A 2Q0BA 2I1MA 1STCE 1OZ1A 3OUKA 5ETCA 5EKOA 2R9SA 2XIXA 3IPHA 5D10A 1GIIA 2E9PA 2ZDTA 4RC3A 5HE1A 3MPTA 3I60A 2SRCA 5CXZA 1QPCA 1YXVA 2UZVA 4G9RA 4HYUA 3AGLA 4F0IA 4YUQA 2WMBA 4N57A 1KWPA 4F65A 1Q8TA 5I5ZA 3PXKA 4IZYA 5JRSA 3R2YA 4XOYA 4U80A 2V0DA 2RKUA 1GZNA 3VBTA 4AAAA 3L1SA 2PVRA 3R1SA 1YI4A 5E8YA 3WYXA 4R1VA 5D11A 3C7QA 4IQ6A 1GZKA 5JMSA 4IFGA 4YJUA 2R3LA 4JDJA 3UODA 3KF4A 3B8RA 2CMWA 1OB3A 1LPUA 2GMXA 4I0TA 1M7QA 1QCFA 3HRBA 4PP7A 1Q5KA 2BCJA 3NDMA 2C6KA 5CX9A 5AX3A 1F5QA 1K2PA 4O38A 3NCGA 3ZSGA 4CZUA 3SVVA 5C8NA 2C5NA 1M2PA 2C6DA 3ZUUA 4QPAA 2YABA 5DHJA 5HKMA 4D4VA 4DHFA 4EOMA 3PP1A 2JKOA 3WZUA 2J90A 4S33A 4C34A 2YERA 3GQLA 4NU1A 5HO7A 5JSMA 4W4WA 4NM0A 3V5PA 1WBSA 3NYNA 4JDKA 1W7HA 3HECA 5ITAA 3L8XA 5AP4A 2A19B 5M57A 3FEGA 4QNYA 2WIPA 3SGCA 4FUXA 2VWIA 5I9UA 2ITUA 2QU6A 3F61A 3BBWA 4FI1A 3ODZX 4V0GA 5ACBC 4DT9A 5BMMA 4E6QA 1PW2A 3F2NA 4TW9A 5J95A 4IAAA 5JKGA 2XKFA 2X7OA 3TN8A 2WTIA 1HCKA 3VQHA 5AUTA 3HX4A 3RAKA 1FVRA 3NMUF 2HW6A 3NUAA 4IE9A 5CF8A 5JFXA 1Q8WA 2YN8A 3ZM9A 4RFYA 4J8MA 5IA0A 2WMUA 4RZWA 2WIHA 1SVHA 4GYIA 4RJ7A 5TO8A 3ZFMA 4LYNA 2VO0A 3L9LA 3WF7A 5A4TA 2PZYA 2JDTA 2VTRA 4ENXA 4GH2A 1MRUA 3QZGA 1MQBA 2E9OA 5GINE 2VGOA 3F2AA 3OS3A 1U46A 1ZXEA 2KULA 4FL3A 4QTAA 5IF1A 5IEYA 2BAJA 3QLFA 1VZOA 2YDJA 2BR1A 3AGMA 3MIYA 4FYNA 4KBKA 4MNFA 1FVVA 4FV6A 4FKWA 3NUSA 3G51A 4WUAA 2WKMA 2QI8A 3F5PA 4ALUA 5IH4A 2V7OA 5T68A 2BROA 3F88A 4RJ3A 5LOHA 3P86A 3Q4ZA 4BCIA 4RPVA 2WOUA 4O7LA 5HLNA 3PPKA 4JQEA 4E4LA 1ZMUA 2PVMA 3E92A 4FKSA 4H1JA 3PSDA 4V05A 1KE8A 2NNWB 4MXXA 3WF9A 4BIBA 4DFLA 5DR6A 5BVKA 4EK5A 3CS9A 4ID7A 2X7FA 1UNGA 3OP5A 3UIXA 4O7WA 4IB1A 2OZOA 1Z57A 2FUMA 3SD0A 5CEOA 1R3CA 3K5VA 4PDYA 1Q8YA 3KRWA 2IVUA 4BDHA 4LMUA 3D0EA 3OVVA 2UW9A 4F9WA 5IPJA 4FT0A 5CT0A 2ZV8A 1YHWA 1OKVA 2YCQA 3BHTA 3C0IA 4IZ5A 3C5UA 4M15A 3BYUA 5FLFA 3H0YA 1JVPP 4E1ZA 3TL8A 4X2NA 3CY2A 4J95A 5DE2A 4CG9A 3KULA 4MF1A 1J91A 1UKHA 2Z8CA 4FE2A 3T3UA 4HYHA 2HYYA 3QTWA 4WD5A 4BCGA 3BLHA 3Q3BA 2ITYA 2BIYA 4YJQA 4LI5A 3NNWA 5CTPA 4XG2A 3OWPA 4GT5A 4YHFA 2HOGA 3I5NA 4TRLA 4CKJA 2WTJA 4CZTA 3GOKA 5KKRC 3A61A 4FNWA 4JJRA 2C5OA 2CNUA 2WEVA 3W2CA 5I9YA 3EN7A 1NT2A 2B54A 4I5PA 3NYXA 4RGJA 4ITIA 2W1DA 3VJNA 4EH3A 3B8QA 1Y6BA 3GVUA 2WOTA 3N9XA 3OOGA 2PVFA 3CQWA 3R0TA 2R0IA 2ITPA 3U55A 3HV6A 5A46A 4F1OA 4U3ZA 1QPDA 1Z5MA 4L01A 5ANIA 4DEHA 4FT9A 4M69B 1M52A 2B9HA 3AMAA 1PXKA 3D83A 3GCVA 4I5CA 5CSVA 4C4GA 4EJNA 3OTVA 4FT5A 5J9ZA 3QD2B 3U6IA 4GG5A 1P2AA 4QMSA 3QZHA 4EH5A 1OKYA 4R5SA 4U45A 3RNIA 2ZYBA 2QLUA 2YIRA 3RHKA 1ND4A 2VTIA 1OIYA 4QQCA 4UWBA 4CTCA 3DZQA 3PXYA 4ASEA 5M09A 3QZFA 1BI7A 3AC1A 1CMKE 4U43A 4J1RA 2VO6A 2XKCA 4I21A 2RGPA 2ZV7A 2XK3A 3DKCA 4HPUE 4P7EA 5AADA 2GQSA 2YZLA 2W1ZA 2YA9A 3KCKA 4RSSA 3PXQA 4MAOA 5CNNA 3V6RA 4BR3A 4FSWA 5IG1A 3MH2A 3KK9A 2BZJA 2X6EA 4MBIA 4YHJA 2GNIA 2XBJA 3E8DA 2W06A 4I22A 4FKUA 4AU8A 3C4CA 4OT6A 4F9CA 1W0XC 3ELJA 5IDPA 3GU7A 5A4EA 3EN5A 4BGGA 4QNAA 3EQBA 2I0YA 2X8EA 3DGKA 3EFWA 3N51A 3W2SA 4J99A 4EWQA 4IMYA 3TJCA 4EOJA 1F3MC 3VBYA 2OZAA 2OJIA 4WT6A 4FKQA 3TZ7A 2WTDA 1FQ1B 3BIZA 3HV5A 3REPA 1H1WA 4AXAA 4N0SA 2VX3A 4GT4A 5BVOA 4FV2A 1ATPE 2PUIA 3RPSA 4ACMA 1M17A 3B2WA 2PZPA 2WMVA 2V5QA 3Q2JA 5E7RA 2W1CA 4IWOA 2JKKA 1YWVA 4IFCA 2UZEA 3E7VA 4XG7A 5T6KA 5L2SA 1QPEA 4AP7A 3M11A 4ONAA 5DEWA 4EH4A 4WZYA 1Q3DA 3H3CA 4ANLA 3QTXA 1PF8A 3DXNA 3D14A 5E92A 3HEGA 3SOAA 4RBLA 4GIHA 4RVKA 1SVGA 4UY9A 5IA2A 3QXPA 4BTKA 4Z7GA 4JVGA 4AT3A 5AP6A 3W0PA 5HG8A 2WTWA 2EXCX 4EL9A 4EKKA 4RIXA 4L7FA 4R3PA 3CY3A 4Y72A 3N4TA 5DBXA 4FTIA 3G0EA 4AW0A 2CKQA 4IIRA 3SXRA 5LQFA 4I41A 4O6LA 3R7VA 3GT8A 4C33A 2OXDA 4QPSA 3QTZA 2BRGA 5M06A 3UIBA 1PHKA 3MTFA 4GU6A 3BGPA 2X6DA 3E3PA 2Z2WA 3QKLA 5CWZA 3VIDA 2P55A 3WI6A 4DAWA 3OW3A 4AE9A 4U94A 1OIQA 2C3IB 4KIPA 5BVEA 3HV3A 3GFWA 3LM5A 5IQCA 3R1QA 3MVMA 4OGRA 1GY3A 2R3KA 3DLSA 3F3WA 4QTCA 4FKJA 4O0YA 3GI3A 4YZBA 3IOKA 3G9NA 4O0WA 5BVWA 3FI4A 3QRIA 2GHGA 4HOKA 2OK1A 5DVRA 1IEPA 3HP2A 5AX9A 4FGRA 2VWYA 4WKQA 4TYIA 5CAQA 5L8LA 3SAYA 2W1GA 3BLQA 2JKMA 3TKIA 2W5BA 2J0LA 2P33A 1OM1A 3WZKA 5LMBA 4D4SA 3AOXA 1KV2A 2H96A 3GU4A 3GB2A 5FRIA 2QO2A 2VTNA 4LRKA 4EEVA 2XF0A 3KKVA 3NAXA 2WPAA 4XX9A 4D1XA 4YO4A 5L6OA 4PL3A 4FL1A 3KU2A 4GL9A 4PRJA 5F1ZA 2PL0A 5BUIA 4ZTQA 5HNGA 4U97A 5ANKA 3ZH8A 1JWHA 3PTGA 4IVAA 4CT2A 4E4XA 4ACCA 4BCOA 4DINA 5DRBA 3TCPA 3LXLA 4BCKA 1YXTA 1JNKA 2XYUA 3N4VA 5DEYA 1YDRE 1PXNA 4R7BA 4YZNA 4P5QA 4CEGA 1PKDA 2VTQA 3LFSA 3ANQA 4FTOA 2QONA 3FHRA 5FDXA 5AV0A 3S4QA 3QL8A 2F4JA 2VN9A 4XV2A 5HVYA 1YOMA 1JPAA 3NW7A 3OXIA 3W55A 2QCSA 1KE7A 4FKLA 3SV0A 3LQ5A 2ZOQA 2BVAA 3OEZA 1EH4A 3VS3A 4ZLZA 2IVVA 3CQEA 2CHLA 5FXRA 4YPDA 4R77A 1OUYA 4HVGA 3PVWA 3FYKX 2XNOA 4I1ZA 2VTTA 4W4VA 1WBNA 1JKSA 4GT3A 5HG9A 3VS0A 5IEXA 5AUWA 3ULZA 4O96A 4LGGA 3IDCA 5EFQA 4X6RA 3VRYA 1JKKA 2BUJA 2VTOA 5I9VA 3CD8A 1L3RE 3CIKA 3E87A 4J53A 2PYWA 5ETFA 2QLQA 4L00A 3ATTA 4DTAA 5JRQA 2BHHA 4BBEA 4JLCA 3LCDA 4IM3A 3ORMA 2FA2A 4MHAA 4HVHA 1E9HA 4PDOA 1PY5A 5TKDA 4XS2A 2QG5A 3FDNA 4B9DA 3LXKA 2JIVA 4FSNA 3TM0A 5HX6A 4MBJA 2VD5A 5E90A 2PWLA 3ZC5A 4X3JA 3EH9A 3DK6A 2YM4A 2WGJA 3RCJA 5KHXA 4WA9A 3LFFA 2QC6A 2YIQA 4JR7A 2WMXA 4YC6A 4USFA 4DEAA 5K5NA 3QQUA 4Q9ZA 2J5FA 2XNPA 4FIJA 2W9FB 2Y9QA 3TKUA 2ZM1A 5CSXA 4QMMA 3OD6X 3EN6A 3NS9A 1OECA 3Q2MA 1SZMA 4LMNA 1UU3A 3U87A 5HBJA 1OKWA 1LUFA 5KZIA 4FIGA 1NVQA 4BTFA 4YJPA 5HBEA 4DTBA 4CMUA 3OXZA 4DGMA 5FUTA 3HVCA 3LCKA 4F6SA 4RC2A 4PMMA 1TQMA 1ZZ2A 4XNEA 1FVTA 5LVPA 3COKA 5IMEA 4RX5A 2UV2A 2KTYA 3O0GA 4BF2A 3ORIA 1G5SA 5AIKA 2C6EA 3THBA 2X39A 3GC7A 2C0OA 4WG4A 3R7IA 3ZS5A 5CSPA 3RAHA 1ZRZA 3UNJA 2OIBA 4RG0A 3V51A 2BKZA 3FUPA 3CR0A 3PA4A 4WOVA 4X2GA 4PV0A 4EHVA 1J7IA 4W8EA 4YTCA 2VO3A 3EZVA 4CNHA 1J1BA 3V6SA 5IISA 3BI6A 4AZEA 3O23A 4O0SA 4J98A 2GDOA 1ZYJA 3U54A 3IDBA 4EKLA 3R8LA 3FMJA 4JL9A 4R1YA 1AQ1A 3IDPA 4O27B 3CKWA 4FICA 3FMMA 3P08A 4S34A 3ENHA 4AFEA 3V8TA 2XNBA 4PUZA 3CBLA 2Y6MA 4HCVA 4DEGA 1ZYDA 4H39A 4Y73A 5AUVA 5H9BA 3W10A 2EB3A 1UU9A 3S95A 2JFLA 4NW6A 2VTAA 4CD0A 5AP2A 2HY81 3W2OA 1XH5A 2CGWA 5ANOA 4O6EA 3KVWA 2BRBA 2FSLX 3BHVA 1YXSA 3PA3A 3QCQA 2C47A 1IR3A 3F66A 3LQ3A 4Z16A 2XMYA 3D9VA 3VULA 1SVEA 3QZIA 4TWPA 4EOQA 1O6YA 4CLJA 5FDPA 3A7FA 4XV1A 2R3JA 3HMNA 1XHAA 3NUUA 4FV7A 4I5MA 5AAEA 1UV5A 5CF6A 1KV1A 3NLBA 4TWNA 4BCFA 4K33A 5C03A 2QO7A 4M13A 3FL4A 4QMQA 2R7BA 4UEUA 2IG7A 3QKKA 3PY3A 4XV3A 3RINA 4D5HA 3W2RA 4ZSLA 5C8KA 3QTQA 1W82A 4GVJA 3Q5IA 3FY0A 4EK4A 5IH5A 1XH9A 2G2HA 4XV9A 4Y83A 1KE5A 2JBPA 2GFSA 2ITXA 3F7WA 4C4IA 3ET7A 3E64A 3KMUA 3PJ1A 2BALA 4F9YA 2A0CX 5IU2A 3QD0A 4O0XA 5HO8A 4OTHA 3V04A 3F3UA 4GYGA 4GRBA 4UXQA 5K3YA 1CKPA 3TACA 2WMQA 3BCEA 3HUCA 3CSVA 2BHEA 4G9CA 4TWCA 2WQNA 4BKJA 4FSTA 2CN8A 5HLPA 2VTJA 3VUDA 4FTLA 4ARKA 3VS4A 4QP3A 3BHHA 3DKGA 2XA4A 4WNPA 4IX5A 1OIUA 3QTUA 2FH9A 1RJBA 2CSNA 4PQNA 3OEFX 3FXZA 4RT7A 3CGFA 1B38A 3FI3A 4XLVA 2HZ4A 3FLWA 4DH5A 2C0TA 4BCJA 5KKRB 4A9UA 2B4SB 2J51A 4ZP5A 2YM5A 3P5KA 3NAYA 5CXHA 3COHA 3RJCA 4BCPA 5IA1A 5IH6A 3FBVA 1T45A 3BLRA 3KK8A 1TKIA 5EHYA 3P1AA 4F1TA 3U51A 2VX0A 1WVXA 1ZYSA 5HVKA 2PVHA 4H36A 4LL5A 1V0BA 3DT1A 3BV3A 1YW2A 5B0XA 3OROA 5CZHA 4EH9A 4QP8A 4EOKA 5KNJA 3CLYA 3G33A 4FUYA 3EL8A 3EOCA 1BYGA 4C7TA 4KD1A 4EOSA 3KB7A 2BDWA 2RL5A 1UKIA 3UTOA 4YBKA 5EOBA 3ZO4A 2QR8A 2CKEA 2XNGA 3OMVA 5AV4A 5KCVA 4L6QA 3JY0A 4NH1A 4R6VA 4CG8A 4W8DA 3K3JA 3P4KA 2ZAZA 5CAPA 1IASA 4RIWB 4DTKA 1Q99A 2J50A 3L8PA 4AGUA 1UU8A 3FQHA 1HCLA 3SX9A 2G2FA 5CT7A 3ATSA 3V5QA 3LIJA 4HJOA 4L53A 2QOFA 3DTCA 5EYDA 5C4LA 2X9FA 3N4UA 2C69A 4FT3A 2GHMA 1WBOA 4O84A 2BTRA 3VVHA 4ZLOA 1OL7A 2GNLA 5ETAA 4KINA 2F57A 4ZSJA 3RWQA 5IQFA 4LV8A 5HU3A 4XG6A 4B8LA 3Q60A 2XRUA 4GKIA 5B2LA 1MRVA 2ERZE 4GVAA 3GCPA 3U9CA 2C5YA 3UVQA 2VRXA 3ZEWA 2C5VA 5B2MA 3MJ1A 2Z60A 3PY1A 4EH7A 4MXCA 2QKRA 5LVNA 4FTAA 3BYMA 3MIAA 4FKGA 4QTEA 2R0UA 4BDBA 1H8FA 3TYKA 3IK3A 5LVMA 1H1PA 2G2IA 3RAWA 5M4CA 3EQIA 5AUUA 2ITOA 5EI8A 4DEEA 4H58A 3O17A 4ZJVA 4JBQA 4EC8A 3ZONA 5AFVA 4M8TA 1I09A 2HZNA 2WXVA 4G5PA 3AXWA 3LFAA 3ZYAA 2PE1A 3UPXA 2BRNA 3FXWA 2UZBA 3FMHA 3CTQA 3AC3A 4JX7A 3I7CA 3K54A 3BEGA 2ESMA 3DAKA 4IWQA 4U81A 5A3XA 4AW5A 3HDMA 3HNGA 3LOKA 3KXXA 4FMQA 3O7LD 2VO7A 4L42A 2IW9A 1ZLTA 2O2UA 4NJ3A 2Z7QA 4PNKA 3PRIA 3DBFA 4AN3A 4BYJA 2YIYA 3EFJA 4MTAA 3LCOA 4D58A 1XH6A 2IW8A 4ASXA 5BVDA 5JN2A 3QLGA 5DGZA 3F69A 3S0OA 4BDKA 3OZ6A 3LAUA 3RAIA 4FBXA 4GMYA 4X2FA 4MXYA 5DR9A 3KREA 4OTWA 4CKRA 5L2TA 3EQCA 5D7AA 4EORA 4NFNA 2VGPA 1TVOA 4AW2A 4C38A 2OIDA 3O71A 3DJ7A 3MGYA 3LVPA 3OWLA 4IX4A 1JQHA 3KXZA 2ZMCA 4PMTA 2JLDA 2P4IA 4ZY4A 3MB6A 5F94A 5CEMA 5HICA 5CANA 5FEDA 5AJQA 1ZARA 4U5JA 1I44A 3RHXA 3AT2A 3MS9A 3R83A 2W4KA 1H01A 2BPMA 2WHBA 3O8UA 4WNKA 5EQPA 2XM8A 3MVLA 3D7TA 3G5DA 2J4ZA 3QC4A 4ZTSA 1KE6A 2EVAA 5JGBA 3LM0A 1OPLA 5FXSA 5JGDA 3HGKA 2VU3A 2HAKA 1ZY4A 3MN3A 3F6XA 2REIA 2QOQA 2CGUA 2IZUA 5EI2A 1JKLA 3NNXA 4WBOA 2QOBA 3BU6A 4L44A 1R0PA 3CEKA 4J71A 2VX1A 4EQUA 5HE3A 3OCSA 5IUHA 3IW4A 3MDYA 3R9DA 4NKSA 4R78A 4J8NA 1OVEA 1Q8ZA 1ZOGA 3OW4A 3R00A 3EYHA 3UG1A 2EUFB 3F5XA 3HAMA 3LKMA 3G6HA 4M97A 4BI2A 4ALWA 3VS6A 4BI0A 3VW6A 2VWZA 4JI9A 2C1BA 3RPOA 2G01A 4XP2A 3F3VA 4BVUA 2BDJA 3QRUA 4YTIA 2WMAA 3E5AA 4F6WA 4ENYA 3E8NA 2PMOX 4O7NA 2B52A 3Q53A 3Q4CA 3FC2A 4DFUA 4I0RA 2HIWA 3QQLA 3C1XA 3LFQA 4FIFA 2YZAA 2F9GA 2R4BA 5E8TA 4AX8A 3MH0A 3MTLA 5JZNA 4ZJIA 2EB2A 5M55A 2A4LA 2V7AA 4YGAA 3UOLA 5JH6A 4CQEA 3LMIA 4B8MA 4A9TA 1SMHA 4YZMA 3UC4A 1O6KA 2XYNA 4O21A 2O0UA 3UNZA 3R8MA 1YHVA 2ITVA 3VS2A 3TZMA 3QAME 3EMGA 3H9FA 3W32A 1J1CA 4ERKA 3SRVB 3L9MA 3DTWA 4DC2A 4D2SA 3DKOA 5BNJA 5FM3A 3PVGA 5E8WA 2IW6A 4J97A 3LFBA 2Y0AA 4G17A 4RZVA 2BRMA 1A9UA 3COMA 1H0WA 1SNXA 4A9SA 3KFAA 4LOOA 5AV1A 4KUJA 4BBFA 1RW8A 3CD3A 2R3OA 5BMSA 2RFNA 4EHZA 2R7IA 3ZFXA 4ZK5A 1OMWA 3TV7A 3ERKA 3PY0A 4ZTHA 3EQHA 2XIRA 4HGEA 4FG8A 3PWYA 3GC0A 4CMOA 2UUEA 3D5XA 3DLZA 4EHGA 5C26A 5D1JA 3A60A 5HCXA 4EONA 4HW7A 2ZM4A 3LFDA 4RQKA 4EQMA 2IPXA 5IA3A 4IHPA 4OTDA 4AT5A 5FXQA 5M53A 4JIKA 4WNMA 5HORA 2H6DA 4F4PA 2XZSA 4I20A 2XKEA 5TR6A 4AACA 2O5KA 4ASZA 5DPVA 3VUGA 2Q83A 3VW8A 2YM6A 4NM7A 3D2KA 3SXSA 4KKHA 3ZRLA 1YWRA 4M0ZA 3NNUA 4XRJA 4WSYA 4DGLC 5FQDC 3LMGA 3UOKA 3VUMA 3UPZA 4G1WA 2AUHA 3AG9A 4TNBA 4ZTRA 5FD2A 5FP6A 2CJMA 5TF9A 3POOA 5DOSA 5H8BA 4KBCA 5JGAA 5HLWA 4QMUA 5CEQA 2OFUA 4O83A 2VWVA 4DG3E 3NYVA 2PUUA 3W0RA 4XP0A 3VJOA 1BL6A 4RLLA 4D4RA 2UW0A 4HGLA 4FSMA 4O91A 4LRJA 5AM7A 2YCRA 3RMFA 3UGCA 4AZVA 4EH6A 2PK9A 2XJ0A 4G3CA 4L3JA 4OTIA 3OTUA 1P4FA 4RIWA 4FTUA 5AA9A 3W33A 1O9UA 3R7EA 3DNDA 4NK9A 4FK3A 3QWKA 4IAFA 5LXMA 4FIEA 4RJ6A 3NUPA 3PXRA 4F0GA 4OTRA 2YCSA 2WU6A 3W1FA 4U9AA 4NKAA 4P5ZA 3IG7A 5KBRA 4JAIA 3DOGA 5EW9A 3UOHA 4JOAA 3D15A 5EM8A 3W18A 5IQIA 4ZEGA 3S2PA 4C3FA 4IX6A 1PXPA 3HRCA 5A9UA 3TG1A 4M14A 3FWQA 3C4ZA 4EUUA 1V1KA 4CLIA 3EQGA 2OLCA 3W2QA 2OKRA 4RA5A 2OWBA 4D0WA 1Q41A 3JVRA 4A4XA 5KMOA 2XCHA 5JFWA 4D1ZA 4RMZA 4GK3A 1R39A 1WVYA 3DU8A 3P23A 5L2WA 2QHMA 3FZRA 3HUBA 4L67A 2PU8A 3TWJA 2VTPA 5L2IA 4NM3A 2JITA 4F7JA 5JQ5A 3UBDA 5E8UA 3SOCA 3WBLA 1PXIA 4LM5A 5GJDA 5HIBA 3PDTA 2VWUA 2ITTA 2XS0A 3EB0A 5EM5A 3AC4A 3I1AA 2CCHA 2FGIA 3CC6A 4U44A 2Y8OA 3W8QA 2H34A 5KMIA 3AC2A 4ANMA 1CKIA 3U4WA 3TIZA 4CRSA 3QF9A 4XG9A 5HGIA 3IW7A 5CS6A 4FV0A 5A14A 2DUVA 3AD4A 3ID6C 5G1XA 3QHRA 1URCA 4FK6A 4O7PA 5DNRA 4G3GA 4M67A 4FVRA 3QD4A 4FR4A 4P90A 3PIZA 3QU0A 4I24A 4MD7E 5LVLA 4K18A 3FPQA 1YVJA 2WFYA 2C5XA 5J8IA 5CAVA 2R3PA 2WAJA 4F6UA 3IW5A 3V3VA 3WE4A 2FSOX 3FZPA 2W1IA 3CTHA 3OHTA 2XH5A 3FKLA 4E7WA 1UU7A 1KOBA 2FB8A 2PZIA 3DB6A 4F70A 2OXXA 3QQKA 3QYWA 3R7YA 1V0PA 3NIZA 3I7BA 1H0VA 3LPBA 4BCQA 1M7NA 3UOJA 3G6GA 4K6ZA 4YJNA 4BDJA 3ZBFA 3ZDUA 4RWLA 4FTNA 4K2RA 1RQQA 2CLQA 4TKSA 4F1MA 3V5JA 2XP2A 3DB8A 4FGBA 3MJ2A 3QGWA 3SLSA 5HTCA 4RWJA 4OW8A 1LEWA 4ITJA 2OGVA 3PJ2A 3VHEA 4EK3A 4L52A 4BB4A 5JQ8A 3FI8A 4Y5HA 3RPRA 4JG8A 2ITZA 3KN6A 2HCKA 3Q9WA 3BYVA 3WZDA 2YACA 4EYJA 4WHZA 4ORKA 1KSWA 4BYIA 5LWMA 5EH0A 3IS5A 4EK6A 3TNIA 2W99B 2UVXA 4OUCA 4CTBA 5HVJA 1JSUA 3C5IA 4WIHA 2RG5A 5BUJA 3HA8A 3SDJA 2G9XA 4QMPA 4GV1A 4BDFA 5D9HA 3DK7A 5E9EA 3AT4A 4IAYA 4WG5A 4AFJA 1ZOHA 3CTJA 2B9FA 3ORLA 4L8MA 3ZFYA 5H8GA 4KIQA 2R64A 3V01A 3QUEA 4MK0A 4NTSA 4P2KA 3JXWA 4PTEA 2NRUA 4ERWA 1OL1A 2C0IA 3PA5A 3UIUA 3SHEA 4E5WA 3PLAE 5J87A 3VBVA 1BUHA 3FLQA 3PRFA 4B99A 4II5A 3COIA 2XK8A 3I4BA 3W0OA 1WBTA 2YJRA 5DT0A 3ZDIA 4ACDA 4JQ8A 5FEQA 4B4LA 4NL0A 3EN4A 2W9ZB 3Q9ZA 3DDQA 2IVTA 2HY0A 3DK3A 3FI2A 3C4EA 3A8WA 2C3KA 3ZZEA 3A4PA 1MQ4A 4CVAA 3VF9A 5FBOA 2RIOA 1H00A 2W05A 5DR2A 3QGYA 2J9MA 4ZY5A 3QRJA 4CRLA 4C4FA 4FZ7A 4QP6A 2JKQA 2OF2A 2Y4IC 4I6HA 4ANBA 2UZDA 3FSKA 4FKTA 4Q5EA 3MVHA 4YZDA 2OJFE 4FNXA 3UC3A 2DS1A 5BX0A 4ZS4A 3EIDA 3WYYA 2GS2A 4YTFA 5HD4A 3Q96A 1VYWA 1Y91A 4NWMA 1BL7A 2C6IA 1OL5A 4FL2A 3KMWA 4EUTA 1CDKA 3BEAA 3TDWA 4EOPA 4IJ9A 4GK2A 2IZSA 4FVQA 3U4UA 1G3NA 1NA7A 3R9HA 4LUEA 5CNOA 5HTBA 4G34A 4OTGA 3QQFA 2GHLA 4D28A 3ORKA 4GSBA 3CPCA 3KCFA 4MYGA 3R9RA 4EZ3A 3R8PA 4FSRA 4JQ7A 4JRNA 3MVJA 5ACKA 1H1SA 3ALNA 3LQ8A 4H3QA 3ZLYA 3R22A 2FYSA 3SC1A 2QU5A 3PJ3A 4MNEB 5KUPA 5HG7A 4AQCA 3C4WA 4KBAA 1Q4LA 4FSUA 3TUDA 5H2UA 3PP0A 3JVSA 4I4FA 4MKCA 4WBBB 4I6BA 3QQGA 3KRXA 4WRSA 1G8AA 3D94A 4FKPA 3ZUTA 4ANSA 4AN9A 4C61A 3POZA 3S00A 3PIXA 4H3PA 2CKOA 1PXOA 4L43A 3QCXA 4HGSA 4JT3A 2VNYA 4F7SA 5I9WA 1FGIA 3MFUA 2XJ1A 4QP2A 3H10A 3PSCA 5KMLA 3BV2A 3TIYA 3FQSA 4D9TA 5LCKA 2CLXA 5L8KA 3K5UA 2VZ6A 1FINA 2JIUA 4IM0A 4RIYB 3WZEA 2OBJA 4AA4A 4C3RA 4RFMA 4FTCA 3KXHA 2GTMA 4APCA 4C3PA 3UG2A 3UP7A 5CI6A 3QTSA 3V5LA 3I6UA 4DT8A 1CM8A 1IA9A 2IN6A 2ETKA 5F95A 4QYEA 1GJOA 4ALVA 2HW7A 4XG3A 4EWHA 4I4EA 3PWDA 4X7QA 2F2UA 3T3VA 4RVLA 4AA0A 4K9YA 2QHNA 3V8SA 4PNIA 2JDVA 4ZMEA 4GFMA 2CGVA 3QKMA 4EYMA 3UDBA 4K1BA 4DH8A 4IBMA 5HNIX 2YISA 4E4NA 4AW1A 3ZRKA 4C2WA 3OBGA 5J5SA 2Z7LA 3VS1A 2J2IB 3BRBA 1CTPE 2HWPA 4JRVA 5IQEA 4BIDA 2JC6A 3E3BX 3BHYA 4YLLA 4YSMA 3VUIA 2XIZA 5AEPA 2HXQA 3IW6A 4ZLYA 3Q6UA 5M07A 1X8BA 3O96A 4C02A 4FKOA 3VAPA 4O2ZA 5LMAA 4DH3A 2HXLA 2JGZA 4JBPA 4D0XA 3R28A 3KVXA 1PYEA 1PXJA 3EQPA 1XJDA 4N4SA 2ZB1A 5HQ0A 3EKKA 3MB7A 4IAKA 2Y6OA 3MWUA 4E73A 4O7TA 2E9VA 3L8VA 5GJGA 4CFXA 4MD9E 4FODA 2BAKA 1P14A 4UWYA 2WNTA 2A27A 5AV2A 5HCYA 3G15A 1YOJA 5E4HA 2UVZA 3EYGA 3GFEA 3D5VA 3FXXA 5CVHA 4AZSA 3R6XA 5I0BA 4IX3A 1APME 2X9EA 3TUCA 4YP8A 2J0JA 3ULIA 2FSMX 3PSBA 1DAWA 3IQ7A 4FV3A 4OTQA 3QRKA 3PUPA 4N70A 5HI2A 5TOZA 5FTGA 4DG0E 3WARA 3K3IA 3Q5ZA 2VTHA 3KA0A 3QALE 2QOOA 4GG7A 4M7IA 4NYEA 4GJ3A 5E8XA 3RWPA 3DPKA 3FLYA 2PMNX 5KX8A 3ORXA 3QCSA 3U6HA 4JDHA 5I4NA 2OXYA 5CQWA 2GTNA 3C4FA 4TY1A 2Y7JA 4R3RA 3MESA 3MH3A 3SW4A 3VC4A 1GAGA 3F9NA 1GIHA 1VR2A 3BE2A 4K11A 4AZTA 3UO5A 3CKXA 4QYYA 1Q3WA 3FE3A 4FZDB 2I0HA 4KKEA 5HHWA 3VUHA 3BELA 3CCNA 4HCTA 4EQCA 4OLIA 3FLNC 2UVYA 4O0RA 1OBDA 4DA5A 5I9XA 1XH7A 3OUNB 4I0SA 5G6VA 3ZBXA 2X4ZA 4CFFA 1ZOEA 2O8YA 4L3LA 2ONLC 4X2JA 4F9BA 4BZOA 3NIEA 1YKRA 4YPSA 3BX5A 3HKOA 5EDPA 4XEYA 3WE8A 3ZTXA 5LMKC 2C4GA 2WTKB 4U42A 3L8SA 4QMVA 1UWHA 4I3ZA 4O81A 2C6OA 3GGFA 4ZSGA 2QKWB 4PWNA 3C0HA 2O3PA 1DI9A 1UVRA 2OJ9A 2XBAA 3QTRA 4QP7A 4YTHA 5L6PA 4IC7A 1YI6A 4JNWA 5CSHA 3KRRA 2X7GA 4IWDA 4XUFA 5KBQA 4MEDA 4YR8A 1FMOE 4LV5A 5HIEA 4UB7A 3AC5A 3LFCA 4QP9A 5FP5A 3D4QA 2YHVA 4KA3A 4LRMA 1YDSE 4XJ0A 3MY0A 5GHVA 3VUKA 4NIFB 1ERKA 2PVNA 3PE2A 5K4JA 3JY9A 2JEDA 5IEVA 3DS6A 1YWNA 3O8TA 1H08A 3KGAA 3PZHA 2ZM3A 3R63A 4QMTA 5CI7A 1S9IA 5ANDA 5FBNC 4QMZA 3QA0A 1WZYA 5CQUA 4IH8A 4XOZA 1XBBA 4KAOA 2YM7A 4FEXA 2HK5A 3QFVA 4BTMA 4QMNA 5EYMA 3ITZA 4EJ7A 5AP1A 3AD6A 1NXKA 4WUNA 2B0QA 4BDIA 4DEDA 1J3HA 4JS8A 4USDA 3BE9A 3WF5A 2XIKA 3M2WA 4FIIA 4W4XA 4PDPA 3OBJA 2V55A 3OT8A 3PVBA 4O82A 4C4JA 2UW5A 2WU7A 4X0MA 3E8EA 1MRYA 4C59A 4YZ9A 1PXLA 4CFWA 4RWIA 3LXNA 4FSQA 3UYTA 3O50A 4U79A 3LMHA 2RFDA 4C4HA 3DQWA 4G3EA 2QOKA 4NUSA 3UP2A 1YHSA 5E1SA 5ETIA 4U8ZA 3ETAA 3ZRMA 5BUEA 3PFQA 3VF8A 3ZHPC 3W0QA 2R5TA 4BHNA 4XCUA 5HEZA 3P0MA 1LP4A 2X2MA 1MUOA 3EZRA 4G31A 4H05A 4CV9A 3MSSA 3U6JA 1ZYCA 1A06A 4AOJA 2O65A 2PZ5A 2UZUE 5D12A 5AAGA 4IM2A 5LVOA 1XKKA 3GCQA 3BPRA 3VBQA 1NY3A 1YRPA 5EQYA 5JK3A 3ZU7A 3UQGA 5D7VA 1YXXA 3D5WA 3FAAA 5A4LA 5CU2A 2WELA 3ROCA 1F0QA 1REJA 4UBAA 2HWOA 4U3YA 5IQBA 1J7UA 5CU0A 4KSQA 5DFPA 4FTTA 4ZTNA 2UW8A 4LOPA 5A4QA 4ZMFA 4QQJA 3ZSHA 3A7GA 3KULB 5CF5A 3MI9A 3R04A 3R9OA 3P78A 2YM8A 1UWJA 1VJYA 3AT3A 3DZOA 2GSFA 5L8JA 3UVPA 4O7OA 3ZXTA 2YDIA 3SG9A 3UO6A 3ZMMA 1KUTA 1Q97A 1XBCA 4OTFA 4U0IA 4E6CA 2R3MA 2X81A 3T9TA 5AMNA 4M12A 1O6LA 4UZHA 3TDVA 5FGKA 3TJDA 2X8DA 2QD9A 4DFZE 2F2CB 1W84A 4B6LA 1KOAA 5A6NA 1JSVA 1YI3A 4JR3A 5M4IA 4RX9A 5CVGA 2PZRA 1K9AA 2BZIB 2R3NA 3OCGA 3A99A 3R8ZA 4JXFA 1WBWA 3BQRA 4TYEA 5HESA 1Q61A 2WTVA 4ZTLA 5CLPA 1SM2A 4HNIA 4C58A 4GEOA 5DG5A 4LOQA 5L3AA 3F3ZA 3NW6A 2B1PA 3I6WA 2PHKA 4QO9A 2PVLA 4Z9LA 2ZVAA 1IAHA 4C35A 5J9YA 1OPJA 2C6TA 2GCDA 2R3QA 4XLIA 2BAQA 1OITA 2XIYA 3E88A 2V22A 4QMWA 3A62A 3ACKA 4DFNA 2XCKA 3NUXA 4JG7A 4QMYA 3GCUA 3W16A 1OL6A 2FO0A 4N6YA 3CQUA 4N6ZA 4P4CA 1H4LA 4DEBA 2G15A 2V62A 4V04A 4DE4A 3DDPA 5E8SA 4DFYA 3F3TA 4MXAA 5EKNA 1M2QA 2WZJA 4HYSA 5EW3A 4A06A 2RF9A 4MBLA 2E9NA 5EYCA 3QHWA 3WIGA 3CE3A 3ZSIA 4GK4A 4IEBA 2I6LA 3MA6A 3WIKA 1FGKA 2UZNA 3F2RA 4O7SA 2VWBA 1UNHA 1OIRA 2GU8A 3QUPA 3FMLA 3JS2A 3R7OA 4PL4A 2I0EA 3RPVA 5BVNA 5CAUA 1OKZA 1GZOA 3UO4A 4W4YA 3ZCLA 3BYSA 3QC9A 5DRDA 1XWSA 3VBWA 1TQPA 2OZAB 3FQEA 3MPAA 2OW3A 3H0ZA 4JG6A 4XRLA 3RM6A 4E6AA 4L45A 3RP9A 3R8UA 2QOIA 5IMXA 2X4FA 4O86A 1Q62A 4YJOA 3ZOSA 3I5ZA 3IGGA 1ZAOA 3PIYA 2XVDA 4FKVA 4IB3A 4M3QA 3RCDA 2BTSA 2XKDA 2CNQA 4IAIA 2YDKA 4XH6A 1WCCA 5GIOE 2R3GA 2Z7RA 5CY3A 3ZO1A 2PMIA 2ERKA 2W4JA 2Y4IB 2UZWE 4PX6A 4YLKA 1ZMVA 3NYOA 4G3FA 3F5GA 2PTKA 2PVYA 2QVSE 3OOMA 5AP0A 4CFVA 3NVMB 3KRLA 3LCTA 4HZRA 4E8AA 5GJFA 1LR4A 1PKGA 3KN5A 4TPTA 5EHLA 4E26A 1OBGA 4RIXB 4YHTA 4J52A 4UYNA 4EHEA 1OPKA 3QRTA 4C36A 4XG8A 4ZIMA 2YAKA 3A7HA 4Y85A 2ACXA 2BIKB 1YXUA 2XK4A 3EKNA 3L9NA 4LUDA 2GNFA 4YBJA 4ANQA 3O7LB 5LJJA 2QOCA 3C9WA 3FKOA 3BHUA 3CXWA 3GU8A 3L9PA 2LGCA 2GPHA 3OFMA 4XBRA 3NSZA 4ACGA 3NNVA 4KS8A 2JBOA 2XRWA 2XK9A 4D5KA 5HBHA 3E93A 3C50A 4FV1A 3KF7A 5KE0A 3Q9XA 1XBAA 5M51A 4R7IA 3HMOA 3H4JA 4AE6A 4IB0A 5AUXA 3D2IA 2C3JA 2WMTA 4PTCA 4QQTA 3UMXA 4FOBA 4IDTA 5HIDA 4RLKA 4DBNA 2W5AA 4DGOA 4FV8A 4FX3A 1Y8GA 2CPKE 3LCSA 5EDQA 2F7XE 4H1MA 3TV4A 5EOLA 4F64A 4AGWA 5HE2A 4HPTE 4NSTA 4JX3A 3DA6A 4NTTA 5CF4A 1ZZLA 3Q04A 4F7NA 5AP3A 4O2PA 5C4KA 1V0OA 2GNJA 3EN9A 3GC9A 4UV0A 5FG8A 3ANRA 3Q6WA 5AIRA 3VBXA 4EC9A 5CAOA 4ZTMA 2YJSA 2XB7A 5CYIA 3ZEPA 3KL8A 4TNDA 3JYAA 4U41A 5E8VA 5DT3A 3KC3A 3NRMA 2A1AB 2WTKC 3JR1A 3MBLA 3ORZA 4ZZOA 4FKIA 3HL7A 1JSTA 2FSTX 3OCTA 3OC1A 5HG5A 5BYLA 3TTJA 4HVDA 4HZSA 1UNLA 2VUWA 1BI8A 2ITQA 5CU4A 4EOIA 2B55A 1M2RA 3GBZA 4YNOA 5C8MA 5F4NA 5CEIA 3VN9A 4TL0A 3M1SA 2NP8A 3I0OA 1DS5A 3LJ1A 2GS6A 2W4OA 3KXGA 4RIOA 5TT7A 3I0QA 4TZRA 4EI4A 5AUYA 4HVIA 5CASA 2XJ2A 3HDNA 4BCNA 5K4IA 3OCBA 2BILB 1FBNA 3KEXA 2J0IA 1H26A 2DWBA 4C37A 3QQJA 1XH8A 2UW4A 4EBVA 1BMKA 1PJKA 4QMOA 2AYPA 3VHKA 3ZLXA 4YNEA 4RVMA 2P2IA 4RWKA 5KMMA 3RZBA 4I23A 4KS7A 4UWCA 4U40A 5EG3A 2QURA 4M84A 3KMMA 3DXPA 4Q9SA 3EQDA 2W5HA 3QD3A 4FC0A 4UYAA 5B2KA 3OWKA 4B0GA 4D2RA 3UIMA 2HELA 2ITNA 2JIIA 2O63A 4M68A 4NM5A 3D7ZA 5EI6A 2OU7A 3DAJA 2C68A 4AWIA 3TXOA 3ZC6A 2WTCA 4PMPA 1JLUE 4C0TA 5EDRA 1H27A 2UW6A 4FIHA 2B53A 5IQGA 2GQGA 3PPZA 3R9NA 3UQFA 1GZ8A 5A4CA 3MY5A 5DH3A 2XNMA 4BDAA 4O7VA 5F20A 2BFYA 2OG8A 3MFRA 4YMJA 4B7TA 5EQEA 2YEXA 4XHKB 5HZNA 5CU3A 4HGTA 4MWHA 3TNWA 2YWVA 4WO5A 1WFCA 3Q9YA 4F7LA 3HLLA 2GFCA 4MQ1A 4RVTA 1PMVA 3KY2A 3ORTA 4RA4A 2ZV2A 3QYZA 3RK5A 3TZ9A 2UW3A 3O8PA 5AP5A 2I40A 4AOTA 2XEYA 4RJ8A 2VWWA 4YJVA 4ZZMA 4R3CA 1IAJA 4DFXE 3MYGA 4UALA 5M4FA 2OH4A 4ZXTA 5BPYA 3G0FA 3C0GA 3AMYA 5A54A 4GCJA 5FTOA 4AUAA 4BN1A 4IW0A 1HOWA 1E1VA 3PYYA 2H8HA 3UZPA 4TTHB 4FTQA 4NJDA 3Q32A 3P7BA 4BHZA 2JDRA 2BZKB 5CEKA 4QMXA 4BIEA 3LJ2A 4Y8DA 4GUEA 4Z3VA 5J1WA 2CKPA 2BRHA 2XK6A 3O2MA 3SXFA 3UJGA 1U59A 3EWHA 1YDTE 4I93A 4PY1A 4YLJA 2JFMA 2CNVA 4FNYA 1KE9A 5BYZA 5IA4A 4UX9A 4FSYA 5DLSA 4IDVA 3NGAA 2ZV9A 4AS0A 3LW0A 4DH1A 5IA5A 4LL0A 4OBOA 3LLAA 4MD8E 4IZAA 4AN2A 2VTSA 1H07A 5EW8A 2J5EA 3G2FA 4J96A 1S9JA 4TYHB 5HCZA 2HZ0A 2PSQA 2YAAA 3GCSA 3OF0A 3BBTB 3RM7A 4R5YA 4JBOA 3JPVA 3HV4A 1JKTA 4XMOA 1SNUA 4LG4A 1DI8A 2C1AA 2F7EE 1H1RA 2XNEA 4DLIA 2R3FA 2CGXA 4OBQA 5CSWA 1ZY5A 3EQFA 4LQMA 5LARA 3FPMA 4UN0C 4ACHA 4GKHA 3FYJX 3FZOA 4QYGA 4X3FB 3UYSA 4FEVA 5IDNA 1YQJA 3Q4TA 5E91A 4L68A 3U9NA 3Q52A 3FLZA 4CCBA 3A2CA 3A4OX 3NVKI 4FZFB 2OI4X 2VAGA 3E7OA 1FPUA 1XR1A 3ORPA 5GIPE 1VYZA 2QQ7A 4IC8A 3VQUA 3IKAA 3UVRA 4BZDA 4FNZA 3QXOA 4I92A 4JIAA 5AA8A 2VWXA 3HAVA 2IJMA 2UZOA 4DN5A 4LFIA 2PVKA 2RFSA 3HMIA 3LXPA 4A4OA 4RRVA 1CKJA 5ANGA 3RI1A 2ZMDA 3PJ8A 2C3LA 2X8IA 3MW1A 3D5UA 3KQ7A 4S31A 5A6OA 3FZSA 2UZLA 3EFKA 4F63A 2P2HA 1MP8A 1W8CA 4RX7A 3DAEA 4DITA 3TUBA 1BX6A 1K3AA 4FEWA 5JFVA 4C4EA 4CFNA 4USEA 5DN3A 3ROYA 5B7VA 3LHJA 4O22A 4C2VA 5H3QA 4KRCA 5ANJA 3NEWA 4GUBA 5IQHA 5DIAA 3BGQA 3T9IA 2JAVA 4DH7A 2X0GA 5IQDA 5DWRA 4YZCA 5KMNA 2HZIA 3H30A 3JUHA 3P7CA 2QG7A 1Z9XA 5CALA 4BDCA 1QL6A 1CSNA 3F5UA 3S1HA 3SA0A 2PE2A 2Y4PA 3NPCA 5DYJA 5JEBA 4CV8A 1JOWB 4F09A 2YM3A 4KKGA 4ASDA 3SRVA 2PULA 3FC1X 2QR7A 3KXNA 4NZWB 3UQCA 2ZDUA 2Z02A 3W2PA 4HYIA 4QP1A 4CXAA 2QOLA 4QP4A 4AOIA 3PVUA 4AZFA 3VO3A 3TNPC 2X2LA 3PZEA 4R7HA 3HYHA 2EWAA 2BFXA 2W96B 4JBVA 3PE1A 3Q4UA 4APPA 3FZ1A 3PXFA 1XQZA 3IW8A 1U5QA 4FG7A 2W1FA 4BZNA 4FA2A 2E2BA 4UZDA 1WVWA 5EM7A 1XO2B 4GW8A 3R8VA 2ZJWA 2B9IA 2ITWA 3ZM4A 4GU9A 4GFGA 4F99A 5LCJA 4ZSAA 4ZZNA 3PJCA 2BZHB 1NW1A 3DNEA 2X2KA 1U54B 4FTRA 2A2AA 4MXOA 5E8ZA 2AC5A 2YCFA 4AGCA 3H9OA 4DFBA 4E93A 4QQ5A 4DLJA 3G9LX 1A48A 4L3PA 2XEZA 2GNGA 4JDIA 3GXLA 4U98A 2R2PA 4RJ4A 2C30A 5J1VA 4AZWA 1RE8A 3SW7A 1NVSA 3QCYA 3TI1A 3WF6A 2YFXA 5K9IA 5M4UA 3E62A 4G16A 2DQ7X 2W17A 5ICPA 3DQXA 3FHIA 4V01A 4FOCA 3ZLWA 2J6MA 4OR5A 3VS5A 4BDGA 3FY2A 4FTMA 4TXCA 3ZO2A 3GU5A 3F82A 3IONA 3QUDA 4IANA 2LAVA 1URWA 4M0YA 1GNGA 2IZTA 4QMLA 3RK7A 2WMRA 4Y95A 4A9RA 5CENA 5DT4A 2PE0A 4HCUA 5D41A 5E1EA 4FV4A 4S32A 3C51A 4CGAA 4EH2A 4EZ7A 5M44A 1OI9A 5AV3A 1R78A 2I7QA 4FVPA 4MH7A 4IJPA 1W83A 4K8AA 3BQCA 5C9CA 2JAMA 3NZ0A 4F0FA 3II5A 2NRYA 3OY1A 4FG9A 3VNTA 2VTMA 3FMDA 3GNIB 2VNWA 2J0KA 1Q8UA 5KMKA 1B39A 4A7CA 1RDQE 4KABA 2PPQA 4XG4A 4AGDA 5H8EA 1IRKA 3TZ8A 4QTBA 2Q0NA 1XH4A 2YITA 2W1EA 4A07A 4UXLA 4IVDA 4AT4A 3RKBA 3WILA 4ZOGA 4EK8A 3BU3A 4D1SA 4GJ2A 4IACA 2EU9A 2QODA 1J7LA 5KMJA 4K0YA 3BZ3A 3K2LA 3DBCA 4EZ5A 2J0MB 1PYXA 2ZB0A 3UE4A 2OJGA 4NCTA 4I6QA 5AWMA 5EM6A 1Y8YA 2EXMA 4AG8A 1E1XA 2WD1A 4FTKA 4D55A 3DCVA 4ZSEA 2W1HA 3BYOA 4LGHA 4MQ2A 4WRGA 4D4YA 4MX9A 1B6CB 3TNHA 4BY9E 5I9ZA 3BKBA 4Z7HA 3CJGA 5IZFA 3G90X 2IVSA 2Z7SA 5EK7A 1DM2A 4DCEA 4BI1A 5F9EA 1OGUA 2W0JA 2BKKA 4KB8A 4KIOA 2YWPA 2ETRA 2XK7A 4S30A 4YURA 3NW5A 2FVDA 3FL5A 3OXTA 3QQHA 3KRJA 4G3DA 4G6OA 2G1TA 3RALA 4I94A 2B7AA 3DXQA 3P9JA 2OFVA 3EHAA 4NW5A 3RVGA 4CMTA 4TYJA 4DCAA 3GENA 4ITHA 2XUUA 2ONLA 3R73A 4ZAUA 1L8TA 5BVFA 4QTDA 5BQ0A 1QMZA 3UZRA 4CT1A 2X1NA 3O51A 5LMKA 3ZXZA 4E4MA 2PVJA 4O0VA 1Q24A 4X6QC 2F7ZE 5KO1A 3E8CA 4PDSA 4BCHA 4PMSA 3HZTA 3R7UA 3MA3A 2C6MA 4TYHA 1H28A 2OJJA 3DKFA 2RFEA 1UA2A 4WNOA 4A9YA 3DFCB 3FKNA 4TWOA 3DBQA 4NCTC 3R01A 4MXZA 3V8WA 2R3RA 4RX8A 3VRZA 4GS6A 1Y6AA 3I79A 4I5HA 3D7TB 3AD5A 4NFMA 4TN6A 1IA8A 1W98A 3M42A 3WZJA 2WO6A 3ENMA 2R3IA 3AC8A 3NUYA 3P79A 2VTLA 4FV5A 4YC8A 4Q2AA 4O7ZA 3R71A 3R1YA 5IUIA 1YOLA 3TTIA 3PPJA 3VWAA 1G8SA 4HNFA 1GOLA 1GIJA 3GP0A 4X3FA 4ZS0A 3B2TA 5FM2A 2PUNA 4RQVA 3RTPA 3PXZA 3FJQE 1IG1A 2BDFA 4KSPA 5AP7A 5KZ0A 1R0EA 2P3GX 3GU6A 2WMSA 3HA6A 1AD5A 3LE6A 1T46A 2P0CA 1PMUA 3EL7A 3V5TA 3HMPA 4JAJA 3TNQB 4BRXA 3OWJA 4HVSA 3OY3A 1PMNA 2C6LA 4QYHA 1BKXA 3UZTA 1PRYA 1R1WA 2O64A 3I81A 4DF3A 3R2BA 1NVRA 1P5EA 1PMEA 3PG1A 4EBWA 4Q5HA 4DBXA 2I0VA 3UMWA 4V0GB 2OICA 3HRFA 2PUPA 4H3BA 2XM9A 3SQQA 4RC4A 3CJFA 3DJ5A 3QTIA 3R02A 4G2FA 4E6DA 5CEPA 1M14A 3FMNA 2RG6A 1JBPE 1DAYA 3LFNA 2WEIA 3ALOA 2OF4A 3PG3A 4J7BA 5L6WL 4O7YA 4PF4A 2NO3A 4X21A 5J9LA 3BWJA 4YO6A 1H24A 3VS7A 2UZTA 3LFEA 5HX8A 3NWWA 4C62A 2OO8X 4X3FC 3FZTA 3RGFA 1ZWSA 4D9UA 4DGNA 2JDSA 4YSJA 2YIXA 3QBNA 2F49A 5CVFA 3HV7A 4BDEA 5ANEA 5C1QB 4CFMA 1AGWA 4FTJA 5AUZA 3ACJA 4Y46A 4FKRA 3IOPA 4FYOA 3MV5A 4QT1A 2WB8A 2IWIA 3GQIA 1H1QA 4KNBA 4CKIA 3QX4A 3RK9A 3IGOA 4FT7A 4K77A 4PL5A 2E9UA 2OSCA 1REKA 1WAKA 3GEQA 5K5XA 5EYKA 3QA8A 3ZLSA 2GQRA 4QYFA 1TQIA 1QPJA 1WBVA 2W7XA 2WQBA 4BDDA 4RJ5A 3MPMA 4DEIA 3OG7A 5AAFA 5IQAA 4O0TA 4PP9A 1U54A 2ETMA 4OT5A 4E20A 1H25A 4IADA 4WG3A 5M56A 3C13A 3GUBA 3AQVA 5GNKA 3WOWA 2NPQA 5EHOA 2UW7A 4GIIA 2JD5A 4YJTA 3E63A 3H9RA 4OBPA 4CFUA 1OL2A 3DY7A 4MNEA 3SG8A 1SYKA 3FSFA 4IAZA 5M08A 4G6LA 3T8OA 3V5WA 4U7ZA 4EOLA 4G6NA 4MVFA 4EH8A 3RPYA 3CGOA 4EOOA 2J7TA 2VV9A 4ZY6A 3UNKA 3DBDA 3AMBA 3FMKA 4S2ZA 2JDOA 5JZJA 2QOHA 3TKHA 3PLSA 4CSVA 3SKCA 4O7RA 4DGGA 5BYYA 4AA5A 3F7ZA 3ORNA 4BCMA 2IZRA 4DYMA 2HENA 1BLXA 4KWPA 1FOTA 4IZ7A 4L46A 2IO6A 1P4OA 4YJRA 2PY3A 3MFTA 3BWFA 4DG2E 4RFZA 2DYLA 4Z55A 4RIYA 3EFLA 2OH0E 4FEUA 4MCVA 3ZZWA 4A4LA 4CCUA 4ZJJA 1LEZA 3BU5A 3FMEA 5HU9A 3DV3A 3C4XA 3CP9A 2OIQA 4GFOA 4NT4A 5HD7A 3R30A 5HNBA 2YIWA 5HE0A 3TV6A 4AF3A 3DFAA 5LWNA 1Y57A 3W0SA 3GOPA 3S3IA 2QO9A 3A8XA 4FZ6A 4IWPA 5JFSA 2GNHA 3R21A 3MY1A 3HMMA 4IVCA 5CU6A 3WF8A 3W0MA 3P7AA 3W8LA 4QRCA 4TYGA 4BC6A 3MH1A 4BGHA 1FMKA 4X2KA 3DJ6A 1U5RA 3DBEA 4XBUA 3R1NA 2GS7A 4IVBA 4KRDA 3QWJA 4L9IA 5FEEA 3ODYX 3FV8A 3NUNA 2WMWA 4MWIA 5FTQA 4E5AX 3LZBA 4YC3A
chains in the Genus database with same CATH superfamily
3U8WA 2H9VA 2WQOA 4E5BA 5C27A 2CCIA 2QNJA 4F08A 5C01A 3HP5A 4O0UA 4Y5QA 5CZIA 2WQEA 3LJ0A 3IECA 3ZO3A 4BBMA 4IB5A 3W0NA 2BMCA 2WQMA 4QOXA 1XMLA 3QX2A 1U4DA 2CDZA 2R3HA 3NX8A 4BTJA 1JAMA 3A7IA 5AM6A 5T3QA 2XNNA 2B9JA 5DA3A 3NCZA 1PXMA 3TEIA 2CN5A 4FEQA 4L7SA 4BGQA 3FLSA 3LLTA 3OT3A 5JT2A 5KHWA 1VEBA 3CPBA 4YJSA 5IUGA 2PMLX 3EQRA 3TT0A 3A7JA 3MFSA 4TT7A 3EJ1A 5J7HA 1ZMWA 4YU2A 1WMKA 3KXMA 4BICA 4F9AA 3ZUVA 3NR9A 4G5JA 4I6FA 3IO7A 4FV9A 4FSZA 4XP3A 4U6RA 3BGZA 4FZAB 4PTGA 1OUKA 1WBPA 2AC3A 3GC8A 4XYFA 5DI1A 2Q0BA 2I1MA 1STCE 1OZ1A 3OUKA 5ETCA 5EKOA 2R9SA 2XIXA 3IPHA 5D10A 1GIIA 2E9PA 2ZDTA 4RC3A 5HE1A 3MPTA 3I60A 2SRCA 5CXZA 1QPCA 1YXVA 2UZVA 4G9RA 4HYUA 3AGLA 4F0IA 4YUQA 2WMBA 4N57A 1KWPA 4F65A 1Q8TA 5I5ZA 3PXKA 4IZYA 5JRSA 3R2YA 4XOYA 4U80A 2V0DA 2RKUA 1GZNA 3VBTA 4AAAA 3L1SA 2PVRA 3R1SA 1YI4A 5E8YA 3WYXA 4R1VA 5D11A 3C7QA 4IQ6A 1GZKA 5JMSA 4IFGA 4YJUA 2R3LA 4JDJA 3UODA 3KF4A 3B8RA 2CMWA 1OB3A 1LPUA 2GMXA 4I0TA 1M7QA 1QCFA 3HRBA 4PP7A 1Q5KA 2BCJA 3NDMA 2C6KA 5CX9A 5AX3A 1F5QA 1K2PA 4O38A 3NCGA 3ZSGA 4CZUA 3SVVA 5C8NA 2C5NA 1M2PA 2C6DA 3ZUUA 4QPAA 2YABA 5DHJA 5HKMA 4D4VA 4DHFA 4EOMA 3PP1A 2JKOA 3WZUA 2J90A 4S33A 4C34A 4AXCA 2YERA 3GQLA 4NU1A 5HO7A 5JSMA 4W4WA 4NM0A 3V5PA 1WBSA 3NYNA 4JDKA 1W7HA 3HECA 5ITAA 3L8XA 5AP4A 2A19B 5M57A 3FEGA 4QNYA 2WIPA 3SGCA 4FUXA 2VWIA 5I9UA 2ITUA 2QU6A 3F61A 3BBWA 4FI1A 3ODZX 4V0GA 5ACBC 4DT9A 5BMMA 4E6QA 1PW2A 3F2NA 4TW9A 5J95A 4IAAA 5JKGA 2XKFA 2X7OA 3TN8A 2WTIA 1HCKA 3VQHA 5AUTA 3HX4A 3RAKA 1FVRA 3NMUF 2HW6A 3NUAA 4IE9A 5CF8A 5JFXA 1Q8WA 2YN8A 3ZM9A 4RFYA 4J8MA 5IA0A 2WMUA 4RZWA 2WIHA 1SVHA 4GYIA 4RJ7A 5TO8A 3ZFMA 4AXDA 4LYNA 2VO0A 3L9LA 3WF7A 5A4TA 2PZYA 2JDTA 2VTRA 4ENXA 4GH2A 1MRUA 3QZGA 1MQBA 2E9OA 5GINE 2VGOA 3F2AA 3OS3A 1U46A 1ZXEA 2KULA 4FL3A 4QTAA 5IF1A 5IEYA 2BAJA 3QLFA 1VZOA 2YDJA 2BR1A 3AGMA 3MIYA 4FYNA 4KBKA 4MNFA 1FVVA 4FV6A 4FKWA 3NUSA 3G51A 4WUAA 2WKMA 2QI8A 3F5PA 4ALUA 5IH4A 2V7OA 5T68A 2BROA 3F88A 4RJ3A 5LOHA 3P86A 3Q4ZA 4BCIA 3AKLA 4RPVA 2WOUA 4O7LA 5HLNA 3PPKA 4JQEA 4E4LA 1ZMUA 2PVMA 3E92A 4FKSA 4H1JA 3PSDA 4V05A 1KE8A 1OGYA 2NNWB 4MXXA 3WF9A 4BIBA 4DFLA 5DR6A 5BVKA 4EK5A 3CS9A 4ID7A 2X7FA 1UNGA 3OP5A 3UIXA 4O7WA 4IB1A 2OZOA 1Z57A 3NFGB 2FUMA 3SD0A 5CEOA 1R3CA 3K5VA 4PDYA 1Q8YA 3KRWA 2IVUA 4BDHA 4LMUA 3D0EA 3OVVA 2UW9A 4F9WA 5IPJA 4FT0A 1TFFA 5CT0A 2ZV8A 1YHWA 1OKVA 2YCQA 3BHTA 3C0IA 4IZ5A 3C5UA 4M15A 3BYUA 5FLFA 3H0YA 1JVPP 4E1ZA 3TL8A 4X2NA 3CY2A 4J95A 5DE2A 4CG9A 3KULA 4MF1A 1J91A 1UKHA 2Z8CA 4FE2A 3T3UA 4HYHA 2HYYA 3QTWA 4WD5A 4BCGA 3BLHA 3Q3BA 2ITYA 2BIYA 4YJQA 4LI5A 3NNWA 5CTPA 4XG2A 3OWPA 4GT5A 4YHFA 2HOGA 3I5NA 4TRLA 4CKJA 2WTJA 4CZTA 3GOKA 5KKRC 3A61A 4FNWA 4JJRA 2C5OA 2CNUA 2WEVA 3W2CA 5I9YA 3EN7A 1NT2A 2B54A 4I5PA 3NYXA 4RGJA 4ITIA 2W1DA 3VJNA 4EH3A 3B8QA 1Y6BA 3GVUA 2WOTA 3N9XA 3OOGA 2PVFA 3CQWA 3R0TA 2R0IA 2ITPA 3U55A 3HV6A 5A46A 4F1OA 4U3ZA 1QPDA 1Z5MA 4L01A 5ANIA 4DEHA 4FT9A 4M69B 1M52A 2B9HA 3AMAA 1PXKA 3D83A 3GCVA 4I5CA 5CSVA 4C4GA 4EJNA 3OTVA 3BL9A 4FT5A 5J9ZA 3QD2B 3U6IA 4GG5A 1P2AA 4QMSA 3QZHA 4EH5A 1OKYA 4R5SA 4U45A 3RNIA 2ZYBA 2QLUA 2YIRA 3RHKA 1ND4A 2VTIA 1OIYA 4QQCA 4UWBA 4CTCA 3DZQA 3PXYA 4ASEA 5M09A 3QZFA 1BI7A 3AC1A 1CMKE 4U43A 4J1RA 2VO6A 2XKCA 4I21A 2RGPA 2ZV7A 2XK3A 3DKCA 4HPUE 4P7EA 4I6LA 5AADA 2GQSA 2YZLA 2W1ZA 2YA9A 3KCKA 4RSSA 4BJJA 3PXQA 4MAOA 5CNNA 3V6RA 4BR3A 4FSWA 5IG1A 3MH2A 3KK9A 2BZJA 2X6EA 4MBIA 4YHJA 2GNIA 2XBJA 3E8DA 2W06A 4I22A 4FKUA 4AU8A 3C4CA 4OT6A 4F9CA 1W0XC 3ELJA 5IDPA 3GU7A 5A4EA 3EN5A 4BGGA 4QNAA 3EQBA 2I0YA 2X8EA 3DGKA 3EFWA 3N51A 3W2SA 4J99A 4EWQA 4IMYA 3TJCA 4EOJA 1F3MC 3VBYA 2OZAA 2OJIA 4WT6A 4FKQA 3TZ7A 2WTDA 1FQ1B 3BIZA 3HV5A 3REPA 1H1WA 4AXAA 4N0SA 2VX3A 4GT4A 5BVOA 4FV2A 1ATPE 2PUIA 3RPSA 4ACMA 1M17A 3B2WA 2PZPA 2WMVA 2V5QA 3Q2JA 5E7RA 2W1CA 4IWOA 2JKKA 1YWVA 4IFCA 2UZEA 3E7VA 4XG7A 5T6KA 5L2SA 1QPEA 4AP7A 3M11A 4ONAA 5DEWA 4EH4A 4WZYA 1Q3DA 3H3CA 4ANLA 3QTXA 1PF8A 3DXNA 3D14A 5E92A 3HEGA 3SOAA 4RBLA 4GIHA 4RVKA 1SVGA 4UY9A 5IA2A 3QXPA 3W0PA 4BTKA 4JVGA 4AT3A 5AP6A 4Z7GA 5HG8A 2WTWA 2EXCX 4EL9A 4EKKA 4RIXA 4L7FA 4R3PA 3CY3A 4Y72A 3N4TA 5DBXA 4FTIA 3G0EA 4AW0A 2CKQA 4IIRA 3SXRA 5LQFA 4I41A 4O6LA 3R7VA 3GT8A 4C33A 2OXDA 4QPSA 3QTZA 2BRGA 5M06A 3UIBA 1PHKA 3MTFA 4GU6A 3BGPA 2X6DA 3E3PA 2Z2WA 3QKLA 5CWZA 3VIDA 2P55A 3WI6A 4DAWA 1ZYLA 3OW3A 4AE9A 4U94A 1OIQA 2C3IB 4KIPA 5BVEA 3HV3A 3GFWA 3LM5A 5IQCA 3R1QA 3MVMA 4OGRA 1GY3A 2R3KA 3DLSA 3F3WA 4QTCA 4FKJA 4O0YA 3GI3A 4YZBA 3IOKA 3G9NA 4O0WA 5BVWA 3FI4A 3QRIA 2GHGA 4HOKA 2OK1A 5DVRA 1IEPA 3HP2A 5AX9A 4FGRA 2VWYA 4WKQA 4TYIA 5CAQA 5L8LA 3SAYA 2W1GA 3BLQA 2JKMA 3TKIA 2W5BA 2J0LA 2P33A 1OM1A 3WZKA 5LMBA 4BJJB 4D4SA 3AOXA 1KV2A 2H96A 3GU4A 3GB2A 5FRIA 2QO2A 2VTNA 4JMQA 4LRKA 4EEVA 2XF0A 3KKVA 3NAXA 2WPAA 4XX9A 4D1XA 4YO4A 5L6OA 4PL3A 4FL1A 3KU2A 4GL9A 4PRJA 5F1ZA 2PL0A 5BUIA 4ZTQA 5HNGA 4U97A 5ANKA 3ZH8A 1JWHA 3PTGA 4IVAA 4CT2A 4E4XA 4ACCA 4BCOA 4DINA 5DRBA 3TCPA 3LXLA 4BCKA 1YXTA 1JNKA 2XYUA 3N4VA 5DEYA 1YDRE 1PXNA 4R7BA 4YZNA 4P5QA 4CEGA 1PKDA 2VTQA 3LFSA 3ANQA 4FTOA 2QONA 3FHRA 5FDXA 5AV0A 3S4QA 3QL8A 2F4JA 2VN9A 4XV2A 5HVYA 1YOMA 1JPAA 3NW7A 3OXIA 3W55A 2QCSA 1KE7A 4FKLA 3SV0A 3LQ5A 2ZOQA 2BVAA 3OEZA 1EH4A 3VS3A 4ZLZA 2IVVA 3CQEA 2CHLA 5FXRA 4YPDA 4R77A 1OUYA 4HVGA 3PVWA 3FYKX 2XNOA 4I1ZA 2VTTA 4W4VA 1WBNA 1JKSA 4GT3A 5HG9A 3VS0A 5IEXA 5AUWA 3ULZA 4O96A 4LGGA 3IDCA 5EFQA 4X6RA 3VRYA 1JKKA 2BUJA 2VTOA 5I9VA 3CD8A 1L3RE 3CIKA 3E87A 4J53A 2PYWA 5ETFA 2QLQA 4L00A 3ATTA 4DTAA 5JRQA 2BHHA 4BBEA 4JLCA 3LCDA 4IM3A 3ORMA 2FA2A 4MHAA 4HVHA 1E9HA 4PDOA 1PY5A 5TKDA 4XS2A 2QG5A 3FDNA 4B9DA 3LXKA 2JIVA 4FSNA 3TM0A 5HX6A 4MBJA 2VD5A 5E90A 2PWLA 3ZC5A 4X3JA 3EH9A 3DK6A 2YM4A 2WGJA 3RCJA 5KHXA 4WA9A 3LFFA 2QC6A 2YIQA 4JR7A 2WMXA 4YC6A 4USFA 4DEAA 5K5NA 3QQUA 4Q9ZA 2J5FA 2XNPA 4FIJA 2W9FB 2Y9QA 3TKUA 2ZM1A 5CSXA 4QMMA 3OD6X 3EN6A 3NS9A 1OECA 3Q2MA 1SZMA 4LMNA 1UU3A 3U87A 5HBJA 1OKWA 1LUFA 5KZIA 4FIGA 1NVQA 4BTFA 4YJPA 5HBEA 4DTBA 4CMUA 3OXZA 4DGMA 5FUTA 3HVCA 3LCKA 4F6SA 4RC2A 4PMMA 1TQMA 1ZZ2A 4XNEA 1FVTA 5LVPA 3COKA 5IMEA 4RX5A 2UV2A 2KTYA 3O0GA 4BF2A 3ORIA 1G5SA 5AIKA 2C6EA 3THBA 2X39A 3GC7A 2C0OA 4AAYA 4WG4A 3NFFB 3R7IA 3ZS5A 5CSPA 3RAHA 1ZRZA 3UNJA 2OIBA 4RG0A 3V51A 2BKZA 3FUPA 3CR0A 3PA4A 4WOVA 4X2GA 4PV0A 4EHVA 1J7IA 4W8EA 4YTCA 2VO3A 3EZVA 4CNHA 1J1BA 3V6SA 5IISA 3BI6A 4AZEA 3O23A 4O0SA 4J98A 2GDOA 1ZYJA 3U54A 3IDBA 4EKLA 3R8LA 3FMJA 4JL9A 4R1YA 1AQ1A 3IDPA 4O27B 3CKWA 4FICA 3FMMA 3P08A 4S34A 3ENHA 4AFEA 3V8TA 2XNBA 4PUZA 3CBLA 2Y6MA 4HCVA 4DEGA 1ZYDA 4H39A 4Y73A 5AUVA 5H9BA 3W10A 2EB3A 1UU9A 3S95A 2JFLA 4NW6A 2VTAA 4CD0A 5AP2A 2HY81 3W2OA 1XH5A 2CGWA 5ANOA 4O6EA 3KVWA 2BRBA 2FSLX 3BHVA 1YXSA 3PA3A 3QCQA 2C47A 1IR3A 3F66A 3LQ3A 4Z16A 2XMYA 3D9VA 3VULA 1SVEA 3QZIA 4TWPA 4EOQA 1O6YA 4CLJA 5FDPA 3A7FA 4XV1A 2R3JA 3HMNA 1XHAA 3NUUA 4FV7A 4I5MA 5AAEA 1UV5A 5CF6A 1KV1A 3NLBA 4TWNA 4BCFA 4K33A 5C03A 4MUQA 2QO7A 4M13A 3FL4A 4QMQA 2R7BA 4UEUA 2IG7A 3QKKA 3PY3A 4XV3A 3RINA 4D5HA 3W2RA 4ZSLA 5C8KA 3QTQA 1W82A 4GVJA 3Q5IA 3FY0A 4EK4A 5IH5A 1XH9A 2G2HA 4XV9A 4Y83A 1KE5A 2JBPA 2GFSA 2ITXA 3F7WA 4C4IA 3ET7A 3E64A 3KMUA 3PJ1A 2BALA 4QDVA 4F9YA 2A0CX 5IU2A 3QD0A 4O0XA 5HO8A 4OTHA 3V04A 3F3UA 4GYGA 4GRBA 4UXQA 5K3YA 1CKPA 3TACA 2WMQA 3BCEA 3HUCA 3CSVA 2BHEA 4G9CA 4TWCA 2WQNA 4BKJA 4FSTA 2CN8A 5HLPA 2VTJA 3VUDA 4FTLA 4ARKA 3VS4A 4QP3A 3BHHA 3DKGA 2XA4A 4WNPA 4IX5A 1OIUA 3QTUA 2FH9A 1RJBA 2CSNA 4PQNA 3OEFX 3FXZA 4RT7A 3CGFA 1B38A 3FI3A 4XLVA 2HZ4A 3FLWA 4DH5A 2C0TA 4BCJA 5KKRB 4A9UA 2B4SB 2J51A 4ZP5A 2YM5A 3P5KA 3NAYA 5CXHA 3COHA 3RJCA 4BCPA 5IA1A 5IH6A 3FBVA 1T45A 3BLRA 3KK8A 1TKIA 3BL7A 5EHYA 3P1AA 4F1TA 3U51A 2VX0A 1WVXA 1ZYSA 5HVKA 2PVHA 4H36A 4LL5A 1V0BA 3DT1A 3BV3A 1YW2A 5B0XA 3OROA 5CZHA 4EH9A 4QP8A 4EOKA 5KNJA 3CLYA 3G33A 4FUYA 3EL8A 3EOCA 1BYGA 4C7TA 4KD1A 4EOSA 3KB7A 2BDWA 2RL5A 1UKIA 3UTOA 4YBKA 5EOBA 3ZO4A 2QR8A 2CKEA 2XNGA 3OMVA 5AV4A 5KCVA 4L6QA 3JY0A 4NH1A 4R6VA 4CG8A 4W8DA 3K3JA 3P4KA 2ZAZA 5CAPA 1IASA 4RIWB 3UDZA 4DTKA 1Q99A 2J50A 3L8PA 4AGUA 1UU8A 3FQHA 1HCLA 3SX9A 2G2FA 5CT7A 3ATSA 3V5QA 3LIJA 4HJOA 4L53A 2QOFA 3DTCA 5EYDA 5C4LA 2X9FA 3N4UA 2C69A 4FT3A 2GHMA 1WBOA 4O84A 2BTRA 3VVHA 4ZLOA 1OL7A 2GNLA 5ETAA 4KINA 2F57A 4ZSJA 3RWQA 5IQFA 4LV8A 4AF3A 5HU3A 4XG6A 4B8LA 3Q60A 2XRUA 4GKIA 5B2LA 1MRVA 2ERZE 4GVAA 3GCPA 3U9CA 2C5YA 3UVQA 2VRXA 3ZEWA 2C5VA 5B2MA 3MJ1A 2Z60A 3PY1A 4EH7A 4MXCA 2QKRA 5LVNA 4FTAA 3BYMA 3MIAA 4FKGA 4QTEA 2R0UA 4BDBA 1H8FA 3TYKA 3IK3A 3RNYA 1H1PA 2G2IA 3RAWA 5LVMA 5M4CA 3EQIA 5AUUA 2ITOA 1ST0A 5EI8A 4DEEA 4H58A 3O17A 4ZJVA 4JBQA 4EC8A 3ZONA 5AFVA 4M8TA 1I09A 2HZNA 2WXVA 4G5PA 3AXWA 3LFAA 3ZYAA 2PE1A 3UPXA 2BRNA 3FXWA 2UZBA 3FMHA 3CTQA 3AC3A 4JX7A 3ML1A 3I7CA 3K54A 3BEGA 2ESMA 3DAKA 4IWQA 4U81A 5A3XA 4AW5A 3HDMA 3HNGA 3LOKA 3KXXA 4FMQA 3O7LD 2VO7A 4L42A 2IW9A 1ZLTA 2O2UA 4NJ3A 2Z7QA 4PNKA 3PRIA 3DBFA 4AN3A 4BYJA 2YIYA 3EFJA 4MTAA 3LCOA 4D58A 1XH6A 2IW8A 4ASXA 5BVDA 5JN2A 3QLGA 5DGZA 3F69A 3S0OA 4BDKA 3OZ6A 3LAUA 3RAIA 4FBXA 4GMYA 4X2FA 4MXYA 5DR9A 3KREA 4OTWA 5BV3A 4CKRA 3EQCA 5L2TA 5D7AA 4EORA 4NFNA 2VGPA 1TVOA 4AW2A 4C38A 2OIDA 3O71A 3DJ7A 3MGYA 3LVPA 3OWLA 4IX4A 1JQHA 3KXZA 1ST4A 2ZMCA 2JLDA 2P4IA 4PMTA 3MB6A 5F94A 4ZY4A 5HICA 5CEMA 5CANA 5FEDA 5AJQA 1ZARA 4U5JA 1I44A 3RHXA 3AT2A 3MS9A 3R83A 2W4KA 1H01A 2BPMA 2WHBA 3O8UA 4WNKA 5EQPA 2XM8A 3MVLA 3D7TA 3G5DA 2J4ZA 3QC4A 4ZTSA 1KE6A 2EVAA 5JGBA 3LM0A 1OPLA 5FXSA 5JGDA 3HGKA 2VU3A 2HAKA 1ZY4A 3MN3A 3F6XA 2REIA 2QOQA 2CGUA 2IZUA 5EI2A 1JKLA 3NNXA 4WBOA 2QOBA 3BU6A 4L44A 1R0PA 3CEKA 4J71A 2VX1A 4EQUA 5HE3A 3OCSA 5IUHA 3IW4A 3MDYA 3R9DA 4NKSA 4R78A 4J8NA 1OVEA 1Q8ZA 1ZOGA 3OW4A 3R00A 3EYHA 4LV7A 3UG1A 2EUFB 3F5XA 3HAMA 3LKMA 3G6HA 4M97A 4BI2A 4ALWA 3VS6A 4BI0A 3VW6A 2VWZA 4JI9A 2C1BA 3RPOA 2G01A 4XP2A 3F3VA 4BVUA 2BDJA 3QRUA 4YTIA 2WMAA 3E5AA 4F6WA 4ENYA 3E8NA 2PMOX 4O7NA 2B52A 3Q53A 3Q4CA 3FC2A 4DFUA 4I0RA 2HIWA 3QQLA 3C1XA 3LFQA 4FIFA 2YZAA 2F9GA 2R4BA 5E8TA 4AX8A 3MH0A 3MTLA 5JZNA 4ZJIA 2EB2A 5M55A 2A4LA 2V7AA 4YGAA 3UOLA 5JH6A 4CQEA 3LMIA 4B8MA 4A9TA 1SMHA 4YZMA 3UC4A 1O6KA 2XYNA 4O21A 2O0UA 3UNZA 3R8MA 1YHVA 2ITVA 3VS2A 3TZMA 3QAME 3EMGA 3H9FA 3W32A 1J1CA 4ERKA 3SRVB 3L9MA 3DTWA 4DC2A 4D2SA 3DKOA 5BNJA 5FM3A 3PVGA 5E8WA 2IW6A 4J97A 3LFBA 2Y0AA 4G17A 4RZVA 2BRMA 1A9UA 3COMA 1H0WA 1SNXA 4A9SA 3KFAA 4LOOA 5AV1A 4KUJA 4BBFA 1RW8A 3CD3A 2R3OA 5BMSA 2RFNA 4EHZA 2R7IA 3ZFXA 4ZK5A 1OMWA 3TV7A 3ERKA 3PY0A 4ZTHA 3EQHA 2XIRA 4HGEA 4FG8A 3PWYA 3GC0A 4CMOA 2UUEA 3D5XA 3DLZA 4EHGA 5C26A 5D1JA 3A60A 5HCXA 4EONA 4HW7A 2ZM4A 3LFDA 4RQKA 4EQMA 2IPXA 5IA3A 4IHPA 4OTDA 4AT5A 5FXQA 5M53A 4JIKA 4WNMA 5HORA 2H6DA 4F4PA 2XZSA 4I20A 2XKEA 5TR6A 4AACA 2O5KA 4ASZA 5DPVA 3VUGA 2Q83A 3VW8A 2YM6A 4NM7A 3D2KA 3SXSA 4KKHA 3ZRLA 1YWRA 4M0ZA 3NNUA 4XRJA 4WSYA 4DGLC 5FQDC 3LMGA 3UOKA 3VUMA 3UPZA 4G1WA 2AUHA 3AG9A 4TNBA 4ZTRA 5FD2A 5FP6A 2CJMA 5TF9A 3POOA 5DOSA 5H8BA 4KBCA 5JGAA 5HLWA 4QMUA 5CEQA 2OFUA 4O83A 2VWVA 4DG3E 3NYVA 2PUUA 3W0RA 4XP0A 3VJOA 1BL6A 4RLLA 4D4RA 2UW0A 4HGLA 4FSMA 4O91A 4LRJA 5AM7A 2YCRA 3RMFA 3UGCA 4AZVA 4EH6A 2PK9A 2XJ0A 4G3CA 4L3JA 4OTIA 3OTUA 1P4FA 4RIWA 4FTUA 5AA9A 3W33A 1O9UA 3R7EA 3DNDA 4NK9A 4FK3A 3QWKA 4IAFA 5LXMA 4FIEA 4RJ6A 3NUPA 3PXRA 4F0GA 4OTRA 2YCSA 2WU6A 3W1FA 4U9AA 4NKAA 4P5ZA 3IG7A 5KBRA 4JAIA 3DOGA 5EW9A 3UOHA 4JOAA 3D15A 5EM8A 3W18A 5IQIA 4ZEGA 3S2PA 4C3FA 4IX6A 3BLAA 1PXPA 3HRCA 5A9UA 3TG1A 4M14A 3FWQA 3C4ZA 4EUUA 1V1KA 4CLIA 3EQGA 2OLCA 3W2QA 2OKRA 4RA5A 2OWBA 4D0WA 1Q41A 3JVRA 4DHZA 4A4XA 5KMOA 2XCHA 5JFWA 4D1ZA 3AKJA 4RMZA 4GK3A 1R39A 1WVYA 3DU8A 3P23A 5L2WA 2QHMA 3FZRA 3HUBA 4L67A 2PU8A 3TWJA 2VTPA 5L2IA 4NM3A 2JITA 4F7JA 5JQ5A 3UBDA 5E8UA 3SOCA 3WBLA 1PXIA 4LM5A 5GJDA 5HIBA 3PDTA 2VWUA 2ITTA 2XS0A 3EB0A 5EM5A 3AC4A 3I1AA 2CCHA 2FGIA 3CC6A 4U44A 2Y8OA 3W8QA 2H34A 5KMIA 3AC2A 4ANMA 1CKIA 3U4WA 3TIZA 4CRSA 3QF9A 4XG9A 5HGIA 3IW7A 5CS6A 4FV0A 5A14A 2DUVA 3AD4A 3ID6C 5G1XA 3QHRA 1URCA 4FK6A 4O7PA 5DNRA 4G3GA 4M67A 4FVRA 3QD4A 4FR4A 4P90A 3PIZA 3QU0A 4I24A 4MD7E 5LVLA 4K18A 3FPQA 1YVJA 2WFYA 2C5XA 5J8IA 5CAVA 2R3PA 2WAJA 4F6UA 3IW5A 3V3VA 3WE4A 2FSOX 3FZPA 2W1IA 3CTHA 3OHTA 2XH5A 3FKLA 4E7WA 1UU7A 1KOBA 2FB8A 2PZIA 3DB6A 4F70A 2OXXA 3QQKA 3QYWA 3R7YA 1V0PA 3NIZA 3I7BA 3PFYA 1H0VA 3LPBA 4BCQA 1M7NA 3UOJA 3G6GA 4K6ZA 4YJNA 4BDJA 3ZBFA 3ZDUA 4RWLA 4FTNA 4K2RA 1RQQA 2CLQA 4TKSA 4F1MA 3V5JA 2XP2A 3DB8A 4FGBA 3MJ2A 3QGWA 3SLSA 5HTCA 4RWJA 4OW8A 1LEWA 5A4QA 4ITJA 2OGVA 3PJ2A 3VHEA 4EK3A 4L52A 2XANA 4BB4A 5JQ8A 3FI8A 4Y5HA 3RPRA 4JG8A 2ITZA 3KN6A 2HCKA 3Q9WA 3BYVA 3WZDA 2YACA 4EYJA 4WHZA 4ORKA 1KSWA 4BYIA 5LWMA 5EH0A 3IS5A 4EK6A 3TNIA 2W99B 2UVXA 4OUCA 4CTBA 5HVJA 1JSUA 3C5IA 4WIHA 2RG5A 5BUJA 3HA8A 3SDJA 2G9XA 4QMPA 4GV1A 4BDFA 4FJVA 5D9HA 3DK7A 5E9EA 3AT4A 4IAYA 4WG5A 4AFJA 1ZOHA 3CTJA 2B9FA 3ORLA 4L8MA 3ZFYA 5H8GA 4KIQA 2R64A 3V01A 3QUEA 4MK0A 4NTSA 4P2KA 3JXWA 4PTEA 2NRUA 4ERWA 1OL1A 2C0IA 3PA5A 3UIUA 3SHEA 4E5WA 3PLAE 5J87A 3VBVA 1BUHA 3FLQA 3PRFA 4B99A 4II5A 3COIA 2XK8A 3I4BA 3W0OA 1WBTA 2YJRA 5DT0A 3ZDIA 4ACDA 4JQ8A 5FEQA 4B4LA 4NL0A 3EN4A 2W9ZB 3Q9ZA 3DDQA 2IVTA 2HY0A 3DK3A 3FI2A 3C4EA 3A8WA 2C3KA 3ZZEA 3A4PA 1MQ4A 4CVAA 3VF9A 5FBOA 2RIOA 1H00A 2W05A 5DR2A 3QGYA 2J9MA 4ZY5A 3QRJA 4CRLA 4C4FA 4FZ7A 4QP6A 3VONA 2JKQA 2OF2A 2Y4IC 4I6HA 4ANBA 2UZDA 3FSKA 4FKTA 4Q5EA 3MVHA 4YZDA 2OJFE 4FNXA 3UC3A 2DS1A 5BX0A 4ZS4A 3EIDA 3WYYA 2GS2A 4YTFA 5HD4A 3Q96A 1VYWA 1Y91A 4NWMA 1BL7A 2C6IA 1OL5A 4FL2A 3KMWA 4EUTA 1CDKA 3BEAA 3TDWA 4EOPA 4IJ9A 4GK2A 2IZSA 4FVQA 3U4UA 1G3NA 1NA7A 3R9HA 4LUEA 5CNOA 5HTBA 4G34A 4OTGA 3QQFA 2GHLA 4D28A 3ORKA 4GSBA 3CPCA 3KCFA 4MYGA 3R9RA 4EZ3A 3R8PA 4FSRA 4JQ7A 4JRNA 3MVJA 5ACKA 1H1SA 3ALNA 3LQ8A 4H3QA 3ZLYA 3R22A 2FYSA 3SC1A 1XMMA 2QU5A 3PJ3A 4MNEB 5KUPA 5HG7A 4AQCA 3C4WA 4KBAA 1Q4LA 4FSUA 3TUDA 5H2UA 3PP0A 3JVSA 4I4FA 4MKCA 4WBBB 4I6BA 3QQGA 3KRXA 4WRSA 1G8AA 3D94A 4FKPA 3ZUTA 4ANSA 4AN9A 4C61A 3POZA 3S00A 3PIXA 4H3PA 2CKOA 1PXOA 4L43A 3QCXA 4HGSA 4JT3A 2VNYA 4F7SA 5I9WA 1FGIA 3MFUA 2XJ1A 4QP2A 3H10A 3PSCA 5KMLA 3BV2A 3TIYA 3FQSA 4D9TA 5LCKA 2CLXA 5L8KA 3K5UA 2VZ6A 1FINA 2JIUA 4IM0A 4RIYB 3WZEA 2OBJA 4AA4A 4C3RA 4RFMA 4FTCA