5GIOE

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 63
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gioE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gioE02
3WZUA 1OKZA 2QCSA 3ITZA 2PZYA 4WNPA 5CLPA 3BYUA 4U97A 5BUJA 4HGTA 4YJQA 2XCKA 2BZGA 2NXEA 2CJMA 2GU8A 3IOKA 5CAUA 1GOLA 3P7CA 2PE0A 3KF7A 4Z55A 4TL0A 3IGOA 3QZHA 1CKPA 3HA7A 3L9PA 4R7HA 2J90A 5D7VA 5A9UA 1G8SA 4QTEA 4RVGA 3ZM4A 3TZ8A 4PMTA 3U51A 4G5JA 5CVDA 1KSWA 2VTMA 3UPXA 2CGWA 4FV8A 1XBCA 4FVRA 2JFLA 2WQMA 4JDJA 2P1DA 2ITWA 2X9EA 2VTPA 4B8LA 3FZSA 1IR3A 2CCHA 4BDBA 2UW8A 3NCGA 3KXXA 5ITAA 5KBRA 4TN6A 5HFJA 5K0CA 5L3AA 3UJAA 2PUIA 5E8UA 3I58A 1R18A 4YJSA 3JY0A 1GZ8A 3EFWA 3OBGA 2JH8A 4CKBA 3MTEA 2WEIA 4EYJA 4YTFA 3E05A 2CHLA 1BI7A 4RWLA 1FGIA 2B9IA 3PIZA 4E7WA 3OXTA 5LQFA 3QXOA 4XG9A 3D2KA 2ITNA 3R9RA 2EVAA 3ZUVA 3P7AA 3ANXA 4PYNA 3I64A 3MFUA 5DG5A 3B3FA 4FT5A 3DB8A 5EI8A 4ASZA 5LQKA 5CASA 1DL5A 1YDRE 4G6NA 2UVYA 3QRUA 3F66A 2JHCA 4KRDA 5F2NA 2ZB1A 3WARA 3U8WA 2V62A 2YISA 5E90A 2DUVA 3MY1A 2SRCA 4FIEA 4TWNA 2XCHA 3FXWA 3UBDA 1UNLA 2ERCA 5CVUA 3QD2B 1H4LA 2PYWA 1UA2A 3NWBA 4AUKA 4O7NA 5AFVA 4ZJVA 2XYQA 2YCFA 3Q9XA 5DLYA 3P2KA 3LXKA 4HH4A 1HNNA 5EHGA 2YIWA 2W0JA 1YWVA 3AGMA 3ATTA 3FTFA 4JQEA 4HYSA 4C59A 4EOPA 4OTQA 1J7UA 3EWHA 3GFWA 1JSTA 4NM3A 4YZMA 4R77A 5HZNA 4DEHA 2YM7A 2PUPA 3FHIA 4OR5A 4TYGA 3ME5A 3TNPC 2XVAA 4CWAA 1W98A 5GJFA 2VTAA 4EOOA 1UKHA 3HDMA 3KL8A 4KRCA 2I6GA 2JDOA 3QYZA 2VAGA 5ANJA 2OF2A 5HG5A 2PULA 1SZMA 2XIYA 2QOIA 3PWDA 3QTIA 2JDTA 1RI3A 4IAAA 2BTRA 3JYAA 4RGJA 5IH4A 3F2RA 1E1VA 2RG6A 4NL0A 2C3IB 5H8GA 2QE6A 3THSA 3KKZA 2PL0A 2X4ZA 3HTXA 4RX9A 4QNAA 5H02A 2B7AA 1P4FA 4PTGA 3LZBA 4J7BA 5IQAA 2IJMA 4E2XA 3BWBA 3BCEA 5KNJA 5F1ZA 3OXZA 2Z8CA 3C4FA 3QLFA 1Y6BA 3BQRA 4L00A 4QPAA 3COKA 4O83A 5IPJA 3POOA 2REIA 4QMNA 3UOHA 4DEIA 4IMYA 3OEZA 4Q2AA 2VTTA 3EQIA 4IB3A 4QP8A 3ZYAA 1XDSA 5K0BA 3SXJA 1VP9A 4D58A 5CAVA 3PZHA 5CSVA 3GI3A 2XM8A 3U6IA 5T3QA 2ZZNA 4J99A 4O22A 4O6LA 3OD6X 4BGHA 3PA5A 4CZUA 4X2NA 3CR0A 3FSKA 2R2PA 3FUPA 4WKQA 3DH0A 3G5TA 4QQCA 3NW9A 5LMAA 3KC3A 2GHLA 4A9YA 2VU3A 1YXXA 4BBMA 3EVGA 4QDKA 1QPCA 1NV9A 1OL6A 4H1MA 4LOQA 4U3YA 5EHYA 3X0DA 2OJIA 5HNIX 3SAYA 3OTVA 3PZEA 3QTQA 4NM0A 3NMUF 3U4WA 4HGEA 3NUNA 3RGFA 2P35A 3Q96A 3R21A 3KPUA 5EMLA 4E2YA 5ICEA 3A7FA 1WBNA 3CD3A 4EHVA 4P58A 3SGCA 1ND4A 4KIOA 5CAQA 3GBZA 1U4DA 5I0BA 1PXKA 3DLCA 4X0MA 1G38A 3W55A 5AMNA 4CKJA 4GOMD 4YJTA 4AXAA 1LR4A 3E93A 3BEAA 5KMOA 2ZLBA 4AW5A 1YZ3A 3I9FA 4EKIA 2IZUA 2VTSA 1SVEA 5EI2A 5E2AA 2HWPA 4AZSA 3PRFA 3UP2A 3FBVA 1R78A 3EVZA 4I92A 4JL9A 5LQRA 5FTOA 1IAHA 2BR1A 4UYNA 5AP4A 3THBA 3U9CA 4Y83A 4I4FA 3ZLSA 4G3CA 3QUPA 2RGPA 5IEYA 4BLVA 3VIDA 3DDPA 1XJ5A 3VUIA 4ALVA 5HIBA 3OCJA 2BPMA 2PY3A 4EK3A 3IKAA 3QALE 4OW8A 2QOCA 5AAEA 5LMBA 3EFLA 2W05A 4AN2A 2JLDA 1KR5A 4O27B 3ZO1A 1U59A 4N6YA 3FPQA 5DWRA 3UOLA 4F99A 1ZWSA 4RZWA 5F94A 1PXPA 3QHRA 2PV0A 3AQVA 4EMSA 4LI5A 5LVPA 4DCMA 3NNWA 2HWKA 2C7PA 3OPNA 4E6AA 2H6DA 3UNZA 3VYWA 1YOLA 4IVDA 1XCLA 3DB6A 1DI8A 5EIWA 1X1CA 2LD4A 4ZTRA 3FY0A 3O31A 1B42A 3QGYA 2EUFB 4FTLA 4FV5A 5F2KA 3BV3A 1RJGA 2CNQA 1VYWA 4XV9A 4NFMA 2FHPA 4IANA 2NO3A 4WG3A 1R8YA 4MD8E 5BXYA 3QD3A 1H08A 4YNOA 3MVHA 3G15A 4EHZA 2XK7A 3G89A 4O0TA 4XV1A 5FCDA 2F7XE 4QP2A 4A4XA 2XBMA 3CIKA 4H1JA 4O7TA 2WQOA 3EL8A 4I5MA 2W9ZB 4JR3A 4IZ5A 4YZDA 4ZTNA 3WF7A 2Q0BA 3R02A 3MFRA 4FMQA 3GCVA 1L3CA 3HVIA 2BUJA 4PGGA 5IA1A 3DXYA 1BLXA 5C27A 4A6DA 3I53A 5DPVA 4CLIA 4BCFA 3TUDA 4ACGA 2G71A 2OW3A 4M0YA 4ER0A 3DOGA 5BVWA 3IW4A 3OROA 4YJVA 1G55A 4XCXA 4EH7A 3FI2A 5EM8A 4AAAA 1VJYA 1R0EA 5LQCA 4FS8A 3PJ1A 2K4MA 1O9GA 3RK5A 4Z7HA 4EK4A 4FKUA 2O8YA 3SG9A 5DR2A 2PVNA 5BYYA 3ZFXA 2NP6A 5FHRA 1OZ1A 3ORNA 5EKOA 3OU7A 4MNEB 3DLIA 1Y8YA 2G2HA 3DZOA 3CTQA 2YCSA 4JDKA 4U40A 4MXYA 1LP4A 2RKUA 3QF9A 5AP0A 2EWAA 3EKKA 4B9DA 3WYYA 4EQUA 5I9XA 4ZTMA 3CJQA 4M12A 3CEKA 3DK7A 3AC3A 2ITVA 3AXTA 4YUVA 2OIBA 5CX9A 2WPAA 1IY9A 4X2GA 3BGQA 4QMXA 4V0GB 1JG4A 3IDPA 4YZCA 3VAPA 1OVEA 2GS2A 1AGWA 3F2AA 2P3QA 4R1VA 5EYMA 4X6RA 3AC5A 3NCZA 1CKJA 3DK6A 5AUUA 2HWOA 4X61A 4GSBA 2OSCA 5EM5A 2DYLA 2WHBA 2VTQA 3VUDA 4D0WA 1PMUA 2BR3A 2IP2A 3EFKA 4FTKA 4ZZMA 5C26A 4QPPA 3H3CA 5K05A 4K2RA 5E9QA 4PL3A 3OOMA 4ERKA 5A4LA 3AC2A 4N70A 4E26A 2QODA 4YTHA 1ORIA 5IUHA 5AIKA 4A4LA 1JBPE 5IQDA 3VN9A 3ER9A 3B5IA 4RIXA 1Q3DA 5FEDA 1I09A 3KEXA 5E91A 4BHNA 4YZ9A 2F7ZE 2VWIA 3GU8A 5HGIA 1OR8A 2Y1XA 3GGDA 1NVQA 2BFXA 2WMRA 3BLHA 3MH3A 4FICA 2BRMA 1FINA 4XG6A 1KV1A 3R28A 3UYSA 3OE4A 4FT4A 3TM4A 2ZM1A 5ANGA 1GZOA 2A1AB 2QKRA 5CM2Z 3BHHA 1JKTA 3COMA 5H9BA 2IH5A 1R1WA 3WF8A 4XBRA 1H26A 3F6XA 4FV0A 3B8RA 4OUCA 3GP0A 5DH3A 3UZPA 3VSEA 2P3OA 3VBWA 3D5WA 2Z6AA 1PYEA 4QPSA 5IH6A 3AWIA 2OLCA 2IVSA 3H0YA 4I6HA 4RSRA 2VWXA 1PMNA 3S4QA 3EGEA 4OTGA 3R8VA 1OM1A 1XKKA 3HMMA 4S31A 4GFGA 5CZIA 4RC4A 2UW3A 5HU3A 4CCUA 5E8JA 2R3HA 4PYJA 2BFYA 5AJQA 3LL7A 2XIKA 4BBFA 4Q9SA 1UV5A 3DKFA 4PYKA 2BHHA 3GC9A 3HCAA 2JKKA 3F7WA 5ERGB 3ZC5A 1M52A 4U43A 1XH5A 4YUYA 4XG4A 2KTYA 2GPHA 4CKIA 3KR0A 1KPHA 4PP7A 2C1BA 4TNBA 4D9TA 3OY3A 2IG7A 4E5BA 4XOZA 4X1OA 3SMQA 3PTGA 3FAAA 1M2PA 1ZAOA 4QMLA 5IUGA 4EQZA 2OF4A 4XLVA 2I7CA 2ZIEA 1REKA 3LCCA 5IEVA 5LSAA 2R64A 3UODA 3OWJA 4U5JA 4ZIMA 2RL5A 4RYLA 5HILA 3FYKX 1TVOA 3LM0A 1M0EA 5B1SA 2BAKA 4NJDA 4KD1A 5IQIA 4YUQA 4AGUA 4GK3A 4J52A 3TZMA 5ANIA 1PXNA 1U54B 4PDPA 2R5TA 1DUSA 2OGVA 4BBEA 4BIDA 4C34A 4D1ZA 5HVYA 5ETIA 4C7TA 3KQVA 3GRZA 4MXCA 3PG1A 4F65A 1TPYA 2B52A 3FZPA 4YLKA 5KZIA 5B2KA 3C7QA 3DNDA 4O7YA 3ZFYA 4BCMA 1ZARA 1XBAA 2QD9A 4GS6A 4I5CA 4MEDA 1E1XA 1NXKA 2R3IA 3VW8A 4ANQA 4GU6A 5IISA 4E31A 1J7IA 1RDQE 3HDNA 2B0QA 4UOEA 1KOBA 1J1BA 2W5BA 3MA3A 4U79A 3CGGA 2YACA 2PT6A 3UC4A 5EZSA 4AFEA 3SVZA 4EWHA 3G5LA 5EZQA 2OG8A 4TWPA 3SX9A 4FT9A 4KSQA 3WZDA 3DJ5A 4TW9A 4E30A 5HLPA 3NYVA 5BUIA 2BH2A 3F5XA 1H27A 4D2SA 2UW0A 4I6FA 4ZTHA 4RC2A 3U6JA 4FTQA 3R30A 4ID7A 4ENYA 5ICPA 2PK9A 4EL9A 3DK3A 4U45A 4IJ9A 1ZMWA 2IZRA 2XKEA 4FKLA 5C8MA 1JKKA 3G6HA 2WTIA 4QO9A 5E92A 1OGUA 2ETKA 5L6PA 3T3UA 3UQFA 3VO3A 5CEKA 3SXSA 1R00A 1BOOA 5C1IA 2HTEA 2ZBRA 3FZRA 2OBJA 4JX7A 3PY0A 4QQJA 5B2MA 5CF4A 3GXOA 3A7HA 1OL1A 2B55A 4L68A 4JOAA 3OZTA 3FZOA 2XKDA 2WTKC 4P7EA 4ZMEA 2J5FA 3FDNA 4BDAA 1X1DA 3H2BA 2IVVA 2GMXA 2GTNA 2WMAA 2ZOQA 4DEDA 4F7LA 1JR4A 5IA5A 3S95A 3CQWA 5AEPA 2UZDA 3ZSGA 4AWIA 2FCAA 3LAUA 2WEVA 4HCVA 5EDPA 3E8SA 5FBOA 3DTNA 4YSJA 4D1XA 4LG4A 2AOVA 3UDBA 1SNXA 5HQ0A 4G56A 5BP7A 3LKZA 3TJDA 3CSVA 5M4CA 2YIXA 3KK9A 3QRIA 4WRGA 5DEWA 2GNJA 3V6SA 4AQCA 4ENXA 1NW5A 1Q0TA 3A4PA 2CMWA 4KUJA 1H1WA 1RE8A 3IECA 4NWMA 5IA4A 4PYOA 1F0QA 4IC7A 1JAMA 3LXNA 3KKVA 4GT4A 4RJ7A 4ASDA 3UJDA 4MWZA 4IX4A 5FTWA 4RVLA 1ZMVA 4RQVA 4TKSA 3KXGA 3TUCA 1WBOA 3C4XA 4H05A 2G72A 1ZYSA 3SW7A 2QC6A 5LVOA 4IADA 3UPZA 2VN9A 4C35A 2GS9A 3BU6A 4MAOA 2VNYA 1VPTA 3LKDA 4IEBA 3OZRA 4YMJA 1J7LA 3BYMA 3AC1A 4Q5EA 4KS8A 3CXWA 3GUBA 3RCDA 3UQGA 5HOQA 4CFUA 5KS2A 3PFQA 4IVBA 1XCJA 2O0UA 1KIAA 5J95A 4JI9A 3TM0A 3FXZA 4EK8A 1K9AA 4WBBB 4GC9A 5DTMA 3BWMA 5BUEA 3E63A 3NYXA 4TYHA 5EOVA 2C7OA 3FYJX 2PZIA 2WMBA 4MBJA 4EOKA 3ROCA 3SSNA 2Y0AA 4U9AA 1H1DA 4PCAA 2R3OA 2YIRA 4FG9A 2VDVE 4IKPA 4IBMA 3TNQB 1KE8A 3R6TA 3VS0A 4AX8A 2XRWA 3RNIA 3AJDA 5E2BA 1KP9A 2YFXA 4FTUA 4L3PA 5I4NA 2YM4A 2YCRA 3VF8A 4KW7A 4E32A 4DQ0A 4RQKA 2XBJA 3TKUA 3KPYA 1LPUA 4FT3A 4XNEA 4YZBA 1OL7A 3IK3A 4NUSA 4FA2A 2WQNA 2AVDA 4FVQA 3LECA 3LFDA 3H9RA 4FZAB 4M69B 3H30A 4PIMA 2UZTA 1XQZA 2OO8X 3R00A 4QMYA 4FKTA 3CBGA 4OTWA 5HIDA 3NTVA 4C3PA 3M42A 3ROYA 4RTSA 5F2OA 3NW6A 2GH1A 2R3KA 3AGLA 3MCTA 4KIQA 4O0WA 4BI0A 3O17A 5ETCA 3HUBA 4BTJA 4CMTA 3MWUA 5CQUA 2G01A 3C3YA 4Z2YA 3A61A 1IA9A 5BPYA 4H58A 5J1VA 2IFTA 4NKSA 4L3JA 4XEYA 3OU6A 3DKCA 5A4CA 4QDJA 3MPAA 2IBTA 5JSMA 4FEVA 2XVMA 3DFCB 3JVRA 3T9IA 3R9HA 1KPIA 5C9CA 5CF6A 4AG8A 5EH0A 4QTTB 4RVFA 3KQ7A 5E9WA 3FC1X 4M68A 5JQ8A 3JWJA 1YXVA 4EKGA 4CKCA 5FQOA 2ERZE 2VTNA 2BZJA 4DGGA 3FI3A 2R7BA 5CU3A 3CQUA 2ZTHA 2VTOA 3NUPA 2YZLA 4G6OA 4DGMA 2XNNA 4PMPA 3Q87B 4GOOD 4PL4A 2I6LA 3RAWA 4USEA 2VWBA 4GVJA 4CRLA 2OICA 3QX4A 4ZMFA 3NDJA 3VC1A 3LDFA 1ZOGA 3ODYX 3R73A 5EGSA 4F63A 5FWDA 3UJ7A 4C07A 4J98A 4GQBA 4RWZA 3UGCA 3M6WA 4YTCA 3S68A 1JWHA 3I7BA 2ONZA 4XX9A 4V0QA 4B4LA 3RP9A 4IFGA 3SLSA 3A27A 2HY81 2G1TA 4FC0A 3HRBA 3KULA 4JG8A 5IDPA 5E8RA 2WXVA 1L3RE 3FYCA 3CS9A 3QWKA 2VRXA 3CKWA 5J8IA 4D0XA 4DBNA 5EKUA 5ANEA 3F5PA 2W9FB 3WZJA 4YJRA 2CCIA 2XRUA 3ZFMA 1WBPA 3I1AA 2IPXA 3LMHA 1UU9A 5AP1A 1QMZA 4QQNA 3Q60A 4ZEGA 3NIZA 5M53A 2OWBA 1YHSA 2GFSA 3D5XA 3OCGA 1VR2A 4IWPA 4JG7A 3VBXA 3ZDIA 5JFXA 4H3PA 3ENMA 2UZUE 5EYDA 5HORA 5D41A 3VRYA 2XKFA 4F84A 3IW6A 1H25A 4NK9A 3R2BA 4X2FA 3QCXA 2ZVJA 4JNWA 4CFNA 5EG5A 1BKXA 5FLFA 5BW5A 2G15A 4EI4A 2PMNX 4XV2A 5BYLA 4EH6A 2HK5A 5EOBA 5J1WA 5FA5A 4TYEA 4EQCA 2R6ZA 4M67A 3VULA 3FMLA 4EEVA 1FGKA 5FULA 2FYSA 3DR5A 3CBLA 3EB0A 1AD5A 1DAWA 2EB3A 2ETMA 2W1GA 2XYVA 2IW8A 3QX2A 2HELA 2IVTA 3AD4A 3ENHA 4HPUE 3E8CA 4K11A 3GNLA 1J3HA 3A60A 2OBFA 3NNXA 4C4IA 3E7VA 1UNGA 3Q9YA 3REOA 2E5WA 4WOVA 3U87A 5DX1A 5FGKA 4FGRA 3TV4A 5AADA 4O0YA 4AE6A 3ELYA 5DFPA 1IXKA 5E8ZA 5EM6A 4AOIA 2PU8A 5JT2A 1RI5A 4KWCA 5DM0A 3SGLA 2AC5A 4R1YA 3E62A 5AV2A 3D14A 2YIYA 3R0QA 1SMHA 2ITPA 2VGOA 4DMGA 3TT0A 4QOXA 3VBYA 2XK8A 4MQ2A 1FVRA 3A4OX 3PA3A 2C5YA 5AUWA 1AQJA 4CFXA 4RG0A 1YF3A 5EVJA 4B17A 3LFBA 4QTBA 3W32A 1OIYA 1U46A 1W7HA 1DM2A 3BX5A 3FJQE 3TV7A 2WAJA 1M2QA 4V0GA 1JQHA 2YXEA 4N0SA 3W2RA 4JG6A 1TW2A 5E1OA 1XVAA 4MXZA 1JSVA 4PL5A 2J50A 5HNGA 4FK3A 4EOIA 2R7IA 2XUUA 3Q4TA 2PKWA 3FZGA 2I62A 3D2LA 2UW7A 1P1BA 3BHYA 4EC9A 5JGBA 4JDIA 1APME 2ITTA 3QCQA 4XG7A 3I5UA 3CC8A 3LBYA 1PW2A 2DS1A 4UV0A 4PY1A 3FKNA 2R0IA 3ZCLA 5A4EA 4ACCA 2NXNA 5HIJA 4BF2A 5TT7A 5IZFA 2GPYA 3FKLA 1Q97A 4O0SA 2ZCJA 4GEKA 4BCKA 4CSVA 3NWEA 1RQQA 3MJ1A 3KGAA 3Q2JA 2BDWA 2RIOA 3DGKA 4IZYA 4L8MA 1BI8A 3QUEA 4FSUA 3KQMA 5F95A 2JBOA 3WBLA 5T67A 3O7LB 2PBFA 2I0HA 3OCSA 3LFAA 4UZDA 2C1AA 4FKSA 5BMSA 3U6HA 4D55A 5L2IA 4C33A 4G5PA 4AW2A 3S3IA 2BRGA 2CKEA 3PFHA 4BDJA 3A26A 3PXZA 2HAKA 5CEIA 4DEAA 5AX3A 4LOOA 4RIOA 3UMXA 4AZVA 5DM4A 3UE4A 1XDZA 1KE7A 1XWSA 2ZDTA 4GV1A 4M7IA 5EK7A 4XUCA 2C0TA 5GIPE 3E7PA 4F9WA 3KR1A 2OK1A 1OKVA 2UZEA 3OVVA 2H11A 2P33A 4FUYA 4A7CA 3FRIA 2XMYA 3UBTA 4X6QC 2ZB0A 1SYKA 5BQ0A 3C6KA 3EMDA 3HV6A 5E9EA 4ZK5A 9MHTA 4O2PA 3UTOA 4C3RA 3ORTA 4MF1A 3VBTA 4LWOA 3HMPA 3UG2A 4EOLA 8MHTA 4J8MA 2C5XA 3ZLXA 2Z6UA 4DFUA 3Q9WA 3AXSA 5FP6A 4AT5A 3KY2A 3SV0A 3WSTA 2PVRA 4J71A 1NVRA 2OZAB 2C6KA 5TO8A 2CL5A 4FTNA 3GO4A 1Z5MA 4L42A 5CI7A 5KHXA 2C5VA 3FPHA 3KU1A 1OUYA 2UW5A 4GH2A 3RPSA 3C3PA 5TR6A 1QZZA 3P9IA 4IAYA 2C69A 3IDCA 4IWDA 4IIRA 2JD5A 3LMGA 5HESA 2HCKA 4IX3A 5HO7A 3HMNA 3DJ6A 5G6VA 3TMAA 5AM7A 3R9DA 3ZO2A 3VS4A 5DRTA 2B3TA 3UA4A 2YDIA 2XK9A 3C4EA 4O81A 5HE0A 3TNIA 1NKVA 4BP1A 4ALWA 4RTLA 3MFTA 3LLTA 4FSWA 3HCEA 1G3NA 3TTJA 4FSNA 4M84A 4CTKA 3ET7A 1X1AA 1U5RA 5IMXA 2XA4A 3P5KA 4C2VA 3LBFA 5FM3A 4ER7A 3AXWA 3HX4A 1XH8A 3QBNA 3PVWA 2WFYA 2BVAA 5KX8A 2UYHA 3DNEA 1UWVA 4B6LA 4QQ5A 3P86A 5D7AA 1OL2A 5CSXA 3ZEPA 4QMWA 5HBEA 2AC3A 2B1PA 5HCYA 1YB2A 5A3XA 3IOPA 3ERKA 3JWHA 3EEOA 3ORZA 1QPDA 1OMWA 3EVDA 4LGHA 3GRYA 4QVGA 4E2ZA 3POZA 2PXAA 4O6EA 3QTRA 4QP3A 5CU6A 2RF9A 4F6SA 4YV1A 2RFNA 4DEGA 4F7NA 1AF7A 3QGWA 1FVTA 3NAYA 1H24A 4BCOA 2CSNA 3NDIA 2FB8A 3HYHA 3O96A 2VTJA 3LKMA 4HOKA 3I0QA 3W8QA 5IQGA 1QYRA 2KW5A 4OX9Y 1YW2A 2PE1A 4FKQA 4ER6A 2ZZMA 5D1JA 4RT7A 4FKJA 5L6WL 1QAOA 3I6UA 4ZOGA 5EHLA 1G60A 2WA1A 3P08A 4P5QA 3W8LA 3ORPA 3Q4ZA 4L7FA 1L8TA 3A7DA 5KYGA 3NUAA 4JAJA 5AUXA 3M4XA 3R71A 3ELJA 4JBQA 3II5A 3FUVA 2XK4A 3GIWA 4W4XA 2NP7A 1BX6A 2OKRA 2ZIGA 3WE4A 2UZNA 3L8PA 4F70A 3F3UA 4I21A 2X2MA 4RJ8A 4Y5QA 1N7IA 3THRA 4GFOA 3FUWA 3V8SA 4ORKA 3TOSA 2XVDA 3ZSIA 4BI2A 1U5QA 1MRVA 4GEOA 4CT1A 4RIYB 5K0GA 5HG7A 2VDWA 2GQGA 4FT0A 4L53A 1INLA 4EVIA 3MDYA 5T68A 5KKRB 3C0KA 3FUXA 1PXIA 3GENA 4JBOA 4FV4A 4S30A 2JDVA 4ONAA 4CTJA 4I5PA 2AUHA 4HRAA 2W99B 2C3JA 2XNBA 3ZRKA 5EKNA 3P8ZA 3QKMA 4IWQA 3BKXA 4TWCA 4QRCA 4YHJA 2BZKB 3MESA 4ACHA 3DQWA 2F2UA 2YN8A 2QOOA 4I1ZA 4ZTQA 3SQQA 1PXMA 4YP8A 3ZBFA 2WOUA 2YDKA 3NIEA 4YURA 1PJZA 5CALA 1U2ZA 3SX0A 3MTFA 4O7ZA 3TKHA 4LWPA 3SA0A 4NSTA 4M97A 3UIXA 3V01A 4WHZA 3B8QA 2P4IA 5M06A 5L2SA 3P97A 2VWUA 2O65A 2Y8OA 3QFVA 4BDFA 3QHWA 4KDCA 3LIJA 4QP4A 4AA4A 4AGCA 4M38A 4NECA 4YV2A 2I0VA 3RJCA 1JG1A 5CSHA 5DLSA 3DA6A 3PRIA 2A0CX 5E1SA 4EH4A 1BYGA 5EI6A 3VNTA 1JQEA 2PXCA 3PVCA 5AP6A 2IDJA 2QVSE 4IWOA 1BKYA 4LV8A 4DFNA 4OBXA 4M36A 4R8RA 2C5OA 3GU6A 4X7QA 4FZDB 2X8DA 4WUNA 4GJ3A 1GIHA 4U81A 2XJ0A 4ZSEA 3UMWA 3BELA 5KCVA 5JZJA 4RTOA 1MHTA 5CTPA 3I0OA 4S32A 5HEKA 3SOAA 3LCUA 4GKHA 3HRFA 4E4XA 3LOKA 3L9MA 2FSTX 3LCOA 2R0UA 2WK1A 3BZBA 4YUWA 4GT5A 3ZLYA 3GNIB 5LWNA 3LMIA 3MVJA 2HYYA 1W82A 2WU6A 4G17A 3VBVA 1R6AA 3IEIA 3W1FA 2QURA 4K1BA 2C68A 3Q6UA 1R0PA 4BLWA 3HP2A 4W8DA 4AA5A 2BRHA 3MA6A 4OGRA 2YDJA 3G7UA 2V7AA 3OFMA 2OB2A 3RKBA 1B6CB 4GIIA 2ITYA 1Q8YA 1REJA 3V51A 5CF8A 5HD4A 5IA3A 3KK8A 2C6MA 2V7OA 4CFVA 2C3LA 3GC8A 4RJ5A 2GNLA 4FEUA 3DU8A 2YXDA 3GOPA 2ZZKA 4HZRA 1JG3A 3N51A 2YJSA 3D2IA 4D2RA 2JAVA 1GY3A 4HVGA 5LJJA 4RVDA 5DWQA 5DR6A 1RI2A 1GIIA 3G9LX 3L9NA 3CJGA 1JSZA 1XH4A 4YBJA 3TQSA 3MS9A 5G02A 3RPRA 5HBJA 2FK8A 4F7SA 4IFCA 1BHJA 5MHTA 2FPOA 5KO1A 3FSFA 4I0SA 2OO3A 3UJ8A 5HIEA 2BDJA 1PMVA 4XV3A 3ZHPC 3EJ1A 4FTIA 4BTMA 4P4CA 4ZS4A 2PT9A 4E6CA 4PCLA 1EJ6A 4N57A 5K5NA 2ONLA 2Y1WA 5LMKA 2ZIFA 1JPAA 4X3FA 5HE1A 3R83A 2E9VA 3UO6A 1ZOEA 4FK6A 1LUFA 3E5AA 3KA0A 5CSPA 5HIIA 2JITA 2NXCA 4EZ5A 2BCJA 2IW9A 3UOKA 3IYLW 1PMEA 4DYMA 1WZNA 2GHGA 3KRLA 5CWZA 3V3VA 4DINA 2PVCA 3F4KA 5JR3A 3Q5ZA 3O7WA 5IQCA 3FI4A 3DMFA 3DT1A 4QTCA 1URCA 3P79A 4UEUA 5HLWA 3MTIA 1H00A 3QQUA 2P8JA 3K3IA 4JDHA 1IEPA 4RWKA 4WSYA 4KIGA 3E88A 3A7GA 4IAFA 1R39A 2ITOA 4O82A 4JRNA 4O7RA 4IM2A 4RSSA 5M5BA 5C03A 3NNUA 4J1RA 3RMFA 4RTQA 3LHJA 5J7HA 3KRWA 3QOWA 1SVGA 5I9ZA 3RWPA 1NBIA 3ZUTA 2CNVA 3P78A 5BVOA 5P8WA 2Y7JA 3SVVA 1JVPP 2HZNA 4TY1A 5M55A 5M44A 1YXSA 2OJGA 3PXQA 3MPMA 4UY9A 4MWIA 5M4IA 3HA3A 1IA8A 4HTFA 5DTRA 2G1PA 3FMHA 5K8VA 3OTUA 3PXFA 4FZ6A 4EK6A 3LDGA 2XJ1A 4IQ6A 1YFJA 1WBWA 3G5DA 2GS6A 1TQIA 3FLSA 3OF0A 4IAKA 4PDYA 3V8WA 5BVNA 4AACA 4EJNA 5HTCA 4PGHA 5CCXA 3WILA 1KYZA 3PY3A 1OIQA 1ZYDA 2JKQA 4KKHA 3FY2A 3GWZA 3PY1A 5BYZA 1PRYA 2UV2A 1GZNA 2XYUA 5CVHA 3ZM9A 4ZLZA 1VP3A 2HNKA 3M6XA 3QTZA 4BCJA 5JFSA 2QG5A 3KQYA 4HVSA 1JKLA 3RM7A 3JXWA 3LCKA 4J53A 3RZBA 5FBNC 2EX4A 1FMKA 3RHKA 2Z6QA 2PWYA 4BZNA 3HEGA 4GIHA 2BIYA 2PX4A 3FMJA 3RPYA 4R6WA 4WVLA 4GRBA 4DH5A 3F5GA 5CT7A 4Z3VA 2Q41A 5CSWA 3ZOSA 3O8UA 3DXNA 2X2LA 3HP5A 3TWJA 4JT3A 3G88A 3UWPA 4MNEA 5EW8A 5EMJA 3FQHA 3FYDA 5EHOA 3ATSA 2IN6A 2WU7A 3OC1A 1IAJA 1YOMA 4XRLA 5FRIA 2QKWB 5GNKA 3DQXA 3DBFA 3SXFA 3VVHA 4DFYA 3EQDA 4GFMA 3QTUA 3CLYA 3HLLA 4HVIA 5HICA 3AMYA 4DC2A 5AA9A 2FUMA 3V5JA 2PY6A 5BVKA 3KU2A 5BVDA 4DG2E 5DVRA 3LFFA 5EOLA 5HEZA 2N47A 3M6VA 4H3QA 4XP3A 3HCFA 4Q5HA 4AA0A 2WQBA 2YERA 1PHKA 3MAGA 5EMKA 1Z57A 3QRJA 5I9YA 3QQGA 4J95A 1YKRA 1F38A 2OZVA 4GC5A 5CAOA 3VHEA 4X3FB 4M13A 1OBGA 4FZVA 4RA5A 2W1HA 1Q5KA 1ERKA 3B89A 1CMKE 1V0BA 1KE9A 2BALA 4AF3A 4IV8A 4FL1A 4MXAA 4BZDA 4IAZA 2X8IA 2ITXA 4J8NA 5HE2A 1SQGA 2EXMA 2WIPA 3V8TA 5HU9A 4WXHA 4BDCA 5DSTA 1D2GA 4PDOA 3GCZA 3ACKA 5DR9A 4ZSJA 3CY3A 5BX0A 3P9CA 5GIOE 1Z3CA 3SSOA 1Y6AA 4ZJJA 3GQLA 4IAIA 1WCCA 3DLZA 4QTDA 4DT9A 3R8ZA 3GU3A 4PINA 2W4OA 1PXJA 3D83A 4RZVA 1XDUA 3FXXA 4YC6A 5IF1A 3BQCA 4OA8A 4MTAA 4F85A 2PUNA 3EL7A 3PJ2A 3E3PA 4C4EA 3ALOA 4QNYA 4B0GA 3NS9A 2A27A 2EJTA 1VE3A 3NUXA 3OWKA 3S1HA 2AOTB 4XRJA 4BTKA 4YO4A 3BHTA 3FMMA 1H1RA 4FX3A 1GJOA 4MD9E 4TNDA 4A9RA 4C2WA 5I9WA 4BVUA 5IQEA 2ETRA 3FTDA 3SM3A 3V8VA 1M17A 2WMQA 3DP7A 5IMEA 5M4UA 3MERA 5C4LA 3HECA 3E3BX 4FSZA 1JTFA 4UYAA 2OZAA 3N4VA 2NYUA 4CXAA 4DE4A 2ZV9A 1TW3A 3QXPA 1YI3A 4AZWA 5JRQA 3UYTA 1Q0SA 4U44A 5D1NA 1NW3A 5IKMA 4AN9A 3FPJA 4ARKA 2C0OA 3L8SA 4V04A 5FQDC 3L8XA 4B99A 4BDEA 4DGNA 3C13A 2QU5A 2PX2A 1Y8GA 4I20A 3VHKA 3UZTA 3O7LD 3H10A 3GOKA 4L6QA 1UKIA 3LFNA 4PTEA 4R7BA 2EG5A 5CY3A 1JQDA 4HCUA 4MD7E 2QY6A 1OPLA 2BKKA 2QOQA 4OTIA 5M08A 4FSXA 4ZTBA 4C03A 2O06A 2XNMA 4ALUA 2I9KA 3DS6A 4RLKA 2Y6MA 2W1DA 3G51A 4YSMA 1STCE 4UBAA 3UFBA 3BKBA 4OA5A 5LQNA 4MHTA 3OZ6A 2XEYA 4PP9A 4UZHA 3UQCA 4RLLA 4AOJA 4BR3A 1RJDA 3CPBA 2C6DA 3I60A 3TTIA 3ZSHA 4AZEA 3GJYA 5CENA 5I5ZA 4Z9LA 3DJ7A 4RJ3A 4YJNA 4BKJA 2FRXA 4HW7A 2IWIA 3A7EA 2UZWE 3QOXA 5I9VA 2QLUA 4A9SA 4ANLA 2WTWA 2C7RA 3A7IA 3U54A 1BL6A 3ALNA 3N4UA 3OUNB 3C5IA 3R0TA 4D5HA 3E23A 4M7RA 5AWMA 3UNJA 5DX0A 4KKGA 2X9FA 1P91A 2ZAZA 3BLRA 1I9GA 2HXQA 2OFVA 4QPNA 2V7EA 3PVUA 5CF5A 2PVJA 3VS2A 3DPKA 3ORIA 4X63A 4ZZNA 5KZ0A 2HMYB 4XUFA 4BCQA 5JFWA 2G9XA 3BBTB 3KVXA 3OEFX 4KNBA 3E64A 4OTRA 3SKCA 4FNWA 4CLJA 1EQAA 4L9IA 4QMOA 1SVUA 5B0XA 4Y72A 4ZJIA 4ZY4A 4DBXA 3HCBA 1XHAA 5DXJA 5KVAA 1ZXEA 5JZNA 3HNGA 5KBQA 4ZLOA 3RWQA 4G3GA 4FG7A 5CIYA 4LM5A 3A7JA 4MK0A 3RIEA 2VX3A 3OOGA 1H1PA 7MHTA 3GU7A 3HA6A 4I94A 4O91A 4R05A 5K0FA 1MQ4A 4MXOA 2YEXA 2AOTA 3WI6A 3COHA 4L7SA 3F9NA 4LRMA 3TXOA 4HVDA 2C5NA 2QR8A 3ORKA 3ULZA 2CGVA 3D7ZA 1CDKA 5D1HA 2CKDA 1KHHA 3ORMA 3KCKA 3NW7A 3C5UA 2BRNA 4PWNA 5EQYA 4HYIA 3BHVA 3GXLA 4EH8A 1SQFA 4C4AA 4BDDA 4GJ2A 4GVAA 3HA5A 4GF5A 3KRJA 2IZSA 5EFQA 1WMKA 3KQTA 5DT3A 4BGQA 4BN1A 5FQNA 3R8PA 3EVBA 4HNFA 2RFEA 3GT8A 4RIWB 2X6EA 4I3ZA 4AN3A 4MXXA 2B9FA 3V5PA 4DCGA 3D0EA 4IB0A 4O86A 3LVPA 2OJJA 5BMMA 5LQUA 1B38A 1I44A 3MSSA 1OPKA 4M37A 2FA2A 3NEWA 4P7GA 1YI6A 1YHWA 5KMLA 3BYVA 2I0YA 3BU5A 4ZXTA 1NW6A 2PGXA 3ZLWA 3Q52A 5L8KA 2XK3A 2QOKA 3R9XB 3ZC6A 3MVMA 5IQFA 5JUWA 3E8NA 1UU8A 3NLBA 3NRMA 2ZMCA 2CNUA 3D15A 4O7SA 4EBVA 4IV0A 3KXHA 2P41A 4G34A 4L01A 3MPTA 5ANOA 3OG7A 3WIKA 2A19B 2A4LA 4YUZA 4U0IA 3U55A 4A6EA 5A14A 2BTSA 2WTCA 4U42A 2CGXA 4GUBA 2RG5A 2UYCA 3PJ3A 3KR9A 4HCTA 4GYGA 4DFZE 3HMOA 3T3VA 1OL5A 4QP7A 4C08A 1FVVA 4OT5A 2VO0A 5AAGA 2PWPA 4O38A 1PY5A 2WO6A 3FC2A 4I41A 3BYSA 3TR6A 5E7RA 2ZJWA 4KAOA 5A46A 2F49A 1XTPA 3PX3A 3DY7A 1P39A 2UUEA 3W2PA 3ZU7A 2P40A 4YPSA 2ZWVA 3OZSA 2GLUA 1S9JA 2PZRA 3G0FA 4FIHA 4LRKA 4ITHA 3RAHA 4F4PA 2QQ7A 4PV0A 3JWIA 2CPKE 1ZRZA 3H4JA 3KN5A 3DBDA 5DHJA 3IO7A 4AW1A 5K03A 5CEPA 3VJNA 2VZ6A 3PLSA 4FIGA 2QNJA 4LV5A 4Y73A 2B25A 2YABA 2PVLA 3BV2A 3BHUA 2ZM3A 4APPA 4P7FA 2YXLA 4ZSGA 3O0GA 4W4WA 2AOXA 3HAVA 3C4CA 4LMUA 4FTRA 3JY9A 3DMHA 3TM5A 1XJDA 2VTRA 4ZAUA 3D94A 3QRKA 5E8VA 3KRXA 3EQFA 5KMNA 3FZTA 3QQJA 4XLIA 2UYQA 2OY0A 1P14A 3PSBA 4HPTE 4I22A 5DN3A 5FDPA 1ZG3A 4FR0A 3T9TA 2QI8A 3KVWA 5M07A 5FM2A 3CP9A 5JN2A 4NJ3A 2AR0A 3OCTA 4L7VA 3R7OA 3RAIA 4E6QA 1T46A 3HGKA 3HKOA 4RPVA 3RW9A 3AT3A 4PMSA 4WO5A 3D7TA 4JBVA 4JR7A 5HZMA 2JG3A 4DN5A 4KBKA 5EEGA 4FL2A 2NRUA 4FEXA 4RTPA 3PDTA 2W17A 3DMGA 3HVCA 5IDNA 4UWYA 3C4ZA 2H34A 3P23A 4O21A 3O50A 4FODA 4WNKA 3FMEA 5DT4A 4FL3A 3UJGA 1EH4A 4DH7A 3PUPA 1QCFA 2W4JA 2Y9QA 4A4OA 4BYIA 3CCFA 1KE5A 3CGFA 3KMUA 2PVKA 2YM6A 2QLQA 5A4QA 3OT8A 4J96A 3R6XA 2W1ZA 3Q4UA 4R6VA 5CEQA 4ASXA 4F1OA 2X1NA 1V39A 3NJRA 3RODA 3R04A 1PXOA 3A62A 1F3LA 4KIFA 4NM5A 1UU3A 1L9KA 3RHXA 3UP7A 4CFFA 4F7JA 4AZFA 4V01A 1W84A 1JG2A 4RJ6A 4DFBA 2UVZA 3FTCA 1AQ1A 2R3QA 4FNZA 5AP7A 2PUUA 3BXOA 3FLWA 4LL0A 3T7SA 3OT3A 3PG3A 4RMZA 2DULA 3KPWA 5M4FA 4DT8A 5AIRA 4QVKA 4JQ7A 4E5WA 1NVSA 1FOTA 4NFNA 3K3JA 3TDWA 4JLCA 2CLQA 2AS0A 1JSUA 4PUZA 4QMMA 3TN8A 3NSZA 2JEDA 5ICFA 5CS6A 5HVJA 3G2QA 4G9CA 3UOJA 1Q61A 3HNRA 3GEQA 1F5QA 2Y6OA 3A8WA 5HIMA 3PXYA 2R3NA 3MB6A 5D10A 3QQHA 2VWVA 2WZJA 2AOWA 2B2CA 2IGTA 1E9HA 3KHKA 4YJPA 1T45A 1CM8A 4QQKA 4G3EA 1HOWA 3C51A 4QMPA 3MYGA 3NGAA 2XIXA 4QYFA 4E5AX 2YX1A 2PHKA 5FADA 4ANSA 5EYCA 3BE9A 2X81A 4AW0A 4QP6A 1XR1A 2IO6A 2XB7A 4O84A 2A2AA 2IDKA 2XNOA 4Y8DA 3F5UA 5TKDA 1NW7A 4GT3A 5EQJB 1Q8WA 3NR9A 3ANRA 2WTDA 5KE0A 3ZMMA 2XNEA 4EONA 5JGDA 1NV8A 1IRKA 3FQEA 3R63A 4RJ4A 4WIHA 3SXRA 3L8VA 4C37A 3EHAA 3GQIA 3OWLA 3G33A 3MH0A 4FNYA 4OTDA 1CKIA 1UWJA 2ZV2A 3V5TA 3MN3A 2YAAA 4FUXA 4USDA 4DCAA 3RINA 4AT4A 2QOFA 2J0KA 2VTIA 1RI1A 4U3ZA 4Y85A 2W96B 3KMWA 3EZVA 4G2FA 4IDTA 3DDQA 3HAMA 4F08A 5CU0A 2WQEA 4NT4A 3B7PA 2Z60A 4HYUA 3OY1A 5E1MA 4CKEA 3GC7A 3QD4A 3KFAA 5AV3A 3CKKA 3KN6A 2JIIA 4KABA 2YR0A 3VQHA 4DTAA 4FP9A 4DGLC 2QYOA 4N4SA 1WBVA 2WMVA 3A99A 1G8AA 5DNRA 5L6OA 3NVKI 1KYWA 2R3GA 3R2YA 1OITA 3FPGA 1EAMA 5TF9A 1L3BA 1UWHA 2R9SA 4GKIA 3G2OA 2J9MA 2FSOX 4E4MA 4EORA 4W4YA 4PIPA 1P4OA 4X2KA 4RRVA 3LX6A 3SD0A 1WS6A 2W06A 1JNKA 4FOBA 3L8DA 5HCXA 3NUUA 1RW8A 4Q9ZA 4V05A 1PYXA 1RJFA 4MIKA 3C9WA 3LCDA 4KA3A 3RTPA 1QL6A 5E8SA 1GIJA 2UW6A 4YV0A 5H8EA 2YM3A 3COIA 5GHVA 2W1IA 2XF0A 3FEGA 3HV7A 4I5HA 1ZYJA 2A14A 3NYNA 5LR6A 2I0EA 5AUYA 5K01A 4GUAA 3REPA 4HJOA 5HIKA 2CN8A 4ERWA 3MGYA 3Q53A 4R3CA 4CV8A 3BGPA 4FSMA 3SRVA 1J91A 4BHZA 4C62A 2Z7RA 1ATPE 3LCSA 2OB1A 4TZRA 1UIRA 4E4NA 4EHEA 4ER5A 3FLQA 3C0IA 4QTAA 4YHTA 2WKMA 3TNWA 3PSDA 2YQZA 2P3GX 4RTJA 2J0IA 3RVGA 3KCFA 4PX6A 3ZDUA 3E87A 2OXDA 3R1YA 4H36A 1O9UA 4FSTA 3T7RA 4GUEA 4DGOA 4R78A 4R6XA 2X7FA 2FVDA 3AG9A 3OWPA 4OQDA 5CXHA 4KVZA 2VZ9A 4FI1A 4OQEA 4PNIA 4RVHA 2QO9A 4KRGA 1WFCA 4EUUA 3OFJA 4FKRA 1O6KA 2PSQA 5AP2A 2OFUA 2HXLA 5ACBC 4APCA 3A4TA 4RA4A 4USFA 4O7VA 2XKCA 5B7VA 4GCJA 2P7HA 3D4QA 4FTCA 3LFSA 3Q9ZA 4JIKA 5T6KA 3FPMA 4DA4A 2VNWA 4EOSA 3WF5A 4DKJA 4U7ZA 3QAME 1ZGJA 5LMKC 4F0FA 2H96A 4JVGA 3HRCA 2IIPA 4F09A 1H1QA 3MB7A 4E70A 2WMXA 5C8NA 1NY3A 1ZOHA 4L44A 4O0XA 2AN5A 3MH2A 2XH5A 4CG8A 5ETAA 4EOQA 3BKWA 3NDMA 2QG7A 4I0RA 1DI9A 4CXMA 3DFAA 4D9UA 3MW1A 4C38A 2HOGA 1L1EA 1R8XA 3TLJA 3IGGA 2G8NA 4HGZA 3BIZA 5L2WA 5AX9A 5J9YA 1KPGA 2WMTA 3R8LA 1NW1A 2I40A 5LWMA 4PYLA 2B53A 2C6OA 3MJ2A 4RIXB 3G8BA 2UZ4A 1T43A 4R8SA 1OECA 3RCJA 4W4VA 4BICA 2H00A 4H0NA 4QYEA 5DI1A 2PVHA 2JKOA 4WA9A 2CKPA 3FE3A 5IQBA 3W2QA 4X41A 1ZZLA 3R1NA 4X60A 3DKGA 3AC8A 4HZSA 4NZWB 3ZXZA 2ITZA 4TYIA 4X3JA 5K09A 4NU1A 3DAEA 2V0DA 3TNHA 4PNKA 5LQAA 3VC4A 2YITA 2PSSA 5HCZA 4AUAA 2HR1A 2FO0A 4UXQA 4PMMA 3LM5A 4KBCA 5KHWA 3WE8A 4OLIA 3GRRA 4L52A 1OKWA 4W8EA 3VWAA 4IZ7A 5I9UA 2R3JA 2XIZA 3JR1A 2UW9A 3P4KA 4Y2HA 4K9YA 1KV2A 2LGCA 3PP0A 4IM0A 4LUEA 4FEWA 4I6QA 3EMGA 2B9EA 4CVAA 2CGUA 3FUTA 4YPDA 4EH3A 3FPEA 4D28A 3BZ3A 3QD0A 5F9EA 3NUSA 5AUZA 3BBWA 2NXJA 3QKKA 4ZLYA 2PLWA 3CD8A 5EQEA 2BAJA 5HI2A 2ZMDA 3ZONA 3TG1A 3L1SA 4TRLA 2Z2WA 2JAMA 4O96A 5K3YA 4DFLA 4MBIA 2HW7A 4HGLA 3HEMA 4FYOA 5ICCA 2Z7LA 3EH9A 4FKGA 4IWNA 3E7OA 3F82A 3O71A 4FV1A 5HNBA 2AN4A 2NRYA 1FJXA 4BCHA 1WAKA 1A06A 2ITQA 4BIBA 1H0WA 2BZHB 3Q4CA 3FUUA 4U8ZA 1WXWA 4C04A 5HBHA 4B8MA 5EHIA 2O5KA 4O0RA 3UG1A 3Q32A 4FTJA 1ZKDA 5AV0A 5T64A 4OT6A 5FTGA 3FTEA 4FEQA 2AZTA 1LEWA 1TQMA 5HG9A 3GB2A 2YCQA 4FV7A 2YIQA 4D5KA 4IZAA 3MVLA 4BTFA 1OBDA 2PMIA 2HV9A 4MQ1A 2JFMA 1YFLA 5CVFA 5GP1A 5K0NA 4EYMA 4DH3A 4V0RA 4BDGA 4M0ZA 5LCKA 5BNJA 4LFIA 3K2LA 2XS0A 3DUWA 4QMTA 2R3LA 5FXQA 2YHVA 4GOLD 4RV9A 3EPPA 4U6RA 3WOWA 1RI4A 3LQ3A 5ETFA 4YLLA 1A48A 2P2IA 1RJEA 3D5VA 5DT0A 4O7WA 2AN3A 3JWGA 3G9NA 2QM3A 3MQ2A 1UU7A 4G3FA 4PYIA 4L3LA 3VRZA 3WZEA 4BCNA 2J6MA 2P55A 1M6EX 3EYHA 4N6ZA 5FDXA 4RVTA 5J87A 4X2JA 5AAFA 3ZRLA 1FP2A 4LUDA 4WT6A 3RPVA 1NE2A 5CVVA 4FNXA 1I1NA 5AM6A 4IH8A 4G31A 4DITA 2X7GA 2OH4A 4C4JA 1SUSA 1B39A 3QC4A 3OFKA 3SDJA 4A06A 3TZ9A 2GNHA 1DCTA 3F7ZA 2YM8A 2JBPA 3CE3A 3EN5A 3QTWA 1U54A 2PVFA 4MX9A 4R5SA 5HO8A 2J0LA 3OHTA 1Y57A 4FKOA 4ANMA 4DH8A 3ORLA 5HLNA 1WBSA 5CXZA 2VGPA 4JIAA 1OPJA 3OE5A 1H07A 1Z9XA 3R1QA 2XIRA 4FGBA 4S34A 3UVQA 1NA7A 1YQJA 2BRBA 3ID6C 4GU9A 4IHPA 4P5ZA 2C6LA 4ACDA 4E6DA 2B9JA 2Y4IB 4IJPA 3HMIA 3KF4A 3GDHA 2GQRA 5DTQA 3HL7A 4IVAA 3M6UA 4XMOA 4I93A 2PX8A 3V04A 3CC6A 4FTMA 2O07A 2ZWAA 2BAQA 4R7IA 4YO6A 1D2CA 3EVFA 1KWPA 3DAKA 4KDRA 5J9LA 3ODZX 5KUPA 2R3FA 5B2LA 5K5XA 4AU8A 3CJTA 2ZVAA 3GRUA 3TKYA 5CQWA 3R9NA 3VQUA 2BKZA 2OZOA 3OS3A 4KBAA 4EC8A 3NW5A 1R3CA 2C30A 2E9NA 5EG3A 1Q8TA 2XYNA 4RFMA 1GAGA 4IC8A 5DEYA 2OPBA 2OU7A 2R4BA 4CNHA 3Q5IA 3UO5A 2HZIA 2P2HA 2QOBA 3CCNA 4BIEA 4F1TA 3ER8A 1SG9A 4CRSA 4JXJA 4G6LA 2HENA 2X39A 3DV3A 3EOCA 1XO2B 4LL5A 4EUTA 2VS1A 1WVXA 3EQBA 2OXTA 4KS7A 4AOTA 4AGDA 3KQQA 3NNVA 4RVKA 3RK9A 5C8KA 5KMJA 2CDZA 5AA8A 2GSFA 4L43A 2VDUE 2V5QA 2GAFA 5BVEA 5CVJA 2Z02A 4D4VA 2ZULA 1JKSA 4EK9A 1RJBA 5GJGA 2Z7SA 3TL8A 3BLQA 4RX5A 3UA3A 3PTAA 3Q04A 3Q7EA 2X0GA 5KKRC 2XNGA 2EJUA 4HSGA 1Y91A 5L8LA 3FKOA 3MIAA 4TYHB 4RWJA 2GB4A 2Z7QA 3QQFA 3SW4A 3VUHA 1FPQA 1QAQA 4CV9A 1ZGAA 4XUEA 3HVHA 4G1WA 4OTFA 5CNNA 5EQPA 3ZZEA 5CNOA 1M6YA 3R7EA 1XXLA 4IM3A 3WZKA 4DTKA 5CEMA 4K6ZA 3AOXA 3ZZWA 1QANA 2VUWA 5JRSA 2VTHA 3BI6A 4NW5A 3CJRA 3KPVA 2H9VA 3ORHA 5DPMA 2PXXA 2C3KA 4EKLA 3W16A 2J51A 4DHFA 3AY0A 5CUQA 2F4JA 3HUCA 2IZTA 3Q6WA 3U9NA 3HA8A 3EZRA 5C4KA 2O2UA 4FV9A 4Y5HA 5F20A 4IX6A 4MCVA 3VS5A 4MQ4A 3WYXA 3DXZA 2E9PA 1FPUA 2GHMA 5IEXA 4FIFA 3PIYA 2DPMA 4A9UA 4F9CA 1OIRA 1ZYCA 2PE2A 3EQHA 4EH2A 4BY9E 5HX6A 1SVHA 2WMWA 3PX2A 1A9UA 2J0MB 5JEBA 1CTPE 2ZM4A 5HX8A 2X4FA 4C4GA 3RM6A 2GFCA 4C4FA 4EHGA 3DTWA 3ZH8A 1NT2A 3BGIA 3BGDA 3P7BA 3QUDA 4YGAA 1YHVA 1YVJA 2PMLX 3PVBA 4MH7A 1QAMA 3FI8A 3NZ0A 3UIMA 5DYJA 3AMBA 1CSNA 1FBNA 2E9UA 1V0OA 2Q83A 3EN6A 4FTOA 4YNEA 1FMOE 2JGZA 3H9OA 2WA2A 4EZ3A 4O29A 4XUDA 1Q8UA 1AV6A 1XBBA 1X8BA 3PE1A 3P0MA 3QRTA 1SM2A 3IHTA 1Q24A 3LFEA 3UNKA 3S00A 4XCUA 3T8OA 1Q99A 4X3FC 4Y46A 3ELUA 5IH3A 2ONLC 1VYZA 2AOUA 3BRBA 4OBWA 1JSXA 3QQLA 4NKAA 1SKMA 3MHTA 5E8TA 3ZO4A 4O0VA 3AMAA 2V22A 4YU2A 4FKWA 4Z16A 5FXRA 4IACA 5DT2A 2QOLA 3Q2MA 2O0LA 3BEGA 1EG2A 2ZFUA 5DRBA 2O3PA 4QMVA 2RFSA 1ORHA 3MH1A 3G2MA 5K4JA 1M7QA 3LJ0A 4CFMA 4FV6A 1K2PA 4C58A 3PVGA 4UALA 2YVLA 4BB4A 4GYIA 4LGGA 3KQSA 5DIAA 3TDVA 1S9IA 4MBLA 3AT2A 3C0GA 4GK2A 3MCZA 2QU6A 2VD5A 4NYEA 5F4NA 2BM9A 4EBWA 2XM9A 2KULA 4BZOA 4PTCA 1W0XC 4K33A 3E92A 5KQSA 5M57A 4PWYA 3OMVA 4YLJA 4O0UA 3RALA 2YUIA 3HVJA 1OKYA 3TEIA 3IDBA 1W8CA 3MGGA 4M15A 3QLGA 3BPRA 5CCBA 3BWJA 3FMNA 4MWHA 4KKEA 4XJ0A 2GNFA 1URWA 3RI1A 4DF3A 1N7JA 5J5SA 5CVGA 3EGVA 4BLUA 1MP8A 3B2WA 1QPEA 2NP8A 1MJFA 2ORED 4DA5A 2ZV7A 4EK5A 5AV1A 2F2CB 2B54A 3ULIA 3JUHA 4F0GA 3MTLA 3EKNA 4BC6A 4D4SA 2PTKA 3GGFA 2XBAA 4E8AA 3G0EA 1H28A 4LECA 3DBEA 3S2PA 4YMGA 2R3PA 4FTTA 4QYGA 2QO2A 5DRDA 3W18A 4RIWA 1SUIA 4F86A 1YWNA 4WG4A 4XP2A 3BWFA 2P0CA 4CG9A 2JIUA 3DBCA 3QA8A 4ANBA 1NW8A 1P1CA 5LARA 3M33A 3TKAA 5LVMA 3SRVB 1WVWA 1V0PA 2QHNA 3GCPA 2CLXA 2GNGA 3KULB 3OXIA 4QMUA 3W33A 1HMYA 5H2UA 3IV6A 4YBKA 1VLMA 3G2FA 5DXAA 3DKOA 3FLYA 4FV2A 3HCCA 5FD2A 4B7TA 3E8EA 3PYYA 3F3TA 4XG3A 4XOYA 5EKXA 2JHPA 1BL7A 2XP2A 2QRVA 4GOND 4E2WA 3GFEA 4CTBA 3I5NA 4CKRA 2I7QA 5E8YA 3LDUA 1IASA 4IB1A 5FXSA 3PXKA 4QYYA 3VUKA 4K77A 3P71T 2OI4X 3TJCA 3BWCA 3LLAA 4FR4A 2CN5A 3MY5A 3M70A 3RAKA 1JQ3A 1WVYA 4LMNA 1OB3A 3KXZA 3ZBXA 4ZSLA 2UW4A 4C02A 2E9OA 4UXLA 4FZ7A 5IUIA 3EEYA 2YTZA 2QONA 3KRRA 3QA0A 5L8JA 2JC6A 3ETAA 5DBXA 3ZRMA 4ASEA 5GINE 3U4UA 4TT7A 4JQ8A 1H01A 3D7TB 2IBSA 3ELWA 2ESMA 5JMSA 4RIYA 3A2CA 3O8PA 3N4TA 4OBOA 1Y8CA 3PPKA 4X21A 3DXQA 3HV5A 2ERKA 2CMHA 2VO7A 2YWPA 3C0HA 3FHRA 4I24A 3IPHA 3UJCA 2UVXA 3FLNC 3JPVA 2JKMA 2Q0NA 3I5ZA 4F9BA 4LG1A 4MNFA 3K54A 5AUVA 5K4IA 1KUTA 2WMSA 1ZLTA 2C6IA 3CTJA 1M14A 4YHFA 4CMUA 1WY7A 3KQPA 1IG1A 1K3AA 2C47A 2G2FA 3EQGA 3H0ZA 3LFQA 3PSCA 3QYWA 4EH5A 3CKXA 5IQHA 1VBFA 3SR4A 3PPJA 5KQRA 4XG8A 3UVRA 3F3VA 4E73A 2VV9A 4MKCA 4D1SA 3DXXA 5G1XA 4EJ7A 4QTUB 3O8TA 3KREA 4UWBA 3ZS5A 2WELA 2ONYA 5LCJA 2LAVA 4FZFB 3GCUA 3W10A 3RPOA 2G2IA 4LOPA 2UZOA 4ZY5A 3UZRA 2R3MA 1XH6A 4OTHA 2IVUA 3K5VA 2J4ZA 2YA9A 3O23A 2BHEA 4BDKA 2BR4A 3QTXA 1FQ1B 3F3WA 4M3QA 5ACKA 1R74A 4HYHA 5ICGA 3KXMA 4CZTA 4WNMA 3NPCA 4XYFA 3TRKA 2X2KA 4E20A 1I4WA 2GS7A 1ZY5A 2W5AA 3QTSA 4KWPA 1D2HA 3LCVB 2VO6A 5HVKA 5K0EA 2WIHA 2PJDA 2VO3A 4CTCA 4DG0E 4YTIA 4E93A 3VJOA 3AD6A 3F69A 3LPBA 5ANDA 5C9ZA 2OYRA 2VWYA 4MYGA 4E1ZA 3BWYA 3DCVA 3EN9A 4LYNA 1JLUE 4XBUA 2PX5A 3LHDA 4P7KA 4EOJA 5T6BA 2W1EA 3KQOA 1H8FA 1YDTE 5CYIA 3TIYA 3HM2A 2PVMA 5C0OE 5U4XA 4DTBA 4BDHA 3C50A 3QC9A 4CT2A 5GM1A 3QKLA 2QRVB 3A8XA 2VTLA 4HG2A 5EEHA 2WB8A 5LOHA 4AZTA 2CKOA 2BILB 3TIZA 3TI1A 2FYTA 3SC1A 1YDSE 5CT0A 2WGJA 1JTEA 3VC2A 5GWXA 4K8AA 5DX8A 1PKGA 2VWZA 5FA8A 3C4WA 2F9GA 4Y30A 4ITJA 4AP7A 4YC3A 2J2IB 4XG2A 4RFZA 3ZUUA 4EWQA 2X8EA 4F9YA 2IH4A 2I1MA 4OBPA 5EW3A 3EVEA 5E9JA 3M11A 2O57A 3GRVA 4BP3A 4BCPA 3EN7A 4K18A 3NWWA 5LVNA 3P9NA 3MFSA 3BGVA 4I6BA 3FL4A 3VF9A 3GVUA 3B3GA 1SNUA 3ZXTA 4EKKA 3ELDA 2QO7A 4P90A 1ZMUA 5AP3A 2Y4IC 4AT3A 3K0BA 4RBLA 3LGAA 4PYMA 2UZBA 2NNWB 4BCGA 4I4EA 1YWRA 2R3RA 4Y95A 3N9XA 5C1QB 2YZAA 4O7LA 1GNGA 4FGZA 3BYOA 4RTRA 3SOCA 4YJUA 2V74B 4YMHA 2UZLA 5ANKA 4NW6A 3W2CA 2B9HA 5HE3A 4KIPA 3R22A 5EMMA 2H1RA 3EVAA 2VP3A 1GZKA 1Q8ZA 5CZHA 4P2KA 5L2TA 3BT7A 4NCTC 3V5QA 3QWJA 4CD0A 2ZV8A 4RWIA 3UC3A 4UN0C 2QR7A 1ZQ9A 5IH5A 3MB5A 4UX9A 1OI9A 4GK4A 3PT9A 2BR5A 1VQ1A 5KMKA 3UJ6A 2X6DA 2GCDA 3CPCA 2JDSA 3D9VA 1Q62A 3CTHA 4GW8A 2GNIA 2W4KA 3HCDA 5DRYA 5CEOA 1P5EA 4JXFA 4DLIA 3LQ5A 3T0IA 2P7IA 3PE2A 3IONA 4O2ZA 4CFWA 3LXLA 1ZZ2A 4ITIA 3PP1A 4U41A 3UIUA 4EQMA 5A54A 3C6MA 3Q3BA 4GL9A 4ZY6A 5CAPA 4BYJA 5CU2A 4RTMA 5E4HA 3IW5A 1LEZA 3UIBA 4BI1A 3TACA 5LQJA 2ESRA 2XJ2A 4RTNA 4FSYA 3PJCA 4CGAA 3R7UA 3IQ7A 4FIIA 5DGZA 2FGIA 3V6RA 1J1CA 4QMQA 3QV2A 4FSRA 2C0IA 3PIXA 4GG7A 5HG8A 5HHWA 3TV6A 2GQSA 3LCTA 2E2BA 3OW3A 4CEGA 2ACXA 3ACJA 3KR2A 2XEZA 3FLZA 2HW6A 3I81A 4NCTA 3DAJA 2Y4PA 4RX7A 5E8WA 5TOZA 2IW6A 4FBXA 4U80A 3RK7A 4M8TA 3W2OA 1EIZA 3ERCA 4WNOA 3GCQA 4MTLA 4I23A 3PB3A 3R1SA 3FQSA 3FMKA 5FG8A 5JGAA 3PLAE 2OJ9A 4RX1A 1OUKA 3KB7A 3QCYA 4PRJA 5CU4A 4PNEA 4WUAA 2G70A 4IW0A 3VS6A 4DLJA 3EGIA 3U81A 4EZ7A 4DZRA 5IU2A 1M2RA 3TKIA 2J7TA 3F3ZA 2PZ5A 4L46A 4YZNA 3AC4A 4P7JA 5GOZA 4HGSA 5H8BA 2BIKB 3EYGA 4EH9A 3P2EA 4TWOA 3QZFA 4YUXA 3OP5A 2OH0E 4D4RA 3LPMA 3CQEA 5EC8A 3PXRA 2O63A 3OW4A 5GJDA 4HTFB 4XP0A 1YXUA 4PYQA 5FUBA 1YOJA 5C01A 4I0TA 1DAYA 5FUTA 2CWWA 1YI4A 3QQKA 4FV3A 4WD5A 2P3LA 5FEQA 2J0JA 2OJFE 3FV8A 2VX0A 3EMBA 2PWLA 5DE2A 3NUYA 2OIQA 4EOMA 1O9HA 1HCLA 3IW7A 3D5UA 4FG8A 3FL5A 5E1EA 5CANA 4NH1A 2YM5A 1VIDA 3QU0A 1XH7A 3OUKA 4QYHA 3T7TA 1H0VA 2W7XA 4QP9A 3VS3A 4A07A 1KXZA 1BMKA 4IDVA 3G90X 3IW8A 3FPFA 4FSDA 3UJ9A 3ZEWA 4HVHA 4DCEA 4QMZA 3JVSA 4E33A 2RFDA 3LJ1A 3ZTXA 2XYRA 1WG8A 3KQWA 1Q41A 2FSLX 4G9RA 3WF6A 1W83A 4C0TA 3NX8A 3LSTA 4ZS0A 4FKIA 2BDFA 3KXNA 3E8DA 2GTMA 4ZTSA 5H3QA 3S0OA 1YZHA 2DWBA 2C7QA 3R7YA 3R7IA 3DLSA 5E1DA 2AVNA 4NM7A 1MRUA 4ZZOA 2PZPA 5K0JA 2JIVA 1G6Q1 2AYPA 3EFJA 5HTBA 5DM1A 5DOSA 3WF9A 5A6NA 5DM2A 4AGWA 5HD7A 4JS8A 1UVRA 4TTHB 5JQ5A 3PPZA 4UB7A 1N2XA 3FZ1A 3AT4A 4CQEA 2WMUA 2R3SA 2GA9A 3LJ2A 2WTKB 3VBQA 4DG3E 1JOWB 4ACMA 3VUMA 1VL5A 2O64A 4D4YA 3I4BA 4JJRA 3PJ8A 4ATNA 3IG7A 1P2AA 2V55A 3TPZA 5CD1A 3P9JA 2EFJA 3V5WA 3HZTA 3OCBA 1O54A 4GG5A 2WTVA 3HV4A 3G6GA 3QL8A 1OIUA 4XHKB 3C1XA 4L67A 4C4HA 1AQIA 2FK7A 4HC4A 10MHA 2C6TA 4HNIA 5D12A 2NPQA 4RC3A 4TXCA 1VEBA 3LQ8A 2W5HA 2JDRA 3FWQA 3MI9A 3O51A 2JJQA 5BVFA 4GBED 5K9IA 2WOTA 5JKGA 4FT2A 1V1KA 3UO4A 5M56A 2ZBPA 3MY0A 3EIDA 2QOHA 4FKPA 4L45A 5IG1A 4K6MA 4DEEA 5KMIA 3TFWA 4IX5A 1MUOA 1TQPA 1ZY4A 4GMYA 2AOUB 1DS5A 2ZDUA 2ZSUA 4POOA 4F6WA 2W1FA 4FSQA 3B2TA 3F88A 3H9FA 5JK3A 3R7VA 3TCPA 2F7EE 5M09A 5E1BA 5HKMA 2ADMA 3MBLA 3K6RA 4QQTA 3TUBA 3PS9A 3K5UA 3DOUA 2YWVA 5D9HA 4XH6A 3R01A 1YXTA 1UFKA 3B3JA 2QHMA 2F57A 2FSMX 2UZVA 1X1BA 3KPJA 1VZOA 1O6YA 2PPQA 3IS5A 3M2WA 2OXYA 2EU9A 5FHQA 4C06A 2BMCA 3CY2A 2WNTA 2OIDA 3EN4A 3LE6A 5EW9A 1BC5A 3VUGA 3R3HA 5EIFA 2PVYA 1PF8A 2OXXA 1FP1D 4WG5A 2YAKA 5FP5A 2WD1A 2BROA 4AE9A 4C36A 3ORXA 4PQNA 3VW6A 4OBQA 3OBJA 4C61A 3DZQA 4IE9A 4IB5A 2C4GA 2EXCX 4YC8A 3AD5A 3L9LA 4FYNA 4JRVA 4DEBA 1WXXA 3BUSA 2WTJA 4R3RA 2BM8A 3R8MA 1H1SA 4FKVA 4CMOA 4F0IA 3GCSA 2ZW9A 2CKQA 1WZYA 1EJ0A 3VS1A 4FE2A 4FTAA 4HGYA 4YJOA 4DH1A 3ANQA 5DA3A 3A25A 4A9TA 4KB8A 5FEEA 3LFCA 4R3PA 3NVMB 3TZ7A 4BGGA 4FOCA 3UZUA 4DM3A 4ZTLA 4Z7GA 3V5LA 2HZ0A 5EPEA 1X19A 4U7TB 3DXPA 3LXPA 3HV3A 4R5YA 4C3FA 1KE6A 1MRYA 1PXLA 4S2ZA 4F6UA 5JFVA 3M1SA 1O6LA 4DFXE 2ZBQA 3BGZA 1G5SA 4ISCA 5AV4A 1UNHA 2VWWA 3EQPA 5EDRA 2EB2A 1TKIA 2CMGA 3P2IA 3DBQA 2ZYBA 2YJRA 3PA4A 2XK6A 3R9OA 3GC0A 1Q4LA 4II5A 4IVCA 4QP1A 4F9AA 2JH9A 3F2NA 3O4FA 4G16A 2F8LA 5BW4A 5IA2A 2XZSA 2HIWA 1ZHFA 5J9ZA 4BRXA 4CCBA 5EDQA 3GU4A 3BU3A 1NBHA 3UJBA 3NYOA 4G3DA 4JBPA 5CVEA 3SSMA 3O2MA 3KMMA 4LQMA 3GU5A 5E8XA 3WIGA 3G8AA 2FH9A 1M7NA 4KINA 2W1CA 3I79A 4MHAA 2JHAA 2UYOA 3EQRA 4F1MA 2XNPA 4ER3A 1KOAA 1HCKA 4RTKA 5FTQA 5EM7A 3SHEA 4JAIA 4ZSAA 1IM8A 4U7PB 3V97A 5K0LA 5AP5A 2OKCA 2H8HA 4QT1A 4S33A 3FMDA 3NAXA 4PF4A 3P1AA 3FRHA 4C05A 5LXMA 3LW0A 3HP7A 3SG8A 1L3IA 1BUHA 1PJKA 2GDOA 4H39A 3UVPA 5EYKA 3QZIA 5M51A 5GM2A 5JH6A 4MVFA 3DTCA 4TYJA 5CI6A 4NTSA 4DAWA 1F3MC 4AS0A 4PDSA 3EQCA 3I6WA 1YRPA 1MQBA 3VS7A 3P9KA 1PKDA 3CVOA 4AFJA 3W2SA 4LRJA 4RX8A 1QPJA 5IA0A 5KMMA 4ZP5A 3EVCA 4M14A 2ITUA 5A6OA 4E4LA 5AUTA 3HVKA 4XS2A 5D11A 2IH2A 3CGOA 2BZIB 2HZ4A 4H3BA 2J5EA 4QMSA 4UWCA 3ZO3A 4RVMA 3PFGA 2DQ7X 2PMOX 4K0YA 3BE2A 4NIFB 4WBOA 2X7OA 3JS2A 4RFYA 3I7CA 3MIYA 2C6EA 4NTTA 4FT7A 4YR8A 5LVLA 4BCIA 3F61A 2O05A 3R24A 5FWAA 4KSPA 3R8UA 3DULA 2B4SB 3QZGA 1Q3WA 3OU2A 3MV5A 4FVPA 4J97A 4BDIA 1WBTA 2HY0A 3G2PA 4PONA 3QCSA 2B78A 5DSXA 4TPTA 4WRSA 5A4TA 3CJFA 1XH9A 4F64A 2VX1A 3PWYA 4JX3A 4FIJA 1YUBA
chains in the Genus database with same CATH superfamily
2AYZA 4D2IA 3MVEA 5CLPA 3BYUA 2D0DA 4QD3A 4CQMA 4RFVA 4IH9A 4OGKA 3L9PA 5A9UA 3BXGA 1EGAA 1DFIA 4JHXA 5LL6P 2HSJA 4PMTA 1U28C 2TMKA 2QRNA 2VSYA 3ZCXA 1R18A 4TOIA 1L4UA 1TYBE 4KMSA 2GNPA 1KWKA 4HPWA 3ZUVA 4UEJA 5ITVA 4Y6OA 4RK6A 1EPUA 1MHPA 2QG9A 1DL5A 3U8WA 4G0VA 4TWNA 4OH1A 3TTWA 1TVCA 3ZNPA 2ZP1A 1R8SA 4HBGA 1ISMA 3DYBA 3OO1A 4RJJA 4LF6B 2IYQA 4JAVC 2Q62A 2YIWA 3DPUA 3EWHA 1JSTA 1I6WA 1PLKA 1IEVA 3JQAA 1MEOA 4KRCA 2JVIA 2VAGA 5K2MA 1P0MA 4TV8B 2GZSA 1U7WA 3TEJA 5TMEA 5IH4A 5ALNA 3THSA 1FYXA 4Y2GA 1DLIA 5CPFA 4WXMA 4J7BA 1MG5A 1ICIA 5IPJA 4C1BA 4ILKA 1C8KA 4IMYA 2ZBVA 2EATA 3BBPA 3WE7A 2ZRBA 3NW9A 4U9HS 2WJ4A 2ZDHA 4QDKA 2CHVA 4ML3A 4IGEA 2PMBA 3PXUA 1M6VA 3QTQA 2NADA 3H11B 3P9ZA 3V1TC 4YLYA 3QX7A 4BFTA 3E93A 1YZ3A 3O8LA 3LC7O 2IZUA 1A2QA 4DPKA 1GNTA 4EK3A 1OBFO 3EFLA 3EDMA 2GLTA 2YBEA 4UAJA 2C7PA 5LPNA 1GCIA 5JEDA 4DEXA 4JJKA 3LC1O 4ZVVA 3H8JA 3F71A 5A4KA 2HCJB 4MUBA 1JU9A 4WG3A 4WZAB 2C1ZA 5AVZA 4ERXA 2O19A 4ZTNA 4NU0A 4QJBA 4JP5A 1KARA 1HFEL 3DO6A 4EH7A 1DQSA 2A59A 1OROA 5LQCA 4FS8A 4KLRA 2K4MA 5M3BA 2CXTA 4EK4A 1EUCA 4E5KA 1E6KA 1Y8YA 3O4HA 4G1EB 2EWAA 2P6MA 1RNLA 4W5WA 2G9NA 3UJPA 1SB9A 2C4VA 3THYA 3RUPA 3GFVA 4TYMA 3F2AA 2FWMX 2G40A 2VTQA 4HVAA 1XCMA 2KBFA 3EFKA 1FPMA 4CMCA 4N70A 1ORIA 3QKTA 5AIKA 3OEHD 2YWRA 4FPXA 4FICA 1SXJC 3R28A 5ANGA 4WJKB 4AMYA 2Z2IA 3K0AA 1AKEA 2RK3A 1KAHA 3C48A 4QPSA 3UAVA 2V7QD 4OTGA 1LC3A 4G2TA 1JE1A 3KYDA 3ZWQA 1FXWF 2I7TA 4YO7A 1Q50A 3DKFA 4Y6SA 2VF5X 1JB1A 2VOJA 4IDNA 2DUUA 2GXSA 3V55A 2V8BA 3J7TA 4QMLA 3WBFA 5KYWA 4MKGA 3WYBA 2R64A 2JARA 1DHTA 3UNXA 1YOBA 4L4XA 4V2IA 5IQIA 4F2GA 3TZMA 1FQWA 1OWNA 3GJ3A 1NU8A 4MUMA 1TPYA 4I4TB 1FMCA 1UL1X 3WLLA 2BYTA 2M6SA 3IXLA 4IXWA 2YACA 3UC4A 3LU1A 4XVQA 3G5LA 5EZQA 1ONPA 1VHQA 5BUIA 2EKZA 3PHCA 6GPBA 4KQIA 3BMOA 2WOJA 2Q29A 4WD3A 1EX1A 3DZIA 1VPVA 3OOYA 2CD9A 3T3UA 2DCMA 3PY0A 3V46A 2BHRA 4L68A 2CVPA 1I5OA 4Q1CA 2UZDA 4I3GA 1FP7A 5BP7A 1Q19A 2A0FA 1H66A 1RE8A 4ZZ1A 3KKVA 2C2MA 3EZLA 3QKSA 5G3ZA 2N3ZA 5C8YB 4TWJA 3KXGA 1WBOA 3G23A 4A8JA 3UDZA 1Q14A 4URFA 1K6MA 2Q9BA 2FWRA 2KX7A 2FTKE 3QY0A 5DOZA 3IE1A 1C0PA 2P9TA 3RADC 4U9AA 4R2WA 4JIMA 5IKXA 3TNQB 1UBOS 2I4RA 1ZJWA 4FT3A 3EZ2A 4XJXA 5DHTA 4FA2A 3OTQA 3CZCA 1XQZA 1VPEA 3K1AB 5ETCA 5IP5A 4Z2YA 3SHQA 2Q8PA 4DMFA 1W4ZA 3S7ZA 1FA9A 1TZKA 1VBKA 2BZJA 4BX8A 4DGMA 1NOKA 4GVJA 4ZMFA 3R75A 3FMIA 1PT8A 1K88A 4Q4HA 4C07A 3BZWA 1A8PA 1Z6XA 1KSFX 2FFQA 1DUIA 4I4LA 3W5UA 4B3GA 1NVMB 3WZJA 1WUKS 3I1AA 4QQNA 1SVKA 2BE9A 2J4FA 2J3HA 4IWPA 1C9YA 4H3PA 5FUXA 4JR2A 2LRHA 3T41A 2C3PA 4X2FA 4HAYA 4CQLB 4H4CA 3VBEA 3QPVA 3F7MA 3R41A 3AO0B 5BYLA 4EH6A 1UKZA 5EP2A 2RGAA 1X70A 3F6SA 3E8CA 3UXHA 2W2MA 3GLHB 2FV8A 3N2NA 5AADA 5EIBC 1OZAA 3H8VA 1RM5A 5K45A 5C37A 2YYZA 4B17A 1WEKA 1JSVA 1UOQA 2GPWA 3KYCA 4JDIA 4J0GA 3QGMA 4RSGA 1Z17A 3RLFA 2ZCJA 1N36B 3MJ1A 3K5PA 3DCIA 1KEKA 3LFAA 3WWYA 1QHHA 2XHEA 1I6KA 4Z7JA 2Q0XA 3A26A 2C54A 3SQDA 4AI6A 4BGDA 1IY2A 3UBTA 3R5HA 1Y3AA 3HV6A 2CUTA 5H8WA 2UXDB 2Z8ZA 3DYVA 5FP6A 1P7ZA 4RIFA 5AMXA 2AC7A 3LDHA 2K7ZA 3GO4A 1C7RA 1M1YE 3H5NA 1A9PA 3ZWYA 1NA5A 1ZC3A 3OP1A 2J46A 3V42A 1JDSA 1TD9A 3K8QA 3N2KB 4BP1A 2ZKLA 3TTJA 2DTDA 3ET7A 1JH9A 2OHXA 1U5RA 3PX7A 1KAOA 4RDCA 1I7PA 1T36B 3BMNB 2ZPAA 4N40A 3MWEA 3MMXA 3FR7A 5J63A 4JB3A 4TYYA 3R0ZA 2CZGA 4EVQA 3O75A 1NTRA 1XHLA 3RYIA 4R8LA 5BSUA 4NMMA 4IDBA 2PRIA 1HO3A 4LHZA 2JLCA 3RWOA 5AUXA 3ELJA 3A4YA 3U3MA 2NP7A 1XDDA 5F98A 3FWYA 1MPXA 5T41A 4GFOA 4MLCA 1ZXBA 1K8QA 4EVIA 1P9RA 2N42A 4JBOA 5IUJC 3GJ5A 2AUHA 4HRAA 3VVBA 3OETA 4V2UA 3N76A 1LBEA 5CLLA 4UHEA 4YAKA 3GARA 1TM5E 3LH5A 3MTFA 3TKHA 2Q99A 3RYFB 4M97A 5M06A 3P97A 2I0VA 2FFHA 5LMKA 4P33A 3DA6A 2A0CX 3TQFA 2H31A 4BVHA 3GU6A 1OYOA 1ZM4A 3S7TA 2FQQA 3IPXA 1C5KA 1FFEA 3UT6A 5KKNB 2NU9A 2XUJA 4DN6A 3NBUA 4BRZA 3ABRB 3LMIA 3ZS8A 1CQWA 3ZH9B 1WQ4A 4NXNB 4OMUA 2ZRFA 5AVRA 3TQCA 4EZEA 4NE7A 2YXDA 2GBFA 1K92A 3IR6A 1EE2A 4NPAA 4D3XA 3IJPA 3KAJA 2BF4A 4LE2A 2XAOA 1P4HA 1ULTA 1C9JA 3EUWA 4MGIR 1LUFA 3UOKA 3BIFA 2P2LA 4UEUA 1H00A 3QQUA 2IE8A 3F8TA 4FCVA 4F60A 1ZD9A 4IM2A 1UPFA 4J1RA 1DKOA 4YWJA 2OTCA 3GJ7A 3IS3A 2FWJA 4QFMA 4JCCA 1WDMA 3LDGA 3GH1A 1WBWA 1S9HA 1TQIA 3EMKA 2Q3FA 2O7SA 3QOYA 1THGA 3VO8A 2QRZA 5BYZA 1CV2A 3T1NA 1VP3A 4U2KA 3RZBA 4R16A 2EX4A 1C1XB 1VLLA 2G4VA 4MH0R 2VHUA 4YT4A 3DLTA 3RVKA 3WGGA 3JYLA 5TQ0B 1IEQA 3HP5A 4MNEA 5A3JA 3AOEC 3LI2A 3ENZA 3OC1A 3DZHA 3DQXA 5K3FA 1FDSA 1UK8A 4HVIA 3AMYA 2FUMA 3M6VA 1X9HA 4RZXA 3PITA 2WHEA 1BHSA 3UQYS 2VOEA 3VHEA 3I9KA 1XL1A 2ZUSA 1YKGA 4J8NA 1MA3A 2EXMA 4FMBB 5HU9A 3OPQA 5DSTA 1VCIA 1BS2A 1G41A 5DR9A 5BX0A 3GRCA 1OWOA 3D83A 4YC6A 4IG4A 5AK3A 5JD3A 3EA0A 2GI4A 5I9WA 2DWOA 4JLJA 2H7CA 3O74A 3UAOA 2HCBA 4DE4A 1R0BA 1RYMA 3SFTA 4XPIA 2Q1SA 3H10A 3B1YA 4MD7E 1W29A 1WHTB 5LQNA 5AK0A 4X97A 1BEEA 3ZSHA 4R2HA 3TD6A 5I5ZA 4Z9LA 1B43A 1FFGA 4PC1A 4YJNA 1EXMA 3T35A 2PGLA 2XV1A 2VWGA 2WTWA 1I10A 1P2VA 3HXTA 5HQJA 2XE6A 4KKGA 1OX6A 2PVJA 1YZYA 2QS9A 2ZRNA 3PDWA 5JFWA 4KNBA 1Y8QB 4F6CA 3HCBA 1XHAA 3PUIA 3AKJA 4RGQA 4XW2A 2FZCA 3KKOA 3WWCA 2PL5A 1C1YA 3ZE7A 2G76A 1CDKA 1L4FA 1QPBA 1UBMS 3NW7A 4HNRA 2BGRA 4EH8A 3GFFA 3O3CA 4B35A 3KQTA 3FMGA 5LYJB 1XZIA 3D6NB 4I3ZA 3WYAA 1S01A 2Y1GA 5JY1A 1B38A 1I44A 4M37A 1NKSA 2CEAA 2DUMA 3DKPA 3SHWA 5FFMA 4BVBA 1TECE 2CEKA 2ZMCA 2GYYA 4HGOA 5ANOA 1YR1A 3FGZA 3HN2A 1WV1A 3SEZA 4AXEA 3KR9A 4QHTA 1B2LA 1IC6A 4CT0A 1TXGA 3EBOA 3FC2A 3BYSA 3TR6A 4KAOA 1P39A 2C5EA 3Q41A 5JVDA 1A8HA 4HCJA 3OT1B 3NAQA 5FIUA 3COJA 4OB7A 3OLWA 4NZZA 1K7YA 5I8PA 3CEMA 1FFDA 5KYVA 2YABA 1HFKA 5EUCA 3KVOA 1IWBB 2C2GA 3QQJA 1GGHA 2UYQA 2OY0A 3H9EO 5I45A 3U9TA 1LX7A 3D4IA 4OFBA 3WWZA 3HGKA 3HKOA 1JR2A 4WO5A 4JR7A 3DDOA 2R65A 3SU8A 5J4KA 4KBKA 4EGSA 2I7VA 3H0KA 4EMBA 4FODA 4DA7A 3FMEA 1EH4A 3PR2B 1T9DA 3HI4A 4IXMA 1V45E 5KUTA 1GHTA 1M75A 1KU6A 1Z4LA 3QX8A 2UVZA 3QWBA 3ER6A 5EWLB 1JGTA 5AIRA 4NFNA 3BULA 4F9TA 2CLQA 4Z49A 2VNSA 4LVUA 3PWSA 4M60A 2GO7A 2NQTA 4YRLA 1KGDA 2C9YA 1GD1O 1I7DA 4N0QA 1HOWA 3IDQA 4MRMA 3UK6A 2XWPA 5T4HA 1GM5A 2XB7A 2A2AA 3EGWA 1OFGA 5TKDA 3OICA 2ZUVA 1WNTA 1UKCA 3V5TA 3WLNA 2VTIA 3KMWA 4F8EA 4GMXA 3AEZA 4P4TA 2PSJA 1Z0AA 4N4SA 1X0XA 4KPEC 1RRPA 1QDUA 4Q03A 3ZI0A 3KXKA 4MHOA 2GASA 2BWJA 1L9XA 4FEGA 2PUHA 4IDCA 4JQZA 2UW6A 3QVLA 4JL8A 2O7QA 1XK7A 1JBQA 2E4AA 4TZRA 1UIRA 3HO1A 4YHTA 4R69A 2VAXA 3BXEA 5KX5B 3IVRA 4R78A 4CKYA 3QQ5A 4LTMA 2E4ZA 3OFJA 3QFCA 3A4TA 5DNWA 4USFA 5IWCA 1UZNA 4WLEA 9LDTA 4FTCA 1HQCA 1E2FA 3COSA 3WF5A 2YIVX 5ES4B 4R3UC 3E58A 4TXLA 4X1YA 4D9UA 4BB0A 2NSHA 2PMFA 1NW1A 1FDVA 3DB1A 2X41A 4RIXB 3L18A 1GNSA 4WA9A 3W2QA 4X41A 1ZZLA 1WY5A 3TLMA 4QPCA 5LQAA 4CE6A 1XZQA 4C2UA 4TTPA 2J9YB 2XVZA 1R15A 3TL6A 2UW9A 1M7BA 4P0TA 4FYJA 4LUEA 3HB4X 4KXUA 4EH3A 2EZ9A 1V8FA 3HDVA 4MWEA 3JY6A 4MVJG 4LHYA 4M9RA 4ACAA 1HYHA 3TX6A 4BIBA 2O3JA 2ILVA 2LE0A 2XDYA 4LBVA 2I8CA 3EGDB 4HWPA 5K0NA 2ZUTA 1CUEA 1V8PA 4MP3A 4KQ6A 3PU6A 1Q83A 5ARDA 5IK2A 4K9PA 4G31A 1LZLA 4XQCA 3SDJA 4FMDF 3DPSA 4BWYA 4LJRA 2I3DA 1U54A 2VJOA 3CXRA 3PFBA 2HWYA 2Z5LA 1TQ2A 5FOQA 3R5JA 1Q7BA 3IVAA 4JUCA 4A10A 5EJIA 2MTBA 1VKOA 1CNMA 3ZGOA 2W6NA 2X3YA 4KDRA 1B16A 1E2UA 3GRUA 1T9ZA 2XYNA 2IZ6A 3UO5A 4LQLA 1DBWA 5DU2A 4JXJA 3AHCA 1U0OC 3KWFA 3M6AA 4AGDA 4RC9A 2K87A 2YZ7A 3O6VA 4EK9A 2C5GA