5GIOE

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 63
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gioE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gioE02
1QPDA 4Q5HA 1H0VA 3TOSA 4AGCA 4FOCA 4FL1A 5CEIA 4RT7A 3G2MA 4WVLA 3RIEA 5CF5A 2RIOA 5EHIA 4GKHA 2BUJA 5CVEA 4O21A 1KV1A 7MHTA 1CKJA 3Q4UA 3ELDA 2C6LA 2C6MA 2GNJA 2YCQA 3CD8A 3OY3A 4FV1A 3UPXA 1UFKA 1UWVA 5FHRA 3QQLA 3L8DA 3Q60A 4F0FA 2C6OA 3LFNA 5EM5A 3SW7A 3OEZA 2FVDA 1YUBA 4L53A 4G9RA 1JWHA 3FE3A 4ZIMA 4E7WA 2QYOA 3G9LX 5IA0A 2BM9A 2ITQA 4AF3A 3NWEA 4BLWA 1I4WA 5LQUA 3C4ZA 3B5IA 4KKEA 5CEQA 3GRUA 4USEA 5IQAA 3KQQA 3O7WA 3P9IA 3O50A 2E9VA 3QCYA 4JI9A 3RPOA 3B3GA 4M36A 2UZNA 3Q4ZA 3QRJA 3V5PA 3FKOA 4HGEA 2XS0A 4E20A 4BCNA 2NXJA 4F9YA 4EK8A 2F8LA 3QF9A 4E2WA 5DLSA 1VEBA 1V0BA 3EQCA 5CY3A 3ZRLA 2UW8A 3ORIA 1H1DA 1NW8A 4NZWB 2PSSA 2YXDA 5DSXA 2HAKA 5FEDA 3SXSA 3WZEA 3ZSIA 5LQCA 2X7OA 2F7XE 3S00A 4KD1A 3QQHA 3LCUA 1Q0TA 4O7YA 4OQEA 3W32A 2F2CB 4NFMA 5HFJA 3RW9A 3B8QA 4A4LA 2BDJA 5AV0A 2YM3A 3UOJA 4CLIA 2B9HA 2ZV2A 1ZKDA 4GEKA 4N4SA 3TR6A 3CLYA 3BBWA 3G6GA 3OZRA 4O29A 4D5HA 4C4JA 3WI6A 2FH9A 4QNYA 3MPTA 2Z7LA 3K0BA 4QMWA 3CP9A 2WK1A 3EVDA 2OLCA 4AXAA 5CF6A 2Q83A 2VTMA 4AW2A 2QI8A 2OJFE 2ZWVA 4IIRA 2R3PA 3CC8A 2IH5A 4ZS0A 5EHOA 1ZOGA 5KMMA 4P7KA 4A9YA 5DSTA 3D4QA 4YZCA 3RP9A 3GIWA 4CKIA 3LFEA 3OMVA 4YZMA 4BCOA 4DYMA 3E05A 3QGYA 5IUIA 4FT5A 2ZMCA 4KBCA 3HV5A 2RFNA 3OCTA 5AFVA 4UXLA 4UWCA 2PBFA 5HIJA 3F4KA 3VS3A 5CF8A 2OXTA 2GPYA 2QHNA 4F99A 1ZG3A 2ONLC 1HCLA 3DH0A 3V5LA 4EH6A 4RWLA 3MB5A 1J1CA 1ZARA 3KRJA 4MEDA 5CI7A 4ZSLA 1A06A 5T68A 4QP4A 3POZA 3UQGA 3W10A 3DAEA 1YW2A 3FTDA 1KOBA 2PY6A 3DULA 4RTMA 3FSFA 5EM8A 3VRYA 4FSYA 2RFEA 4XOYA 3ZO2A 5FM3A 5J95A 4C05A 5F2OA 1W83A 3C0HA 2ZIGA 3TDVA 4IFGA 2WGJA 5F20A 3TXOA 3QTUA 5GHVA 4ACHA 3S2PA 1O9HA 3ODZX 3W2OA 2R0UA 5LVOA 3OZ6A 5DTMA 4JAJA 5ANKA 3SLSA 5I9VA 2DPMA 2UYOA 3DTNA 4YUVA 2C5NA 2CKPA 4DITA 5CSVA 2DQ7X 5ITAA 2PY3A 3KN6A 4Q9SA 3DB6A 2QRVA 1G8SA 3R7OA 2PVFA 4BCFA 4FR0A 4R6WA 4X2KA 2W5BA 3O7LB 3DY7A 2V55A 5BVEA 4ASEA 5M06A 3QA0A 2BDWA 2R3JA 4DEDA 5BVDA 3NWBA 5CUQA 3TM5A 1XJ5A 4E2YA 3ENHA 2PZYA 5KO1A 4RGJA 3R1YA 5JFXA 2XCKA 5EG5A 2B25A 5ICCA 1XJDA 2R9SA 4CSVA 2YCRA 2PGXA 2J2IB 3KQSA 1M17A 4AA0A 2WTJA 3FYKX 5JZNA 4ARKA 5CT0A 3E63A 2JEDA 1SQGA 2PX8A 4RSRA 4CZTA 3POOA 5FA8A 2XNMA 2IBSA 3JWIA 2KTYA 5E9EA 4BVUA 1DM2A 1PXJA 1Q5KA 4DFXE 4U44A 5E8ZA 2R3HA 4QT1A 4CVAA 4RWJA 1TW3A 3QOWA 5EZSA 3PVUA 5HESA 2P7IA 2YQZA 4FK3A 3LQ3A 4RVFA 4JVGA 4XMOA 4G6LA 1YVJA 4TWOA 4WA9A 2W9ZB 3VRZA 3WZJA 4USFA 5HLWA 5T67A 5E7RA 3P7CA 2UZOA 2BRHA 4K0YA 4XLIA 5DVRA 5TR6A 3U81A 2P2IA 4PYOA 1DL5A 3NDMA 2YITA 1YOMA 3DK3A 3SW4A 5A4TA 4OTQA 4WT6A 5DN3A 5DM2A 4NCTC 4NKAA 1JPAA 3R9RA 4U7TB 3FMEA 4FZDB 4M0YA 4Z7HA 2KULA 4RQVA 4FC0A 4EQCA 4CFWA 4XUEA 5D1JA 3DXZA 1O9UA 4KDRA 3PIYA 4O7NA 4GU6A 4IAAA 3F82A 1M2RA 4H3QA 3LMGA 4ITJA 5DT0A 5AV1A 2YM5A 1WY7A 5FHQA 1OGUA 1PXIA 2I9KA 3B2WA 4FTQA 3R9HA 3KULA 1RW8A 2J90A 3LPMA 4ZJIA 3SDJA 1JLUE 2B78A 3D83A 3VS1A 3LGAA 3R30A 3PVGA 3IYLW 5FQOA 5JR3A 4DE4A 3RTPA 4FSRA 3GRYA 2WHBA 3TFWA 2PWLA 3U9CA 3TM0A 2NNWB 3B2TA 3M1SA 5DXAA 2F9GA 4M69B 4FICA 2IW6A 1Z57A 4TNDA 3PJ2A 3FUVA 4XBRA 2X8IA 3F61A 3JPVA 1P1CA 3FZSA 2G2HA 3F7ZA 3L8XA 5C8KA 5LWNA 4O7ZA 5ANOA 2G72A 4MXXA 3T9IA 2QD9A 4GK3A 4YBJA 2I0EA 3GEQA 1F3MC 4XG2A 3GU6A 5DHJA 4FKQA 4L52A 5K4IA 3NR9A 2ETKA 2R4BA 3F3TA 3KR0A 2WPAA 3UIMA 3VC1A 4YPDA 5CVVA 1SUIA 3FYDA 2NO3A 2LD4A 2P0CA 3FY0A 3LHJA 4I22A 4EONA 2W05A 5LCKA 3QX4A 4HYIA 4XV9A 2R7BA 3LKMA 2UUEA 3OFJA 2Y0AA 5HX6A 5DX8A 5E1DA 4BB4A 2WA2A 2VDVE 5ACKA 3EFJA 3SSMA 3ZONA 2QLUA 3PLSA 3KK8A 3RCJA 1YB2A 3C13A 1PXNA 4M14A 1XH9A 2ZULA 1NY3A 4X6RA 2R3NA 3GCSA 4RTKA 1YI3A 3G90X 4RIXB 3NGAA 3EFLA 2QG7A 3F7WA 4FIEA 4B0GA 4BLVA 4QOXA 4NIFB 2GDOA 4O6LA 5EKXA 2P33A 2ZZMA 1PW2A 3G0FA 5IA1A 3RWPA 2C6IA 4QMMA 2XYNA 1NVRA 3DKFA 4ZTQA 5JKGA 3ORNA 1SVEA 3KR1A 5HCXA 2WIPA 4QVGA 4CKRA 3A60A 4BN1A 4OQDA 3SOAA 2IDJA 3CEKA 4K6MA 5J1VA 3AMAA 5E9JA 4AUKA 1FOTA 2XK7A 3EQFA 3IW8A 5ANGA 4DFUA 4FNYA 3ZRKA 1V0OA 4DEAA 1OITA 1JQDA 3K6RA 2EU9A 3AC4A 3P4KA 4YJVA 3TL8A 2VWVA 3FUTA 4QMOA 2HMYB 4P5QA 1M52A 2CLXA 3RALA 5HGIA 4R6XA 3C9WA 2GHGA 3RAHA 1KPHA 2HW6A 4BDKA 3LFAA 4F9WA 1Y8CA 4QQ5A 4S32A 3U51A 2BZJA 4XCXA 4RIXA 1UKIA 3V5TA 3TUCA 2W1HA 5H3QA 3BYMA 4G34A 1UU3A 3COHA 3K54A 2QOKA 2R5TA 3VS4A 1QANA 2X7GA 3C4CA 3MFTA 4S30A 2IW9A 5LQRA 1PYXA 3BCEA 5HZNA 10MHA 4O6EA 3DXYA 1O6YA 3B8RA 4EOQA 5ERGB 1UNHA 1X19A 3HMMA 3Q9ZA 4G3FA 4WBOA 4XV2A 5CVFA 3D7TB 4FEXA 5BW5A 2DYLA 5CTPA 2OG8A 4ZZMA 4HVDA 2EJUA 2GNGA 3LCCA 4M37A 2HTEA 2OXYA 4JOAA 4FV0A 1IA9A 4MXYA 2DWBA 4ZSGA 3RAIA 3B7PA 5E1BA 2IN6A 2PE1A 5HORA 3M2WA 1M0EA 2WTKB 5EVJA 4FGRA 4GT4A 1YDTE 4C58A 3IG7A 4GQBA 1Z5MA 4DT9A 1ZHFA 1YWVA 4BBEA 3C51A 2YIYA 4QTCA 4BY9E 3TQSA 1H26A 4I24A 2FSLX 5JEBA 1NKVA 2Z7RA 2YIRA 5HE2A 3R8LA 1EH4A 4DFYA 2YHVA 4PYJA 5KUPA 4JG7A 1P1BA 2I6GA 2EB3A 2ERZE 3IHTA 3PG3A 4LMNA 2OZAA 3H9OA 4HZRA 4MXOA 5K0LA 3QRIA 3NYOA 4I20A 5KCVA 3O71A 4JJRA 4G3CA 2ERCA 4MBLA 4Y5HA 4QYEA 4Y83A 5BVNA 4KNBA 3RINA 2WMRA 5F1ZA 5EDQA 1ZMWA 4I4FA 5E8VA 3NUPA 4FSWA 3RAWA 2J0MB 2C6KA 4FT9A 3M6WA 5D7AA 4TYGA 4ZOGA 3BWMA 3CQWA 1PXKA 4ER6A 4FKIA 5CF4A 4D2SA 1YXVA 3DPKA 1BKXA 3DNEA 5AIRA 4PY1A 1QMZA 4A9TA 5K4JA 4GUAA 1JOWB 3Q53A 4PNKA 5B0XA 4CKCA 3W18A 4KW7A 1QL6A 1YWNA 3R2BA 2UW6A 4FKRA 3QQUA 1FINA 4FTNA 2R0IA 3BGZA 3QTZA 3JWHA 5IEYA 4RJ5A 4FTTA 4USDA 3BT7A 2XEZA 4G3EA 5I4NA 1UU8A 1Y6BA 4ENYA 3EEOA 2B54A 4XP3A 3ZLYA 5C1QB 4I94A 3ZDIA 1KPGA 4IVBA 4OA5A 2ZFUA 5HEKA 4D0XA 2PSQA 1A9UA 2W1CA 5FBNC 4F86A 3FI3A 3H9FA 4I5PA 3IQ7A 5ICFA 4FVRA 2HENA 4NM0A 1ZZLA 4EC8A 2CN8A 2Y4IC 2X6DA 2PUNA 2X1NA 2GH1A 3CBGA 4PMMA 3W2QA 4B6LA 2Z6AA 2J4ZA 4JS8A 4MAOA 4UYNA 2J50A 1KXZA 2P1DA 3MH1A 4EZ5A 5IISA 3SVZA 4ZJVA 1P39A 4LWPA 2O06A 2OJ9A 1L3IA 3EL8A 2JLDA 2UZEA 4X1OA 3DB8A 1B39A 2J6MA 3IDCA 3LLAA 2C5VA 3P9JA 3ORXA 4PV0A 4QMZA 5FM2A 1O54A 3OW3A 4AT5A 2CKOA 4E4XA 4H39A 2P8JA 1JQHA 3GQIA 1OL2A 3DK7A 3D2KA 4PYLA 3VN9A 2XVAA 2G2IA 3AMYA 3WILA 4L3PA 3OE5A 4PIPA 5JH6A 3P08A 4QTUB 3HA3A 4G2FA 5M5BA 4QTAA 2AOVA 3FDNA 5CD1A 3FMJA 5IPJA 4Z55A 2XIRA 4GG5A 4J53A 2R6ZA 5HLNA 1X1AA 4EKKA 5CAUA 1SKMA 3U87A 5CIYA 5FDPA 1YHSA 2ZDTA 3UO6A 4A06A 4ZLOA 3FMLA 4BP3A 1WMKA 5KYGA 4HNFA 5IMXA 3BGVA 4QPPA 2HCKA 2CNQA 1Q8WA 4IDTA 2FHPA 3UVQA 3UJDA 3C7QA 3VBXA 1M7QA 2VGPA 2F4JA 4YR8A 2OFUA 4P2KA 4X21A 1O6LA 3D7TA 2ZBPA 3SMQA 3E87A 4Z16A 3KQTA 3LL7A 4WIHA 2VO7A 3R3HA 5DLYA 5K0NA 3I4BA 4YZBA 3U6JA 3FHRA 3KHKA 3UWPA 3P9CA 2GTNA 1JVPP 3NVMB 4EWQA 3Q04A 3AJDA 2FO0A 4TKSA 2J5FA 4EJ7A 5LQAA 2HY0A 2GQRA 3O7LD 3NUXA 4O38A 3EQRA 4PP7A 1U46A 4FG9A 4DCGA 3NS9A 3O8TA 3EQBA 3KXZA 3H0YA 4KRCA 3TLJA 4YMHA 4D1XA 5HICA 4ZSAA 2XNEA 2XJ1A 3EWHA 5FEQA 2JKOA 1U5QA 4C04A 3C5IA 5AAFA 2ZBRA 3BWYA 3KK9A 4II5A 4TYIA 5C9CA 4L45A 1BC5A 3LECA 2XK3A 2QU6A 3QKKA 4NH1A 4EKIA 4O27B 4P58A 4YUXA 5LQKA 2PVYA 3MH2A 4F84A 2JG3A 2WTCA 3EL7A 3HV4A 1RQQA 4GYIA 4ZTHA 4CCUA 4DINA 3UFBA 3NNWA 1KUTA 5IEXA 4ZSEA 1XH4A 4CZUA 5J9YA 4EQMA 3SGCA 3I60A 3PA4A 3TG1A 1H0WA 3EQHA 3OEFX 4FYNA 1W82A 2LGCA 4R3CA 3ZLXA 4YSJA 3PZHA 1NW6A 2XYVA 3P2IA 5CZHA 2K4MA 3EOCA 4NW5A 4TXCA 3MV5A 1P91A 3M70A 1TQPA 4TWPA 4W4WA 4K33A 3PVCA 4BLUA 2R64A 3QX2A 2CWWA 3R8MA 4GT3A 3BWJA 1MQ4A 2YZAA 3MB7A 4KIOA 3NWWA 5FEEA 4CMTA 5K03A 5ICEA 2C6EA 1YXUA 2WD1A 3OS3A 4WKQA 1RJFA 3GJYA 4UOEA 3L9MA 1ZAOA 3M33A 4U42A 1J1BA 4RA5A 3U4UA 3DXXA 5IZFA 3EKKA 4ASZA 1NW1A 4DH8A 2CLQA 5IU2A 4FS8A 2YDJA 3UG1A 3AT3A 3PSCA 3TUDA 3HGKA 3GRVA 1FVTA 1AQIA 3MH3A 4DH3A 4IAYA 2H34A 2GS2A 3MIYA 4FNWA 4BGHA 3SGLA 5KZIA 1WBWA 4UZHA 2BM8A 1WBNA 4HG2A 4MBIA 1CKPA 1OL1A 1SVHA 2HZIA 3N51A 2JKMA 4E6AA 4QQKA 5ICGA 2QOHA 5EW8A 4CMOA 5EHYA 3VUIA 4I21A 2X2KA 2Q0BA 4YZNA 3KPUA 4H3PA 5DM4A 4FBXA 2XK4A 3OP5A 4IWOA 4G56A 4ALVA 3Q3BA 1GZKA 4RVLA 5HILA 3Q4CA 3LFDA 3U55A 3VVHA 5IH6A 4PTCA 4E2XA 3BQRA 5K05A 3A7FA 3DCVA 3R00A 3DAJA 5FTQA 3REPA 1JTEA 3DDQA 3ET7A 4O0YA 5A3XA 3RVGA 2BR5A 4ORKA 4U3YA 5FQDC 1QPEA 3VUMA 5CVJA 3VHKA 1JKLA 3A7GA 1H1RA 3FLZA 4OTDA 4EZ3A 3FPEA 5AMNA 4M84A 3OU2A 4EH9A 1BHJA 2ITUA 1UU7A 1N7IA 4PYIA 5EMLA 3T9TA 2I7CA 1Q4LA 5A6OA 3ELWA 2QOOA 3HX4A 5J87A 1Q0SA 4EZ7A 2QODA 3DP7A 1H07A 4DEGA 3H9RA 1YDRE 2YERA 3PRFA 4U41A 2PL0A 1QPJA 4WRGA 5CSHA 3WOWA 3ZDUA 4NK9A 3QTQA 1WVWA 2JFLA 3FUXA 3DAKA 2ZB0A 1PKGA 5B2LA 5HIEA 3R7UA 3DTWA 5EI2A 2EX4A 4RQKA 4OT5A 4IX3A 4FTRA 4CRSA 1KE7A 4FNXA 2XKCA 2YWPA 2WEVA 3KY2A 1XTPA 4Y2HA 4F6UA 1VP9A 4GH2A 3UZPA 1X1DA 5D10A 3WF9A 2PZRA 1XDSA 3NSZA 3QD4A 4IB3A 5GM1A 3TKHA 5H02A 4GT5A 4QMUA 3MFSA 2ESMA 5HVYA 4DFLA 4DTKA 5AADA 4UX9A 4QTTB 1S9IA 3FMHA 4HCVA 4G6NA 2RFDA 3IOKA 3VF8A 2IVUA 3VW6A 4D58A 5CQWA 4CTKA 2ADMA 4BBFA 3PWYA 4GL9A 4R8SA 2RF9A 3ORMA 3AY0A 4WNPA 3EYHA 4PCLA 2OJJA 3OC1A 5LVLA 2VO3A 3AQVA 1QYRA 3HVHA 1I44A 1OKZA 3HV6A 4I3ZA 1QAMA 2XJ2A 3RNIA 2CSNA 3QYZA 3GU8A 1JAMA 3ORZA 2CKQA 3E5AA 4YUZA 3F5XA 3FZOA 3Q2JA 4FEWA 3D5XA 4MHAA 4E5AX 4F0IA 4DCEA 3LKZA 4RTOA 2F57A 3V97A 4FKUA 4WXHA 3HUBA 4O0XA 4DHFA 5IKMA 4OX9Y 4IAFA 2VX3A 4HGTA 3IS5A 4XG9A 4CG8A 4CG9A 5C0OE 1ZWSA 4DTAA 3G2OA 4PDOA 4ZTLA 3KRWA 4W8DA 3EN6A 2W1EA 3R83A 4HGYA 2YZLA 4AE6A 4YMGA 2YABA 1GOLA 3KRXA 5CEOA 3TKYA 4IC7A 1R74A 4MIKA 2CGXA 1G38A 3FTFA 5JFSA 4RFYA 4M97A 2IW8A 4KAOA 3HAVA 2HWOA 3K2LA 4JDHA 3SVVA 4RWKA 5HHWA 4CTBA 3HDMA 2EWAA 2Y4IB 3EFKA 3GP0A 2CNUA 3DJ6A 3H4JA 3VJNA 3VS0A 3QZIA 1PXPA 3ZTXA 3ZZEA 1JG2A 3MY1A 4H58A 5I9WA 2OIQA 1K2PA 3DU8A 4ITHA 4OTGA 5EG3A 2IZUA 3ZLSA 3FMDA 2A19B 3SKCA 4B8MA 3QRKA 3GWZA 1I1NA 5LMKA 5C4LA 3ROCA 1DCTA 1U5RA 2W1FA 5M56A 2ZM4A 2YA9A 2ZAZA 3QYWA 2ZM1A 3QHWA 3PVBA 2UZLA 1AQ1A 1BL6A 1BOOA 3UP2A 4X0MA 4FT7A 3RHXA 3HP5A 4C0TA 4GC9A 3R28A 1BLXA 2JDTA 3QD2B 4GFOA 4HVSA 2FPOA 3UE4A 3OT3A 3QCXA 1SG9A 5EW9A 1ZYJA 2Y7JA 3QKLA 2GMXA 3FI4A 1Q3WA 3WZKA 2CCIA 4ER3A 3AD6A 3CSVA 4JAIA 3TT0A 1PMNA 1PJZA 4ER5A 3KPVA 2PV0A 2HZ4A 1KR5A 3UJBA 4K2RA 2IG7A 4J98A 5AX3A 4MTAA 2OBJA 2BPMA 3LXKA 5J9LA 2YEXA 3KPWA 5AP0A 5I0BA 3HVIA 1ZXEA 2CPKE 1WXXA 3A7DA 4I0SA 5CM2Z 3CJRA 4OTHA 3I0QA 4WSYA 1OPKA 2GHLA 5JFVA 4R3PA 3FPQA 2QURA 5HX8A 3EGEA 1APME 2O63A 5CVHA 5TOZA 3M42A 3SOCA 3SM3A 5EKOA 1EJ6A 3UODA 2X8EA 5AUTA 4JXFA 3UMWA 5A4CA 3BE2A 4RZVA 4NJDA 2J7TA 3BHHA 3KA0A 4BZDA 5TO8A 4LM5A 4WO5A 5GIOE 2UZBA 3FXXA 4A9RA 3OU7A 2IDKA 2B3TA 1P5EA 4RV9A 3LDGA 2G9XA 1PRYA 4NTTA 3UJ8A 4IQ6A 4N0SA 5HEZA 3GB2A 3ALNA 2QLQA 3ANRA 3DFCB 4YJRA 4HW7A 5JT2A 4HRAA 3O0GA 5AA8A 2OF2A 4BHNA 4BRXA 3ME5A 4D1ZA 3A99A 5ANEA 3HA7A 3HDNA 2QY6A 2XP2A 4BCGA 3HRFA 4O7LA 3T8OA 3A4PA 4QDKA 3CGOA 4ZJJA 1OUYA 4FKLA 4H1MA 4X63A 2YFXA 1PMUA 5L6OA 3TZMA 2AOTB 3HMOA 3ETAA 4IE9A 4MKCA 4HYUA 3UNZA 3LDUA 4M67A 3HMNA 3WIGA 3I7CA 4LGGA 3CR0A 4ID7A 5HE1A 5BYYA 5KMIA 3A4OX 4V01A 5E90A 5E1EA 2W7XA 4LG1A 4O2ZA 4DA4A 4F7JA 2OB2A 3IDPA 2NXEA 4J7BA 4UXQA 2BR4A 3UIBA 3DUWA 2PVNA 5FQNA 2P3QA 4RVHA 1Y57A 2IZTA 4X2FA 1IEPA 2QKRA 4EOLA 3NUUA 4IZYA 3W8QA 3ZO3A 1FBNA 4BCPA 2GA9A 3D7ZA 3W2RA 1W8CA 1QCFA 4PWYA 2NYUA 3CTJA 2ITPA 3CKXA 3RJCA 1SNXA 2UYQA 3IV6A 4CT2A 3HAMA 5M08A 2BHEA 4NW6A 4Z2YA 4GK2A 1J3HA 4C08A 2O5KA 4KIGA 4BZOA 5DR6A 4IZAA 4HVIA 3P2EA 1SM2A 1GNGA 3CY2A 4APCA 3LCDA 3THSA 1JSTA 4GOMD 2PLWA 2R3KA 3AC1A 4C61A 1W7HA 2CGUA 5I9UA 4FV5A 4D4RA 1CTPE 1KE6A 2OU7A 3NCGA 5ETAA 2UVZA 4K77A 3ALOA 4PL3A 3ZM9A 4C4EA 2W1IA 4XLVA 3UGCA 1B42A 4RJ3A 5GIPE 3O4FA 4CKJA 4IV0A 3E23A 3F6XA 3RPYA 3O96A 2BR3A 5AX9A 2X2MA 5DM1A 5E8SA 1U4DA 3A4TA 2X8DA 3R9NA 1Y8GA 2FCAA 3OWPA 4GIIA 4YUWA 3R9DA 3LPBA 4TYHB 2GAFA 4AW1A 1R8XA 4YLLA 3CKWA 3P23A 3QD0A 4Y30A 4A6DA 2JITA 1M2PA 3GENA 3LZBA 2VDWA 1XHAA 3KQVA 3EN7A 4E6CA 3BIZA 5CQUA 3PXRA 2OO3A 3EEYA 2C3IB 4O0UA 3CCNA 3L8PA 4F9CA 1LEZA 2CCHA 1LPUA 4XBUA 4EH7A 4YO4A 3T7TA 2UZDA 3QFVA 2Y6MA 3Q6WA 4XRLA 5HCYA 3V5QA 3CGGA 3OHTA 2ITZA 3OXIA 4MNEB 4TY1A 2GSFA 2HWPA 2XUUA 4ZTSA 4ZMEA 5L2WA 2F7EE 4KDCA 4CD0A 3QCSA 3CKKA 3KPJA 1OIQA 4RJ7A 3I5ZA 5GM2A 3PX3A 1NV9A 4UALA 5KS2A 3OOGA 4FSQA 3NIEA 2NP8A 3MW1A 3H10A 4CTJA 4BC6A 2UW7A 3TV6A 3D5VA 4AX8A 2HR1A 4JBPA 5IA2A 3OTVA 3HZTA 4UWBA 5EQPA 1N7JA 4ZAUA 4WUAA 2C7RA 1LUFA 3ZBFA 1SNUA 2PX5A 4YV2A 3LQ8A 4FT2A 3OWJA 3BBTB 5HBEA 1G60A 5U4XA 4FV6A 4PNIA 4KIQA 1Q8TA 1OVEA 2BRGA 5AP4A 4BKJA 3IW5A 3FLSA 3TTJA 4DEHA 3LBFA 3S95A 1D2CA 1P2AA 3KMWA 4FKVA 3F3ZA 3FHIA 4EEVA 1Q62A 2ZSUA 4DG0E 5JRQA 2XK8A 3KCKA 1URWA 2LAVA 4HNIA 1U59A 1AGWA 4WG4A 3HRCA 3L9LA 4IVDA 4BDCA 2WMAA 1B38A 3CJFA 5M09A 2XMYA 2QCSA 4CV9A 5BVFA 1PF8A 3L9NA 3QXOA 2ZZKA 4AZTA 3P71T 3FMKA 3KVXA 3HV3A 4FSDA 1PXOA 2ZYBA 5JGBA 1AQJA 2ZMDA 2I6LA 3FQEA 4XUFA 5E8JA 3VYWA 4C3FA 3EVZA 5D7VA 4U9AA 4GKIA 4O0WA 3R7EA 2ZV9A 5CVDA 1BI8A 2BH2A 4ANBA 4GEOA 3UOLA 3QZGA 1NT2A 3EVBA 3NPCA 3Q52A 3ODYX 4FK6A 4R77A 3O23A 1NXKA 3EPPA 5EDRA 3PP0A 2PXXA 3HCCA 2X4FA 2ZOQA 2Y9QA 4TRLA 1UIRA 3ANQA 3DFAA 5HBHA 3ZMMA 3MGYA 3MYGA 3OCBA 1G5SA 4M15A 2GNLA 4AUAA 5KHWA 3FLQA 4ATNA 3E8NA 3DS6A 4RX7A 5HVJA 5BYZA 3PX2A 3FJQE 4FGZA 4AE9A 1M7NA 4M12A 3W2SA 1VZOA 4I5HA 5AUVA 3SQQA 1MRVA 5E1MA 1OL6A 4BTJA 1KIAA 2E9OA 1YKRA 2QQ7A 4PP9A 4AACA 3I6UA 4BDFA 2JHPA 4ZTBA 2WFYA 3F3VA 3FYCA 3ELJA 3PP1A 5FD2A 3TKAA 2R3LA 1INLA 3AC5A 4F0GA 2OZOA 2C1AA 2C5XA 3AT2A 3Q5IA 1RDQE 3TKUA 3OPNA 2F49A 5K5NA 1HNNA 5EMKA 1F0QA 1F38A 4G5PA 4FSUA 4HVHA 2QOCA 2I62A 2BRBA 2XYQA 2UZUE 4QYGA 4DGLC 2BZIB 1WS6A 1TW2A 2OYRA 1PMEA 3A8XA 4C34A 3DMGA 3G8AA 4HCTA 4IB5A 4S2ZA 3E3PA 4BCMA 4AGWA 3QBNA 3QC9A 3MA6A 4GUBA 4FG7A 3ID6C 3R8VA 4F4PA 3LKDA 3JYAA 3OG7A 4JRNA 4C4FA 1OKVA 4F6WA 2B2CA 3S4QA 2PX2A 2XYRA 4HC4A 5KMNA 4PYMA 2IBTA 4F1OA 4KBKA 2PVHA 2PYWA 1FGKA 2IVVA 3DBQA 3MSSA 4PMTA 5EYDA 3FL4A 3ZHPC 2BMCA 1LP4A 5KHXA 1TPYA 2NXCA 5EEHA 2UYHA 4I6BA 1WG8A 5FULA 4DG2E 4RIYA 5IEVA 4G1WA 5BX0A 3U6IA 1NV8A 3NYXA 5AV4A 1H01A 3BYSA 4L68A 3FXZA 3ER8A 2JD5A 4WG3A 1RE8A 5D41A 1WBSA 3SV0A 3TZ9A 3BXOA 3LSTA 3HMPA 4WUNA 5HG8A 5AM6A 3QQKA 1OI9A 4IAZA 3W55A 3FY2A 4ZY6A 4V0GA 3SSNA 3TTIA 2B9JA 3FC2A 1FVVA 4B7TA 3CPBA 4CRLA 2RFSA 3CJTA 5FUBA 3DV3A 3FI2A 1YWRA 3GCUA 4EOMA 4C06A 4IAKA 3O17A 2ONZA 1XWSA 1ZY4A 2W4JA 3B3FA 4DM3A 3PWDA 1OBGA 3QQGA 5HKMA 2ZLBA 4KUJA 3ZXZA 3EH9A 4Z9LA 3C3PA 1Q8UA 2OKCA 2G15A 1YRPA 4QMVA 4QQCA 5IMEA 3RM7A 4FIFA 3BYUA 4J96A 4QPAA 1S9JA 4HVGA 4RC2A 2YTZA 4TPTA 3DBDA 4DF3A 4LUEA 3UVPA 2VTLA 4FIIA 4CXAA 3CTHA 3GI3A 4BR3A 3A2CA 2CMWA 4EOIA 2CL5A 5DM0A 1MUOA 2JAVA 1YQJA 3CY3A 3EYGA 3KMUA 4FTLA 2WA1A 3A26A 3LIJA 3VUKA 2EJTA 2PMLX 2PX4A 1JG1A 3ACJA 2BRMA 2ZBQA 4UB7A 2XKDA 5K01A 2XKEA 3OUNB 5DYJA 1Q8ZA 4FGBA 2YIQA 2AC5A 4D55A 1FQ1B 2AC3A 3EGVA 3R9OA 3GT8A 3P79A 4AGUA 3SA0A 4M38A 3SHEA 3S68A 4CV8A 3D15A 5CALA 4MHTA 2HOGA 4XP2A 3SXRA 3CC6A 4GUEA 4CTCA 3OZTA 2BZKB 5K9IA 3DLIA 2DS1A 4GC5A 3KU2A 5T6BA 5KVAA 3ORLA 3QTXA 2OF4A 3F2AA 4UEUA 2AZTA 3N4TA 3FPHA 3FWQA 5EI8A 3T7SA 4WRSA 1EG2A 4JBQA 5FBOA 1SVUA 2W4KA 3OWKA 5K0BA 1T43A 2UZTA 4ACMA 4H0NA 2P4IA 3KQ7A 3OW4A 4YHJA 4RTLA 3TIYA 2NPQA 2W5AA 2WMXA 4QP2A 4YHFA 2ORED 1VYWA 2ZCJA 3BE9A 4A4OA 4DN5A 5FXRA 3KF7A 1U54B 3I53A 2VWIA 5HO8A 2HZ0A 4O0TA 2CHLA 2G01A 2Z02A 3BLRA 3F5GA 4GFGA 4LOPA 2UW5A 2VWWA 3LOKA 5AUYA 3ZSHA 2IH4A 5F94A 4RVMA 5FXSA 2PVMA 4IX4A 3VJOA 3UOKA 2HNKA 3BHVA 3I5UA 2J9MA 1OR8A 5EIWA 2GNFA 4H1JA 1PXLA 2H96A 3HRBA 2P3LA 5K0EA 4RWZA 4FEVA 3WE8A 4NL0A 4DG3E 1XH6A 3KULB 4FTJA 4O22A 4U80A 4UY9A 4AA4A 1CMKE 1XQZA 2JH8A 3R1NA 3G5TA 5FCDA 2ITTA 4HGSA 4KRGA 3NRMA 4E4NA 3I81A 4RFMA 4TYEA 5AM7A 3JUHA 1OL5A 2J0LA 1FVRA 4NYEA 3M6VA 4R7IA 3BRBA 4D0WA 3MQ2A 3MIAA 2VN9A 4J8MA 2XK6A 4FSXA 1K9AA 5DBXA 3ELYA 4PONA 2ITXA 2VWZA 4LI5A 2WU6A 2C0OA 4NU1A 2BZHB 4D9UA 2YVLA 3C4WA 3F5PA 4V0QA 2HWKA 3HL7A 4G3GA 3R6TA 4WHZA 3SX9A 4EJNA 4PMPA 4JL9A 5CNNA 5E2AA 3BYVA 3KKZA 4YJNA 1HCKA 3GU3A 3KCFA 5IQEA 4RTNA 4K11A 3BQCA 2GTMA 3E7OA 4NM3A 1IRKA 4EKGA 4IM0A 5HLPA 2A2AA 3HVJA 3ZM4A 3PXZA 4RBLA 1H1WA 1MRYA 3F2NA 2W96B 2XNPA 3LMIA 4IANA 4YPSA 3G0EA 4DGMA 5M53A 4I41A 5E1SA 3HEMA 2XBMA 4FTIA 4XNEA 2JDRA 4FODA 3E62A 4EUTA 3VSEA 2BFYA 4L00A 2PTKA 3FSKA 3UJ6A 4LL5A 4FYOA 4FKOA 2VO6A 1IAJA 3OD6X 3TEIA 1YHVA 4BDJA 4FP9A 4GBED 2E5WA 3D2IA 4M3QA 1PY5A 4RX8A 1E9HA 5JSMA 4M7RA 5CAOA 3C0KA 1V0PA 3AD4A 5AP5A 3T3VA 5K0JA 2JKQA 3UIUA 3CIKA 1MHTA 1H28A 3PPKA 4GK4A 2OI4X 3QUDA 3A7JA 3H30A 3IONA 2IIPA 5EW3A 3FUWA 3KQOA 5MHTA 1OPJA 3LJ1A 3I9FA 4D1SA 3PSBA 4IB0A 2WEIA 4KS8A 2WQBA 3FXWA 4KWPA 4ZY4A 3P0MA 5AUZA 4E73A 3ZBXA 4GVJA 3H3CA 2UW9A 3Q9WA 2VTNA 4X2JA 4A4XA 4UZDA 1L3CA 5L2IA 5HIBA 5LMAA 3GBZA 5G1XA 3W1FA 2YAKA 4BCQA 5BNJA 4L01A 5C1IA 2EVAA 2A1AB 5A14A 4QMSA 5F2NA 5KMLA 4F09A 4N57A 3HTXA 3BGIA 3LXNA 4AOTA 4TNBA 3MAGA 5CXHA 5M4UA 3GRRA 5KQRA 2C7OA 3FMMA 3V5JA 3DKCA 4BGGA 2FK7A 2PT6A 2UZWE 2WMQA 3DLSA 3C5UA 3O8UA 4JIKA 5HOQA 5H8GA 4U5JA 4R7BA 3E64A 4ZY5A 4ANLA 4CFMA 3FZRA 2XNBA 4QTDA 5CVGA 5DT4A 4CNHA 4FZ7A 3VO3A 3OOMA 4ZP5A 4RIOA 1ZQ9A 2R3IA 3FBVA 3TNHA 2OGVA 2XEYA 5DR9A 4Y95A 1ERKA 3FRHA 3VWAA 4A9SA 5CU2A 5EHLA 3LQ5A 2RL5A 4BTFA 1UVRA 1VLMA 3BLHA 1U2ZA 1P4FA 3MJ1A 4L43A 2XVDA 5J1WA 3NDIA 4MH7A 2JIVA 1JQ3A 3EVCA 5AWMA 3NTVA 4ZTNA 4AAAA 1GIHA 2ITOA 3KL8A 1HMYA 3EQDA 2JDOA 3CCFA 3HP2A 4U0IA 3G2QA 5C01A 3QKMA 2RKUA 1NW3A 1KYZA 2P55A 1GY3A 5CYIA 4F63A 1NW5A 3OBGA 3WF7A 5IDNA 1DAWA 2JKKA 4IWDA 4YC8A 4BCIA 1ZGAA 2VP3A 2Z7QA 3FPMA 2C4GA 3KXHA 5DX1A 1FJXA 4PRJA 5FTGA 3ERKA 4P7EA 3W8LA 2XNOA 1A48A 3AT4A 2KW5A 2I0HA 4EH4A 1DS5A 1XDZA 4IWQA 5CXZA 4DGGA 3WARA 2VX0A 3SRVB 5ICPA 3S0OA 2IZRA 2PZPA 1XBAA 5EOBA 2EG5A 4J97A 4LOOA 4AW5A 4KB8A 3HCDA 5BMSA 4YU2A 2J51A 4QRCA 3UNKA 4DH5A 4W4VA 4FUYA 4IW0A 4L3JA 3C4FA 4U8ZA 3SAYA 2QRVB 5LQNA 3P2KA 3NIZA 2C7QA 4O83A 4PL4A 4D4SA 4OLIA 3ZSGA 5CLPA 3PRIA 3MVLA 3T3UA 3GXLA 3EFWA 1X8BA 3KKVA 2JH9A 4W4XA 1G8AA 5BVKA 2X7FA 2QO7A 3FUUA 2VZ9A 3EQGA 4XOZA 4D4YA 2GS9A 1ATPE 3QTWA 1QAOA 3MTFA 3R04A 4X7QA 3PT9A 5HG5A 2UZ4A 4QMTA 3UP7A 4MBJA 3Q5ZA 4FZFB 1L3RE 4GRBA 3UZUA 3ORTA 1ZMUA 3DXNA 5CSXA 1D2HA 1XO2B 4YC6A 3DZOA 4M8TA 4XRJA 5J9ZA 3CTQA 5EGSA 2Y1WA 4NM5A 4YURA 3LVPA 5EKUA 3D14A 2FUMA 1JTFA 4AN9A 1ZYDA 4LV5A 3HUCA 1ZGJA 4DGOA 2O64A 4ZK5A 2BKZA 5A6NA 3UO5A 2JC6A 2YM6A 4RLLA 2V7EA 4BCJA 4BI0A 4EK9A 5E8YA 2EB2A 4BDEA 5H9BA 4FUXA 5KE0A 5GINE 2GHMA 4ZSJA 4ER0A 4XUCA 4RLKA 3MBLA 3QHRA 4MYGA 5CEKA 4TWCA 1UKHA 2WMTA 2X9EA 5E8WA 1HOWA 4MCVA 4CLJA 4J95A 3MI9A 2G1PA 3N4UA 4GJ2A 4D9TA 3QWJA 4RA4A 4I6HA 2E2BA 4IDVA 3THBA 3E92A 2AN3A 2XBJA 5K3YA 3LXLA 3UC4A 4M0ZA 4NECA 3W2PA 4PUZA 3AC3A 3VS2A 3BGDA 1NVSA 3PPJA 3KRLA 5HG9A 1BUHA 2ITYA 2IO6A 3BZBA 4EOJA 5HI2A 4BIBA 2C7PA 2FA2A 2RGPA 3OUKA 3AD5A 4QMYA 4WD5A 2BHHA 1OL7A 3GCZA 4YJSA 3GVUA 5A54A 3CBLA 4XG4A 4HGLA 3GOPA 2QO9A 5L8KA 4KA3A 1JG4A 4JQ7A 4AZEA 2WO6A 5LMKC 3ULIA 4IWNA 2ERKA 4FZ6A 5LXMA 4ISCA 2Y4PA 2R3MA 5CU6A 2WZJA 5DH3A 4IVCA 4E1ZA 2W06A 1OECA 4FSMA 4GSBA 3R1QA 2BIYA 3GO4A 4PGGA 3E3BX 3NUSA 3R22A 2XK9A 3CVOA 2VTTA 4GVAA 4RPVA 4U81A 1T46A 2IPXA 2AOTA 2QOLA 4ER7A 4IB1A 3TRKA 3PYYA 2YIXA 4IJPA 2FSMX 2OIDA 3KXMA 4O0SA 3R8PA 2C6DA 5IA4A 3HCBA 1YXSA 1H27A 3OF0A 4ASXA 3NNUA 5HIMA 1OPLA 5E9QA 5JQ5A 5AP3A 3ZUUA 3PPZA 4O7SA 4O91A 2XM8A 3EZVA 3VC4A 1FP1D 4FTMA 3R63A 4W4YA 1WCCA 2V5QA 3ZH8A 4X41A 3SRVA 4K9YA 3ENMA 3R7IA 3AXTA 3OFKA 4IV8A 3RODA 3ATSA 4JDKA 4RVKA 3DR5A 4HOKA 5DRYA 2PJDA 3BGPA 2VX1A 3FQSA 5CU0A 2QE6A 1SVGA 2PVKA 4EORA 5B2KA 4CFFA 2W1GA 4DEEA 3KR2A 3SC1A 1XKKA 2FYSA 4BF2A 4F70A 5K5XA 5L8LA 3I0OA 2QM3A 3EN9A 3UA3A 4IADA 3VQUA 4E32A 1XBBA 2UZVA 3GU7A 3VUGA 5KQSA 5CSPA 3VULA 5C27A 4E5WA 1E1XA 5CX9A 1B6CB 4WNMA 2OZVA 5E8RA 3BV3A 1VP3A 4DMGA 5BUJA 3QXPA 5IQBA 2J0IA 1CDKA 3BELA 5DX0A 4XHKB 4XV1A 2VTPA 4QMPA 2WTVA 5M44A 5CVUA 4MD7E 3WYYA 3VIDA 4JR7A 4XYFA 5CANA 2CMHA 4E30A 4K8AA 4Y73A 4PGHA 5JUWA 3GUBA 5D12A 4IC8A 4L6QA 4RJ6A 4F85A 4OBWA 3O2MA 4EOSA 3TZ8A 5LVNA 4J52A 1YHWA 3QWKA 4QTBA 1ZOEA 2WMSA 5HVKA 4IBMA 1UA2A 2XRUA 4BGQA 4EK3A 4F9AA 5TKDA 5DEYA 2R2PA 4N6YA 2QONA 5BUEA 3U6HA 4EOKA 1Q99A 1NBHA 1QZZA 2J5EA 2YR0A 4FTKA 2B9EA 5AP2A 4MXAA 1XBCA 3R02A 4BDGA 3QOXA 4V0RA 1IASA 5DXJA 4U6RA 5BW4A 2YXLA 3R73A 2WMBA 3WZUA 2SRCA 2NRYA 3TNPC 1DUSA 2BCJA 3HA8A 3LAUA 4E4LA 3BKWA 4MQ1A 4RC3A 2OY0A 4E8AA 5AP6A 3TNIA 3V6RA 3JWGA 4ZS4A 5K8VA 2CKDA 4EQUA 4R5SA 4YJUA 5EPEA 4RX9A 4WOVA 5ACBC 1TKIA 2VTJA 1JG3A 4D28A 3TIZA 2OSCA 4QPSA 2G70A 5ANJA 5AUXA 2P2HA 4GV1A 4Q5EA 5TT7A 4C37A 2VV9A 2XRWA 3TJDA 3UTOA 4GJ3A 4LRKA 3ANXA 2GPHA 3UIXA 2YX1A 3LDFA 4UYAA 4MXCA 2HV9A 2Y6OA 1WVXA 5GJFA 1DI8A 3TZ7A 4ERWA 1Y8YA 3PY0A 3IECA 4ANMA 4Z7GA 5IUHA 2Y1XA 5F2KA 4QYHA 5EQJB 1LEWA 4CWAA 3AOXA 3BU3A 4R7HA 4YO6A 2VWYA 4HGZA 1JNKA 3FV8A 4JR3A 3D9VA 2BAJA 3MFUA 5A4EA 3P1AA 5DE2A 3NJRA 4AGDA 1L3BA 1YDSE 4YTHA 3LFBA 3ZXTA 4IJ9A 3D0EA 4HYSA 3V51A 2BTSA 4EOOA 3TI1A 4OBXA 1JKKA 2XYUA 3QLGA 5E92A 5AV3A 4CKEA 2CDZA 4FX3A 3BYOA 2BZGA 2FK8A 2N47A 4X60A 3GOKA 3PXYA 3UMXA 2P3OA 3HM2A 3VBVA 5I5ZA 3PE2A 2O0UA 4E2ZA 1SYKA 3TNQB 4BDAA 1NVQA 4ZMFA 4QMQA 1FPUA 5L2SA 4R3RA 5K09A 3SR4A 1SZMA 2C5YA 3LXPA 4G9CA 3KXGA 4FVQA 5CSWA 5EKNA 3UO4A 2XH5A 3BLQA 3I6WA 1XDUA 4YV1A 3UBTA 3MH0A 5EC8A 5LR6A 1ZLTA 3KN5A 2XJ0A 5CNOA 5JMSA 1WXWA 1XH8A 4L9IA 4TL0A 3QGWA 4BICA 4ZLZA 5HD7A 3RM6A 3U8WA 2QC6A 3KQMA 2PPQA 2Q0NA 4ZTMA 2GLUA 3UJ9A 1WAKA 1H25A 4I6FA 5KBQA 4C36A 4ANSA 1JSXA 3PFGA 4RTSA 3FI8A 2HELA 3HLLA 3MJ2A 3PA5A 4EBVA 2B55A 3G88A 3Q87B 4J99A 3K5VA 2ESRA 4JXJA 4C33A 1J7IA 2FB8A 3KF4A 3GDHA 5JRSA 4S31A 4FV8A 4P7JA 3HNGA 3UA4A 2VNWA 2NP6A 5E4HA 4RTQA 2X39A 3FLYA 3G5LA 4AZWA 4MNEA 3W16A 3FUPA 1FMKA 3K3JA 3LCTA 4KABA 5I9ZA 3MY0A 3I64A 3E7PA 2BDFA 4EOPA 4E31A 4PDSA 4QQNA 3DNDA 3UJGA 2BIKB 4PF4A 3QC4A 3WE4A 4QTEA 4CT1A 2QR7A 3FZPA 3A61A 2WMVA 3MVMA 2AN4A 3GGDA 3IGGA 5P8WA 2X0GA 4H05A 1P14A 4TYHA 5LQJA 4QQJA 1OUKA 5LMBA 5C26A 4IFCA 3VBQA 3QU0A 4EKLA 2PK9A 2AOUA 3ORHA 3QL8A 5HU9A 3FAAA 3EHAA 4YV0A 4FI1A 2HZNA 3R7VA 4UWYA 2AOXA 3WIKA 4R6VA 4Y46A 4AFEA 3L9PA 3QD3A 5HNIX 3ZUVA 4PYQA 3T0IA 1ZRZA 1WFCA 3S1HA 2V7OA 1BMKA 2O05A 4C2WA 1NBIA 3WSTA 3OXTA 4EI4A 1OKWA 4U40A 3AXWA 2PXAA 2VAGA 3RMFA 2ZDUA 2B1PA 4R1YA 3LFCA 4XG8A 1ZZ2A 1KOAA 3HCAA 2JBOA 3COMA 3GQLA 2E9NA 4RIWA 1IAHA 3ZC6A 2R3GA 4FIHA 3UJ7A 3MDYA 4V0GB 3LFFA 3ER9A 2HXLA 4KKHA 3KEXA 1PXMA 3MVHA 4I6QA 5KMKA 5H8EA 2CMGA 3REOA 4CCBA 4TN6A 1AV6A 3QQFA 4K1BA 4LGHA 5AAEA 1LR4A 1R0EA 3G33A 3U54A 3GU5A 4HYHA 4BHZA 1RJGA 1PHKA 3CS9A 3ZEWA 4MNFA 3NW5A 1MRUA 5EHGA 5F9EA 2UYCA 4XP0A 5DIAA 2W99B 3KGAA 3LCSA 4WNKA 3AGMA 4U45A 4ZLYA 3NW7A 4QVKA 3F88A 2OZAB 3RHKA 3TJCA 4AOJA 4JNWA 1OBDA 4RTRA 4RVTA 5DTRA 5HZMA 3ZZWA 2WXVA 4AQCA 4QYYA 4EK6A 5HE3A 3E8SA 2PVJA 3ZS5A 4BDDA 1BX6A 1YOJA 2GCDA 4R78A 4WG5A 5ETCA 1PMVA 5LOHA 3BKBA 3GGFA 5L3AA 2H11A 4RTJA 3ERCA 2C6TA 4QP8A 3OY1A 1REJA 4WNOA 4P90A 4GF5A 3A7IA 3EZRA 4JBVA 4YTIA 2FSOX 4GYGA 5FXQA 1NE2A 1EQAA 1T45A 3PB3A 3UPZA 3PE1A 3OZSA 4FT0A 4FTOA 5H2UA 2XF0A 3KB7A 2PUIA 5FDXA 3V8TA 1H4LA 2W0JA 3VS5A 3F9NA 3NNXA 3PY3A 3D5UA 2REIA 3BWCA 3I79A 5LQFA 3G8BA 4DA5A 2O0LA 4DT8A 4OTWA 3ORKA 3EVFA 5DNRA 3LX6A 4JBOA 4PQNA 5FG8A 4L7FA 4L8MA 3MTLA 3Q9YA 1K3AA 3MPMA 4YUYA 1Q3DA 4BYJA 1R3CA 1Y91A 3QTRA 4YC3A 5DT3A 1WVYA 4JIAA 3DGKA 4B8LA 3GRZA 4DEBA 4RVGA 5EQYA 3UOHA 3X0DA 4NFNA 2HK5A 1RI5A 5C9ZA 5HCZA 4CXMA 2Z2WA 2B0QA 4RJ8A 4OBPA 4IX5A 3ZOSA 2IWIA 2B7AA 2QU5A 2ZWAA 1KE9A 3NAYA 1KP9A 4DFNA 4RZWA 4CKBA 2R3RA 4DKJA 2UW0A 3BGQA 3FZ1A 3BHTA 5DTQA 4PTGA 4TWNA 1QAQA 2Q41A 5IUGA 4KIFA 3DBCA 4L44A 4E6DA 2ETMA 2WAJA 3GC9A 3VBTA 2QOFA 1VIDA 3IEIA 5M4IA 4MWZA 3HMIA 4I5CA 2YM4A 1Z3CA 2Z6UA 2P35A 4FEUA 4C4IA 1RI4A 3A8WA 3DT1A 4UN0C 3VW8A 5C03A 3IW6A 3UYTA 5M07A 2JHAA 1JSZA 4MXZA 2PHKA 3BKXA 2OJIA 1ZY5A 4XG3A 3TPZA 2JBPA 3M4XA 5GJDA 4C3RA 3VBYA 1MQBA 2QHMA 3LFSA 3SSOA 3GFEA 1F5QA 3EMDA 2AUHA 3QALE 1XH7A 4W8EA 2CGWA 2QOQA 3I1AA 5JQ8A 3KMMA 1YOLA 4AFJA 5DPMA 5DEWA 1ZYCA 5CAVA 3LCVB 2WOUA 2C30A 2IJMA 4DFBA 4QP3A 5BPYA 3ZEPA 1M14A 2VTOA 3ZO1A 2I40A 3ULZA 3QLFA 4TTHB 5BMMA 4EH3A 1R0PA 2R3SA 1WBTA 3QQJA 3Q9XA 3MHTA 1L8TA 2H8HA 3G7UA 3DKGA 3DQXA 5J7HA 1GIJA 2I0VA 4OTFA 4YHTA 5IA3A 4EH2A 3HA5A 1UV5A 2YWVA 4AN3A 4CFVA 2HYYA 5D1NA 4EHGA 4KBAA 3NYVA 2EFJA 2VRXA 2AVDA 2C1BA 3QA8A 4YUQA 4E33A 5K0CA 1JSUA 4G17A 3AWIA 3D2LA 1OZ1A 3CQUA 2ETRA 2ONYA 4R8RA 3G51A 5DPVA 1X1BA 4CFUA 1TQIA 3R21A 5HQ0A 3Q7EA 3NCZA 3PA3A 3QZFA 4A7CA 1TVOA 5CAPA 4IAIA 4C03A 1ZMVA 3LFQA 3FQHA 4BTMA 3Q32A 2XIKA 4EC9A 5L2TA 4D5KA 5HBJA 4KWCA 5JFWA 4F7NA 4XH6A 3HYHA 4KVZA 2A27A 3GC8A 3RKBA 3VQHA 2AN5A 2A14A 2UVXA 1VBFA 4I5MA 2G8NA 4LYNA 3TUBA 2OH4A 3GXOA 1JKSA 3LCKA 4LMUA 5T64A 2VGOA 2C69A 2V0DA 4MQ2A 3UYSA 1I9GA 2ITNA 2PE2A 1R39A 2QOBA 2XM9A 2XZSA 3F3UA 3OFMA 4JX3A 4YGAA 4CFXA 4BI2A 5M4FA 2AS0A 3SD0A 3HVKA 2OXDA 3C50A 4ZZNA 3FTCA 4GOND 1YXTA 2WOTA 4YJPA 3V6SA 2JDSA 3UZRA 2VTIA 4OBOA 4FSTA 3KU1A 3P9KA 2AYPA 3ZLWA 3MWUA 1H1QA 4C4HA 5IQHA 4JQ8A 4ZEGA 4NUSA 2IVSA 3OU6A 2ZM3A 3EQPA 2WQOA 3M6XA 4FL2A 1OM1A 4IWPA 3I7BA 5CI6A 2VTAA 2BFXA 4BZNA 4BCHA 3TKIA 2R3QA 4EMSA 2A4LA 3R71A 5CU4A 1O9GA 3C6MA 1AD5A 5KZ0A 3EJ1A 5FADA 2W1DA 4LUDA 2PMOX 3P7AA 3PJCA 3ZFMA 4C62A 5LVMA 3NW6A 4FT3A 5CZIA 3F5UA 4ALUA 5C4KA 3RK9A 1L9KA 4IH8A 4KKGA 5LSAA 4YZDA 2V74B 1FGIA 3ZUTA 5ETIA 2WKMA 3TNWA 5DRDA 4RIWB 4G6OA 3OWLA 3QUPA 5M4CA 1GZNA 4RJ4A 4O0VA 4D2RA 5HD4A 9MHTA 3BWBA 5KMOA 4JX7A 3QV2A 4GCJA 5E91A 4JT3A 2VWUA 4H3BA 4M7IA 4MWIA 4XX9A 4R1VA 5DG5A 5IQIA 1UNLA 2JDVA 5IF1A 4QNAA 1M6YA 2PVCA 3CGFA 2GQSA 3BHYA 5DFPA 1G3NA 3RPSA 4HH4A 4FV4A 5C8NA 3PJ3A 1RI3A 2HW7A 3DOGA 1TQMA 5K0FA 2G2FA 2ZIEA 5IQDA 4ZTRA 3KQPA 3R8UA 1IY9A 4C4AA 4BBMA 3PDTA 3TN8A 3KXNA 2JGZA 4U3ZA 3PSDA 4O0RA 3R6XA 2WB8A 4FNZA 3PFHA 5EH0A 4FKGA 5HU3A 2OO8X 3SXFA 3SG8A 5EMJA 2VD5A 5GJGA 4P7FA 4FKSA 4JG6A 4DBXA 2EUFB 1Q61A 3D5WA 3SG9A 5LWMA 3NLBA 5D1HA 3R0TA 3FMNA 4RG0A 3RCDA 5IH3A 4C59A 2GQGA 2YCFA 2NRUA 4G5JA 1V1KA 4MD8E 4O81A 3WBLA 1IXKA 4POOA 3PXKA 2ZW9A 4FOBA 3OROA 5DGZA 2VO0A 3COKA 1H24A 3L8VA 4JG8A 2BILB 4KSQA 4DH1A 4F08A 5KNJA 3LM0A 1VE3A 4G3DA 5TF9A 4EK5A 2DUVA 2UV2A 3ZU7A 2R3FA 1RJDA 2I7QA 4B99A 5CS6A 1OIRA 5EYKA 1N2XA 2C3JA 4QP7A 5IA5A 1YF3A 3FKNA 1GJOA 2WNTA 4KIPA 4MVFA 4B17A 1PYEA 1EAMA 2WMWA 1YXXA 5DWQA 4X3FA 5LCJA 5HO7A 5M55A 3V8VA 3PJ1A 4QP1A 2JFMA 2HIWA 3R8ZA 3FRIA 4F7LA 2PVLA 3R1SA 3KC3A 4YJQA 4QMLA 4OT6A 4QO9A 3HECA 4RX1A 2GS7A 4PWNA 2YUIA 2I0YA 1WBOA 3CQEA 4X2GA 1PJKA 4MWHA 3AC8A 5LVPA 3A25A 3IGOA 4AW0A 2ZV7A 4ACDA 1Y6AA 4AZSA 1YFLA 4NJ3A 3DMHA 2V22A 1FMOE 1J91A 3OVVA 3GNLA 4M68A 3P5KA 4FL3A 1H8FA 3D94A 4OW8A 2YJRA 2VUWA 3DDPA 3NX8A 4OR5A 4AU8A 1KSWA 3PUPA 4LRMA 4PYKA 4NWMA 3DQWA 5L6PA 4F1MA 1U54A 2WTIA 4FR4A 4E4MA 5CCBA 2WTDA 3WZDA 3II5A 1R78A 4OGRA 4X3JA 4I1ZA 3LJ0A 4P4CA 3UG2A 3UVRA 4IZ7A 3GCQA 2E9UA 1KPIA 1STCE 4PMSA 3GNIB 4M13A 1FPQA 1H00A 2B4SB 4PDYA 4C35A 2YM8A 5LARA 4EH5A 4EH8A 2VS1A 1EJ0A 1R18A 2CJMA 2P7HA 5F95A 3JS2A 3MFRA 3ZYAA 3ZC5A 5CCXA 1ND4A 5A4QA 2IVTA 3ZFXA 4BDBA 2Y8OA 5FTOA 2R3OA 1WZYA 2YM7A 4FTAA 4APPA 1XR1A 5FTWA 4DZRA 4G31A 3KQWA 4E70A 3LJ2A 3MS9A 2YCSA 3PJ8A 4Y5QA 5AEPA 4MTLA 4FKTA 4YNEA 4R5YA 1DI9A 1O6KA 1SQFA 1R8YA 4C07A 4I23A 4ENXA 5HE0A 5B7VA 3BX5A 2ZIFA 2XNGA 3DXQA 1REKA 4GW8A 1I09A 2GFSA 1KV2A 3G2FA 3GC7A 3OCSA 3P7BA 4E26A 3UZTA 3DBFA 1VPTA 4QPNA 4Q2AA 3MY5A 5EQEA 4BCKA 2GFCA 1KYWA 3THRA 4IMYA 3F69A 5AV2A 3VF9A 4FG8A 2YISA 4P5ZA 5FP5A 4D4VA 3NUYA 3OCJA 3FTEA 1RJEA 4EQZA 2O57A 3PIZA 5DT2A 3OCGA 2ZZNA 2OPBA 4CFNA 4C4GA 2PXCA 4RYLA 5G02A 1Z9XA 3IDBA 5JN2A 4PCAA 3FZGA 3BI6A 5A4LA 4U97A 5AJQA 3NVKI 4YBKA 3FPFA 5HIKA 1Q97A 1WBPA 3FLWA 3EN4A 3PG1A 3MB6A 4RRVA 5T6KA 3O8PA 4U7PB 5FGKA 5HTBA 1URCA 4F65A 3JR1A 4MD9E 2G1TA 2X81A 3V01A 4YZ9A 5A46A 4K6ZA 5HIIA 2VWXA 4C2VA 1AF7A 3R2YA 4K18A 3ORPA 2XB7A 4NCTA 5B2MA 5L8JA 3FPJA 4Y85A 3N4VA 5GWXA 3QCQA 2Z60A 3TM4A 4PYNA 3DZQA 1BL7A 3UJAA 1ORIA 1QPCA 3V3VA 2O8YA 4JQEA 5KMJA 3A7EA 3VHEA 4BI1A 1BKYA 4FIGA 2O2UA 4NSTA 3U9NA 4BYIA 3IW7A 5IH5A 2AVNA 3RGFA 2XIXA 5EDPA 4RIYB 3ZO4A 2XVMA 3B3JA 2ZVAA 4PINA 3PXFA 4OTRA 4E6QA 5FLFA 4XCUA 2VTSA 3G6HA 1VL5A 2JHCA 3LBYA 1FP2A 5FA5A 5M51A 2H6DA 3FLNC 5EYMA 3HCEA 4HSGA 4QMNA 2H00A 3BEAA 5ANIA 2ITVA 3WF8A 1D2GA 3NAXA 4NT4A 3P8ZA 4AN2A 5BVOA 2WELA 3KRRA 4EHVA 4DGNA 4RVDA 5GNKA 3RZBA 4PIMA 1VR2A 4RC4A 2GNHA 3QRUA 4YNOA 3V04A 5AAGA 3UQCA 5AP7A 4FIJA 4LRJA 3NDJA 3VC2A 1R1WA 4NKSA 4PX6A 2VU3A 2WIHA 3GCVA 4S33A 5FUTA 2BAKA 2C0IA 4O84A 4XG7A 3RPVA 4ONAA 3R24A 3MERA 4IVAA 3OXZA 3VS7A 2YXEA 1UWJA 3RK7A 3DA6A 2FYTA 1XCLA 2C3KA 4F9BA 4EYJA 2J0JA 5CWZA 4C02A 2FGIA 1DAYA 4YLKA 2VZ6A 4FMQA 4FV2A 3ZRMA 5IQFA 4KRDA 4WBBB 1RJBA 2WTWA 3EGIA 1P4OA 3RPRA 5IH4A 2BR1A 3PTAA 3VUDA 1NA7A 4Q9ZA 3QUEA 4JRVA 1E1VA 4QP6A 2YJSA 3LMHA 3NNVA 3OTUA 4AZVA 1YZ3A 4DCMA 4ERKA 3EVAA 4YMJA 5HTCA 3UC3A 1XCJA 5HIDA 2GS6A 2UVYA 3BEGA 2VWBA 4FVPA 2YDKA 3NW9A 3VBWA 3V8SA 4FSZA 4IHPA 3UBDA 2X9FA 2OW3A 2PZIA 4IACA 4X6QC 4J71A 4B9DA 4JLCA 3VS6A 3QTSA 2V62A 4I0RA 4UBAA 1CKIA 4NTSA 3UNJA 5EEGA 2W17A 2B9IA 2C47A 2CN5A 2YIWA 3C4EA 4YJTA 1W0XC 1R6AA 4XG6A 4FTUA 5HNGA 3OBJA 4EHZA 3E7VA 4F7SA 3KPYA 3KFAA 3NUNA 1W98A 4DAWA 2YACA 2OB1A 2VDUE 5EIFA 3TMAA 4DQ0A 2OK1A 3EIDA 3E8CA 4F64A 5KX8A 2HXQA 5JGDA 5FWAA 5EMMA 1EIZA 2PUPA 3KR9A 5BXYA 2WQNA 1KWPA 4TZRA 5EM7A 5AUWA 5DWRA 3U4WA 3NYNA 4AS0A 2Z7SA 1XXLA 2PWYA 1YI6A 2WU7A 1ORHA 4LWOA 4OA8A 1OMWA 4YTFA 2AR0A 1BYGA 4LQMA 3LCOA 4YTCA 3GCPA 2ZB1A 4OBQA 5BVWA 3VAPA 5H8BA 5EOVA 2B52A 4YLJA 4O2PA 4RFZA 1KE5A 5ETFA 2WMUA 2OBFA 4DLJA 2OH0E 3MGGA 2QOIA 2H9VA 1IR3A 4ZZOA 1RI2A 2P3GX 5HG7A 3DBEA 4MF1A 4AT3A 2IZSA 4FE2A 4IM2A 2ONLA 3TDWA 1M6EX 3EB0A 3QTIA 1XVAA 4GG7A 1VQ1A 3CJQA 3ELUA 3R9XB 3H0ZA 4BIDA 3G15A 5HNBA 2EXMA 1J7UA 4MX9A 4E93A 3IK3A 3WF6A 2HY81 3E8DA 2GNIA 4I93A 1OKYA 2CGVA 3W2CA 1GIIA 3LLTA 4AZFA 3KREA 3JXWA 4GOOD 3A7HA 4X2NA 3OT8A 2PZ5A 3BHUA 4I92A 3IW4A 4FKWA 2Z8CA 3A62A 2C0TA 4L67A 3GU4A 2W1ZA 3DJ5A 3ATTA 3WYXA 5AUUA 4LV8A 1IM8A 5BUIA 2W9FB 1H08A 2I1MA 4DFZE 4C38A 4U7ZA 4LOQA 4PDPA 1V39A 3LHDA 3HA6A 1GAGA 5J5SA 5JGAA 2ZVJA 2C5OA 3KQYA 3C6KA 4GIHA 3DJ7A 4BTKA 3EKNA 3FYJX 3IPHA 4BDIA 5IQCA 5K0GA 3C0GA 3F66A 1H1PA 3EMGA 1PKDA 4FTCA 3IOPA 5DR2A 3EQIA 5LJJA 4EL9A 2NXNA 2GU8A 2FSTX 3O31A 1IG1A 4AG8A 3UQFA 2J0KA 3BUSA 1ZOHA 3C4XA 2Z6QA 4QDJA 2BVAA 4GS6A 4J8NA 4OTIA 4XUDA 2A0CX 3BPRA 3BV2A 2RG5A 4FT4A 4HPUE 3HVCA 4RX5A 4NM7A 2XIZA 2ITWA 2O3PA 4FA2A 4EWHA 5CAQA 3DLCA 4BP1A 3V8WA 5E2BA 2B53A 3AMBA 4IEBA 3G2PA 5EYCA 2F2UA 3O51A 3R7YA 3DTCA 4O7TA 3MN3A 2PVRA 4A9UA 3TV7A 3I5NA 5F4NA 2ACXA 5L6WL 4V05A 2B9FA 3K5UA 3NEWA 2C68A 2XIYA 4X3FC 4AWIA 3NZ0A 3G9NA 4KINA 5CEMA 2ZV8A 2O65A 3HCFA 5FP6A 4BDHA 3NUAA 4F1TA 2QR8A 3JVSA 5I9YA 3CD3A 3R01A 1NW7A 4FEQA 4QP9A 3AC2A 2QO2A 2PT9A 2X6EA 2IGTA 2XCHA 4AOIA 3DK6A 4JDJA 2RG6A 4RWIA 4TW9A 5DI1A 2PWPA 1Q41A 5BQ0A 4AP7A 4QMXA 2QVSE 3ACKA 4N70A 1Q24A 3C1XA 4HZSA 1OB3A 4TYJA 4DBNA 4TT7A 1CM8A 2JJQA 3Q2MA 3MA3A 1JSVA 2JAMA 3TV4A 1JR4A 3G5DA 2AOUB 3HKOA 4XS2A 3MCZA 3Q96A 5IDPA 3CPCA 3P9NA 4DCAA 5D11A 3LE6A 1M2QA 1UNGA 5DOSA 2BRNA 3TACA 3FPGA 4GOLD 3RWQA 5E8UA 3QZHA 4L42A 4FZAB 3L8SA 5EK7A 4QQTA 2IFTA 4U79A 5GOZA 5E9WA 3E93A 2F7ZE 5DA3A 2QKWB 3DXPA 4N6ZA 3AGLA 5JZJA 3PIXA 3RK5A 3I58A 4LL0A 2NP7A 4EBWA 2V7AA 3C0IA 4U43A 5AA9A 3M11A 3EVGA 5BP7A 1GZ8A 2BKKA 3COIA 1IA8A 2E9PA 2W5HA 2ZJWA 2XNNA 4O7RA 3BU6A 4EVIA 3CXWA 3DLZA 2BROA 2UW3A 5AP1A 5J8IA 3FC1X 4A6EA 3RAKA 3HV7A 3DKOA 1KE8A 3WF5A 2IP2A 4FKJA 5EZQA 3ZFYA 1RI1A 3QAME 3VUHA 3TWJA 2PMNX 3FEGA 3Q4TA 2FRXA 5FWDA 1H1SA 5KBRA 3T7RA 2X2LA 3CJGA 3F2RA 4KSPA 1UU9A 3FKLA 4J1RA 3BWFA 2DULA 5EFQA 4IX6A 2P40A 5BYLA 3P86A 2OJGA 4KS7A 4B4LA 2P41A 3AG9A 3JVRA 1R00A 2OFVA 4ZXTA 4Z3VA 2ZTHA 3PXQA 3M6UA 4ITIA 5JK3A 3C3YA 2PMIA 3EVEA 2BAQA 5E8XA 1X1CA 3CE3A 4CMUA 5B1SA 5KKRC 3PZEA 4HTFA 3S3IA 4V04A 5DRBA 3KVWA 1WBVA 4L3LA 2BTRA 1VJYA 1OIYA 2UW4A 4JDIA 4Y8DA 2PE0A 5CT7A 5G6VA 2AOWA 4HCUA 4O86A 4GFMA 4HJOA 3HEGA 3SXJA 3G89A 2QG5A 4F6SA 4X3FB 4GU9A 2BALA 4UV0A 3LW0A 4FSNA 1Q8YA 4YSMA 3ZCLA 4YJOA 5I9XA 2PU8A 5C8MA 1VYZA 4RMZA 5AIKA 3VNTA 4PNEA 5A9UA 3PS9A 2XA4A 2JIIA 4EYMA 3ROYA 4O7VA 5M57A 1WZNA 2CNVA 3JWJA 4FKPA 4X61A 5GP1A 2IH2A 2WQMA 2YDIA 5CENA 3QRTA 2W4OA 1OIUA 3V5WA 3P78A 3HP7A 3TCPA 5DRTA 3UDBA 1JKTA 1F3LA 3UJCA 5IG1A 2GB4A 4CEGA 4FZVA 5D9HA 4ANQA 2VTHA 4EHEA 3FL5A 2OIBA 1GZOA 1G55A 1XH5A 3K3IA 4HPTE 4IM3A 4IZ5A 3W33A 2YN8A 3BU5A 4FV7A 4AA5A 3NMUF 1SUSA 4LFIA 4HTFB 4XEYA 3MTEA 4I4EA 1G6Q1 3MCTA 2PUUA 4C3PA 4PL5A 4LECA 3B89A 2C3LA 4Y72A 4EK4A 2WTKC 3EN5A 2PULA 4O7WA 1MP8A 3ITZA 4S34A 4QYFA 3GFWA 5ANDA 4CQEA 2O07A 3PVWA 4ASDA 5CU3A 5EOLA 4G16A 1L1EA 3RI1A 4FV3A 4R05A 2CKEA 3SX0A 1YI4A 4O96A 1W84A 4I0TA 4DEIA 3R0QA 4MQ4A 2YAAA 3IKAA 1UWHA 4GMYA 3MVJA 4L46A 4AT4A 4FV9A 3HNRA 1MJFA 3BZ3A 5E8TA 1CSNA 3PLAE 4YP8A 4MK0A 3LM5A 3DOUA 4O82A 4P7GA 4LG4A 3JY9A 3AXSA 2XKFA 3PY1A 2H1RA 5CEPA 4ALWA 3GC0A 4EUUA 1JQEA 2G71A 1ZYSA 4DLIA 4DTBA 3MESA 4DC2A 2VNYA 4L7SA 3L1SA 3A27A 4IKPA 4CGAA 3MTIA 3P97A 1JBPE 2WQEA 1J7LA 4RTPA 4E5BA 2EXCX 2JIUA 4OUCA 5IQGA 1YZHA 2OKRA 2VTRA 1YFJA 5EI6A 1BI7A 2X4ZA 3N9XA 4PTEA 2OXXA 4ACGA 3PFQA 2OWBA 3DMFA 4RSSA 3OE4A 3IO7A 5EM6A 2OICA 2QNJA 2XBAA 3JY0A 5T3QA 4A07A 5KKRB 4XJ0A 1KHHA 3FZTA 2PKWA 3H2BA 2VTQA 3E88A 3Q6UA 4DH7A 5CASA 3EMBA 3MPAA 5E1OA 3PTGA 4BIEA 1SMHA 4L7VA 3KXXA 3F3WA 4XV3A 5FRIA 8MHTA 4H36A 3E8EA 2R7IA 4ACCA 4C7TA
chains in the Genus database with same CATH superfamily
5K0SA 2Z2YA 5JYEA 1C0PA 3K0HA 5K3BA 3G2MA 2JLVA 1O57A 4JHLA 2F9LA 3CR8A 4DSUA 3MCUA 2A1IA 3R3YA 3P0HA 4PC3A 5A4MS 3NRCA 3SBDA 3SEAA 2E87A 4EITA 4LFAB 4TMTA 1IB0A 2NXJA 3FPBA 1VEBA 1BXZA 4KCGA 5A3QA 5FEDA 3WZEA 1HF3A 4JWTA 3LY8A 3R3WA 2ZJ6A 4NFMA 3WNZA 1KSGA 2B9HA 2ZV2A 1P1JA 1LEHA 4O29A 2Q21A 3TLEA 3HE3A 5BSWA 2OLCA 4DFDA 2ZWVA 4IIRA 1H8EA 3N8DA 2VHXA 1KK0A 3RP9A 3ZWNA 4CKIA 1IRIA 2RFNA 3OCTA 3VU9A 1WTAA 1FFAA 4BLUA 2CLLB 5DO9A 2REOA 1FU8A 1T5OA 3LP5A 2XCUA 2H6EA 4YLYA 5F2OA 3C0HA 1F48A 4BFVA 4Q1VA 1LVGA 4O6VA 3TR5A 3IVAA 2UYOA 4EY3A 2IY8A 4G8BA 1KC1A 3O8CA 4OY3A 2O2EA 1OSNA 4E2YA 1WLYA 1XPUA 5AXAA 4RORA 2J2IB 4BBAA 4J3FA 1KK3A 1DM2A 2H2WA 2DBZA 3KCNA 3HXOA 4XMOA 3NH6A 2OQRA 3E7DA 2B20A 2P2IA 4L2IA 5TMBA 1YOMA 4NKAA 4EQCA 2QRJA 1QPBA 2HBYA 2ZSIA 1SULA 1CUVA 1LDGA 2JFUA 1Y4SA 1RW8A 2PTGA 1ZCBA 1N2HA 1AO3A 2MINA 4DE4A 4IGIA 1SVOA 1K5GA 3PJ2A 3LZ6A 4K28A 3F7ZA 1JHAA 4F56A 1F3MC 3OSZA 2DGDA 1P1HA 4EONA 5LCKA 3DZHA 4ZV7A 5E1DA 1IEWA 3PKJA 3RCJA 1P29A 2K87A 4JKIA 3F7WA 3ETGA 2HJSA 4NIFB 2NVBA 1XF9A 1V3QE 2C6IA 2R7LA 2GPJA 1U0HC 1M1YB 3I6MA 3GDGA 5K5EA 4BDKA 4OQYA 3GCXA 5KHLB 3ZVLA 3V5TA 4IHJA 3MFTA 4ENUA 1G20A 3BCEA 2YQ5A 3DXYA 3HMMA 4G3FA 4D8XA 5LLDA 2X9GA 2DYLA 4D3FA 5MF6A 2J9XB 4NNJA 5AIBA 2IN6A 1IY0A 5ES4B 3WL8A 1ZHFA 3P1JA 4AXDA 4FEEA 4LE0A 4KSBA 5KUPA 1LXCA 1EJ2A 3AJRA 4ZKEA 3T4EA 4LMNA 4HZRA 4HCJA 4PC6A 4NIMA 1KJWA 5AOBA 2J3EA 1ZJ4A 2TSYB 1R6DA 1LLFA 4JL6A 2R11A 2IXDA 2IZZA 2XXAB 4FDMA 4N5MA 4KW7A 2G80A 2NV0A 2NVUB 3HI4A 2I66A 4FTTA 3U13A 2CDNA 3WYCA 4ENYA 4XP3A 2DX7A 1LX6A 3ZK9A 2VXCA 2ZE8A 5TQ2A 1GAWA 2BFBB 4CCSA 4QJ5A 4UYNA 1KXZA 5CA1F 5KTPA 1B39A 1M1YA 3ORXA 2A58A 1RS0A 1J23A 5CCEA 3SNHA 1Z33A 2G2IA 5AW7A 2JI8A 4KLZA 4QTAA 4KXNA 2PGNA 4Z55A 3RNYA 5CAUA 3C1OA 3WISA 2HF2A 4YRJA 1OZFA 2JI4A 2Y27A 5CH8A 2FHPA 5CJ2A 1ORVA 1VL1A 5HM8A 3CO5A 4G37A 3U1BA 2XAUA 1YK0A 4PE5B 4ZYXA 3JPYA 4HDCA 2FO0A 4G89A 3JVUA 4KRCA 1JHRA 1ZC4A 1WHSB 4I1UA 3BWYA 4MVJE 3FSGA 4L45A 3A2LA 2J5RA 3GP3A 3VU9B 3TPCA 3UGKA 4GYIA 2GAAA 4WPGA 1G8HA 2FSSA 2IOHA 4QO7A 1RZUA 1P91A 2FRDA 4MWSA 3BXGA 3F6BX 4WFQA 1F8YA 3BFVA 2DZDA 4UDNA 1RQRA 2IHYA 4YJGA 4CU5A 1FVTA 4DBLE 4DH3A 1B8NA 5KZIA 3K1ZA 3A06A 2CLEB 4Z7QB 5JD3A 1EA7A 1LB1B 2XK4A 4A0HA 2D0DA 1N7GA 1LRLA 3VVHA 3A0UA 3V46A 5JAPA 4ARZB 1NJ8A 1EDEA 2YOFA 1CBUA 3OU2A 4I4TB 5BV7A 1WP4A 3MC1A 5KOJA 3ZD6A 4F8EA 3MCWA 1OGJA 2TMYA 2XZTA 5FOVA 3HB9A 3ED1A 1GFSA 1GA4A 4DSAA 5UKDA 3U6BA 5GM1A 1SIOA 1YZKA 3HDJA 1KJQA 3R8CA 5CCXA 2IVUA 4KKVA 3RTGA 1O6GA 2B34A 3SYNA 5LVLA 1QYRA 5CNJA 1OKZA 5FLEX 1FYFA 2JJ8A 4M1YA 4F0IA 2GPSA 1S1CA 2VX3A 4DTAA 4EUEA 3LFUA 4W8DA 2VCEA 3M3DA 1G38A 3W9BA 3HAVA 3KKEA 3AHGA 1OBCA 2FP3A 5LIRA 4KP7A 2A19B 4JUAA 1E7MA 2ZM4A 2WWGA 5IAKA 4JCOA 2CV1A 2D4HA 1AKEA 3E9RA 4QC2A 1UJMA 4AS2A 1LJUA 3QKLA 2D2VA 1E8NA 4UVGA 1PJZA 1KR5A 3ZS9A 4MTAA 2WAMA 1E0SA 3NHKA 3EXEB 5CVHA 2G5PA 4WFKA 3O03A 1M1NA 3ND9A 2J7TA 5GIOE 2AMYA 1B6RA 1PNVA 1G59A 2QLQA 3KZMA 1FJ2A 2OF2A 1TI7A 4US1R 1MABB 4MGKR 4AY6A 4X20A 1EM8B 1I3MA 4X97A 5HE1A 1V2GA 2C9ZA 3P0JA 3BILA 3O47A 1PTJA 4LG1A 3IDPA 3VPHA 1LK0A 1S8OA 1L9XA 1KVTA 1OB5A 1ONNA 1C9DB 3L8EA 5HSGA 1TJYA 1Q1QA 1U7HA 5A0VA 3WBKA 1JYSA 3UC5A 2PLWA 3N58A 4U2BA 4D4RA 2R8PA 4XLVA 1B42A 3QPCA 3MA0A 3WADA 4XTRA 1DHRA 3EHDA 4GKAA 2F8TA 3ZQJA 2C3OA 3P23A 3L06A 1TXGA 4WRRA 4O2BB 1Z2EA 3U4QB 1MN6A 1K5PA 3V80A 5B58T 4W5NA 2O2JA 1W49A 3OECA 5ES3A 3E1KA 2IYQA 2MDTA 3OWJA 2BCGY 1DAKA 2R65A 3IW5A 3M9XA 1CEXA 1U31A 4PM4A 4DPLA 2O8EB 1GNPA 2WD7B 3HJAA 1PF8A 4DQDA 2BEUA 3FHCB 4MV7A 3OJOA 4I4NA 3OPMA 4QREA 4KREA 2VPIA 2ZFYA 3B5EA 3G5UA 4G63A 1WRBA 2A9OA 3MYGA 4M15A 1CSEE 1PL7A 2O2SA 3SC4A 1KIAA 2HADA 1JZTA 3O3CA 3MINB 3BTSA 2I2WA 4J76A 4LYDA 5K5NA 1FTQA 1F38A 4EW6A 3RQIA 1F51E 1WS6A 1TW2A 2CLFB 5HJ7A 3E3PA 1JMYA 3R8VA 4OQNA 1I1QB 4II3A 3S4QA 4TMKA 4AF7A 4JJ7A 2PYWA 2JW5A 3RYFA 1GPYA 2FLKA 1KNXA 5L9AA 4C4PA 3M7IA 4I6BA 1E1MA 1DPFA 1P4HA 2P1ZA 4YBRA 4BUJA 4CMGA 3DM5A 3FXZA 1PG0A 3LSTA 3W9SA 1GVNB 3O1HB 1ECFA 2ACVA 5AJUA 1X74A 1BE1A 2RFSA 3DV3A 4OXXA 1DXYA 4BU1A 5T4HA 1E3IA 5JT1A 2C4HA 3L7IA 4KUJA 3V8BA 4QMVA 2ZUDA 4J96A 2YTZA 1U0NA 4JH0A 3ESBA 3HMKA 2D62A 1IHXA 4KBGA 3AWDA 2ZXUA 3KP1A 3EYGA 2R48A 1JG1A 2OHXA 3JRNA 3N2ZB 1WZ2A 1TF2A 5IXJA 3AFGA 3W7VA 4Z1OA 4FD2A 3CC6A 2ICAA 4GC5A 1Q17A 4LY0A 5KVAA 2YVAA 3FPHA 4G07A 1E5LA 3GLFA 4B8WA 4IFBA 1OUMA 3KLNA 2W4KA 4V3BA 4H0NA 2P6NA 3I32A 1X7XB 2ZCJA 3I53A 3LUGA 2HZ0A 2UW5A 5LUBA 5B3JC 2ODPA 4RF4A 5I51A 3KULB 2CV2A 1CMKE 3JQCA 2HSWA 1BKDR 3CNNA 4RYDA 2VN9A 2H1VA 3SXUB 2WU6A 2C0OA 2JLYA 1P77A 4J1QA 1N6NA 4JJ8A 1XU4A 3WV4A 2GTMA 5EJEA 2A2AA 2AV6A 4R7GA 4FMPA 3A4IA 4FDVA 4EDFA 2ZIXA 3MS4A 4D9GA 3KHSA 1U0TA 2JK0A 3C0KA 3GN1A 4HN9A 4RGVA 1H28A 1X87A 4HUQB 4QUGA 1XRJA 2CNWD 1VYVA 5FA6A 4LX0A 4ARSA 4EJSB 5KYTA 1G0OA 3ROTA 3AHFA 5CXHA 1QFZA 3D8HA 5AVYA 4IJMA 2JEYA 2FZ4A 3MGBA 4QBHA 1ZQ9A 1VRWA 2D5IA 2BFBA 2BBWA 1VLMA 2ZWOA 5J1WA 5AWMA 1M2OA 4JA2A 1OWPA 4KMMA 4HNGA 3GH3A 4U0IA 4DLBA 4QX6A 1NW3A 1GLGA 4MHOA 1GY3A 3K2EA 3JARB 2OUKA 1A48A 1OXMA 2KW5A 3V00A 1LV8A 1TQ2A 4RFSA 4U8ZA 3W3AH 3AUTA 2G4VA 1K6JA 3CLTC 1YJ5A 1X8BA 4DC9A 1RMTA 1XKQA 4GRBA 3E7WA 3GQVA 4YC6A 2RFLA 2CKMA 1Q44A 1Z18A 1NVXQ 4M87A 1N3IA 3H9BA 1NONA 4QARA 3IRUA 4WECA 2FLVA 4PGFA 4FUXA 4OHPA 4FX5A 4TWCA 2R8ZA 4XWWA 3DZFA 4MUYA 4GJ2A 4F4DA 1Q91A 3L77A 1HFKA 1L4FA 4REMA 3BH0A 3HXKA 2X41A 2Y77A 1MRZA 4MWBA 3BZBA 4EOJA 3BGWA 3BXFA 1S9DA 4JLDA 4COOA 1HE2A 2O8FA 1D7OA 4JC4A 3FVVA 4IS2A 2X0FA 1GKKA 1Q1BA 2I2XB 3TRKA 3PYYA 1L7QA 4JR2A 4N3GA 1OPLA 5E9QA 3QF7A 4EPWA 3RYFB 1QIIA 2HFJA 1AKNA 5KZMB 1TQHA 2WF6A 3AF3A 1QU2A 2V0CA 1XKKA 1CFZA 4RZUA 4JMLA 1AKTA 5EYPA 5IQBA 2V6JA 2JAOA 2UZAA 3FVTA 4YJKA 5DX0A 4QMPA 4L16A 3HEAA 4GEGA 1M2HA 3GUBA 4F2DA 4MO9A 1UDCA 1Y1TA 3QXHA 1VSBA 2C54A 4BDGA 4EVSA 3VJRA 1P4JA 1VKJA 2FQQA 2SRCA 2GJ9A 4WADA 5AP6A 3V6RA 1CY0A 4ZS4A 3U4AA 1QH1B 5ANJA 2VV9A 3RC2A 4Y98A 2G0AA 2VJCA 3I9V1 1Y8YA 4NXNB 3FE2A 2YWFA 3GAZA 2VWYA 4EZBA 4XIFA 1PJ2A 5ALUA 2FOLA 3FH0A 1JKKA 3H4MA 2YWEA 4CL3A 4MEAA 1BSVA 1CR4A 2K7FA 3TNQB 1G9SA 2QW1A 1KGDA 3L9XA 1RPJA 5CNOA 5JMSA 4L9IA 1VL8A 4YT2A 5F73A 2QC6A 3EOZA 4DWOA 4HLCA 4CMBA 1BHJA 2XB9A 3LCTA 2BEJA 2REXB 1ZK4A 5CDUA 3DGFC 3LWNA 1T6BY 3P9PA 4CT1A 1TM2A 2PRSA 4FVTA 3GGDA 4QRIA 2BGUA 2CK3D 1FFDA 2QQEA 4OXRA 3PNVA 4GMFA 2MR5A 2AFRA 2ZR7A 3K73O 1GO2A 4R6VA 4D41A 4EJ6A 1GAJA 1JNYA 2Y0CA 5BSHA 1N4AA 3SFTA 4RMHA 3HCAA 4BVKA 3OLYA 1LR4A 4MGYR 1I9CA 2ZANA 4AY4A 5JS7A 5ETJA 4CEJB 1CRPA 2QZSA 1OASA 5CB4F 2PSDA 1LS6A 4AYXA 1WHTA 3DLHA 2PVJA 4ZVMA 4RY0A 4GLFA 3SC2A 1RAFA 2P6UA 4QDXA 4FTOA 3KB7A 3GZTB 2I2BA 5K8LA 4TRMA 3KIOC 3TEJA 3PY3A 1QO0A 1RWBA 3KBOA 4OGGA 4UXIA 3EVFA 3NCHA 3FHTA 3LVBA 4L50A 5EQYA 4IX5A 4C76A 4ZCPA 1AY0A 2ZPAA 3FCUB 5M4IA 4I5CA 4FEUA 3IW6A 3BKXA 1ZY5A 3VBYA 4UNRA 2X14A 2PZJA 1P44A 3N8HA 4X3CA 5IAAA 1K8ZB 2DPHA 1H5QA 2F1IA 3QLFA 1ETUA 1Z47A 3CW2A 3L8HA 5J7HA 1WB9A 2JLRA 4BQEA 5D1NA 3O4GA 3MINA 2XD9A 1EVLA 4E33A 4G17A 2ZM5A 4QEBA 4RNCA 3DL4A 4XEHA 1LRKA 3TQRA 1UAGA 2CY0A 4BMZA 4EABA 3UYSA 2PE2A 3HZRA 3OEYA 3O8BA 4BI2A 4JQZA 1WDLA 3UZRA 5JY6A 1GOTA 2UUBB 3G2KA 2WF9A 3I28A 3MJTA 2Q49A 1FX1A 1OM1A 2XUDA 1F12A 4YJGB 5BRAA 4LUDA 3ISVA 5CZIA 2GAOA 2OORC 4MNTA 4YZDA