5GIOE

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 63
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gioE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gioE02
3E3BX 2LD4A 3T7SA 1ZYSA 4BBMA 2Q0NA 3OCSA 1AQ1A 1YI4A 2R3KA 3EZRA 4EZ5A 4B9DA 3F6XA 3PE1A 4U3ZA 4R7HA 2XK7A 5CENA 3IW5A 5ANOA 2VX1A 1Y8CA 4C2VA 3C5UA 5I4NA 2VO3A 3DB6A 3KXHA 3KREA 1PXLA 3PSCA 4FS8A 2GTMA 3SQQA 2BZKB 3QUPA 4JG6A 4YMJA 1OKWA 5K03A 3D5UA 4WO5A 4ASZA 2GNFA 4IMYA 2CN8A 4PP7A 3KR0A 5LCJA 2F8LA 4IVCA 2PVYA 1PMNA 4L9IA 4YTFA 5BP7A 1QPEA 2GA9A 5DM4A 4G3DA 4G56A 5KZ0A 3HA7A 4FNZA 4JIAA 4R7IA 4D2SA 4V01A 2QLUA 5LWNA 3ELUA 4S2ZA 4ATNA 4IZAA 3D2LA 5DLYA 4BRXA 5LQJA 3HEMA 3I6UA 3GENA 1NVQA 4HZRA 3E23A 4ONAA 1X8BA 3I60A 4FV3A 3VBQA 5DSXA 1L1EA 3Q4ZA 3R1SA 4KKEA 2BPMA 4XOYA 4L53A 2GTNA 3LXLA 4U3YA 4R1VA 2R7BA 5C0OE 4FV5A 3PS9A 4DLIA 2B7AA 4TKSA 1JSUA 3MGGA 3IW8A 3HVJA 4O0XA 5EZQA 3W2CA 3AMAA 5L2TA 1KWPA 4FSDA 5IA2A 3JVRA 2JG3A 3TG1A 4A9RA 5IEVA 1BUHA 5AWMA 5T6KA 4RA5A 2FO0A 4YO6A 3EL7A 4BCGA 2PUNA 4M12A 3KHKA 2CMGA 2PY6A 3D14A 4RC4A 4W4WA 2BM9A 4GK4A 4ERWA 3CY2A 2PULA 4M68A 3P9KA 3DV3A 2EFJA 2Q0BA 4MNEB 3W8QA 2BR4A 4GT3A 4FIJA 5FTOA 2YCSA 3GCZA 4U8ZA 3M70A 4PYLA 3S95A 3KQOA 2ITXA 4OTIA 4QMYA 4MXOA 2GH1A 3AXSA 2X6DA 4DEEA 3MH2A 5JFSA 4Y8DA 2GDOA 3DUWA 3G5DA 4IX3A 5LVMA 3BE2A 2VTHA 4BI0A 1ZMVA 3E8DA 3NW7A 2UYOA 1Q61A 4D28A 2ZIFA 10MHA 3F2AA 1JG2A 3CJRA 4C4JA 2HYYA 3LFNA 2GU8A 1ATPE 4M15A 4QPSA 5K9IA 2DWBA 2XNPA 1PRYA 5CQUA 5DEYA 2X81A 2DS1A 3QAME 2CMHA 4AN3A 4Z7HA 2DULA 3OCBA 1P91A 4UN0C 1UNHA 3VBVA 5DX1A 4Y46A 1ZY4A 2ONYA 2I1MA 5K0CA 3S68A 5K09A 2RG6A 3QD0A 3C0HA 3TZMA 1KE7A 4FKWA 1GOLA 2ZB1A 3P71T 5CEPA 1ERKA 4CSVA 5M5BA 3C7QA 1J1CA 4ZSLA 1B42A 4CVAA 1KXZA 2C1AA 2PX8A 3OXTA 3GJYA 5G1XA 1L9KA 2H8HA 4QMVA 4D4YA 2B78A 3EYGA 5BVDA 5AV4A 2O06A 4ZTLA 4QPNA 2FSMX 2IG7A 4E2WA 4G3EA 3KU1A 3WZJA 4E7WA 3VUDA 4JQ7A 4F0FA 2ZIEA 4HGZA 3D5XA 1JWHA 2E2BA 3SG9A 4XOZA 5DIAA 2G01A 5FWAA 4L42A 3I4BA 5CSHA 3ZRLA 5LMBA 2VWUA 2XYNA 3CKKA 3QL8A 4X1OA 4CD0A 3HMMA 3KF7A 3MERA 3GC0A 4F6SA 5DTQA 2CKEA 4C62A 2I7QA 4FSTA 2XF0A 3D2KA 4ZTQA 3WSTA 4HJOA 5CI7A 2PSSA 4X41A 3BV3A 4CNHA 5E9JA 2WZJA 5IQFA 3NWEA 1RQQA 2YM6A 3FC2A 4XV3A 5DX8A 4DCEA 2YHVA 2YCQA 3MGYA 2C6MA 3V3VA 1NVSA 3R9RA 4ZTHA 4RIWB 3A8WA 4JX3A 1WFCA 4CTJA 2B1PA 3LE6A 4R6VA 3ER8A 3L9LA 3NNWA 4L7VA 4GJ2A 2C6DA 2VNYA 4WRGA 3GU8A 3R9DA 3NYOA 4USDA 5D9HA 3THSA 3KGAA 3OP5A 4F9YA 3JUHA 3UYTA 3R63A 1PJZA 3LXKA 4I5CA 5E8SA 3FWQA 4UY9A 1IG1A 2VTLA 4MWZA 3Q9XA 3EPPA 2W1IA 3C3YA 5HCZA 3GNIB 4XP2A 2NPQA 3G8BA 3LLTA 1U54B 4B4LA 4YJRA 2W5HA 2ZW9A 3POZA 4O6LA 1VPTA 5EH0A 4D0WA 4AT5A 5EMKA 1RJEA 3FPQA 2XK8A 4FTQA 1UU3A 1YKRA 4YZCA 3TM0A 5IQDA 3H0YA 3ZFYA 3CBLA 3DBCA 4NM7A 5CXZA 3OZ6A 4BC6A 3PVGA 1JR4A 2WQEA 4TYEA 4I0SA 2CJMA 5F9EA 4RJ4A 3SX9A 3QRIA 3KVXA 4U44A 4PNEA 4HVSA 1NBHA 2C5XA 4O0YA 3CQEA 5LQUA 2YIRA 3NUUA 5CF8A 2CL5A 2Q83A 3ZTXA 2RFEA 4WUAA 3GRZA 4O22A 3DNDA 4PYMA 5EI6A 1NW3A 4FEVA 5EFQA 4BP1A 4IM3A 2GQSA 2ZBPA 4QPPA 1YOMA 3SG8A 4NFMA 5DRBA 4GW8A 2HNKA 1YOLA 2WMUA 4CFXA 4O7ZA 5FD2A 1KPIA 2XZSA 2A1AB 3E88A 1GAGA 4FX3A 3ZRMA 4PNKA 3QWJA 2PUIA 5GP1A 2VS1A 4CXMA 5HU3A 4I6FA 5GM1A 1G60A 3EVAA 1QANA 3WI6A 2UZUE 4OT5A 1NBIA 3GU3A 5ETCA 1PMEA 2IVTA 3Q87B 2X9EA 3V5LA 1SUSA 3G9NA 5BX0A 5EHYA 4D5KA 4YMHA 3NDJA 4GG7A 1XVAA 4EOQA 4FVRA 4I5HA 2XP2A 4ANBA 3KXZA 3ZUTA 3VRYA 2CGUA 4F84A 4QMLA 4IM2A 4DGMA 4XYFA 2CGVA 1ZWSA 5P8WA 3NYXA 3GNLA 4C4HA 4FSYA 3V6RA 4F64A 3BXOA 4GFGA 1JNKA 4MBIA 2QKRA 3QQKA 2BRNA 2W1FA 4TWNA 3TTIA 4D1SA 3DLCA 4CLJA 5BYZA 5AP5A 3TV6A 3FI8A 3FV8A 4GMYA 3IG7A 1XR1A 5FADA 4DN5A 3LDUA 1ZAOA 1Q8ZA 4YUXA 3W33A 4L45A 4IDTA 5LQCA 4HTFA 3MB7A 2J5FA 2R3FA 3EQIA 3A7HA 3EQPA 5ICFA 4FSUA 4EH8A 3MH3A 3R0TA 4U5JA 3LECA 3HNGA 3EVDA 2GS7A 2LGCA 4HYUA 2BH2A 3M2WA 2FB8A 2P55A 5BVKA 3OFJA 4IAZA 3DNEA 5EDRA 3MHTA 3LCDA 1J7LA 2YEXA 3LQ5A 2PVNA 4AN2A 2PE2A 1BKXA 2JIUA 4I1ZA 2XRWA 3R01A 1EQAA 3V5QA 3GQIA 4WIHA 4ISCA 3I5UA 4UWCA 1P14A 3QYZA 1VZOA 3L9NA 4FV4A 2I0EA 4HNIA 1URWA 3F7WA 3VQUA 4FTKA 3IHTA 2F57A 4YZNA 4LGHA 3MFUA 2VTQA 5JQ8A 1EH4A 4FKJA 2PZRA 3FY2A 4CFWA 4WVLA 3QCXA 5GJDA 2J2IB 5A3XA 4XS2A 2FVDA 4YR8A 2XS0A 3HV6A 3A99A 3C4WA 4E32A 1DI8A 3TN8A 4C36A 2NXEA 4MCVA 3ID6C 2JBPA 2UZBA 5DA3A 4B8MA 3DU8A 4BDJA 1L3RE 2C6IA 5KMIA 4M38A 3F2NA 3MW1A 4PDSA 3PP0A 1GZNA 1UU7A 3QQLA 3FMKA 3Q53A 4WG5A 4TZRA 3Q60A 5G6VA 4BTMA 2WTJA 5EEGA 5GIPE 5KX8A 4QDJA 3W2QA 2XRUA 2PZIA 4Z9LA 3ERCA 2R3LA 4QMPA 2OFUA 4YZMA 1H1DA 3VC2A 2QURA 2BZJA 3AJDA 3G5TA 5KBRA 3TQSA 1KPGA 2XYVA 4CWAA 4L67A 1YVJA 5BVOA 4H3BA 2YX1A 4YHTA 3U6IA 4U81A 4ZOGA 1XWSA 3NVMB 5JRQA 4J95A 4X61A 3F3VA 5EEHA 4L3JA 3GRRA 1X1BA 4IHPA 5E8JA 3MFSA 4C0TA 2BAKA 3TJCA 1ZYJA 5FLFA 5F4NA 3HCCA 3QRJA 3PPJA 1BLXA 5EPEA 4RWZA 3VS6A 3EJ1A 4V0GB 3H9OA 5HORA 4D2RA 3GCVA 3U6JA 4AGUA 4IANA 1W7HA 2XVAA 5DWRA 4R6WA 3LFCA 1R39A 5LMAA 2VO0A 2Y9QA 1K3AA 5FCDA 4KWCA 2JFMA 4F7JA 1YHVA 2Z2WA 1WBWA 3OVVA 3EN6A 3OWPA 3OHTA 5D41A 5DM2A 4IJ9A 2X6EA 1R3CA 2A27A 3ZLSA 5KMMA 2P3QA 3VC4A 5KE0A 4NKSA 5AADA 5IISA 3R02A 3F3UA 2WMAA 2VZ6A 3VBYA 4FTRA 4GU6A 4MH7A 1VE3A 2VO6A 3NZ0A 1XDUA 3R04A 4DCAA 4JL9A 2AOTA 3KY2A 1KE5A 4NZWB 4HW7A 5KYGA 4GKIA 3P7CA 3HV4A 2PV0A 2AOVA 1OKYA 2SRCA 3COMA 5CZIA 2ITOA 3KKVA 1OIQA 2QHMA 3VJOA 3CP9A 4W8EA 1H28A 5M56A 2AN4A 4NCTC 3DXYA 3DH0A 4XH6A 2X2LA 1O6KA 4A6EA 2OI4X 3AGLA 3FQSA 5DR6A 5HNIX 5HE1A 2UW6A 4IB3A 1VJYA 4UYNA 3B7PA 3BELA 4DCGA 3ZC5A 2X0GA 4UZHA 5HLWA 2PX4A 4AOTA 4AA0A 5EOVA 3MJ1A 4OTDA 4MXXA 4QMOA 1NW7A 2WMTA 4PONA 4P7EA 3UOHA 3FMDA 3BKXA 2HAKA 3ENMA 4FBXA 3TM5A 2XJ2A 3MVLA 5AUTA 4ACDA 5DWQA 4ANQA 2OU7A 2C7OA 3E64A 1OKZA 4QDKA 4PIPA 4M14A 1H1PA 3NGAA 3UMXA 3D7TB 3EQGA 5AX3A 1N7JA 5CZHA 1K9AA 3HA5A 5ICPA 1SVEA 3GQLA 4P5ZA 1YB2A 4LMNA 4D4SA 5L2IA 1ZGAA 5CAVA 5EOLA 3PRFA 3KXGA 3L9MA 4NFNA 4ZY6A 5ACKA 4XUCA 5IQHA 3ZXZA 3OY1A 4KKHA 1VR2A 4I0RA 4FTAA 4CLIA 3CVOA 1FP2A 3VULA 3VS7A 3RPVA 2JHCA 2QR7A 4V04A 1Z3CA 2QVSE 2RIOA 4I24A 3ELDA 4AN9A 3P1AA 5E1MA 3QUDA 3ORHA 4CFMA 5M09A 4PYNA 3OW3A 2ERZE 2WU6A 4OA8A 3T3UA 4FKLA 3OC1A 4PCAA 4JNWA 4RX8A 4HGSA 4EOJA 4J1RA 3Q2MA 2BZIB 3U4UA 3D0EA 1OIYA 4WSYA 3M1SA 2VRXA 1M17A 1M52A 1PYEA 3B3GA 2HY81 1KR5A 1KOAA 3LCUA 4PL5A 5CEKA 2P7IA 4F70A 2YM3A 3QQUA 3FLQA 4D9TA 4OTFA 2XK3A 4Z55A 2C7QA 4M97A 4E4MA 4ACMA 3TNHA 3LIJA 3E7OA 4LWPA 3JPVA 3NS9A 4GH2A 2WIPA 2JH8A 3NW9A 2FK8A 4FSMA 3HVCA 2P3GX 3FQHA 1SG9A 3GU5A 3S3IA 4UB7A 4NCTA 4WA9A 3VS2A 5A4CA 5CF5A 4AW2A 3JXWA 3FRIA 3QGWA 5D1HA 4EOLA 5HD7A 3KCKA 4HVIA 5ICCA 3QC9A 4OGRA 2PYWA 2GQRA 4JBOA 3U55A 4FT2A 3FI3A 4NSTA 2FYTA 4HOKA 2XNBA 4EOPA 4R1YA 1H24A 4FR4A 3P9CA 1XBAA 5K05A 4DFBA 3H30A 4O7LA 5EHLA 3VBWA 4L01A 2IZTA 3WZEA 5J1VA 4DG2E 4EQUA 4E6CA 3DQXA 4YJSA 3LJ0A 3HCDA 5BYLA 3EQFA 4AGWA 5AV0A 2QU6A 3R8ZA 2GNJA 4PIMA 4ANSA 2CKQA 3FPMA 3M11A 4YUQA 3RHKA 1U59A 4FIGA 4GK3A 4K77A 3TTJA 3IGGA 2PWYA 1OKVA 4L7SA 1TQMA 5LMKC 3TWJA 2WNTA 2XJ0A 2Z8CA 3R8VA 4IWPA 1WBNA 4ALVA 3PIYA 4ITJA 2ERKA 2C6KA 2R5TA 4WHZA 3MV5A 1UIRA 4PWNA 2VTOA 4R7BA 3KMWA 4DM3A 2JH9A 1ND4A 2W1CA 2NXCA 4XLVA 5CWZA 2GHMA 3P2EA 4R77A 3O2MA 4TTHB 3OEZA 1FPQA 3NR9A 2WEVA 4YUZA 5M53A 4O84A 2QE6A 5LOHA 2YA9A 3ZCLA 3HLLA 2OF2A 2IFTA 4JBVA 3M33A 2IDJA 4DEDA 3OOGA 3E8CA 5HILA 2IW9A 4ZY5A 2C5VA 4YJNA 1I44A 1BI8A 2UVZA 5AV2A 4FNXA 1VLMA 1LP4A 5CU0A 3ZOSA 4CTKA 4I23A 2JHPA 4R78A 3N51A 2XNGA 1TW3A 3N4UA 5DH3A 4EOIA 1Z9XA 3FKOA 4D9UA 3ELWA 3SKCA 5A6OA 2IH5A 5CCXA 2Z60A 3HA3A 4FL2A 1JKTA 4LM5A 2IZSA 4J8NA 1IRKA 3UJDA 1OPJA 3UJCA 4L00A 5FULA 2J4ZA 4TWOA 3EQBA 5E7RA 4TNBA 1L3CA 2IWIA 1Y91A 5C26A 1QZZA 4MAOA 3BWYA 4EHGA 4EK6A 1FGIA 1SQGA 4FG7A 4FZVA 4ZEGA 5JGDA 5AUZA 4RZWA 2QQ7A 1APME 3R1YA 1PJKA 3PVWA 4AOIA 2YXLA 1Q5KA 4QVKA 5EHGA 3UJAA 4QYHA 4RVKA 5D12A 2BTRA 5KKRC 4BGHA 2B25A 3OTUA 5IA5A 2OPBA 3P2KA 4GT4A 2Y4PA 2XYQA 3UNKA 3RI1A 1RDQE 3EFKA 5DR2A 3ORXA 4GUAA 1YDSE 1W83A 4WRSA 3FYJX 5CEOA 5HKMA 5KQSA 5HX6A 1PXKA 4IACA 1MQ4A 3K5UA 4YNOA 3DOGA 3VBXA 2UZWE 2QOOA 3TMAA 3R7UA 1X1AA 2G2FA 3RP9A 5LMKA 3PSBA 4E33A 5KMJA 3G6HA 4YO4A 4N4SA 5ETAA 2NXNA 1HNNA 3TUBA 3E93A 5LXMA 5HEKA 2WQBA 4BGQA 4C35A 3EOCA 3PG3A 4I6QA 4DYMA 5CVDA 5K0EA 3HMIA 2YZAA 3UBDA 3UC3A 5DT0A 4CT2A 3AWIA 2YAKA 5CQWA 4AX8A 4GRBA 3PUPA 3IW7A 3PJ2A 3KPVA 4ITHA 3CC8A 3VSEA 3NMUF 1P1CA 4IBMA 2NXJA 5IMEA 3DZQA 4BDCA 4TXCA 3G8AA 4FT0A 5DPMA 1OI9A 1FQ1B 4GVAA 4CXAA 3F3ZA 3RPSA 3FMLA 3BYSA 4EONA 3LMHA 5TT7A 2V62A 1GZOA 3D15A 3K5VA 2QCSA 2PSQA 2WOTA 3MQ2A 3FZ1A 1ORIA 2HV9A 3VAPA 2GPYA 2GNGA 3RKBA 1KPHA 2WMVA 4C3RA 4FSXA 2VP3A 4Q5EA 3HMPA 2WU7A 2Y6MA 1RJBA 4M0YA 3PT9A 5FXRA 3CCNA 4BR3A 5B2KA 4PYJA 5L8JA 5LJJA 4U80A 3F69A 3V5JA 1M6EX 5EMJA 3IOKA 4C06A 4HTFB 4OR5A 3SRVA 2WTKC 3AD5A 4FZAB 4MTAA 4DGLC 4JRVA 3NVKI 2AVDA 4JVGA 3FQEA 3BIZA 4IAIA 5DE2A 3G33A 1NXKA 4Z3VA 4RVGA 3TRKA 3ZBFA 3DTCA 2YERA 3OS3A 3QBNA 4FEUA 4KIGA 3U51A 5KS2A 5FQOA 4LECA 1N7IA 3OPNA 3RIEA 4C4GA 4EKGA 4C4AA 2O57A 4O81A 2ITQA 3WILA 2JKQA 3PXZA 2BILB 4GFMA 4DFZE 3WIGA 5D10A 4NIFB 3BBTB 4M69B 5HVJA 4ZIMA 4PF4A 5E8VA 3SMQA 1PMVA 2JD5A 5BVWA 3BLHA 3O7WA 4YUYA 2CSNA 2IH2A 4HGEA 4CFUA 2VGPA 3IOPA 2VDUE 2ZBQA 2VTJA 3LCVB 3W8LA 1KIAA 3WF9A 1OB3A 4CKBA 5IA3A 1PXMA 4PL4A 4R8SA 1NA7A 4ZLYA 4W4VA 1JKSA 3ROYA 2ZWAA 3REOA 5BNJA 2CDZA 1E1XA 4K6ZA 4UEUA 4FV0A 1R0PA 4FL1A 3H9RA 2OKCA 3U4WA 1O6YA 4ZXTA 4PNIA 4RSSA 4PMPA 5GINE 3VW8A 1KP9A 5A9UA 1SNXA 4QMTA 3G89A 2GPHA 4P7GA 3R0QA 4G16A 4D55A 4JXFA 1FVVA 4TT7A 3FAAA 2XMYA 3QRUA 5E8WA 5JFXA 1WXWA 3QTSA 3M6UA 1VIDA 3LFEA 2P1DA 4YV0A 3TLJA 3BLQA 4RTPA 3DXPA 5BW5A 4J53A 3VW6A 2JJQA 3C13A 3LJ2A 4FZ7A 3PXRA 2I40A 3SVVA 5E2BA 5JK3A 2BFYA 1EIZA 4BCOA 3ZFXA 4IKPA 3UJBA 2XUUA 3FMMA 3VHKA 2O63A 4K18A 2PY3A 3KQSA 3RODA 3OU6A 4F08A 4OQEA 3O71A 3ZZWA 4XUEA 3W2SA 4WBOA 4GOLD 5E8ZA 5KBQA 4LUEA 4FTUA 2O65A 4MEDA 2NO3A 3EVBA 1GIJA 3NUSA 4RQKA 5CTPA 4IH8A 3VS1A 2NRUA 3JS2A 3KR1A 3QTZA 3LLAA 2ITYA 4FTCA 3DAEA 1XKKA 4LQMA 3VUMA 1OL5A 1SQFA 2VUWA 3P86A 2AOWA 3ZSGA 3VS4A 4D4VA 1UU9A 5FM3A 1F0QA 4J7BA 3THBA 4FSNA 1JSXA 3ZSHA 4AE6A 4FKRA 2WPAA 2YWPA 3KF4A 3A8XA 2IPXA 2WMWA 5DPVA 5IPJA 4U42A 2EWAA 4MNEA 4ENXA 4QQKA 4ZY4A 5HNBA 4AZSA 4MNFA 3NWBA 4DFXE 3BEAA 5TO8A 1IA9A 2XEZA 4FT5A 1A9UA 4FA2A 2VTSA 3MS9A 5HO7A 2AC5A 4DT9A 4IVDA 2OG8A 3AT4A 3W2RA 4EH3A 4HCTA 3UA4A 3LBYA 3K2LA 4FV7A 4KINA 4DGGA 1ZGJA 4DMGA 1Z57A 4DG3E 4WNKA 3ENHA 4M7RA 4K2RA 2CWWA 4LL5A 2PUUA 2O05A 5E90A 1JSVA 3OFMA 2CN5A 2QO9A 3HAMA 5T67A 1JG4A 5B1SA 3PLSA 3L8XA 3MFRA 4QPAA 4DLJA 3GVUA 5EQJB 4EYMA 4YJUA 2F2UA 3U54A 2W05A 3QGYA 4QNYA 3VF9A 4AUAA 2W4JA 5M4CA 4FZ6A 4FUYA 2WB8A 3MFTA 3HP7A 3CD8A 4FNWA 4UZDA 4FTIA 5H3QA 3FZPA 3U81A 5HIKA 5HTBA 3P97A 3CJFA 5LWMA 1XJDA 5C1QB 4PDPA 3GU4A 4RPVA 4DG0E 4U9AA 2I0YA 2VDVE 2B9HA 5LVLA 2Y6OA 5IH4A 4XHKB 5EVJA 2ZV2A 2ETMA 4KIPA 1NKVA 2F7EE 4IWQA 4UXQA 3LJ1A 2OWBA 2V7OA 1GZ8A 3KQMA 4FTNA 2W9ZB 5EW9A 2XBAA 1F3LA 3ATSA 2ZB0A 4EQZA 3RCJA 3W1FA 1MJFA 4X6RA 4JBQA 4S33A 3U87A 4XV1A 4FVQA 4A6DA 2QR8A 2C4GA 3QTQA 3R30A 4Z7GA 2YQZA 5DRYA 4I0TA 2YUIA 4FGRA 3QWKA 5CSPA 1S9IA 3CBGA 3TXOA 2JIVA 3FZSA 1URCA 3QUEA 4R3RA 3UZTA 5M4FA 1JQEA 3SOCA 2ITTA 3FPHA 2W4OA 2GNIA 2B53A 3P7AA 2JIIA 1CSNA 5EK7A 2RFSA 3ORNA 1NW8A 4AUKA 5LVPA 4WNMA 2QOCA 2VWXA 3A7GA 4L44A 4QQCA 3ZU7A 5EKOA 3NIEA 2J50A 2ZV9A 3O17A 3KCFA 5TF9A 3TNQB 4RJ5A 4BHNA 4EZ3A 3SLSA 2QOQA 5HESA 2HW7A 3O31A 2HY0A 1YZHA 3FXXA 2C6LA 5EYKA 4JDKA 3P23A 5FRIA 4C04A 3EWHA 2ZSUA 5M4IA 1LR4A 4YUVA 3B2TA 3V6SA 3UO4A 5FM2A 4AA5A 8MHTA 5HIBA 1GY3A 4P4CA 2IJMA 5HE2A 4HCUA 4HCVA 3PYYA 3MY0A 4O29A 1WXXA 3O8TA 1U54A 4EQCA 5GJGA 3UE4A 3NCZA 3TKAA 2J0JA 2YXDA 5FHQA 2PVCA 3HV5A 2GFSA 2X7GA 3EQRA 4KDCA 4X2KA 3QOWA 1MUOA 2H96A 4GIHA 2BMCA 2YAAA 4DFNA 3R9NA 4NM3A 3Q4UA 1H00A 3GU7A 2PHKA 3DA6A 3DFCB 2QRVB 4DEGA 3SSMA 5AX9A 5C4KA 2ESRA 2PT9A 5EQYA 2BFXA 5AM7A 3QA8A 5JQ5A 3KQQA 3E63A 3KB7A 1VQ1A 3A4OX 4CMOA 3OBJA 1UWJA 2PVHA 1UA2A 3UTOA 3KL8A 4NECA 1J7UA 4EOKA 3MH0A 2GAFA 4X6QC 4GV1A 3ORZA 3NPCA 2BR1A 1O9HA 4FV6A 2H34A 1XDSA 5DVRA 4FUXA 4KDRA 3Q5IA 2W1EA 3QX2A 1H25A 4NTTA 3CTQA 4PX6A 3NW6A 2FH9A 3SW7A 3KPYA 4AE9A 3ZFMA 4FKPA 1VP3A 4UWBA 1NV9A 5LQAA 3UC4A 2G9XA 3A7EA 4AAAA 5BVEA 3UVPA 5MHTA 3HKOA 5CXHA 2PVKA 3H2BA 2VTMA 2WOUA 3GWZA 2DYLA 3REPA 4A7CA 4JX7A 1G8SA 3KR2A 4ZMFA 2WXVA 3JWIA 2OKRA 3AC4A 5E9WA 1V0PA 4L43A 4EUUA 2GS9A 3O0GA 4H05A 5A46A 3UG1A 2GQGA 3U9CA 2VD5A 3CR0A 5M44A 1G55A 1KYWA 2AS0A 5AP3A 5CVVA 4HVHA 4UXLA 5FEDA 4EK5A 1GIIA 2OBJA 4A07A 2OF4A 3EFLA 3ZYAA 4RTMA 4AGCA 2J0KA 4FV1A 3ZHPC 3IONA 1U46A 1STCE 2C5NA 1JOWB 2XYUA 5FQNA 3NWWA 3NJRA 4S31A 5LCKA 2PXXA 3P0MA 4C02A 2G70A 4AT4A 4F9BA 3AD6A 4TW9A 1GIHA 3P9IA 1FGKA 3ZO1A 3FMJA 1WBTA 3QC4A 5DT4A 5G02A 4MTLA 2P8JA 3MCTA 4FIFA 3BHUA 4F63A 3RINA 3IV6A 3DAJA 4XV2A 5DFPA 4EK4A 4MXCA 2ZYBA 3RNIA 3D5VA 4R5SA 4N6ZA 4O2PA 3F3WA 3X0DA 4ZJJA 4RWLA 4KBKA 4MXYA 4NTSA 4XLIA 3VRZA 4EH4A 2A0CX 5AIRA 4MXAA 2CGXA 4B6LA 4XP3A 3K6RA 4YZBA 3PJ3A 3FTCA 3CTHA 4CMTA 4N57A 3ROCA 2FSOX 3D7ZA 3AC1A 4XG3A 1IM8A 2H00A 3UOJA 3DAKA 2PX2A 2WMQA 3ULIA 3IDBA 1H27A 3E3PA 3Q52A 4D1ZA 3F2RA 2AOUA 3ZSIA 3GT8A 3WF8A 5AEPA 2NP6A 3FMEA 5AP0A 1RJGA 3PZHA 1CMKE 3BGDA 5LSAA 2OZAA 4X3FC 4OBXA 3IPHA 4OLIA 1NVRA 4M84A 3EYHA 3FHRA 3UZUA 5DLSA 1KE8A 3ORPA 1JSTA 2VWBA 4TYHA 3ZRKA 4BCIA 2XK9A 1M7QA 2EUFB 4TY1A 3DXXA 3RZBA 5F2NA 4E4XA 2V7EA 5EM7A 1YW2A 3EMGA 4BYJA 2NNWB 3JY9A 3P79A 1WS6A 4ER3A 2WIHA 2UZVA 3PX2A 3IW4A 3HDNA 3ITZA 4YHFA 3FUXA 3MTLA 5BUEA 5HD4A 3BT7A 1X1CA 1Y57A 3PJ8A 5ANKA 2BAQA 1QAQA 1DI9A 2JDRA 5E9QA 4OTHA 4LOPA 3F4KA 4QVGA 2Y1XA 1R18A 3UDBA 4IX4A 2BM8A 4LG1A 5KMOA 2YXEA 3UJ7A 3FZGA 5EM6A 1FJXA 3LSTA 2QI8A 2A4LA 3D2IA 2P33A 3EVGA 2OH0E 4F9WA 4QNAA 4YV2A 4E1ZA 5CVEA 3LFFA 2OJIA 4GCJA 4PYIA 2BDFA 3PP1A 3FYKX 2UYQA 2C6TA 3OWLA 4DA4A 5ETFA 3WZDA 3KR9A 2QOLA 4KKGA 1OPLA 3K0BA 3HUCA 4E93A 3R2BA 3L1SA 4FKIA 3SRVB 1XBBA 4KB8A 4E8AA 3KQWA 4K1BA 4I6BA 5AP4A 4QTUB 3CEKA 4ZS4A 3S4QA 5HZMA 4E31A 4PP9A 3W18A 3K54A 3WE4A 5C8NA 3UIBA 1FP1D 3FLNC 5DSTA 2JDVA 4BI2A 4U40A 4GF5A 4EEVA 4ZSAA 2HZIA 3WYXA 4QP8A 4KW7A 4O91A 1G3NA 3SV0A 4OBOA 3COHA 2XK6A 3LFQA 3HV3A 3UO5A 2IVSA 2ZM1A 4IC8A 4A4XA 3Q9WA 4PCLA 2VDWA 3P7BA 3R71A 5KKRB 2DPMA 1H0WA 3GRVA 4O96A 4ER6A 1SZMA 2XVDA 4QQNA 3C50A 4W4XA 1OL7A 3MDYA 3FPGA 3UZPA 4DH3A 4L8MA 5KO1A 4OTQA 4QMMA 3AG9A 4C05A 2C3KA 4X3FA 3NUPA 2YWVA 1H1RA 4HNFA 4GL9A 2HK5A 4RX9A 3MVMA 1IEPA 3PVBA 3D4QA 3C0IA 4I4EA 4RWJA 3ORKA 3OW4A 1XHAA 5HIIA 4FI1A 2ZMDA 4YP8A 3O96A 4QRCA 3U8WA 2Y1WA 4AGDA 5I9UA 3TPZA 3TKYA 2RFDA 3TKUA 2EU9A 2R3NA 3BGVA 1JQHA 4UBAA 3KQTA 4XG4A 2GB4A 2P2IA 4IADA 1TQIA 1REJA 4CMUA 2PVMA 4GOMD 3ALNA 5EKNA 4NW6A 2BHEA 4H58A 1M6YA 3MN3A 1Q41A 1RE8A 2ZDTA 3RPRA 3GBZA 5IA0A 4TN6A 2FA2A 3L8VA 4CZUA 4RLKA 3T8OA 3NRMA 4U6RA 4YSMA 3TZ7A 3UPZA 4ACCA 1SVUA 4E4LA 4I20A 3MH1A 2HCKA 4PMSA 3ZH8A 3ZO3A 5A6NA 2F49A 4E6AA 2OZOA 2YVLA 3SDJA 2O5KA 3D7TA 3FLWA 5BYYA 4GG5A 2WTKB 2X39A 3Q3BA 3Q2JA 5M4UA 4M0ZA 2RL5A 5FG8A 3BWBA 3KPUA 2XM9A 3BPRA 3UP7A 4DITA 3SHEA 3AY0A 4OBQA 4FODA 4NW5A 4FNYA 4FKVA 3SXFA 2B2CA 3FZOA 4F65A 2HXLA 3PWYA 3DMGA 2E9PA 3LOKA 5CAQA 4BY9E 5B2MA 1T46A 4AW5A 1ZMUA 3TI1A 1IASA 1P5EA 1OZ1A 2P4IA 5AV3A 1B38A 1JG3A 2F7XE 4EORA 5IQCA 3N4TA 3NEWA 4MYGA 3P9NA 4M3QA 3LAUA 5EG5A 5EIWA 2W5AA 3ZUUA 5EW8A 4MHTA 4JR7A 1KV1A 1TQPA 4C34A 2QNJA 4LMUA 3Q7EA 3WOWA 4BCQA 2UZEA 3R9XB 1KE9A 1HOWA 2FRXA 2KTYA 5K3YA 5IH5A 1D2CA 4U41A 5KUPA 5AM6A 5DT2A 4G34A 2F9GA 4QTCA 3VVHA 5HIEA 4DH5A 4EH5A 2JGZA 3EIDA 4EWQA 5E8XA 3OUNB 4C4EA 3RPYA 3FUTA 1PXJA 2XIZA 4BTJA 5J87A 2JBOA 3RK5A 1RJDA 4EOOA 1IXKA 2GSFA 2G72A 3PXFA 2C3LA 4WNOA 5LARA 1Q8UA 5EI2A 2P41A 3BWJA 4TPTA 2QHNA 2BHHA 4AXAA 5B7VA 2PL0A 2EVAA 2C0OA 5FHRA 1AD5A 1ZRZA 2G2HA 3I53A 4EH7A 5DI1A 2WKMA 3DXQA 4DGOA 3IO7A 3FZTA 1PW2A 3EVEA 2X7OA 4TL0A 4FKSA 5KZIA 4KSPA 4EI4A 4CKJA 2PE0A 3QD4A 5GNKA 5AAFA 3PIXA 1WG8A 2PZPA 3LZBA 3FJQE 3G7UA 4BICA 3LPMA 2RGPA 5AP6A 2O3PA 1WVWA 4RIXA 5KQRA 4E5AX 2CKOA 3E92A 3BGIA 1ZYCA 3FUUA 3R7EA 3L8DA 2PZ5A 4LFIA 5GWXA 3LFAA 3QD3A 2BR5A 4BDFA 1R1WA 1OITA 2PT6A 3TM4A 4TYJA 3OF0A 3UQCA 4QT1A 5J1WA 2CKPA 3QCQA 5JUWA 4O38A 1RJFA 3OROA 4X2FA 4RWIA 1F5QA 3GCPA 5HE0A 3AGMA 2VTAA 3I9FA 2VX0A 3CJGA 4BCMA 3UJ9A 4HZSA 1FINA 2W1ZA 5FDPA 3A26A 1U5RA 5FQDC 5AFVA 4UWYA 3DT1A 3PY1A 1WZNA 2IGTA 1PYXA 4PTCA 4CFNA 4JG7A 2IBTA 1BL7A 1JBPE 2VNWA 2GHLA 5CVJA 5IEXA 1YQJA 5IA1A 1OUKA 3QALE 4XG6A 2R3HA 4ENYA 2P40A 4RJ8A 3DJ7A 4YUWA 4RIOA 4FSWA 4V0RA 3GIWA 4NUSA 4IEBA 5BXYA 5T68A 5F94A 4BIEA 9MHTA 3KK9A 4RT7A 5ANEA 4LL0A 4IV0A 5BPYA 4FT9A 1JVPP 1PKDA 4KD1A 3T7RA 5K0JA 2R3JA 2XIRA 3KN6A 5KNJA 4O7VA 3V8TA 1QPJA 2Z6AA 4APCA 1MHTA 2R64A 3LW0A 3BHHA 4QMUA 4GS6A 2E9VA 1QPCA 4HPTE 3QTRA 3KFAA 3FMNA 3PTGA 4ZMEA 4Y72A 3F88A 3R6XA 5M55A 4ZZNA 5CLPA 4DC2A 3KMMA 1UKIA 3WZUA 4FICA 2C47A 2B9EA 5IF1A 4YBJA 3WF7A 3SGCA 5IMXA 1PXIA 3MYGA 1FBNA 3KPWA 2QG7A 4NU1A 3PIZA 4APPA 1Q3DA 4CV8A 4B99A 2B54A 3A61A 3PPKA 1VEBA 3OXIA 4PV0A 4R05A 5I9XA 5K8VA 3GC7A 1IAHA 4IWDA 1KYZA 3OZTA 5CU4A 4E2YA 3CGFA 4ER5A 2HWOA 5L8KA 5EZSA 4IB0A 4ALUA 5FEEA 3HCBA 2UZTA 3SGLA 4JQ8A 1D2GA 3HP2A 3BGPA 4ER7A 5HU9A 3W2PA 3NX8A 4E4NA 3TNIA 2HOGA 3UIXA 1AF7A 2FSLX 3TZ9A 4EK3A 3QF9A 2OSCA 2ORED 3BYUA 4XG7A 3GXLA 2QU5A 3SXJA 5JT2A 4MBLA 2ZZMA 2UW5A 3F5GA 3FI4A 4DTAA 1OBGA 1ZOEA 1YF3A 5IZFA 1XJ5A 3SOAA 3BKWA 4FV9A 3R8PA 4HPUE 3G2FA 3VQHA 2XYRA 4RVTA 4FKGA 3DBQA 2AOXA 4TRLA 4E20A 3G90X 2R3RA 3RK7A 3CJQA 3VYWA 4G1WA 4F86A 2I9KA 4MQ4A 2OLCA 1H01A 4F4PA 4X60A 5JKGA 4PRJA 3QZHA 4NM5A 3R8LA 4X63A 4BF2A 4FTTA 4ZSEA 3EKKA 1WBPA 1FOTA 2CLQA 3UOKA 2B3TA 3ZXTA 4ZZMA 2HELA 3M6VA 4P7KA 5J9LA 4F7SA 2PWLA 2Q41A 2W9FB 4KS7A 1ZQ9A 1IAJA 3I0QA 2RF9A 2EJUA 1WMKA 1F3MC 4F99A 4A9UA 4YTCA 3P8ZA 5D7VA 1QCFA 3QTUA 5E8UA 2OXXA 4DTKA 3NAXA 5DXJA 4C33A 4HGLA 3A25A 4S34A 4R5YA 4GYGA 2VGOA 2AOUB 3NCGA 4RX7A 3RPOA 2HZ4A 4KA3A 4RTRA 3Q9ZA 2Z6QA 2OZAB 3Q4TA 4FZDB 1J3HA 3KULB 4JOAA 2C68A 2ETRA 3HGKA 1I4WA 3RAKA 1U4DA 1OR8A 4RC2A 3DKFA 2JDOA 4GC9A 4TYHB 3M6XA 3C51A 2JDTA 4FGZA 2OJ9A 1M2QA 2PMIA 2B4SB 3ZMMA 3EFJA 5AUXA 4DH7A 2VV9A 5ERGB 3KA0A 4FGBA 3DKGA 3P08A 5C01A 3C4EA 2JKOA 4A9TA 3OT8A 1DUSA 3VUIA 1HCKA 4KWPA 3EQCA 4CRSA 4USEA 3HV7A 3EGEA 2IVUA 3BU3A 1ZZ2A 3BU6A 5BVFA 2HWKA 3OEFX 2OJJA 4TYIA 4Z2YA 4RTSA 2YM5A 4FEQA 4AFJA 4GK2A 4J96A 3FLYA 3C4ZA 3KKZA 4JIKA 5H8EA 4C3FA 2ERCA 3FRHA 4IX6A 4DEBA 1MRVA 4J52A 3T3VA 4CKCA 5HZNA 3FC1X 2BUJA 4CQEA 1JQDA 5C8MA 1SUIA 4Q5HA 4RTJA 4ALWA 1ZLTA 1XH8A 4RQVA 4FR0A 3TNPC 2WA1A 1ZXEA 5T6BA 3UWPA 2IVVA 5EYCA 2YDKA 4FYOA 4QTEA 2W5BA 5ICEA 2HENA 4I93A 3NYNA 5CU3A 2ZCJA 3ALOA 3TEIA 2FHPA 4ID7A 4TWCA 2QD9A 3O4FA 5EIFA 2VN9A 3OTVA 1L3IA 2PVJA 4HGTA 2EXMA 4XP0A 3ZONA 3FE3A 2W06A 2J0MB 1LEWA 5K0BA 1PXOA 3DS6A 3UVRA 5HBEA 3M4XA 3E8EA 2HTEA 3PRIA 4BCNA 3EEYA 1G5SA 3DY7A 2ITUA 3UIUA 2HIWA 3HRCA 5TOZA 3UP2A 4EC9A 2Z7QA 1PMUA 4BZOA 2OW3A 3UJGA 3G15A 4FP9A 1PHKA 4U7PB 4O7TA 2BZGA 2W96B 4ZTNA 1MRUA 1RW8A 3DK7A 2YZLA 4MK0A 4IFGA 3SA0A 3LFBA 3MCZA 3FPFA 1YZ3A 2G2IA 4CKRA 3DP7A 5EC8A 3SVZA 5H9BA 2XEYA 5JRSA 4X3FB 4YU2A 1YDTE 3GU6A 4RFMA 5H2UA 4OBPA 3UODA 4A9SA 3T9IA 4AP7A 3ME5A 3Q04A 1PXPA 1L3BA 1G6Q1 2QODA 3VUHA 2K4MA 5JGBA 3KMUA 5A4TA 3TL8A 4E6QA 3UIMA 4H0NA 3C9WA 1U2ZA 2A2AA 3C0KA 4YJOA 3PFHA 2B9JA 4DBXA 4AWIA 3HL7A 1LPUA 4MVFA 4X3JA 4EBVA 3PDTA 3KQYA 4DFUA 2YISA 4QO9A 1O9UA 1ZYDA 4QMWA 2OJGA 3HAVA 3FTEA 4F9AA 5K4JA 4FT4A 3WBLA 1CM8A 3BYOA 3C3PA 3DBFA 3FUWA 3ER9A 2BRGA 2BAJA 4DZRA 4K11A 3TIYA 3QTXA 3ZDUA 2XB7A 4E5WA 3I5NA 1INLA 1JAMA 4Q2AA 2HWPA 4YSJA 4G31A 3QKKA 2QONA 2VWZA 2Z7LA 2NRYA 2BALA 5ANDA 2IBSA 2YACA 2NP8A 2R2PA 4O0VA 4EBWA 3O7LD 4YJVA 5HLNA 3AXTA 4FIHA 1JKLA 1EJ6A 1QAOA 4ERKA 3GCUA 4RFZA 3E8NA 2BIKB 4H1JA 1Y6AA 2G71A 5IDPA 4C07A 4JS8A 4G3CA 2IO6A 3GXOA 1I9GA 3RTPA 4JG8A 4Y30A 5CVHA 4UYAA 2ITNA 5M07A 2HXQA 4GQBA 4GU9A 3QZGA 5JFVA 4RJ7A 4QP7A 3ORMA 5AA8A 1CKPA 5HCXA 3EN5A 5LVOA 2HMYB 4BIBA 5L2SA 3A7IA 2X8EA 5FP5A 3F9NA 3R9OA 2QM3A 3HTXA 1E9HA 3UG2A 4FKTA 5DT3A 1O54A 1V0BA 4AW1A 3QLGA 4C38A 2PPQA 5ETIA 1OECA 4MF1A 3SXSA 2Z7SA 3CJTA 2X7FA 4ACHA 4U0IA 1YWVA 2Z02A 5HEZA 1H8FA 1MP8A 4H3QA 2OYRA 4ZLZA 1WZYA 4J97A 4KSQA 4RV9A 3VN9A 3E5AA 3FYCA 4FSRA 4MKCA 3LCKA 1Q0TA 3FXWA 4II5A 4FIEA 3MESA 3DQWA 3LBFA 4AFEA 2YFXA 5CANA 3S2PA 2I0VA 4JDIA 3OBGA 5CSVA 3O8PA 4I6HA 4S30A 3UQGA 1CKJA 3BEGA 2FGIA 5HIDA 5EQEA 4ZZOA 3GDHA 2JKKA 4ANMA 4EHEA 2G1PA 5EM8A 3PY0A 2UVYA 3EVCA 4NL0A 5DXAA 3W2OA 4OW8A 4X21A 4MHAA 3RMFA 4GT5A 3D83A 2VZ9A 2QRVA 4C3PA 3O23A 1W8CA 2AVNA 3NUNA 4RC3A 3IQ7A 4ZJIA 3E87A 3KRXA 2O0UA 2VTTA 3POOA 5CAOA 3BKBA 4GIIA 5DM1A 3ZLWA 3HDMA 4AQCA 1KSWA 4FK3A 5JR3A 3FEGA 1SNUA 2R4BA 4PYOA 3EGVA 3OE5A 2B9FA 1NW6A 4X7QA 1XBCA 3NNUA 1H1WA 2VX3A 5BMMA 4PTGA 1Q97A 2OY0A 4ZTBA 4RTNA 4ANLA 4W8DA 2XIYA 4RVHA 5BMSA 2BROA 4CTCA 4U7ZA 3LM0A 2BZHB 5C1IA 3B8RA 3P78A 2V22A 3ZEPA 3FBVA 4E70A 5HI2A 3UGCA 4HYIA 4M13A 5K0FA 4RIXB 3RAHA 2YCFA 1XH4A 4DE4A 3GOPA 4BCJA 3C6MA 4PDYA 5HE3A 2ONLC 1UWHA 4NM0A 2BCJA 2CNQA 3ELYA 3NTVA 4LUDA 3SM3A 2DQ7X 4PYKA 4OX9Y 4EH9A 2PU8A 5E1BA 4DTBA 3BE9A 2C3IB 4XEYA 4RRVA 2CMWA 3W16A 1TVOA 4PY1A 3PA4A 4CT1A 2ZZKA 3RALA 3QZIA 2JHAA 3PVUA 1TW2A 1JG1A 4O0UA 2NYUA 4LRJA 3EKNA 5F1ZA 3LCCA 5LVNA 3IECA 4HSGA 4LOQA 3DGKA 3BQCA 1DS5A 4YLKA 3PXYA 5J7HA 2UVXA 1WCCA 3VIDA 1MQBA 4ZP5A 1JQ3A 2WQNA 3ORIA 5F20A 3MJ2A 2J9MA 1UWVA 2VTIA 2PMOX 2ZVAA 4F1TA 3AC5A 3RVGA 3O50A 5E92A 2PVRA 5E4HA 3CY3A 3NYVA 2XBMA 1AGWA 3WYYA 2J7TA 3B2WA 1IA8A 4ZSGA 1P4OA 5DX0A 5J5SA 3PG1A 4WG4A 2IW8A 4RWKA 3DULA 2J0IA 4O0RA 3ZEWA 2OGVA 2I6GA 5AUUA 1ZOGA 4XG2A 4LRKA 4O2ZA 4JAJA 2B9IA 4JDJA 3AC2A 1Q8YA 1DM2A 4OT6A 3RWPA 1BMKA 3CSVA 3MI9A 4BDAA 5BUJA 3L8SA 1OGUA 3DK3A 5IQIA 2UZOA 3V97A 4RVFA 3IGOA 3KQVA 4TNDA 4QQJA 4EUTA 4FKUA 4NT4A 4RSRA 4B7TA 3CPBA 3V8SA 1S9JA 2QC6A 4K33A 4I22A 4P58A 1WVYA 5EQPA 3LHDA 4DEHA 2JDSA 3G6GA 3SR4A 4FTJA 4H39A 5F2OA 4IAYA 1YHWA 2GNLA 3ODYX 2WFYA 2W1HA 3HRBA 1NY3A 5HIMA 5IH6A 3ERKA 3TIZA 2PE1A 5KMNA 3R00A 3R8MA 3UNZA 3D5WA 1BC5A 4K0YA 3AOXA 3I7CA 4GEOA 4F09A 3R6TA 1KOBA 3DTWA 4UALA 4L7FA 5AAEA 4LWOA 2X8DA 5J9YA 4BLWA 4RX1A 4RIYA 4H1MA 4J98A 3V51A 5FGKA 5BQ0A 3LCTA 4AF3A 4ZLOA 5ICGA 4RJ6A 5GJFA 2OBFA 3FMHA 2J6MA 1N2XA 3KEXA 2ONLA 2WTWA 1ORHA 4XV9A 3ANRA 3LPBA 2FPOA 2N47A 1OIUA 2PXCA 1PKGA 2YM4A 5F2KA 1H0VA 4IZ5A 4YMGA 4QP3A 4YJQA 4BCKA 2H6DA 3O51A 2O0LA 3ZLYA 1VL5A 2UZDA 2E5WA 4F7NA 5IQBA 2J0LA 3FTDA 2W99B 3W55A 3HX4A 3BUSA 4BDBA 3CD3A 2WO6A 5L8LA 2GHGA 2UZ4A 3B5IA 4I94A 3CQUA 3BU5A 5C9CA 3JVSA 2QG5A 3QA0A 5HFJA 3EVFA 3OT3A 2VWYA 4DH8A 2OO3A 3RJCA 3UVQA 5IH3A 1WBVA 3DOUA 3RGFA 2WTIA 5L2WA 1YRPA 4CGAA 3H0ZA 5IA4A 3R83A 2EX4A 1VBFA 1OVEA 4FSZA 5EDPA 3HECA 5CAUA 3JWGA 3PTAA 5KHWA 5L6PA 4QMSA 4FV8A 1YHSA 2P7HA 1X1DA 4YV1A 2Y0AA 4MWHA 4KRCA 4K8AA 4Y2HA 4RTOA 1XH7A 2KULA 3D9VA 5EM5A 3A2CA 4FEXA 3DKCA 3ET7A 3TCPA 2ESMA 4FG9A 4NJDA 3ANXA 2QYOA 3PLAE 3AT3A 5HOQA 2QOIA 3HRFA 2PXAA 3EQDA 4CRLA 5A54A 2H11A 5HVKA 4IIRA 4BHZA 1LEZA 3PX3A 1M2RA 2LAVA 5D1JA 4R6XA 4O27B 3DBEA 2ZFUA 3DXZA 2WMRA 4DCMA 4N0SA 3COKA 2XKDA 5CD1A 4N6YA 4AZWA 3KXMA 3VBTA 5CM2Z 3UA3A 2ITVA 5CALA 2CCHA 5IDNA 5J9ZA 1OL2A 2CGWA 4CFFA 1HCLA 3MAGA 2WEIA 4P7JA 4F0IA 5TR6A 4JDHA 3U9NA 5AIKA 5FTGA 4FC0A 4DINA 3FPJA 2ZV8A 2Y4IC 3I79A 4W4YA 5HO8A 2AN5A 3CPCA 3A60A 4BZNA 2XNNA 4J71A 2B0QA 5A4LA 4I5MA 4EH2A 3HNRA 5CVGA 4JAIA 3B89A 2YIWA 2UW3A 1Q62A 1ZZLA 3B3FA 5EMLA 4GUBA 5AAGA 3QTIA 3KRJA 2C7PA 3R7OA 2P3OA 2WTCA 3HVIA 3BQRA 2YR0A 4FE2A 3QKMA 3FDNA 4YC6A 3Q6WA 1A48A 3LFSA 5I0BA 5K01A 2OIDA 4EC8A 3GUBA 4C61A 1SKMA 2XNMA 3VC1A 3FL4A 4TYGA 2GCDA 1YFLA 3JWHA 2XCHA 3AC3A 4QOXA 4JI9A 1HMYA 1TKIA 2PWPA 2Y7JA 1T43A 4PDOA 4LI5A 4PMTA 2PK9A 3ORLA 3OWJA 3R73A 4ZK5A 4YJPA 2ZM4A 3CGOA 1BL6A 2OB1A 2J90A 2C5YA 5IQGA 1Q0SA 3I6WA 2G15A 4KABA 2WQMA 4MQ1A 5M08A 3KQPA 3C4CA 2BDWA 4CG8A 2PVLA 5EHOA 5JZJA 3A27A 4GOND 2WQOA 3E7PA 1VYWA 4IW0A 2QO2A 4Y83A 3BWCA 3LXNA 3R8UA 4XCUA 3LL7A 4IQ6A 2HZ0A 5LQKA 2R9SA 4ARKA 4EKKA 4PGGA 3FKLA 5AUYA 1X19A 3FTFA 1QYRA 5ANIA 5DNRA 4POOA 1XCJA 4EYJA 2B52A 4OUCA 2PVFA 4P5QA 4EZ7A 3I7BA 1F38A 3UZRA 4XUFA 4EKLA 4XG9A 4ZTMA 3M6WA 4IB1A 5B2LA 2EB3A 2AUHA 4G6NA 5FTQA 4HRAA 4CCUA 4EK8A 5JZNA 4L3LA 3OCJA 3O8UA 4CZTA 4FZFB 4F6WA 2O2UA 3I5ZA 2AZTA 4F6UA 3R9HA 4L6QA 3LGAA 1WBOA 2PGXA 5IUGA 3HZTA 5L3AA 2JLDA 5K0LA 5HG7A 2OFVA 1PY5A 4E30A 3Q96A 3HMNA 5BVNA 3FPEA 3LVPA 4MWIA 3ZO4A 5LR6A 3BYVA 3HVKA 4F1OA 3V5WA 5J95A 4FSQA 2AN3A 4EWHA 2HZNA 4YZ9A 2C3JA 2R0IA 4M36A 3BRBA 2O64A 2OH4A 2R3SA 2BRMA 4GSBA 3E62A 1E1VA 4KBCA 2O07A 5IQAA 4YJTA 3DCVA 3Q4CA 5L6WL 5K4IA 3V04A 4KIQA 2ZIGA 3DK6A 2CLXA 5J8IA 4YC8A 5HBJA 2CKDA 1RI5A 3OMVA 4BDGA 2GS6A 5CAPA 4YNEA 4O7YA 5FXSA 4QQ5A 3DMHA 2J51A 3FLSA 3ANQA 2KW5A 3F61A 5CCBA 5FUBA 1Q4LA 2W17A 3UOLA 4G9CA 2E9NA 3EQHA 5AJQA 3CKWA 2EG5A 4E2XA 4ORKA 1V1KA 2UW9A 2I0HA 4USFA 3DKOA 1R6AA 2YJRA 3KVWA 4DQ0A 2B55A 1R0EA 3QZFA 4QP6A 1A06A 2ZULA 3ZDIA 2GS2A 3I81A 3QLFA 1NE2A 4XUDA 3VS5A 3PJCA 4XX9A 3GC8A 3G0EA 5CX9A 4G5JA 4BYIA 5KHXA 3P5KA 3E05A 3TJDA 2XIKA 3Q9YA 3RAIA 1Q99A 4RTKA 3CTJA 3BV2A 4K9YA 3A7DA 4E5BA 3ORTA 3WZKA 1R74A 4UX9A 3HA6A 4DKJA 2W4KA 3R7IA 3N4VA 3QQFA 3KRWA 3V01A 2OZVA 4C2WA 4PUZA 4E73A 3CCFA 4DEAA 5C27A 3AQVA 3LKZA 2YJSA 3EN7A 3FSKA 4D58A 3Q5ZA 3EH9A 3PSDA 7MHTA 3WIKA 3G2MA 4A06A 5CVFA 5EI8A 1UNLA 2I62A 4RTQA 3MVHA 2RKUA 2CNVA 5HTCA 4S32A 5D1NA 3PVCA 4R3CA 3ZLXA 2JAMA 2AC3A 3T7TA 5E1OA 1YXXA 4DH1A 2BR3A 4F1MA 1RI1A 5TKDA 2WELA 4BLVA 2R0UA 1OPKA 2YDIA 2FYSA 4ZAUA 4I4FA 4JBPA 4BTFA 4KNBA 4IZ7A 1R00A 3LM5A 2OXTA 3R2YA 2X2MA 1UU8A 4IVAA 4QYYA 3PPZA 1OM1A 3QQGA 5FEQA 4QMNA 1GZKA 3G51A 2BRBA 4IWOA 4V05A 5I5ZA 3MBLA 4BDHA 3TT0A 1B6CB 4BN1A 3V5PA 2WGJA 3C5IA 5AV1A 2ZZNA 3BZ3A 4G6LA 3LDFA 3IEIA 5CT0A 4PMMA 3H9FA 4AACA 3CLYA 1BOOA 4O7RA 2NP7A 3KU2A 2OICA 4R8RA 2CHLA 5KCVA 4XBRA 5HIJA 2WD1A 3DB8A 3DDQA 3KRLA 3AMBA 2YIQA 4A4OA 1YWRA 5FTWA 4EHZA 4ZTSA 5IU2A 5ANGA 1J1BA 4QP2A 3A4PA 3HM2A 3QKLA 4FVPA 3BGZA 4MD9E 4NK9A 3TOSA 4UV0A 5E8YA 4RGJA 1P4FA 2G1TA 3HA8A 1KV2A 3SD0A 4K6MA 4LOOA 4KBAA 1V0OA 1XH5A 3TUCA 3HCEA 1YXSA 4F0GA 3PXQA 4V0QA 1U5QA 4U43A 2I7CA 2V74B 4M8TA 3BWFA 1Q8WA 3GO4A 3R3HA 2X2KA 5GIOE 2A19B 4EOSA 4O83A 2XK4A 4QYGA 5BW4A 5BUIA 3CQWA 4YC3A 4DAWA 4FTLA 3RWQA 1RI2A 3OG7A 4OA5A 1JKKA 3F7ZA 4EOMA 5E8TA 3MTEA 4DHFA 4RTLA 5AP7A 1Y6BA 1SVHA 3MB6A 5DR9A 4FYNA 4EVIA 3LQ8A 1GNGA 1P39A 3OCTA 3RM7A 1SYKA 3DLZA 2QLQA 2ZOQA 4BZDA 1M14A 4E26A 2WA2A 1XCLA 3DJ5A 3IK3A 3MPTA 3A7FA 3QQHA 2UV2A 1UKHA 5JFWA 4HC4A 2FUMA 3LXPA 4BDKA 4IWNA 3QYWA 5CEMA 3CXWA 3DPKA 2BKZA 3LMIA 5EYMA 4ER0A 3RCDA 2PMNX 3U6HA 2Z6UA 5L6OA 3MVJA 2QOBA 4C08A 1R8YA 3VS3A 3BYMA 2BIYA 3R1QA 2XVMA 3OXZA 4QP1A 2PMLX 4I92A 5DGZA 3ZM9A 2QOHA 4BI1A 2P3LA 5FXQA 4OTWA 4CG9A 3VWAA 4IX5A 3F5UA 3TACA 5DHJA 2R3GA 4CFVA 2C5OA 4LYNA 3H10A 3KULA 4M67A 4CV9A 5DRDA 1YUBA 4XRJA 4XJ0A 4C03A 5GHVA 3SC1A 2OO8X 1WY7A 4H3PA 3DLIA 4PL3A 3VNTA 4JJRA 2R3QA 5FBOA 2F4JA 3HCFA 2C1BA 4WOVA 4FMQA 5K5NA 3LDGA 3VUGA 3IDPA 3EL8A 4CKIA 4CCBA 4HVGA 3G2PA 4DEIA 2WHBA 1ZHFA 2H1RA 4RIYB 3V8VA 1H4LA 4RZVA 3NUXA 3NLBA 4DFLA 4MD8E 4YZDA 2H9VA 1QPDA 2G8NA 5EHIA 3KK8A 3ATTA 5E9EA 4WD5A 2V55A 3DMFA 5HNGA 1Q3WA 1Q24A 3RHXA 4GUEA 1G8AA 3B8QA 4LV5A 5CF4A 3L8PA 2PKWA 3TKIA 4RG0A 5FBNC 3AMYA 3NDIA 1NV8A 2P35A 4I21A 4KAOA 2P2HA 5FUTA 5E1SA 3GC9A 5AMNA 2VWVA 5H02A 5KVAA 3R7VA 5ITAA 3GEQA 4AT3A 2QKWB 3QHWA 2ZTHA 4XRLA 1WVXA 5HHWA 4RLLA 3FY0A 2FK7A 5CU2A 4FKOA 2C0IA 3MPMA 2IIPA 2IP2A 1Z5MA 5EMMA 1R8XA 4JXJA 1QAMA 4HVDA 4QYFA 3QFVA 4O0TA 5DOSA 4NH1A 2OIQA 3PB3A 3MIYA 4GKHA 3NUYA 3RW9A 3COIA 3WF5A 5KMKA 5H8BA 3I58A 1Y8YA 3DJ6A 2X1NA 5E1EA 1REKA 5HG9A 4BIDA 4I5PA 3LX6A 2RG5A 2ZDUA 4YLJA 5DBXA 4O7SA 5CF6A 4DGNA 4QTTB 4JRNA 3NNXA 3FZRA 2UW7A 3WARA 2HW6A 4PWYA 3SAYA 3BGQA 4G3GA 4GOOD 2P0CA 4KS8A 4O0WA 3IKAA 3DR5A 4N70A 3LMGA 1BKYA 2RFNA 5EDQA 4BBEA 3EMBA 3DBDA 4C7TA 3G88A 3UO6A 5DEWA 2QY6A 2BRHA 4KRGA 3BCEA 5A4QA 3KC3A 4YLLA 3QX4A 5AUWA 4WXHA 5CU6A 3PE2A 2YITA 4BDEA 3BLRA 5JGAA 5HX8A 4FTMA 4FOBA 5C8KA 4HYSA 1BYGA 2ZMCA 3QU0A 4Q9ZA 1J7IA 1XXLA 2WAJA 3OOMA 3OZRA 3NW5A 3D94A 5JMSA 1NW5A 1KE6A 3P4KA 2W7XA 3V5TA 2VO7A 5I9WA 3OFKA 4RA4A 3OWKA 3L9PA 3TUDA 4EKIA 4WKQA 1UFKA 3VHEA 1P2AA 3F5PA 4PTEA 4QP4A 4XNEA 1TPYA 2IW6A 5I9YA 2VTNA 3EFWA 4QMZA 4X2JA 1UVRA 4BDIA 5EOBA 2WTVA 1EJ0A 5HICA 5AP1A 3ZM4A 2QOFA 5M51A 3ZBXA 3QRKA 1L8TA 2I6LA 3UBTA 2ZBRA 5B0XA 4MD7E 5ANJA 3ELJA 2AYPA 3AC8A 2BTSA 4DBNA 1D2HA 2CCIA 2PZYA 3EEOA 4EQMA 4D1XA 3OU2A 4I41A 1YOJA 4QMXA 2UYCA 3QXOA 1OL1A 3LKMA 5CSXA 3S0OA 4OBWA 2R3OA 5A4EA 1FPUA 2IZUA 2VWWA 4AZVA 3MWUA 4KIFA 3RK9A 2ZV7A 3QOXA 4AU8A 1WBSA 4J99A 3I1AA 4G3FA 3II5A 2C69A 4IC7A 4FV2A 1EAMA 3AD4A 3VO3A 5JH6A 3G0FA 4NWMA 4RYLA 4FOCA 4P2KA 3E8SA 5GM2A 4C4IA 2IH4A 1LUFA 5HGIA 2ITZA 3P2IA 2X4ZA 3PFGA 1BX6A 2X8IA 4WBBB 1H1QA 2EXCX 1AQIA 2ZLBA 3GRYA 3GGFA 3MPAA 1ZKDA 2W1DA 3HCAA 3K3IA 5FWDA 4JLCA 5F95A 2PJDA 4IDVA 3N9XA 4PQNA 1YXVA 4BDDA 4G17A 4C59A 3EZVA 2DUVA 4L52A 2Y4IB 4DT8A 3MY1A 3PWDA 3UJ6A 3PXKA 1W0XC 3G5LA 3CE3A 3Q6UA 4BLUA 2JAVA 2WTDA 1ZOHA 2VTRA 3UYSA 5EG3A 2C0TA 3FUPA 3TV7A 4CKEA 3LCOA 1W82A 2CNUA 4IM0A 4U97A 4QTAA 5JN2A 1JTFA 5EGSA 2GNHA 5GOZA 2ITPA 1XQZA 4OTGA 4IAKA 1YWNA 4UOEA 4BCFA 4BGGA 4Q9SA 3ZS5A 2GLUA 1O6LA 4CEGA 2R3MA 5H8GA 3C4FA 4HYHA 3CKXA 4DF3A 1FVTA 3TDVA 3F82A 4F7LA 3EGIA 2PX5A 4BBFA 4GJ3A 4X2NA 1CKIA 3BHYA 4IE9A 5DRTA 1AV6A 3QHRA 4PINA 2VTPA 1B39A 3OE4A 2V5QA 2Y8OA 1DCTA 4NYEA 1DL5A 2AOTB 4MBJA 4O21A 3DTNA 2C30A 4AW0A 3ACJA 4O6EA 1IY9A 5K0GA 1H07A 4RBLA 3OZSA 4FKQA 2XA4A 3THRA 2UW8A 2UZNA 5IQEA 4G2FA 2W0JA 3LHJA 4AZTA 4O7WA 3TV4A 2QOKA 4KIOA 2WK1A 4NJ3A 4BB4A 4O0SA 4AZFA 4ZS0A 2UUEA 3SXRA 3HMOA 1J91A 3LCSA 3F5XA 4RVLA 5CNOA 1OBDA 3R22A 4WUNA 1ZY5A 2OB2A 3VJNA 4FT7A 5FDXA 3LKDA 3C1XA 4QP9A 1JSZA 5I9ZA 4X0MA 3S1HA 3OCGA 4C58A 1YI6A 5E2AA 3V8WA 2W1GA 5D7AA 5D11A 2V0DA 2ZWVA 4H36A 3KXNA 4Y73A 4DFYA 4EHVA 3QRTA 4FEWA 4EL9A 2UW0A 4EH6A 1QMZA 3MSSA 4Y5HA 4JQEA 4Y5QA 4ITIA 4IVBA 2WMSA 5AA9A 2OXYA 4RVDA 3BHVA 3SX0A 5KMLA 4MIKA 4R3PA 4QMQA 1XH6A 1KUTA 2REIA 4TWPA 2QO7A 4FT3A 5A14A 1XTPA 1FMKA 4IB5A 3TNWA 1G38A 3HP5A 2F7ZE 4M7IA 1WAKA 5DTRA 2FSTX 4I3ZA 2J5EA 3GCSA 4RVMA 4HG2A 3QXPA 3UNJA 3OUKA 4A9YA 3G2QA 2XNOA 1OIRA 3DDPA 1H1SA 2YCRA 3TR6A 1ZG3A 3DFAA 2YTZA 4QTBA 2YN8A 3IW6A 3FSFA 5C03A 1NW1A 3I0OA 5C4LA 4WG3A 4Z16A 4MX9A 3BX5A 1IR3A 2GFCA 1YFJA 4O7NA 1V39A 5CS6A 2XBJA 3EN9A 1P1BA 3AXWA 5DG5A 3O7LB 2ZM3A 1ZARA 2VU3A 4RIWA 3ZUVA 1RI4A 3DXNA 3FYDA 2JKMA 5HVYA 3PA3A 1YI3A 3F66A 4JT3A 3ZZEA 5IKMA 4AOJA 3T9TA 4AZEA 5E8RA 2XKEA 2ETKA 4EJNA 5HBHA 3H4JA 3BZBA 5IG1A 2ITWA 3GOKA 3MY5A 5AP2A 1BHJA 3KXXA 2XNEA 5FP6A 3GGDA 2XCKA 5CEIA 2V7AA 3OY3A 5K5XA 3ETAA 4RX5A 2ACXA 5M57A 3A7JA 2XM8A 3QD2B 3GFWA 2O8YA 1W98A 1I09A 4M37A 1CTPE 1MRYA 1JLUE 2XKCA 3GFEA 3QCSA 3SSNA 3ODZX 2XJ1A 3FHIA 5AUVA 1Y8GA 3QQJA 5CYIA 3CIKA 1NT2A 4BP3A 5T3QA 4BCHA 3RAWA 3JY0A 3KQ7A 2R6ZA 3IYLW 4B17A 3R24A 4IAAA 3UJ8A 3K3JA 2JEDA 4D4RA 3CC6A 3MA6A 2YIYA 2BKKA 3NIZA 2WMXA 1R78A 4D0XA 1H26A 4ASEA 3R7YA 4LG4A 4C37A 4D5HA 3FL5A 5C9ZA 4LRMA 3BI6A 2HR1A 2XKFA 2UZLA 3GB2A 5U4XA 1T45A 5LQFA 3I64A 3MA3A 4ZSJA 3G2OA 1XH9A 3E7VA 2CPKE 5HQ0A 1CDKA 4KUJA 3MB5A 3EVZA 3NUAA 1XO2B 1O9GA 3R1NA 4NKAA 1RI3A 3W32A 3IDCA 3G9LX 3Q32A 4IAFA 5HG5A 4P7FA 3TDWA 4YPSA 5CASA 1PF8A 4BCPA 4LGGA 3NDMA 3GRUA 3NSZA 3CGGA 3B3JA 4YBKA 4ACGA 4BVUA 2OXDA 1KHHA 3A62A 3GP0A 1YDRE 5HCYA 4GVJA 2JFLA 2E9UA 4LV8A 4J8MA 5DM0A 3QV2A 3R28A 4EK9A 3TZ8A 5CIYA 2JC6A 3HUBA 2BVAA 1W84A 3FUVA 3FLZA 5DN3A 3C0GA 1OUYA 2Z7RA 3JYAA 4DA5A 4IV8A 3JWJA 3BWMA 2R3IA 2PBFA 3C6KA 3SW4A 5FA8A 3JR1A 4O86A 3VUKA 1XDZA 4MXZA 3EMDA 5HG8A 4AA4A 2EB2A 3HEGA 4C4FA 4YGAA 4YURA 1DAWA 3KN5A 2PUPA 4FK6A 5E91A 1EG2A 5IUIA 4RMZA 4AG8A 1JTEA 4JR3A 4XG8A 2ZVJA 5EYDA 3UFBA 4OQDA 4L46A 2ONZA 4AS0A 4GC5A 2BDJA 1M7NA 2JITA 4GBED 3FXZA 3PFQA 4ZTRA 3FI2A 3FKNA 2XIXA 4YTHA 2F2CB 3SSOA 3VF8A 3EN4A 5DTMA 1FMOE 3HYHA 4KRDA 3F3TA 1VP9A 5IUHA 4A4LA 4G5PA 3KRRA 1DAYA 4YTIA 2OJFE 3KPJA 4RFYA 1M0EA 4BTKA 2R3PA 2YM7A 5CSWA 4YHJA 3WF6A 4YPDA 2AR0A 2PLWA 4U79A 1YXUA 5EKXA 2IDKA 3IS5A 1ZMWA 3BHTA 3NAYA 3QTWA 4WT6A 2WMBA 3ZC6A 2GMXA 2ADMA 4L3PA 4GFOA 2E9OA 5IEYA 3S00A 5CVUA 2ZAZA 4Y85A 3AT2A 5LQNA 3LQ3A 3MIAA 3ZO2A 3M42A 3P9JA 4EJ7A 5EKUA 4L68A 3DLSA 2C6EA 3C4XA 4G9RA 1OMWA 4CTBA 3MTFA 2ZJWA 2C6OA 4IFCA 4B8LA 5EW3A 5FA5A 3H3CA 3OD6X 3DZOA 3VS0A 1UV5A 5DYJA 3W10A 1JPAA 4PYQA 3LFDA 3ULZA 4BKJA 4FTOA 3OU7A 1FVRA 4PGHA 3ACKA 5CNNA 4XMOA 3GCQA 1YXTA 4EMSA 1GJOA 3NNVA 4O82A 4QQTA 2OIBA 4XCXA 2YDJA 3CS9A 5I9VA 4KVZA 2C7RA 1BI7A 4X2GA 1UNGA 3UMWA 3UPXA 3MTIA 2YABA 4FG8A 3TKHA 2A14A 3TFWA 1Q8TA 5JSMA 4HGYA 2XH5A 4QYEA 1M2PA 5CT7A 5CI6A 3BBWA 4OTRA 1VYZA 4V0GA 4GYIA 5M06A 3UQFA 2X4FA 2VWIA 5CUQA 1OL6A 2VAGA 5JEBA 3PA5A 5CY3A 1I1NA 5CEQA 5T64A 3QCYA 5ACBC 2UYHA 2IN6A 4B0GA 4P90A 4Y95A 4E2ZA 2PTKA 3PJ1A 2UW4A 2YM8A 4XBUA 2X9FA 4ASDA 3T0IA 3EHAA 4FL3A 4G6OA 4QTDA 3GI3A 2R7IA 1SM2A 4RJ3A 1AQJA 3HVHA 4HH4A 1SMHA 1H08A 1SVGA 3PY3A 4ASXA 2FCAA 5HLPA 1K2PA 4FIIA 1PXNA 4WNPA 4E6DA 3PZEA 5K0NA 1QL6A 4U45A 3RM6A 4ZJVA 5E1DA 3EB0A 2YIXA 2OK1A 2EJTA 4IZYA 2IZRA 4IJPA 4GEKA 3A4TA 5LQRA 4U7TB 3WE8A 4MQ2A 4F85A 4F9CA 3R21A
chains in the Genus database with same CATH superfamily
2LR0A 2ZSDA 2P1ZA 1BS1A 1NJ6A 3T7SA 3K20A 4BBMA 1PQYA 3ZWXA 2QX9A 1AQ1A 1YI4A 4H3SA 2XUGA 4EZ5A 2CBXA 3PXBA 4BUCA 4U3ZA 3TYKA 3IT0A 2XK7A 5A3SA 4KXXA 3GFFA 3A1FA 3IW5A 1V1RB 3AILA 2II6A 2G4VA 2JFNA 1CYDA 2VX1A 5ER9A 5I4NA 4IOJA 3KREA 3VZRA 1EJ2A 4QARA 3V4SA 2ORIA 2V6MA 4E2FA 1RLIA 1OKWA 4BE9A 3D5UA 2G07A 4WO5A 1T5HX 5EP3A 4IMYA 1JA0A 1SUFA 1OH5A 1C9EA 4PP7A 3BFKA 4OYYA 3ZNQA 3JS5A 3KR0A 4DHJA 5LCJA 3OEHA 1HV8A 1GD1O 4IVCA 4LJSA 4L9IA 4YTFA 3Q10A 4TSKA 4UBLA 4G3DA 4G56A 2MJLA 5AVZA 2R6GA 4BIIA 2V59A 4V01A 3PGMA 4NYJR 5LWNA 1E9VA 2OK8A 5ALKA 3L1VA 3AM3A 1DKLA 4BRXA 5DLYA 1RYYA 2R8YA 1X8BA 3I60A 3O26A 1K5DA 2WU8A 2YBEA 4QECA 2H0QA 5DSXA 1L1EA 3R1SA 4XOYA 4DR4B 3LXLA 4QXRA 3IEMA 2R7BA 5C0OE 2PZJA 3L6CA 4OLHA 3C74A 3OM1A 4DLIA 1UZUA 2B7AA 1I1OA 3ZWOA 2HSWA 1B43A 3EGOA 3MGGA 1QE5A 3HVJA 3ZBUA 1MOPA 2P2LA 4WX2B 3H11B 2OGUA 4RA5A 1M1YA 4DQDA 3EL7A 2CMGA 2EBHX 1DX4A 5HE8A 3GH3A 4RC4A 2AG0A 4Y2PA 4GK4A 2Q49A 4DBVO 1VRWA 1UFVA 3P9KA 3WO1A 1RIFA 4X92A 4K6CA 1HE2A 1JZQA 5FTOA 3JZMA 2QD1A 2Q3JA 2QTGA 4M89A 1JUDA 2VQ3A 1ZBDA 5JYCA 2Y05A 4CMKA 4TQ9A 3MJDA 1DADA 4QMYA 4MXOA 2X6DA 2ZFYA 3J81A 4IHKA 1QHEA 3G17A 4UM9D 5DN9A 3G5DA 4J4HA 2ZCVA 3WRYC 1Z7BA 3GLFE 3I9V6 4LCEA 2FSFA 10MHA 3A6DA 1UEXC 1YJAA 1ATPE 4KC0A 4Y67A 2BMDA 2C9ZA 1PRYA 3CZCA 5HG0A 2DS1A 4AN3A 4Z7HA 3BE6A 3OCBA 1P91A 1UANA 2IYVA 2W2KA 2PGJA 2JPDA 3V4PB 4IP0A 1ZY4A 1SELA 1F6WA 5B2ZA 4DMHA 3RJ9A 3H9QA 2VF4X 2FN8A 1BEZA 4GDFA 2RG6A 3QD0A 3L6OO 3VVMA 5CXXA 4G5OA 1V2HE 1GOLA 2PH5A 1EK5A 2JGLA 1T0PA 1G41A 1G9TA 4A73A 4ZSLA 1B42A 1KXZA 2OVFA 4B2IA 3B48A 3HR7A 5J3JA 5G1XA 1L9KA 4D4YA 5FH9A 4UARA 3LY8A 4UOZA 2IZ6A 1V26A 4IIGA 2O06A 3O4IA 4QPNA 1GLVA 5A3QA 5EI5A 3H2IA 1SBQA 1NQAO 1RQPA 1G7RA 3AEQB 4RHTA 4D79A 4EY4A 5BV1A 3QTBA 1F9AA 3G68A 4JYAB 4AXDA 4AQYB 5TE9A 2J6IA 2PMBA 2Y76A 3U3RA 1E3WA 1H05A 4E13A 3E7FA 3NHYA 5FWAA 3I4BA 3AMVA 3EF1A 2BMJA 3DG9A 1V5WA 4YA6A 5GADl 3CKKA 1ICIA 2QTAA 4CD0A 4RDIA 2I7TA 1P6QA 3GY0A 1QH1B 5ITSA 2R7MA 5DTQA 3B9BA 1R7RA 1EFRD 4BRSA 4WAUA 1KAMA 1S3FA 2VQFB 4XB1A 4QELA 3O8OB 3WSTA 1NC3A 4WBNB 4DHEA 1N2BA 2FWNA 1QIGA 2GK4A 3TB4A 1TAHA 4U7WA 3GP8A 3GPCA 5IBCA 4DCEA 2YHVA 2RH5A 1Z7YA 1UK7A 5E7QA 5BYBA 4ZTHA 1IU9A 1V37A 1YTLA 4JX3A 4TX1A 2B1PA 4PTYA 3ER8A 3L9LA 4NI5A 3NNWA 3H5NA 1QZ3A 2JGDA 3QHPA 2XHEA 2F00A 1FLVA 4USDA 5D9HA 3AJEA 4FYJA 3OP5A 3PQ5A 3WWPA 1AGRA 5EJ6A 2AUNA 2VTLA 3EPPA 4UCFA 1J1UA 3L04A 3PUZA 3H87A 5JH7B 3WRWA 2VOEA 2ZT6A 3G6WA 1ISHA 1T9CA 1U6IA 1VKNA 1YR3A 1VPTA 5EH0A 4X8HA 4Z4FA 2X2FA 1KAHA 3WGLA 3G0DA 1RJEA 3JW8A 1UU3A 4YZCA 1ZVJA 4ZCQA 5IQDA 3CEAA 1G8MA 5INTA 4JLKA 5LLTA 1CQJB 3DBCA 2RFLA 4BC6A 3RRYA 3QBJA 5A5VA 4I0SA 1YCFA 2KYRA 1VPEA 1OH6A 1LI5A 1XJQA 1CUDA 1NBHA 2CXSA 3CQEA 5LQUA 5CF8A 4FFBB 1Q84A 3ZTXA 4D4HA 2OL4A 4PYMA 1OFHA 4MJ7A 1TUGA 4FEVA 5EFQA 4IM3A 3SDZA 1N1MA 4QPPA 4HDSA 1FQOA 13PKA 5DRBA 4GW8A 3TH5A 1W5SA 5KYYA 5BO5A 3I05A 2WMUA 1O8CA 1G20A 3ZDDA 1KPIA 2YVQA 4QUHA 5BPFA 3E88A 4MUKA 4WBNF 3BWDD 4BB6A 2H18A 4NVRA 3LX8A 4PNKA 2HOQA 3TSWA 4WGGA 2PUIA 4LX0A 1KZ4A 2ZANA 1L5LA 1RC1A 2QJTA 4MMXB 4QTXA 3AW9A 3EWAA 3KJNA 5GM1A 1QANA 3WI6A 3L1KA 3H1GA 4TMZA 4IYRA 4F38A 2NX2A 2BFFA 1Y3BE 3GU3A 1KO7A 4MRPA 4MA0A 5GJCA 1AS2A 2X9EA 1TYZA 4D5KA 4YMHA 1U7OA 2Z30A 3NDJA 3TTYA 3W06A 4EOQA 4FVRA 3VU8A 3FOFC 1N92A 5KTYA 3HJUA 1VXOA 3VRYA 1L8LA 1TD1A 2W70A 3EQ9A 3WQRA 1ECLA 4DGMA 5BOSB 1ZWSA 1TRKA 5JH7F 2HWWA 4NMLA 4C4HA 2PK3A 4XPZA 1LNSA 3NR2A 2DRIA 4LW8A 1T25A 1LNQA 3KQUA 2I71A 3NJ4A 4HEA6 5J58A 4MBIA 1AK2A 1M2FA 1NXTA 1NP3A 3TTIA 1XTKA 3HHPA 4A27A 2J3EA 3SIWA 3ECAA 5AI9A 3TV6A 3QKSB 3FV8A 5ALWA 5F1KA 4DLNA 3WKBA 5EKDA 2ZRBA 4DN5A 1D3AA 5FADA 4LVNA 2UZ3A 2JEOA 4EA9A 3LDUA 1ZAOA 3VPHA 3PQCA 1Q8ZA 1D07A 3W33A 3T0GA 5BR1A 4JN6B 4HTFA 2WPDA 1SQSA 3VR4A 3A7HA 5ICFA 3NBKA 3X1DA 4FSUA 2PZEA 3NV7A 2NVUA 2XUDA 2GS7A 4EUHA 3BM5A 1RYNA 5CB8A 3HKCB 4YI5A 5B1EA 4IAZA 1BA2A 3DNEA 3MHTA 3LCDA 1CP2A 3SPXA 1Y7IA 3E7DA 2R2AA 5FDFA 2HMAA 3DVSX 2XRWA 2I29A 4GIBA 3V5QA 4LJAA 4JI3B 1MGPA 4ZHQA 1UJ5A 1IL0A 5DMHA 1J4AA 3FNGA 1EFTA 4KTVE 2C29D 4EHFA 4DV5B 3QYZA 1BWSA 3MSXA 2PSFA 2QT9A 1AQYA 2Y1OA 4UMVA 3G1UA 4X3OA 2OLKA 3H1TA 1BXZA 2PZRA 4QOIA 2GCEA 2EW1A 3WGJA 1AXGA 1CXZA 2VSNA 3I2IA 1SCJA 4DQXA 3K2EA 4C36A 5A2GA 1DXYA 2VJMA 1JFTA 1Z2EA 2B98A 2XMRA 3K9GA 3F2NA 1FTSA 1UU7A 1NY6A 1LV7A 2KLHA 4UD6A 2CC2A 3VNAA 4N8DA 3GMSA 1CW2B 4ZT7A 5FPSA 1L6IA 5KX8A 2VAPA 4QDJA 5IF9A 4WXPA 2HA4A 2IXFA 4YAGA 4E51A 3ERCA 2R3LA 3RRZA 4A03A 3SYKA 3VC2A 3IUNA 2VJBA 3AJDA 3G5TA 3TQSA 3KE8A 4O2AA 1P81A 2YIJA 4BRUA 2P4SA 3AQIA 3IJPA 4P5EA 1XWSA 3PRJA 4R9NA 2JLYA 1SCDA 4L3JA 3OPYB 3V4RA 1MNAA 3INYA 3MFSA 2WSIA 1NLZA 3EJ6A 1ZYJA 1SVNA 3LPNA 4FMDB 2PRJA 1CQXA 1ZUIA 4M76B 2R79A 3HCCA 1K6EA 4JOBA 2XX3A 3WBFA 5CLGA 1E7MA 1T8RA 3C5EA 4G0UA 4EABA 4Z3OA 1L8OA 4CI9A 3P26A 4Z3DA 4AGUA 1W7HA 5DWRA 5E6UB 4V0MA 4BO6A 5LMAA 2QRGA 2ZIWB 3D2AA 1FMLA 3ROZA 4UKDA 3OVVA 3G5UA 2JRCA 1HQKA 5D41A 4V38A 5DM2A 5TVGA 4GPAA 2Y67A 4IJ9A 4NARA 3ZWCA 1R3CA 3ZLSA 2P3QA 1VE9A 1H93A 3DVAB 2BEUB 4Q3NA 3DE4X 1M8KA 3GAAA 4JR1A 3R02A 1L7BA 1CPYA 3Q3EA 4PAQA 4RF3A 2VDWB 4WHMA 2I6TA 4MH7A 3TVYA 2ZI3A 4HH1A 2Q4RA 3NZ0A 2HF9A 3ZCVA 2XJ4A 3OIDA 4G1EB 1JBQA 1A9PA 3MPUA 1ANKA 4R83A 3FDIA 1KE5A 2C2XA 2XVZA 3QYPA 4E88A 4F11A 4K9OA 2HLHA 1A9XB 4K5QA 2GUGA 2VPPA 1L8XA 1II8B 3HKEB 3KKVA 1LA2A 2QAJA 2Q50A 1H28A 5M56A 4R8VA 3DXYA 4DM4A 1GCIA 2QVZX 4X5OA 3DQQA 4BKOA 4IDFA 4FMDF 5HNIX 2UW6A 4TQUS 2RHMA 3B7PA 3NP9A 1FDOA 1WLYA 2B1IA 3A0UA 4EEKA 4Y2GA 1G1MA 5DTEA 4PZLA 3SF8A 1EE1A 1NZDA 4ZCLA 4G09A 2QUAA 4GGOA 4AOTA 4AA0A 2D4HA 3MJ1A 4IRMA 4OTDA 4QICA 5JADA 4LZLA 4TS3A 3I0ZA 3GLHB 5D00A 1SBZA 4PONA 1ZCAA 4MWBA 2WE7A 2XSZD 3UOHA 3FMDA 4GLBA 4G36A 2XNHA 4YJDA 1X8KA 2QTFA 4L3OA 4FBXA 5A7GA 3MVLA 2GD0A 4RVNA 5AUTA 3UATA 2HN9A 1I3NA 3E64A 4M7WA 2I67A 5C5CA 4B45A 1H1PA 4G0ZA 1KQNA 3ZJTA 5E6SB 1O6CA 3R3WA 3WADA 5AX3A 1ZU5A 1K9AA 3RHFA 3L4BC 4OGGA 1LVGA 1SVEA 2VYND 3LBAA 1ZM2A 2KX7A 3SF0A 5CAVA 2C8LA 1US8B 4B3SB 4ZY6A 4JSRA 4JU9A 3ZXZA 3ZK9A 3HXTA 1GGJA 4G97A 4I0RA 4CLIA 2GLXA 1FP2A 3IUSA 3G6KA 3VULA 1RXYA 4YQFA 4AN1A 4LBWA 1EQUA 3UJNA 2PZMA 2A0FA 3TTTA 1Z3CA 3EWIA 4MDEA 4RE5A 1L1QA 1GNVA 5BQFA 1H0SA 2CFTA 1Q2UA 5LP6C 1X7YB 1M34A 4MGHA 2YOGA 2JL1A 1UR5A 5TQVA 4IRXA 1MQ9A 2E49A 4P8RA 2TMYA 4PCAA 4NNPA 1SVWA 2FGKA 1VG0B 2LE0A 1DRUA 1ECGA 3AR9A 2WB2A 3OQIA 3D0EA 3M1SA 2W58A 4I8XA 2CL7X 4CIBA 2NT3A 4DPMA 4G1BA 5CEKA 4F70A 3TTVA 4EGJA 3FLQA 1Q77A 121PA 2RH4A 4E4MA 3X1ZA 5FJJA 4LWPA 4FYMA 2DVMA 2WIPA 2JH8A 4DGQA 4FSMA 1TFRA 3QXGA 2P3GX 3ORFA 3L5KA 2DGDA 4D4LA 2OAQ1 3M2TA 4ND7A 4Q9IA 5IC6A 1IH8A 3VS2A 1PUIA 4U39A 4AW2A 3JXWA 1A8PA 4U0JA 1ETUA 3WOHA 1YVPA 3NHBA 1IJBA 3F6CA 4B0OA 1E7WA 2ZWIA 2YVAA 4OGRA 1QO0D 1S9DA 4WN9A 3WIEA 4BJHB 1IHPA 1U3FA 1KOFA 1RPTA 2DQZA 2YWJA 2JA1A 1OTYA 3AINA 5GZ1A 1B0AA 4HOKA 2XNBA 3F5FA 1XZMA 1Y5MA 4R1YA 4FR4A 3EZ9A 3P9CA 2WKRA 4V0NA 3H30A 4R2KA 1N8NA 6Q21A 4R3WA 4NMHA 2XUFA 2IZTA 1B7GO 3WZEA 4DG2E 1Y48E 3NC4A 2ZRJA 1FTGA 4KQHA 2PR2A 4XIYA 5BYLA 4BCBA 5KC9A 1X1QA 4ZTZB 4AGWA 3DMYA 1SH7A 4PIMA 1IBRA 4ANSA 4Q3KA 4FX2A 1BWRA 3KYIB 5KUTA 4B3CA 4LFCB 3S81A 4EY3A 4GK3A 1ONNA 3TTJA 5IU6A 3L4BA 1UUFA 3A3YA 3SLRA 2A9KA 3TWJA 2XJ0A 3U7RA 3R8VA