5GIOE

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
molecule tags Transferase/rna
source organism Sulfolobus solfataricus
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
total genus 63
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gioE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gioE02
3TNPC 4BGHA 4E93A 5B2MA 5BMMA 2W5BA 2JIIA 3V3VA 3LDFA 3PJ2A 5I9VA 5KQRA 3E7VA 4OLIA 3DXZA 5D7VA 4BB4A 3G2MA 4QQJA 3QHWA 5BXYA 5FP6A 2QE6A 1P5EA 3HCBA 1TQMA 2CCHA 2VTQA 3P7BA 4FIIA 3W2PA 5F9EA 1KOBA 1DL5A 4K77A 5J7HA 4UYNA 5E8YA 3SRVB 5JT2A 2YTZA 4I6HA 3QOXA 4C2VA 5HVKA 2Q0NA 4X7QA 3C6KA 2F7EE 2NXCA 5EEHA 4O84A 4ZY4A 2OI4X 4IMYA 5AV3A 3OTVA 3QL8A 4FZDB 2P3OA 5E8JA 5J9LA 2WQOA 3PSBA 4NSTA 3A7GA 4WT6A 4GK3A 2BVAA 3QZFA 4F09A 2JHCA 3IW7A 3SKCA 4TYHB 5AADA 3LAUA 5EM7A 3EQDA 4R5SA 3KR2A 2OBJA 4IDVA 4R3PA 3RALA 3R7EA 4CKBA 4IDTA 2JKKA 5DI1A 4CCBA 4XP3A 4EUTA 4DEHA 3OUKA 4DH3A 3FMNA 2XMYA 3FI4A 2FHPA 3EVGA 2UW9A 4BDBA 3NJRA 4AA0A 1QAOA 1Y57A 3E8DA 3BKXA 2RIOA 3PXFA 2V5QA 4EKLA 5KO1A 4FT3A 4ITJA 5HD7A 3M6XA 3OUNB 4YHFA 5BUEA 2O5KA 1R39A 3ZSIA 3IGGA 4XCUA 2YEXA 4I4FA 2F49A 4QTDA 5LQUA 3ZXZA 3FY0A 2VTNA 3R9NA 3CY3A 3DAKA 3IOKA 3BWCA 2X0GA 2CMWA 5K4JA 4X21A 5EMJA 4O29A 3OY3A 4WG5A 2BIKB 1V0BA 3H3CA 2PE2A 3NLBA 4KS7A 1BC5A 5G6VA 1GIJA 1BKXA 2BCJA 3AD6A 3F9NA 1FGIA 4YLLA 3OU7A 4KBKA 3ZC6A 2G1PA 2YISA 3BHHA 4JR3A 2A4LA 3CKWA 4JDHA 5IDPA 5LVOA 5D41A 4OQEA 2YJRA 4HGTA 4FSNA 4OR5A 4MYGA 4QYFA 4AU8A 1KWPA 4IB0A 3OP5A 4RVLA 4XS2A 3HEGA 3FJQE 3CPBA 4UXLA 3T8OA 2ITZA 1H07A 4RBLA 1M0EA 5DRYA 3BLRA 3MH2A 4YV0A 1XBCA 4B8MA 4D1ZA 4A9YA 4TXCA 4USEA 3R3HA 2XKEA 4Y5QA 5FM2A 4GMYA 3C4EA 2BTSA 2C0TA 5AMNA 1URCA 5A4TA 1YOJA 4RGJA 5DT3A 4IE9A 1XH5A 3BGQA 1JSTA 3QQGA 4EWQA 5GM2A 5KHWA 3SDJA 1YDRE 1W0XC 2OG8A 3FMMA 3UBDA 4OT6A 4CTCA 2NP8A 3CR0A 2CNUA 1ZKDA 3ZUUA 5AIKA 3A26A 3DU8A 2ZCJA 2UZNA 5CX9A 5AUZA 2G9XA 3SX9A 3GEQA 5KZIA 2PLWA 3OWKA 5ANJA 1YFLA 3U54A 1OKZA 3U6HA 4ID7A 4RJ8A 3VW8A 4O6LA 3RGFA 4RX7A 3OCGA 4L45A 1L3BA 3R9HA 2OJGA 3OW4A 3OVVA 2OGVA 3FE3A 3CGOA 3HNRA 3Q6UA 3Q53A 3VBYA 2ZZNA 3MB5A 1YHWA 3I64A 3FKNA 2UVZA 2GNLA 2ZWAA 4D2RA 2EFJA 4FV1A 5EKNA 3UO6A 4FT2A 2GTMA 3E8CA 3ZFYA 1UNGA 4IKPA 2HCKA 2AOUB 1DI9A 4G3EA 4D9TA 3C0GA 3NW7A 5BPYA 3MBLA 3P5KA 3DB6A 4Y85A 3EVZA 3F3UA 4FSUA 2PK9A 3KQ7A 4Y30A 3EHAA 2YIXA 4LQMA 4QPNA 4IVAA 4EZ5A 2R9SA 4U0IA 1R8YA 1RI1A 2YITA 4F84A 2I7QA 4FNYA 2VDWA 2UW8A 4BDCA 3FWQA 4H3QA 3QTIA 4BGGA 5CVDA 3NDIA 4CTJA 4D4VA 3A61A 3FUWA 2CLXA 4H0NA 2CHLA 3GU4A 4EWHA 2IWIA 3PP1A 4CT1A 3V8TA 3PPKA 4BY9E 4YZCA 2WQBA 3UNJA 3KEXA 4HCVA 3ZLSA 1EJ6A 1GZ8A 3OZ6A 5JQ8A 4C04A 5AAEA 1PMVA 4Q9ZA 5CYIA 1U5QA 2PVMA 2UVYA 4G5JA 4KKHA 4RA5A 4YHTA 3ZEWA 4E5AX 3H30A 3GVUA 5HD4A 1BMKA 3LQ8A 4G56A 3DK7A 3PXKA 4LRKA 3LCOA 4DA4A 4YR8A 4AUAA 4R3RA 4YMGA 2XVAA 3DB8A 3LKMA 3FPGA 2I6GA 5T6BA 5CY3A 2Z7LA 3VW6A 2JG3A 3MFSA 4NK9A 5CSXA 1OPLA 1KPIA 3G90X 4Y95A 1FPQA 2ZDTA 4ACGA 4CFMA 3UVRA 2IVTA 3V01A 4W8EA 4BGQA 4GC5A 2JITA 1M14A 4TT7A 3UQCA 1VE3A 4B99A 3OE5A 4ISCA 4GJ2A 4H58A 5M07A 1TPYA 3DA6A 1QYRA 4Q2AA 5DOSA 2ZVJA 4GUAA 2OICA 4QP6A 5FADA 4EKGA 4CG9A 5HU9A 4M14A 3K54A 5KKRC 5CVJA 3LQ3A 3MW1A 4FEQA 1F3LA 2WFYA 5JRSA 4BI2A 4ZOGA 1Y8YA 3VULA 4A9RA 3KULB 3ZFMA 2UYOA 5IKMA 1UKHA 2Y8OA 3HP2A 3KR9A 2GPHA 4FX3A 4IAYA 3SV0A 3L9MA 3NIEA 4PWYA 5FWDA 3GI3A 3ZO2A 2ZIGA 1Q97A 3QYWA 4OBWA 5IUGA 2YAAA 2AN5A 2WTVA 4DGLC 3FTCA 3VN9A 1YZ3A 2YCQA 3BGDA 5KNJA 3ZTXA 1MHTA 2ZV2A 4JX7A 3U51A 2OU7A 1OMWA 2HELA 3QXPA 4EQCA 3F88A 3O7WA 2ZFUA 4NM5A 3FRHA 4DM3A 2R5TA 2PV0A 2X4FA 2YDJA 4FYNA 2EG5A 3Q32A 4J97A 4TZRA 2EJUA 2QLQA 2G70A 2R3SA 3BZ3A 3LCUA 3LKZA 4PIPA 4U7PB 2VWWA 3THSA 3PVUA 3BGPA 2UZUE 3KREA 3LE6A 4FIJA 3THRA 4NFNA 3WBLA 2QYOA 3UE4A 2GS6A 2IH4A 3ZS5A 5BVDA 3KQVA 5H8GA 4RWJA 4X3FA 5EI6A 2C5YA 3MY1A 4NUSA 1ZGJA 2EX4A 3SM3A 2XK6A 3QRTA 3T3UA 2J2IB 1LP4A 2HTEA 3PJCA 3RWPA 1I1NA 3ER9A 1L8TA 5FULA 3RHKA 4BI0A 1W7HA 2AUHA 4BTJA 1J7UA 3LJ1A 3RIEA 2PHKA 3BZBA 3EGIA 5CS6A 4I24A 4TNBA 3E88A 4HVSA 3C0HA 3Q9WA 4Z9LA 2OIDA 3OU6A 5CU3A 3TZ8A 1X8BA 4GVJA 4GW8A 4U3ZA 3B3JA 3MESA 3DFCB 3M70A 4JXJA 4RX9A 3RPSA 5FXQA 4FSTA 4ZJVA 2YIWA 2NNWB 4MNEB 4NFMA 3LHJA 1YZHA 2W99B 3KF4A 4N0SA 5HEZA 3TKHA 2C7RA 4F7JA 4ER3A 5BVOA 3ZO3A 5C26A 3R71A 5K9IA 4NZWB 2C6IA 3TIZA 5HO7A 2IZRA 5P8WA 3IDBA 2I9KA 3T0IA 3GC9A 5DXAA 1S9IA 3L9NA 1Y91A 4MX9A 4BLWA 5KS2A 2GQGA 3QKLA 1WBTA 3SVVA 3ZFXA 3E8SA 4PYJA 4NM3A 4ZZOA 4GQBA 1SYKA 2J0MB 3OXTA 4DG0E 4F65A 5K0LA 1J91A 2WMVA 2VU3A 4NCTC 3JWIA 5CT7A 4M12A 3HDNA 3AY0A 4KA3A 1YUBA 5AX9A 2O8YA 4DYMA 4CKRA 4MVFA 3EN6A 1M7QA 5JFXA 3MIAA 3NGAA 3FI3A 2CGVA 3PRFA 4AWIA 4CFFA 4AF3A 5DM1A 4IZAA 5LXMA 1FJXA 3KXNA 5IQIA 4KABA 2PUIA 4MIKA 5CCXA 3A7IA 2WKMA 5DM4A 5E7RA 3AJDA 2XP2A 4USFA 3PDTA 3ENMA 4DCGA 1E1XA 4MXZA 3R8VA 2V7EA 1UWVA 3NUSA 5EW9A 2VP3A 4LECA 1OKWA 2Y6OA 4RX1A 2J51A 2QOQA 2XIXA 3G0FA 5ICGA 4KIQA 3Q4ZA 3HCCA 2VTTA 5CXZA 2LAVA 5HIEA 2XEYA 4BTFA 5JGAA 5CASA 1AD5A 3G2QA 4EH7A 5FQOA 4HCTA 4YNEA 3NUPA 4F64A 2CGUA 2PUPA 4E6DA 3KPUA 1KPGA 2WHBA 2W9FB 4MNEA 2PZYA 3PVWA 4DA5A 4Z55A 1CM8A 3ZZEA 3PVGA 5G02A 3EKNA 5HHWA 3GIWA 2R3QA 5B2LA 2VUWA 1QL6A 3A7FA 3NCZA 5DBXA 4DH1A 4EVIA 4B6LA 3WE4A 4WOVA 7MHTA 4KS8A 4MXCA 3FMEA 3I58A 5LARA 3MI9A 4AP7A 3FLQA 4H3PA 5F20A 3FYJX 4DH7A 4DN5A 4BCHA 3G2OA 3E87A 3GRYA 1NW8A 3OCJA 1VP3A 4UXQA 4EOPA 1QPDA 5EHIA 3ULZA 3FQSA 1G8AA 3CP9A 4L53A 4C2WA 1AQIA 4RVGA 3LW0A 3EEOA 3TM5A 5BUIA 3WIKA 3QRUA 4F9YA 1VLMA 3WIGA 1O6LA 2VO6A 4NH1A 3GRVA 3TL8A 4V01A 2UW7A 3L1SA 5CENA 4RRVA 4WVLA 5ICCA 3TG1A 2WO6A 3V6SA 4O7WA 4ZTLA 2GMXA 1APME 4IM0A 2IDKA 5EM5A 1IASA 2BR5A 4XCXA 2BRMA 4FK3A 2R3OA 4O0RA 4ALWA 2HMYB 3KCFA 2EB2A 5D11A 1NVSA 3VS6A 1DS5A 1I09A 2Z7RA 5ANDA 4EC8A 3VJOA 4JJRA 2HZ0A 5H8BA 4RWZA 4O0TA 3MV5A 1MQ4A 4YJUA 5FG8A 1XDZA 3W16A 3VQHA 5KBRA 5M44A 4MNFA 3EL8A 4Y83A 2QOKA 4DCEA 1WXXA 4YUVA 2R3FA 3V51A 3BU6A 1Q61A 5IQEA 2YIRA 4WUNA 4BZNA 3QZIA 5CM2Z 2YM5A 4ENYA 1JG1A 2BHEA 1A48A 3GCZA 4J52A 4LOOA 4K0YA 3V8SA 3UQFA 2R3JA 1CDKA 2V7AA 4EBWA 4O83A 4ASDA 3CJGA 1PF8A 3ANQA 1K9AA 2QG7A 2CKDA 4XRJA 3BYSA 4FZFB 3E92A 1UVRA 2JFLA 1Q0SA 2Y1XA 2R3MA 4FZ7A 4FKJA 3RKBA 1XTPA 5IQDA 5J1VA 5LQFA 4FGBA 4EH5A 2C4GA 2HW7A 1DI8A 4LYNA 1ZARA 3VO3A 5FDPA 3U4WA 2HR1A 4LFIA 4IAKA 3M2WA 4RIWA 2W5AA 3OE4A 4YV2A 4ERKA 3HVJA 5T64A 5LQKA 1OPJA 2DQ7X 4DEIA 3AXTA 3GENA 4DEDA 1XVAA 3HTXA 4N6YA 4O0SA 4QQNA 3LXKA 1SQFA 2YIQA 2JAMA 2P4IA 4EYMA 4RJ4A 1VJYA 2ZOQA 4DHFA 3HRCA 3IPHA 2WAJA 4QNYA 4ACCA 4XG3A 1WAKA 3ERKA 3E3BX 2EXMA 4QO9A 3K2LA 3Q9ZA 4XG4A 2NPQA 4YJQA 5EM6A 1JTEA 2XIKA 3BGIA 3EEYA 3ZLYA 5DLSA 1H00A 3UG2A 3EQPA 3A4TA 4XUCA 5DIAA 3QCSA 5AV1A 5JQ5A 5DG5A 3GFWA 4EZ7A 3JUHA 4UN0C 5JKGA 4OTRA 3MH3A 4DH8A 4R6VA 4A9SA 2K4MA 2B9EA 2YUIA 4J96A 5AWMA 5FRIA 3RHXA 4CSVA 4F86A 1V0PA 2BROA 2W5HA 3FZPA 3QTWA 3G15A 5AUXA 4GEKA 1KE6A 2AC5A 3PXQA 4DG2E 2VTSA 3GNLA 4ASZA 3NSZA 2JAVA 3EFWA 4HYSA 4R78A 3E05A 4IB5A 4LV8A 4FR4A 2IDJA 4BDKA 2QR8A 4S32A 4TNDA 5CU4A 2NXJA 3DOUA 1KIAA 3OEZA 4O6EA 1Q41A 1X1DA 2QY6A 4YJVA 4FSXA 4OTIA 3S95A 2YCSA 4MF1A 4BP3A 3OPNA 3CXWA 3SHEA 4DKJA 3F7ZA 5EIWA 3R7VA 4WBBB 5LCKA 1O54A 2PMLX 2AOWA 4PMSA 1H26A 2P8JA 1H1DA 4NTSA 2PXCA 3OD6X 3FPMA 3QD3A 3FMLA 4DINA 1M7NA 4OX9Y 4FUXA 3F3TA 1YXSA 5I9UA 3BU5A 5J5SA 4QT1A 4FYOA 3IW4A 1H1WA 2OXXA 5CXHA 5IG1A 4EKIA 1UKIA 5DRDA 1UIRA 4C06A 5E1SA 3RNIA 1T45A 4ZIMA 2A14A 2A1AB 1ZY5A 5AIRA 5TOZA 3LGAA 1M6YA 3LBYA 5EG5A 2IIPA 1F38A 4RFYA 4YJSA 3VS0A 4DEEA 3EZVA 4H3BA 2VTMA 3NTVA 1SVUA 3BGZA 3DK6A 3LFAA 4O21A 4K6ZA 3SOAA 1L3RE 4MXXA 3WZJA 4YSJA 3DXYA 3ELYA 2GS7A 2XYUA 2Y0AA 5DR6A 1JVPP 1RW8A 3P7AA 4ZS0A 3PPJA 1FQ1B 4FTCA 4ZSGA 1TQPA 5CEKA 5EFQA 4PCLA 3NYOA 3Q52A 5IMEA 5EMMA 3LCKA 2XNPA 3A7HA 4EQZA 4CV8A 1KPHA 2IPXA 3ATTA 2PXXA 5JH6A 4FTLA 1MQBA 1Q8UA 2PVJA 3R1QA 1KSWA 4U9AA 5K5NA 1OKYA 3CS9A 3DMGA 4HH4A 1W8CA 2I0HA 2QOIA 2ZV9A 4IB3A 4QMTA 5HFJA 5ICFA 1KE9A 4G6OA 4JI9A 2FH9A 4RZWA 4YC6A 4FKTA 4GCJA 3FSFA 2RL5A 3QQLA 4EK8A 1TW3A 4GRBA 3RK5A 3DY7A 4Z7HA 5E1DA 2W4JA 3REPA 4FT5A 4JIKA 2EB3A 2AZTA 3Q4TA 3TOSA 5BNJA 1KE5A 2F57A 4BDEA 4FV3A 5M53A 5IUHA 2IZSA 3R8PA 3BQCA 2C3KA 4J1RA 1X1AA 1DM2A 3ET7A 4RVDA 4LUEA 1N7IA 4IAZA 2OPBA 1EH4A 3WF9A 2RF9A 2VNYA 3QRIA 3RCJA 2YM3A 4K1BA 4XUFA 3IKAA 3HCDA 5I5ZA 4YO4A 2JDSA 4BBEA 1KXZA 5CEQA 3R7IA 3FRIA 3I9FA 1CTPE 3PG3A 1UWHA 4AT5A 4QMPA 1RI5A 4O81A 1P14A 1XKKA 3KF7A 3ZM4A 4E4NA 5LVPA 3PX2A 3UJ6A 2XK4A 5DWQA 4BCJA 5EKUA 3I6WA 4ZTBA 1GOLA 3W2CA 2PVLA 2R3LA 4QMOA 3UJ8A 4XV1A 3EMDA 5JZNA 5D10A 3FXZA 4RMZA 3K3IA 1NVRA 1JG2A 3HVHA 2WTKC 4RLLA 4JQEA 1KOAA 4YMHA 3PVBA 1BUHA 3LFNA 3F5UA 4GIIA 3ORKA 4K2RA 5EYCA 5IA3A 5M09A 3AWIA 3NVMB 3OW3A 3UJAA 2W1ZA 4MCVA 3ENHA 5J95A 3FYKX 5HNGA 5HNIX 1H1PA 5AUWA 3QQHA 4O7VA 4JIAA 4WIHA 3RODA 3LXNA 2HY0A 5K0GA 4OTHA 5LJJA 3O4FA 2WMRA 2VDVE 3KR0A 3UGCA 4PP7A 1H24A 1QPCA 4IX4A 4XUEA 3NVKI 3PY0A 4FG8A 5FHQA 3FUUA 3LMGA 4HOKA 1CKIA 1CKPA 1U54A 2YDIA 3NW5A 5M08A 3PB3A 4RJ6A 3G89A 4OBPA 1NW1A 4V0QA 1RI3A 4X63A 3R02A 4FVRA 3CCFA 2B53A 4QMLA 3VYWA 3MTFA 4FVPA 3VUMA 2YDKA 5KCVA 4AGUA 5E8SA 4YHJA 3KC3A 4WO5A 2JKOA 3M6WA 4YBKA 3PA3A 2XA4A 4WKQA 3C5UA 5L2TA 3T7RA 1WBWA 3EQBA 1JG3A 4V0RA 5DX8A 1NKVA 1VIDA 4RC4A 4BHNA 3HAVA 5CF8A 3LBFA 1XH9A 4A6DA 1M52A 3OY1A 3ZO4A 5JRQA 2RFEA 3REOA 3RPRA 4FV5A 1A06A 3MA6A 3O0GA 1D2GA 5FGKA 4PNIA 4XH6A 5GIPE 1O9HA 4L3PA 2VZ6A 4AQCA 3C6MA 5CVVA 4J71A 3HMIA 4Q5HA 2QOHA 1NBHA 5E4HA 4HTFA 4EOJA 3R2YA 4NYEA 4BCQA 3BV2A 4DITA 4RIYB 3D2IA 3COKA 1SMHA 5EGSA 3RZBA 3E3PA 4CKEA 1BOOA 8MHTA 3EFKA 1F5QA 3MQ2A 1Z57A 1UU8A 1E9HA 4C4AA 3KRWA 4YJRA 1G55A 1G3NA 2B3TA 3SG9A 1Y8CA 4IV8A 5HIIA 3TCPA 4EH3A 1ZHFA 3ALOA 4FL2A 5DRBA 4CKIA 5KMMA 2GNJA 3FQHA 2VTRA 3ROCA 4CLJA 1SZMA 2Y4IC 5CT0A 4U80A 5CALA 4QTAA 4FTRA 4WRGA 1JSZA 3MGGA 4IWQA 2UYHA 4YO6A 4FTQA 2ZTHA 1CKJA 5JGBA 4CFUA 3U6JA 3QQJA 5DRTA 3D2KA 5E8RA 2IG7A 5E92A 4K6MA 3PFQA 3PJ8A 3F5XA 5EYMA 3TNQB 5AAGA 3EN5A 3WZKA 5G1XA 2RG6A 2WQMA 3FYDA 4QTTB 2XNNA 5AAFA 3HA6A 3R9RA 1SQGA 3LX6A 3MY5A 4AFEA 3FUTA 4FTKA 4P7FA 3FC1X 4G2FA 3U81A 2F2UA 1XH4A 1ZMUA 3OEFX 2O0LA 4CRSA 2WMSA 4XOZA 2VD5A 1H0VA 2VWVA 5GHVA 3O8UA 5ANEA 1BI7A 5AV0A 2BKKA 2WD1A 3BYOA 4C4GA 4FKIA 4FK6A 3SSMA 2EVAA 3C13A 3CGFA 2C6TA 4YV1A 2AOTA 5IQBA 2O3PA 3SGCA 1SUIA 3QYZA 2PKWA 4DMGA 2YQZA 2CLQA 2XKFA 5K4IA 3PPZA 4IWOA 2XK3A 4FTIA 5IQHA 2VX1A 3ALNA 3ID6C 5CU6A 5HLWA 5EHOA 5FQDC 3II5A 2ZVAA 3ZDUA 4AW1A 1SKMA 4FT0A 4F70A 4U40A 1JQEA 4TRLA 3G8AA 2H1RA 3H9RA 3O8PA 4AZVA 3NAXA 4U41A 1QAMA 5LR6A 3QCQA 1JKKA 2E2BA 3VNTA 1F0QA 2IJMA 3G9LX 3NPCA 3G5DA 3QTRA 3WF5A 1R0PA 3ELDA 2YWPA 2ZSUA 5A9UA 4MXYA 3BUSA 5DTQA 2HWOA 5IA1A 3TMAA 1Q0TA 4RFZA 2VO7A 3KXHA 1OPKA 3GC0A 3PWYA 4KSQA 4UY9A 5GNKA 3UVPA 1TW2A 3S1HA 2P40A 2IW6A 2NRUA 4O27B 2QM3A 3C0IA 2JC6A 2IVSA 4RC3A 3WZUA 1H0WA 4EOIA 3PXZA 4I94A 3VBWA 2XJ2A 4BVUA 4D55A 5HLNA 3ME5A 2H9VA 4LWOA 4I3ZA 3ORXA 3MHTA 1B39A 3BU3A 3TRKA 4ATNA 4MBJA 4V0GB 2BZKB 2YWVA 4FV4A 3R8LA 4ANLA 1VPTA 4C59A 2G2IA 4AT4A 2ZBPA 2W1HA 2P2IA 3PE2A 3R01A 1PRYA 4NW5A 3OG7A 3NUXA 3P7CA 4A7CA 4C7TA 5FHRA 4ANBA 3DKFA 4U7ZA 3LPMA 4FKWA 5EOLA 4FT7A 3HEMA 4PIMA 2FK7A 5DSTA 1QZZA 3CGGA 4YZ9A 2JHPA 5CEPA 3NWBA 2X6DA 3ITZA 3X0DA 2BM8A 2UW0A 2C6EA 4HW7A 2EJTA 4NKAA 2XYRA 4DGNA 2UYCA 2WOTA 2C3JA 4JBOA 2OH4A 4U81A 3A4OX 1YXUA 3R2BA 3TJCA 4IM3A 1M6EX 2BPMA 1YHVA 4CMOA 3HX4A 4RA4A 2WQEA 2AVNA 4O7NA 4PL5A 2IN6A 4D5HA 2WMWA 4CWAA 4OBQA 3HM2A 4JS8A 4AG8A 3KU1A 5AV2A 3TUDA 3D2LA 1XO2B 2PZIA 1XXLA 4EL9A 1XH8A 4H05A 4TL0A 3PT9A 4QVGA 5E9JA 1XQZA 1YF3A 3D9VA 3EN4A 1Q8TA 3LFBA 4FV2A 3R0TA 4I6FA 3BWFA 4F7NA 5L8LA 2H11A 3B7PA 3IDPA 4XLVA 4O7RA 4ZTSA 1LUFA 3V5PA 4GV1A 5ITAA 2I7CA 4BP1A 1CSNA 1YQJA 4RIYA 4F9AA 5GP1A 4G3DA 2X2LA 4QOXA 2HNKA 1FVVA 3DLCA 3LDGA 2WA2A 4S31A 4ZEGA 2CN8A 4PY1A 5AP2A 2YN8A 3MPAA 1Q3DA 4EJ7A 2PTKA 1JSVA 2OF4A 2PE1A 3F2NA 3MIYA 4U97A 3TNIA 1G5SA 4APCA 4F9BA 1TVOA 2UZDA 2YM7A 3PWDA 3ACKA 4RVMA 3MVJA 3UC4A 2B2CA 5DM2A 2XVDA 1W98A 5HZMA 1ZYCA 2Z6QA 4XMOA 5LOHA 3BQRA 4D4YA 4K33A 3ZDIA 4M7RA 1Y6AA 3BWMA 3UWPA 3KRJA 2IH5A 2XIYA 5TF9A 4CV9A 4C08A 3F69A 3WOWA 2C6KA 4YJNA 3FC2A 3E8EA 3NWWA 5L8KA 4PYKA 5KVAA 2OO3A 4F0GA 1PKDA 5U4XA 4XG8A 4YTIA 4RWKA 3MTLA 4YU2A 3SAYA 4E2ZA 3HLLA 4M84A 4F7SA 4L7SA 4X0MA 4C33A 2GHLA 4ZY6A 5HQ0A 4MD8E 2F7ZE 3QQKA 2RFDA 5A4EA 5M51A 4XLIA 2HZ4A 2UW4A 2Z60A 2OJFE 3LL7A 1U2ZA 1I4WA 3CQWA 2VDUE 2HK5A 3LFDA 5EQEA 1XHAA 2J0JA 3M1SA 3TV6A 2XYNA 5L2SA 3K0BA 3KQQA 4BKJA 3COIA 4YZDA 4E6CA 5BYZA 3RK9A 2PVFA 3Q4UA 4F6UA 2YZLA 1SG9A 1AV6A 3BLHA 4MAOA 2OFUA 2FGIA 4LRMA 3E5AA 4ZSJA 4GG7A 4EOOA 4F6WA 5C8NA 2PX4A 2F9GA 2XUUA 3AOXA 5HI2A 4OQDA 4BCPA 3DXXA 3GJYA 3QA8A 4FG7A 5IA5A 5DTRA 4EOQA 4EOSA 4P90A 5B1SA 1XDUA 3LMHA 2NRYA 3EQFA 3PTAA 4FTAA 5DT0A 1Z3CA 3I5ZA 5AP5A 3TI1A 4QP4A 1Q3WA 4TY1A 4Y2HA 3OT3A 3SXSA 3HA5A 3L8PA 5KMOA 2J0LA 3CQUA 3MFUA 4LL5A 5K0FA 2C1BA 3DTNA 2OIQA 5TT7A 4P4CA 3P79A 2QODA 2Z7QA 3ULIA 1ZXEA 2ZM3A 3QUDA 2JIVA 4OUCA 4QQ5A 4FV8A 4RJ3A 4AGDA 2XM9A 4J98A 4FSYA 3BGVA 1ZZLA 2CKQA 1ZRZA 3A99A 3FQEA 5JFSA 1MJFA 4FT9A 3ROYA 4RWLA 3E63A 3P9CA 2J5EA 4PDPA 4RVKA 2PSQA 1UU7A 3I7BA 3GCPA 3SW4A 1U54B 3E23A 3T7TA 3RMFA 3EJ1A 4EQMA 5K0EA 5CVFA 3BE9A 2LGCA 4M13A 5CQUA 3OHTA 1YI3A 3RW9A 4E31A 4XV2A 1NV8A 5K05A 4MWHA 4QP7A 3VUGA 2FRXA 3KHKA 3R28A 4E30A 3CTHA 4OTDA 2V22A 2ONZA 2BDFA 2Q41A 3JPVA 1NW3A 3C4CA 1XJDA 2PWPA 3KK8A 4DT9A 5C8MA 3SW7A 2OZOA 4GU9A 1A9UA 3O96A 1FP2A 2PX5A 3RAHA 3U9CA 4CZTA 5K0NA 2ITUA 2Z2WA 3BE2A 3V04A 4AZTA 2YIYA 4ZZNA 5M4FA 3KQTA 3SVZA 4IBMA 4NU1A 3MVMA 3V5JA 3TIYA 4OT5A 5H9BA 4X61A 2VN9A 5DA3A 3GWZA 1BL7A 1YI6A 2ZV7A 4E7WA 2ZB0A 3UJGA 3TV7A 3MCZA 5E9WA 3DTWA 3F66A 3UMXA 3O17A 5A4CA 5IU2A 5FUBA 3EVEA 1ZOGA 3Q9XA 1Z5MA 4FEUA 3R04A 5CQWA 3S2PA 4C4HA 4DLJA 5CEOA 3NMUF 3AC8A 3ZRLA 4BDFA 5HBJA 4O7LA 1FP1D 3NR9A 4GK2A 3F5GA 1IG1A 4GYGA 5CEIA 4AA4A 5LWNA 4JX3A 3SSOA 3EQCA 2O57A 2R4BA 3UOKA 5IZFA 3VIDA 1K3AA 4G9CA 4S34A 3LFCA 3F82A 4KIPA 4XYFA 5I0BA 1YWVA 4L3JA 5AX3A 1Q99A 2CJMA 3LOKA 3JWHA 2H8HA 3VHEA 2XJ0A 1JTFA 4KIOA 4BIBA 1RJBA 3FMJA 5E1MA 3DDQA 3G6GA 3ACJA 3QD0A 3EVAA 4GFOA 1H27A 1NY3A 3QWJA 4RPVA 3TTJA 2I1MA 2J5FA 1WG8A 2JFMA 5CCBA 5T3QA 3OOGA 3NNVA 5DR9A 5E8ZA 3KPJA 3O71A 3NUAA 5F95A 1VL5A 3OMVA 3EQGA 4OTQA 4DC2A 1INLA 4GS6A 5LQCA 1R1WA 3LLAA 3DP7A 3GC8A 4KDCA 4AX8A 4ASEA 4R3CA 4APPA 3R30A 3S4QA 2V7OA 4M0YA 4YC3A 5DGZA 3R1SA 2PT6A 4G17A 4FEWA 4WBOA 4BDIA 3NCGA 3UA4A 1G8SA 4I92A 4BIDA 4R5YA 4C3PA 3NWEA 3I0QA 1K2PA 1KHHA 3LDUA 3UMWA 5M57A 5EZSA 4I0RA 2J0IA 2XM8A 2YXDA 2WTKB 2JBOA 4AGWA 1O9GA 3TDWA 2FCAA 2PZ5A 4YJPA 4LMNA 3A8WA 3UZUA 3D0EA 3LCSA 4IC7A 5AFVA 3VJNA 3P9NA 5HE1A 1GAGA 3MCTA 1YXVA 4KBAA 2JIUA 3BPRA 1X1CA 3BHTA 3CTQA 2WTIA 3V5QA 2VZ9A 3F4KA 2FO0A 4O82A 5GJGA 3JS2A 4FKVA 4IC8A 4XBRA 3U6IA 4A07A 3KPYA 4OA5A 2PULA 2QO7A 4A9UA 3C4WA 3HAMA 1ZGAA 3K6RA 2I40A 1OZ1A 2WU6A 4D0WA 5A46A 1AQ1A 1FVTA 3OCBA 5ANOA 5LQRA 4W4YA 2PVNA 3UQGA 4FVQA 2VX3A 4PINA 4PONA 2CN5A 3I53A 3BELA 2W1GA 3R21A 4I6BA 4QP2A 4JG7A 4F9WA 4M38A 3OC1A 2VNWA 3VUIA 4D2SA 1XH7A 4F99A 5A4LA 4PV0A 5JSMA 2ONYA 3DDPA 2IO6A 1BKYA 2J4ZA 4UV0A 3SQQA 4GIHA 4DGMA 4EYJA 1GZKA 2GDOA 5HGIA 3TLJA 2ITYA 4FSMA 3UP7A 2Y4IB 2YR0A 4CXMA 1XH6A 4RTLA 5DR2A 1J1BA 3Q96A 5HG7A 4AAAA 3BT7A 1R8XA 4UBAA 4GVAA 2VRXA 3A60A 2YCRA 3WZDA 5C01A 5C03A 3W2QA 4PWNA 5HG9A 3LPBA 2IGTA 4IAAA 1VZOA 3UP2A 4QPAA 5L3AA 4YTHA 4FR0A 3FLSA 4YPSA 5AP0A 1MUOA 5DT2A 3LQ5A 4QYGA 4IB1A 5JEBA 3QGYA 4GOLD 3JYAA 5IA2A 2F2CB 2WEIA 3Q60A 4KW7A 4TYIA 2OZVA 2B55A 3MSSA 4I41A 4L42A 2ZM1A 2PY6A 4KIFA 3ZRMA 5EKXA 2OIBA 4FP9A 2WA1A 2QKRA 3P08A 3DLIA 5HTCA 2R3IA 2B7AA 3ZBXA 3PFHA 2FSTX 1JSXA 4YZMA 2ZB1A 3NUUA 3LSTA 3ZU7A 4O0YA 3K3JA 5HX8A 5L6PA 3U8WA 4DFXE 2HV9A 2QOFA 2C5VA 2UZBA 2P41A 1WVWA 5FTWA 5H02A 2ONLC 3DKCA 4YJTA 3RVGA 5EVJA 4LWPA 5AUUA 2ZM4A 2HW6A 2O0UA 3F6XA 3Q2MA 4ONAA 4DBXA 5F2KA 1SUSA 1WBNA 3TXOA 4X41A 4O7ZA 2FPOA 4QP8A 5EQPA 2PVRA 4IZYA 4FZVA 4P7JA 3OWLA 1Q5KA 2NP7A 5IA0A 3WILA 3GDHA 3CBLA 3NNXA 5HORA 4PUZA 3RCDA 4BDHA 4AZFA 3TKYA 2AS0A 3DNDA 4JDKA 3FZGA 4OBXA 2WZJA 3KULA 3MH0A 3FYCA 4C02A 4R8RA 4AZWA 2A27A 3HYHA 2ZYBA 4W8DA 4DTAA 5A6OA 5HX6A 1EAMA 3DLSA 4EK3A 4WG3A 4ER6A 3I7CA 3TNHA 3BHVA 3ETAA 3UO4A 1R78A 4AUKA 2WMQA 5IUIA 3W55A 1ZWSA 2IP2A 4YUXA 3TKIA 5ICPA 4NT4A 2BRHA 4TWCA 3GGFA 1WFCA 4I5CA 3AQVA 4QTCA 4BDGA 2Z8CA 5IEVA 5IEYA 3TUBA 1KR5A 3B3FA 1Y6BA 4B7TA 2YERA 4IFCA 4YP8A 4UX9A 1RJFA 3COMA 1NBIA 2XS0A 2P55A 4FE2A 4M7IA 4I4EA 5FP5A 2FUMA 2C47A 3BHYA 4I0TA 4JAJA 5H2UA 3ZXTA 3QUEA 3ZO1A 4ITHA 4C03A 1YW2A 3QQUA 3V8VA 3V97A 3RAKA 4UWCA 1LPUA 2BAQA 2BRGA 3GRRA 3QHRA 4K18A 1YKRA 2PVHA 3F2RA 3KCKA 4OBOA 2BDWA 2X7GA 1PXKA 3KXMA 1IAJA 1PXMA 4ZJJA 2ITPA 4AACA 2WB8A 4BCOA 1G60A 5LMAA 5ANKA 3SLSA 1REJA 5C9CA 3IDCA 4RTNA 1B42A 1ZYDA 5CAQA 3QX2A 4KINA 3DKGA 2RG5A 3N9XA 3PA5A 4MBIA 1OVEA 4QMZA 3UYTA 5IQFA 5FXRA 3EVCA 5AA9A 1PY5A 3BCEA 1B38A 4JRVA 2NXNA 2B0QA 1UA2A 2ZJWA 1QMZA 3FPFA 2F4JA 5K03A 1HCLA 4R7HA 2VWYA 4V0GA 3UOLA 4EJNA 5HIBA 1ORIA 3QQFA 4QYEA 4ZSAA 3LKDA 4IX5A 5GIOE 4TWNA 5HU3A 1QAQA 1O9UA 4XBUA 1JKLA 1UU3A 3C4XA 4G3FA 3TJDA 3HVIA 4DH5A 3M33A 2WTDA 4Y46A 5BP7A 4QMQA 2JLDA 3QTQA 4HG2A 4GBED 4O7TA 3C3YA 1DAWA 4Z2YA 4AS0A 1FBNA 2ITNA 2DS1A 4Y5HA 5AP4A 5BYYA 4GC9A 5HTBA 4ACHA 2BR4A 3OFKA 3LFEA 3HRFA 4ZSLA 4QQKA 4C58A 1SNXA 5EYKA 1FMKA 4BIEA 4FSDA 3Q4CA 4CTKA 4DCAA 2FK8A 4RWIA 2P0CA 5KMNA 1NV9A 4GOOD 2YACA 5ETIA 5C4LA 4QDKA 5GOZA 2CKPA 2F7XE 2UV2A 4U79A 5EDRA 3RPYA 4PTEA 4RQKA 1R00A 2WPAA 4TKSA 3PLSA 3MJ1A 3DR5A 2XYQA 4HC4A 4C4FA 5CLPA 3CEKA 4A9TA 3MAGA 5LQAA 2OF2A 3MFRA 3FZOA 4LV5A 4CXAA 3P71T 4C61A 4POOA 2B25A 2IH2A 4ANMA 4IIRA 2JHAA 3HCEA 1KV2A 2OY0A 1PMUA 4Q9SA 5CVUA 5LMKA 4LUDA 4GUBA 4FKLA 1FPUA 3FEGA 2OB1A 3L8SA 1VYZA 3WF6A 1ND4A 4FSQA 1OIQA 1OB3A 2HWKA 4NKSA 2OZAA 3R83A 3TM4A 2HWPA 2R0IA 3ORPA 2XIRA 3MB7A 5EYDA 4FSZA 4U3YA 1FINA 5HILA 1YHSA 2GSFA 4LOQA 4KKGA 4AN2A 3OU2A 1BX6A 2G15A 5KBQA 2AOTB 3DT1A 2FA2A 3PXRA 4PQNA 4RIWB 4WD5A 3ZH8A 5IDNA 3CJRA 4TWOA 5DNRA 2CGXA 5ETCA 3MDYA 4HNIA 3BEGA 4MXAA 1ZLTA 3UZRA 1JG4A 1OL7A 2CDZA 2QU6A 3GQLA 4ANQA 2BILB 4L52A 4XG7A 1JBPE 1FVRA 3QRKA 2OKCA 1AQJA 4KDRA 3C4ZA 4OW8A 4YJOA 3AMBA 2GS2A 3I6UA 3JR1A 3OBGA 2G1TA 2O64A 3G51A 2VTPA 5BVWA 4DCMA 4QTEA 5K0JA 3DBDA 2C0OA 3IYLW 4RTSA 1IAHA 4RIXB 4KWCA 3I1AA 4R1YA 3ORHA 1J1CA 3CVOA 3GU6A 4HZSA 2QO9A 2IZTA 1WCCA 3AC5A 5GWXA 3KXZA 3NUYA 4FC0A 3A25A 5EOVA 4MD9E 2R6ZA 4R6XA 1ZY4A 3SG8A 2P1DA 3EN7A 4DFNA 4A06A 4HVHA 3S68A 2QOCA 4OTWA 2ERKA 5L6WL 1HNNA 4DFUA 4JBPA 1OECA 1TQIA 4P58A 3ORMA 5HICA 2J0KA 4D58A 5EW8A 3SC1A 2JGZA 5EKOA 1W82A 5AUYA 4QMNA 4WA9A 3W18A 2ITQA 2OSCA 3L8VA 3PJ3A 4FG9A 1U46A 2GQRA 4NJ3A 2QLUA 2B9HA 4G34A 4HZRA 1JR4A 5T67A 4BBMA 4V05A 3V5LA 5DPMA 4PYQA 5EM8A 3VS5A 3KMMA 3QUPA 4UZHA 1PHKA 3AD5A 1TKIA 2ITWA 2WTJA 4QMMA 4IX6A 2ZMCA 3ELWA 4N57A 4DEAA 2O63A 5CANA 4R05A 4AE9A 1R0EA 3CKKA 4MQ4A 5GJDA 4NW6A 2WEVA 1M17A 3DBQA 2R3KA 4FOBA 4E4LA 2QC6A 1H1QA 5CF5A 2OJ9A 4JBVA 2JH8A 4RZVA 3PTGA 3QOWA 5FUTA 5HIKA 4KRCA 2OXDA 2Y9QA 2ETMA 3KN5A 3AGLA 3FMHA 3KL8A 2BRBA 3NW6A 4PP9A 3QGWA 3CBGA 3P2KA 3DXQA 5CU0A 2CL5A 5JUWA 4WNKA 3DH0A 2E9UA 3Q2JA 4E1ZA 4M37A 5DN3A 2B9JA 3DAEA 1ZOHA 4NM0A 4O0UA 4S30A 2GNIA 2WK1A 2PJDA 4ZTNA 2ZLBA 2G71A 1OKVA 4EORA 4ZAUA 1YB2A 1YWNA 4KAOA 2ITTA 4W4VA 4TPTA 2AOVA 2C5OA 3D14A 5BVKA 1IY9A 2ACXA 3DK3A 3GXLA 3U55A 3VS2A 3ZONA 4XEYA 4DTBA 1STCE 4FGRA 4XJ0A 1H08A 4WSYA 3W1FA 5KZ0A 2PYWA 2JDOA 4GOND 4FTOA 3NYVA 2JDTA 2A19B 3KMWA 3AD4A 4DG3E 3FLWA 4YTFA 3ZRKA 4X2GA 4E4XA 2FSMX 3MN3A 3NUNA 3ZBFA 2HIWA 2W1CA 2NXEA 5K0BA 5CD1A 1N7JA 1V39A 3G5LA 2IBSA 4UB7A 3HUCA 4N6ZA 4RC2A 2C6LA 2OJJA 3L9LA 5B0XA 3WF7A 5IMXA 4UOEA 3ODYX 4LGGA 2PX8A 3GU7A 5ICEA 3OF0A 3OOMA 4I1ZA 3G7UA 1OBDA 4IJPA 5CAVA 5JR3A 3FI8A 3G2PA 5DX0A 3R8MA 3UPZA 2GTNA 5E8VA 4ZK5A 4YNOA 4X1OA 4YGAA 3UIXA 4BTKA 1SM2A 1J3HA 1REKA 3F61A 4UWBA 3ZUVA 5TKDA 4CNHA 1D2HA 4M68A 4AN3A 2YX1A 3C0KA 4GYIA 4GF5A 3E62A 4KNBA 2BR3A 3FTEA 2I0VA 5DXJA 2LD4A 1Q62A 2NO3A 3QKKA 1OI9A 4K11A 1RQQA 4Y72A 5DEWA 5H3QA 4EKKA 4GJ3A 4P5ZA 4U5JA 4YURA 3VUHA 3RAIA 3KK9A 4FKSA 4X6QC 4AN9A 3ATSA 3IG7A 2X8DA 4DLIA 1VYWA 4RFMA 3ZOSA 4ERWA 4GL9A 3VC1A 5J9YA 2WTCA 5E1EA 1FOTA 1OL5A 4O2ZA 2PGXA 4QP9A 5FA5A 5CIYA 3PP0A 4GT3A 4W4WA 3WZEA 2GS9A 5D1JA 2YFXA 3RWQA 3OCSA 5EMLA 4A4OA 3HA7A 3SXRA 1YI4A 1DAYA 3H10A 3P0MA 3R00A 4YZBA 5E8UA 4BC6A 9MHTA 2YCFA 3NNUA 5AP7A 5C1QB 4I5MA 3PYYA 3P78A 4PCAA 4DTKA 2XF0A 3VBTA 4DZRA 3IECA 1EG2A 5CSPA 4EMSA 3DAJA 4BLUA 5EI8A 4GEOA 4QPSA 4HNFA 4PDSA 4II5A 3UIBA 3ZYAA 5C1IA 5KE0A 1VR2A 2WIPA 2Z7SA 5FTGA 4HVIA 4E4MA 3UA3A 3FUXA 1ORHA 3FTFA 5EIFA 3T9IA 2X39A 3KGAA 4XG2A 4FIFA 2X9EA 3ELUA 2QNJA 3ER8A 3QAME 5DFPA 3GC7A 4BDDA 3FLYA 1RI2A 2B52A 3CJFA 1WXWA 4C4JA 4F85A 3LXPA 1PXNA 2QCSA 5FEDA 2XNEA 3O7LB 3E7PA 5DE2A 3VUKA 4E26A 5AA8A 4FKGA 5AUTA 2ZIFA 2H00A 1KE7A 3F3WA 4L9IA 4IWDA 3VRZA 3GOPA 4EH2A 1M2RA 2PUNA 3B8RA 3BYUA 4FZ6A 4TYJA 4C4EA 5IISA 3R24A 2XKCA 4DFYA 5M4IA 3W8LA 4M67A 4G3CA 2ADMA 4GOMD 3EB0A 3H4JA 2QOLA 1WMKA 2EU9A 2B9FA 4CQEA 5IH6A 1G38A 2QOBA 2XBMA 3OS3A 4GFGA 4J8NA 3CD8A 4L01A 4IJ9A 5EI2A 4DF3A 4OTFA 2JH9A 4KSPA 4QMYA 2ITXA 3EFJA 3GCVA 5ANIA 2PVKA 4HTFB 1PXIA 4JDIA 5AUVA 2VGOA 3F3VA 3NIZA 2KTYA 2QHMA 3Q87B 3OZTA 2ITVA 1URWA 3DBCA 2ZULA 4MWZA 3DJ7A 3FHRA 3R1YA 2RKUA 3FKLA 3QTXA 4O0WA 1KE8A 4TYHA 3JVSA 5AJQA 5M55A 4ALUA 4ALVA 2ZW9A 1ZYJA 4TTHB 3KPVA 4HRAA 2ONLA 3KVXA 2H96A 2WMAA 1KYWA 4FGZA 3SR4A 3SXFA 3IGOA 4IFGA 5CF6A 3O50A 4NM7A 2FYTA 1H01A 2OYRA 4ER0A 1NW6A 4X2KA 2YM4A 2F8LA 4DBNA 2GHMA 1BLXA 3CC8A 3EOCA 3DOGA 4QMWA 3Q6WA 3UC3A 1EQAA 4H39A 1R74A 3FTDA 4P2KA 5E9QA 4O0XA 1QCFA 3P4KA 2GCDA 4C62A 1X19A 1JKSA 4C0TA 3BWJA 3UDBA 4IEBA 5KMLA 5LWMA 5FDXA 3ZLXA 4JLCA 3LM5A 3DXNA 4QQCA 3KQYA 3E8NA 1ATPE 2EWAA 4BRXA 1RE8A 3OZSA 1SVHA 4LI5A 2CKOA 3WF8A 4HVDA 5ERGB 5T6KA 3RINA 2CNQA 4GKHA 3HV3A 1H4LA 3A2CA 4I0SA 4MXOA 5GJFA 1PKGA 4CD0A 4FA2A 3GRUA 3HP7A 5FCDA 3ZSHA 4D9UA 1CMKE 4Y8DA 3QKMA 4AT3A 3KQPA 1GZOA 5EW3A 4PF4A 3MB6A 1O6YA 4CLIA 5LMKC 3MTEA 3IW6A 4IX3A 5CZHA 3CD3A 2XCKA 3HKOA 3N4UA 5C27A 4ZLZA 5JN2A 5KMKA 5LCJA 3NS9A 2HXQA 3THBA 4AW0A 4R7IA 3OWPA 5M06A 2OXTA 2E5WA 5KKRB 3D5WA 3AGMA 2VTJA 1UV5A 2QO2A 4IV0A 3I79A 3UTOA 4QQTA 2W4KA 4YMJA 1IM8A 2VWUA 4RJ5A 4USDA 4MH7A 2QONA 5CI6A 3R7YA 3KRRA 2B9IA 2GA9A 4QVKA 4BCFA 2VV9A 3DQXA 5CEMA 2ITOA 4XHKB 5DWRA 5L2WA 2O05A 1H25A 1H1SA 1M2PA 4MWIA 4DFBA 4E6AA 3CCNA 1R6AA 2C7PA 2C30A 4A4LA 2E9NA 1QPEA 2DWBA 2OXYA 4D0XA 2UYQA 2YXEA 3IS5A 4FIGA 1WY7A 4JQ8A 2W17A 3EQRA 4HGSA 3P2EA 1YFJA 1MRVA 2Z6AA 2J6MA 2HXLA 2BH2A 5E91A 2P2HA 3TKUA 3AXSA 4Z3VA 3BX5A 3NNWA 5T68A 3QU0A 3A8XA 4WNMA 4YSMA 4C36A 1P1BA 2PVYA 1EIZA 1BL6A 5E1OA 3Q04A 2YJSA 4X2FA 3QCYA 3ORNA 3ZLWA 3LFFA 3CPCA 4GUEA 4I5HA 4L68A 5CU2A 5EHLA 1PJZA 1BI8A 1S9JA 2J7TA 3GNIB 1JQDA 3OROA 1XCJA 4KRGA 2V74B 4QPPA 5B7VA 3MWUA 4CG8A 4KVZA 2Q83A 4MEDA 1DUSA 2BRNA 4MBLA 5A4QA 3MTIA 3OXZA 3NW9A 4HCUA 2G8NA 3GUBA 2CWWA 1OGUA 3DCVA 4D4SA 2CGWA 2ZIEA 2WTWA 1EJ0A 3VRYA 5DM0A 2ZAZA 3H9OA 3GRZA 4HGZA 2YVLA 2Y4PA 5DTMA 4I93A 2JDRA 5K01A 5BW5A 3V8WA 2BHHA 4O86A 4JDJA 3I81A 5CVGA 5F2OA 2BMCA 3VS4A 2CKEA 3U4UA 1XWSA 4OA8A 4EOMA 5CVEA 2OWBA 3QFVA 3R7UA 5EH0A 4E20A 4YUQA 3QF9A 4UZDA 3GCUA 3DXPA 5HCZA 4IHPA 1IA9A 3TT0A 5HOQA 4RTRA 2R3RA 5ACKA 2UZTA 3G0EA 3PJ1A 4J53A 4LGHA 3LJ0A 3PG1A 5I4NA 5HIMA 4IQ6A 1XBAA 2GNGA 3JVRA 3ZEPA 4CGAA 4PNEA 2VWIA 3BIZA 3FPEA 3P9KA 4AW2A 5EPEA 3NAYA 2VWZA 1O6KA 2ERZE 4PTGA 3VS3A 5HLPA 2WU7A 3BBTB 4HVGA 3LECA 5E1BA 2C68A 3D5XA 3HRBA 5CVHA 3HV7A 3HUBA 3ORTA 5GM1A 4JG8A 5BVNA 2Y6MA 1JAMA 4FOCA 3EGEA 4EK9A 1ZYSA 3SD0A 2V55A 1Q24A 3ZC5A 4B17A 2BFXA 2R7BA 4B4LA 5IH3A 2X9FA 3I4BA 3RI1A 3FL5A 1KV1A 4EQUA 3IO7A 3LCTA 4F7LA 5JZJA 4DE4A 2XYVA 4CZUA 4JOAA 4F1TA 2GPYA 3P1AA 3B8QA 4R77A 5IA4A 5AM7A 3P86A 4RTKA 5C9ZA 3VUDA 4BZOA 2PBFA 3M6UA 4M15A 1PMEA 4O2PA 4TYEA 5EHYA 3L9PA 3DULA 2EXCX 3PSDA 5JFVA 2QI8A 5AEPA 3UO5A 3P97A 4QTUB 3TFWA 4RIOA 4MHTA 4CEGA 3D7TB 1V0OA 3KB7A 5CAUA 3GB2A 5FLFA 3DGKA 2C3IB 5HBHA 1UU9A 3NX8A 3OCTA 3P23A 3O51A 4CFVA 1YRPA 4L43A 4L7VA 4IADA 5AP6A 3DS6A 1B6CB 2PZRA 3DLZA 3HMPA 2PX2A 4RSRA 3FXXA 2C7OA 3QTUA 1OIYA 2OW3A 2PE0A 4FEVA 4Y73A 3OWJA 5K3YA 2ZZKA 5AP1A 4FZAB 4EH6A 5GINE 3DJ6A 3D7TA 4CRLA 3QLGA 3A27A 3CY2A 5HZNA 4X2JA 5FTQA 3TKAA 3PX3A 2PL0A 4E8AA 4RG0A 5IQCA 1P4OA 3DTCA 3FLZA 4D1SA 2C6DA 2OLCA 1WBVA 3C50A 3KA0A 3ANXA 4PMPA 3MERA 4ER7A 5HCXA 5EDPA 3TZ9A 3VS1A 4QMVA 1NXKA 1PYEA 4NCTA 4DAWA 4ZZMA 3O2MA 4BDAA 3Q7EA 4C35A 4YUYA 2C3LA 4DT8A 1P1CA 3OZRA 2HENA 3V5WA 4TWPA 2XZSA 3D94A 5CNNA 3ORLA 2IFTA 2BZGA 1PXPA 1Q8WA 3KFAA 4X3JA 4RTJA 4XG9A 4RSSA 2PXAA 5H8EA 4NJDA 3EL7A 3H0ZA 3C5IA 1ZQ9A 4BCIA 1L3IA 3TZ7A 4P7GA 3EVDA 3IK3A 4XP2A 3WSTA 3GOKA 3W2SA 1GJOA 2X6EA 3W8QA 5HEKA 5J1WA 3UVQA 4L00A 1OUKA 2OO8X 4I20A 2FSLX 2CCIA 4CTBA 2P7IA 2ZBQA 5EDQA 4LG4A 2AVDA 3FUVA 3L8XA 3R73A 3Q9YA 2I0EA 3EVFA 4F4PA 1PMNA 4AZEA 3H9FA 1D2CA 1JQHA 3KRXA 2X7FA 3PSCA 2PMIA 2Y7JA 2B4SB 5D12A 4EEVA 4E5WA 4TN6A 5HE3A 4X3FC 2IW8A 3S3IA 3SA0A 3CQEA 4FSRA 3KXGA 4X3FB 4F1OA 5A6NA 1RJDA 5FXSA 2BM9A 4H1MA 3GU5A 2HY81 4LM5A 2UW6A 2WELA 4ZTQA 4BDJA 1U4DA 3QZGA 4N70A 3R6TA 3TACA 2QURA 4LG1A 1NW5A 4GT5A 4ARKA 1I44A 3IHTA 4NL0A 1X1BA 3HVKA 1H8FA 4YC8A 4EH8A 1FMOE 2YHVA 1VQ1A 1OBGA 3HV6A 4FI1A 3VQUA 3VVHA 5DVRA 2GLUA 3T7SA 2E9PA 3QXOA 4EUUA 3CIKA 2WQNA 5M5BA 3F7WA 4JAIA 2OK1A 1JSUA 2XNOA 5D7AA 5HE0A 4QP3A 3C9WA 3RM7A 2ERCA 2GFSA 1Q4LA 1OITA 4K8AA 3UIMA 1G6Q1 2AOXA 1QANA 5MHTA 1L9KA 1LEWA 4KIGA 1JLUE 4QMUA 3D5VA 4IANA 3RM6A 4XOYA 2W06A 3C1XA 3N51A 4EH9A 1PXLA 4ENXA 1Y8GA 4JBQA 3AT3A 5HE2A 3BYMA 3JY9A 3EIDA 4WHZA 3N4TA 3ZCLA 3H2BA 1ZG3A 3L8DA 4AOTA 3CLYA 3BRBA 5JGDA 4DEBA 4LRJA 4NTTA 3E7OA 3CSVA 4HSGA 3DPKA 3LJ2A 1IR3A 3EH9A 2QR7A 4HGLA 3A62A 4LOPA 3ZSGA 4EONA 3R8UA 1RDQE 1SVEA 3EYHA 4PL4A 2C5NA 3W2RA 3KQWA 3U87A 4BLVA 3H0YA 5HNBA 1R3CA 2QRVB 1OIUA 3IV6A 4ZTHA 4RTOA 2BKZA 4L46A 4S33A 4FNWA 2BAJA 2J90A 5HG5A 3SOCA 4BICA 4TW9A 4WNOA 5BQ0A 3O23A 1YDTE 4W4XA 5HO8A 4XRLA 2CMGA 3HDMA 2C6MA 5F2NA 2C69A 4FIEA 4HPTE 2EUFB 3FZ1A 3QC9A 2YXLA 5CZIA 3EMBA 3NDJA 3B2TA 3COHA 2IW9A 3GCSA 3R9DA 2XVMA 2R7IA 2VX0A 4ER5A 3PVCA 3UJCA 3MPTA 3FMDA 2AN4A 2X81A 3A7EA 4UYAA 4HGEA 2HZIA 4OGRA 4UWYA 3RP9A 5I9WA 2UZ4A 4JVGA 2QQ7A 3D15A 3F2AA 5KYGA 5LSAA 3C7QA 2OH0E 2NYUA 3G88A 2QG5A 4EHVA 4U42A 3TDVA 3EVBA 4L8MA 5LVLA 3I60A 2DPMA 2VTAA 3GP0A 2RFSA 5M56A 3WI6A 2BALA 4MKCA 4RIXA 2JJQA 3UJDA 4E70A 1YXTA 5BVFA 3BWYA 3M11A 3UODA 3R0QA 3UZPA 4CKCA 4XV9A 2ORED 1AGWA 2UZLA 1H28A 3JXWA 4ITIA 4PRJA 5IQAA 4ZY5A 2SRCA 3AC4A 1LEZA 3PLAE 2O06A 2IVUA 3JY0A 3VC2A 2O07A 3HL7A 2GNFA 2W96B 3KR1A 2YABA 3HECA 2PMNX 2XNBA 3AMAA 4QYHA 3UG1A 4R6WA 4MQ2A 2R3PA 3HV4A 3I5UA 3KPWA 4MTLA 5K0CA 2VAGA 4IVBA 3CTJA 3RK7A 2G72A 2W1DA 2YM6A 3PUPA 4M97A 4YLKA 1ZOEA 3E64A 4GKIA 5IF1A 2P3QA 3B5IA 3OT8A 5FD2A 5KMJA 3IOPA 3C3PA 5DX1A 3GBZA 3ODZX 2WOUA 3FPHA 2WMTA 1WBSA 3PIXA 3GCQA 4UALA 3UYSA 4M36A 4HGYA 5E8TA 4CFWA 2W0JA 4FSWA 2XB7A 4RVHA 3DNEA 1XCLA 2BIYA 3ZZWA 1IA8A 3V6RA 5A14A 3BI6A 4RTPA 2C1AA 5KUPA 3TPZA 3DFAA 3FZTA 1PYXA 4G3GA 4Q5EA 4E2XA 4XV3A 4BYJA 10MHA 2J9MA 3Q3BA 4FV9A 4I23A 4RX8A 3W2OA 5CNOA 4PMMA 1YWRA 1GNGA 1IEPA 3NZ0A 3OXIA 4PDYA 2XBJA 3VHKA 3MGYA 4B9DA 5DLYA 4RTMA 5FQNA 5HVYA 2VGPA 2ZMDA 4MQ1A 4BI1A 3TEIA 3AMYA 5ETAA 5L8JA 4G1WA 4D28A 5EQJB 2REIA 4EHEA 5C8KA 4M0ZA 1MRUA 2JKQA 4HPUE 2ZBRA 4B8LA 4DGGA 4K9YA 3FI2A 4C05A 4GT4A 4AXAA 3TQSA 4ZMEA 3FHIA 4EI4A 5JK3A 2IZUA 3F5PA 1P39A 3MVHA 3EFLA 3MYGA 3UJ7A 5JMSA 4NWMA 2R0UA 4CKJA 4PYOA 2YA9A 2XK9A 4AFJA 4PGHA 3SGLA 3CJTA 4H1JA 4WRSA 1WVXA 1ERKA 4XP0A 2AYPA 2X2KA 2ESRA 1V1KA 3MVLA 3POZA 4IWPA 4F1MA 5FBOA 1IRKA 3EPPA 4BCMA 5EG3A 2B78A 5EZQA 3FLNC 5BVEA 3PE1A 4ZLOA 2O65A 3B3GA 3FPJA 3D5UA 4D4RA 4FS8A 4QMSA 1JWHA 4C3FA 5M4UA 3CE3A 3FZSA 4CFXA 5M4CA 3TR6A 4XNEA 2UW5A 4PYIA 4RV9A 3SSNA 5IQGA 1GZNA 1U59A 3MA3A 3QBNA 5TO8A 2DULA 3QC4A 2PSSA 2FSOX 3VSEA 1XDSA 4QNAA 4HJOA 4EK5A 3KKZA 4KBCA 2BAKA 1SVGA 2V62A 5ANGA 5KMIA 3FPQA 2UZVA 2JDVA 1BHJA 2DYLA 5J87A 3KMUA 4BN1A 3TUCA 1OR8A 2KULA 2JEDA 4P7KA 3IONA 3OBJA 4ZSEA 2A2AA 3ANRA 2H6DA 2XIZA 1DCTA 4WXHA 2R3HA 1ZMWA 2XNMA 5CSHA 3VBXA 4GSBA 3UFBA 4E2YA 5K5XA 4U8ZA 2P35A 1ZMVA 4CMTA 5J9ZA 5HIJA 1RI4A 3K5VA 4X2NA 3VC4A 3FMKA 3MJ2A 2PU8A 3QALE 4C34A 4DEGA 3P8ZA 2BUJA 2C6OA 2XJ1A 3DUWA 4E32A 2JBPA 4G9RA 1OL1A 3MPMA 1PJKA 3T3VA 5DPVA 4M8TA 2XRUA 1OUYA 4JR7A 4PDOA 2UZOA 3G2FA 3DBFA 1YVJA 4FL3A 4O0VA 5F4NA 4AOIA 2JD5A 2KW5A 2G2FA 3LMIA 3A7JA 2BZJA 4GG5A 2QU5A 4GU6A 4RJ7A 3HA3A 3G9NA 3UOJA 2IVVA 2E9OA 4KUJA 3PZHA 2BFYA 4UEUA 4ZTRA 2OFVA 3ZM9A 2W1IA 3QX4A 4O7YA 5LMBA 1NE2A 1NW7A 3SXJA 2QVSE 4GK4A 4RLKA 5HESA 4EHZA 4M69B 3MS9A 5IPJA 3ORIA 2WXVA 4CMUA 4XG6A 4HYUA 4YUZA 2XK7A 2XBAA 4A6EA 2OBFA 4J99A 2UUEA 4ZTMA 4XX9A 4E33A 3RTPA 4C37A 3HGKA 4QTBA 3GFEA 3VF8A 4EC9A 3BKWA 4RYLA 3RJCA 4YUWA 2GHGA 2XNGA 4EH4A 3PS9A 4RVFA 5E2AA 3PIZA 3QLFA 3A4PA 4QDJA 4C38A 3QRJA 5IEXA 4HYIA 5IH4A 2BTRA 3EMGA 3UJ9A 5I9XA 3AT2A 1ZAOA 4R7BA 4WNPA 5IH5A 1QPJA 3LCDA 3QCXA 4O38A 4RVTA 3TM0A 4BHZA 2BDJA 3KXXA 4PX6A 4AZSA 3ERCA 4YPDA 2UZWE 2W7XA 2GB4A 3M6VA 1AF7A 4X6RA 4FBXA 1WBPA 4KB8A 4A4XA 4YTCA 5CWZA 4PTCA 5KHXA 3TNWA 1NA7A 2X2MA 4FTMA 3DKOA 2X4ZA 3JWGA 2RGPA 2ZDUA 3CC6A 3FBVA 3R6XA 4BZDA 2PZPA 2AN3A 3D4QA 4J7BA 2PUUA 1OL6A 4RX5A 4WG4A 3P9IA 4FKRA 4FUYA 4LMUA 1J7IA 3RPVA 2R3NA 3CKXA 4NIFB 4BYIA 4U6RA 4XUDA 2E9VA 2V0DA 5EC8A 4O7SA 5CAPA 4YBJA 4GFMA 2ESMA 1PXOA 3R9OA 4E2WA 1GY3A 2W05A 3NRMA 4P7EA 2YM8A 3HP5A 3QA0A 5C4KA 4FTTA 5E90A 5HG8A 3PY1A 5HBEA 1JPAA 4IH8A 1E1VA 2J50A 5BYLA 3EN9A 5CTPA 4MK0A 2O2UA 3HVCA 5BUJA 3KQMA 4G6NA 4L7FA 4PGGA 2R2PA 4G5PA 4ZP5A 3AXWA 4YZNA 4EHGA 2PWLA 3NYXA 1RJGA 3D83A 2AOUA 4G31A 2BR1A 4FTJA 3GT8A 3FUPA 4G6LA 2PY3A 2YZAA 5JFWA 4L44A 5FEEA 3Q5IA 3K5UA 5BMSA 2GQSA 3FKOA 5CF4A 4LL0A 4F9CA 5I9ZA 3I5NA 3OTUA 4I22A 4JRNA 3VBQA 3B2WA 2GU8A 4BCGA 2N47A 4FNZA 1LR4A 4RT7A 3MFTA 1NVQA 5HIDA 3W33A 4CT2A 3KQSA 1U5RA 3T9TA 4BTMA 2X8IA 5DHJA 1XJ5A 5D1NA 2VWBA 3DV3A 4PYMA 1JNKA 2CPKE 2FVDA 3E93A 3PRIA 4QP1A 5K09A 5FA8A 2CMHA 2ETKA 3WYXA 4V04A 3TV4A 3HCFA 3ZHPC 2C7QA 2I6LA 4FICA 2OZAB 2WIHA 4ZXTA 4ZLYA 2GNHA 3BBWA 4PL3A 5FM3A 4CCUA 4C07A 2QD9A 3FV8A 2CNVA 5EQYA 5HVJA 2YAKA 3QD4A 4KD1A 4QYYA 5ACBC 3UNKA 4ACDA 2HZNA 1P91A 3PXYA 5I9YA 5AP3A 4EK4A 4U45A 2X1NA 3S00A 2VS1A 4PYLA 1FGKA 5DSXA 4FL1A 5E9EA 3QV2A 3G6HA 3HNGA 3POOA 4EK6A 2A0CX 5DT4A 5L2IA 1I9GA 3B89A 3WE8A 3WARA 1YXXA 4I5PA 1W83A 3FL4A 2OKRA 4QMXA 1KP9A 1M2QA 1WS6A 2FYSA 1JKTA 2VTIA 3MY0A 2P3LA 4FV0A 5BX0A 3UJBA 2W4OA 2UW3A 3AC2A 4JXFA 1T43A 3FXWA 4AE6A 4FEXA 5E8WA 2PVCA 1IXKA 3A7DA 3BEAA 3KQOA 1ZZ2A 2XH5A 2PMOX 3BV3A 3HV5A 4JQ7A 3OFJA 1BYGA 5BW4A 1L1EA 5L6OA 5LVNA 2QOOA 4BF2A 4F63A 4R8SA 4O22A 3VAPA 2W9ZB 2B54A 3O31A 2DUVA 4FTNA 1HMYA 4DGOA 2HOGA 5ETFA 1Z9XA 3DQWA 3Q5ZA 3V5TA 4EZ3A 1UFKA 3EKKA 4BBFA 1MRYA 4DFLA 3UPXA 3R9XB 4S2ZA 3HMMA 2I62A 4EOLA 3DZOA 4M3QA 4MHAA 2JKMA 3VWAA 3W10A 1YOMA 4FV6A 3LLTA 4OTGA 3G33A 1P2AA 2XEZA 3OFMA 4GH2A 1F3MC 3O7LD 3UNZA 2R3GA 3LHDA 2GH1A 3M4XA 4J95A 3IW5A 1VBFA 3C51A 2CSNA 1N2XA 4NECA 3UBTA 3GQIA 2R64A 3R7OA 2ZZMA 1T46A 3U9NA 3EGVA 2OJIA 4P5QA 2P3GX 2WMXA 3FAAA 2G01A 3VBVA 2HAKA 2GAFA 3EZRA 1MP8A 4AOJA 4TYGA 3TWJA 4F6SA 3UZTA 3QD2B 1XR1A 3LM0A 3QWKA 3PIYA 5CSWA 3BYVA 1OL2A 3LFSA 2UVXA 2WGJA 3UOHA 4EBVA 3LXLA 3W32A 3LCVB 3EYGA 2VTOA 5E8XA 1JQ3A 4QRCA 4EOKA 4FKPA 3R8ZA 4FODA 1PW2A 5LVMA 1GIIA 3FSKA 3PZEA 3SX0A 4J8MA 3DMFA 4CFNA 3FZRA 1HOWA 3ZMMA 1GIHA 3QTSA 4HYHA 2QHNA 3NDMA 5B2KA 3HMNA 4N4SA 5TR6A 5FWAA 3D7ZA 4RTQA 3R1NA 4ORKA 4U7TB 4KRDA 3LFQA 3ELJA 3JWJA 2VTHA 2X7OA 4IVCA 2RFNA 1RJEA 3P2IA 3TN8A 3GXOA 4R1VA 5D1HA 3KU2A 2QKWB 2I0YA 4JT3A 2VO0A 4MTAA 5EK7A 4BCKA 2BZHB 3KY2A 3BXOA 1R18A 5K8VA 3IEIA 3KVWA 4RQVA 1JOWB 1KUTA 3PY3A 3QTZA 5D9HA 4AW5A 5FTOA 3EQHA 2AC3A 2VWXA 4ZMFA 2ZV8A 3KKVA 4FV7A 3EWHA 1WZNA 4ZS4A 2PWYA 2WMUA 1P4FA 2PPQA 3R63A 3O8TA 4FKOA 1PXJA 4PMTA 2PT9A 3GGDA 4IW0A 2FB8A 2P33A 4IAIA 5FBNC 4I6QA 5EEGA 4ZJIA 2BZIB 3DZQA 4FIHA 2C0IA 4CVAA 4IWNA 4C3RA 1YDSE 3P9JA 3KRLA 5FEQA 4PNKA 3VF9A 2AR0A 3LCCA 3SRVA 4L67A 4DQ0A 5CSVA 4C4IA 4AGCA 3PA4A 3S0OA 2XKDA 5CI7A 4FTUA 4U44A 4F0FA 3NEWA 4E73A 3DMHA 1UNLA 3DJ5A 2B1PA 3QZHA 4G16A 3KN6A 4FNXA 3ORZA 5J8IA 4ASXA 5AM6A 2W1EA 4BR3A 1WZYA 4D5KA 4U43A 3VS7A 1Q8ZA 4H36A 1HCKA 1WVYA 4F0IA 3GU3A 3IW8A 4FMQA 5LQNA 3F3ZA 3BWBA 3LZBA 4DFZE 2XK8A 2G2HA 3LIJA 4WUAA 3DBEA 3TZMA 1YOLA 4IM2A 4ANSA 3HMOA 4E5BA 2ZWVA 4IZ5A 1VEBA 5HKMA 1H1RA 3AC3A 3HA8A 1OM1A 3I0OA 4FT4A 2HYYA 1SNUA 3ZUTA 2QRVA 5LQJA 5AV4A 5KX8A 3BLQA 3G8BA 4X60A 2Q0BA 5E2BA 2WNTA 2X8EA 2Y1WA 2W1FA 3C4FA 2OB2A 1W84A 1WBOA 4F08A 3UIUA 4KKEA 1Q8YA 5HCYA 4E6QA 2Z6UA 1VP9A 2VTLA 4JG6A 5DYJA 4PYNA 5CUQA 3LVPA 4IAFA 3PFGA 1UWJA 3AT4A 4D1XA 3AC1A 4I21A 4Z7GA 3FY2A 1UNHA 5CAOA 3BKBA 5DEYA 5A3XA 3AG9A 5A54A 3CJQA 2H34A 5EHGA 3N4VA 5F94A 3SMQA 3M42A 4ACMA 3GO4A 5EOBA 5C0OE 2C5XA 2GFCA 2XCHA 3HCAA 4YLJA 2NP6A 4FKUA 3FDNA 2ETRA 2Z02A 3BHUA 1J7LA 3GU8A 3R22A 4IVDA 4O96A 5F1ZA 3WYYA 4AA5A 4KWPA 4B0GA 4Z16A 3HZTA 2WMBA 3IQ7A 1KYZA 3RPOA 3TTIA 4JL9A 4O91A 2XRWA 1L3CA 5EMKA 4BCNA 4FKQA 2P7HA 2IBTA 3MH1A 5KQSA 4L6QA 1NT2A 4JNWA 2UZEA 3NYNA 4IZ7A 4MD7E 1OIRA 4IACA 1XBBA 5DH3A 2VO3A 4L3LA 3G5TA 3RAWA 3EQIA
chains in the Genus database with same CATH superfamily
4Q02A 3W8EA 2WYWA 3PJ2A 4A1OA 1E0SA 4NFYA 4OK6A 4CDMA 2JGRA 2IS4A 5E8JA 2WQOA 4NSTA 2YY7A 4MVJP 3RBVA 3SKCA 4TYHB 3NGLA 4XB2A 4RVOA 4N48A 4IDTA 2Q27A 1R0SA 3ZU2A 5G0WA 4GXTA 1QAOA 1TUIA 2O5RA 3PXFA 4EKLA 2Z1MA 4ITJA 4F9GA 4IIFA 1VHTA 4YHFA 1JHPA 3GN2A 3RWMB 4DNPA 4FFLA 4WG5A 3NLBA 1LTHR 2ZQYA 3WGNA 1YZKA 2REXB 4E7PA 3OZXA 1XBCA 2AI1A 2XKEA 3OIUA 1ZN7A 1OLXB 4ALJA 1XH5A 1E3WA 4KH0A 4DVJA 3E9MA 1E5VA 4E5NA 4OT6A 5F5LA 2ZI7A 2WQ6A 5ANJA 4QHTA 3I1FA 4RJ8A 4RX7A 2OJGA 1BJKA 3CGOA 2J5QA 3MB5A 4B8YA 2GHRA 1KSHA 4JYBA 4IIJB 5I47A 3KQ7A 4BXOB 4EQ6A 1X8JA 3E7FA 4ICIA 4KQXA 1ONSA 4Q4HA 2UW8A 2C5GA 3C85A 1U0BB 2NO9A 1LDMA 2CHLA 1EEXB 1JKJB 3A4IA 1IDN1 4ZDWA 4C04A 4NBWA 2C4UA 3CX7A 3Q3JB 5AJYA 1S2DA 1ZRSA 2XVAA 4YCMA 1T25A 1O95A 3DV2A 3MFSA 2HNBA 1LZLA 4CIAA 2BKVA 5GOTA 4BGQA 1VE3A 5M07A 4JKOA 4NCHA 5CT4A 3PC4A 2R8BA 4CMIA 1K3FA 2VDNB 1V45E 2W2NA 4N49A 1E9SA 5IKMA 3KR9A 3ZO2A 1EE9A 3W2FA 4PGMA 1D1QA 3FRHA 4PSVA 2VDWB 4NFLA 3UUWA 2VRCD 3O38A 2H07A 4Y2RA 2UZUE 1M1NA 1B26A 5H8GA 1NF8A 2C5YA 1TUBA 4OMDA 4ZGGA 3QRTA 1LP4A 5JZ9A 1JVNA 3RIEA 2ZJAA 2AJDA 1G7RA 3O8QA 3Q9WA 4Z9LA 5CU3A 1X8BA 4GVJA 4RO0A 4JLMA 3GQVA 5FV4A 4N0SA 5HEZA 2C7RA 3OH8A 4L85A 1PK7A 4CM9D 2Y4NA 3T0IA 1GSOA 3AM5A 3FPLA 4W5TA 2PL5A 5EIOA 3C3CA 2QN8A 1E1CB 1MD9A 4DG9A 1IHDA 1TUGA 1SBNE 5AH0A 5CT7A 1JHOA 1H1TA 4IQ4A 4EG4A 3H1EA 4FD3A 5DGDA 3T4EA 3TSOA 1X15A 3S1LA 4FM9A 3NUSA 5EW9A 1E9CA 2X13A 4AF6A 1T6YA 3HCCA 4J1QA 2VTTA 5FQOA 4YP7A 1UDXA 3RWOA 3ND9A 4BRZA 3EHDA 2QQFA 3H2HA 4TZTA 5EP4A 1M66A 1LKZA 2RGEA 3G2OA 4B3TB 2ISQA 1NW8A 1U7HA 1EH5A 3FQSA 3LX5A 4ZOAA 3PNPA 3ZY4A 3VO1A 4V01A 4WVLA 2RARA 3JVIA 3TG1A 1FYDA 1J8VA 2CDNA 4ZTLA 4YJ2F 1A50B 2I6TA 5EM5A 2FXIA 4QYXA 2R3OA 4Y6PA 2PKYX 2MSLA 1NXQA 1P77A 1VYTA 1KH3A 3RVBA 5HK9A 4HGNA 1XEAA 2MR5A 3GCZA 3QU9A 2R3JA 1CDKA 1FQKA 3HXMA 4L6IA 2QG7A 1WMFA 2R3MA 3DZ8A 5FDPA 4OHPA 2CLEB 4XDHA 2YIQA 1AVTA 1TCCA 3ZD7A 1FS4A 4FX5A 1SURA 3ZY2A 4PS0A 1EVLA 4PY2A 3R76A 2XALA 5DLSA 1ES9A 3E5RA 3HFGA 1MOPA 2QLTA 5J3JA 2ZEJA 4BZZA 3CVJA 4JI0B 1D9XA 3DOUA 1P1IA 5F98A 3G5AA 3CXWA 3DM5A 3R7VA 1H26A 3MCAA 1Q7TA 3W5VA 4J1TC 5DRDA 3CH4B 4ZIMA 3NAGA 4HQKA 2HLDA 3VQTA 3VR3A 5I01A 1PFGA 1VKOA 3IVGA 1KYIA 5JZVA 5IDQA 3JV7A 2WHPA 4BCDA 1X3LA 3QLTA 3OLCX 2PVJA 1E6UA 2R6JA 4CMHA 4IB3A 3EFEA 1YIOA 1X2BA 1SEVA 3DF7A 2ZYDA 1XGKA 3Q1LA 1OC2A 2QMYA 5HMMA 2LRHA 5CJ2A 2DFLA 4DJAA 3U80A 1ZMXA 1OAKA 4G5QA 4ECAA 4OHFA 1LI5A 2WTKC 1YA8A 3ORKA 5IJZA 3OW3A 2QTBA 1KJJA 2V8OA 1T2EA 4RD6A 4D2IA 1M2VA 1FDTA 5FHQA 3G0IA 5H3LA 3JS5A 3G89A 2FE1A 2QRNA 3ZGZA 2NO1A 1Z5ZA 2BISA 1PR6A 3RC9A 4AGUA 4YHJA 5B3AA 4WKQA 2VT6A 1IVSA 4UUBA 3EQBA 3NT2A 3M8KA 4HTFA 3AUSA 3DMYA 4FYKA 5FTNA 3BV2A 2WUEA 5AJTA 2J3KA 1JEJA 2CBZA 2D06A 1G17A 3H4TA 1E9HA 1ETUA 2ZS9A 2IY8A 2HJRA 1A5ZA 5D84A 1K75A 2O2CA 4FTRA 1UC4B 4CMIB 3ZTTA 5JOQA 3TNQB 1PQUA 1E2IA 2INGX 1W8IA 1XH4A 1XNHA 4LKOA 4C5BA 3TLEA 4OVKA 2WT4A 1AZWA 5B6PA 3SGCA 2XUGA 4DBLE 2XECA 1MR3F 2XK3A 5IQHA 5FQDC 2ZVAA 3Q3EA 2FPMA 4WKPA 5TMEA 2PUTA 2ZYUX 1FVOA 4U41A 5B4UA 4XDYA 2JCGA 3QTRA 4BATA 5DTQA 5IA1A 3ADDA 2P40A 3S1HA 3UO8B 4FR2A 2C9OA 4IVPA 4QOGA 1FX0B 3OCYA 4XH9B 3ME5A 1O2DA 2VLBA 1VLLA 1OYOA 4V0GB 3SI7A 2VG8A 3OPVA 4A7CA 4NXMB 4PC6A 4I9UA 2J6HA 2D0IA 2C3JA 1PT9A 2OH4A 3R2BA 3I6ZA 5KYXB 3MSCA 3I23A 2VK2A 3D2LA 4TL0A 1QHHA 4FHEA 3I5XA 5PNTA 3DL0A 3ZDBA 3BWDD 4AI6A 3LJKA 1NVVR 1JLKA 3BQRA 1Y6AA 2IH5A 2FKNA 4CV9A 3LF2A 3WOWA 4G8JA 1TKCA 4F0GA 4A8HA 1V5GA 4TYQA 4L7SA 5AI0A 4Q12A 5M51A 4XZ3A 3GJZA 5DXFA 4D4MA 2TMKA 5G3ZA 1C3OB 2XYNA 3KQQA 3IAM1 2WIDA 3A6HA 1JEYA 5HI2A 3PNSA 1HDGO 1JSRA 2ORVA 1HR0B 2HXGA 4IDPA 3OT3A 2VWHA 1IOVA 2CLFB 1K6EA 4JNKA 1GGKA 1U3FA 5FPSA 3TS1A 1F4PA 5EPUA 1ZZLA 3QHQA 4RVKA 3SW4A 1U54B 4EQMA 3BE9A 5LXTF 1EDBA 2V22A 1XZKA 5THXA 4I1IA 4HGOA 3IKLA 4P8RA 2GSDA 3O1LA 1DBWA 2LXNA 3V5JA 3ZDYB 2P6PA 1VSTA 1JNYA 5FUBA 3AY6A 1UR5A 1HDYA 3S2PA 3BZUA 2Z2IA 3CUEF 3BD6A 2HT1A 3BJZA 5GADl 1N4DA 3F82A 1MB3A 3LNCA 4ML3A 4N8EA 3QG1A 4PEVA 4CRWB 3ZR4B 1TEZA 1VL5A 3U2QA 3O4VA 2P4QA 3OQMA 3THYA 3UB4A 4APPA 3FOZA 1ESNA 4JP3A 3BFKA 3D7RA 2R8OA 2YJGA 3QIAA 3TFOA 4S04A 5CDYA 1KSGA 4A27A 3KPYA 3JS2A 3HFJA 5FDFA 4D0WA 2AQKA 3BA6A 3EBPA 2YRFA 4BNDB 4F9WA 4JG7A 1UXJA 3VUIA 5A4LA 2P9EA 2J9XB 5EJ4A 3SQQA 2RGDA 3TLJA 1OBOA 5K8JB 2VH2A 1N6LA 4N47A 1CG6A 1MUOA 3EA5A 2OZVA 4ZCLA 4BLOA 3P08A 4ZVTA 1P7PA 2AXEA 1X7XB 3GR6A 4G8CA 5L6PA 1BCRA 4F04A 1RYDA 2O0UA 3Q2MA 1U02A 1PZHA 5F2KA 3R75A 3TXOA 4HN4B 5BSFA 4BOYA 1U1FA 1U3UA 1A27A 3T9CA 1IYZA 4RA9B 4LXXA 3HYHA 3VSDA 4KZPA 3P4UA 3V8NA 1AQNA 1CR4A 1KQNA 1YE3A 1ZWSA 4OHUA 5ICPA 1CXZA 4TWCA 5IEYA 2ZVQX 3HY4A 2YERA 3I9KA 3QU2A 5IANA 2HU5A 2ZK7A 1YQUA 3DEIA 3RAKA 1M54A 1N0IA 4D99A 3KXMA 1REJA 5C9CA 4LFAB 4CEHB 3PA5A 3BCEA 2B0QA 1T34A 1MXFA 4XQCA 3UOLA 4EJNA 5HIBA 4U7DA 1QAQA 4XBUA 4R1LA 3BXEA 5HZGA 4IIXA 2PGLA 3BL6A 1KK1A 2JLDA 3QTQA 2AH5A 3TQTA 4DDVA 3D3WA 3NKLA 3KM0A 4Z2YA 4AY2A 4YP9A 5I9IA 1WDTA 3D8SA 1SNXA 4DIFA 4HAVA 2UV2A 3RPYA 1T3HA 1FPMA 3IP9A 1WDKA 1K7SN 1LX7A 1K4YA 3WLHA 1V8PA 3FMGA 4PZ0A 3FEGA 1HRDA 3O8BA 3AHJA 2ZXFA 2E7ZA 2XIRA 1WHTA 4EECA 2G15A 1VOTA 4MARA 4HNIA 1ZLTA 1C3EA 5LD2B 3H5NA 3ABRB 3LU1A 2ZTMA 4E1VA 3QVTA 1A1SA 1WCCA 1QZ3A 1YL7A 4DFNA 1KO5A 3RTDA 5HICA 2J0KA 2OK8A 3B7PA 3PJ3A 1NW9B 1JQJC 1W48A 2B9HA 2BLNA 1X8LA 3V5LA 2A58A 4FFNA 5EHQA 2QRUA 4I6EA 1TCVA 4JJ7A 3A04A 1JIKA 2JAQA 3QOWA 2HBRA 3MWEA 3NW6A 2QL6A 3ZJYA 3QI2A 4ROTA 3SQOA 4O0UA 1ZOHA 2GNIA 1XCOA 4PPYA 3E0QA 3TLMA 3CZ4A 5DCUA 5BVKA 5KX5F 1PGOA 3NFGB 5F3WB 2V0GA 1ZJWA 4G0ZA 5ITZA 4EG3A 4AXXA 4DOMA 1TAGA 5C31A 4LGGA 3BWXA 2GEVA 1E77A 2HSGA 5DX0A 1SCIA 3P5JC 3ZUVA 1YCDA 3OCXA 2LD4A 1NM5A 5H0IA 1R8YA 1RQQA 4EKKA 2GWRA 4ERWA 4V1CA 1RMYA 2WTCA 1QRRA 1BN6A 2IVZA 4MP3A 1J8FA 3HA7A 4MWDA 1YI4A 4IINA 4M9UA 4RM3A 1NG1A 3MYRA 4B47A 1LPSA 2HX1A 3HYTA 2C2MA 2XF0A 3VBTA 5CSPA 4QPZA 4TZ6A 1Z28A 1N0UA 5IYZF 4QPSA 3TMKA 4WASA 5FTGA 1H2YA 2ZOSA 1J0AA 5EIFA 2WEKA 3SIWA 1WXWA 3SC3A 2DH6A 2QCSA 1ZZEA 4E88A 1GCAA 3PENA 5C7OO 4EH2A 3R24A 4MVYA 4XGQA 1OLOA 1CR1A 1VFPA 4GOXA 2EKZA 2ZW9A 3EXFA 4P3PA 4D8UA 2GI4A 2X1LA 2X0IA 4O0XA 2IV3A 1BMDA 3UDBA 3DXNA 1RE8A 5DW0A 2Q2NA 5B2ZA 2HSDA 3C2QA 4BGDA 1X1QA 1V8FA 4ZLZA 4RDHA 3D5WA 2W4KA 4YMJA 3P27A 2ABWA 2JD1A 1LNQA 4YYEA 2C30A 5FWNA 4QM6A 1L5SA 1WY7A 3P2EA 1WPRA 3TKUA 5T68A 5CGZA 3D2BA 4D0SA 5EWLA 4LN1A 4E03A 1Z6GA 1JIJA 2HK6A 4U2FA 2A9QA 3FVTA 3D54D 4AY5A 4EW3A 5DM0A 3R8XA 5ADHA 2GF9A 2GPBA 1IEVA 2J5RA 2XUPA 1NGSA 2BM0A 3EA0A 3UGTA 3BXPA 5EH0A 2PUCA 3A6FA 4K9OA 2GSWA 2OQVA 4I6JA 3LJ0A 3NYIA 4YMVA 2KBEA 1LS6A 4WCVA 3ZEPA 1FDRA 3WNBA 3RSSA 4H7PA 4J91A 4F7DA 4DDUA 2XWSA 2C07A 5IEJA 5IH3A 4WN9B 4F7LA 4TTJA 4F1TA 4OXRA 2XMSA 2R79A 4CLOA 2JD0A 3JD1A 4UCXA 3NHSA 5HIAA 5CAUA 1UP6A 2WJGA 1WF6A 4LMBA 2RJNA 3H5WA 3QP9A 5BR4A 4P33A 3OM0A 4GPEA 4JR1A 3C7AA 1KP2A 1SCBA 3I2GA 3P19A 3NBMA 5AKZA 5BN3B 3OJLA 3QVVA 4EPRA 4ESOA 4DIMA 3U39A 3H0ZA 1RYFA 4AS3A 1RHUA 1GNRA 3UK7A 3WGOA 2WJZB 9GPBA 3NHWA 3U5TA 4MW7A 4EEVA 3IIEA 2QGNA 2R5FA 1RQNA 1NWHA 2DY0A 4OH1A 2QX6A 3CLTD 4ZTQA 1YZTA 3WP0A 2CCKA 1I44A 3GEDA 1VECA 1FQWA 1VQ1A 2H6EA 3QXOA 4EUUA 3I2KA 5DGHA 3MMPA 2R60A 4O4JB 3NNSA 2X0EA 4PRKA 4W8GA 1PXLA 2QQ0A 3JY9A 4OQYA 1LK0A 4GT1A 4TV8F 3DE4X 2HPVA