5GIOE

Crystal structure of box c/d rnp with 12 nt guide regions and 13 nt substrates
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 63
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gioE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5gioE02
2VDWA 2JDOA 4KW7A 4W4XA 3PXRA 4EOJA 3MAGA 5LSAA 4C38A 5DTMA 3TM4A 4E6QA 1PXKA 2B2CA 3ZLYA 3ZC6A 3EN7A 3IYLW 3G9LX 3PJ1A 1ZMUA 3OE5A 3KHKA 4RVDA 3RCJA 3VRYA 3GDHA 2W96B 4Y30A 3L9LA 2IZRA 4JOAA 4U42A 1QAQA 3OWPA 5A6NA 2JKKA 3C0HA 2IVSA 3LBFA 4O82A 3HRCA 3KCFA 1IM8A 1YXXA 5T3QA 4X6RA 1I1NA 3ORXA 3MESA 4V0QA 2F2CB 4FGBA 1ZZ2A 4FODA 5AP1A 3KGAA 4DEIA 1RI2A 3QBNA 4QDKA 3LM5A 3HRFA 2ZFUA 3Q04A 2BPMA 1R8XA 5L2IA 3PB3A 1CTPE 3MY0A 3T9IA 3GCUA 5FM2A 2J2IB 3TKHA 3TKIA 2GTMA 4KKHA 1PKGA 1R39A 1R78A 3A25A 4IB0A 3RPOA 5CZHA 3RNIA 4BI1A 3N4UA 3VF8A 4BZOA 1NV8A 3EQBA 3E7VA 5LMKA 3HA5A 2WQBA 3D5WA 4UYNA 3PA5A 4EHEA 4EKLA 3AD6A 1INLA 4BCQA 3FLWA 3GQLA 5DPVA 5HQ0A 2W4OA 3R1SA 1Q8TA 3G15A 5M4FA 3W18A 4H1MA 2X4ZA 4NUSA 4GIHA 4ZJIA 2R3NA 4NM0A 2Y6OA 1XDSA 4I1ZA 4ACCA 3I60A 4JBQA 3VW6A 1Q97A 1SNXA 4IB1A 5JKGA 5A4LA 2CKOA 4A9UA 1UKHA 2JBPA 2VTJA 1YW2A 2VZ6A 3DBDA 3H9OA 1OUKA 2JGZA 4PWNA 3ER9A 3WSTA 4H3PA 4X1OA 4TW9A 5H8BA 3R01A 4CTJA 3LJ1A 5CAQA 2WA2A 4PQNA 1JQHA 1L8TA 3E87A 2HY81 4UY9A 4F9BA 3VS4A 2HW6A 4MD8E 3R22A 4IC8A 3EWHA 4J8MA 2CL5A 3F3UA 4M0YA 4UALA 2Y4PA 4YO6A 2QLUA 5IQAA 3PFHA 4PF4A 2CMGA 3EN5A 1PXNA 4ER5A 3SXRA 3T7TA 3BYUA 3ZU7A 3LFQA 3LDUA 4DEDA 4IZYA 1XQZA 2E9NA 2YIQA 4GU6A 3BWYA 1Q99A 4DLJA 3LQ8A 3ZONA 3WE4A 2XVDA 3LL7A 2PUPA 4F6SA 3M70A 3LLTA 4TXCA 4J53A 4XOZA 3QQJA 3O71A 3AJDA 4MXYA 4XP2A 3QOXA 4IH8A 3DXQA 3FUWA 4FZAB 3RHXA 5LJJA 2CGVA 4D9TA 2WU7A 4O83A 2I40A 4IVDA 4ACMA 3HYHA 2PE2A 5JZJA 5E8XA 3OCBA 4X2KA 4Z7GA 4FVRA 4BIBA 3PPJA 3FZ1A 4N0SA 1P1BA 5CSXA 4Y95A 2ADMA 4HOKA 3UTOA 3G5TA 3G2OA 4W4WA 4NW5A 4RFZA 3WZJA 3WF5A 3ZXZA 2F57A 2UZVA 3RPYA 3G5LA 3QUDA 4J8NA 3UVPA 4U7PB 3Q7EA 2X6DA 5ICCA 4GUBA 1XBCA 3KKZA 4GEOA 5CVFA 2WKMA 4ZIMA 4OA8A 5KQSA 1P14A 3BYVA 3FMLA 3PJ2A 4QMNA 3R6XA 5JR3A 4FUXA 1MUOA 2VTPA 1PXJA 3R1NA 1QZZA 5GP1A 1JTEA 3FYCA 5KYGA 1JSVA 4FKVA 1WBOA 1Q8WA 4GUEA 4ISCA 2ERKA 2WB8A 1QMZA 2PMIA 3RZBA 2ZV8A 4GOOD 2QG7A 2Y7JA 3UQFA 3QHRA 4DG0E 4DMGA 4AN9A 3QFVA 2AOTB 5KNJA 4DFZE 3OZ6A 2O07A 3EGIA 2XP2A 4FZFB 5GNKA 3G0FA 2ITQA 2YHVA 2F8LA 4W4VA 5A4EA 5GJFA 2WMAA 2NXNA 3KU2A 3DCVA 2ITOA 1Q3DA 5AP3A 3CBLA 4NJ3A 2OIBA 5FP6A 4D1XA 3OCSA 4RQVA 3RPRA 4YR8A 3R2YA 4E6AA 3BE2A 4GH2A 4IV8A 4O0VA 3GFEA 5E1EA 2V0DA 3BGDA 2R3JA 4WXHA 4NK9A 5HNGA 5DPMA 4PX6A 4C62A 3M6VA 3PG1A 1JQEA 2QM3A 3FI3A 3PLAE 5FBOA 3LM0A 5IH3A 4ERWA 3ZLWA 3AXWA 2CHLA 5CSWA 2OJJA 4KRCA 3WZUA 3FLNC 3ZZEA 4R05A 4JDIA 3QX2A 5EYCA 4UZDA 4FGRA 4IW0A 2ZAZA 1V1KA 5G6VA 4NM7A 4G6OA 5DX0A 2UZDA 5J1VA 3R63A 3P78A 4GRBA 2EXCX 2UV2A 4EK5A 3EFLA 4J95A 5KZIA 2DPMA 4KIQA 3I7CA 3OY1A 2I6GA 1W83A 4FSYA 1Q4LA 1OI9A 3OW3A 3VJNA 2IW8A 2QKWB 4PDYA 4WNMA 1H4LA 2YDJA 2VDVE 3A7FA 3DJ5A 1YFJA 5FRIA 3T7RA 4WSYA 5EDPA 5JQ8A 3MTLA 3HM2A 3QWKA 4QTTB 4HVSA 4LI5A 4YSJA 3RPSA 5H3QA 3WIKA 4IEBA 5FQNA 4RVMA 4ZTHA 2Z7QA 4KBCA 3CY2A 3NCGA 1H1PA 2R3LA 1PXMA 1KXZA 3EZVA 1JR4A 2NP6A 5K0CA 5FP5A 4QMXA 4TNDA 1GZ8A 3OCGA 1XBBA 4QMOA 4PTEA 3DTCA 3QZHA 2O05A 1XTPA 4KB8A 3O23A 3UE4A 3R8VA 4FTJA 5C8KA 2YAAA 4EOIA 3GRYA 4J7BA 2OYRA 4RVTA 4ZK5A 4BDCA 5LOHA 3DZQA 2I9KA 4RWJA 1TW3A 4FG7A 3PIXA 3VC1A 4I22A 3TJDA 2R7BA 4DCAA 3FZPA 3RWPA 1VP3A 1KE9A 3UJGA 4FEVA 3VUMA 3V5LA 4BCMA 5FBNC 2Q41A 5LVMA 2OJGA 2C3KA 5EYMA 3F3TA 4FR0A 3UP2A 1O9GA 1JQDA 2QO2A 5HIKA 4YTFA 3UZTA 3LGAA 3KQWA 4MXZA 3OUKA 5DEYA 1JWHA 3PLSA 4KVZA 3GVUA 5KBQA 1VYWA 3IV6A 4KRDA 4HG2A 3SSMA 1HOWA 4LECA 4F9AA 5EIWA 1WXXA 2X9FA 2C3IB 2FVDA 5JFSA 4WIHA 4H39A 5IQHA 1M7NA 2BM8A 3ME5A 3MN3A 2ZM4A 4C33A 4GFMA 3RIEA 4TNBA 1WVXA 5GIPE 4E30A 2C5OA 4QMSA 4AS0A 2C6MA 4CKCA 3ENMA 3ROYA 5L6WL 2YABA 4UXQA 3ORTA 3QD4A 2J0MB 1OPKA 1KE5A 3A26A 4OLIA 2PVMA 2Z8CA 2XYUA 3PSBA 3KR0A 5AP0A 5ACKA 2OI4X 3HRBA 2YWPA 5IUIA 3OEFX 1ORHA 5J9LA 1EH4A 3EQHA 3WZKA 3DZOA 1YI4A 1SMHA 4WG3A 3PXKA 3V8SA 4CFNA 3NW7A 3OFMA 3V04A 3NUYA 2R7IA 3MTFA 3LVPA 4WUAA 2PWLA 4L68A 5HLWA 3W16A 4S34A 4LL0A 1W7HA 4L46A 2PVJA 4PYLA 2E9PA 3RJCA 1IAJA 2XK7A 3EVFA 4RWKA 3Q2JA 2BROA 2PBFA 3DH0A 1PYEA 5FXSA 3QRKA 3JWJA 3GCSA 5CVHA 4RX1A 5DXAA 3E64A 4AT4A 1O9HA 3BZ3A 2O8YA 4F7JA 4JIAA 4UV0A 5EIFA 4AW0A 5I9YA 5HG8A 3HTXA 5A4QA 1PMVA 3BYSA 3V01A 3LXPA 3QC9A 1UNLA 3SV0A 4RTRA 3KK9A 1R3CA 2ZULA 1B6CB 1FP2A 2QE6A 1DI8A 4JG8A 2BR5A 2IP2A 2G2FA 3TI1A 4I41A 4IAYA 5ANIA 4GT4A 4NYEA 2B0QA 1IA9A 3WI6A 5CEKA 5IZFA 1J91A 4PYIA 4DEGA 3MY1A 2XKCA 3NAXA 2J5FA 3ELWA 1GJOA 3EKNA 3ZFXA 3KEXA 5EM8A 3AWIA 4QO9A 3JWGA 3BXOA 4NM5A 3OY3A 5HIEA 2P7HA 2LAVA 4DH7A 3G8AA 2OG8A 4ZSJA 4FNZA 3WILA 2JDRA 3CPBA 3KQQA 5BYZA 4FIJA 3UPZA 1YI6A 2GHMA 3G2MA 4X21A 4FT9A 4K11A 1Y6AA 4PL5A 3DK7A 5JZNA 3FYDA 5CU6A 3TPZA 2BDFA 3E7OA 4USFA 3R0TA 4CG9A 4MBIA 5TF9A 2DQ7X 4NT4A 3QTQA 4MXAA 1AD5A 4D55A 3FSKA 1UNGA 5CEIA 2JFMA 2PULA 2WZJA 3SQQA 5CI6A 2HTEA 3ZLXA 3E8SA 1MRYA 3TL8A 2CGUA 4PY1A 2GLUA 3OTVA 5G1XA 5EHGA 4O0RA 3A8XA 3QRTA 5AP4A 3ZFMA 4AZSA 2EJUA 4BTKA 3UO4A 3S68A 1L1EA 2W05A 2BILB 5JRSA 4BBMA 2CKPA 4HSGA 3DBFA 1JG4A 3PA3A 5CD1A 3UG2A 5ANGA 2O63A 2XUUA 3R9NA 1SM2A 2OPBA 4F7SA 3AC5A 5AX3A 3P79A 2PWYA 1KV2A 5L6PA 3D0EA 1PW2A 4QQKA 4OBXA 2OBFA 3FXWA 3AMBA 1K2PA 4KWPA 2I0EA 4BDFA 5EHOA 3FPEA 4QQTA 1OPJA 4E26A 2O57A 3ZOSA 3D9VA 4GC5A 5ITAA 4EWQA 5IU2A 5D7VA 3DA6A 4BTJA 4D2SA 5EHLA 2ZJWA 3RINA 4ZLOA 2XKEA 3D2KA 1TKIA 5A46A 3RK9A 2WQMA 5E90A 5DHJA 2AS0A 2UW8A 5CIYA 2PZPA 4AQCA 4JQ7A 1LR4A 4YTIA 1KYZA 1U5RA 1KV1A 3BRBA 3F5UA 1SVGA 1H24A 4F0IA 3NUSA 3EN9A 3FXXA 2UUEA 2FO0A 3Q9ZA 1SVEA 4ZTQA 4POOA 3D2LA 5P8WA 3GU8A 2JKQA 5EQYA 3SAYA 1NT2A 4CGAA 5E9QA 3R8LA 2H00A 2OFUA 2WO6A 3QZIA 3HCFA 3DNEA 4Y72A 3QKMA 4U45A 3MJ1A 4L44A 2EB2A 1KE7A 5EKXA 2YVLA 3O17A 3Q9YA 5B0XA 5EEGA 4ANLA 3TDWA 3C4CA 2WMQA 2QG5A 3CD3A 1WBTA 2P33A 4IADA 3K6RA 3PP1A 4AA0A 2B9EA 4FV3A 2WEIA 3QAME 3MQ2A 4TTHB 2R3MA 3S1HA 1H0VA 4J1RA 3VYWA 4FV5A 3FMHA 4JRNA 4WBBB 2V7OA 4UYAA 3C0KA 1DCTA 4OTGA 4YV0A 1VJYA 5K09A 1ZXEA 3DLIA 3FL4A 4JDJA 2C6TA 5AA8A 5L8LA 4YURA 2IBTA 2VTAA 3ZCLA 3A61A 5FDXA 2HELA 2ZZNA 2EXMA 2V55A 3CJTA 2A4LA 3HMPA 1KPHA 4I24A 1IAHA 3RW9A 1OIRA 2GPYA 5BVOA 4L3LA 5TO8A 2B25A 4MYGA 1PY5A 2IPXA 1Q0TA 5E4HA 3KA0A 4ZZMA 2YZLA 2CMWA 4ZSGA 3CGFA 5EQPA 3PY0A 5LVOA 5MHTA 4ITHA 5KQRA 4RJ3A 4FOCA 2YM7A 5HIJA 3CR0A 2GFSA 2ETRA 3P8ZA 3LAUA 2F4JA 2WTVA 2AVNA 2PT9A 2UVZA 1H26A 3MI9A 4EK9A 3NCZA 1BMKA 3HUBA 4G3EA 4ZZNA 1M17A 1OKVA 5IQGA 4X63A 4FKIA 3F2RA 4GOND 2BH2A 5CCXA 3QZGA 3QUPA 3FY0A 5K4JA 4IVAA 4EVIA 4F70A 1JTFA 4XMOA 4F9CA 4AA4A 4F7NA 1H1SA 3HUCA 3TJCA 2OFVA 2ZV7A 4EQUA 2WQOA 4DLIA 2J50A 3EFKA 4BIDA 2BAKA 5FEQA 3NNUA 2HENA 3A7EA 5DWRA 1ZZLA 2BAQA 4ACHA 3NUNA 4H3QA 4Q5EA 1V0OA 4MVFA 2C6IA 4NKAA 2J0IA 4AE9A 4NW6A 2Y1WA 5K0LA 4I23A 5AUUA 3PRFA 2W0JA 2VTIA 2Y0AA 4FT5A 4CFXA 3RP9A 2WOUA 4O91A 3R21A 3HGKA 2B53A 4J99A 1OL2A 3G8BA 4FGZA 3F7ZA 4GFGA 4BTMA 5AEPA 2CKDA 3MFSA 3KY2A 1B39A 3LIJA 3Q4TA 2C5NA 3A60A 3BT7A 3QU0A 3GGDA 4QP4A 3UQCA 3Q4UA 1URCA 3HV3A 2X0GA 4PL3A 3QGYA 2KW5A 2ITYA 3E88A 3UVQA 5EW9A 4P2KA 4FTTA 2R0UA 2R64A 3OEZA 3VULA 3EEYA 5FHQA 4FS8A 4RTJA 3UZUA 1KOAA 3Q3BA 2OF4A 3NJRA 3R30A 4HCVA 3OP5A 2X8IA 3SA0A 4HH4A 2OB1A 3HP2A 2ITNA 4UWYA 3KRXA 4PTGA 1KSWA 4OBOA 3T8OA 3QALE 4K8AA 2XM9A 2ZM1A 4I6FA 2QOKA 4O81A 2PVKA 4EH2A 2B54A 1CKJA 2JIUA 4YZBA 3A27A 3SVZA 3GNIB 3BBTB 5GM1A 2C5XA 4NWMA 2GMXA 3BQRA 4C02A 4G3FA 4EK4A 3MY5A 3FPQA 3C9WA 1KWPA 5T68A 2GNHA 3UJBA 5AJQA 1MQ4A 4V0GB 1Z5MA 2X4FA 3M11A 3OFJA 5HE2A 4O29A 5A54A 3QXOA 4GOMD 4I94A 3FC2A 3ORNA 5DTQA 5GINE 5L2WA 2G2IA 3HV7A 3ULIA 5CLPA 4U41A 5DT0A 2WIHA 4GBED 2YXDA 2YM6A 3W8LA 3SGLA 3MB7A 3IDBA 3ORIA 3QC4A 4FSDA 4F99A 1KHHA 2XEYA 5HEKA 2C1AA 3HX4A 4JLCA 2W1IA 5BVKA 2ZVAA 3L8DA 3SM3A 5AUZA 3LHJA 5CT7A 2VUWA 4G31A 4EHGA 2Y1XA 2FSOX 3QQKA 4CTBA 1JG2A 4Y46A 3QD2B 4JDHA 3MS9A 3DGKA 1T46A 2BZKB 5DT3A 1RE8A 3QTWA 3AMAA 2CNQA 4ALVA 4QP3A 4ZEGA 3P5KA 3G7UA 3NIEA 4O7VA 5AUVA 4QTAA 1L9KA 3C13A 5K0FA 4O22A 4LWPA 1MRVA 3I4BA 1K3AA 2OLCA 1U59A 2AOTA 3E92A 3AMYA 4U79A 4FSXA 3ZS5A 3GCZA 2J0KA 5K01A 3W2CA 4QP2A 4CKJA 5GJGA 1H01A 4FYOA 3OOGA 3ZTXA 4DHFA 4QMQA 4EK3A 3KB7A 3NNWA 2XVAA 4ZTLA 4IDVA 3P9IA 3P9KA 4L45A 3U51A 4QNYA 5TR6A 5D1JA 3E3BX 5ICPA 3EQCA 3ZHPC 3B8RA 4R77A 4H58A 3D7TB 2XA4A 4GJ2A 3H4JA 1J7LA 1YOJA 4O6LA 4F09A 4DFXE 3D5UA 3P86A 4Q9SA 4FZVA 1ZOGA 4R6WA 3P2IA 1WBNA 4O27B 2E9VA 4H0NA 1M2QA 4Q2AA 3CJQA 2R2PA 5K4IA 4BGGA 4O7ZA 4BDDA 2VO0A 1H08A 4XP3A 4EONA 3OC1A 4CKRA 2JFLA 4CKBA 4LL5A 3JWIA 1P4OA 2I62A 2IW6A 3D83A 2VS1A 3UYTA 2JDSA 4OBQA 1YUBA 2O0UA 4QMMA 3ZXTA 4YC8A 3SX9A 1I44A 2X81A 4E4NA 2VWYA 3POOA 4DFYA 5LR6A 1Q24A 4EQMA 1YOMA 5BVFA 3NWWA 4GV1A 2BKZA 2XVMA 3E8CA 3SHEA 2VWVA 5DEWA 3L9MA 3UC3A 5DOSA 4S32A 4DCEA 4FZ6A 2YZAA 2JLDA 2CNVA 4E2XA 3KRRA 4RSRA 5H02A 1XCLA 3TG1A 3MA3A 2HWPA 5HKMA 5CEPA 3P2KA 4JQ8A 3ZSIA 1JVPP 4GK3A 5FCDA 5LQJA 3ZUTA 5KMMA 2AVDA 3O0GA 4BZNA 1YHWA 2G71A 2B9HA 4OTQA 4QMWA 3SXSA 3MWUA 3ORKA 1H1RA 5JEBA 2C7PA 5JN2A 2CN5A 3LDGA 1BC5A 3QCXA 3PFGA 3R24A 4DEHA 5AV4A 3LMGA 2G1PA 5L2SA 3OWKA 2E9UA 4MHTA 3FSFA 5EDRA 2Z7LA 5BP7A 4WNKA 5DR6A 4PONA 4FYNA 3VF9A 3FYKX 1GAGA 3PY3A 3CTQA 2PK9A 3F5XA 4U97A 3BBWA 5IEVA 2OXXA 4PTCA 5K5NA 3DT1A 2XB7A 5HLPA 1M0EA 4C61A 5GM2A 3OTUA 3VWAA 3DNDA 4BCGA 4RIWA 2ITUA 1NA7A 2B9FA 1XR1A 2DYLA 4ENYA 2W1CA 2XJ1A 3RVGA 5EC8A 2XCKA 4YJPA 4KDRA 3I79A 4RC4A 2ZDUA 3W2PA 5LQNA 2UVXA 2UW6A 2VZ9A 5DRBA 1GZOA 3ALOA 4MXOA 4O7SA 3VUIA 3KPUA 2VTRA 2CWWA 4CQEA 4RJ4A 3EQIA 3SW7A 1FMKA 1OBGA 4I4EA 4E2WA 3P9NA 5HVKA 9MHTA 4CFFA 3F5GA 1H1QA 3DLSA 4USDA 4C07A 3I64A 3A7HA 2JH8A 2UZUE 2FK7A 4FT0A 2UZ4A 1GIHA 2QOCA 4CKEA 3I1AA 5IKMA 2UZEA 5EI8A 1VLMA 4A4XA 3UA4A 3SDJA 3L1SA 1X1DA 2OJIA 4IZAA 1CSNA 3MVLA 3C4FA 3CTHA 1QAMA 5JFXA 5AV1A 3D7ZA 3QX4A 4ZLZA 4WT6A 1FJXA 4ZSAA 3L8SA 5J5SA 2JEDA 3I53A 4O21A 2C6OA 4ZJVA 2NP8A 3U54A 4HCUA 3KU1A 1VBFA 5LQAA 4IZ5A 5AAGA 4QMLA 2RFNA 4R7HA 3ATSA 4I3ZA 2WA1A 4D4VA 4R6XA 2HZIA 3MCZA 3KREA 3KQVA 3ERCA 3ZFYA 2J4ZA 3MTIA 5HCXA 2WNTA 2Y6MA 2IJMA 4BLWA 1OL5A 3GO4A 1GZKA 5C1QB 1PXIA 3NVMB 3TNPC 2BM9A 4GKHA 5KUPA 2H96A 1MQBA 4DH8A 2G9XA 5H9BA 3VS1A 5L2TA 3NIZA 4GSBA 2ORED 5EFQA 5EZQA 3BGVA 3OHTA 2ZIEA 4O86A 4C34A 4G3DA 4DH1A 2C7QA 3IONA 4YUZA 4IB3A 4QNAA 3C4XA 3MV5A 3EMBA 3SKCA 4YLJA 3KQMA 4ATNA 5CUQA 1WXWA 5FQDC 4HGSA 1Q61A 3UVRA 1XXLA 1G60A 4DA4A 5AWMA 4IVCA 2BHEA 5FXQA 2PXCA 3R71A 5CASA 2UYQA 1U5QA 4G17A 2JITA 2RFEA 2BRBA 3GENA 3QL8A 3TV4A 1RJGA 3UBTA 4BYIA 4IX3A 3G88A 4C3RA 1RI1A 4RFMA 4RVLA 5C01A 4ER0A 3WZDA 4YC6A 5TKDA 4BDEA 4XYFA 4XS2A 4YLKA 4G1WA 3D4QA 3FUTA 3PWDA 4C4IA 1W0XC 5HO7A 4IX4A 1OL1A 2PT6A 3BU5A 3WOWA 1CKIA 1BHJA 5K0EA 4WBOA 3FEGA 3KPVA 3B2WA 4GC9A 5C0OE 1G55A 4TPTA 2ZWVA 4RIYB 3ZLSA 4ASDA 3PTGA 2ZMDA 4QDJA 1PXLA 3KPYA 3TEIA 4EJNA 2G2HA 1R1WA 5E8VA 2Z2WA 3ZSGA 5CF6A 5F2OA 5IH4A 4E5WA 4L7VA 1KIAA 3DU8A 5M51A 1UU8A 5DVRA 3QYWA 3QLFA 4J98A 4ASZA 5B1SA 3N4TA 4GT5A 4EJ7A 2PVRA 3NZ0A 4QYFA 3VBVA 4FG8A 3IW5A 3B3JA 5DG5A 3E7PA 5IF1A 2W4JA 2BZIB 2IDJA 3EVEA 3AT2A 4KBKA 4HYIA 4M12A 3EVAA 4O7RA 5IQCA 2A2AA 3KPWA 4FV0A 4E1ZA 3EEOA 3PVGA 4CRLA 2VTTA 1HNNA 3OF0A 4FA2A 5I0BA 3THRA 3U8WA 4PNEA 2GPHA 4FC0A 2G72A 1Y91A 4LM5A 5IA3A 2IG7A 4FZ7A 2FCAA 2XJ2A 5T67A 3VRZA 5IQBA 5K03A 4DBXA 2VDUE 5FA5A 4PMMA 4C4GA 1VIDA 4R6VA 1P39A 2R0IA 5DYJA 3WZEA 3HMNA 3JY9A 1M2PA 4BP3A 1O6LA 4N57A 2GHGA 5BVDA 4RLKA 5CAUA 3HVJA 2AC5A 5K0NA 3HNRA 1EJ6A 2GCDA 4OBPA 1X1BA 5CF8A 3VS3A 5EI6A 4F64A 4M8TA 4QVKA 3UPXA 2VV9A 4HNIA 1Y8CA 4HYUA 2ZIGA 3VS7A 3CJRA 2HZNA 2A19B 2Z02A 4J71A 2GQSA 2QNJA 5ICGA 3F82A 1CMKE 3TZMA 3TN8A 2QHNA 3DR5A 2P2IA 3EYGA 3LFEA 2VO7A 4V01A 3NTVA 1BYGA 5J1WA 2SRCA 3A7GA 4RIXB 4CTCA 4XG8A 2IN6A 4CKIA 2VTSA 2ZZMA 2R3FA 2XEZA 2X7GA 2QQ7A 4DF3A 1VYZA 3W10A 2F2UA 4AU8A 5I9XA 2JHCA 1BL6A 3FYJX 5IA4A 3V5TA 3GU5A 1PJZA 2IZSA 4M67A 4O0UA 4TWNA 4XBRA 3TIYA 2WXVA 4L7FA 3VUGA 2BUJA 3LXKA 3BQCA 2GNFA 3FKOA 3OCTA 3E93A 4EKIA 2WELA 2PJDA 2PVNA 3C4EA 3VC2A 1REKA 2QOOA 3KQPA 1J3HA 3LKZA 5EZSA 4JBVA 4TN6A 3UG1A 3FPFA 3CQWA 2XBJA 2GNJA 5M09A 3IQ7A 5E1SA 4YSMA 3R8MA 4N6YA 5D1NA 4DYMA 3BI6A 1KOBA 1SUSA 3QV2A 3FC1X 2YAKA 3U6JA 3MB6A 1NV9A 1ZARA 3HVKA 2ITWA 5GWXA 4NZWB 2CMHA 4ZXTA 4Y85A 3EMDA 4WNPA 1G38A 2ERCA 2XZSA 4JX3A 4BIEA 4BC6A 4U3ZA 5ICFA 4FIHA 5C4LA 1H1WA 2W5BA 3R8ZA 3VS2A 1DAYA 1F0QA 3DQXA 2VD5A 2WOTA 4RVKA 5IA5A 2VTNA 4ZY4A 3Q5IA 1FINA 2QHMA 1TPYA 3EH9A 5A6OA 3PS9A 4EHZA 4FI1A 3OBGA 4U5JA 5E8UA 1YF3A 3ZEPA 2ZBRA 2YIYA 2WQEA 4K33A 4RWZA 1G8SA 1NW7A 2JIVA 1UNHA 4PGGA 3DJ7A 2AYPA 3CSVA 2BVAA 4U7ZA 3QXPA 1TQMA 1ZGAA 4E2ZA 1VPTA 2NYUA 4DINA 4QMPA 1OKYA 3RAHA 2ZTHA 3R9XB 3EQDA 3P4KA 5T64A 2C5VA 2ZB0A 4YMGA 3VBWA 3NDIA 4FEUA 4I20A 3RAIA 5FTGA 4KINA 4JBOA 2QR8A 4U6RA 4G3GA 3VS0A 3OXTA 4JXJA 2YM3A 4FIIA 4JQEA 2IDKA 1PYXA 3RALA 3B3FA 4OT6A 4XG3A 2YJRA 2C0IA 5FA8A 3ZZWA 3FPHA 1DL5A 5DT4A 2ETMA 3FDNA 2WTIA 4M13A 5E1BA 3B8QA 3PJ3A 4DE4A 2PY6A 5EKUA 5DX8A 4W8DA 5CU0A 3F3VA 3G2PA 3FZOA 2Q83A 4UEUA 1OL7A 3D15A 3LCOA 4OGRA 5JSMA 2CSNA 2BZHB 5EQEA 4KSPA 5C27A 4RC3A 1YKRA 4NKSA 3WF7A 4H05A 3GCQA 3QKKA 3KULB 3O96A 5J9YA 3LFCA 4FSTA 5GIOE 3P08A 4V0GA 3A99A 3DKOA 1MJFA 3LCDA 4E31A 3O8PA 1NY3A 3NDJA 2R3OA 2CDZA 4FNXA 3ZM9A 5CS6A 3HA6A 5AIKA 3HCAA 3FWQA 3WE8A 4PIMA 4BCOA 5AP5A 5EMKA 3LFAA 4FX3A 3PP0A 5HTCA 4KIFA 4DT8A 4XLVA 5LQFA 4OQEA 3C1XA 5DM0A 2CLQA 4O0WA 4KAOA 3KRLA 4EH8A 2C47A 5KHXA 4GFOA 5J87A 2YCSA 5JMSA 4L67A 4V04A 5HTBA 4RZWA 1SVHA 4EWHA 4CXMA 3MVHA 2P8JA 4PCLA 3RK5A 4EMSA 2JDVA 1YHSA 5C8NA 2FA2A 1RJBA 1ZMVA 4HYHA 4HTFB 4M68A 5AA9A 1F3LA 1R0EA 3OPNA 2P4IA 1D2HA 3HVHA 3CBGA 2XK4A 3UGCA 4K9YA 2E9OA 5HG9A 4EYJA 2YXEA 1RJFA 2G01A 3IHTA 3C6MA 5EHIA 2XIYA 3NW5A 3BKXA 4F9YA 3RCDA 3BWCA 2N47A 1ZOHA 3OUNB 4FUYA 3QQHA 3VJOA 2C68A 3R7VA 4R7BA 4PIPA 2P1DA 3FMDA 2AN5A 1N7JA 1EG2A 3R00A 3ORLA 5D1HA 3Q5ZA 3Q52A 3LLAA 4PWYA 3OU6A 1L3BA 1PMNA 5CVUA 4MH7A 2FUMA 3DS6A 4MHAA 3BHUA 2VTOA 3FPMA 4TWPA 3PFQA 4AA5A 4MEDA 4DBNA 1B42A 2OSCA 5IEXA 4C4AA 1AV6A 3BYOA 3GEQA 3HMMA 4DGGA 2G70A 2BDJA 1ZRZA 5CANA 4EK6A 3KPJA 4MKCA 4C4FA 3UIBA 4AP7A 4IDTA 3IDCA 5C8MA 3T0IA 4U8ZA 1GY3A 5EG5A 3B3GA 4D1ZA 1LEZA 5EEHA 4AW2A 5HZNA 2UYOA 4CZTA 1AQ1A 4E8AA 2WFYA 3DXYA 1KYWA 4RA5A 4QVGA 3UJ6A 5BQ0A 1U46A 4RFYA 3RTPA 3UOLA 2OIQA 5HVYA 2R3QA 4M97A 5F1ZA 1Q3WA 3IW4A 2P41A 4EQZA 1KPIA 3OVVA 4BP1A 3MIAA 5IEYA 3D5VA 3HLLA 4KD1A 1OECA 3W2RA 5B2KA 4MIKA 4W4YA 4KIPA 4ZP5A 4GL9A 3MSSA 2QOFA 3P97A 5I5ZA 3R7EA 2EU9A 3W2SA 4B0GA 4X3FB 2GSFA 5E8TA 2GDOA 3GI3A 4YNEA 4BZDA 4HJOA 3EVDA 3FLZA 1XDZA 3OU7A 5FLFA 3FKNA 3P9JA 1OR8A 1H8FA 5HIBA 4QP6A 2HR1A 3SSNA 4B6LA 2C3LA 5DR2A 5LQKA 3OROA 2AOXA 1I4WA 2YQZA 4D58A 5CVVA 2IGTA 4ACDA 5CEMA 5EMJA 5IUGA 4XV9A 3VIDA 4FT2A 4BCIA 1NW3A 3K5UA 3FL5A 3TOSA 1ZYCA 3BLHA 4A07A 3MYGA 2QOQA 2EUFB 3PX2A 3IW8A 1N2XA 2GHLA 2W06A 4A7CA 1XVAA 3I0QA 4PMTA 3NWEA 4ANQA 5CEOA 3ET7A 1A48A 5F2KA 5EHYA 1YXUA 2IH4A 2XNBA 3GJYA 3DLCA 2VO3A 2HK5A 5CSVA 5L3AA 2YTZA 5EKNA 4E5BA 1WS6A 4O7WA 3V5QA 3FXZA 3DTWA 4E33A 4XV2A 4C2VA 4CV9A 5JGBA 1JKTA 2FK8A 5LCJA 3TZ9A 2ZYBA 4ITIA 4WD5A 4YJTA 2W9ZB 3Q4CA 3ACKA 4I5HA 4DAWA 2NNWB 3TIZA 3C5IA 2QODA 1RI4A 2W17A 3NNVA 3JUHA 2XNEA 3GBZA 4FTNA 4ANMA 2Z6UA 5C9ZA 1FVRA 3CTJA 1KE8A 2J0LA 4D4RA 4XG6A 4K0YA 4RTSA 3PUPA 3I5UA 4ASXA 4X3JA 3F6XA 2ITPA 3NSZA 1IY9A 2YCQA 4O7YA 2R3KA 2YM4A 2PVFA 3G6GA 4G9CA 4BI0A 3P1AA 5DSTA 1NVSA 4FKTA 5IH6A 4PYJA 4AOIA 4FL3A 3LBYA 1XKKA 2O65A 5LMBA 4DG3E 1Z9XA 2WHBA 3UJ8A 3EVCA 5AP6A 1YDTE 3JPVA 4HVGA 4BBFA 1XH5A 2RGPA 2IIPA 4ZS4A 3QRUA 5I9VA 5BPYA 4CZUA 2BFYA 3LMHA 3ITZA 3PVWA 3OWLA 3QOWA 3PVBA 4YZMA 1NW6A 4XBUA 2PKWA 3FTDA 1JAMA 5K0JA 1YXTA 3CY3A 3LMIA 3CD8A 1YWNA 5DN3A 4C7TA 1W8CA 4DQ0A 2RG6A 4A9SA 1DAWA 3DXNA 5KMIA 3RHKA 4ACGA 4YJRA 2QYOA 5IQDA 4KIGA 2G1TA 3FMKA 3R8PA 3HA7A 5AP7A 1REJA 2WTDA 2OBJA 4EBVA 3HEMA 3AGMA 1UU9A 3LXNA 3OD6X 1X1AA 2W1GA 3GXLA 5K5XA 5HE0A 3RKBA 5HNIX 3JY0A 4QQCA 3IGOA 3LFDA 5HO8A 3R9DA 5HICA 4QTDA 4XEYA 3V97A 3DDPA 5BYYA 2PVHA 4HZRA 4DZRA 3ZO1A 4QTBA 4DN5A 5ANDA 3RK7A 2HZ0A 4USEA 5M4UA 1U4DA 5DXJA 1VP9A 5AAFA 4RYLA 2BIKB 2QY6A 5B2LA 2BR4A 2PXAA 2V74B 3QF9A 4RBLA 4AGWA 5KX8A 3FPGA 1UFKA 4BCFA 2X7OA 3DB6A 4DA5A 2W1HA 2O5KA 4FT7A 4MWZA 3KXZA 3JXWA 2EB3A 4CMTA 3MPAA 3MERA 4BRXA 5IQEA 4O2PA 5IISA 3O50A 2VGPA 2VWZA 1IG1A 1XJDA 3KRJA 4YMHA 1UKIA 4X7QA 3ORZA 4M0ZA 3AGLA 1XDUA 4RIYA 5HCZA 4IFGA 1NVQA 3HAMA 3I5NA 5HD7A 3W2QA 1SKMA 4L7SA 4FSRA 4ORKA 2GU8A 2BALA 2QKRA 4G5JA 4OQDA 5FG8A 5KS2A 3EQGA 2UYHA 4YZCA 3DBCA 1SYKA 4DH3A 2REIA 2C0TA 2X2LA 1XHAA 3ATTA 3HNGA 1WBVA 3EPPA 1IA8A 3PXFA 2PWPA 3DK3A 4H3BA 4DT9A 4RC2A 3NYVA 4A06A 3FZSA 3BV2A 3V5PA 5LMAA 4F63A 4IANA 2W1ZA 5BYLA 2E2BA 2QCSA 4LMNA 4XP0A 1FGIA 1QAOA 4ENXA 3VHEA 3WYXA 3G6HA 3QTRA 5E8RA 3F69A 5BVEA 3QQLA 3FLQA 3KQYA 4TYHB 4R8SA 4ZOGA 5IDNA 2GH1A 2EJTA 4G6LA 4FG9A 4TWOA 3R7UA 5HD4A 3LCTA 4NTTA 3BE9A 4JIKA 4EHVA 4GT3A 4WA9A 4I5PA 3EGVA 3SSOA 4GVAA 2R9SA 4HGZA 5EYDA 3VBTA 3TXOA 4BI2A 4YBKA 1R00A 5DI1A 3F61A 5IA0A 3ZDUA 3HEGA 4FTQA 3LOKA 3TMAA 4I0RA 2HW7A 1ORIA 5DA3A 4IM0A 5T6KA 5CM2Z 3MGYA 2OXTA 5M06A 1WCCA 3BGPA 4EH5A 4A9TA 3TQSA 3ZBFA 4R3CA 5ETIA 3UIMA 1G6Q1 3H3CA 3ZO4A 2FGIA 4FSNA 4RIWB 4RIXA 2JKMA 2YDIA 4QYGA 5IDPA 3NVKI 3SR4A 4RTMA 4RG0A 3U6HA 3VUHA 5JK3A 4GYGA 2OGVA 4UWBA 4I0SA 2ZCJA 5LMKC 3BPRA 3QRIA 4IMYA 4Z2YA 3TCPA 1NKVA 3KR9A 2PXXA 2V7EA 1OITA 4CMUA 3ANXA 4X2GA 4FE2A 4FT4A 1UVRA 3GRUA 4GVJA 2GS9A 4XOYA 4I0TA 4RTLA 2PZIA 3QTUA 4X3FC 2AZTA 4PRJA 3RODA 1CKPA 3A62A 4BKJA 4IAZA 4QPPA 3UQGA 3W33A 4WOVA 5KMOA 1SZMA 3QGWA 2B1PA 2XNGA 4C0TA 1G8AA 3R7IA 1JSZA 4NCTC 2X2MA 3I81A 3IO7A 3S4QA 4CEGA 4Z3VA 3P9CA 4LQMA 2AR0A 4PDOA 5FEDA 1H07A 4RTNA 4CTKA 3FLYA 3DAEA 4ZTSA 5JFWA 2PZ5A 2J6MA 1M6YA 4D5HA 4EC8A 3KXHA 1R18A 5E8SA 5I9WA 3V6RA 2WMWA 5FXRA 5KCVA 3P71T 5BW5A 3FKLA 5FD2A 3MPTA 3DP7A 3LJ0A 3MJ2A 4C05A 5HG5A 3IOKA 4AUAA 4XCXA 4YUYA 4F65A 1M2RA 2XRWA 4EZ5A 2PGXA 4RJ8A 2NPQA 3NW9A 1G5SA 2F7ZE 3DY7A 5C9CA 4B7TA 2JAMA 4MD9E 1FBNA 4RWIA 5D11A 4BN1A 4KBAA 2WK1A 2XF0A 3EN4A 5KMKA 4QTUB 3B7PA 4XUFA 2VWWA 3I9FA 3WARA 5CXHA 4WHZA 4FKOA 3V51A 1G3NA 4WUNA 5L8KA 4PYKA 3F9NA 4EOPA 2I7QA 5K9IA 1L3CA 2YACA 2ITTA 4FTAA 5KE0A 5EVJA 3PE2A 3PA4A 3KKVA 2VWXA 2OJFE 4P7EA 4AG8A 2YWVA 4YMJA 3VSEA 2A14A 3Q96A 2YR0A 2FH9A 2UW3A 2BMCA 2QC6A 4DTKA 3NUUA 2JKOA 4BCHA 4YJUA 5AV3A 1L3IA 4NM3A 1S9JA 1OUYA 3TACA 3UYSA 4EKKA 5LVPA 2XK6A 3D94A 5DH3A 4BHZA 4TYJA 5AADA 2RKUA 4CFVA 3H9FA 1JPAA 2C30A 4PV0A 4ZMFA 4R1VA 3P7BA 3C6KA 3ALNA 1VR2A 3S3IA 2QRVB 2ZWAA 4WO5A 2RFSA 3HV5A 5DRDA 4PYQA 3FI8A 4GK4A 4EH9A 2ZSUA 2XMYA 1WAKA 4IFCA 4E6DA 4EH4A 3KULA 3QA8A 4QPNA 3HA3A 3KR1A 2GTNA 4GIIA 2XBAA 2ONYA 2BDWA 4EORA 1LUFA 5HZMA 3R1QA 1AQIA 5DM2A 4BDJA 4BDAA 2A27A 4JJRA 5LQUA 5C26A 4LOQA 5F9EA 2PSQA 4GK2A 3EJ1A 2PX8A 5AUTA 3PX3A 4OBWA 3MBLA 4ZJJA 3VW8A 4ER3A 4FVPA 3DOUA 4UZHA 2OY0A 5CU3A 3IW7A 5FDPA 1RI5A 1UA2A 5EQJB 4M15A 5J9ZA 4GCJA 3P23A 4YBJA 3TUCA 3LPMA 2BR3A 3FTEA 3GGFA 2PV0A 3TKUA 2J7TA 3SOCA 5CVGA 3TDVA 5DE2A 3FZTA 2CPKE 1LPUA 1H1DA 3NUPA 4HTFA 3KQTA 4EUTA 3LFBA 1YDSE 2PSSA 2HOGA 5CT0A 4Z55A 1JSXA 1EQAA 3THSA 3PXYA 3CJFA 3GC8A 3HV6A 4ZZOA 4O0TA 5DBXA 5A9UA 4K6ZA 2QO7A 3WIGA 5JQ5A 3CE3A 4IB5A 2BZGA 3DUWA 3ENHA 4XRLA 1BKXA 4ANBA 2XIKA 1URWA 3MGGA 5DIAA 3BYMA 4C59A 1Y8GA 3AC2A 5AV2A 2ZV9A 2OXYA 2WMSA 4KKGA 2QOIA 2ESMA 5HNBA 3VNTA 3DMGA 1Q0SA 2FHPA 3OT8A 5IQIA 3FJQE 3BLRA 5E1OA 2OICA 1Q41A 4FV8A 4M7RA 4L3PA 2ITZA 4PMPA 1XBAA 5IH5A 3SX0A 1V0BA 5HESA 2JIIA 4HVIA 2I0YA 4FL2A 4RX9A 1MRUA 2RL5A 3KXGA 2OU7A 3GC7A 3QA0A 2DUVA 3P7AA 4GW8A 3QCQA 4A9RA 3IGGA 4NFNA 3FHRA 4FKRA 4QMZA 4RVGA 2B9IA 2WTCA 4ARKA 3OOMA 1IR3A 5T6BA 3SXJA 4FTRA 1YHVA 3ROCA 5M5BA 3B2TA 3VVHA 3GCVA 4MBJA 4M3QA 3UIUA 4YTCA 1NBHA 7MHTA 1U2ZA 2VWBA 4EEVA 3G2FA 3POZA 1H27A 3BZBA 3M42A 4IACA 3UNZA 4FZDB 1H28A 2J51A 3EHAA 5H8GA 3AXSA 4G34A 2W5AA 2X1NA 2XK9A 1D2GA 3SG9A 3ETAA 1PMUA 3HCBA 3LDFA 3UWPA 2R3PA 3DDQA 1J1BA 5IG1A 5D9HA 3SG8A 4MQ4A 2B55A 3AG9A 3GU3A 4D9UA 1A06A 1RW8A 1F38A 1FOTA 3G51A 5EGSA 3G0EA 3E5AA 4X3FA 3HCCA 2FRXA 4C36A 5EOVA 3MVJA 3CQUA 3T7SA 3TFWA 4NSTA 3L8VA 2QLQA 3CC6A 1KP9A 5DFPA 2YCRA 3R04A 2C7OA 3PZEA 3A7DA 1MHTA 5IPJA 5FTOA 2YDKA 5M4IA 2IW9A 1SQGA 3W8QA 3ZUVA 5KHWA 3JVRA 3NLBA 4QYEA 4NCTA 2C0OA 2UYCA 4DGOA 3JWHA 2RIOA 3MDYA 1PJKA 3DV3A 3FTFA 3E8NA 4AUKA 3PIYA 5ANKA 5IA2A 2ZIFA 4FSMA 4S31A 3BU3A 1JLUE 5CF4A 2GS2A 4C4EA 2VTHA 5JFVA 3SRVB 1OKZA 3CKKA 3K54A 4HGYA 1NW1A 2VX1A 2PMLX 5HVJA 3KN5A 2OW3A 2IH2A 2OZAA 2YX1A 4IX6A 4D5KA 3R9RA 3KQOA 5K0BA 2UVYA 3O51A 1V39A 2QVSE 4PNIA 2JBOA 3R83A 5FULA 5CXZA 3UOHA 2IH5A 4R8RA 3DKCA 3HV4A 2NXCA 1JG1A 3DXZA 5CU2A 4ASEA 1TW2A 2W99B 4DCMA 3F5PA 2FSLX 1TQIA 2X9EA 5FWDA 3W2OA 5GJDA 4IVBA 3TKAA 4F86A 4EKGA 3QYZA 3P2EA 2BRMA 1QPJA 4AOTA 1QPEA 5EG3A 4M36A 1RJEA 5M44A 1JKKA 2XNMA 4EOQA 1YRPA 2YISA 4PL4A 5HX8A 4UN0C 3EGEA 4P7FA 1M6EX 4JS8A 2ZM3A 4MNEB 3ORMA 3DXXA 2X2KA 5E1MA 3BU6A 3Q6UA 3FMJA 3OT3A 5LARA 5CAPA 5CNOA 4FIEA 2JD5A 4OTIA 4YUQA 3I0OA 4GG5A 3GRZA 2HY0A 4MQ2A 1APME 2VU3A 3ZM4A 4JT3A 2QURA 3F3WA 1JBPE 2C5YA 2ZZKA 2Y9QA 1OGUA 4ID7A 2UW4A 5F4NA 5AV0A 4O0XA 3I6WA 5CSPA 5HI2A 3KN6A 2VTLA 3BEAA 1Q8UA 4QMVA 1L3RE 4RGJA 2JG3A 2GB4A 4YJSA 3KQ7A 3CIKA 2J5EA 3TV6A 4I5MA 4RX7A 5HU3A 1FMOE 3TTIA 2OF2A 4PMSA 3EVBA 2VO6A 2RG5A 3CQEA 4P4CA 3PSDA 1PXOA 3M33A 2Y4IC 4U7TB 1R74A 4JR3A 8MHTA 4KS7A 5ACBC 2ONLC 3F2NA 5CY3A 4AN2A 5E8ZA 5EYKA 3ZEWA 5BVNA 2IVVA 1OIUA 2HYYA 5U4XA 5A3XA 2OH0E 4UXLA 4AZVA 1H25A 2XK8A 2GS6A 4B8MA 2P35A 4L43A 1H00A 4U80A 3HL7A 3CC8A 4XJ0A 3L9PA 3G2QA 1ZQ9A 1YWVA 4G5PA 4M38A 3C5UA 3ELJA 1Q8YA 3PJ8A 3OS3A 5FHRA 4PYMA 3FRIA 1ZYJA 5AAEA 4IJPA 3MH1A 1FPQA 1QPDA 1BKYA 4QTCA 3NUXA 2FSMX 5M57A 4FR4A 4NIFB 3IG7A 4F6UA 4PCAA 2H8HA 4U0IA 4AGDA 4OUCA 2EWAA 3UO5A 4L01A 3UFBA 3F66A 5J8IA 4R1YA 4EYMA 3TNQB 4AZEA 3A4PA 4Y5QA 3FY2A 2O3PA 5D12A 1RI3A 4I6HA 5E8WA 2AN3A 3KRWA 5KBRA 3ULZA 3A2CA 2Q0BA 3ZYAA 4MBLA 1XO2B 3G5DA 5KMLA 1FQ1B 4XCUA 5I9ZA 2YIWA 4ZAUA 1DUSA 4DFLA 1NVRA 3T3VA 4JX7A 3MH0A 3ANQA 1O9UA 1ZYDA 5E7RA 3GXOA 5AM7A 3C4WA 2B78A 1R0PA 2PUNA 1W98A 4AX8A 5HBHA 4S30A 2NXEA 4ZY6A 3ZRKA 4EZ7A 2XIRA 3TR6A 5HBEA 3EOCA 5J95A 4YO4A 3O7WA 2YIXA 5CWZA 4MAOA 2OIDA 3IK3A 1LEWA 1X8BA 4LV8A 3EIDA 3RI1A 2B3TA 4IWPA 3GRVA 3E8DA 4PUZA 3PJCA 5ANOA 1Q8ZA 1WZNA 4DTAA 3M6WA 3IPHA 4HVDA 4I92A 2GA9A 3H9RA 4BGHA 3K2LA 3M6XA 4RX8A 5DRYA 4CFWA 1BX6A 2OKRA 4NU1A 3SLSA 4AGUA 2C6EA 3KR2A 1OKWA 5JRQA 3PG3A 4F6WA 3ER8A 4Y73A 1QL6A 4FV1A 3C0IA 4IWOA 2BFXA 3HKOA 3RM6A 1OIQA 3EQRA 5FTQA 5GHVA 3LHDA 1Z3CA 2WMVA 3FQHA 3FBVA 2OB2A 3KF7A 3I5ZA 5ERGB 4GKIA 5LXMA 4C2WA 2JHPA 4U44A 1QYRA 3OU2A 3ANRA 4QMTA 3F7WA 5B7VA 3DFCB 4TYHA 2PZRA 1ZKDA 5CAVA 3HECA 2PMOX 1YI3A 2J0JA 5EMLA 2YFXA 4C4HA 4HGEA 4FL1A 4FKUA 4E4LA 2R3IA 2IBSA 4QPAA 3I58A 3DOGA 3GCPA 3PXZA 3IKAA 4KA3A 5FEEA 4E4MA 3BHHA 3L8PA 4XHKB 2O06A 1OVEA 4QT1A 2CN8A 4FV6A 3B5IA 4KSQA 2H6DA 2WMRA 3R6TA 3UIXA 3PWYA 3ZO3A 3VN9A 1HCLA 1T43A 1D2CA 3TNHA 2B4SB 3Q2MA 3NWBA 2YN8A 4PP9A 5IMXA 2XNNA 4O7LA 4XX9A 3ZDIA 5LWNA 1ZY4A 3O7LD 3ODZX 3UDBA 1X19A 4FOBA 2BR1A 2I7CA 1ZLTA 2P2HA 1NW8A 3DMFA 4P7KA 5BVWA 4HC4A 1JKSA 4N6ZA 4CV8A 2DS1A 1ZOEA 3ELDA 3T9TA 4ONAA 4DEEA 4QYHA 3U87A 4AE6A 3EFJA 3BX5A 5EM7A 3QHWA 1UU7A 2CGXA 4F1OA 1P4FA 2R4BA 2HXQA 4WG4A 4YNOA 4IAFA 2IVTA 4ZTNA 2XIZA 3DJ6A 4Z9LA 3CEKA 3MB5A 4IZ7A 3EYHA 4N70A 4BF2A 1WMKA 3MVMA 2EFJA 1YZHA 4F84A 3PVCA 4I6BA 1U54B 4PDPA 1WBSA 3RAWA 4RJ7A 4CFUA 3RGFA 1SQFA 1OB3A 5BX0A 5DM1A 2P0CA 3UO6A 3SD0A 3OE4A 5LCKA 3FZRA 4JAIA 2W7XA 2G15A 4NECA 2IFTA 5H2UA 4GJ3A 4OTDA 3UJ9A 2QOHA 4NJDA 2UZWE 5E92A 3U81A 2PX2A 2H9VA 3G9NA 4C04A 2VTQA 2C1BA 1OPLA 4FIFA 5C03A 2UZLA 3DKGA 4O38A 2YM5A 4RIOA 2R3SA 2C6LA 4RT7A 4XUCA 4HPUE 2GNLA 2XYRA 2Z6AA 2P7IA 4P58A 3PT9A 4ALWA 2IWIA 2QU6A 4MCVA 3THBA 1IASA 3COMA 2R6ZA 3VBQA 3K5VA 4L52A 2W9FB 2ONLA 3UJAA 2ZLBA 1WVWA 2YJSA 2YA9A 3PTAA 3VUKA 5HU9A 4FV9A 4MNFA 3W1FA 5H8EA 5BUJA 5F2NA 2NP7A 3KFAA 3AT4A 2P3OA 1HMYA 1JSTA 4D0WA 5DWQA 4P7JA 2ERZE 3VBXA 4ZSEA 4YP8A 3KXXA 3R2BA 4L42A 4R7IA 5CAOA 2VX3A 3WF8A 1QCFA 1TQPA 3LPBA 4AZTA 4QPSA 3FHIA 2JDTA 4M7IA 3MH2A 4XLIA 3NGAA 5CX9A 2R3RA 2ONZA 3VBYA 3DAKA 3LE6A 4D0XA 4MWIA 4J52A 4U9AA 3BGQA 4YHJA 3LCKA 4P90A 3AT3A 1M7QA 5IMEA 5BW4A 1CDKA 5CQUA 1OZ1A 3TRKA 2VWUA 3HDMA 2VNWA 5EDQA 4NL0A 5EW8A 3K3JA 1ERKA 5EM6A 4FSUA 3HCDA 2PMNX 1S9IA 1R8YA 3U4UA 2QRVA 4E70A 3NRMA 4LRJA 3OW4A 3EL7A 4BGQA 2GQRA 3V8WA 1J7IA 2P55A 2VP3A 4Y8DA 4B8LA 4YV1A 2W1EA 4K6MA 2WMBA 5AIRA 4L00A 1EIZA 1BOOA 3BWMA 2K4MA 4XNEA 5M07A 4E5AX 4BDIA 5D10A 3FPJA 4L6QA 3MFRA 4XV3A 2BKKA 4GMYA 3M1SA 3DKFA 4XRJA 2ZBQA 4ZMEA 4KRGA 3KMWA 1KPGA 1Y57A 4RJ5A 2HZ4A 1NXKA 1WFCA 4CWAA 1YXSA 3NYNA 4U43A 1SVUA 4L8MA 1XH9A 2KULA 1ZGJA 4FTIA 4ITJA 3IW6A 2UW7A 4QTEA 4QP1A 5HE1A 2E5WA 4K2RA 2YM8A 3LECA 5ANEA 5HG7A 1NE2A 3KF4A 1BI8A 5DLSA 4FTOA 3PY1A 4O6EA 3B89A 3GOKA 3FQEA 3GU4A 2UZNA 5DRTA 2UZBA 4ZS0A 4BCJA 3R7YA 3F4KA 3ZSHA 4LOOA 4LUEA 4M37A 4JNWA 3HP7A 4DKJA 5LVLA 4RVFA 3EVGA 1Y8YA 3COKA 3CP9A 4K18A 4RTPA 4M84A 2W1FA 4G3CA 4AW1A 3GC0A 3TUBA 4DFNA 4DM3A 4G16A 3VQHA 1FVVA 3E23A 1UWHA 2ITXA 2G8NA 3FRHA 4LUDA 4YC3A 1AQJA 5LWMA 3ZH8A 5ETAA 3NX8A 5E9JA 3OFKA 5M08A 1BLXA 4FTCA 4BDBA 2PPQA 4CG8A 3R28A 2YIRA 2XKDA 2GNGA 4HGTA 3DXPA 4KNBA 3MTEA 2OXDA 4KWCA 5G02A 4U3YA 2I0VA 3TNWA 1M52A 4LRMA 2VX0A 3KC3A 1BL7A 5KMJA 2VNYA 3ZRMA 4E4XA 4EH3A 3QQGA 1PMEA 4F85A 1P2AA 4LV5A 4XH6A 4A6EA 1OM1A 3RMFA 2VTMA 5HCYA 4GOLD 3R02A 3GOPA 3Q32A 5CU4A 5HEZA 4I6QA 3OMVA 4BDHA 3EVZA 4RJ6A 3QD0A 4FEQA 4HZSA 3LW0A 3LSTA 2YERA 3BKWA 5ANJA 3UOJA 1UIRA 1F5QA 4O84A 2V7AA 3UJ7A 3FV8A 4BDKA 4PNKA 4JG7A 4FV7A 4ERKA 4J97A 4QOXA 4DH5A 3PXQA 3JVSA 3NUAA 3CGOA 3LCSA 3SMQA 4DTBA 2A0CX 1ATPE 3HMOA 1ZAOA 4FSZA 4X61A 3EB0A 5A14A 2Y8OA 3MH3A 4BCPA 3DPKA 5HOQA 5FGKA 4DGMA 1YXVA 3EMGA 4DG2E 3X0DA 4R5YA 2H34A 3LKMA 4AFJA 3TKYA 3S0OA 3R7OA 3BGZA 4U40A 4C3PA 4AAAA 2VGOA 4BCNA 4XG9A 4EZ3A 4H1JA 2HWKA 4G56A 4E93A 4L3JA 2CLXA 4V05A 3LCUA 3SRVA 4HPTE 3R9OA 3CCFA 2DWBA 3K3IA 1Q5KA 2QU5A 5DM4A 4YZ9A 4EH7A 5E2BA 3WBLA 5EMMA 2J9MA 4MTLA 3OG7A 4HNFA 4S33A 4ZY5A 1OIYA 1XJ5A 1O54A 4KDCA 3D5XA 3TNIA 3RAKA 2CKEA 3TTJA 2W1DA 3D14A 2QO9A 1VEBA 2YEXA 4JVGA 3SGCA 1BI7A 2X6EA 1HCKA 4MQ1A 4FKLA 4EUUA 4NFMA 2PHKA 3LFNA 5K3YA 2XCHA 4O96A 3QTXA 1BUHA 1XH6A 4I5CA 3TUDA 4FKGA 2C3JA 2KTYA 1Z57A 2HNKA 4MNEA 4D4YA 3TT0A 2RF9A 2PY3A 5BUIA 1QANA 5EW3A 3UC4A 2BCJA 1YB2A 4C08A 2F7EE 2FB8A 5CCBA 3C51A 4J96A 2XKFA 5JUWA 4FV4A 1IRKA 2WTWA 1XCJA 4D28A 3NW6A 1EAMA 4FK6A 3F3ZA 2OZVA 3PE1A 2WIPA 4FSQA 3FQSA 1PHKA 3ZMMA 3Q4ZA 3FE3A 3V5WA 3D2IA 4IWQA 2AOUB 4FTLA 4TY1A 4RTKA 3GQIA 1RQQA 3ZUUA 4RRVA 3FI2A 4OTWA 5KO1A 3C7QA 4I21A 2IVUA 3IOPA 1V0PA 4F1TA 5DGZA 4MXXA 3DLZA 2GAFA 3GRRA 2Z6QA 2ESRA 3HVCA 2B7AA 2PVLA 4F08A 3ERKA 4AT3A 4IWNA 5KZ0A 3COIA 3QZFA 4LWOA 3NYXA 3OCJA 4V0RA 1STCE 3REPA 4DEAA 2UW5A 3TWJA 1AGWA 4DGNA 3C3PA 4B9DA 4GU9A 4TYIA 4I93A 3M6UA 3DTNA 4BR3A 4UOEA 5BXYA 5LQCA 2B9JA 1WBWA 4ZSLA 3UZRA 4RWLA 2ZW9A 3AY0A 4I4FA 2J90A 2Z7SA 1YOLA 1RDQE 4CT2A 3OXZA 4LGGA 4O7NA 3L8XA 2IO6A 3FMMA 5EM5A 2NO3A 5L8JA 4RVHA 5EH0A 2FSTX 3NDMA 4BHNA 3O8UA 4YZNA 1YDRE 3CKXA 5JGDA 1GOLA 3LJ2A 3LKDA 1N7IA 5A4TA 3U55A 4ZLYA 4DC2A 2ZBPA 5GOZA 2EX4A 2R5TA 4DEBA 4JXFA 4QRCA 2R3HA 3JS2A 4AZWA 4HYSA 4CSVA 2YITA 4LYNA 3UP7A 2UW9A 3HDNA 4CT1A 5C1IA 4TZRA 2BHHA 3VQUA 3E8EA 1JKLA 3HZTA 4JDKA 3G90X 3UMWA 4AT5A 4K1BA 4YUXA 4MF1A 4AGCA 4AW5A 2HCKA 3PZHA 3OZRA 1XH8A 3SC1A 10MHA 2JAVA 2O2UA 3NYOA 1IEPA 3CCNA 2JHAA 2ZB1A 1OMWA 3MCTA 2WMUA 5M55A 5DSXA 4B99A 3NMUF 3W55A 3HA8A 2R3GA 3HVIA 3QUEA 1WZYA 4FKJA 4BVUA 5FUBA 4A6DA 1IXKA 5AUWA 3PDTA 5HILA 3EQPA 3FUPA 2VAGA 3GB2A 3HCEA 3LQ5A 3I6UA 5DX1A 4XUEA 3MFUA 4A9YA 4XUDA 4AZFA 4FBXA 1GZNA 3EZRA 4IM3A 3VS5A 4U81A 2ZDTA 2X39A 5AMNA 4YPSA 5HIDA 4MXCA 3QCSA 3C50A 3NPCA 3E3PA 3BKBA 1PRYA 4MD7E 4JAJA 3BHTA 5A4CA 3ORPA 2XH5A 2XRUA 3DULA 3KXMA 1AF7A 1H0WA 4WNOA 3F88A 3H10A 3OBJA 4OW8A 4F9WA 2PTKA 2OO3A 3PPZA 4JI9A 1FGKA 4UBAA 2PE1A 4E2YA 2ZOQA 4FTMA 4O2ZA 2QOLA 5CVDA 3II5A 5FQOA 3WF6A 2FYTA 3FTCA 3P0MA 4PYNA 3DK6A 4PP7A 2BTSA 4OTRA 2CCIA 4X0MA 2PX5A 5M53A 3MIYA 3QQUA 4UWCA 4EBWA 3BLQA 1ZYSA 2LD4A 5JH6A 4YJVA 2PE0A 2I1MA 3N4VA 3V5JA 4EOOA 1J7UA 1VQ1A 5M56A 5AP2A 4YJQA 3UJDA 4W8EA 4MX9A 4XG4A 1SG9A 1PXPA 2VRXA 3ID6C 5HIMA 3OXIA 3QD3A 3AC3A 4HRAA 3QWJA 3R8UA 4E20A 1KUTA 3FMEA 1KE6A 5AUYA 4GG7A 2V62A 3E62A 4YHTA 4QP7A 2BIYA 2BZJA 4RZVA 4FSWA 3EKKA 1I9GA 2HAKA 2DULA 4R5SA 4II5A 1M14A 4QP9A 3C4ZA 3R73A 2OZAB 4JG6A 2WTKB 3VO3A 3EL8A 3COHA 3KVXA 3MPMA 2OO8X 4B4LA 2V22A 4FIGA 3FZGA 2Z60A 1FVTA 4M69B 2PLWA 3CVOA 2VN9A 4UX9A 2O64A 4GF5A 4RX5A 3M4XA 1O6KA 3H0YA 3A7JA 4AF3A 2HV9A 1SUIA 4PGHA 2C6DA 1A9UA 5ETFA 5CNNA 3NEWA 4LGHA 1PF8A 3A7IA 3PIZA 2GFCA 5E2AA 4EOKA 3BWBA 3FMNA 4CMOA 3LCCA 4FEWA 5HORA 5CALA 4O0SA 5E9WA 3LCVB 2BAJA 2O0LA 4FKPA 4OT5A 3PSCA 4QQJA 4RSSA 5CF5A 5EPEA 4BICA 2WAJA 4YPDA 2ACXA 1JSUA 4HVHA 5E8JA 3BV3A 3CS9A 2QD9A 5E91A 5CVEA 1X1CA 3A8WA 3CJGA 2PVYA 3DBQA 2IZUA 4TL0A 3MW1A 2XBMA 2P3QA 3KVWA 4P7GA 4A4OA 3IECA 5HX6A 1U54A 3O7LB 1Q62A 4GEKA 1F3MC 3C3YA 3TLJA 4FKWA 5HLNA 3PRIA 3S95A 5CI7A 1UWVA 4Y83A 1E9HA 2YCFA 4AFEA 5JT2A 4OX9Y 4BTFA 5EOBA 2UZOA 2WU6A 4Q5HA 4R78A 4KS8A 4YHFA 4RA4A 3MHTA 1FPUA 3QTZA 1P5EA 2XJ0A 1W82A 4LMUA 3VHKA 1ZWSA 4DFUA 4GYIA 4X2FA 4JBPA 3ELUA 3AC4A 1XH4A 2CGWA 4WRSA 2OKCA 3CXWA 4GQBA 1E1XA 2HWOA 3GNLA 5KKRB 4X6QC 2HMYB 4DITA 4ZTMA 1ZHFA 3ODYX 3TZ8A 4EH6A 5M4CA 4RQKA 4C37A 3S2PA 2QOBA 2RFDA 3V3VA 4QMUA 3UJCA 3UODA 3M2WA 3PPKA 2YXLA 5FADA 4X41A 4APCA 3BWJA 2XNOA 1WY7A 3VAPA 2JJQA 5HIIA 2X7FA 4CCBA 5IA1A 4CCUA 2XK3A 2X8DA 4R3PA 5TOZA 1JOWB 2CKQA 2PZYA 4KABA 4H36A 4AN3A 4ER6A 2V5QA 4OA5A 3SXFA 3OZSA 2BRNA 3LFSA 4EI4A 3FUUA 4QMYA 4IIRA 4WKQA 2JH9A 3DQWA 5AM6A 2GNIA 4FNWA 3GC9A 2P3LA 2Z7RA 3SOAA 4YJNA 2VWIA 4A4LA 1OL6A 1UV5A 4RMZA 5BUEA 5CEQA 3R3HA 4P5ZA 1ND4A 3Q87B 3RM7A 4TYEA 4CRSA 2WMTA 1JNKA 5LQRA 3CKWA 1DI9A 5D7AA 4E73A 4OTHA 4Z16A 1WVYA 3IDPA 3WF9A 3A4OX 1GNGA 5FWAA 5JGAA 3GP0A 4NTSA 3HP5A 1YZ3A 3PVUA 5CQWA 3KCKA 2WGJA 4F4PA 4D4SA 5K8VA 3WYYA 4QYYA 5KVAA 4LG1A 5EK7A 5L6OA 2C7RA 2BRHA 4YUVA 1QPCA 4FVQA 2CNUA 4RPVA 4AACA 2AN4A 4WRGA 1KR5A 3QLGA 3BELA 3W32A 5IUHA 4EC9A 2IZTA 5FUTA 1YWRA 4S2ZA 3NNXA 2H1RA 5TT7A 2CCHA 3VC4A 3QTSA 3NAYA 2NRUA 4HCTA 2I6LA 2AOVA 3IS5A 3O4FA 2XM8A 3O31A 2ITVA 3A4TA 3TM5A 2FPOA 2PL0A 4BLVA 3REOA 4C35A 3KMUA 3ZC5A 2W5HA 3N51A 3KMMA 4IE9A 3G33A 5EI2A 5DT2A 4LG4A 1K9AA 3N9XA 3O8TA 2WPAA 3DBEA 4FTKA 4TKSA 3LFFA 4EOSA 1E1VA 3HAVA 4D2RA 3UZPA 3CGGA 3R0QA 5IQFA 2ZMCA 3NS9A 3GT8A 4FT3A 4EOLA 2HIWA 4FMQA 2CJMA 4G2FA 4IV0A 2GQGA 4FV2A 5DR9A 3TM0A 3TZ7A 1P1CA 4P5QA 4UB7A 1RJDA 3EFWA 4KKEA 1NW5A 5ICEA 2UZTA 4IX5A 1VE3A 4D1SA 4OTFA 4CLIA 4APPA 4FKSA 3HMIA 4ANSA 4TT7A 3BCEA 2PUIA 3GFWA 3BUSA 3L9NA 5FM3A 3T3UA 4YJOA 4LFIA 1B38A 5I9UA 3AC8A 5B2MA 2QI8A 3KL8A 4LOPA 3QQFA 3MA6A 4DFBA 4FKQA 4ZTRA 3FUVA 5HHWA 2XYQA 3ACJA 3UNKA 3R9HA 3Q9WA 1T45A 4R3RA 3P7CA 5E8YA 1JQ3A 3BHYA 4X2JA 2PU8A 3GU6A 4BCKA 5HE3A 4XV1A 1ZMWA 1NBIA 4Z7HA 3K0BA 5CZIA 4Y2HA 3F2AA 3TV7A 5D41A 5K0GA 3UOKA 2OK1A 4O0YA 4QP8A 3LQ3A 3U4WA 4RTOA 4FTUA 2JC6A 3QTIA 3LZBA 1VL5A 2C6KA 3DMHA 4IWDA 1PKDA 1R6AA 3SVVA 5AFVA 1VZOA 3KXNA 3Q53A 1YQJA 2ZVJA 4N4SA 2WD1A 3NR9A 4LRKA 1WG8A 3LX6A 1EJ0A 1LP4A 3E05A 4YLLA 4C3FA 3H30A 2I0HA 1UU3A 5LVNA 4E32A 3UNJA 4QQNA 4PDSA 3EN6A 5DTRA 3RPVA 4WVLA 3BWFA 3PYYA 4JRVA 3FLSA 2FYSA 3JR1A 2WTKC 5C4KA 3SW4A 2C4GA 4G9RA 3FUXA 2UW0A 3RWQA 1UWJA 4TWCA 2NXJA 4GS6A 2F7XE 4YGAA 1XH7A 4B17A 4FEXA 2XIXA 2OWBA 5K05A 1Y6BA 3I7BA 5CSHA 5EKOA 4IAKA 5DNRA 4OR5A 3BIZA 1GIIA 5BNJA 3V8VA 2Y4IB 4CXAA 5I4NA 3ELYA 3QCYA 2B52A 2PX4A 5BMSA 1JG3A 2EG5A 4YUWA 4GUAA 3FAAA 1WBPA 4JL9A 5CENA 4ALUA 4BY9E 3CPCA 3S00A 2A1AB 2YUIA 4PYOA 2H11A 2AOWA 2P3GX 3DB8A 4E7WA 3ZO2A 4CVAA 3H0ZA 4IAIA 2QONA 3C0GA 3ZRLA 2WTJA 3CLYA 4BDGA 4WG5A 4X2NA 3BHVA 1TVOA 5ETCA 1J1CA 5EOLA 3O2MA 2GS7A 4CLJA 4E6CA 1SNUA 4HW7A 4FP9A 4ZTBA 4L53A 1O6YA 4IQ6A 4MK0A 5F94A 1CM8A 5HGIA 4F0GA 4FICA 2WMXA 3V6SA 1OBDA 4IAAA 1XWSA 4L9IA 5E9EA 3Q60A 4IKPA 4RV9A 1MP8A 1P91A 4BB4A 4Y5HA 4IJ9A 4ER7A 3IEIA 4JR7A 2WQNA 3VS6A 2EVAA 2XYNA 4CNHA 2PYWA 3VUDA 4G6NA 4HGLA 1YFLA 2AOUA 3V8TA 4EL9A 5BMMA 5CYIA 4BLUA 2OZOA 5F20A 4O7TA 2LGCA 4RTQA 4IC7A 4C4JA 3U6IA 3BGIA 4XG7A 3E63A 5HFJA 3OWJA 3R1YA 4MWHA 4PINA 4F1MA 4EOMA 3GIWA 3LXLA 2PVCA 3AOXA 3MFTA 2Q0NA 3U9CA 4CFMA 3QRJA 2XYVA 3UBDA 5F95A 1ZY5A 2OH4A 2W4KA 3ZBXA 5AUXA 3Q6WA 5CTPA 5KKRC 3GUBA 4CD0A 3U9NA 2P40A 3JYAA 2QR7A 3OZTA 3GWZA 3KK8A 4NH1A 2XS0A 5KMNA 1FP1D 4DCGA 3AQVA 5AX9A 5FTWA 4XG2A 1DM2A 4YTHA 5HBJA 2WEVA 4C06A 4C58A 4F7LA 1GIJA 3G89A 4TYGA 2HXLA 2C69A 4FK3A 2ETKA 1I09A 4BYJA 3FI4A 3AC1A 3QKLA 2PUUA 4AXAA 4AOJA 3AXTA 3H2BA 4DGLC 2XNPA 2AUHA 1DS5A 4AWIA 4KUJA 2F9GA 4X60A 3ORHA 4RLLA 5CVJA 4K77A 3BEGA 4C03A 3DFAA 3Q9XA 4YZDA 4EK8A 3GU7A 2F49A 4KIOA 2NRYA 4IM2A 1ZG3A 1W84A 2BTRA 1YVJA 4F0FA 4MTAA 3EQFA 4QQ5A 4BBEA 2BRGA 4YU2A 3KQSA 2ZV2A 5E1DA 2AC3A 4TRLA 3AD5A 4M14A 2OJ9A 4IHPA 4FNYA 4EQCA 3DAJA 4YV2A 4Q9ZA 2X8EA 4IBMA 3UA3A 5DLYA 3AD4A 5J7HA 3D7TA 3UMXA
chains in the Genus database with same CATH superfamily
2QHXA 5IAGA 3BRSA 4EOJA 3U62A 3TM4A 2ODPA 2YJ4A 2B2CA 3ZC6A 3P94A 1DX4A 3EN7A 3M6AA 3IYLW 5TMPA 1H6BA 1ZD9A 5CDTA 3OE5A 4GW3A 1WY5A 5D84A 2VJNA 4JOAA 1QAQA 1HR0B 4YMIA 4RDHA 3Q3HA 4TYMA 2IOHA 1YXXA 4ZPJA 5IHPA 3RJZA 3N2NA 5EE5B 1I1NA 2JLQA 4OUDB 4L0DA 1NIJA 1UMCB 4V0QA 2QBYA 3B5JA 3IDQA 5MF6A 4B2PA 4DEIA 5CITA 5EPOA 2OXCA 4QDKA 4E3WA 4B3HA 3I4CA 3K9HA 3ESDA 4NEQA 3VO2A 2BMAA 3DZGA 4JD5A 2PMEA 1USWA 2XT0A 2UV8A 3GCUA 5FM2A 2J2IB 5AW0A 3K2IA 3TTXA 5EJAA 2P6MA 2VXOA 3GBVA 1D09A 5LMKA 2WFAA 2C9YA 3U4HA 2PH3A 3D5WA 2DSNA 3PA5A 1ZK2A 4OY3A 4EKLA 5A4FS 4ZT3A 3AD6A 2H1OA 2EX0A 3IOMA 3K8ZA 3MIZA 3G68A 3B1FA 5DPVA 5HQ0A 2W4OA 3S29A 2XA9A 1ZN9A 3A6PC 3M89A 5AKEA 3L3BA 1U1GA 5HQTA 3SYMA 4DA7A 3NGXA 1NHWA 3BORA 8ABPA 4GIHA 3PXUA 4ZJIA 3C3MA 1YOVB 4NM0A 4BFSA 2D8AA 3FJ1A 3M82A 1U90A 5EYPA 1U0RA 3I6MA 1SNXA 3EEQA 4N5LA 3QHAA 4A9UA 1RHJA 3W8RA 1K66A 3HC7A 3GP5A 3PZRA 4QXPA 4R9SA 1VPEA 1EWYA 2C4UA 4Z99A 4C14A 1Z9BA 4TW9A 1JHPA 5T4FA 1DC8A 5CM8B 4CEJA 3R0ZA 4CTJA 4QGGA 4ZK6A 5CAQA 3TRIA 1V25A 3L1KA 4PQNA 2OFWA 4LE2A 1GUFA 1R50A 4HS9A 2LW7A 3JVVA 4TT3A 2GKOA 4Q4HA 4F9BA 4YRJA 3CR3C 2XUZA 3NFRA 4MD8E 3FUCA 1HDXA 3CO0S 4IFEA 1C3LA 1WNTA 3FIJA 1VJTA 4TN5A 1U2RA 4HP8A 3RJMA 1B2LA 2QLUA 4XWGA 2VAWA 3PFHA 3TB4A 5H70A 3GLFE 6Q21A 5JBNA 1YR6A 1I1OA 4CMBA 2W22A 3VDRA 4ER5A 3EA5A 3LDUA 2GERA 1UM8A 3KZCA 2E9NA 1RC0A 2BP7A 2YIQA 5FNVB 5GPBA 3PCXA 3BWYA 1IY0A 4DLJA 4OJQA 1K27A 1BN7A 3ABOB 4CPDA 1C0IA 2X6QA 4WADA 2VDKB 2RHBA 1ODCA 1PR6A 2NZXA 2XVDA 3LL7A 3MJCA 4TXCA 1L4BA 4XOZA 3QQJA 4Y2TA 2AQHA 4MXYA 1Y8ZA 2DM6A 3AHJA 2X8WA 3HB5X 3K4QA 3BGWA 2CHGA 4KYTA 1V0JA 2WU7A 3T9DA 4MCHA 2PLAA 3I8SA 1NXVA 1FFEA 4FFRA 5H3HA 4OD0A 1UPAA 5E4JA 1WW8A 2F3UA 3I9OA 3LP6A 2W70A 5K8JB 3OCBA 3FZ1A 3C3DA 4IP0A 2R6HA 3VBEA 1NWCA 4Y95A 3MGAA 2B83A 3F1LA 4HOKA 2VRBA 4S05A 1NVXQ 3G5TA 2J5QA 3WZJA 1F12A 3INTA 1B6GA 2UZVA 3RPYA 4M1WA 2GD1O 4F06A 5KNCD 5CMLA 1IN4A 1XYGA 1ZH4A 3Q88A 3DVAB 3Q7EA 2X6DA 2FVXA 2WSSD 5CVFA 3H5IA 1HG1A 4OA8A 1SCDA 3DEYX 1K5HA 5JAMA 3L7AA 3FMLA 1Q95A 4FUXA 4MQEA 4FYMA 3KJIA 2UDPA 5GP1A 3LY9A 1NU6A 1JTEA 3QKWA 5KYGA 1J2EA 3GP8A 1WBOA 3UK6A 1Q8WA 3W3AH 1M6HA 1XKTA 1IN6A 4NYJQ 2QG7A 2NPIA 3QZUA 4DG0E 4Q3NA 1ZEMA 4HLNA 4QGBA 1EFUA 1VL0A 4MR7B 4DFZE 3NYRA 3RF7A 1MORA 1J9EA 4WH0A 3R2JA 2F8LA 1T25A 1PQPA 2NXNA 2YJGA 3DCVA 1ZLYA 4QOIA 3HDGA 1IJBA 3LZ6A 1GIAA 3TXAA 2OIBA 3BTUA 1GOTA 1UP7A 4EB8A 4RQVA 3R2YA 3BE2A 2HUNA 3GFEA 5E1EA 1J5XA 5TGDA 1RZVA 2RGAA 4WXHA 2ACVA 2NUTA 2P79A 4F04A 2R1ZA 2PZGA 1O77A 3ITDA 1L4EA 2GN2A 3S1SA 1P4GA 3FCXA 5FBOA 5DGCA 1T15A 5IH3A 5IC5A 1I1HA 3ZLWA 1FU4A 4Y6PA 2OJJA 4KRCA 4DBLE 5EFZA 3ZZEA 4ALIA 3QX2A 1SXJC 3L0DA 2P4EA 3HPQA 1WMAA 3UG6A 1UAAA 3URMA 1HF3A 1NVMB 1SCUA 5FYDA 2ZAZA 3O8RA 4NM7A 4G6OA 5ERYA 2UZDA 4IMRA 2B61A 3R63A 1A0OA 1PF7E 4GRBA 5TSDA 1B8OA 1F06A 4KITB 3DZHA 4KIQA 2J3KA 3TKLA 4E94A 2I6GA 3FCOA 5KYKA 1I4EB 1Y1RA 1G3IA 1OI9A 5I51A 3VJNA 2IW8A 4ZCPA 3ZU3A 2QKWB 4DWJA 5AHRA 4PBSA 1J22A 3LQQA 2YDJA 3DE3X 2R97A 1KO4A 1Z33A 1EZ1A 1E7WA 3UNXA 1OXVA 3SF8A 4ARCA 1TM3E 2O20A 3ZS9A 4HVSA 4LI5A 4TRNA 3K1TA 3ZWQA 5FQNA 4RVMA 1J0EA 1VRWA 2PKYX 4O4JF 2J3HA 3AZOA 4KBCA 1DAFA 4L3WA 1W8DA 3NCGA 1KFEB 1H1PA 1MBZA 3AIOA 4CEIA 1H6CA 1JR4A 2NP6A 5K0CA 3DM9B 5FP5A 4QMXA 2WWWA 1G2OA 3FAZA 1PYOA 3OCGA 1XBBA 3QIVA 4OK6A 2D1TA 1A9RA 4Y2XA 2NPOA 2O05A 1XTPA 3O23A 3R8VA 1AJEA 3DTVD 2FZ5A 3HMQA 3DBHA 2OYRA 5E7MA 4YLYA 4ZK5A 4BDCA 3U4QB 1W4ZA 4FG7A 3PIXA 1B00A 1M6VA 5JYEA 5DLQC 2HHCA 1XQ6A 1BAPA 1E58A 5AD1A 5KTPA 7AT1A 4LDZA 1QF7A 3GPLA 3A4IA 2O8BA 3RWPA 1GPLA 4K0KB 4EB0A 5DT9A 3VV3A 5ELMA 3WB1A 4RM3A 4FKMA 1UBFA 3V5LA 2Q41A 2GK6A 3ROXA 2C3KA 3LGSA 4FR0A 1SURA 5A4IS 5PNTA 1RRPA 2FUEA 1Z8FA 2VZEA 1EXMA 2NAFA 3CRVA 5J2TF 2QO2A 1Q77A 1XV5A 3HCOA 1VI6A 2WUFA 4HX5A 4PLVA 3UZTA 5C32A 4MXZA 3OUKA 5BWNA 1K7YA 1K0UA 4BFUA 2ZJ4A 3H1FA 5KBQA 1N25A 3QPVA 1U0EA 3VTFA 4AY6A 4M1EA 1EE9A 2RIPA 2WV7A 3Q6IA 1AC5A 1XL1A 5CJ2A 3L7DA 4ZCRA 2A1TS 2VT3A 1MIHA 1JTVA 1WXXA 2OCDA 2X9FA 3S2FA 3OX3A 5I9TA 3F3SA 1T9DA 5IQHA 1YR8A 2Y66A 1PL8A 4QD3A 1DIAA 3MN3A 1EM8A 4QGHA 2ZM4A 3G13A 3GRCA 1UXHA 3F6EX 3TX2A 3GLKA 3VR6D 4BXOA 4TNBA 1TAQA 1PKXA 4ZVLA 2VOEA 1JH8A 3UWOA 1EFRD 1JR2A 2NU7B 1GZDA 3T5CA 2OV1A 5ESXA 3ZOZA 4CKEB 5K8CA 3FSJX 3ROYA 3HYSA 3OZWA 3I4FA 2YW9A 2PGLA 2IYZA 3ORTA 3R7WA 1RE0A 1TCVA 1KE5A 1X2EA 1H22A 2GEKA 2PVMA 3FLAA 5JMTA 3CN7A 5FTMA 4UFNA 4CQMB 5BV1A 1ORHA 3FKSD 3F8WA 3WZKA 2V0GA 3G2LA 2CVPA 1I36A 3V8SA 3G17A 3E70C 3V04A 3MTFA 2X8JB 5LFAA 1JGTA 1NQ5A 1E98A 1DQNA 1U28A 2PWLA 4S34A 2O5VA 3AZPA 4O63O 4HATA 4TV9B 4YRIA 2PVJA 4LVOA 1Y9ZA 2DJ5A 1NSFA 2PBFA 1QHXA 3VR5D 4Z3OA 3DH0A 1CRPA 2WMOB 3FPBA 3QRKA 2R1VA 3H2GA 1ST2A 3JWJA 5CVHA 2W6PA 4LCJA 5K0SA 5DLDA 1T3LA 1UMBA 3NVDA 3INGA 1GTJ1 4YJ2F 4RV4A 4Q4JA 4JIAA 2AD1A 3HTXA 1RQGA 3SV0A 1R3CA 2E49A 4JG8A 3WLSA 2BR5A 2IP2A 3OSUA 4IMJB 2GN6A 4I41A 1VLHA 4KC0A 2NXWA 1RCTE 1KBZA 1IA9A 5K9ZA 3WI6A 5CEKA 3IUMA 1SD5A 5B3KA 2DHDA 3WYGA 2MHCA 1Y7IA 1HDCA 3R5JA 3NAXA 1XZCA 4OL9A 3A04A 3EKNA 3UYKA 4J2TA 3I2HA 3KEXA 1G3QA 2DE0X 4MVJP 5IJXA 3KDPA 3OY3A 2IYUA 1F8YA 1I80A 3ETCA 3AKZA 3G8AA 2OG8A 1ZAYA 5EWLA 1VE7A 3A3NA 4E14A 3LAWA 2JDRA 3CPBA 5FPHA 2JRCA 3RV3A 5BYZA 4DXHA 1OXUA 2OQIA 1DIRA 5ADUS 1Z25A 4RK0A 4DCVA 4CBVA 1OC2A 4X21A 5JADA 4FLFA 4CM4A 1Y6AA 4PL5A 4F71A 1PT9A 3V2IA 1EX9A 2BDFA 1AKUA 4CG9A 4ZOLA 4NI5A 4FHFA 5FJJA 2VPWA 4DCPA 3QTQA 1X7XB 1JKJB 2ZK7A 2X15A 3DZBA 4RPLA 5JCJD 3NBKA 4YO8A 5AP9A 3IP8A 3QVWA 3G8CA 2O3SA 2IDZA 2G4VA 2HTEA 1L0BA 1XHEA 1A5ZA 1MRYA 1RWOA 1D4AA 2E1PA 2CGUA 4PY1A 3U4IA 1XZQA 1SXPA 1SOVA 3IEXA 4FIZA 3DAPA 1UP4A 3QRTA 5AP4A 4ZHQA 5A2GA 2EJUA 3EZXA 1CZNA 3IALA 1L1EA 2W6QA 1Q19A 3AG5A 1JHDA 2HQRA 2JAXA 2LR0A 1SXJA 2R44A 3BJMA 1JG4A 3PNBA 3J80A 2ONJA 1G98A 1N4AA 2ZUCA 3MUFA 1ND6A 3T5GA 3UG2A 2HSDA 2O63A 4N8EA 4WZBA 2NVUA 3AC5A 3KOOA 3LUBA 4ESHA 3OZEA 1QKIA 4CFYA 4Y0NA 5AX3A 1KL7A 5A5GA 1KV2A 5L6PA 1M1YE 2PUBA 3BD7A 1EUYA 1W88B 1PJSA 1YQXA 4LOKA 1DZ3A 5IAOA 2XRYA 2NZVG 3K94A 4GGOA 2OBFA 4G84A 1EIWA 3QVJA 3TSYA 1FMJA 1FSGA 3C14C 3KBBA 4OLJA 3IEKA 1IHXA 2HQ1A 3HG7A 5ETJA 5K2OA 1QLHA 5FV7A 4QL3A 2J45A 4GC5A 5ITAA 4LHYA 2CHUA 2GF0A 4N39A 1E9SA 1NOKA 4JT4A 1X94A 4Y9RA 1N34B 4KSYA 4LWQA 1IMOA 2ZJWA 2BTQA 4H17A 3RK9A 1RP7A 5DHJA 2AS0A 5CIYA 2Q9AA 2ZPUA 1P17A 2FEKA 4MARA 2EP7A 1OPXA 3PDWA 2D8MA 1X92A 2C2XA 1SVGA 2C31A 4F0IA 1USKA 1DS6A 5BQ3A 1ZCZA 4IL5A 4X00A 4HO1X 5FT9A 3Q9ZA 2PBRA 3ETHA 4G0QA 2YY5A 4ZTQA 2H1LA 3GU8A 3SAYA 4CGAA 5E9QA 1LPBB 4AJKA 1DTEA 2WO6A 3QZIA 3DNEA 3QKMA 4JQSA 1CY7A 5K2MA 4L44A 4FBLA 4Q01A 2R4QA 5AH0A 4L0CA 2RIRA 4R7ZA 1T2CA 2OD9A 3ZJYA 1QU2A 2UZ3A 2WEIA 1QORA 4TTHB 5KSZA 3S1HA 4TZ0A 3WGVA 4FV5A 1V2HE 5FPSA 3LQRA 3ZZTA 1N5OX 4G5YA 4OI1A 4KR7A 5K09A 1ZXEA 3DLIA 3FL4A 4JDJA 3R4VA 3IILA 2ZVPX 5B37A 2ZZNA 4GLJA 3CJTA 1UOPA 1QR2A 1ZFNA 3V8EA 2P5SA 5FWXB 3N0XA 2GPYA 3D6FA 2R85A 4L3LA 3AF3A 2B25A 4TOIA 2ZFYA 1GRNA 1Q0TA 2ID8A 4UATA 3BFPA 3PSAA 2CMWA 5EQPA 3KZNA 1I2CA 4F4UA 5MHTA 4RJ3A 3EEFA 3GLGB 5AUOB 2WZCA 4FUTA 4MUNA 2YM7A 2BF7A 4DC0A 1H93A 5HIJA 3GFBA 1K8QA 1R27A 2O2SA 2WP8J 2F4JA 3NASA 3MI9A 2XY4A 3HUBA 4G3EA 5EZ6B 1AZWA 3DCNA 4PS0A 2I80A 5COAA 3WB9A 1YI1A 1NVDA 2HJWA 4FHGA 4CLXA 3CMCO 3NTXA 4QXMA 4NYJ