3W0OA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia, ternary complex with adp and hygromycin b
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0oA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0oA02
4DCAA 4R7BA 3UZRA 3HAVA 1J7IA 3TDVA 4FEXA 4O7OA 3W0SA 3CSVA 3ATTA 3DXPA 4DFUA 1NW1A 3TYKA 2PPQA 4BR3A 5C4LA 3HAMA 3FI8A 2BKKA 1J7UA 5IQIA 5EQPA 3W0NA 3C5IA 4DBXA 4R78A 4R77A 5IQEA 3W0MA 4DT8A 4GKIA 3W0QA 4DTBA 4N57A 3LQ3A 2PUNA 4DT9A 5EQEA 2IG7A 3F2RA 5C4KA 5IQHA 3MESA 4H05A 3ATSA 3W0OA 5IQGA 4PDYA 1L8TA 2CKQA 3TDWA 3N4TA 4CG9A 4DTAA 4CG8A 4O7PA 1ND4A 5IQFA 2PU8A 3G15A 5FUTA 2Q83A 3DXQA 3W0RA 5IQBA 2PULA 3SG9A 5FTGA 4U94A 2QG7A 3N4VA 4FEUA 4CGAA 5IQCA 4DFBA 4WZYA 1J7LA 3Q2JA 5AFVA 3SG8A 5IQAA 5EQYA 4DE4A 3TM0A 3N4UA 3FEGA 3SGCA 2PUPA 5BYLA 4DA5A 3W0PA 2PYWA 4FEWA 4FEVA 4ORKA 5IQDA 2PUIA 2I7QA 4GKHA 2OLCA 2B0QA 3JR1A 4U98A 4EJ7A 2CKOA 3ZM9A 2CKPA
chains in the Genus database with same CATH superfamily
2W9ZB 4ZTQA 1SNUA 4DFZE 1UNLA 4EYMA 5CU6A 3WOWA 3UZRA 2VX0A 3AT2A 3LFDA 4BTJA 1H00A 1Y8YA 2WTKB 4RX9A 3UNKA 3HYHA 5FGKA 2EB3A 4FIJA 3ORNA 3UOKA 4ZZNA 1H25A 4JAJA 3R01A 2Y7JA 5AP3A 4XG7A 2PSQA 4R3PA 4KBAA 4DLIA 3LJ0A 3B8QA 3TCPA 3HVCA 1G5SA 2C6OA 5BMSA 4D9TA 3S0OA 2VN9A 2WMBA 4D1ZA 5HE0A 4CNHA 4YZCA 5FD2A 4BHZA 4F7JA 4R78A 2O64A 2DQ7X 5HCYA 3DJ7A 3EWHA 3TIZA 3MW1A 5IMXA 2ITZA 4YJTA 3EQPA 3IW7A 1ZZLA 1JKKA 2X81A 4NU1A 4D0XA 2B54A 3GC7A 4FVPA 4PMMA 3QQKA 4WKQA 3W0MA 3W0QA 2VTHA 4X2FA 5IEVA 3KXGA 2UW5A 3LQ3A 3R1NA 4N57A 2LAVA 3ZDIA 4C4IA 4UZHA 4LMNA 5ITAA 2IG7A 4GK3A 4F9WA 3OCSA 2YZLA 3VW8A 2XIYA 3QQLA 4JBOA 4P5ZA 2XCKA 4IAFA 4YBKA 2WQEA 3CY2A 3H9OA 5IQGA 3OP5A 3JUHA 3TDWA 4KWPA 5DPVA 3R9DA 3D7TA 2UW4A 2PZRA 3GU6A 2VUWA 4FOCA 5LMKA 2CHLA 4TRLA 1YWVA 4XBUA 2R3MA 3OFMA 3OY3A 4ZTLA 2AUHA 4AT3A 3PFYA 2BUJA 4FKIA 2O2UA 4N0SA 3I7BA 1Q5KA 2W0JA 2ZYBA 4FV2A 4LUDA 5E8XA 5CS6A 1PMVA 4ZS0A 3RP9A 1OL7A 1OIQA 5M4FA 4YTFA 4Y72A 1H8FA 2C30A 1WVXA 3P86A 1URWA 5GIPE 4A9TA 3FPQA 4HW7A 4WZYA 5FP5A 4DEIA 3NPCA 4MBIA 1YDRE 4C02A 1Q8TA 5D12A 1OL6A 3O17A 4CZTA 1ZYDA 1WBWA 3OUKA 4BDCA 5HI2A 3D2KA 3VS3A 3S00A 4RSSA 3I6WA 3PE2A 4FKLA 2OXYA 4J8NA 4C0TA 5FXQA 5LXMA 4BDDA 3QA0A 3II5A 4RZVA 3HMOA 1JSTA 3H30A 4RJ3A 5LJJA 3EQDA 5EOLA 3TUCA 2UZTA 4KNBA 3TMOA 2GNJA 3A62A 2PY3A 4ZSLA 2VRXA 4RRVA 4LI5A 3UC4A 4WSYA 2R3JA 4GS6A 4FVQA 2PZ5A 3A61A 1IA8A 1XH4A 2VTQA 3COKA 2B9FA 1PKGA 3D9VA 3GC9A 5IH5A 2JDVA 2UZBA 3CD8A 1L3RE 4QYHA 5BVEA 3ODZX 2EXMA 2V7AA 3HV4A 1BMKA 3ORXA 5EM5A 5HNGA 4AZWA 2A27A 3IS5A 1REJA 1YKRA 2QCSA 3COMA 2HCKA 3MB6A 3ORPA 3QCXA 4JAIA 3P78A 3PY0A 3VUDA 4BZOA 5JGDA 4P5QA 4RQKA 3BKBA 1FGIA 4CFWA 3E5AA 1Q41A 1BX6A 5HX6A 3TL8A 3UO4A 3V5JA 5J1VA 4YMJA 4RFYA 5AAEA 4WHZA 3PG3A 3SLSA 2WELA 4Q5EA 5EYCA 3VVHA 3LFCA 2ZV8A 5CEMA 5KX8A 4D5HA 3GOKA 5JN2A 3WIKA 4CVAA 3FZ1A 4RJ4A 5F1ZA 3CIKA 3ERKA 3PXFA 4KSPA 4C35A 2BKKA 3QD2B 4BCNA 4BB4A 3OXZA 5EQPA 4F9CA 4FT3A 2E9VA 1K9AA 3QQUA 3H0YA 4NM3A 1BL6A 5HG8A 5C01A 1Q8UA 3ZSGA 4DBXA 3W2QA 5AA8A 3V5WA 3ORLA 4YZNA 4HPTE 3I5ZA 3RM6A 4AA5A 5HESA 5CAUA 3HV6A 3JS2A 3WE4A 4AZEA 2W5HA 3MPMA 4O22A 3QTUA 2UZUE 5E8UA 4S30A 2BAKA 5BV3A 2OZOA 2LGCA 4XCUA 3FLZA 3QCQA 4FVRA 3NW7A 4MEDA 1ATPE 4EH4A 5HEZA 5T68A 2ERZE 2VTNA 3UZPA 5J9LA 4KBKA 3QQHA 5ANEA 4O91A 3G0EA 1QCFA 4MAOA 3QRKA 4QQ5A 2YZAA 4PDOA 3G15A 1XHAA 3DLZA 3DV3A 4ZY6A 5JQ5A 3DFCB 3SXFA 2JFMA 2Y4IB 3K3IA 3LCDA 4YHJA 1W0XC 3C9WA 4YHFA 3L8SA 5HNIX 2UZOA 3MH3A 5EM7A 2QKRA 4CKJA 4K8AA 3VF8A 1W7HA 3AGMA 3Q2MA 4QMWA 3DZQA 3JVSA 3WF6A 4BCGA 5GINE 5KCVA 2VWXA 3PTGA 2WTVA 3BQRA 5DN3A 4ASZA 5C8KA 3E88A 4B0GA 5A9UA 2BZJA 3ROYA 4ENYA 2WQOA 4ZJIA 2VGOA 3UDTA 3QRJA 5EW8A 2BROA 1J7LA 4I6BA 3TJDA 2YDIA 3I0QA 4J71A 4PL5A 2BRNA 3UNJA 3F69A 3ENMA 1M2RA 3NX8A 1UWJA 3SGCA 4MWHA 1TQMA 2E9OA 5DT0A 1R1WA 4FODA 3LXPA 2VO0A 3SOCA 4NWMA 4ZS4A 2FA2A 3KXNA 4YNEA 3AC4A 3LFFA 4FNZA 2C68A 1ZMUA 3IGGA 4L53A 3FMMA 5AUXA 2IZSA 5AP0A 3LCTA 3SC1A 5BUIA 3U6JA 2BFYA 2OLCA 5CAVA 5ETCA 1RQQA 4U43A 1IR3A 2OXXA 4QQJA 4U98A 5FEEA 3QGWA 3AMYA 3PJCA 4BGHA 1T45A 2BTRA 2QONA 3P79A 5DEWA 4CFVA 3CJGA 4XJ0A 2UW3A 1BI7A 4FV7A 3DU8A 2ITUA 3GGFA 4JL9A 5A4CA 1Q8YA 3C0IA 4FZAB 4PTEA 3SRVB 2CKOA 3CBLA 1QMZA 2FB8A 2XYUA 3ML1A 1OUYA 3NLBA 4NJ3A 2JIIA 5L8JA 5KKRB 4I94A 3Q9ZA 4BCFA 1H28A 5IA1A 3O8PA 4YZMA 3HP2A 2QR7A 1OI9A 3GCSA 3Q32A 1BL7A 4WT6A 2BIYA 3F61A 5HKMA 4I3ZA 5M08A 3EQCA 3VC4A 2I1MA 4G31A 4D55A 4PMPA 2YJSA 2JD5A 4M13A 3SW7A 4MNEA 4DFUA 1H1PA 4KRDA 4BDKA 3CE3A 3FI4A 3PLSA 4BN1A 3G90X 1WVWA 1RJBA 5KHXA 5L2WA 3Q9WA 4O0VA 1T46A 1DM2A 4D2RA 1KV2A 1ZYLA 4HGTA 2IVTA 4RWKA 3F3UA 4BDFA 2I0VA 3OWKA 1TVOA 5DR9A 1FVTA 5CEQA 2YITA 3LJ2A 5D1JA 3UP2A 3P08A 4MXOA 4NL0A 4UV0A 1Q3WA 4YP8A 4EORA 4BGGA 1URCA 2R3IA 3TI1A 5IQHA 3I81A 3AGLA 4C4JA 4F1MA 4H05A 3IDCA 4RC3A 2XJ2A 4XV2A 4X7QA 4RIYA 2WMWA 4RJ6A 5J87A 5IA2A 4HGLA 4PY1A 1UNGA 3UIBA 4TYJA 3OROA 2GPHA 2ITTA 3KIOC 5EFQA 4AT4A 4O7TA 5JFXA 5I9ZA 4CKIA 4FG7A 1Q3DA 2O63A 4AZSA 3FLQA 1G8AA 3UQCA 3W8QA 2ITXA 3MIYA 2CNVA 2G15A 3IKAA 3QALE 3DBDA 1XH6A 3W2SA 4BDGA 2QOBA 3GT8A 2F7ZE 3BELA 3TTIA 1H1WA 5L8KA 2QVSE 2XRWA 3R8MA 2BAJA 4WG3A 5A54A 4F0IA 4IADA 4YJQA 3HLLA 2NO3A 3EQHA 4FX3A 5TKDA 4FKVA 2H9VA 2HY81 5IF1A 4XRLA 5DT4A 3OC1A 1KSWA 2AYPA 4DFBA 4H36A 4F08A 4FYOA 4QYFA 4S34A 4YZDA 3W2PA 1H0VA 3W55A 4E5AX 2WPAA 3MTFA 2DYLA 3HDMA 4DGMA 3TM0A 1MRVA 1SNXA 3K5VA 4C4GA 4YJVA 4H58A 4QP2A 5I4NA 2GTNA 2YM6A 3HA6A 3ZS5A 3PJ8A 2XANA 3BGQA 5EI8A 2PYWA 4K18A 3I4BA 2X8DA 3Q6UA 1NVRA 3GUBA 3WF5A 4F9BA 3F2AA 3FLSA 4G17A 3T9TA 3HUCA 4W4YA 4GCJA 4GKHA 3TEIA 5AUWA 5AP1A 2ITQA 3QYZA 3OCTA 4DEAA 4JR3A 3W32A 4IDVA 3MPAA 2GDOA 5AUUA 5LVMA 3D94A 1M7QA 3JR1A 3CR0A 3VS2A 4GK4A 5EDQA 4ZLYA 3S4QA 3W1FA 1YI4A 2GS2A 2VV9A 2CGVA 4FYNA 5KHWA 4BC6A 2R3RA 3EN5A 5DG5A 5M44A 4RIXA 2GHGA 3H10A 3ZEWA 4IIRA 2QOKA 4ANLA 5CF4A 2WHBA 4USDA 1KE9A 4JT3A 3W2RA 4HGSA 4U5JA 3HAVA 4QMLA 4DDGA 1DS5A 5AV0A 4YSMA 4O96A 4EH8A 3E87A 3RNYA 2VTSA 3NIEA 5FM2A 2CSNA 1APME 3UG1A 1J7IA 5LCJA 3E7VA 2F9GA 4H1MA 1FQ1B 2VO7A 4BI2A 3QZGA 3TV7A 4CMTA 4DTKA 1V0BA 5M55A 5JMSA 2OIBA 3HV3A 4TYGA 1TQIA 3LMIA 2HXLA 2QU6A 2B1PA 2VAGA 4JRVA 4FBXA 3VQHA 2W1FA 4F70A 4Q9ZA 5GIOE 1BUHA 1WBSA 2GTMA 3FLYA 4M69B 3BBWA 4P7EA 1GOLA 3NZ0A 2X2KA 3FJQE 2XM9A 5FRIA 4QTCA 1TQPA 1ZWSA 2VTPA 4FTCA 4FIFA 3ENHA 4EJNA 4NZWB 1QL6A 1VYZA 2VX3A 3C4XA 4H3PA 1W84A 3EKKA 3C4FA 5ETIA 5JT2A 2JIVA 2PUNA 3AQVA 4TPTA 4YO6A 2JDSA 5DR6A 3FI2A 3F2RA 3FL5A 4XYFA 4YJNA 1OBDA 3QWKA 2BAQA 4NIFB 3KFAA 4Y95A 4BCHA 5A4TA 1P5EA 3EQRA 3FWQA 2OIQA 2ZDTA 2HOGA 2GFSA 3A7GA 2QOQA 3FKLA 2QOIA 3OUNB 4MTAA 2C6EA 3LAUA 1J3HA 2XS0A 4BGQA 5IA0A 1OB3A 4I5PA 4IM0A 1SVGA 1OL2A 2R3LA 4G3CA 1CDKA 4AG8A 5CY3A 3QTSA 4NTSA 2RF9A 3R73A 3K54A 1MQ4A 3HGKA 1DAWA 3MY1A 3RNIA 3TKUA 3EQIA 3D5WA 5B0XA 5EW3A 4MUQA 2DWBA 3MJ1A 1J91A 3ORMA 5FLFA 2C5NA 2SRCA 4KABA 4EQUA 1Y8GA 5AUTA 4F99A 1KV1A 3VBTA 3UDBA 4I0RA 2X0GA 5I5ZA 4H3QA 1FINA 3TN8A 4HJOA 3BEAA 3GOPA 5FBOA 5LVLA 4A9RA 2HWOA 5CT0A 3PXQA 4ZTNA 4KUJA 5AMNA 2QO7A 3ZC6A 4FEWA 2C6KA 4C3FA 5M07A 2OWBA 3EH9A 5CAQA 5E90A 2ZB0A 2J0MB 2XIXA 3RAHA 3PXYA 4FIGA 3AC1A 1JBPE 1YQJA 2A2AA 4BTKA 5JH6A 4PF4A 3UVRA 5HCXA 2F2CB 1OITA 4O6EA 1GY3A 5LARA 1R0EA 2OH0E 3BRBA 4NM5A 3PXKA 4WUNA 3QYWA 3VS5A 3QTRA 2BRMA 3ZXZA 2PUUA 4GH2A 3R7UA 3E63A 1PW2A 1U5QA 2HZ0A 3DOGA 3EMGA 3AKLA 3KB7A 3KVWA 1WCCA 5HVKA 4EJ7A 4ZXTA 2C1BA 3NUPA 3OXTA 4D1SA 4X6RA 2AC5A 5A4EA 2HW7A 3E8EA 3AKKA 4L3LA 3BHYA 3G2FA 3MFSA 4LMUA 4ASEA 4FKQA 3DBQA 3MBLA 4K0YA 3H4JA 4FV8A 4O7YA 1XR1A 3WILA 4EH7A 3EN7A 3WIGA 2X2LA 5K4JA 3IW8A 4GYIA 2WXVA 2VTOA 3F9NA 3CKXA 3I1AA 4FEXA 4M15A 2RFSA 3QC4A 4YPDA 5JZJA 4FR4A 4KAOA 4LFIA 4QMUA 3QTXA 4XNEA 5HG9A 4DHIB 3SRVA 1ZZ2A 1OL1A 3FC2A 4IZ5A 1A48A 1PJKA 3HAMA 3FI8A 4O84A 5KMJA 4BCKA 5E4HA 2GU8A 4F0GA 3VRYA 3S2PA 3W0NA 3QQJA 3R7IA 4FZDB 3FMEA 3ZYAA 4CKRA 1ZRZA 3MA3A 2W05A 2YIRA 2PVKA 3PVGA 5AP2A 3GC0A 3S95A 2WTCA 3DDQA 4F6UA 1P14A 3KC3A 4UX9A 2YM8A 3DKOA 2XBAA 3KXMA 3LW0A 3M42A 4V04A 4LL0A 5IUGA 5AP4A 5HE2A 3UOHA 2W96B 3BU6A 3EN9A 4DFLA 4E26A 3FXXA 4JVGA 2X39A 5HD4A 5BMMA 4L9IA 4F7NA 4GJ2A 5EYMA 3BU5A 3VUHA 2UZWE 3QBNA 3UMWA 2WMVA 2R3KA 2YM4A 3NYOA 3TV4A 4MXAA 4BJJB 2FUMA 2JKKA 3KK8A 3DA6A 1CKIA 3KVXA 5CNNA 5HQ0A 3DXQA 5DWRA 2XK9A 5IQBA 2VTAA 4E4XA 3CS9A 5HU9A 4C4HA 2Z7LA 3LXKA 3QL8A 4X2KA 1YXTA 2KULA 3LXNA 3QXOA 5CT7A 2RFEA 3ZZWA 4AZVA 4RLLA 1Y91A 3VUMA 1RDQE 4ZTMA 2YERA 4U9AA 1H26A 2W7XA 2UVZA 3MYGA 1FOTA 4IAYA 4ANMA 5HHWA 4OTHA 3PDTA 5CZHA 4ZK5A 4P2KA 4DGOA 5CALA 4PP9A 4WBOA 1UU7A 2C3LA 4MQ2A 3T9IA 1R0PA 3W16A 2DUVA 1OBGA 3ZO4A 3C4WA 4DINA 3FMNA 4GFMA 5BVNA 4USEA 3AXWA 1H1QA 1XBCA 1RW8A 4XP3A 5EQYA 5IMEA 2B4SB 2Z8CA 4LUEA 3FQSA 3FMHA 3VNTA 3L8XA 4TXCA 4RVKA 3F3WA 3SV0A 2GNIA 4KRCA 2WMAA 2CLQA 1XBBA 4KKGA 3DLSA 3PRFA 3DB6A 2OBJA 2GSFA 3D0EA 4R1VA 3UIXA 2UV2A 4EK4A 4A4XA 5D7VA 4J8MA 1PRYA 2YIWA 3QWJA 1G3NA 4AW0A 5DRBA 2VWWA 3QX4A 4YBJA 2ZB1A 3D4QA 4ONAA 2JKMA 2XJ1A 3BZ3A 4Y46A 3ZU7A 2HELA 4MD7E 4BY9E 2BHEA 4EZ3A 1XMLA 4OUCA 5AIKA 5ETFA 5ACKA 1JKLA 4K1BA 3ZRKA 2OZAA 4XX9A 2ZFYA 4V05A 2CMWA 4QTBA 2Z7RA 3QTWA 3TNIA 4DCAA 3LKMA 4DH8A 2QLUA 5I9UA 4QMVA 4KBCA 3VS1A 2PE2A 2QQ7A 3L9LA 1YVJA 4FK3A 3Q5ZA 3OBGA 1W83A 2WTJA 3GCVA 3KQ7A 4XG8A 4AN3A 4CRSA 1KE8A 3GXLA 1R39A 2ZVAA 3NWWA 1YWRA 1VR2A 3VBWA 4ARKA 4FSQA 2P33A 2PVJA 1JSVA 3NW6A 4EONA 3U6HA 3UOJA 4ITJA 3DXPA 1SMHA 3ZLXA 2BRGA 2OSCA 2WTDA 4BR3A 2V7OA 3DZOA 3QZFA 5AP5A 4F63A 1U54A 5HVYA 4NKAA 5FTQA 5IH6A 3QQFA 4B8MA 3OZ6A 4G3DA 2OFUA 3KULB 2B9JA 2J7TA 5HLNA 3ZFYA 2Y4PA 2C6IA 1ZXEA 4CZUA 2VNWA 4IM3A 4W8DA 5AAFA 3ZDUA 3NFGB 3NUAA 3WE8A 5FXRA 3GVUA 4GRBA 1YOJA 3PVWA 1JSUA 3KMMA 3QUDA 3FZPA 1BYGA 4G3FA 5JRSA 1G8JA 3K3JA 2EWAA 5CENA 1LPUA 4DEDA 3QKLA 3FMKA 5B2MA 5L6OA 2X7GA 3SDJA 2XBJA 4DEEA 2EUFB 4HVGA 3E8DA 4FA2A 4PL3A 1OGUA 2QLQA 2VTJA 4RJ8A 4BCPA 3BHTA 4CG8A 4C33A 5IQFA 1FBNA 3UOLA 3DK3A 4II5A 1KOAA 3LPBA 4EC9A 4QMSA 5HG7A 3OWJA 3QTZA 3PE1A 5GJFA 5M51A 3M1SA 4UBAA 5FBNC 3CPCA 2B7AA 2J50A 3NR9A 4NFMA 4OGRA 4R3RA 4FIEA 3BWFA 4IWDA 1Y6BA 1A9UA 3Q4UA 3KRJA 4AN2A 3AOXA 1IG1A 1V0PA 3CQEA 2ZM3A 5BVOA 5J9YA 2WIHA 3UVPA 4BZNA 4EH6A 4BCIA 4O83A 3LZBA 5AA9A 3QA8A 3TG1A 5M4IA 5AIRA 4CSVA 4JDJA 4O27B 1YDTE 1XKKA 2XK4A 4CEGA 4D58A 3SG8A 1G8KA 4YO4A 4C59A 2YACA 3NGAA 3OOGA 3P9JA 1NVSA 3BYSA 2C0OA 3R02A 3VS6A 4CTCA 4FV9A 3UG2A 3BU3A 4FV0A 4WRGA 2XH5A 4ACDA 3W0PA 5AX9A 2WD1A 2NP8A 5EG3A 4AZFA 4YTCA 3MVJA 4WIHA 2XKDA 4USFA 4YC8A 5HLWA 3F66A 3MTLA 4FKUA 2EU9A 5CEKA 1JVPP 1WBOA 3FMDA 4G1WA 5GNKA 3TXOA 3DJ5A 3BQCA 2XNOA 3MFRA 4R5YA 3ZC5A 1ZLTA 3QHWA 4I4FA 4QOXA 5E8VA 3RAKA 2R9SA 2C47A 3RHKA 3EFWA 4YLKA 1QPJA 4LM5A 5GHVA 3ZRMA 2IVSA 5EM6A 5KZIA 4AAAA 3UPZA 3PFQA 5CU3A 4UXLA 3VJOA 2XP2A 5H8EA 2XARA 2ZV9A 3LFNA 5DOSA 4ZLZA 3MY0A 3TZ8A 4MK0A 3GU5A 3BIZA 2UUEA 1XMMA 3L8VA 4G16A 4U81A 4C38A 2BVAA 5F20A 4D0WA 2WGJA 4IVAA 2HENA 3MA6A 1REKA 5G1XA 4QMMA 3GEQA 1KUTA 3RPVA 1OPLA 2XNEA 2YCQA 3QKMA 5CVGA 1XH5A 3ELJA 3ZLWA 5CSVA 4C3RA 2X1NA 5JSMA 1B38A 3ULZA 4FZ7A 3VBYA 4FGRA 4R1YA 5CQWA 4RX8A 2PZIA 1UU3A 3MH0A 3WZEA 5J5SA 3JVRA 2IZRA 2C6DA 4IQ6A 4IB3A 2R3NA 3IG7A 4A06A 2P2HA 1WMKA 2HZ4A 3QRIA 3RM7A 4O38A 2QOFA 3V5TA 4BCJA 3SHEA 2YCFA 3C4EA 3KXXA 2QU5A 2WTIA 3GU4A 4WG4A 5EYKA 3IO7A 4FKOA 3MGYA 5JZNA 4DAWA 2VTTA 4GKIA 4W4VA 4I20A 4C62A 5AM7A 3CGOA 3DKGA 1Q24A 3ZSIA 3ALOA 3F5UA 3LMGA 2BR1A 2OF2A 2EB2A 2PHKA 3EQBA 3EYGA 3PXZA 4N6YA 2O0UA 4NH1A 3RZBA 1PXNA 4UWBA 1PXIA 3F3VA 2XIKA 4X2GA 4PWNA 2QOOA 4W8EA 4TY1A 4RFMA 5DIAA 5CF8A 3OEFX 1J1BA 3OEZA 3R8ZA 1ZAOA 1VEBA 4OR5A 3N4TA 4BTFA 5F9EA 5LMKC 2B52A 2C0TA 1CTPE 4X3FA 3F88A 1JQHA 5AV3A 2VNYA 4Y83A 4U3ZA 5HD7A 3Q9XA 2W1HA 2EXCX 5EI2A 1ZMWA 2ETMA 2WMXA 3POOA 4HYSA 4ZP5A 3ZEPA 2VWIA 3PYYA 4U94A 4AOIA 4ZMEA 2EVAA 4ZTHA 4BDAA 4O7ZA 5EI6A 5EDPA 2J0KA 3QRUA 4EK8A 2JGZA 3FZOA 3K5UA 4QP4A 3RK5A 4EI4A 2A4LA 2UW9A 1OKZA 3P7AA 4DN5A 3TV6A 3VJNA 4C61A 3EZRA 3O5AA 3TNQB 3EQGA 3R7OA 5BQ0A 1OPJA 1IEPA 5E8ZA 3UODA 5E8TA 3FEGA 3UJGA 4FIHA 4V01A 1Q97A 2BRHA 1VZOA 1S9IA 2CCHA 3W2OA 1CM8A 1YXSA 3BYOA 2IN6A 4O7SA 5T3QA 5M53A 3SAYA 4CD0A 3BPRA 2C3IB 5KZ0A 4AQKA 4TT7A 2AC3A 4AFEA 4AF3A 1UU9A 4AOJA 4O82A 2UW8A 4DYMA 3UE4A 4TNDA 3ZO3A 4IJ9A 2ONLA 2J4ZA 4TYHB 2ETRA 3OVVA 3ZTXA 4RWIA 3KK9A 2PVFA 5CLPA 3KGAA 4MX9A 2RIOA 4FNYA 5CASA 3FXWA 4FSNA 4BDJA 2CNUA 2ZOQA 2PVYA 3A4PA 3R1QA 3R63A 1H24A 4KINA 4U8ZA 4XUFA 4FIIA 2GQRA 2BIKB 2HWPA 3I5NA 4XH6A 5HCZA 4DFNA 5CEPA 4J96A 4QP3A 4FTQA 4JIKA 2O5KA 4JR7A 4F1OA 4GMYA 1R3CA 3MH1A 4HCUA 4GFOA 3LM5A 3R8VA 3TTJA 3A7JA 4FMQA 3ZUUA 3W2CA 4HGEA 1P4FA 4IVDA 2C5XA 4EH2A 5IPJA 3MVLA 3F6XA 3JY0A 4IWQA 5F4NA 4D1XA 3QXPA 2UW0A 5FEQA 3AMAA 4FKWA 5CI6A 3VS7A 3PZEA 4FUXA 2IWIA 2W06A 3WZDA 4PNKA 3N51A 1J7UA 3B2TA 3SW4A 5J95A 2IZUA 4OT5A 3MY5A 3LHJA 4F7LA 4H1JA 2OF4A 2R3HA 4ASDA 3WYYA 1NT2A 1IASA 5M09A 3NSZA 4FKTA 4UWCA 4DC2A 2BHHA 5LWNA 3L1SA 1ZMVA 2IW9A 5L8LA 4FZFB 2VWYA 2WMQA 4FSTA 4GEOA 4IVBA 2XK6A 4L44A 3A2CA 3A7FA 3CPBA 4NM0A 4EOSA 3G6GA 2WTWA 4FSWA 2OKRA 3FZRA 4EK3A 4HVHA 1ZYSA 2XNPA 2O8YA 2YDJA 4M97A 5EOBA 4FTJA 3NCGA 5KNJA 4PDYA 2WB8A 5IU2A 3OF0A 4YJSA 3ZRLA 3GB2A 3I6UA 5DVRA 3VWAA 4A9SA 4EOQA 5CXZA 3CQWA 4FSYA 4G6LA 5AUZA 4DTAA 4JRNA 4FT7A 4IW0A 2I6LA 4GYGA 3PSDA 4LL5A 4N6ZA 2Q83A 2XEZA 5EK7A 1I09A 4TWPA 1OIUA 4EHVA 5EM8A 4O7LA 3E8CA 3R22A 3I0OA 3Q53A 4FOBA 5K5XA 2Z7SA 4XV1A 1PF8A 5DYJA 5IZFA 4I21A 3PIZA 5E92A 4HOKA 1WAKA 4WOVA 4HNFA 1H1SA 4CV9A 4OT6A 5E1EA 5EYDA 2OI4X 3G51A 4RWLA 3T3VA 4F09A 2H96A 4QEBA 3V5PA 2P4IA 3FKNA 3U6IA 3QD0A 1O6KA 2BDWA 3LIJA 4CFUA 4GIIA 4AW2A 4JLCA 3PY3A 4FV1A 4KIOA 4O7WA 5CSHA 2OG8A 4DA5A 1FGKA 4GVAA 4DHZA 3TUDA 4CFXA 3CEKA 2QOCA 5AV1A 1OIRA 3QD3A 5IUIA 4K2RA 3R00A 4EYJA 3FMLA 4PTCA 5CWZA 4WO5A 4GW8A 4O21A 3ZFMA 1O6LA 4OTGA 3KRWA 5A3XA 4FL2A 3MV5A 3DK7A 1YI3A 5M57A 2DS1A 3HMMA 3RPSA 5IUHA 4G5JA 2GMXA 5DH3A 2Y0AA 4YR8A 3GU8A 3PY1A 4G5PA 4U79A 3VUIA 3NDMA 4KIPA 3FI3A 3UQFA 2V0DA 4D2SA 3IQ7A 3Q5IA 1ZY5A 2WZJA 2J6MA 1MRUA 2YHVA 1VLRA 2CN5A 3FQEA 4XOZA 4PQNA 3PA4A 5BVFA 3ET7A 5LVOA 4M12A 3WF7A 1YXUA 4I5HA 3QCSA 3EN6A 4ACHA 4TYIA 4Z55A 1X8BA 3ZM9A 3FL4A 3OWLA 4IANA 4ZOGA 3NUNA 5BYYA 2CDZA 3DGKA 4QP6A 5TT7A 1LEZA 2B53A 2ETKA 4KKEA 4A4LA 3BHVA 3ANRA 5FXSA 2IW6A 4FNXA 4R6VA 3UGCA 2R3OA 2XA4A 3C51A 3LM0A 2YJRA 4ALUA 3NMUF 3HUBA 2WO6A 4S31A 4TTHB 4CT1A 2XM8A 3U9NA 3WZKA 4JG7A 4Z9LA 3W18A 4MXCA 3W0SA 5L6WL 3VHKA 4ITHA 3LQ8A 4X2JA 3A99A 3E3BX 4S2ZA 3NAYA 4ZIMA 4DBNA 4HYUA 2W4JA 1JPAA 3F3TA 4FT5A 3DK6A 1XH7A 3LQ5A 4GV1A 4MBJA 4WA9A 3UQGA 3QX2A 3RPRA 3O8TA 2YA9A 3QD4A 4Z3VA 5HBEA 4B4LA 3OWPA 5CANA 3P7BA 4NYEA 4NCTC 4YC6A 4MKCA 3O50A 3U4WA 4M3QA 4UB7A 4E6AA 3RHXA 5JRQA 1R78A 1U46A 2VWUA 5ANIA 3FPMA 4DT9A 3QTIA 4RJ7A 2X7OA 4BBEA 5EHLA 3ANQA 2XCHA 3R9OA 4FV4A 1SVHA 3IOPA 4Y85A 4L67A 5LVPA 4F4PA 1BLXA 4C37A 4D5KA 5ACBC 5DT3A 3GQIA 4FG9A 5HX8A 4X2NA 2IPXA 2QI8A 2WQNA 3R9NA 3UP7A 1PYEA 4QMPA 4FC0A 4DLJA 3TKHA 1UA2A 3R0TA 2G2HA 3DT1A 2IJMA 3RTPA 4XP2A 3PP0A 3ZH8A 3B8RA 4L43A 4DH5A 4I6HA 1M17A 2O65A 4DITA 3FV8A 3BEGA 2Q0BA 2R3GA 5KBRA 3DPKA 4AXDA 4TWCA 2R3FA 3IDPA 5HZNA 2YM7A 4IMYA 1UVRA 1J1CA 3C50A 4L3PA 3P0MA 5B2KA 2XAOA 1IAHA 3ZHPC 3QU0A 3KXHA 3L8PA 3ZO1A 4EOOA 2BDFA 2PVMA 3F3ZA 4R7HA 5BNJA 2JFLA 5IQAA 2PE0A 4AZTA 1NA7A 4E1ZA 4FTAA 5M06A 3KL8A 4JJRA 3KCFA 2X8EA 4JMQA 4UN0C 4C36A 5IG1A 5LCKA 3REPA 1IAJA 4DEGA 3DKCA 4L3JA 1F3MC 3G9LX 2GCDA 4IZ7A 2OW3A 5ANOA 4QYEA 1GZKA 2C6TA 5AV2A 2CNQA 3VS0A 2F57A 4QNYA 2H8HA 3JYAA 3UO6A 2ZV7A 1PXOA 1H1RA 4IX6A 4RVTA 5C03A 2FH9A 2G2FA 4LRKA 3R8UA 4E93A 2YWVA 2B0QA 2I0HA 1PMNA 5DLSA 3EKNA 3T3UA 3BGZA 3BLHA 4BKJA 2WOTA 2C3KA 4Q2AA 5HU3A 3ZUVA 3HMPA 4GUEA 2OU7A 5E8SA 3SA0A 4JDKA 4ACGA 2F7EE 5AADA 4DF3A 3UO5A 4JQ7A 1JAMA 3D7TB 2PMLX 3ZFXA 3KRRA 1WZYA 1UKIA 2PMIA 2VGPA 3UBDA 1OZ1A 3AT3A 4BDIA 4E4MA 4QMXA 4CFMA 3QHRA 2YISA 5CZIA 1LEWA 4WNOA 5HLPA 3FHRA 3ITZA 3JPVA 3R28A 3UNZA 3DKFA 3ETAA 4ANBA 1O9UA 5A14A 3CQUA 4QP8A 3E92A 4TZRA 5HIBA 4N70A 3D5VA 3CSVA 1E1VA 4MD8E 5CU4A 3BYUA 4RPVA 4C4EA 3TYKA 3C7QA 3HMNA 5KE0A 5JEBA 4YJPA 3W33A 3A8WA 3FKOA 1XWSA 3CXWA 1UWHA 4S32A 4MVFA 3U54A 4KSQA 3LVPA 4ERKA 3ID6C 3VO3A 2YAAA 1ZOGA 4CLJA 3EYHA 5K4IA 4G9CA 5E8WA 3HEGA 5JFVA 1PXMA 3NFFB 3SXSA 2Y6MA 3R7VA 2Y9QA 5IQEA 5JGBA 4HYIA 3BHUA 4O0WA 4QDVA 4WG5A 4QPAA 3W8LA 5LQFA 1OPKA 3R71A 1QPDA 5FEDA 2PVRA 2YIXA 3GI3A 5FQDC 3PPZA 3V3VA 4AX8A 2I40A 5AV4A 3O8UA 1HCLA 3MB7A 4RGJA 3FQHA 4WBBB 3R6XA 1TFFA 3PJ3A 4OBPA 1BKXA 3W0OA 3ZO2A 4UXQA 4AW1A 1GIHA 2HK5A 4EBVA 5K5NA 3GQLA 4PMTA 2R64A 5HBJA 5DBXA 1AGWA 5TR6A 1GNGA 1XO2B 3VW6A 4O7NA 1ZYJA 3LCKA 4HCTA 1NXKA 5FUTA 4IDTA 4IFCA 2WMSA 2FGIA 3QC9A 4FSZA 4W4XA 1KE6A 3OY1A 4QYGA 4CQEA 5IA4A 4AU8A 2CLXA 4O81A 5C8MA 1OECA 3E62A 4CGAA 1Q8ZA 3SKCA 4AXEA 4ZY5A 2R3QA 3O0GA 3G0FA 2W5AA 2YCSA 4L00A 3R83A 2QODA 2HIWA 5AP7A 3VBQA 4AA4A 4DGGA 4DH1A 4MCVA 4GG7A 4KS7A 3P5JC 3TACA 2RFDA 3FDNA 2XJ0A 3Q2JA 5AFVA 3AD6A 3HA8A 3WYXA 2ITPA 3HRCA 4DH3A 2XRUA 5JFSA 2B9IA 4IBMA 3OMVA 1W8CA 5EDRA 3HDNA 4PTGA 3LXLA 4MXXA 3A7HA 4J95A 5L3AA 3D83A 4FZ6A 5KMKA 2ITVA 2W1EA 5IQDA 5M56A 5CAPA 4IAZA 4WNPA 3ORIA 5I9YA 3DB8A 4G2FA 4UYNA 4GUBA 3THBA 2XKCA 3ZONA 2I7QA 4G6NA 4O86A 3SVVA 4A9UA 4DGLC 2GS7A 4EOIA 3H3CA 1B6CB 5DA3A 1M52A 2FSTX 4NFNA 4B8LA 3PWYA 4OW8A 5LWMA 1IRKA 5G6VA 4CV8A 4FI1A 3Q9YA 4FKJA 4HYHA 4I1ZA 4JG6A 3LFSA 4U40A 4EEVA 4AGUA 4D4SA 3CJFA 4CT2A 2JEDA 2C5YA 4RLKA 4UWYA 3JXWA 4XRJA 4C2WA 2XYNA 3IECA 1Z9XA 3WZUA 4RA5A 2VZ6A 4BICA 3OCGA 4AAYA 3KCKA 3MS9A 5GJGA 4EBWA 2GNFA 4F65A 4D4YA 2E9PA 2GNLA 1JKTA 5HTBA 2FVDA 2YM5A 5DI1A 4TWOA 3SD0A 4GT5A 3TZMA 4XV3A 2JDTA 4IH8A 3VBVA 3WI6A 3NEWA 3EZVA 4O7OA 4FKRA 4YZBA 3NYVA 3V6RA 1LR4A 4I0TA 1I44A 2ZM4A 4TNBA 5HO8A 5C4LA 4GFGA 2ZDUA 3HKOA 2UW6A 5HTCA 2JIUA 3VONA 3V5QA 2GS6A 3DTCA 4F7SA 1MP8A 1U5RA 3EL8A 3QLGA 4XP0A 4QDEA 4ZSAA 4FKPA 5KBQA 4BCQA 3OW4A 3ODYX 3RKBA 4B7TA 3MVMA 4DTBA 2IVVA 4S33A 3FLNC 3V04A 4I24A 2G9XA 4BBFA 4H3BA 2PZYA 2V5QA 2BALA 3CLYA 4M67A 4V0GB 5CVHA 4U0IA 2W9FB 5A6OA 5LMAA 3ORZA 3POZA 3RWQA 5JKGA 2PK9A 5DGZA 5HE3A 4XHKB 1PKDA 2CKQA 3EFKA 2VWZA 4FICA 3UYSA 4DHFA 4ZLOA 3CCNA 1PXLA 3K2LA 4QMQA 5J9ZA 3ORKA 3BV3A 4H39A 4PMSA 3FUPA 2R0UA 3L9PA 3ZXTA 1SYKA 3EQFA 2WEIA 2J90A 2ITOA 3R2BA 3U9CA 2XK3A 3Q52A 3PG1A 4EK6A 3NNUA 3TNPC 4WNMA 4JBPA 4NJDA 5ANJA 5JK3A 4JQ8A 2R2PA 4I6QA 4D28A 4I5CA 3RJCA 3IDBA 4AT5A 3F82A 3LFQA 2OJIA 4EOMA 2W17A 3C4ZA 4CCUA 3QGYA 3MJ2A 3DAEA 4IVCA 1ST0A 4TKSA 1M2PA 4HZSA 2V22A 3EFLA 4L7FA 2ZJWA 3NNXA 2HZNA 2OICA 1GIIA 2XNGA 3G9NA 2GHMA 3O96A 4NW6A 1Y6AA 1KE7A 3TNWA 3PWDA 3KN6A 3FLWA 4RBLA 4R3CA 4RFZA 4BF2A 1LP4A 4G3GA 5F94A 3NS9A 4EOPA 4F0FA 3PA5A 1YI6A 2I0EA 2VO3A 2JKQA 3QLFA 4JBVA 3CP9A 5HVJA 3ZCLA 3BLAA 5CAOA 2VO6A 1Q99A 1VJYA 3KF4A 4RX5A 3KKVA 4QMYA 4FTOA 5CVFA 4IB1A 4BHNA 5DR2A 4LQMA 4FTRA 3WARA 5FDPA 2C0IA 4YU2A 2YFXA 3N9XA 1DI9A 1OKWA 3D14A 2PUIA 3P1AA 3E8NA 2WU7A 1XBAA 4IAIA 4XV9A 3H9FA 1M14A 2BZKB 4G6OA 5CX9A 3IGOA 4GIHA 4U3YA 5JGAA 2R5TA 3IK3A 3Q4CA 4R7IA 3AC5A 3OT8A 4U6RA 2J0LA 4QP7A 3Q04A 5FP6A 3I79A 3I60A 3R7YA 4CLIA 3QQGA 4DH7A 2W4KA 2R7BA 4JIAA 5C1QB 1GZOA 5HORA 3RPYA 4YJUA 3F5XA 1YHWA 4F78A 3DQXA 5HIDA 4XOYA 4RIYB 5HGIA 4HNIA 5CSPA 2G01A 2HZIA 4BCOA 4WD5A 2JAVA 3NAXA 4QTEA 3VAPA 3BLQA 4LRMA 2OK1A 5D9HA 2Z02A 4GVJA 5CEOA 1ZOEA 3FSKA 1OMWA 2RKUA 4YTHA 3LCSA 5EKNA 3AC2A 4LOOA 3C13A 5J8IA 5KMMA 3CD3A 4GL9A 3ZZEA 4OTWA 4X3JA 4APPA 5LVNA 2OJ9A 3OXIA 3GFEA 4EOLA 3E7OA 4QMZA 4YNOA 4PDSA 4Z16A 3FY2A 4M14A 4IWPA 3SX9A 5D7AA 1EH4A 3UVQA 2PL0A 4M8TA 4DCEA 2J0IA 2XKFA 4IC8A 4EQMA 5BUEA 3EL7A 2C4GA 2KTYA 2WMTA 4E20A 3AC8A 4PL4A 4A4OA 4IE9A 4U41A 3BI6A 3R30A 2OO8X 1GZ8A 4MXYA 3KRXA 3KEXA 2C5VA 4I41A 3RK9A 4GU9A 3CTHA 4LRJA 3BYVA 1WBNA 4M0YA 3UMXA 5ETAA 3LLAA 3V5LA 3LE6A 5FDXA 1YRPA 4MH7A 5ANKA 1JOWB 4BIEA 4U42A 2UVXA 4FV3A 2QR8A 3FAAA 1SZMA 4QTAA 4FG8A 4EZ5A 3ATSA 3F2NA 3U87A 1JLUE 2HXQA 2R3PA 4EUTA 2BTSA 2XUUA 4RIOA 3FHIA 1GJOA 1Q62A 4RMZA 3O7LB 5AUYA 5EHYA 4TL0A 3DJ6A 3PSBA 2NYAA 4DEHA 3QAME 3UIMA 4L6QA 2X9EA 3BL7A 4FSUA 2WFYA 2IO6A 4O7PA 3PJ1A 2XK8A 3ZUTA 3MFUA 1H08A 2JLDA 3W0RA 5K9IA 4RIXB 5TO8A 4YTIA 4ZEGA 4CMUA 2ITNA 4YGAA 5TOZA 3UC3A 1WBTA 4CXAA 2ESMA 3ACJA 2OH4A 3BHHA 3HP5A 4Q5HA 4AS0A 4YPSA 3QUEA 3NNVA 4TYEA 2C6LA 4FSMA 4HZRA 4K9YA 4WNKA 4M68A 2JDOA 2XAMA 2P2IA 3QKKA 4ZSEA 3G5DA 2W5BA 3DBFA 2FSOX 3MIAA 1XH8A 1ZOHA 1KE5A 3O7LD 3QCYA 5L2IA 3BWJA 3ORTA 5IA5A 4JDHA 3OTUA 3N4UA 2ITWA 2PUPA 4MNFA 5KMIA 4F6SA 1KOBA 2J2IB 3GFWA 1ZYCA 4FEVA 3Q60A 4ORKA 1SVEA 2GQGA 2F7XE 3BE2A 4E6DA 4UALA 4O0UA 5I9VA 2HY0A 4L8MA 4LG4A 5CI7A 5EHOA 5E9EA 1JWHA 1AD5A 3E3PA 5M4UA 2J5FA 4PX6A 4PNIA 2UZEA 3UZTA 3LFBA 4CCBA 5EKOA 2UZNA 2XMYA 4JX7A 1OVEA 5CTPA 4BJJA 3KXZA 3TIYA 5A4QA 4AN9A 2OFVA 5CF6A 4A7CA 3SOAA 4BTMA 3DAJA 2YDKA 3GBZA 2FYSA 3GCQA 1ERKA 4RVMA 2YWPA 2Y8OA 3DCVA 2VX1A 4NTTA 4YHTA 4EH5A 4ZMFA 1LUFA 3UTOA 3FMJA 4ANQA 3AMBA 1FPUA 2JKOA 4YC3A 3RALA 4U80A 3VF9A 2XALA 4GSBA 3UIUA 4LV8A 4B99A 4JI9A 4QNAA 3M11A 3SQQA 4IJPA 4YLLA 5L2TA 4FT9A 4AE6A 3NYNA 3OG7A 4IX4A 4FSRA 5CXHA 4AGCA 3PIXA 1GAGA 2A0CX 3ATTA 3FYJX 1MQBA 4M0ZA 5CNOA 3RCDA 3P4KA 4BI0A 4G9RA 2Z60A 4O0TA 2QNJA 2WQMA 4OTDA 3ZBFA 1RE8A 3FBVA 4ZJVA 4ERWA 2JBPA 4M7IA 4DGNA 4RC2A 2F4JA 3QRTA 4O2ZA 4XG4A 4NUSA 4GU6A 1YDSE 1PMUA 3S3IA 2FSMX 1Q8WA 5DNRA 3M2WA 4F9YA 3PJ2A 1FMKA 4Y5HA 2BKZA 2F2UA 3PPKA 1PXPA 3AD5A 5KUPA 4FTMA 4J98A 1YW2A 4PV0A 1OIYA 1YOMA 3D5XA 3HZTA 3PXRA 4FL1A 5AM6A 5EQEA 1PXKA 2CGXA 4ZSGA 5F95A 1OKYA 4KIQA 2JDRA 2ZM1A 4F1TA 4O2PA 4JOAA 4DG2E 4C34A 2C69A 4X3FC 2QO2A 4JQEA 4GJ3A 4IEBA 4MF1A 4IAAA 4X21A 1H27A 4EH3A 4JXFA 5A4LA 4OTQA 4DG0E 2A19B 2H34A 2V55A 5T6KA 3QF9A 2G1TA 1ZARA 2I0YA 4F64A 3GU7A 4FTNA 4U7ZA 2C1AA 2FO0A 3I7CA 2QURA 3NUUA 3QUPA 1QPEA 2X2MA 3HMIA 4FTIA 4KB8A 4OLIA 4ID7A 4V0GA 4XEYA 2J5EA 2QG7A 5FTGA 3DNDA 2XIRA 4J52A 4FTKA 4JNWA 2WEVA 3AD4A 1WBVA 2RFNA 3TJCA 1G8SA 3TZ9A 2C6MA 4E5WA 3DFAA 5IH4A 4QT1A 4I23A 4LOPA 5EH0A 5IA3A 4AXCA 2UW7A 5E7RA 3Q6WA 3GENA 3PIYA 4O0SA 2XB7A 4EWHA 3AG9A 1PHKA 4AACA 3NVMB 2BMCA 3O51A 3L9MA 3KULA 2XNMA 4I0SA 4R5SA 4FJVA 4XLVA 2NRUA 4XLIA 3R7EA 5HO7A 4Z7GA 2XK7A 3Q4TA 2BPMA 2X6DA 2ONLC 3NVKI 3CTJA 2QG5A 2HW6A 2X7FA 3FZSA 4L7SA 2V62A 3MPTA 4PRJA 4NM7A 4XG3A 5DRDA 3ZSHA 1XH9A 2BILB 2NRYA 2VWVA 3G33A 2AEGA 1WVYA 4I6FA 4JBQA 4O6LA 2XKEA 3EFJA 3QFVA 3H0ZA 5C27A 2REIA 3U51A 1XJDA 5BX0A 3EJ1A 2GNHA 4XG9A 2IVUA 1DI8A 4W4WA 5D11A 5H8BA 3GC8A 1HOWA 5BYZA 2CKPA 4E8AA 3A8XA 3Q4ZA 3RVGA 3V01A 2W99B 2E2BA 2QHMA 3C0HA 4C7TA 4R7BA 2WQBA 4NK9A 3OTVA 3VULA 2YN8A 4FV6A 4K77A 1OM1A 4K11A 3NRMA 5BPYA 4NCTA 4EOJA 5D10A 4U45A 5IDPA 3ZMMA 2R0IA 3DXNA 2W4OA 1CKPA 5J1WA 3NCZA 4FE2A 3PVUA 1A06A 3E93A 3R8PA 2JBOA 2OJJA 2ERKA 4DFYA 1STCE 5CSXA 2XNBA 4L42A 5HIEA 3PUFC 4EUUA 2PVNA 3V51A 2Y6OA 3NUSA 3ZLYA 4QMNA 5B7VA 1NW1A 4KD1A 4XMOA 4A9YA 4G34A 4EKLA 3D7ZA 5HBHA 2RGPA 4YLJA 4MD9E 4C4FA 2ZMDA 4QP1A 5IQIA 3GP0A 2PVHA 4BBMA 4C3PA 2OIDA 1GZNA 4XS2A 4R77A 5HICA 1K2PA 2Q0NA 3BBTB 3VBXA 2XNNA 3CY3A 5I9XA 3COHA 3R2YA 4LGGA 4Y5QA 4YURA 5B2LA 3QZHA 4AXAA 2VTIA 3AKJA 5I0BA 5HE1A 2J0JA 4JX3A 4LV5A 4QRCA 4EHEA 2A1AB 4EH9A 2B9HA 3BCEA 4P4CA 4FV5A 1JKSA 1KWPA 1MUOA 3ZM4A 2PVLA 4Q9SA 4CFFA 2B55A 3F5GA 3MESA 4EHGA 1FVRA 2WOUA 3KU2A 4FL3A 4BYJA 1DAYA 4QMTA 4D4RA 5DEYA 2WU6A 4DG3E 5CU0A 4RA4A 4CG9A 2CGWA 2X9FA 2WTKC 1UNHA 3NNWA 4E4NA 4I92A 4G3EA 4GT3A 3QTQA 4L68A 3PP1A 2PU8A 2QC6A 2VU3A 4XG6A 2YEXA 3DBEA 1OL5A 3RCJA 2GFCA 4U97A 1MRYA 2YIQA 4P90A 2OZAB 4FKSA 3FZTA 3CKWA 2PMNX 2ITYA 4YZ9A 4CMOA 4NSTA 3PRIA 3HRFA 5KMOA 4IX5A 4RT7A 4XBRA 4NKSA 3HX4A 4B6LA 1HCKA 3DTWA 4RG0A 4K6ZA 3RMFA 3RPOA 3D2IA 2UVYA 4BCMA 1WFCA 2PTKA 5IQCA 4Y73A 1YWNA 4DFXE 4BZDA 4J99A 4CRLA 4FK6A 2NNWB 2QD9A 3DDPA 3C1XA 3DQWA 4JDIA 5AJQA 1QPCA 3AT4A 4EK5A 5H8GA 3ZOSA 2BFXA 3R21A 4DE4A 4RIWB 2JC6A 3BL9A 2QO9A 3MN3A 2ZAZA 5BYLA 3PSCA 1TKIA 3GNIB 1CMKE 4ZTSA 3R04A 1UKHA 4UZDA 3BLRA 3D5UA 4L45A 1U54B 3BE9A 5CYIA 4F6WA 4LDTA 1F5QA 1FVVA 1JNKA 1UV5A 3KF7A 4OTFA 3VQUA 3HV5A 3VN9A 2CKEA 3FSFA 4ZY4A 3NYXA 2QOLA 5BVKA 4ZJJA 1PYXA 1VYWA 3D15A 1V1KA 2OGVA 2P3GX 4IWOA 3U8WA 4BDEA 3LLTA 4RJ5A 4TW9A 1S9JA 3IOKA 4E73A 4YJOA 4ZAUA 4ASXA 3MH2A 4FNWA 4M84A 3NUXA 2O3PA 4EHZA 2W1GA 2BDJA 4E4LA 3S1HA 3P23A 5HNBA 3HV7A 3HRBA 3KREA 4BDHA 3V8TA 4AFJA 4CTBA 3OHTA 4D9UA 4GG5A 5L2SA 3CC6A 4UEUA 3F7ZA 4Y8DA 4QPSA 4X6QC 4AOTA 3OCBA 2VTMA 3O23A 3BGPA 5M4CA 3O2MA 3LJ1A 3TDVA 4AA0A 4HVDA 4EKKA 2E9NA 3OS3A 2W1DA 2PWLA 3VUGA 3V8WA 3EIDA 3FYKX 3DY7A 4QQCA 2WMUA 3DS6A 3R1YA 5A46A 2RG6A 2CCIA 4LYNA 2OJGA 2VWBA 2W1CA 3DAKA 3RI1A 4BRXA 3FXZA 3RAIA 5D41A 4FUYA 2QHNA 3KY2A 4AWIA 3ROCA 3UDSA 4C2VA 4D4VA 5IEXA 3Q96A 2HYYA 4JG8A 1M7NA 4EQCA 4BDBA 5AWMA 2J51A 5JFWA 4AGDA 3IW4A 3OW3A 4DT8A 4HCVA 4TYHA 3V8SA 1H4LA 5CU2A 2WIPA 3NUYA 4FEQA 4MXZA 3TWJA 3VHEA 2XF0A 3EN4A 3E64A 4DEBA 2GQSA 1CKJA 4FGBA 1O6YA 1IA9A 5H9BA 4QTDA 3ALNA 2PZPA 4EC8A 4EOKA 3LOKA 1CSNA 3PLAE 2XVDA 5A6NA 2BZHB 1ZY4A 2ZMCA 2CJMA 3FY0A 3KA0A 4IB5A 4XG2A 3NW5A 5IEYA 2YABA 1BI8A 1PY5A 5ANDA 4HVSA 1YXVA 2X6EA 1P2AA 3C5UA 3BX5A 5AX3A 3IPHA 5HG5A 4KKHA 1F0QA 4EZ7A 4I6LA 5GJDA 3R8LA 4A07A 4QQTA 4J7BA 1SM2A 4DHJA 2JAMA 1B39A 4LGHA 3W10A 1Z57A 2WAJA 4MWIA 4GT4A 5AEPA 4E6CA 3SG9A 3LFAA 1E9HA 5BVWA 5E8YA 3G6HA 3TZ7A 5LMBA 3UDZA 4O0RA 4IAKA 4TWNA 4BVUA 5C8NA 3GCUA 4N4SA 1U4DA 2IZTA 3PZHA 2X4ZA 4X0MA 3LMHA 3MSSA 1ST4A 4FTLA 2R7IA 1H07A 4ANSA 2QKWB 4J1RA 4F9AA 3OD6X 2PE1A 5ICPA 2J9MA 2R4BA 3ACKA 4PP7A 2JITA 4OBOA 4PUZA 2OJFE 2Z2WA 4ALWA 3P5KA 2P55A 4GK2A 3TNHA 3DNEA 3PPJA 4WUAA 4CFNA 4YUQA 4ALVA 4APCA 3RWPA 2WMRA 4O0XA 4AQCA 5C9CA 3TKIA 2WNTA 4O0YA 1H0WA 3A7IA 4O7VA 3MFTA 4QO9A 4I5MA 3VIDA 3GCPA 5CSWA 4L46A 2UZDA 4E6QA 3A60A 2C3JA 4FTUA 3O71A 3EOCA 2GNGA 4YSJA 4MQ1A 4BI1A 5IDNA 3R9HA 3P7CA 4ZZMA 2YAKA 2OXDA 3C0GA 3JY9A 3WZJA 1Q61A 2YIYA 3BV2A 5DHJA 2XEYA 1P4OA 2Y4IC 2IW8A 1OGYA 2GHLA 3MVHA 3EB0A 2BCJA 2XIZA 1NY3A 4YJRA 4WRSA 4ITIA 4IACA 3IONA 4KA3A 4ACMA 3HL7A 5CEIA 4RC4A 4JS8A 4HVIA 4J53A 4X3FB 1V0OA 4RQVA 1K3AA 2C5OA 5AP6A 4ZZOA 3KRLA 3H9RA 4RX7A 2W1IA 2E9UA 4AGWA 3QZIA 2UZVA 1NVQA 4U44A 5ANGA 5AUVA 5TF9A 4AE9A 4FKGA 5JQ8A 2X4FA 3PVBA 3HNGA 3RINA 4RZWA 4BIDA 4AUAA 2PPQA 3WF9A 3KMWA 1YOLA 5LOHA 3MI9A 3T8OA 4EWQA 4IHPA 4Z7HA 3KN5A 3C5IA 2VTLA 4IZAA 2Z7QA 1WBPA 3VRZA 3LCOA 3MWUA 4QP9A 5H3QA 5H2UA 2X8IA 3R1SA 3CTQA 2BZIB 1Z5MA 2YM3A 4IX3A 4L52A 3FE3A 5C4KA 4E5BA 3EHAA 3PA3A 1PMEA 2CN8A 4EL9A 2XZSA 3FC1X 4ENXA 1OKVA 5KKRC 4UYAA 2CGUA 3COIA 1PXJA 4PDPA 3OT3A 1L8TA 2QOHA 4UY9A 2RG5A 4HPUE 3F5PA 2VTRA 2ACXA 4AP7A 5KMLA 5AAGA 4AW5A 1W98A 4J97A 5K3YA 3R9RA 2W1ZA 3TT0A 2FSLX 4BYIA 4E7WA 5J7HA 1ND4A 1YXXA 3MDYA 3WF8A 1YHVA 1UU8A 1H01A 3F7WA 4B9DA 3RAWA 5CF5A 2NPQA 2PULA 2VD5A 4I4EA 4QMOA 3RGFA 3RK7A 3OOMA 4FTTA 1OUKA 3N4VA 3PUPA 4FEUA 2HAKA 3IW6A 3IW5A 1XQZA 2RL5A 4IZYA 5CQUA 5L6PA 3AC3A 3VUKA 1Q4LA 2BRBA 3BYMA 5BUJA 4LV7A 2YCRA 4ACCA 5I9WA 4L01A 4IC7A 4RWJA 5FM3A 3VS4A 1YHSA 3NIZA 4OTRA 5EW9A 4MHAA 4OBQA 2P0CA 4C58A 5KMNA 3WBLA 3U55A 5BVDA 2PMOX 1M2QA 4FT0A 4I22A 1GIJA 4RVLA 4NT4A 2WKMA 4IB0A 3C4CA 3OBJA 2G2IA 4K33A 4MYGA 4NW5A 4O7RA 5FG8A 5C26A 3TUBA 3CGFA 3ULIA 3ZLSA 5KO1A 4BIBA 1Y57A 3L9NA 3U4UA 4DDIA 5IISA 1FMOE 1W82A 3V6SA 3DBCA 2H6DA 4TN6A 2UZLA 3LFEA 4ZTRA 4LOQA 3UYTA 3Q3BA 4MBLA 3HECA 3ZBXA 2CPKE 4RIWA 3B2WA 1AQ1A 4IM2A 5DE2A 3A4OX 1E1XA 2ZV2A 2F49A 5FTOA 3UPXA 5E91A 3SXRA 4IFGA 4AXFA 5E1SA 1U59A 4MNEB 5DFPA 3KMUA 4QYYA 4ZSJA 4KS8A 4I93A 4OTIA
chains in the Genus database with same CATH topology
2W9ZB 4ZTQA 1SNUA 4DFZE 1UNLA 4EYMA 5CU6A 3WOWA 3UZRA 2VX0A 3AT2A 3LFDA 4BTJA 1H00A 1Y8YA 2WTKB 4RX9A 3UNKA 3HYHA 5FGKA 2EB3A 4FIJA 3ORNA 3UOKA 4ZZNA 1H25A 4JAJA 3R01A 2Y7JA 5AP3A 4XG7A 2PSQA 4R3PA 4KBAA 4DLIA 3LJ0A 3B8QA 3TCPA 3HVCA 1G5SA 2C6OA 5BMSA 4D9TA 3S0OA 2VN9A 2WMBA 4D1ZA 5HE0A 4CNHA 4YZCA 5FD2A 4BHZA 4F7JA 4R78A 2O64A 2DQ7X 5HCYA 3DJ7A 3EWHA 3TIZA 3MW1A 5IMXA 2ITZA 4YJTA 3EQPA 3IW7A 1ZZLA 1JKKA 2X81A 4NU1A 4D0XA 2B54A 3GC7A 4FVPA 4PMMA 3QQKA 4WKQA 3W0MA 3W0QA 2VTHA 4X2FA 5IEVA 3KXGA 2UW5A 3LQ3A 3R1NA 4N57A 2LAVA 3ZDIA 4C4IA 4UZHA 4LMNA 5ITAA 2IG7A 4GK3A 4F9WA 3OCSA 2YZLA 3VW8A 2XIYA 3QQLA 4JBOA 4P5ZA 2XCKA 4IAFA 4YBKA 2WQEA 3CY2A 3H9OA 5IQGA 3OP5A 3JUHA 3TDWA 4KWPA 5DPVA 3R9DA 3D7TA 2UW4A 2PZRA 3GU6A 2VUWA 4FOCA 5LMKA 2CHLA 4TRLA 1YWVA 4XBUA 2R3MA 3OFMA 3OY3A 4ZTLA 2AUHA 4AT3A 3PFYA 2BUJA 4FKIA 2O2UA 4N0SA 3I7BA 1Q5KA 2W0JA 2ZYBA 4FV2A 4LUDA 5E8XA 5CS6A 1PMVA 4ZS0A 3RP9A 1OL7A 1OIQA 5M4FA 4YTFA 4Y72A 1H8FA 2C30A 1WVXA 3P86A 1URWA 5GIPE 4A9TA 3FPQA 4HW7A 4WZYA 5FP5A 4DEIA 3NPCA 4MBIA 1YDRE 4C02A 1Q8TA 5D12A 1OL6A 3O17A 4CZTA 1ZYDA 1WBWA 3OUKA 4BDCA 5HI2A 3D2KA 3VS3A 3S00A 4RSSA 3I6WA 3PE2A 4FKLA 2OXYA 4J8NA 4C0TA 5FXQA 5LXMA 4BDDA 3QA0A 3II5A 4RZVA 3HMOA 1JSTA 3H30A 4RJ3A 5LJJA 3EQDA 5EOLA 3TUCA 2UZTA 4KNBA 3TMOA 2GNJA 3A62A 2PY3A 4ZSLA 2VRXA 4RRVA 4LI5A 3UC4A 4WSYA 2R3JA 4GS6A 4FVQA 2PZ5A 3A61A 1IA8A 1XH4A 2VTQA 3COKA 2B9FA 1PKGA 3D9VA 3GC9A 5IH5A 2JDVA 2UZBA 3CD8A 1L3RE 4QYHA 5BVEA 3ODZX 2EXMA 2V7AA 3HV4A 1BMKA 3ORXA 5EM5A 5HNGA 4AZWA 2A27A 3IS5A 1REJA 1YKRA 2QCSA 3COMA 2HCKA 3MB6A 3ORPA 3QCXA 4JAIA 3P78A 3PY0A 3VUDA 4BZOA 5JGDA 4P5QA 4RQKA 3BKBA 1FGIA 4CFWA 3E5AA 1Q41A 1BX6A 5HX6A 3TL8A 3UO4A 3V5JA 5J1VA 4YMJA 4RFYA 5AAEA 4WHZA 3PG3A 3SLSA 2WELA 4Q5EA 5EYCA 3VVHA 3LFCA 2ZV8A 5CEMA 5KX8A 4D5HA 3GOKA 5JN2A 3WIKA 4CVAA 3FZ1A 4RJ4A 5F1ZA 3CIKA 3ERKA 3PXFA 4KSPA 4C35A 2BKKA 3QD2B 4BCNA 4BB4A 3OXZA 5EQPA 4F9CA 4FT3A 2E9VA 1K9AA 3QQUA 3H0YA 4NM3A 1BL6A 5HG8A 5C01A 1Q8UA 3ZSGA 4DBXA 3W2QA 5AA8A 3V5WA 3ORLA 4YZNA 4HPTE 3I5ZA 3RM6A 4AA5A 5HESA 5CAUA 3HV6A 3JS2A 3WE4A 4AZEA 2W5HA 3MPMA 4O22A 3QTUA 2UZUE 5E8UA 4S30A 2BAKA 5BV3A 2OZOA 2LGCA 4XCUA 3FLZA 3QCQA 4FVRA 3NW7A 4MEDA 1ATPE 4EH4A 5HEZA 5T68A 2ERZE 2VTNA 3UZPA 5J9LA 4KBKA 3QQHA 5ANEA 4O91A 3G0EA 1QCFA 4MAOA 3QRKA 4QQ5A 2YZAA 4PDOA 3G15A 1XHAA 3DLZA 3DV3A 4ZY6A 5JQ5A 3DFCB 3SXFA 2JFMA 2Y4IB 3K3IA 3LCDA 4YHJA 1W0XC 3C9WA 4YHFA 3L8SA 5HNIX 2UZOA 3MH3A 5EM7A 2QKRA 4CKJA 4K8AA 3VF8A 1W7HA 3AGMA 3Q2MA 4QMWA 3DZQA 3JVSA 3WF6A 4BCGA 5GINE 5KCVA 2VWXA 3PTGA 2WTVA 3BQRA 5DN3A 4ASZA 5C8KA 3E88A 4B0GA 5A9UA 2BZJA 3ROYA 4ENYA 2WQOA 4ZJIA 2VGOA 3UDTA 3QRJA 5EW8A 2BROA 1J7LA 4I6BA 3TJDA 2YDIA 3I0QA 4J71A 4PL5A 2BRNA 3UNJA 3F69A 3ENMA 1M2RA 3NX8A 1UWJA 3SGCA 4MWHA 1TQMA 2E9OA 5DT0A 1R1WA 4FODA 3LXPA 2VO0A 3SOCA 4NWMA 4ZS4A 2FA2A 3KXNA 4YNEA 3AC4A 3LFFA 4FNZA 2C68A 1ZMUA 3IGGA 4L53A 3FMMA 5AUXA 2IZSA 5AP0A 3LCTA 3SC1A 5BUIA 3U6JA 2BFYA 2OLCA 5CAVA 5ETCA 1RQQA 4U43A 1IR3A 2OXXA 4QQJA 4U98A 5FEEA 3QGWA 3AMYA 3PJCA 4BGHA 1T45A 2BTRA 2QONA 3P79A 5DEWA 4CFVA 3CJGA 4XJ0A 2UW3A 1BI7A 4FV7A 3DU8A 2ITUA 3GGFA 4JL9A 5A4CA 1Q8YA 3C0IA 4FZAB 4PTEA 3SRVB 2CKOA 3CBLA 1QMZA 2FB8A 2XYUA 3ML1A 1OUYA 3NLBA 4NJ3A 2JIIA 5L8JA 5KKRB 4I94A 3Q9ZA 4BCFA 1H28A 5IA1A 3O8PA 4YZMA 3HP2A 2QR7A 1OI9A 3GCSA 3Q32A 1BL7A 4WT6A 2BIYA 3F61A 5HKMA 4I3ZA 5M08A 3EQCA 3VC4A 2I1MA 4G31A 4D55A 4PMPA 2YJSA 2JD5A 4M13A 3SW7A 4MNEA 4DFUA 1H1PA 4KRDA 4BDKA 3CE3A 3FI4A 3PLSA 4BN1A 3G90X 1WVWA 1RJBA 5KHXA 5L2WA 3Q9WA 4O0VA 1T46A 1DM2A 4D2RA 1KV2A 1ZYLA 4HGTA 2IVTA 4RWKA 3F3UA 4BDFA 2I0VA 3OWKA 1TVOA 5DR9A 1FVTA 5CEQA 2YITA 3LJ2A 5D1JA 3UP2A 3P08A 4MXOA 4NL0A 4UV0A 1Q3WA 4YP8A 4EORA 4BGGA 1URCA 2R3IA 3TI1A 5IQHA 3I81A 3AGLA 4C4JA 4F1MA 4H05A 3IDCA 4RC3A 2XJ2A 4XV2A 4X7QA 4RIYA 2WMWA 4RJ6A 5J87A 5IA2A 4HGLA 4PY1A 1UNGA 3UIBA 4TYJA 3OROA 2GPHA 2ITTA 3KIOC 5EFQA 4AT4A 4O7TA 5JFXA 5I9ZA 4CKIA 4FG7A 1Q3DA 2O63A 4AZSA 3FLQA 1G8AA 3UQCA 3W8QA 2ITXA 3MIYA 2CNVA 2G15A 3IKAA 3QALE 3DBDA 1XH6A 3W2SA 4BDGA 2QOBA 3GT8A 2F7ZE 3BELA 3TTIA 1H1WA 5L8KA 2QVSE 2XRWA 3R8MA 2BAJA 4WG3A 5A54A 4F0IA 4IADA 4YJQA 3HLLA 2NO3A 3EQHA 4FX3A 5TKDA 4FKVA 2H9VA 2HY81 5IF1A 4XRLA 5DT4A 3OC1A 1KSWA 2AYPA 4DFBA 4H36A 4F08A 4FYOA 4QYFA 4S34A 4YZDA 3W2PA 1H0VA 3W55A 4E5AX 2WPAA 3MTFA 2DYLA 3HDMA 4DGMA 3TM0A 1MRVA 1SNXA 3K5VA 4C4GA 4YJVA 4H58A 4QP2A 5I4NA 2GTNA 2YM6A 3HA6A 3ZS5A 3PJ8A 2XANA 3BGQA 5EI8A 2PYWA 4K18A 3I4BA 2X8DA 3Q6UA 1NVRA 3GUBA 3WF5A 4F9BA 3F2AA 3FLSA 4G17A 3T9TA 3HUCA 4W4YA 4GCJA 4GKHA 3TEIA 5AUWA 5AP1A 2ITQA 3QYZA 3OCTA 4DEAA 4JR3A 3W32A 4IDVA 3MPAA 2GDOA 5AUUA 5LVMA 3D94A 1M7QA 3JR1A 3CR0A 3VS2A 4GK4A 5EDQA 4ZLYA 3S4QA 3W1FA 1YI4A 2GS2A 2VV9A 2CGVA 4FYNA 5KHWA 4BC6A 2R3RA 3EN5A 5DG5A 5M44A 4RIXA 2GHGA 3H10A 3ZEWA 4IIRA 2QOKA 4ANLA 5CF4A 2WHBA 4USDA 1KE9A 4JT3A 3W2RA 4HGSA 4U5JA 3HAVA 4QMLA 4DDGA 1DS5A 5AV0A 4YSMA 4O96A 4EH8A 3E87A 3RNYA 2VTSA 3NIEA 5FM2A 2CSNA 1APME 3UG1A 1J7IA 5LCJA 3E7VA 2F9GA 4H1MA 1FQ1B 2VO7A 4BI2A 3QZGA 3TV7A 4CMTA 4DTKA 1V0BA 5M55A 5JMSA 2OIBA 3HV3A 4TYGA 1TQIA 3LMIA 2HXLA 2QU6A 2B1PA 2VAGA 4JRVA 4FBXA 3VQHA 2W1FA 4F70A 4Q9ZA 5GIOE 1BUHA 1WBSA 2GTMA 3FLYA 4M69B 3BBWA 4P7EA 1GOLA 3NZ0A 2X2KA 3FJQE 2XM9A 5FRIA 4QTCA 1TQPA 1ZWSA 2VTPA 4FTCA 4FIFA 3ENHA 4EJNA 4NZWB 1QL6A 1VYZA 2VX3A 3C4XA 4H3PA 1W84A 3EKKA 3C4FA 5ETIA 5JT2A 2JIVA 2PUNA 3AQVA 4TPTA 4YO6A 2JDSA 5DR6A 3FI2A 3F2RA 3FL5A 4XYFA 4YJNA 1OBDA 3QWKA 2BAQA 4NIFB 3KFAA 4Y95A 4BCHA 5A4TA 1P5EA 3EQRA 3FWQA 2OIQA 2ZDTA 2HOGA 2GFSA 3A7GA 2QOQA 3FKLA 2QOIA 3OUNB 4MTAA 2C6EA 3LAUA 1J3HA 2XS0A 4BGQA 5IA0A 1OB3A 4I5PA 4IM0A 1SVGA 1OL2A 2R3LA 4G3CA 1CDKA 4AG8A 5CY3A 3QTSA 4NTSA 2RF9A 3R73A 3K54A 1MQ4A 3HGKA 1DAWA 3MY1A 3RNIA 3TKUA 3EQIA 3D5WA 5B0XA 5EW3A 4MUQA 2DWBA 3MJ1A 1J91A 3ORMA 5FLFA 2C5NA 2SRCA 4KABA 4EQUA 1Y8GA 5AUTA 4F99A 1KV1A 3VBTA 3UDBA 4I0RA 2X0GA 5I5ZA 4H3QA 1FINA 3TN8A 4HJOA 3BEAA 3GOPA 5FBOA 5LVLA 4A9RA 2HWOA 5CT0A 3PXQA 4ZTNA 4KUJA 5AMNA 2QO7A 3ZC6A 4FEWA 2C6KA 4C3FA 5M07A 2OWBA 3EH9A 5CAQA 5E90A 2ZB0A 2J0MB 2XIXA 3RAHA 3PXYA 4FIGA 3AC1A 1JBPE 1YQJA 2A2AA 4BTKA 5JH6A 4PF4A 3UVRA 5HCXA 2F2CB 1OITA 4O6EA 1GY3A 5LARA 1R0EA 2OH0E 3BRBA 4NM5A 3PXKA 4WUNA 3QYWA 3VS5A 3QTRA 2BRMA 3ZXZA 2PUUA 4GH2A 3R7UA 3E63A 1PW2A 1U5QA 2HZ0A 3DOGA 3EMGA 3AKLA 3KB7A 3KVWA 1WCCA 5HVKA 4EJ7A 4ZXTA 2C1BA 3NUPA 3OXTA 4D1SA 4X6RA 2AC5A 5A4EA 2HW7A 3E8EA 3AKKA 4L3LA 3BHYA 3G2FA 3MFSA 4LMUA 4ASEA 4FKQA 3DBQA 3MBLA 4K0YA 3H4JA 4FV8A 4O7YA 1XR1A 3WILA 4EH7A 3EN7A 3WIGA 2X2LA 5K4JA 3IW8A 4GYIA 2WXVA 2VTOA 3F9NA 3CKXA 3I1AA 4FEXA 4M15A 2RFSA 3QC4A 4YPDA 5JZJA 4FR4A 4KAOA 4LFIA 4QMUA 3QTXA 4XNEA 5HG9A 4DHIB 3SRVA 1ZZ2A 1OL1A 3FC2A 4IZ5A 1A48A 1PJKA 3HAMA 3FI8A 4O84A 5KMJA 4BCKA 5E4HA 2GU8A 4F0GA 3VRYA 3S2PA 3W0NA 3QQJA 3R7IA 4FZDB 3FMEA 3ZYAA 4CKRA 1ZRZA 3MA3A 2W05A 2YIRA 2PVKA 3PVGA 5AP2A 3GC0A 3S95A 2WTCA 3DDQA 4F6UA 1P14A 3KC3A 4UX9A 2YM8A 3DKOA 2XBAA 3KXMA 3LW0A 3M42A 4V04A 4LL0A 5IUGA 5AP4A 5HE2A 3UOHA 2W96B 3BU6A 3EN9A 4DFLA 4E26A 3FXXA 4JVGA 2X39A 5HD4A 5BMMA 4L9IA 4F7NA 4GJ2A 5EYMA 3BU5A 3VUHA 2UZWE 3QBNA 3UMWA 2WMVA 2R3KA 2YM4A 3NYOA 3TV4A 4MXAA 4BJJB 2FUMA 2JKKA 3KK8A 3DA6A 1CKIA 3KVXA 5CNNA 5HQ0A 3DXQA 5DWRA 2XK9A 5IQBA 2VTAA 4E4XA 3CS9A 5HU9A 4C4HA 2Z7LA 3LXKA 3QL8A 4X2KA 1YXTA 2KULA 3LXNA 3QXOA 5CT7A 2RFEA 3ZZWA 4AZVA 4RLLA 1Y91A 3VUMA 1RDQE 4ZTMA 2YERA 4U9AA 1H26A 2W7XA 2UVZA 3MYGA 1FOTA 4IAYA 4ANMA 5HHWA 4OTHA 3PDTA 5CZHA 4ZK5A 4P2KA 4DGOA 5CALA 4PP9A 4WBOA 1UU7A 2C3LA 4MQ2A 3T9IA 1R0PA 3W16A 2DUVA 1OBGA 3ZO4A 3C4WA 4DINA 3FMNA 4GFMA 5BVNA 4USEA 3AXWA 1H1QA 1XBCA 1RW8A 4XP3A 5EQYA 5IMEA 2B4SB 2Z8CA 4LUEA 3FQSA 3FMHA 3VNTA 3L8XA 4TXCA 4RVKA 3F3WA 3SV0A 2GNIA 4KRCA 2WMAA 2CLQA 1XBBA 4KKGA 3DLSA 3PRFA 3DB6A 2OBJA 2GSFA 3D0EA 4R1VA 3UIXA 2UV2A 4EK4A 4A4XA 5D7VA 4J8MA 1PRYA 2YIWA 3QWJA 1G3NA 4AW0A 5DRBA 2VWWA 3QX4A 4YBJA 2ZB1A 3D4QA 4ONAA 2JKMA 2XJ1A 3BZ3A 4Y46A 3ZU7A 2HELA 4MD7E 4BY9E 2BHEA 4EZ3A 1XMLA 4OUCA 5AIKA 5ETFA 5ACKA 1JKLA 4K1BA 3ZRKA 2OZAA 4XX9A 2ZFYA 4V05A 2CMWA 4QTBA 2Z7RA 3QTWA 3TNIA 4DCAA 3LKMA 4DH8A 2QLUA 5I9UA 4QMVA 4KBCA 3VS1A 2PE2A 2QQ7A 3L9LA 1YVJA 4FK3A 3Q5ZA 3OBGA 1W83A 2WTJA 3GCVA 3KQ7A 4XG8A 4AN3A 4CRSA 1KE8A 3GXLA 1R39A 2ZVAA 3NWWA 1YWRA 1VR2A 3VBWA 4ARKA 4FSQA 2P33A 2PVJA 1JSVA 3NW6A 4EONA 3U6HA 3UOJA 4ITJA 3DXPA 1SMHA 3ZLXA 2BRGA 2OSCA 2WTDA 4BR3A 2V7OA 3DZOA 3QZFA 5AP5A 4F63A 1U54A 5HVYA 4NKAA 5FTQA 5IH6A 3QQFA 4B8MA 3OZ6A 4G3DA 2OFUA 3KULB 2B9JA 2J7TA 5HLNA 3ZFYA 2Y4PA 2C6IA 1ZXEA 4CZUA 2VNWA 4IM3A 4W8DA 5AAFA 3ZDUA 3NFGB 3NUAA 3WE8A 5FXRA 3GVUA 4GRBA 1YOJA 3PVWA 1JSUA 3KMMA 3QUDA 3FZPA 1BYGA 4G3FA 5JRSA 1G8JA 3K3JA 2EWAA 5CENA 1LPUA 4DEDA 3QKLA 3FMKA 5B2MA 5L6OA 2X7GA 3SDJA 2XBJA 4DEEA 2EUFB 4HVGA 3E8DA 4FA2A 4PL3A 1OGUA 2QLQA 2VTJA 4RJ8A 4BCPA 3BHTA 4CG8A 4C33A 5IQFA 1FBNA 3UOLA 3DK3A 4II5A 1KOAA 3LPBA 4EC9A 4QMSA 5HG7A 3OWJA 3QTZA 3PE1A 5GJFA 5M51A 3M1SA 4UBAA 5FBNC 3CPCA 2B7AA 2J50A 3NR9A 4NFMA 4OGRA 4R3RA 4FIEA 3BWFA 4IWDA 1Y6BA 1A9UA 3Q4UA 3KRJA 4AN2A 3AOXA 1IG1A 1V0PA 3CQEA 2ZM3A 5BVOA 5J9YA 2WIHA 3UVPA 4BZNA 4EH6A 4BCIA 4O83A 3LZBA 5AA9A 3QA8A 3TG1A 5M4IA 5AIRA 4CSVA 4JDJA 4O27B 1YDTE 1XKKA 2XK4A 4CEGA 4D58A 3SG8A 1G8KA 4YO4A 4C59A 2YACA 3NGAA 3OOGA 3P9JA 1NVSA 3BYSA 2C0OA 3R02A 3VS6A 4CTCA 4FV9A 3UG2A 3BU3A 4FV0A 4WRGA 2XH5A 4ACDA 3W0PA 5AX9A 2WD1A 2NP8A 5EG3A 4AZFA 4YTCA 3MVJA 4WIHA 2XKDA 4USFA 4YC8A 5HLWA 3F66A 3MTLA 4FKUA 2EU9A 5CEKA 1JVPP 1WBOA 3FMDA 4G1WA 5GNKA 3TXOA 3DJ5A 3BQCA 2XNOA 3MFRA 4R5YA 3ZC5A 1ZLTA 3QHWA 4I4FA 4QOXA 5E8VA 3RAKA 2R9SA 2C47A 3RHKA 3EFWA 4YLKA 1QPJA 4LM5A 5GHVA 3ZRMA 2IVSA 5EM6A 5KZIA 4AAAA 3UPZA 3PFQA 5CU3A 4UXLA 3VJOA 2XP2A 5H8EA 2XARA 2ZV9A 3LFNA 5DOSA 4ZLZA 3MY0A 3TZ8A 4MK0A 3GU5A 3BIZA 2UUEA 1XMMA 3L8VA 4G16A 4U81A 4C38A 2BVAA 5F20A 4D0WA 2WGJA 4IVAA 2HENA 3MA6A 1REKA 5G1XA 4QMMA 3GEQA 1KUTA 3RPVA 1OPLA 2XNEA 2YCQA 3QKMA 5CVGA 1XH5A 3ELJA 3ZLWA 5CSVA 4C3RA 2X1NA 5JSMA 1B38A 3ULZA 4FZ7A 3VBYA 4FGRA 4R1YA 5CQWA 4RX8A 2PZIA 1UU3A 3MH0A 3WZEA 5J5SA 3JVRA 2IZRA 2C6DA 4IQ6A 4IB3A 2R3NA 3IG7A 4A06A 2P2HA 1WMKA 2HZ4A 3QRIA 3RM7A 4O38A 2QOFA 3V5TA 4BCJA 3SHEA 2YCFA 3C4EA 3KXXA 2QU5A 2WTIA 3GU4A 4WG4A 5EYKA 3IO7A 4FKOA 3MGYA 5JZNA 4DAWA 2VTTA 4GKIA 4W4VA 4I20A 4C62A 5AM7A 3CGOA 3DKGA 1Q24A 3ZSIA 3ALOA 3F5UA 3LMGA 2BR1A 2OF2A 2EB2A 2PHKA 3EQBA 3EYGA 3PXZA 4N6YA 2O0UA 4NH1A 3RZBA 1PXNA 4UWBA 1PXIA 3F3VA 2XIKA 4X2GA 4PWNA 2QOOA 4W8EA 4TY1A 4RFMA 5DIAA 5CF8A 3OEFX 1J1BA 3OEZA 3R8ZA 1ZAOA 1VEBA 4OR5A 3N4TA 4BTFA 5F9EA 5LMKC 2B52A 2C0TA 1CTPE 4X3FA 3F88A 1JQHA 5AV3A 2VNYA 4Y83A 4U3ZA 5HD7A 3Q9XA 2W1HA 2EXCX 5EI2A 1ZMWA 2ETMA 2WMXA 3POOA 4HYSA 4ZP5A 3ZEPA 2VWIA 3PYYA 4U94A 4AOIA 4ZMEA 2EVAA 4ZTHA 4BDAA 4O7ZA 5EI6A 5EDPA 2J0KA 3QRUA 4EK8A 2JGZA 3FZOA 3K5UA 4QP4A 3RK5A 4EI4A 2A4LA 2UW9A 1OKZA 3P7AA 4DN5A 3TV6A 3VJNA 4C61A 3EZRA 3O5AA 3TNQB 3EQGA 3R7OA 5BQ0A 1OPJA 1IEPA 5E8ZA 3UODA 5E8TA 3FEGA 3UJGA 4FIHA 4V01A 1Q97A 2BRHA 1VZOA 1S9IA 2CCHA 3W2OA 1CM8A 1YXSA 3BYOA 2IN6A 4O7SA 5T3QA 5M53A 3SAYA 4CD0A 3BPRA 2C3IB 5KZ0A 4AQKA 4TT7A 2AC3A 4AFEA 4AF3A 1UU9A 4AOJA 4O82A 2UW8A 4DYMA 3UE4A 4TNDA 3ZO3A 4IJ9A 2ONLA 2J4ZA 4TYHB 2ETRA 3OVVA 3ZTXA 4RWIA 3KK9A 2PVFA 5CLPA 3KGAA 4MX9A 2RIOA 4FNYA 5CASA 3FXWA 4FSNA 4BDJA 2CNUA 2ZOQA 2PVYA 3A4PA 3R1QA 3R63A 1H24A 4KINA 4U8ZA 4XUFA 4FIIA 2GQRA 2BIKB 2HWPA 3I5NA 4XH6A 5HCZA 4DFNA 5CEPA 4J96A 4QP3A 4FTQA 4JIKA 2O5KA 4JR7A 4F1OA 4GMYA 1R3CA 3MH1A 4HCUA 4GFOA 3LM5A 3R8VA 3TTJA 3A7JA 4FMQA 3ZUUA 3W2CA 4HGEA 1P4FA 4IVDA 2C5XA 4EH2A 5IPJA 3MVLA 3F6XA 3JY0A 4IWQA 5F4NA 4D1XA 3QXPA 2UW0A 5FEQA 3AMAA 4FKWA 5CI6A 3VS7A 3PZEA 4FUXA 2IWIA 2W06A 3WZDA 4PNKA 3N51A 1J7UA 3B2TA 3SW4A 5J95A 2IZUA 4OT5A 3MY5A 3LHJA 4F7LA 4H1JA 2OF4A 2R3HA 4ASDA 3WYYA 1NT2A 1IASA 5M09A 3NSZA 4FKTA 4UWCA 4DC2A 2BHHA 5LWNA 3L1SA 1ZMVA 2IW9A 5L8LA 4FZFB 2VWYA 2WMQA 4FSTA 4GEOA 4IVBA 2XK6A 4L44A 3A2CA 3A7FA 3CPBA 4NM0A 4EOSA 3G6GA 2WTWA 4FSWA 2OKRA 3FZRA 4EK3A 4HVHA 1ZYSA 2XNPA 2O8YA 2YDJA 4M97A 5EOBA 4FTJA 3NCGA 5KNJA 4PDYA 2WB8A 5IU2A 3OF0A 4YJSA 3ZRLA 3GB2A 3I6UA 5DVRA 3VWAA 4A9SA 4EOQA 5CXZA 3CQWA 4FSYA 4G6LA 5AUZA 4DTAA 4JRNA 4FT7A 4IW0A 2I6LA 4GYGA 3PSDA 4LL5A 4N6ZA 2Q83A 2XEZA 5EK7A 1I09A 4TWPA 1OIUA 4EHVA 5EM8A 4O7LA 3E8CA 3R22A 3I0OA 3Q53A 4FOBA 5K5XA 2Z7SA 4XV1A 1PF8A 5DYJA 5IZFA 4I21A 3PIZA 5E92A 4HOKA 1WAKA 4WOVA 4HNFA 1H1SA 4CV9A 4OT6A 5E1EA 5EYDA 2OI4X 3G51A 4RWLA 3T3VA 4F09A 2H96A 4QEBA 3V5PA 2P4IA 3FKNA 3U6IA 3QD0A 1O6KA 2BDWA 3LIJA 4CFUA 4GIIA 4AW2A 4JLCA 3PY3A 4FV1A 4KIOA 4O7WA 5CSHA 2OG8A 4DA5A 1FGKA 4GVAA 4DHZA 3TUDA 4CFXA 3CEKA 2QOCA 5AV1A 1OIRA 3QD3A 5IUIA 4K2RA 3R00A 4EYJA 3FMLA 4PTCA 5CWZA 4WO5A 4GW8A 4O21A 3ZFMA 1O6LA 4OTGA 3KRWA 5A3XA 4FL2A 3MV5A 3DK7A 1YI3A 5M57A 2DS1A 3HMMA 3RPSA 5IUHA 4G5JA 2GMXA 5DH3A 2Y0AA 4YR8A 3GU8A 3PY1A 4G5PA 4U79A 3VUIA 3NDMA 4KIPA 3FI3A 3UQFA 2V0DA 4D2SA 3IQ7A 3Q5IA 1ZY5A 2WZJA 2J6MA 1MRUA 2YHVA 1VLRA 2CN5A 3FQEA 4XOZA 4PQNA 3PA4A 5BVFA 3ET7A 5LVOA 4M12A 3WF7A 1YXUA 4I5HA 3QCSA