3W0OA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia, ternary complex with adp and hygromycin b
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0oA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0oA02
2BKKA 4CGAA 3SG8A 3ATSA 5BYLA 3ZM9A 3FI8A 1J7IA 2PUPA 3SG9A 5IQGA 4U94A 3W0MA 5EQPA 2OLCA 3W0SA 2CKPA 3Q2JA 3W0QA 4BR3A 4FEWA 3UZRA 2CKOA 3G15A 3W0PA 5C4KA 5IQCA 4FEXA 4DT9A 3DXPA 5EQYA 3FEGA 4H05A 3HAVA 3LQ3A 3TYKA 3SGCA 2IG7A 1ND4A 5FUTA 2PYWA 4N57A 3JR1A 2B0QA 3N4VA 5IQIA 4DA5A 4O7OA 5IQFA 1J7UA 3N4TA 2PUNA 4GKIA 4FEUA 5IQHA 1NW1A 4U98A 4R7BA 4O7PA 3CSVA 2CKQA 5IQBA 4PDYA 4R77A 2Q83A 4GKHA 4DT8A 4DTAA 4DTBA 3ATTA 3N4UA 4R78A 4CG9A 5C4LA 4DFUA 5EQEA 3W0NA 4DBXA 5IQEA 4DE4A 2PPQA 5IQAA 3TDWA 4ORKA 1L8TA 3MESA 4EJ7A 3F2RA 2PULA 2QG7A 3C5IA 2PUIA 4DCAA 2I7QA 3W0RA 4DFBA 2PU8A 3DXQA 3W0OA 3HAMA 5AFVA 4FEVA 1J7LA 4CG8A 3TM0A 5IQDA 5FTGA 3TDVA 4WZYA
chains in the Genus database with same CATH superfamily
4PX6A 4FKJA 5BYZA 2X8IA 2R3LA 4FBXA 2W06A 2VV9A 4L68A 4LV7A 4BDIA 3P7BA 4XLVA 4I94A 4MXCA 5DFPA 1ZOGA 3PLSA 2F2CB 3ACJA 3RVGA 4AWIA 4MWHA 1ZY4A 2X4FA 4FJVA 1B39A 1H07A 2VGOA 4GFMA 1XBCA 3I1AA 3KXHA 5FM3A 5BUEA 5JEBA 4AXCA 5KMJA 2IWIA 1PYEA 4DEGA 3OZ6A 3R2YA 1TKIA 3D14A 5CEIA 4EZ7A 5IEYA 5JGAA 1SMHA 1H00A 4BBMA 4LV5A 4EC9A 3Q9WA 3DOGA 4G9CA 5F94A 2XNPA 4QP3A 4UV0A 4BTMA 4FV2A 3VRYA 2O5KA 4C7TA 4I5HA 3W2CA 5ACBC 4JX7A 1URWA 4KBKA 3L8VA 4XG2A 3OWKA 3K2LA 5FRIA 4UALA 3NAYA 3UG2A 4WD5A 4PP7A 4Y5QA 3FQSA 4FSQA 4CLJA 3E8NA 3D2IA 2NRYA 2JDVA 3I7BA 3M11A 4HYIA 3QYWA 5HO8A 4D9UA 4OT5A 2C69A 2JKKA 1U54A 4U0IA 1R3CA 4C2VA 1STCE 5KBRA 1M7NA 3IW5A 4QNAA 1FVRA 2Z8CA 4HJOA 1A9UA 4B4LA 3F9NA 5EK7A 4AE9A 4BJJA 1B38A 3GC0A 4PDSA 4O7LA 4NYEA 2V22A 5CU2A 5DN3A 3LMIA 4ANSA 3AKLA 4O6LA 4AU8A 4RFZA 4O96A 4O81A 2OF2A 4S2ZA 4RX5A 4K6ZA 4FEUA 5DT0A 4C62A 3KC3A 4I6HA 3GC9A 3TNHA 4CKJA 3NUYA 4FSYA 5I9WA 3FXZA 1XBAA 4PDYA 4AW5A 5HLNA 5EOLA 4WT6A 5IA5A 1PMVA 3HRBA 4QT1A 5A54A 2XALA 1YXUA 5JFXA 1JWHA 1YXSA 5IU2A 3QYZA 3UYSA 2QC6A 3T9IA 2FSTX 3WZDA 4ZLYA 1OIYA 1XO2B 2WEIA 4LG4A 4M84A 4JNWA 3MY1A 3HRFA 1QL6A 1ZYSA 3MTFA 3D15A 4IWPA 3KXZA 4YZ9A 1NVQA 4JIKA 3WZKA 2IVVA 2UW9A 4BB4A 1PXLA 2WQBA 3AT2A 3VW6A 4R5YA 1BYGA 5C03A 2Z7SA 3KRLA 2W1HA 2YDJA 3ENMA 4PNIA 3KK8A 4LUEA 2IN6A 3PA3A 1H28A 2R3OA 4ANBA 5AM6A 4ZJIA 3PWYA 2B7AA 5A4LA 4FR4A 3TWJA 4OTQA 2X4ZA 4YJUA 5E8WA 1LP4A 3W2SA 3MESA 2YACA 3QUEA 5AUZA 2OZAB 4XP0A 4F9BA 2Y4PA 3S00A 5CVFA 1W7HA 2ETMA 2GDOA 2VX3A 4N70A 2VNWA 4TYGA 4RFYA 2O2UA 3QZHA 3CIKA 2OJ9A 3D5XA 3LJ0A 1SYKA 2GQGA 3OCBA 2PHKA 4FKPA 3V04A 4RJ4A 4EKKA 4ZMEA 2NNWB 3LFBA 5FD2A 1AD5A 3ZLYA 5JH6A 1WVWA 3BYMA 3EN4A 3P4KA 4H3QA 1NT2A 4PWNA 4HYHA 5HTBA 4XBUA 3VF9A 5EM6A 1GZNA 2BRMA 4GCJA 4XS2A 2WMQA 4BTJA 4M0YA 3SG8A 3R63A 1PMNA 2GSFA 2J0IA 4PMMA 5HD7A 4ZS0A 2X1NA 3I0OA 2B9HA 3TUCA 4HZRA 4A06A 5DGZA 4FT5A 3KU2A 1Y8YA 4FKSA 4ZMFA 3K3JA 4QMSA 5IA1A 1ZLTA 2W4OA 2XKFA 4FUYA 1YHSA 4EHVA 3TNIA 2XK4A 5KZIA 2I40A 4C37A 2YDIA 2J6MA 4RJ8A 4XG8A 5KX8A 2VWYA 4RT7A 2Z60A 3R7IA 4I5PA 3HNGA 4RC4A 3QFVA 2QOQA 3CJFA 2A19B 4NT4A 4FEWA 2WTVA 5G1XA 3UZRA 1YOJA 3IW6A 3W0PA 3FKLA 4ACDA 4YNOA 4DEIA 3NPCA 5IQCA 5I9YA 3E5AA 1YXTA 3P7CA 3QTZA 3NSZA 4NUSA 5GNKA 2B9FA 4DGLC 3H4JA 3G0FA 3Q3BA 3C13A 4ZK5A 2J0KA 1OUYA 3AGMA 3Q52A 4DHIB 4O84A 3RPRA 4Y8DA 3R83A 4FKIA 1M2PA 1CSNA 2ZAZA 3P86A 3F7ZA 4OBPA 5AIRA 5DR2A 3AGLA 5ANKA 4DEAA 4JOAA 3GCPA 3VS0A 5F4NA 4JLCA 3POOA 2QU6A 3BGPA 3EQCA 4FT7A 2GTMA 4I0TA 4YJVA 5DEWA 2OXXA 3DY7A 4U40A 2JKOA 2WIPA 1JKTA 4MEDA 1FMOE 4WOVA 3WYYA 5LMBA 2ITWA 2JD5A 5BVDA 5DWRA 3TKUA 4U97A 4U43A 4GKIA 3UZTA 3JPVA 4C35A 3ZRMA 4DGNA 3DAKA 5IH4A 2XKCA 4OLIA 5IDPA 5BVFA 4FV0A 4LL5A 3KVWA 2B9JA 2JIIA 1Y6AA 1MQBA 1OIRA 2ESMA 4FT0A 4O2ZA 4RWKA 4L42A 4DBNA 1DS5A 4MXZA 2C3LA 4CFVA 3KXGA 3LZBA 4EEVA 4FK6A 5AA8A 4RQVA 3RI1A 5DOSA 3OUKA 4GT3A 4L01A 4E6AA 2PVMA 1Q62A 3BU3A 2QURA 3CXWA 4ACHA 2JDRA 3SW4A 5AAEA 3E88A 2PZRA 4QP9A 2WQNA 3SX9A 3Q9YA 2HW7A 2C5YA 3BLAA 1OPKA 3HVCA 4O21A 3KCKA 3SXSA 5EDRA 4DEEA 2ITNA 3KRXA 2Z02A 4RA4A 2C6DA 3NWWA 4FTMA 3S1HA 5KMNA 5DBXA 1M17A 4D1ZA 2XKEA 3E64A 4IWDA 4B8MA 4J8NA 2VTLA 1JPAA 2VAGA 4LMUA 4O7NA 3OROA 4BY9E 5FBOA 4D2SA 4DLJA 1FVTA 2B55A 4IDTA 3LFDA 5L6WL 5D11A 5L2SA 4IIRA 4UN0C 4AZSA 4D4YA 2R0UA 3W0OA 4UXLA 5CXHA 1AGWA 2PE2A 3R00A 3SKCA 4ZIMA 4I5CA 3FXWA 4EHGA 5HE1A 4BHNA 2QI8A 3O71A 4IAZA 3OOMA 1XR1A 4TWOA 4YLJA 5ICPA 4YJSA 5E8SA 2W96B 4IC8A 2OZAA 2JFMA 2GNJA 3N9XA 2CGVA 3Q32A 4AQCA 4XJ0A 4IC7A 4AZWA 4EHZA 4ZZMA 4B9DA 3QCQA 5T3QA 1T45A 2CLXA 2YISA 5AV1A 1UV5A 4FIJA 4D5KA 4CSVA 3SW7A 3LXKA 3CY3A 5LJJA 4RLKA 4X2FA 3PXQA 5AUYA 4NFMA 2ZB1A 3A61A 4RC2A 3VBVA 2UZWE 3C0GA 3VW8A 1H8FA 3V8TA 1GIIA 4FK3A 1MRUA 3PY0A 4ID7A 4K18A 4D4VA 2VTOA 4IBMA 4DN5A 2P2IA 2EUFB 3FYKX 3HECA 4KSQA 4IZ7A 1TQPA 4ACCA 3CY2A 1YVJA 3DGKA 4AOIA 3I7CA 5C4KA 5H8BA 3U6JA 2J2IB 1P4FA 2Y4IB 4F09A 3DXPA 4G16A 2ZVAA 3FEGA 4FNZA 4BR3A 2OFUA 3LQ3A 3MVHA 1RE8A 4KBAA 4FTLA 4IVCA 5CWZA 5AP0A 4QYEA 4M0ZA 3LJ2A 5M44A 4D0WA 2IG7A 4GT4A 4NCTA 3UVQA 4WG5A 2R3JA 3R02A 4ITJA 2XNMA 5IPJA 4FV9A 4NSTA 2EXMA 5AV0A 5IA4A 1V0OA 2OBJA 3QLFA 3QQUA 1I09A 4WRSA 4O6EA 4ZY6A 2R3NA 3MSSA 3VS1A 2JFLA 4FVPA 5ANJA 4EUUA 2OJIA 3RZBA 5H9BA 4M3QA 2AYPA 1LEWA 4JDHA 4G5PA 5DT3A 4YGAA 1H1SA 4I6LA 4AW1A 3OTUA 2J5EA 3NNVA 4O7YA 2Z7LA 2GQSA 4FKQA 3R8VA 4EI4A 3PJCA 4ERKA 5CEKA 4AP7A 3QQLA 4MBJA 3MVJA 1ZMVA 2X81A 4F1TA 2C6EA 4RC3A 4YJPA 3W33A 4EOSA 2W5BA 3PJ8A 5C4LA 5C8KA 3MVLA 3HKOA 4IB5A 4S31A 3F69A 4KKGA 3VO3A 4AA0A 1M52A 3FMEA 1LUFA 4K33A 3FZPA 2PVJA 4FKGA 3QZGA 4IANA 4QMOA 4ZEGA 3MIAA 3EQFA 2RKUA 4FKRA 4YJRA 4G6LA 2W1GA 3E8CA 3U4WA 4U9AA 3HLLA 1BI8A 1WCCA 3OP5A 3ORZA 4MXOA 2FH9A 1U5RA 3PYYA 4DFYA 3PA5A 4KKEA 3IDCA 2HWPA 1XH5A 3ORPA 1H25A 4K77A 5TF9A 4PTCA 4M67A 4O38A 5FTQA 2W1IA 2GFCA 1WZYA 1GZOA 4QTCA 5CU6A 1H0WA 2C1BA 2RFEA 2XP2A 3NCGA 3O23A 2B1PA 4FTRA 4GSBA 4AF3A 2BRNA 3S4QA 2I7QA 3OD6X 1QPCA 3R8LA 2ITTA 3QTSA 3ALNA 4NM5A 2JLDA 2QOHA 3RPYA 2C6MA 3NIEA 3TM0A 2OIDA 5T68A 5IA3A 3R21A 3UE4A 3G9LX 5CU4A 2IW8A 4D58A 3Q4CA 4EHEA 3U54A 1IRKA 3G6HA 3DQXA 4CT1A 3ATSA 4L6QA 4ASEA 2KULA 3VBQA 4N0SA 3R1SA 4FSUA 5AWMA 4FUXA 5CF5A 3LFCA 3HV5A 3SV0A 3TMOA 4BGQA 5LMKA 3TNPC 5FEEA 2QOIA 1SM2A 4IQ6A 2VWVA 2V7OA 1YWVA 4MQ2A 2Z7RA 3LCSA 4EH3A 1PKGA 2BCJA 2ZFYA 3LFSA 3LW0A 3QQGA 5AM7A 3RMFA 3GQLA 3KMWA 3VQUA 4DHZA 2CKPA 2VWUA 4A9TA 1O9UA 4M97A 5BMMA 3ERKA 3DBCA 2A4LA 3LLAA 4LUDA 4RX9A 3PPJA 4FA2A 3WE4A 4KA3A 4BYJA 4CTBA 2GNGA 4AN3A 4TYJA 5TKDA 2J4ZA 4CKRA 4CCUA 5DG5A 3WIKA 3ELJA 3FI4A 4O7WA 5AP6A 2QODA 1KWPA 1KE8A 3HMPA 5FUTA 2CJMA 5EI8A 4GG5A 2X7OA 3NYNA 1J91A 3D5VA 3ZO3A 1CTPE 4H1JA 3I60A 1UNLA 2YITA 3OXTA 1P5EA 3PG1A 4AS0A 2WMTA 3DV3A 4DH3A 2YIRA 3FLQA 4G6OA 4I4FA 3VONA 2YABA 4JX3A 3QGYA 3KCFA 4AN2A 5M06A 5I9ZA 4H36A 3GU7A 4HCUA 3EN7A 5LOHA 1YI4A 4CMUA 3PLAE 3C1XA 3EQBA 3II5A 3FSKA 4GVJA 5IQBA 4YSJA 1BMKA 5CF8A 4CFUA 1XKKA 3ODZX 2VTRA 3B2WA 3ROYA 5HBJA 2QLQA 4AX8A 1BUHA 4XH6A 4E6QA 2WU6A 4K2RA 5A14A 1OGUA 2W1DA 4XCUA 3ZEWA 3ITZA 1ERKA 4O7RA 4DGMA 4PF4A 4DFUA 1P14A 1G3NA 2EB2A 1R1WA 4WNOA 1KSWA 3IDBA 5HG9A 3TJDA 5BVNA 1SZMA 3F5GA 4I4EA 4YBJA 2Q0BA 2YIYA 3HUBA 2BR1A 2J7TA 5B0XA 5D7VA 3QU0A 5M07A 3F3WA 4XP2A 4O0WA 1OBGA 4TPTA 5AUTA 3PZEA 5I4NA 2PTKA 4YC6A 3UNJA 5IH5A 4XRLA 3A4OX 4H3PA 2P4IA 3NYOA 3C5IA 2UZDA 3UG1A 5BQ0A 4V05A 3BYSA 5CEQA 1ST4A 1YI3A 2FSMX 2RFNA 4FKOA 4FGRA 3IKAA 4GFGA 3UNZA 3HMNA 2XK9A 3PRFA 1IA9A 4UY9A 4BCMA 2B53A 4MCVA 4M14A 3UQFA 3CR0A 5TOZA 3DKFA 2OH0E 2EVAA 3R1NA 2X39A 3BIZA 1OPJA 4IX3A 4R1YA 3SRVB 4BCKA 1FINA 3PZHA 3NUNA 1Q3WA 5E8VA 3TV4A 3EQHA 3ORMA 5A4TA 4EH6A 3MB7A 4W4VA 3VF8A 5HX8A 4XG4A 2XBJA 5IG1A 4AGUA 5DNRA 4BDDA 2XRUA 1NY3A 1V0BA 5CVGA 3ZBFA 2PZ5A 2YEXA 4F9AA 1ST0A 3FC2A 1OPLA 5JQ5A 2Y4IC 4O7VA 3ORTA 1M2RA 4UWBA 4IAIA 3O7LD 5AP3A 4G2FA 1ZOEA 2X2MA 2XJ0A 3HEGA 4ZXTA 5KE0A 4E5BA 4PRJA 2XM8A 4XEYA 3R71A 3KGAA 5IUGA 3UDTA 2NPQA 3G51A 2QOBA 2CKOA 3KREA 4LRMA 5BX0A 4DT9A 4C59A 2PZIA 3H9FA 4IVBA 4JS8A 4XV2A 2JAMA 3MY5A 3DNEA 4FSNA 3HRCA 3OG7A 4QYHA 4EWHA 4F7SA 4JIAA 1J1CA 1ZMWA 2HXQA 2VO6A 1KE9A 2XVDA 3W8LA 2J50A 2XBAA 5JGDA 4PDPA 2VU3A 2GQRA 4JL9A 4GV1A 1R39A 2QOLA 1F5QA 2XNGA 4EOOA 4HPTE 1O6YA 4EJNA 4L3LA 2XYNA 2YAAA 3QF9A 3GUBA 2O8YA 4NM7A 4QPAA 5LWNA 3UVRA 5IQHA 4H58A 2F7ZE 5KZ0A 4X3FC 5HKMA 1XMLA 2DWBA 2V7AA 3QX2A 4S34A 5AX3A 3BX5A 5HICA 3KULB 1G8JA 3ID6C 3KF4A 3PJ2A 3HX4A 4FIEA 4L43A 5L2TA 2WMBA 3P78A 3R9HA 4DT8A 2PVLA 5M09A 4AZEA 3PSDA 4AXEA 4O0SA 2BFXA 2PSQA 3MFUA 3PA4A 3MFTA 2NYAA 3TZ7A 3W2RA 1WBSA 1H27A 4Z16A 4BDEA 4C4EA 3NGAA 3RPVA 4QQCA 3WZEA 2I0EA 4WG3A 3F66A 4P7EA 5FEQA 2IVTA 4FKUA 2ZV2A 5LVLA 5CNOA 4A9YA 3ORLA 4QP2A 5HG5A 3SC1A 2XRWA 4ZTSA 4XRJA 4YU2A 3F3TA 3GT8A 4O91A 5F20A 1WFCA 2WTCA 2PVYA 4J53A 1W84A 3QKLA 5F9EA 5CT0A 3LHJA 3VN9A 2WELA 2WMWA 4O0UA 2NP8A 5K4JA 4WBOA 4G31A 4D1XA 5EM5A 3F61A 3TCPA 2PULA 2UZOA 4FSMA 2QG7A 5KMMA 1URCA 3LMHA 1B6CB 1VYWA 4A4LA 3U8WA 4EK4A 4EQMA 5FDPA 4JG8A 3ANQA 2ZV7A 3MY0A 4QMMA 1I44A 4QYFA 2QG5A 3FXXA 2QKRA 5JFVA 4EQCA 4F63A 3ORNA 5EM8A 5H8GA 4DLIA 3O5AA 4JJRA 3P79A 4Q9ZA 3E3PA 3NX8A 4WZYA 4BZNA 1H0VA 4I0SA 3TT0A 3GCVA 1P4OA 2PVFA 5AV2A 4CT2A 4EOKA 3SDJA 3OW4A 3QCXA 3DTCA 3OY3A 1FGIA 1TQMA 2PE0A 3I5ZA 3COHA 5BYLA 2F4JA 2W9FB 4JG7A 2BIYA 3BQRA 4XV9A 1HCKA 3EFWA 5HHWA 3CD3A 3KVXA 4X0MA 2A0CX 2W1EA 3U87A 4ANLA 3KRRA 5B2LA 3WZJA 4BC6A 4C58A 2JGZA 2VO3A 1Q24A 3KK9A 5I9UA 4K8AA 3BI6A 4EKLA 1UNHA 1IA8A 2I6LA 4RIYA 4XG3A 3SRVA 3BHYA 4GL9A 5M08A 5AADA 4FT9A 1XH8A 5EQPA 4GU6A 2ZYBA 4ITHA 2FGIA 3A7IA 1MUOA 3QD3A 4FTUA 2VNYA 4JBQA 4CFNA 3F7WA 3E7VA 4DDIA 4GFOA 4KKHA 4L3JA 2CSNA 4RPVA 4B8LA 3FLYA 2CGWA 3VUDA 4EH4A 2HXLA 2XIRA 3LJ1A 3NUXA 3BHHA 1R78A 2IPXA 5CAQA 2JBPA 3R30A 2X7FA 3DT1A 3R8UA 5CSHA 5FP5A 3PUFC 3ZDUA 1WAKA 5BUIA 2XB7A 4DITA 5M4IA 3RGFA 4PTGA 1NXKA 4DH5A 3TJCA 1CM8A 3CTHA 2XANA 2WMXA 5CU0A 3VVHA 3FKNA 5BUJA 2GCDA 4DGOA 2IW6A 4GT5A 4UYAA 4L8MA 3OOGA 4A07A 2PE1A 3EIDA 4HNIA 4E4LA 3S2PA 1REKA 2GU8A 1KV2A 4PL5A 2CLQA 4ZTRA 4AT3A 1U46A 3I6WA 3MTLA 3MDYA 3LPBA 4BTKA 2F57A 1ZZ2A 2VUWA 2JEDA 2CPKE 2PVRA 1UU8A 3EQRA 5LMAA 3FPQA 3VUHA 4EBWA 3NW6A 5ITAA 4R78A 2Y8OA 2Y9QA 2BTSA 2YCFA 3FMJA 4D5HA 2XEZA 3QQHA 3W0NA 2HENA 2HK5A 2Z2WA 1JQHA 3HUCA 1WMKA 4EH8A 3S0OA 3V8SA 5IZFA 2X2KA 3WF9A 3GOPA 2XH5A 3KULA 3B2TA 2C6LA 4M8TA 4MNEB 4PV0A 2YIXA 1JKKA 2BZIB 3M2WA 3QRJA 4DGGA 5FG8A 4EJ7A 5FP6A 4O22A 4FZFB 4FTNA 4EOJA 5LVMA 3VUMA 4G3GA 4RIOA 1YI6A 2WKMA 3DNDA 3BHVA 3R9RA 3TL8A 4KAOA 2PVNA 5LXMA 3D7TB 5J7HA 3WIGA 4ZTQA 4D28A 4JT3A 2VD5A 4TY1A 3FZTA 2WQEA 3CGOA 4CV9A 4ZJVA 5CANA 5AAFA 4EH9A 1JVPP 2XYUA 3Q2MA 3UOKA 3ZU7A 3CQUA 5EG3A 2PMNX 2OJJA 5HX6A 2R3MA 4ASXA 3CE3A 3TEIA 4NTTA 3UGCA 5EI2A 3GNIB 4YSMA 2WAJA 3IOKA 4MQ1A 3BL7A 5E8YA 3VAPA 2ETKA 1YRPA 3DDPA 3NNWA 4KABA 2RG6A 4FTIA 2XUUA 4EC8A 5KNJA 2JAVA 3EH9A 4BF2A 1JLUE 4BDBA 2E2BA 4E4MA 4FG8A 1SVHA 2WB8A 5ACKA 1XHAA 1E1VA 3FI2A 4M12A 2OIBA 4ASDA 3VNTA 2WEVA 4QTBA 4BCHA 5JGBA 4U8ZA 4A9UA 4GK3A 4QP1A 5GIOE 3BGQA 3CPCA 4FKLA 2OG8A 3MVMA 4G5JA 4XV1A 4YC8A 2IW9A 4KRDA 1PF8A 4ZJJA 5HIDA 3HV4A 2C3IB 3R0TA 2XAMA 4D4RA 3MA3A 2XNNA 4GMYA 5EOBA 4IAYA 3W0SA 3D0EA 4BCNA 2C6KA 3Q2JA 5A3XA 2E9VA 3UYTA 2YERA 3BYUA 3G15A 3O8TA 1YXVA 4KRCA 3TV7A 1WVXA 5EW9A 1M7QA 3HV3A 4HZSA 3H0YA 3NDMA 3NRMA 2ZV9A 2J90A 3PXKA 5LVOA 3PY3A 4U3ZA 4IZAA 2C5OA 2BFYA 3VC4A 3P5KA 4Y85A 4NL0A 5CYIA 3H30A 3MH0A 1CMKE 3AMBA 3R28A 4WHZA 3RALA 3OF0A 4KD1A 2FYSA 3DB8A 2GHGA 2RFSA 3COMA 3BLQA 2BZKB 4EZ5A 3ODYX 4IHPA 2G01A 3N4VA 3ZZEA 4EYJA 3DB6A 4IWOA 4QO9A 3ZXTA 1VJYA 2ITPA 4EWQA 4RQKA 4FT3A 4OTRA 4F64A 4R1VA 3EOCA 4O7TA 4OTGA 2UUEA 2PUNA 4OTWA 1Q4LA 2UW0A 3OBJA 4V01A 1U5QA 3EYGA 3FQHA 3R73A 4B6LA 4EORA 4CLIA 2YCQA 2GNIA 3CSVA 3O17A 4RJ5A 1FOTA 3KEXA 3I81A 4QP8A 3BKBA 3UC4A 5K5NA 4IADA 2JBOA 3D4QA 5DVRA 4I93A 2H9VA 5J9LA 4HNFA 1NVRA 3D94A 4FSRA 5AEPA 4H39A 2QNJA 4M13A 2I1MA 3V01A 2AUHA 2XNOA 1FMKA 5CF6A 4NJ3A 2V5QA 1UWHA 1IEPA 3AD6A 3A8WA 3CTJA 4JI9A 3KXMA 4RVLA 2OH4A 2WFYA 4FSWA 4X21A 4E1ZA 1XQZA 3ZFYA 3BWJA 3U6IA 3KN5A 1PRYA 2ITQA 3R2BA 4IMYA 4WBBB 5L8KA 5L6OA 3EZVA 3AC4A 5I0BA 2OF4A 1G5SA 3KXXA 3PXZA 3JXWA 4HCTA 4TYEA 4OBQA 4WG4A 4CXAA 4Q5EA 1W83A 1XH6A 4EH7A 2V0DA 3DK3A 3KN6A 4FZ7A 2J0MB 1Q8UA 3LOKA 1PXOA 4I6FA 4WNMA 3F2RA 5HCXA 2XMYA 4IW0A 4L3PA 3ZZWA 2PUIA 2OFVA 4AXFA 4C4HA 3QRKA 4HVIA 3CCNA 4DFBA 3SLSA 1YWNA 4L7FA 5AP7A 3A99A 3QKKA 3V6RA 4JBOA 1OIUA 5LCJA 4R3PA 1XMMA 1J7LA 3ZXZA 4AXAA 1K2PA 2QCSA 2V55A 3RTPA 4D1SA 4AE6A 1PXJA 3TI1A 5K9IA 3L9MA 5L2IA 5BVOA 5DRBA 2QD9A 4CGAA 3Q04A 3RCDA 3BV3A 5IDNA 4AT5A 4FNXA 4FKTA 2O63A 3SQQA 2C5XA 5JZNA 2C0OA 5ANIA 3KMUA 3ZHPC 4ARKA 4BCIA 3UOJA 1GNGA 4BIDA 5E8UA 3CQWA 3H9RA 3FQEA 1QCFA 4BDHA 5L8JA 2VTQA 5KMLA 2UW5A 5FQDC 3JY9A 2VTNA 2W7XA 5KMIA 3V5QA 1AQ1A 1K3AA 3VHKA 4HVGA 5IQGA 4U94A 3HMOA 4QMYA 3SVVA 2BMCA 3HP2A 3FWQA 2V62A 1UKIA 4G9RA 4S33A 3RK5A 5IEXA 5C27A 3PVBA 2R2PA 2XCHA 2HZ4A 4F9CA 3CLYA 3IGGA 2XIYA 3Q9ZA 4TT7A 4JMQA 2P0CA 4XUFA 2FB8A 3BU6A 3O7LB 4RJ7A 4C36A 2UZVA 3QD4A 1ZWSA 2UW4A 3QL8A 2FSLX 3MYGA 4BCQA 3IOPA 3O51A 4YJNA 2R64A 2W1ZA 2WTWA 3G9NA 3QLGA 4U81A 5I9VA 3LE6A 1FBNA 4JBPA 2YWVA 3Q6WA 4F6UA 2VWWA 4YUQA 5J5SA 4NZWB 4EOMA 2QHMA 3RINA 3RK9A 1KOBA 5FBNC 5C26A 2QR7A 1YHWA 1J7UA 4O0TA 3N4TA 3E87A 5A6OA 3TN8A 5CZHA 4USEA 2XKDA 2GS7A 1YW2A 2ZMCA 3ENHA 4BCGA 1OKWA 3FLNC 1RDQE 3WF5A 4C4IA 3AQVA 3H9OA 4PL3A 3R7OA 3PPKA 4MXXA 4LDTA 3A7GA 1WBVA 4YTCA 2ZMDA 1OM1A 1CKJA 1LR4A 2CGXA 3IONA 2B4SB 2Y0AA 3VBXA 3ULZA 2YM8A 3ZSHA 4NU1A 3A7FA 3TIZA 3D7ZA 2I0YA 4QPSA 4ZSEA 3ATTA 3N4UA 1H1QA 1VZOA 3GU4A 3IECA 2QLUA 2VTAA 4PNKA 4H3BA 3JYAA 4AZVA 3BPRA 3SXRA 1KE6A 2ZJWA 1PXMA 4Q5HA 1IAHA 3CQEA 2YCSA 1GIHA 4P4CA 5CI7A 3ZBXA 1FGKA 3MB6A 3ZM4A 3DDQA 2Q0NA 2CN8A 3KQ7A 2RL5A 1WBOA 2ZOQA 4XLIA 1Y57A 2VTHA 5CX9A 4ZTHA 3V8WA 5DA3A 3W2QA 4RJ3A 4AFEA 3R7UA 5FM2A 2R9SA 3K54A 4BDKA 2BDJA 3DA6A 5CASA 4USFA 2RF9A 2BDWA 1TQIA 3LFQA 3NUUA 3OWLA 2BPMA 4XOYA 2SRCA 1Q99A 3DXQA 4QMUA 5DIAA 2UW8A 4U45A 4NW6A 2ZM4A 3R1QA 4MD8E 1OZ1A 5AP5A 3FUPA 4X3FB 3UIBA 4CNHA 1Z5MA 4RZVA 2XM9A 4YPSA 4FZ6A 5AMNA 4ALVA 4QMQA 4M68A 3WE8A 4IX5A 4BICA 3DZQA 4MVFA 4TNDA 3ZH8A 3FHRA 4APPA 4BN1A 3I79A 3MH1A 3QGWA 5E90A 5AP2A 3FLWA 2LAVA 3GU8A 4E7WA 4BBEA 3MH3A 3L9NA 5DI1A 3RNIA 5HNIX 3AT3A 3W8QA 3LM5A 4JRVA 2RFDA 3QA0A 4K0YA 3L9PA 4RGJA 5TT7A 3R9OA 3SXFA 2O65A 3EQPA 2GHMA 5HVKA 3JY0A 2G2IA 4LMNA 3WF7A 2UW6A 4TYHB 3R7VA 4QTAA 2J51A 4RX8A 5DPVA 4FG9A 3ROCA 4DHJA 3O0GA 4FV7A 4YTFA 1DI8A 4MYGA 1GJOA 3FMNA 3OBGA 4U6RA 4ACMA 2R5TA 2ITXA 3VRZA 2HZNA 1LEZA 4J7BA 3UMXA 5CEOA 2GS6A 3DKOA 3ZLWA 5IUIA 2F9GA 3FLSA 5DHJA 4X2KA 4F0IA 3PP0A 4BBFA 3POZA 3D9VA 4JVGA 4U5JA 2WTDA 5D9HA 5EQYA 1PXNA 1YXXA 4BGHA 4DG2E 4FZAB 3OT8A 3HP5A 1H1WA 3ZUTA 3WBLA 3COIA 5HLWA 3TYKA 3SGCA 3FE3A 4U79A 4J99A 3DLZA 3BE9A 3BRBA 3UQCA 5HCYA 4LYNA 1E1XA 1J3HA 3FMDA 4KIQA 4DTKA 3ZDIA 4N57A 4GK4A 3FI3A 5FDXA 1JSVA 5C01A 5F95A 4IAAA 1R0EA 4KB8A 3R8MA 4YZCA 3PY1A 2JC6A 4IVDA 4O7SA 3TUBA 3OMVA 2UVZA 3FJQE 2JKMA 5HU9A 2BILB 4CEGA 1UU9A 4FTAA 4O7PA 4OTIA 1ZZLA 3ORKA 3VULA 5EDQA 3QD0A 5E7RA 4RBLA 5EYDA 4S30A 3R01A 1K9AA 3GC7A 2A2AA 4GKHA 4ZAUA 5HLPA 3ETAA 3EN6A 3D83A 2BKZA 3QCSA 2OIQA 4FTOA 4G1WA 4JQ8A 4OTFA 3V3VA 3ZSGA 4FIIA 2B52A 2OSCA 3NVKI 2BRGA 2VX0A 3LVPA 2CNQA 3OW3A 3VUGA 3QC9A 4HGEA 1JNKA 4FC0A 3C4ZA 2WMVA 3G90X 4IVAA 3QD2B 4IJPA 1IG1A 4OGRA 3BYOA 3ZCLA 4CFWA 1ZYJA 3EFJA 4AAAA 4X7QA 3UDZA 4JQEA 3RP9A 4FGBA 4AW0A 4M7IA 4LOQA 2G2HA 5ETAA 3K5VA 4IB0A 1YDTE 3QTWA 5EDPA 4YJQA 4ANQA 5DE2A 4TN6A 3RWQA 3GQIA 4JAJA 5HVJA 3V6SA 4ERWA 2VTSA 2ERZE 3Q53A 4Z7HA 5EHYA 2E9UA 3CTQA 4D0XA 4O0VA 4TTHB 4TWNA 4GYGA 5HESA 3DAJA 4I6BA 5J9ZA 4U44A 4I41A 1DI9A 2R3KA 3ORIA 4LOOA 3WF8A 5BNJA 4IM3A 3QRUA 4KIOA 5M4FA 3G2FA 3OC1A 1FQ1B 3UZPA 2WPAA 3FMHA 5C8MA 2VO0A 4LRJA 4YPDA 2W5AA 3V5TA 2R7IA 4CMOA 3AD5A 3T8OA 3UTOA 4MBIA 3H0ZA 3NUPA 2UZEA 4AOJA 2J5FA 4BGGA 2CKEA 4OTDA 3A7HA 4FTJA 4I1ZA 1OL6A 2AEGA 3CKXA 1FPUA 3OXZA 4G34A 4MF1A 3KMMA 3UIUA 4U3YA 2WTKB 4B7TA 1TVOA 4AT4A 2CNVA 3NZ0A 3R22A 3R7EA 4L53A 3DJ6A 4NTSA 4XX9A 2O3PA 2YZLA 3IW8A 3NYVA 4DEBA 2XK7A 4X3FA 4ENXA 2X9EA 2ZM1A 2VWZA 5IF1A 4UWYA 4EL9A 5L6PA 2EU9A 4I24A 3T3UA 2JITA 3DCVA 3PXRA 2ITYA 1PJKA 2UVYA 5C8NA 4IDVA 4QYGA 3GXLA 2R3FA 3MN3A 4DH8A 3PFQA 3DS6A 4I0RA 2DQ7X 3IG7A 2VTTA 4FEXA 4J1RA 3K3IA 5HE0A 4BCFA 1H01A 1BLXA 3ZRLA 2W17A 4AGDA 2R3IA 4QQTA 3DFCB 5AJQA 2G9XA 3ZSIA 2UZNA 2CHLA 2FVDA 3EQIA 4AW2A 1BL7A 3G0EA 4RG0A 3W2OA 4X2NA 3FAAA 3PTGA 4FTQA 5E92A 4C0TA 4G3CA 4WRGA 3ZLSA 4C3FA 1YKRA 4GG7A 3BZ3A 3PIXA 3HGKA 3JR1A 2OJGA 5HD4A 4J8MA 3MI9A 4LV8A 4HGLA 4TRLA 4BKJA 4ANMA 2HYYA 2OI4X 3FMLA 3QQFA 4OBOA 4O83A 5HG8A 2CDZA 1KE5A 4DYMA 4CZTA 3LFAA 3OEFX 4ZSAA 2W1CA 3NUAA 5CLPA 3C9WA 4UB7A 2CN5A 2VN9A 5B2KA 4KS7A 2R3RA 3GP0A 3NW5A 4HYSA 4R3RA 3R7YA 4AZFA 3Q5ZA 4QDVA 1CKIA 3CGFA 2YM4A 3ZEPA 2PZYA 4DTBA 4PMSA 1OKZA 2UW7A 3ZOSA 1DAYA 3MV5A 3FZSA 3OEZA 4TWPA 4YHFA 3TXOA 4FIFA 3W2PA 4AN9A 2VGPA 5C9CA 4F7LA 1H24A 3TZ9A 4XHKB 3NIZA 4C2WA 2EXCX 2W5HA 5FTOA 3F5XA 4ZZNA 4LM5A 4YZMA 3EFKA 5A46A 4A4XA 4W4XA 4FV8A 4JAIA 4LOPA 4GVAA 2PPQA 4BDFA 5KKRB 3F88A 3DBFA 3FL5A 3P08A 3QRTA 4V0GB 5CAVA 3FBVA 3GCSA 3Q4UA 2WMSA 3UOLA 1OVEA 1L8TA 2QOCA 2YM5A 2Y7JA 3O96A 5D10A 3ZO1A 4Y5HA 4K11A 4BIBA 3GCUA 4Z3VA 5CF4A 4TKSA 4E4XA 2W9ZB 5DH3A 3MJ2A 3DJ7A 4BCJA 5M4CA 5H2UA 1U54B 1O6KA 2UZTA 3E8DA 3HAMA 4JDJA 4NKAA 3WOWA 3D5UA 1VEBA 4L7SA 4FSZA 1NVSA 3EKNA 1JAMA 3GC8A 4PY1A 4BJJB 3RCJA 4E6DA 3AC5A 4DBXA 3A4PA 5FTGA 2W0JA 5E91A 4WIHA 3RHKA 3R9DA 4CZUA 4DH1A 5LVNA 3ACKA 2FO0A 4YO6A 2BHHA 2ONLA 2HW6A 4Y46A 5TO8A 3RWPA 4F9YA 3L1SA 4DFXE 4YHTA 4LGGA 4L9IA 3O8PA 3PJ3A 3UNKA 5CEPA 4EK5A 3OS3A 4ITIA 3MGYA 4O82A 4QYYA 4WO5A 2NO3A 2YIWA 5HNBA 3VBYA 4Y95A 3L8SA 3MPTA 5AV4A 2QO2A 3C4CA 5T6KA 5HQ0A 2UVXA 5I5ZA 3DK7A 3LFEA 4IB3A 4FYNA 4IM2A 4QMLA 5J9YA 4CKIA 2E9OA 4CVAA 1PXIA 5LVPA 4DCEA 4FV4A 3BBWA 4GU9A 5HCZA 2OXYA 3BEGA 3KY2A 1H08A 5EFQA 3IK3A 2XIZA 3WF6A 4C3RA 3NS9A 1UVRA 5J87A 3OWJA 2IZUA 2XNBA 4L46A 4FSTA 1JBPE 1QMZA 3ULIA 5ETFA 2OU7A 2QO9A 4WNKA 4JXFA 4L44A 3QRIA 3GBZA 3CS9A 1HOWA 1HCLA 1RJBA 2PMOX 3FZ1A 4BI1A 1YHVA 3MA6A 3QC4A 3W55A 5IQFA 2IZTA 2GHLA 3ZFMA 3U9NA 1WBNA 3TKHA 5CNNA 4ZZOA 3E92A 4L52A 4U98A 2VTMA 4LI5A 5BVKA 5HI2A 2X8DA 5AAGA 3CP9A 3CPBA 1XH9A 4FI1A 1SVEA 2LGCA 3DAEA 4AZTA 1O6LA 4GK2A 3UDBA 3ZTXA 1YQJA 4U7ZA 4ZY4A 5KBQA 1OI9A 4E4NA 4BDCA 3VBWA 1IASA 4QQ5A 5AP4A 1PHKA 2XARA 3AC8A 1WVYA 2XIXA 2ONLC 3KIOC 5EYCA 3RM7A 4NIFB 2VO7A 4AUAA 4P5QA 4ZSGA 4C4GA 4NW5A 1S9JA 2BALA 3O8UA 3BLHA 2GMXA 2WOUA 4ZLZA 4JRNA 3JVSA 4D4SA 3EFLA 1Y91A 5K3YA 3ZUVA 3AKKA 5CSWA 3UC3A 2C5VA 1ZAOA 5IQAA 2DS1A 5JZJA 4F78A 2QU5A 3AC1A 3QTXA 4IX4A 4RVKA 4BVUA 5FLFA 3PXFA 3V5LA 4I22A 4ENYA 2W99B 3C4XA 4APCA 2GNFA 5DR9A 2ETRA 3ZMMA 1WBWA 3PDTA 5JSMA 3VJOA 1REJA 1OL5A 4RSSA 2CGUA 4KBCA 4EH5A 3W0RA 3F5PA 2PU8A 5J8IA 2WTKC 5B7VA 5EKOA 1BL6A 4FEVA 3M42A 4RWIA 4V0GA 1KUTA 3GVUA 4A4OA 4AA4A 4DC2A 5GIPE 3W10A 3H10A 4F6WA 4RX7A 2BAQA 5E1EA 4YTHA 5HNGA 4YC3A 1XWSA 3R6XA 4ONAA 3AXWA 2YWPA 3OTVA 2XZSA 4WUAA 3W1FA 2HWOA 4IACA 3ZO2A 4ASZA 4I21A 3F6XA 4BI0A 4D2RA 3HMMA 5BV3A 1EH4A 2R3HA 4ZP5A 3THBA 4F0GA 2GNLA 3DLSA 1J7IA 4GUEA 4C4JA 4RVTA 3EWHA 2R3GA 3A8XA 3AKJA 5E8TA 3FYJX 4YZDA 4FZDB 2O64A 4NH1A 1G8AA 4QP6A 1ZYDA 4J95A 3F82A 3KRJA 2XJ2A 2AC5A 3P7AA 5F1ZA 3RHXA 4DFLA 1U59A 4WA9A 2H34A 3UO4A 5JFWA 5E8ZA 4QMXA 4UYNA 5HBEA 4WNPA 2BAJA 5CAPA 4M15A 3BBTB 3TACA 3HAVA 4KUJA 4TXCA 5D7AA 4OTHA 1CKPA 1OL2A 2FSOX 3FMKA 4ZSLA 1Q5KA 3KFAA 4DINA 4BYIA 4R5SA 4F70A 3NW7A 4GJ3A 4DAWA 4D55A 5IA0A 3ZO4A 3PG3A 1OMWA 5IQIA 5DEYA 3AOXA 3PVUA 4C3PA 3AMAA 4O7OA 4FTTA 2NRUA 3F3UA 4MBLA 2C5NA 2IZRA 4XG7A 3E93A 3GFWA 5CSVA 5HBHA 3UJGA 3KKVA 4DFZE 5M55A 5FXRA 2YIQA 4L67A 4F0FA 3WZUA 1OITA 4X2JA 4N4SA 4Z9LA 3QTQA 4II5A 3VS5A 5HORA 3TV6A 5KUPA 2OKRA 4IAFA 4QRCA 3C7QA 1PW2A 2CKQA 4JG6A 2UV2A 4J52A 3OCGA 2WNTA 4RA5A 1Q8TA 3IO7A 3CKWA 1PY5A 3EJ1A 4ACGA 3DXNA 5CEMA 3IS5A 3P23A 5KKRC 4KWPA 3DBQA 5HIBA 3UPXA 4RLLA 3EZRA 2BHEA 4I6QA 1ZYLA 4IX6A 3BL9A 1ZYCA 2DYLA 3C50A 3QXOA 4IFGA 3GU5A 4OR5A 1QPJA 4PTEA 3JVRA 5LWMA 4CFXA 1W98A 3A60A 4MH7A 5AUWA 5BPYA 2HAKA 2H8HA 4QP4A 1OB3A 2C4GA 4W4WA 4EOIA 5JQ8A 2RG5A 3BHUA 2X8EA 4CRLA 1E9HA 2YFXA 2W4KA 3S3IA 4C38A 4X6RA 2UZBA 4ORKA 3AD4A 4U41A 5AA9A 5A9UA 2B54A 3JS2A 1IR3A 5H8EA 1KOAA 2ITZA 3VUKA 2IVUA 3MFSA 5ANOA 4P2KA 1G8SA 1MP8A 5CALA 4YMJA 2Y6OA 5BVWA 2GTNA 3O50A 1PXPA 5CTPA 2YZAA 3PPZA 4PMPA 3VBTA 2WGJA 5LCKA 4CD0A 3SAYA 3GI3A 4CG8A 2E9NA 4RIWB 1JOWB 5EYKA 4BHZA 2JDSA 2WD1A 3EQDA 2R3PA 5GJDA 5A6NA 2WZJA 2IJMA 2QQ7A 4J98A 4F65A 4W4YA 3ZONA 3L8XA 2ITVA 2OO8X 3AC3A 4C33A 2HCKA 1DM2A 2HZIA 2JKQA 5EHLA 1VR2A 2QR8A 4EH2A 4FICA 1Z9XA 1L3RE 3QTRA 3MJ1A 3RPSA 5J1VA 5H3QA 2ZV8A 3ZC6A 4CCBA 2QO7A 2HIWA 4HCVA 2JIUA 5CT7A 1A06A 2BZJA 4UZDA 2UW3A 3I6UA 3QCYA 1LPUA 4MNEA 4R3CA 3W0MA 1YDRE 5JFSA 1V1KA 1V0PA 2BVAA 3UQGA 3HV6A 3BGZA 1SVGA 3LIJA 3OUNB 3W16A 3EB0A 3EL8A 3DPKA 3N51A 2HZ0A 3NFFB 3NR9A 3VS7A 4F1OA 5IUHA 4TNBA 4XG6A 4RMZA 3D7TA 2H6DA 2YM3A 4USDA 2C68A 2YCRA 2VWIA 3IW7A 5GJFA 4ZSJA 4F7NA 3TZ8A 3FDNA 1U4DA 5AIKA 4RRVA 5FXSA 5DT4A 2OGVA 3BCEA 3GU6A 4DA5A 3ML1A 4U42A 4I23A 4YHJA 1OKYA 2REIA 4L45A 4E73A 4EZ3A 5A4QA 3U9CA 3D5WA 1NA7A 4NM0A 1GZKA 4JBVA 4P5ZA 4YJOA 1OIQA 3FZRA 3GB2A 2WIHA 3DQWA 5FGKA 1Q41A 4I20A 1XH7A 2C0IA 4R77A 3VS6A 1GZ8A 4BIEA 4GW8A 5KHWA 1ATPE 1KV1A 2Q83A 2XJ1A 3OVVA 4IWQA 4Y73A 3SD0A 4O0XA 4MD9E 4S32A 1ZOHA 2RGPA 4DEHA 2WO6A 2J0JA 3UIMA 3TUDA 4F6SA 2ZDTA 4CMTA 1M14A 3DFAA 3NNUA 4FOBA 3BV2A 4KS8A 2PMLX 3SOAA 2YN8A 5BMSA 3E63A 3W32A 5AUVA 3IW4A 2OWBA 2QOFA 3P0MA 3Q96A 3TNQB 3LFFA 3LCOA 3EN9A 1R0PA 4ZTMA 1APME 4X6QC 5HGIA 1G8KA 3MBLA 4XMOA 1UU3A 2ITOA 1SNUA 4TZRA 1Q8WA 3PJ1A 5CENA 3ANRA 2VRXA 4XOZA 5CAUA 2PL0A 3FY2A 4GJ2A 4G3FA 1GOLA 4YTIA 2JIVA 3A7JA 4B0GA 4ZTNA 2PMIA 5HU3A 3QALE 4CV8A 1BKXA 5GHVA 5L2WA 4PUZA 1JKLA 3SOCA 3BE2A 3CEKA 5KO1A 2WMRA 4FV6A 2WOTA 3C0HA 4NFNA 4YBKA 5CU3A 4BI2A 2XCKA 2QOOA 3BELA 4JR7A 1ZRZA 4IB1A 2I0VA 4CFMA 2ZB0A 1Q8ZA 3GENA 4X2GA 3T9TA 5KCVA 3HV7A 2WTJA 2IO6A 3QWJA 5DR6A 3TKIA 2VZ6A 4ZOGA 3RM6A 4G6NA 4ZS4A 2VTIA 3MPMA 4JQ7A 1Q97A 5EW8A 4MWIA 3R04A 4FTKA 3OY1A 2OZOA 1PKDA 3HA6A 4BDJA 4EQUA 4MTAA 4HVSA 5KMKA 4C4FA 2GNHA 4IJ9A 4YR8A 3FKOA 2I0HA 4NK9A 4WSYA 4E6CA 4UX9A 3LM0A 3FI8A 3NUSA 2G1TA 3F3ZA 1FVVA 3GGFA 4J71A 3E62A 3LCTA 3QX4A 3TZMA 3HYHA 4BDAA 3QTUA 3IPHA 2R0IA 2BUJA 4RIWA 3S95A 2HOGA 3TTIA 1BX6A 5IEVA 5D12A 1VYZA 3UVPA 4RFMA 4FIHA 1OL1A 3PVGA 4QMTA 4BZDA 4IE9A 3KF7A 3LAUA 4JDKA 4C34A 4YURA 5GINE 4FKVA 4G17A 3QTIA 1OECA 4DHFA 2XK6A 1IAJA 1OKVA 4QQJA 2X7GA 3KB7A 4YZBA 3NEWA 5D1JA 1XBBA 3R8PA 4E93A 3EL7A 2VTJA 4OUCA 5GJGA 3TNWA 3CJGA 3NFGB 4A9SA 3DTWA 4E20A 4EONA 1MRVA 2XK3A 2UZUE 2IZSA 3D2KA 3AC2A 5E4HA 3A2CA 2IVSA 4ZY5A 4QMNA 4E5AX 4EBVA 3C5UA 5M53A 3FMMA 4MXAA 4AFJA 4R6VA 4H1MA 4MD7E 5CSXA 3PXYA 2YA9A 1Y8GA 2EWAA 5IMEA 2B0QA 2OJFE 3R9NA 3NYXA 5E8XA 4DG3E 2VWXA 5HO7A 4FVQA 1SNXA 1YOLA 3MS9A 3OXIA 2OXDA 3DZOA 4DG0E 3FY0A 2XAOA 3CC6A 2XA4A 4KIPA 3EQGA 3U6HA 5DYJA 1W8CA 4N6ZA 5CY3A 4HOKA 3SHEA 4CTCA 3U55A 2QKWB 3QBNA 4GRBA 3WARA 4B99A 4F4PA 4BZOA 2X0GA 2BRBA 5FEDA 4IEBA 2PZPA 4UBAA 4MAOA 4O2PA 4YLKA 2HELA 3FLZA 5AUUA 1X8BA 1GIJA 3P5JC 5G6VA 2QVSE 4DTAA 5BVEA 2C1AA 2A27A 4KSPA 5HEZA 3U51A 3F2NA 5EHOA 4LL0A 4GUBA 2X2LA 4FV5A 4JDIA 2C30A 3RNYA 1W0XC 3G5DA 3PSBA 3F3VA 3E8EA 4Q9SA 4DEDA 4NM3A 2R7BA 3PP1A 1PXKA 3PE2A 4XP3A 5AP1A 4LQMA 5EQEA 3REPA 3NAXA 4MX9A 2ACXA 4O86A 4HVHA 5IQEA 2GS2A 2UZLA 1H26A 3MW1A 4NCTC 5ANEA 3RAWA 1Y6BA 4BCOA 2YHVA 2OICA 3MPAA 5HTCA 2C3JA 2G2FA 2PUUA 2WTIA 4EUTA 5J1WA 4TWCA 5CSPA 1OBDA 2C6TA 3HA8A 4MK0A 4F99A 3EHAA 4UXQA 2WMAA 4GIIA 5JN2A 2PK9A 3VUIA 4YLLA 4JR3A 3VS3A 3FPMA 3M1SA 3I4BA 4J97A 1RQQA 1QPDA 1ZMUA 3HDMA 5I9XA 2YDKA 3BLRA 3UOHA 3ZRKA 3UP2A 4Z7GA 2E9PA 5EKNA 5M4UA 1Z57A 3TG1A 4FTCA 1UWJA 2X6EA 3E7OA 4R7HA 3LXPA 5ANDA 2G15A 5K5XA 3DKGA 3RAHA 2VWBA 3DK6A 3G6GA 2P33A 4AG8A 3UPZA 2BKKA 1XJDA 2HY81 5CAOA 5IH6A 5IMXA 4IAKA 4EK8A 2YJRA 4AXDA 3UIXA 4FG7A 3MH2A 5JMSA 3PSCA 4C61A 3CD8A 4WUNA 2PVKA 3C4EA 2C6IA 4FMQA 3OWPA 4TL0A 2BRHA 1JSUA 2PUPA 3L9LA 1YOMA 3SG9A 3P9JA 2C3KA 3QHRA 3OT3A 1JKSA 1A48A 1F3MC 4KINA 2PVHA 4HPUE 3VHEA 5ANGA 4R7IA 4BCPA 2X6DA 3W18A 2BDFA 3PRIA 5DRDA 1QPEA 3C4WA 3RJCA 2W1FA 3FSFA 3E3BX 3VJNA 2WMUA 3W0QA 4E8AA 2C47A 3QWKA 3QZIA 5AV3A 4BDGA 3F5UA 3G33A 1UKHA 3AMYA 3BYVA 3DBDA 4U80A 5D41A 2CNUA 2O0UA 4L00A 4PDOA 1PMUA 2XK8A 2OW3A 3ZFXA 2GFSA 3VS4A 4H05A 3VWAA 5EYMA 4HGSA 3OHTA 3QA8A 4EK3A 4LFIA 3OFMA 4MXYA 4FX3A 5FXQA 2BTRA 5JK3A 4MHAA 4MKCA 4AQKA 3MFRA 4YNEA 3V5JA 4BRXA 2PYWA 3QQJA 5K4IA 5CQUA 4FNWA 3GFEA 1Q3DA 3K5UA 4FKWA 4GS6A 4NKSA 4WKQA 5CXZA 5HIEA 3IQ7A 4DH7A 4F7JA 4FL2A 3UODA 4A9RA 4YJTA 4ALUA 2BZHB 5LQFA 3WYXA 3PVWA 5E9EA 3FC1X 5LMKC 2X9FA 3UBDA 1NW1A 4RIXB 4R7BA 2J9MA 3ORXA 3LLTA 4TYIA 4TW9A 4K1BA 4OT6A 2B9IA 2QHNA 4IFCA 4Q2AA 3ZYAA 5L8LA 4EK6A 2PY3A 2JDTA 1GY3A 4IM0A 2R4BA 2WHBA 2WU7A 4FODA 5DLSA 3NNXA 3TTJA 4QOXA 1W82A 4RWLA 4TYHA 2ITUA 5AX9A 5HG7A 4DFNA 3CBLA 2WXVA 3Q6UA 4UZHA 3PUPA 2A1AB 4PL4A 3UDSA 3BEAA 4M69B 3RAKA 3GCQA 4XG9A 4RJ6A 2WQMA 2AC3A 4LGHA 3IDPA 3KL8A 4IZ5A 3GOKA 1UNGA 3P1AA 2F49A 2Y6MA 2YJSA 4RIYB 4DE4A 3I5NA 3PIZA 5KMOA 4FEQA 3QUPA 4NJDA 1UU7A 2EB3A 4X3JA 3TDWA 4E26A 5CS6A 4CFFA 1DAWA 2ZDUA 4XYFA 3UMWA 3OCSA 3ZS5A 4EYMA 2CCIA 4AGCA 4FNYA 1RW8A 4AAYA 1H1RA 3LFNA 1T46A 3TIYA 3QXPA 3HMIA 4G3EA 2F2UA 4AACA 4XNEA 1F0QA 1XH4A 3NVMB 4QNYA 3O2MA 4V04A 3ZLXA 4BTFA 4DDGA 5IA2A 1WBPA 2ERKA 4RZWA 4GYIA 3HZTA 4O0YA 3PIYA 3RKBA 5AFVA 1PMEA 3ET7A 4QMWA 3QAME 4FVRA 4I3ZA 4FE2A 1KE7A 4QMZA 5IQDA 3TDVA 3UO6A 4EOPA 5A4CA 1JSTA 3FL4A 3MIYA 4G3DA 3SA0A 3UO5A 4KNBA 4J96A 4YP8A 3EKKA 4F08A 2R3QA 5ETCA 3LCKA 5EW3A 2C6OA 2XS0A 3BQCA 4Y72A 3QUDA 5EM7A 4F9WA 3JUHA 3Q5IA 4NWMA 3ZM9A 3PFYA 5HZNA 3A62A 4IH8A 5JKGA 1GAGA 4QMVA 3HL7A 5HVYA 2XNEA 2C0TA 1OL7A 2KTYA 3BU5A 3AT4A 4UEUA 4W8EA 5E1SA 4HYUA 2P2HA 1ZARA 4XBRA 2P3GX 3C0IA 4RVMA 4QP7A 2VX1A 4OW8A 4ZLOA 4LRKA 2OLCA 3NLBA 3OCTA 4DF3A 4HW7A 3FHIA 4FOCA 4GEOA 4EOQA 2VTPA 2W05A 5M51A 3IGOA 1M2QA 3I0QA 3L8PA 5L3AA 1ZXEA 2H96A 5HE3A 5C1QB 1YWRA 4HGTA 3T3VA 4FV3A 4GH2A 4QTEA 2WQOA 3LMGA 5M56A 4QMPA 3V51A 1J1BA 3WILA 3ZC5A 3BWFA 5IISA 5HE2A 4QDEA 4FL3A 4K9YA 1ND4A 4PQNA 2FUMA 3LXNA 2XIKA 4FYOA 1UA2A 3LCDA 2YAKA 5CZIA 3COKA 5JRSA 3Q4TA 4P90A 3KRWA 3EN5A 3Q4ZA 4QEBA 2YM6A 4W8DA 5EI6A 5LARA 2HY0A 4MUQA 3LKMA 3F2AA 4Y83A 3QKMA 3R1YA 4AOTA 4RWJA 5TR6A 5A4EA 3FZOA 2JDOA 4MNFA 3ALOA 4IZYA 1H4LA 1P2AA 3H3CA 1MRYA 3KXNA 3NMUF 1S9IA 1CDKA 1MQ4A 5EH0A 4AGWA 4I5MA 2QOKA 3V5WA 2XF0A 2W4JA 2CMWA 1VLRA 3BHTA 3LQ5A 4N6YA 3MWUA 4A7CA 4HVDA 2QONA 3RK7A 4PP9A 4F1MA 4YZNA 4CQEA 4GIHA 4PMTA 3B8QA 1OUKA 1OGYA 3ZUUA 4Z55A 3DU8A 3PWDA 3GEQA 4C02A 2F7EE 4O27B 1TFFA 3DBEA 3VQHA 4CG9A 5JRQA 3LQ8A 3Q9XA 3R8ZA 2ZM3A 1WBTA 5JT2A 2DUVA 4ALWA 5KHXA 3RPOA 3U4UA 3DKCA 1ZY5A 2FA2A 3DJ5A 3EMGA 3QZFA 4RIXA 3FV8A 2BAKA 3C4FA 2BROA 2F7XE 5CQWA 3VIDA 1YDSE 3C51A 4YO4A 4UWCA 1BI7A 4XV3A 3WI6A 4ZTLA 3HDNA 4D9TA 4FIGA 3UP7A 2CCHA 4I92A 2BIKB 3PE1A 1Q8YA 3Q60A 5CI6A 4O0RA 3B8RA 2RIOA 1Q61A 3LXLA 3QHWA 4FL1A 3NCZA 5AUXA 3QQKA 4FV1A 4EOLA 5BYYA 2YM7A 4O7ZA 3V5PA 2GPHA 4CRSA 5CVHA 4E5WA 2PWLA 2P55A 5J95A 5ETIA 5M57A 4QTDA 2J0LA 4AA5A 4DCAA 2XEYA 3RAIA 3AG9A 1H1PA 2OK1A 2Z7QA 3VS2A 3EYHA 3KA0A 5B2MA 1PYXA
chains in the Genus database with same CATH topology
4PX6A 4FKJA 5BYZA 2X8IA 2R3LA 4FBXA 2W06A 2VV9A 4L68A 4LV7A 4BDIA 3P7BA 4XLVA 4I94A 4MXCA 5DFPA 1ZOGA 3PLSA 2F2CB 3ACJA 3RVGA 4AWIA 4MWHA 1ZY4A 2X4FA 4FJVA 1B39A 1H07A 2VGOA 4GFMA 1XBCA 3I1AA 3KXHA 5FM3A 5BUEA 5JEBA 4AXCA 5KMJA 2IWIA 1PYEA 4DEGA 3OZ6A 3R2YA 1TKIA 3D14A 5CEIA 4EZ7A 5IEYA 5JGAA 1SMHA 1H00A 4BBMA 4LV5A 4EC9A 3Q9WA 3DOGA 4G9CA 5F94A 2XNPA 4QP3A 4UV0A 4BTMA 4FV2A 3VRYA 2O5KA 4C7TA 4I5HA 3W2CA 5ACBC 4JX7A 1URWA 4KBKA 3L8VA 4XG2A 3OWKA 3K2LA 5FRIA 4UALA 3NAYA 3UG2A 4WD5A 4PP7A 4Y5QA 3FQSA 4FSQA 4CLJA 3E8NA 3D2IA 2NRYA 2JDVA 3I7BA 3M11A 4HYIA 3QYWA 5HO8A 4D9UA 4OT5A 2C69A 2JKKA 1U54A 4U0IA 1R3CA 4C2VA 1STCE 5KBRA 1M7NA 3IW5A 4QNAA 1FVRA 2Z8CA 4HJOA 1A9UA 4B4LA 3F9NA 5EK7A 4AE9A 4BJJA 1B38A 3GC0A 4PDSA 4O7LA 4NYEA 2V22A 5CU2A 5DN3A 3LMIA 4ANSA 3AKLA 4O6LA 4AU8A 4RFZA 4O96A 4O81A 2OF2A 4S2ZA 4RX5A 4K6ZA 4FEUA 5DT0A 4C62A 3KC3A 4I6HA 3GC9A 3TNHA 4CKJA 3NUYA 4FSYA 5I9WA 3FXZA 1XBAA 4PDYA 4AW5A 5HLNA 5EOLA 4WT6A 5IA5A 1PMVA 3HRBA 4QT1A 5A54A 2XALA 1YXUA 5JFXA 1JWHA 1YXSA 5IU2A 3QYZA 3UYSA 2QC6A 3T9IA 2FSTX 3WZDA 4ZLYA 1OIYA 1XO2B 2WEIA 4LG4A 4M84A 4JNWA 3MY1A 3HRFA 1QL6A 1ZYSA 3MTFA 3D15A 4IWPA 3KXZA 4YZ9A 1NVQA 4JIKA 3WZKA 2IVVA 2UW9A 4BB4A 1PXLA 2WQBA 3AT2A 3VW6A 4R5YA 1BYGA 5C03A 2Z7SA 3KRLA 2W1HA 2YDJA 3ENMA 4PNIA 3KK8A 4LUEA 2IN6A 3PA3A 1H28A 2R3OA 4ANBA 5AM6A 4ZJIA 3PWYA 2B7AA 5A4LA 4FR4A 3TWJA 4OTQA 2X4ZA 4YJUA 5E8WA 1LP4A 3W2SA 3MESA 2YACA 3QUEA 5AUZA 2OZAB 4XP0A 4F9BA 2Y4PA 3S00A 5CVFA 1W7HA 2ETMA 2GDOA 2VX3A 4N70A 2VNWA 4TYGA 4RFYA 2O2UA 3QZHA 3CIKA 2OJ9A 3D5XA 3LJ0A 1SYKA 2GQGA 3OCBA 2PHKA 4FKPA 3V04A 4RJ4A 4EKKA 4ZMEA 2NNWB 3LFBA 5FD2A 1AD5A 3ZLYA 5JH6A 1WVWA 3BYMA 3EN4A 3P4KA 4H3QA 1NT2A 4PWNA 4HYHA 5HTBA 4XBUA 3VF9A 5EM6A 1GZNA 2BRMA 4GCJA 4XS2A 2WMQA 4BTJA 4M0YA 3SG8A 3R63A 1PMNA 2GSFA 2J0IA 4PMMA 5HD7A 4ZS0A 2X1NA 3I0OA 2B9HA 3TUCA 4HZRA 4A06A 5DGZA 4FT5A 3KU2A 1Y8YA 4FKSA 4ZMFA 3K3JA 4QMSA 5IA1A 1ZLTA 2W4OA 2XKFA 4FUYA 1YHSA 4EHVA 3TNIA 2XK4A 5KZIA 2I40A 4C37A 2YDIA 2J6MA 4RJ8A 4XG8A 5KX8A 2VWYA 4RT7A 2Z60A 3R7IA 4I5PA 3HNGA 4RC4A 3QFVA 2QOQA 3CJFA 2A19B 4NT4A 4FEWA 2WTVA 5G1XA 3UZRA 1YOJA 3IW6A 3W0PA 3FKLA 4ACDA 4YNOA 4DEIA 3NPCA 5IQCA 5I9YA 3E5AA 1YXTA 3P7CA 3QTZA 3NSZA 4NUSA 5GNKA 2B9FA 4DGLC 3H4JA 3G0FA 3Q3BA 3C13A 4ZK5A 2J0KA 1OUYA 3AGMA 3Q52A 4DHIB 4O84A 3RPRA 4Y8DA 3R83A 4FKIA 1M2PA 1CSNA 2ZAZA 3P86A 3F7ZA 4OBPA 5AIRA 5DR2A 3AGLA 5ANKA 4DEAA 4JOAA 3GCPA 3VS0A 5F4NA 4JLCA 3POOA 2QU6A 3BGPA 3EQCA 4FT7A 2GTMA 4I0TA 4YJVA 5DEWA 2OXXA 3DY7A 4U40A 2JKOA 2WIPA 1JKTA 4MEDA 1FMOE 4WOVA 3WYYA 5LMBA 2ITWA 2JD5A 5BVDA 5DWRA 3TKUA 4U97A 4U43A 4GKIA 3UZTA 3JPVA 4C35A 3ZRMA 4DGNA 3DAKA 5IH4A 2XKCA 4OLIA 5IDPA 5BVFA 4FV0A 4LL5A 3KVWA 2B9JA 2JIIA 1Y6AA 1MQBA 1OIRA 2ESMA 4FT0A 4O2ZA 4RWKA 4L42A 4DBNA 1DS5A 4MXZA 2C3LA 4CFVA 3KXGA 3LZBA 4EEVA 4FK6A 5AA8A 4RQVA 3RI1A 5DOSA 3OUKA 4GT3A 4L01A 4E6AA 2PVMA 1Q62A 3BU3A 2QURA 3CXWA 4ACHA 2JDRA 3SW4A 5AAEA 3E88A 2PZRA 4QP9A 2WQNA 3SX9A 3Q9YA 2HW7A 2C5YA 3BLAA 1OPKA 3HVCA 4O21A 3KCKA 3SXSA 5EDRA 4DEEA 2ITNA 3KRXA 2Z02A 4RA4A 2C6DA 3NWWA 4FTMA 3S1HA 5KMNA 5DBXA 1M17A 4D1ZA 2XKEA 3E64A 4IWDA 4B8MA 4J8NA 2VTLA 1JPAA 2VAGA 4LMUA 4O7NA 3OROA 4BY9E 5FBOA 4D2SA 4DLJA 1FVTA 2B55A 4IDTA 3LFDA 5L6WL 5D11A 5L2SA 4IIRA 4UN0C 4AZSA 4D4YA 2R0UA 3W0OA 4UXLA 5CXHA 1AGWA 2PE2A 3R00A 3SKCA 4ZIMA 4I5CA 3FXWA 4EHGA 5HE1A 4BHNA 2QI8A 3O71A 4IAZA 3OOMA 1XR1A 4TWOA 4YLJA 5ICPA 4YJSA 5E8SA 2W96B 4IC8A 2OZAA 2JFMA 2GNJA 3N9XA 2CGVA 3Q32A 4AQCA 4XJ0A 4IC7A 4AZWA 4EHZA 4ZZMA 4B9DA 3QCQA 5T3QA 1T45A 2CLXA 2YISA 5AV1A 1UV5A 4FIJA 4D5KA 4CSVA 3SW7A 3LXKA 3CY3A 5LJJA 4RLKA 4X2FA 3PXQA 5AUYA 4NFMA 2ZB1A 3A61A 4RC2A 3VBVA 2UZWE 3C0GA 3VW8A 1H8FA 3V8TA 1GIIA 4FK3A 1MRUA 3PY0A 4ID7A 4K18A 4D4VA 2VTOA 4IBMA 4DN5A 2P2IA 2EUFB 3FYKX 3HECA 4KSQA 4IZ7A 1TQPA 4ACCA 3CY2A 1YVJA 3DGKA 4AOIA 3I7CA 5C4KA 5H8BA 3U6JA 2J2IB 1P4FA 2Y4IB 4F09A 3DXPA 4G16A 2ZVAA 3FEGA 4FNZA 4BR3A 2OFUA 3LQ3A 3MVHA 1RE8A 4KBAA 4FTLA 4IVCA 5CWZA 5AP0A 4QYEA 4M0ZA 3LJ2A 5M44A 4D0WA 2IG7A 4GT4A 4NCTA 3UVQA 4WG5A 2R3JA 3R02A 4ITJA 2XNMA 5IPJA 4FV9A 4NSTA 2EXMA 5AV0A 5IA4A 1V0OA 2OBJA 3QLFA 3QQUA 1I09A 4WRSA 4O6EA 4ZY6A 2R3NA 3MSSA 3VS1A 2JFLA 4FVPA 5ANJA 4EUUA 2OJIA 3RZBA 5H9BA 4M3QA 2AYPA 1LEWA 4JDHA 4G5PA 5DT3A 4YGAA 1H1SA 4I6LA 4AW1A 3OTUA 2J5EA 3NNVA 4O7YA 2Z7LA 2GQSA 4FKQA 3R8VA 4EI4A 3PJCA 4ERKA 5CEKA 4AP7A 3QQLA 4MBJA 3MVJA 1ZMVA 2X81A 4F1TA 2C6EA 4RC3A 4YJPA 3W33A 4EOSA 2W5BA 3PJ8A 5C4LA 5C8KA 3MVLA 3HKOA 4IB5A 4S31A 3F69A 4KKGA 3VO3A 4AA0A 1M52A 3FMEA 1LUFA 4K33A 3FZPA 2PVJA 4FKGA 3QZGA 4IANA 4QMOA 4ZEGA 3MIAA 3EQFA 2RKUA 4FKRA 4YJRA 4G6LA 2W1GA 3E8CA 3U4WA 4U9AA 3HLLA 1BI8A 1WCCA 3OP5A 3ORZA 4MXOA 2FH9A 1U5RA 3PYYA 4DFYA 3PA5A 4KKEA 3IDCA 2HWPA 1XH5A 3ORPA 1H25A 4K77A 5TF9A 4PTCA 4M67A 4O38A 5FTQA 2W1IA 2GFCA 1WZYA 1GZOA 4QTCA 5CU6A 1H0WA 2C1BA 2RFEA 2XP2A 3NCGA 3O23A 2B1PA 4FTRA 4GSBA 4AF3A 2BRNA 3S4QA 2I7QA 3OD6X 1QPCA 3R8LA 2ITTA 3QTSA 3ALNA 4NM5A 2JLDA 2QOHA 3RPYA 2C6MA 3NIEA 3TM0A 2OIDA 5T68A 5IA3A 3R21A 3UE4A 3G9LX 5CU4A 2IW8A 4D58A 3Q4CA 4EHEA 3U54A 1IRKA 3G6HA 3DQXA 4CT1A 3ATSA 4L6QA 4ASEA 2KULA 3VBQA 4N0SA 3R1SA 4FSUA 5AWMA 4FUXA 5CF5A 3LFCA 3HV5A 3SV0A 3TMOA 4BGQA 5LMKA 3TNPC 5FEEA 2QOIA 1SM2A 4IQ6A 2VWVA 2V7OA 1YWVA 4MQ2A 2Z7RA 3LCSA 4EH3A 1PKGA 2BCJA 2ZFYA 3LFSA 3LW0A 3QQGA 5AM7A 3RMFA 3GQLA 3KMWA 3VQUA 4DHZA 2CKPA 2VWUA 4A9TA 1O9UA 4M97A 5BMMA 3ERKA 3DBCA 2A4LA 3LLAA 4LUDA 4RX9A 3PPJA 4FA2A 3WE4A 4KA3A 4BYJA 4CTBA 2GNGA 4AN3A 4TYJA 5TKDA 2J4ZA 4CKRA 4CCUA 5DG5A 3WIKA 3ELJA 3FI4A 4O7WA 5AP6A 2QODA 1KWPA 1KE8A 3HMPA 5FUTA 2CJMA 5EI8A 4GG5A 2X7OA 3NYNA 1J91A 3D5VA 3ZO3A 1CTPE 4H1JA 3I60A 1UNLA 2YITA 3OXTA 1P5EA 3PG1A 4AS0A 2WMTA 3DV3A 4DH3A 2YIRA 3FLQA 4G6OA 4I4FA 3VONA 2YABA 4JX3A 3QGYA 3KCFA 4AN2A 5M06A 5I9ZA 4H36A 3GU7A 4HCUA 3EN7A 5LOHA 1YI4A 4CMUA 3PLAE 3C1XA 3EQBA 3II5A 3FSKA 4GVJA 5IQBA 4YSJA 1BMKA 5CF8A 4CFUA 1XKKA 3ODZX 2VTRA 3B2WA 3ROYA 5HBJA 2QLQA 4AX8A 1BUHA 4XH6A 4E6QA 2WU6A 4K2RA 5A14A 1OGUA 2W1DA 4XCUA 3ZEWA 3ITZA 1ERKA 4O7RA 4DGMA 4PF4A 4DFUA 1P14A 1G3NA 2EB2A 1R1WA 4WNOA 1KSWA 3IDBA 5HG9A 3TJDA 5BVNA 1SZMA 3F5GA 4I4EA 4YBJA 2Q0BA 2YIYA 3HUBA 2BR1A 2J7TA 5B0XA 5D7VA 3QU0A 5M07A 3F3WA 4XP2A 4O0WA 1OBGA 4TPTA 5AUTA 3PZEA 5I4NA 2PTKA 4YC6A 3UNJA 5IH5A 4XRLA 3A4OX 4H3PA 2P4IA 3NYOA 3C5IA 2UZDA 3UG1A 5BQ0A 4V05A 3BYSA 5CEQA 1ST4A 1YI3A 2FSMX 2RFNA 4FKOA 4FGRA 3IKAA 4GFGA 3UNZA 3HMNA 2XK9A 3PRFA 1IA9A 4UY9A 4BCMA 2B53A 4MCVA 4M14A 3UQFA 3CR0A 5TOZA 3DKFA 2OH0E 2EVAA 3R1NA 2X39A 3BIZA 1OPJA 4IX3A 4R1YA 3SRVB 4BCKA 1FINA 3PZHA 3NUNA 1Q3WA 5E8VA 3TV4A 3EQHA 3ORMA 5A4TA 4EH6A 3MB7A 4W4VA 3VF8A 5HX8A 4XG4A 2XBJA 5IG1A 4AGUA 5DNRA 4BDDA 2XRUA 1NY3A 1V0BA 5CVGA 3ZBFA 2PZ5A 2YEXA 4F9AA 1ST0A 3FC2A 1OPLA 5JQ5A 2Y4IC 4O7VA 3ORTA 1M2RA 4UWBA 4IAIA 3O7LD 5AP3A 4G2FA 1ZOEA 2X2MA 2XJ0A 3HEGA 4ZXTA 5KE0A 4E5BA 4PRJA 2XM8A 4XEYA 3R71A 3KGAA 5IUGA 3UDTA 2NPQA 3G51A 2QOBA 2CKOA 3KREA 4LRMA 5BX0A 4DT9A 4C59A 2PZIA 3H9FA 4IVBA 4JS8A 4XV2A 2JAMA 3MY5A 3DNEA 4FSNA 3HRCA 3OG7A 4QYHA 4EWHA 4F7SA 4JIAA 1J1CA 1ZMWA 2HXQA 2VO6A 1KE9A 2XVDA 3W8LA 2J50A 2XBAA 5JGDA 4PDPA 2VU3A 2GQRA 4JL9A 4GV1A 1R39A 2QOLA 1F5QA 2XNGA 4EOOA 4HPTE 1O6YA 4EJNA 4L3LA 2XYNA 2YAAA 3QF9A 3GUBA 2O8YA 4NM7A 4QPAA 5LWNA 3UVRA 5IQHA 4H58A 2F7ZE 5KZ0A 4X3FC 5HKMA 1XMLA 2DWBA 2V7AA 3QX2A 4S34A 5AX3A 3BX5A 5HICA 3KULB 1G8JA 3ID6C 3KF4A 3PJ2A 3HX4A 4FIEA 4L43A 5L2TA 2WMBA 3P78A 3R9HA 4DT8A 2PVLA 5M09A 4AZEA 3PSDA 4AXEA 4O0SA 2BFXA 2PSQA 3MFUA 3PA4A 3MFTA 2NYAA 3TZ7A 3W2RA 1WBSA 1H27A 4Z16A 4BDEA 4C4EA 3NGAA 3RPVA 4QQCA 3WZEA 2I0EA 4WG3A 3F66A 4P7EA 5FEQA 2IVTA 4FKUA 2ZV2A 5LVLA 5CNOA 4A9YA 3ORLA 4QP2A 5HG5A 3SC1A 2XRWA 4ZTSA 4XRJA 4YU2A 3F3TA 3GT8A 4O91A 5F20A 1WFCA 2WTCA 2PVYA 4J53A 1W84A 3QKLA 5F9EA 5CT0A 3LHJA 3VN9A 2WELA 2WMWA 4O0UA 2NP8A 5K4JA 4WBOA 4G31A 4D1XA 5EM5A 3F61A 3TCPA 2PULA 2UZOA 4FSMA 2QG7A 5KMMA 1URCA 3LMHA 1B6CB 1VYWA 4A4LA 3U8WA 4EK4A 4EQMA 5FDPA 4JG8A 3ANQA 2ZV7A 3MY0A 4QMMA 1I44A 4QYFA 2QG5A 3FXXA 2QKRA 5JFVA 4EQCA 4F63A 3ORNA 5EM8A 5H8GA 4DLIA 3O5AA 4JJRA 3P79A 4Q9ZA 3E3PA 3NX8A 4WZYA 4BZNA 1H0VA 4I0SA 3TT0A 3GCVA 1P4OA 2PVFA 5AV2A 4CT2A 4EOKA 3SDJA 3OW4A 3QCXA 3DTCA 3OY3A 1FGIA 1TQMA 2PE0A 3I5ZA 3COHA 5BYLA 2F4JA 2W9FB 4JG7A 2BIYA 3BQRA 4XV9A 1HCKA 3EFWA 5HHWA 3CD3A 3KVXA 4X0MA 2A0CX 2W1EA 3U87A 4ANLA 3KRRA 5B2LA 3WZJA 4BC6A 4C58A 2JGZA 2VO3A 1Q24A 3KK9A 5I9UA 4K8AA 3BI6A 4EKLA 1UNHA 1IA8A 2I6LA 4RIYA 4XG3A 3SRVA 3BHYA 4GL9A 5M08A 5AADA 4FT9A 1XH8A 5EQPA 4GU6A 2ZYBA 4ITHA 2FGIA 3A7IA 1MUOA 3QD3A 4FTUA 2VNYA 4JBQA 4CFNA 3F7WA 3E7VA 4DDIA 4GFOA 4KKHA 4L3JA 2CSNA 4RPVA 4B8LA 3FLYA 2CGWA 3VUDA 4EH4A 2HXLA 2XIRA 3LJ1A 3NUXA 3BHHA 1R78A 2IPXA 5CAQA 2JBPA 3R30A 2X7FA 3DT1A 3R8UA 5CSHA 5FP5A 3PUFC 3ZDUA 1WAKA 5BUIA 2XB7A 4DITA 5M4IA 3RGFA 4PTGA 1NXKA 4DH5A 3TJCA 1CM8A 3CTHA 2XANA 2WMXA 5CU0A 3VVHA 3FKNA 5BUJA 2GCDA 4DGOA 2IW6A 4GT5A 4UYAA 4L8MA 3OOGA 4A07A 2PE1A 3EIDA 4HNIA 4E4LA 3S2PA 1REKA 2GU8A 1KV2A 4PL5A 2CLQA 4ZTRA 4AT3A 1U46A 3I6WA 3MTLA 3MDYA 3LPBA 4BTKA 2F57A 1ZZ2A 2VUWA 2JEDA 2CPKE 2PVRA 1UU8A 3EQRA 5LMAA 3FPQA 3VUHA 4EBWA 3NW6A 5ITAA 4R78A 2Y8OA 2Y9QA 2BTSA 2YCFA 3FMJA 4D5HA 2XEZA 3QQHA 3W0NA 2HENA 2HK5A 2Z2WA 1JQHA 3HUCA 1WMKA 4EH8A 3S0OA 3V8SA 5IZFA 2X2KA 3WF9A 3GOPA 2XH5A 3KULA 3B2TA 2C6LA 4M8TA 4MNEB 4PV0A 2YIXA 1JKKA 2BZIB 3M2WA 3QRJA 4DGGA 5FG8A 4EJ7A 5FP6A 4O22A 4FZFB 4FTNA 4EOJA 5LVMA 3VUMA 4G3GA 4RIOA 1YI6A 2WKMA 3DNDA 3BHVA 3R9RA 3TL8A 4KAOA 2PVNA 5LXMA 3D7TB 5J7HA 3WIGA 4ZTQA 4D28A 4JT3A 2VD5A 4TY1A 3FZTA 2WQEA 3CGOA 4CV9A 4ZJVA 5CANA 5AAFA 4EH9A 1JVPP 2XYUA 3Q2MA 3UOKA 3ZU7A 3CQUA 5EG3A 2PMNX 2OJJA 5HX6A 2R3MA 4ASXA 3CE3A 3TEIA 4NTTA 3UGCA 5EI2A 3GNIB 4YSMA 2WAJA 3IOKA 4MQ1A 3BL7A 5E8YA 3VAPA 2ETKA 1YRPA 3DDPA 3NNWA 4KABA 2RG6A 4FTIA 2XUUA 4EC8A 5KNJA 2JAVA 3EH9A 4BF2A 1JLUE 4BDBA 2E2BA 4E4MA 4FG8A 1SVHA 2WB8A 5ACKA 1XHAA 1E1VA 3FI2A 4M12A 2OIBA 4ASDA 3VNTA 2WEVA 4QTBA 4BCHA 5JGBA 4U8ZA 4A9UA 4GK3A 4QP1A 5GIOE 3BGQA 3CPCA 4FKLA 2OG8A 3MVMA 4G5JA 4XV1A 4YC8A 2IW9A 4KRDA 1PF8A 4ZJJA 5HIDA 3HV4A 2C3IB 3R0TA 2XAMA 4D4RA 3MA3A 2XNNA 4GMYA 5EOBA 4IAYA 3W0SA 3D0EA 4BCNA 2C6KA 3Q2JA 5A3XA 2E9VA 3UYTA 2YERA 3BYUA 3G15A 3O8TA 1YXVA 4KRCA 3TV7A 1WVXA 5EW9A 1M7QA 3HV3A 4HZSA 3H0YA 3NDMA 3NRMA 2ZV9A 2J90A 3PXKA 5LVOA 3PY3A 4U3ZA 4IZAA 2C5OA 2BFYA 3VC4A 3P5KA 4Y85A 4NL0A 5CYIA 3H30A 3MH0A 1CMKE 3AMBA 3R28A 4WHZA 3RALA 3OF0A 4KD1A 2FYSA 3DB8A 2GHGA 2RFSA 3COMA 3BLQA 2BZKB 4EZ5A 3ODYX 4IHPA 2G01A 3N4VA 3ZZEA 4EYJA 3DB6A 4IWOA 4QO9A 3ZXTA 1VJYA 2ITPA 4EWQA 4RQKA 4FT3A 4OTRA 4F64A 4R1VA 3EOCA 4O7TA 4OTGA 2UUEA 2PUNA 4OTWA 1Q4LA 2UW0A 3OBJA 4V01A 1U5QA 3EYGA 3FQHA 3R73A 4B6LA 4EORA 4CLIA 2YCQA 2GNIA 3CSVA 3O17A 4RJ5A 1FOTA 3KEXA 3I81A 4QP8A 3BKBA 3UC4A 5K5NA 4IADA 2JBOA 3D4QA 5DVRA 4I93A 2H9VA 5J9LA 4HNFA 1NVRA 3D94A 4FSRA 5AEPA 4H39A 2QNJA 4M13A 2I1MA 3V01A 2AUHA 2XNOA 1FMKA 5CF6A 4NJ3A 2V5QA 1UWHA 1IEPA 3AD6A 3A8WA 3CTJA 4JI9A 3KXMA 4RVLA 2OH4A 2WFYA 4FSWA 4X21A 4E1ZA 1XQZA 3ZFYA 3BWJA 3U6IA 3KN5A 1PRYA 2ITQA 3R2BA 4IMYA 4WBBB 5L8KA 5L6OA 3EZVA 3AC4A 5I0BA 2OF4A 1G5SA 3KXXA 3PXZA 3JXWA 4HCTA 4TYEA 4OBQA 4WG4A 4CXAA 4Q5EA 1W83A 1XH6A 4EH7A 2V0DA 3DK3A 3KN6A 4FZ7A 2J0MB 1Q8UA 3LOKA 1PXOA 4I6FA 4WNMA 3F2RA 5HCXA 2XMYA 4IW0A 4L3PA 3ZZWA 2PUIA 2OFVA 4AXFA 4C4HA 3QRKA 4HVIA 3CCNA 4DFBA 3SLSA 1YWNA 4L7FA 5AP7A 3A99A 3QKKA 3V6RA 4JBOA 1OIUA 5LCJA 4R3PA 1XMMA 1J7LA 3ZXZA 4AXAA 1K2PA 2QCSA 2V55A 3RTPA 4D1SA 4AE6A 1PXJA 3TI1A 5K9IA 3L9MA 5L2IA 5BVOA 5DRBA 2QD9A 4CGAA 3Q04A 3RCDA 3BV3A 5IDNA 4AT5A 4FNXA 4FKTA 2O63A 3SQQA 2C5XA 5JZNA 2C0OA 5ANIA 3KMUA 3ZHPC 4ARKA 4BCIA 3UOJA 1GNGA 4BIDA 5E8UA 3CQWA 3H9RA 3FQEA 1QCFA 4BDHA 5L8JA 2VTQA 5KMLA 2UW5A 5FQDC 3JY9A 2VTNA 2W7XA 5KMIA 3V5QA 1AQ1A 1K3AA 3VHKA 4HVGA 5IQGA 4U94A 3HMOA 4QMYA 3SVVA 2BMCA 3HP2A 3FWQA 2V62A 1UKIA 4G9RA 4S33A 3RK5A 5IEXA 5C27A 3PVBA 2R2PA 2XCHA 2HZ4A 4F9CA 3CLYA 3IGGA 2XIYA 3Q9ZA 4TT7A 4JMQA 2P0CA 4XUFA 2FB8A 3BU6A 3O7LB 4RJ7A 4C36A 2UZVA 3QD4A 1ZWSA 2UW4A 3QL8A 2FSLX 3MYGA 4BCQA 3IOPA 3O51A 4YJNA 2R64A 2W1ZA 2WTWA 3G9NA 3QLGA 4U81A 5I9VA 3LE6A 1FBNA 4JBPA 2YWVA 3Q6WA 4F6UA 2VWWA 4YUQA 5J5SA 4NZWB 4EOMA 2QHMA 3RINA 3RK9A 1KOBA 5FBNC 5C26A 2QR7A 1YHWA 1J7UA 4O0TA 3N4TA 3E87A 5A6OA 3TN8A 5CZHA 4USEA 2XKDA 2GS7A 1YW2A 2ZMCA 3ENHA 4BCGA 1OKWA 3FLNC 1RDQE 3WF5A 4C4IA 3AQVA 3H9OA 4PL3A 3R7OA 3PPKA 4MXXA 4LDTA 3A7GA 1WBVA 4YTCA 2ZMDA 1OM1A 1CKJA 1LR4A 2CGXA 3IONA 2B4SB 2Y0AA 3VBXA 3ULZA 2YM8A 3ZSHA 4NU1A 3A7FA 3TIZA 3D7ZA 2I0YA 4QPSA 4ZSEA 3ATTA 3N4UA 1H1QA 1VZOA 3GU4A 3IECA 2QLUA 2VTAA 4PNKA 4H3BA 3JYAA 4AZVA 3BPRA 3SXRA 1KE6A 2ZJWA 1PXMA 4Q5HA 1IAHA 3CQEA 2YCSA 1GIHA 4P4CA 5CI7A 3ZBXA 1FGKA 3MB6A 3ZM4A 3DDQA 2Q0NA 2CN8A 3KQ7A 2RL5A 1WBOA 2ZOQA 4XLIA 1Y57A 2VTHA 5CX9A 4ZTHA 3V8WA 5DA3A 3W2QA 4RJ3A 4AFEA 3R7UA 5FM2A 2R9SA 3K54A 4BDKA 2BDJA 3DA6A 5CASA 4USFA 2RF9A 2BDWA 1TQIA 3LFQA 3NUUA 3OWLA 2BPMA 4XOYA 2SRCA 1Q99A 3DXQA 4QMUA 5DIAA 2UW8A 4U45A 4NW6A 2ZM4A 3R1QA 4MD8E 1OZ1A 5AP5A 3FUPA 4X3FB