3W0OA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia, ternary complex with adp and hygromycin b
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0oA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0oA02
1J7UA 4O7OA 3ATSA 5IQFA 2I7QA 3N4VA 3HAMA 5C4LA 3SGCA 1L8TA 5BYLA 5IQIA 3C5IA 5IQCA 2CKQA 2CKPA 3SG8A 5IQEA 2PULA 4FEWA 5IQAA 4U98A 3CSVA 4CGAA 1J7IA 3F2RA 4WZYA 4O7PA 2BKKA 3FEGA 3W0NA 3Q2JA 3ATTA 4H05A 5FUTA 3N4UA 5FTGA 5EQPA 4DTBA 4CG8A 4DCAA 3TDWA 3G15A 3DXQA 3ZM9A 4PDYA 5EQYA 2QG7A 4GKHA 3W0OA 5IQBA 5EQEA 3TDVA 4DE4A 4DTAA 4N57A 4R77A 5IQGA 5IQHA 3W0QA 4FEUA 3FI8A 4ORKA 3W0MA 2PPQA 4DT8A 2Q83A 4CG9A 3W0SA 4FEVA 4DT9A 4FEXA 2PUPA 4DFBA 3N4TA 3UZRA 4GKIA 3HAVA 3W0PA 4DA5A 2CKOA 2IG7A 3W0RA 3LQ3A 4U94A 2OLCA 3MESA 4R78A 5IQDA 3DXPA 3TM0A 1NW1A 4BR3A 3SG9A 2B0QA 2PUIA 2PU8A 3TYKA 2PYWA 1J7LA 5C4KA 3JR1A 5AFVA 1ND4A 4DBXA 2PUNA 4DFUA 4R7BA 4EJ7A
chains in the Genus database with same CATH superfamily
4JOAA 4EBVA 1UA2A 2BIKB 5KMMA 5DRBA 2G9XA 2ZV9A 3DNEA 1WBWA 4HVIA 1F0QA 2CJMA 4XHKB 5HVJA 4G16A 4RJ6A 5DWRA 4K8AA 3EOCA 3TG1A 4JRNA 3VVHA 4HVGA 4WD5A 2QODA 3RJCA 2QKWB 4AU8A 2C6MA 3BPRA 4ZS0A 4FTQA 3DFAA 2YJSA 4CFXA 4IZ7A 3W8QA 2FYSA 5CI7A 3I6UA 5TR6A 4ZTLA 5KO1A 2XK3A 3OMVA 3P08A 3FY2A 3O96A 4DFZE 4CCUA 4D4SA 1OKZA 1R0PA 4PTGA 4W4XA 5IG1A 3AGMA 2W1FA 4FIGA 3SC1A 4I6QA 2JKOA 3PE1A 4EUUA 2XALA 3KMWA 4GJ3A 4GG7A 2REIA 2PWLA 4FV6A 5BUEA 3RKBA 3HLLA 4FGBA 3PVBA 4RRVA 5FUTA 4YZ9A 3HA8A 5EI6A 4MX9A 5GNKA 4WO5A 4TYHB 1KV1A 3EHAA 2RFSA 2YWPA 3LPBA 4J52A 4Z9LA 3F3TA 3G15A 4I4FA 3FLYA 4RIXB 4I4EA 1P4FA 4TYGA 1XBCA 4EOQA 2QG7A 4JBQA 4DDGA 3IDCA 4FIHA 1EH4A 2X39A 3QGYA 4NH1A 1PXMA 2CNQA 4FT0A 5LJJA 3FMDA 3L9MA 3NFGB 4M3QA 4XX9A 2W96B 2W1IA 3R0TA 4KIQA 2OJGA 1A9UA 1J1CA 4I5CA 5AP7A 1SVGA 5FBNC 4ZTQA 1XBAA 2ZM4A 5JRQA 1PXNA 2ZB0A 4G3DA 4CSVA 3AD4A 4CZTA 3VHKA 4NCTA 1AGWA 1U4DA 3BCEA 5IZFA 2VU3A 4FUYA 5CYIA 1LPUA 1CKIA 4AF3A 2HOGA 3P79A 4GVJA 2NNWB 2E9VA 2XAOA 3AKLA 2WEVA 3A61A 3EKKA 2WU6A 3Q4UA 4JT3A 4XBUA 4BYJA 2WOTA 1Q8WA 2O3PA 1OUKA 2VGPA 4FIIA 3ZCLA 3HV7A 5E8VA 4UYAA 4RX8A 2XIXA 4F7JA 5FQDC 5HTBA 1FPUA 3AMAA 3W0RA 4ZY5A 3MA3A 1KE8A 1P14A 2OLCA 1FVVA 4R78A 5KMKA 4RX9A 4FKLA 1O6YA 2FO0A 4F99A 1GIHA 2OXXA 4XV3A 3V5PA 2PUIA 1VZOA 4YJVA 2J5FA 4EOJA 4PV0A 3NUYA 2JFLA 4BY9E 4NUSA 2BALA 3ORLA 4U80A 4C02A 2IVTA 3SAYA 4F7NA 4EKKA 1XWSA 1TVOA 2LGCA 2VAGA 3QALE 2HZ0A 3AC4A 4RFYA 2ZYBA 3ULZA 3VRZA 4IAKA 1CKJA 1STCE 3EYHA 4BDAA 2W7XA 4B99A 4EJ7A 3F3VA 4ZTRA 3ROCA 4O7OA 1OL5A 4N6YA 3UZTA 3CQEA 4JRVA 3VF9A 3QQGA 4I22A 3C9WA 2AEGA 4QTDA 5IA5A 2Y9QA 5EH0A 4FTMA 4FZ6A 5HGIA 1DM2A 4RVKA 1UVRA 1GZKA 5BUIA 2ZDTA 4QMXA 4U5JA 3QQKA 2XM8A 4C2VA 4DFXE 4NFNA 2JFMA 5BYYA 3AD5A 3FHRA 2CSNA 3VF8A 5FDXA 2R7BA 4FZDB 2VX3A 4HOKA 4ASEA 3SG8A 2R3OA 3HUBA 3D7ZA 3T9TA 1H1RA 5KKRC 2CN8A 2VX0A 3S95A 2PVFA 3FY0A 4C58A 3MSSA 1H25A 3PG3A 2QOLA 2JDOA 4GEOA 2YIQA 4XRLA 3A4PA 4TPTA 2HW7A 4R7HA 3SVVA 3MPAA 4MBJA 2BTSA 3F7WA 1XHAA 2ITNA 2Y6MA 2ZB1A 2GNHA 2ONLA 2XIYA 1NXKA 3NUPA 3O2MA 4I0TA 4YC6A 3UE4A 4EKLA 3R8UA 2VTQA 3FHIA 3TNIA 4EZ7A 1V0OA 2NRYA 4HW7A 1OIQA 4USFA 3NWWA 3A7IA 4FSNA 4AE9A 3F3ZA 2O2UA 5JZJA 5CF4A 5HHWA 4C3FA 4ALUA 4XH6A 3F69A 3WF7A 2XNOA 3KRRA 2PZ5A 4G9CA 5CSVA 3RNYA 3K5UA 3FSKA 3DB6A 3ZONA 2XP2A 1GOLA 3VW6A 3A99A 4RFMA 2HY81 3QC4A 5IUIA 3PZEA 5L2SA 4BCMA 2A2AA 2JDRA 4J53A 4N57A 5EYMA 4NU1A 1FBNA 4YJPA 5H3QA 5BVOA 1SZMA 2BILB 2XNPA 2YIYA 1H24A 2BZKB 4BGHA 3F7ZA 1JPAA 5CNNA 1Q3WA 5HO7A 4MYGA 3RM6A 3FI8A 1PXKA 1NY3A 4Y95A 1WMKA 2IW9A 3COHA 4OTRA 4N6ZA 4UB7A 3BRBA 2LAVA 4E73A 2JD5A 1PXLA 3KFAA 4O83A 2XCKA 2R9SA 1GJOA 3BEGA 1B38A 2W9ZB 3G9LX 4LV8A 2WMTA 3PP0A 3QC9A 4U42A 4YHTA 5EYKA 2XH5A 1GZ8A 2IVUA 4O38A 2WZJA 4RJ5A 2PMIA 1ZWSA 4IWDA 4D0XA 2DUVA 3BHVA 5EYCA 2WO6A 2HW6A 3DAKA 2OW3A 3CIKA 4JIKA 5IISA 4FTAA 3PIYA 4G6NA 2I0YA 5DEYA 5LOHA 3FYJX 4F70A 3TUDA 2I0EA 2YM4A 4I24A 5F9EA 1H01A 4AOJA 5FGKA 1Q8TA 3OD6X 3LXLA 1Q97A 4MCVA 4ZMEA 2VO6A 3AOXA 4E93A 4BIEA 4IE9A 3W2QA 3BEAA 2VO0A 3IDBA 5FTOA 1ND4A 2PVNA 4PP9A 3PY0A 2P0CA 4AE6A 4EOOA 3BHUA 3M42A 3SXSA 3QD3A 5ICPA 4LRJA 4CCBA 2X2MA 3GU4A 4AXCA 3GFEA 1J7UA 4L43A 4YJOA 1M2QA 3ATSA 2XKFA 5HZNA 3F3UA 4FV7A 2OGVA 3E3BX 4XLIA 4IVAA 1YXSA 5DR2A 4XRJA 3VUGA 5IA1A 2Z7QA 4WHZA 4QMYA 3OTUA 2W99B 2WAJA 3G33A 5IQIA 3GB2A 5EOLA 2HENA 5C9CA 3TV4A 1UKIA 3I6WA 1H27A 2EVAA 4JDIA 3TUCA 1OL2A 4DDIA 4NCTC 4PP7A 3DY7A 4UXLA 5IQEA 5LVNA 2PULA 3ZO3A 3Q4TA 2QOCA 5AM7A 3R1SA 4QQ5A 5IQAA 2NRUA 2JC6A 3MTLA 5HD4A 4FG7A 2CGXA 4QP4A 4O7NA 4PNKA 5L8LA 3BYOA 2ETKA 5F1ZA 5C8NA 4CGAA 4QMVA 1JKKA 5HU3A 2F2CB 3QKMA 3PA4A 1UU7A 5J87A 2Y0AA 2RFDA 5LWNA 3R8PA 1OPLA 5A4CA 3FAAA 3EQIA 4UALA 4ZZNA 5HTCA 1YRPA 4GRBA 4IX6A 4NIFB 5AX3A 4R1VA 2R3GA 5E91A 4I5HA 2JIIA 4JI9A 3ENMA 4CFFA 4QP2A 4EH3A 4PDYA 4RX7A 3FQEA 4KNBA 4OGRA 4FTKA 4YU2A 1JKLA 3E8NA 1VLRA 4C4FA 2GTNA 3ZLSA 3K3JA 4F08A 4IVCA 3FPQA 3RHXA 3E63A 5AA8A 2X8IA 4CKJA 1TKIA 2YDIA 3ZLWA 4D1ZA 2IVVA 2OJFE 3FKNA 3VBYA 4BCPA 4M12A 4MUQA 4QNAA 3FQHA 3FLZA 4ZJVA 3V01A 4B8MA 5FXQA 5J1WA 2QCSA 5CU4A 2WU7A 3BL9A 4ZZOA 3TKUA 1ATPE 1MP8A 3SXRA 4UN0C 4C4JA 4DT8A 3QGWA 2ITYA 2Q83A 4IJPA 1E1XA 4FUXA 5DHJA 2PUPA 3CC6A 3O17A 4G5PA 2O64A 3E3PA 4QDVA 3TT0A 4AZVA 3EQCA 1G5SA 2XARA 3TL8A 3VJNA 3VS6A 1VR2A 2C0TA 3ACJA 5IA0A 4C4GA 3TIZA 3UMWA 4V05A 3ZU7A 1CMKE 3A60A 4XMOA 3OXIA 2GCDA 3TM0A 1XMLA 5G6VA 3LJ2A 2JKKA 5ANEA 2WQNA 4GT5A 1ZMUA 4NJ3A 2P55A 4WUNA 3MW1A 2G15A 3NPCA 4XEYA 4Y83A 2BPMA 3TNPC 1ZY5A 2ITTA 3UIXA 3VJOA 3DK6A 4CQEA 2Y4PA 4CFWA 3Q4ZA 1W84A 3EFKA 1ZMVA 4AOIA 3GT8A 1H0VA 3PE2A 5BQ0A 3BGPA 1LUFA 1M7NA 3DB8A 4J97A 3UQGA 4FG9A 3F3WA 4YNOA 1OBGA 4FNZA 1KOAA 3Q53A 3VONA 4EQCA 5IEXA 1YWNA 5LARA 3KULB 4RPVA 4ZLYA 5LWMA 3HECA 4TNDA 4Y72A 4D5HA 4HCVA 5CANA 3Q6UA 3IW4A 3R30A 3L8XA 4HPTE 2AYPA 3THBA 4AXFA 4CT1A 5D41A 2EB3A 3BWFA 4BDEA 5JH6A 4FSMA 5IQCA 4JQEA 5AUVA 4IM2A 3Q60A 2W5BA 3HP2A 2EUFB 3KN5A 4XUFA 1ZYLA 4Q5HA 3CJGA 4TYIA 5CSWA 3ORTA 4CRSA 4RBLA 3C4EA 1YXVA 5EHYA 4TRLA 3EN9A 4ANLA 4AWIA 2XKDA 3D0EA 3O7LD 4BI0A 4L8MA 4BC6A 4DCEA 3LQ5A 3TTIA 3NUSA 1J7IA 2OJIA 3QHRA 4O7WA 5AV3A 3CR0A 3D7TA 5KZ0A 3RAWA 4O7PA 3D4QA 1TQMA 3OBGA 2RFNA 2XRUA 4IX5A 3AKKA 1WAKA 2XANA 4AN2A 3GCVA 3BV3A 5DPVA 3LQ8A 5IEYA 1ST0A 3HX4A 4I1ZA 3W18A 4O91A 2JGZA 3NW7A 1L3RE 3OTVA 3PJ3A 3UDTA 4RX5A 3EL8A 4FT9A 3NAYA 2IO6A 3U9CA 4KS8A 4MWHA 4BICA 3TCPA 1Q41A 2BFYA 4A7CA 4ZY4A 1XMMA 3ORZA 4JVGA 4E4LA 3KU2A 1Q4LA 5TT7A 4FTCA 4FNXA 4FKIA 2O63A 4TZRA 1WBNA 1FINA 3FLSA 3FMJA 3JXWA 4FR4A 5HNBA 3RPYA 4DGNA 5AADA 4F65A 4IB0A 1GIIA 2WB8A 2YHVA 3R8LA 5JN2A 2J0IA 5IQHA 3I1AA 4F7LA 3RPRA 4RZWA 4X3JA 2QOBA 3QUPA 3PY1A 3K2LA 4UWCA 3TMOA 4F1OA 4TKSA 5F94A 1PY5A 3MGYA 3M1SA 4J1RA 2YITA 4XV1A 3RK5A 4RJ3A 4DHZA 2OIQA 3LIJA 4IBMA 4YTCA 1PXJA 5I0BA 5LVOA 2WTDA 3KB7A 3EQPA 3HMPA 1XBBA 5AUZA 5IH6A 3LQ3A 3IOKA 3OWLA 1JOWB 2VWBA 4QYGA 3U51A 4LMNA 1OI9A 4HJOA 2X7OA 1DAYA 5AP5A 5GJDA 3D83A 5FEDA 2B4SB 3POOA 5HD7A 4DEIA 2PYWA 4I6FA 3FZTA 3QCSA 2OZOA 2R0IA 2YN8A 3FUPA 4IC8A 3WZJA 4RT7A 4HCTA 4JMQA 2A0CX 2IN6A 3P1AA 3IPHA 5FBOA 4X2JA 4Z7HA 3KREA 3MFSA 4FKUA 4E6DA 3U4UA 4FSYA 4QO9A 2E9UA 2UW6A 2YDJA 4X6QC 2VX1A 3OC1A 5HEZA 3VAPA 1P4OA 3E7OA 1RQQA 4RVMA 4AT3A 3V3VA 1KSWA 3OXZA 4IAFA 4IAAA 1WZYA 2VUWA 2GHLA 4IEBA 5EKOA 5IF1A 2EB2A 3EZRA 3IW7A 4DH8A 4E1ZA 3I79A 4Z55A 2OH4A 3Q9ZA 2YAKA 2XJ2A 4TWOA 4MD7E 1U54A 3WF8A 3MFTA 5DI1A 5BVDA 3DDPA 3H4JA 4IHPA 3DGKA 5AIRA 3F82A 5H8GA 3TZ8A 3UG2A 3VS2A 3V5LA 1VEBA 3COMA 4PL4A 4ZAUA 1ZZLA 3DQWA 3CSVA 5G1XA 4QNYA 1PXOA 4F64A 4QYHA 4D4RA 5LQFA 2BDWA 1M17A 1H1PA 1Q8ZA 3FYKX 4OT5A 4J99A 4BDKA 3HV6A 3UG1A 4FEQA 4A9UA 5AIKA 4ANSA 4RZVA 4YJTA 3F6XA 4OTQA 2OF4A 4JR7A 3Q04A 4AFJA 2PZPA 4OUCA 4GS6A 3W0OA 3U6IA 3F5UA 4QMPA 4C36A 2AUHA 3VUDA 5LCKA 4FSQA 3DBDA 4WSYA 3B8RA 2J7TA 3TDVA 4IM0A 4F9WA 4P7EA 3NW6A 3BHYA 3ANQA 3PA3A 4XG3A 5CXZA 3FXWA 3LFNA 2BDJA 4H58A 1JSTA 2PE1A 2I0HA 4FKQA 1CSNA 2GHGA 3PVWA 4MD8E 4LOQA 5H8EA 4DBNA 1KV2A 2IJMA 3KRJA 4I93A 2JDTA 2X9EA 4NSTA 5CU6A 3ZSIA 4IVBA 4OTHA 1Y8YA 3RMFA 4MD9E 5F4NA 3GENA 5FD2A 3NYOA 4OBOA 2O8YA 1BL6A 1M52A 3R6XA 4QMMA 3IO7A 5DH3A 3SQQA 1V1KA 1J3HA 3R21A 4G6LA 5JKGA 4IACA 3JVRA 1K2PA 4Y46A 3F5XA 2Z2WA 3QKKA 4U9AA 3ZC5A 4BBEA 4AUAA 1ZYSA 4DG3E 4D4VA 3MFUA 3OOGA 4HZSA 2J50A 3CTHA 2J2IB 4YMJA 3CKWA 4WT6A 5HE2A 4PL5A 3RAKA 5E92A 5M55A 4KIOA 3R7OA 3RAHA 1Q3DA 2QO9A 2BTRA 3C4XA 3I60A 3GCSA 4IAYA 3UYSA 3SKCA 2RG6A 1CKPA 3VUMA 5GIOE 3OWPA 4A06A 4OTIA 4DGOA 5D9HA 4EHGA 4EQMA 2YCQA 2GPHA 1H1QA 2YWVA 4PF4A 3ZDUA 4FKSA 3NYNA 2CGVA 4YLKA 1H8FA 4EORA 4O7SA 5L8KA 4FIJA 4A4LA 4UY9A 1OKVA 4DFLA 2WGJA 1H08A 2WTKC 4LV5A 5CQUA 4ANQA 3CQWA 3GC9A 3QXOA 3QLGA 5L6PA 2HELA 2WELA 3AD6A 3BLRA 3F61A 3FZOA 5EHOA 4CTBA 4YURA 3QTUA 4P4CA 2BRHA 2OBJA 2WQBA 3DPKA 4RWIA 3UO4A 4AA4A 4RC2A 2QU5A 4I20A 2FSTX 2UZEA 4YBKA 4ID7A 2QOOA 2WTWA 2C5OA 4BCHA 2VTLA 2WMBA 4BTJA 4MBLA 4BYIA 4DFYA 4EYMA 2XKCA 2J5EA 3MVJA 2E9PA 5KZIA 5HX6A 4C7TA 3IG7A 4XG2A 3JY9A 4GYIA 4O0YA 4WBBB 2UZVA 4XOZA 4OW8A 3D94A 3RALA 3GU7A 2UZDA 5GJGA 2RF9A 3I81A 3OW3A 5JRSA 4F6WA 2QOIA 1LEWA 3N51A 4E7WA 4D5KA 3VNTA 4HZRA 3ZEWA 4LM5A 4BCQA 2C6TA 3NDMA 4U81A 5CEMA 5EK7A 5CQWA 1MRVA 2ITPA 3QCYA 4F0FA 4YTIA 4O27B 4BHZA 3JPVA 2J0JA 2ZJWA 3OBJA 5DBXA 3ZS5A 5M4FA 4CVAA 3CLYA 4F6SA 2CKQA 4KWPA 4C4IA 4NM0A 5CASA 1OL6A 4L00A 3SDJA 5CF8A 3UOKA 4JBPA 1W0XC 3OY3A 1G8SA 4O84A 3K3IA 3PG1A 4JAIA 3GEQA 3U87A 4WNPA 2PVLA 2JIVA 4NM7A 5LMBA 1OPKA 4FZAB 2G2HA 3DOGA 4JXFA 2CKEA 4HVSA 5E8WA 2QR7A 3MS9A 3QX2A 1QCFA 1YHWA 1YOMA 4BZNA 5JFSA 4XG9A 2BZHB 2YAAA 1KE7A 4UXQA 4V0GA 4C61A 4YLLA 2OIBA 3NCGA 1JLUE 2ETRA 3TXOA 1FMKA 2JDVA 4FJVA 2EXCX 2QC6A 3U8WA 4QDEA 2V22A 2W1CA 2I40A 3W8LA 3FI4A 4DCAA 2HAKA 2C3IB 5ETFA 5EW8A 5M07A 2F49A 5HG9A 1ST4A 5IUHA 4FT3A 4C4HA 3C4WA 4FE2A 4FC0A 5EQYA 4BCJA 4DAWA 5AP6A 2GQRA 2VWVA 5L2TA 3EL7A 4TWNA 4JBVA 4V01A 1B39A 5AP3A 3UP2A 3WI6A 4RLKA 1JVPP 2BRBA 3KC3A 2WHBA 4ZTSA 2OF2A 5C03A 5KBRA 3G51A 3E62A 4GSBA 2GQGA 3P23A 3QAME 4U0IA 3SRVB 4A9YA 4QYFA 4XP2A 2X2LA 2QHNA 4LDTA 4DE4A 1UWHA 2HWPA 4L67A 4QMTA 4ZSGA 5HESA 3FKOA 4GT3A 3Q5ZA 4QMQA 5KMNA 5DT3A 5A14A 4D2RA 4GIHA 4QYEA 4XV2A 2VRXA 3D14A 4FEUA 2C6EA 4KSPA 2YM3A 1WBOA 1IEPA 4S31A 3BU6A 3EKNA 4C59A 2E9NA 2PK9A 3DLZA 5M44A 2XK8A 2W1HA 2C6DA 3LM5A 4IAIA 2PSQA 3UZPA 3ZO1A 4V04A 3ZUVA 2XM9A 1BL7A 3DAEA 3A62A 2HYYA 2O0UA 3OROA 3QD2B 1YXTA 3TKIA 4LI5A 2OKRA 5I9YA 4ZIMA 3UTOA 1OVEA 4U44A 4G1WA 1W83A 3MB7A 3L8PA 3P5KA 3RPSA 2OI4X 4FV4A 2XK6A 3HV3A 3PJ1A 1ZAOA 3BQCA 3PXRA 4PTCA 5DIAA 4FTUA 2XIRA 3KMUA 4IANA 2BKZA 1XH5A 3EZVA 3F5GA 3ZFXA 4IB1A 3MA6A 3PXYA 1BKXA 3EQDA 5FTQA 4AXEA 2W9FB 3DKFA 3CE3A 3MB6A 1ZYJA 3BWJA 4IIRA 4OTGA 3D5WA 3KA0A 1IRKA 2WQOA 3KKVA 3MIAA 4FMQA 4YZMA 2H6DA 4O22A 5ANGA 4DYMA 2WTIA 4IWQA 3W2OA 4YSJA 2ZMCA 3MJ1A 4O6EA 1WVYA 2V0DA 3IKAA 3OP5A 1KWPA 5HVYA 3LCTA 3UC4A 1R3CA 3CY3A 4Q5EA 4B9DA 4EK6A 1WFCA 2WMVA 4FKVA 3GOPA 2NP8A 5J9ZA 4EONA 3UPZA 3UP7A 2IWIA 4UZDA 2J0LA 2F4JA 4TW9A 3C13A 3LFEA 5LVLA 5KCVA 1LEZA 4RC3A 4CEGA 5ANOA 3RGFA 3SOAA 4Z16A 4MQ1A 4GG5A 3EQGA 3MH2A 3ZXZA 2HZ4A 4EI4A 3CQUA 2XEYA 3NGAA 3IW6A 4MH7A 3SHEA 2QO7A 1H0WA 3MY5A 4GT4A 4E6CA 3D9VA 3P9JA 3BLQA 5HG8A 3PJ2A 4G6OA 4FIFA 5AV1A 2WIPA 3EQHA 4OT6A 3WF9A 4XG8A 5M08A 3EH9A 1PKDA 3WF5A 4AW2A 3E7VA 3KULA 5CXHA 4DHIB 4XP3A 3P4KA 4LGHA 2GNIA 5AA9A 4JG6A 5GINE 5FEEA 4J71A 4AX8A 2X6EA 3C4ZA 4TYJA 2OK1A 3LXNA 4O0VA 3VBVA 5M09A 4WZYA 4CFMA 2V7AA 2AC3A 4I0RA 1O6LA 4YP8A 4EOLA 4IB3A 3F2AA 2WQEA 3WE8A 2JKQA 4AGDA 3JYAA 4FT5A 1PXPA 4NJDA 3VBXA 5HU9A 2BHEA 3OXTA 4BJJB 2VTJA 2QU6A 3CGFA 4EH8A 2WXVA 2XK9A 4PMTA 3VS3A 5HNIX 1UNGA 4PL3A 1YXUA 3LZBA 1KE9A 4C3PA 3WZDA 4L53A 3PLSA 4KINA 3E88A 4YZCA 5JK3A 4I5PA 3BHTA 4UV0A 4FV8A 3KRXA 3E93A 4L46A 4D1SA 2W4JA 3PSDA 4UZHA 4A9TA 4N4SA 2NO3A 3P7AA 3HL7A 4HYUA 4R77A 3NNXA 5EM6A 4L3JA 5ANIA 2ITVA 5EG3A 3NVKI 5GIPE 3ALOA 4W4YA 2W1GA 3QTZA 4WA9A 4X2GA 3I0QA 4OLIA 4X2FA 3IDPA 3Q52A 3FZPA 2J0MB 4FTOA 2VWZA 3DS6A 2ITZA 3HA6A 5C27A 4PMPA 1XH7A 2PPQA 4BCKA 4EHEA 3QQHA 4PDOA 3TZ7A 4AZWA 2B53A 2P33A 4DH3A 4LGGA 5K5NA 3BLHA 3FSFA 1BMKA 2PVJA 5IDNA 2CLQA 5H2UA 2R3QA 4E5WA 3UZRA 3QLFA 1CM8A 4MEDA 3LAUA 5DLSA 3LKMA 1UNHA 3W0PA 2DQ7X 3MFRA 5A9UA 4ZTNA 4GCJA 2OZAB 4MF1A 2XAMA 1OM1A 3QCQA 1S9JA 4RIOA 5CEQA 3KRWA 1SM2A 4R1YA 5AV2A 3SG9A 1R78A 2GS2A 2IVSA 4FZFB 2YISA 2PU8A 4ACHA 3ZLYA 3I7BA 3JY0A 4GVAA 3QRKA 4UWBA 5CEIA 3RK9A 1H28A 4R6VA 4DHFA 2VTHA 2XNBA 1XQZA 5M53A 4TTHB 3UIMA 3AQVA 3VW8A 4BBMA 2BZJA 5CAPA 4L42A 4R7BA 3C0GA 3A8XA 2RKUA 2QOKA 2G2IA 2GMXA 4EZ3A 2R64A 5D7VA 4ITHA 4BCNA 4CFNA 3TKHA 2W4KA 2B9IA 2OZAA 2H34A 3ACKA 3E8EA 4HPUE 1FOTA 3ZMMA 1F5QA 4DHJA 1G8AA 1W82A 1QPCA 3F5PA 3PJCA 4B7TA 2IZSA 2ACXA 2CCHA 3ID6C 5IPJA 5KHXA 4WUAA 3O51A 5TF9A 5IH5A 4QTBA 4YZBA 3ORIA 3P86A 3MVMA 2HCKA 4ENXA 3UQFA 4RWKA 4HVDA 4YR8A 2WMXA 1YWRA 2UZBA 3PUFC 4J96A 3SX9A 2VTTA 4DTKA 5B2MA 5E7RA 3EYGA 2W0JA 1OKYA 1Z5MA 2PZIA 5KUPA 5KMLA 3C0IA 1Z57A 3H3CA 3PFYA 2BAJA 3FZ1A 3PJ8A 3PVGA 4ZSEA 3FMMA 4MXZA 3ODYX 3ZO2A 2R3MA 1W8CA 4OTFA 2XEZA 3QTWA 4XBRA 2R3JA 2BROA 3ORPA 3WIKA 3EQRA 3HDNA 3KCKA 5B0XA 4RIYB 5CY3A 2J0KA 2Z60A 4QPAA 1APME 4O0SA 5BVWA 3REPA 4YJQA 3V8WA 3EQBA 4B4LA 1OGYA 3EFLA 2DWBA 4BJJA 1I09A 1YXXA 3RK7A 2ZV8A 4YNEA 5JGDA 3KL8A 4RJ8A 3ERKA 5A46A 5D1JA 3KXZA 5HG5A 3VBWA 3QQUA 1GZOA 3ORKA 3ZEPA 3ZH8A 2X4FA 4ARKA 4D2SA 4EH7A 2W5HA 2Y7JA 3IONA 1BYGA 4CV9A 5I9WA 4I0SA 4AS0A 4AN9A 3FLWA 1NVQA 2QI8A 4NW6A 3HVCA 4A9RA 2OH0E 4H3QA 4FI1A 5E8ZA 4DGLC 4PDPA 2W1EA 5FLFA 2PHKA 4A9SA 3WILA 4I6LA 1UKHA 1REKA 3QWJA 3UNKA 4EQUA 3DZOA 2GNFA 3QU0A 4DFBA 3W2CA 4IMYA 3V8TA 3MYGA 4UEUA 2PE0A 2ZDUA 5B7VA 4LYNA 3T8OA 2B54A 4AP7A 5L2IA 3H10A 1SNUA 3G5DA 5HCYA 5A4LA 1NW1A 3D5UA 3VIDA 4AACA 4B0GA 3DV3A 5EI8A 4DH5A 5E8UA 2R3FA 1YDTE 4DH7A 5CAQA 3G9NA 4BDCA 2JIUA 2R3LA 1J7LA 1ZARA 4M0YA 1MRYA 3R2YA 1TQIA 5AUTA 2CPKE 2YM6A 4KSQA 2C0IA 3ZBFA 1NVSA 3OCBA 4KD1A 5IEVA 2QG5A 2OG8A 5J9LA 4C34A 4K11A 4YC8A 4BDGA 5HLNA 3G6GA 4B6LA 1H1SA 4G5JA 3BQRA 4ZSAA 5C8KA 3GFWA 5EFQA 2WFYA 5JFVA 3AT3A 3OWJA 4RIYA 3EJ1A 1YKRA 2ZAZA 4IADA 4CLIA 5C4LA 2C6IA 5I9VA 1L8TA 5CSXA 3FV8A 4H1JA 1R0EA 5JMSA 1JSVA 4F9AA 3O0GA 5AUUA 2ZM1A 1PMEA 5HVKA 3QUDA 2WMUA 4M14A 3MWUA 5F20A 2C47A 3BYSA 3EN7A 4USDA 3TZMA 4EOIA 2QR8A 4AT4A 4JDHA 4XOYA 2CGWA 2CN5A 3FI3A 3IW5A 3R02A 3TV7A 1Y57A 2W17A 3SXFA 4YTFA 1YI4A 2XK7A 1M2PA 1I44A 2YM8A 3FMKA 4I3ZA 2B1PA 3UDBA 4QYYA 3OT8A 3PIZA 4LL0A 3VUHA 3HKOA 1YW2A 3IQ7A 5HICA 1Q24A 4N0SA 3SV0A 3HMMA 1DI9A 4FOCA 4TWCA 3ZRKA 1JWHA 4ASDA 4D9UA 4EC9A 3NIZA 2X6DA 4OR5A 3VUIA 3I5NA 2YERA 4RWJA 5AP4A 4ZY6A 3DK7A 3LCDA 3N9XA 3LJ0A 4FL2A 4C3RA 5DGZA 4HYHA 4FYNA 4E4MA 2CNVA 4NT4A 4O7LA 3HP5A 4M84A 4UWYA 5CF6A 2VD5A 2ITUA 3D15A 3MJ2A 5FM2A 4ACDA 4EH9A 2GNGA 4X3FC 1IA9A 2VN9A 3HZTA 3GC7A 4CKRA 4YBJA 4CT2A 4AG8A 4ZSLA 4X2KA 3JUHA 4LOOA 4PRJA 2YFXA 2B55A 3G0FA 2XRWA 4V0GB 4FICA 5AWMA 3OG7A 3QYZA 2I0VA 2OFVA 5CLPA 4MTAA 5AV0A 3R28A 4DEAA 1OB3A 3CTQA 3DBCA 5BVFA 2C6OA 5C26A 4F6UA 5HQ0A 3SD0A 3W32A 3A8WA 4UYNA 1JAMA 4FZ7A 1U5QA 2EU9A 3FDNA 5DFPA 2BRMA 3RZBA 1KE5A 3EFJA 2UV2A 3MTFA 4LMUA 4MBIA 4MQ2A 5FEQA 2IW8A 3VS5A 5BMSA 4S2ZA 2J6MA 5IMXA 5JQ8A 2H96A 1GAGA 4PDSA 3GCUA 4NL0A 3RVGA 5E1EA 2R3PA 5CS6A 3ODZX 3G0EA 3NYVA 3ET7A 3VN9A 4KAOA 2OSCA 2HZNA 4DF3A 2X1NA 3MPTA 5CAOA 5HBJA 5CU2A 1XKKA 3F88A 5C1QB 2WEIA 1OITA 4MNEA 4F4PA 3TNWA 1H07A 3PUPA 3C51A 2WD1A 4IWOA 4YO6A 2WNTA 3SW4A 4Y73A 5JQ5A 3MVHA 3W2SA 3VS0A 2VO3A 2X9FA 3FMHA 3NIEA 1NA7A 3S1HA 3O5AA 4FTRA 4O6LA 4DITA 4KKHA 3DA6A 3NYXA 4JBOA 4M0ZA 4ACMA 4HGLA 5CX9A 3GC8A 3MH1A 3DCVA 4IAZA 3LXKA 2E9OA 3KF4A 1UNLA 3PRFA 2UW9A 4CKIA 2XYUA 2B9HA 4TWPA 4LFIA 1A06A 5A54A 4GK2A 4IX3A 5J8IA 4GFMA 2YEXA 3FWQA 4AFEA 4FIEA 5K4IA 5HX8A 5BYLA 2VTOA 4L3LA 3AMYA 1GNGA 3FL4A 4YHFA 4ZEGA 2BMCA 4MWIA 3O8UA 3FZSA 2Y8OA 4RSSA 3UOHA 4EH4A 3C5IA 4IJ9A 4KUJA 4ZSJA 4KBAA 3WE4A 2CCIA 1TQPA 2ITWA 4ASXA 2ZVAA 3PXQA 4YJNA 2B9FA 4MVFA 3ZHPC 3AG9A 3HV4A 3P7BA 3V6RA 4FL1A 3S0OA 3E64A 1OECA 2P2IA 4P2KA 3KIOC 3FJQE 3V6SA 4QQJA 4FSTA 4FTIA 2C1BA 2EXMA 3K5VA 1BI8A 4L7FA 4BB4A 4F9YA 4C33A 3LM0A 4HNIA 5HI2A 1E9HA 5AAEA 5TKDA 3UOJA 2GFCA 2XJ0A 2XNGA 3CP9A 3FEGA 4WKQA 5DEWA 5HIBA 2G2FA 3RINA 1Q62A 4QMLA 4RC4A 3OVVA 2PVYA 3OFMA 3G6HA 4CXAA 4BDIA 3MV5A 5BVKA 4G2FA 4WIHA 3KK9A 4LRKA 3C0HA 4A07A 4BKJA 5B2LA 1SMHA 3R8VA 3L8VA 5CALA 2WTJA 4X3FB 4GMYA 1OIYA 4NFMA 2CMWA 2KTYA 3Q4CA 1SVHA 1Y8GA 4GFGA 4MHAA 1SVEA 5EDQA 3BKBA 2VTSA 1UU3A 3TEIA 2F2UA 5HCZA 2B7AA 4EH2A 4NM5A 5L6OA 4QP6A 3G2FA 3H9FA 2JBOA 4DGMA 2AC5A 5T6KA 2HXLA 4RVLA 3OEZA 4YJSA 4CNHA 4DTAA 4H36A 3CEKA 4EJNA 3ZLXA 4DEEA 3A7HA 4JIAA 3B2WA 4M7IA 4GU6A 5CSPA 2B9JA 3FL5A 5LVPA 4H1MA 3PPJA 1O9UA 3TTJA 3W0QA 2C4GA 1WBVA 5FXRA 4R3PA 4L68A 3EIDA 3VWAA 4DLJA 5L3AA 4D28A 2A19B 4R3CA 5GHVA 3OEFX 3V51A 5HE3A 4DT9A 4YTHA 1U54B 2UZNA 4X6RA 3Q96A 4AA0A 1Z9XA 4O0XA 5M06A 2BZIB 3DBEA 3DFCB 4C37A 4QMZA 3SOCA 2VTRA 3A7FA 4QPSA 3ZC6A 2ESMA 3PYYA 3T9IA 5ANKA 2VWYA 3GGFA 2UW0A 2C3KA 4QEBA 3ZDIA 4AXAA 2IG7A 4E4NA 3DAJA 4RJ7A 4DEDA 4EWHA 1H4LA 1QMZA 5B2KA 1OMWA 2YCRA 4DH1A 3S4QA 5EM7A 1H1WA 1PW2A 3R00A 3IOPA 3I4BA 3KCFA 4M15A 2SRCA 2UW7A 3LFFA 5GJFA 4FV0A 3QQLA 4ITIA 5BMMA 3WOWA 4FX3A 4S33A 5IH4A 4L6QA 1XH6A 1PYXA 3BV2A 3O71A 3R7EA 1ZMWA 3R8ZA 5DA3A 5AP2A 4EOPA 1M14A 3PXZA 4EYJA 4EEVA 3S2PA 4K6ZA 3HRFA 1NVRA 5CEPA 4QQTA 3V04A 2GNJA 3C5UA 4E6AA 3NNUA 4O82A 2Y6OA 3TZ9A 3U9NA 2QO2A 2VWUA 1V0PA 3NUUA 3L8SA 3OCTA 1RDQE 3FMLA 4BCIA 5JFXA 1HCKA 3GC0A 3UBDA 5CSHA 4U43A 3IGGA 5DE2A 2DYLA 5F95A 3QRIA 4F1TA 3DTWA 4WRGA 1K9AA 3GCQA 1PF8A 5E8XA 4FK3A 3QA0A 1FGIA 5EDPA 4QP7A 4X0MA 4CD0A 2QQ7A 4JDJA 3GUBA 3HYHA 2CKPA 5BYZA 3LMGA 2FB8A 2HY0A 2X7FA 4I92A 4ALVA 3LFQA 3R71A 4JQ7A 3NVMB 3RM7A 4D4YA 3VUKA 1WBTA 4YSMA 5HIEA 5KX8A 4W4WA 1BLXA 4BRXA 4LQMA 2UW4A 3QX4A 2XS0A 3LLAA 4LL5A 2UZWE 3MBLA 2C68A 3ANRA 3A7JA 4PY1A 3UVQA 4UX9A 2VO7A 3I7CA 5CU3A 4F0GA 3H9RA 5EM8A 2FSMX 2WMWA 3QTRA 1T45A 1RJBA 5I9ZA 2YM5A 2C5NA 3FPMA 4JAJA 4LG4A 3UDZA 2P3GX 4LV7A 4NM3A 3VC4A 3TDWA 2EWAA 3OF0A 3SLSA 3AXWA 2H9VA 2UUEA 3IW8A 2P2HA 4WNOA 3ZZEA 3V5WA 1B6CB 4K18A 5J7HA 3QTSA 4G17A 4D9TA 2WTKB 4GUBA 2OICA 4FL3A 4FKJA 4GL9A 3SA0A 2Y4IB 1T46A 5DG5A 5EYDA 3Q9WA 4O0WA 2VNYA 2C3JA 4HVHA 3JS2A 1SNXA 4F9CA 3LMIA 4AZEA 3D7TB 2V55A 2HK5A 3VS4A 2X8DA 2YIXA 3KMMA 2A4LA 3ROYA 1U46A 3RCDA 2R3IA 3KXHA 4F9BA 2BRNA 4FTJA 5CZHA 2C6LA 4QP8A 2BCJA 3DJ5A 3GXLA 5CAVA 3NZ0A 3CGOA 4EOSA 5HBHA 2VWWA 3WZUA 3H0YA 4PNIA 1PYEA 4CG9A 4EHVA 1CTPE 3BELA 3NNVA 4GU9A 3ZRLA 1FGKA 3W55A 4JLCA 3QUEA 3R8MA 5L6WL 3LW0A 1XJDA 4JJRA 4IX4A 1G8JA 1SYKA 4GKIA 4BGQA 1HCLA 1IA8A 3NR9A 4NZWB 4U97A 5KE0A 2GQSA 3MESA 1S9IA 3VBQA 3MIYA 4BR3A 4ZTHA 3KK8A 2ITXA 1DAWA 3LFDA 4NW5A 3GU8A 4U45A 4XG7A 1OUYA 4O0RA 1GZNA 4K2RA 4I6HA 1VJYA 3TIYA 2UVYA 4BDDA 5A6NA 4M97A 2PY3A 2YCSA 3JR1A 4HYIA 2W05A 2CNUA 3QHWA 3BIZA 4BF2A 1ZOEA 4QMNA 2I6LA 1KOBA 4FNWA 4U3YA 1GIJA 3W16A 5FM3A 3RHKA 2IZUA 5FRIA 4C35A 2Z02A 5C01A 3ENHA 4ACCA 5HKMA 2QLUA 5CEOA 2YM7A 5ACBC 5IQFA 2UZLA 3HEGA 4RA4A 3R7YA 4PMMA 4FGRA 1UU8A 2XK4A 5D11A 5CF5A 1P5EA 3Q3BA 4TXCA 3VS7A 5M57A 4EK5A 4OTWA 2BDFA 1E1VA 3LFCA 3I0OA 3M11A 5ANDA 5ANJA 4EWQA 3FXXA 2JLDA 2PVRA 5BUJA 5A3XA 4QOXA 2NYAA 2W4OA 3NUAA 4TNBA 4DGGA 4YO4A 3VRYA 3TJDA 3R1NA 4K0YA 3U54A 3UYTA 2IZRA 5M4CA 2GTMA 1H00A 3B2TA 4AOTA 4QTEA 2BR1A 2XMYA 4O7YA 2W06A 3HNGA 1XH4A 3QRUA 4R5SA 2C0OA 3ZO4A 3V5JA 4CFUA 4F78A 4ERWA 3QZIA 5LMKC 4DLIA 5HE0A 3FBVA 2X0GA 3QZHA 3R9OA 3GQIA 5DYJA 4DEGA 4G9RA 4HNFA 2BKKA 3ULIA 4BTFA 3ATTA 3AT2A 2VNWA 2YIRA 2RGPA 2XNEA 1YDSE 3NRMA 1XH8A 3R22A 4XJ0A 2PMNX 5CNOA 4C2WA 2F57A 5FTGA 5EQPA 4ZLOA 1DS5A 5DN3A 2J9MA 4APCA 4FV5A 4FSWA 5BVEA 2WPAA 3QD4A 5BV3A 3DJ7A 5EM5A 4GFOA 2OXYA 5DRDA 5D7AA 5EQEA 4F1MA 4W8EA 3ZRMA 4QT1A 2UVZA 1IG1A 3E8DA 3Q6WA 3U4WA 3O7LB 4RA5A 3QYWA 1Y6AA 3KVWA 3UJGA 3V8SA 2W1DA 1JKSA 1QPJA 2GNLA 2ERKA 3HRBA 2VTPA 4YJUA 3RPVA 3RWQA 3V5QA 4OTDA 4YJRA 1V0BA 5DR9A 4YZNA 4DINA 1QL6A 2HIWA 3UNZA 4HGSA 5IA4A 1W7HA 3KXGA 4ZLZA 2PUUA 3O50A 3QA8A 5AM6A 1XH9A 3GU5A 5CENA 3R04A 3ZFMA 4BDJA 2W1ZA 2CLXA 5JFWA 2OO8X 3CTJA 3QRJA 4FVQA 4EC8A 3TV6A 3UODA 4TL0A 5CU0A 3WZKA 3POZA 2GDOA 4JL9A 2GSFA 4GK4A 1BI7A 3EFWA 3U6JA 2QNJA 4JG7A 1OBDA 4EK3A 4YHJA 4RQKA 3UIBA 2ZV7A 4QRCA 4AAAA 4BI1A 1IAHA 3NNWA 4TN6A 4W8DA 5CI6A 3DJ6A 5CT0A 2R3NA 4E26A 3QZFA 2R3KA 5ITAA 3CXWA 2CKOA 1YHVA 1BUHA 1IAJA 2I1MA 3HMIA 4U94A 5IQDA 2H8HA 2KULA 4HCUA 2X2KA 3NFFB 4ANMA 4FBXA 4R5YA 3TWJA 2R0UA 2XJ1A 4H39A 2B0QA 2PTKA 3BI6A 3E5AA 4MXYA 3CD8A 4YZDA 1PHKA 4FA2A 4FKOA 3BZ3A 4O2ZA 4BIBA 5C4KA 2Z7RA 5AFVA 4DBXA 1KUTA 2JDSA 1P2AA 2BAQA 4YPSA 4ALWA 2XNNA 3CBLA 4XP0A 3NX8A 4ZS4A 2PMLX 3KY2A 4XYFA 4ASZA 5E8SA 4C4EA 2YCFA 5FP6A 3GU6A 3E92A 2Z8CA 4BGGA 2OJJA 4IWPA 2C5VA 1MQBA 3M2WA 3HAMA 4AA5A 2HXQA 4X2NA 4RFZA 5H9BA 2QD9A 3BGQA 3DBFA 3LLTA 2O5KA 4IM3A 5AX9A 3ZUTA 5BNJA 4BCOA 5CZIA 2F7ZE 2DS1A 4AW1A 3AKJA 2GS7A 4O2PA 2QONA 5TO8A 3LCOA 3JVSA 2XUUA 3DKCA 3OUNB 5DNRA 3CJFA 5CWZA 4EBWA 2QOFA 4EH6A 4BN1A 5JGAA 4QTCA 3FMNA 5LMKA 1ZXEA 4WG5A 1YOJA 3O8TA 4LUEA 4FTLA 1OKWA 4A4OA 1H26A 4D0WA 3UVPA 3UO6A 3CS9A 3DT1A 5DT4A 3LE6A 5K4JA 3ORXA 1YI3A 2Q0NA 4IQ6A 4ZK5A 4M8TA 5E8TA 5K5XA 4I41A 1ZOHA 3Q9XA 4IDVA 3EQFA 4FKRA 4I21A 2BRGA 3OCGA 4TYEA 5FP5A 4BCFA 3G90X 4X7QA 1DI8A 5FXSA 1BX6A 4FSZA 3BBWA 4JX7A 5FDPA 1ZLTA 4I94A 3SW7A 4MNFA 4AZFA 4Y5HA 5CAUA 1IR3A 2C69A 3PSBA 3LCSA 4ANBA 1FVRA 4EZ5A 3PIXA 4ENYA 3RPOA 3ZTXA 2BHHA 4FV1A 3NS9A 2BIYA 1PXIA 2IZTA 4II5A 4ITJA 4X3FA 5I9UA 4PX6A 3TACA 2PE2A 3FKLA 3ZM4A 3MY0A 2WMQA 4WBOA 3GNIB 2RL5A 4FKPA 3ZZWA 4DC2A 4Z3VA 1U5RA 2HZIA 5KKRB 5CTPA 2XNMA 5AJQA 3QTIA 2XIKA 5M56A 2OIDA 3P5JC 2R4BA 2JBPA 2ZFYA 4FK6A 4S32A 5HLPA 4BHNA 4BDHA 3KXMA 2VTIA 4ORKA 4W4VA 3HUCA 3TNHA 2WMRA 3A7GA 3L9PA 1J1BA 3R1YA 4P5ZA 3W0MA 4GW8A 2C1AA 5AUXA 4RG0A 3COIA 1FQ1B 4JR3A 1AD5A 1VYZA 1OIUA 2FH9A 4FEVA 1ZYDA 4L01A 4O81A 3DZQA 4U7ZA 3VQHA 3GP0A 4RQVA 4XLVA 4BCGA 4D58A 4DEHA 3MY1A 4AW5A 2QOHA 2YJRA 3S3IA 3AC2A 4K1BA 5CVGA 3KRLA 3A4OX 3QFVA 5EDRA 3L9NA 2PL0A 3U55A 4AN3A 4U6RA 4DA5A 4KRCA 3L1SA 5JSMA 3OW4A 3NAXA 4IDTA 2YDKA 3KXXA 3HGKA 3NEWA 5CVFA 4AZSA 5H8BA 1Y6BA 3QL8A 3QTXA 2PVKA 3LXPA 3AT4A 5E9EA 3RNIA 5L2WA 2XF0A 3OOMA 4O86A 4C62A 4C38A 1VYWA 3TYKA 3E87A 5E8YA 2X4ZA 2C5XA 1OGUA 3LCKA 4M68A 1ZOGA 3BX5A 4OBPA 3CCNA 4X21A 3WARA 2UZTA 3DLSA 4O7TA 4QMSA 4FV2A 4JX3A 4MAOA 5EI2A 5IU2A 5D10A 3CD3A 5IUGA 4QTAA 4JQ8A 2RFEA 4DFUA 5BVNA 2CDZA 2IW6A 2JEDA 1URCA 2OXDA 4J8NA 2UW5A 3DDQA 4E6QA 4QQCA 4AT5A 5JT2A 4MXOA 3ZFYA 2I7QA 1OPJA 2YZLA 3EN6A 4MNEB 1WCCA 3KF7A 4J8MA 3ZSGA 4DFNA 2A27A 5AUYA 3BBTB 1J91A 2XB7A 3D5XA 4MK0A 4EOKA 2ZOQA 3I5ZA 4QMOA 1ZYCA 3R01A 2V7OA 3A2CA 3COKA 4QMUA 3LFAA 3HMOA 4G3CA 1QPDA 4NYEA 5CT7A 1LR4A 2X81A 4O7ZA 3FQSA 2GU8A 4P5QA 3OUKA 2YZAA 5E1SA 3PY3A 2JAVA 3QCXA 3BYMA 4B8LA 4N70A 5I9XA 4FSUA 4KBCA 4QMWA 4FNYA 3D2IA 2VV9A 3QQJA 3GBZA 3C50A 4KKEA 1WVXA 5ACKA 4HYSA 3ZXTA 3EWHA 3F66A 4KB8A 4L52A 5CVHA 4F09A 1JBPE 3UVRA 4F7SA 2PZYA 5LVMA 3W0NA 2QURA 4H05A 4MXCA 4BBFA 4PTEA 3PWYA 1G8KA 2P4IA 1Q5KA 4S34A 2B52A 3WZEA 5JZNA 1RW8A 4IH8A 4QP1A 4FOBA 3MN3A 3VULA 4DTBA 2XVDA 2UVXA 4O7VA 1UWJA 4HGEA 4FTNA 3ETAA 1YWVA 3DXQA 4GK3A 2WKMA 5IA2A 4WG4A 5KMJA 4M67A 1YQJA 4GKHA 4RVTA 4CFVA 3BU3A 5IQBA 1WVWA 3P78A 1M2RA 1YHSA 5KMOA 3R63A 3W33A 2YABA 4FYOA 3O23A 4NKAA 1JKTA 5AAFA 4ACGA 4EHZA 2ITOA 3S00A 4CMUA 2VTNA 4F63A 2QLQA 3P7CA 4M13A 2XKEA 1G3NA 3NMUF 4WNKA 5M51A 3H0ZA 3PZHA 4I5MA 4BDBA 4IB5A 4AGUA 4IC7A 1OL7A 4L9IA 4TT7A 1Y91A 3D5VA 2FSLX 2Y4IC 3FMEA 4FTTA 5IQGA 4L45A 1JNKA 1R1WA 4GH2A 4ZJJA 4ZXTA 4XV9A 2YA9A 5HG7A 4KKGA 3OZ6A 4O21A 5D12A 4R7IA 4TY1A 4XG4A 4DN5A 2FGIA 2XBJA 3GI3A 3V5TA 1ZRZA 5AP1A 4IW0A 3NW5A 4FEXA 3FLQA 2IPXA 3EB0A 3RTPA 3UMXA 2VGOA 4CTCA 4BVUA 5LCJA 3PDTA 4EL9A 4G31A 5K9IA 4KIPA 5I4NA 3UPXA 2V62A 2XIZA 5T68A 4XG6A 1URWA 4IVDA 2Z7SA 4Y5QA 4YLJA 1M7QA 5DVRA 3WYYA 5A6OA 1Q8YA 3FLNC 4S30A 3F2NA 3IK3A 3QF9A 4NTTA 3BYVA 4AAYA 5J1VA 2GFSA 4IZAA 4MXXA 5M4UA 3WIGA 4P90A 3BE9A 4GJ2A 4ZMFA 1PMNA 4EH5A 2PUNA 5I5ZA 1O6KA 1PKGA 2R3HA 3BYUA 3CPCA 3DTCA 4ZOGA 1KE6A 3OS3A 3UDSA 4E8AA 4HGTA 3R9DA 3OY1A 4K9YA 5HNGA 4FODA 3VQUA 4UBAA 4GIIA 3QTQA 2FA2A 2ZV2A 1ZZ2A 3QWKA 2R3RA 4JDKA 4O7RA 4BTKA 3FZRA 1CDKA 2GS6A 4FKGA 3HV5A 1WBSA 4NKSA 3SGCA 3T3UA 4PQNA 1YDRE 2Q0BA 5CEKA 5IDPA 5JEBA 2RIOA 5HO8A 1OZ1A 3MDYA 4QP9A 4XCUA 2WMAA 5BPYA 4GYGA 5M4IA 5ETCA 4CZUA 4ZP5A 4H3PA 5AMNA 3AMBA 5LXMA 2FUMA 3MPMA 3R9HA 1X8BA 3QZGA 5KNJA 3NSZA 5HCXA 3W1FA 4AXDA 5EKNA 4Y85A 3F9NA 3PXKA 4LUDA 4U3ZA 3C4CA 5HORA 4JNWA 3BE2A 4ERKA 3PXFA 2ERZE 3OT3A 4GV1A 2F7XE 2XCHA 2C5YA 4RGJA 2QHMA 2FVDA 3IS5A 3UQCA 2XYNA 3F2RA 3LHJA 5J95A 2JKMA 2J51A 3Q2JA 3AC5A 1Q99A 2VWIA 4MXAA 4WG3A 5LMAA 5AAGA 3DK3A 4Y8DA 3FE3A 3DU8A 4BDFA 3TUBA 2R7IA 2JAMA 3ITZA 2BFXA 4CG8A 4U41A 1MQ4A 2XA4A 3II5A 3LVPA 2F7EE 3UGCA 4AW0A 4FT7A 4EUTA 3MH0A 3ZYAA 4PWNA 4OBQA 2G1TA 3D2KA 5EOBA 3NCZA 4LOPA 2BUJA 4YC3A 2QVSE 4RJ4A 1XO2B 5HIDA 1OIRA 1GY3A 4IFGA 4L7SA 4FVPA 4FKTA 4IFCA 4USEA 3FC1X 4J95A 4KA3A 5E4HA 3W2PA 3QXPA 1XR1A 3SRVA 1JQHA 3DQXA 4R3RA 5KBQA 2VTAA 2F9GA 3PVUA 4JG8A 4LRMA 3LFSA 2C6KA 1HOWA 3FI2A 4FV9A 4BTMA 3ELJA 4L44A 4WRSA 2WOUA 3Q32A 1IASA 4J98A 4KBKA 4I23A 3RI1A 3Q9YA 1R39A 1UU9A 3HMNA 3NLBA 3PSCA 3ZSHA 3ML1A 2RG5A 2PVMA 4H3BA 4O0TA 4U40A 1TFFA 3MI9A 2WTVA 5HE1A 2O65A 4PUZA 4FSRA 3ORNA 5IMEA 3QBNA 3PRIA 4RMZA 3KEXA 5JGBA 2ITQA 3NUXA 2ZM3A 3L9LA 3QKLA 3FC2A 3HAVA 1PMUA 3LJ1A 4AQCA 3R1QA 3PLAE 3VO3A 4K77A 3ZBXA 2JITA 1ZY4A 4BZOA 3GCPA 3W2RA 2UZOA 3GVUA 4G3FA 3DXPA 1Q61A 1OL1A 2E2BA 2XBAA 5A4QA 2W5AA 5BX0A 3B8QA 2NPQA 3R7VA 1PRYA 2BAKA 3RCJA 3ORMA 3C7QA 4FKWA 4EK4A 4E20A 3BHHA 3HDMA 1U59A 3C1XA 2R5TA 3GOKA 4ZTMA 3MH3A 4WNMA 3BL7A 3R9RA 3QQFA 4G34A 3QRTA 3AC1A 4O0UA 1FMOE 4KABA 3O8PA 3TJCA 4FV3A 2CHLA 2UW8A 2X8EA 4BI2A 5T3QA 4CRLA 4CMOA 3W10A 1NT2A 5AUWA 4IZYA 3ZUUA 2C30A 3N4VA 3NUNA 4NK9A 5DT0A 4RIXA 5ETAA 4EK8A 4KS7A 4JS8A 3VHEA 3OWKA 4DG2E 1LP4A 4ONAA 3GQLA 4TYHA 4DG0E 4A4XA 4I6BA 3BU5A 4Q9SA 3R7IA 2Z7LA 3R83A 3WBLA 4AGCA 2VTMA 3CKXA 3PPZA 3QD0A 4J7BA 2UW3A 2OJ9A 3Q5IA 1F3MC 3OCSA 3UNJA 4FVRA 3U6HA 4FEWA 1MUOA 2C3LA 3UIUA 1MRUA 4U98A 1FVTA 3WF6A 3R7UA 3EN5A 2A1AB 4AQKA 2J4ZA 3KVXA 3RP9A 2X7GA 2ZMDA 4BIDA 5A4TA 5KHWA 2VZ6A 3DBQA 3VBTA 5ETIA 3EMGA 2OU7A 3EN4A 3BGZA 3H9OA 3DKGA 4APPA 3AGLA 3IGOA 5HLWA 3UO5A 4BZDA 3N4UA 1A48A 4C0TA 2YIWA 4YPDA 3WYXA 3R2BA 2OWBA 3KQ7A 3HRCA 4KRDA 3ZM9A 4E5BA 4F0IA 3TI1A 2V5QA 2YACA 5DOSA 2WMSA 5L8JA 5EHLA 4CV8A 4YGAA 4NTSA 4ZZMA 3R73A 3PFQA 4G3EA 1REJA 4G3GA 2VWXA 1QPEA 2PVHA 3PPKA 4L3PA 4QP3A 5FG8A 3PWDA 2WIHA 1WBPA 3AC8A 5C8MA 3PA5A 3R9NA 1ERKA 3T3VA 3UC3A 2WTCA 2PZRA 3H30A 4MKCA 3MVLA 2QKRA 4IZ5A 4ZJIA 4E4XA 4YUQA 1UV5A 4Q9ZA 2QOQA 4DEBA 3LMHA 1K3AA 4Q2AA 3AC3A 4XS2A 3FXZA 4Z7GA 4XNEA 2BVAA 4RIWA 3C4FA 3ALNA 5AP0A 5AV4A 3CY2A 4FG8A 4AGWA 4U79A 2R2PA 1PMVA 5TOZA 4CLJA 1Q8UA 4AZTA 2OFUA 3KN6A 2PMOX 4K33A 3W0SA 2ONLC 5E90A 4CMTA 4D55A 5EW3A 3OHTA 3N4TA 2CGUA 3IECA 3LOKA 5EW9A 4GUEA 5K3YA 2FSOX 3DNDA 2XZSA 3LFBA 3RAIA 3KGAA 4RLLA 2UZUE 5DR6A 4D1XA 2J90A 3UOLA 1YI6A 2G01A 1PJKA 3TNQB 5KMIA 2ETMA 1RE8A 3TN8A 4WOVA 3Q2MA 3E8CA 4RIWB 3DXNA 3ZOSA 3VS1A 3CPBA 1W98A 5J9YA 3PP1A 5HBEA 5J5SA 3RWPA 3DKOA 5A4EA 5IA3A 2HWOA 4NWMA 4PMSA 3KXNA 4U8ZA 2WQMA 3PTGA 1AQ1A 4E5AX 3BLAA 2GHMA 3P0MA 4EOMA 1YOLA 4O96A 5AEPA 3K54A 4M69B 4RWLA 1YVJA 1JSUA
chains in the Genus database with same CATH topology
4JOAA 4EBVA 1UA2A 2BIKB 5KMMA 5DRBA 2G9XA 2ZV9A 3DNEA 1WBWA 4HVIA 1F0QA 2CJMA 4XHKB 5HVJA 4G16A 4RJ6A 5DWRA 4K8AA 3EOCA 3TG1A 4JRNA 3VVHA 4HVGA 4WD5A 2QODA 3RJCA 2QKWB 4AU8A 2C6MA 3BPRA 4ZS0A 4FTQA 3DFAA 2YJSA 4CFXA 4IZ7A 3W8QA 2FYSA 5CI7A 3I6UA 5TR6A 4ZTLA 5KO1A 2XK3A 3OMVA 3P08A 3FY2A 3O96A 4DFZE 4CCUA 4D4SA 1OKZA 1R0PA 4PTGA 4W4XA 5IG1A 3AGMA 2W1FA 4FIGA 3SC1A 4I6QA 2JKOA 3PE1A 4EUUA 2XALA 3KMWA 4GJ3A 4GG7A 2REIA 2PWLA 4FV6A 5BUEA 3RKBA 3HLLA 4FGBA 3PVBA 4RRVA 5FUTA 4YZ9A 3HA8A 5EI6A 4MX9A 5GNKA 4WO5A 4TYHB 1KV1A 3EHAA 2RFSA 2YWPA 3LPBA 4J52A 4Z9LA 3F3TA 3G15A 4I4FA 3FLYA 4RIXB 4I4EA 1P4FA 4TYGA 1XBCA 4EOQA 2QG7A 4JBQA 4DDGA 3IDCA 4FIHA 1EH4A 2X39A 3QGYA 4NH1A 1PXMA 2CNQA 4FT0A 5LJJA 3FMDA 3L9MA 3NFGB 4M3QA 4XX9A 2W96B 2W1IA 3R0TA 4KIQA 2OJGA 1A9UA 1J1CA 4I5CA 5AP7A 1SVGA 5FBNC 4ZTQA 1XBAA 2ZM4A 5JRQA 1PXNA 2ZB0A 4G3DA 4CSVA 3AD4A 4CZTA 3VHKA 4NCTA 1AGWA 1U4DA 3BCEA 5IZFA 2VU3A 4FUYA 5CYIA 1LPUA 1CKIA 4AF3A 2HOGA 3P79A 4GVJA 2NNWB 2E9VA 2XAOA 3AKLA 2WEVA 3A61A 3EKKA 2WU6A 3Q4UA 4JT3A 4XBUA 4BYJA 2WOTA 1Q8WA 2O3PA 1OUKA 2VGPA 4FIIA 3ZCLA 3HV7A 5E8VA 4UYAA 4RX8A 2XIXA 4F7JA 5FQDC 5HTBA 1FPUA 3AMAA 3W0RA 4ZY5A 3MA3A 1KE8A 1P14A 2OLCA 1FVVA 4R78A 5KMKA 4RX9A 4FKLA 1O6YA 2FO0A 4F99A 1GIHA 2OXXA 4XV3A 3V5PA 2PUIA 1VZOA 4YJVA 2J5FA 4EOJA 4PV0A 3NUYA 2JFLA 4BY9E 4NUSA 2BALA 3ORLA 4U80A 4C02A 2IVTA 3SAYA 4F7NA 4EKKA 1XWSA 1TVOA 2LGCA 2VAGA 3QALE 2HZ0A 3AC4A 4RFYA 2ZYBA 3ULZA 3VRZA 4IAKA 1CKJA 1STCE 3EYHA 4BDAA 2W7XA 4B99A 4EJ7A 3F3VA 4ZTRA 3ROCA 4O7OA 1OL5A 4N6YA 3UZTA 3CQEA 4JRVA 3VF9A 3QQGA 4I22A 3C9WA 2AEGA 4QTDA 5IA5A 2Y9QA 5EH0A 4FTMA 4FZ6A 5HGIA 1DM2A 4RVKA 1UVRA 1GZKA 5BUIA 2ZDTA 4QMXA 4U5JA 3QQKA 2XM8A 4C2VA 4DFXE 4NFNA 2JFMA 5BYYA 3AD5A 3FHRA 2CSNA 3VF8A 5FDXA 2R7BA 4FZDB 2VX3A 4HOKA 4ASEA 3SG8A 2R3OA 3HUBA 3D7ZA 3T9TA 1H1RA 5KKRC 2CN8A 2VX0A 3S95A 2PVFA 3FY0A 4C58A 3MSSA 1H25A 3PG3A 2QOLA 2JDOA 4GEOA 2YIQA 4XRLA 3A4PA 4TPTA 2HW7A 4R7HA 3SVVA 3MPAA 4MBJA 2BTSA 3F7WA 1XHAA 2ITNA 2Y6MA 2ZB1A 2GNHA 2ONLA 2XIYA 1NXKA 3NUPA 3O2MA 4I0TA 4YC6A 3UE4A 4EKLA 3R8UA 2VTQA 3FHIA 3TNIA 4EZ7A 1V0OA 2NRYA 4HW7A 1OIQA 4USFA 3NWWA 3A7IA 4FSNA 4AE9A 3F3ZA 2O2UA 5JZJA 5CF4A 5HHWA 4C3FA 4ALUA 4XH6A 3F69A 3WF7A 2XNOA 3KRRA 2PZ5A 4G9CA 5CSVA 3RNYA 3K5UA 3FSKA 3DB6A 3ZONA 2XP2A 1GOLA 3VW6A 3A99A 4RFMA 2HY81 3QC4A 5IUIA 3PZEA 5L2SA 4BCMA 2A2AA 2JDRA 4J53A 4N57A 5EYMA 4NU1A 1FBNA 4YJPA 5H3QA 5BVOA 1SZMA 2BILB 2XNPA 2YIYA 1H24A 2BZKB 4BGHA 3F7ZA 1JPAA 5CNNA 1Q3WA 5HO7A 4MYGA 3RM6A 3FI8A 1PXKA 1NY3A 4Y95A 1WMKA 2IW9A 3COHA 4OTRA 4N6ZA 4UB7A 3BRBA 2LAVA 4E73A 2JD5A 1PXLA 3KFAA 4O83A 2XCKA 2R9SA 1GJOA 3BEGA 1B38A 2W9ZB 3G9LX 4LV8A 2WMTA 3PP0A 3QC9A 4U42A 4YHTA 5EYKA 2XH5A 1GZ8A 2IVUA 4O38A 2WZJA 4RJ5A 2PMIA 1ZWSA 4IWDA 4D0XA 2DUVA 3BHVA 5EYCA 2WO6A 2HW6A 3DAKA 2OW3A 3CIKA 4JIKA 5IISA 4FTAA 3PIYA 4G6NA 2I0YA 5DEYA 5LOHA 3FYJX 4F70A 3TUDA 2I0EA 2YM4A 4I24A 5F9EA 1H01A 4AOJA 5FGKA 1Q8TA 3OD6X 3LXLA 1Q97A 4MCVA 4ZMEA 2VO6A 3AOXA 4E93A 4BIEA 4IE9A 3W2QA 3BEAA 2VO0A 3IDBA 5FTOA 1ND4A 2PVNA 4PP9A 3PY0A 2P0CA 4AE6A 4EOOA 3BHUA 3M42A 3SXSA 3QD3A 5ICPA 4LRJA 4CCBA 2X2MA 3GU4A 4AXCA 3GFEA 1J7UA 4L43A 4YJOA 1M2QA 3ATSA 2XKFA 5HZNA 3F3UA 4FV7A 2OGVA 3E3BX 4XLIA 4IVAA 1YXSA 5DR2A 4XRJA 3VUGA 5IA1A 2Z7QA 4WHZA 4QMYA 3OTUA 2W99B 2WAJA 3G33A 5IQIA 3GB2A 5EOLA 2HENA 5C9CA 3TV4A 1UKIA 3I6WA 1H27A 2EVAA 4JDIA 3TUCA 1OL2A 4DDIA 4NCTC 4PP7A 3DY7A 4UXLA 5IQEA 5LVNA 2PULA 3ZO3A 3Q4TA 2QOCA 5AM7A 3R1SA 4QQ5A 5IQAA 2NRUA 2JC6A 3MTLA 5HD4A 4FG7A 2CGXA 4QP4A 4O7NA 4PNKA 5L8LA 3BYOA 2ETKA 5F1ZA 5C8NA 4CGAA 4QMVA 1JKKA 5HU3A 2F2CB 3QKMA 3PA4A 1UU7A 5J87A 2Y0AA 2RFDA 5LWNA 3R8PA 1OPLA 5A4CA 3FAAA 3EQIA 4UALA 4ZZNA 5HTCA 1YRPA 4GRBA 4IX6A 4NIFB 5AX3A 4R1VA 2R3GA 5E91A 4I5HA 2JIIA 4JI9A 3ENMA 4CFFA 4QP2A 4EH3A 4PDYA 4RX7A 3FQEA 4KNBA 4OGRA 4FTKA 4YU2A 1JKLA 3E8NA 1VLRA 4C4FA 2GTNA 3ZLSA 3K3JA 4F08A 4IVCA 3FPQA 3RHXA 3E63A 5AA8A 2X8IA 4CKJA 1TKIA 2YDIA 3ZLWA 4D1ZA 2IVVA 2OJFE 3FKNA 3VBYA 4BCPA 4M12A 4MUQA 4QNAA 3FQHA 3FLZA 4ZJVA 3V01A 4B8MA 5FXQA 5J1WA 2QCSA 5CU4A 2WU7A 3BL9A 4ZZOA 3TKUA 1ATPE 1MP8A 3SXRA 4UN0C 4C4JA 4DT8A 3QGWA 2ITYA 2Q83A 4IJPA 1E1XA 4FUXA 5DHJA 2PUPA 3CC6A 3O17A 4G5PA 2O64A 3E3PA 4QDVA 3TT0A 4AZVA 3EQCA 1G5SA 2XARA 3TL8A 3VJNA 3VS6A 1VR2A 2C0TA 3ACJA 5IA0A 4C4GA 3TIZA 3UMWA 4V05A 3ZU7A 1CMKE 3A60A 4XMOA 3OXIA 2GCDA 3TM0A 1XMLA 5G6VA 3LJ2A 2JKKA 5ANEA 2WQNA 4GT5A 1ZMUA 4NJ3A 2P55A 4WUNA 3MW1A 2G15A 3NPCA 4XEYA 4Y83A 2BPMA 3TNPC 1ZY5A 2ITTA 3UIXA 3VJOA 3DK6A 4CQEA 2Y4PA 4CFWA 3Q4ZA 1W84A 3EFKA 1ZMVA 4AOIA 3GT8A 1H0VA 3PE2A 5BQ0A 3BGPA 1LUFA 1M7NA 3DB8A 4J97A 3UQGA 4FG9A 3F3WA 4YNOA 1OBGA 4FNZA 1KOAA 3Q53A 3VONA 4EQCA 5IEXA 1YWNA 5LARA 3KULB 4RPVA 4ZLYA 5LWMA 3HECA 4TNDA 4Y72A 4D5HA 4HCVA 5CANA 3Q6UA 3IW4A 3R30A 3L8XA 4HPTE 2AYPA 3THBA 4AXFA 4CT1A 5D41A 2EB3A 3BWFA 4BDEA 5JH6A 4FSMA 5IQCA 4JQEA 5AUVA 4IM2A 3Q60A 2W5BA 3HP2A 2EUFB 3KN5A 4XUFA 1ZYLA 4Q5HA 3CJGA 4TYIA 5CSWA 3ORTA 4CRSA 4RBLA 3C4EA 1YXVA 5EHYA 4TRLA 3EN9A 4ANLA 4AWIA 2XKDA 3D0EA 3O7LD 4BI0A 4L8MA 4BC6A 4DCEA 3LQ5A 3TTIA 3NUSA 1J7IA 2OJIA 3QHRA 4O7WA 5AV3A 3CR0A 3D7TA 5KZ0A 3RAWA 4O7PA 3D4QA 1TQMA 3OBGA 2RFNA 2XRUA 4IX5A 3AKKA 1WAKA 2XANA 4AN2A 3GCVA 3BV3A 5DPVA 3LQ8A 5IEYA 1ST0A 3HX4A 4I1ZA 3W18A 4O91A 2JGZA 3NW7A 1L3RE 3OTVA 3PJ3A 3UDTA 4RX5A 3EL8A 4FT9A 3NAYA 2IO6A 3U9CA 4KS8A 4MWHA 4BICA 3TCPA 1Q41A 2BFYA 4A7CA 4ZY4A 1XMMA 3ORZA 4JVGA 4E4LA 3KU2A 1Q4LA 5TT7A 4FTCA 4FNXA 4FKIA 2O63A 4TZRA 1WBNA 1FINA 3FLSA 3FMJA 3JXWA 4FR4A 5HNBA 3RPYA 4DGNA 5AADA 4F65A 4IB0A 1GIIA 2WB8A 2YHVA 3R8LA 5JN2A 2J0IA 5IQHA 3I1AA 4F7LA 3RPRA 4RZWA 4X3JA 2QOBA 3QUPA 3PY1A 3K2LA 4UWCA 3TMOA 4F1OA 4TKSA 5F94A 1PY5A 3MGYA 3M1SA 4J1RA 2YITA 4XV1A 3RK5A 4RJ3A 4DHZA 2OIQA 3LIJA 4IBMA 4YTCA 1PXJA 5I0BA 5LVOA 2WTDA 3KB7A 3EQPA 3HMPA 1XBBA 5AUZA 5IH6A 3LQ3A 3IOKA 3OWLA 1JOWB 2VWBA 4QYGA 3U51A 4LMNA 1OI9A 4HJOA 2X7OA 1DAYA 5AP5A 5GJDA 3D83A 5FEDA 2B4SB 3POOA 5HD7A 4DEIA 2PYWA 4I6FA 3FZTA 3QCSA 2OZOA 2R0IA 2YN8A 3FUPA 4IC8A 3WZJA 4RT7A 4HCTA 4JMQA 2A0CX 2IN6A 3P1AA 3IPHA 5FBOA 4X2JA 4Z7HA 3KREA 3MFSA 4FKUA 4E6DA 3U4UA 4FSYA 4QO9A 2E9UA 2UW6A 2YDJA 4X6QC 2VX1A 3OC1A 5HEZA 3VAPA 1P4OA 3E7OA 1RQQA 4RVMA 4AT3A 3V3VA 1KSWA 3OXZA 4IAFA 4IAAA 1WZYA 2VUWA 2GHLA 4IEBA 5EKOA 5IF1A 2EB2A 3EZRA 3IW7A 4DH8A 4E1ZA 3I79A 4Z55A 2OH4A 3Q9ZA 2YAKA 2XJ2A 4TWOA 4MD7E 1U54A 3WF8A 3MFTA 5DI1A 5BVDA 3DDPA 3H4JA 4IHPA 3DGKA 5AIRA 3F82A 5H8GA 3TZ8A 3UG2A 3VS2A 3V5LA 1VEBA 3COMA 4PL4A 4ZAUA 1ZZLA 3DQWA 3CSVA 5G1XA 4QNYA 1PXOA 4F64A 4QYHA 4D4RA 5LQFA 2BDWA 1M17A 1H1PA 1Q8ZA 3FYKX 4OT5A 4J99A 4BDKA 3HV6A 3UG1A 4FEQA 4A9UA 5AIKA 4ANSA 4RZVA 4YJTA 3F6XA 4OTQA 2OF4A 4JR7A 3Q04A 4AFJA 2PZPA 4OUCA 4GS6A 3W0OA 3U6IA 3F5UA 4QMPA 4C36A 2AUHA 3VUDA 5LCKA 4FSQA 3DBDA 4WSYA 3B8RA 2J7TA 3TDVA 4IM0A 4F9WA 4P7EA 3NW6A 3BHYA 3ANQA 3PA3A 4XG3A 5CXZA 3FXWA 3LFNA 2BDJA 4H58A 1JSTA 2PE1A 2I0HA 4FKQA 1CSNA 2GHGA 3PVWA 4MD8E 4LOQA 5H8EA 4DBNA 1KV2A 2IJMA 3KRJA 4I93A 2JDTA 2X9EA 4NSTA 5CU6A 3ZSIA 4IVBA 4OTHA 1Y8YA 3RMFA 4MD9E 5F4NA 3GENA 5FD2A 3NYOA 4OBOA 2O8YA 1BL6A 1M52A 3R6XA 4QMMA 3IO7A 5DH3A 3SQQA 1V1KA 1J3HA 3R21A 4G6LA 5JKGA 4IACA 3JVRA 1K2PA 4Y46A 3F5XA 2Z2WA 3QKKA 4U9AA 3ZC5A 4BBEA 4AUAA 1ZYSA 4DG3E 4D4VA 3MFUA 3OOGA 4HZSA 2J50A 3CTHA 2J2IB 4YMJA 3CKWA 4WT6A 5HE2A 4PL5A 3RAKA 5E92A 5M55A 4KIOA 3R7OA 3RAHA 1Q3DA 2QO9A 2BTRA 3C4XA 3I60A 3GCSA 4IAYA 3UYSA 3SKCA 2RG6A 1CKPA 3VUMA 5GIOE 3OWPA 4A06A 4OTIA 4DGOA 5D9HA 4EHGA 4EQMA 2YCQA 2GPHA 1H1QA 2YWVA 4PF4A 3ZDUA 4FKSA 3NYNA 2CGVA 4YLKA 1H8FA 4EORA 4O7SA 5L8KA 4FIJA 4A4LA 4UY9A 1OKVA 4DFLA 2WGJA 1H08A 2WTKC 4LV5A 5CQUA 4ANQA 3CQWA 3GC9A 3QXOA 3QLGA 5L6PA 2HELA 2WELA 3AD6A 3BLRA 3F61A 3FZOA 5EHOA 4CTBA 4YURA 3QTUA 4P4CA 2BRHA 2OBJA 2WQBA 3DPKA 4RWIA 3UO4A 4AA4A 4RC2A 2QU5A 4I20A 2FSTX 2UZEA 4YBKA 4ID7A 2QOOA 2WTWA 2C5OA 4BCHA 2VTLA 2WMBA 4BTJA 4MBLA 4BYIA 4DFYA 4EYMA 2XKCA 2J5EA 3MVJA 2E9PA 5KZIA 5HX6A 4C7TA 3IG7A 4XG2A 3JY9A 4GYIA 4O0YA 4WBBB 2UZVA 4XOZA 4OW8A 3D94A 3RALA 3GU7A 2UZDA 5GJGA 2RF9A 3I81A 3OW3A 5JRSA 4F6WA 2QOIA 1LEWA 3N51A 4E7WA 4D5KA 3VNTA 4HZRA 3ZEWA 4LM5A 4BCQA 2C6TA 3NDMA 4U81A 5CEMA 5EK7A 5CQWA 1MRVA 2ITPA 3QCYA 4F0FA 4YTIA 4O27B 4BHZA 3JPVA 2J0JA 2ZJWA 3OBJA 5DBXA 3ZS5A 5M4FA 4CVAA 3CLYA 4F6SA 2CKQA 4KWPA 4C4IA 4NM0A 5CASA 1OL6A 4L00A 3SDJA 5CF8A 3UOKA 4JBPA 1W0XC 3OY3A 1G8SA 4O84A 3K3IA 3PG1A 4JAIA 3GEQA 3U87A 4WNPA 2PVLA 2JIVA 4NM7A 5LMBA 1OPKA 4FZAB 2G2HA 3DOGA 4JXFA 2CKEA 4HVSA 5E8WA 2QR7A 3MS9A 3QX2A 1QCFA 1YHWA 1YOMA 4BZNA 5JFSA 4XG9A 2BZHB 2YAAA 1KE7A 4UXQA 4V0GA 4C61A 4YLLA 2OIBA 3NCGA 1JLUE 2ETRA 3TXOA 1FMKA 2JDVA 4FJVA 2EXCX 2QC6A 3U8WA 4QDEA 2V22A 2W1CA 2I40A 3W8LA 3FI4A 4DCAA 2HAKA 2C3IB 5ETFA 5EW8A 5M07A 2F49A 5HG9A 1ST4A 5IUHA 4FT3A 4C4HA 3C4WA 4FE2A 4FC0A 5EQYA 4BCJA 4DAWA 5AP6A 2GQRA 2VWVA 5L2TA 3EL7A 4TWNA 4JBVA 4V01A 1B39A 5AP3A 3UP2A 3WI6A 4RLKA 1JVPP 2BRBA 3KC3A 2WHBA 4ZTSA 2OF2A 5C03A 5KBRA 3G51A 3E62A 4GSBA 2GQGA 3P23A 3QAME 4U0IA 3SRVB 4A9YA 4QYFA 4XP2A 2X2LA 2QHNA 4LDTA 4DE4A 1UWHA 2HWPA 4L67A 4QMTA 4ZSGA 5HESA 3FKOA 4GT3A 3Q5ZA 4QMQA 5KMNA 5DT3A 5A14A 4D2RA 4GIHA 4QYEA 4XV2A 2VRXA 3D14A 4FEUA 2C6EA 4KSPA 2YM3A 1WBOA 1IEPA 4S31A 3BU6A 3EKNA 4C59A 2E9NA 2PK9A 3DLZA 5M44A 2XK8A 2W1HA 2C6DA 3LM5A 4IAIA 2PSQA 3UZPA 3ZO1A 4V04A 3ZUVA 2XM9A 1BL7A 3DAEA 3A62A 2HYYA 2O0UA 3OROA 3QD2B 1YXTA 3TKIA 4LI5A 2OKRA 5I9YA 4ZIMA 3UTOA 1OVEA 4U44A 4G1WA 1W83A 3MB7A 3L8PA 3P5KA 3RPSA 2OI4X 4FV4A 2XK6A 3HV3A 3PJ1A 1ZAOA 3BQCA 3PXRA 4PTCA 5DIAA 4FTUA 2XIRA 3KMUA 4IANA 2BKZA 1XH5A 3EZVA 3F5GA 3ZFXA 4IB1A 3MA6A 3PXYA 1BKXA 3EQDA 5FTQA 4AXEA 2W9FB 3DKFA 3CE3A 3MB6A 1ZYJA 3BWJA 4IIRA 4OTGA 3D5WA 3KA0A 1IRKA 2WQOA 3KKVA 3MIAA 4FMQA 4YZMA 2H6DA 4O22A 5ANGA 4DYMA 2WTIA 4IWQA 3W2OA 4YSJA 2ZMCA 3MJ1A 4O6EA 1WVYA 2V0DA 3IKAA 3OP5A 1KWPA 5HVYA 3LCTA 3UC4A 1R3CA 3CY3A 4Q5EA 4B9DA 4EK6A 1WFCA 2WMVA 4FKVA 3GOPA 2NP8A 5J9ZA 4EONA 3UPZA 3UP7A 2IWIA 4UZDA 2J0LA 2F4JA 4TW9A 3C13A 3LFEA 5LVLA 5KCVA 1LEZA 4RC3A 4CEGA 5ANOA 3RGFA 3SOAA 4Z16A 4MQ1A 4GG5A 3EQGA 3MH2A 3ZXZA 2HZ4A 4EI4A 3CQUA 2XEYA 3NGAA 3IW6A 4MH7A 3SHEA 2QO7A 1H0WA 3MY5A 4GT4A 4E6CA 3D9VA 3P9JA 3BLQA 5HG8A 3PJ2A 4G6OA 4FIFA 5AV1A 2WIPA 3EQHA 4OT6A 3WF9A 4XG8A 5M08A 3EH9A 1PKDA 3WF5A 4AW2A 3E7VA 3KULA 5CXHA 4DHIB 4XP3A 3P4KA 4LGHA 2GNIA 5AA9A 4JG6A 5GINE 5FEEA 4J71A 4AX8A 2X6EA 3C4ZA 4TYJA 2OK1A 3LXNA 4O0VA 3VBVA 5M09A 4WZYA 4CFMA 2V7AA 2AC3A 4I0RA 1O6LA 4YP8A 4EOLA 4IB3A 3F2AA 2WQEA 3WE8A 2JKQA 4AGDA 3JYAA 4FT5A 1PXPA 4NJDA 3VBXA 5HU9A 2BHEA 3OXTA 4BJJB 2VTJA 2QU6A 3CGFA 4EH8A 2WXVA 2XK9A 4PMTA 3VS3A 5HNIX 1UNGA 4PL3A 1YXUA 3LZBA 1KE9A 4C3PA 3WZDA 4L53A 3PLSA 4KINA 3E88A 4YZCA 5JK3A 4I5PA 3BHTA 4UV0A 4FV8A 3KRXA 3E93A 4L46A 4D1SA 2W4JA 3PSDA 4UZHA 4A9TA 4N4SA 2NO3A 3P7AA 3HL7A 4HYUA 4R77A 3NNXA 5EM6A 4L3JA 5ANIA 2ITVA 5EG3A 3NVKI 5GIPE 3ALOA 4W4YA 2W1GA 3QTZA 4WA9A 4X2GA 3I0QA 4OLIA 4X2FA 3IDPA 3Q52A 3FZPA 2J0MB 4FTOA 2VWZA 3DS6A 2ITZA 3HA6A 5C27A 4PMPA 1XH7A 2PPQA 4BCKA 4EHEA 3QQHA 4PDOA 3TZ7A 4AZWA 2B53A 2P33A 4DH3A 4LGGA 5K5NA 3BLHA 3FSFA 1BMKA 2PVJA 5IDNA 2CLQA 5H2UA 2R3QA 4E5WA 3UZRA 3QLFA 1CM8A 4MEDA 3LAUA 5DLSA 3LKMA 1UNHA 3W0PA 2DQ7X 3MFRA 5A9UA 4ZTNA 4GCJA 2OZAB 4MF1A 2XAMA 1OM1A 3QCQA 1S9JA 4RIOA 5CEQA 3KRWA 1SM2A 4R1YA 5AV2A 3SG9A 1R78A 2GS2A 2IVSA 4FZFB 2YISA 2PU8A 4ACHA 3ZLYA 3I7BA 3JY0A 4GVAA 3QRKA 4UWBA 5CEIA 3RK9A 1H28A 4R6VA 4DHFA 2VTHA 2XNBA 1XQZA 5M53A 4TTHB 3UIMA 3AQVA 3VW8A 4BBMA 2BZJA 5CAPA 4L42A 4R7BA 3C0GA 3A8XA 2RKUA 2QOKA 2G2IA 2GMXA 4EZ3A 2R64A 5D7VA 4ITHA 4BCNA 4CFNA 3TKHA 2W4KA 2B9IA 2OZAA 2H34A 3ACKA 3E8EA 4HPUE 1FOTA 3ZMMA 1F5QA 4DHJA 1G8AA 1W82A 1QPCA 3F5PA 3PJCA 4B7TA 2IZSA 2ACXA 2CCHA 3ID6C 5IPJA 5KHXA 4WUAA 3O51A 5TF9A 5IH5A 4QTBA 4YZBA 3ORIA 3P86A 3MVMA 2HCKA 4ENXA 3UQFA 4RWKA 4HVDA 4YR8A 2WMXA 1YWRA 2UZBA 3PUFC 4J96A 3SX9A 2VTTA 4DTKA 5B2MA 5E7RA 3EYGA 2W0JA 1OKYA 1Z5MA 2PZIA 5KUPA 5KMLA 3C0IA 1Z57A 3H3CA 3PFYA 2BAJA 3FZ1A 3PJ8A 3PVGA 4ZSEA 3FMMA 4MXZA 3ODYX 3ZO2A 2R3MA 1W8CA 4OTFA 2XEZA 3QTWA 4XBRA 2R3JA 2BROA 3ORPA 3WIKA 3EQRA 3HDNA 3KCKA 5B0XA 4RIYB 5CY3A 2J0KA 2Z60A 4QPAA 1APME 4O0SA 5BVWA 3REPA 4YJQA 3V8WA 3EQBA 4B4LA 1OGYA 3EFLA 2DWBA 4BJJA 1I09A 1YXXA 3RK7A 2ZV8A 4YNEA 5JGDA 3KL8A 4RJ8A 3ERKA 5A46A 5D1JA 3KXZA 5HG5A 3VBWA 3QQUA 1GZOA 3ORKA 3ZEPA 3ZH8A 2X4FA 4ARKA 4D2SA 4EH7A 2W5HA 2Y7JA 3IONA 1BYGA 4CV9A 5I9WA 4I0SA 4AS0A 4AN9A 3FLWA 1NVQA 2QI8A 4NW6A 3HVCA 4A9RA 2OH0E 4H3QA 4FI1A 5E8ZA 4DGLC 4PDPA 2W1EA 5FLFA 2PHKA 4A9SA 3WILA 4I6LA 1UKHA 1REKA 3QWJA 3UNKA 4EQUA 3DZOA 2GNFA 3QU0A 4DFBA 3W2CA 4IMYA 3V8TA 3MYGA 4UEUA 2PE0A 2ZDUA 5B7VA 4LYNA 3T8OA 2B54A 4AP7A 5L2IA 3H10A 1SNUA 3G5DA 5HCYA 5A4LA 1NW1A 3D5UA 3VIDA 4AACA 4B0GA 3DV3A 5EI8A 4DH5A 5E8UA 2R3FA 1YDTE 4DH7A 5CAQA 3G9NA 4BDCA 2JIUA 2R3LA 1J7LA 1ZARA 4M0YA 1MRYA 3R2YA 1TQIA 5AUTA 2CPKE 2YM6A 4KSQA 2C0IA 3ZBFA 1NVSA 3OCBA 4KD1A 5IEVA 2QG5A 2OG8A 5J9LA 4C34A 4K11A 4YC8A 4BDGA 5HLNA 3G6GA 4B6LA 1H1SA 4G5JA 3BQRA 4ZSAA 5C8KA 3GFWA 5EFQA 2WFYA 5JFVA 3AT3A 3OWJA