3W0QA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n203a), ternary complex with amp-pnp and hygromycin b
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
ATSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNAVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 90
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0qA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0qA02
2PUNA 3SGCA 4DBXA 2PU8A 3C5IA 2PYWA 3ATTA 2Q83A 3W0OA 3TYKA 5C4KA 4R78A 3W0NA 3CSVA 4GKIA 2PUIA 4DA5A 3DXQA 3N4UA 3TDVA 3N4TA 3G15A 4CG8A 1J7IA 4PDYA 4CGAA 3LQ3A 4U94A 3F2RA 3W0QA 4O7OA 1ND4A 4DFBA 5IQIA 3ZM9A 5IQCA 2CKPA 4U98A 1J7UA 4H05A 4DT9A 3FI8A 4N57A 4GKHA 5IQFA 3SG9A 4DE4A 3HAMA 3TDWA 4BR3A 3ATSA 5FTGA 3W0RA 4EJ7A 5BYLA 5IQDA 3W0SA 4DTAA 3DXPA 2PUPA 3Q2JA 5EQYA 2BKKA 2OLCA 2QG7A 3MESA 4FEUA 5IQAA 4FEWA 3TM0A 3W0PA 4DFUA 2CKOA 3W0MA 2B0QA 4ORKA 3UZRA 1J7LA 4DCAA 1NW1A 5AFVA 5IQEA 2I7QA 4WZYA 5EQEA 5FUTA 3FEGA 4O7PA 2PPQA 2IG7A 3SG8A 1L8TA 5IQHA 3JR1A 5IQBA 4R7BA 5IQGA 2CKQA 4FEVA 5C4LA 4DT8A 4DTBA 4FEXA 4CG9A 3HAVA 3N4VA 2PULA 4R77A 5EQPA
chains in the Genus database with same CATH superfamily
2WMTA 3GQLA 3QALE 4AUAA 4GW8A 2XF0A 3ACKA 4F9YA 5HG7A 5ACBC 2P2HA 3I81A 4EWHA 2HW6A 2NPQA 3TI1A 4UYNA 4AXFA 1UVRA 2CSNA 3BYSA 3O51A 5GJGA 4AOIA 5I9YA 1Q5KA 5B2MA 3QAME 2WPAA 3QZIA 5HLPA 3PUPA 4IE9A 5JRQA 3DB8A 1WBWA 4ZOGA 2CMWA 3GOPA 3NGAA 1WBSA 3R9RA 3S3IA 4QTCA 3PJCA 4MQ1A 4DHFA 2R64A 3CTQA 2P2IA 2XKCA 4I3ZA 4FKIA 3U6HA 3C51A 1NVSA 2YWVA 1XH8A 3G9LX 3NDMA 5E92A 5HKMA 1WBTA 5T6KA 4OLIA 2G2HA 4XV9A 4AA5A 1H1RA 2QURA 3DOGA 4PDYA 1CKPA 4XH6A 4OTRA 3ZO4A 2XUUA 2E9NA 2FGIA 3GUBA 4QTBA 2VX1A 2Y9QA 3LQ3A 4Y8DA 3VONA 4WNMA 4FTCA 5J9LA 3C4WA 5FTOA 3TT0A 3IGOA 4JBPA 4BTJA 1MUOA 1H08A 3LCKA 4Q5HA 3QTUA 4C33A 2YIRA 4YJTA 1X8BA 1U5QA 4ID7A 5DHJA 3QHRA 4GK4A 2X4FA 3UIBA 4CLIA 5CWZA 2XEZA 3ORTA 3D7TA 4USDA 3GXLA 4PL4A 3VNTA 4PDOA 2BPMA 4GS6A 4RVTA 5AUYA 4AU8A 4N57A 5EHLA 1ZAOA 2R2PA 3P7BA 4MEDA 3W10A 5FG8A 3JY9A 3P08A 3PPKA 1KV2A 3PXKA 5DLSA 5D7VA 2ONLA 5HD7A 1PXJA 1REJA 4FC0A 4UZHA 2PZPA 4BHNA 3GC8A 5HX8A 4S33A 5AP6A 4D1XA 5EI8A 3KRJA 3NSZA 1OKVA 4QMNA 2ETKA 4F09A 4BIBA 5FDPA 3G6HA 5CZIA 3R9DA 3ZSHA 5LJJA 3HX4A 3MVMA 5H3QA 3SA0A 1W98A 3HMPA 4G3FA 4IWPA 4N6YA 2B9HA 4GIIA 3A8XA 1FOTA 3E8EA 4FTIA 4NM0A 4FKOA 3I0QA 4DEAA 2UZNA 4C38A 4CTCA 2RFEA 2W5AA 5J9ZA 3UIUA 4DFNA 3VIDA 5DT4A 4NW6A 4ZXTA 3PTGA 4QP6A 5AX9A 3CR0A 4A9RA 2E9OA 2OIQA 3MESA 4PTEA 3TM0A 1YWVA 1FVTA 3H0YA 1JSTA 3FQEA 3HMOA 3AKLA 1KOBA 2X81A 3KB7A 1VLRA 1J7LA 3FHIA 3FKOA 3QC4A 3NUAA 3R8UA 3VUMA 3A60A 3MIAA 5A4QA 2C6LA 1KWPA 1OKYA 2ITTA 3KU2A 2RF9A 4PP7A 4KABA 3UO4A 4EZ5A 3RKBA 2F4JA 1JSUA 4RFMA 4X7QA 4ALWA 3OHTA 5BUJA 2CHLA 1APME 2XJ2A 3BV3A 3GOKA 3GFEA 4FSRA 4FIIA 1YWNA 4PMTA 4IZ5A 5I9VA 4CG9A 2WGJA 1H4LA 2CDZA 4Y73A 1HOWA 1QPJA 2OIBA 4JBQA 2J4ZA 4QYHA 3RPSA 3ATTA 1XMLA 1XO2B 4RJ8A 3W32A 2WQMA 4PF4A 5BMMA 3O71A 2Z7QA 3FKNA 2XNMA 4AW0A 3FMJA 4MBLA 3UBDA 4DH8A 2Z7SA 4FZFB 4J7BA 5C8NA 2WMWA 4U3YA 2Q0NA 2G2FA 4G31A 4I5CA 5IPJA 1KSWA 3F69A 3MW1A 2UZWE 4AZTA 3PPZA 4ZY6A 2BHEA 5M51A 4AN3A 4EH6A 2JLDA 4FZ7A 5IA3A 4FYOA 1ZLTA 4O0VA 4CG8A 3LXNA 4JS8A 2WFYA 3Q9WA 4AGWA 1FVRA 2HWPA 2IPXA 2XBAA 2YDIA 3FL5A 4WRGA 4EH7A 3P86A 5CXZA 5E8VA 4O0YA 4CXAA 4ZP5A 4YC8A 2QOLA 4PY1A 1QPEA 1W83A 1G8JA 1H01A 4MXXA 3R21A 4FSZA 5AUZA 2J7TA 3W8LA 2BDJA 3ZFYA 4APPA 3SOAA 3MB7A 5AM6A 5B0XA 4FBXA 3RVGA 2JDVA 3LKMA 4I21A 1PKGA 3FMKA 3HA8A 3S0OA 3ZMMA 2OXXA 2XNNA 1TQMA 1VEBA 4EH2A 4YR8A 1IA8A 4IJPA 2BZJA 3GP0A 3C13A 2F7XE 3O8PA 4GSBA 4ACGA 2JDSA 1YXSA 4OGRA 4C02A 2FH9A 4YPDA 1FBNA 4XV1A 1PXMA 3RHXA 4IHPA 2JIIA 4KRDA 2ZM1A 3ACJA 4WG3A 3C1XA 5K5XA 5DOSA 2UW8A 3KRLA 3LFFA 4QP1A 4UWYA 4EZ7A 3I0OA 3FZRA 4QP4A 5DIAA 4FV4A 3VUGA 5FTGA 1JKKA 3HMMA 1OL7A 5BYLA 1PMEA 3KC3A 1AQ1A 2UZOA 3P7AA 2UV2A 4A9SA 4WSYA 5EYKA 5BVEA 1PJKA 4PUZA 2OXDA 4L9IA 1OMWA 3KN6A 2GDOA 2B54A 3UOHA 1QL6A 2OH0E 5M4FA 2RKUA 4F9BA 1UU7A 2UZEA 3F5GA 2W99B 3R28A 5E8TA 5AV4A 3VHEA 5IQAA 4K8AA 4WG5A 4EBVA 4U8ZA 3EQFA 1PXKA 4I4EA 1B38A 3P1AA 5CENA 3LPBA 2VTOA 1OIRA 4UX9A 3QLGA 4LRMA 2R7BA 5IZFA 3PG3A 2P33A 4IB0A 5ETFA 3RGFA 2JKKA 1K3AA 1YWRA 2JBPA 4FTRA 5AP3A 3MA3A 2YDJA 5GHVA 4QP7A 3SVVA 5IMXA 4C4FA 4X21A 5IQBA 2VZ6A 5K9IA 1URCA 3LW0A 4U80A 5KMIA 3MYGA 3ANQA 4JIKA 2J5EA 3I1AA 5HVKA 3H0ZA 4OT5A 4RX5A 5A4TA 4GT4A 4EKKA 1ZYDA 4Z7HA 1W8CA 2IZTA 3BQCA 4QPSA 2BROA 2R3RA 2XCHA 3RNIA 3ITZA 4F0FA 3P23A 3VBWA 2C0OA 5ANDA 4HZSA 3EZRA 3OWPA 4DEIA 3HUCA 3QTWA 3PRFA 3ALOA 3KMUA 3PXRA 5F95A 3UP7A 4AE9A 1SMHA 1UU8A 2PU8A 3UNZA 5I9WA 5IU2A 3MTFA 5HLNA 3R2YA 2GNFA 4E4NA 4BDIA 1UNHA 4IX5A 3FMNA 3WYXA 5BVWA 5LCJA 3FDNA 4APCA 2PVHA 3LM0A 4NJ3A 3LXPA 3EOCA 3HRCA 1PF8A 2PUIA 3UE4A 4DYMA 3IDBA 3VBQA 4XBRA 1TFFA 5HTBA 3KCKA 1ST0A 2YM6A 2I40A 5BQ0A 3ZDIA 3LJ1A 5E1SA 2A2AA 1YQJA 3TTJA 5CF6A 3MFTA 3UVRA 4RFZA 2C3IB 4EHVA 5C8KA 1SZMA 4TNDA 2BIKB 3LMHA 2O5KA 2PMIA 4O7TA 4JIAA 4WHZA 3RAKA 4KUJA 4BICA 3UQFA 2R3GA 1AD5A 5L2WA 3OWLA 2YN8A 3AT4A 3CD8A 4JNWA 3AT2A 1BL6A 4BDJA 4EH9A 3QQGA 4RT7A 3R22A 1ZOGA 3QRKA 1JOWB 4O2ZA 4JQ8A 4NK9A 3FZOA 2QVSE 4GUEA 3NNXA 4L00A 3ZM9A 4M3QA 4Y95A 4IB3A 1GNGA 4EUUA 2PTKA 3TUBA 4M13A 2J0IA 2VTQA 2A1AB 5TR6A 3NW7A 5DGZA 4U7ZA 3UYTA 5HO7A 3ALNA 1XH7A 2VWVA 3QGYA 4W8DA 3PJ1A 3FI4A 4C2WA 5L6WL 3I79A 2R3HA 3ERKA 3NZ0A 2V62A 3QX4A 4GH2A 4N6ZA 4X3FB 2UW4A 3MJ2A 3Q9YA 4AN9A 4AQKA 4F1MA 1PRYA 2EVAA 4TZRA 1YI6A 3TZ9A 4EOJA 3H3CA 1Q8TA 3EN6A 5EK7A 4IQ6A 1QPCA 4RWIA 4GYGA 3LFAA 4KD1A 4BB4A 4ZZNA 1CKJA 3KY2A 1W0XC 4R3RA 3F3WA 4X2FA 3TKHA 1OL2A 1YI3A 4JAIA 4TY1A 3DXPA 2VO6A 2ITVA 4GYIA 3U9NA 4C7TA 1M2PA 4XRJA 5JRSA 3PXYA 2X8EA 2XIKA 4O91A 1H0WA 2OLCA 5KMOA 3VQHA 4AQCA 5AV1A 2E9UA 2JEDA 4FT7A 5L8LA 2O2UA 1V0PA 4WNPA 3EH9A 3OG7A 2QOHA 2WEVA 2ZFYA 4FMQA 4FNZA 4DCAA 5E90A 2ZV8A 1ZMWA 2I7QA 2J0LA 2F49A 2OF4A 3H9OA 4FV5A 1DAWA 4I1ZA 4OBPA 1V1KA 2YCQA 5AV2A 5FP5A 2ZB1A 3FEGA 4EI4A 3P7CA 5JFVA 4TYGA 2UW7A 3JPVA 4I92A 3UQCA 4FVQA 4A06A 4O0RA 4BI0A 5TF9A 5FTQA 3HMIA 2OF2A 4F9CA 4BCOA 3QQUA 1OZ1A 3ZUVA 3F2NA 4O96A 5IEVA 4GFMA 3LFSA 2NNWB 5ANIA 5JH6A 1OL1A 4FSYA 5A14A 2W05A 4O2PA 3FMDA 4O0TA 3IOKA 2PVLA 4AT5A 3TV4A 5IDNA 2YIYA 1B39A 5GIOE 1PY5A 4IJ9A 1GZ8A 3TTIA 4UXQA 3Q60A 4YHFA 4BI1A 5EHOA 1LR4A 3DCVA 4AXAA 4R78A 4HVGA 3LLAA 1OUYA 2C0TA 3R8ZA 5I4NA 2J51A 2OJJA 4M14A 4ALUA 1V0BA 4CLJA 2YJSA 4B9DA 4FSWA 3BV2A 4JQEA 5T68A 3IECA 4QMPA 4ZSAA 4AW1A 3ZCLA 1WCCA 1WFCA 4EOKA 3CEKA 4L3JA 3C4ZA 5CF5A 4FKQA 4IFGA 1H26A 4U42A 3DJ6A 3QD0A 3VBTA 3W1FA 4DITA 2UW6A 1VYZA 3DS6A 3COIA 5HNBA 3KRRA 1SNUA 4S32A 4O82A 2C68A 5EDQA 2PSQA 2AYPA 2C5YA 4EK5A 1K9AA 2W5BA 2FSMX 4NKAA 4XG7A 4M0ZA 5BNJA 2ITYA 2WOTA 3CE3A 2C1BA 2X9FA 3BRBA 3GU5A 3NCGA 4I94A 4JX3A 4W4YA 4FTNA 3RPRA 4CV9A 4YO4A 1HCKA 2Z7RA 3FYKX 4X3FA 4WT6A 4TWCA 4NH1A 2W9ZB 1QMZA 1A48A 1YOJA 4CFWA 4XHKB 5DYJA 5FBOA 2XKEA 4JLCA 3VQUA 3KREA 2WTWA 4FX3A 4X0MA 4C36A 2XIRA 4C4EA 1G8SA 4RC4A 3RJCA 2A0CX 4RQKA 5ETIA 4MKCA 4IAZA 1Q62A 3FJQE 4L01A 3HUBA 3L9LA 2NRUA 4P90A 3QRIA 2IJMA 1OITA 4O0WA 1KOAA 3OXZA 4GG7A 3QTXA 5DT0A 3ZC5A 3EWHA 3ZBXA 4YZDA 4DTAA 2EWAA 1BL7A 3AKKA 4O6LA 4L43A 2WQEA 2W1HA 3RTPA 4KBCA 4O7SA 4AZEA 4HVSA 4FV7A 3KXMA 2XH5A 2Y7JA 3FQHA 4FG7A 3O8TA 2QG7A 3Q4UA 4L53A 4S34A 5IUGA 1Q8WA 3OT3A 5CYIA 1PXLA 3PXZA 1ZMUA 4FKLA 4FV3A 4HGSA 4ORKA 5JGAA 3U55A 4FL1A 3RM7A 5AEPA 3E3PA 4R5SA 4CFVA 4IM0A 5IDPA 2GNJA 5AUTA 3GGFA 2Y8OA 3Q6WA 4YC6A 5BUIA 4XNEA 5IQHA 3OFMA 4CQEA 2B4SB 4PNKA 5G1XA 4X2JA 2UZBA 4MBIA 4IC8A 3GT8A 5F9EA 2AC3A 4F4PA 1NVQA 5FD2A 3ZRMA 2OK1A 2QOCA 3SD0A 2G1TA 3DJ7A 4XV3A 3SX9A 1SNXA 3EQHA 3PZHA 4O84A 2Y0AA 2EXMA 2PULA 5F1ZA 4USFA 3QYWA 4R77A 4EOOA 2X9EA 1U59A 2V55A 3BL9A 4FK3A 4OTHA 4DCEA 4RVKA 4DBXA 3QBNA 3C5IA 3QTQA 3ZXTA 3ZYAA 1H1WA 5HG8A 3ZS5A 5CSWA 4I5MA 4EWQA 4ASZA 5EI6A 3M1SA 3F3UA 3HDNA 2WMSA 3TNPC 4HYHA 1H0VA 4BN1A 4K2RA 5CEPA 2X6EA 3UDTA 4LFIA 3ZLYA 5LMBA 1WVYA 2Y4PA 4YLJA 4ZLOA 3DXQA 3HKOA 1BUHA 3IW4A 5CY3A 4WBOA 4BJJB 2J0KA 5GJFA 2E9PA 4QQCA 2PHKA 3DKFA 3BZ3A 5DR6A 5A54A 2XIXA 4ACDA 3E64A 4I24A 3PLAE 3Q3BA 2PY3A 2VGPA 2VUWA 4FG9A 4M7IA 3AXWA 4I5PA 2X6DA 5B2LA 3IKAA 2B53A 5T3QA 4PL5A 4IACA 4G6OA 4DINA 4CFFA 3D14A 4FZDB 4MXCA 3AG9A 2OXYA 3RZBA 1TVOA 3OEZA 4C62A 3RAHA 5DRDA 2WMQA 2WMVA 2IWIA 3KXNA 3AC2A 1XKKA 3IW5A 4YJUA 4CT1A 2YCFA 4TN6A 5ANOA 3FWQA 4U43A 3QTIA 3IPHA 4G6NA 2VTIA 4IVBA 5HG9A 1KV1A 1DAYA 1W82A 1JAMA 2O3PA 3BBWA 3DPKA 3LJ0A 4NM7A 3G0EA 4RX8A 5IA2A 2QCSA 3KVXA 2OGVA 4ZJJA 4F7JA 2QONA 2PZYA 3CQUA 3E92A 2GS7A 3OW3A 4FTQA 4HVHA 1Y57A 4XLVA 4I6QA 3F88A 4XV2A 5CLPA 3Q53A 3BEAA 3CS9A 3UVQA 5DI1A 3W0RA 3V5LA 4BIEA 4EYJA 5AADA 3O8UA 3W33A 4W4WA 4IX4A 3EFKA 3KGAA 3MVLA 4PQNA 1PHKA 5M09A 2Y4IB 3K3IA 4FYNA 2VNYA 3TZMA 4YTIA 4QTEA 2FUMA 3NUNA 4FIEA 1GOLA 4LM5A 4CRLA 3UPXA 4HPTE 3WIGA 1Y8GA 3FPMA 3QD2B 4DDGA 2O64A 5EW9A 5AAFA 1MRVA 4HYSA 4V0GB 5DT3A 4BTFA 4QRCA 3D7TB 3UZRA 4DH1A 3HL7A 5CZHA 3ORXA 1XH5A 4G3DA 2XRWA 5FM3A 3F7WA 3HECA 1H00A 3KFAA 4FL3A 3OCBA 5JFXA 1U4DA 4JDHA 3IGGA 4NFNA 4TNBA 1ZRZA 5C26A 4AF3A 5EFQA 4K6ZA 3ZSGA 4AGDA 2GHGA 3VJOA 2WTJA 2VTRA 1Y91A 2V22A 5F94A 4I22A 4TTHB 5JFWA 4EQMA 2WIPA 1FVVA 4FKJA 3AKJA 4YMJA 5EDRA 3PPJA 2H34A 2PVYA 3F9NA 3KK9A 4K11A 3LLTA 3TIZA 2R3LA 4GL9A 4AXCA 4CVAA 2XNBA 3PIZA 5CU0A 4FE2A 5M06A 4G2FA 4XG6A 4BDAA 5BV3A 3BGZA 4MAOA 4PNIA 3WZEA 2BILB 2Q83A 3F5PA 3N9XA 3GNIB 3IO7A 4D4RA 2XNEA 3DU8A 4YHJA 3BGQA 4YSMA 1ZMVA 3DKOA 5BYZA 3MPTA 2Z02A 4C3FA 4F63A 4YJPA 1YDRE 1OM1A 3NAYA 4BVUA 1H1QA 3A4OX 4IWQA 3TNWA 4ACHA 4Q2AA 3PY1A 4RA4A 4DGMA 2YIQA 5GNKA 1OIUA 2A4LA 3DNDA 3QXOA 3VAPA 3DBDA 2QQ7A 2X2LA 3PSDA 4FV0A 4H3QA 4Y5HA 4AOTA 1ATPE 4GFOA 1L3RE 4DHZA 4RIYB 4KIPA 4IZ7A 1MP8A 3ORNA 4DG2E 2YFXA 5TKDA 4GV1A 5CS6A 4RPVA 4QQJA 4S30A 4DH7A 1F0QA 3AD4A 3FZ1A 2WTKB 4BBEA 5HBEA 5DNRA 3AC1A 5KHWA 3A7GA 4TXCA 4H1MA 2GHLA 5AAGA 2IO6A 3MA6A 3ENMA 2R5TA 4R6VA 4XCUA 5DH3A 5EYDA 2ITPA 4I41A 2CKPA 2ETRA 4MCVA 4D2RA 4F7LA 4Q9ZA 5BPYA 1UNGA 4J8MA 1OKWA 4O81A 5CEQA 4DH5A 3PJ3A 3CTJA 4NTTA 3GC7A 3OW4A 2VWZA 3I4BA 4JBVA 4R3CA 5B7VA 2XIZA 4RLKA 2WQNA 4O0SA 4W8EA 1NA7A 1YOMA 3VS3A 1K2PA 1GAGA 3B8QA 4BTKA 3HP2A 4HCUA 4EKLA 4NJDA 2FVDA 5C1QB 2CCIA 1RW8A 5HCYA 4OTFA 2W4OA 2QR8A 3TCPA 1J91A 3PIXA 4UXLA 4V0GA 1UU3A 2FB8A 2UZTA 1Y6AA 3D5XA 3FQSA 5D9HA 3IG7A 5HE1A 4ENXA 5HORA 5LVNA 3Q2JA 4OTDA 1M2QA 3CQEA 5AAEA 2BZHB 3IOPA 2YM4A 3F5UA 3VBYA 3KL8A 5E4HA 4JI9A 3V5PA 3PVGA 1STCE 3UIXA 4BYIA 2HZ4A 3FXXA 3RINA 4FV8A 3SLSA 2SRCA 4FICA 5IQEA 1JWHA 4ZTMA 1DI9A 3BHUA 3VF8A 5KKRB 2W4KA 3D0EA 3UTOA 4AZSA 4DBNA 2OU7A 4QMSA 1P5EA 4FZAB 4MNEB 4O6EA 4X2NA 3R9NA 3ZOSA 4ANSA 3QWKA 3DY7A 3UZTA 4FZ6A 1H24A 1IAJA 3PA4A 4H39A 3A8WA 4RGJA 5FEEA 4ZJIA 3SOCA 4K33A 5HGIA 2BAQA 3DA6A 2HYYA 1PMVA 3GCSA 2I1MA 3DGKA 3MVHA 4YBKA 4IVDA 3HAVA 5E8WA 2ZMDA 5ANEA 5BVOA 1CDKA 3MN3A 4KRCA 3EQRA 5J1VA 1WVXA 3TNIA 3RK9A 4CFUA 4E1ZA 1R3CA 3W0OA 4TPTA 5E9EA 4C4IA 1G3NA 4D5HA 3V01A 4JBOA 4R7HA 5HE0A 3A61A 3EN7A 3CSVA 3K5VA 3KVWA 4PRJA 5FP6A 5LWMA 2ACXA 1GZOA 3FZPA 4RIYA 2OJIA 3B2TA 4XRLA 4DEDA 4Y46A 3QA0A 3FAAA 2HOGA 1WZYA 3R02A 4TRLA 4TWPA 4E93A 3FLSA 3GC9A 4GK2A 4YLLA 4ZJVA 3NUXA 3A2CA 3V6SA 1V0OA 5E1EA 3CPBA 3FMMA 3D15A 4OTIA 3MDYA 3CIKA 2BMCA 5K4IA 4EH4A 4YGAA 4BKJA 4GUBA 1YXXA 5A9UA 4U0IA 1OBGA 2BRNA 2CCHA 3P5JC 4G9CA 3UP2A 4UB7A 3VS0A 4O7OA 3FSKA 4YZNA 4XG3A 5J1WA 2Q0BA 3OXIA 4KAOA 3V51A 5JK3A 4G5JA 5D1JA 2BRGA 1YXUA 3ORPA 4PDSA 3R7VA 1OVEA 3OZ6A 4E5AX 4U98A 3O7LB 3PP0A 4IB1A 2PZIA 2QOKA 4PX6A 3PFYA 3ZDUA 3FLWA 4ZEGA 3SXRA 4DEHA 5IUHA 5M56A 1OKZA 4FKRA 1AGWA 2IVVA 4PTGA 4BCQA 4BDGA 2R3KA 2X8IA 3DLSA 4E6QA 3ZBFA 5KBQA 1UU9A 5IMEA 2JFMA 3MY5A 5CAQA 1KE6A 3DTCA 2DQ7X 2R3PA 3Q04A 3WILA 2E9VA 3VF9A 5KZ0A 5D41A 3ATSA 1YXVA 3T9IA 3L8XA 2GFSA 3W8QA 4MWHA 1UNLA 3KF7A 4DGGA 3R7OA 4ZTNA 3MH3A 2F2CB 3BYOA 4O86A 5IA4A 5I5ZA 4RIWB 4C61A 4QP3A 3KK8A 3C4XA 3FLNC 3QRUA 2F7ZE 3FBVA 4K9YA 3ZSIA 2YAKA 5C9CA 4H58A 1UWJA 3PVWA 4O27B 2B9JA 4S2ZA 4JXFA 5EQYA 1R0EA 2FYSA 2C6OA 3LQ5A 3LFQA 3MFRA 3OTUA 3GBZA 4GT5A 4WA9A 5HE2A 4MNEA 4FT3A 2FSOX 4FKPA 4LV8A 2OG8A 3NR9A 2G9XA 2REIA 4XEYA 4YJRA 3EL7A 3VS4A 1GY3A 2B9FA 3AMAA 3PG1A 2YM3A 2VX3A 2B52A 5IUIA 4OUCA 3EB0A 2W17A 2VRXA 2VWIA 2UW0A 3O17A 1OB3A 2CLXA 2WZJA 2DYLA 3Q4ZA 2PPQA 5CU2A 4YTCA 4M68A 4XG2A 4D4SA 4ZZOA 2XBJA 3RNYA 4V01A 4Y85A 5HVJA 2OJ9A 5C4LA 5HNGA 5KZIA 3VUIA 4DFZE 5CALA 3H9RA 2WELA 3ID6C 2C6IA 4FKSA 3EQIA 4UZDA 1JKTA 2JKOA 2ZM4A 4FEXA 3LFEA 3QKKA 3EZVA 4FSNA 4C35A 4AG8A 2GS6A 3DJ5A 2ZJWA 4DN5A 1PXPA 1SYKA 5HBJA 5I9ZA 1RJBA 3FSFA 2QR7A 3Q5ZA 3K54A 4IAKA 4JVGA 3KEXA 2OJGA 2R3QA 2ZV9A 4JRVA 2QOIA 4MD7E 5DEWA 3FY0A 4RFYA 1RDQE 4ZTHA 2DUVA 2IN6A 4EORA 3ZH8A 2W7XA 3ZEWA 2FO0A 2VD5A 2ZDUA 4IEBA 3QQHA 3JY0A 4U40A 4CMUA 3PFQA 4CFMA 4YO6A 4GJ2A 4DDIA 1R0PA 4WRSA 4YJQA 4BCNA 1F5QA 1OI9A 2YISA 4L46A 5IQFA 5L2IA 3MPMA 2XKFA 4E7WA 4B4LA 4KBAA 4F64A 2GQGA 3CY2A 5AJQA 3AC3A 3QD3A 5JEBA 4YTFA 3QYZA 3UOKA 2OH4A 3VN9A 1GIJA 1JSVA 3G15A 4CFXA 2WMXA 3M42A 2VV9A 1SVGA 4YHTA 3SW4A 3H10A 2XNGA 4WKQA 3VHKA 5IA1A 2J6MA 2WNTA 2XK4A 3I7CA 3P79A 5EW3A 2OI4X 4MXAA 4ZSJA 3F2RA 5DPVA 3W0QA 2C3JA 3WE4A 4BDDA 4CMOA 1Q61A 1H1PA 2GPHA 3G6GA 3HLLA 5K5NA 4EHGA 1G8AA 5EOBA 5HX6A 4DFBA 3F2AA 3FI3A 5HU9A 4ZSLA 4UYAA 1U5RA 3OMVA 4OW8A 2BKZA 4M67A 4CFNA 3OOMA 3F82A 4FTAA 2O8YA 3RHKA 2VO3A 3OROA 3WF7A 3ZXZA 4L45A 4EHEA 4I20A 2BFXA 4FGRA 4IIRA 2R3NA 2YCSA 2HENA 4YLKA 2EB2A 4M84A 5AM7A 4EK6A 3IQ7A 2YHVA 4RA5A 3QFVA 4BCGA 3DV3A 3VW6A 3K2LA 4I4FA 4RIWA 4FGBA 3ZLWA 3EJ1A 4ANLA 4BBMA 1XR1A 2GQRA 3DBEA 4L7SA 5AX3A 2E2BA 5A46A 1SM2A 1H25A 3MFUA 3OUKA 1UA2A 3PVUA 5IG1A 4CSVA 4FIGA 4MD9E 2VO7A 3KN5A 5HESA 3ZZWA 4CZTA 3KRWA 3L9NA 4EH5A 3HRBA 2WTCA 3UOJA 1BI8A 2J9MA 2J50A 1A06A 3CBLA 4FIJA 4JR3A 4DEBA 2WB8A 3R9HA 5CAUA 2PUPA 4I6HA 2W5HA 1T45A 5HHWA 4U79A 4D0WA 5CSXA 3NNUA 2C47A 4IAIA 4O7RA 4KWPA 4XG4A 3W0PA 3ANRA 5CI7A 2PZRA 2B0QA 4QMVA 5ETCA 1ZOHA 3JVSA 3LFCA 4DF3A 3MPAA 4TYEA 1YVJA 3OD6X 5AUVA 2A19B 3U4WA 3FY2A 2JIVA 1JVPP 3QTRA 5IH5A 4DFLA 1R1WA 3ZONA 4Z9LA 4I5HA 4ASEA 3JR1A 2LAVA 3N51A 2OICA 4L6QA 4M12A 2DWBA 5B2KA 3JS2A 4J96A 4FR4A 2Z2WA 3DBQA 2IW9A 3TXOA 4X3FC 3V8TA 1UKIA 2BRBA 4P5QA 3EQPA 5H8BA 4UALA 3TV6A 3M11A 4J71A 2XS0A 3KXZA 3R8LA 3ZEPA 3CGFA 4J98A 4AOJA 4E4MA 2VTJA 3PXFA 3IONA 2C3KA 3Q96A 2JC6A 4AACA 2VTTA 1MQ4A 3R7EA 2QU5A 5CAPA 4D1ZA 4Z7GA 3TKUA 2VTSA 3E62A 4ZS4A 3PSCA 4L68A 2I0EA 3LFDA 4CV8A 3NYVA 2GNGA 4J95A 4N70A 2GNIA 4Q9SA 1W7HA 5D7AA 5EYCA 2JDOA 2OFVA 4J52A 3LMIA 3QQLA 4F6WA 2QODA 3UJGA 2WTVA 2BTRA 3LM5A 4LMUA 4TT7A 3TWJA 5A4CA 3KMMA 2F9GA 4TL0A 3V3VA 4G3CA 2EU9A 3LCTA 3PXQA 4BCPA 4O7WA 2BZIB 5TT7A 3RCJA 3SRVA 4AE6A 3AGLA 4TKSA 5ANKA 4XMOA 4GIHA 4TW9A 3VULA 3DBFA 5AA8A 3AC4A 5E91A 2CN5A 4RC3A 1CMKE 1A9UA 2CGVA 4FTLA 3BYMA 2BCJA 3I5ZA 4TWOA 4B8LA 4WUAA 4EONA 3AOXA 2I0VA 5HCXA 2B55A 2WMRA 3B8RA 4LGHA 5E8SA 3HV7A 2B9IA 1Q99A 4IW0A 3ZU7A 4GKHA 3BBTB 4FT5A 5CQUA 2RL5A 4JT3A 2J2IB 3SG9A 3W2OA 4DG0E 4ASXA 4FODA 5EKOA 3QX2A 1IEPA 5H2UA 3G2FA 4O7LA 5KUPA 3FC1X 5I9UA 3ORKA 2WKMA 5LMKC 4XLIA 5LXMA 3GCUA 5ETAA 5EW8A 3PSBA 2AEGA 5FEQA 3TMOA 3KQ7A 3S95A 2J90A 4NT4A 4FSMA 5CVFA 4EOMA 3QXPA 2ITQA 3W0SA 2F7EE 3JYAA 3TZ7A 4AT3A 4GT3A 5A3XA 3GCPA 3UVPA 2QU6A 2QD9A 3OWKA 5J9YA 4QNYA 3F3VA 3D4QA 1H27A 4F6UA 2C5XA 2QLUA 3Q5IA 3HA6A 4X6QC 1P4FA 2I0HA 4FK6A 4FTJA 5HEZA 1TQPA 4NU1A 3K3JA 2WHBA 3UG2A 3ZO2A 2IZUA 2RG6A 2R3MA 3LCDA 3PA5A 2BIYA 3PLSA 4QP8A 5E8XA 4NCTC 3ET7A 5EM6A 4USEA 4OTWA 3PWDA 3NW6A 4V05A 3VUDA 4LRKA 3BLHA 4RJ3A 3CKWA 4ZS0A 1YXTA 3RM6A 3DFCB 3WBLA 4D4YA 3U6JA 1PMNA 5DE2A 5AP2A 3G0FA 2WAJA 1U46A 2JD5A 3GQIA 1TKIA 2HY81 5HCZA 3HV4A 3R7IA 3UNKA 1JPAA 4RX9A 4YZCA 3W2SA 4JR7A 1JKLA 2QOBA 3MBLA 5KBRA 2VX0A 5M4CA 3HV3A 4JL9A 1Q41A 4JJRA 2X7FA 3HYHA 2HWOA 5J95A 2JGZA 3UYSA 5JGDA 2EXCX 2XMYA 4ALVA 3EQGA 4OR5A 2VNWA 4L3PA 4DEEA 4KIQA 5GJDA 3AD6A 3DDPA 2BVAA 3DFAA 4AGUA 4LUDA 5BVFA 4IDVA 2WTIA 3MH1A 4X2KA 5EM8A 4ZIMA 1U54B 2OW3A 3RALA 3TYKA 3NYNA 4C4HA 5GIPE 1IG1A 2UZDA 1ZY5A 3V8WA 3UDZA 4YNOA 1G8KA 2UVYA 4GFGA 4LMNA 2PVJA 5CI6A 3V5QA 4D1SA 3QHWA 4S31A 3R1NA 1VZOA 1T46A 2HZNA 5DBXA 3ZFMA 4IX3A 4P2KA 1PXOA 4FTUA 3ZO1A 2JDTA 3LMGA 3QUPA 3BLRA 4RMZA 3RP9A 2UW3A 3D2IA 5J8IA 1VR2A 1YDSE 3OVVA 5FLFA 4FL2A 2GU8A 4GEOA 5KMKA 5M44A 5EM5A 5BVDA 2GS2A 5CT0A 3S4QA 4ANQA 2C5VA 3CY3A 2KTYA 4FA2A 3DKCA 2R3JA 4WBBB 3NNVA 5DN3A 1NT2A 3G51A 5AP0A 2P0CA 3ZUUA 4FUXA 2B7AA 4FI1A 5IH4A 5HIDA 5I9XA 3MWUA 5ANJA 2GQSA 2XANA 3WZDA 5AUUA 1UWHA 4YJOA 4B6LA 4EK8A 4HVIA 4DHJA 1LEWA 1H07A 2HCKA 3FV8A 3DK3A 3O23A 2VWBA 4BY9E 3U4UA 5HO8A 5FQDC 3NUUA 3QCYA 3LXKA 3Q9XA 3LFBA 5TOZA 1WAKA 2AC5A 3AGMA 4I93A 5D11A 3VUKA 3A7JA 1YDTE 3NNWA 2V7AA 3ROYA 2GMXA 4L44A 3VS6A 2OSCA 1G5SA 5HU3A 4EBWA 4DLJA 2C69A 4BZDA 1JBPE 4ZTRA 4AZFA 4ZY4A 1XBAA 5HQ0A 2QKWB 3R6XA 2O63A 3QRTA 2PMOX 3EYHA 3NYOA 4IH8A 4QDEA 3ZLSA 3T3VA 4BCKA 4E6CA 2OBJA 3EMGA 2BRMA 3E7VA 4EC8A 4HOKA 5CU4A 4MF1A 5E8ZA 3R7UA 3UC4A 4IMYA 4IM3A 1URWA 4DGNA 2WOUA 3AD5A 1FINA 4BTMA 2C6MA 4I0RA 4UY9A 1OIQA 4IFCA 3TIYA 2PE0A 1Q4LA 2V5QA 2X4ZA 3M2WA 3R1QA 4FNWA 3VC4A 2PVRA 2BUJA 2BKKA 4FEQA 4BBFA 2A27A 4KNBA 3CD3A 3FMHA 3VS1A 3F7ZA 3AMBA 3NFFB 4MK0A 2UVZA 2C5NA 3NRMA 3PDTA 1BMKA 1IA9A 4LDTA 2JDRA 2VTLA 2ITNA 4F6SA 5HNIX 3P9JA 2EUFB 4YNEA 3W2PA 4JG8A 3PWYA 4G3GA 4LV5A 1XWSA 4NW5A 5FUTA 3POOA 2UZUE 2UZLA 3V04A 2KULA 2UUEA 1L8TA 3DDQA 2W06A 4FTTA 2BAJA 4R7BA 4E5BA 1O6YA 3MTLA 4KKHA 1Q3DA 2ZB0A 2ZV2A 3CP9A 4IWOA 1IASA 4UWBA 4Y83A 4EQUA 4GMYA 1XQZA 2C6DA 4FV6A 5JKGA 3R1SA 4MXOA 4XG9A 2ERZE 1U54A 4TWNA 4EHZA 4IAYA 3TN8A 2GNHA 4D0XA 4YURA 1IAHA 5BMSA 3TG1A 3OT8A 3PYYA 4EZ3A 2P4IA 5AA9A 2QG5A 4NWMA 3DK7A 5FGKA 2XRUA 5HVYA 2BZKB 4II5A 3S00A 2PVNA 1FMOE 3ML1A 2IZSA 4PMMA 4M69B 3E8NA 2X39A 3L1SA 4RLLA 4L7FA 4O0UA 4Q5EA 4RRVA 4ITHA 4XP2A 3HMNA 4FJVA 4RBLA 1M52A 1MQBA 5CU3A 2RFNA 3HRFA 4RQVA 1CM8A 1FQ1B 4DA5A 2ITWA 1OPKA 3QCQA 1KE7A 2FSTX 4NUSA 3TDVA 3EFLA 2QO2A 2Y6OA 4R1YA 5L2SA 4H3PA 4IDTA 2BRHA 3QQJA 4U81A 4F70A 2PE2A 3EKKA 3LCSA 2WEIA 4F9AA 4KB8A 3G5DA 3UODA 1H1SA 4EOLA 3S2PA 4R5YA 1YOLA 2ONLC 2QLQA 4GG5A 2RIOA 4G3EA 4DFYA 1ND4A 1TQIA 1P4OA 4BC6A 1S9JA 5M4UA 3PZEA 3WIKA 5J7HA 3II5A 5A6OA 5IQIA 1SVEA 4P7EA 2BAKA 2BFYA 3ORZA 1NVRA 4ZMFA 5IQCA 3GC0A 3F3TA 4I23A 3FXZA 2C6TA 4RJ4A 2RFDA 1J7UA 2VTMA 4NSTA 4BGQA 1OUKA 1YI4A 3MGYA 3UG1A 2WQBA 4U45A 5F20A 3FI8A 4DT9A 4JOAA 5M4IA 1O6LA 2NRYA 5ICPA 3ODYX 5CEMA 4AW2A 2OZAB 2JITA 5HICA 2VTHA 5DEYA 3VO3A 3POZA 1FMKA 3NUYA 2XEYA 3VS2A 4C34A 4DE4A 3EFJA 5CEIA 4HVDA 4RIOA 4RJ7A 5CEKA 3V8SA 4G16A 4F65A 2XK7A 4KBKA 4XS2A 4KS8A 5EH0A 3O2MA 4CRSA 3WF8A 4DG3E 2HZIA 1WBOA 3I60A 1Q8ZA 2H8HA 4I0TA 3FI2A 2WXVA 3OY1A 4JMQA 1LPUA 4QMMA 2ZAZA 2CN8A 5CT7A 1H8FA 4Y5QA 4A9TA 4IBMA 1OIYA 5KNJA 3E3BX 4EOPA 1GIIA 3TKIA 2YJRA 2QKRA 2UZVA 5FXQA 4IX6A 4A07A 3QA8A 4QYYA 3SXFA 4FEUA 3OXTA 4FEWA 3Q9ZA 4UBAA 4UEUA 1F3MC 4DFUA 3IW7A 4F1OA 5KMMA 3W0MA 2C3LA 2WTKC 3BELA 3KCFA 2QOOA 3D5VA 4DGLC 3D9VA 4NM5A 4HPUE 2RGPA 5E8UA 3NVKI 4CCBA 4NYEA 5AP4A 2VWYA 4NZWB 2ERKA 2ITOA 4WZYA 1XMMA 5EQEA 1EH4A 3C9WA 4CKIA 3HGKA 3MH0A 3O7LD 2PMNX 2NYAA 2ITZA 3NUPA 4C59A 4FEVA 5FXRA 1GIHA 4AGCA 5HE3A 4QQTA 2XZSA 4F7NA 1IRKA 5BVKA 3QWJA 4FNXA 3A7FA 2G2IA 3W18A 3VRZA 4BDKA 3FKLA 5KHXA 5FRIA 1NXKA 4TYHA 3VS5A 3NFGB 3QD4A 2PUNA 3NS9A 3SGCA 2R3OA 3BLQA 2BR1A 3GCVA 3KKVA 3R01A 1QPDA 4GCJA 2PYWA 4TYIA 4WNOA 3R8MA 4EOIA 3R0TA 4QDVA 3W16A 3GEQA 2YDKA 2VGOA 2X2KA 3DQWA 4QO9A 3DT1A 1WVWA 3R9OA 3SHEA 3OP5A 2J0JA 4PV0A 5FEDA 1PKDA 3OY3A 4G1WA 4HNFA 5HG5A 3V5WA 2XP2A 3N4TA 4E5WA 2XALA 2YA9A 4FIFA 3AC8A 2QO9A 4E26A 5K4JA 2XJ1A 3WYYA 4J8NA 4CNHA 5D12A 3R7YA 4I6FA 4OT6A 2Y6MA 4E8AA 5CVGA 3VJNA 4LL0A 3E88A 4GJ3A 4BIDA 5LVMA 5KKRC 4G34A 4ZY5A 5KMNA 3NPCA 2HXLA 3U87A 4M15A 3BYVA 4K18A 5TO8A 1PW2A 3QUDA 2GTMA 2JIUA 1B6CB 3BI6A 3IW6A 1ST4A 1ZYJA 3C4FA 3VBXA 2X2MA 3HNGA 5JZJA 4FT0A 2UVXA 3DZOA 2OZAA 4U9AA 1E1VA 3Q6UA 4LOQA 4AZWA 2NP8A 4QEBA 5DWRA 5M53A 3ZFXA 5C01A 3ENHA 3FHRA 2XAMA 2BALA 4H05A 4FKWA 1OPLA 2X7OA 5EG3A 3FXWA 4O7NA 3V5JA 3BE9A 1KE5A 3JVRA 4ZK5A 3FPQA 3ZRLA 4XUFA 2VWUA 3R73A 4XBUA 2PMLX 4FKVA 2XM8A 4FKTA 3TNHA 4QP2A 4FTMA 5DFPA 4HGEA 4D28A 1Q24A 3DQXA 3LAUA 3PIYA 1GZNA 3R71A 2JKMA 2LGCA 2PVKA 2O0UA 2WIHA 2YIXA 4EH3A 2VWWA 1QCFA 1OGUA 1HCLA 2QOFA 3KXGA 4O83A 4X2GA 2ZV7A 4FV2A 2YITA 4A4XA 4AT4A 3KXHA 3QCSA 4R1VA 4O38A 3R00A 4DAWA 5IH6A 4EQCA 1Q8UA 4QTAA 4MHAA 2GFCA 3CKXA 3TACA 4A9YA 5L2TA 3DBCA 4IAFA 5EKNA 4QMLA 2ZYBA 2VO0A 4G6LA 2C30A 4P5ZA 3MY0A 4L3LA 4RWLA 5CVHA 4BDEA 5A6NA 1DS5A 3BLAA 3I7BA 3UDSA 3FLQA 4RZVA 3ZZEA 3EQDA 3R30A 4QNAA 3U6IA 2XK9A 1DM2A 1M7QA 3G9NA 5EHYA 2ITXA 2PZ5A 3GENA 3MJ1A 3LXLA 3MH2A 4RJ5A 1J1CA 4AXDA 5KE0A 1SVHA 3MI9A 4KSPA 4M0YA 4U41A 3GU8A 2WQOA 3A99A 4MNFA 3SV0A 4AZVA 4IZAA 2W1CA 4AA4A 2BDFA 2F57A 4MVFA 4E20A 4BCFA 4U44A 2YM8A 2VTAA 5LCKA 4IADA 4O7PA 4ZSGA 4ACCA 5CAOA 3ORLA 1RE8A 3QL8A 3C7QA 2WU7A 4QMYA 2XJ0A 5I0BA 4E73A 3WI6A 4DT8A 1UV5A 3LOKA 4YZBA 2XCKA 5J5SA 3H30A 3NW5A 3BHTA 1ZWSA 4JDKA 4D58A 3QQKA 1XBBA 2OZOA 2VTNA 5BYYA 2P3GX 5EQPA 2GTNA 5L8JA 4ERWA 2WO6A 2IVUA 4FOBA 4IANA 3EHAA 4RX7A 2QC6A 3E63A 3T3UA 2CLQA 4C2VA 3D5WA 4HW7A 2W0JA 1CSNA 2C1AA 4EOQA 4QMWA 3QGWA 2HIWA 5K3YA 4IWDA 4KKEA 5C4KA 3F6XA 4YUQA 4C58A 3TL8A 3WF9A 3PVBA 4BZNA 3LVPA 1ZYLA 4FIHA 3RMFA 5JZNA 4CEGA 2HAKA 5CNNA 3NIZA 4ZLYA 5EYMA 2GCDA 3ZLXA 2CNVA 5CASA 5CF4A 4K1BA 1RQQA 4QMTA 4F08A 3EN9A 1PYXA 3A4PA 3FMEA 2OJFE 4BDBA 5HI2A 3LJ2A 4CZUA 4LYNA 1LEZA 3TV7A 5LVOA 2YZAA 2B1PA 2VN9A 2IW6A 1WBNA 3QLFA 1OL6A 4WO5A 5AP5A 4X3JA 4BRXA 4DGOA 1XBCA 4BI2A 4O7YA 2PL0A 1JQHA 5M08A 3MFSA 5LQFA 1YHSA 1Z5MA 4PTCA 4AXEA 4WD5A 3COMA 2BDWA 4BGGA 4FSTA 2YERA 1JNKA 1BKXA 3U9CA 3VS7A 1BLXA 3BHYA 1Q8YA 3WOWA 2G15A 4O7VA 3DB6A 3D5UA 2PUUA 2W9FB 4FT9A 4LI5A 4BCIA 2CGWA 4EOSA 4H3BA 3KIOC 2ZDTA 3QF9A 1OL5A 4F99A 5CAVA 3UGCA 3H4JA 3DAKA 4WNKA 4HCTA 5DG5A 4B7TA 5IISA 2JFLA 4HYUA 4LGGA 1OBDA 2XARA 4EYMA 5DR9A 2OKRA 4ITJA 4EJ7A 3ZO3A 4KIOA 2YIWA 5DRBA 4XP0A 4CT2A 4YJVA 5AV3A 3SRVB 2VU3A 3RPVA 3RWQA 3DKGA 4LV7A 3JXWA 4XOYA 4GVJA 1XH6A 4YPSA 3QTSA 4ZSEA 3UPZA 4J1RA 5EOLA 3ZM4A 2GHMA 2OFUA 3G33A 5JT2A 5JGBA 1J1BA 4NIFB 4CCUA 4MTAA 3GFWA 4D2SA 3BE2A 2XAOA 4MX9A 1M14A 2IZRA 3RWPA 2CKOA 4XP3A 4U3ZA 4YBJA 2ZOQA 1P2AA 3VBVA 1WBPA 4E4XA 2GNLA 2XYNA 4F7SA 4B99A 3HZTA 2ZVAA 3R63A 4KINA 2CNUA 5L3AA 4QYEA 4C4GA 5AFVA 1ZYSA 4JDIA 3MSSA 4C3RA 2YABA 5KMLA 4I6BA 4N4SA 3WF6A 4FVRA 5AMNA 4CMTA 3E5AA 5EDPA 3E93A 3SAYA 3CJFA 4GVAA 1YHWA 2VTPA 5IEYA 5IEXA 4MUQA 2XKDA 2CKQA 4ZZMA 4ZTLA 3OC1A 1PXIA 5CSHA 4WOVA 4YSJA 3C0IA 4DTBA 2Z8CA 3KMWA 5G6VA 1YW2A 3WZJA 3BGPA 3EN5A 3F66A 3N4VA 3PRIA 3LQ8A 3U8WA 1Q3WA 3Q4CA 3MY1A 3RCDA 3EQCA 3CCNA 1NY3A 4FTKA 1ZYCA 1W84A 2CGXA 1BYGA 3BWJA 3CXWA 5IA5A 1XH4A 3PJ2A 2R0IA 3E87A 3RPYA 2XNPA 2H96A 2XK8A 2HW7A 3R04A 4QMZA 4DLIA 4RC2A 4EUTA 3UIMA 4QMUA 2RFSA 1E1XA 2VWXA 1Y8YA 3W0NA 1S9IA 3UNJA 3V5TA 2CGUA 3R8VA 2X1NA 4QYFA 3BQRA 4RG0A 3TNQB 3UO6A 3T9TA 1FPUA 3R8PA 2OIDA 4FV1A 3OBGA 4HYIA 4Y72A 3Q4TA 2AUHA 1P14A 2WMUA 3IK3A 4PDPA 5C8MA 1R39A 4NM3A 1H28A 1J7IA 3QC9A 3T8OA 3HV6A 3TZ8A 4H1JA 5H9BA 2C0IA 3LCOA 4BGHA 3SXSA 1PYEA 3FLYA 4JG6A 4W4XA 3VW8A 4HNIA 4EC9A 3MVJA 3FE3A 4F78A 4U94A 4XJ0A 1KE9A 2JBOA 4R7IA 4AWIA 4BF2A 4EH8A 2JAVA 4BCMA 3QZFA 5CXHA 4FTOA 2BTSA 3GU6A 3RPOA 5LVPA 3GVUA 3HVCA 4FKGA 4JRNA 4U6RA 2IW8A 4ENYA 2NO3A 4KSQA 3ODZX 2XNOA 1PMUA 2X8DA 2VAGA 5EM7A 1YKRA 3G90X 4QTDA 5FBNC 3REPA 4QT1A 3DK6A 3I5NA 4F0GA 3WZUA 4Z16A 3Q2MA 3D7ZA 3TJDA 3KF4A 4BDHA 5CQWA 2HXQA 2Z60A 2R0UA 4OBQA 4R3PA 2OO8X 3NX8A 1CKIA 2YAAA 3UZPA 4C0TA 3VVHA 4YZ9A 5CNOA 5ACKA 3RI1A 2W1DA 1OECA 4XYFA 4K0YA 3UOLA 5BX0A 3OCSA 1VYWA 1M7NA 3C4CA 5JQ8A 1XJDA 4U97A 3RK5A 1BX6A 4LL5A 4K77A 4MBJA 3QCXA 4H36A 5M55A 3NAXA 1ZZ2A 3WE8A 3ZC6A 4D9TA 4C3PA 4MYGA 5IQDA 2RG5A 4ANBA 3D94A 5JSMA 3MS9A 3FZSA 3BHVA 2XVDA 4LRJA 4J53A 4M8TA 2QO7A 4LQMA 4MQ2A 5FXSA 4O22A 3ORIA 3F5XA 2CNQA 3THBA 5F4NA 2R7IA 3SC1A 1LP4A 4ZTQA 3TJCA 2ETMA 3A7IA 5IF1A 4FUYA 4KKGA 4FOCA 3MB6A 1FGKA 1Y6BA 3PY3A 1XHAA 2W96B 3NYXA 1NW1A 4XOZA 5LWNA 3BU3A 4HJOA 4MXZA 4RWKA 4AFEA 4JDJA 4ONAA 4ARKA 4F1TA 1BI7A 4OBOA 3A7HA 3VUHA 3OUNB 3NVMB 3P78A 4FV9A 2I6LA 3KULB 3BX5A 3CTHA 3CGOA 3QTZA 4QPAA 3MV5A 1I09A 3FZTA 4FNYA 2WU6A 2YZLA 4FKUA 3U51A 5AUWA 3ULZA 5A4EA 5BUEA 4E4LA 3C0HA 2YM7A 5H8EA 2V7OA 3IS5A 3B2WA 1CTPE 3NCZA 4L8MA 3ZHPC 3DZQA 4ITIA 4A4OA 3LE6A 4IB5A 1MRUA 1PXNA 3FC2A 4QOXA 4Z3VA 3COKA 4FVPA 4QQ5A 3OWJA 5KMJA 4AA0A 2R3IA 2X7GA 1WBVA 2UW9A 3BEGA 3EYGA 3F61A 4V04A 3SDJA 3O96A 3CC6A 2IVTA 3DXNA 1REKA 2QOQA 3H9FA 3OCGA 3CLYA 3N4UA 3BL7A 5ANGA 4UV0A 3EQBA 3D83A 3FL4A 3E7OA 3E8CA 1GJOA 4RWJA 4U5JA 5DVRA 1M17A 4QMQA 3OTVA 1YHVA 4CKRA 3DTWA 4QP9A 2CJMA 4JG7A 3C5UA 4O7ZA 5D10A 4ASDA 3RK7A 1GZKA 2G01A 4RIXB 2YACA 3L9PA 2QNJA 2EB3A 1R78A 3ROCA 3TUDA 4Z55A 4D9UA 2ZMCA 4AAYA 5KX8A 4EJNA 2H6DA 4EK3A 5ITAA 4KA3A 2PE1A 4BDCA 2R9SA 3BYUA 2ZM3A 4GRBA 3UMXA 3W2QA 4DH3A 4OTGA 3QUEA 3FUPA 4G9RA 3GCQA 3PP1A 5AP7A 4HGLA 4IAAA 2PK9A 1IR3A 2YCRA 4PWNA 2HK5A 3AQVA 4I0SA 4AFJA 4MD8E 3C4EA 5L6PA 3IW8A 4B8MA 3SQQA 3ETAA 3NWWA 5L8KA 3HAMA 3KRXA 3TDWA 2CKEA 2JKQA 3LZBA 5JN2A 4A7CA 4BR3A 4D4VA 4CD0A 3R2BA 5HZNA 4LOOA 3F3ZA 4F0IA 4HGTA 4G17A 5DR2A 4YC3A 3RAWA 1I44A 5BVNA 3JUHA 3A62A 4OTQA 3BWFA 2FA2A 4NFMA 3C0GA 3AMYA 3FMLA 5LOHA 5AP1A 3BU6A 2OWBA 3DNEA 3FLZA 4LUEA 4O0XA 1OPJA 3EFWA 4E6AA 3GU4A 2WMBA 3ULIA 3ZRKA 1YRPA 1LUFA 1O6KA 1WMKA 3W55A 1Q97A 1Z9XA 5AIRA 2W1EA 2XK3A 1Z57A 4NTSA 4GU6A 4AS0A 4BCHA 4D5KA 3IDPA 3UMWA 5LMKA 2HY0A 2HZ0A 4JQ7A 2WMAA 4IZYA 3AC5A 3KULA 4RSSA 3KA0A 5AIKA 3U54A 4BCJA 3ELJA 4UWCA 3SW7A 3DAEA 3OCTA 1ZARA 3WARA 4J97A 4I6LA 5JMSA 3CPCA 4RVLA 4AAAA 4ZAUA 5C03A 3E8DA 4XX9A 4EEVA 2R3FA 2J0MB 3HEGA 4YTHA 5DA3A 5LVLA 4A9UA 5HBHA 5A4LA 2XM9A 3D2KA 5IQGA 2HELA 3GU7A 2DS1A 5FDXA 3QRJA 2ESMA 2JAMA 2W1ZA 3LFNA 3VRYA 4AN2A 4ERKA 3NMUF 2WTDA 1OGYA 3MIYA 5CF8A 3UO5A 4NCTA 4N0SA 4FG8A 5E8YA 4M97A 5LMAA 3OEFX 4MWIA 3BPRA 2W4JA 3R83A 5HLWA 2QHNA 4CTBA 2PVMA 1FGIA 4E6DA 5L6OA 3PE2A 2YEXA 2BHHA 5CANA 4LG4A 4AW5A 4L52A 3L8PA 4YJSA 4GKIA 4P4CA 5H8GA 3KXXA 5AUXA 3P4KA 4WG4A 1MRYA 4DTKA 1E9HA 4NKSA 3TEIA 4EK4A 3O50A 4RVMA 4X6RA 2I0YA 4BYJA 5CX9A 2YWPA 3K5UA 3NIEA 2YM5A 4IVAA 1M2RA 4QYGA 3O0GA 4RIXA 4YJNA 3AT3A 3QZGA 5AWMA 1ZZLA 3COHA 3BHHA 2QI8A 1VJYA 5CSVA 4PMPA 2Z7LA 1UKHA 4B0GA 2W1GA 2GSFA 3BKBA 4CGAA 1JLUE 4W4VA 3QZHA 3PUFC 3NEWA 2Y4IC 2PVFA 3CJGA 3R1YA 4QMOA 3L8SA 4ZMEA 3V6RA 3Q32A 2ITUA 2QHMA 3PY0A 1XH9A 4TYHB 2W1IA 2CPKE 3L8VA 3DLZA 3QU0A 3I6WA 2C6KA 2FSLX 3OS3A 3RAIA 3ZTXA 4PP9A 4ACMA 3EIDA 1ZXEA 4YU2A 3S1HA 4MH7A 2C6EA 4QMXA 4XG8A 5HIBA 4UN0C 2IVSA 5KO1A 2PWLA 4O21A 4NL0A 4FSQA 3BIZA 4IM2A 4KS7A 4TYJA 3TUCA 1ERKA 5M07A 5HD4A 2O65A 3EN4A 5HTCA 4JAJA 5EI2A 2XB7A 4CKJA 3LIJA 3ZUTA 3NLBA 4HCVA 3OOGA 4L67A 5JFSA 4AX8A 3FYJX 3OF0A 3P5KA 5CSPA 2WD1A 2R4BA 4ZTSA 1DI8A 4JX7A 3W2CA 2W1FA 5HIEA 2C5OA 4WUNA 4J99A 2J5FA 3PA3A 4YP8A 4IC7A 4HZRA 3HV5A 3PE1A 4ANMA 4C4JA 2F2UA 3BU5A 1KUTA 1O9UA 4BDFA 5LARA 3EL8A 2H9VA 1ZY4A 1JKSA 2P55A 3ORMA 3P0MA 4YZMA 5CU6A 3GB2A 3UQGA 5CEOA 3UC3A 3WZKA 2C4GA 4C37A 5M57A 3L9MA 3QQFA 5GINE 4DC2A 3PJ8A 3DAJA 3UDBA 1ZOEA 3CQWA 4PL3A 3W2RA 1KE8A 1J3HA 4GK3A 3O5AA 4BZOA 4GU9A 4ZLZA 4LOPA 4BJJA 2XA4A 3QKLA 4IVCA 5E7RA 3LHJA 3BCEA 3HDMA 5JQ5A 5C27A 3VWAA 4WIHA 3OBJA 2UW5A 3WF5A 2IG7A 3SG8A 4A4LA 4AP7A 2X0GA 5FM2A 4D55A 4F9WA 4L42A 4BHZA 5KCVA 3HP5A 5CTPA 3EKNA 5IA0A 2XIYA 4DHIB 3NUSA 3I6UA 4G5PA 3SKCA 4DEGA 4FSUA 2XYUA 3QKMA 5J87A 4EL9A 3C50A 2V0DA 3GI3A 3IDCA 3Q52A 4MXYA 4DFXE 5AV0A 4RZWA 2XK6A 4PMSA 4RJ6A
chains in the Genus database with same CATH topology
2WMTA 3GQLA 3QALE 4AUAA 4GW8A 2XF0A 3ACKA 4F9YA 5HG7A 5ACBC 2P2HA 3I81A 4EWHA 2HW6A 2NPQA 3TI1A 4UYNA 4AXFA 1UVRA 2CSNA 3BYSA 3O51A 5GJGA 4AOIA 5I9YA 1Q5KA 5B2MA 3QAME 2WPAA 3QZIA 5HLPA 3PUPA 4IE9A 5JRQA 3DB8A 1WBWA 4ZOGA 2CMWA 3GOPA 3NGAA 1WBSA 3R9RA 3S3IA 4QTCA 3PJCA 4MQ1A 4DHFA 2R64A 3CTQA 2P2IA 2XKCA 4I3ZA 4FKIA 3U6HA 3C51A 1NVSA 2YWVA 1XH8A 3G9LX 3NDMA 5E92A 5HKMA 1WBTA 5T6KA 4OLIA 2G2HA 4XV9A 4AA5A 1H1RA 2QURA 3DOGA 4PDYA 1CKPA 4XH6A 4OTRA 3ZO4A 2XUUA 2E9NA 2FGIA 3GUBA 4QTBA 2VX1A 2Y9QA 3LQ3A 4Y8DA 3VONA 4WNMA 4FTCA 5J9LA 3C4WA 5FTOA 3TT0A 3IGOA 4JBPA 4BTJA 1MUOA 1H08A 3LCKA 4Q5HA 3QTUA 4C33A 2YIRA 4YJTA 1X8BA 1U5QA 4ID7A 5DHJA 3QHRA 4GK4A 2X4FA 3UIBA 4CLIA 5CWZA 2XEZA 3ORTA 3D7TA 4USDA 3GXLA 4PL4A 3VNTA 4PDOA 2BPMA 4GS6A 4RVTA 5AUYA 4AU8A 4N57A 5EHLA 1ZAOA 2R2PA 3P7BA 4MEDA 3W10A 5FG8A 3JY9A 3P08A 3PPKA 1KV2A 3PXKA 5DLSA 5D7VA 2ONLA 5HD7A 1PXJA 1REJA 4FC0A 4UZHA 2PZPA 4BHNA 3GC8A 5HX8A 4S33A 5AP6A 4D1XA 5EI8A 3KRJA 3NSZA 1OKVA 4QMNA 2ETKA 4F09A 4BIBA 5FDPA 3G6HA 5CZIA 3R9DA 3ZSHA 5LJJA 3HX4A 3MVMA 5H3QA 3SA0A 1W98A 3HMPA 4G3FA 4IWPA 4N6YA 2B9HA 4GIIA 3A8XA 1FOTA 3E8EA 4FTIA 4NM0A 4FKOA 3I0QA 4DEAA 2UZNA 4C38A 4CTCA 2RFEA 2W5AA 5J9ZA 3UIUA 4DFNA 3VIDA 5DT4A 4NW6A 4ZXTA 3PTGA 4QP6A 5AX9A 3CR0A 4A9RA 2E9OA 2OIQA 3MESA 4PTEA 3TM0A 1YWVA 1FVTA 3H0YA 1JSTA 3FQEA 3HMOA 3AKLA 1KOBA 2X81A 3KB7A 1VLRA 1J7LA 3FHIA 3FKOA 3QC4A 3NUAA 3R8UA 3VUMA 3A60A 3MIAA 5A4QA 2C6LA 1KWPA 1OKYA 2ITTA 3KU2A 2RF9A 4PP7A 4KABA 3UO4A 4EZ5A 3RKBA 2F4JA 1JSUA 4RFMA 4X7QA 4ALWA 3OHTA 5BUJA 2CHLA 1APME 2XJ2A 3BV3A 3GOKA 3GFEA 4FSRA 4FIIA 1YWNA 4PMTA 4IZ5A 5I9VA 4CG9A 2WGJA 1H4LA 2CDZA 4Y73A 1HOWA 1QPJA 2OIBA 4JBQA 2J4ZA 4QYHA 3RPSA 3ATTA 1XMLA 1XO2B 4RJ8A 3W32A 2WQMA 4PF4A 5BMMA 3O71A 2Z7QA 3FKNA 2XNMA 4AW0A 3FMJA 4MBLA 3UBDA 4DH8A 2Z7SA 4FZFB 4J7BA 5C8NA 2WMWA 4U3YA 2Q0NA 2G2FA 4G31A 4I5CA 5IPJA 1KSWA 3F69A 3MW1A 2UZWE 4AZTA 3PPZA 4ZY6A 2BHEA 5M51A 4AN3A 4EH6A 2JLDA 4FZ7A 5IA3A 4FYOA 1ZLTA 4O0VA 4CG8A 3LXNA 4JS8A 2WFYA 3Q9WA 4AGWA 1FVRA 2HWPA 2IPXA 2XBAA 2YDIA 3FL5A 4WRGA 4EH7A 3P86A 5CXZA 5E8VA 4O0YA 4CXAA 4ZP5A 4YC8A 2QOLA 4PY1A 1QPEA 1W83A 1G8JA 1H01A 4MXXA 3R21A 4FSZA 5AUZA 2J7TA 3W8LA 2BDJA 3ZFYA 4APPA 3SOAA 3MB7A 5AM6A 5B0XA 4FBXA 3RVGA 2JDVA 3LKMA 4I21A 1PKGA 3FMKA 3HA8A 3S0OA 3ZMMA 2OXXA 2XNNA 1TQMA 1VEBA 4EH2A 4YR8A 1IA8A 4IJPA 2BZJA 3GP0A 3C13A 2F7XE 3O8PA 4GSBA 4ACGA 2JDSA 1YXSA 4OGRA 4C02A 2FH9A 4YPDA 1FBNA 4XV1A 1PXMA 3RHXA 4IHPA 2JIIA 4KRDA 2ZM1A 3ACJA 4WG3A 3C1XA 5K5XA 5DOSA 2UW8A 3KRLA 3LFFA 4QP1A 4UWYA 4EZ7A 3I0OA 3FZRA 4QP4A 5DIAA 4FV4A 3VUGA 5FTGA 1JKKA 3HMMA 1OL7A 5BYLA 1PMEA 3KC3A 1AQ1A 2UZOA 3P7AA 2UV2A 4A9SA 4WSYA 5EYKA 5BVEA 1PJKA 4PUZA 2OXDA 4L9IA 1OMWA 3KN6A 2GDOA 2B54A 3UOHA 1QL6A 2OH0E 5M4FA 2RKUA 4F9BA 1UU7A 2UZEA 3F5GA 2W99B 3R28A 5E8TA 5AV4A 3VHEA 5IQAA 4K8AA 4WG5A 4EBVA 4U8ZA 3EQFA 1PXKA 4I4EA 1B38A 3P1AA 5CENA 3LPBA 2VTOA 1OIRA 4UX9A 3QLGA 4LRMA 2R7BA 5IZFA 3PG3A 2P33A 4IB0A 5ETFA 3RGFA 2JKKA 1K3AA 1YWRA 2JBPA 4FTRA 5AP3A 3MA3A 2YDJA 5GHVA 4QP7A 3SVVA 5IMXA 4C4FA 4X21A 5IQBA 2VZ6A 5K9IA 1URCA 3LW0A 4U80A 5KMIA 3MYGA 3ANQA 4JIKA 2J5EA 3I1AA 5HVKA 3H0ZA 4OT5A 4RX5A 5A4TA 4GT4A 4EKKA 1ZYDA 4Z7HA 1W8CA 2IZTA 3BQCA 4QPSA 2BROA 2R3RA 2XCHA 3RNIA 3ITZA 4F0FA 3P23A 3VBWA 2C0OA 5ANDA 4HZSA 3EZRA 3OWPA 4DEIA 3HUCA 3QTWA 3PRFA 3ALOA 3KMUA 3PXRA 5F95A 3UP7A 4AE9A 1SMHA 1UU8A 2PU8A 3UNZA 5I9WA 5IU2A 3MTFA 5HLNA 3R2YA 2GNFA 4E4NA 4BDIA 1UNHA 4IX5A 3FMNA 3WYXA 5BVWA 5LCJA 3FDNA 4APCA 2PVHA 3LM0A 4NJ3A 3LXPA 3EOCA 3HRCA 1PF8A 2PUIA 3UE4A 4DYMA 3IDBA 3VBQA 4XBRA 1TFFA 5HTBA 3KCKA 1ST0A 2YM6A 2I40A 5BQ0A 3ZDIA 3LJ1A 5E1SA 2A2AA 1YQJA 3TTJA 5CF6A 3MFTA 3UVRA 4RFZA 2C3IB 4EHVA 5C8KA 1SZMA 4TNDA 2BIKB 3LMHA 2O5KA 2PMIA 4O7TA 4JIAA 4WHZA 3RAKA 4KUJA 4BICA 3UQFA 2R3GA 1AD5A 5L2WA 3OWLA 2YN8A 3AT4A 3CD8A 4JNWA 3AT2A 1BL6A 4BDJA 4EH9A 3QQGA 4RT7A 3R22A 1ZOGA 3QRKA 1JOWB 4O2ZA 4JQ8A 4NK9A 3FZOA 2QVSE 4GUEA 3NNXA 4L00A 3ZM9A 4M3QA 4Y95A 4IB3A 1GNGA 4EUUA 2PTKA 3TUBA 4M13A 2J0IA 2VTQA 2A1AB 5TR6A 3NW7A 5DGZA 4U7ZA 3UYTA 5HO7A 3ALNA 1XH7A 2VWVA 3QGYA 4W8DA 3PJ1A 3FI4A 4C2WA 5L6WL 3I79A 2R3HA 3ERKA 3NZ0A 2V62A 3QX4A 4GH2A 4N6ZA 4X3FB 2UW4A 3MJ2A 3Q9YA 4AN9A 4AQKA 4F1MA 1PRYA 2EVAA 4TZRA 1YI6A 3TZ9A 4EOJA 3H3CA 1Q8TA 3EN6A 5EK7A 4IQ6A 1QPCA 4RWIA 4GYGA 3LFAA 4KD1A 4BB4A 4ZZNA 1CKJA 3KY2A 1W0XC 4R3RA 3F3WA 4X2FA 3TKHA 1OL2A 1YI3A 4JAIA 4TY1A 3DXPA 2VO6A 2ITVA 4GYIA 3U9NA 4C7TA 1M2PA 4XRJA 5JRSA 3PXYA 2X8EA 2XIKA 4O91A 1H0WA 2OLCA 5KMOA 3VQHA 4AQCA 5AV1A 2E9UA 2JEDA 4FT7A 5L8LA 2O2UA 1V0PA 4WNPA 3EH9A 3OG7A 2QOHA 2WEVA 2ZFYA 4FMQA 4FNZA 4DCAA 5E90A 2ZV8A 1ZMWA 2I7QA 2J0LA 2F49A 2OF4A 3H9OA 4FV5A 1DAWA 4I1ZA 4OBPA 1V1KA 2YCQA 5AV2A 5FP5A 2ZB1A 3FEGA 4EI4A 3P7CA 5JFVA 4TYGA 2UW7A 3JPVA 4I92A 3UQCA 4FVQA 4A06A 4O0RA 4BI0A 5TF9A 5FTQA 3HMIA 2OF2A 4F9CA 4BCOA 3QQUA 1OZ1A 3ZUVA 3F2NA 4O96A 5IEVA 4GFMA 3LFSA 2NNWB 5ANIA 5JH6A 1OL1A 4FSYA 5A14A 2W05A 4O2PA 3FMDA 4O0TA 3IOKA 2PVLA 4AT5A 3TV4A 5IDNA 2YIYA 1B39A 5GIOE 1PY5A 4IJ9A 1GZ8A 3TTIA 4UXQA 3Q60A 4YHFA 4BI1A 5EHOA 1LR4A 3DCVA 4AXAA 4R78A 4HVGA 3LLAA 1OUYA 2C0TA 3R8ZA 5I4NA 2J51A 2OJJA 4M14A 4ALUA 1V0BA 4CLJA 2YJSA 4B9DA 4FSWA 3BV2A 4JQEA 5T68A 3IECA 4QMPA 4ZSAA 4AW1A 3ZCLA 1WCCA 1WFCA 4EOKA 3CEKA 4L3JA 3C4ZA 5CF5A 4FKQA 4IFGA 1H26A 4U42A 3DJ6A 3QD0A 3VBTA 3W1FA 4DITA 2UW6A 1VYZA 3DS6A 3COIA 5HNBA 3KRRA 1SNUA 4S32A 4O82A 2C68A 5EDQA 2PSQA 2AYPA 2C5YA 4EK5A 1K9AA 2W5BA 2FSMX 4NKAA 4XG7A 4M0ZA 5BNJA 2ITYA 2WOTA 3CE3A 2C1BA 2X9FA 3BRBA 3GU5A 3NCGA 4I94A 4JX3A 4W4YA 4FTNA 3RPRA 4CV9A 4YO4A 1HCKA 2Z7RA 3FYKX 4X3FA 4WT6A 4TWCA 4NH1A 2W9ZB 1QMZA 1A48A 1YOJA 4CFWA 4XHKB 5DYJA 5FBOA 2XKEA 4JLCA 3VQUA 3KREA 2WTWA 4FX3A 4X0MA 4C36A 2XIRA 4C4EA 1G8SA 4RC4A 3RJCA 2A0CX 4RQKA 5ETIA 4MKCA 4IAZA 1Q62A 3FJQE 4L01A 3HUBA 3L9LA 2NRUA 4P90A 3QRIA 2IJMA 1OITA 4O0WA 1KOAA 3OXZA 4GG7A 3QTXA 5DT0A 3ZC5A 3EWHA 3ZBXA 4YZDA 4DTAA 2EWAA 1BL7A 3AKKA 4O6LA 4L43A 2WQEA 2W1HA 3RTPA 4KBCA 4O7SA 4AZEA 4HVSA 4FV7A 3KXMA 2XH5A 2Y7JA 3FQHA 4FG7A 3O8TA 2QG7A 3Q4UA 4L53A 4S34A 5IUGA 1Q8WA 3OT3A 5CYIA 1PXLA 3PXZA 1ZMUA 4FKLA 4FV3A 4HGSA 4ORKA 5JGAA 3U55A 4FL1A 3RM7A 5AEPA 3E3PA 4R5SA 4CFVA 4IM0A 5IDPA 2GNJA 5AUTA 3GGFA 2Y8OA 3Q6WA 4YC6A 5BUIA 4XNEA 5IQHA 3OFMA 4CQEA 2B4SB 4PNKA 5G1XA 4X2JA 2UZBA 4MBIA 4IC8A 3GT8A 5F9EA 2AC3A 4F4PA 1NVQA 5FD2A 3ZRMA 2OK1A 2QOCA 3SD0A 2G1TA 3DJ7A 4XV3A 3SX9A 1SNXA 3EQHA 3PZHA 4O84A 2Y0AA 2EXMA 2PULA 5F1ZA 4USFA 3QYWA 4R77A 4EOOA 2X9EA 1U59A 2V55A 3BL9A 4FK3A 4OTHA 4DCEA 4RVKA 4DBXA 3QBNA 3C5IA 3QTQA 3ZXTA 3ZYAA 1H1WA 5HG8A 3ZS5A 5CSWA 4I5MA 4EWQA 4ASZA 5EI6A 3M1SA 3F3UA 3HDNA 2WMSA 3TNPC 4HYHA 1H0VA 4BN1A 4K2RA 5CEPA 2X6EA 3UDTA 4LFIA 3ZLYA 5LMBA 1WVYA 2Y4PA 4YLJA 4ZLOA 3DXQA 3HKOA 1BUHA 3IW4A 5CY3A 4WBOA 4BJJB 2J0KA 5GJFA 2E9PA 4QQCA 2PHKA 3DKFA 3BZ3A 5DR6A 5A54A 2XIXA 4ACDA 3E64A 4I24A 3PLAE 3Q3BA 2PY3A 2VGPA 2VUWA 4FG9A 4M7IA 3AXWA 4I5PA 2X6DA 5B2LA 3IKAA 2B53A 5T3QA 4PL5A 4IACA 4G6OA 4DINA 4CFFA 3D14A 4FZDB 4MXCA 3AG9A 2OXYA 3RZBA 1TVOA 3OEZA 4C62A 3RAHA 5DRDA 2WMQA 2WMVA 2IWIA 3KXNA 3AC2A 1XKKA 3IW5A 4YJUA 4CT1A 2YCFA 4TN6A 5ANOA 3FWQA 4U43A 3QTIA 3IPHA 4G6NA 2VTIA 4IVBA 5HG9A 1KV1A 1DAYA 1W82A 1JAMA 2O3PA 3BBWA 3DPKA 3LJ0A 4NM7A 3G0EA 4RX8A 5IA2A 2QCSA 3KVXA 2OGVA 4ZJJA 4F7JA 2QONA 2PZYA 3CQUA 3E92A 2GS7A 3OW3A 4FTQA 4HVHA 1Y57A 4XLVA 4I6QA 3F88A 4XV2A 5CLPA 3Q53A 3BEAA 3CS9A 3UVQA 5DI1A 3W0RA 3V5LA 4BIEA 4EYJA 5AADA 3O8UA 3W33A 4W4WA 4IX4A 3EFKA 3KGAA 3MVLA 4PQNA 1PHKA 5M09A 2Y4IB 3K3IA 4FYNA 2VNYA 3TZMA 4YTIA 4QTEA 2FUMA 3NUNA 4FIEA 1GOLA 4LM5A 4CRLA 3UPXA 4HPTE 3WIGA 1Y8GA 3FPMA 3QD2B 4DDGA 2O64A 5EW9A 5AAFA 1MRVA 4HYSA 4V0GB 5DT3A 4BTFA 4QRCA 3D7TB 3UZRA 4DH1A 3HL7A 5CZHA 3ORXA 1XH5A 4G3DA 2XRWA 5FM3A 3F7WA 3HECA 1H00A 3KFAA 4FL3A 3OCBA 5JFXA 1U4DA 4JDHA 3IGGA 4NFNA 4TNBA 1ZRZA 5C26A 4AF3A 5EFQA 4K6ZA 3ZSGA 4AGDA 2GHGA 3VJOA 2WTJA 2VTRA 1Y91A 2V22A 5F94A 4I22A 4TTHB 5JFWA 4EQMA 2WIPA 1FVVA 4FKJA 3AKJA 4YMJA 5EDRA 3PPJA 2H34A 2PVYA 3F9NA 3KK9A 4K11A 3LLTA 3TIZA 2R3LA 4GL9A 4AXCA 4CVAA 2XNBA 3PIZA 5CU0A 4FE2A 5M06A 4G2FA 4XG6A 4BDAA 5BV3A 3BGZA 4MAOA 4PNIA 3WZEA 2BILB 2Q83A 3F5PA 3N9XA 3GNIB 3IO7A 4D4RA 2XNEA 3DU8A 4YHJA 3BGQA 4YSMA 1ZMVA 3DKOA 5BYZA 3MPTA 2Z02A 4C3FA 4F63A 4YJPA 1YDRE 1OM1A 3NAYA 4BVUA 1H1QA 3A4OX 4IWQA 3TNWA 4ACHA 4Q2AA 3PY1A 4RA4A 4DGMA 2YIQA 5GNKA 1OIUA 2A4LA 3DNDA 3QXOA 3VAPA 3DBDA 2QQ7A 2X2LA 3PSDA 4FV0A 4H3QA 4Y5HA 4AOTA 1ATPE 4GFOA 1L3RE 4DHZA 4RIYB 4KIPA 4IZ7A 1MP8A 3ORNA 4DG2E 2YFXA 5TKDA 4GV1A 5CS6A 4RPVA 4QQJA 4S30A 4DH7A 1F0QA 3AD4A 3FZ1A 2WTKB 4BBEA 5HBEA 5DNRA 3AC1A 5KHWA 3A7GA 4TXCA 4H1MA 2GHLA 5AAGA 2IO6A 3MA6A 3ENMA 2R5TA 4R6VA 4XCUA 5DH3A 5EYDA 2ITPA 4I41A 2CKPA 2ETRA 4MCVA 4D2RA 4F7LA 4Q9ZA 5BPYA 1UNGA 4J8MA 1OKWA 4O81A 5CEQA 4DH5A 3PJ3A 3CTJA 4NTTA 3GC7A 3OW4A 2VWZA 3I4BA 4JBVA 4R3CA 5B7VA 2XIZA 4RLKA 2WQNA 4O0SA 4W8EA 1NA7A 1YOMA 3VS3A 1K2PA 1GAGA 3B8QA 4BTKA 3HP2A 4HCUA 4EKLA 4NJDA 2FVDA 5C1QB 2CCIA 1RW8A 5HCYA 4OTFA 2W4OA 2QR8A 3TCPA 1J91A 3PIXA 4UXLA 4V0GA 1UU3A 2FB8A 2UZTA 1Y6AA 3D5XA 3FQSA 5D9HA 3IG7A 5HE1A 4ENXA 5HORA 5LVNA 3Q2JA 4OTDA 1M2QA 3CQEA 5AAEA 2BZHB 3IOPA 2YM4A 3F5UA 3VBYA 3KL8A 5E4HA 4JI9A 3V5PA 3PVGA 1STCE 3UIXA 4BYIA 2HZ4A 3FXXA 3RINA 4FV8A 3SLSA 2SRCA 4FICA 5IQEA 1JWHA 4ZTMA 1DI9A 3BHUA 3VF8A 5KKRB 2W4KA 3D0EA 3UTOA 4AZSA 4DBNA 2OU7A 4QMSA 1P5EA 4FZAB 4MNEB 4O6EA 4X2NA 3R9NA 3ZOSA 4ANSA 3QWKA 3DY7A 3UZTA 4FZ6A 1H24A 1IAJA 3PA4A 4H39A 3A8WA 4RGJA 5FEEA 4ZJIA 3SOCA 4K33A 5HGIA 2BAQA 3DA6A 2HYYA 1PMVA 3GCSA 2I1MA 3DGKA 3MVHA 4YBKA 4IVDA 3HAVA 5E8WA 2ZMDA 5ANEA 5BVOA 1CDKA 3MN3A 4KRCA 3EQRA 5J1VA 1WVXA 3TNIA 3RK9A 4CFUA 4E1ZA 1R3CA 3W0OA 4TPTA 5E9EA 4C4IA 1G3NA 4D5HA 3V01A 4JBOA 4R7HA 5HE0A 3A61A 3EN7A 3CSVA 3K5VA 3KVWA 4PRJA 5FP6A 5LWMA 2ACXA 1GZOA 3FZPA 4RIYA 2OJIA 3B2TA 4XRLA 4DEDA 4Y46A 3QA0A 3FAAA 2HOGA 1WZYA 3R02A 4TRLA 4TWPA 4E93A 3FLSA 3GC9A 4GK2A 4YLLA 4ZJVA 3NUXA 3A2CA 3V6SA 1V0OA 5E1EA 3CPBA 3FMMA 3D15A 4OTIA 3MDYA 3CIKA 2BMCA 5K4IA 4EH4A 4YGAA 4BKJA 4GUBA 1YXXA 5A9UA 4U0IA 1OBGA 2BRNA 2CCHA 3P5JC 4G9CA 3UP2A 4UB7A 3VS0A 4O7OA 3FSKA 4YZNA 4XG3A 5J1WA 2Q0BA 3OXIA 4KAOA 3V51A 5JK3A 4G5JA 5D1JA 2BRGA 1YXUA 3ORPA 4PDSA 3R7VA 1OVEA 3OZ6A 4E5AX 4U98A 3O7LB 3PP0A 4IB1A 2PZIA 2QOKA 4PX6A 3PFYA 3ZDUA 3FLWA 4ZEGA 3SXRA 4DEHA 5IUHA 5M56A 1OKZA 4FKRA 1AGWA 2IVVA 4PTGA 4BCQA 4BDGA 2R3KA 2X8IA 3DLSA 4E6QA 3ZBFA 5KBQA 1UU9A 5IMEA 2JFMA 3MY5A 5CAQA 1KE6A 3DTCA 2DQ7X 2R3PA 3Q04A 3WILA 2E9VA 3VF9A 5KZ0A 5D41A 3ATSA 1YXVA 3T9IA 3L8XA 2GFSA 3W8QA 4MWHA 1UNLA 3KF7A 4DGGA 3R7OA 4ZTNA 3MH3A 2F2CB 3BYOA 4O86A 5IA4A 5I5ZA 4RIWB 4C61A 4QP3A 3KK8A 3C4XA 3FLNC 3QRUA 2F7ZE 3FBVA 4K9YA 3ZSIA 2YAKA 5C9CA 4H58A 1UWJA 3PVWA 4O27B 2B9JA 4S2ZA 4JXFA 5EQYA 1R0EA 2FYSA 2C6OA 3LQ5A 3LFQA 3MFRA 3OTUA 3GBZA 4GT5A 4WA9A 5HE2A 4MNEA 4FT3A 2FSOX 4FKPA 4LV8A 2OG8A 3NR9A 2G9XA 2REIA 4XEYA 4YJRA 3EL7A 3VS4A 1GY3A 2B9FA 3AMAA 3PG1A 2YM3A 2VX3A 2B52A 5IUIA 4OUCA 3EB0A 2W17A 2VRXA 2VWIA 2UW0A 3O17A 1OB3A 2CLXA 2WZJA 2DYLA 3Q4ZA 2PPQA 5CU2A 4YTCA 4M68A 4XG2A 4D4SA 4ZZOA 2XBJA 3RNYA 4V01A 4Y85A 5HVJA 2OJ9A 5C4LA 5HNGA 5KZIA 3VUIA 4DFZE 5CALA 3H9RA 2WELA 3ID6C 2C6IA 4FKSA 3EQIA 4UZDA 1JKTA 2JKOA 2ZM4A 4FEXA 3LFEA 3QKKA 3EZVA 4FSNA 4C35A 4AG8A 2GS6A 3DJ5A 2ZJWA 4DN5A 1PXPA 1SYKA 5HBJA 5I9ZA 1RJBA 3FSFA 2QR7A 3Q5ZA 3K54A 4IAKA 4JVGA 3KEXA 2OJGA 2R3QA 2ZV9A 4JRVA 2QOIA 4MD7E 5DEWA 3FY0A 4RFYA 1RDQE 4ZTHA 2DUVA 2IN6A 4EORA 3ZH8A 2W7XA 3ZEWA 2FO0A 2VD5A 2ZDUA 4IEBA 3QQHA 3JY0A 4U40A 4CMUA 3PFQA 4CFMA 4YO6A 4GJ2A 4DDIA 1R0PA 4WRSA 4YJQA 4BCNA 1F5QA 1OI9A 2YISA 4L46A 5IQFA 5L2IA 3MPMA 2XKFA 4E7WA 4B4LA 4KBAA 4F64A 2GQGA 3CY2A 5AJQA 3AC3A 3QD3A 5JEBA 4YTFA 3QYZA 3UOKA 2OH4A 3VN9A 1GIJA 1JSVA 3G15A 4CFXA 2WMXA 3M42A 2VV9A 1SVGA 4YHTA 3SW4A 3H10A 2XNGA 4WKQA 3VHKA 5IA1A 2J6MA 2WNTA 2XK4A 3I7CA 3P79A 5EW3A 2OI4X 4MXAA 4ZSJA 3F2RA 5DPVA 3W0QA 2C3JA 3WE4A 4BDDA 4CMOA 1Q61A 1H1PA 2GPHA 3G6GA 3HLLA 5K5NA 4EHGA 1G8AA 5EOBA 5HX6A 4DFBA 3F2AA 3FI3A 5HU9A 4ZSLA 4UYAA 1U5RA 3OMVA 4OW8A 2BKZA 4M67A 4CFNA 3OOMA 3F82A 4FTAA 2O8YA 3RHKA 2VO3A 3OROA 3WF7A 3ZXZA 4L45A 4EHEA 4I20A 2BFXA 4FGRA 4IIRA 2R3NA 2YCSA 2HENA 4YLKA 2EB2A 4M84A 5AM7A 4EK6A 3IQ7A 2YHVA 4RA5A 3QFVA 4BCGA 3DV3A 3VW6A 3K2LA 4I4FA 4RIWA 4FGBA 3ZLWA 3EJ1A 4ANLA 4BBMA 1XR1A 2GQRA 3DBEA 4L7SA 5AX3A 2E2BA 5A46A 1SM2A 1H25A 3MFUA 3OUKA 1UA2A 3PVUA 5IG1A 4CSVA 4FIGA 4MD9E 2VO7A 3KN5A 5HESA 3ZZWA 4CZTA 3KRWA 3L9NA 4EH5A 3HRBA 2WTCA 3UOJA 1BI8A 2J9MA 2J50A 1A06A 3CBLA 4FIJA 4JR3A 4DEBA 2WB8A 3R9HA 5CAUA 2PUPA 4I6HA 2W5HA 1T45A 5HHWA 4U79A 4D0WA 5CSXA 3NNUA 2C47A 4IAIA 4O7RA 4KWPA 4XG4A 3W0PA 3ANRA 5CI7A 2PZRA 2B0QA 4QMVA 5ETCA 1ZOHA 3JVSA 3LFCA 4DF3A 3MPAA 4TYEA 1YVJA 3OD6X 5AUVA 2A19B 3U4WA 3FY2A 2JIVA 1JVPP 3QTRA 5IH5A 4DFLA 1R1WA 3ZONA 4Z9LA 4I5HA 4ASEA 3JR1A 2LAVA 3N51A 2OICA 4L6QA 4M12A 2DWBA 5B2KA 3JS2A 4J96A 4FR4A 2Z2WA 3DBQA 2IW9A 3TXOA 4X3FC 3V8TA 1UKIA 2BRBA 4P5QA 3EQPA 5H8BA 4UALA 3TV6A 3M11A 4J71A 2XS0A 3KXZA 3R8LA 3ZEPA 3CGFA