3W0QA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n203a), ternary complex with amp-pnp and hygromycin b
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
ATSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNAVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0qA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0qA02
4EJ7A 3Q2JA 4DT8A 2CKQA 4R78A 3TDWA 2CKOA 3ATTA 4U98A 3F2RA 3N4TA 2Q83A 4DA5A 4DTBA 3MESA 3SG9A 3SGCA 2PULA 3G15A 2PUIA 5IQEA 3TYKA 4GKIA 4FEXA 3CSVA 2CKPA 3W0NA 1J7IA 4GKHA 5FUTA 5IQAA 3N4UA 4DTAA 5IQIA 3DXPA 5IQBA 5EQYA 5IQGA 4BR3A 5AFVA 5EQEA 2PUNA 3LQ3A 4R77A 3W0PA 5EQPA 2BKKA 3W0OA 5IQCA 2IG7A 5IQHA 4DBXA 3DXQA 4ORKA 1J7LA 3HAVA 3JR1A 3ZM9A 3C5IA 4CG9A 3TDVA 4FEUA 3W0MA 4R7BA 3SG8A 2B0QA 4O7PA 5C4KA 2PU8A 1J7UA 4WZYA 4DE4A 2PPQA 3UZRA 3W0SA 4O7OA 3N4VA 5C4LA 4U94A 5IQFA 4PDYA 3TM0A 2I7QA 4CGAA 5IQDA 4DFUA 3ATSA 4DT9A 2QG7A 4H05A 4CG8A 3W0QA 4DCAA 3HAMA 4DFBA 2OLCA 1NW1A 3W0RA 1L8TA 1ND4A 3FI8A 4N57A 4FEVA 3FEGA 4FEWA 5FTGA 5BYLA 2PUPA 2PYWA
chains in the Genus database with same CATH superfamily
2FSMX 3RM7A 3W2SA 3R8PA 4ZTMA 2XK3A 3NNUA 3Q2JA 5DHJA 3ZLYA 4IC7A 4GUEA 4FKSA 4FKVA 4XG3A 3BI6A 3R9NA 3TNQB 5LVOA 3WYYA 4FTNA 1Y57A 4II5A 3NCGA 1PMEA 4K0YA 5JQ8A 4HVDA 3OW4A 5DWRA 4OBPA 3R83A 2J51A 4WBOA 4OR5A 2FUMA 3E88A 2WMRA 2R3JA 4FTRA 5KMMA 3IGOA 5A9UA 3MJ2A 3LJ0A 5KHXA 5HE3A 4ZY6A 4ZLZA 4JBPA 4ASZA 2RFEA 5KUPA 2PVYA 4ASDA 5TO8A 4BJJA 3AD4A 3GUBA 5LWNA 3IDCA 3O0GA 1VJYA 2BZJA 2BALA 2CKPA 4OTHA 1H08A 3GC8A 4L52A 3CCNA 4V04A 3U4WA 2RF9A 5CT0A 2VWYA 4G16A 2WPAA 2BR1A 2ZB0A 4JDIA 3DBQA 2Z7RA 4OTQA 4QTAA 5IDNA 2AC5A 3EZRA 4APCA 2JAVA 4MD7E 4RX5A 2EVAA 3KULA 5AM6A 4F1OA 3R7UA 5HTBA 4GYIA 4WRGA 4G3DA 2W4KA 2RG5A 4OTIA 2PSQA 3FMKA 3HMMA 1PMNA 3HV5A 3OTUA 3FMJA 4FTIA 5E8YA 3PJ3A 5EQPA 2Z8CA 4JX7A 4RFYA 1PYEA 4AACA 4PDOA 1ZMUA 2V7AA 3PP0A 4B7TA 1PMUA 4JBVA 2CLQA 2XM8A 1JVPP 1XH4A 5L2TA 2P4IA 2VWVA 4DAWA 3HAVA 3QQJA 3R1YA 3DB8A 2YABA 2YITA 3GOPA 4AU8A 2G9XA 4X7QA 1CTPE 5A4CA 1RDQE 4I6LA 1WBTA 3ZFYA 3U87A 3EQBA 5D10A 3NLBA 5HX8A 4ZJIA 3VJOA 1ZOGA 2AUHA 4U0IA 4F9YA 2IW6A 3F61A 3REPA 2W7XA 3AT4A 1J7UA 2X1NA 3PVBA 4BDGA 1ZY4A 4HGSA 3RWPA 3RVGA 3UQCA 5AV3A 3UG2A 3HRBA 5AUXA 2C0OA 2Y6OA 4I94A 4EH3A 2YCSA 3KVXA 2F57A 1QMZA 2R3MA 3GI3A 3R0TA 4I3ZA 1MP8A 1LPUA 1VR2A 3EQPA 5KMKA 2A0CX 1DI9A 2J0JA 1DM2A 3ZUUA 5HIEA 4YTCA 3KK9A 3TI1A 2RG6A 4UXLA 4AOJA 2W99B 3EL8A 4CFWA 5IQFA 4FT7A 1QPEA 2WNTA 4PUZA 1NVRA 4YLJA 5JQ5A 4WIHA 1YDTE 3KIOC 3GVUA 3F7ZA 3PJCA 4BDEA 3HA8A 3FV8A 3S00A 1OPKA 2XJ2A 2QOCA 1F0QA 3FMNA 3K54A 3PPKA 3RPSA 3W0RA 5KBQA 2HAKA 4HGTA 4IC8A 4QTDA 2JEDA 1YKRA 1W8CA 2WTDA 3JVSA 3QRUA 4KD1A 4I92A 2GFCA 5CXZA 5FTGA 4E7WA 3FL5A 4YNOA 3NMUF 2B52A 2QOQA 3ZBXA 3HDNA 4RIWB 4A9UA 4AT5A 4V05A 2YCRA 4GK3A 5AV4A 2QOIA 3LFBA 1PRYA 2OJFE 4RWLA 4C61A 1HCLA 2IN6A 5ANKA 4RQKA 3A8XA 2PE2A 4MKCA 4YC6A 4E6QA 3NAXA 1PXNA 2GCDA 2WKMA 3NW6A 4YNEA 5F95A 3A7IA 1ZWSA 3LLAA 3PDTA 4LDTA 1UNLA 2R3GA 3D7ZA 4FKUA 2C5VA 1A06A 3AMBA 4KBAA 4PTCA 3CTHA 5LVMA 2WELA 5CQUA 3SD0A 3KGAA 3PIXA 3OWLA 2BAJA 2PUIA 3HP2A 5ANIA 3RCDA 5EHOA 2QVSE 5J95A 5CEOA 2NPQA 4O86A 4F9AA 4Q9ZA 2HYYA 4O0WA 3BYOA 3R9HA 2H9VA 4GT3A 1H1QA 3EQHA 4YJRA 3NYXA 3ZDIA 4DFXE 3HX4A 4F4PA 4DF3A 2W5AA 2UV2A 3ZZEA 2E2BA 3PXZA 4O0VA 3T8OA 1Y8GA 3OT8A 1H4LA 2G01A 4CRSA 3DKOA 4GU9A 4K9YA 3NUNA 3UPZA 1H0WA 1NA7A 1OKZA 4RX9A 4B6LA 2B7AA 4KINA 4C02A 2QLUA 5AFVA 3ZUTA 5AIKA 5EI8A 3P9JA 3O50A 5AV2A 3VULA 3ZTXA 4KAOA 4BCMA 4FT5A 4G17A 5IA5A 4AW1A 3BYUA 4MWIA 5HG9A 2J0IA 3C4WA 1QL6A 4YZCA 3EMGA 3NRMA 4ARKA 3CQEA 4Y95A 4CT2A 3P5KA 3THBA 4B8LA 1IEPA 2R64A 2XAOA 4NT4A 4U5JA 4ZSLA 1W7HA 3AD6A 5AP6A 3LLTA 4O21A 1Y6BA 4HCVA 2QKRA 4ORKA 3NUUA 3NGAA 5E8VA 5J9YA 2Y7JA 4NWMA 3QTWA 3L9NA 3RP9A 2XIKA 3FC1X 3O7LD 2Z7QA 5H8GA 3ZONA 3LJ1A 3FMDA 4PMMA 3RK5A 3U51A 4Z3VA 4J97A 3WYXA 5ITAA 5M4UA 1YI6A 3CD3A 5IH6A 4IM0A 1G8SA 3E8DA 2JKOA 1OI9A 4YU2A 2PU8A 4AZFA 4DE4A 2PL0A 4J96A 3TV4A 2X81A 3OXTA 3ACKA 3LVPA 4L7SA 3RNIA 3QC4A 4FSQA 3Q6WA 4J8MA 4L45A 3EHAA 2JFLA 3Q4ZA 4TTHB 3DXNA 3L1SA 1SVHA 1T45A 2I0VA 1PXIA 2QI8A 1KE5A 2XKCA 4FV8A 4QP3A 5HIBA 2VTAA 3R71A 3O23A 4J1RA 4FVPA 4PP7A 1RQQA 4QPSA 4MX9A 4ZY4A 5DT4A 1XJDA 2YFXA 2FSTX 4NU1A 1R0PA 2VO0A 3P79A 1OPLA 3G9LX 2V22A 4G6LA 4HVGA 3O5AA 3A7GA 3LQ8A 2J4ZA 1UWJA 2OLCA 2XIXA 2Z7LA 4X2KA 3UZPA 3U6JA 4BTFA 3VJNA 2FH9A 4D2SA 2R7IA 3NYNA 1PKDA 1LR4A 4JG7A 5J9LA 3V8WA 3H0ZA 1WCCA 2WQBA 3FLZA 4RZVA 5L8JA 2CDZA 2IVUA 3HVCA 5EI2A 3UBDA 3ZBFA 4EJNA 4ZMEA 4F6WA 5BMMA 1Q41A 4BIBA 3QLFA 4BN1A 3FLWA 1V0PA 3OHTA 4AA5A 4R3RA 3V5PA 4JRVA 3GC7A 4DT8A 4ZJJA 3P7CA 2CN8A 1Q99A 5IF1A 4FV7A 1OBDA 4B9DA 2XNEA 3VBTA 4I24A 3HKOA 2J90A 4OTGA 1CKIA 2I0YA 3IONA 3R7OA 1OUKA 4AOIA 3B8QA 4YLKA 4JVGA 1KE8A 5AV1A 4CFNA 2FGIA 4YPSA 4DINA 1H24A 5M07A 4UXQA 4DTBA 2PK9A 1U4DA 2FYSA 1Q24A 1YI4A 3ENHA 2CSNA 3QD3A 4FSZA 4OT5A 4JS8A 4MHAA 4ERKA 5IA3A 4EZ7A 4MH7A 3V6SA 4M7IA 5GNKA 2ETMA 3VW6A 4QTEA 4NSTA 2XF0A 2P0CA 2BAQA 3O51A 4IE9A 4RRVA 5AAFA 2HENA 3TZ8A 4XP2A 3IGGA 2OW3A 2PVHA 3Q04A 4DTAA 4E4LA 3O96A 1OB3A 3FZTA 3E8NA 2IZTA 1WFCA 3D14A 3AD5A 3A61A 3P23A 4FIJA 3ZM4A 4ZTSA 5EM8A 3FUPA 5IPJA 3BQRA 1PY5A 2YIRA 3NVMB 4EYMA 1CSNA 3IW7A 5KMNA 2ITXA 4G6OA 2ITQA 4K8AA 4R77A 5BVOA 3W32A 4IB3A 4ZS0A 1M17A 5CI6A 3U9NA 5J5SA 3E8EA 1U54B 4OTFA 2CCIA 4U3ZA 3DFCB 3P7BA 5FBOA 5J1WA 5DI1A 3GU5A 3PIYA 5M06A 4EQMA 2VWXA 4RC3A 3U6HA 3OFMA 5CSVA 3ZYAA 2VTJA 4C38A 4E6CA 4QMNA 2QOOA 3C13A 2C6OA 5CWZA 1GIIA 4U3YA 3Q9XA 3I4BA 1S9IA 4Z16A 4UZHA 4X6QC 2QODA 1JBPE 3W2CA 2F2CB 4L8MA 4JAJA 2R7BA 2VTSA 4J71A 3QAME 5CU0A 3L8SA 4QDVA 4O7ZA 4MBIA 5C4KA 4MCVA 4NK9A 3PG3A 4IX4A 3G51A 2JBOA 4JX3A 3KMMA 3L9MA 3NEWA 4DHZA 4XHKB 1NT2A 2WTCA 1B38A 2PTKA 2FA2A 4AS0A 3PXKA 4GCJA 4ZAUA 1M2RA 5LVLA 4EH5A 4FL2A 3AQVA 2XIRA 3A4OX 1SNXA 2PVFA 1H1RA 4TRLA 3RNYA 5AV0A 2XUUA 3UDTA 1KV2A 5HD4A 4NJDA 4X2GA 3VNTA 1M14A 3F5GA 4YTFA 5BV3A 5LMKA 4WG3A 5DRBA 1JNKA 5T6KA 4EOJA 2P2HA 3F88A 3HAMA 4YJUA 4F9CA 5DA3A 3ZLWA 3K5VA 3TJDA 4BDKA 5A14A 2OO8X 2UZUE 2WMXA 2VGOA 2WQOA 5BYZA 1FMKA 1YOMA 3UMXA 3LXNA 4O7TA 3T3UA 2GTMA 5DH3A 5DE2A 5LARA 4F65A 1GZ8A 2XK6A 4M84A 4G3EA 4XMOA 4A07A 1H01A 1VYZA 3D9VA 1H8FA 1OL6A 3E8CA 2CGVA 3HNGA 3Q52A 5DR6A 5C26A 3MGYA 1W84A 3U8WA 3UOLA 1YXUA 2ZV2A 2WTIA 4YURA 4RGJA 5AADA 4NFMA 2ERKA 4L53A 4C4FA 3LQ5A 4ONAA 5ETAA 2C5OA 4C4HA 5I9YA 5IMEA 3HL7A 2C6TA 3NNWA 3PLSA 4ZS4A 2RGPA 2ZJWA 3AMYA 3F2RA 2BHEA 2GQSA 3QLGA 5DT0A 1ZMVA 2UW4A 1Q8UA 5CALA 4NM5A 3F66A 3ODZX 4FTUA 4LGGA 4C2WA 4LRKA 3VQHA 5CVFA 2PULA 3BE9A 2UZNA 3EQGA 1H27A 3QTUA 4MWHA 5DIAA 4BBMA 3LFNA 3CKXA 3RHXA 3H4JA 3CKWA 5AWMA 3PY3A 3MJ1A 4KUJA 3B2WA 2GDOA 3G2FA 1GIJA 4AXEA 3TZ9A 3TZMA 4QNAA 4O82A 4E26A 2LGCA 3D5UA 1AQ1A 2QOKA 2YM8A 3JXWA 3VHEA 2CGXA 2JLDA 4RIXA 4FKRA 4G5JA 2SRCA 4EK4A 1UU3A 4YHJA 1UA2A 1UKHA 4O0RA 4XG2A 4CTBA 5KKRC 3EFLA 2NRYA 1OZ1A 2YIXA 4PMSA 3ZHPC 3IOPA 3ACJA 5M51A 4FIHA 4KBKA 4CLJA 4HGEA 4NUSA 4RWKA 3ZO1A 4TT7A 4C4IA 2H34A 5AAEA 2YA9A 3EN7A 4C4JA 4NM3A 5IQCA 4IWOA 3ERKA 4NL0A 3GU6A 4D1SA 5BMSA 4YZNA 3AC8A 2KULA 4RG0A 4D2RA 2WU7A 3F3WA 3SQQA 5IMXA 4I0SA 2XKDA 5KMIA 4FR4A 2V0DA 4ZOGA 2X2LA 2E9PA 3H10A 4I5MA 3SOAA 4O22A 2C0IA 5A54A 2RFNA 3MB6A 4FSRA 3ANQA 2WGJA 3DCVA 3MVMA 4NW6A 4IWQA 2JIIA 4LV5A 1PF8A 2QO9A 5B0XA 5E8XA 2HY0A 4FKWA 3FSKA 4AOTA 1BI7A 1KE9A 2RIOA 3KMUA 2R3LA 2XEYA 3MY5A 4IJPA 4YSJA 3CP9A 4AN9A 4CTCA 5LQFA 5HCYA 3BHUA 3UODA 4L67A 2C5NA 4JBOA 3LZBA 1JQHA 3QU0A 2UZLA 2VWZA 4JQ7A 4XG7A 4YBKA 4ZSJA 1UU9A 3WI6A 3RPVA 3W8LA 1YOJA 1U5RA 3ZRKA 3AXWA 1W83A 2BVAA 3L8PA 4JQ8A 5J7HA 2O65A 4DEEA 1OKWA 3I6WA 3UGCA 3GBZA 4DITA 3U4UA 3R8UA 4B4LA 4B8MA 4S2ZA 1OL1A 4DFUA 2P55A 3BGZA 1E9HA 3DTWA 2QG7A 4IAYA 5EM5A 5A6NA 5CF8A 3OWJA 2HW6A 3OY3A 4DCAA 2O3PA 4UY9A 3KXMA 4DN5A 4DTKA 5CSPA 4YZMA 3D5XA 3E3PA 3W33A 4FG9A 3NUSA 4BJJB 4IZ7A 2X4ZA 1MRYA 3OY1A 1M52A 4A4XA 3LFQA 3OC1A 2XIZA 2R3PA 3ANRA 3QD0A 4O0XA 2F7ZE 4YPDA 2GS6A 4UALA 2F4JA 4TYHA 3OWPA 3R63A 3KULB 4GYGA 4FSUA 3CS9A 2W1IA 1U46A 3OBGA 2VU3A 5D12A 3BEAA 5FGKA 4F09A 5J87A 1ATPE 3OF0A 2QQ7A 5KHWA 2VTNA 5HO7A 3FKOA 3K2LA 5E8ZA 5EDQA 5HEZA 3ZRMA 1XH7A 4RJ8A 5C01A 5K4JA 5G1XA 2XCKA 4ANLA 4DA5A 4W4VA 1OECA 4ANBA 3SG9A 2CNQA 2J9MA 4GG7A 4MD9E 4S34A 2UW0A 4D9UA 4H3PA 4MK0A 2DUVA 2YERA 4P7EA 3C4XA 1YXXA 2OIDA 3AC1A 5EYDA 5FDXA 3HEGA 4O7RA 3ORPA 3E87A 2HELA 3PJ8A 1PXKA 3GCSA 3W1FA 3F3VA 2PE1A 3COIA 1IAHA 2EB3A 4OBOA 3CLYA 2IPXA 1YHWA 5H8BA 1XMLA 2GS7A 3CPBA 3DXPA 3QKMA 5CY3A 2OJ9A 3R00A 2WHBA 4IVAA 1DS5A 2R3RA 3KY2A 4IB0A 3BYSA 3OG7A 4AP7A 2ZM4A 3CE3A 5AP7A 3AKLA 2X6EA 3OCSA 3DFAA 3R8VA 3ZLSA 5M56A 1P4FA 2HXQA 5JSMA 4N4SA 1OKVA 2YM4A 3OCGA 5HU9A 3VWAA 5IQHA 4O6EA 4E8AA 3MV5A 4YO4A 1IG1A 3HV7A 3II5A 2EB2A 4YJNA 4EI4A 4RLKA 3A62A 1CKPA 2OH0E 1FBNA 2BTRA 4U81A 2C6KA 2QD9A 4CFXA 3JR1A 5AEPA 1P5EA 3HP5A 5DFPA 4EYJA 1Q3DA 3GFWA 3NNXA 3NFFB 4QP2A 3S3IA 4RVMA 4QYYA 1M2PA 2E9UA 3PA4A 2XNGA 4FZ6A 4IJ9A 4QMYA 4FVRA 1H00A 3FMHA 3QX2A 5KBRA 4TNBA 4J53A 5DG5A 5IA4A 4EH2A 2JC6A 4GIHA 3IOKA 2EXMA 3R7EA 1UV5A 3MVJA 4QOXA 3NZ0A 4G9RA 5GHVA 5EK7A 4FC0A 4DHJA 4MF1A 2JITA 2ZM3A 3K5UA 2UW5A 3AT3A 4W4WA 4O7WA 1ZXEA 1E1VA 4XRJA 3V8TA 3G90X 3HLLA 5KZIA 1REKA 2NNWB 4PDYA 4IQ6A 2I7QA 3F69A 4AW0A 2ITVA 3QF9A 3PPZA 4FI1A 4ENYA 4IW0A 5CASA 4AUAA 3LHJA 3QD4A 1MQBA 3R22A 3R2BA 4CG8A 4YP8A 4AZVA 4JL9A 4K6ZA 5BPYA 3R04A 2W4JA 2Z02A 4TYGA 1L8TA 1WZYA 3G0FA 4W8DA 5AP3A 2BROA 4C58A 3PXQA 3FZSA 4FKJA 3UVRA 3QQFA 5K9IA 3QQHA 1SYKA 3MTLA 3F3TA 3CBLA 4FA2A 4Y83A 1ZYLA 3PXRA 4BB4A 3G5DA 1PXMA 3FKLA 4HPTE 4FJVA 4EBWA 2GTNA 5HBJA 2J7TA 2OJIA 1GIHA 5TOZA 5I0BA 1YRPA 2XYNA 2YZAA 4BICA 3GXLA 3DA6A 4QMXA 2W9FB 4ZZOA 1ZAOA 3KXNA 2F7EE 3HECA 3NVKI 3NSZA 4X3FA 4QYHA 1F3MC 3HMNA 2YIQA 2W1FA 4RZWA 5TF9A 1G8KA 3DAJA 3QRJA 3ZDUA 4XG6A 3V5QA 4BTMA 3V5TA 1Q61A 3LMGA 3CTJA 1PW2A 1OGUA 3D7TA 4FV6A 4ALUA 2OFVA 1K3AA 2Z2WA 3M2WA 4AE6A 1QPCA 4JT3A 4IMYA 1WBOA 3RAWA 1SMHA 3L8XA 1YQJA 4BCOA 4OW8A 3POZA 3PWYA 4IAIA 4YJOA 3KVWA 5A3XA 4FZAB 4UWYA 3I79A 3QCXA 5J1VA 3R21A 4FTMA 3ZFXA 2CGWA 4TXCA 4TWCA 3F5XA 3ALNA 2G2FA 2UW6A 4OLIA 3VVHA 2R5TA 5E8UA 3Q4CA 3W0PA 3WIKA 3FMMA 2CJMA 4FV2A 2UZVA 4AAYA 2VUWA 2C5XA 5BVWA 2W1CA 3L9PA 3KK8A 3QCYA 4I1ZA 3Q5IA 4BYIA 2XALA 1J91A 4C62A 4TYEA 3TNHA 5H3QA 4EK8A 4F7LA 3NUXA 1YHSA 4AT4A 3VBVA 4O7LA 4G3FA 2XYUA 3RI1A 5EH0A 1J7LA 3U55A 5HQ0A 3ZM9A 4L68A 4FTAA 4FV4A 2BZKB 4LMUA 5GJFA 4FT9A 5CAOA 3NFGB 5L6OA 2ZV7A 3DNEA 4XBRA 4BIEA 2GNGA 3CC6A 4FKQA 3DB6A 1MUOA 2W1EA 1YXTA 4TY1A 4AXFA 5AMNA 3GCPA 1TQPA 1LUFA 2XNOA 2C3JA 3SDJA 4APPA 3D15A 3UZRA 1ZYDA 4OTWA 2PY3A 3IPHA 2O5KA 4FTOA 1OVEA 1W98A 4XV1A 1JAMA 1WAKA 3LFCA 4G2FA 4DH7A 4S33A 2X7FA 2VO3A 3P4KA 3UJGA 5IUIA 1JLUE 5GJDA 4BHZA 4IFGA 1JKTA 4U40A 2BUJA 5FM2A 4EHEA 4C3RA 4I41A 4RIOA 4XG4A 5T68A 4D9TA 4R6VA 3ATSA 4FTQA 3QX4A 3UYSA 2C5YA 3Q60A 3W0QA 3JUHA 4YC3A 3DQWA 4HJOA 3QC9A 4QMUA 3BU6A 3JPVA 4IDVA 3FQEA 2J6MA 4UN0C 3PY0A 5C03A 4WNOA 4WNKA 4BDAA 1STCE 5HE2A 4BZOA 3C0HA 2W1ZA 4JAIA 5BUEA 3WF9A 3RAHA 3AOXA 4C7TA 4DEGA 4RFMA 5I9ZA 3TZ7A 3QGYA 3R7VA 1WBPA 3VF9A 4ACCA 2EXCX 4F0IA 2H6DA 3LPBA 2QHNA 4FIGA 4WBBB 4DGOA 5IH4A 3Q9WA 3LFDA 3TIZA 5M53A 4FSWA 4PQNA 3KF7A 2C3KA 4YZBA 4X2JA 3DKCA 3I1AA 4GSBA 2V62A 3UO4A 2R0UA 3GQIA 3FE3A 4D1XA 4GT4A 4U98A 2XK7A 4GJ2A 2BZHB 3WZEA 5LJJA 3UG1A 5AP2A 4OT6A 4EBVA 3MH3A 3BV2A 3EFKA 3QUDA 5CAUA 4G3GA 2Q0NA 3FY2A 2PVRA 4FKTA 3VUKA 3RWQA 4CSVA 4LL5A 4A9SA 4JG8A 4FNZA 4WUNA 4TL0A 4YO6A 2VV9A 4X0MA 4NCTA 3FI4A 4QPAA 4F08A 3F7WA 5HESA 5IQIA 2GNLA 4U42A 1ST0A 1TKIA 2PVJA 5AA8A 1FMOE 4IM2A 1S9JA 3LXPA 4FOCA 3WILA 4C59A 4EK3A 5LMKC 3O17A 5CEQA 5IQGA 3EQFA 4KBCA 4A4OA 4AXAA 1K9AA 2X9EA 3MIYA 3QYWA 2CPKE 4FNWA 2PVNA 2WIPA 4HYHA 3MB7A 4ITIA 4DGNA 3VN9A 4UZDA 3H9OA 4E1ZA 3DBEA 3LCOA 4FICA 4YBJA 2JFMA 4PX6A 1Q97A 4WT6A 3PVUA 2PZYA 3QA0A 4GL9A 3Q4UA 4O38A 4AGWA 3BEGA 4Q5EA 3AC3A 4EH4A 3UPXA 2BRMA 4V01A 4AN2A 1ZOEA 4KABA 4H1MA 4RJ6A 3FLNC 2BRBA 3V8SA 4CT1A 3R9RA 2UW9A 5FXSA 3W0MA 4YTHA 4AXCA 4QP4A 2B9JA 2R3HA 3TKIA 2UZBA 1ZARA 4QYEA 5IG1A 4C34A 2IZRA 3TEIA 3GCQA 5JGDA 4PNIA 4WZYA 3EQCA 5AP4A 3NIZA 3Q5ZA 4JQEA 4BF2A 2PPQA 1FOTA 4I93A 4DYMA 1YDSE 5CX9A 3UIUA 2YN8A 4NYEA 1UWHA 3LXKA 3W0SA 4QMMA 3R02A 4XBUA 1XHAA 4WA9A 2VX3A 4RJ5A 5HLNA 3O7LB 2W17A 4RT7A 3F3UA 1KUTA 3R2YA 3N4VA 2GFSA 2QC6A 1OM1A 4FK6A 2B9HA 3ET7A 2W05A 4YZDA 5B2KA 2RFDA 3FMLA 3I7BA 3RKBA 4DCEA 2BDFA 4EK5A 5IU2A 2GSFA 2WIHA 2ZV8A 3BV3A 3QALE 4QMQA 3TV7A 5BUIA 4N0SA 3CXWA 4EHVA 5HX6A 4C2VA 3LCDA 5HG7A 2XM9A 3BBTB 2J2IB 5AUZA 4KIOA 3BE2A 4O84A 4ZTNA 3P1AA 4G5PA 2VTMA 4Z7HA 5J9ZA 3IW4A 5EDPA 4X6RA 3V6RA 3M42A 2O63A 2VNYA 2F2UA 3C4ZA 5M4FA 3F3ZA 4HNIA 3HZTA 3UYTA 4AFJA 4FTTA 4AZWA 4EOOA 1X8BA 4ZTRA 5JFXA 4RIXB 3QBNA 3AC2A 2HZNA 4DFNA 4IZAA 3PTGA 3MFTA 4FKOA 4IX5A 3VRZA 5HKMA 1NXKA 4E4XA 1MRVA 4YC8A 5ETCA 3R8MA 2C1BA 4I0TA 3LKMA 2YHVA 3BLAA 3KF4A 5BVFA 3ENMA 2I6LA 3S1HA 5CENA 1EH4A 3C0IA 4DH5A 5DVRA 4NFNA 1CDKA 3FI3A 5JFVA 4TPTA 5AX3A 3RK9A 1P14A 4LL0A 1O9UA 2H96A 2UW7A 2YWPA 1OIUA 5ANDA 2Q83A 4AQKA 4AG8A 3BHYA 2WQMA 4NJ3A 5E90A 3ULZA 5LWMA 1REJA 1H1PA 4QP7A 5DR2A 3EB0A 3SXFA 4G31A 2GQRA 2XJ1A 4R5YA 2QONA 1KE7A 3PVWA 2OU7A 3ZO2A 3FSFA 5A6OA 1ZOHA 3CD8A 5CAPA 5HBEA 4R1YA 4GFMA 4AW2A 2W1DA 3E63A 3EN4A 4AE9A 3HGKA 4U44A 5TT7A 3ZSIA 4MNEA 3MFUA 2X39A 3UVQA 3FJQE 4WD5A 4BIDA 4MBLA 2WMWA 3PFQA 3GU4A 4M12A 3SRVA 4EH8A 5IQBA 3SVVA 3BQCA 2R3NA 3A7HA 2VGPA 4TWOA 4MXXA 4U7ZA 1Y6AA 2YIWA 2G1TA 3L8VA 3OWKA 4FSMA 4IH8A 3Q6UA 4CD0A 5HLWA 4GUBA 3KXGA 3OXIA 2QU5A 5EW9A 3WF5A 3UOJA 3VBWA 2ZVAA 4EZ3A 4FUXA 3SV0A 1LEZA 4GG5A 4WUAA 5HG8A 3FAAA 2KTYA 3FKNA 3AGMA 4DH1A 2IZSA 4AN3A 4QTBA 2BAKA 3LMIA 3UNJA 3ZO3A 4DBXA 5EKNA 4AX8A 3D83A 4A9YA 3MY1A 4GRBA 3NUYA 3ID6C 4HGLA 4IAKA 3DLZA 1K2PA 3OZ6A 4LFIA 4ZSEA 3TKHA 4WHZA 4IANA 3UO6A 2FVDA 2JGZA 2VTIA 2QLQA 4IHPA 5AP5A 3KMWA 4FEUA 2CKEA 1QCFA 2JDOA 2W96B 3HMIA 3COMA 2XRUA 4QMWA 1OUYA 4AWIA 2XB7A 2VN9A 3QD2B 3GC0A 4PTGA 3W10A 4L3PA 2VZ6A 3BELA 4TYHB 1URWA 3ORXA 1BI8A 2YM5A 4BGGA 4YUQA 2J0MB 3VS1A 3DJ5A 5DT3A 1IASA 1XH8A 2EU9A 3I0OA 3TNIA 4CMUA 3QTZA 5D11A 3H30A 1YI3A 1Y91A 2HY81 4FUYA 4MD8E 3DV3A 4BHNA 4CRLA 4FBXA 3KN6A 1AD5A 1APME 2AEGA 1R78A 3DK7A 2V5QA 1O6YA 1ZY5A 2OI4X 3FXXA 3PIZA 4W4XA 4F63A 3TL8A 2IWIA 4I6HA 4J52A 4HNFA 5C27A 4CV8A 2ZMCA 4DFBA 2UW8A 5ANJA 1ND4A 1Q8TA 1V1KA 1W0XC 2VTHA 4NM7A 3CQUA 3ZC6A 2ZYBA 4L00A 4FGBA 4EK6A 5G6VA 4RX7A 2HCKA 3CGOA 2YISA 1JSUA 3DDQA 2UUEA 4LQMA 5AP1A 2XKEA 3DKGA 3FMEA 1ZMWA 2OZOA 3PRIA 3LMHA 3EN9A 5B2MA 5JFSA 4YJPA 4AAAA 2GNFA 4ENXA 1TQIA 3FQHA 3FY0A 3F2NA 3PRFA 4O7VA 4O7NA 2GU8A 1V0OA 2P33A 3ATTA 2XS0A 3WOWA 1WBSA 3HRCA 3PFYA 4P5ZA 3IO7A 2BRNA 4AF3A 4CKRA 4USEA 5F94A 5IDPA 2G2IA 4FV1A 2WZJA 4K18A 4ITHA 1M2QA 3OP5A 3Q96A 5EYCA 4CKJA 3JS2A 1BL6A 3BHTA 1TFFA 3BYMA 3FDNA 4MYGA 2UZDA 3IECA 3L9LA 4QMPA 1ERKA 1YWVA 2PE0A 5CZHA 4FEXA 3NCZA 1ZYSA 4QRCA 4ALWA 2CCHA 1H25A 3QZGA 4FKPA 5JK3A 4ZY5A 4TKSA 4I20A 1URCA 2UW3A 3FPQA 2QHMA 4X3FC 4HOKA 3LW0A 3MW1A 4K2RA 1H28A 1RW8A 3FLSA 3P78A 4RVTA 5LCKA 4EOIA 4AT3A 3WZDA 4CCUA 5EQYA 4D1ZA 4YMJA 5CQWA 4GVJA 4RC4A 4ALVA 5DRDA 3MPMA 4XH6A 4Y73A 4XJ0A 4QYGA 1R3CA 2I1MA 2WOUA 2X7GA 4UB7A 2BDWA 4C36A 3MFRA 4DH8A 4CVAA 4H3BA 1PYXA 3ORMA 5D9HA 4N70A 4E6AA 5E8WA 4PL3A 5EHLA 4CZUA 1PJKA 3DBDA 4JDHA 4EOSA 3UE4A 3MTFA 4MXOA 3GCUA 3ZMMA 3DXQA 2A27A 4F9BA 4XG9A 4RSSA 4ZZNA 2BIYA 3OMVA 5A4LA 3CQWA 4U97A 2RFSA 4ZLYA 3GQLA 3IDPA 3TMOA 1B6CB 1WVYA 2B0QA 4J8NA 3FC2A 3ML1A 3QUPA 4U9AA 3BWFA 3R7IA 2I40A 1LP4A 4R7IA 1WBVA 3VF8A 3ZXTA 5C1QB 5EW8A 1FQ1B 1YXVA 5CF5A 4BC6A 2XCHA 4D5KA 4EC8A 2ITZA 2HZ4A 2YEXA 1Z9XA 3UDZA 4D55A 4F6SA 4IVCA 5CANA 4PNKA 4RJ7A 4U43A 4F99A 3GB2A 2QKWB 1XBAA 3MY0A 1WBNA 4GEOA 5FRIA 5M44A 5JH6A 2B55A 1MQ4A 5BUJA 4QMZA 4LM5A 4AZEA 4D0WA 3OUKA 4X3FB 1YHVA 5AUWA 3DNDA 5A46A 3NWWA 1BX6A 4ZTHA 3W55A 3C4FA 4EORA 4FG7A 4FV5A 5JFWA 5JRQA 5FEQA 3UOHA 4BYJA 4DLJA 5CLPA 4LUEA 3R6XA 5HVJA 5FLFA 2GHLA 4GFOA 3K3JA 3QKKA 4C37A 3QTSA 3OTVA 1ST4A 4LI5A 2Y4PA 3I0QA 1JSTA 4IWPA 4BDIA 4EUTA 3HV4A 4MAOA 4YHTA 4EC9A 4RBLA 5DR9A 1P2AA 5DEWA 3FEGA 3JY9A 5FD2A 1GNGA 4KRCA 2VWWA 4HW7A 3W2OA 5A4TA 1OBGA 4FT3A 5CU6A 4IFCA 4QMOA 3RMFA 5AX9A 4HVHA 3ETAA 4JXFA 5L6WL 1GAGA 4MXAA 3RJCA 3QQLA 4M3QA 4DLIA 4ZK5A 2PVKA 2EWAA 3ODYX 5KX8A 3IW6A 5EM6A 1G8AA 3KQ7A 4O6LA 3BCEA 3O8UA 1U5QA 2I0EA 4X2NA 4YTIA 1QPJA 2UZEA 2H8HA 2ZB1A 3SX9A 4IWDA 5L6PA 4CFUA 2X4FA 4QP9A 1KOAA 3NW5A 5D7AA 3EKNA 4DGLC 2HWPA 5FP6A 4I6FA 3SA0A 5CSXA 3HMPA 5ETFA 2VTPA 4QEBA 3RPYA 2QURA 3UP7A 2R2PA 5EG3A 4UWBA 5CVHA 3RAKA 3QQKA 2GHGA 3UC3A 5JZJA 4Y8DA 1Q62A 4KNBA 3I81A 2OXDA 2R3KA 3TYKA 4E20A 3GP0A 5F1ZA 3OOGA 5I9XA 3WBLA 4BDJA 4FTCA 3ZFMA 1MRUA 3KXXA 3VHKA 2XBAA 4QYFA 1Z57A 2OSCA 3KU2A 3LFAA 3OW3A 4FNXA 3DBFA 4GH2A 4PMPA 2BFXA 4D4RA 3AGLA 3H9RA 3QTQA 2OJGA 4O81A 4Q9SA 3PSCA 5AJQA 5JT2A 2OF2A 5L3AA 3BBWA 5CI7A 3SXRA 3LIJA 3FHRA 4FZDB 2X9FA 3CR0A 3B8RA 1G8JA 3KL8A 4AA0A 4BR3A 4GV1A 4O83A 4QQJA 5CF6A 1H1WA 4MVFA 4RVKA 4CFVA 2ETKA 3SC1A 4XYFA 4ANQA 2C1AA 4XS2A 4H39A 5CEMA 3OXZA 4NIFB 3EJ1A 3F82A 4MUQA 2IG7A 3E5AA 5E91A 3QYZA 1SVEA 4O7SA 4QO9A 4I5PA 2NRUA 2OF4A 2OK1A 3ZUVA 1UU7A 2ITPA 3DK3A 2OGVA 4LMNA 5HE1A 4QQCA 3VONA 5L2SA 2WO6A 2JBPA 4JDKA 5IEYA 5E1SA 1V0BA 5ETIA 3ZC5A 3QHWA 3QWKA 4EH6A 3NR9A 1JKKA 4RJ3A 5C8KA 3PXFA 4O7PA 1VEBA 4XP3A 5K4IA 3R01A 4BBEA 3HDMA 5IEVA 5AUYA 3NPCA 2XIYA 1J3HA 4BCQA 3Q2MA 5GIOE 3OCTA 3VS7A 4WO5A 3ZS5A 4O7OA 1XKKA 4E6DA 2OXXA 4FODA 3NX8A 2XA4A 4DEIA 3FPMA 4QMSA 2E9VA 3JYAA 3RPRA 5HZNA 2BFYA 2XK9A 4CQEA 4V0GA 5EHYA 1Z5MA 2VX0A 2P3GX 2FB8A 3MDYA 3R28A 3R8LA 3TIYA 4BBFA 3Q3BA 4O91A 2UZWE 4M0ZA 5IQDA 2QG5A 1Q8YA 5AIRA 5CEIA 2C0TA 1KSWA 3UNZA 3RM6A 2XZSA 4IEBA 4O0SA 1Y8YA 4G9CA 2PZIA 2HXLA 4N57A 5KCVA 5LMBA 2A4LA 3QHRA 3A2CA 1XH9A 4HCTA 4GU6A 3W8QA 4FOBA 4M13A 2W5BA 4W4YA 1W82A 3QZHA 4NZWB 5CAQA 5KMLA 5EI6A 4L7FA 4GJ3A 4AA4A 2W06A 3W16A 4UBAA 2QOHA 4BKJA 2HWOA 4RWIA 3UP2A 3ROCA 4EJ7A 4PDPA 5CXHA 2CKQA 2HW7A 2YM6A 3TXOA 4YJTA 4HZSA 4L01A 4EH7A 4XX9A 5LMAA 4ACHA 1OIYA 3TWJA 2YZLA 1JKSA 3CY2A 4FV9A 2UVYA 3HMOA 5IH5A 5M08A 3BYVA 3DOGA 3N51A 1SNUA 4GW8A 3H3CA 4OUCA 3D5VA 4FK3A 2V7OA 4FV0A 3MESA 4UWCA 3VS5A 3DS6A 2I0HA 2OZAA 4CLIA 3OT3A 3OVVA 2PUUA 3SHEA 3LOKA 3EN6A 3BX5A 2CN5A 3SAYA 3NYVA 1FGIA 3BU5A 5FDPA 3UNKA 4E73A 5HTCA 3VAPA 4XOZA 2X0GA 3CSVA 4IB5A 4P4CA 4QMLA 2OXYA 1UKIA 3DPKA 4WSYA 2OKRA 2YAAA 1RJBA 3ELJA 2YACA 4I5HA 2XVDA 3QTRA 4Y85A 4ZP5A 1YW2A 3GENA 3N4UA 4KIPA 4WNMA 3T9IA 4ANMA 2Y8OA 2X2MA 5CF4A 3CTQA 4ZSGA 4CEGA 1KE6A 3V51A 4F1MA 3LFSA 5H2UA 3PA5A 2BILB 5ACBC 2R3IA 5FTOA 2FSLX 4LV7A 4YJVA 2C68A 4GS6A 1PMVA 3EL7A 4FMQA 3TNPC 2R3OA 3W0OA 4QP6A 2J50A 2O8YA 3WF6A 3VQUA 2OG8A 4U79A 1BKXA 5LOHA 4WNPA 2JAMA 3LJ2A 4F78A 5C8MA 3COKA 5FEDA 4L9IA 2J5FA 1OIRA 4FVQA 4WG4A 2WMAA 1WVWA 4M69B 4WG5A 2IW8A 3P7AA 5HI2A 2XRWA 5JMSA 1FGKA 2OIQA 3NW7A 5ANOA 4DG2E 3VUIA 2WAJA 3BKBA 2YIYA 4YR8A 4I0RA 2VTTA 3W2RA 2YAKA 2WFYA 4F7JA 4MNFA 4NTSA 3F5PA 4FYNA 1OKYA 4AFEA 2ONLA 4PF4A 4IACA 5FTQA 3AT2A 5TKDA 3VRYA 4A7CA 3IKAA 2WTKC 2CHLA 3CY3A 4BGHA 4CZTA 4CKIA 4EH9A 3MA3A 2C30A 2WQNA 3R7YA 2XNPA 4JMQA 1M7QA 4X2FA 1UNGA 3GFEA 4ACMA 5LVPA 4JRNA 3KA0A 3QCSA 2B54A 4R3CA 3RK7A 4J7BA 5E8TA 4U94A 1J1BA 3QUEA 2QOBA 1ZLTA 2VTQA 2WOTA 3C4CA 3E93A 3TM0A 5C9CA 4Z55A 3FXWA 4IM3A 5DGZA 3HUBA 2XARA 1SVGA 2XJ0A 3BHHA 3MH2A 4IIRA 1OMWA 1XWSA 2GS2A 4FZ7A 4O27B 3DK6A 3R1QA 4O96A 3TKUA 3R1SA 5AUUA 4AQCA 3MH1A 4R7HA 3U9CA 4JBQA 3VUDA 5K5NA 3MPAA 1P4OA 1DI8A 4FEWA 4TW9A 3PJ2A 4DDGA 2VD5A 5I5ZA 4EOLA 4GK4A 4MBJA 2XNNA 4RIYA 4MNEB 3SXSA 4DBNA 1ZZ2A 2PHKA 1KOBA 2ITUA 3HYHA 4LOPA 5EOBA 1H0VA 3LM5A 2A19B 3DQXA 3SRVB 2JDRA 3PJ1A 2FSOX 4LV8A 5B7VA 3OD6X 1FPUA 3MVLA 5ACKA 4M67A 4DEDA 5KMOA 4DGGA 3VO3A 4BCIA 2ESMA 3VW8A 3OUNB 2NO3A 4ZXTA 1L3RE 3N4TA 2CLXA 2WTKB 3P86A 4IAAA 3QFVA 4CMTA 4KSPA 4M14A 4YZ9A 2OIBA 4LOQA 1ZZLA 1BL7A 1ZRZA 5IQEA 1G3NA 2ZDTA 1XO2B 5LCJA 4AZSA 4DDIA 3TN8A 1VZOA 1BLXA 2XMYA 5KZ0A 4RLLA 5TR6A 2C47A 2ZMDA 4OTDA 3ZCLA 4ASEA 5EYMA 4UX9A 4LRMA 2YM3A 5KMJA 4XLVA 3ALOA 4JNWA 2ZOQA 5M09A 3R9DA 3SKCA 2X8IA 3QXOA 1IR3A 2B9FA 4J95A 1O6LA 1PXPA 1DAYA 4L3LA 4M97A 4DEAA 5HCZA 1NY3A 2JDVA 3ZEWA 3IK3A 3KXHA 2WMQA 5EQEA 4FG8A 3TV6A 4MQ2A 4WOVA 2PUNA 4BTKA 3KRLA 3PE2A 4LGHA 5L2IA 4BCJA 3QRIA 3CJGA 2WMSA 1OL2A 3FHIA 2RKUA 3IW8A 4H3QA 4I6BA 4MQ1A 4DC2A 4FGRA 1SZMA 1I44A 2DWBA 4JIKA 5KO1A 1XMMA 4P90A 3W18A 3Q9ZA 3TUCA 3S4QA 3AC4A 3BGPA 4AGUA 5BX0A 3PSBA 4U6RA 4ITJA 4DHIB 2XH5A 2F9GA 2QOLA 3PY1A 4JR7A 3UIMA 5JEBA 4CG9A 3TDVA 3OBJA 3R73A 3EQRA 3DGKA 4FX3A 4R3PA 3ZEPA 4IADA 4A9TA 2VTLA 4LRJA 5D41A 3VUMA 5M4CA 3CGFA 5ANEA 2GMXA 2YCFA 4OGRA 3PVGA 4GFGA 5B2LA 2WD1A 1HOWA 5CEKA 3DZQA 4RQVA 2W1GA 3DLSA 3G33A 3Q32A 3LAUA 2C6LA 4XV3A 1PKGA 3BU3A 5CNOA 5E1EA 4FKIA 3PP1A 4CFFA 3ROYA 3KB7A 4TWNA 2OFUA 2G2HA 1KWPA 3GOKA 4CGAA 4CMOA 4EHGA 1PXLA 5L8LA 4M15A 2ZM1A 4QQ5A 3P5JC 1YDRE 5DNRA 2XNBA 3V5JA 3EFJA 4QMVA 3WIGA 5ICPA 2O0UA 3VC4A 2J0KA 2PZRA 2YCQA 2IZUA 3KRRA 3C5UA 5HNGA 3DY7A 4QDEA 4ASXA 1IA9A 3WF7A 2W4OA 3UVPA 2R4BA 4GK2A 4USDA 4CNHA 3RINA 3EFWA 5AUTA 3GEQA 4Z7GA 3QRKA 5FXQA 1GOLA 2GQGA 4P2KA 5I9VA 2WQEA 1JWHA 2BRHA 3FZPA 5EFQA 3DAEA 5BYLA 5E4HA 4CV9A 1ZYJA 2PYWA 3HV6A 4XNEA 3LFEA 4BCHA 3JY0A 2WTWA 3I5NA 4Y5HA 3P08A 2VWIA 3VS2A 4BI2A 1GY3A 4E5BA 1U59A 3QXPA 3MYGA 4A4LA 2BDJA 4TN6A 4X3JA 2DYLA 3OEZA 4Q2AA 3FZ1A 2GPHA 2CKOA 5HNIX 4RA5A 3BLQA 3GCVA 3FYJX 5FM3A 4HVSA 3TTJA 5FG8A 4PP9A 5CU4A 2AYPA 1AGWA 4BDFA 3MI9A 3NUAA 4DGMA 2DQ7X 3QA8A 3M11A 4CCBA 5CSHA 4KB8A 3C0GA 2CNVA 2C69A 1XR1A 2GNHA 1YOLA 4L3JA 5H9BA 5EM7A 5M57A 3KRXA 2B53A 5HIDA 2C3LA 4RFZA 2F7XE 4GKIA 2CGUA 5EYKA 4MEDA 4ANSA 3ORIA 2ITNA 3OEFX 4FTLA 1H07A 2QR8A 4RMZA 3ORLA 3ZH8A 5GINE 2XANA 3D2IA 3G9NA 3ZZWA 4EOPA 4PV0A 3A7FA 3LCTA 5T3QA 4ZZMA 4J98A 1J1CA 3C50A 4B99A 5AA9A 2E9NA 1XH6A 2WEIA 4F64A 4ACDA 4DFLA 4WRSA 5I4NA 3V01A 4K11A 2BHHA 4M8TA 5IA2A 2HIWA 5K3YA 4EOKA 4XLIA 2GNIA 3QCQA 3C4EA 2BMCA 2X6DA 4IX3A 2C6IA 4ERWA 4GMYA 1I09A 1FVTA 2HK5A 3MA6A 4XRLA 4Y5QA 4EONA 5IUHA 1XH5A 3TTIA 3Q53A 5CVGA 2VTOA 3D5WA 4C4EA 4F1TA 2OJJA 3EIDA 3LCKA 4G6NA 3CJFA 3PWDA 4WKQA 3GU7A 5AP0A 4Z9LA 4I21A 2PMIA 4C3FA 4BCGA 1XQZA 3I7CA 3P0MA 2X8DA 3PXYA 4UV0A 4IBMA 3QTIA 3NS9A 3KEXA 4R7BA 4CXAA 4KWPA 3RTPA 4PDSA 4KS8A 3W2PA 3KXZA 4FKGA 3RGFA 3VS3A 4HVIA 4QNYA 4AXDA 4ACGA 2WMVA 2W9ZB 5A4EA 3COHA 5CEPA 4TZRA 3SW4A 3D94A 4PMTA 4QP1A 4U41A 3NDMA 3E92A 4ID7A 5M4IA 3G0EA 4GIIA 3PSDA 4BCKA 3A8WA 4O7YA 3UQFA 4BY9E 3CEKA 5IEXA 2B9IA 3V04A 4BDDA 1FVVA 4I6QA 4D4SA 4KKHA 2XK4A 4K77A 4UYNA 3TACA 5IZFA 2W1HA 4L6QA 5E92A 2RL5A 3BPRA 3ULIA 2ITYA 3QQUA 2YJSA 3MIAA 3NIEA 4IX6A 4C0TA 3RAIA 2WTJA 3FLQA 3VBYA 4RVLA 5I9WA 4PY1A 4E5AX 5JN2A 2PVMA 3ZO4A 1FINA 4QT1A 2WEVA 2UVXA 3EYHA 3EQIA 4C35A 3QL8A 3AKKA 3JVRA 4KKEA 3V5WA 3I60A 3IS5A 3VBXA 4S31A 4BCPA 5IISA 1HCKA 3R1NA 3FL4A 4FV3A 4ZLOA 5BVDA 2P2IA 2PWLA 3GC9A 3TDWA 4X21A 3GGFA 3QRTA 1Q8ZA 4EOMA 3UC4A 4DEHA 2VWBA 4N6YA 5CU2A 2C6DA 3FZOA 4C3PA 3I6UA 4BRXA 4LOOA 5FEEA 3MPTA 3KKVA 5FQDC 3IW5A 1CM8A 2X2KA 4H58A 5EOLA 5CAVA 5HU3A 1A48A 1CMKE 3VIDA 2Z7SA 1JPAA 2W0JA 3SGCA 3PG1A 3Q9YA 3A7JA 4QMTA 5CYIA 4O0YA 3OOMA 4I23A 4TWPA 5BNJA 3VUHA 4JR3A 2HOGA 2XK8A 3ZXZA 5HO8A 1CKJA 2PMLX 5CNNA 2IVTA 3WARA 5J8IA 2Y4IC 3FYKX 3VS0A 5FUTA 5IQAA 3DBCA 4K33A 4DG0E 5DPVA 4FL1A 3KCFA 4O0TA 3DU8A 3KREA 4RIWA 2ZDUA 4RWJA 4DH3A 2YJRA 2ZFYA 3A4PA 3NAYA 4R1VA 3PUPA 5CU3A 4BI1A 1H1SA 2V55A 3U6IA 3SLSA 4OBQA 5HE0A 1M7NA 4EKLA 3LQ3A 4FEQA 4JJRA 4L42A 4V0GB 4BDHA 4O0UA 3WZUA 3MFSA 2BPMA 4L44A 3DZOA 4TYIA 5L2WA 2WXVA 2BRGA 4F7NA 3R30A 3WF8A 4RX8A 1OGYA 3ZU7A 3QZFA 4EEVA 3TG1A 4FSYA 1OIQA 4S30A 2PMOX 3TCPA 4IDTA 4IZYA 4C33A 1OITA 3PE1A 1PHKA 4GVAA 4U80A 5JRSA 3S95A 4D4VA 2WMBA 4BDBA 5HBHA 3FQSA 4NTTA 1SM2A 5KNJA 3MBLA 5KE0A 4U45A 1YXSA 4FE2A 3I5ZA 3QKLA 5HNBA 3ZSGA 3IDBA 4I22A 2QU6A 5HICA 3QQGA 2YDJA 5L8KA 4DG3E 1XBCA 3BHVA 3GT8A 4YSMA 2JIUA 2BIKB 2X7OA 3S0OA 4O2PA 3OS3A 2W5HA 3QZIA 4M0YA 4BI0A 3KFAA 2Y4IB 2BKZA 3IQ7A 4HCUA 3WE4A 4F6UA 3KN5A 1Q5KA 5EDRA 1R1WA 5H8EA 2NP8A 3LM0A 3TUBA 5DEYA 3RALA 2QO7A 2WTVA 5DN3A 4E4NA 4RJ4A 4PL4A 3AMAA 2IVSA 2OZAB 2XBJA 5I9UA 1E1XA 4ZTLA 4DT9A 4H05A 2ONLC 3PA3A 3BL9A 3E64A 4YGAA 2IW9A 4XOYA 4EWHA 3BLRA 3FI8A 4NKSA 4IVDA 4HYUA 5HVKA 4MXZA 4FEVA 3D0EA 4R5SA 3W2QA 4DFZE 2FO0A 4IAFA 1KV1A 5FXRA 3MS9A 3HA6A 3MWUA 3AKJA 3R9OA 3RPOA 4C4GA 4P5QA 4FL3A 3ZRLA 5LXMA 4ZIMA 3BWJA 3QGWA 1NVQA 4L46A 4PRJA 1IAJA 5E7RA 4I5CA 3RCJA 4H36A 4F7SA 3UOKA 4EOQA 2ITOA 3F9NA 3RZBA 2ITTA 4R78A 3EKKA 2IO6A 3BLHA 4XUFA 2R3QA 4AGCA 3R8ZA 4LUDA 4HPUE 4XV9A 3ORZA 1TQMA 3PPJA 5BVKA 3K3IA 5DOSA 4LYNA 3D7TB 3C7QA 4IVBA 5HLPA 4B0GA 1F5QA 4UYAA 2C4GA 5GIPE 4TNDA 1UNHA 2IVVA 3H0YA 3U54A 5BVEA 4FTJA 3PLAE 1VYWA 2BZIB 2ZAZA 3OROA 3LXLA 2ACXA 4EKKA 5IA1A 5E9EA 4IAZA 3UTOA 4RC2A 4FZFB 3W0NA 4TYJA 1J7IA 3F6XA 5FP5A 4KA3A 4GKHA 3F5UA 1PXJA 3ORTA 2Y9QA 2REIA 2YDIA 3MVHA 1GJOA 4E5WA 2PMNX 3MH0A 3EZVA 3O71A 2Q0BA 2R0IA 2PZPA 3FZRA 3EOCA 2HZ0A 3FI2A 3D4QA 1NVSA 3UMWA 4QP8A 1IRKA 5CSWA 1UU8A 2BKKA 5C8NA 5CTPA 2ZV9A 3EQDA 4Y72A 3UO5A 4QQTA 4FIEA 4HYSA 4PTEA 4S32A 2B1PA 4D0XA 4E4MA 2YDKA 3DTCA 2JKQA 3LE6A 4MTAA 3ORKA 3UIXA 5F20A 3M1SA 3LFFA 2Y0AA 2J0LA 4JG6A 3NNVA 4XCUA 2R9SA 3EYGA 4L43A 5KKRB 3KC3A 2JIVA 3C5IA 4JI9A 2OWBA 3TUDA 2ITWA 5EKOA 2YWVA 4BTJA 2PZ5A 3EWHA 3E7OA 1WBWA 3O8TA 3AC5A 4Q5HA 4RIYB 5HVYA 1JSVA 3FBVA 4YJQA 2VTRA 3EN5A 2WU6A 4I4EA 2IJMA 2O2UA 2C6EA 2LAVA 5JKGA 4RPVA 3E3BX 3DKFA 4XP0A 4PWNA 2C6MA 1WMKA 3DJ6A 3FWQA 3PYYA 2VWUA 4NCTC 4IZ5A 5DYJA 3CPCA 3HUCA 1FVRA 5FBNC 4A9RA 5EW3A 4NW5A 2QCSA 1LEWA 2UZOA 2WMUA 1VLRA 4FT0A 1U54A 4RA4A 1DAWA 4XG8A 3NYOA 3O8PA 4Y46A 1UVRA 4BCFA 4PL5A 5AM7A 1QPDA 4FIFA 4FNYA 4FSNA 4F0FA 2JKKA 1GZNA 4EQCA 4QTCA 2BCJA 2XKFA 4FIIA 4D5HA 4BGQA 3E62A 5ANGA 5IUGA 3KCKA 2VRXA 5GJGA 3ZLXA 4BZNA 2XNMA 4AW5A 3PZHA 2JDSA 3GNIB 3UDSA 2WMTA 3HRFA 3UZTA 1O6KA 5E8SA 3NUPA 2VAGA 2PUPA 3QWJA 2Y6MA 5DBXA 4ZTQA 3T3VA 4EUUA 3IG7A 5JGBA 2XP2A 3ORNA 4BCNA 5CT7A 3BZ3A 5DLSA 3BGQA 2GNJA 2XAMA 3DJ7A 1B39A 3CIKA 3N9XA 4OTRA 1YWNA 2WB8A 5BVNA 4GT5A 4JOAA 1WVXA 2JD5A 3VS6A 4U8ZA 3SOCA 3QTXA 3G6HA 4JDJA 4EL9A 4EQUA 2XEZA 2VO7A 4F0GA 5K5XA 4USFA 4XEYA 2OH4A 2YM7A 4FKLA 4G34A 2PVLA 3UQGA 3ITZA 1OL7A 3G15A 4J99A 3DT1A 4O2ZA 5HORA 1A9UA 1Q8WA 3F2AA 2EUFB 2OBJA 4FYOA 3PUFC 1GZKA 4YHFA 5HHWA 3KRWA 3RHKA 3VUGA 1ZYCA 3FLYA 3V5LA 3BRBA 4F70A 3EH9A 2JDTA 4BVUA 3FXZA 2VNWA 4FSTA 3GU8A 4NKAA 3T9TA 1BYGA 4YLLA 5BQ0A 2C3IB 4MXYA 4XV2A 4ZMFA 4D58A 5HCXA 5HD7A 5AUVA 1OL5A 4KS7A 5BYYA 4G3CA 4N6ZA 3G6GA 4YJSA 5LVNA 3C51A 3UDBA 3VBQA 4MXCA 1BUHA 5F4NA 4F9WA 4D4YA 4G1WA 3C9WA 2G15A 2AC3A 4AGDA 3S2PA 3LCSA 3MN3A 2ETRA 1Q3WA 3VS4A 4BDCA 1TVOA 3TNWA 4EHZA 4FTKA 2VO6A 3B2TA 3TJCA 2BTSA 5JGAA 1XBBA 4LG4A 1YWRA 3KRJA 4JLCA 4I4FA 3PZEA 4H1JA 4HZRA 5M55A 2QNJA 1R0EA 2QR7A 4UEUA 5IA0A 2O64A 3DDPA 3ZOSA 2CMWA 2DS1A 3SG8A 3A99A 4EWQA 1OPJA 1GZOA 1IA8A 3TT0A 3WZJA 2A1AB 3E7VA 2QO2A 3BIZA 2QOFA 3WE8A 2CNUA 5HGIA 4BZDA 4KSQA 5HG5A 2Z60A 3HV3A 2UVZA 3MSSA 1JKLA 4KRDA 1G5SA 4E93A 3D2KA 1BMKA 4A06A 3WZKA 3O2MA 3DAKA 3AG9A 2B4SB 4M68A 1T46A 5C4LA 1RE8A 2E9OA 5A4QA 2ERZE 3ZSHA 5CZIA 2A2AA 3H9FA 4DFYA 2X8EA 3OCBA 4KKGA 1PXOA 4AZTA 2VX1A 3Q4TA 3POOA 4ZEGA 5CS6A 5AAGA 4ZJVA 3C1XA 2UZTA 4EZ5A 5JZNA 3UIBA 3BL7A 3SW7A 4D28A 1JOWB 4K1BA 1NW1A 4CFMA 4IB1A 2OICA 5D7VA 1R39A 4NM0A 1Q4LA 5D1JA 4JIAA 1YVJA 2JKMA 1H26A 2R3FA 4DHFA 4NH1A 4HYIA 2GHMA 4ZSAA 5F9EA 2HZIA 3V3VA 2F49A 2J5EA 3A60A 4DEBA 4W8EA 4KIQA 2NYAA
chains in the Genus database with same CATH topology
2FSMX 3RM7A 3W2SA 3R8PA 4ZTMA 2XK3A 3NNUA 3Q2JA 5DHJA 3ZLYA 4IC7A 4GUEA 4FKSA 4FKVA 4XG3A 3BI6A 3R9NA 3TNQB 5LVOA 3WYYA 4FTNA 1Y57A 4II5A 3NCGA 1PMEA 4K0YA 5JQ8A 4HVDA 3OW4A 5DWRA 4OBPA 3R83A 2J51A 4WBOA 4OR5A 2FUMA 3E88A 2WMRA 2R3JA 4FTRA 5KMMA 3IGOA 5A9UA 3MJ2A 3LJ0A 5KHXA 5HE3A 4ZY6A 4ZLZA 4JBPA 4ASZA 2RFEA 5KUPA 2PVYA 4ASDA 5TO8A 4BJJA 3AD4A 3GUBA 5LWNA 3IDCA 3O0GA 1VJYA 2BZJA 2BALA 2CKPA 4OTHA 1H08A 3GC8A 4L52A 3CCNA 4V04A 3U4WA 2RF9A 5CT0A 2VWYA 4G16A 2WPAA 2BR1A 2ZB0A 4JDIA 3DBQA 2Z7RA 4OTQA 4QTAA 5IDNA 2AC5A 3EZRA 4APCA 2JAVA 4MD7E 4RX5A 2EVAA 3KULA 5AM6A 4F1OA 3R7UA 5HTBA 4GYIA 4WRGA 4G3DA 2W4KA 2RG5A 4OTIA 2PSQA 3FMKA 3HMMA 1PMNA 3HV5A 3OTUA 3FMJA 4FTIA 5E8YA 3PJ3A 5EQPA 2Z8CA 4JX7A 4RFYA 1PYEA 4AACA 4PDOA 1ZMUA 2V7AA 3PP0A 4B7TA 1PMUA 4JBVA 2CLQA 2XM8A 1JVPP 1XH4A 5L2TA 2P4IA 2VWVA 4DAWA 3HAVA 3QQJA 3R1YA 3DB8A 2YABA 2YITA 3GOPA 4AU8A 2G9XA 4X7QA 1CTPE 5A4CA 1RDQE 4I6LA 1WBTA 3ZFYA 3U87A 3EQBA 5D10A 3NLBA 5HX8A 4ZJIA 3VJOA 1ZOGA 2AUHA 4U0IA 4F9YA 2IW6A 3F61A 3REPA 2W7XA 3AT4A 1J7UA 2X1NA 3PVBA 4BDGA 1ZY4A 4HGSA 3RWPA 3RVGA 3UQCA 5AV3A 3UG2A 3HRBA 5AUXA 2C0OA 2Y6OA 4I94A 4EH3A 2YCSA 3KVXA 2F57A 1QMZA 2R3MA 3GI3A 3R0TA 4I3ZA 1MP8A 1LPUA 1VR2A 3EQPA 5KMKA 2A0CX 1DI9A 2J0JA 1DM2A 3ZUUA 5HIEA 4YTCA 3KK9A 3TI1A 2RG6A 4UXLA 4AOJA 2W99B 3EL8A 4CFWA 5IQFA 4FT7A 1QPEA 2WNTA 4PUZA 1NVRA 4YLJA 5JQ5A 4WIHA 1YDTE 3KIOC 3GVUA 3F7ZA 3PJCA 4BDEA 3HA8A 3FV8A 3S00A 1OPKA 2XJ2A 2QOCA 1F0QA 3FMNA 3K54A 3PPKA 3RPSA 3W0RA 5KBQA 2HAKA 4HGTA 4IC8A 4QTDA 2JEDA 1YKRA 1W8CA 2WTDA 3JVSA 3QRUA 4KD1A 4I92A 2GFCA 5CXZA 5FTGA 4E7WA 3FL5A 4YNOA 3NMUF 2B52A 2QOQA 3ZBXA 3HDNA 4RIWB 4A9UA 4AT5A 4V05A 2YCRA 4GK3A 5AV4A 2QOIA 3LFBA 1PRYA 2OJFE 4RWLA 4C61A 1HCLA 2IN6A 5ANKA 4RQKA 3A8XA 2PE2A 4MKCA 4YC6A 4E6QA 3NAXA 1PXNA 2GCDA 2WKMA 3NW6A 4YNEA 5F95A 3A7IA 1ZWSA 3LLAA 3PDTA 4LDTA 1UNLA 2R3GA 3D7ZA 4FKUA 2C5VA 1A06A 3AMBA 4KBAA 4PTCA 3CTHA 5LVMA 2WELA 5CQUA 3SD0A 3KGAA 3PIXA 3OWLA 2BAJA 2PUIA 3HP2A 5ANIA 3RCDA 5EHOA 2QVSE 5J95A 5CEOA 2NPQA 4O86A 4F9AA 4Q9ZA 2HYYA 4O0WA 3BYOA 3R9HA 2H9VA 4GT3A 1H1QA 3EQHA 4YJRA 3NYXA 3ZDIA 4DFXE 3HX4A 4F4PA 4DF3A 2W5AA 2UV2A 3ZZEA 2E2BA 3PXZA 4O0VA 3T8OA 1Y8GA 3OT8A 1H4LA 2G01A 4CRSA 3DKOA 4GU9A 4K9YA 3NUNA 3UPZA 1H0WA 1NA7A 1OKZA 4RX9A 4B6LA 2B7AA 4KINA 4C02A 2QLUA 5AFVA 3ZUTA 5AIKA 5EI8A 3P9JA 3O50A 5AV2A 3VULA 3ZTXA 4KAOA 4BCMA 4FT5A 4G17A 5IA5A 4AW1A 3BYUA 4MWIA 5HG9A 2J0IA 3C4WA 1QL6A 4YZCA 3EMGA 3NRMA 4ARKA 3CQEA 4Y95A 4CT2A 3P5KA 3THBA 4B8LA 1IEPA 2R64A 2XAOA 4NT4A 4U5JA 4ZSLA 1W7HA 3AD6A 5AP6A 3LLTA 4O21A 1Y6BA 4HCVA 2QKRA 4ORKA 3NUUA 3NGAA 5E8VA 5J9YA 2Y7JA 4NWMA 3QTWA 3L9NA 3RP9A 2XIKA 3FC1X 3O7LD 2Z7QA 5H8GA 3ZONA 3LJ1A 3FMDA 4PMMA 3RK5A 3U51A 4Z3VA 4J97A 3WYXA 5ITAA 5M4UA 1YI6A 3CD3A 5IH6A 4IM0A 1G8SA 3E8DA 2JKOA 1OI9A 4YU2A 2PU8A 4AZFA 4DE4A 2PL0A 4J96A 3TV4A 2X81A 3OXTA 3ACKA 3LVPA 4L7SA 3RNIA 3QC4A 4FSQA 3Q6WA 4J8MA 4L45A 3EHAA 2JFLA 3Q4ZA 4TTHB 3DXNA 3L1SA 1SVHA 1T45A 2I0VA 1PXIA 2QI8A 1KE5A 2XKCA 4FV8A 4QP3A 5HIBA 2VTAA 3R71A 3O23A 4J1RA 4FVPA 4PP7A 1RQQA 4QPSA 4MX9A 4ZY4A 5DT4A 1XJDA 2YFXA 2FSTX 4NU1A 1R0PA 2VO0A 3P79A 1OPLA 3G9LX 2V22A 4G6LA 4HVGA 3O5AA 3A7GA 3LQ8A 2J4ZA 1UWJA 2OLCA 2XIXA 2Z7LA 4X2KA 3UZPA 3U6JA 4BTFA 3VJNA 2FH9A 4D2SA 2R7IA 3NYNA 1PKDA 1LR4A 4JG7A 5J9LA 3V8WA 3H0ZA 1WCCA 2WQBA 3FLZA 4RZVA 5L8JA 2CDZA 2IVUA 3HVCA 5EI2A 3UBDA 3ZBFA 4EJNA 4ZMEA 4F6WA 5BMMA 1Q41A 4BIBA 3QLFA 4BN1A 3FLWA 1V0PA 3OHTA 4AA5A 4R3RA 3V5PA 4JRVA 3GC7A 4DT8A 4ZJJA 3P7CA 2CN8A 1Q99A 5IF1A 4FV7A 1OBDA 4B9DA 2XNEA 3VBTA 4I24A 3HKOA 2J90A 4OTGA 1CKIA 2I0YA 3IONA 3R7OA 1OUKA 4AOIA 3B8QA 4YLKA 4JVGA 1KE8A 5AV1A 4CFNA 2FGIA 4YPSA 4DINA 1H24A 5M07A 4UXQA 4DTBA 2PK9A 1U4DA 2FYSA 1Q24A 1YI4A 3ENHA 2CSNA 3QD3A 4FSZA 4OT5A 4JS8A 4MHAA 4ERKA 5IA3A 4EZ7A 4MH7A 3V6SA 4M7IA 5GNKA 2ETMA 3VW6A 4QTEA 4NSTA 2XF0A 2P0CA 2BAQA 3O51A 4IE9A 4RRVA 5AAFA 2HENA 3TZ8A 4XP2A 3IGGA 2OW3A 2PVHA 3Q04A 4DTAA 4E4LA 3O96A 1OB3A 3FZTA 3E8NA 2IZTA 1WFCA 3D14A 3AD5A 3A61A 3P23A 4FIJA 3ZM4A 4ZTSA 5EM8A 3FUPA 5IPJA 3BQRA 1PY5A 2YIRA 3NVMB 4EYMA 1CSNA 3IW7A 5KMNA 2ITXA 4G6OA 2ITQA 4K8AA 4R77A 5BVOA 3W32A 4IB3A 4ZS0A 1M17A 5CI6A 3U9NA 5J5SA 3E8EA 1U54B 4OTFA 2CCIA 4U3ZA 3DFCB 3P7BA 5FBOA 5J1WA 5DI1A 3GU5A 3PIYA 5M06A 4EQMA 2VWXA 4RC3A 3U6HA 3OFMA 5CSVA 3ZYAA 2VTJA 4C38A 4E6CA 4QMNA 2QOOA 3C13A 2C6OA 5CWZA 1GIIA 4U3YA 3Q9XA 3I4BA 1S9IA 4Z16A 4UZHA 4X6QC 2QODA 1JBPE 3W2CA 2F2CB 4L8MA 4JAJA 2R7BA 2VTSA 4J71A 3QAME 5CU0A 3L8SA 4QDVA 4O7ZA 4MBIA 5C4KA 4MCVA 4NK9A 3PG3A 4IX4A 3G51A 2JBOA 4JX3A 3KMMA 3L9MA 3NEWA 4DHZA 4XHKB 1NT2A 2WTCA 1B38A 2PTKA 2FA2A 4AS0A 3PXKA 4GCJA 4ZAUA 1M2RA 5LVLA 4EH5A 4FL2A 3AQVA 2XIRA 3A4OX 1SNXA 2PVFA 1H1RA 4TRLA 3RNYA 5AV0A 2XUUA 3UDTA 1KV2A 5HD4A 4NJDA 4X2GA 3VNTA 1M14A 3F5GA 4YTFA 5BV3A 5LMKA 4WG3A 5DRBA 1JNKA 5T6KA 4EOJA 2P2HA 3F88A 3HAMA 4YJUA 4F9CA 5DA3A 3ZLWA 3K5VA 3TJDA 4BDKA 5A14A 2OO8X 2UZUE 2WMXA 2VGOA 2WQOA 5BYZA 1FMKA 1YOMA 3UMXA 3LXNA 4O7TA 3T3UA 2GTMA 5DH3A 5DE2A 5LARA 4F65A 1GZ8A 2XK6A 4M84A 4G3EA 4XMOA 4A07A 1H01A 1VYZA 3D9VA 1H8FA 1OL6A 3E8CA 2CGVA 3HNGA 3Q52A 5DR6A 5C26A 3MGYA 1W84A 3U8WA 3UOLA 1YXUA 2ZV2A 2WTIA 4YURA 4RGJA 5AADA 4NFMA 2ERKA 4L53A 4C4FA 3LQ5A 4ONAA 5ETAA 2C5OA 4C4HA 5I9YA 5IMEA 3HL7A 2C6TA 3NNWA 3PLSA 4ZS4A 2RGPA 2ZJWA 3AMYA 3F2RA 2BHEA 2GQSA 3QLGA 5DT0A 1ZMVA 2UW4A 1Q8UA 5CALA 4NM5A 3F66A 3ODZX 4FTUA 4LGGA 4C2WA 4LRKA 3VQHA 5CVFA 2PULA 3BE9A 2UZNA 3EQGA 1H27A 3QTUA 4MWHA 5DIAA 4BBMA 3LFNA 3CKXA 3RHXA 3H4JA 3CKWA 5AWMA 3PY3A 3MJ1A 4KUJA 3B2WA 2GDOA 3G2FA 1GIJA 4AXEA 3TZ9A 3TZMA 4QNAA 4O82A 4E26A 2LGCA 3D5UA 1AQ1A 2QOKA 2YM8A 3JXWA 3VHEA 2CGXA 2JLDA 4RIXA 4FKRA 4G5JA 2SRCA 4EK4A 1UU3A 4YHJA 1UA2A 1UKHA 4O0RA 4XG2A 4CTBA 5KKRC 3EFLA 2NRYA 1OZ1A 2YIXA 4PMSA 3ZHPC 3IOPA 3ACJA 5M51A 4FIHA 4KBKA 4CLJA 4HGEA 4NUSA 4RWKA 3ZO1A 4TT7A 4C4IA 2H34A 5AAEA 2YA9A 3EN7A 4C4JA 4NM3A 5IQCA 4IWOA 3ERKA 4NL0A 3GU6A 4D1SA 5BMSA 4YZNA 3AC8A 2KULA 4RG0A 4D2RA 2WU7A 3F3WA 3SQQA 5IMXA 4I0SA 2XKDA 5KMIA 4FR4A 2V0DA 4ZOGA 2X2LA 2E9PA 3H10A 4I5MA 3SOAA 4O22A 2C0IA 5A54A 2RFNA 3MB6A 4FSRA 3ANQA 2WGJA 3DCVA 3MVMA 4NW6A 4IWQA 2JIIA 4LV5A 1PF8A 2QO9A 5B0XA 5E8XA 2HY0A 4FKWA 3FSKA 4AOTA 1BI7A 1KE9A 2RIOA 3KMUA 2R3LA 2XEYA 3MY5A 4IJPA 4YSJA 3CP9A 4AN9A 4CTCA 5LQFA 5HCYA 3BHUA 3UODA 4L67A 2C5NA 4JBOA 3LZBA 1JQHA 3QU0A 2UZLA 2VWZA 4JQ7A 4XG7A 4YBKA 4ZSJA 1UU9A 3WI6A 3RPVA 3W8LA 1YOJA 1U5RA 3ZRKA 3AXWA 1W83A 2BVAA 3L8PA 4JQ8A 5J7HA 2O65A 4DEEA 1OKWA 3I6WA 3UGCA 3GBZA 4DITA 3U4UA 3R8UA 4B4LA 4B8MA 4S2ZA 1OL1A 4DFUA 2P55A 3BGZA 1E9HA 3DTWA 2QG7A 4IAYA 5EM5A 5A6NA 5CF8A 3OWJA 2HW6A 3OY3A 4DCAA 2O3PA 4UY9A 3KXMA 4DN5A 4DTKA 5CSPA 4YZMA 3D5XA 3E3PA 3W33A 4FG9A 3NUSA 4BJJB 4IZ7A 2X4ZA 1MRYA 3OY1A 1M52A 4A4XA 3LFQA 3OC1A 2XIZA 2R3PA 3ANRA 3QD0A 4O0XA 2F7ZE 4YPDA 2GS6A 4UALA 2F4JA 4TYHA 3OWPA 3R63A 3KULB 4GYGA 4FSUA 3CS9A 2W1IA 1U46A 3OBGA 2VU3A 5D12A 3BEAA 5FGKA 4F09A 5J87A 1ATPE 3OF0A 2QQ7A 5KHWA 2VTNA 5HO7A 3FKOA 3K2LA 5E8ZA 5EDQA 5HEZA 3ZRMA 1XH7A 4RJ8A 5C01A 5K4JA 5G1XA 2XCKA 4ANLA 4DA5A 4W4VA 1OECA 4ANBA 3SG9A 2CNQA 2J9MA 4GG7A 4MD9E 4S34A 2UW0A 4D9UA 4H3PA 4MK0A 2DUVA 2YERA 4P7EA 3C4XA 1YXXA 2OIDA 3AC1A 5EYDA 5FDXA 3HEGA 4O7RA 3ORPA 3E87A 2HELA 3PJ8A 1PXKA 3GCSA 3W1FA 3F3VA 2PE1A 3COIA 1IAHA 2EB3A 4OBOA 3CLYA 2IPXA 1YHWA 5H8BA 1XMLA 2GS7A 3CPBA 3DXPA 3QKMA 5CY3A 2OJ9A 3R00A 2WHBA 4IVAA 1DS5A 2R3RA 3KY2A 4IB0A 3BYSA 3OG7A 4AP7A 2ZM4A 3CE3A 5AP7A 3AKLA 2X6EA 3OCSA 3DFAA 3R8VA 3ZLSA 5M56A 1P4FA 2HXQA 5JSMA 4N4SA 1OKVA 2YM4A 3OCGA 5HU9A 3VWAA 5IQHA 4O6EA 4E8AA 3MV5A 4YO4A 1IG1A 3HV7A 3II5A 2EB2A 4YJNA 4EI4A 4RLKA 3A62A 1CKPA 2OH0E 1FBNA 2BTRA 4U81A 2C6KA 2QD9A 4CFXA 3JR1A 5AEPA 1P5EA 3HP5A 5DFPA 4EYJA 1Q3DA 3GFWA 3NNXA 3NFFB 4QP2A 3S3IA 4RVMA 4QYYA 1M2PA 2E9UA 3PA4A 2XNGA 4FZ6A 4IJ9A 4QMYA 4FVRA 1H00A 3FMHA 3QX2A 5KBRA 4TNBA 4J53A 5DG5A 5IA4A 4EH2A 2JC6A 4GIHA 3IOKA 2EXMA 3R7EA 1UV5A 3MVJA 4QOXA 3NZ0A 4G9RA 5GHVA 5EK7A 4FC0A 4DHJA 4MF1A 2JITA 2ZM3A 3K5UA 2UW5A 3AT3A 4W4WA 4O7WA 1ZXEA 1E1VA 4XRJA 3V8TA 3G90X 3HLLA 5KZIA 1REKA 2NNWB 4PDYA 4IQ6A 2I7QA 3F69A 4AW0A 2ITVA 3QF9A 3PPZA 4FI1A 4ENYA 4IW0A 5CASA 4AUAA 3LHJA 3QD4A 1MQBA 3R22A 3R2BA 4CG8A 4YP8A 4AZVA 4JL9A 4K6ZA 5BPYA 3R04A 2W4JA 2Z02A 4TYGA 1L8TA 1WZYA 3G0FA 4W8DA 5AP3A 2BROA 4C58A 3PXQA 3FZSA 4FKJA 3UVRA 3QQFA 5K9IA 3QQHA 1SYKA 3MTLA 3F3TA 3CBLA 4FA2A 4Y83A 1ZYLA 3PXRA 4BB4A 3G5DA 1PXMA 3FKLA 4HPTE 4FJVA 4EBWA 2GTNA 5HBJA 2J7TA 2OJIA 1GIHA 5TOZA 5I0BA 1YRPA 2XYNA 2YZAA 4BICA 3GXLA 3DA6A 4QMXA 2W9FB 4ZZOA 1ZAOA 3KXNA 2F7EE 3HECA 3NVKI 3NSZA 4X3FA 4QYHA 1F3MC 3HMNA 2YIQA 2W1FA 4RZWA 5TF9A 1G8KA 3DAJA 3QRJA 3ZDUA 4XG6A 3V5QA 4BTMA 3V5TA 1Q61A 3LMGA 3CTJA 1PW2A 1OGUA 3D7TA 4FV6A 4ALUA 2OFVA 1K3AA 2Z2WA 3M2WA 4AE6A 1QPCA 4JT3A 4IMYA 1WBOA 3RAWA 1SMHA 3L8XA 1YQJA 4BCOA 4OW8A 3POZA 3PWYA 4IAIA 4YJOA 3KVWA 5A3XA 4FZAB 4UWYA 3I79A 3QCXA 5J1VA 3R21A 4FTMA 3ZFXA 2CGWA 4TXCA 4TWCA 3F5XA 3ALNA 2G2FA 2UW6A 4OLIA 3VVHA 2R5TA 5E8UA 3Q4CA 3W0PA 3WIKA 3FMMA 2CJMA 4FV2A 2UZVA 4AAYA 2VUWA 2C5XA 5BVWA 2W1CA 3L9PA 3KK8A 3QCYA 4I1ZA 3Q5IA 4BYIA 2XALA 1J91A 4C62A 4TYEA 3TNHA 5H3QA 4EK8A 4F7LA 3NUXA 1YHSA 4AT4A 3VBVA 4O7LA 4G3FA 2XYUA 3RI1A 5EH0A 1J7LA 3U55A 5HQ0A 3ZM9A 4L68A 4FTAA 4FV4A 2BZKB 4LMUA 5GJFA 4FT9A 5CAOA 3NFGB 5L6OA 2ZV7A 3DNEA 4XBRA 4BIEA 2GNGA 3CC6A 4FKQA 3DB6A 1MUOA 2W1EA 1YXTA 4TY1A 4AXFA 5AMNA 3GCPA 1TQPA 1LUFA 2XNOA 2C3JA 3SDJA 4APPA 3D15A 3UZRA 1ZYDA 4OTWA 2PY3A 3IPHA 2O5KA 4FTOA 1OVEA 1W98A 4XV1A 1JAMA 1WAKA 3LFCA 4G2FA 4DH7A 4S33A 2X7FA 2VO3A 3P4KA 3UJGA 5IUIA 1JLUE 5GJDA 4BHZA 4IFGA 1JKTA 4U40A 2BUJA 5FM2A 4EHEA 4C3RA 4I41A 4RIOA 4XG4A 5T68A 4D9TA 4R6VA 3ATSA 4FTQA 3QX4A 3UYSA 2C5YA 3Q60A 3W0QA 3JUHA 4YC3A 3DQWA 4HJOA 3QC9A 4QMUA 3BU6A 3JPVA 4IDVA 3FQEA 2J6MA 4UN0C 3PY0A 5C03A 4WNOA 4WNKA 4BDAA 1STCE 5HE2A 4BZOA 3C0HA 2W1ZA 4JAIA 5BUEA 3WF9A 3RAHA 3AOXA 4C7TA 4DEGA 4RFMA 5I9ZA 3TZ7A 3QGYA 3R7VA 1WBPA 3VF9A 4ACCA 2EXCX 4F0IA 2H6DA 3LPBA 2QHNA 4FIGA 4WBBB 4DGOA 5IH4A 3Q9WA 3LFDA 3TIZA 5M53A 4FSWA 4PQNA 3KF7A 2C3KA 4YZBA 4X2JA 3DKCA 3I1AA 4GSBA 2V62A 3UO4A 2R0UA 3GQIA 3FE3A 4D1XA 4GT4A 4U98A 2XK7A 4GJ2A 2BZHB 3WZEA 5LJJA 3UG1A 5AP2A 4OT6A 4EBVA 3MH3A 3BV2A 3EFKA 3QUDA 5CAUA 4G3GA 2Q0NA 3FY2A 2PVRA 4FKTA 3VUKA 3RWQA 4CSVA 4LL5A 4A9SA 4JG8A 4FNZA 4WUNA 4TL0A 4YO6A 2VV9A 4X0MA 4NCTA 3FI4A 4QPAA 4F08A 3F7WA 5HESA 5IQIA 2GNLA 4U42A 1ST0A 1TKIA 2PVJA 5AA8A 1FMOE 4IM2A 1S9JA 3LXPA 4FOCA 3WILA 4C59A 4EK3A 5LMKC 3O17A 5CEQA 5IQGA 3EQFA 4KBCA 4A4OA 4AXAA 1K9AA 2X9EA 3MIYA 3QYWA 2CPKE 4FNWA 2PVNA 2WIPA 4HYHA 3MB7A 4ITIA 4DGNA 3VN9A 4UZDA 3H9OA 4E1ZA 3DBEA 3LCOA 4FICA 4YBJA 2JFMA 4PX6A 1Q97A 4WT6A 3PVUA 2PZYA 3QA0A 4GL9A 3Q4UA 4O38A 4AGWA 3BEGA 4Q5EA 3AC3A 4EH4A 3UPXA 2BRMA 4V01A 4AN2A 1ZOEA 4KABA 4H1MA 4RJ6A 3FLNC 2BRBA 3V8SA 4CT1A 3R9RA 2UW9A 5FXSA 3W0MA 4YTHA 4AXCA 4QP4A 2B9JA 2R3HA 3TKIA 2UZBA 1ZARA 4QYEA 5IG1A 4C34A 2IZRA 3TEIA 3GCQA 5JGDA 4PNIA 4WZYA 3EQCA 5AP4A 3NIZA 3Q5ZA 4JQEA 4BF2A 2PPQA 1FOTA 4I93A 4DYMA 1YDSE 5CX9A 3UIUA 2YN8A 4NYEA 1UWHA 3LXKA 3W0SA 4QMMA 3R02A 4XBUA 1XHAA 4WA9A 2VX3A 4RJ5A 5HLNA 3O7LB 2W17A 4RT7A 3F3UA 1KUTA 3R2YA 3N4VA 2GFSA 2QC6A 1OM1A 4FK6A 2B9HA 3ET7A 2W05A 4YZDA 5B2KA 2RFDA 3FMLA 3I7BA 3RKBA 4DCEA 2BDFA 4EK5A 5IU2A 2GSFA 2WIHA 2ZV8A 3BV3A 3QALE 4QMQA 3TV7A 5BUIA 4N0SA 3CXWA 4EHVA 5HX6A 4C2VA 3LCDA 5HG7A 2XM9A 3BBTB 2J2IB 5AUZA 4KIOA 3BE2A 4O84A 4ZTNA 3P1AA 4G5PA 2VTMA 4Z7HA 5J9ZA 3IW4A 5EDPA 4X6RA 3V6RA 3M42A 2O63A 2VNYA 2F2UA 3C4ZA 5M4FA 3F3ZA 4HNIA 3HZTA 3UYTA 4AFJA 4FTTA 4AZWA 4EOOA 1X8BA 4ZTRA 5JFXA 4RIXB 3QBNA 3AC2A 2HZNA 4DFNA 4IZAA 3PTGA 3MFTA 4FKOA 4IX5A 3VRZA 5HKMA 1NXKA 4E4XA 1MRVA 4YC8A 5ETCA 3R8MA 2C1BA 4I0TA 3LKMA 2YHVA 3BLAA 3KF4A 5BVFA 3ENMA 2I6LA 3S1HA 5CENA 1EH4A 3C0IA 4DH5A 5DVRA 4NFNA 1CDKA 3FI3A 5JFVA 4TPTA 5AX3A 3RK9A 1P14A 4LL0A 1O9UA 2H96A 2UW7A 2YWPA 1OIUA 5ANDA 2Q83A 4AQKA 4AG8A 3BHYA 2WQMA 4NJ3A 5E90A 3ULZA 5LWMA 1REJA 1H1PA 4QP7A 5DR2A 3EB0A 3SXFA 4G31A 2GQRA 2XJ1A 4R5YA 2QONA 1KE7A 3PVWA 2OU7A 3ZO2A 3FSFA 5A6OA 1ZOHA 3CD8A 5CAPA 5HBEA 4R1YA 4GFMA 4AW2A 2W1DA 3E63A 3EN4A 4AE9A 3HGKA 4U44A 5TT7A 3ZSIA 4MNEA 3MFUA 2X39A 3UVQA 3FJQE 4WD5A 4BIDA 4MBLA 2WMWA 3PFQA 3GU4A 4M12A 3SRVA 4EH8A 5IQBA 3SVVA 3BQCA 2R3NA 3A7HA 2VGPA 4TWOA 4MXXA 4U7ZA 1Y6AA 2YIWA 2G1TA 3L8VA 3OWKA 4FSMA 4IH8A 3Q6UA 4CD0A 5HLWA 4GUBA 3KXGA 3OXIA 2QU5A 5EW9A 3WF5A 3UOJA 3VBWA 2ZVAA 4EZ3A 4FUXA 3SV0A 1LEZA 4GG5A 4WUAA 5HG8A 3FAAA 2KTYA 3FKNA 3AGMA 4DH1A 2IZSA 4AN3A 4QTBA 2BAKA 3LMIA 3UNJA 3ZO3A 4DBXA 5EKNA 4AX8A 3D83A 4A9YA 3MY1A 4GRBA 3NUYA 3ID6C 4HGLA 4IAKA 3DLZA 1K2PA 3OZ6A 4LFIA 4ZSEA 3TKHA 4WHZA 4IANA 3UO6A 2FVDA 2JGZA 2VTIA 2QLQA 4IHPA 5AP5A 3KMWA 4FEUA 2CKEA 1QCFA 2JDOA 2W96B 3HMIA 3COMA 2XRUA 4QMWA 1OUYA 4AWIA 2XB7A 2VN9A 3QD2B 3GC0A 4PTGA 3W10A 4L3PA 2VZ6A 3BELA 4TYHB 1URWA 3ORXA 1BI8A 2YM5A 4BGGA 4YUQA 2J0MB 3VS1A 3DJ5A 5DT3A 1IASA 1XH8A 2EU9A 3I0OA 3TNIA 4CMUA 3QTZA 5D11A 3H30A 1YI3A 1Y91A 2HY81 4FUYA 4MD8E 3DV3A 4BHNA 4CRLA 4FBXA 3KN6A 1AD5A