3W0QA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n203a), ternary complex with amp-pnp and hygromycin b
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
ATSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNAVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
total genus 90
structure length 296
sequence length 296
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0qA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0qA02
5EQPA 5IQAA 4O7OA 3N4VA 4GKHA 3W0SA 4DCAA 3SG9A 4DT9A 4CG8A 3MESA 1J7UA 3FEGA 3DXPA 2CKOA 5BYLA 2PUNA 5C4KA 3W0QA 4DE4A 4R7BA 4CG9A 5IQFA 3N4UA 1ND4A 2OLCA 4DTAA 4PDYA 4GKIA 3TDWA 1NW1A 4CGAA 2PUIA 4DTBA 3F2RA 5C4LA 3TDVA 3TM0A 3HAMA 2PU8A 3C5IA 4U94A 3W0MA 5EQEA 2BKKA 3CSVA 4WZYA 5FUTA 3W0OA 3HAVA 4FEWA 3JR1A 5IQEA 4BR3A 4DBXA 2IG7A 4EJ7A 3G15A 4DFBA 2PULA 3Q2JA 5IQCA 3SGCA 4N57A 5EQYA 4FEUA 2QG7A 4R77A 4H05A 4O7PA 4R78A 4FEVA 3N4TA 3ZM9A 3LQ3A 3UZRA 3ATSA 4ORKA 1J7IA 1L8TA 2CKQA 3W0RA 3DXQA 5IQBA 4DT8A 3SG8A 2PUPA 3FI8A 1J7LA 3W0PA 2PPQA 2B0QA 3W0NA 2CKPA 5AFVA 5IQHA 4FEXA 5FTGA 4U98A 5IQGA 2Q83A 5IQIA 3TYKA 4DA5A 5IQDA 3ATTA 2I7QA 2PYWA 4DFUA
chains in the Genus database with same CATH superfamily
3OWPA 5HQ0A 3F9NA 3R7YA 5H8GA 4QEBA 5CVFA 4BGGA 1LEWA 2OO8X 3DB8A 4CFFA 3NAXA 3F82A 4FGBA 3ZSHA 2WQOA 2GNHA 4NM3A 1YXTA 5I4NA 3SXSA 2H8HA 1YOLA 3HLLA 2QO7A 1U59A 2RKUA 4UXQA 3R7OA 3DK3A 2RIOA 2E9OA 2GSFA 2XKFA 2X7FA 3KMWA 4PWNA 4KKEA 4AA5A 1ZYCA 1IAJA 2GS7A 2RFDA 5JFXA 5L6PA 4NIFB 4R7BA 5IUHA 4I94A 3RZBA 4XOZA 4RT7A 2YITA 3MY0A 3TJCA 4B0GA 4ANBA 3HMOA 4E4NA 4GU9A 5IA0A 4BIDA 4RX7A 4FTAA 5M07A 4AXFA 4C02A 3ZHPC 4TL0A 4YHTA 4XV2A 4L3LA 2UW4A 3MJ1A 2CNUA 4CGAA 1OL7A 2VAGA 4UN0C 3EFKA 3FPMA 3MGYA 4QMLA 4XYFA 4HVSA 3FXZA 3GOPA 2PK9A 2HELA 4D5KA 5CEMA 2BDFA 5DWRA 1M52A 3GCVA 4PDPA 4XG3A 3UZPA 4U94A 4L8MA 5H8BA 2QOFA 2VUWA 4JNWA 5IU2A 2LGCA 2C3IB 1JNKA 5CU0A 3K54A 2RL5A 4Y83A 3EL8A 4WIHA 1F0QA 3R83A 3G2FA 2O2UA 2VTPA 4FX3A 3GNIB 3HGKA 3Q2MA 2AC3A 4PL3A 4KKGA 4QPAA 4YURA 2R9SA 3UZTA 4QYYA 3RPSA 4BKJA 3QRIA 3G15A 5AUZA 2VWYA 4RIOA 2CLQA 2PULA 3PY0A 4L6QA 4CZUA 4ENXA 1R1WA 3AGLA 4ANSA 3QU0A 1OBGA 4BDCA 2QO2A 1ZXEA 2R4BA 2X6DA 3DOGA 3LXKA 4FIHA 4FV8A 3QKMA 4NU1A 2Q0BA 3VONA 2W1HA 2XK9A 2W5HA 2RFEA 4Y5HA 2XARA 5LVPA 4UB7A 4AXAA 2PZ5A 3FLSA 4C4FA 5EYDA 3AXWA 2O0UA 2PVHA 4R5YA 3BI6A 5E8VA 4O86A 2P55A 3BYVA 4PTEA 3ZLYA 3D15A 1ATPE 3RK5A 4UZHA 3MH0A 3IECA 5JFVA 4BI2A 3ANQA 3C5UA 3H0YA 3NW7A 3NVMB 3AGMA 3ENHA 1L8TA 2CKQA 3RGFA 3UOHA 3C0GA 3EJ1A 2A19B 5IQBA 4W8EA 3RM6A 1H28A 3DLZA 3EL7A 1XWSA 2RFNA 3SG8A 5KMIA 5HO7A 5IA1A 3PSBA 4XOYA 3TTIA 1BUHA 4XV3A 1CKIA 3LMHA 3ZXTA 3EMGA 5HBEA 3W8LA 2PHKA 3PG3A 3QBNA 3QHRA 4EYJA 1ZAOA 3PUFC 3IDBA 2HXLA 4F1TA 5DYJA 4JI9A 5C27A 4PX6A 2C1BA 2NYAA 5A4CA 4IFCA 4BCJA 5IQGA 2YAAA 3FWQA 3DKCA 3F88A 3BGQA 3QX4A 4FTMA 4YZDA 3P78A 4GUBA 4X2FA 3M2WA 3DS6A 3I0OA 5AP3A 4M0YA 4ZTNA 2YISA 3WF6A 1R3CA 4D9UA 2C3KA 4NSTA 4CV8A 3BRBA 3COHA 4GK2A 4BHNA 5IH4A 4C2WA 4ZMFA 3ZUUA 2OJGA 3LCKA 4HW7A 3MVHA 4GUEA 5CZHA 4FNYA 4RZVA 3PXRA 4RSSA 4L68A 5JZNA 1Y6AA 3BYMA 3NW5A 3MB7A 5DRBA 3BU5A 2YN8A 3WOWA 4FKGA 5KMJA 1FVRA 3H30A 1YKRA 3QA0A 4LI5A 3R71A 3PFQA 5A14A 3EYHA 1ND4A 3D94A 3DBEA 4AZFA 3V51A 3D5VA 4AQCA 3SHEA 3R7VA 4HNFA 3D5XA 3F61A 4G6NA 3ZC6A 4F9BA 4MXCA 3QA8A 1OKZA 4XLIA 4ZTSA 3W2RA 2CPKE 5BX0A 3GVUA 3HAMA 2ITVA 4FODA 2XIXA 4O7LA 4TWOA 4UZDA 2G2IA 4A9TA 4WA9A 3FI4A 2BRMA 2OGVA 2XNPA 2C69A 2ITPA 5LCJA 4O84A 4IJ9A 5B2KA 2O5KA 4M84A 1H26A 4E4XA 4Q9SA 3L8SA 3DY7A 4YTCA 3FKNA 5HCXA 3PE2A 2WHBA 1URWA 4YJRA 5IG1A 4BYJA 1GIHA 4KBKA 4DF3A 2YM3A 3R1SA 3A7HA 2FUMA 4QP9A 4WG4A 3DQWA 3Q9YA 5I9UA 5LARA 5HLNA 2C47A 1RE8A 3BLHA 3C4ZA 5BYYA 2IN6A 4AOIA 3FL5A 4Q9ZA 4CFXA 3MH1A 4YU2A 2X4ZA 3WZDA 4FV0A 1ZOEA 2G01A 1OVEA 3GFWA 3NFFB 3PDTA 4MBLA 2B7AA 3NZ0A 3QWKA 4XX9A 3QKKA 5L2SA 3HMMA 2QD9A 2I0VA 3ORIA 4MBJA 5ETIA 1DAWA 3D4QA 4XEYA 4AAYA 1ZLTA 2HWPA 2BZJA 2ETMA 3LCSA 4DDGA 2WPAA 1OIUA 3ZS5A 4GH2A 3DBDA 5AV4A 5L2TA 2WTIA 3FC1X 5DG5A 5AADA 2ZOQA 3KCKA 3NVKI 4X3FC 3P08A 1CDKA 1IRKA 1SZMA 4ZIMA 5BVOA 3VS3A 5HIBA 4ASDA 2OICA 2W1GA 4FSMA 4GVAA 4XG2A 2QI8A 1CSNA 4ACGA 2WIPA 1P5EA 4O7VA 3KIOC 3IOKA 2PPQA 3Q4CA 4WD5A 3OOMA 4GIHA 4D4VA 4EK4A 4F7SA 3HNGA 5AP5A 2F7XE 4QQJA 2JDVA 4FIJA 3PWDA 2VO6A 2XVDA 3DNDA 3BGPA 3ZFXA 3KF7A 3PJ3A 3IQ7A 5ETAA 5C8NA 4OTIA 1UVRA 2Z7LA 3JPVA 4NWMA 1ZYSA 3BIZA 4M14A 2JIUA 5I9WA 2R0UA 4GK3A 1WFCA 5TOZA 4D0XA 1W98A 2YIQA 2XALA 5LVLA 3IO7A 4BDDA 2OSCA 3KXHA 4JT3A 2UW3A 3C51A 3QXOA 3RPVA 2XNOA 4L7FA 4S32A 3LCTA 3ZZWA 2XJ1A 3GU8A 3Q9WA 2CKOA 3QHWA 4G17A 4LDTA 2WMSA 4BJJB 4UXLA 1K2PA 3FUPA 5GHVA 1BI7A 1VLRA 1GOLA 1LUFA 4FNXA 4NTTA 4F0GA 4J52A 3UYSA 4EHVA 3QRUA 2BDWA 2WD1A 4ALUA 3K3JA 4I5MA 3VUDA 3P0MA 4A9YA 3EQDA 4N70A 4QMPA 3D7TB 4XG7A 4YLKA 4EWHA 3PLSA 3ZH8A 1P14A 3BHHA 3UQFA 3DLSA 1KE6A 2I0HA 3UIXA 5E7RA 4X21A 4D1ZA 3BWFA 2BKZA 5E9EA 4ZTHA 3U87A 3OFMA 3ZBXA 4MXYA 1Y8YA 4LYNA 1YOJA 3FZOA 4F64A 5D9HA 3SQQA 3V5TA 3LFCA 4O7SA 4W4WA 4BCMA 4FV7A 4K11A 3VJNA 4TT7A 2WTWA 4JXFA 2HZIA 3WZKA 5CAQA 3FDNA 5EM7A 3NFGB 4EHEA 3F7ZA 2OK1A 4H58A 4EQUA 2BKKA 4IEBA 1KSWA 4FVQA 3EQFA 4RWKA 3PJCA 3NUUA 1HCLA 3P1AA 3BCEA 1BLXA 2OH4A 3PSCA 2CGUA 3P5KA 2OIBA 2HAKA 4DHJA 4AN2A 5F20A 1WBVA 4D2SA 4EKKA 3U55A 3P7AA 2NP8A 3DBQA 4HZRA 3QCYA 4O2ZA 4UYNA 5FLFA 4EBWA 1DAYA 5A4LA 1XBAA 2JITA 4GG7A 3WYYA 3MY5A 3LMGA 5FDXA 1PXPA 2ZYBA 1PKGA 1QMZA 4AX8A 3FYJX 2V7OA 4EQMA 3WZUA 4DH5A 4H3BA 5BVNA 3BU6A 4A7CA 2R3PA 3IK3A 4QYFA 4UWYA 3U4UA 4DTKA 2ERZE 4ACHA 4BCGA 3LOKA 3GUBA 3QQGA 4FZDB 4YZCA 4NKAA 3ZFMA 3UGCA 1FBNA 2Y4PA 3NCGA 3LCOA 4PV0A 1OKVA 4D4SA 5HZNA 3O0GA 5HI2A 3VUKA 4R1VA 3V5LA 3ORMA 2XS0A 4OBPA 4ITHA 3QZFA 1UNHA 4BBMA 2IVVA 2GNLA 2VD5A 2VTIA 3POZA 5ANIA 4C0TA 4F63A 4WRGA 2ACXA 5CU3A 2QR8A 2W96B 4TYEA 2WMVA 1TQIA 5M53A 3E87A 5E8WA 2X9FA 3DT1A 4DFUA 3F6XA 2PZPA 4K18A 5EM5A 4FSWA 2VTQA 2X0GA 4CRSA 5AIKA 4DHFA 4C7TA 3PPJA 1PMNA 3QQJA 5J7HA 3KCFA 2XKEA 3R8LA 4BYIA 2XZSA 3G33A 3HDMA 4APCA 2C5VA 2XYNA 3MESA 2XF0A 4QMNA 2ZDUA 2GU8A 5T68A 2ZM4A 4TWNA 4O22A 3UP2A 4PMPA 3E64A 1PXIA 2CCHA 3IDPA 5CT7A 3BEGA 2WB8A 4FV3A 4CFVA 4CD0A 5A4EA 1NA7A 4I41A 4C2VA 1YWNA 2HY81 2OJJA 3A4PA 3F2AA 4LV7A 4YJOA 4E6AA 5HO8A 3LFQA 3ZBFA 4F70A 1IASA 1FQ1B 5CZIA 3ALNA 2DUVA 3HP5A 5M4IA 5C03A 4EK8A 3BU3A 2PMOX 3NYVA 4LGGA 2ZV2A 3D2KA 5AUYA 5GIPE 4AOJA 3UG2A 2C6KA 4IJPA 4QP2A 4MD7E 5LWNA 5CSPA 3QD0A 5KBRA 2OFVA 2W9ZB 4FKIA 3FMHA 3Q32A 4F0FA 3OY3A 5ANJA 2X1NA 3TDVA 5DLSA 3FXXA 2YEXA 4EC9A 1QPEA 1OL1A 4CFNA 4LQMA 3R9OA 1SMHA 3RPOA 4BRXA 4RIYB 5HG9A 3KMUA 4BIEA 1KOAA 2VX0A 1ST4A 4C4GA 1LP4A 3H10A 1WBNA 3JUHA 4UWBA 1XH9A 3W8QA 1JQHA 3D14A 4IX5A 3OP5A 2JKQA 3KN6A 4GVJA 4DLIA 4BTMA 3L9PA 1M14A 5M4UA 2GQGA 3G90X 1ZYDA 4D58A 2OIDA 3F5PA 4H1JA 3ZO2A 4DBXA 2X8EA 1PMEA 3V6SA 2QG5A 2J7TA 2CHLA 2HK5A 4FSRA 3JVSA 2GFSA 2Y6OA 4HGLA 4M8TA 4V05A 1H4LA 5FBOA 1G8SA 4HGEA 2UZWE 4IQ6A 5DT4A 4QTDA 4R77A 3VS4A 3CTQA 2BZHB 3KRWA 4L52A 4NW6A 3FSFA 3MYGA 4AS0A 2AEGA 2YJRA 2DQ7X 5F94A 4HZSA 4OTHA 3K2LA 5ANEA 4JS8A 3FKLA 4L3PA 3L8XA 3A99A 2B4SB 4CQEA 4AE9A 2HZ0A 4DH1A 5D1JA 3HX4A 4EUUA 2OJIA 4IWQA 2OIQA 3VRZA 4AA4A 4BCFA 1V0OA 1MRVA 3CEKA 3LW0A 2VTMA 4FKOA 4I5PA 4MAOA 2UVYA 5IA5A 3BELA 4RA4A 1XMLA 1HCKA 4QYGA 2UUEA 5J9ZA 4A4LA 1ST0A 1OL2A 2OG8A 2BTSA 3W0NA 4XG6A 1Q99A 3BQRA 3PY3A 4K9YA 1W8CA 4U98A 3F7WA 2QHMA 3ATTA 4QO9A 4CV9A 5I0BA 4O0YA 3AKKA 4QQCA 3Q53A 4M15A 2XNNA 3V04A 3QZIA 2ITUA 4YO6A 2O64A 3B2TA 5JKGA 4F99A 3MFUA 5A4QA 2H9VA 3ZDUA 4W4YA 4ZY4A 4MQ1A 5LCKA 3SG9A 1FGKA 2P2HA 3TV7A 1PXOA 4E8AA 3JY9A 1WBPA 4IM0A 5EHYA 4DT9A 1ZZ2A 3R9NA 4PNKA 1YXXA 1FINA 1H1WA 1U4DA 3FEGA 3U54A 4BBFA 3WZEA 5C8MA 3FMNA 5AP0A 3FMLA 3A62A 2GTMA 4L9IA 4P5QA 4EH6A 4AQKA 4JLCA 2QR7A 4RMZA 3EFWA 3O5AA 4WUNA 2YM8A 4FIIA 5EK7A 4KINA 3AKJA 5CAUA 4YBJA 4FA2A 2UW5A 2C5OA 1UWJA 1Q8YA 2WQMA 3DBFA 4Y95A 3DFAA 5CVGA 3D9VA 3HYHA 4BZDA 4U43A 3MI9A 2ITWA 4O2PA 2VTHA 4RJ5A 1M2PA 3H9OA 4O7YA 4E5AX 1WBTA 3ZSGA 3WE8A 4J8NA 3O8UA 4WBBB 3VS6A 2ZAZA 3CS9A 4OBOA 4F9YA 1OIYA 2XIYA 4I5HA 4QP7A 5AX9A 1PXMA 3ANRA 4ZTLA 2IZUA 2XK6A 3AMAA 3MWUA 4NM0A 5AUTA 2VU3A 2JKOA 4TTHB 3O8TA 2I0EA 3C0HA 3PWYA 1LPUA 4G6OA 2BAKA 4JR7A 2HIWA 1Q8TA 3E7VA 3NW6A 1UKIA 2PUUA 3Q6WA 5FUTA 2J2IB 5L3AA 4PDSA 4M12A 1JKSA 3OWKA 2B9IA 4Y8DA 3ML1A 3FMMA 4IAZA 4DINA 5KMLA 4B8LA 1YQJA 4BR3A 2HCKA 3GT8A 3MA3A 3C4CA 4I22A 4ZS4A 3L8PA 3Q2JA 2Q0NA 3QYZA 4QYEA 4QP6A 4YC6A 2X39A 5DT0A 2VTSA 5HHWA 5IH6A 4RVLA 2ITYA 4G31A 3U51A 4FKRA 2IZRA 3BHVA 2XUUA 4NJDA 4EK3A 3F5UA 4FV1A 2QLQA 4TZRA 4V0GB 3SA0A 4MH7A 1JKTA 3BLAA 4FEQA 5FEDA 2PVNA 3NUPA 4BIBA 1H07A 4DEGA 3EQGA 4ZY5A 4A9RA 4FTQA 4FYOA 1JPAA 2QKWB 3DK7A 1G8AA 3N4TA 5HGIA 1W84A 4CNHA 5TF9A 4BTJA 5BPYA 4GJ2A 2YA9A 3FZSA 1PXJA 4K6ZA 4WNOA 3ID6C 2A27A 4LM5A 4DT8A 4MEDA 3OW3A 2FSMX 4LUDA 3SXFA 3FMJA 3ROCA 4AW1A 4BZOA 4NCTC 5LMAA 3ZXZA 1Y8GA 3QWJA 3GU6A 4WNMA 4I3ZA 4O7ZA 3VWAA 5L6OA 4CLJA 5DEYA 4J8MA 4FL2A 2XAOA 5CSHA 4BCHA 4EOPA 3G9LX 3UDTA 2PVKA 1UU3A 4HVHA 3GCUA 2XKCA 4JL9A 3TL8A 2VO7A 5HX8A 4JIKA 4C35A 4DCEA 1KUTA 4CZTA 4ZLZA 2FH9A 3I7BA 5HTCA 4DG0E 5KX8A 4U40A 2C6IA 3CXWA 3E92A 5FTQA 3KK8A 4I6FA 3PRFA 1H25A 2XK8A 3FLQA 2F49A 4IFGA 4JRNA 3TV4A 3ODYX 3PVBA 4TNDA 4U80A 2C6LA 2YIYA 3FKOA 3L1SA 3QF9A 3BLRA 3PJ8A 2JIIA 4CTCA 3OY1A 4F78A 4XBUA 3E7OA 3OCGA 3R22A 4JBPA 5BYLA 1REKA 1YDRE 2XRWA 3MVLA 3TZ9A 1YXSA 3HECA 4NM5A 4E6CA 3R2BA 1AGWA 4OLIA 4FTJA 4TWCA 3VUHA 4AF3A 4DEIA 4TN6A 1ZOGA 4XBRA 4L3JA 4RLLA 5HCYA 3R28A 4HPUE 3UPXA 4QP4A 5EDQA 4AZEA 5IEXA 2ZM3A 3DK6A 5FQDC 4PDYA 2Z60A 2C3LA 3BYOA 3DV3A 3KXGA 4S34A 5D12A 5GJGA 1MP8A 3ACKA 2CN5A 3OW4A 4FIFA 3SX9A 4ACCA 2XNBA 4EBVA 1WBWA 4HOKA 5JGDA 3ROYA 3FYKX 3DXNA 4QMSA 2ITOA 3V3VA 4FUYA 2G1TA 4WNPA 3UDZA 3QD2B 4BI1A 5HVKA 4YNOA 3TZ7A 5HICA 2UW6A 1OL5A 4JDJA 3IPHA 3PP0A 4XHKB 3GBZA 4YZBA 2WMWA 5C01A 2BDJA 4JAJA 3RNIA 3WIGA 5EW9A 3UNJA 3UNKA 4L00A 2ONLA 3I81A 5L8KA 3NIZA 4GSBA 5J8IA 3JXWA 4GRBA 3LCDA 3FMEA 5FGKA 4RIWB 2WQNA 4MXOA 3DZQA 5CXHA 3HA6A 4KSQA 4A4OA 3OS3A 3PG1A 4U97A 1OMWA 5AUWA 5HNGA 5HE3A 4A9UA 2UW0A 3CIKA 1JSUA 3KF4A 3NUXA 3C1XA 3PIZA 2CMWA 4IDVA 4F0IA 4USEA 3PVWA 2OU7A 3B2WA 4AP7A 4J53A 3A7IA 4F65A 5JN2A 3DPKA 3OT3A 1SVGA 5FP6A 5HLWA 3E5AA 3OCTA 2EB3A 4AZVA 2XNEA 3L8VA 1KWPA 2ZMDA 3R9RA 3ZC5A 2R3IA 4XRJA 4NK9A 3EN6A 3IW4A 3AD6A 3O23A 4JG6A 3VJOA 4BJJA 4GYIA 4FV5A 5BUJA 4ANMA 2BUJA 3AC1A 4FT7A 4RLKA 3CJFA 4ONAA 4U81A 3VQHA 4A4XA 2JDSA 2PL0A 3HV4A 3A7GA 1Y57A 3BE2A 3PXKA 4M0ZA 4YHFA 5EKOA 3V8WA 3PJ1A 3LAUA 3F66A 4B99A 4ZTRA 2C5XA 4K2RA 2B53A 4WHZA 4MYGA 1M2RA 2W4KA 5AUVA 3W0PA 3S1HA 5L2IA 5KMKA 1KOBA 4HYHA 4G3EA 4U0IA 4YLLA 4DAWA 4FC0A 4MF1A 4CFWA 4U45A 3DQXA 1XH4A 3PE1A 4FEXA 2C68A 2VWIA 3RMFA 5F9EA 4AA0A 3NNWA 2XCKA 5C9CA 5I9YA 5KKRC 2XEZA 4U79A 3ZU7A 2X7GA 2XRUA 3BYUA 4ZEGA 4L67A 3WF5A 4YNEA 4IANA 1UNGA 2QONA 1YOMA 1I44A 2C5YA 2YZLA 2I0YA 4RC4A 4E73A 5J9LA 1KE5A 5HG5A 3JS2A 5E8ZA 4NM7A 3VUGA 3VAPA 4BVUA 4C59A 2O3PA 1Q5KA 4Z55A 1A06A 2HOGA 2PZIA 2WOTA 4OTDA 4AOTA 1H24A 4I6LA 1OGUA 5KMNA 2VZ6A 4B8MA 3VS7A 2GCDA 5AMNA 4EEVA 4YTHA 5DI1A 1Q8ZA 3FL4A 3CC6A 3QLFA 2ONLC 5LJJA 3R8PA 4BCPA 5GINE 1E1VA 2CSNA 5A6OA 3DTCA 3NNXA 3RALA 1Q8WA 4E6DA 3BBWA 2V55A 1H1SA 4UALA 3DBCA 3DAJA 4YPDA 1OIQA 1U5RA 1UU8A 3N4UA 3PIXA 3KY2A 3E93A 2WEVA 4JQ7A 4QMMA 2OLCA 3NYNA 2YM4A 1XHAA 1MRYA 2GHMA 4H3PA 4GT4A 5DIAA 4FIEA 1P4FA 4GKIA 3DAEA 4N6YA 1Q3WA 3THBA 2BFYA 4DFZE 1FMKA 1M7QA 5DGZA 5IMXA 5AEPA 5K5XA 1FVVA 2YIXA 3V8TA 3WARA 4AGDA 4AW0A 3QC9A 4JQ8A 1YXVA 3R30A 5C4LA 3BE9A 3QCXA 4USFA 3A8WA 3OVVA 1TVOA 3P5JC 1WMKA 2PU8A 3AT2A 4MXAA 4NFNA 4O7TA 2R0IA 2W1FA 4ZS0A 1UWHA 4IX3A 2YIRA 5BMMA 4DGLC 5EYCA 5AV2A 1CM8A 3ZEPA 4DG3E 3QLGA 4JRVA 5CENA 1OECA 3CSVA 2OFUA 3QZHA 2Y4IB 3U9CA 1UV5A 4GCJA 1ERKA 2QKRA 4RQKA 4IB3A 2PZYA 3CKXA 3OCBA 3UYTA 4L45A 5IQEA 2YDJA 4ZAUA 4HVDA 3EN7A 2XIRA 4DFBA 4ACDA 2B9HA 3CY3A 4I5CA 5HNIX 4FSUA 1YI3A 4IH8A 4IVBA 4FG8A 4FI1A 4I21A 5IF1A 5IQCA 3DB6A 4O83A 3SGCA 3EKKA 2GMXA 5AX3A 4V01A 4DITA 4MD8E 3Q96A 4JVGA 1R0EA 4ZXTA 2VX1A 3NCZA 4C37A 5CAVA 3I60A 2YJSA 5K5NA 1W0XC 3R8UA 2BZKB 2XB7A 5DHJA 2OZAA 4C33A 4BDAA 4CCBA 4GMYA 3R73A 2R3QA 1PYEA 3HP2A 4PL5A 5EOLA 4S31A 3VS0A 4AW2A 2IVSA 3EQRA 4U3YA 1YI4A 2YERA 4L43A 3UC4A 4JBOA 4NT4A 1W7HA 3BHUA 3F69A 5ANOA 4A06A 5HG7A 5JFWA 3QD4A 3G0FA 3LZBA 3QQLA 1JAMA 4U41A 2VTOA 3AT3A 3FPQA 4EK5A 3VNTA 4YPSA 5M09A 2X6EA 2F7EE 1XR1A 3LQ8A 4YJUA 3LFDA 4XP3A 5CNOA 4BCQA 3PLAE 3LFAA 2EU9A 3BKBA 5JRQA 3I5ZA 3OWJA 2PVFA 3ENMA 2Q83A 3QTRA 4O7WA 5FEEA 4DA5A 4EWQA 3VS1A 4BC6A 3TUBA 5DA3A 1S9IA 3CD3A 3IGOA 5CF5A 3H4JA 2I7QA 4LMUA 3ZSIA 4IBMA 3NMUF 1X8BA 3ZTXA 1F5QA 3SKCA 1ZWSA 4O7OA 1IA8A 2UW8A 2CCIA 3N4VA 4GIIA 3H3CA 1VYZA 5A4TA 4Z3VA 4JG8A 3C9WA 5E1SA 4QPSA 3P4KA 2QC6A 5J87A 4F09A 4O91A 4CEGA 3MV5A 4NZWB 5M06A 3HZTA 2AYPA 5ANGA 4ANQA 3G5DA 1XBBA 3RAIA 4EJNA 2C1AA 5AV0A 5ETFA 2JDRA 3HDNA 3Q52A 5J9YA 3POOA 4XP2A 3AD4A 4FKJA 5AP7A 3I79A 3ZUTA 3LIJA 5J1WA 3GQIA 2QOIA 5C4KA 1VEBA 4AAAA 4DEEA 4ZK5A 3LXLA 3TN8A 3UBDA 5JRSA 3SW7A 4ACMA 4Y85A 2XM9A 3GC8A 3Q60A 2YM6A 3CGOA 4NW5A 3UDBA 4DTAA 3QQHA 3DAKA 1YDSE 3ZO3A 1PY5A 4TW9A 5IUIA 1PMUA 4O81A 4WUAA 4IM2A 2F9GA 1AD5A 1ZY4A 3HRFA 4C4EA 4CFUA 4DYMA 1JLUE 1XO2B 4BDHA 3OHTA 4FSZA 4JIAA 4A07A 4JMQA 2ZDTA 4ASXA 3UQCA 5JQ8A 2BPMA 3PSDA 3HMPA 4I0TA 3UOKA 3UMWA 3V5JA 4PRJA 3KEXA 3SVVA 1GY3A 4MTAA 4W4VA 4IX6A 4YTIA 2WMQA 3L9NA 3PZHA 5TR6A 1B39A 3AOXA 2A0CX 5EW8A 5HVJA 1DM2A 5KMMA 4RPVA 4XJ0A 4C3PA 1KE9A 2Y9QA 4I0RA 2QU6A 2XK3A 4LV5A 4G3GA 4EI4A 2FSLX 1GAGA 4AG8A 2PTKA 5CEPA 4ALWA 2VV9A 4KUJA 1OPLA 2QHNA 3VS5A 4GG5A 3AQVA 2BAJA 4QMUA 3K5UA 3VW8A 2ZJWA 4QNYA 4EZ5A 5FM2A 2G2FA 2X2KA 5FG8A 4FZFB 5JFSA 3QTXA 2ZM1A 2BHHA 4F6WA 1Q61A 4XV1A 3CJGA 4WO5A 2UW7A 1G8KA 3CE3A 3WI6A 3WYXA 4BDJA 3VBXA 5LMKC 4DFLA 4EUTA 1CKJA 1MQBA 1LEZA 3ZRLA 4OT6A 4EH3A 4ZZNA 5AJQA 5KHXA 4JDKA 3P23A 3CQUA 4KIQA 3ZOSA 4XG9A 3A60A 3VBYA 5IDNA 2FYSA 4RWIA 4FG7A 5DE2A 3R8MA 1J7IA 3LLTA 2CN8A 2WTDA 3MW1A 3ERKA 3NRMA 1O9UA 3ULZA 4QP3A 5DR9A 3UQGA 4U44A 3W33A 3RCDA 1Q62A 1YRPA 4S30A 1BYGA 1YHWA 2SRCA 4L53A 3BYSA 2X4FA 2WIHA 3Q5IA 3ET7A 3OTUA 2J5EA 3LFNA 4KS8A 3NR9A 4Y72A 4YC8A 4U5JA 1MQ4A 3F3VA 4FV4A 2CKPA 4HNIA 4RJ8A 2RG5A 4CTBA 2VRXA 5KCVA 2BRBA 3W32A 4UY9A 4X3FA 3NDMA 5FTGA 3K3IA 3ZO4A 5IQDA 4G6LA 3E8DA 3OBGA 4G16A 4CKIA 5JH6A 2WMRA 3E8CA 3SOCA 1B38A 1FOTA 3AC8A 2JLDA 2Z7RA 2YCFA 3FLNC 4KKHA 4DBNA 5EQPA 5CX9A 3UE4A 3Q4TA 3ZYAA 4G5JA 4RWJA 5J95A 2VO0A 2J9MA 4IAKA 3UTOA 3O71A 4AGCA 4MWHA 2VWZA 3SW4A 5DH3A 4LFIA 2NPQA 4YZ9A 2VWUA 1GNGA 2VTNA 4FNZA 1STCE 2E9NA 1U46A 3E63A 3WF7A 3U6HA 1PRYA 4KBCA 2PZRA 3DXPA 4I1ZA 4AE6A 4BI0A 1JSVA 3OTVA 4XG8A 5M4CA 1FMOE 1W82A 3HUCA 1IAHA 4M13A 3Q9XA 1JOWB 1UNLA 3C0IA 5CU2A 4F08A 3QGYA 1BMKA 4ITJA 5EDRA 5AUXA 3QTIA 3W2PA 4DFYA 3BL9A 4B4LA 2F7ZE 3ZLWA 4OBQA 2XANA 3V5PA 5LMKA 3N9XA 3OOGA 2W7XA 3R1NA 4AT3A 2P3GX 2X9EA 3KREA 5E8SA 3QQFA 3MS9A 3UP7A 3ZEWA 4CXAA 2WTKB 3FSKA 3MTFA 1OM1A 4M68A 3FMDA 3VULA 4J98A 1WZYA 4TPTA 1GJOA 3FHRA 4EHZA 2QOOA 4NFMA 3LHJA 5ITAA 2BROA 3HV3A 4AGUA 2GS2A 2HW6A 4LUEA 4FV9A 3R8VA 5IZFA 3BV3A 5DR2A 5A54A 2XJ0A 4J71A 4S2ZA 2EWAA 2OZAB 4KABA 4KIOA 2P33A 5J5SA 5JGBA 3LM0A 4GS6A 5K4JA 4D0WA 3IW5A 2FSOX 3COKA 1Z57A 3NX8A 2R3FA 3DKGA 4YSMA 2IG7A 3FJQE 4U9AA 3S4QA 2X8IA 4RG0A 5L8JA 4R6VA 4USDA 3GENA 2IJMA 4E6QA 5CYIA 3QTUA 3H9RA 2ITXA 3EZVA 4NKSA 5FD2A 4CMOA 2HWOA 4GYGA 2FB8A 1H1RA 2JDOA 2W05A 3CD8A 3LLAA 4D55A 5KZ0A 4EOLA 5E1EA 3RNYA 3UNZA 4I23A 4AT4A 3TJDA 3PXYA 4K33A 2XK4A 2W1EA 1KE7A 2BFXA 2R3RA 4FKPA 4XCUA 3ACJA 3TEIA 3W1FA 3RHKA 1FVTA 3ZM9A 2WELA 3AT4A 2ERKA 3FQHA 4YO4A 4O38A 1SNUA 3ATSA 3UVRA 1JKLA 4FKSA 3IDCA 2QO9A 5IEYA 1B6CB 2JAVA 4HGTA 1OZ1A 4LG4A 5JEBA 3DKFA 2IVUA 4V0GA 4FTUA 5LQFA 3ORZA 5FBNC 3II5A 5KKRB 5HCZA 3BWJA 1SM2A 1OI9A 4R7IA 4I24A 3GCPA 4O0TA 2OF2A 3QZGA 5KO1A 2XAMA 2JGZA 2J0IA 3LJ1A 5BQ0A 5EW3A 2UZUE 4CMUA 2JFMA 5HIDA 3FY2A 3DJ5A 4JBVA 2Z7SA 4D9TA 3GGFA 4KWPA 2J0JA 2W0JA 3ZDIA 3FQSA 5GJFA 2Y6MA 3R00A 3UODA 3AMBA 4IWDA 2OXDA 4AUAA 4LOPA 4LRKA 5AA8A 3IKAA 4IAFA 3QFVA 4FOCA 3KQ7A 3QTQA 4G3CA 2V22A 4ZY6A 3BEAA 4K8AA 3SDJA 1TQPA 4ZTMA 2PUNA 4FT0A 5IISA 2PMIA 4FT9A 3EN5A 1Q41A 2B55A 4DE4A 3O7LD 4CG9A 2I1MA 4DGMA 5LXMA 2VWVA 5BVDA 5M57A 4ASEA 4XG4A 4C3FA 4EL9A 3WZJA 3BHYA 4FTRA 5AUUA 3GC7A 5A46A 3Q9ZA 4RX9A 3PP1A 1YI6A 3E8EA 5DN3A 1P4OA 4PMMA 2WU6A 2XP2A 1YXUA 2IW6A 3PYYA 1NW1A 1QCFA 2FSTX 3OUNB 4OUCA 3MPAA 4PY1A 4FTTA 3COIA 5BVWA 4EORA 2C3JA 2R2PA 3RM7A 2YFXA 3F2RA 1NVRA 2BIYA 2I6LA 4K77A 5C26A 3CY2A 4JX7A 1Y6BA 4GFOA 1ZMUA 2VWWA 3FBVA 4AZSA 2W5BA 3FZ1A 4LL5A 4E5WA 2PSQA 1GIJA 5B2LA 3MFTA 4FT3A 1G8JA 3HKOA 4Q2AA 5CSXA 3V5QA 2C0OA 4YJSA 4R7HA 5AP2A 2IZTA 5HG8A 3BBTB 2GNGA 4NCTA 3ZO1A 2W9FB 4QTEA 5CT0A 5JT2A 1PF8A 4PTGA 3UO4A 4QMWA 3TG1A 4EOIA 1FGIA 3UC3A 2XK7A 3TNHA 2JKMA 4BHZA 2I40A 4QMOA 2IW8A 3PVUA 2C6TA 3EFJA 3QUPA 3BHTA 2RG6A 4L44A 3PRIA 4IZAA 4G9RA 4NYEA 4JQEA 4KSPA 2WQEA 4RIXA 3LFBA 5JSMA 4FSQA 2WTJA 1E1XA 2XYUA 4IZ7A 2W5AA 5CU6A 3EN4A 5BMSA 3TI1A 4LL0A 4IW0A 4FZ7A 3S00A 4RX5A 3MJ2A 3VN9A 1R39A 4R78A 4ARKA 5K4IA 3VIDA 4QYHA 3KXXA 3GP0A 1TKIA 2F2CB 4RX8A 4F1MA 5FXQA 3M11A 2J90A 4R5SA 5KUPA 2UZBA 2WNTA 3CTHA 3F5GA 3UZRA 2REIA 3LMIA 2A4LA 1OKWA 1O6YA 2B52A 5AP1A 3ZONA 2FVDA 3ORPA 3FZRA 3PTGA 1T45A 2O65A 3SOAA 1H8FA 1H27A 4HCUA 5KMOA 5LVNA 3VBTA 1MRUA 3KC3A 1XQZA 5M56A 2PE1A 5KBQA 3D2IA 4YZNA 3TV6A 4NH1A 2RFSA 3I1AA 4TYIA 4LRMA 4DHIB 3HA8A 4IM3A 1QPDA 1KV2A 5G1XA 4DGOA 1OPJA 5AFVA 2CNQA 3KB7A 3QKLA 4WNKA 4IDTA 2CLXA 4J1RA 4PP7A 2R7IA 1GZNA 3EQIA 4OGRA 1BX6A 3LXPA 2ETKA 3RKBA 4D4YA 5F1ZA 2YZAA 3MB6A 4IVCA 1A48A 3AKLA 4JDIA 3W2OA 3B8RA 4O6LA 4EH4A 3A7FA 1UA2A 4IVAA 4ZMEA 4BY9E 4BZNA 4RGJA 4BDKA 4EH2A 5K3YA 1ZRZA 4G34A 2W99B 4GT3A 2DS1A 4CG8A 3SAYA 4MNEA 2V5QA 3G51A 2CJMA 1U54B 4IZ5A 4GJ3A 1SYKA 5CLPA 4RJ6A 3QCSA 4FV6A 3UMXA 4GU6A 4UX9A 4D5HA 3GI3A 5FDPA 2YM5A 1XH8A 1H01A 2FGIA 3W18A 2BVAA 3F3WA 2BZIB 3QTWA 5AP4A 1APME 4DGGA 4F6UA 4JX3A 1GZOA 2F57A 4XLVA 5IQFA 3RVGA 3O96A 5IDPA 3NEWA 3FXWA 4AXEA 1OKYA 4AT5A 1BL6A 1URCA 2G2HA 2XMYA 4MWIA 4GK4A 3EHAA 4FZAB 4OTFA 1Q4LA 2HY0A 5CSVA 4ZJJA 4ALVA 4RIWA 3EZRA 2QVSE 3VF9A 4FGRA 1BL7A 4CVAA 3DFCB 3TM0A 2BCJA 3L9LA 3S95A 2P4IA 2V7AA 3TIYA 2Y8OA 3E3PA 4TY1A 5CVHA 3E88A 5LVOA 3C5IA 3EYGA 4G3FA 2G15A 3A4OX 4CRLA 2PMLX 3R21A 1VJYA 4ID7A 3Q04A 2X2LA 4DEAA 3QXPA 3V01A 3KMMA 3A8XA 2CGWA 3NAYA 4CLIA 1LR4A 2RGPA 3MIAA 4AN3A 4GT5A 3NYOA 4Z7HA 2GHLA 3LVPA 4U3ZA 3TKHA 4FG9A 4EJ7A 3WF8A 4EOSA 2C5NA 3EB0A 2GTNA 4GW8A 1QPCA 2R3LA 4RFYA 4LMNA 5BUIA 3FC2A 4RJ7A 2E9PA 4KRDA 4P90A 3C4WA 5ANKA 2EB2A 3T8OA 3AC3A 4H05A 2UZDA 3C7QA 4IACA 1H1QA 4LV8A 5D10A 1ZYLA 3C4XA 1VZOA 3GEQA 4J99A 1XH6A 1O6KA 1XH5A 2XIZA 2LAVA 4HVIA 4AU8A 4IHPA 4O0RA 5DNRA 5HORA 4KA3A 2BRHA 4I0SA 1U5QA 4BDIA 4DN5A 2H6DA 2VTRA 3DCVA 3F3TA 3OMVA 5J1VA 4IWOA 2Z7QA 3VUIA 2R3JA 2R5TA 1XJDA 3A2CA 2QOQA 4OTGA 3ZLXA 2J0KA 1H1PA 2EUFB 4FKWA 1WAKA 3BX5A 3KL8A 2VTAA 3PA5A 4MQ2A 1RQQA 4C62A 4DH8A 4X6RA 4E5BA 2BMCA 3TZMA 4NJ3A 3KRXA 2J5FA 3TZ8A 3PXQA 4IMYA 1V0PA 4MCVA 4QOXA 3W55A 4BCIA 5CY3A 4X3JA 5CS6A 3QD3A 4C36A 4BBEA 1NXKA 4MBIA 2IZSA 2ZVAA 4FE2A 2UV2A 4QTCA 5CEQA 2GDOA 1QL6A 3ORXA 2V0DA 2IO6A 3GOKA 4FTKA 1NVSA 4H39A 4ZSAA 2XA4A 3LQ5A 1GZ8A 4E4MA 1VYWA 1L3RE 1SVHA 4EQCA 2X7OA 3EH9A 2R64A 3KRLA 3PA4A 2JIVA 3I4BA 3FLWA 4GKHA 4P4CA 3UG1A 2W1DA 4FL3A 4J7BA 4L7SA 4O7RA 3TUDA 2XEYA 4C38A 2QODA 3OT8A 2AC5A 2QQ7A 3MBLA 2R3MA 1UU7A 4IE9A 1QPJA 2VGOA 4LGHA 3ALOA 3PZEA 2BHEA 4QP1A 4YJPA 1J7UA 2Z2WA 4EKLA 4XV9A 2QOKA 1OBDA 3GQLA 3KVWA 3F2NA 4ITIA 4EOOA 3FZPA 2X2MA 3RHXA 2O63A 3VBVA 1YW2A 3HL7A 3P7BA 2J6MA 3CQWA 2YWPA 1OUKA 4MX9A 3CBLA 2BALA 1WVYA 3GC9A 2ZB1A 2Y0AA 3O17A 3ORTA 4FR4A 4L42A 1GIIA 2BILB 2R3HA 4TYHB 4V04A 3VVHA 3N51A 1OPKA 2HYYA 2W4OA 3LFEA 2XBJA 2CGXA 4C34A 4X7QA 3CQEA 3FAAA 1OUYA 2JBPA 2VGPA 3NNVA 4FVRA 2YHVA 3E3BX 3MTLA 4ANLA 3O50A 5DRDA 4R3CA 4D1XA 3TWJA 1OL6A 3R8ZA 3IOPA 2C6OA 4X2NA 4WG5A 4HPTE 2O8YA 4N4SA 4RFZA 4Y46A 4Y73A 4IZYA 1KE8A 4CMTA 3CGFA 3P9JA 2H34A 2PVRA 4FZ6A 4EOQA 5CEIA 3EQBA 4M69B 3FI2A 2C4GA 2PWLA 3AG9A 2OWBA 4H36A 1Z9XA 2QCSA 4DEDA 4ZZOA 3QX2A 2YCSA 3QL8A 4AFEA 4KD1A 3JVRA 3OEZA 3MPTA 3TKUA 5EM8A 1G3NA 2B9FA 3DDQA 2IW9A 1WCCA 3FI3A 2YDIA 5ANDA 3R1QA 3PA3A 4M3QA 4R1YA 1WVWA 4XMOA 3HRCA 3OXZA 2UZEA 2UZOA 5BVKA 4BB4A 5E92A 4EZ3A 4ZOGA 4HYUA 5GJDA 4K1BA 2NO3A 3EQHA 3I0QA 3Q4ZA 4QQTA 3ZM4A 4U6RA 4GEOA 1JVPP 4PMSA 1ZYJA 2QU5A 1Q3DA 5E8YA 4BGHA 4YMJA 2YACA 3F5XA 3ITZA 4OTRA 4FOBA 4O0VA 4FKLA 4I4EA 4IADA 4X2KA 2OZOA 2DYLA 2ITTA 5F4NA 3CR0A 4FEVA 4QMVA 1V0BA 3MSSA 3EKNA 4X2GA 4YC3A 5AAFA 3WE4A 5CI6A 3EIDA 3OXIA 4O27B 2VWBA 3C4FA 3RI1A 3MN3A 4YGAA 2GPHA 3AC5A 4ORKA 4RVTA 3CPBA 5FM3A 5DR6A 5IA4A 2PVJA 2WTKC 3EFLA 3P79A 3TXOA 2J0MB 3OD6X 5BVEA 3UIMA 5C1QB 2IPXA 3KXZA 4KB8A 4U42A 3FZTA 1J7LA 2XIKA 3GCQA 4C4HA 4M7IA 3VC4A 2IWIA 4RIXB 4C4JA 3SD0A 4RC3A 2UZLA 4TYHA 4X0MA 4F7JA 2OXXA 4EH9A 3OG7A 4W4XA 3V5WA 4EONA 3R9HA 5AP6A 5IQIA 2EXCX 4HYSA 1UU9A 4MUQA 4E20A 3KXNA 3GB2A 3LFFA 3OCSA 3R1YA 3DGKA 4E93A 4MD9E 4D4RA 4YTFA 5DBXA 2Z8CA 3TIZA 4JJRA 4DCAA 5LOHA 2VNWA 3M42A 2Y7JA 4PQNA 1U54A 1PW2A 2C6EA 2GNIA 5HX6A 1R78A 3A61A 3ODZX 4FK6A 4GFMA 4PMTA 5AAGA 2GNFA 4TNBA 4I4FA 3QAME 2C30A 2F4JA 4FV2A 2R3NA 5CQWA 3RAKA 3W0QA 3UPZA 2NNWB 3GXLA 3B8QA 4PDOA 5A9UA 3ZRMA 3W2QA 3EOCA 3KRRA 4XH6A 3ULIA 3UIBA 4EYMA 1J1CA 4G5PA 3BL7A 1Q8UA 2WOUA 4BDBA 4RZWA 4WSYA 3NUSA 1M2QA 5IMEA 4BN1A 4MHAA 4QMYA 2DWBA 3O2MA 4BF2A 4BTFA 2VTJA 3NIEA 4IVDA 5ETCA 2GFCA 2AUHA 4AACA 4M97A 5EHOA 4WBOA 5FRIA 3UO5A 4KIPA 2R3GA 1CTPE 5EQEA 2XNGA 5FTOA 4WRSA 3W16A 4CKRA 5AV1A 4O21A 4M67A 4BTKA 4WZYA 2VNYA 4DH7A 3REPA 1PJKA 2OJFE 3ORKA 3VBWA 3DJ6A 5BNJA 2VWXA 3NLBA 3RAWA 5HLPA 4J95A 4ZLOA 4BDEA 3PFYA 2JC6A 4AGWA 4YZMA 4QDEA 3PIYA 2VTLA 4D2RA 4N57A 2E2BA 3PUPA 5ICPA 1F3MC 4CCUA 3HMIA 1H0WA 5CF6A 4ZSLA 4KRCA 4KAOA 3PJ2A 5EI8A 3H9FA 3ELJA 5BV3A 2UVXA 3IW6A 2P0CA 4S33A 5HBHA 2CDZA 3MVMA 4FSYA 4O7NA 4R3PA 2C0IA 5JQ5A 3TUCA 2ZMCA 2PVMA 3LPBA 4RVMA 3COMA 3U6IA 1IA9A 5EHLA 4ZSGA 1FPUA 4NL0A 4Y5QA 3LQ3A 4ZP5A 3BLQA 4FKVA 3OUKA 5B0XA 4FNWA 3OBJA 3C50A 5D7AA 4FSTA 3DDPA 3W0RA 5KNJA 5EI2A 2BR1A 3GCSA 4U8ZA 1PXLA 3NSZA 5EH0A 4F1OA 3LM5A 2WMUA 2PMNX 2XH5A 3G0EA 3MFRA 3T3UA 3VBQA 2PUPA 4F7NA 4IB1A 4DHZA 3D7TA 1YWVA 2KULA 2XKDA 2W1CA 2OI4X 4QMXA 3TKIA 3R7EA 2ETRA 4YUQA 2QOCA 3VW6A 3UO6A 2BTRA 1ZMWA 3G6GA 2IVTA 3L9MA 4AFJA 2P2IA 3FMKA 4WG3A 2W06A 4ZZMA 1YWRA 4KS7A 1OIRA 5EFQA 4ERWA 1H08A 4XS2A 4KBAA 4RC2A 3MIYA 5ACBC 3TNQB 5EYMA 1EH4A 3JYAA 4O0XA 2YIWA 4B7TA 1Y91A 2ZFYA 4O6EA 4QMTA 5CSWA 5HU9A 4MNEB 3W0SA 3JY0A 4I6QA 3NGAA 4EK6A 3LJ2A 2HZ4A 4I93A 2VO3A 1V1KA 4EH5A 3KFAA 4C3RA 2GQSA 1Q24A 5LWMA 2WO6A 4DGNA 5AM6A 2FA2A 4R3RA 4NTSA 2UZNA 4RA5A 5FEQA 2JEDA 5AAEA 3VHEA 2Y4IC 4F9AA 3IG7A 3VHKA 5I5ZA 5D7VA 4QTBA 3R0TA 2UZVA 4PF4A 1OB3A 3EQCA 2QOBA 5AIRA 4ZLYA 5HBJA 4FKUA 3R9DA 2ITQA 3H0ZA 5GNKA 3U4WA 3WIKA 1ZOHA 3UVPA 5CEOA 3GU7A 3BPRA 4F6SA 2WTVA 3QRTA 4UV0A 2NRUA 1PMVA 3CTJA 3ZUVA 4C58A 4QTAA 5DPVA 3R2YA 2XCHA 1H00A 4ZTQA 3AC4A 2YDKA 3TDWA 4CKJA 4IX4A 4F7LA 5CWZA 1M7NA 4HYIA 4OW8A 4TKSA 3PPZA 4DTBA 1ZY5A 3R01A 4GV1A 4O0WA 3TCPA 4CT2A 5KHWA 4J97A 5TT7A 1PXNA 4BGQA 3U6JA 4YJNA 3OROA 4FTIA 1OGYA 4D1SA 4CT1A 3RK9A 5IPJA 3TACA 2ZV7A 3W0MA 5F95A 3Q5ZA 5C8KA 2H96A 2YCQA 3BV2A 4II5A 3QRKA 3RWQA 2NRYA 4RRVA 3KRJA 4FTNA 1DI8A 4OR5A 2V62A 4JOAA 3EQPA 4NUSA 3NUYA 4Z16A 1P2AA 2R3KA 3W0OA 2W1ZA 4G9CA 3HV5A 4JAIA 2JAMA 3JR1A 3PVGA 4PUZA 5E8TA 3ORNA 4RJ3A 3FY0A 3S2PA 3QTSA 5EM6A 2BIKB 4DFXE 2UW9A 3PPKA 4MKCA 5BUEA 2EVAA 1JSTA 5BYZA 5JZJA 4PTCA 3QALE 2CKEA 3KVXA 2QG7A 3Q4UA 3VUMA 4B6LA 3A7JA 2XJ2A 4FYNA 5H9BA 4EOMA 1IEPA 2JDTA 4RIYA 3ZFYA 4WOVA 4HCTA 3MY1A 3RAHA 4YR8A 4ERKA 4YHJA 2YABA 3OZ6A 1K3AA 5M44A 1GZKA 4JDHA 4C4IA 4UEUA 3ZCLA 3RCJA 3SC1A 5JK3A 3W2CA 3VO3A 3SRVA 4I6HA 2R7BA 3E8NA 3GU5A 2OKRA 3QC4A 2RF9A 3NWWA 3IW8A 3FLYA 3MVJA 3NPCA 4O96A 1I09A 5AV3A 5HVYA 1ZMVA 3ZRKA 2WMTA 4BDGA 3FI8A 4IAIA 2ITNA 3ETAA 3OEFX 2G9XA 4TRLA 4CFMA 4FICA 3GFEA 4N0SA 1RJBA 4DEHA 4FSNA 4EOJA 5JMSA 5HESA 1J3HA 3KULA 5IQHA 1J1BA 1H0VA 2CNVA 4QQ5A 4XNEA 5DFPA 4ZJVA 5LMBA 3QQKA 2XBAA 1WBSA 2OW3A 3T9IA 2JKKA 4AXCA 3KXMA 1NVQA 3IONA 4I20A 1JWHA 5EI6A 3HMNA 4FTCA 2X81A 3U9NA 3ZMMA 5HU3A 5IQAA 3DZOA 3D7ZA 3V6RA 1HOWA 4RQVA 3F3UA 2QOHA 3RPYA 4HJOA 2BAQA 4IB0A 3IS5A 4FTLA 3PXFA 4IC7A 2WMXA 2WTCA 3D83A 3NNUA 5A3XA 3R02A 2QLUA 3RTPA 3UIUA 3TT0A 1SVEA 4UWCA 2CGVA 4QMQA 5H8EA 3QQUA 1CKPA 3TNIA 3AD5A 4QMZA 3FV8A 5EDPA 3FHIA 3TTJA 5CF4A 1XBCA 1M17A 3SLSA 4MK0A 1OITA 3DNEA 5K9IA 5GIOE 1JKKA 2YWVA 5T3QA 2VTTA 3HUBA 3QYWA 5CI7A 2OBJA 3RJCA 3U8WA 4AN9A 5CTPA 1ZARA 1UKHA 5ACKA 3QCQA 4ZSJA 4N6ZA 4G2FA 1KV1A 5CEKA 4O0UA 2WU7A 1RDQE 3IW7A 4YJVA 4X3FB 3UOLA 2OF4A 5AA9A 1O6LA 4BCOA 3RK7A 4RFMA 5E90A 3FE3A 4FT5A 3HV7A 3D0EA 2B54A 4YBKA 5I9ZA 2WZJA 4JG7A 5HNBA 4APPA 3R04A 5H3QA 2GNJA 4UYAA 5EG3A 1TQMA 5E8XA 4FMQA 4UBAA 2XNMA 2HZNA 5HTBA 1A9UA 5HE0A 5CAOA 3DKOA 5L8LA 4O0SA 3EN9A 5EOBA 4GFGA 3MDYA 4E26A 2B1PA 5I9VA 2GS6A 3LFSA 3SRVB 5AWMA 4ENYA 4L46A 2J51A 2F2UA 3DA6A 4LRJA 3SXRA 4AW5A 3SV0A 3HAVA 5CF8A 1W83A 1WVXA 3OXTA 1Q97A 4FEWA 4LOQA 3R6XA 1PXKA 4FL1A 4JBQA 1YHVA 1PKDA 2WAJA 2X8DA 1MUOA 3RPRA 5CXZA 5I9XA 1PHKA 5B7VA 3OC1A 5D41A 1RW8A 4TWPA 2W1IA 5DEWA 1IR3A 4FVPA 5EQYA 4FEUA 3DTWA 5L6WL 2C0TA 5CASA 5A6NA 4GL9A 3P86A 1NY3A 4AXDA 4DEBA 1S9JA 4A9SA 2JD5A 3CCNA 5M55A 4EHGA 4TYGA 5IA2A 2HW7A 3DU8A 4MNFA 1ZZLA 3LJ0A 3CP9A 1J91A 3CPCA 3Q6UA 4XRLA 4ZJIA 4DC2A 4QT1A 4YJTA 4L01A 4BDFA 5B2MA 2BRGA 2GHGA 3O51A 1YHSA 4IIRA 4QRCA 3PXZA 5LVMA 4HCVA 2BRNA 5E8UA 4ASZA 2FO0A 4RVKA 4K0YA 5IEVA 3O7LB 4E1ZA 5EKNA 4OT5A 2YCRA 4IWPA 2PVYA 4FK3A 2YAKA 5HE2A 4AZTA 4DG2E 4DLJA 2WGJA 4FTOA 2E9UA 3MH3A 4EC8A 4PL4A 4E7WA 5EYKA 3W2SA 3E62A 2OJ9A 5KE0A 3MFSA 1R0PA 2EXMA 2C6DA 3KU2A 5E91A 4HVGA 4H1MA 5DOSA 3UDSA 4H3QA 1CMKE 4FUXA 2ITZA 4I6BA 5CQUA 3VRYA 2J0LA 2ZV8A 2W4JA 2WMBA 3QUDA 4W8DA 1XMMA 4FBXA 4C61A 5HD4A 4MVFA 4BICA 3AC2A 3QGWA 3RP9A 3WILA 4FIGA 4LOOA 3OF0A 2C6MA 3KN5A 3FLZA 4YJQA 5HKMA 4AZWA 4EH8A 3S0OA 2VX3A 3LE6A 4X2JA 1G5SA 4DDIA 3M1SA 4TXCA 3F3ZA 5HD7A 2PE2A 3I7CA 3MA6A 5HIEA 2QNJA 1Z5MA 2B9JA 4FJVA 5H2UA 5HE1A 3EWHA 3KKVA 3AMYA 1YVJA 2J50A 2KTYA 2VN9A 3P7CA 3ZZEA 2OH0E 2UVZA 1XKKA 3TNWA 4O82A 3RWPA 1AQ1A 4EZ7A 4P5ZA 4F9CA 4G3DA 4ZSEA 3C13A 4Z9LA 4F9WA 4EOKA 3CLYA 2HENA 2WXVA 5BVFA 3BZ3A 3I6WA 5D11A 5FXRA 2Z02A 3QUEA 5IA3A 4E4LA 3WBLA 4Q5HA 4AWIA 2A1AB 4BCKA 3QRJA 3R7IA 3R7UA 2PUIA 4P7EA 3NUNA 2OXYA 4Z7GA 5IUGA 2ZV9A 4OTQA 3R63A 5HEZA 2ZB0A 4U7ZA 4DFNA 2QURA 5FXSA 3CKWA 4P2KA 4IC8A 2WQBA 4XUFA 4WT6A 3D5UA 5L2WA 4IAAA 1REJA 1YDTE 5TO8A 3NYXA 2E9VA 2XM8A 1K9AA 3UJGA 3IGGA 2WKMA 2A2AA 2WEIA 4WKQA 2YM7A 3GC0A 5T6KA 3I5NA 5TKDA 1DI9A 3UVQA 3VQUA 3I6UA 3KGAA 4RJ4A 1E9HA 3K5VA 5JGAA 3NS9A 4I92A 5DVRA 1JBPE 4J96A 4MXZA 5CNNA 2PVLA 1DS5A 2QOLA 2WMAA 5AM7A 4RWLA 4BCNA 3BQCA 3G9NA 1XH7A 3MPMA 4DH3A 3KULB 3DJ7A 3TMOA 4FKQA 3BGZA 3G6HA 3MH2A 4PNIA 2W17A 3W10A 1WBOA 1IG1A 3QTZA 4D28A 3S3IA 3LXNA 4Q5EA 4HGSA 4IAYA 4JR3A 4O7PA 5KZIA 4YP8A 5M08A 3O8PA 3NUAA 4KNBA 3V8SA 5CALA 4OTWA 1BKXA 5CAPA 4G1WA 4YLJA 4CSVA 3KK9A 5G6VA 1TFFA 3UOJA 3HVCA 3TNPC 3OWLA 2UZTA 4YSJA 5CU4A 2PE0A 4FKTA 4RBLA 3PY1A 3VF8A 3ZLSA 1VR2A 3DXQA 4MXXA 2HXQA 3Q3BA 5IH5A 3LKMA 2ESMA 2J4ZA 5FP5A 4EH7A 3D5WA 3RINA 5M4FA 1SNXA 5M51A 3VS2A 1PYXA 3KA0A 1NT2A 1BI8A 1T46A 2B0QA 3T3VA 5E4HA 4X6QC 4PP9A 5DT3A 2JBOA 5CANA 4XP0A 4IB5A 4QNAA 2JFLA 3T9TA 3WF9A 3C4EA 4B9DA 2PY3A 2R3OA 2WFYA 3GU4A 3HV6A 4QDVA 3TYKA 3HRBA 3HEGA 4F4PA 4TYJA 2GQRA 2PYWA 3ORLA 4QP8A 3FQEA
chains in the Genus database with same CATH topology
3OWPA 5HQ0A 3F9NA 3R7YA 5H8GA 4QEBA 5CVFA 4BGGA 1LEWA 2OO8X 3DB8A 4CFFA 3NAXA 3F82A 4FGBA 3ZSHA 2WQOA 2GNHA 4NM3A 1YXTA 5I4NA 3SXSA 2H8HA 1YOLA 3HLLA 2QO7A 1U59A 2RKUA 4UXQA 3R7OA 3DK3A 2RIOA 2E9OA 2GSFA 2XKFA 2X7FA 3KMWA 4PWNA 4KKEA 4AA5A 1ZYCA 1IAJA 2GS7A 2RFDA 5JFXA 5L6PA 4NIFB 4R7BA 5IUHA 4I94A 3RZBA 4XOZA 4RT7A 2YITA 3MY0A 3TJCA 4B0GA 4ANBA 3HMOA 4E4NA 4GU9A 5IA0A 4BIDA 4RX7A 4FTAA 5M07A 4AXFA 4C02A 3ZHPC 4TL0A 4YHTA 4XV2A 4L3LA 2UW4A 3MJ1A 2CNUA 4CGAA 1OL7A 2VAGA 4UN0C 3EFKA 3FPMA 3MGYA 4QMLA 4XYFA 4HVSA 3FXZA 3GOPA 2PK9A 2HELA 4D5KA 5CEMA 2BDFA 5DWRA 1M52A 3GCVA 4PDPA 4XG3A 3UZPA 4U94A 4L8MA 5H8BA 2QOFA 2VUWA 4JNWA 5IU2A 2LGCA 2C3IB 1JNKA 5CU0A 3K54A 2RL5A 4Y83A 3EL8A 4WIHA 1F0QA 3R83A 3G2FA 2O2UA 2VTPA 4FX3A 3GNIB 3HGKA 3Q2MA 2AC3A 4PL3A 4KKGA 4QPAA 4YURA 2R9SA 3UZTA 4QYYA 3RPSA 4BKJA 3QRIA 3G15A 5AUZA 2VWYA 4RIOA 2CLQA 2PULA 3PY0A 4L6QA 4CZUA 4ENXA 1R1WA 3AGLA 4ANSA 3QU0A 1OBGA 4BDCA 2QO2A 1ZXEA 2R4BA 2X6DA 3DOGA 3LXKA 4FIHA 4FV8A 3QKMA 4NU1A 2Q0BA 3VONA 2W1HA 2XK9A 2W5HA 2RFEA 4Y5HA 2XARA 5LVPA 4UB7A 4AXAA 2PZ5A 3FLSA 4C4FA 5EYDA 3AXWA 2O0UA 2PVHA 4R5YA 3BI6A 5E8VA 4O86A 2P55A 3BYVA 4PTEA 3ZLYA 3D15A 1ATPE 3RK5A 4UZHA 3MH0A 3IECA 5JFVA 4BI2A 3ANQA 3C5UA 3H0YA 3NW7A 3NVMB 3AGMA 3ENHA 1L8TA 2CKQA 3RGFA 3UOHA 3C0GA 3EJ1A 2A19B 5IQBA 4W8EA 3RM6A 1H28A 3DLZA 3EL7A 1XWSA 2RFNA 3SG8A 5KMIA 5HO7A 5IA1A 3PSBA 4XOYA 3TTIA 1BUHA 4XV3A 1CKIA 3LMHA 3ZXTA 3EMGA 5HBEA 3W8LA 2PHKA 3PG3A 3QBNA 3QHRA 4EYJA 1ZAOA 3PUFC 3IDBA 2HXLA 4F1TA 5DYJA 4JI9A 5C27A 4PX6A 2C1BA 2NYAA 5A4CA 4IFCA 4BCJA 5IQGA 2YAAA 3FWQA 3DKCA 3F88A 3BGQA 3QX4A 4FTMA 4YZDA 3P78A 4GUBA 4X2FA 3M2WA 3DS6A 3I0OA 5AP3A 4M0YA 4ZTNA 2YISA 3WF6A 1R3CA 4D9UA 2C3KA 4NSTA 4CV8A 3BRBA 3COHA 4GK2A 4BHNA 5IH4A 4C2WA 4ZMFA 3ZUUA 2OJGA 3LCKA 4HW7A 3MVHA 4GUEA 5CZHA 4FNYA 4RZVA 3PXRA 4RSSA 4L68A 5JZNA 1Y6AA 3BYMA 3NW5A 3MB7A 5DRBA 3BU5A 2YN8A 3WOWA 4FKGA 5KMJA 1FVRA 3H30A 1YKRA 3QA0A 4LI5A 3R71A 3PFQA 5A14A 3EYHA 1ND4A 3D94A 3DBEA 4AZFA 3V51A 3D5VA 4AQCA 3SHEA 3R7VA 4HNFA 3D5XA 3F61A 4G6NA 3ZC6A 4F9BA 4MXCA 3QA8A 1OKZA 4XLIA 4ZTSA 3W2RA 2CPKE 5BX0A 3GVUA 3HAMA 2ITVA 4FODA 2XIXA 4O7LA 4TWOA 4UZDA 2G2IA 4A9TA 4WA9A 3FI4A 2BRMA 2OGVA 2XNPA 2C69A 2ITPA 5LCJA 4O84A 4IJ9A 5B2KA 2O5KA 4M84A 1H26A 4E4XA 4Q9SA 3L8SA 3DY7A 4YTCA 3FKNA 5HCXA 3PE2A 2WHBA 1URWA 4YJRA 5IG1A 4BYJA 1GIHA 4KBKA 4DF3A 2YM3A 3R1SA 3A7HA 2FUMA 4QP9A 4WG4A 3DQWA 3Q9YA 5I9UA 5LARA 5HLNA 2C47A 1RE8A 3BLHA 3C4ZA 5BYYA 2IN6A 4AOIA 3FL5A 4Q9ZA 4CFXA 3MH1A 4YU2A 2X4ZA 3WZDA 4FV0A 1ZOEA 2G01A 1OVEA 3GFWA 3NFFB 3PDTA 4MBLA 2B7AA 3NZ0A 3QWKA 4XX9A 3QKKA 5L2SA 3HMMA 2QD9A 2I0VA 3ORIA 4MBJA 5ETIA 1DAWA 3D4QA 4XEYA 4AAYA 1ZLTA 2HWPA 2BZJA 2ETMA 3LCSA 4DDGA 2WPAA 1OIUA 3ZS5A 4GH2A 3DBDA 5AV4A 5L2TA 2WTIA 3FC1X 5DG5A 5AADA 2ZOQA 3KCKA 3NVKI 4X3FC 3P08A 1CDKA 1IRKA 1SZMA 4ZIMA 5BVOA 3VS3A 5HIBA 4ASDA 2OICA 2W1GA 4FSMA 4GVAA 4XG2A 2QI8A 1CSNA 4ACGA 2WIPA 1P5EA 4O7VA 3KIOC 3IOKA 2PPQA 3Q4CA 4WD5A 3OOMA 4GIHA 4D4VA 4EK4A 4F7SA 3HNGA 5AP5A 2F7XE 4QQJA 2JDVA 4FIJA 3PWDA 2VO6A 2XVDA 3DNDA 3BGPA 3ZFXA 3KF7A 3PJ3A 3IQ7A 5ETAA 5C8NA 4OTIA 1UVRA 2Z7LA 3JPVA 4NWMA 1ZYSA 3BIZA 4M14A 2JIUA 5I9WA 2R0UA 4GK3A 1WFCA 5TOZA 4D0XA 1W98A 2YIQA 2XALA 5LVLA 3IO7A 4BDDA 2OSCA 3KXHA 4JT3A 2UW3A 3C51A 3QXOA 3RPVA 2XNOA 4L7FA 4S32A 3LCTA 3ZZWA 2XJ1A 3GU8A 3Q9WA 2CKOA 3QHWA 4G17A 4LDTA 2WMSA 4BJJB 4UXLA 1K2PA 3FUPA 5GHVA 1BI7A 1VLRA 1GOLA 1LUFA 4FNXA 4NTTA 4F0GA 4J52A 3UYSA 4EHVA 3QRUA 2BDWA 2WD1A 4ALUA 3K3JA 4I5MA 3VUDA 3P0MA 4A9YA 3EQDA 4N70A 4QMPA 3D7TB 4XG7A 4YLKA 4EWHA 3PLSA 3ZH8A 1P14A 3BHHA 3UQFA 3DLSA 1KE6A 2I0HA 3UIXA 5E7RA 4X21A 4D1ZA 3BWFA 2BKZA 5E9EA 4ZTHA 3U87A 3OFMA 3ZBXA 4MXYA 1Y8YA 4LYNA 1YOJA 3FZOA 4F64A 5D9HA 3SQQA 3V5TA 3LFCA 4O7SA 4W4WA 4BCMA 4FV7A 4K11A 3VJNA 4TT7A 2WTWA 4JXFA 2HZIA 3WZKA 5CAQA 3FDNA 5EM7A 3NFGB 4EHEA 3F7ZA 2OK1A 4H58A 4EQUA 2BKKA 4IEBA 1KSWA 4FVQA 3EQFA 4RWKA 3PJCA 3NUUA 1HCLA 3P1AA 3BCEA 1BLXA 2OH4A 3PSCA 2CGUA 3P5KA 2OIBA 2HAKA 4DHJA 4AN2A 5F20A 1WBVA 4D2SA 4EKKA 3U55A 3P7AA 2NP8A 3DBQA 4HZRA 3QCYA 4O2ZA 4UYNA 5FLFA 4EBWA 1DAYA 5A4LA 1XBAA 2JITA 4GG7A 3WYYA 3MY5A 3LMGA 5FDXA 1PXPA 2ZYBA 1PKGA 1QMZA 4AX8A 3FYJX 2V7OA 4EQMA 3WZUA 4DH5A 4H3BA 5BVNA 3BU6A 4A7CA 2R3PA 3IK3A 4QYFA 4UWYA 3U4UA 4DTKA 2ERZE 4ACHA 4BCGA 3LOKA 3GUBA 3QQGA 4FZDB 4YZCA 4NKAA 3ZFMA 3UGCA 1FBNA 2Y4PA 3NCGA 3LCOA 4PV0A 1OKVA 4D4SA 5HZNA 3O0GA 5HI2A 3VUKA 4R1VA 3V5LA 3ORMA 2XS0A 4OBPA 4ITHA 3QZFA 1UNHA 4BBMA 2IVVA 2GNLA 2VD5A 2VTIA 3POZA 5ANIA 4C0TA 4F63A 4WRGA 2ACXA 5CU3A 2QR8A 2W96B 4TYEA 2WMVA 1TQIA 5M53A 3E87A 5E8WA 2X9FA 3DT1A 4DFUA 3F6XA 2PZPA 4K18A 5EM5A 4FSWA 2VTQA 2X0GA 4CRSA 5AIKA 4DHFA 4C7TA 3PPJA 1PMNA 3QQJA 5J7HA 3KCFA 2XKEA 3R8LA 4BYIA 2XZSA 3G33A 3HDMA 4APCA 2C5VA 2XYNA 3MESA 2XF0A 4QMNA 2ZDUA 2GU8A 5T68A 2ZM4A 4TWNA 4O22A 3UP2A 4PMPA 3E64A 1PXIA 2CCHA 3IDPA 5CT7A 3BEGA 2WB8A 4FV3A 4CFVA 4CD0A 5A4EA 1NA7A 4I41A 4C2VA 1YWNA 2HY81 2OJJA 3A4PA 3F2AA 4LV7A 4YJOA 4E6AA 5HO8A 3LFQA 3ZBFA 4F70A 1IASA 1FQ1B 5CZIA 3ALNA 2DUVA 3HP5A 5M4IA 5C03A 4EK8A 3BU3A 2PMOX 3NYVA 4LGGA 2ZV2A 3D2KA 5AUYA 5GIPE 4AOJA 3UG2A 2C6KA 4IJPA 4QP2A 4MD7E 5LWNA 5CSPA 3QD0A 5KBRA 2OFVA 2W9ZB 4FKIA 3FMHA 3Q32A 4F0FA 3OY3A 5ANJA 2X1NA 3TDVA 5DLSA 3FXXA 2YEXA 4EC9A 1QPEA 1OL1A 4CFNA 4LQMA 3R9OA 1SMHA 3RPOA 4BRXA 4RIYB 5HG9A 3KMUA 4BIEA 1KOAA 2VX0A 1ST4A 4C4GA 1LP4A 3H10A 1WBNA 3JUHA 4UWBA 1XH9A 3W8QA 1JQHA 3D14A 4IX5A 3OP5A 2JKQA 3KN6A 4GVJA 4DLIA 4BTMA 3L9PA 1M14A 5M4UA 2GQGA 3G90X 1ZYDA 4D58A 2OIDA 3F5PA 4H1JA 3ZO2A 4DBXA 2X8EA 1PMEA 3V6SA 2QG5A 2J7TA 2CHLA 2HK5A 4FSRA 3JVSA 2GFSA 2Y6OA 4HGLA 4M8TA 4V05A 1H4LA 5FBOA 1G8SA 4HGEA 2UZWE 4IQ6A 5DT4A 4QTDA 4R77A 3VS4A 3CTQA 2BZHB 3KRWA 4L52A 4NW6A 3FSFA 3MYGA 4AS0A 2AEGA 2YJRA 2DQ7X 5F94A 4HZSA 4OTHA 3K2LA 5ANEA 4JS8A 3FKLA 4L3PA 3L8XA 3A99A 2B4SB 4CQEA 4AE9A 2HZ0A 4DH1A 5D1JA 3HX4A 4EUUA 2OJIA 4IWQA 2OIQA 3VRZA 4AA4A 4BCFA 1V0OA 1MRVA 3CEKA 3LW0A 2VTMA 4FKOA 4I5PA 4MAOA 2UVYA 5IA5A 3BELA 4RA4A 1XMLA 1HCKA 4QYGA 2UUEA 5J9ZA 4A4LA 1ST0A 1OL2A 2OG8A 2BTSA 3W0NA 4XG6A 1Q99A 3BQRA 3PY3A 4K9YA 1W8CA 4U98A 3F7WA 2QHMA 3ATTA 4QO9A 4CV9A 5I0BA 4O0YA 3AKKA 4QQCA 3Q53A 4M15A 2XNNA 3V04A 3QZIA 2ITUA 4YO6A 2O64A 3B2TA 5JKGA 4F99A 3MFUA 5A4QA 2H9VA 3ZDUA 4W4YA 4ZY4A 4MQ1A 5LCKA 3SG9A 1FGKA 2P2HA 3TV7A 1PXOA 4E8AA 3JY9A 1WBPA 4IM0A 5EHYA 4DT9A 1ZZ2A 3R9NA 4PNKA 1YXXA 1FINA 1H1WA 1U4DA 3FEGA 3U54A 4BBFA 3WZEA 5C8MA 3FMNA 5AP0A 3FMLA 3A62A 2GTMA 4L9IA 4P5QA 4EH6A 4AQKA 4JLCA 2QR7A 4RMZA 3EFWA 3O5AA 4WUNA 2YM8A 4FIIA 5EK7A 4KINA 3AKJA 5CAUA 4YBJA 4FA2A 2UW5A 2C5OA 1UWJA 1Q8YA 2WQMA 3DBFA 4Y95A 3DFAA 5CVGA 3D9VA 3HYHA 4BZDA 4U43A 3MI9A 2ITWA 4O2PA 2VTHA 4RJ5A 1M2PA 3H9OA 4O7YA 4E5AX 1WBTA 3ZSGA 3WE8A 4J8NA 3O8UA 4WBBB 3VS6A 2ZAZA 3CS9A 4OBOA 4F9YA 1OIYA 2XIYA 4I5HA 4QP7A 5AX9A 1PXMA 3ANRA 4ZTLA 2IZUA 2XK6A 3AMAA 3MWUA 4NM0A 5AUTA 2VU3A 2JKOA 4TTHB 3O8TA 2I0EA 3C0HA 3PWYA 1LPUA 4G6OA 2BAKA 4JR7A 2HIWA 1Q8TA 3E7VA 3NW6A 1UKIA 2PUUA 3Q6WA 5FUTA 2J2IB 5L3AA 4PDSA 4M12A 1JKSA 3OWKA 2B9IA 4Y8DA 3ML1A 3FMMA 4IAZA 4DINA 5KMLA 4B8LA 1YQJA 4BR3A 2HCKA 3GT8A 3MA3A 3C4CA 4I22A 4ZS4A 3L8PA 3Q2JA 2Q0NA 3QYZA 4QYEA 4QP6A 4YC6A 2X39A 5DT0A 2VTSA 5HHWA 5IH6A 4RVLA 2ITYA 4G31A 3U51A 4FKRA 2IZRA 3BHVA 2XUUA 4NJDA 4EK3A 3F5UA 4FV1A 2QLQA 4TZRA 4V0GB 3SA0A 4MH7A 1JKTA 3BLAA 4FEQA 5FEDA 2PVNA 3NUPA 4BIBA 1H07A 4DEGA 3EQGA 4ZY5A 4A9RA 4FTQA 4FYOA 1JPAA 2QKWB 3DK7A 1G8AA 3N4TA 5HGIA 1W84A 4CNHA 5TF9A 4BTJA 5BPYA 4GJ2A 2YA9A 3FZSA 1PXJA 4K6ZA 4WNOA 3ID6C 2A27A 4LM5A 4DT8A 4MEDA 3OW3A 2FSMX 4LUDA 3SXFA 3FMJA 3ROCA 4AW1A 4BZOA 4NCTC 5LMAA 3ZXZA 1Y8GA 3QWJA 3GU6A 4WNMA 4I3ZA 4O7ZA 3VWAA 5L6OA 4CLJA 5DEYA 4J8MA 4FL2A 2XAOA 5CSHA 4BCHA 4EOPA 3G9LX 3UDTA 2PVKA 1UU3A 4HVHA 3GCUA 2XKCA 4JL9A 3TL8A 2VO7A 5HX8A 4JIKA 4C35A 4DCEA 1KUTA 4CZTA 4ZLZA 2FH9A 3I7BA 5HTCA 4DG0E 5KX8A 4U40A 2C6IA 3CXWA 3E92A 5FTQA 3KK8A 4I6FA 3PRFA 1H25A 2XK8A 3FLQA 2F49A 4IFGA 4JRNA 3TV4A 3ODYX 3PVBA 4TNDA 4U80A 2C6LA 2YIYA 3FKOA 3L1SA 3QF9A 3BLRA 3PJ8A 2JIIA 4CTCA 3OY1A 4F78A 4XBUA 3E7OA 3OCGA 3R22A 4JBPA 5BYLA 1REKA 1YDRE 2XRWA 3MVLA 3TZ9A 1YXSA 3HECA 4NM5A 4E6CA 3R2BA 1AGWA 4OLIA 4FTJA 4TWCA 3VUHA 4AF3A 4DEIA 4TN6A 1ZOGA 4XBRA 4L3JA 4RLLA 5HCYA 3R28A 4HPUE 3UPXA 4QP4A 5EDQA 4AZEA 5IEXA 2ZM3A 3DK6A 5FQDC 4PDYA 2Z60A 2C3LA 3BYOA 3DV3A 3KXGA 4S34A 5D12A 5GJGA 1MP8A 3ACKA 2CN5A 3OW4A 4FIFA 3SX9A 4ACCA 2XNBA 4EBVA 1WBWA 4HOKA 5JGDA 3ROYA 3FYKX 3DXNA 4QMSA 2ITOA 3V3VA 4FUYA 2G1TA 4WNPA 3UDZA 3QD2B 4BI1A 5HVKA 4YNOA 3TZ7A 5HICA 2UW6A 1OL5A 4JDJA 3IPHA 3PP0A 4XHKB 3GBZA 4YZBA 2WMWA 5C01A 2BDJA 4JAJA 3RNIA 3WIGA 5EW9A 3UNJA 3UNKA 4L00A 2ONLA 3I81A 5L8KA 3NIZA 4GSBA 5J8IA 3JXWA 4GRBA 3LCDA 3FMEA 5FGKA 4RIWB 2WQNA 4MXOA 3DZQA 5CXHA 3HA6A 4KSQA 4A4OA 3OS3A 3PG1A 4U97A 1OMWA 5AUWA 5HNGA 5HE3A 4A9UA 2UW0A 3CIKA 1JSUA 3KF4A 3NUXA 3C1XA 3PIZA 2CMWA 4IDVA 4F0IA 4USEA 3PVWA 2OU7A 3B2WA 4AP7A 4J53A 3A7IA 4F65A 5JN2A 3DPKA 3OT3A 1SVGA 5FP6A 5HLWA 3E5AA 3OCTA 2EB3A 4AZVA 2XNEA 3L8VA 1KWPA 2ZMDA 3R9RA 3ZC5A 2R3IA 4XRJA 4NK9A 3EN6A 3IW4A 3AD6A 3O23A 4JG6A 3VJOA 4BJJA 4GYIA 4FV5A 5BUJA 4ANMA 2BUJA 3AC1A 4FT7A 4RLKA 3CJFA 4ONAA 4U81A 3VQHA 4A4XA 2JDSA 2PL0A 3HV4A 3A7GA 1Y57A 3BE2A 3PXKA 4M0ZA 4YHFA 5EKOA 3V8WA 3PJ1A 3LAUA 3F66A 4B99A 4ZTRA 2C5XA 4K2RA 2B53A 4WHZA 4MYGA 1M2RA 2W4KA 5AUVA 3W0PA 3S1HA 5L2IA 5KMKA 1KOBA 4HYHA 4G3EA 4U0IA 4YLLA 4DAWA 4FC0A 4MF1A 4CFWA 4U45A 3DQXA 1XH4A 3PE1A 4FEXA 2C68A 2VWIA 3RMFA 5F9EA 4AA0A 3NNWA 2XCKA 5C9CA 5I9YA 5KKRC 2XEZA 4U79A 3ZU7A 2X7GA 2XRUA 3BYUA 4ZEGA 4L67A 3WF5A 4YNEA 4IANA 1UNGA 2QONA 1YOMA 1I44A 2C5YA 2YZLA 2I0YA 4RC4A 4E73A 5J9LA 1KE5A 5HG5A 3JS2A 5E8ZA 4NM7A 3VUGA 3VAPA 4BVUA 4C59A 2O3PA 1Q5KA 4Z55A 1A06A 2HOGA 2PZIA 2WOTA 4OTDA 4AOTA 1H24A 4I6LA 1OGUA 5KMNA 2VZ6A 4B8MA 3VS7A 2GCDA 5AMNA 4EEVA 4YTHA 5DI1A 1Q8ZA 3FL4A 3CC6A 3QLFA 2ONLC 5LJJA 3R8PA 4BCPA 5GINE 1E1VA 2CSNA 5A6OA 3DTCA 3NNXA 3RALA 1Q8WA 4E6DA 3BBWA 2V55A 1H1SA 4UALA 3DBCA 3DAJA 4YPDA 1OIQA 1U5RA 1UU8A 3N4UA 3PIXA 3KY2A 3E93A 2WEVA 4JQ7A 4QMMA 2OLCA 3NYNA 2YM4A 1XHAA 1MRYA 2GHMA 4H3PA 4GT4A 5DIAA 4FIEA 1P4FA 4GKIA 3DAEA 4N6YA 1Q3WA 3THBA 2BFYA 4DFZE 1FMKA 1M7QA 5DGZA 5IMXA 5AEPA 5K5XA 1FVVA 2YIXA 3V8TA 3WARA 4AGDA 4AW0A 3QC9A 4JQ8A 1YXVA 3R30A 5C4LA 3BE9A 3QCXA 4USFA 3A8WA 3OVVA 1TVOA 3P5JC 1WMKA 2PU8A 3AT2A 4MXAA 4NFNA 4O7TA 2R0IA 2W1FA 4ZS0A 1UWHA 4IX3A 2YIRA 5BMMA 4DGLC 5EYCA 5AV2A 1CM8A 3ZEPA 4DG3E 3QLGA 4JRVA 5CENA 1OECA 3CSVA 2OFUA 3QZHA 2Y4IB 3U9CA 1UV5A 4GCJA 1ERKA 2QKRA 4RQKA 4IB3A 2PZYA 3CKXA 3OCBA 3UYTA 4L45A 5IQEA 2YDJA 4ZAUA 4HVDA 3EN7A 2XIRA 4DFBA 4ACDA 2B9HA 3CY3A 4I5CA 5HNIX 4FSUA 1YI3A 4IH8A 4IVBA 4FG8A 4FI1A 4I21A 5IF1A 5IQCA 3DB6A 4O83A 3SGCA 3EKKA 2GMXA 5AX3A 4V01A 4DITA 4MD8E 3Q96A 4JVGA 1R0EA 4ZXTA 2VX1A 3NCZA 4C37A 5CAVA 3I60A 2YJSA 5K5NA 1W0XC 3R8UA 2BZKB 2XB7A 5DHJA 2OZAA 4C33A 4BDAA 4CCBA 4GMYA 3R73A 2R3QA 1PYEA 3HP2A 4PL5A 5EOLA 4S31A 3VS0A 4AW2A 2IVSA 3EQRA 4U3YA 1YI4A 2YERA 4L43A 3UC4A 4JBOA 4NT4A 1W7HA 3BHUA 3F69A 5ANOA 4A06A 5HG7A 5JFWA 3QD4A 3G0FA 3LZBA 3QQLA 1JAMA 4U41A 2VTOA 3AT3A 3FPQA 4EK5A 3VNTA 4YPSA 5M09A 2X6EA 2F7EE 1XR1A 3LQ8A 4YJUA 3LFDA 4XP3A 5CNOA 4BCQA 3PLAE 3LFAA 2EU9A 3BKBA 5JRQA 3I5ZA 3OWJA 2PVFA 3ENMA 2Q83A 3QTRA 4O7WA 5FEEA 4DA5A 4EWQA 3VS1A 4BC6A 3TUBA 5DA3A 1S9IA 3CD3A 3IGOA 5CF5A 3H4JA 2I7QA 4LMUA 3ZSIA 4IBMA 3NMUF 1X8BA 3ZTXA 1F5QA 3SKCA 1ZWSA 4O7OA 1IA8A 2UW8A 2CCIA 3N4VA 4GIIA 3H3CA 1VYZA 5A4TA 4Z3VA 4JG8A 3C9WA 5E1SA 4QPSA 3P4KA 2QC6A 5J87A 4F09A 4O91A 4CEGA 3MV5A 4NZWB 5M06A 3HZTA 2AYPA 5ANGA 4ANQA 3G5DA 1XBBA 3RAIA 4EJNA 2C1AA 5AV0A 5ETFA 2JDRA 3HDNA 3Q52A 5J9YA 3POOA 4XP2A 3AD4A 4FKJA 5AP7A 3I79A 3ZUTA 3LIJA 5J1WA 3GQIA 2QOIA 5C4KA 1VEBA 4AAAA 4DEEA 4ZK5A 3LXLA 3TN8A 3UBDA 5JRSA 3SW7A 4ACMA 4Y85A 2XM9A 3GC8A 3Q60A 2YM6A 3CGOA 4NW5A 3UDBA 4DTAA 3QQHA 3DAKA 1YDSE 3ZO3A 1PY5A 4TW9A 5IUIA 1PMUA 4O81A 4WUAA 4IM2A 2F9GA 1AD5A 1ZY4A 3HRFA 4C4EA 4CFUA 4DYMA 1JLUE 1XO2B 4BDHA 3OHTA 4FSZA 4JIAA 4A07A 4JMQA 2ZDTA 4ASXA 3UQCA 5JQ8A 2BPMA 3PSDA 3HMPA 4I0TA 3UOKA 3UMWA 3V5JA 4PRJA 3KEXA 3SVVA 1GY3A 4MTAA 4W4VA 4IX6A 4YTIA 2WMQA 3L9NA 3PZHA 5TR6A 1B39A 3AOXA 2A0CX 5EW8A 5HVJA 1DM2A 5KMMA 4RPVA 4XJ0A 4C3PA 1KE9A 2Y9QA 4I0RA 2QU6A 2XK3A 4LV5A 4G3GA 4EI4A 2FSLX 1GAGA 4AG8A 2PTKA 5CEPA 4ALWA 2VV9A 4KUJA 1OPLA 2QHNA 3VS5A 4GG5A 3AQVA 2BAJA 4QMUA 3K5UA 3VW8A 2ZJWA 4QNYA 4EZ5A 5FM2A 2G2FA 2X2KA 5FG8A 4FZFB 5JFSA 3QTXA 2ZM1A 2BHHA 4F6WA 1Q61A 4XV1A 3CJGA 4WO5A 2UW7A 1G8KA 3CE3A 3WI6A 3WYXA 4BDJA 3VBXA 5LMKC 4DFLA 4EUTA 1CKJA 1MQBA 1LEZA 3ZRLA 4OT6A 4EH3A 4ZZNA 5AJQA 5KHXA 4JDKA 3P23A 3CQUA 4KIQA 3ZOSA 4XG9A 3A60A 3VBYA 5IDNA 2FYSA 4RWIA 4FG7A 5DE2A 3R8MA 1J7IA 3LLTA 2CN8A 2WTDA 3MW1A 3ERKA 3NRMA 1O9UA 3ULZA 4QP3A 5DR9A 3UQGA 4U44A 3W33A 3RCDA 1Q62A 1YRPA 4S30A 1BYGA 1YHWA 2SRCA 4L53A 3BYSA 2X4FA 2WIHA 3Q5IA 3ET7A 3OTUA 2J5EA 3LFNA 4KS8A 3NR9A 4Y72A 4YC8A 4U5JA 1MQ4A 3F3VA 4FV4A 2CKPA 4HNIA 4RJ8A 2RG5A 4CTBA 2VRXA 5KCVA 2BRBA 3W32A 4UY9A 4X3FA 3NDMA 5FTGA 3K3IA 3ZO4A