5C4LA

Conformational alternate of sisomicin in complex with aph(2")-iva
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoglycoside binding and catalysis specificity of aminoglycoside 2-phosphotransferase IVa: A thermodynamic, structural and kinetic study.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
molecule keywords APH(2'')-Id
total genus 98
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c4lA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 5c4lA02
2WB8A 3O7LB 3O2MA 2EB3A 3FHRA 5BYLA 2HWOA 4FV5A 3TNWA 5CZIA 5LMBA 4ZIMA 3WI6A 3CQWA 4I4EA 5ICPA 4YSJA 2O5KA 2JITA 4EK3A 4E8AA 4AAAA 2R3FA 2QOKA 3NYNA 3NW6A 4RT7A 1OL1A 5C01A 2IW9A 3ZO1A 2GFCA 2XVDA 3CEKA 3C4WA 2FVDA 3ANQA 4U6RA 5AP6A 3R73A 3TUBA 4CNHA 4MCVA 1FVTA 5IQAA 2OXYA 4DEGA 4B0GA 3EFLA 2B0QA 3QLGA 3NVMB 5T3QA 1O6LA 3LQ3A 5CAQA 4Z3VA 5HD4A 2E9NA 3BGZA 2HOGA 3QZIA 3PTGA 4NM3A 4MBLA 5BX0A 3IW5A 4IEBA 2UZTA 4FTOA 3COMA 3DKFA 2QO2A 4GG5A 4K8AA 5CT0A 5A4CA 4AP7A 4O27B 3TYKA 4YJQA 1QPEA 2PVNA 1WBSA 2XKDA 2WTKB 3IQ7A 3OBJA 1UU8A 2JBOA 4J99A 5LMAA 2UZBA 2YA9A 4USDA 4HZSA 4IQ6A 3QCSA 3CJFA 3OUKA 2H34A 2A1AB 3UP2A 3AGLA 3VW8A 4GK4A 4YJNA 4I23A 3E8EA 3LFBA 1BI8A 2C6DA 1W84A 2EUFB 3NW7A 4C2WA 2W1CA 4J1RA 3VBVA 3FYKX 4PDPA 3R1QA 2JD5A 4YSMA 4C4JA 4JQ8A 2YDKA 5CEOA 1NXKA 4IM2A 4KS8A 5CX9A 3RJCA 4HW7A 4UN0C 4A9SA 3NS9A 5EYKA 4CZTA 4HCUA 3ZXTA 1NVQA 2BFYA 3PSDA 3MVLA 2OZAB 4L46A 1YOJA 4AA4A 2AC3A 4BCJA 4ZTMA 4IE9A 5G1XA 3Q60A 3KY2A 3OEZA 2WTDA 1FMKA 4N0SA 4D5HA 4CXAA 5JMSA 3DBCA 3G51A 3CBLA 3NAYA 1O6KA 3GU4A 4G9RA 4NCTA 4OBPA 1ZOHA 3OOGA 4AT3A 3MS9A 3BU5A 3QTQA 1XH4A 3GCVA 4ALUA 2FUMA 4EUTA 2QHNA 3DK3A 4R3PA 1MRYA 3ANRA 5DH3A 5C4KA 2R3NA 1IASA 4M15A 4XG9A 3D9VA 1SVGA 3MFTA 5EM8A 4O7WA 2F2CB 3DJ6A 4FR4A 1AD5A 3H3CA 4UYNA 3DAEA 1GIJA 5KBQA 3TACA 4RC2A 1LEZA 5CASA 5JZNA 4D4RA 2CGVA 2V0DA 2VN9A 3NEWA 5FLFA 4X3FA 4FVQA 2GS7A 1FBNA 1UVRA 4X2JA 1PMEA 3RMFA 4CMTA 1H8FA 2XCHA 5FEQA 4ZS4A 3UQFA 1GY3A 4FSMA 3KEXA 2PZPA 4GFGA 4ZOGA 2CNQA 4BDAA 4A4OA 5IZFA 2B9JA 2PVHA 3EQGA 3ZUVA 2IZUA 3BHTA 2XP2A 3OD6X 5DNRA 3FSFA 4D4SA 4CD0A 5ANOA 5KE0A 1W0XC 4AQCA 5IEXA 3FPMA 4EONA 2FO0A 1ZYDA 2W5BA 2FSOX 5AP4A 3TUDA 2J2IB 4FTNA 4AZEA 3ZU7A 5KMLA 2QD9A 4I0RA 3PUPA 3PXQA 4W4WA 4XEYA 2H96A 2OJ9A 2YCQA 3F66A 3G6GA 3OTUA 4RWIA 2I6LA 4U42A 3WYXA 3I6UA 2ITTA 4KKEA 5FP6A 3I5ZA 4JXFA 4PWNA 5DN3A 4D1XA 5KO1A 2G2HA 5BYZA 2CN8A 3V5JA 4UX9A 5CSXA 4YTCA 2VZ6A 2J9MA 4U94A 5F20A 2J7TA 1OKWA 4OTRA 4ZSGA 1KV1A 2YM4A 3UE4A 2F49A 2GHGA 4PNIA 5A54A 3UC4A 3S00A 3A99A 3R1YA 2R3OA 1Q4LA 3CIKA 4GT5A 2QURA 4BZOA 3W8QA 4QMXA 4X21A 4BDBA 3R71A 1XO2B 3Q9YA 4BDKA 4YLKA 4LL5A 4IM0A 4DA5A 5A4QA 1YHVA 4NJDA 3QGYA 3R9RA 4FSUA 3LIJA 3TTIA 3IW6A 1PY5A 3P78A 1V0PA 5H3QA 1OZ1A 2YABA 5B2LA 1OM1A 4EYMA 4IAFA 2OIDA 3GOPA 3QWJA 5DR9A 4BTKA 2VNWA 4OTWA 4RA4A 3GQIA 3LLTA 3D2KA 2VV9A 5BPYA 3FWQA 4J95A 1OKZA 4FKVA 3DBQA 4FZAB 4A06A 4I3ZA 5HE3A 4FKGA 2YIXA 2QG7A 2Y4IC 4FIFA 4JIAA 4L8MA 4TTHB 4RC3A 4QP2A 3UO4A 4R1YA 3HV4A 2IG7A 2WQMA 4DCEA 4DH3A 3PJCA 4M13A 1XBAA 2B54A 3CD8A 3BHHA 3DNDA 3SD0A 4YJOA 4D55A 4NIFB 4MNFA 4ZTHA 3DV3A 3G6HA 3QRTA 4ZSEA 5HEZA 3RAIA 4F7JA 5EH0A 5IUGA 1QPJA 5CS6A 3QHRA 5AUZA 1BI7A 4YTHA 2WMBA 1WBNA 2XJ1A 3HRFA 4KRCA 4ASEA 3H9RA 4BN1A 1JKSA 3PY1A 3T9IA 3BRBA 4R3CA 3W1FA 3DK6A 2VTSA 3M42A 3UIMA 3CGOA 3S3IA 4BCFA 4RX8A 4LV5A 5CEMA 5AP3A 4B7TA 1Q61A 1H25A 2V5QA 4GYIA 4BTJA 3QQGA 4XV1A 4GH2A 3W2QA 2JBPA 5CAPA 2RF9A 3GC8A 3T8OA 2RFSA 4Q5EA 1LR4A 1H08A 4O0SA 5HESA 4PY1A 3W16A 4KD1A 3ZTXA 4C61A 5JH6A 4M3QA 4QP8A 2CPKE 2OH0E 3FLYA 4K18A 2Z7LA 4FV0A 2ITPA 2BZHB 4DG0E 2XNPA 4FSZA 2WQEA 4X0MA 5HBHA 2X8DA 2E9OA 4O7SA 4DBXA 3AD5A 1JWHA 4DFZE 1KE6A 1FVVA 1GZNA 1AQ1A 4I6BA 4O0WA 3A7GA 5DG5A 5D9HA 1X8BA 2VWXA 3LXNA 3QALE 5AIKA 4OW8A 2J0IA 1Q99A 4FKRA 5D11A 4O83A 3UJGA 4XOZA 5M55A 1V1KA 3PJ2A 3QZHA 4EZ3A 1M14A 2YCSA 4DG3E 4FIHA 1TVOA 2CKOA 4AW2A 2WZJA 3CTHA 3W33A 2XIRA 3PLSA 1PKGA 3A62A 4MNEA 4WUNA 3CCNA 4DEBA 5M08A 2WMSA 4JR7A 4DH5A 1R39A 1NA7A 4C0TA 2R9SA 3PFQA 4EJ7A 3VQUA 3OWJA 2UVZA 4FIJA 4ANSA 4O0YA 2XK6A 3HRBA 5E8VA 5IQGA 5EOBA 4ZXTA 2WTWA 3UOHA 1Q8UA 2CKPA 4XX9A 3EIDA 4Y85A 2YFXA 3EFJA 3D7TB 5AAEA 3MJ2A 3SLSA 3JY0A 3CPBA 3FMNA 3RP9A 4FEWA 2WMRA 3ZFYA 4F1OA 4FKIA 3W0RA 3TNHA 1IAJA 4NKAA 1J1CA 2OG8A 2W4JA 4NM0A 4DCAA 5KKRB 3JVSA 4YBKA 2VTOA 4S2ZA 3LQ5A 4IX6A 3SG9A 3RHKA 3BHUA 3DFAA 3UQCA 5L2IA 3KRWA 3BLHA 4FBXA 4LL0A 4D1ZA 4C4EA 3MA3A 1H1RA 5L2WA 3LFEA 2PY3A 2EVAA 5D12A 3P79A 1UNGA 2QLQA 4CTCA 2PL0A 5CZHA 3VHKA 2WIPA 1V0OA 1ZYCA 3I7CA 5EI6A 3TL8A 4U79A 3QTRA 4G9CA 4AU8A 3HKOA 5IA2A 2F4JA 3UO5A 4O0XA 3KRLA 3R8UA 3E8NA 4QQ5A 1YOLA 2YACA 4EOPA 3KF7A 4FTJA 3OROA 4GW8A 4PRJA 3K2LA 2ETKA 2QO7A 2XNMA 3N4VA 3VUKA 3C51A 5CXZA 4BCOA 3WYYA 4GU9A 4G16A 5HX6A 1OITA 4Y5QA 3ZHPC 3G9LX 3OWPA 3CTJA 4O7TA 1ZMWA 4X2KA 4W4YA 1NY3A 4XNEA 4ZSLA 2X6EA 4PP7A 3QLFA 2OSCA 3Q52A 5ETIA 4BIBA 3MI9A 5KMMA 2R3QA 3THBA 3VF9A 3RAHA 3UPZA 3GCUA 2BALA 3H9FA 2VUWA 4MQ1A 5GINE 3W2PA 4AW0A 4M0ZA 3A60A 4I22A 4GVAA 1MQ4A 5J87A 4MNEB 4DHFA 1OB3A 2OICA 3E7VA 3OEFX 5LMKC 1YKRA 3EWHA 4L42A 4U97A 3R0TA 4XLVA 5LWMA 2UW0A 4F70A 2BDWA 2VX1A 1JSTA 3IDBA 3U55A 3ORXA 4DTKA 5ITAA 3FKLA 2WPAA 4PTGA 4IVDA 4XH6A 3ZSGA 3EKKA 4FODA 4IDVA 2QKWB 3OZ6A 3Q3BA 5G6VA 4EK5A 4J53A 4FL1A 4OTIA 4FGBA 4TYGA 5A6NA 3A8WA 4FKQA 3CQUA 4WRSA 3ENHA 3V8WA 5J7HA 4O96A 5EW3A 5CF8A 3ZZEA 4U45A 3NCZA 4R1VA 5D1JA 4AFJA 3I0OA 2W06A 2X4ZA 4FKSA 5EQYA 5HG9A 4AT4A 3MB6A 4V01A 3DOGA 1I09A 4MWIA 4O21A 2QCSA 4ACCA 5I9VA 5J9YA 4DGNA 2Z8CA 4RMZA 3MB7A 5F95A 2V7OA 4A4XA 3FZOA 4FTTA 5HG7A 4I4FA 3NAXA 2WELA 4QNAA 2WU7A 4V04A 2HELA 2ITVA 2XJ0A 2Y4IB 3FYJX 3C4FA 4G6NA 1FINA 4I5HA 3JUHA 5I9XA 4YZDA 4GT3A 5TT7A 1CDKA 4D1SA 4X3FB 2PTKA 4BVUA 4WBOA 4JDJA 2ZB0A 2QODA 1O6YA 4NT4A 5IISA 3EQIA 4ZZOA 3LW0A 5DIAA 3KFAA 4QMOA 2BZKB 4ID7A 4EBVA 4LOOA 5E7RA 2Y8OA 3TZ7A 2BAJA 3TG1A 2ITXA 2PE1A 2Z2WA 3DLSA 2C0IA 3PVBA 3GC0A 3ROYA 1SVHA 4L67A 3E8DA 2O2UA 4HVSA 3ZS5A 4M67A 3MTLA 2Q0NA 4F63A 2QLUA 4FSRA 3Q5IA 4MXOA 3C1XA 4BGQA 2C5XA 3M11A 1P4OA 1YDTE 1YXUA 4U43A 4MH7A 4PL4A 3ZLWA 2ACXA 5AUWA 3REPA 4Z16A 1BYGA 5LVNA 3NZ0A 3ERKA 4U5JA 5CSWA 5F1ZA 3F9NA 5CQWA 2PUUA 3KB7A 2R3LA 4TN6A 4F0IA 3R63A 1CM8A 4C58A 4JX7A 3K5UA 3PRIA 4BDGA 5DOSA 2UZDA 4XBRA 3NWWA 4IJPA 2YWPA 3NYXA 2FYSA 2ZMDA 3D2IA 3KN5A 5DLSA 3HGKA 3CTQA 2WQNA 5GJFA 4IZ7A 3V6RA 4AGCA 4H39A 5EW8A 4BZDA 1H00A 4LFIA 2VTNA 4E26A 1JAMA 3WZDA 2V55A 5A6OA 4RX7A 1M52A 4FKPA 3QKLA 2VU3A 2W4OA 4ANLA 5JGAA 2G2IA 3BQRA 3I81A 3C7QA 4L52A 3NMUF 3ZUUA 2YM8A 3V8TA 4DYMA 2Z7QA 4M12A 3I5NA 4NK9A 4CFUA 4E20A 3ITZA 3BV3A 3SXFA 3Q2JA 3JXWA 4F7NA 5FRIA 4FL3A 4MWHA 4DEHA 3FZSA 4FTKA 3SC1A 3PVWA 4ZY5A 2CN5A 3AC4A 3AMBA 4I93A 4LRKA 2C3IB 3BQCA 4JIKA 5EG3A 2PVFA 3SOAA 4BDFA 2ETRA 4JT3A 3IDPA 3NRMA 3GOKA 3KULA 4JBVA 3DY7A 4RIYB 2V22A 3OXIA 5HQ0A 3FMLA 4FT0A 1PW2A 1VYZA 3Q4ZA 4KIQA 2XRWA 3BX5A 4TYHA 4L01A 3HNGA 3MVMA 3DQXA 3QQUA 5EQPA 4ZTNA 4P90A 3TTJA 1R0EA 3QX2A 2XM9A 5KMNA 5KX8A 4I6FA 3DTWA 3KXNA 4GFMA 4JAJA 1JOWB 2ZM4A 4FK6A 1ERKA 4IAAA 2UZVA 4O0TA 4FV1A 2OZOA 3NUAA 5CU6A 2HAKA 4D58A 4DGMA 3PJ8A 1OIRA 4FNWA 5IQBA 3N4TA 3FEGA 4YLLA 3VS2A 2Y7JA 4TL0A 2NNWB 5EW9A 2IVSA 1TQIA 4DGGA 3PJ3A 3VQHA 3R7IA 5HLWA 1OL7A 3HLLA 4FUXA 4MAOA 4TRLA 2XS0A 3DAJA 3PIXA 5M56A 2C6OA 4RJ7A 4MXXA 1JPAA 5A4LA 3QQKA 3R30A 4FT7A 4D28A 3TEIA 2PUPA 4EH8A 3ENMA 2QC6A 3KU2A 1W7HA 2GQGA 4PDSA 3PXZA 4U8ZA 2IZTA 2UZWE 2WMUA 3SV0A 3WZUA 1PKDA 4PMPA 3MW1A 4UZHA 5EDRA 1DAWA 2J0MB 3VJNA 2GS2A 5AJQA 4BIEA 3PXFA 2R4BA 3ULZA 3VVHA 4QYGA 5AFVA 3VUGA 4EOMA 4DH7A 3D7ZA 4FSYA 4DT8A 2W1ZA 3PYYA 4FICA 4EORA 3SRVA 1LP4A 4MX9A 5CF6A 1PXLA 3LZBA 3UTOA 1FVRA 5KMOA 4XYFA 3LMHA 4BBFA 4EOOA 2UZEA 1H07A 4HJOA 3ZLXA 4UWCA 2BFXA 3W10A 2BCJA 3POOA 4GS6A 2GMXA 3W0QA 3P5KA 4AW1A 5FQDC 1NVSA 2X2KA 4G5JA 5CU4A 3IGGA 4BF2A 4YZMA 4JX3A 3TZ8A 4F9YA 2IZRA 2RFDA 1YI3A 2UVXA 1CMKE 1F5QA 3NSZA 2GNIA 2XBJA 5DHJA 1WBWA 3OCBA 3QUEA 3TIYA 4USFA 5LVOA 3D4QA 4GFOA 4YC3A 3GGFA 4RVLA 4YO6A 3ZDIA 4DAWA 3ZM4A 1DAYA 1OUYA 2P4IA 4RWKA 2G01A 4AZVA 3O96A 3HRCA 4L9IA 4NTSA 1H1PA 4CFWA 2PHKA 3H4JA 4E7WA 3PIYA 4C36A 2CLQA 2QQ7A 2XIYA 4G34A 5EOLA 5HGIA 2NRYA 2HENA 2ITOA 2ITNA 3AMAA 3KKVA 4RJ3A 4IX3A 5AV3A 5FXRA 4IJ9A 4C02A 3ETAA 3U9NA 1R3CA 2WKMA 5DFPA 4S30A 1YHSA 3RAKA 3U87A 5CSPA 2I7QA 1QMZA 3F3TA 4GKIA 3ORIA 4Q2AA 3SXSA 2XNNA 4G2FA 3VBXA 5M51A 4PL3A 4R7BA 4I20A 1BL7A 4P5QA 4RJ4A 3WIKA 3PWDA 4DEEA 3TCPA 5KHXA 3R28A 1R78A 4QO9A 3DBDA 3D14A 3QTSA 3RCJA 2OBJA 5KZIA 2HY0A 2PZ5A 2QOFA 2ZV7A 2Q83A 3FDNA 3G0FA 3LJ1A 4H1JA 4LRJA 3HMNA 4NU1A 4CKIA 4IX4A 1GJOA 1H24A 1URCA 4KRDA 3R8PA 2YAAA 3TT0A 3COIA 4JAIA 4DF3A 1GNGA 3WZJA 4QP1A 4S34A 4ARKA 4CZUA 1IA8A 3EYHA 3CY3A 2ERKA 2OJGA 3R8VA 4KSQA 2C6EA 1H1SA 2W1HA 4EZ5A 4RA5A 2BIYA 3KQ7A 4ZEGA 4F0GA 1G8AA 1M7NA 4IZYA 2JKMA 4JRVA 4O0UA 5CYIA 4FG7A 4FKOA 3W0SA 4FKLA 3RK9A 2VTQA 4ZTRA 3W2CA 2W17A 3KK8A 4XJ0A 5JT2A 2RFEA 4RWLA 3FXWA 4DH1A 4HGLA 3U9CA 3TNPC 4NCTC 5AA8A 4BRXA 5C8MA 3RNIA 4MXAA 4DLIA 3FKNA 5CT7A 2ITWA 4RFZA 3LE6A 2J5FA 3TZ9A 2Z7SA 5L8JA 4TNDA 3A7FA 4BTMA 4KA3A 3EL7A 2PZYA 3VUHA 2OW3A 1UWHA 2C69A 2KULA 4MQ2A 4Z7HA 2JKOA 3GU7A 5M06A 2HXQA 2VRXA 4BCKA 4APCA 5AA9A 2J5EA 5CAUA 2VX0A 4IB0A 4ZLOA 2E2BA 5EYMA 2FSLX 3K3IA 4YGAA 3QQHA 4TKSA 1NT2A 2ETMA 2ZB1A 1URWA 4FKJA 4G31A 3TKUA 1H4LA 4XG4A 3R7UA 4XP0A 2RIOA 2WMTA 1M2PA 1UU9A 2W1IA 3QC9A 4QMUA 4DFXE 3BU3A 5DVRA 4F1MA 5I9ZA 5KMJA 1NW1A 2WMAA 3U6HA 3MIAA 2OLCA 4BY9E 3A4PA 4EHGA 2YIRA 3I6WA 3Q4UA 5I4NA 5AADA 4OR5A 3MSSA 4Z55A 1G5SA 1TQPA 2X7FA 3C50A 3PIZA 3ZH8A 1BLXA 2YDIA 1LUFA 5EM6A 5JGBA 4PTCA 4M14A 3OHTA 2P33A 2WGJA 4U80A 4O82A 3MH1A 4MEDA 1FGIA 4B4LA 2C1AA 3DBEA 3LHJA 4QOXA 4R78A 5J1WA 3ZC5A 3HP5A 3RTPA 5TF9A 5E8XA 1TQMA 3I7BA 3BHYA 1RW8A 3ROCA 1XKKA 4DH8A 3II5A 4TYJA 4AG8A 4ALWA 4CQEA 3VUDA 3QA0A 4F6WA 2OWBA 1STCE 2R3HA 1YW2A 4I41A 4YP8A 3F5XA 1CTPE 4EK8A 2HY81 4E6QA 4YC8A 1XWSA 3EN7A 4Y5HA 2BHEA 3OMVA 3LFCA 5IA4A 4FSWA 4TPTA 2W96B 4ZS0A 5IMEA 1ZOGA 4XP3A 4EQUA 5LJJA 3L1SA 4CLIA 4C3RA 2JIIA 3NNVA 3HMMA 2X9FA 2XUUA 1P14A 4RX9A 5FUTA 4PMTA 5A14A 3ORPA 3DDPA 3TNQB 3VNTA 4OUCA 4YUQA 3FAAA 4FIEA 4LG4A 1YQJA 5L2TA 4EHEA 2YM6A 3R2BA 3P4KA 4J8MA 1YXVA 4MXYA 4QYHA 5EYCA 5BMSA 4L45A 3OG7A 5TOZA 3VULA 4AOIA 1Q5KA 2HZ0A 4FKWA 1ZARA 4QP7A 5JRSA 1XQZA 4HYUA 4AXAA 3AT2A 5C27A 4FIIA 4H1MA 3E8CA 2GTMA 3P23A 3P0MA 4DITA 5A9UA 2JKQA 4ZP5A 4ANBA 3TI1A 3WF5A 2BUJA 4RLLA 3SHEA 2ZDUA 2EU9A 1OI9A 4TY1A 3C0HA 3FY0A 3AGMA 3PJ1A 4HVHA 2XBAA 3TV7A 3RALA 1VZOA 4HNFA 5L6WL 3H0YA 2Z60A 4BCIA 5HCZA 1GAGA 2XJ2A 4LUDA 4AACA 5LWNA 3U51A 1UKHA 1GOLA 3V04A 1JSUA 5DPVA 3LCOA 1Q62A 3R8LA 4QMQA 3RGFA 2R3RA 2PSQA 3OCSA 3UZTA 2WMVA 2UW4A 3MFSA 4BTFA 3MA6A 3DGKA 5H2UA 5IEYA 3TUCA 1IG1A 3MTFA 2CGXA 1LPUA 2FA2A 5F4NA 3L9MA 1E1XA 3NW5A 1SNUA 4NWMA 3ZLSA 4C34A 5M57A 4U41A 3QF9A 5K4JA 3CP9A 1BMKA 4O7LA 3F3WA 2BDJA 2F9GA 3NIEA 4O6EA 5CENA 3UC3A 2C6TA 1HCLA 2F2UA 4G1WA 3W32A 5HORA 4ASZA 1FOTA 3DAKA 2C47A 5CNNA 5ANEA 1WVYA 4FTAA 5DR6A 1MRUA 5ETCA 4CCUA 4MXCA 2CLXA 3QQFA 4XV9A 4QMVA 5AM6A 3TKHA 3EQFA 4NSTA 4AZTA 2VWYA 3UYSA 3VO3A 4W8DA 4U9AA 3ORLA 3OTVA 3GC7A 4IAZA 1KWPA 1OBGA 2IO6A 4ANQA 3UNJA 1HCKA 3BYUA 4EWQA 3HA6A 4KABA 3OC1A 4XG3A 5JKGA 1SMHA 4U81A 3RAWA 4I5MA 4ACDA 5CEPA 3L9LA 5KMIA 4IFGA 4DGLC 2OIBA 5TR6A 2CCHA 2W1EA 2F7XE 5HNGA 3KCFA 4CLJA 3QZFA 2YM7A 2XRUA 1OECA 3W0MA 3PY3A 2XF0A 2O8YA 3A7HA 4O91A 5FEEA 3ZLYA 5CALA 3R6XA 4NM5A 3C13A 2C30A 4P7EA 4BGGA 4FNXA 2OZAA 5C8KA 1BX6A 1UKIA 5JSMA 2UUEA 2G1TA 4LI5A 2C6MA 3GU5A 3O8PA 5CNOA 3ORNA 1JKLA 3NUSA 3ZRMA 4W4XA 4D9UA 5FTGA 4XG2A 4F09A 4R5YA 3D15A 4PDYA 4R77A 3AOXA 2CCIA 4X2FA 4C33A 2DS1A 4OTDA 3O51A 5AUYA 4BI0A 2VNYA 2WEVA 3BE9A 3HV3A 4QP3A 3UG1A 4ERKA 3MV5A 2NP8A 3EH9A 1XR1A 5FTOA 3FLWA 2UW3A 5AP1A 3WOWA 2W1DA 2Y9QA 3DCVA 1Q8WA 5HCYA 4QTBA 3A61A 5EHLA 4PMMA 3WZKA 4EC8A 3D5UA 1OKYA 1YRPA 4Y46A 5HNIX 2PMIA 1J7IA 5KUPA 4EHZA 2VWIA 2C6IA 4DEAA 1RJBA 2FSTX 2Y4PA 3M1SA 5E1SA 2O0UA 4JNWA 3EOCA 3GFWA 2Y6MA 2QI8A 5HICA 4B99A 2QR8A 3QQLA 4UZDA 4XG6A 4QTEA 3TXOA 3ORKA 2XEYA 3EN5A 4JDHA 3UG2A 2DYLA 4ANMA 4AX8A 2OIQA 3QX4A 3LJ2A 2B9HA 4TWCA 4C4HA 1H26A 3A7IA 3GQLA 2A4LA 4EK6A 1YWNA 4G6OA 4JI9A 2UW9A 3FPQA 3QTUA 3VS1A 3SA0A 4ZSJA 2EWAA 4BGHA 4IAKA 3EQHA 3LXLA 3SDJA 3UNZA 4BDEA 3L8PA 1P4FA 4UY9A 1VEBA 3UNKA 3MH3A 3PXRA 2R3MA 3PVUA 3PA5A 2CMWA 4BHNA 3O8UA 5CTPA 3SAYA 3UVQA 2ZV2A 4M8TA 4R5SA 2YIQA 4DGOA 3MH0A 5J8IA 4AWIA 2YERA 1S9IA 3GNIB 3MPMA 3FMEA 4AZSA 4YPDA 3ZCLA 4WIHA 4ZY6A 2WMWA 2EB2A 4WUAA 3W2OA 4WD5A 5EHYA 4FOBA 3NVKI 4CFXA 3R8MA 5H8BA 5M4FA 4BDHA 1K9AA 4M0YA 3NDMA 5E8ZA 5EK7A 2UW6A 3L8VA 4GG7A 3H0ZA 2VTLA 4WG4A 4CTBA 2F7ZE 3QHWA 2VTIA 4IHPA 4UWYA 4A07A 5IPJA 4MK0A 4IANA 4ACMA 1M7QA 5CF4A 3C4CA 3FSKA 1Z5MA 5HIDA 2X0GA 3SRVB 1PXIA 2BDFA 5HE2A 3NNWA 2FB8A 4FTMA 4HNIA 2FH9A 2OFUA 5HZNA 2WTVA 4II5A 5L8LA 3GCPA 1VYWA 3Q5ZA 5EQEA 1B38A 3MPTA 3ZUTA 3IDCA 2IVVA 2GQSA 2HIWA 4AW5A 1U5RA 3BEAA 5E90A 4CMUA 5CAOA 1OL2A 4MD9E 1OMWA 4Y95A 3FZ1A 2FGIA 3PZHA 3FY2A 4I6QA 4UXLA 3HV6A 2VX3A 2GFSA 2JLDA 3BEGA 3TDWA 4F65A 2NO3A 3AG9A 4HGSA 4QTCA 2PK9A 5B2KA 1G3NA 1YXTA 4L43A 3VS4A 3KVXA 4GYGA 3LM0A 4TYIA 1IAHA 3SQQA 1ZZ2A 2JAMA 3A2CA 3QA8A 4FC0A 5HCXA 1KE7A 1Y8YA 4KAOA 4FTCA 3BU6A 3FQSA 4WOVA 5AV4A 3R9NA 3CS9A 4O7YA 3FE3A 4FZ7A 5ANIA 2RFNA 2WQOA 2WO6A 4EOQA 1WVWA 3R7OA 2JDVA 4O22A 4IFCA 1K2PA 3LFFA 4IWDA 1WBVA 4LOPA 3NUUA 4LMUA 1NVRA 4GCJA 3RM7A 2J4ZA 3EJ1A 3A7JA 4I1ZA 3FUPA 4IDTA 4GT4A 3EYGA 3R7YA 5K9IA 4QMWA 4ZAUA 2AUHA 4DFLA 3AXWA 5JRQA 4FZ6A 4WNKA 1ZMUA 3P7AA 4IB3A 4ENYA 4ZLZA 2RG5A 3KXHA 5EKNA 2OJIA 1ZLTA 1SYKA 2HW7A 2PU8A 4RJ6A 2ZMCA 3G33A 4N6ZA 3VJOA 3Q4TA 3GI3A 4V0GB 1PXMA 2YDJA 2XA4A 2P0CA 2RG6A 3MIYA 4XRJA 4FV4A 4BC6A 3PPZA 2R64A 4QTAA 4RC4A 5DEWA 3DXQA 4WHZA 3UIUA 5L8KA 2OJFE 3F2NA 3ZONA 2WFYA 4I6HA 1PMVA 2WTCA 2LGCA 1JSVA 5CI6A 2XMYA 2PUNA 5CLPA 2B53A 4ASXA 5DA3A 4LRMA 4USEA 1PYEA 4YJTA 4FYOA 2ITYA 1F3MC 3BLQA 4RVKA 4H05A 3FI8A 3QRUA 2BRGA 4O86A 4ZTLA 4K77A 3LXKA 3BGQA 3KRXA 1Q3DA 4RX5A 4MYGA 2WMXA 3DFCB 4ERWA 2VTRA 4BDCA 4AE9A 2YM5A 3TIZA 2QU6A 4K2RA 1W8CA 3EQDA 4F7LA 5H8EA 5J1VA 1QL6A 2GU8A 3UZRA 4BCPA 5FTQA 5BVOA 3PA3A 2GHLA 4GJ3A 4OTGA 3GBZA 3OOMA 5HO8A 3UVPA 4AOJA 3VS5A 5IH5A 2X6DA 4CMOA 2BTRA 2I0YA 2R0UA 4UYAA 2W4KA 2VO7A 4DINA 5HVKA 5JN2A 3H9OA 4WNMA 4AGUA 3W0NA 4FT3A 3FZTA 4QPSA 3UIXA 4C37A 1SZMA 2VTHA 1KSWA 2VTPA 3CE3A 4HOKA 3TKIA 4U3YA 4ASDA 2C6LA 3FZRA 3MWUA 4IAIA 1BKXA 2YISA 4YZ9A 1Q8ZA 2W05A 1M2RA 5D7VA 5AP2A 3QD4A 4QRCA 4E73A 1XHAA 1APME 4YTFA 1GIHA 4BI1A 2GDOA 2OF2A 3BIZA 3DTCA 4CFVA 4A7CA 5JFXA 4N6YA 3H10A 3PRFA 1Q3WA 4DTAA 4YO4A 3R00A 4V05A 4M97A 4L3JA 4RQVA 3NUPA 4M84A 4F9WA 1CKPA 1SM2A 2WTKC 4JQEA 3HX4A 3QTZA 4Q5HA 3TV6A 2OJJA 3DK7A 3R7VA 5JFSA 2X2MA 5M4CA 2A0CX 3HL7A 3BWFA 3F88A 4CT2A 4YURA 3F3UA 1Q97A 2JIVA 5FGKA 3AD6A 3DT1A 3T3VA 2ITUA 4R7IA 2QHMA 5DR2A 5CSHA 3W2SA 3NCGA 3C0GA 4C3FA 5AMNA 4ZTSA 4J96A 4XRLA 4QQTA 5C9CA 3LMIA 5IUIA 1U54B 2JFMA 1JKTA 2WQBA 1K3AA 3FQEA 4TYEA 2LAVA 2GSFA 4FTIA 4FV6A 5HX8A 4ACGA 5E91A 3QQJA 5K5XA 3PPJA 3EN4A 4FTUA 4AE6A 2C0TA 4YR8A 3QCXA 4Y83A 4EYJA 5I0BA 2UW5A 1DM2A 1WVXA 1YWRA 3PXKA 1W98A 2B1PA 3VS6A 1EH4A 3ZFXA 1M17A 2QO9A 3OWLA 3QD3A 4UBAA 4GK3A 3VS7A 4BDDA 4LOQA 3UGCA 5GIPE 1OPJA 1T46A 4PV0A 4O6LA 3U54A 3VIDA 3C5UA 3EFWA 3BV2A 5EM7A 4ITJA 3OCGA 4YPSA 5M09A 4RVMA 4KBCA 5EI2A 5E8YA 1ZY4A 1YI4A 4FKUA 3UO6A 5J9LA 3FMKA 3ORTA 2YN8A 3G5DA 1JLUE 5I9WA 2UZOA 3IGOA 2OU7A 5CAVA 3QUDA 4ZLYA 2VGOA 5L6PA 4Y8DA 5E92A 4NZWB 3OT8A 2BKZA 2C5VA 3PDTA 4FT5A 3SW7A 4DLJA 5E8SA 4JBPA 5GJDA 2OKRA 3MN3A 4J71A 5T68A 3KA0A 5I9UA 3RK5A 3BWJA 4FTQA 3P86A 2JEDA 5IDNA 4O81A 4PUZA 4EJNA 5I5ZA 4L3PA 3G0EA 3U4WA 3QTWA 3AC2A 5EKOA 3IECA 3VBTA 4NM7A 2X39A 3D5XA 3F69A 3D94A 4MF1A 4EUUA 5ACBC 2QOQA 3A4OX 5DWRA 4HGEA 5EM5A 1R0PA 2I0EA 3KCKA 3JY9A 4J7BA 3ALOA 3GCQA 3VBQA 4HYIA 4LGGA 3IK3A 3VRYA 2BAKA 4IH8A 1ZYJA 3QBNA 2KTYA 2PZIA 4LV8A 4ORKA 4YHTA 4C2VA 4F9AA 3GENA 3EB0A 3PY0A 5FBOA 3NYOA 3PE2A 3ZDUA 2PVKA 3TN8A 3W18A 4F9CA 3W0PA 3B2TA 5LCKA 3FXZA 4U7ZA 1ZRZA 4IVBA 3PP0A 5DT0A 3GB2A 3EFKA 1F0QA 4EK4A 3KREA 2XNBA 4HCTA 4CKRA 3QD0A 5CU3A 1MRVA 3I0QA 4DEDA 1PXJA 1WCCA 3ZXZA 3CLYA 4JG7A 3V51A 4EZ7A 4B9DA 2VTAA 5HVYA 5CU2A 2IW8A 5CEKA 5AIRA 1LEWA 3VWAA 3OY1A 4EKKA 3NNXA 1PYXA 1WAKA 3MVJA 4BR3A 5FXSA 3V5QA 1U59A 4QMZA 5CI7A 5CQUA 4BKJA 3BHVA 4U3ZA 5KNJA 2Q0BA 4QTDA 1TKIA 5IUHA 4E6AA 3RZBA 4IADA 1XH7A 3KULB 4EOKA 4J8NA 4YZNA 2XIZA 5IQCA 3Q6UA 4HYHA 5E9EA 3O7LD 1PMUA 3R01A 4BCQA 4QMNA 5BVDA 2WHBA 4N70A 1XH6A 2XZSA 3OVVA 4FV8A 1A9UA 3F5PA 3DA6A 4LM5A 1GZKA 4EWHA 5A3XA 3EQCA 3O23A 2ZVAA 4LGHA 4GEOA 2BRMA 1BL6A 3K5VA 5FEDA 2C0OA 3SXRA 2QOIA 4BB4A 2XYUA 4G17A 5IA5A 4C59A 2R3IA 3RI1A 4KS7A 3ZRKA 5AUVA 3NIZA 2G2FA 3LFAA 3HAVA 4QMLA 4F9BA 2PULA 5FG8A 1GIIA 2YHVA 3LPBA 3WF6A 1H01A 3CQEA 4RLKA 2XNGA 4ALVA 2IJMA 4DFYA 3VC4A 1PXNA 3CKXA 3DZOA 4G3CA 3UOLA 3QZGA 3BKBA 1U54A 2ZV8A 1FMOE 3LCSA 5J9ZA 3F2RA 3LVPA 3L8SA 5JFVA 3KXXA 4X2GA 5CVFA 4CRLA 5JQ8A 4IZ5A 1KE9A 4JLCA 5AV0A 2H8HA 3DZQA 4DG2E 3AC3A 5EDQA 4EHVA 4J97A 2UZNA 2VD5A 5HLPA 3CJGA 4ACHA 4HVIA 3E3BX 1ZMVA 4FTLA 3F82A 4H3BA 1UNLA 2RL5A 3K3JA 5BUJA 2BAQA 3RPVA 4MD8E 4EL9A 4R3RA 2YAKA 4RPVA 2IVTA 4BYIA 3HV7A 4KIOA 4BBMA 3OY3A 4ZJVA 1WBTA 2B4SB 3TDVA 3DB6A 3W55A 5M07A 5EDPA 3FLQA 4L68A 5HD7A 2PZRA 2AC5A 4IB1A 4EH2A 4BI2A 4JBOA 4GJ2A 2WEIA 2G15A 3IW8A 2QOCA 4QMMA 3UZPA 4AT5A 4CG9A 3JR1A 2UZLA 4I0SA 4NTTA 5HI2A 5CXHA 5D41A 3MYGA 5BYYA 3ALNA 2E9UA 4YZBA 5FDPA 3FL5A 4RWJA 3ZOSA 2EXCX 3E63A 4D0XA 3I4BA 4F64A 2ZV9A 3KMMA 4TXCA 1MQBA 1H1WA 3OS3A 4ZK5A 2PYWA 3MY1A 1KOBA 2YJSA 2P2HA 4BDIA 5J5SA 5DRBA 3BELA 3UDBA 3LCTA 2YITA 3UOKA 4DC2A 4E1ZA 2ONLA 3OP5A 3ATSA 4AA0A 3LOKA 5E1EA 3Q32A 4ZMEA 1QCFA 1H1QA 1XBBA 3JPVA 5ACKA 3OFMA 4RIXA 4FV3A 5KKRC 5LQFA 1J7UA 3IPHA 5DT4A 4GRBA 4KB8A 2X7OA 4L53A 4YMJA 1H0VA 3QGWA 5AUUA 2OGVA 5DGZA 2QOHA 1A06A 4C35A 5IA1A 3LQ8A 4AZFA 1ATPE 4FNZA 1UA2A 2PE0A 1B6CB 4OT6A 2XKFA 3QUPA 4PX6A 3JYAA 5BUEA 2XEZA 4TYHB 1W82A 4CFNA 3EKNA 3RKBA 5IQIA 2GNHA 3ATTA 4MTAA 3IONA 4F7SA 2O64A 4NFMA 5E8TA 1WFCA 5C1QB 3ZEPA 2ESMA 3QRKA 2C1BA 1YOMA 3IW7A 2XK4A 5AP0A 1RQQA 3VS0A 5LXMA 3E7OA 3E5AA 4OT5A 2ITQA 2WOUA 5E8WA 4IWOA 1AGWA 3HZTA 3QCYA 4FVRA 2GNLA 3AMYA 3HMPA 3AT4A 4ZSAA 2PVJA 3PXYA 5F94A 4J98A 3EMGA 2IVUA 4O38A 5LOHA 4KBKA 4MD7E 4EOJA 3EQPA 3HUCA 5BQ0A 4PMSA 5HIBA 4CT1A 5L3AA 3KF4A 4APPA 3BE2A 4ITHA 2XK9A 3ET7A 3LAUA 4KINA 4O0VA 4TW9A 4HGTA 4GU6A 2JFLA 4FG9A 4IWPA 4I21A 2CKQA 2J90A 5ETAA 1WMKA 4OTFA 4PNKA 2F57A 4DE4A 2VTJA 3AC1A 4NKSA 5A4EA 2CNVA 4D9TA 1E1VA 4EQCA 5C4LA 2YM3A 4G3FA 4AA5A 3DQWA 3F5UA 2ERZE 3BZ3A 4K6ZA 3HMIA 3ID6C 4IVAA 3VF8A 3DXPA 2GHMA 3V5TA 4AOTA 3IKAA 3V5LA 1BUHA 4NL0A 1KV2A 4QP6A 2ITZA 3C4ZA 2HWPA 4QP9A 5BVEA 2HZIA 2B9FA 5FDXA 3C4XA 2GS6A 3UVRA 5AV2A 2VWWA 3I79A 4YHJA 4XS2A 2C5OA 5M44A 2J50A 4E6CA 3VUIA 2YEXA 3F5GA 3PWYA 4RFYA 2W9ZB 3BYOA 3D5VA 4IIRA 3PSBA 5DBXA 3E93A 3ZBFA 4NFNA 2A27A 2HXLA 4JL9A 1U46A 1PRYA 4GUEA 3RPOA 4HPTE 3UBDA 4CGAA 2ZDTA 4E4NA 5BUIA 4WZYA 5B7VA 3RINA 4HCVA 5LVLA 1GZOA 4F4PA 4CVAA 5JEBA 3MDYA 4BDJA 4DFNA 5HO7A 3UOJA 1Q8YA 3PG3A 1KE5A 4FV2A 2X7GA 1JNKA 2OF4A 3WF9A 2JDOA 4U44A 1U5QA 3E64A 2ZM1A 3OF0A 3R1SA 4M68A 5GHVA 4IX5A 4RBLA 3TNIA 1P2AA 4ZZNA 3KN6A 4X2NA 3AT3A 3RPYA 1UU7A 4I94A 1L8TA 3FC1X 4KWPA 3VBWA 5L6OA 4EOSA 3NUNA 3U8WA 3BCEA 2ZJWA 3VAPA 1OPLA 4E5WA 4F6UA 4UV0A 4C7TA 4FGRA 1OUKA 5C8NA 5M4UA 5IA0A 1IRKA 4D2RA 2GNGA 3QCQA 3PG1A 3PVGA 3OWKA 4AZWA 4D4VA 3UP7A 4G5PA 5T6KA 4CEGA 2X8EA 4K9YA 4E93A 4JQ7A 5K3YA 2YIWA 4I5PA 4FZFB 4RZVA 4EH6A 5CANA 4CG8A 5ANDA 5C03A 3D83A 1OIYA 3EQRA 4JRNA 2O3PA 1OBDA 2YZAA 4G3EA 4MVFA 3U6JA 3HDNA 3TV4A 1PXOA 4WA9A 2XNEA 3ZO3A 4FG8A 4I0TA 1VR2A 2J6MA 1Y57A 2X9EA 1OPKA 4AN2A 3HA8A 3WILA 1V0BA 3IO7A 3ZSHA 3FBVA 4FSTA 1PF8A 2OXDA 1PHKA 5HE0A 2JC6A 1J7LA 2JDSA 4QMTA 4ONAA 3U4UA 2GNFA 3U6IA 3DDQA 4ITIA 4EQMA 3E87A 4FZDB 2VWZA 2CSNA 1DI9A 3ZEWA 3RHXA 3R02A 1ZWSA 3QKKA 3GP0A 4GK2A 5AP7A 5IQEA 4QYYA 4X3JA 2DQ7X 5IH6A 1MUOA 5DRDA 5M4IA 3HEGA 5HG5A 3FI3A 4C4GA 3F6XA 4TWOA 2CKEA 3DJ5A 4CCBA 3R9OA 4BICA 5AUXA 1FPUA 3FQHA 4X3FC 3H30A 5ANKA 2HW6A 3WIGA 1Z9XA 1GZ8A 3UODA 5B2MA 3LCKA 2UV2A 1YI6A 4LMNA 3OUNB 3P08A 2BILB 2X2LA 3S2PA 3GUBA 3UIBA 2J51A 2PWLA 1OIQA 3NX8A 2R7BA 3PZEA 3HAMA 5TKDA 1UU3A 1Z57A 3DKCA 4TZRA 3V5WA 2I0VA 2C4GA 3B8QA 4QPAA 2PUIA 4AGWA 3MESA 2WAJA 4L7FA 4GVJA 1B39A 1H27A 4BHZA 1Q24A 1DS5A 4ZY4A 5LVPA 1OL6A 3Q9WA 4RSSA 5DYJA 3MGYA 2YWVA 4NW5A 5CVHA 4QQCA 3WARA 1J3HA 3O17A 4F1TA 4PP9A 4DFUA 4H3PA 5IMXA 3D7TA 4C4IA 4HVDA 2CJMA 3G9NA 4JR3A 4YJUA 4YJVA 3QXPA 5I9YA 2BIKB 3ODZX 2AYPA 4RIOA 4UALA 4WKQA 5ETFA 4DEIA 4PF4A 3P9JA 3KMUA 2OFVA 4IC7A 3QD2B 1KE8A 2WXVA 3JVRA 4FUYA 2W9FB 3ACJA 3TWJA 3LFDA 3FHIA 3ELJA 1OGUA 1WZYA 1E9HA 5HE1A 4N57A 2IW6A 3NYVA 4PQNA 3V6SA 2YCFA 3DS6A 3G90X 3HECA 1IA9A 1OL5A 2BZJA 3JS2A 2VWUA 2V62A 3VUMA 2CGUA 4L44A 1ZAOA 2QNJA 3QFVA 1XH8A 3GXLA 2BTSA 2QOOA 1UNHA 2VO6A 3MFUA 5H8GA 4NW6A 1ZZLA 2VO0A 2W5AA 2VWBA 3BYMA 2J0LA 3LFQA 3O0GA 3P1AA 4YLJA 2BR1A 4I5CA 5EI8A 1YWVA 4FNYA 4RFMA 2X1NA 2XK7A 3VHEA 4O2ZA 3T9TA 4RIWB 4CSVA 5D10A 3IS5A 2ZM3A 2X4FA 3LMGA 4RZWA 1XJDA 4MBJA 2VAGA 2I0HA 5IQDA 2J0JA 4RQKA 2IN6A 3VBYA 3C0IA 3T3UA 4BYJA 4XP2A 3L9NA 4KBAA 4O7OA 3BBTB 4BCHA 4CRSA 5LVMA 3G2FA 4RIXB 3F61A 3R7EA 4E5BA 5BVNA 3EN9A 1WBPA 4JG6A 4OBQA 3WF8A 1FQ1B 2CNUA 3UMXA 4FSNA 4ZTQA 5JFWA 2QG5A 5GNKA 2OK1A 2JDTA 3LXPA 4ZZMA 2W7XA 5H9BA 3S95A 2OXXA 3HVCA 4EOIA 4L6QA 4CV9A 5JQ5A 3ORMA 3DB8A 2CGWA 1MP8A 2BRNA 3QYWA 4H36A 4B6LA 2B9IA 4ENXA 5AUTA 3IW4A 3UYTA 3SKCA 2XM8A 3WF7A 4DTBA 2R5TA 3V3VA 3ODYX 4O7ZA 2PVRA 4BCNA 1XH9A 4H58A 3V8SA 2E9PA 2R3PA 2YCRA 4ZJJA 3R9DA 2R3JA 3F2AA 1P5EA 4P4CA 3S4QA 5E8UA 3NPCA 2NRUA 3POZA 3OXZA 4W8EA 3AC8A 4JDIA 3SW4A 1JBPE 4C38A 3MY5A 3PE1A 1QPDA 2WIHA 3FJQE 4JDKA 4DFBA 3MY0A 5M53A 2W0JA 2XCKA 3UPXA 4E6DA 2SRCA 3BBWA 2CHLA 2R3KA 3KC3A 4O7VA 5TO8A 5HU9A 2BHHA 2VTTA 4KKGA 5KBRA 2BKKA 4WO5A 3LJ0A 2GPHA 4MXZA 4OBOA 2GCDA 5KHWA 4RVTA 2W99B 4WG5A 3DKGA 1JVPP 1YDRE 4FE2A 2PVYA 3WE8A 4FA2A 3K54A 2HZ4A 5JK3A 4DT9A 3NNUA 5K4IA 1PXPA 3G15A 3HP2A 3Q6WA 4QMSA 3FKOA 4XV2A 2Z7RA 4GL9A 2G9XA 4GUBA 1JKKA 3D5WA 1CKIA 4HZRA 4RGJA 4A9UA 4DN5A 4RJ5A 4QYFA 4R7HA 2B7AA 2UW7A 2UZUE 4Q9ZA 3FV8A 4WSYA 1UV5A 5IEVA 3KRRA 4FEQA 1M2QA 1DI8A 3AD4A 2E9VA 4E4LA 5IQFA 3GC9A 5L2SA 4J52A 1XH5A 3HUBA 3R04A 3KL8A 4A4LA 3VW6A 3GT8A 1VJYA 4M7IA 2C3LA 3RPSA 3SOCA 3FMDA 3E92A 2QOLA 3R83A 2WTIA 4FIGA 2GQRA 2YIYA 4G3GA 4IVCA 5A46A 4KUJA 4L3LA 3ZMMA 4KSPA 4JS8A 1Q41A 2X8IA 3NLBA 4WT6A 4AN3A 2W5HA 5EHOA 2YJRA 4GKHA 4PDOA 5FP5A 3CKWA 4BIDA 4XG8A 4XV3A 1IR3A 5AEPA 3CPCA 3DU8A 4OTQA 2J0KA 3CXWA 4K33A 3QXOA 2WOTA 4RG0A 4YZCA 3RM6A 3UQGA 3E88A 4RJ8A 4GSBA 3SX9A 3FLNC 3KMWA 4IWQA 4A9RA 1L3RE 2WU6A 3P7BA 4A9TA 4M69B 1SVEA 3IG7A 4F08A 1Y6AA 3TM0A 4IB5A 4Y73A 3BYSA 3RK7A 2P3GX 3O71A 4GIHA 4LUEA 3V5PA 2XKEA 3GEQA 4EH3A 2R3GA 2HCKA 4FK3A 3WBLA 4QQJA 2BROA 3LKMA 4OTHA 3DLZA 3QTIA 4IC8A 2C5YA 3LFNA 3BLRA 4XBUA 5D7AA 4CKJA 4PTEA 3ZRLA 2C6KA 2JIUA 2A2AA 3Q04A 1ZOEA 1G8SA 4I24A 2I40A 3EN6A 4K1BA 5HKMA 4U40A 5KCVA 4Z7GA 2GNJA 2VWVA 4YNOA 5DEYA 3B2WA 5HVJA 1UWJA 3CD3A 1YHWA 3LCDA 3C9WA 4O2PA 3RPRA 3F3ZA 5KMKA 3MFRA 4RIWA 5CSVA 2Z02A 5BVKA 4BZNA 3MJ1A 3NGAA 1W83A 4JVGA 5AX9A 1SNXA 1U4DA 4FOCA 5HBEA 5BVFA 2H6DA 4YHFA 3NR9A 3FL4A 3NUYA 2HZNA 3KXMA 5DT3A 4D5KA 3DXNA 4F0FA 5GIOE 5DI1A 5IDPA 3EL8A 2BRBA 3AC5A 4RIYA 5AM7A 3VN9A 4EKLA 3GFEA 4EC9A 3DBFA 4QP4A 4S33A 4YC6A 1KOAA 2RKUA 3L8XA 3OW4A 3CY2A 5LMKA 2UW8A 3PP1A 4B8MA 4YNEA 3OW3A 3EHAA 3QC4A 3RVGA 3SVVA 3LLAA 5HNBA 4QMPA 2B55A 1J1BA 4RRVA 2OO8X 1IEPA 2IWIA 2R0IA 3BPRA 2XYNA 2P2IA 3I60A 1OKVA 3R1NA 4OGRA 3KGAA 4A9YA 2QOBA 4CV8A 3QRIA 5FD2A 3WE4A 3RCDA 3KK9A 3O50A 2DUVA 4F99A 2O65A 3CSVA 4UB7A 1YXXA 3N9XA 3ZO2A 3PSCA 3ZYAA 4BCGA 5C26A 4XCUA 2WD1A 2QVSE 4CFFA 3IOKA 3CR0A 4ZMFA 3V01A 5AWMA 4IAYA 4F6SA 3HDMA 3ZC6A 4C62A 4IMYA 3E62A 2ZOQA 3BYVA 2GTNA 3F7ZA 1RE8A 3P7CA 2C3KA 4IZAA 4MKCA 5AX3A 4O7RA 5AP5A 3GVUA 4L7SA 4MBIA 5CU0A 3DJ7A 3BGPA 3R22A 5IQHA 2XB7A 2PPQA 3PA4A 2W1FA 4HPUE 4K0YA 3RWPA 5IA3A 4WNPA 2ZAZA 4FT9A 4QT1A 3Q9ZA 4XOYA 4YTIA 1Q8TA 4AUAA 4FL2A 2O63A 5DE2A 3QKMA 4W4VA 4O84A 3UMWA 4HVGA 5IU2A 1ZYSA 2PVMA 5HG8A 1H0WA 1OIUA 4G6LA 2QU5A 5F9EA 2Y0AA 3ULIA 2OH4A 2QONA 4UXQA 1CKJA 4L00A 3S0OA 4IM3A 2P55A 4P2KA 5CEQA 3R8ZA 3WZEA 4AF3A 1A48A 2B52A 2XIXA 2BMCA 4TNBA 4JJRA 4FEVA 5HTBA 2R2PA 4FV9A 2JAVA 3F3VA 1REJA 3ACKA 5FM3A 3C4EA 3QYZA 4WG3A 3O8TA 1PJKA 3OT3A 5BVWA 1H28A 4U98A 2JDRA 4O0RA 5HLNA 5AV1A 3SG8A 3PPKA 4YBJA 3COHA 2FSMX 2VO3A 3MBLA 3FMHA 4FSQA 3KXZA 4KKHA 3ZZWA 3ZBXA 3Q2MA 4TWNA 1Y8GA 3HMOA 3W2RA 3QU0A 4FI1A 4WRGA 2I1MA 2NPQA 1PXKA 4Y72A 4AS0A 2R7IA 4D4YA 3FMMA 1ND4A 3I1AA 5E4HA 1FGKA 4YJRA 4QMYA 4ZJIA 4PL5A 3Q53A 3N4UA 2OI4X 2Y6OA 3CGFA 3QTXA 4K11A 5IG1A 2XH5A 1T45A 4EH7A 3LM5A 4AGDA 2XKCA 4Q9SA 2XNOA 2WNTA 1JQHA 2W1GA 4XG7A 3MH2A 2C3JA 2PMNX 3DKOA 5BMMA 1Y91A 3HYHA 2ONLC 3N51A 4X6QC 1I44A 3DNEA 2BZIB 1YVJA 4EH9A 1QPCA 4EOLA 1R1WA 4NH1A 3SGCA 4O7PA 2JGZA 3R2YA 2C5NA 4C3PA 1ZY5A 3CC6A 4EH5A 2PMOX 3IOPA 5J95A 3KXGA 3OXTA 3ZSIA 3MPAA 3FZPA 4XHKB 2JKKA 3L9PA 3OBGA 4I92A 3Q9XA 2REIA 2EXMA 4X7QA 5A4TA 5AAFA 2PVLA 5HIEA 3TJCA 3ZO4A 1S9JA 3KVWA 2VTMA 3PLAE 4GIIA 4MHAA 2X81A 4E5AX 4CFMA 4EEVA 2YZLA 4KIPA 1CSNA 3FXXA 4WNOA 3M2WA 5B0XA 3VRZA 4XLIA 3F7WA 2XK8A 5ANGA 4NYEA 4EBWA 3FI2A 4TT7A 5AAGA 3QL8A 5EYDA 4V0GA 4G3DA 4IW0A 2QKRA 2ZYBA 2PMLX 1YDSE 4FTRA 4GV1A 3B8RA 4JG8A 5EFQA 3W8LA 4BBEA 2RGPA 3BI6A 4U0IA 2VGPA 3NUXA 2H9VA 4XMOA 5HBJA 5ANJA 5JZJA 4FEUA 4S31A 4UEUA 4YU2A 4S32A 4IACA 4AFEA 1WBOA 1O9UA 3ORZA 2XK3A 4XUFA 3GU8A 3D0EA 2IPXA 3QWKA 4Z9LA 3VS3A 4AN9A 4D0WA 5K5NA 3LFSA 3S1HA 4KNBA 3FLSA 1REKA 1ZXEA 3E3PA 1YXSA 4FV7A 3GU6A 4GMYA 4DBNA 5FXQA 3W0OA 3KRJA 4NJ3A 1J91A 3HV5A 5GJGA 3C5IA 1Y6BA 2A19B 5KZ0A 4E4MA 4OLIA 2HYYA 2UVYA 2BPMA 3COKA 3QAME 4TWPA 2IZSA 3ZM9A 4FYNA 1PMNA 5JGDA 5CY3A 4LYNA 3OCTA 4IBMA 3FI4A 4UWBA 3MVHA 3A8XA 2BRHA 4FVPA 4YJPA 5FBNC 3R9HA 4D2SA 4FKTA 1KUTA 5HTCA 4H3QA 3R21A 4O7NA 3EQBA 3QRJA 5FM2A 4FMQA 1RDQE 3EZVA 5LARA 2WTJA 2F7EE 1HOWA 4JBQA 4FX3A 2PE2A 5CVGA 5CEIA 4P5ZA 3TJDA 3ZFMA 4C4FA 5IF1A 4QYEA 1OVEA 2XIKA 5CF5A 3AQVA 4EH4A 3Q4CA 4LQMA 4WBBB 4YJSA 2DWBA 2C68A 4NUSA 2BVAA 3TZMA 4E4XA 3FLZA 2HK5A 4QNYA 2CDZA 4HYSA 4R6VA 4BCMA 5CWZA 4N4SA 5IH4A 2QR7A 4JOAA 2WMQA 2V7AA 5LCJA 3FMJA 3DPKA 3RWQA 4EI4A 1XBCA 5HU3A 3FC2A 3EZRA 3Q96A 3GCSA 5HHWA 4B8LA 4X6RA 4FEXA 5BNJA
chains in the Genus database with same CATH superfamily
2WB8A 3O7LB 3O2MA 2EB3A 3FHRA 5BYLA 2HWOA 4FV5A 3TNWA 5CZIA 5LMBA 4ZIMA 3WI6A 3CQWA 4I4EA 5ICPA 4YSJA 2O5KA 1XMMA 2JITA 4EK3A 4E8AA 4AAAA 2R3FA 2QOKA 3NYNA 3NW6A 4RT7A 1OL1A 5C01A 2IW9A 3ZO1A 2GFCA 2XVDA 3CEKA 3C4WA 2FVDA 3ANQA 4U6RA 5AP6A 3R73A 3TUBA 4CNHA 4MCVA 1FVTA 5IQAA 2OXYA 4DEGA 4B0GA 3EFLA 2B0QA 3QLGA 3NVMB 5T3QA 1O6LA 3LQ3A 5CAQA 4Z3VA 5HD4A 2E9NA 3BGZA 2HOGA 3QZIA 3PTGA 4NM3A 4MBLA 5BX0A 3IW5A 4IEBA 2UZTA 4FTOA 3COMA 3DKFA 2QO2A 4GG5A 4K8AA 5CT0A 5A4CA 4AP7A 4O27B 3TYKA 4YJQA 1QPEA 2PVNA 1WBSA 2XKDA 2WTKB 3IQ7A 3OBJA 1UU8A 2JBOA 4J99A 5LMAA 2UZBA 2YA9A 4USDA 4HZSA 4IQ6A 3QCSA 3CJFA 3OUKA 2H34A 2A1AB 3UP2A 3AGLA 3VW8A 4GK4A 4YJNA 4I23A 3E8EA 3LFBA 1BI8A 2C6DA 1W84A 2EUFB 3NW7A 4C2WA 2W1CA 4J1RA 3VBVA 3FYKX 4PDPA 3R1QA 2JD5A 4YSMA 4C4JA 4JQ8A 2YDKA 5CEOA 1NXKA 4IM2A 4KS8A 5CX9A 3RJCA 4HW7A 4UN0C 4A9SA 3NS9A 5EYKA 4CZTA 4HCUA 3ZXTA 1NVQA 2BFYA 3PSDA 3MVLA 2OZAB 4L46A 1YOJA 4AA4A 2AC3A 4BCJA 4ZTMA 4IE9A 5G1XA 3Q60A 3KY2A 3OEZA 2WTDA 1FMKA 4N0SA 4D5HA 4CXAA 5JMSA 3DBCA 3G51A 3CBLA 3NAYA 1O6KA 3GU4A 4G9RA 4NCTA 4OBPA 1ZOHA 3OOGA 4AT3A 3MS9A 3BU5A 3QTQA 1XH4A 3GCVA 4ALUA 2FUMA 4EUTA 2QHNA 3DK3A 4R3PA 1MRYA 3ANRA 5DH3A 5C4KA 2R3NA 1IASA 4M15A 4XG9A 3D9VA 1SVGA 3MFTA 5EM8A 4O7WA 2F2CB 3DJ6A 4FR4A 1AD5A 3H3CA 4UYNA 3DAEA 1GIJA 5KBQA 3TACA 4RC2A 1LEZA 5CASA 5JZNA 4D4RA 2CGVA 2V0DA 2VN9A 3NEWA 5FLFA 4X3FA 4FVQA 2GS7A 1FBNA 1UVRA 4X2JA 1PMEA 3RMFA 4CMTA 1H8FA 2XCHA 5FEQA 4ZS4A 3UQFA 1GY3A 4FSMA 3KEXA 2PZPA 4GFGA 4ZOGA 2CNQA 4BDAA 4A4OA 5IZFA 2B9JA 2PVHA 3EQGA 4LV7A 3ZUVA 2IZUA 3BHTA 2XP2A 3OD6X 5DNRA 3FSFA 4D4SA 4CD0A 5ANOA 5KE0A 1W0XC 4AQCA 5IEXA 3FPMA 4EONA 2FO0A 1ZYDA 2W5BA 2FSOX 5AP4A 3TUDA 2J2IB 4FTNA 4AZEA 3ZU7A 5KMLA 2QD9A 4I0RA 3AKKA 3PUPA 3PXQA 4W4WA 4XEYA 2H96A 2OJ9A 2YCQA 3F66A 3G6GA 3OTUA 4RWIA 2I6LA 4U42A 3WYXA 3I6UA 2ITTA 4KKEA 5FP6A 3I5ZA 4JXFA 4PWNA 5DN3A 4D1XA 5KO1A 2G2HA 5BYZA 2CN8A 3V5JA 4UX9A 5CSXA 4YTCA 2VZ6A 2J9MA 4U94A 5F20A 2J7TA 1OKWA 4OTRA 4ZSGA 1KV1A 2YM4A 3UE4A 2F49A 2GHGA 4PNIA 5A54A 3UC4A 3S00A 3A99A 3R1YA 2R3OA 1Q4LA 3CIKA 4GT5A 2QURA 4BZOA 3W8QA 4QMXA 4X21A 4BDBA 3R71A 1XO2B 3Q9YA 4BDKA 4YLKA 4LL5A 4IM0A 4DA5A 5A4QA 1YHVA 4NJDA 3O5AA 3QGYA 3R9RA 4FSUA 3LIJA 2XARA 3TTIA 3IW6A 1PY5A 3P78A 1V0PA 5H3QA 1OZ1A 2YABA 5B2LA 1OM1A 3ML1A 4EYMA 4IAFA 2OIDA 3GOPA 4BJJA 3QWJA 5DR9A 4BTKA 2VNWA 4OTWA 4RA4A 3GQIA 3LLTA 3D2KA 2VV9A 5BPYA 3FWQA 4J95A 1OKZA 3KIOC 4FKVA 3DBQA 4FZAB 4A06A 4I3ZA 5HE3A 4FKGA 2YIXA 2QG7A 2Y4IC 4FIFA 4JIAA 4L8MA 4TTHB 4RC3A 4QP2A 3UO4A 4AXEA 4R1YA 3HV4A 2IG7A 2WQMA 4DCEA 4DH3A 3PJCA 4M13A 1XBAA 2B54A 3CD8A 3BHHA 3DNDA 1OGYA 3SD0A 4YJOA 4D55A 4NIFB 4MNFA 4ZTHA 3DV3A 3G6HA 3QRTA 4ZSEA 5HEZA 3RAIA 4F7JA 5EH0A 5IUGA 1QPJA 5CS6A 3QHRA 5AUZA 1BI7A 4YTHA 2WMBA 1WBNA 2XJ1A 3HRFA 4KRCA 4ASEA 3H9RA 4BN1A 1JKSA 3PY1A 3T9IA 3BRBA 4R3CA 3W1FA 3DK6A 2VTSA 3M42A 3UIMA 3CGOA 3S3IA 4BCFA 4RX8A 4LV5A 5CEMA 5AP3A 4B7TA 1Q61A 1H25A 2V5QA 4GYIA 4BTJA 3QQGA 4XV1A 4GH2A 3W2QA 2JBPA 5CAPA 2RF9A 3GC8A 3T8OA 2RFSA 4Q5EA 1LR4A 1H08A 4O0SA 5HESA 4PY1A 3W16A 4KD1A 3ZTXA 4C61A 5JH6A 4M3QA 4QP8A 2CPKE 2OH0E 3FLYA 4K18A 2Z7LA 4FV0A 2ITPA 2BZHB 4DG0E 2XNPA 4FSZA 2WQEA 4X0MA 5HBHA 2X8DA 2E9OA 4O7SA 4DBXA 3AD5A 1JWHA 4DFZE 3PFYA 1KE6A 1FVVA 1GZNA 1AQ1A 4I6BA 4O0WA 3A7GA 5DG5A 5D9HA 1X8BA 2VWXA 3LXNA 3QALE 5AIKA 4OW8A 2J0IA 1Q99A 4FKRA 5D11A 4O83A 3UJGA 4XOZA 5M55A 1V1KA 3PJ2A 3QZHA 4EZ3A 1M14A 2YCSA 4DG3E 4FIHA 1TVOA 2CKOA 4AW2A 2WZJA 3CTHA 3W33A 2XIRA 3PLSA 1PKGA 3A62A 4MNEA 4WUNA 3CCNA 4DEBA 5M08A 2WMSA 4JR7A 4DH5A 1R39A 1NA7A 3AKJA 4C0TA 2R9SA 3PFQA 4EJ7A 3VQUA 3OWJA 2UVZA 4FIJA 4ANSA 4O0YA 2XK6A 3HRBA 5E8VA 5IQGA 5EOBA 4ZXTA 2WTWA 3UOHA 1Q8UA 2CKPA 4XX9A 3EIDA 4Y85A 2YFXA 3EFJA 3D7TB 5AAEA 3MJ2A 3SLSA 3JY0A 3CPBA 3FMNA 3RP9A 4FEWA 2WMRA 3ZFYA 4F1OA 4FKIA 3W0RA 3TNHA 1IAJA 4NKAA 1J1CA 2OG8A 2W4JA 4NM0A 4DCAA 5KKRB 3JVSA 4YBKA 2VTOA 4S2ZA 3LQ5A 4IX6A 3SG9A 3RHKA 3BHUA 3DFAA 3UQCA 5L2IA 3KRWA 3BLHA 4FBXA 4LL0A 4D1ZA 4C4EA 3MA3A 1H1RA 5L2WA 3LFEA 2PY3A 2EVAA 5D12A 3P79A 1UNGA 2QLQA 4CTCA 2PL0A 5CZHA 3VHKA 2WIPA 1V0OA 1ZYCA 3I7CA 5EI6A 3TL8A 4U79A 3QTRA 4G9CA 4AU8A 3HKOA 5IA2A 2F4JA 3UO5A 4O0XA 3KRLA 3R8UA 3E8NA 4QQ5A 1YOLA 2YACA 4EOPA 3KF7A 4FTJA 3UDSA 3OROA 4GW8A 4PRJA 3K2LA 2ETKA 2QO7A 2XNMA 3N4VA 3VUKA 3C51A 5CXZA 4BCOA 3WYYA 4GU9A 4G16A 5HX6A 1OITA 4Y5QA 3ZHPC 3G9LX 3OWPA 3CTJA 4O7TA 1ZMWA 4X2KA 4W4YA 1NY3A 4XNEA 4ZSLA 2X6EA 4PP7A 3QLFA 2OSCA 3Q52A 5ETIA 4BIBA 3MI9A 5KMMA 2R3QA 3THBA 3VF9A 3RAHA 3UPZA 3GCUA 2BALA 3H9FA 2VUWA 4MQ1A 5GINE 3W2PA 4AW0A 4M0ZA 3A60A 4I22A 4GVAA 1MQ4A 5J87A 4MNEB 4DDIA 4DHFA 1OB3A 2OICA 3E7VA 3OEFX 5LMKC 1YKRA 3UDTA 3EWHA 4L42A 4U97A 3R0TA 4XLVA 5LWMA 2UW0A 4F70A 2BDWA 2VX1A 1JSTA 3IDBA 3U55A 3ORXA 4DTKA 5ITAA 3FKLA 2WPAA 4PTGA 4IVDA 4XH6A 3ZSGA 4F78A 3EKKA 4FODA 4IDVA 2QKWB 3OZ6A 3Q3BA 5G6VA 4EK5A 4J53A 4FL1A 4OTIA 4FGBA 4TYGA 5A6NA 3A8WA 4FKQA 3CQUA 4WRSA 3ENHA 3V8WA 4AAYA 5J7HA 4O96A 5EW3A 5CF8A 3ZZEA 4U45A 3NCZA 4R1VA 5D1JA 4AFJA 3I0OA 2W06A 2X4ZA 4FKSA 5EQYA 5HG9A 4AT4A 3MB6A 4V01A 3DOGA 1I09A 4MWIA 4O21A 2QCSA 4ACCA 5I9VA 5J9YA 4DGNA 2Z8CA 4RMZA 3MB7A 5F95A 2V7OA 4A4XA 3FZOA 4FTTA 5HG7A 4I4FA 3NAXA 2WELA 4QNAA 2WU7A 4V04A 2HELA 2ITVA 2XJ0A 2Y4IB 3FYJX 3C4FA 4G6NA 1FINA 4I5HA 3JUHA 5I9XA 4YZDA 4GT3A 5TT7A 1CDKA 4D1SA 4X3FB 2PTKA 4BVUA 4WBOA 4JDJA 2ZB0A 2QODA 1O6YA 4NT4A 5IISA 3EQIA 4ZZOA 3LW0A 5DIAA 3KFAA 4QMOA 2BZKB 4ID7A 4EBVA 4LOOA 5E7RA 2Y8OA 3TZ7A 2BAJA 3TG1A 2ITXA 2PE1A 2Z2WA 3DLSA 2C0IA 3PVBA 3GC0A 3ROYA 1SVHA 4L67A 3E8DA 2O2UA 4HVSA 3ZS5A 4M67A 3MTLA 2Q0NA 4F63A 2QLUA 4FSRA 3Q5IA 4MXOA 3C1XA 4BGQA 2C5XA 3M11A 1P4OA 1YDTE 1YXUA 4U43A 4MH7A 4PL4A 3ZLWA 2ACXA 5AUWA 3REPA 4Z16A 1BYGA 5LVNA 3NZ0A 3ERKA 4U5JA 5CSWA 5F1ZA 3F9NA 5CQWA 2PUUA 3KB7A 2R3LA 4TN6A 4F0IA 3R63A 1CM8A 4C58A 4JX7A 3K5UA 3PRIA 4BDGA 5DOSA 2UZDA 4XBRA 3NWWA 4IJPA 2YWPA 3NYXA 2FYSA 2ZMDA 3D2IA 3KN5A 5DLSA 3HGKA 3CTQA 2WQNA 5GJFA 4IZ7A 3V6RA 4AGCA 4H39A 5EW8A 4BZDA 1H00A 4LFIA 2VTNA 4E26A 1JAMA 3WZDA 2V55A 5A6OA 4RX7A 1M52A 4FKPA 3QKLA 2VU3A 2W4OA 4ANLA 5JGAA 2G2IA 3BQRA 3I81A 3C7QA 4L52A 3NMUF 3ZUUA 2YM8A 3V8TA 4DYMA 2Z7QA 4M12A 3I5NA 4NK9A 4CFUA 4E20A 3ITZA 3BV3A 3SXFA 3Q2JA 3JXWA 4F7NA 5FRIA 4FL3A 4MWHA 4DEHA 3FZSA 4FTKA 3SC1A 3PVWA 4ZY5A 2CN5A 3AC4A 3AMBA 4I93A 4LRKA 2C3IB 3BQCA 4JIKA 5EG3A 2PVFA 3SOAA 4BDFA 4DHJA 2ETRA 4JT3A 1ST0A 3IDPA 3NRMA 3GOKA 3KULA 4JBVA 3DY7A 4RIYB 2V22A 3OXIA 5HQ0A 3FMLA 4FT0A 1PW2A 1VYZA 3Q4ZA 4KIQA 2XRWA 3BX5A 3NFGB 4L01A 4TYHA 3HNGA 3MVMA 3DQXA 3QQUA 5EQPA 4ZTNA 4P90A 3TTJA 1R0EA 3QX2A 2XM9A 5KMNA 5KX8A 4I6FA 3DTWA 3KXNA 4GFMA 4JAJA 1JOWB 2ZM4A 4FK6A 1ERKA 4IAAA 2UZVA 4O0TA 4FV1A 2OZOA 3NUAA 5CU6A 2HAKA 4D58A 4DGMA 3PJ8A 1OIRA 4FNWA 5IQBA 3N4TA 3FEGA 4YLLA 3VS2A 2Y7JA 4TL0A 2NNWB 5EW9A 2IVSA 1TQIA 4DGGA 3PJ3A 3VQHA 3R7IA 5HLWA 1OL7A 3HLLA 4FUXA 4MAOA 3UDZA 4TRLA 2XS0A 3DAJA 3PIXA 5M56A 2C6OA 4RJ7A 4MXXA 1JPAA 5A4LA 3QQKA 3R30A 4FT7A 4DDGA 4D28A 3TEIA 2PUPA 4EH8A 3ENMA 2QC6A 3KU2A 1W7HA 2GQGA 4PDSA 3PXZA 4U8ZA 2IZTA 2UZWE 2WMUA 3SV0A 3WZUA 1PKDA 4PMPA 3MW1A 4UZHA 5EDRA 1DAWA 2J0MB 3VJNA 2GS2A 5AJQA 4BIEA 3PXFA 2R4BA 3ULZA 3VVHA 4QYGA 5AFVA 3VUGA 4EOMA 4DH7A 3D7ZA 4FSYA 4DT8A 2W1ZA 3PYYA 4FICA 4EORA 3SRVA 1LP4A 4MX9A 5CF6A 1PXLA 3LZBA 3UTOA 1FVRA 5KMOA 4XYFA 3LMHA 4BBFA 4EOOA 2UZEA 1H07A 4HJOA 3ZLXA 4UWCA 2BFXA 3W10A 2BCJA 3POOA 4GS6A 2GMXA 3W0QA 3P5KA 4AW1A 5FQDC 1NVSA 2X2KA 4G5JA 5CU4A 3IGGA 4BF2A 4YZMA 4JX3A 3TZ8A 4F9YA 2IZRA 2RFDA 1YI3A 2UVXA 1CMKE 1F5QA 3NSZA 2GNIA 2XBJA 5DHJA 1WBWA 3OCBA 3QUEA 3TIYA 4USFA 5LVOA 3D4QA 4GFOA 4YC3A 3GGFA 4RVLA 4YO6A 3ZDIA 4DAWA 3ZM4A 1DAYA 1OUYA 2P4IA 4RWKA 2G01A 4AZVA 3O96A 3HRCA 4L9IA 4MUQA 4NTSA 1H1PA 4CFWA 2PHKA 3H4JA 4E7WA 3PIYA 4C36A 2CLQA 2QQ7A 2XIYA 4G34A 5EOLA 5HGIA 2NRYA 3VONA 2HENA 2ITOA 2ITNA 3AMAA 3KKVA 4RJ3A 4IX3A 5AV3A 5FXRA 4IJ9A 4C02A 3ETAA 3U9NA 1R3CA 2WKMA 5DFPA 4S30A 1YHSA 3RAKA 3U87A 5CSPA 2I7QA 1QMZA 3F3TA 4GKIA 3ORIA 4Q2AA 3SXSA 2XNNA 4G2FA 4DHZA 3VBXA 5M51A 4PL3A 4R7BA 4I20A 1BL7A 4P5QA 4RJ4A 3WIKA 3PWDA 4DEEA 3TCPA 5KHXA 3R28A 1R78A 4QO9A 3DBDA 3D14A 3QTSA 3RCJA 2OBJA 5KZIA 2HY0A 2PZ5A 2QOFA 2ZV7A 2Q83A 3FDNA 3G0FA 3LJ1A 4H1JA 4LRJA 3HMNA 4NU1A 4CKIA 4IX4A 1GJOA 1H24A 1URCA 4KRDA 3R8PA 2YAAA 3TT0A 3COIA 4JAIA 4DF3A 1GNGA 3WZJA 4QP1A 4S34A 4ARKA 4CZUA 1IA8A 3EYHA 3CY3A 2ERKA 2OJGA 3R8VA 4KSQA 2C6EA 1H1SA 2W1HA 4EZ5A 4RA5A 2BIYA 3KQ7A 4ZEGA 4F0GA 1G8AA 1M7NA 4IZYA 2JKMA 4JRVA 4O0UA 5CYIA 3PUFC 4FG7A 4FKOA 3W0SA 4FKLA 3RK9A 2VTQA 4ZTRA 3W2CA 2W17A 3KK8A 4XJ0A 5JT2A 2RFEA 4RWLA 3FXWA 4DH1A 4HGLA 3U9CA 3TNPC 4NCTC 5AA8A 4BRXA 5C8MA 3RNIA 4MXAA 4DLIA 3FKNA 5CT7A 2ITWA 4RFZA 3LE6A 2J5FA 3TZ9A 2Z7SA 5L8JA 4TNDA 3A7FA 4BTMA 4KA3A 3EL7A 2PZYA 3VUHA 2OW3A 1UWHA 2C69A 2KULA 4MQ2A 4Z7HA 2JKOA 3GU7A 5M06A 2HXQA 2VRXA 4BCKA 4APCA 5AA9A 2J5EA 5CAUA 2VX0A 4IB0A 4ZLOA 2E2BA 5EYMA 5TKDA 2FSLX 3K3IA 4YGAA 3QQHA 4TKSA 1NT2A 2ETMA 2ZB1A 1URWA 4FKJA 4G31A 3TKUA 1H4LA 4XG4A 3R7UA 2ZFYA 4XP0A 2RIOA 2WMTA 5BV3A 1M2PA 1UU9A 2W1IA 3QC9A 4QMUA 4DFXE 3BU3A 5DVRA 4F1MA 5I9ZA 5KMJA 1NW1A 2WMAA 3U6HA 3MIAA 2OLCA 4BY9E 3A4PA 4EHGA 2YIRA 3I6WA 3Q4UA 5I4NA 5AADA 4OR5A 3MSSA 4Z55A 1G5SA 1TQPA 2X7FA 3C50A 3PIZA 3ZH8A 1BLXA 2YDIA 1LUFA 5EM6A 5JGBA 4PTCA 4M14A 3OHTA 2P33A 2WGJA 4U80A 4O82A 3MH1A 4MEDA 1FGIA 4B4LA 2C1AA 3DBEA 3LHJA 4QDVA 4QOXA 4R78A 3TMOA 5J1WA 3ZC5A 3HP5A 3RTPA 5TF9A 5E8XA 1TQMA 4AXCA 3I7BA 3BHYA 1RW8A 3ROCA 1XKKA 4DH8A 3II5A 4TYJA 4AG8A 4ALWA 4CQEA 3VUDA 3QA0A 4F6WA 2OWBA 1STCE 2R3HA 1YW2A 4I41A 4YP8A 3F5XA 1CTPE 4EK8A 2HY81 4E6QA 4YC8A 1XWSA 3EN7A 4Y5HA 2BHEA 3OMVA 3LFCA 5IA4A 4FSWA 4TPTA 2W96B 4ZS0A 5IMEA 1ZOGA 4XP3A 4EQUA 5LJJA 3L1SA 4CLIA 4C3RA 2JIIA 3NNVA 3HMMA 2X9FA 2XUUA 1P14A 4RX9A 5FUTA 4PMTA 5A14A 3ORPA 3DDPA 3TNQB 3VNTA 4OUCA 4YUQA 3FAAA 4FIEA 4LG4A 1YQJA 5L2TA 4EHEA 2YM6A 3R2BA 3P4KA 4J8MA 1YXVA 4MXYA 4QYHA 5EYCA 5BMSA 4L45A 3OG7A 5TOZA 3VULA 4AOIA 1Q5KA 2HZ0A 4FKWA 1ZARA 4QP7A 4LDTA 5JRSA 1XQZA 4HYUA 4AXAA 3AKLA 3AT2A 5C27A 4FIIA 4H1MA 3E8CA 2GTMA 3P23A 3P0MA 4DITA 5A9UA 2JKQA 4ZP5A 4ANBA 3TI1A 3WF5A 2BUJA 4RLLA 3SHEA 2ZDUA 2EU9A 1OI9A 4TY1A 3C0HA 3FY0A 3AGMA 3PJ1A 4HVHA 2XBAA 3TV7A 3RALA 1VZOA 4HNFA 5L6WL 3H0YA 2Z60A 4BCIA 5HCZA 1GAGA 2XJ2A 4LUDA 4AACA 5LWNA 3U51A 1UKHA 1GOLA 3V04A 1JSUA 5DPVA 3LCOA 1Q62A 3R8LA 4QMQA 3RGFA 2R3RA 2PSQA 3OCSA 3UZTA 2WMVA 2UW4A 3MFSA 4BTFA 3MA6A 3DGKA 5H2UA 5IEYA 3TUCA 1IG1A 3MTFA 2CGXA 1LPUA 2FA2A 5F4NA 3L9MA 1E1XA 3NW5A 1SNUA 4NWMA 3ZLSA 4C34A 5M57A 4U41A 3QF9A 5K4JA 3CP9A 1BMKA 4O7LA 3F3WA 2BDJA 2F9GA 3NIEA 4O6EA 5CENA 3UC3A 2C6TA 1HCLA 2F2UA 4G1WA 3W32A 5HORA 4ASZA 1FOTA 3DAKA 2C47A 5CNNA 5ANEA 1WVYA 4FTAA 5DR6A 1MRUA 5ETCA 4CCUA 4MXCA 2CLXA 3QQFA 4XV9A 4QMVA 5AM6A 3TKHA 3EQFA 4NSTA 4AZTA 2VWYA 3UYSA 3VO3A 4W8DA 4U9AA 3ORLA 3OTVA 3GC7A 4IAZA 1KWPA 1OBGA 2IO6A 4ANQA 3UNJA 1HCKA 3BYUA 4EWQA 3HA6A 4KABA 3OC1A 4XG3A 5JKGA 1SMHA 4U81A 3RNYA 3RAWA 4I5MA 4ACDA 5CEPA 3L9LA 5KMIA 4IFGA 4DGLC 2OIBA 5TR6A 2CCHA 2W1EA 2F7XE 5HNGA 3KCFA 4CLJA 3QZFA 2YM7A 2XRUA 1OECA 3W0MA 3PY3A 2XF0A 2O8YA 3A7HA 4O91A 5FEEA 3ZLYA 5CALA 3R6XA 4NM5A 3C13A 2C30A 4P7EA 4BGGA 4FNXA 2OZAA 5C8KA 1BX6A 1UKIA 5JSMA 2UUEA 2G1TA 4LI5A 2C6MA 3GU5A 3O8PA 5CNOA 3ORNA 1JKLA 3NUSA 3ZRMA 4W4XA 4D9UA 5FTGA 4XG2A 4F09A 4R5YA 3D15A 4PDYA 4R77A 3AOXA 2CCIA 4X2FA 4C33A 2DS1A 4OTDA 3O51A 5AUYA 4BI0A 2VNYA 2WEVA 3BE9A 3HV3A 4QP3A 3UG1A 4ERKA 3MV5A 2NP8A 3EH9A 1XR1A 5FTOA 3FLWA 2UW3A 5AP1A 3WOWA 2W1DA 2Y9QA 3DCVA 1Q8WA 5HCYA 4QTBA 3A61A 5EHLA 4PMMA 3WZKA 4EC8A 3D5UA 1OKYA 1YRPA 4Y46A 5HNIX 2PMIA 1J7IA 5KUPA 4EHZA 2VWIA 2C6IA 4DEAA 1RJBA 2FSTX 2Y4PA 3M1SA 5E1SA 2O0UA 4JNWA 3EOCA 3GFWA 2Y6MA 2QI8A 5HICA 4B99A 2QR8A 3QQLA 4UZDA 4XG6A 4QTEA 3TXOA 3ORKA 2XEYA 3EN5A 4JDHA 3UG2A 2DYLA 4ANMA 4AX8A 2OIQA 3QX4A 3LJ2A 2B9HA 4TWCA 4C4HA 1H26A 3A7IA 3GQLA 2A4LA 4EK6A 1YWNA 4G6OA 4JI9A 2UW9A 3FPQA 3QTUA 3VS1A 3SA0A 4ZSJA 2EWAA 4BGHA 4IAKA 3EQHA 3LXLA 3SDJA 3UNZA 4BDEA 3L8PA 1P4FA 4UY9A 1VEBA 3UNKA 3MH3A 3PXRA 2R3MA 3PVUA 3PA5A 2CMWA 4BHNA 3O8UA 5CTPA 3SAYA 3UVQA 2ZV2A 4M8TA 4R5SA 2YIQA 4DGOA 3MH0A 5J8IA 4AWIA 2YERA 1S9IA 3GNIB 3MPMA 3FMEA 4AZSA 4YPDA 3ZCLA 4WIHA 4ZY6A 2WMWA 1TFFA 2EB2A 4WUAA 3W2OA 4WD5A 5EHYA 4FOBA 3NVKI 4CFXA 3R8MA 5H8BA 5M4FA 4BDHA 1K9AA 4M0YA 3NDMA 5E8ZA 5EK7A 2UW6A 3L8VA 4GG7A 3H0ZA 2VTLA 4WG4A 4CTBA 2F7ZE 3QHWA 2VTIA 4IHPA 1G8JA 4UWYA 4A07A 4MK0A 5IPJA 4IANA 4ACMA 1M7QA 5CF4A 3C4CA 3FSKA 1Z5MA 5HIDA 2X0GA 3SRVB 1PXIA 2BDFA 5HE2A 3NNWA 2FB8A 4FTMA 4HNIA 2FH9A 2OFUA 5HZNA 2WTVA 4II5A 5L8LA 3GCPA 1VYWA 3Q5ZA 5EQEA 1B38A 3MPTA 3ZUTA 3IDCA 2IVVA 2GQSA 2HIWA 4AW5A 1U5RA 3BEAA 5E90A 4CMUA 5CAOA 1OL2A 4MD9E 1OMWA 4Y95A 3FZ1A 2FGIA 3PZHA 3FY2A 4I6QA 4UXLA 3HV6A 2VX3A 2GFSA 2JLDA 3BEGA 3TDWA 4F65A 2NO3A 3AG9A 4HGSA 4QTCA 2PK9A 5B2KA 1G3NA 1YXTA 4L43A 3VS4A 3KVXA 4GYGA 3LM0A 4TYIA 1IAHA 3SQQA 1ZZ2A 2JAMA 3A2CA 3QA8A 4FC0A 5HCXA 1KE7A 1Y8YA 4KAOA 4FTCA 3BU6A 3FQSA 4WOVA 5AV4A 3R9NA 3CS9A 4O7YA 3FE3A 4FZ7A 5ANIA 2RFNA 2WQOA 2WO6A 4EOQA 1WVWA 3R7OA 2JDVA 4O22A 4IFCA 1K2PA 3LFFA 4FJVA 1WBVA 4IWDA 4LOPA 3NUUA 4LMUA 1NVRA 4GCJA 3RM7A 2J4ZA 3EJ1A 3A7JA 4I1ZA 3FUPA 4IDTA 4GT4A 3EYGA 3R7YA 5K9IA 4QMWA 4ZAUA 2AUHA 4DFLA 3AXWA 5JRQA 4FZ6A 4WNKA 1ZMUA 3P7AA 4IB3A 4ENYA 4ZLZA 2RG5A 3KXHA 5EKNA 2OJIA 1ZLTA 1SYKA 2HW7A 2PU8A 4RJ6A 2ZMCA 3G33A 4N6ZA 3VJOA 3Q4TA 3GI3A 4V0GB 1PXMA 2YDJA 2XA4A 2P0CA 2RG6A 3MIYA 4XRJA 4FV4A 4BC6A 3PPZA 2R64A 4QTAA 4RC4A 5DEWA 3DXQA 4WHZA 3UIUA 5L8KA 2OJFE 3F2NA 3ZONA 2WFYA 4I6HA 1PMVA 2WTCA 2LGCA 1JSVA 5CI6A 2XMYA 2PUNA 5CLPA 2B53A 4ASXA 5DA3A 4LRMA 4USEA 1PYEA 4YJTA 4FYOA 2ITYA 1F3MC 3BLQA 4RVKA 4H05A 3FI8A 3QRUA 2BRGA 4O86A 4ZTLA 4K77A 3LXKA 3BGQA 3KRXA 1Q3DA 4RX5A 4MYGA 2WMXA 3DFCB 4ERWA 2VTRA 4BDCA 4AE9A 2YM5A 3TIZA 2QU6A 4K2RA 1W8CA 3EQDA 4F7LA 5H8EA 5J1VA 1QL6A 2GU8A 3UZRA 4BCPA 5FTQA 5BVOA 3PA3A 2GHLA 4GJ3A 4OTGA 3GBZA 3OOMA 5HO8A 3UVPA 4AOJA 3VS5A 5IH5A 2X6DA 4CMOA 2BTRA 2I0YA 2R0UA 4UYAA 2W4KA 2VO7A 4DINA 5HVKA 5JN2A 3H9OA 4WNMA 4AGUA 3W0NA 4FT3A 3FZTA 4QPSA 3UIXA 4C37A 1SZMA 2VTHA 1KSWA 2VTPA 3CE3A 4HOKA 3TKIA 4U3YA 4ASDA