5C4LA

Conformational alternate of sisomicin in complex with aph(2")-iva
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords APH(2'')-Id
publication title Aminoglycoside binding and catalysis specificity of aminoglycoside 2-phosphotransferase IVa: A thermodynamic, structural and kinetic study.
pubmed doi rcsb
source organism Enterococcus casseliflavus
total genus 98
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c4lA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 5c4lA02
3AC2A 3HX4A 1OPKA 3PVBA 4KIPA 4LMUA 3C9WA 5BMMA 1M2PA 3I1AA 3CXWA 2E9UA 3LFEA 3D4QA 2JDRA 4IE9A 4ITJA 5ACKA 1PXNA 4QTBA 3TKHA 2R3MA 2V55A 2CGUA 3UQCA 3A7HA 3KVXA 4RVLA 4JDHA 4KNBA 4I6QA 5LWMA 4I5HA 3D5XA 4ASDA 4HZRA 3F7WA 2I40A 3ID6C 5DWRA 4BCNA 4L3PA 4V01A 5JZNA 4AT4A 3DTCA 3KRJA 3U4UA 2IZSA 2PK9A 3ZM4A 4RWLA 4QP1A 1DAYA 4EORA 1PRYA 3G5DA 3O50A 2C68A 3VQUA 3ORXA 4RX5A 3PXYA 1IG1A 5ETIA 2W9FB 4XH6A 2CSNA 3NIZA 3AGMA 3L8PA 3AGLA 2YZAA 3PPKA 4H1JA 4QYFA 4ZTNA 3RAWA 5F20A 5CX9A 3RPVA 5I9YA 2UZUE 5TR6A 4GMYA 5DI1A 3NNXA 4I5CA 5LMBA 2Y0AA 5A4QA 3LCOA 3DDQA 4GEOA 1GZNA 5AP1A 4D0WA 3KGAA 3R21A 1UU7A 4FMQA 4RFMA 5T3QA 4I93A 3EJ1A 4FK6A 3DB6A 3WF7A 4AZEA 3OP5A 3LQ8A 4FIGA 4GG7A 4U0IA 1R1WA 5KHXA 4A9RA 3E8EA 3ZRMA 1PMNA 3IOPA 4QMLA 4TYGA 3KF4A 2VTQA 2C0TA 3BPRA 3EKNA 3FMKA 2BHEA 3MJ2A 4FV7A 4LRKA 2LAVA 3BGZA 1WBTA 2OXDA 2XEYA 1BLXA 2R3IA 3UG1A 3FXWA 1OPLA 4P7EA 2X8IA 4IANA 5JQ8A 2BDWA 3W0OA 3P0MA 1K2PA 2Y8OA 3L9MA 3TN8A 3QQGA 2GHLA 4I0RA 4IJ9A 4O91A 3AD6A 1OL6A 4C58A 3A2CA 4AGDA 1H1SA 4AG8A 3UOKA 3L1SA 3DGKA 1ZOHA 2VO6A 3L9LA 3OEZA 3D0EA 4DBXA 5CYIA 4CFXA 5FEDA 2J0IA 3P9JA 4N6ZA 2G2IA 5E1SA 5CEQA 5TT7A 2NRUA 5IA2A 4ZSJA 4BZDA 4DITA 4ACMA 5HO7A 4LUDA 5CSPA 3QGYA 5IA0A 4FODA 4CZUA 4FZ6A 2J50A 2VTTA 4AN9A 3AD5A 3OFMA 3GFEA 3ZCLA 3R2YA 5CZHA 4H58A 2PVNA 4CKIA 3F3WA 4U45A 2H34A 1YWNA 2BAKA 3Q5IA 1FBNA 5HE0A 1AQ1A 1O9UA 5HKMA 3LLAA 3CGOA 4L3LA 3ZXZA 4EOJA 4PX6A 4X2NA 4ENYA 5CEOA 1WAKA 2ITUA 4RC2A 2C1BA 5LXMA 5FM3A 2VWZA 2XCKA 3MB6A 5AJQA 4GL9A 4RJ8A 3TZ8A 5KO1A 3ZFYA 4L43A 4M67A 2UW0A 5LWNA 3RGFA 3DDPA 3FYJX 3MIAA 2BILB 1A06A 4JIAA 2ITVA 4CRSA 5D1JA 1M7QA 4IZ7A 4CMUA 4C3FA 2OICA 4MK0A 5AUYA 1M14A 2R3LA 3UP7A 5IQCA 5EK7A 2QOCA 5JEBA 4M14A 2R3QA 5K9IA 3O7LD 4HJOA 4UWCA 4B6LA 5T6KA 4D58A 2QOFA 4P4CA 3NW6A 4YHTA 4FVQA 2O65A 4CMOA 1UNLA 2XK8A 3W2RA 4P5ZA 4TL0A 5JK3A 3VUGA 3EQRA 3LQ3A 5IA5A 3MPAA 1L3RE 2QOQA 3QL8A 5I9VA 4Z7GA 4EH6A 3TYKA 2H8HA 3QBNA 5AWMA 3MH3A 2YDJA 2YISA 4BYIA 4C3PA 3M2WA 4E4LA 3M42A 4M68A 3OWKA 2C0OA 4EONA 4R6VA 3BQCA 3PJ3A 3BYMA 5L2IA 3F2NA 1BUHA 3R83A 5HE1A 3ZONA 5L2TA 5GJGA 2VRXA 2WMQA 4ONAA 3UNZA 5E4HA 4O0SA 3Q52A 2X39A 4B9DA 4V0GA 4K6ZA 3RK7A 4NJ3A 2BHHA 4CV9A 4EK5A 5E8XA 4YJRA 5DGZA 4CLIA 5IF1A 2PVHA 3EN5A 1OKYA 2G15A 2HIWA 3FYKX 3PG3A 3MI9A 3D9VA 4QNAA 3JY9A 5JN2A 3DY7A 2QVSE 4EL9A 4CFFA 1CMKE 3KVWA 2H6DA 4NFMA 4BDHA 4ZMEA 3ULZA 4CQEA 3VBQA 2JKKA 2E9VA 2WMRA 3G33A 5I9ZA 2QD9A 3G90X 4QPAA 2E9NA 2OZOA 1YXVA 2P2HA 1YXXA 1OUKA 3DJ5A 4ZXTA 3QQFA 4HNIA 4O0XA 3K5VA 2NPQA 4GU6A 2BKZA 4BDKA 2P55A 3A4PA 3R7EA 4I24A 4FV1A 1SZMA 1M2RA 4BCIA 3CQWA 2JD5A 4S30A 2VWBA 3EL7A 4NSTA 5HIBA 4CCBA 1H0WA 3V8TA 5BYYA 3LJ0A 3QALE 5HI2A 3HP2A 5CAVA 3KULB 1DAWA 1OIQA 3LXLA 4JG8A 4KS8A 4DF3A 3OT3A 4S2ZA 3MPMA 2OW3A 1H08A 3PYYA 5KZ0A 2C5VA 3ACJA 3KF7A 5AV4A 2VWVA 3ORKA 1V0PA 4CRLA 3DU8A 3A7JA 2B9HA 3LCSA 5IUGA 4R7BA 2IZRA 4BCFA 5HQ0A 2FB8A 5CF5A 2OI4X 3DAEA 1OB3A 5E91A 2RIOA 4L52A 3VO3A 4G9CA 4Y95A 4AZVA 1IA8A 2DWBA 3MYGA 4M13A 1R39A 3LPBA 5M4IA 4C4FA 3TWJA 4ID7A 3JUHA 2RKUA 4M7IA 3QA0A 5IEVA 3THBA 4U7ZA 2PSQA 4IAAA 4E4NA 2GMXA 4FTJA 2I0EA 2OFUA 4PDOA 2XJ0A 3ET7A 2PZ5A 3N51A 3VHEA 3AC8A 4O7PA 4FTAA 3BYOA 1PXMA 2ITQA 4TKSA 4XYFA 3S95A 3W33A 3RP9A 1PXOA 2VUWA 4M12A 3F3UA 3D2IA 5CTPA 1YHWA 3BLRA 2Y6MA 3E3PA 3HRBA 4FGBA 3FAAA 3TTIA 2YHVA 4EH5A 4MYGA 3DAJA 5AIRA 2GQGA 3H0ZA 3TT0A 4A9SA 4CD0A 5ICPA 1E1VA 1YI3A 3OY1A 4RZVA 5LARA 3P1AA 2I0HA 4CNHA 2ZV7A 5CEKA 4XG7A 5BVDA 4C4GA 3QXOA 2VTJA 3W10A 5HLNA 4NW5A 4V04A 3QUEA 1CKJA 3C13A 1YW2A 3MVLA 5B7VA 3HA8A 1U54B 5J1VA 1Y57A 3DNEA 5DT3A 3IGGA 3HKOA 5ANKA 5E8WA 3JPVA 3LXKA 3WE4A 1ZRZA 3QX4A 3PVUA 4MD7E 3TZMA 3NZ0A 3PRIA 3QYZA 4NYEA 3GCVA 4GIIA 4ZTHA 2HXQA 4TZRA 5A54A 3GOKA 5HU9A 4ZTSA 4ZSGA 2GU8A 3UMXA 2BDFA 2BROA 1YHVA 4DLJA 5GIOE 3DLZA 5AM7A 5AX9A 3RM6A 3RNIA 4WRGA 4ZZOA 2BDJA 4I6BA 4O83A 4RJ3A 3NIEA 4J98A 1IAJA 4BDJA 2GTNA 5LVOA 3MA6A 1G8AA 4NM7A 4EUUA 4DH1A 2C6MA 3B8QA 4ZTQA 1IASA 4KKHA 3FPQA 3OXZA 4JG7A 1J1CA 3SQQA 4BZNA 2X6EA 2B9FA 2WMAA 3I4BA 3N4UA 4OBPA 5J7HA 3PZHA 4G5PA 5GJFA 4U6RA 3I7BA 2PMIA 1M52A 4GT5A 1ZYCA 3NX8A 4ZLZA 5AUTA 4NW6A 3EYGA 5IDNA 3TG1A 4FEXA 3TJCA 4KUJA 2HZNA 4DAWA 5BNJA 2QLUA 2ZYBA 4FZFB 3SA0A 1P14A 3IW6A 5E8UA 2E9OA 3OS3A 3HECA 1TQPA 2OZAB 4K33A 4XNEA 4YZDA 3BHUA 2XH5A 4O0UA 5I9UA 5FXQA 5CF4A 2VWYA 3II5A 4BIEA 3DBEA 4MBLA 4F6SA 4LOQA 4NWMA 4FKOA 4DEEA 1J1BA 3EIDA 2R3RA 4HPTE 3D83A 2VX3A 4O2ZA 5C03A 4BIBA 5M51A 2C6KA 3E87A 1NVQA 2ZM1A 4WNKA 3RHXA 1CKPA 4FYNA 2FSTX 3O17A 5EM5A 4PV0A 2CNVA 4BN1A 3F5XA 2HZ0A 4E20A 4Z7HA 2IWIA 1IEPA 1AGWA 3MFTA 4I4EA 4FSTA 4BCGA 3ANRA 2UVYA 4AW2A 4D2SA 2IZUA 1TQMA 3NW7A 2PE2A 1QPDA 4PMMA 3QQKA 4JT3A 3N4VA 5D9HA 4O22A 5HX6A 1UWJA 4FT9A 4RIWA 4DGLC 3BHHA 3E7VA 3QTXA 4B8MA 2KTYA 4RWIA 4EK4A 4OR5A 4KABA 3TTJA 4F7SA 1V0BA 1H01A 3R9HA 3JVSA 4EYJA 4UYAA 3DNDA 3PWYA 5C01A 2UZEA 3WF5A 5IPJA 4RJ6A 3KCKA 2WZJA 2GHMA 4GRBA 3V5JA 1JLUE 3DBCA 5IMXA 4Z55A 2VU3A 1IR3A 4G6OA 3CJFA 4IM3A 3ZUTA 1LR4A 3DLSA 3WF6A 5JGDA 3GOPA 2BTSA 2GNFA 2QOLA 2WO6A 2J0JA 4JI9A 4U40A 3RWQA 2XBAA 3CPBA 4FL3A 4L46A 3FKNA 1Q3DA 2O63A 4NL0A 5CWZA 3QRKA 5DT4A 1WVXA 3B8RA 5BVEA 3MDYA 4F9AA 1BMKA 4S32A 4DHFA 1W82A 1H1WA 3NNVA 5H3QA 5EI8A 1NY3A 3BV3A 4ZLOA 4MXCA 4UBAA 5J95A 4LYNA 3UVQA 4CV8A 5IQAA 5IDPA 4YGAA 3QLFA 4MVFA 4IX4A 4K9YA 5IISA 2GDOA 3MH0A 3ZSHA 5DE2A 4OTWA 4F08A 3BGPA 3Q4TA 2G9XA 2CCHA 2I0YA 3LFAA 4F9WA 3CBLA 1BYGA 2IZTA 5HX8A 1MP8A 3SG8A 2UZBA 2W5HA 2XNOA 2OGVA 4CCUA 3COHA 4FEVA 5DHJA 4ZMFA 3KRRA 3QUDA 2WOUA 4OUCA 4BKJA 1R0EA 5FEQA 3R9DA 5C26A 3F3ZA 5CXHA 4ZS4A 3A62A 2OBJA 5EKNA 3HUBA 3O8TA 2QOIA 4R5YA 4E26A 5H8GA 4RX8A 3G9NA 4M84A 4AX8A 3REPA 4U5JA 5K3YA 4ZIMA 2AC3A 5IA3A 2XYNA 3P08A 1DI8A 5HG9A 5CSVA 3IW7A 4ACDA 3RALA 1FPUA 2C6TA 4JDJA 4U8ZA 3RZBA 5AUWA 3VS6A 1U5RA 5LJJA 4HZSA 1OL1A 4GJ3A 4U9AA 3VN9A 3NVMB 1PMVA 4IB3A 3T3UA 3EQBA 5B2KA 3VUIA 3WZUA 2HZ4A 2BRMA 5E8SA 3ZRLA 1Y8GA 3BYUA 3VW6A 3VUMA 4ZJJA 2Q83A 5BVOA 1FGIA 4EC9A 5HG5A 5KMIA 3RHKA 5JRSA 1JVPP 3NMUF 3EFKA 4KA3A 2CCIA 4W8EA 1MQBA 3BYVA 4YMJA 2VWUA 3GB2A 1U46A 5IQEA 1YXSA 2R3OA 4U97A 2J51A 2G1TA 4BI1A 3SOCA 1FGKA 2OXXA 4HVHA 2F7ZE 3QLGA 2JKQA 4FT3A 4OTDA 2BVAA 1GIHA 4HYHA 3SXRA 4TT7A 3QQUA 4TYJA 3VWAA 4IAIA 2OJ9A 4L9IA 2VWIA 3PG1A 4ZK5A 5C8NA 2WKMA 3G51A 3MY5A 2Y6OA 2YAAA 3ENMA 5AP5A 4ALUA 2I1MA 4H39A 2W06A 3ZLYA 3U51A 3KRWA 4RJ5A 3R22A 2XIZA 2R0UA 3DKCA 4FT5A 3D14A 4H05A 4QMXA 4Y5HA 3TNWA 2GTMA 3VJNA 1YDRE 1BL6A 4O6EA 1QMZA 1OI9A 1PMUA 4IC7A 5FBNC 3BQRA 2B54A 4DH7A 4BCPA 4H3PA 4MHAA 2PZIA 1TKIA 3UOLA 4BCQA 4K1BA 4RGJA 4TYIA 5ETAA 4GVJA 2WTDA 4IB5A 3ROYA 4FI1A 4WZYA 3LMHA 2BRGA 3KXMA 3QCXA 4JX7A 2DYLA 3LFCA 3R9OA 3HDMA 2V22A 3UZTA 2PZRA 3TV7A 4J71A 3V01A 4EQCA 2Q0BA 4MWIA 5J9LA 4GCJA 1SVEA 2PE0A 5DA3A 4IBMA 2XM8A 4S33A 3ETAA 3HRCA 3GUBA 4RA4A 3R8PA 4F99A 3DV3A 2X6DA 3MVJA 2XKCA 4MAOA 2I6LA 4RC4A 3ZUUA 3C0IA 4JJRA 2W1FA 4PP9A 3E93A 5AAFA 3UO5A 4FTQA 3SG9A 3VUKA 2XIKA 3R0TA 4BCKA 3CKWA 2J0KA 4FSYA 2F9GA 3H10A 2WFYA 4DA5A 4XHKB 3DZOA 1E9HA 3E3BX 3QZHA 5F1ZA 5CEIA 4D1ZA 4FKPA 3QA8A 3OOMA 3ROCA 3VAPA 5EQPA 4ACCA 3LFQA 3NSZA 4Y73A 1WBVA 3QX2A 1Q99A 4CT1A 3NWWA 4RQKA 1Z5MA 4YZCA 2QLQA 3VRYA 3WE8A 4CSVA 4LV8A 2FUMA 2P0CA 3F69A 3PJ8A 2V0DA 1R0PA 2Z7LA 2RG5A 4O27B 4KAOA 3ZC6A 4BHNA 4F1TA 2BFXA 3MIYA 1I44A 2X1NA 3CJGA 4ACHA 4Q9ZA 3ZDUA 5KNJA 1KUTA 4MCVA 1NW1A 1WVWA 3V3VA 3EZRA 3Q5ZA 2EWAA 2X4ZA 3EZVA 4FTIA 1URWA 3LXNA 4FZDB 2F2UA 2CN5A 3FQEA 5E8YA 4B7TA 1UKIA 4O86A 3RTPA 4U3ZA 3CTQA 4IAFA 3GC0A 4MBIA 2ONLC 2C30A 2W9ZB 3FMEA 5ANIA 5EW3A 3ZDIA 3PY0A 3MGYA 3R63A 4QNYA 4TYHB 2Z60A 2GNGA 1JSTA 4HPUE 2ZAZA 2Z02A 3TNPC 5L2WA 4AXAA 2W96B 1YXTA 3FLZA 3O71A 4J96A 4TWPA 4QPSA 5KMLA 4QMNA 2WTKC 4O7LA 3RAIA 2RL5A 3FMDA 4G2FA 4MQ2A 3H0YA 4X7QA 4AT5A 1ZY4A 4AGUA 4AZWA 2RGPA 3O51A 4YZBA 4RJ7A 3I79A 3V6RA 4BDCA 3PVWA 3CE3A 3OWLA 4KKGA 4BHZA 5JFSA 3QWKA 3FKOA 2BKKA 4QP8A 4YPSA 4YHFA 2C3KA 3P23A 2XK7A 2ONLA 2J0MB 2OJGA 4MNEB 3DBQA 3VBYA 4EH8A 1RQQA 3UQFA 5M06A 1NVSA 4FG7A 4TWOA 4RLKA 4PQNA 3QGWA 4IZ5A 3SDJA 5DIAA 4EZ5A 3UE4A 1Q97A 1WBOA 5I9WA 1ZOGA 2QOBA 3PE1A 5LCKA 1TVOA 5FDPA 1XO2B 2CJMA 2W0JA 3MY0A 4GK2A 4HGSA 3FEGA 5TOZA 3RCJA 3FE3A 4J99A 3SOAA 4EI4A 3FZRA 4R77A 4X6QC 2A19B 2HK5A 1Q8WA 3G2FA 3UOJA 4CFNA 3UQGA 3I0OA 4BI0A 2WHBA 3D5UA 3H9OA 5T68A 4WA9A 5CVHA 5BYZA 4DH3A 2WIPA 4F6WA 1ZY5A 5AFVA 1XBBA 3KULA 4RIYB 3LAUA 2A0CX 3C5UA 3QQLA 4PTEA 4XV2A 4DEGA 4FSQA 4RZWA 4L44A 1UV5A 2OU7A 3QTSA 4IX6A 4XP3A 4QP2A 4Y8DA 4USEA 3B2TA 4RIXB 4DFUA 4UV0A 4DYMA 5HBJA 1VZOA 1FMKA 3UG2A 2IJMA 5I0BA 2V7AA 4GYIA 3PIYA 3ATSA 4AZTA 3OROA 4OLIA 2FSOX 5AA8A 3VW8A 1MRVA 3Q9WA 3U9CA 1JKTA 4EWQA 1YOMA 3U8WA 2R3GA 4F9YA 3KMWA 4KKEA 3TUCA 2J5FA 3ELJA 5EM8A 3WZDA 3NNWA 5JSMA 4JVGA 4O7NA 3EQDA 4ZSEA 3FI4A 5JRQA 4E8AA 3FMNA 3DFCB 3W16A 3QZFA 3U6IA 4TY1A 1P4FA 2EU9A 2R3PA 2VGOA 5AUVA 2ZB1A 5EDRA 3OVVA 3R7UA 4I4FA 2PVFA 2R0IA 4KINA 2QCSA 3O96A 3R73A 2X7FA 4FIIA 4P5QA 4U3YA 4USDA 4YJVA 5HVYA 2NNWB 3UO4A 4QMMA 4KWPA 2IG7A 2J2IB 4GV1A 2PVJA 2QO7A 3EOCA 3PTGA 4M3QA 3VC4A 2J7TA 1O6LA 4I5MA 2R5TA 4B4LA 3PSDA 4KIOA 1YI4A 3EWHA 3VS4A 3R8MA 3QFVA 5M09A 2R2PA 3UP2A 2JIIA 3ZM9A 3W0RA 3ORLA 4WO5A 3R30A 4ZJIA 3OTVA 1XH9A 3R7IA 1ZMUA 2H9VA 1H1RA 4BGQA 4PTGA 1U54A 2GSFA 3GEQA 2XCHA 3CD8A 3O23A 4G34A 3OF0A 4DTBA 3N9XA 1JAMA 3LVPA 4HOKA 2JAMA 2YITA 2OFVA 5FLFA 3PXQA 3R7YA 4KSPA 4U79A 3UGCA 3ZLWA 4HCUA 3UIBA 2OSCA 2QOHA 4EQUA 2WELA 5CU3A 5IZFA 4IAYA 1W0XC 4BCOA 2XJ2A 4AA4A 3C4EA 4XV3A 1P2AA 2GQRA 2ITXA 5M53A 2W4KA 2GPHA 2UW9A 4YLLA 5EYMA 4ZSLA 4FT7A 4FKUA 1H26A 4X3FB 5B2MA 4CKJA 3ANQA 2ZDTA 4S31A 4OTRA 2JGZA 5TKDA 2BZHB 5JMSA 4N6YA 3CY2A 5K4IA 4XOYA 5IH6A 4FIEA 1P4OA 4DFXE 2R64A 4HGTA 2YN8A 3KL8A 4Y72A 3V5PA 2I0VA 5HHWA 1WBPA 4QP4A 4F7JA 3E8CA 3ACKA 3Q32A 1WFCA 1YXUA 2C6EA 2WEVA 1OIUA 2OG8A 3QRUA 4ZSAA 1YWRA 2VNWA 3QD3A 4O7OA 5A9UA 5CF8A 4O0YA 1YDSE 2ZV2A 4YZNA 4JLCA 3VHKA 4DG0E 2XP2A 4E7WA 4R78A 2OZAA 2HENA 1XKKA 3HV3A 4USFA 3IKAA 3NUSA 4J52A 5BX0A 1U4DA 4FTTA 4PNIA 3ORZA 4RWKA 3T9IA 3TKIA 1JKLA 1NXKA 1YI6A 2OIBA 4YTHA 2ZM4A 4IDVA 3ZO2A 4XRLA 4XCUA 4Y5QA 4BBEA 4EEVA 5HLWA 4EOLA 3RK5A 3EFJA 4FSZA 3G6GA 4PDPA 3ZU7A 5HD4A 4JBPA 2YCFA 4ITIA 4O21A 3HDNA 2X9FA 2PVYA 4FBXA 2EVAA 4WUAA 3UPXA 5EYDA 3HL7A 3SV0A 1ZZLA 3OW3A 4BR3A 4FVRA 4UN0C 3BBWA 5A4TA 5AAEA 3O8UA 4QYYA 2ITPA 4I1ZA 4TWCA 3ZYAA 3H9FA 3UVPA 3DQWA 2WQNA 4C34A 3ULIA 2CKOA 4NM3A 5HTBA 5AV3A 1LP4A 2W7XA 3PJ1A 2CDZA 3Q60A 4BDEA 4FV6A 4YZMA 4YC6A 3RM7A 3H3CA 4KRDA 4GKIA 2OJFE 1PXIA 1Y8YA 1GJOA 3KMMA 2BRNA 4HCVA 5IEXA 2VTMA 1ZWSA 3HVCA 4C0TA 2C6IA 2XNNA 4FNWA 4NIFB 4R1YA 4OTFA 4D9TA 4I0TA 2W1DA 3QKKA 2QO2A 4H1MA 1YVJA 4O0WA 5AP0A 3OCBA 4QP6A 4YNEA 3VUDA 3R1QA 1Y6AA 1MRUA 4DBNA 3LJ1A 4PUZA 4G6NA 4QTEA 4JL9A 3AT2A 1ND4A 2O64A 5HCYA 1XJDA 4GFMA 4A9UA 4P2KA 3NNUA 5CVGA 2CNUA 4C2WA 3L9PA 3WILA 4EH3A 2QNJA 3E7OA 5AP6A 4ERKA 4I94A 4BRXA 3QU0A 4XG9A 4ALVA 4WUNA 1Q3WA 5A46A 3TZ9A 1G8SA 3GCPA 3HEGA 3KN6A 4L6QA 2HELA 1H1PA 3RCDA 4G5JA 4EOQA 4ZZNA 4IVCA 4QMUA 4AS0A 4QRCA 5HCZA 3ITZA 5BVFA 2J5EA 1KE7A 1WBNA 2UW3A 4GW8A 3UC3A 2WTCA 3D5VA 3IDBA 4ORKA 4PDYA 2ZMCA 2BUJA 3F2RA 4ZS0A 3RKBA 3F5PA 5ETFA 4EBVA 3OBGA 4EKLA 4ANBA 3PXKA 5EQEA 3F66A 4GK4A 1JPAA 4GJ2A 5EM7A 2UW6A 4JQ7A 4IMYA 2VTPA 2WEIA 4QMVA 2BALA 3LOKA 2YM3A 3P7AA 4AE9A 2J90A 5IH4A 2PVRA 4RT7A 4ZTLA 3QCSA 4F1MA 4GSBA 4OTHA 3F2AA 2HOGA 3CSVA 1Q61A 5D7AA 3VS2A 1XH5A 4LM5A 4DFNA 2QG7A 3TNQB 4W4YA 2IW9A 4JQ8A 3BHVA 4M8TA 3FI3A 3P7CA 4QMWA 4ASEA 4O0TA 4NM5A 5F94A 3JXWA 2YZLA 5BMSA 4FUXA 3L9NA 2F4JA 3KCFA 4KD1A 4RVTA 1DI9A 5D7VA 3LJ2A 4TXCA 1OBDA 2BIYA 4L7SA 3A7GA 4MWHA 3MFSA 4AGCA 3I81A 3SW4A 3ZZWA 2JLDA 3QUPA 4FG9A 2VTAA 3ZO3A 3QC9A 4IB0A 4F64A 1OIYA 1PW2A 4W4VA 4BTJA 3FLSA 4O2PA 1G5SA 4GVAA 4CFUA 4NFNA 4EHVA 2CKEA 5LVPA 3LIJA 4EH2A 2C4GA 5H9BA 5EDQA 4GUBA 2UUEA 4XUFA 4DT9A 4F63A 5I9XA 1KSWA 2C0IA 4RJ4A 2WOTA 1OKVA 5L6PA 2HWPA 2YIXA 2PY3A 5CANA 1ZMVA 2HYYA 2YM4A 3UTOA 4GT4A 1UA2A 4YR8A 2R3JA 5JFXA 4FNYA 2J0LA 2WMSA 4J1RA 4WKQA 5E7RA 3CKXA 4N70A 3QTRA 5FXRA 1SNXA 3ZSIA 5AADA 4FL2A 1MRYA 5F95A 4FTRA 2EXMA 4BYJA 3F3VA 4C7TA 3QZGA 2WB8A 4R3CA 3OBJA 2JEDA 4U98A 4CTBA 4RFZA 3GNIB 4F4PA 4ZEGA 1IA9A 5M07A 2B7AA 4GFOA 2WMBA 2PWLA 1RE8A 5EW8A 3R00A 4JAJA 5FM2A 4I21A 4EOPA 5KMMA 3FMLA 3SX9A 4F0FA 4WG4A 4DCAA 4C4HA 5HG7A 3ZTXA 3HMNA 5IQIA 1EH4A 3FJQE 3B2WA 3PA4A 1BKXA 2EB3A 5KKRB 3ORIA 4LGGA 2YDKA 4AA5A 3Q9ZA 5AX3A 2JDTA 4FIJA 4ANMA 4MXYA 5FP6A 5DLSA 5GHVA 4O6LA 3RPOA 5A4CA 4FV8A 3TDWA 1GOLA 4J8NA 5C4KA 3K54A 5JGAA 4O81A 3FLNC 5C1QB 5LQFA 5I5ZA 1HOWA 5ANEA 4PP7A 2UZTA 2W99B 2WMUA 1ZOEA 3FUPA 3NYNA 3Q4ZA 3QCYA 4FYOA 3DJ7A 4M69B 4RC3A 4ZY4A 1KE9A 5EH0A 5M55A 4FTMA 3K3IA 3ZHPC 4DC2A 3V8WA 4IX5A 4FVPA 1Q62A 1H27A 2X8DA 1OMWA 4IEBA 4LI5A 4YJQA 4DG3E 4BTMA 4CLJA 2C3LA 3W18A 3A61A 3ZMMA 2XIYA 4L00A 4C35A 3A7IA 1OKWA 3RPSA 3E8DA 3TIYA 1PXPA 4IVAA 4RVKA 3E92A 3QZIA 1Q5KA 5EG3A 4C33A 3F88A 4M0YA 5CI7A 4GU9A 2O5KA 4FSMA 3EQPA 3GT8A 2JBPA 5DR6A 4UZHA 3PLSA 2WNTA 2WXVA 5BUIA 2PUUA 2A1AB 3PY3A 3VBVA 2YIWA 4EHGA 2QR7A 3OWPA 4I41A 4MF1A 5LMAA 1PXLA 1REKA 3RAKA 4FKLA 4IFCA 3Q2MA 1Y6BA 3FMHA 5HE2A 2UZDA 3Q4CA 3GU7A 4JBQA 2E2BA 4KS7A 2CKPA 4D5KA 3W0PA 3PY1A 4I23A 2JC6A 4EZ7A 2WTWA 3FY2A 4TYHA 2GCDA 4QOXA 1XQZA 4TYEA 4C36A 4GFGA 5KHWA 4WIHA 4E6QA 1QPEA 3FDNA 4FE2A 3PSBA 4C38A 3ZO1A 4LV5A 4W8DA 1NT2A 3FC1X 4RMZA 2VO7A 3KB7A 4WG3A 5HVKA 4QP9A 1R3CA 1Z9XA 2R4BA 5HE3A 3G9LX 5L6WL 3U4WA 3ZFXA 5C4LA 3IDCA 3DT1A 3E5AA 4HYIA 3RK9A 3Q6UA 4IZYA 4E6AA 3POZA 3TUDA 4WNMA 3KKVA 4IFGA 2X7GA 3QTQA 4I6FA 3BI6A 4LUEA 4MNEA 3W2SA 3KXGA 3TV6A 4HVSA 1PMEA 4BDBA 3CIKA 1B39A 1FVRA 3KA0A 1H25A 4L01A 1GNGA 2BRHA 1J7LA 2FSLX 2W4JA 3OXTA 4XG4A 3CC6A 5AMNA 3W2CA 1PKGA 3MBLA 1OL2A 2WMTA 5CSXA 4EQMA 2BZKB 4XX9A 3S00A 3MH2A 1GIIA 3FMMA 3KXNA 4D1SA 4MD8E 1HCLA 3Q53A 4KBAA 4YLKA 3OTUA 3AD4A 3I5ZA 3W2OA 1PYEA 3H9RA 4B99A 4R3RA 3HV6A 3C4ZA 3G0EA 5J8IA 3ZLSA 3W0MA 4G3CA 4P90A 1WZYA 4U44A 1XH8A 4FNXA 2ZB0A 1KV2A 2PUIA 4RIYA 4V0GB 4FKJA 4XMOA 3UYSA 4Q5HA 2XK6A 3R8LA 1JWHA 4OBOA 2IN6A 3VNTA 3PPZA 3KXHA 1XR1A 3AC3A 3ORMA 4F1OA 2QG5A 3AQVA 4XG3A 1ZMWA 3ALOA 4RIXA 4DGNA 3NGAA 4L68A 3IW5A 3JVRA 5IUHA 4NTSA 4BCHA 5E92A 1H07A 2O8YA 3KRLA 4FOBA 3ENHA 5E90A 3VS5A 3WZJA 4FV4A 1OBGA 3CQUA 5B2LA 4FICA 3GVUA 1H1QA 4FZAB 4QTDA 2LGCA 5EI2A 4O7TA 4EHEA 5ACBC 3VJOA 4DEHA 2JKOA 1X8BA 3NUNA 2P2IA 4J95A 5IA1A 4LFIA 4C61A 4JX3A 4V05A 4MBJA 4WG5A 3NDMA 3WF9A 4FIFA 4FL1A 1BX6A 3UVRA 4YBKA 3NPCA 4GYGA 5CF6A 1KE8A 3M11A 4IWQA 4RX7A 2OIQA 2QOKA 5BYLA 4YURA 3V5WA 3U6JA 4AWIA 4ZAUA 4A4LA 4L3JA 5E8ZA 4APCA 4A4XA 3DXPA 3PRFA 2GNLA 4C02A 3DPKA 1JKSA 3OHTA 4APPA 4EOMA 4IAKA 3D15A 4IWOA 1OUYA 1SM2A 1QL6A 2OH4A 3LM0A 3LMIA 3GI3A 1ZARA 3R02A 1M2QA 3FI2A 4LL0A 4C62A 1Q24A 2P4IA 3FKLA 3QTWA 3RPYA 4BY9E 5KBRA 4JDIA 4K8AA 3ZEPA 3UNKA 4ZY6A 5DEYA 5E8TA 1ZAOA 2AC5A 4RPVA 2VX0A 5L6OA 4LQMA 2ERKA 2ETRA 4TPTA 3W0SA 4D4VA 3QRJA 3GC8A 5HEZA 4EWHA 2VNYA 3PA5A 5AUZA 3DAKA 4ZOGA 3D2KA 2P3GX 1JSUA 2EUFB 4X3FC 3WBLA 3ALNA 3FL5A 4WNOA 5AEPA 5A4EA 2R7IA 3NVKI 4AZSA 1GIJA 3QC4A 3EKKA 5M4CA 5BUJA 3FBVA 1YRPA 5CENA 3GBZA 5IU2A 5CAUA 3HV4A 1XWSA 4HNFA 3KU2A 2GNHA 3U55A 5FRIA 4DGGA 4OTQA 3TDVA 1U59A 1MUOA 3WOWA 4AOJA 4DGOA 3ATTA 1PJKA 1PYXA 1ZXEA 5A3XA 4A9YA 3O2MA 4IVBA 3R28A 4MX9A 3MTFA 3W0NA 4ZTRA 2V7OA 4D4SA 3BU3A 3GQIA 3IQ7A 4CKRA 4X3FA 2PMOX 5HG8A 3WIKA 5CI6A 2OIDA 4YHJA 4DH5A 2PL0A 2XJ1A 4U42A 5C8KA 5E1EA 3TXOA 3RINA 4LRMA 2FH9A 3LFSA 3EQFA 5DNRA 5LMKC 2CLQA 4IB1A 2PVMA 3FZ1A 1LEZA 2GNIA 1CKIA 5IQBA 3NCGA 2XNBA 3W0QA 4FKRA 2XBJA 1ZYJA 2C3JA 2QHNA 1VYZA 4CEGA 3TCPA 4XP0A 1NVRA 3FL4A 3NUXA 3UDBA 2XB7A 5JQ5A 3Q2JA 2BR1A 2GFCA 4RX9A 4EH9A 4ASXA 4QMQA 3QD2B 2R9SA 4RA5A 1UWHA 4FT0A 1OKZA 3KREA 3QQHA 3L8VA 2Z8CA 4IACA 1FINA 5FXSA 5A14A 4IM0A 5CLPA 4EH4A 1JKKA 3Q96A 1XH6A 5EW9A 4F6UA 2VGPA 3NR9A 4IH8A 3VBTA 2X8EA 5LMKA 3D7TB 3IECA 4O82A 4TN6A 4ENXA 4QMZA 3UOHA 3EHAA 2CPKE 4ERWA 2RFNA 3DKGA 3K3JA 5AIKA 3PDTA 4RIOA 2C5XA 3ERKA 5FD2A 4ZLYA 1XHAA 3QD0A 4AACA 4OTIA 1BL7A 5BQ0A 2YERA 5IH5A 3U87A 3QD4A 4BB4A 2W5BA 5FQDC 3GQLA 5BPYA 1FOTA 5K4JA 2UV2A 3AT3A 4G9RA 4M97A 4J8MA 3GCQA 3MA3A 2BZIB 4YJPA 3IW4A 2VWWA 3GENA 4X21A 5GNKA 3OCTA 4NK9A 3QKMA 3VBWA 4AU8A 4EHZA 3UPZA 4K2RA 4E6DA 2CN8A 2HY81 3RPRA 3ZFMA 4DT8A 3MW1A 3RI1A 2IVVA 3HRFA 3VS3A 3CGFA 5IMEA 2J9MA 5HU3A 2YIYA 2ITNA 3FLQA 3IO7A 3KXZA 4XLVA 3UZRA 4FA2A 4IADA 1XBCA 2JIVA 1H00A 2VTIA 4XBUA 5AP7A 4EJNA 5L8KA 3MESA 3MWUA 4FKVA 2W1ZA 5H8EA 5KUPA 2WMVA 4PMTA 3PLAE 2YABA 4PNKA 4WNPA 3LE6A 4FIHA 5FP5A 3FZTA 3HAVA 4ACGA 4UEUA 4U80A 1P5EA 2YJRA 5FBOA 2Y7JA 3DJ6A 5HBEA 5IG1A 3FSKA 4XP2A 5KMOA 2Z7SA 4Y46A 4R5SA 4YJOA 4DG2E 2WU6A 4FEWA 4F0GA 4JNWA 3EQCA 4IAZA 5HICA 1IAHA 1UU3A 4EOKA 2WQMA 4LRJA 2JDSA 3TNIA 5HESA 1K9AA 3MN3A 3DS6A 4KIQA 2C6OA 4RG0A 3KK8A 3VS0A 4RWJA 2BIKB 3GCSA 2FA2A 4F7NA 3IW8A 4E6CA 3TV4A 3VIDA 1W84A 2Z7RA 3MVHA 3HAMA 4HYUA 4TTHB 2XNMA 2YFXA 1KE6A 3BLQA 3WARA 2YIRA 5GJDA 3SXFA 4NM0A 4WOVA 2HWOA 2WQEA 1RW8A 4R7HA 5AA9A 1OPJA 2CKQA 1CM8A 5DEWA 3N4TA 4BI2A 3GU8A 3KRXA 1PF8A 1M7NA 4KBCA 4BBFA 3ZBXA 3A8XA 5CAQA 2UZNA 4DFYA 3ZBFA 2PE1A 4R1VA 3LMGA 3OCSA 4HW7A 5AM6A 3R8ZA 4PMSA 4A06A 1U5QA 1OM1A 4DLIA 4YNOA 1PHKA 2HAKA 2YWVA 3TACA 4QMSA 5ETCA 3C50A 4O0RA 3UBDA 5C27A 3CTHA 4M15A 2H96A 3VRZA 4FSUA 1H8FA 5CSHA 4FOCA 2KULA 3NAXA 3I0QA 1MQ4A 4BICA 2G01A 2B0QA 3SRVB 3ORTA 3NEWA 3COIA 1K3AA 5HNIX 5LVMA 2HZIA 4IWDA 1OVEA 4HCTA 3R7OA 2VTLA 2XKDA 2XK9A 2VTOA 5DG5A 3RJCA 3ZLXA 4EK6A 3NW5A 3IG7A 5DT0A 3LW0A 2CHLA 1OECA 3FPMA 4NT4A 4O7VA 5CQWA 4QQ5A 5DRBA 4ARKA 4QYEA 2WD1A 1YHSA 3CTJA 4QT1A 4GKHA 4BGHA 5M56A 2G2HA 1UKHA 4RBLA 3FXZA 2OH0E 3KXXA 2ITZA 2OKRA 2DUVA 3HMIA 3ZSGA 4CT2A 5M08A 4A07A 3G0FA 3OUKA 3DXNA 3V6SA 2RFDA 3DK3A 4YPDA 4AE6A 4DEIA 5KKRC 4YJNA 4I92A 3T3VA 3QAME 4I3ZA 4IX3A 1RDQE 4YO6A 2IO6A 5KCVA 5FUTA 4DGMA 3NUYA 5EM6A 1AD5A 4HGEA 3R8UA 1VEBA 2ZV9A 3C51A 1KWPA 3DTWA 4BCMA 2VTHA 4E5AX 4RRVA 5AV1A 2ZVAA 3UIXA 4D9UA 5B0XA 3R9RA 4A7CA 2RG6A 5HGIA 4HVGA 3IONA 1WCCA 1T45A 2XK3A 2V5QA 4MXAA 2ETMA 4IHPA 2NRYA 3ODYX 3FMJA 4BBMA 4C59A 2X2MA 2B9IA 4JBVA 2FSMX 4PL5A 2YM7A 4QTAA 1XBAA 1B6CB 2XMYA 4TRLA 1BI8A 4ANLA 2F49A 5HLPA 3LFNA 5EFQA 1H28A 5HIDA 2X2KA 2VAGA 2QQ7A 3R7VA 4F0IA 2NP8A 3P7BA 4XG8A 4IWPA 4DN5A 1PKDA 4JQEA 4FV3A 5HBHA 2RFSA 5BVKA 4FV5A 3DB8A 4G31A 5HNGA 4PMPA 3F5UA 3MH1A 2ERZE 5D41A 1J91A 5BUEA 4FGRA 4EOIA 2EXCX 2GS2A 2OO8X 3BLHA 4IIRA 3BWFA 3QF9A 4H36A 2VN9A 3AC5A 5E8VA 4PL3A 3BX5A 3VQHA 5DR2A 2BAQA 1XH7A 3I60A 4OGRA 3ZXTA 5CSWA 4N0SA 3R2BA 2YACA 2B4SB 3I6UA 4BDDA 2B9JA 3NYXA 5EQYA 2F57A 2OWBA 1UU8A 3NS9A 1W83A 4NUSA 2X4FA 3GFWA 5HNBA 1Q8TA 4J7BA 1A48A 1YDTE 4ZY5A 3VUHA 4YSMA 4EBWA 4G3GA 3RWPA 1FQ1B 1OL5A 2CGWA 5HD7A 2V62A 5A6OA 3Q9XA 2QURA 3IDPA 5J5SA 3ZRKA 4F9BA 5AAGA 3WZKA 2CNQA 3AXWA 4FSRA 4I6HA 5EHLA 2UZLA 4YP8A 3S1HA 2YIQA 5CS6A 3PA3A 3QWJA 3LCTA 4FKSA 5D12A 4AF3A 3BYSA 2ESMA 3CPCA 4C3RA 1GAGA 2XNPA 3IK3A 1GZKA 3BU6A 5EHYA 3BE2A 2WQOA 4FK3A 4YBJA 3ZC5A 4UY9A 2J6MA 4X6RA 2WU7A 5ANDA 2XIRA 3DKFA 3W1FA 4F70A 4QO9A 3SHEA 3D7ZA 2QODA 4C37A 4XS2A 3FZPA 4ZTMA 4FUYA 4JR3A 3HV7A 4Q5EA 2VO0A 3ORPA 5CZIA 5L8LA 2JKMA 4CTCA 2YEXA 2JITA 4BF2A 4J53A 1TQIA 4DFBA 1SNUA 4OT5A 3ZUVA 2ACXA 2VTSA 4KBKA 2EB2A 4UWBA 3UO6A 5CU0A 3BRBA 3LM5A 3WF8A 4DTAA 2QHMA 2YJSA 4FSWA 4UXLA 4BGGA 4AW5A 2JIUA 4FTUA 4Q9SA 3UNJA 3JY0A 4UXQA 3NUUA 4E5BA 3R8VA 3OD6X 5DN3A 4D4RA 4I0SA 4WBOA 3PUPA 5LVNA 5FEEA 2J4ZA 5CVFA 3Q6WA 4D28A 1DM2A 4EOOA 4L8MA 2ZOQA 3C4FA 5ANGA 3KQ7A 2ZV8A 3GP0A 5FTGA 3WZEA 4JR7A 3LFBA 4YTFA 4AT3A 2XNGA 5J1WA 3OMVA 4QQJA 4X2GA 4H3QA 2RFEA 4XRJA 5DYJA 4MXXA 5EYCA 5DPVA 3RVGA 4YLJA 3LXPA 4JAIA 2W17A 3CS9A 5GINE 1RJBA 2ITOA 3Q3BA 1OZ1A 2X81A 3JYAA 4KRCA 4FG8A 1FVVA 2XK4A 4QTCA 1KE5A 4J97A 4AW1A 3NYVA 4C4JA 2YM8A 2JFLA 5DBXA 2UZWE 4BDIA 4HYSA 2HXLA 2YA9A 2OXYA 3TL8A 1Q8YA 4D4YA 1UVRA 1QPJA 2JDVA 4AFJA 2OK1A 2R3NA 1L8TA 3T9TA 3QRIA 3GU4A 5M4UA 2UW7A 2UZOA 3WIGA 3L8SA 4GG5A 4FKGA 4BDFA 5A4LA 3LKMA 3W2PA 2WTKB 4LOOA 4MD9E 2PZYA 2RF9A 4B0GA 2PMLX 3R71A 4IM2A 2UVZA 1GY3A 3A8WA 3HMMA 4FTOA 4XOZA 3C7QA 5FTQA 5ITAA 2W05A 3A60A 4M0ZA 2Y4IB 2Z2WA 3TUBA 1ERKA 4NU1A 4F7LA 3F6XA 3I5NA 3HYHA 2UZVA 3OEFX 3Q9YA 4FTCA 1JOWB 3V51A 2O0UA 3VS1A 4GT3A 3R6XA 5TO8A 4E4MA 2OJIA 3SKCA 4BIDA 3EN9A 2VZ6A 5FG8A 4PRJA 1W7HA 2WGJA 3L8XA 5EOLA 3MB7A 3EN4A 4MH7A 3W55A 4JOAA 3NUAA 2R3FA 4DH8A 3EMGA 3S3IA 2ZM3A 4ASZA 4DFZE 5HZNA 4G6LA 4AA0A 4ANQA 3C5IA 4DTKA 2P33A 3P4KA 5BVWA 1IRKA 3V04A 4AN3A 4Z3VA 2F2CB 5KMKA 3PE2A 1QPCA 4WD5A 3UC4A 2IPXA 3M1SA 2QC6A 3DK6A 3MSSA 4G3FA 4FEUA 5GIPE 3ZEWA 2C69A 4AOIA 3EQHA 4CZTA 2XF0A 4QMYA 4DINA 5JFWA 2GS7A 3LHJA 3MV5A 3HMOA 2PVKA 4DE4A 5LVLA 4AUAA 2XS0A 1KV1A 2XNEA 3ORNA 3JS2A 5J87A 5JFVA 3WYYA 4MTAA 1Q8ZA 3BEAA 3BIZA 5AV2A 4E73A 4HVIA 2XKFA 2PULA 2DS1A 3KK9A 5AV0A 3V5LA 4HGLA 2YM6A 3DFAA 2BPMA 4GH2A 4EK8A 1Q4LA 3FZOA 3PZEA 4CVAA 3P79A 5TF9A 4FEQA 3OXIA 3HA6A 4O84A 4O7WA 2FGIA 4IVDA 4U41A 4DEDA 2I7QA 1T46A 4E1ZA 3LQ5A 2WAJA 3FXXA 2HCKA 1WBSA 3QKLA 3COKA 3HLLA 3P78A 4ZZMA 2W4OA 1A9UA 4U81A 1ATPE 5ANOA 4K18A 2GQSA 3FQSA 2XA4A 4FKIA 4XV1A 3VVHA 4D1XA 3WI6A 2PMNX 1Q8UA 2WMXA 2IW8A 2WQBA 5AUUA 3DBDA 4GS6A 4NTTA 3NYOA 4I20A 3OY3A 3QCQA 2W1HA 2YAKA 3DK7A 3Q04A 4JRVA 2W5AA 1JBPE 2QO9A 4UZDA 5HCXA 3COMA 4G1WA 4NCTC 4XJ0A 1Z57A 1ZYSA 3K2LA 2QKWB 3RAHA 4EJ7A 3F61A 1URCA 3KMUA 5AP2A 4BTKA 3HV5A 4NH1A 4MKCA 5FGKA 2C5NA 4FV0A 4MEDA 1DS5A 4IZAA 2G2FA 3OZ6A 2C47A 1M17A 4NKAA 1KOAA 2BFYA 3AMYA 3D7TA 5CXZA 3F5GA 1JNKA 1YOJA 3EFLA 4WHZA 4YJUA 3ODZX 4JG6A 4LL5A 5H2UA 4OT6A 2IW6A 4Z9LA 1V1KA 4NCTA 3FQHA 4FV2A 5H8BA 2PTKA 4FTKA 3UMWA 2OF2A 4D2RA 2FYSA 3NRMA 4FX3A 4EZ3A 4G17A 4ZJVA 5IEYA 3GXLA 3BEGA 4FV9A 4JIKA 4OTGA 4QQCA 4C2VA 1J3HA 5KMNA 3FY0A 4L53A 1SYKA 3AC1A 3LFDA 4MQ1A 4NKSA 3R1YA 3CLYA 4XG2A 2W1EA 3R04A 3V5TA 3OC1A 2B52A 3V5QA 5G6VA 3EQIA 2F7EE 2WTJA 2F7XE 3U54A 3PXRA 3TKUA 1WVYA 3PJ2A 4UB7A 3CP9A 2CGVA 4IDTA 4YC3A 5K5XA 2B1PA 3MJ1A 4PL4A 1XH4A 5CU6A 3TI1A 3UIMA 1Q41A 3E62A 4WRSA 1CTPE 3I7CA 4AP7A 2ZJWA 4EH7A 2BTRA 4GK3A 2Y9QA 3PSCA 4OBQA 3PIXA 4AFEA 3SXSA 4DEBA 3QTZA 3EYHA 2XM9A 4D55A 1FVTA 3D5WA 2YCQA 2X2LA 2QU6A 2PYWA 4E4XA 1YWVA 5EDPA 3FHIA 2JAVA 1H4LA 4CFMA 3IOKA 4JRNA 3EH9A 5G1XA 5M44A 4EYMA 3PWDA 2VD5A 1UNHA 2YCSA 2YWPA 3K5UA 2XIXA 3C0GA 2BZJA 3KY2A 4O0VA 4PF4A 4RSSA 3S4QA 5CAPA 3HNGA 4A9TA 1Y91A 3MFUA 4AW0A 3UODA 2VV9A 2VX1A 2VTNA 2UW8A 4F9CA 5JGBA 2XUUA 3P5KA 3PP0A 3GGFA 3AG9A 4BDAA 1LEWA 5ANJA 4YZ9A 3VF9A 3ZOSA 3BU5A 4CG8A 3AMBA 4NZWB 3Q4UA 2XEZA 3FLYA 2YM5A 3FWQA 3PIZA 4E93A 3QQJA 1NA7A 5D10A 5IQFA 2R7BA 4E5WA 3F9NA 2IVUA 1PXKA 3E88A 4YTCA 1W8CA 1OGUA 4XLIA 3GU6A 1CSNA 4LGHA 3O8PA 4QYHA 2R3HA 2C6DA 2WTIA 3QTIA 2PUNA 3GC9A 3A4OX 5IQGA 1J7UA 4N57A 3HGKA 4ITHA 1F5QA 3DXQA 4LMNA 4PWNA 4R3PA 2IVSA 4YC8A 4K77A 2YDIA 1ZZ2A 3DQXA 2BCJA 5CASA 1BI7A 2BMCA 3E63A 1J7IA 3DCVA 1B38A 3E8NA 2GHGA 3TZ7A 4PDSA 3WYXA 5KBQA 4IC8A 2B53A 3TJDA 4O7SA 2ZDUA 2UW4A 3EN6A 3ZH8A 5EOBA 4DCEA 3CQEA 1OIRA 2JBOA 3VBXA 5CEPA 2JFMA 4HVDA 1OITA 4FZ7A 3MPTA 4K0YA 3SRVA 3BHTA 5M4FA 4XBRA 5KE0A 4H3BA 4RFYA 5CT7A 3UYTA 1VYWA 3MTLA 3R1SA 3BKBA 4X2JA 5HIEA 4D0XA 3BHYA 4JDKA 2XZSA 3BWJA 3E64A 1KOBA 2CMWA 3FI8A 3FZSA 5HVJA 5IA4A 1G3NA 2PPQA 4X2FA 3OCGA 3JR1A 3OT8A 2BRBA 4Q2AA 3DBFA 5I4NA 4U43A 2AUHA 2W1CA 2XRUA 4OW8A 4F65A 5A6NA 2C6LA 4EK3A 2JDOA 4Y85A 4CMTA 3HMPA 4QQTA 4K11A 2REIA 4L67A 3KFAA 5DH3A 3R9NA 5IUIA 5KX8A 2PZPA 3CY3A 3FHRA 3KN5A 2QKRA 5L3AA 1HCKA 4AZFA 4BVUA 4F09A 2C5YA 3SVVA 4QMPA 5CNOA 3QHRA 3KC3A 3OUNB 3OW4A 2C3IB 3R01A 4FKWA 4A4OA 5FTOA 2Y4PA 3UIUA 4FTNA 4QP3A 3SAYA 3UZPA 4BDGA 4C4EA 2DQ7X 2CGXA 2R3KA 4QMTA 5CQUA 5CY3A 4X3JA 3PFQA 1UNGA 4TNDA 3QTUA 2WPAA 4FNZA 4CFWA 3BV2A 1SVHA 4UX9A 4JXFA 4FKTA 4EC8A 2O2UA 3O7LB 1QCFA 5CALA 3BBTB 4X0MA 4FC0A 4ZP5A 3CR0A 1LPUA 4II5A 2UVXA 4WT6A 1WMKA 3I6WA 1S9JA 4XV9A 5EYKA 3IPHA 3PPJA 4L45A 5DOSA 4C4IA 2PHKA 4Y83A 3C4XA 3CEKA 3VULA 1O6KA 1W98A 2YCRA 4WSYA 5DVRA 2PU8A 5CT0A 3UJGA 3AT4A 4O38A 3DA6A 1SMHA 2BAJA 4PY1A 3ZS5A 3R1NA 4G16A 4O7ZA 3LFFA 5JKGA 2FO0A 2FVDA 4UALA 4AN2A 2ETKA 2SRCA 3SC1A 2XVDA 4DEAA 1YKRA 2AYPA 1CDKA 1YQJA 3F7ZA 4JS8A 3C1XA 1PXJA 2B55A 4IW0A 2QR8A 4AAAA 3FV8A 4WBBB 3LLTA 3W8LA 3AOXA 3U6HA 4AQCA 3AMAA 4KSQA 4BZOA 2WMWA 3LZBA 5C8MA 2W1IA 1H0VA 4BCJA 1E1XA 5DFPA 2VO3A 4NJDA 3T8OA 4G3DA 3EN7A 2Z7QA 2ITTA 3BE9A 4YU2A 3F82A 3MFRA 5CEMA 3VF8A 2HW6A 3DZQA 3KEXA 3QHWA 1ZYDA 3F3TA 2UW5A 3RMFA 5JH6A 2OF4A 3DKOA 5D11A 5AUXA 1ZLTA 2HY0A 4CXAA 3HP5A 2X7OA 3CCNA 4RQVA 4LG4A 1V0OA 2PUPA 1OL7A 2A2AA 2GNJA 2VWXA 2X9EA 4TW9A 1H24A 4W4XA 1R78A 3EFWA 3LCDA 3TIZA 3W8QA 4IJPA 5CNNA 5CU4A 3DOGA 1REJA 4FSNA 4R7IA 5LOHA 2QONA 2PVLA 3OG7A 1WBWA 1STCE 2C5OA 3D94A 4PTCA 3OOGA 3NLBA 2WTVA 3BCEA 2O3PA 4KB8A 4QMOA 1I09A 4O7YA 5BVNA 2A4LA 4QP7A 4MXZA 4L7FA 3P86A 4RLLA 3POOA 3QYWA 4XEYA 3MVMA 2ZMDA 4O7RA 3HZTA 3EQGA 5EKOA 4W4WA 2QI8A 4U94A 3C0HA 3PVGA 3FLWA 4FTLA 4EKKA 4S34A 3NCZA 3SGCA 5KZIA 2C1AA 4XG6A 3W32A 3AC4A 3MS9A 4CFVA 3FSFA 4YJTA 5AP3A 3CD3A 3SW7A 3C4WA 3G15A 1JQHA 5EHOA 4AOTA 4I22A 4YSJA 5J9ZA 1VR2A 1F3MC 4N4SA 1FMOE 4BC6A 4RIWB 3VS7A 4EUTA 2OLCA 3HUCA 5M57A 1F0QA 3BELA 3G6HA 2CLXA 5JZJA 1JSVA 3NUPA 1SVGA 1LUFA 4YJSA 3MY1A 4EOSA 3TM0A 4G3EA 2GFSA 5CAOA 2ITYA 4MXOA 3S0OA 4O96A 3GC7A 2XRWA 4JBOA 4ANSA 3FC2A 4BTFA 2XKEA 2OJJA 3TEIA 4D5HA 3EB0A 4IQ6A 4GIHA 4X2KA 4B8LA 5IQHA 2Y4IC 3IGOA 4TWNA 5AP4A 5CU2A 2E9PA 4YTIA 3SLSA 5L2SA 4CG9A 3W2QA 1GZOA 4LOPA 5DRDA 5FDXA 2X0GA 3GCUA 1PY5A 5L8JA 3ZZEA 1S9IA 2Q0NA 3QRTA 3A7FA 1GZ8A 4L42A 3V8SA 4UWYA 5DR9A 2HW7A 5E9EA 3PXFA 2A27A 3QXPA 2WIHA 5C9CA 5KMJA 4YUQA 3GU5A 3ZO4A 4Z16A 1APME 4DFLA 3O0GA 2ITWA 3TNHA 1O6YA 5EI6A 4ALWA 4TNBA 4I5PA 5HO8A 4CGAA 3A99A 5J9YA 1UU9A 5K5NA 2W1GA 2XYUA 3IS5A 3LCKA 4FR4A 4QYGA 3SD0A 4YO4A 3S2PA 5LCJA 3PXZA 2NO3A 4RVMA 3NAYA 3PP1A 3PJCA 3BZ3A 4FKQA 2QOOA 5F9EA 5JT2A 3H30A 3OWJA 5F4NA 1YOLA 3EL8A 4GUEA 4UYNA 2VTRA 1VJYA 3H4JA 4AGWA 3BGQA 2IVTA 5IQDA 3C4CA 3U9NA 5HTCA 4MNFA 5HORA 2GS6A 2QU5A
chains in the Genus database with same CATH superfamily
3AC2A 3HX4A 1OPKA 3PVBA 4KIPA 4LMUA 3C9WA 5BMMA 1M2PA 3I1AA 3CXWA 2E9UA 3LFEA 3D4QA 2JDRA 4IE9A 4ITJA 5ACKA 1PXNA 4QTBA 3TKHA 2R3MA 2V55A 2CGUA 3UQCA 3A7HA 3KVXA 4RVLA 4JDHA 4KNBA 4I6QA 5LWMA 4I5HA 3D5XA 4ASDA 4HZRA 3F7WA 2I40A 3ID6C 5DWRA 4BCNA 4L3PA 4V01A 5JZNA 4AT4A 3DTCA 3KRJA 3U4UA 2IZSA 2PK9A 3ZM4A 4RWLA 4QP1A 1DAYA 4EORA 1PRYA 3G5DA 3O50A 2C68A 3VQUA 3ORXA 4RX5A 3PXYA 1IG1A 5ETIA 2W9FB 4XH6A 2CSNA 3NIZA 3AGMA 3L8PA 3AGLA 2YZAA 3PPKA 4H1JA 4QYFA 4ZTNA 3RAWA 5F20A 5CX9A 3RPVA 5I9YA 2UZUE 5TR6A 4GMYA 5DI1A 3NNXA 4I5CA 5LMBA 2Y0AA 5A4QA 3LCOA 3DDQA 4GEOA 1GZNA 5AP1A 4D0WA 4BJJA 3KGAA 3R21A 1UU7A 4FMQA 4RFMA 5T3QA 4I93A 3EJ1A 4FK6A 3DB6A 3WF7A 4AZEA 3OP5A 3LQ8A 4FIGA 4GG7A 4U0IA 1R1WA 5KHXA 4A9RA 3E8EA 3ZRMA 1PMNA 3IOPA 4QMLA 4TYGA 3KF4A 2VTQA 2C0TA 3BPRA 3EKNA 3FMKA 2BHEA 3MJ2A 4FV7A 4LRKA 2LAVA 3BGZA 1WBTA 2OXDA 2XEYA 1BLXA 2R3IA 3UG1A 3FXWA 1OPLA 3AKLA 2X8IA 4P7EA 4IANA 5JQ8A 2BDWA 3W0OA 3P0MA 1K2PA 2Y8OA 3L9MA 3TN8A 3QQGA 2GHLA 4I0RA 4IJ9A 4O91A 3AD6A 1OL6A 4C58A 3A2CA 4AGDA 1H1SA 4AG8A 3UOKA 3L1SA 3DGKA 1ZOHA 2VO6A 3L9LA 3OEZA 3D0EA 4DBXA 5CYIA 4CFXA 5FEDA 2J0IA 3P9JA 4N6ZA 2G2IA 5E1SA 5CEQA 5TT7A 2NRUA 5IA2A 4ZSJA 4BZDA 4DITA 4ACMA 5HO7A 4LUDA 5CSPA 1ST0A 3QGYA 5IA0A 4FODA 4CZUA 4DDIA 4FZ6A 2J50A 2VTTA 4AN9A 3AD5A 3OFMA 3GFEA 3ZCLA 3R2YA 5CZHA 4H58A 2PVNA 4CKIA 3F3WA 4U45A 2H34A 1YWNA 2BAKA 3Q5IA 1FBNA 5HE0A 1AQ1A 1O9UA 5HKMA 3LLAA 3CGOA 4L3LA 3ZXZA 4EOJA 4PX6A 4X2NA 4ENYA 1TFFA 5CEOA 1WAKA 2ITUA 4RC2A 2C1BA 5LXMA 5FM3A 2VWZA 2XCKA 3MB6A 5AJQA 4GL9A 4RJ8A 3TZ8A 5KO1A 3ZFYA 4L43A 4M67A 2UW0A 5LWNA 3RGFA 3DDPA 3FYJX 3MIAA 2BILB 1A06A 4JIAA 2ITVA 4CRSA 5D1JA 1M7QA 4IZ7A 4CMUA 4C3FA 2OICA 4MK0A 5AUYA 1M14A 2R3LA 3UP7A 5IQCA 5EK7A 2QOCA 5JEBA 4M14A 2R3QA 5K9IA 3O7LD 4HJOA 4UWCA 4B6LA 5T6KA 4D58A 2QOFA 4P4CA 3NW6A 4YHTA 3NFGB 4FVQA 2O65A 4CMOA 1UNLA 2XK8A 3W2RA 4P5ZA 4TL0A 5JK3A 3VUGA 3EQRA 3LQ3A 5IA5A 3MPAA 1L3RE 2QOQA 3QL8A 5I9VA 4Z7GA 3TYKA 4EH6A 2H8HA 3QBNA 5AWMA 3MH3A 2YDJA 2YISA 4BYIA 4C3PA 3M2WA 4E4LA 3M42A 4M68A 3OWKA 2C0OA 4EONA 4R6VA 3BQCA 3PJ3A 3BYMA 5L2IA 3F2NA 1BUHA 3R83A 5HE1A 3ZONA 5L2TA 5GJGA 2VRXA 2WMQA 4ONAA 3UNZA 5E4HA 4O0SA 3Q52A 2X39A 4B9DA 4V0GA 4K6ZA 3RK7A 4NJ3A 2BHHA 4CV9A 4EK5A 5E8XA 4YJRA 5DGZA 4CLIA 5IF1A 2PVHA 3EN5A 1OKYA 2G15A 2HIWA 3FYKX 3PG3A 3MI9A 3D9VA 4QNAA 3JY9A 5JN2A 3DY7A 2QVSE 4EL9A 4CFFA 1CMKE 3KVWA 2H6DA 4NFMA 4BDHA 4ZMEA 3ULZA 4CQEA 4QEBA 3VBQA 2JKKA 2E9VA 2WMRA 3G33A 5I9ZA 2QD9A 3G90X 4QPAA 2E9NA 2OZOA 1YXVA 2P2HA 1YXXA 1OUKA 3DJ5A 4ZXTA 3QQFA 4HNIA 4O0XA 3K5VA 2NPQA 4GU6A 2BKZA 4BDKA 2P55A 3A4PA 3R7EA 4I24A 4FV1A 1SZMA 1M2RA 4BCIA 3CQWA 2JD5A 4S30A 2VWBA 3EL7A 4NSTA 5HIBA 4CCBA 1H0WA 3V8TA 5BYYA 3LJ0A 3QALE 5HI2A 3HP2A 5CAVA 3KULB 1DAWA 1OIQA 3LXLA 4JG8A 4KS8A 4DF3A 3OT3A 4S2ZA 3MPMA 2OW3A 1H08A 3PYYA 5KZ0A 2C5VA 3ACJA 3KF7A 5AV4A 2VWVA 3ORKA 1V0PA 4CRLA 3DU8A 3A7JA 2B9HA 3LCSA 5IUGA 4R7BA 2IZRA 4BCFA 5HQ0A 2FB8A 5CF5A 2OI4X 3DAEA 1OB3A 5E91A 2RIOA 4L52A 1ZYLA 3VO3A 4G9CA 4Y95A 4AZVA 1IA8A 4AXEA 2DWBA 3MYGA 4M13A 1R39A 3LPBA 5M4IA 4C4FA 3TWJA 4ID7A 3JUHA 2RKUA 4M7IA 3QA0A 5IEVA 3THBA 4U7ZA 2PSQA 4IAAA 4E4NA 2GMXA 4FTJA 2I0EA 2OFUA 4PDOA 2XJ0A 3ET7A 2PZ5A 3N51A 3VHEA 3AC8A 4O7PA 4FTAA 3BYOA 1PXMA 2ITQA 4TKSA 4XYFA 3S95A 3W33A 3RP9A 1PXOA 2VUWA 4M12A 3F3UA 3D2IA 5CTPA 1YHWA 3BLRA 2Y6MA 3E3PA 3HRBA 4FGBA 3FAAA 3TTIA 2YHVA 4EH5A 4MYGA 3DAJA 5AIRA 2GQGA 3H0ZA 3TT0A 4A9SA 4AXFA 4CD0A 1E1VA 1YI3A 3OY1A 4RZVA 5ICPA 5LARA 3P1AA 2I0HA 4CNHA 2ZV7A 5CEKA 4XG7A 5BVDA 4C4GA 3QXOA 2VTJA 3W10A 5HLNA 2XAMA 4NW5A 3ML1A 4V04A 3QUEA 1CKJA 3C13A 1YW2A 3MVLA 5B7VA 3HA8A 1U54B 5J1VA 1Y57A 3DNEA 5DT3A 3IGGA 3HKOA 5ANKA 5E8WA 3JPVA 3LXKA 1XMMA 3WE4A 1ZRZA 3QX4A 3PVUA 4LV7A 4MD7E 3NZ0A 3TZMA 3PRIA 3QYZA 4NYEA 3GCVA 4GIIA 4ZTHA 2HXQA 4TZRA 5A54A 3GOKA 5HU9A 4ZTSA 4ZSGA 2GU8A 3UMXA 2BDFA 2BROA 1YHVA 4DLJA 5GIOE 3DLZA 5AM7A 5AX9A 3RM6A 3RNIA 4WRGA 4ZZOA 2BDJA 4I6BA 4O83A 4RJ3A 3NIEA 4J98A 1IAJA 4BDJA 2GTNA 5LVOA 3MA6A 1G8AA 4NM7A 4EUUA 4DH1A 2C6MA 3B8QA 4ZTQA 1IASA 4KKHA 3FPQA 4F78A 3OXZA 4JG7A 1J1CA 3SQQA 4BZNA 2X6EA 2B9FA 2WMAA 3I4BA 3N4UA 4OBPA 5J7HA 3PZHA 4G5PA 5GJFA 4U6RA 3I7BA 2PMIA 1M52A 4GT5A 1ZYCA 3NX8A 4ZLZA 5AUTA 4NW6A 3EYGA 5IDNA 3TG1A 4FEXA 3TJCA 4KUJA 2HZNA 4DAWA 5BNJA 2QLUA 2ZYBA 4FZFB 3SA0A 1P14A 3IW6A 5E8UA 2E9OA 3OS3A 3HECA 1TQPA 2OZAB 4K33A 4XNEA 4YZDA 3BHUA 2XH5A 4O0UA 5I9UA 5FXQA 5CF4A 2VWYA 3II5A 4BIEA 3DBEA 4MBLA 4F6SA 4LOQA 4NWMA 4FKOA 4DEEA 1J1BA 3EIDA 2R3RA 4HPTE 3D83A 2VX3A 4O2ZA 5C03A 4BIBA 5M51A 2C6KA 3E87A 1NVQA 2ZM1A 4WNKA 3RHXA 1CKPA 4FYNA 2FSTX 3O17A 5EM5A 4PV0A 2CNVA 4BN1A 3F5XA 2HZ0A 4E20A 4Z7HA 2IWIA 1IEPA 1AGWA 3MFTA 4I4EA 4FSTA 4BCGA 3ANRA 2UVYA 4AW2A 4D2SA 2IZUA 1TQMA 3NW7A 2PE2A 1QPDA 4PMMA 3O5AA 3QQKA 3N4VA 4JT3A 5D9HA 4O22A 5HX6A 1UWJA 4FT9A 4RIWA 4DGLC 3BHHA 3E7VA 3QTXA 4B8MA 2KTYA 4RWIA 4EK4A 4OR5A 4KABA 3TTJA 4F7SA 1V0BA 1H01A 3R9HA 3JVSA 4EYJA 4UYAA 3DNDA 3PWYA 5C01A 2UZEA 3WF5A 5IPJA 4RJ6A 3KCKA 2WZJA 2GHMA 4GRBA 3V5JA 1JLUE 3DBCA 5IMXA 4Z55A 2VU3A 1IR3A 4G6OA 3CJFA 4IM3A 3ZUTA 1LR4A 3DLSA 3WF6A 5JGDA 3GOPA 2BTSA 2GNFA 2QOLA 2WO6A 2J0JA 4JI9A 4U40A 3RWQA 2XBAA 3CPBA 4FL3A 4L46A 3FKNA 1Q3DA 2O63A 4NL0A 5CWZA 3QRKA 5DT4A 1WVXA 3B8RA 5BVEA 3MDYA 4F9AA 1BMKA 4S32A 4DHFA 1W82A 1H1WA 3NNVA 5H3QA 5EI8A 1NY3A 3BV3A 4ZLOA 4MXCA 4UBAA 5J95A 4LYNA 3UVQA 4CV8A 5IQAA 5IDPA 4YGAA 3QLFA 4MVFA 4IX4A 4K9YA 5IISA 2GDOA 3MH0A 3ZSHA 5DE2A 4OTWA 4F08A 3BGPA 3Q4TA 2G9XA 2CCHA 2I0YA 3LFAA 4F9WA 3CBLA 1BYGA 2IZTA 5HX8A 1MP8A 3SG8A 2UZBA 2W5HA 2XNOA 2OGVA 4CCUA 3COHA 4FEVA 5DHJA 4ZMFA 3KRRA 3QUDA 2WOUA 4OUCA 4BKJA 1R0EA 5FEQA 3R9DA 5C26A 3F3ZA 5CXHA 4ZS4A 3A62A 2OBJA 5EKNA 3HUBA 3O8TA 2QOIA 4R5YA 4E26A 5H8GA 4RX8A 3G9NA 4M84A 4AX8A 3REPA 4U5JA 5K3YA 4ZIMA 2AC3A 5IA3A 2XYNA 3P08A 3UDTA 1DI8A 5HG9A 5CSVA 3IW7A 4ACDA 3RALA 1FPUA 2C6TA 4JDJA 4U8ZA 3RZBA 5AUWA 3VS6A 1U5RA 5LJJA 4HZSA 1OL1A 4GJ3A 4U9AA 3VN9A 3NVMB 1PMVA 4IB3A 3T3UA 3EQBA 5B2KA 3VUIA 3WZUA 2HZ4A 2BRMA 5E8SA 3ZRLA 1Y8GA 3BYUA 3VW6A 3VUMA 4ZJJA 2Q83A 5BVOA 1FGIA 4EC9A 5HG5A 5KMIA 3RHKA 5JRSA 1JVPP 3NMUF 3EFKA 4KA3A 2CCIA 4W8EA 1MQBA 3BYVA 2XALA 2VWUA 4YMJA 3GB2A 1U46A 5IQEA 1YXSA 2R3OA 4U97A 2J51A 2G1TA 4BI1A 3SOCA 1FGKA 2OXXA 4HVHA 2F7ZE 3QLGA 2JKQA 4FT3A 4OTDA 2BVAA 1GIHA 4HYHA 3SXRA 4TT7A 3QQUA 4TYJA 3VWAA 4IAIA 2OJ9A 4L9IA 2VWIA 3PG1A 4ZK5A 5C8NA 2WKMA 3G51A 3MY5A 2Y6OA 2YAAA 3ENMA 5AP5A 4ALUA 2I1MA 4H39A 2W06A 3ZLYA 3U51A 3KRWA 4RJ5A 3R22A 2XIZA 2R0UA 3DKCA 4FT5A 3D14A 4H05A 4QMXA 4Y5HA 3TNWA 2GTMA 3VJNA 1YDRE 1BL6A 4O6EA 1QMZA 1OI9A 1PMUA 4IC7A 5FBNC 3BQRA 2B54A 4DH7A 4BCPA 4H3PA 4MHAA 2PZIA 1TKIA 3UOLA 4AQKA 4BCQA 4K1BA 4RGJA 4TYIA 5ETAA 4GVJA 2WTDA 4IB5A 3ROYA 4FI1A 4WZYA 3LMHA 2BRGA 3KXMA 3QCXA 4JX7A 2DYLA 3LFCA 3R9OA 3HDMA 2V22A 3UZTA 2PZRA 3TV7A 4J71A 3V01A 4EQCA 2Q0BA 4MWIA 5J9LA 4GCJA 1SVEA 2PE0A 5DA3A 4IBMA 2XM8A 4S33A 3ETAA 3HRCA 3GUBA 4RA4A 3R8PA 4F99A 3DV3A 2X6DA 3MVJA 2XKCA 4MAOA 2I6LA 4RC4A 3ZUUA 3C0IA 4JJRA 2W1FA 4PP9A 3E93A 5AAFA 3UO5A 4FTQA 3SG9A 2XAOA 3VUKA 2XIKA 3R0TA 4BCKA 3CKWA 2J0KA 4FSYA 2F9GA 3H10A 2WFYA 4DA5A 4XHKB 3DZOA 1E9HA 3E3BX 3QZHA 5F1ZA 5CEIA 4D1ZA 4FKPA 3QA8A 3OOMA 3ROCA 3VAPA 5EQPA 4ACCA 3LFQA 3NSZA 4Y73A 1WBVA 3QX2A 1Q99A 4CT1A 3NWWA 4RQKA 1Z5MA 4YZCA 2QLQA 3VRYA 3WE8A 4CSVA 4LV8A 2FUMA 2P0CA 3F69A 3PJ8A 2V0DA 1R0PA 2Z7LA 2RG5A 4O27B 4KAOA 3ZC6A 4BHNA 4F1TA 2BFXA 3MIYA 1I44A 2X1NA 3CJGA 4ACHA 4Q9ZA 3ZDUA 5KNJA 1KUTA 4MCVA 1NW1A 1WVWA 3V3VA 3EZRA 3Q5ZA 1VLRA 2EWAA 2X4ZA 3EZVA 4FTIA 1URWA 3LXNA 4FZDB 2F2UA 2CN5A 3FQEA 5E8YA 4B7TA 1UKIA 4O86A 3RTPA 4U3ZA 3CTQA 4IAFA 3GC0A 4MBIA 2ONLC 2C30A 2W9ZB 3FMEA 5ANIA 5EW3A 3ZDIA 3PY0A 3MGYA 3R63A 4QNYA 4TYHB 2Z60A 2GNGA 1JSTA 4HPUE 2ZAZA 2Z02A 3TNPC 5L2WA 4AXAA 2W96B 1YXTA 3FLZA 3O71A 4J96A 4TWPA 4QPSA 5KMLA 4QMNA 2WTKC 4O7LA 3RAIA 2RL5A 3FMDA 4G2FA 1XMLA 3H0YA 4MQ2A 4X7QA 4AT5A 1ZY4A 4AGUA 4AZWA 2RGPA 3O51A 4YZBA 4RJ7A 3I79A 3V6RA 4BDCA 3PVWA 3CE3A 3OWLA 4KKGA 4BHZA 5JFSA 3QWKA 3FKOA 2BKKA 4QP8A 4YPSA 4YHFA 2C3KA 3P23A 2XK7A 2ONLA 2J0MB 2OJGA 4MNEB 3DBQA 3VBYA 4EH8A 1RQQA 3UQFA 5M06A 1NVSA 4FG7A 4TWOA 4RLKA 4PQNA 3QGWA 4IZ5A 3SDJA 5DIAA 4EZ5A 3UE4A 1Q97A 1WBOA 5I9WA 1ZOGA 2QOBA 3PE1A 5LCKA 1TVOA 5FDPA 1XO2B 2CJMA 2W0JA 3MY0A 4GK2A 4HGSA 3FEGA 5TOZA 3RCJA 3FE3A 4J99A 3SOAA 4EI4A 3FZRA 4R77A 4X6QC 2A19B 2HK5A 1Q8WA 3G2FA 3UOJA 4CFNA 3UQGA 3I0OA 4BI0A 2WHBA 3D5UA 3H9OA 5T68A 4WA9A 5CVHA 5BYZA 4DH3A 2WIPA 4F6WA 1ZY5A 5AFVA 1XBBA 4QDVA 3KULA 4RIYB 3LAUA 2A0CX 3C5UA 3QQLA 4PTEA 4XV2A 4DEGA 4FSQA 4RZWA 4L44A 1UV5A 2OU7A 3QTSA 4IX6A 4XP3A 4QP2A 4Y8DA 4USEA 3B2TA 4RIXB 4DFUA 4UV0A 4DYMA 5HBJA 1VZOA 1FMKA 3UG2A 2IJMA 5I0BA 2V7AA 4GYIA 3PIYA 3ATSA 4AZTA 3OROA 4OLIA 2FSOX 5AA8A 3VW8A 1MRVA 3Q9WA 3U9CA 1JKTA 4EWQA 1YOMA 3U8WA 2R3GA 4F9YA 3KMWA 4KKEA 3TUCA 2J5FA 3ELJA 5EM8A 3WZDA 3NNWA 5JSMA 4JVGA 4O7NA 3EQDA 4ZSEA 3FI4A 5JRQA 4E8AA 3FMNA 3DFCB 3W16A 3QZFA 3U6IA 4TY1A 1P4FA 2EU9A 2R3PA 2VGOA 5AUVA 2ZB1A 5EDRA 3OVVA 3R7UA 4I4FA 2PVFA 2R0IA 4KINA 2QCSA 3O96A 3R73A 2X7FA 4FIIA 4P5QA 4U3YA 4USDA 4YJVA 5HVYA 2NNWB 3UO4A 4QMMA 4KWPA 2IG7A 2J2IB 4GV1A 2PVJA 2QO7A 3EOCA 3PTGA 4M3QA 3VC4A 2J7TA 1O6LA 4I5MA 2R5TA 4B4LA 3PSDA 4KIOA 1YI4A 3EWHA 3VS4A 3R8MA 3QFVA 5M09A 2R2PA 3UP2A 2JIIA 3ZM9A 3W0RA 3ORLA 4WO5A 3R30A 4ZJIA 3OTVA 1XH9A 3R7IA 1ZMUA 2H9VA 1H1RA 4BGQA 4PTGA 1U54A 2GSFA 3GEQA 2XCHA 3CD8A 3O23A 4G34A 3OF0A 4DTBA 3N9XA 1JAMA 3LVPA 4HOKA 2JAMA 2YITA 2OFVA 5FLFA 3PXQA 3R7YA 4KSPA 4U79A 3UGCA 3ZLWA 4DDGA 4HCUA 3UIBA 2OSCA 2QOHA 4EQUA 2WELA 5CU3A 5IZFA 4IAYA 1W0XC 4BCOA 2XJ2A 4AA4A 3C4EA 4XV3A 1P2AA 2GQRA 2ITXA 5M53A 2W4KA 2GPHA 2UW9A 4YLLA 5EYMA 4ZSLA 4FT7A 4FKUA 1H26A 4X3FB 5B2MA 4CKJA 3ANQA 2ZDTA 4S31A 4OTRA 2JGZA 5TKDA 2BZHB 5JMSA 4N6YA 3CY2A 5K4IA 4XOYA 5IH6A 4FIEA 1P4OA 4DFXE 2R64A 4HGTA 2YN8A 3KL8A 4Y72A 3V5PA 2I0VA 5HHWA 1WBPA 4QP4A 4F7JA 3E8CA 3ACKA 3Q32A 1WFCA 1YXUA 2C6EA 2WEVA 1OIUA 2OG8A 3QRUA 4ZSAA 1YWRA 2VNWA 3QD3A 4O7OA 5A9UA 5CF8A 4O0YA 1YDSE 2ZV2A 4YZNA 4JLCA 3VHKA 4DG0E 2XP2A 4E7WA 4R78A 2OZAA 2HENA 1XKKA 3HV3A 4USFA 3IKAA 3NUSA 4J52A 5BX0A 1U4DA 4FTTA 4PNIA 3ORZA 4RWKA 3T9IA 3TKIA 1JKLA 1NXKA 1YI6A 2OIBA 4YTHA 2ZM4A 4IDVA 3ZO2A 4XRLA 4XCUA 4Y5QA 4BBEA 4EEVA 5HLWA 4EOLA 3RK5A 3EFJA 4FSZA 3G6GA 4PDPA 3ZU7A 5HD4A 4JBPA 2YCFA 4ITIA 4O21A 3HDNA 2X9FA 2PVYA 4FBXA 2EVAA 4WUAA 3UPXA 5EYDA 3HL7A 3SV0A 1ZZLA 3OW3A 4BR3A 4FVRA 4UN0C 3BBWA 5A4TA 5AAEA 3O8UA 4QYYA 2ITPA 4I1ZA 4TWCA 3ZYAA 3H9FA 3UVPA 3DQWA 2WQNA 4C34A 3ULIA 2CKOA 4NM3A 5HTBA 5AV3A 1LP4A 2W7XA 3PJ1A 2CDZA 3Q60A 4BDEA 4FV6A 4YZMA 4YC6A 3RM7A 3H3CA 4KRDA 4GKIA 2OJFE 1PXIA 1Y8YA 1GJOA 3KMMA 2BRNA 4HCVA 5IEXA 2VTMA 1ZWSA 2ZFYA 3HVCA 4C0TA 2C6IA 2XNNA 4FNWA 4NIFB 4R1YA 4OTFA 4D9TA 4I0TA 2W1DA 3QKKA 2QO2A 4H1MA 1YVJA 4O0WA 5AP0A 3OCBA 1G8KA 4QP6A 4YNEA 3VUDA 3R1QA 1Y6AA 1MRUA 4DBNA 3LJ1A 4PUZA 4G6NA 4QTEA 4JL9A 3AT2A 1ND4A 2O64A 5HCYA 1XJDA 4GFMA 4A9UA 4P2KA 3NNUA 5CVGA 2CNUA 4C2WA 3L9PA 3WILA 4EH3A 2QNJA 3E7OA 5AP6A 4ERKA 4I94A 4BRXA 3QU0A 4XG9A 4ALVA 4WUNA 1Q3WA 2XARA 5A46A 3TZ9A 1G8SA 3GCPA 3HEGA 3KN6A 4L6QA 2HELA 1H1PA 3RCDA 4G5JA 4EOQA 4ZZNA 4IVCA 4QMUA 4AS0A 4QRCA 5HCZA 3ITZA 5BVFA 2J5EA 1KE7A 1WBNA 2UW3A 4GW8A 3UC3A 2WTCA 3D5VA 3IDBA 4ORKA 4PDYA 2ZMCA 2BUJA 3F2RA 4ZS0A 3RKBA 3F5PA 5ETFA 4EBVA 3OBGA 4EKLA 4ANBA 3PXKA 5EQEA 3F66A 4GK4A 1JPAA 4GJ2A 5EM7A 2UW6A 4JQ7A 4IMYA 2VTPA 2WEIA 4QMVA 2BALA 3LOKA 2YM3A 3P7AA 4AE9A 2J90A 5IH4A 2PVRA 4RT7A 4ZTLA 3QCSA 4F1MA 4GSBA 4OTHA 3F2AA 2HOGA 3CSVA 1Q61A 5D7AA 3VS2A 1XH5A 4LM5A 4DFNA 2QG7A 3TNQB 4W4YA 2IW9A 4JQ8A 3BHVA 4M8TA 3FI3A 3P7CA 4QMWA 4ASEA 4O0TA 4NM5A 5F94A 3JXWA 2YZLA 5BMSA 4FUXA 3L9NA 2F4JA 4FJVA 3KCFA 4KD1A 4RVTA 1DI9A 5D7VA 3LJ2A 4TXCA 1OBDA 2BIYA 4L7SA 3A7GA 4MWHA 3MFSA 4AGCA 3I81A 3SW4A 3ZZWA 2JLDA 3QUPA 4FG9A 2VTAA 3ZO3A 3QC9A 4IB0A 4F64A 1OIYA 1PW2A 4W4VA 4BTJA 3FLSA 4O2PA 1G5SA 4GVAA 4CFUA 4NFNA 4EHVA 2CKEA 5LVPA 3LIJA 4EH2A 2C4GA 5H9BA 5EDQA 4GUBA 2UUEA 4XUFA 4DT9A 4F63A 5I9XA 1KSWA 2C0IA 4RJ4A 2WOTA 1OKVA 5L6PA 2HWPA 2YIXA 2PY3A 5CANA 1ZMVA 2HYYA 2YM4A 3UTOA 4GT4A 1UA2A 4YR8A 2R3JA 5JFXA 4FNYA 2J0LA 2WMSA 4J1RA 4WKQA 5E7RA 3CKXA 4N70A 3QTRA 5FXRA 1SNXA 3ZSIA 5AADA 4FL2A 1MRYA 5F95A 4FTRA 2EXMA 4BYJA 3F3VA 4C7TA 3QZGA 2WB8A 4R3CA 3OBJA 2JEDA 4U98A 4CTBA 4RFZA 3GNIB 4F4PA 4ZEGA 1IA9A 5M07A 2B7AA 4GFOA 2WMBA 2PWLA 1RE8A 5EW8A 3R00A 4JAJA 5FM2A 4I21A 4EOPA 5KMMA 3FMLA 3SX9A 4F0FA 4WG4A 4DCAA 4C4HA 5HG7A 3ZTXA 3HMNA 5IQIA 1EH4A 3FJQE 4BJJB 3B2WA 3PA4A 1BKXA 2EB3A 5KKRB 3ORIA 4LGGA 2YDKA 4AA5A 3Q9ZA 5AX3A 2JDTA 4FIJA 4ANMA 4MXYA 5FP6A 5DLSA 5GHVA 4O6LA 3RPOA 5A4CA 4FV8A 3TDWA 1GOLA 4J8NA 5C4KA 3K54A 5JGAA 4O81A 3FLNC 5C1QB 5LQFA 5I5ZA 1HOWA 5ANEA 4PP7A 2UZTA 2W99B 2WMUA 1ZOEA 3FUPA 3NYNA 3Q4ZA 3QCYA 4FYOA 3DJ7A 4M69B 4RC3A 4ZY4A 1KE9A 5EH0A 5M55A 4FTMA 3K3IA 3ZHPC 4DC2A 3V8WA 4IX5A 4FVPA 4QDEA 1Q62A 1H27A 2X8DA 1OMWA 4IEBA 4LI5A 4YJQA 4DG3E 4BTMA 4CLJA 2C3LA 3W18A 3A61A 3ZMMA 2XIYA 4L00A 4C35A 3A7IA 1OKWA 3RPSA 3E8DA 3TIYA 1PXPA 4IVAA 4RVKA 3E92A 3QZIA 1Q5KA 5EG3A 4C33A 3F88A 4M0YA 5CI7A 4GU9A 2O5KA 4FSMA 3EQPA 3GT8A 2JBPA 5DR6A 4UZHA 3PLSA 2WNTA 2WXVA 5BUIA 2PUUA 2A1AB 3PY3A 3VBVA 2YIWA 4EHGA 2QR7A 3OWPA 4I41A 4MF1A 5LMAA 1PXLA 1REKA 3RAKA 4FKLA 4IFCA 3Q2MA 1Y6BA 3FMHA 5HE2A 2UZDA 3Q4CA 3GU7A 4JBQA 2E2BA 4KS7A 2CKPA 4D5KA 3W0PA 3PY1A 4I23A 2JC6A 4EZ7A 2WTWA 3FY2A 4TYHA 2GCDA 4QOXA 1XQZA 4TYEA 4C36A 4GFGA 5KHWA 4WIHA 4E6QA 1QPEA 3FDNA 4FE2A 3PSBA 4C38A 3ZO1A 4LV5A 4W8DA 1NT2A 3FC1X 4RMZA 2VO7A 3KB7A 4WG3A 5HVKA 4QP9A 1R3CA 1Z9XA 2R4BA 5HE3A 3G9LX 5L6WL 3U4WA 3ZFXA 5C4LA 3IDCA 3DT1A 4LDTA 3E5AA 4HYIA 3RK9A 3Q6UA 4IZYA 4E6AA 3POZA 3TUDA 4WNMA 3KKVA 4IFGA 2X7GA 3QTQA 4I6FA 3BI6A 4LUEA 4MNEA 3W2SA 3KXGA 3TV6A 4HVSA 1PMEA 4BDBA 3CIKA 1B39A 1FVRA 3KA0A 1H25A 4L01A 1GNGA 2BRHA 1J7LA 2FSLX 2W4JA 3OXTA 4XG4A 3CC6A 5AMNA 3W2CA 1PKGA 3MBLA 1OL2A 2WMTA 5CSXA 4EQMA 2BZKB 4XX9A 3S00A 3MH2A 1GIIA 3FMMA 3KXNA 4D1SA 4MD8E 1HCLA 3Q53A 4KBAA 4YLKA 3OTUA 3AD4A 3I5ZA 3W2OA 1PYEA 3H9RA 4B99A 4R3RA 3HV6A 3C4ZA 3G0EA 5J8IA 3W0MA 3ZLSA 4G3CA 4P90A 1WZYA 4U44A 1XH8A