5C4LA

Conformational alternate of sisomicin in complex with aph(2")-iva
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Aminoglycoside binding and catalysis specificity of aminoglycoside 2-phosphotransferase IVa: A thermodynamic, structural and kinetic study.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 98
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c4lA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 5c4lA02
1CKIA 1M2QA 2WEVA 3OROA 4KIOA 3P7BA 5EDPA 4FEXA 2VZ6A 3ZUTA 3NPCA 4PY1A 4O7SA 5GIPE 3K5UA 3TDVA 2QCSA 4QP4A 4Y5QA 3HMPA 2W1EA 1KE6A 2BHEA 5DVRA 3V5PA 3ZDIA 4PDYA 4NJ3A 3OVVA 4GFOA 5E8VA 3QKLA 2VAGA 4BBMA 5HO7A 3I79A 5DT3A 4FOBA 2W4JA 3MB6A 5CVHA 3T3VA 4PP9A 5CYIA 2PMLX 2R3FA 4FSYA 2YM3A 2BDFA 2XJ0A 3C1XA 2VU3A 3TIZA 3T9IA 2WB8A 2CN8A 1OGUA 1P2AA 3NYOA 4V0GB 4BN1A 3UO5A 3DKGA 4KUJA 4RX7A 3WBLA 2PVNA 3SA0A 2JFLA 4FK6A 5CY3A 5LVNA 3UPZA 3ZLXA 1PY5A 4EH6A 4RJ4A 4WBOA 4EK8A 5JFSA 1E1XA 3OXIA 2XIRA 3D15A 5T6KA 4USEA 2H9VA 3NVMB 4IZ5A 4NM3A 5BUEA 3QTSA 1WBSA 3SVVA 4DFNA 1BUHA 3E8DA 4AW2A 3DNEA 2YIXA 3OMVA 4FEWA 5KMLA 5G1XA 3AC5A 2E2BA 5LCJA 3BU6A 3E63A 4DGGA 4CFXA 3IG7A 1T46A 5DRBA 5JFVA 3KRWA 4RQKA 3MTLA 4IIRA 3H0YA 4IB5A 1WBWA 3R8VA 1F5QA 2YJRA 3ZLYA 4EJ7A 5BVDA 4F9CA 1H1QA 3RAWA 4XHKB 3ZXZA 4I41A 3JVSA 3RVGA 3OG7A 4EHGA 3MJ1A 4J96A 2YCQA 3V3VA 2IZSA 3FHRA 2Y4PA 3IS5A 4MF1A 4OTRA 3LCOA 4XEYA 5JQ8A 4BDEA 3C9WA 3QXPA 1YKRA 3N9XA 1CTPE 3Q96A 4FKVA 4IW0A 3KCKA 3EKKA 4HNIA 2F4JA 3EKNA 3GC0A 3NW7A 2R3HA 4QNAA 4UEUA 3FI3A 3U55A 5KBQA 3CR0A 4AE9A 5JZNA 4CEGA 3QTZA 4X6QC 3FXZA 3VULA 5L8LA 1NT2A 3NSZA 2WMUA 4TTHB 4BZOA 5CX9A 1UNHA 4PWNA 3A7HA 1GIIA 3R7VA 4OT6A 3FDNA 3WI6A 3D83A 3OW3A 4JRVA 4CG8A 3H9OA 4BF2A 1FMKA 5HBHA 1R39A 2QODA 2X4ZA 3R21A 3LFQA 1Y91A 2EWAA 4O22A 2IJMA 4M7IA 4X2GA 5HESA 4CTBA 4UWYA 4XG7A 5EKNA 1U59A 2CCHA 5LVMA 5FG8A 3GCVA 3DS6A 5AA8A 2VTLA 2W1GA 5D9HA 3W16A 2PHKA 2UW4A 3O17A 5JRQA 4AF3A 3A8XA 4FSTA 2VX3A 2BMCA 2PPQA 3W1FA 3GGFA 2ZV8A 3MFUA 1O9UA 4NCTC 3EFLA 1O6KA 4F7JA 3A4PA 4C58A 5HE2A 1CKJA 3VO3A 4ZY4A 4RFYA 1Y6BA 4N6ZA 4DFYA 4N0SA 1IR3A 2QG5A 4FKIA 5HNGA 3R9OA 4DH3A 1WBVA 3DTWA 1BI7A 3BYMA 3IW8A 3ZC5A 5JMSA 4M69B 1XH5A 3UNKA 4N70A 3SG8A 1H0VA 3TJCA 3UC3A 5D12A 1OKWA 3C4WA 1QPDA 2ITUA 4FV8A 2VTQA 4JOAA 5JQ5A 3MY5A 4CV9A 4L67A 4XUFA 3DTCA 4D1SA 2ETMA 3PSBA 4JVGA 2BRMA 3MA6A 3BGPA 3R04A 3VBQA 4ZY5A 4FTAA 2XK6A 3BV2A 3FL4A 5A4TA 3K3IA 1GZNA 4QT1A 4EHEA 5ANDA 4FSWA 4R7IA 4ZSAA 3EOCA 4I5HA 2X2LA 3T8OA 2XVDA 4LOQA 3OWPA 1YXUA 2C6TA 3ZU7A 3TV6A 1JSVA 2ZB0A 3NYNA 3ANRA 2ZV9A 3SRVA 2J0LA 2B52A 4FNYA 2QKWB 5KMKA 3ZLWA 3DK6A 5H3QA 5EOLA 4IWPA 4FUXA 4XMOA 2E9NA 3FQHA 4RWKA 3TUDA 3Q6WA 3QD0A 3R2BA 4BHNA 4OUCA 4WNKA 4X3FC 4JDIA 4YJVA 3B8RA 4KNBA 4TY1A 2X8IA 3WZKA 2X1NA 1GIJA 2B53A 2ACXA 3DB8A 4D1XA 1DI9A 2EXCX 3PIYA 1YOJA 2UUEA 4YHJA 3TM0A 3UMXA 4GH2A 4L45A 3MVJA 2HIWA 3O23A 3OWKA 4FL1A 3OBJA 4G9RA 2ZMCA 2Z7LA 5DBXA 3VBVA 4BGGA 2GU8A 4YJUA 3QTWA 4XLVA 4QQCA 3S4QA 2OZAB 3I6UA 5LARA 1URWA 2OZOA 5EI6A 3UOHA 4EBWA 1GOLA 3MPTA 2XA4A 2BFXA 3WF8A 4EQMA 4LGGA 5FXQA 3L8VA 2ITZA 2QR7A 5EYKA 3W2CA 1F3MC 3OUKA 4R5YA 4B8MA 2YIYA 4F9AA 5CF6A 3PLSA 2ZM3A 1KE7A 4FYOA 4R7HA 4DBXA 2G2HA 4KD1A 5EYCA 1OIRA 3LFCA 3LFBA 4EK3A 3LHJA 3A7JA 3PJ2A 1SMHA 4U81A 4CKIA 3QU0A 1QPCA 3T3UA 3QRIA 5ANKA 3COKA 3ZZEA 4C3RA 4YJTA 2CGWA 3R8UA 3PWYA 4USDA 3KXXA 5E92A 3V5LA 3Q4UA 4XX9A 4DC2A 4EH8A 2Z2WA 4IC8A 4OR5A 3MIYA 3R0TA 4J8NA 3M42A 3QX2A 3D9VA 3DAJA 4FV2A 4HZSA 4U80A 3F5PA 5CXHA 3SXFA 4I5PA 2B9IA 4R7BA 3R01A 2J0KA 2VWBA 2GMXA 2WQNA 4I4EA 4PV0A 4A4OA 1K9AA 3FYJX 2WKMA 4NTTA 2WMBA 5EQEA 3HMMA 5CI6A 4YR8A 5CSPA 3KRRA 1ZZLA 3OCGA 4EH4A 2BTRA 1OUKA 3OCSA 4CTCA 2WQBA 3E8CA 4NJDA 5IA4A 3FMDA 4EQCA 2J51A 2XRWA 5FM2A 4NH1A 2PMOX 5FBOA 3O71A 2BFYA 5H8BA 3ZLSA 1ZLTA 4FKUA 5F4NA 5F9EA 3B2WA 1LPUA 5CAQA 3GU4A 1JLUE 3QD2B 2CKEA 2EU9A 3P5KA 4IWDA 3L8XA 5IA0A 4RFMA 3U6IA 4UWBA 5HEZA 3LCKA 4QMZA 2R3QA 5K5NA 4FV1A 2B9JA 3FJQE 2BRHA 4HCTA 4L8MA 5AP1A 4ZTMA 1M7NA 1Q8YA 4FKRA 3FMNA 3DJ7A 4FNZA 5HBJA 4BDGA 4MXOA 5EI8A 2JIVA 4JBQA 2J0IA 3C7QA 3P7CA 5HVYA 4ASZA 4XG6A 3DFCB 1H00A 2X4FA 3Q04A 4YGAA 5H9BA 3TIYA 3VF8A 3WILA 3L8PA 3HVCA 5CF5A 4CNHA 3CTJA 3UG2A 4KABA 4E20A 4KAOA 4YC8A 1Y6AA 2XRUA 3BGQA 3ZXTA 4AA5A 1BL6A 1Q99A 2UZNA 3C5IA 3OOGA 4BGHA 3U9NA 2XH5A 3BZ3A 5EG3A 3EJ1A 4X21A 3GQLA 4K9YA 5M56A 3CJGA 3Q9XA 2JKMA 4H3PA 5KX8A 4NFMA 2C4GA 3NX8A 1Z9XA 4BDKA 5HG7A 3P08A 4GL9A 4KS8A 3Q53A 1EH4A 5AP0A 2Y0AA 2PU8A 3F2RA 3PJ3A 4EH5A 3EQHA 3ZO4A 2GNFA 3QKMA 3VBXA 2UW8A 4AZSA 3IONA 1PKGA 1J7UA 3F5XA 4M84A 2W1FA 2Z8CA 4NW6A 3RK7A 4GEOA 3B2TA 3N4TA 1W0XC 3QYZA 2VTTA 4O21A 5A46A 1AD5A 4LOPA 4MCVA 2A2AA 4D4RA 4MXYA 3FC2A 4MNEB 4BHZA 4D28A 3NUAA 5EI2A 3CIKA 3FLNC 4GT3A 4H39A 2R3KA 2PVKA 2VN9A 4ZTNA 2GPHA 1OPKA 1WBOA 2PE2A 4KIPA 2IO6A 2O3PA 4OTFA 4FKJA 4U98A 4FR4A 2GCDA 2ITWA 2RGPA 3C5UA 3W2PA 3ZSIA 3COHA 5KZ0A 1H1PA 3Q9YA 4L3PA 3F5GA 3OWLA 3HYHA 4QMQA 4AWIA 5DHJA 4GUBA 4PL5A 2OF2A 4AACA 4M8TA 4PDOA 4F08A 1V0PA 4PNIA 4BCGA 2QU5A 4FTOA 3VWAA 3QZFA 4MHAA 4DTKA 1OIUA 4BZNA 4RMZA 2IN6A 4XG8A 1BX6A 3JY9A 3R9HA 4FV5A 1OL6A 4D55A 4E4NA 1BKXA 3C51A 5AP3A 1DAWA 3BHHA 4G5PA 1IAJA 2JD5A 3RCJA 3GCQA 1AQ1A 2RG6A 4R5SA 5HE3A 4IM3A 2JBOA 4Q9SA 3FUPA 3KQ7A 3A61A 3LIJA 4UBAA 4IVCA 2VTMA 2XK7A 5HQ0A 5E8SA 3ZSHA 4O7WA 4NWMA 3MESA 1P4OA 1OL2A 2OXXA 2UW5A 4CQEA 3MY0A 5EFQA 5HIDA 4ERKA 4OTHA 4GT5A 3TKHA 2XIYA 5FDPA 2OICA 2WMAA 5C9CA 2UZDA 4XLIA 4ZTHA 3GFWA 1TVOA 4G1WA 4I6HA 2W06A 4ZLZA 4BDAA 4ZZMA 3U9CA 4E1ZA 2BIYA 1Q97A 4IADA 5HICA 2XKEA 2J7TA 2R3RA 2RF9A 2QD9A 3QTQA 4QTEA 2UZUE 4B9DA 4RPVA 4RC2A 4RLLA 3TYKA 3MBLA 5CNOA 3ZRLA 4V05A 3GBZA 2A4LA 3RNIA 4CZTA 4TNBA 2ZDTA 2Y4IC 4TT7A 3F66A 3H0ZA 5E4HA 1LEWA 2EB3A 2DQ7X 2YM6A 3QF9A 4XCUA 3LJ1A 3VQHA 5KCVA 3AT2A 3ZCLA 3QRTA 3ZBFA 2OWBA 4EOMA 3NUPA 1U4DA 2IZUA 1PJKA 4B4LA 4GJ2A 3KU2A 2R3JA 4BCQA 4WZYA 3EL8A 2CNUA 1ZYSA 3CD3A 4C34A 4WSYA 1IG1A 3UTOA 3CTQA 3EWHA 4PQNA 4BDJA 4A9UA 4L53A 4KINA 3V5WA 2GS6A 4YJPA 3GC8A 4KWPA 2YIWA 3OT3A 5C4LA 3COMA 3TL8A 2V22A 2X2KA 4R6VA 3SOCA 4GS6A 3LXPA 4HVIA 5JGBA 1J7IA 3LLTA 3CP9A 2E9OA 2BUJA 4IE9A 4JL9A 5IUIA 3PXRA 3UVRA 4I0RA 3ZM4A 4C38A 1M2PA 3LQ8A 2O8YA 3UODA 1OI9A 3PDTA 3QWJA 4OT5A 2F7ZE 5EQPA 4ZJIA 4O7OA 4YNOA 4IAIA 2R3MA 2DUVA 2FGIA 3DAEA 3QHRA 2W99B 5CT0A 2I0EA 1JSUA 2BZJA 2C5XA 2J50A 2QHNA 3KGAA 3ODYX 3PY0A 1K3AA 1Q8TA 3D94A 1Q3WA 3POZA 4IZ7A 4WG4A 4ZP5A 2F49A 1MRUA 3NYXA 5C8NA 5HLNA 4MK0A 3PXQA 2C0TA 2UW3A 3DFAA 4I94A 4O7VA 1U54B 4NM7A 2PUNA 2G2FA 1OB3A 2WEIA 3BHVA 5HE0A 1OIYA 2HY0A 3W10A 4FKGA 3ZO3A 5CF4A 1QPEA 5A6OA 3QTXA 2OH4A 4D0XA 3KF7A 3DDQA 4E73A 5DYJA 5A4LA 1OM1A 5H8GA 4U3YA 4BTMA 3AT3A 1FINA 3DBCA 1KV2A 3EHAA 4JR3A 5BVWA 4FIEA 2WMXA 4O0VA 5AP5A 3D5UA 4XG3A 4FKTA 3P79A 2I0VA 4JT3A 4RJ6A 3OZ6A 3AQVA 3VUDA 5BUIA 4ALVA 1YI4A 4WBBB 4YP8A 4BIBA 5DWRA 5DR2A 1P4FA 5BVNA 3SRVB 3VUIA 4AW5A 5LWMA 3U4UA 3EN6A 4AP7A 5T3QA 5CAPA 4UN0C 3W0SA 5DT4A 5CAUA 4OTDA 5E8ZA 2V7AA 4BCIA 3O51A 4GIHA 2CDZA 2GNHA 5BX0A 2ZV7A 2CLXA 4O0SA 2B9FA 2HK5A 3HDMA 5IDPA 3BLQA 4EKLA 2B54A 5I9UA 2LAVA 5EYDA 1ZOEA 5FGKA 5BVEA 4IAFA 4E7WA 4ONAA 4D4VA 1H27A 1I09A 5HLPA 3K3JA 1PHKA 2ESMA 3MPAA 4FMQA 4R3RA 5FP6A 3JPVA 3G9LX 3ERKA 4XG4A 3UNJA 4L01A 4L68A 1PRYA 4CMTA 1GJOA 4O7PA 5LXMA 1SNUA 2J2IB 3FZ1A 2C6OA 3QFVA 4B0GA 3EN9A 3G51A 4QPSA 4FNWA 4BTJA 4ZS4A 2X9FA 2WHBA 3CKXA 2PWLA 3F3UA 4YZNA 4XV1A 2C1AA 2VO0A 2FVDA 3ZM9A 4WG5A 4BRXA 3EN4A 4DTBA 3BYOA 2YDJA 4CRSA 3P86A 4X0MA 3NAYA 2IZTA 4CCBA 4BTFA 2WFYA 4HYIA 5CZIA 5IUHA 5KMNA 1UWJA 4U94A 3DK3A 2J5EA 2YHVA 3KULA 2SRCA 3HKOA 5HCXA 3KRXA 4FTJA 5BYYA 3D7TB 4G3EA 1XBBA 3HNGA 4YTCA 5L3AA 2OJFE 2GNJA 3OTVA 3AD5A 4EL9A 3MB7A 3MVMA 3QTUA 4QO9A 2QOKA 4O82A 1P5EA 5CANA 3E7OA 4EOSA 2BVAA 4YLJA 2ZOQA 4FTRA 2IVTA 3V8SA 4UYNA 3VS2A 4L6QA 1H01A 3BELA 4F9BA 3NR9A 4I20A 4MH7A 5DGZA 2XK3A 4CFNA 2B7AA 3DA6A 1J3HA 4O38A 3PSDA 1REJA 1IAHA 1OL7A 2XK4A 3FWQA 1H07A 5DN3A 5EW3A 3LXKA 5KKRC 5M4FA 2FSLX 3ATTA 3EZRA 2QOIA 3ROYA 2W5BA 5IG1A 4V04A 5C03A 2C3JA 5KMJA 2CKQA 3DKFA 4YJSA 4DGLC 5FTQA 2VWYA 3P7AA 5BVFA 2NPQA 4H1JA 2OIQA 1B39A 2GFCA 4FG8A 3NNXA 3SC1A 4DAWA 3LE6A 4AQCA 5EW8A 3ORZA 4YTHA 2JAMA 3BHYA 3KVWA 4GFMA 4ZJJA 2PZIA 3F2NA 4EOPA 1PYEA 2OO8X 3UZPA 2ITQA 3V8TA 4PTEA 3WE4A 3VRZA 3F3WA 2RFEA 4S30A 4U6RA 5KNJA 4IH8A 1YI6A 2G2IA 4R77A 4GVAA 3S2PA 4CVAA 5M4CA 1W82A 1ZYCA 4ZTSA 2EUFB 4JIKA 3EIDA 4DINA 4YHFA 4CMOA 2C68A 4D9TA 3HMNA 4QTCA 4YJNA 1R78A 2P3GX 3MJ2A 4C2WA 2YCFA 3UOJA 3QALE 4E6AA 1XJDA 4CKRA 4JG8A 3P1AA 3ULIA 5CAVA 4LQMA 2R5TA 3V6RA 2OSCA 4AG8A 3QQKA 4Z3VA 2W1DA 3PJ8A 5CF8A 3MWUA 3G5DA 4RJ3A 2WMTA 3EQIA 2EB2A 4HNFA 2F7XE 2KTYA 1YHVA 3HEGA 5HO8A 4BGQA 5B7VA 1PYXA 2XIKA 2VTJA 3AC1A 4OBQA 1ZY4A 3BPRA 5AUYA 5CSVA 5ICPA 4RIOA 3G90X 4MBJA 2OGVA 4YZBA 2VWWA 3D0EA 3QQHA 4RX9A 4PX6A 5J87A 3BRBA 3I4BA 4JLCA 3W2QA 1XH8A 2XEZA 4FTLA 4OBPA 1Y8GA 2F2CB 4Y95A 5JEBA 4O6LA 2WOTA 3RHKA 4DT8A 2XZSA 2W17A 4UYAA 4XV9A 2YFXA 2XKDA 4BI1A 3LW0A 2O2UA 3M11A 3RI1A 1M52A 2Y4IB 2Z7QA 4MWHA 4QTDA 3A2CA 3OTUA 5CEOA 5KO1A 3OFMA 5L2WA 4C3FA 5DOSA 4EOKA 3CEKA 5M44A 4DEEA 4JRNA 4EORA 2CNQA 1TQPA 3PWDA 5ANIA 3GT8A 5M06A 2HAKA 2R3LA 3PFQA 3RPVA 3CLYA 5BQ0A 5C01A 2XMYA 1R0EA 4FIJA 4AT4A 2IPXA 1MQ4A 3H10A 3KCFA 5EW9A 2QLUA 1GY3A 5IEVA 2VWZA 3OXZA 3R7EA 4BI0A 2NP8A 4ANQA 4RLKA 4ZTLA 4EYJA 3H4JA 3EFKA 3NRMA 2YAKA 5CEQA 5HZNA 2IG7A 4RIWA 1B38A 4OGRA 1NW1A 3TNQB 3C0HA 2VTSA 5HIBA 4L46A 4D1ZA 3VIDA 3CCNA 4QPAA 1NY3A 1FPUA 3GCSA 4AOJA 3TZ7A 3QQFA 3QQGA 3LPBA 3F7WA 3PPJA 4L3LA 2IVVA 3C4XA 4G3CA 4O0YA 1OKYA 3DK7A 3NS9A 4GKHA 1IA8A 4X7QA 3Q4TA 4O7YA 3SQQA 2GHLA 3Q2MA 5CS6A 4KBAA 2A0CX 3ZFYA 5ANJA 4D2SA 4NYEA 4WIHA 4NCTA 5FLFA 4FEUA 2PZRA 4K33A 4G17A 4RIXA 1WVXA 4EHZA 4ZSLA 2VX0A 3W0MA 1Q5KA 3F7ZA 1ATPE 3PVWA 4FGBA 3LXNA 3DY7A 3DXQA 3I0QA 1Q41A 1UU7A 4LRMA 3FZTA 3IQ7A 3LMGA 3PLAE 1Q24A 3PJ1A 2WTJA 1KV1A 2QO2A 3RAKA 3MA3A 5FXSA 3VAPA 5CAOA 1WBPA 2I40A 3D7ZA 4G5JA 5DEWA 3QQUA 2UZLA 4PF4A 3TZMA 3DV3A 4ZS0A 5ETFA 4QP1A 3FXWA 4S31A 5DR9A 3LQ5A 3RM7A 1E1VA 2PYWA 4FA2A 2FSTX 3EQBA 1CM8A 2QVSE 3BBTB 2YZAA 4BI2A 3P0MA 3SHEA 2I0HA 1LP4A 2QI8A 2OU7A 3OD6X 3PXKA 4IZAA 3JXWA 4J53A 3ORXA 3UJGA 2VUWA 4FIFA 2XM9A 3UPXA 4FT7A 1PXNA 4KSQA 3UYTA 4W4YA 4L42A 3VBWA 2WOUA 2IWIA 2P2HA 4IWOA 4E93A 1PXLA 2JDVA 1VR2A 4AE6A 3GENA 3VHKA 3KXZA 2BRNA 1PXOA 5IQEA 4CRLA 2B9HA 2CGXA 2C3IB 2G1TA 5EKOA 4DHFA 5BVOA 2E9UA 5EDRA 4YNEA 4X3FA 4XG2A 3RKBA 5AJQA 3M1SA 1CSNA 3HRBA 2XNEA 3CGFA 4YO6A 4CV8A 5D7AA 5AIRA 4YSMA 3UP7A 4C33A 4E5AX 2FYSA 2OIDA 4RFZA 3POOA 4M3QA 5J7HA 2JGZA 2W1IA 2XYNA 2YM8A 3IK3A 4DEAA 4BY9E 3LKMA 3VBYA 3S00A 5DRDA 1J7LA 3Q4CA 4ENXA 3GB2A 3H30A 1ZWSA 5DI1A 2GQRA 2OKRA 1Q4LA 3FBVA 3W33A 3QCSA 3D4QA 2PULA 4YBJA 2ZV2A 1JKTA 3FYKX 3LVPA 5CI7A 1GZKA 5AEPA 3UQFA 3A4OX 5K3YA 4EOIA 4JDKA 2XEYA 3F3VA 2GHGA 1H24A 5CEMA 2R64A 4G34A 3R9DA 3DB6A 4RWIA 4BYJA 2CHLA 2Z7RA 3I0OA 4JDHA 5DFPA 1YQJA 3U4WA 4M14A 3ZMMA 1AGWA 2R3OA 4CMUA 4P7EA 3TG1A 3UIUA 5A4CA 1JKKA 1Z57A 2NO3A 5KKRB 5A54A 4H36A 1SNXA 4Y72A 3W0PA 4XV2A 1YXSA 3R8ZA 2CKPA 1YWNA 3E92A 4W4XA 1FMOE 2P55A 4HGLA 5D11A 4GVJA 4NM0A 4EH3A 5FM3A 2QONA 3QL8A 3R6XA 4PL3A 3CBLA 4BZDA 2WTKB 2X8DA 3KK8A 4YTIA 3NVKI 4AUAA 3ZH8A 2CMWA 3GU6A 3G0FA 5KMMA 1R3CA 1OIQA 2PSQA 4AN2A 4WA9A 2BIKB 4Z7GA 3AMBA 2ETKA 2WQEA 2UW0A 3AC2A 3BGZA 3P78A 3ZBXA 4DG2E 3TEIA 3UP2A 2VWVA 4BB4A 3QWKA 3TKUA 3CXWA 3MPMA 4ZZOA 2I6LA 5IU2A 2R3PA 1J1BA 1VZOA 2NRYA 3O2MA 4I5CA 4YURA 5LCKA 4ENYA 3FMKA 5FP5A 3UO4A 1BLXA 4MD9E 3SLSA 4O6EA 3W32A 3Q32A 4CD0A 4U40A 5I4NA 4CFWA 3QQLA 4TYGA 4BDBA 5IISA 3UG1A 3R8MA 4BCFA 4F9WA 5D7VA 3HV5A 3LQ3A 3F9NA 2UZEA 4AZEA 1H1WA 2F7EE 2C6DA 2FSMX 2GS7A 3OBGA 2OJGA 3FPQA 3Q9ZA 3PVUA 1FGIA 5E7RA 3PUPA 2WAJA 4EKKA 1H4LA 1YI3A 2CGUA 3CD8A 5IPJA 5E90A 4I6BA 2YZLA 5AP6A 2GS2A 1PXKA 2YDIA 4HVSA 4FSNA 4PMPA 4I93A 3LM5A 3KY2A 4U43A 5C26A 2J6MA 5D1JA 2I7QA 3ULZA 2YDKA 4QMNA 2YCRA 4BDIA 1PMVA 4HVGA 4N6YA 2DS1A 4RWLA 5DLSA 3ZONA 4FZDB 4O81A 4GT4A 4FYNA 4YLLA 3EB0A 4HYUA 4ALUA 4DLJA 3BWFA 3IW4A 3RAHA 5HTCA 1H25A 4TXCA 4O0TA 4QP7A 4AFEA 2OJIA 3EFJA 3WIKA 5HD4A 4FBXA 4LV8A 4G6LA 4RJ5A 3WZUA 4K11A 2VO3A 3LFDA 3BYSA 2HW6A 3LZBA 4XOZA 3UMWA 2O64A 4ITHA 5LOHA 3CC6A 2HXQA 3CQUA 2G9XA 3EN5A 4GCJA 5HCZA 4FICA 2GNLA 1YDTE 4ZMEA 2EVAA 3WF5A 4FK3A 4TYEA 4RA4A 4FUYA 5L2TA 2C5NA 3V51A 1ZOHA 2BKZA 4NU1A 4Y85A 4QYGA 4CLIA 2F2UA 4O0XA 2R2PA 3ZDUA 4BC6A 4E5BA 4CSVA 4CG9A 5E8UA 3VS6A 5J5SA 3QLFA 1IASA 1YXTA 2BAKA 3MH3A 3ACKA 2ZJWA 4IHPA 4AOIA 4FODA 2JKQA 4QQJA 3KN5A 4A7CA 4QMXA 3FLSA 1REKA 4FKPA 4ZJVA 4BDDA 4CKJA 3ZEWA 3H9RA 4BCPA 3PTGA 2W0JA 4RSSA 3ZOSA 3JYAA 5CEKA 3AOXA 3NW6A 3BHUA 1Q3DA 1S9IA 4FKWA 3HRCA 5TKDA 3U54A 3CTHA 1UVRA 1B6CB 2IZRA 3NNWA 3UYSA 3NW5A 2CCIA 5CU3A 2PUUA 4W4VA 1OPJA 4ZSGA 4YU2A 4DEIA 2WMSA 3W0NA 4HGSA 3TV4A 4CFVA 4A9TA 1ND4A 2I1MA 4FI1A 4J52A 4R1YA 2OF4A 2WMWA 3IO7A 3Q3BA 1ZXEA 2UVYA 2WTWA 1KE5A 4U45A 4UXQA 2QQ7A 4P5QA 4YJRA 2QR8A 2WGJA 5AX9A 3R7UA 3TI1A 4DGMA 3VS5A 3ORMA 2QOLA 3AGLA 4YBKA 1ZYJA 2R3NA 4FTUA 1YXVA 1OITA 2PVJA 4FTMA 4I6FA 5LVOA 3CE3A 1YHWA 2BZHB 3F88A 2UW9A 5FD2A 2WTCA 4C02A 3CKWA 4BCNA 4GMYA 2JLDA 2VTAA 4NM5A 4BBFA 4LUDA 2HENA 4FNXA 1I44A 4KIQA 2WNTA 4TPTA 5IA2A 2FA2A 5A6NA 3L9MA 4Y83A 5TF9A 3TJDA 3VJOA 3UIBA 5LMBA 5K9IA 3NNUA 3RPYA 4IJPA 4RRVA 1OBDA 2QOOA 3ODZX 4BICA 1BYGA 5EM5A 3MH1A 5M07A 2QC6A 4RX8A 4WHZA 2PY3A 3C4EA 3KEXA 2XNBA 3Q5IA 4ZXTA 3TKIA 4ZY6A 4AGCA 5B2LA 1T45A 4GG7A 2PE1A 2RIOA 3IDCA 4DH5A 3GCUA 1UU8A 3PIZA 4YZ9A 2CJMA 4Z16A 2BHHA 3R1NA 1UA2A 2CKOA 1KUTA 2H8HA 5A3XA 1A9UA 3BLHA 4YC3A 3LJ2A 4ACCA 5C1QB 5IQHA 4IAAA 3IDPA 5HD7A 1RDQE 4JQ7A 3IPHA 4QMMA 5AFVA 1ZZ2A 2VX1A 2JKOA 3DDPA 2UV2A 3G9NA 4DLIA 1NA7A 3FLWA 3MI9A 3PRFA 5DH3A 2BROA 3NAXA 5LMKC 4O7LA 5KBRA 5FEEA 1YVJA 3FEGA 1YOMA 2EXMA 4TL0A 2UZVA 4YZCA 5DNRA 3F82A 3D5XA 1RE8A 1FBNA 4OTWA 4PMTA 1P14A 4G6NA 4TYIA 4Y46A 3K5VA 4X3JA 3FKLA 4EWHA 2YWVA 3D14A 3A7FA 3A7IA 4IB3A 3E3PA 4KBKA 1UNLA 4F64A 2X9EA 4II5A 2XK9A 3KXMA 2X0GA 4ASDA 4YTFA 3E64A 5HX6A 4O91A 4ANLA 3R83A 3I60A 3GOKA 3KREA 3VVHA 3C4CA 2XNPA 4WOVA 5AV2A 2BDWA 2VWIA 3ZYAA 4DEGA 3AC4A 4K77A 1PXPA 3ZEPA 5HNIX 4G9CA 2ITYA 4GK4A 2Y8OA 3IGOA 4G31A 5I5ZA 3S1HA 4U41A 5G6VA 3PVGA 4F1OA 2DYLA 3ZRKA 5CT7A 5EM7A 1NVSA 4C2VA 3CY3A 2HXLA 4IFCA 4FTIA 5IZFA 3QRKA 3UO6A 4DBNA 5E91A 2OXYA 4CFUA 4OTQA 3ALOA 2VO7A 5I9WA 4C0TA 2PL0A 4ARKA 1DI8A 1Q8UA 4ZEGA 5F94A 3ORTA 5AMNA 3SV0A 3ORPA 5IA5A 5FTOA 4YHTA 2UVZA 4LGHA 1FQ1B 2UW7A 4KSPA 3K54A 3BBWA 2ITVA 1W7HA 2V5QA 2C0IA 4HOKA 3FLQA 2J90A 4X3FB 4A07A 2OG8A 3Q60A 4JBVA 1YDSE 3SW7A 4EC8A 4FOCA 2WU6A 3BV3A 3UZRA 1U46A 3ACJA 3OEFX 2GHMA 5EYMA 4ERWA 3AGMA 3GI3A 4DFUA 4B6LA 3PG3A 2WTIA 4L7SA 2GNIA 4EH7A 3HV6A 3OUNB 3BU3A 2JC6A 3ZFXA 5M08A 2JDRA 1OVEA 4W8DA 1KSWA 3WIGA 3V8WA 4RIYA 2DWBA 2HY81 4RC3A 4AZWA 5A9UA 2Y9QA 4IB0A 3DZOA 3DQWA 3AXWA 3NYVA 5A14A 1BI8A 3RPOA 3U6JA 2VTPA 4KS7A 5AP2A 3L1SA 4FSUA 4UXLA 4FSZA 4Z9LA 4K6ZA 4BCKA 4C37A 3PXYA 4D0WA 3C13A 4GFGA 1WCCA 3FSKA 4ACDA 3S3IA 2XIZA 4UZDA 3KB7A 4M97A 4UZHA 2C5OA 3F2AA 3MH2A 2VNWA 5HU9A 3W8LA 4NT4A 2ZDUA 4M13A 4F7NA 1PW2A 2XNOA 1GZOA 3BQRA 5DG5A 3RK9A 2QOCA 3BIZA 3VS7A 2WO6A 3QTRA 4DEDA 1MQBA 5I0BA 3PZHA 1CMKE 3HA6A 3DOGA 3Q9WA 4QYYA 4WD5A 4FZ7A 3CPCA 2WMRA 4LV5A 4U44A 5IF1A 5JZJA 5K4JA 1UWHA 2P33A 5CSWA 3EQDA 3LFAA 3A7GA 4EEVA 3P4KA 2YAAA 4ANSA 4AU8A 3DCVA 2IVSA 3SAYA 1W98A 4FKQA 2IW9A 3MGYA 5JRSA 3TNHA 3QRUA 5IH4A 3NDMA 4JX7A 1GNGA 5CWZA 3R9RA 3I5ZA 4QQ5A 1PXJA 4M12A 5GJGA 5TOZA 1JAMA 3R8LA 2VO6A 2WD1A 3BKBA 3ORIA 4LL5A 5CEIA 4DF3A 4EHVA 3JR1A 4Z55A 3NZ0A 5JGAA 1H1RA 1UNGA 2YJSA 4K2RA 1JWHA 3DJ6A 3LFEA 5HVJA 3TNWA 3U8WA 3E93A 5AP4A 3C4FA 3ENMA 4YJOA 1ZY5A 4C4HA 3EQPA 4V01A 4E5WA 5CASA 3HLLA 3SD0A 3QD3A 5BMSA 1L8TA 4F7SA 1V1KA 4P5ZA 3KF4A 5AADA 5AP7A 5K4IA 1UU3A 1ERKA 3O50A 3JVRA 4NL0A 1XR1A 1SYKA 3D2IA 3RGFA 1R0PA 4NIFB 4WUNA 1OKVA 4JIAA 5HKMA 4DFZE 1H0WA 2R3GA 1APME 4MKCA 3CJFA 5AV3A 2IVUA 4FVQA 3E62A 4AZFA 3QX4A 4UX9A 3N4UA 5LMAA 5HTBA 3V5TA 4ACGA 5L6WL 5CU0A 3HGKA 1QPJA 4QMWA 4QP3A 4HYHA 1TQIA 3LCTA 2GNGA 4G6OA 4FV7A 4J99A 4PUZA 5HCYA 2UVXA 4I6QA 2BRBA 4F9YA 4ZOGA 3ENHA 1WFCA 4UB7A 2ZM1A 3UVPA 4ZLYA 3TCPA 4GYIA 1G5SA 4JR7A 4EK4A 3OEZA 2JDOA 4QOXA 2V62A 3KK9A 3LCSA 3RTPA 5IQDA 3HAVA 2F57A 5DT0A 4LYNA 3L9NA 4GK3A 4NKAA 4WNMA 2C47A 4GUEA 4JXFA 4FZFB 5TT7A 3S0OA 3FKNA 5JGDA 2XKCA 4R1VA 3FMJA 3F61A 1YOLA 5KZIA 2C6MA 4J95A 3MH0A 4WNOA 2OI4X 1SVGA 4JQEA 4M0ZA 3PPZA 5DEYA 5HE1A 3AC3A 5JFWA 3U6HA 2J5FA 3MFTA 5K5XA 3MN3A 3DLZA 3PY3A 3NNVA 2PUIA 3A8WA 5AV4A 4FV0A 5CQUA 1OZ1A 3KRJA 4RG0A 2HZ0A 4JS8A 4O7ZA 3E8EA 4AX8A 2OZAA 2ZMDA 3GUBA 3KC3A 1NVQA 3PA5A 3QCQA 4BR3A 3QBNA 1WMKA 5HI2A 1J1CA 2BAQA 4DT9A 4FSMA 5M53A 3ZO1A 4S34A 1YDRE 4IQ6A 2H6DA 4I24A 1YXXA 3R7OA 3QC4A 5IQFA 3WF6A 1MUOA 2YISA 5H8EA 2VTHA 3HMIA 4USFA 1LUFA 2BALA 3Q2JA 2WXVA 3RWPA 1V0BA 3RMFA 2BTSA 2JDTA 4EBVA 3BI6A 2BCJA 4YMJA 4CLJA 3HRFA 2PVHA 4QP2A 4QRCA 5EDQA 4YSJA 4K1BA 3I5NA 3QC9A 2C69A 4XRLA 4DFBA 4P90A 3BEAA 4U9AA 2VTRA 2PZ5A 1RQQA 1W84A 3MW1A 3NCZA 4IX5A 4H05A 1PMUA 2O63A 2ONLC 1GIHA 5CSXA 4C59A 4DFLA 4TWOA 3GC7A 1W83A 4AN9A 4GJ3A 4Y5HA 4DYMA 1JQHA 3QQJA 3GXLA 4LMNA 4P2KA 4NFNA 5A4QA 3ID6C 2XNNA 4I0TA 1VEBA 2W1HA 3RP9A 3VN9A 2XUUA 4DH1A 1W8CA 3DBDA 2JBPA 3VF9A 1H8FA 3NEWA 4CCUA 4RJ7A 3HA8A 3G6HA 4HPUE 2WQMA 3MFRA 2RKUA 3F69A 4FTTA 5LVLA 4CT2A 4FL3A 2X2MA 5L6OA 4IZYA 4FT5A 4QMOA 1MP8A 2BRGA 2JITA 4UALA 4XH6A 5AAEA 1X8BA 2O65A 2ZVAA 3VUMA 5AV1A 2QO9A 4Q5HA 5CU4A 4O2ZA 4ZZNA 3PE1A 4OTGA 3PYYA 3VUGA 2PVFA 1XBCA 1XH9A 4PRJA 4C61A 3PA3A 5E9EA 5CVFA 2YM4A 2IW6A 5IDNA 4BIDA 2UW6A 3RCDA 4KKHA 1FVRA 1OPLA 4HCUA 1R1WA 3NUNA 4U8ZA 3P9JA 3CY2A 5H2UA 4R3PA 1Y8YA 3QTIA 3GU7A 5JK3A 2HZ4A 3NUXA 2AC3A 3FAAA 3HAMA 4E6CA 4WRGA 5BPYA 5GIOE 1U5RA 3P23A 5IEXA 3UVQA 2C3KA 3FZSA 3VRYA 4EOQA 5C8KA 4GIIA 4ACMA 3KRLA 3PSCA 4YJQA 1ZMVA 4EQUA 3VS0A 3VS3A 4FSQA 4E6DA 1ZRZA 2YERA 3PP0A 3A62A 4O84A 2B0QA 5ACBC 3WF7A 5I9VA 3BYUA 3RM6A 4Y8DA 3QYWA 3PY1A 4HYSA 2YM7A 4L52A 5AAFA 4L7FA 1H28A 1OL5A 5B2KA 1F0QA 3FZRA 4FT9A 3HL7A 2ITXA 4EOLA 2GSFA 2OW3A 3AMYA 1JKSA 3OHTA 1M7QA 3GCPA 3KXGA 4IX3A 4MNEA 4RC4A 4EI4A 4IC7A 2QU6A 3UBDA 5AIKA 3RZBA 4D5HA 2BZKB 5HG8A 4MXAA 3IECA 4PL4A 1XH7A 5HU3A 5HX8A 4FIGA 3L9PA 5AUXA 3NCGA 4TWNA 5AM7A 3VUHA 4AN3A 3UE4A 1V0OA 4XJ0A 4MQ1A 2R0UA 4ORKA 3ORNA 4XS2A 2PVMA 4E4XA 3WARA 4BCMA 4PDPA 3C0GA 3COIA 2XK8A 4FT3A 4MEDA 4AT3A 4C4GA 2AC5A 4EZ3A 5IMXA 3N51A 4LG4A 3FI8A 4FV6A 3AT4A 4IB1A 1ZAOA 3LFNA 2OBJA 4U97A 2X7OA 3FY0A 3RINA 4EK5A 2YIQA 3N4VA 2XS0A 5HHWA 1MRVA 3SDJA 4BDHA 1CDKA 4ASEA 5AUTA 4TKSA 1UU9A 3O96A 3UDBA 4WRSA 3WZEA 3PA4A 3G15A 3BEGA 1PXMA 4IFGA 4KBCA 4DTAA 4Y73A 1G8SA 5B2MA 3PXFA 3LFSA 5L2SA 1XBAA 4J97A 3DJ5A 1PF8A 3QAME 4TNDA 2PMIA 3BE9A 4YPDA 2Q0BA 5FEQA 3FZPA 5EM6A 5ANOA 4DG0E 5HVKA 3H9FA 4J1RA 4HPTE 3EYHA 3VS4A 4O0WA 2W1ZA 3F5UA 4XRJA 2HWOA 4IAKA 3SXSA 4ITJA 2FB8A 4RVTA 4DH7A 4ITIA 4YUQA 3R1YA 1STCE 2HOGA 4Q5EA 5M4IA 3HV3A 2C6IA 3WZJA 1URCA 3SG9A 1WBNA 2WU7A 5BVKA 4RIYB 4QYHA 3QHWA 4BDCA 2HYYA 3GQIA 3ANQA 2V0DA 4S2ZA 3OCTA 3F6XA 2H34A 4FEVA 3W2OA 4BYIA 3FPMA 1QL6A 5E8TA 4AS0A 3DPKA 5HNBA 3EQRA 5ETIA 5LWNA 5GJFA 2PVLA 3FMHA 3AMAA 3R00A 3GU5A 4FTKA 2W5AA 3O7LD 2WMQA 4KRDA 4GV1A 4DN5A 3DBFA 2PTKA 2G01A 3ROCA 5CU6A 2X6DA 3DU8A 4DEBA 4QTAA 2C5YA 4OBOA 3WZDA 3ZC6A 4A06A 2HZNA 3K2LA 4YZMA 3PE2A 4H1MA 4JNWA 3VW6A 2XCKA 4D4SA 4BBEA 4F09A 3I7CA 4HJOA 4M68A 3C50A 5CTPA 2ZYBA 3WOWA 3FI4A 3FLYA 1KOAA 3AG9A 4W4WA 5EHYA 3GC9A 2Y6MA 2YIRA 3IOPA 4C62A 5DIAA 5LVPA 3R28A 4TYHA 3RWQA 3ITZA 4QMVA 5FXRA 1O6YA 1Y57A 3JS2A 4EK6A 2QHMA 1FVVA 4EOOA 3BCEA 3GP0A 2ITTA 4W8EA 5HIEA 4YLKA 5T68A 3C4ZA 2YCSA 4FVRA 3HUBA 4TZRA 4AW1A 4PP7A 1PXIA 1WAKA 2PVYA 5AV0A 3RALA 5IQCA 4E4MA 4MTAA 3G6GA 4L43A 2QKRA 5EK7A 3NIEA 5ETAA 5LJJA 2O5KA 1KE8A 1U54A 3LCDA 4H3BA 4I21A 3TZ9A 4E4LA 3EYGA 4HVDA 1WBTA 4YC6A 5I9XA 2HELA 5J1VA 4F7LA 4GW8A 4ZLOA 1YRPA 2HW7A 3KMWA 3LMIA 2WQOA 4LUEA 3MTFA 5E1SA 4AA0A 3DGKA 4ZAUA 3VNTA 2FH9A 4TYJA 2YACA 4RA5A 5HLWA 2B1PA 2P4IA 1OMWA 3HP5A 4XYFA 4HVHA 3DXPA 3O7LB 4DITA 5GJDA 4IVDA 3E5AA 2BPMA 3PG1A 3G0EA 2PE0A 4U42A 3R63A 4GSBA 4WT6A 4JX3A 3V04A 5CEPA 3R7YA 3F3ZA 4JI9A 1QMZA 4WUAA 2W4OA 2QLQA 4O96A 3KULB 4M15A 3O8PA 5EQYA 4F99A 1OUYA 4ANBA 4O7TA 3DKCA 3SGCA 4BIEA 3I6WA 3CQEA 5DPVA 2VGOA 4CFFA 2F9GA 3FKOA 2W1CA 4QMUA 3PPKA 4B99A 2YEXA 4ZSEA 2UZOA 5TR6A 4XBUA 4BCOA 3CPBA 4MYGA 3T9TA 4O2PA 4A9SA 4F1TA 4FTNA 3TXOA 4BDFA 4PNKA 2OH0E 4K0YA 2BILB 3TNIA 3FL5A 4AW0A 4J98A 1M17A 2WIHA 3NWWA 4IVAA 2VWUA 4TN6A 2QO7A 2GTNA 5FBNC 3ZTXA 4PMSA 4D9UA 3NMUF 2QNJA 2C6LA 4WKQA 4GRBA 3ZZWA 3G2FA 4AA4A 3WF9A 3HX4A 5JH6A 4FKLA 1H1SA 5FQDC 3UZTA 1Q8WA 2X7GA 3E3BX 3KKVA 4HCVA 3ZS5A 5KMIA 5GHVA 3CQWA 3W0QA 3GU8A 2G15A 3M2WA 5CZHA 4RT7A 5C27A 3TUCA 4QP9A 3DBQA 2V7OA 3VBTA 2JEDA 3PRIA 3R9NA 4OW8A 3S95A 3D7TA 3TDWA 4FTCA 3DBEA 4HGTA 4XP0A 1PKDA 5AX3A 4FL2A 4DFXE 4IEBA 4APCA 4EONA 3HUCA 4KRCA 3RAIA 4C4IA 1JPAA 3KL8A 4MAOA 5IQAA 3SX9A 5FTGA 4D5KA 3RJCA 3DKOA 3W0RA 2GQGA 2O0UA 3E88A 1UV5A 3UOKA 2RFNA 2QG7A 4JQ8A 1H26A 3TACA 5IEYA 2PZYA 2VV9A 4IANA 2YM5A 2HCKA 3UQGA 3LJ0A 1YWVA 3R7IA 4MVFA 2E9VA 3RHXA 3TZ8A 1O6LA 2GQSA 3VS1A 3W55A 4FV4A 3A60A 4H3QA 4PDSA 5HGIA 4F4PA 4O7RA 3QRJA 5IMEA 4AOTA 5IQIA 1G8AA 3KXHA 5LMKA 5KMOA 4FX3A 3GVUA 2V55A 2CN5A 3FQEA 2C6KA 2R7BA 3R2YA 5AA9A 3QKKA 4Z7HA 2NRUA 4JAIA 4UWCA 4RBLA 3OF0A 1OL1A 2C1BA 1RJBA 2XF0A 3HV7A 3RPRA 2WIPA 2X8EA 3FI2A 1UKIA 3SW4A 1IA9A 4UV0A 4A9YA 3EQGA 4C4JA 1KOBA 3ORLA 1YW2A 5JT2A 1U5QA 5FRIA 2B4SB 2XJ2A 3FE3A 4ID7A 4MXZA 4E6QA 1G3NA 4C3PA 4JJRA 3R71A 3UC4A 5KUPA 3DAKA 4D4YA 5I9ZA 3HECA 4EH2A 4X2JA 3IDBA 5ANGA 5TO8A 2XP2A 2VNYA 3OS3A 2BKKA 4IDVA 5E1EA 3MV5A 5E8XA 1KWPA 2ERZE 3I81A 3LM0A 3O8UA 3EZVA 3NUUA 4LL0A 4MNFA 2CLQA 3NUYA 4MQ2A 2CGVA 4PMMA 3W2RA 2B55A 4GU9A 1XKKA 1A48A 5CU2A 3I7BA 4F6WA 1TQMA 3QLGA 2J0JA 3VC4A 3BLRA 2AYPA 3FXXA 3LMHA 4RVKA 3MYGA 5KHWA 1FOTA 2VTIA 5ANEA 3GOPA 4IWQA 2OIBA 4NZWB 2ZB1A 3QD4A 2VTOA 3E7VA 4RIWB 4F65A 5CENA 4QTBA 5M55A 2PMNX 5CNNA 2ETRA 1OBGA 2XBJA 2RFSA 3QCYA 2BAJA 2A1AB 3NUSA 3L9LA 4M0YA 4QYEA 4XP2A 2JAVA 2BDJA 1A06A 5EH0A 5BMMA 3PIXA 3QGWA 5JFXA 5D10A 4G2FA 4YZDA 3SKCA 4A9RA 3R1SA 3OCBA 3WE8A 5CALA 1VYWA 3QUDA 4TW9A 2W96B 1Z5MA 2PZPA 2QOFA 3R8PA 3OC1A 4X2FA 3EQCA 2GDOA 4DGNA 4JG7A 3A99A 4C36A 1H08A 5DA3A 3VW8A 2HWPA 4RIXB 1IEPA 2W4KA 4AGUA 4JBOA 4I3ZA 3PVBA 3FY2A 3LOKA 3NGAA 2VGPA 2YABA 2ZAZA 2WZJA 3CSVA 3DLSA 3ETAA 3KN6A 5L8JA 4K8AA 2Y6OA 4S32A 1ZARA 5FEDA 2XJ1A 3DT1A 2Q83A 3PXZA 4I4FA 4IJ9A 2REIA 3DZQA 2OJ9A 4RGJA 4RVLA 4O7NA 3MS9A 3GFEA 1CKPA 4BKJA 5J9ZA 5FDXA 2R9SA 2Z60A 4GYGA 4AAAA 4AGWA 5E8YA 5HG9A 3DQXA 1SM2A 3MY1A 4ZTRA 4FIIA 1TKIA 2WELA 4IVBA 3KFAA 1OKZA 4C4FA 4V0GA 5LQFA 2XM8A 4KKGA 2W05A 3MIAA 3BE2A 3V01A 2C30A 5M51A 4MD8E 3ZFMA 4BVUA 4KA3A 4ALWA 5DR6A 4U3ZA 5IA1A 3R30A 4MBLA 4CT1A 4Q9ZA 2Q0NA 1LR4A 3R1QA 3EN7A 2W9ZB 2P2IA 4RQVA 3KXNA 3CS9A 5CQWA 3IKAA 3TTIA 4D2RA 2R4BA 3SOAA 3FZOA 3MVLA 5D41A 2JKKA 4AZTA 4XOYA 3II5A 2OK1A 4IACA 4MXXA 4LFIA 4R78A 5EHOA 2XCHA 4I22A 4E26A 2J4ZA 1SVHA 2WPAA 2CPKE 3AD6A 4L9IA 4L3JA 3FV8A 1XH4A 4PTCA 2WMVA 4FZ6A 4EJNA 4FKSA 5HBEA 3TT0A 4QYFA 4A4LA 4U79A 4FVPA 3ALNA 3EH9A 1XWSA 3TTJA 4LM5A 4AXAA 4O83A 5BUJA 4DEHA 5IQGA 3OWJA 3BWJA 2ITOA 3BYVA 4FZAB 3QZIA 3HMOA 1NVRA 1KE9A 2JIUA 3PZEA 1JBPE 4YPSA 3TV7A 4O0RA 3VQUA 4DH8A 2UZTA 3LLAA 4KB8A 4NUSA 3DNDA 2RG5A 5L8KA 2JIIA 5J95A 4C35A 3V6SA 3V5JA 1GAGA 4I92A 3KA0A 5CVGA 3TN8A 4DA5A 5AUWA 2ITPA 2WTDA 1E9HA 2QURA 4S33A 5BYLA 4TYHB 4EUUA 4QMLA 5I9YA 3OY1A 4LI5A 4ZIMA 4MX9A 3AC8A 4GKIA 4FC0A 5EM8A 3WYXA 4AFJA 5IUGA 3QCXA 5BNJA 5ACKA 1YWRA 5HG5A 2E9PA 3NIZA 2OFVA 3EL7A 1XH6A 4QMTA 4MXCA 2A27A 3UQCA 4I23A 4EUTA 3W0OA 4AGDA 4IDTA 4LRKA 1Q62A 3UGCA 2C3LA 1QCFA 4AZVA 4XP3A 3UIXA 4IMYA 3PJCA 3Q5ZA 5FUTA 1SZMA 2YN8A 3BHTA 3F3TA 3HV4A 2QOBA 2XNGA 4TRLA 3BX5A 3W2SA 3FHIA 3KMUA 4FKOA 1HCKA 4B7TA 3R02A 2C6EA 1ZOGA 3OOMA 5AM6A 4MBIA 5F95A 4RWJA 4IAYA 4E8AA 2LGCA 3O0GA 2KULA 4J8MA 5CSHA 4QMYA 4XNEA 3EFWA 5J9LA 2AUHA 3AD4A 4NW5A 2RFDA 3QA8A 4XBRA 2OFUA 2OXDA 4O86A 5C8MA 3QUPA 2CSNA 3FMMA 3TNPC 4F0GA 2FSOX 3IW6A 3PP1A 4M67A 4IX4A 4CXAA 3QA0A 5M4UA 1WVYA 3QZHA 4RVMA 1J91A 3B8QA 3FMEA 2W5HA 4R3CA 3RPSA 3VJNA 3ZUVA 2QOHA 1YHSA 1RW8A 2JFMA 4JDJA 4GU6A 3WYYA 2P0CA 4QMSA 4EOJA 4JG6A 4F70A 1K2PA 3IW5A 2YITA 5ITAA 4F63A 3OP5A 4O27B 2PUPA 4FG9A 4JBPA 2R3IA 4FEQA 4FV9A 4EZ7A 4NK9A 4QP8A 4F6UA 2H96A 5J1WA 1VYZA 5M09A 3QGYA 4D58A 4TWCA 4WG3A 4KKEA 5AUVA 3V5QA 4JAJA 3D5WA 5C4KA 3GEQA 4G3DA 1FVTA 4QMPA 2VD5A 2BZIB 3MFSA 2VTNA 4LRJA 4X2NA 2ONLA 3VUKA 3SXRA 2R0IA 3IOKA 3GNIB 2W9FB 4MWIA 4EC9A 4K18A 3OW4A 3HP2A 1L3RE 4QNYA 4F0FA 3IGGA 2W7XA 4MD7E 1S9JA 2XIXA 4FTQA 3UIMA 2QOQA 2GTMA 3Q52A 4HW7A 2OJJA 4TWPA 1M2RA 3H3CA 3QXOA 1GZ8A 2ERKA 3ATSA 3U87A 2Z02A 5GINE 4G3GA 1PMEA 4F0IA 5HORA 1ZMUA 4O0UA 3QUEA 4A4XA 5L2IA 2XNMA 2J9MA 2XB7A 4WNPA 3EQFA 3ELJA 4CZUA 4NTSA 4FV3A 5KE0A 4YO4A 3MVHA 2XYUA 2Z7SA 4NKSA 3Q6UA 2C0OA 4P4CA 5CXZA 1UKHA 3JUHA 2RL5A 4ACHA 2ZM4A 4EWQA 3KVXA 4PTGA 2PK9A 2R7IA 4FE2A 4HZRA 4L00A 4ZSJA 5AWMA 4N4SA 3E87A 3LAUA 1JKLA 2X7FA 3ZO2A 4CGAA 5IH5A 4XG9A 4ASXA 4AT5A 3ET7A 5JSMA 3CGOA 5ETCA 1DAYA 3L8SA 3Q4ZA 3ZSGA 3TUBA 3KMMA 4XV3A 4GG5A 4QQTA 2IW8A 4U7ZA 2ITNA 2JDSA 3HDNA 4C7TA 5AUZA 4DG3E 3MSSA 3MDYA 4I0SA 1BMKA 3FQSA 4NSTA 4X6RA 5JKGA 1JOWB 5GNKA 5KHXA 1NXKA 3W18A 1Q61A 4EH9A 4N57A 3REPA 4BCHA 5AUUA 2WTKC 4J7BA 1M14A 5F1ZA 2FUMA 4DGOA 4FSRA 4CFMA 1IRKA 4BCJA 4ZMFA 2YA9A 3TWJA 2VRXA 2CNVA 4EYMA 3E8NA 5E8WA 5EHLA 3UNZA 1BL7A 2X81A 4FG7A 4U0IA 2OLCA 3ZRMA 4OTIA 4U5JA 4J71A 3LXLA 1HCLA 4GK2A 2GFSA 1PMNA 4FIHA 4RZVA 3JY0A 4X2KA 4LOOA 2YWPA 2XKFA 3OXTA 3OT8A 4FGRA 4IBMA 4QP6A 3UOLA 4RX5A 4IM2A 1SVEA 3EMGA 4LMUA 4FT0A 5IQBA 2NNWB 4Q2AA 4RZWA 3G33A 1ZYDA 4EZ5A 3VHEA 1JSTA 3OY3A 1JNKA 3FC1X 3R22A 3NLBA 3THBA 1VJYA 1DM2A 1XQZA 4DCAA 1ZMWA 3D2KA 1HOWA 2Y7JA 4H58A 2A19B 1XHAA 3D5VA 4ANMA 4APPA 4C4EA 5J9YA 4HGEA 4OLIA 4IX6A 3O8TA 3FSFA 3LFFA 1JVPP 5DE2A 4L44A 1DS5A 2I0YA 5IA3A 4RJ8A 3ZHPC 1MRYA 5EOBA 4IM0A 5J8IA 2X39A 4F6SA 4WO5A 2WTVA 4ZK5A 4DE4A 4IAZA 2X6EA 3U51A 4DCEA 5CLPA 5A4EA 5M57A 1WZYA 4F1MA 1OECA 3C0IA 3BU5A 3FLZA 5L6PA 2UZBA 3HZTA 2HZIA 3RK5A 3BQCA 2PVRA 3IW7A 2J0MB 2VWXA 5B0XA 1FGKA 4B8LA 5IH6A 1Q8ZA 1XO2B 1LEZA 4UY9A 3W8QA 5AAGA 5BYZA 2FO0A 5JN2A 3DXNA 3R73A 2XBAA 4G3FA 4BTKA 3FMLA 4G16A 2UZWE 3ZUUA 2C5VA 4ZTQA 4I5MA 5F20A 1WVWA 4I1ZA 3QZGA 3I1AA 2BR1A 3ORKA
chains in the Genus database with same CATH superfamily
1CKIA 1M2QA 2WEVA 3OROA 4KIOA 3P7BA 5EDPA 4FEXA 2VZ6A 3ZUTA 3NPCA 4PY1A 4O7SA 5GIPE 3K5UA 3TDVA 4FJVA 2QCSA 4QP4A 4Y5QA 3HMPA 2W1EA 1KE6A 2BHEA 5DVRA 3V5PA 3ZDIA 4PDYA 4NJ3A 3OVVA 4GFOA 5E8VA 3QKLA 2VAGA 4BBMA 5HO7A 3I79A 5DT3A 4FOBA 2W4JA 3MB6A 5CVHA 3T3VA 4PP9A 5CYIA 2PMLX 2R3FA 4FSYA 2YM3A 2BDFA 2XJ0A 3C1XA 2VU3A 3TIZA 3T9IA 2WB8A 2CN8A 1OGUA 1P2AA 3NYOA 4V0GB 4BN1A 3UO5A 3DKGA 4KUJA 4RX7A 3WBLA 2PVNA 3SA0A 2JFLA 4FK6A 5CY3A 5LVNA 3UPZA 3ZLXA 1PY5A 4EH6A 4RJ4A 4WBOA 4EK8A 5JFSA 1E1XA 3OXIA 2XIRA 3D15A 5T6KA 4USEA 2H9VA 3NVMB 4IZ5A 4NM3A 5BUEA 3QTSA 1WBSA 3SVVA 4DFNA 1BUHA 3E8DA 4AW2A 3DNEA 2YIXA 3OMVA 4FEWA 4MUQA 5G1XA 3AC5A 2E2BA 5KMLA 5LCJA 3BU6A 3E63A 4DGGA 4CFXA 3IG7A 1T46A 5DRBA 5JFVA 3KRWA 4RQKA 3MTLA 4IIRA 3H0YA 4IB5A 1WBWA 3R8VA 1F5QA 2YJRA 3ZLYA 4EJ7A 5BVDA 4F9CA 1H1QA 3RAWA 4XHKB 3ZXZA 4I41A 3JVSA 3RVGA 3OG7A 4EHGA 3MJ1A 4J96A 2YCQA 3V3VA 2IZSA 3FHRA 2Y4PA 3IS5A 4MF1A 4OTRA 3LCOA 4XEYA 5JQ8A 4BDEA 3C9WA 3QXPA 1YKRA 3N9XA 1CTPE 3Q96A 4FKVA 4IW0A 3KCKA 3EKKA 4HNIA 2F4JA 3EKNA 3GC0A 3NW7A 2R3HA 4QNAA 4UEUA 3FI3A 3U55A 5KBQA 3CR0A 4AE9A 5JZNA 4CEGA 3QTZA 4X6QC 3FXZA 3VULA 5L8LA 1NT2A 3NSZA 2WMUA 4TTHB 4BZOA 5CX9A 1UNHA 4PWNA 3A7HA 1GIIA 3R7VA 4OT6A 3FDNA 3WI6A 3D83A 3OW3A 4JRVA 4CG8A 3H9OA 4BF2A 1FMKA 5HBHA 1R39A 2QODA 2X4ZA 3R21A 3LFQA 1Y91A 2EWAA 4O22A 2IJMA 4M7IA 4X2GA 5HESA 4CTBA 4UWYA 4XG7A 5EKNA 1U59A 2CCHA 5LVMA 5FG8A 3GCVA 3DS6A 5AA8A 2VTLA 2W1GA 5D9HA 3W16A 2PHKA 2UW4A 3O17A 5JRQA 4AF3A 3A8XA 4FSTA 2VX3A 2BMCA 2PPQA 3W1FA 3GGFA 2ZV8A 3MFUA 1O9UA 4NCTC 3EFLA 1O6KA 4F7JA 3A4PA 4C58A 5HE2A 1CKJA 3VO3A 4ZY4A 4RFYA 1Y6BA 4N6ZA 4DFYA 4N0SA 1IR3A 2QG5A 4FKIA 5HNGA 3R9OA 4DH3A 1WBVA 3DTWA 1BI7A 2ZFYA 3BYMA 3IW8A 3ZC5A 5JMSA 4M69B 1XH5A 3UNKA 4N70A 3SG8A 1H0VA 3TJCA 3UC3A 1ZYLA 5D12A 1OKWA 3C4WA 1QPDA 2ITUA 4FV8A 2VTQA 4JOAA 5JQ5A 3MY5A 4CV9A 4L67A 4XUFA 3DTCA 4D1SA 2ETMA 3PSBA 4JVGA 2BRMA 3MA6A 3BGPA 3R04A 3VBQA 4ZY5A 4FTAA 2XK6A 3BV2A 3FL4A 5A4TA 3K3IA 1GZNA 4QT1A 4EHEA 5ANDA 4FSWA 4R7IA 4ZSAA 3EOCA 4I5HA 2X2LA 3T8OA 2XVDA 4LOQA 3OWPA 1YXUA 2C6TA 3ZU7A 3TV6A 1JSVA 2ZB0A 3NYNA 3ANRA 2ZV9A 3SRVA 2J0LA 2B52A 4FNYA 2QKWB 5KMKA 3ZLWA 3DK6A 5H3QA 5EOLA 4IWPA 4FUXA 4XMOA 2E9NA 3FQHA 4RWKA 3TUDA 3Q6WA 3QD0A 3R2BA 4BHNA 4OUCA 4WNKA 4X3FC 4JDIA 4YJVA 3B8RA 4KNBA 4TY1A 2X8IA 3WZKA 2X1NA 1GIJA 2B53A 2ACXA 3DB8A 4D1XA 1DI9A 2EXCX 3PIYA 1YOJA 2UUEA 4YHJA 3TM0A 3UDSA 3UMXA 4GH2A 4L45A 3MVJA 2HIWA 3O23A 3OWKA 4FL1A 3OBJA 4G9RA 2ZMCA 2Z7LA 5DBXA 3VBVA 4BGGA 2GU8A 4YJUA 3QTWA 4XLVA 4QQCA 3S4QA 2OZAB 3I6UA 5LARA 1URWA 2OZOA 5EI6A 3UOHA 4EBWA 1GOLA 3MPTA 2XA4A 2BFXA 3WF8A 4EQMA 4LGGA 5FXQA 3L8VA 2ITZA 2QR7A 5EYKA 3W2CA 1F3MC 3OUKA 4R5YA 4B8MA 2YIYA 4F9AA 5CF6A 3PLSA 2ZM3A 1KE7A 4FYOA 4R7HA 4DBXA 2G2HA 4KD1A 5EYCA 1OIRA 3LFCA 3LFBA 4EK3A 3LHJA 3A7JA 3PJ2A 1SMHA 4U81A 4CKIA 3QU0A 1QPCA 3T3UA 3QRIA 5ANKA 3COKA 3ZZEA 4C3RA 4YJTA 2CGWA 3R8UA 3PWYA 4USDA 3KXXA 5E92A 3V5LA 3Q4UA 4XX9A 4DC2A 4EH8A 2Z2WA 4IC8A 4OR5A 3MIYA 3R0TA 4J8NA 3M42A 3QX2A 3D9VA 3DAJA 4FV2A 4HZSA 4U80A 3F5PA 5CXHA 3SXFA 4I5PA 2B9IA 4R7BA 3R01A 2J0KA 2VWBA 2GMXA 2WQNA 4I4EA 4PV0A 4A4OA 1K9AA 3FYJX 2WKMA 4NTTA 2WMBA 5EQEA 3HMMA 5CI6A 4YR8A 5CSPA 3KRRA 1ZZLA 3OCGA 4EH4A 2BTRA 1OUKA 3OCSA 4CTCA 2WQBA 3E8CA 4NJDA 5IA4A 3FMDA 4EQCA 2J51A 2XRWA 5FM2A 4NH1A 2PMOX 5FBOA 3O71A 2BFYA 5H8BA 3ZLSA 1ZLTA 4FKUA 5F4NA 5F9EA 3B2WA 1LPUA 5CAQA 3GU4A 1JLUE 3QD2B 2CKEA 2EU9A 3P5KA 4IWDA 3L8XA 5IA0A 4RFMA 3U6IA 4UWBA 5HEZA 3LCKA 4QMZA 2R3QA 5K5NA 4FV1A 2B9JA 3FJQE 2BRHA 4HCTA 4L8MA 5AP1A 4ZTMA 1M7NA 1Q8YA 4FKRA 3FMNA 3DJ7A 4FNZA 5HBJA 4BDGA 4MXOA 5EI8A 2JIVA 4JBQA 2J0IA 3C7QA 3P7CA 5HVYA 4ASZA 4XG6A 3DFCB 1H00A 2X4FA 3Q04A 4YGAA 5H9BA 3TIYA 3VF8A 3WILA 3L8PA 3HVCA 5CF5A 4CNHA 3CTJA 3UG2A 4KABA 4E20A 4KAOA 4YC8A 1Y6AA 2XRUA 3BGQA 3ZXTA 4AA5A 1BL6A 1Q99A 2UZNA 3C5IA 3OOGA 4BGHA 3U9NA 2XH5A 3BZ3A 5EG3A 3EJ1A 4X21A 3GQLA 4K9YA 5M56A 3CJGA 3Q9XA 2JKMA 3UDTA 4H3PA 5KX8A 4NFMA 2C4GA 3NX8A 1Z9XA 4BDKA 5HG7A 3P08A 4GL9A 4KS8A 3Q53A 1EH4A 5AP0A 2Y0AA 2PU8A 3F2RA 3PJ3A 4EH5A 3EQHA 3ZO4A 2GNFA 3QKMA 3VBXA 2UW8A 4AZSA 3IONA 1PKGA 1J7UA 3F5XA 4M84A 2W1FA 2Z8CA 4NW6A 3RK7A 4GEOA 3B2TA 3N4TA 1W0XC 3QYZA 2VTTA 4O21A 5A46A 1AD5A 4LOPA 4MCVA 2A2AA 4D4RA 4MXYA 3FC2A 4MNEB 4BHZA 4D28A 3NUAA 5EI2A 3CIKA 3FLNC 4GT3A 4H39A 2R3KA 2PVKA 2VN9A 4ZTNA 2GPHA 1OPKA 1WBOA 2PE2A 4KIPA 2IO6A 2O3PA 4OTFA 4FKJA 4U98A 4FR4A 2GCDA 2ITWA 2RGPA 3C5UA 3W2PA 3ZSIA 3COHA 5KZ0A 1H1PA 3Q9YA 4L3PA 3F5GA 3OWLA 3HYHA 4QMQA 4AWIA 5DHJA 4GUBA 4PL5A 2OF2A 4AACA 4M8TA 4PDOA 4F08A 1V0PA 4PNIA 4BCGA 2QU5A 4FTOA 3VWAA 3QZFA 4MHAA 4DTKA 1OIUA 4BZNA 4RMZA 2IN6A 4XG8A 1BX6A 3JY9A 3R9HA 4FV5A 1OL6A 4D55A 4E4NA 1BKXA 3C51A 5AP3A 1DAWA 3BHHA 4G5PA 1IAJA 2JD5A 3RCJA 3GCQA 1AQ1A 2RG6A 4R5SA 5HE3A 4IM3A 2JBOA 4Q9SA 3FUPA 3KQ7A 3A61A 3LIJA 4UBAA 4IVCA 2VTMA 2XK7A 5HQ0A 5E8SA 3ZSHA 4O7WA 4NWMA 3MESA 1P4OA 1OL2A 2OXXA 1ST0A 2UW5A 3MY0A 5EFQA 5HIDA 4CQEA 4ERKA 4OTHA 4GT5A 3TKHA 2XIYA 5FDPA 2OICA 2WMAA 5C9CA 2UZDA 4XLIA 4ZTHA 3GFWA 1TVOA 4G1WA 4I6HA 2W06A 4ZLZA 4BDAA 4ZZMA 3U9CA 4E1ZA 2BIYA 1Q97A 4IADA 5HICA 2XKEA 2J7TA 2R3RA 2RF9A 2QD9A 3QTQA 4QTEA 2UZUE 4B9DA 4RPVA 4RC2A 4RLLA 3TYKA 3MBLA 5CNOA 3ZRLA 4V05A 3GBZA 2A4LA 3RNIA 4CZTA 4TNBA 2ZDTA 2Y4IC 4TT7A 3F66A 3H0ZA 5E4HA 1LEWA 2EB3A 2DQ7X 2YM6A 3QF9A 4XCUA 3LJ1A 3VQHA 5KCVA 3AT2A 3ZCLA 3QRTA 3ZBFA 2OWBA 4EOMA 3NUPA 1U4DA 2IZUA 1PJKA 4B4LA 4GJ2A 3KU2A 2R3JA 4BCQA 4WZYA 3EL8A 2CNUA 1ZYSA 3CD3A 4C34A 4WSYA 1IG1A 3UTOA 3CTQA 3EWHA 4PQNA 4BDJA 4A9UA 4L53A 4DHZA 4KINA 3V5WA 2GS6A 4YJPA 3GC8A 4KWPA 2YIWA 3OT3A 5C4LA 3COMA 3TL8A 2V22A 2X2KA 4R6VA 3SOCA 4GS6A 3LXPA 4HVIA 5JGBA 1J7IA 3LLTA 3CP9A 2E9OA 3NFFB 2BUJA 4IE9A 4JL9A 5IUIA 3PXRA 3UVRA 4I0RA 3ZM4A 4C38A 1M2PA 3LQ8A 2O8YA 3UODA 1OI9A 3PDTA 3QWJA 4OT5A 2F7ZE 5EQPA 4ZJIA 4O7OA 4YNOA 4IAIA 2R3MA 2DUVA 2FGIA 3DAEA 3QHRA 2W99B 5CT0A 2I0EA 1JSUA 2BZJA 2C5XA 2J50A 2QHNA 3KGAA 3ODYX 3PY0A 1K3AA 1Q8TA 3D94A 1Q3WA 3POZA 4IZ7A 4WG4A 4ZP5A 2F49A 1MRUA 3NYXA 5C8NA 5HLNA 4MK0A 3PXQA 2C0TA 2UW3A 3DFAA 4I94A 4O7VA 1U54B 4NM7A 2PUNA 2G2FA 1OB3A 2WEIA 3BHVA 5HE0A 1OIYA 2HY0A 3W10A 4FKGA 3ZO3A 4DHJA 5CF4A 1QPEA 5A6OA 4DDIA 3QTXA 4AQKA 2OH4A 4D0XA 3KF7A 3DDQA 4E73A 5DYJA 5A4LA 1OM1A 5H8GA 4U3YA 4BTMA 3AT3A 1FINA 3DBCA 1KV2A 3EHAA 4JR3A 5BVWA 4FIEA 2WMXA 4O0VA 5AP5A 3D5UA 4XG3A 4FKTA 3P79A 2I0VA 4JT3A 4RJ6A 3OZ6A 3AQVA 3VUDA 5BUIA 4ALVA 1YI4A 4WBBB 4YP8A 4BIBA 5DWRA 5DR2A 1P4FA 5BVNA 3SRVB 3VUIA 4AW5A 5LWMA 3U4UA 3EN6A 4AP7A 5T3QA 5CAPA 4UN0C 3W0SA 5DT4A 5CAUA 4OTDA 5E8ZA 2V7AA 4BCIA 3O51A 4GIHA 2CDZA 2GNHA 5BX0A 2ZV7A 2CLXA 4O0SA 2B9FA 2HK5A 3HDMA 5IDPA 3BLQA 4EKLA 2B54A 5I9UA 2LAVA 5EYDA 1ZOEA 5FGKA 5BVEA 4IAFA 4E7WA 4ONAA 4D4VA 1H27A 1I09A 5HLPA 3K3JA 1PHKA 2ESMA 3MPAA 4FMQA 4R3RA 5FP6A 3JPVA 3G9LX 3ERKA 4XG4A 3UNJA 4L01A 4L68A 1PRYA 4CMTA 1GJOA 4O7PA 5LXMA 1SNUA 2J2IB 3FZ1A 2C6OA 3QFVA 4B0GA 3EN9A 3G51A 4QPSA 4FNWA 4BTJA 4ZS4A 2X9FA 2WHBA 3CKXA 2PWLA 3F3UA 4YZNA 4XV1A 2C1AA 2VO0A 2FVDA 3ZM9A 4WG5A 4BRXA 3EN4A 4DTBA 3BYOA 2YDJA 4CRSA 3P86A 4X0MA 3NAYA 2IZTA 4CCBA 4BTFA 2WFYA 4HYIA 5CZIA 5IUHA 5KMNA 1UWJA 4U94A 3DK3A 2XAMA 2J5EA 2YHVA 3KULA 2SRCA 3HKOA 5HCXA 3KRXA 4FTJA 5BYYA 3D7TB 4G3EA 1XBBA 3HNGA 4YTCA 5L3AA 2OJFE 2GNJA 3OTVA 3AD5A 4EL9A 3MB7A 3MVMA 3QTUA 4QO9A 2QOKA 4O82A 1P5EA 5CANA 3E7OA 4EOSA 2BVAA 4YLJA 2ZOQA 4FTRA 2IVTA 3V8SA 4UYNA 3VS2A 4L6QA 1H01A 3BELA 4F9BA 3NR9A 4I20A 4MH7A 5DGZA 2XK3A 4CFNA 2B7AA 3DA6A 1J3HA 4O38A 3PSDA 1REJA 1IAHA 1OL7A 2XK4A 3FWQA 1H07A 5DN3A 5EW3A 3LXKA 5KKRC 5M4FA 2FSLX 3ATTA 3EZRA 2QOIA 3ROYA 2W5BA 5IG1A 4V04A 5C03A 2C3JA 5KMJA 2CKQA 3DKFA 4YJSA 4DGLC 5FTQA 2VWYA 3P7AA 5BVFA 2NPQA 4H1JA 2OIQA 1B39A 2GFCA 4FG8A 3NNXA 3SC1A 4DAWA 3LE6A 4AQCA 5EW8A 3ORZA 4YTHA 2JAMA 3BHYA 3KVWA 4GFMA 4ZJJA 2PZIA 3F2NA 4EOPA 1PYEA 2OO8X 3UZPA 2ITQA 3V8TA 4PTEA 3WE4A 3VRZA 3F3WA 2RFEA 4S30A 4U6RA 5KNJA 4IH8A 1YI6A 2G2IA 4R77A 4GVAA 3S2PA 4CVAA 5M4CA 1W82A 1ZYCA 4ZTSA 2EUFB 4JIKA 3EIDA 4DINA 4YHFA 4CMOA 2C68A 4D9TA 3HMNA 4QTCA 4YJNA 1R78A 2P3GX 3MJ2A 1ST4A 2YCFA 4C2WA 3QALE 4E6AA 1XJDA 4CKRA 3UOJA 4JG8A 3P1AA 3ULIA 5CAVA 4LQMA 2NYAA 2R5TA 3V6RA 2OSCA 4AG8A 3QQKA 4Z3VA 2W1DA 3PJ8A 5CF8A 3MWUA 3G5DA 4RJ3A 2WMTA 3EQIA 2EB2A 4HNFA 2F7XE 2KTYA 1YHVA 3HEGA 5HO8A 4BGQA 5B7VA 1PYXA 2XIKA 2VTJA 3AC1A 4OBQA 1ZY4A 3BPRA 5AUYA 5CSVA 5ICPA 4RIOA 3G90X 4MBJA 2OGVA 4YZBA 2VWWA 3D0EA 3QQHA 4RX9A 4PX6A 5J87A 3BRBA 3I4BA 4JLCA 3W2QA 1XH8A 2XEZA 4FTLA 4OBPA 1Y8GA 2F2CB 4Y95A 5JEBA 4O6LA 2WOTA 3RHKA 4DT8A 2XZSA 2W17A 4UYAA 4XV9A 2YFXA 2XKDA 4BI1A 3LW0A 2O2UA 3M11A 3RI1A 1M52A 2Y4IB 2Z7QA 4MWHA 4QTDA 3A2CA 3OTUA 5CEOA 5KO1A 3OFMA 5L2WA 4C3FA 5DOSA 4EOKA 3CEKA 5M44A 4DEEA 4JRNA 4EORA 2CNQA 1TQPA 3PWDA 5ANIA 3GT8A 5M06A 2HAKA 2R3LA 3PFQA 3RPVA 3BLAA 3CLYA 5BQ0A 5C01A 2XMYA 1R0EA 4FIJA 4YJRA 2IPXA 4AT4A 1MQ4A 3H10A 3KCFA 5EW9A 2QLUA 1GY3A 5IEVA 2VWZA 3OXZA 3R7EA 4BI0A 2NP8A 4ANQA 4RLKA 4ZTLA 4EYJA 3H4JA 3PUFC 3EFKA 3NRMA 2YAKA 5CEQA 5HZNA 2IG7A 4RIWA 1B38A 4OGRA 1NW1A 3TNQB 3AKLA 3C0HA 2VTSA 5HIBA 4L46A 4D1ZA 3VIDA 3CCNA 4QPAA 1NY3A 1FPUA 3GCSA 4AOJA 3TZ7A 3QQFA 3QQGA 3LPBA 3F7WA 3PPJA 4L3LA 2IVVA 3C4XA 4G3CA 4O0YA 1OKYA 3DK7A 3NS9A 4GKHA 1IA8A 4X7QA 3Q4TA 2XAOA 4O7YA 3SQQA 2GHLA 3Q2MA 5CS6A 4KBAA 2A0CX 3ZFYA 5ANJA 1XMMA 4D2SA 4NYEA 4WIHA 4NCTA 5FLFA 4FEUA 2PZRA 4K33A 4G17A 4RIXA 1WVXA 4EHZA 4ZSLA 2VX0A 3W0MA 1Q5KA 3F7ZA 3ML1A 1ATPE 3PVWA 4FGBA 3LXNA 3DY7A 3DXQA 3I0QA 1Q41A 1UU7A 4LRMA 3FZTA 3IQ7A 3LMGA 3PLAE 1Q24A 3PJ1A 2WTJA 1KV1A 2QO2A 3RAKA 3MA3A 5FXSA 3VAPA 5CAOA 1WBPA 2I40A 3D7ZA 4G5JA 5DEWA 3QQUA 2UZLA 4PF4A 3TZMA 3DV3A 4ZS0A 5ETFA 4QP1A 3FXWA 4S31A 5DR9A 3LQ5A 3RM7A 1E1VA 2PYWA 4FA2A 2FSTX 3EQBA 1CM8A 2QVSE 3BBTB 2YZAA 4BI2A 3P0MA 4AXCA 3SHEA 2I0HA 1LP4A 2QI8A 2OU7A 3OD6X 3PXKA 4IZAA 3JXWA 4J53A 3ORXA 3UJGA 2VUWA 4FIFA 2XM9A 3UPXA 4FT7A 1PXNA 4KSQA 3UYTA 4W4YA 4L42A 3VBWA 2WOUA 2IWIA 2P2HA 4IWOA 4E93A 1PXLA 2JDVA 1VR2A 4AE6A 3GENA 3VHKA 3KXZA 2BRNA 1PXOA 5IQEA 4CRLA 2B9HA 2CGXA 2C3IB 2G1TA 5EKOA 4DHFA 5BVOA 2E9UA 5EDRA 4YNEA 4X3FA 4XG2A 3RKBA 5AJQA 3M1SA 1CSNA 3HRBA 2XNEA 3CGFA 4YO6A 4CV8A 5D7AA 5AIRA 4YSMA 3UP7A 4C33A 4E5AX 2FYSA 1VLRA 2OIDA 4RFZA 3POOA 4M3QA 5J7HA 2JGZA 2W1IA 2XYNA 2YM8A 3IK3A 4DEAA 4BY9E 3LKMA 3VBYA 3S00A 5DRDA 1J7LA 3Q4CA 4ENXA 3GB2A 3H30A 1ZWSA 5DI1A 2GQRA 2OKRA 1Q4LA 3FBVA 3W33A 3QCSA 3D4QA 2PULA 4YBJA 2ZV2A 1JKTA 3FYKX 3LVPA 5CI7A 1GZKA 5AEPA 3UQFA 3A4OX 5K3YA 4EOIA 4JDKA 2XEYA 3F3VA 2GHGA 1H24A 5CEMA 2R64A 4G34A 3R9DA 3DB6A 4RWIA 4BYJA 2CHLA 2Z7RA 3I0OA 4JDHA 5DFPA 1YQJA 3U4WA 4M14A 3ZMMA 1AGWA 2R3OA 4CMUA 4P7EA 3TG1A 3UIUA 5A4CA 1JKKA 1Z57A 2NO3A 5KKRB 5A54A 4H36A 1SNXA 4Y72A 3W0PA 4XV2A 1YXSA 3R8ZA 2CKPA 1YWNA 3E92A 4W4XA 1FMOE 2P55A 4HGLA 5D11A 4GVJA 4NM0A 4EH3A 5FM3A 2QONA 3QL8A 3R6XA 4PL3A 3CBLA 4BZDA 2WTKB 2X8DA 3KK8A 4YTIA 3NVKI 4AUAA 3ZH8A 2CMWA 3GU6A 3G0FA 5KMMA 1R3CA 1OIQA 2PSQA 4AN2A 4WA9A 2BIKB 4Z7GA 3AMBA 2ETKA 2WQEA 2UW0A 3AC2A 3BGZA 3P78A 3ZBXA 4DG2E 3TEIA 3UP2A 4QDVA 2VWVA 4BB4A 3QWKA 3TKUA 3CXWA 3MPMA 4ZZOA 2I6LA 5IU2A 2R3PA 1J1BA 1VZOA 2NRYA 3O2MA 4I5CA 4YURA 5LCKA 4ENYA 3FMKA 5FP5A 3UO4A 1BLXA 4MD9E 3SLSA 4O6EA 3W32A 3Q32A 4CD0A 4U40A 5I4NA 4CFWA 3QQLA 4TYGA 4BDBA 5IISA 3UG1A 3R8MA 4BCFA 4F9WA 5D7VA 3HV5A 3LQ3A 3F9NA 2UZEA 4AZEA 1H1WA 2F7EE 2C6DA 2FSMX 2GS7A 3OBGA 2OJGA 3FPQA 3Q9ZA 3PVUA 3AKKA 1FGIA 5E7RA 3PUPA 2WAJA 4EKKA 1H4LA 1YI3A 2CGUA 3CD8A 5IPJA 5E90A 4I6BA 2YZLA 5AP6A 2GS2A 1PXKA 2YDIA 4HVSA 4FSNA 4PMPA 4I93A 3LM5A 3KY2A 4U43A 5C26A 2J6MA 5D1JA 2I7QA 3ULZA 2YDKA 4QMNA 2YCRA 4BDIA 1PMVA 4HVGA 4N6YA 2DS1A 4RWLA 5DLSA 3ZONA 4FZDB 4O81A 4GT4A 4FYNA 4YLLA 3EB0A 4HYUA 3UDZA 4ALUA 4DLJA 3BWFA 3IW4A 3RAHA 5HTCA 1H25A 4TXCA 4O0TA 4QP7A 4AFEA 2OJIA 3EFJA 3WIKA 5HD4A 4FBXA 4LV8A 4G6LA 4RJ5A 3WZUA 4K11A 2VO3A 3LFDA 3BYSA 2HW6A 3LZBA 4XOZA 3UMWA 2O64A 4ITHA 5LOHA 3CC6A 2HXQA 3CQUA 2G9XA 3EN5A 4GCJA 5HCZA 4FICA 2GNLA 1YDTE 4ZMEA 2EVAA 3WF5A 4FK3A 4TYEA 4RA4A 4FUYA 5L2TA 2C5NA 3V51A 1ZOHA 2BKZA 4NU1A 4Y85A 4QYGA 4CLIA 2F2UA 4O0XA 2R2PA 3ZDUA 4BC6A 4E5BA 4CSVA 4CG9A 5E8UA 3VS6A 5J5SA 3QLFA 1IASA 1YXTA 2BAKA 3MH3A 3ACKA 2ZJWA 4IHPA 4AOIA 4FODA 2JKQA 4QQJA 3KN5A 4A7CA 4QMXA 3FLSA 1REKA 4FKPA 4ZJVA 4BDDA 4CKJA 3ZEWA 3H9RA 4BCPA 3PTGA 2W0JA 4RSSA 3ZOSA 3JYAA 5CEKA 3AOXA 3NW6A 3BHUA 1Q3DA 1S9IA 4FKWA 3HRCA 5TKDA 3U54A 3CTHA 1UVRA 1B6CB 2IZRA 3AKJA 3NNWA 3NW5A 3UYSA 2CCIA 5CU3A 2PUUA 4W4VA 1OPJA 4ZSGA 4YU2A 4DEIA 2WMSA 3W0NA 4HGSA 3TV4A 4CFVA 4A9TA 1ND4A 2I1MA 4FI1A 4J52A 4R1YA 2OF4A 2WMWA 3IO7A 3Q3BA 1ZXEA 2UVYA 2WTWA 1KE5A 4QDEA 4U45A 2QQ7A 4P5QA 4UXQA 2QR8A 2WGJA 5AX9A 3R7UA 3TI1A 4DGMA 3VS5A 3ORMA 2QOLA 3AGLA 4YBKA 1ZYJA 2R3NA 4FTUA 1YXVA 1OITA 2PVJA 4FTMA 4I6FA 5LVOA 3CE3A 1YHWA 2BZHB 3F88A 2UW9A 5FD2A 2WTCA 4C02A 3CKWA 4BCNA 4GMYA 2JLDA 2VTAA 4NM5A 4BBFA 4LUDA 2HENA 4FNXA 1I44A 4KIQA 2WNTA 4TPTA 5IA2A 2FA2A 5A6NA 3L9MA 4Y83A 5TF9A 3TJDA 3VJOA 3UIBA 5LMBA 5K9IA 3NNUA 3RPYA 4IJPA 4RRVA 1OBDA 2QOOA 3ODZX 4BICA 1BYGA 5EM5A 3MH1A 5M07A 2QC6A 4RX8A 4WHZA 2PY3A 3C4EA 3KEXA 2XNBA 3Q5IA 4ZXTA 3TKIA 4ZY6A 4AGCA 5B2LA 1T45A 2XANA 4GG7A 2PE1A 2RIOA 3IDCA 4DH5A 3GCUA 1UU8A 4QEBA 3PIZA 4YZ9A 2CJMA 4Z16A 2BHHA 3R1NA 1UA2A 2CKOA 1KUTA 2H8HA 5A3XA 1A9UA 3BLHA 4YC3A 3LJ2A 4ACCA 5C1QB 5IQHA 4IAAA 3IDPA 5HD7A 1OGYA 1RDQE 4JQ7A 3IPHA 4QMMA 5AFVA 1ZZ2A 2VX1A 2JKOA 3DDPA 2UV2A 3G9NA 4DLIA 1NA7A 3FLWA 3MI9A 3PRFA 2AEGA 5DH3A 2BROA 3NAXA 5LMKC 4O7LA 5KBRA 5FEEA 1YVJA 3FEGA 1YOMA 2EXMA 4TL0A 2UZVA 4YZCA 5DNRA 3F82A 3D5XA 1RE8A 1FBNA 4OTWA 4PMTA 1P14A 4G6NA 4TYIA 4Y46A 3PFYA 3K5VA 4X3JA 3FKLA 4EWHA 2YWVA 3D14A 3A7FA 3A7IA 4IB3A 3E3PA 4KBKA 1UNLA 4F64A 2X9EA 4II5A 2XK9A 3KXMA 2X0GA 4ASDA 4YTFA 3E64A 5HX6A 4O91A 4ANLA 3R83A 3I60A 3GOKA 3KREA 3VVHA 3C4CA 3O5AA 3RNYA 2XNPA 4LV7A 4WOVA 5AV2A 2BDWA 2VWIA 3ZYAA 4DEGA 3AC4A 4K77A 1PXPA 3ZEPA 5HNIX 4G9CA 2ITYA 4GK4A 2Y8OA 3IGOA 4G31A 5I5ZA 3S1HA 4U41A 5G6VA 3PVGA 4F1OA 2DYLA 3ZRKA 5CT7A 5EM7A 1NVSA 4C2VA 3CY3A 2HXLA 4IFCA 4FTIA 5IZFA 3QRKA 3UO6A 4DBNA 5E91A 2OXYA 4CFUA 4OTQA 3ALOA 2VO7A 5I9WA 4C0TA 2PL0A 4ARKA 1DI8A 1Q8UA