5C4LA

Conformational alternate of sisomicin in complex with aph(2")-iva
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
MRTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2'')-Id
publication title Aminoglycoside binding and catalysis specificity of aminoglycoside 2-phosphotransferase IVa: A thermodynamic, structural and kinetic study.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase
total genus 98
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c4lA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 5c4lA02
4EOLA 2YM5A 2WQMA 3C9WA 2I0YA 3L9NA 4PY1A 5EK7A 4OTQA 3COHA 3TWJA 3BBTB 2J0MB 4MNFA 1PKGA 4CFWA 5CAOA 5JSMA 2B1PA 4C34A 3VW8A 1WCCA 3OY1A 2FSTX 4AOTA 3O50A 4FVPA 4WO5A 2OW3A 4D1XA 4ASXA 5IEYA 4ZAUA 2C5VA 4E4LA 1BYGA 3P7AA 3R83A 5DRDA 1R39A 5HE2A 3COIA 4AW2A 4I3ZA 2OU7A 1W83A 5DE2A 4ZSGA 5E8YA 2FVDA 2EXCX 2UZDA 4BRXA 4BZDA 4QP9A 3UOJA 5J1VA 2HZIA 4YC3A 2DQ7X 4BDAA 4LV8A 4RMZA 3DK6A 3OP5A 4XV3A 3VHKA 4CSVA 4F4PA 3OXZA 2GTMA 3C0GA 2VTNA 5KNJA 5CI6A 3E62A 3MTLA 2ONLA 1KV1A 1X8BA 2HXQA 2WEIA 3TIYA 3PJ1A 2XJ2A 2JC6A 4RX7A 4EOOA 3BU5A 2W96B 5DIAA 4EBVA 1OPJA 5HIBA 4EH7A 3KXHA 4TWOA 4CV8A 2I6LA 4FE2A 2J0LA 3WE4A 2PVFA 5KMMA 2UZUE 3HNGA 3IKAA 5M08A 2F49A 4ACHA 4FKUA 3EH9A 3FI4A 3P08A 4YJVA 2UZNA 5J5SA 4TY1A 3G6GA 5EW9A 3MVLA 5AP4A 3HUCA 3HV3A 1JBPE 3ETAA 3VUHA 1KUTA 3GU8A 4O7PA 3NNVA 4MHAA 3SC1A 3LW0A 2JDOA 4UN0C 5KMOA 5EI6A 1H26A 3CD3A 3FHRA 3KMWA 5EW8A 3ORXA 3EKKA 2XVDA 3F3TA 3FI3A 4RC2A 2VO3A 3U9CA 4D1SA 1KOAA 2C3LA 1UNGA 3CE3A 5IEXA 3ZO1A 5HIDA 3EFKA 2BCJA 4M12A 2DS1A 4MXYA 2C5XA 4AZWA 4GFGA 4MD9E 3BHYA 2IZTA 3COMA 4LRJA 1BLXA 3A61A 3DOGA 3HL7A 3KY2A 5BYZA 4KA3A 3QQKA 1WVXA 1H1WA 1XKKA 4G31A 5T68A 3D7TB 3VULA 2VWIA 2UW8A 5AM6A 4AAAA 3DZQA 1G8SA 2FB8A 4AXAA 4RX9A 3FPQA 4WG4A 3IDCA 2BTRA 4BCFA 5IMXA 2BAKA 3W8LA 1IA8A 2WMVA 1H28A 2YABA 1ZWSA 4H05A 1GZKA 3EN9A 3MN3A 4KINA 4Y5HA 2X39A 5JN2A 3BLRA 2XIZA 2CKPA 2XJ0A 5BUJA 4BIBA 2A27A 3PVWA 3QTWA 2XYNA 3O8UA 2PVMA 4FYNA 4X21A 2XKFA 3BI6A 5DVRA 4U94A 2BRBA 4L01A 1URWA 5AAEA 3E87A 3NYOA 3WZUA 5LWNA 3ORTA 3ALNA 2QURA 5TR6A 4DTAA 2PVLA 2R3HA 1ZMWA 2UW3A 1WBVA 2VX0A 1UU9A 1NVRA 3ORMA 4LQMA 3JPVA 4TPTA 4AFJA 4ENYA 4DT8A 4C4HA 3S2PA 3UQCA 2X2MA 2OG8A 3Q2MA 1OKZA 4XOYA 1G5SA 1UKIA 3KCFA 3GENA 5FP6A 2I1MA 3CIKA 4BCGA 1YHVA 4BR3A 5CAPA 4OTIA 2Z7SA 4I6QA 2WMXA 2XIRA 2C0IA 4EUUA 5IZFA 3SOAA 3GCVA 2C6MA 4QYHA 3ZO4A 5ETCA 2B54A 1ZAOA 2DYLA 3HMMA 3NX8A 4LFIA 2Y8OA 5I9WA 2J9MA 5FGKA 5L8KA 2PYWA 5CS6A 1J1CA 3A62A 4FMQA 3GVUA 5C26A 2OIDA 4G1WA 4RIYB 2PMLX 2QU6A 3BHHA 5JQ5A 1JAMA 2I0VA 4V04A 3KXZA 2JFMA 3NNUA 3PRIA 3ZLXA 1JSVA 3LAUA 2PWLA 3LQ5A 4TT7A 4AS0A 2J4ZA 4AW0A 4CT2A 3E63A 5BMSA 3O8PA 4JOAA 4TN6A 2WFYA 4NTTA 5K5NA 1XO2B 3VQHA 4I4EA 5HE0A 4QP1A 3AMAA 3W0OA 1E1XA 3EQIA 2NP8A 5FUTA 4YLLA 5LMAA 4IANA 4CFMA 4FKRA 2WEVA 4U45A 3SVVA 4GK2A 5BVEA 2JIIA 5I5ZA 4YZDA 4YTIA 5HG8A 3WF6A 5IG1A 5M55A 4D2RA 4LOPA 3UJGA 2AUHA 3V5PA 2XIXA 3CGFA 3FXXA 4OW8A 4EHZA 3PA3A 4RG0A 3O96A 1XH7A 2ETRA 2PUNA 4ASDA 3HAVA 3I7CA 2UW5A 4DFYA 4ZP5A 4WNKA 5BQ0A 3F66A 3LFNA 4DEAA 4YZBA 5FEQA 4QMNA 2BKKA 2HZNA 3PY1A 2BVAA 4R78A 1ZYCA 3PFQA 2Z7QA 1OL5A 5LWMA 4X2JA 4EH6A 2F7EE 5A3XA 4LMUA 3WE8A 3QAME 3BYUA 5M4CA 1JNKA 2AYPA 3D15A 1UV5A 2SRCA 3IONA 2Y4IC 4K18A 3F9NA 3D5VA 3CQWA 4WKQA 2WOTA 3NW5A 5KZIA 2R3IA 3PXRA 4B99A 4I0SA 4OTWA 1V0OA 1BL7A 1GY3A 4PP9A 5HGIA 4AGCA 4CD0A 4KRDA 4DEEA 3A7GA 5C4KA 3KVWA 4MXOA 5L6OA 3QCQA 3D83A 3ITZA 4I22A 3PZEA 2W5HA 4KBAA 2ZDTA 4LM5A 4U7ZA 5H8GA 4BGQA 2QG5A 3P4KA 2VTOA 5GINE 4GH2A 4OTGA 3ZSGA 3MPTA 5J1WA 2PMIA 3F5GA 5F4NA 4IC8A 3PWYA 1FVTA 5AUTA 3R1YA 4FIEA 2J5EA 3BLQA 3TG1A 4BDCA 5HG7A 3PXKA 4I6BA 4F6UA 4MD7E 4HZRA 1FMOE 5JGDA 3BGPA 3VBVA 4EH2A 3CR0A 3UP7A 3JY0A 4EH5A 4ZTMA 4O83A 3QXPA 4C58A 1Q99A 2C0OA 3GCQA 4RFZA 2XUUA 4C4EA 1WVWA 3FLZA 3CXWA 4S31A 1Y57A 3I6UA 2PUIA 3Q04A 1ZOEA 4TYHA 5JFXA 3ZEPA 3FQHA 4NTSA 2XP2A 3W33A 5TKDA 2JD5A 4DN5A 4II5A 4C35A 3BE2A 3GGFA 4O81A 4FKLA 2C6LA 1K3AA 2WMAA 3PG3A 5CEIA 4AG8A 2QHNA 3SD0A 1UA2A 4FV2A 3Q5ZA 4D5KA 3SOCA 2BDJA 2EXMA 3CKWA 5I9YA 4FSUA 1Q24A 1CKJA 2I0EA 2X7GA 4QYGA 1NY3A 3MGYA 4FIJA 5JKGA 3R01A 1QPCA 2X7OA 4WIHA 3F3VA 5KUPA 3WF8A 1H27A 2CKQA 3BYSA 1JKSA 1GNGA 3ULZA 3KREA 3TEIA 3E8EA 5D41A 4BDJA 3BU6A 2BAJA 5ANDA 4HW7A 4RX5A 4YNOA 4DT9A 4FR4A 5KX8A 5AUZA 4USEA 3PSCA 3QCXA 3MI9A 1YWRA 2RFSA 4O0YA 3ORKA 3UVPA 5IDNA 3CSVA 4CRLA 4J95A 2V62A 3DQWA 4RA4A 2FSOX 2IZSA 1WZYA 3HYHA 2F57A 5DRBA 2OXXA 3QUPA 3F82A 2VRXA 1ATPE 2X8IA 4FVRA 4O7NA 2OXDA 4ZS4A 4U0IA 1KE6A 3VUKA 5EM7A 3ZLSA 1V1KA 4FODA 2OLCA 4H39A 5HD7A 1M7NA 3BYMA 1J3HA 4G3FA 2QOIA 3DKCA 3PP0A 5CASA 4GKIA 1Q8UA 1FQ1B 4QPAA 1H24A 3R21A 4AFEA 3QX2A 2VWXA 2QG7A 3R30A 1PXNA 5HE1A 2HXLA 4HGSA 5IPJA 3LXPA 2VTMA 5ANGA 3VS7A 3M1SA 4CG8A 4X3FB 4DFBA 4MWHA 3SHEA 4ZLZA 3NMUF 2CGVA 4W4WA 5EYCA 4EZ3A 3NUXA 1R78A 4IEBA 4MAOA 4D4YA 1H07A 5ANOA 4OTHA 3FHIA 3LCDA 4F6SA 4K11A 1F0QA 2VU3A 4U41A 1HOWA 4O0RA 3C5IA 2H9VA 1J7LA 3FZSA 5HESA 2XNNA 5CI7A 3NVMB 5K4JA 3QQLA 4YZNA 3Q60A 2VNYA 3G0EA 3HLLA 4EK5A 3D5XA 2YIYA 4D4SA 4J1RA 4YLKA 4AZTA 4O6EA 4EI4A 1LEZA 3MVHA 4LI5A 4QP6A 4FV6A 4YTCA 3R2YA 1ZXEA 1ZZLA 4QP8A 1SM2A 5EDPA 5FP5A 4EH3A 5DN3A 4CEGA 4X2GA 4W8DA 2HWOA 5LVOA 3CCNA 2C6TA 5HO7A 2QR8A 5EQEA 2R0UA 2E9PA 4Y8DA 5CANA 4IZAA 3C7QA 3VRYA 4XG7A 2GHMA 4E26A 2W1CA 3QLFA 1R0EA 3CTJA 3MTFA 3UIXA 2OSCA 4PTGA 3FZTA 3QC4A 4NJDA 1VR2A 4QYFA 3DXQA 4BDIA 4XP3A 3SG9A 4N6ZA 2QOBA 5CSWA 1R0PA 1QCFA 4IADA 4U44A 2OF4A 3U4WA 1FGIA 4PF4A 1FOTA 1Z9XA 2GTNA 3HMIA 5DYJA 4RWJA 4U80A 3D5UA 3QD0A 3ZEWA 4OUCA 5AP3A 4RT7A 3BKBA 2C3IB 5EM8A 2C69A 5TT7A 3I0QA 3MBLA 3PPJA 4IB3A 3M42A 4QMLA 4EOIA 2QOKA 2GNFA 4DGGA 4KSPA 4I24A 1XBAA 2VUWA 5A14A 1H00A 1YOMA 4AOJA 4TKSA 3UYTA 3AD6A 4LL0A 3G6HA 4FSTA 4IM3A 1DI8A 2E9UA 3D4QA 2W0JA 4D2SA 4PV0A 3FY0A 2I40A 3LCSA 3FZPA 4EC9A 1XJDA 4X2FA 4Y5QA 4YC8A 5DEWA 4I0RA 4QMOA 3LFFA 3PIYA 2W1IA 3A2CA 4I4FA 1FGKA 5IA5A 4M0ZA 1LP4A 4PTCA 4JG7A 3JY9A 3SA0A 2IW8A 3EYHA 3KL8A 3LXLA 4RZWA 3TL8A 4DTKA 3HV4A 1SMHA 1OMWA 2BRMA 3NIZA 4XUFA 3QFVA 3I81A 4CTBA 2Y4PA 4GK3A 5K4IA 2VTAA 3OUKA 3LM0A 3GP0A 5E8ZA 3D7ZA 4JI9A 1REJA 4O7VA 2LAVA 3TNWA 4EKKA 4AN9A 3W2CA 2G2IA 4NW5A 1XHAA 3I0OA 4FKTA 3UQFA 2VV9A 1B39A 2CPKE 4O7LA 4CKRA 2W1FA 4X3JA 4IE9A 1YI4A 2JFLA 1CM8A 5CXZA 2XNBA 2HELA 3PP1A 3FLWA 4IACA 1UVRA 2WAJA 2XZSA 4GJ2A 2OKRA 4EQMA 2QONA 4BIDA 5IMEA 2QOFA 4CMTA 5L8LA 3NUAA 4C2WA 3THBA 5E4HA 5K9IA 2F9GA 2EB3A 3DB6A 2IO6A 3S3IA 3MSSA 4IFGA 4TL0A 2JDRA 3T8OA 1KE7A 4LOOA 4MXXA 3V51A 4FTTA 3W1FA 4W8EA 4IVDA 4L3JA 2NRUA 3FMDA 3UOKA 2EWAA 3FZRA 5L2IA 2B52A 5IEVA 3FKNA 4EYMA 3BQCA 3PE1A 4U40A 1KE5A 5BVKA 4ZOGA 3B8QA 1W98A 3OT3A 4NL0A 3ZO3A 2YZAA 3P0MA 5A4QA 3BQRA 5KBRA 2WPAA 2R4BA 2J5FA 4EQCA 2WQEA 4BVUA 2PPQA 4ACCA 3RPRA 1NT2A 4R5YA 3ZRMA 4DF3A 3L8XA 4ERKA 3LMIA 3MY5A 3WARA 4ZLYA 2EB2A 4J8MA 3T3VA 2X6EA 2RFDA 5CY3A 2GFCA 3LFCA 3VS0A 3TIZA 5C8MA 5K3YA 1PKDA 2IVTA 2UZWE 2YWPA 3MA3A 3PUPA 3Q4TA 3R6XA 4FKWA 4MTAA 4GRBA 3L8PA 4XX9A 3TN8A 3TTIA 1ZRZA 4E4MA 4R7IA 3AT4A 4Q5EA 3MA6A 1KWPA 4E6DA 2VD5A 2RFNA 3P5KA 3NUNA 4FEWA 4ZXTA 3VC4A 5A9UA 3OW3A 4FX3A 4L53A 4YPDA 2H96A 2HZ0A 4IZ7A 2NNWB 4PL4A 2WQBA 3ZLWA 2W05A 1O6YA 1B6CB 4QNAA 4LUDA 5LOHA 4YHTA 4QMYA 2VTIA 2ZB0A 3QRKA 3TJDA 1OL2A 3QQFA 3NR9A 3HA6A 3UOLA 2PU8A 5CT0A 5M06A 3RAKA 2JITA 5GNKA 3V6SA 4JR7A 3UNKA 2YIQA 1WBTA 5T6KA 3EIDA 3LLTA 4FI1A 4BKJA 1LPUA 3ANRA 4CMOA 4JL9A 3LQ3A 3R8UA 3RGFA 2XRWA 2BIYA 5GHVA 4RWKA 4L9IA 4H3QA 5L6WL 3F2NA 4BCHA 3VQUA 4F9CA 3H9FA 5H9BA 2PE2A 3H0YA 3EKNA 3JR1A 3Q9YA 1YWVA 4HCVA 2W7XA 3BHUA 5HX6A 3LFEA 4DG0E 1ZOGA 5HI2A 1OPLA 4YJTA 3WIGA 5M51A 2OH4A 3FMJA 5M4IA 2BZJA 2E9NA 4ZTHA 5BX0A 4AN3A 3D5WA 1UWHA 4GVAA 2R3NA 3CQUA 3FYJX 1PJKA 4A9UA 4A7CA 4ENXA 3FLYA 3SRVA 4DH3A 1ZOHA 4GT3A 4RIXA 1XQZA 4DTBA 4M69B 1XH6A 4NM3A 4ZTSA 3R9NA 4WBBB 3WF7A 2B4SB 1JWHA 2WMBA 3P9JA 3VWAA 4D58A 5IISA 4LGHA 2QCSA 3FYKX 4RLKA 3BCEA 4C02A 1A48A 4Q5HA 4O91A 4BCKA 2XYUA 3A7HA 2J51A 5JQ8A 5LMKA 1Q62A 1YXSA 1XH9A 5CVGA 3BHVA 3KFAA 3MWUA 2YN8A 1W8CA 3R7YA 1DS5A 1ZY5A 4DH7A 3RAIA 3WILA 1OBDA 3TDWA 4PX6A 4C59A 3FY2A 4JT3A 3OTVA 4RX8A 3MPAA 4P2KA 1W0XC 1KE8A 3A4PA 4AACA 5AV0A 3LKMA 5HX8A 2GHGA 4MQ2A 2JLDA 2XKCA 3QD3A 5F95A 5HZNA 2V55A 4PWNA 4L42A 2XK7A 5CQUA 3NGAA 5JRQA 2X0GA 5JH6A 3QKLA 5BNJA 3QBNA 5IQBA 2RGPA 3CY2A 2EVAA 4P90A 3DK7A 4QT1A 3R63A 4FL1A 1VJYA 3R22A 4IX3A 3UG2A 2W1DA 3NYXA 4R3CA 3W8QA 3S1HA 5AUXA 2BIKB 2DWBA 2XM9A 3FKOA 3NS9A 3U51A 2XNMA 5JFVA 2C5NA 4E20A 3G9NA 4APPA 4O0TA 3W0QA 4O0WA 4Z55A 3UVRA 3R00A 2VGOA 2ONLC 4EONA 5FTGA 4FNYA 4YBJA 5HNBA 1UU7A 4EHEA 4O7OA 1H0VA 2IWIA 4G9RA 4A4LA 4E4NA 2ZMCA 1QPDA 3NW6A 1HCKA 4IMYA 2GU8A 3P86A 4HGLA 5EKNA 1TQPA 3TJCA 4XG6A 3UZTA 1LEWA 2HY0A 2XMYA 3TTJA 4U42A 5GIOE 3VBYA 4LRKA 4QP4A 5AA8A 1XR1A 4DBXA 3PJ8A 3QXOA 4DH8A 5EFQA 3WF9A 3FL4A 5LVNA 3PIXA 4ALUA 4F65A 2E9VA 4MH7A 3W2OA 2BR1A 3GU6A 2Y6OA 4U43A 4ANQA 2G9XA 2ITPA 4DG3E 4IW0A 5A6OA 4G9CA 3V5WA 1DI9A 4P7EA 4GKHA 4RGJA 5AWMA 3HRCA 2VWVA 3FKLA 3TCPA 3LCKA 3RNIA 4XG8A 3AC3A 2Y0AA 4PQNA 3UO4A 4JDHA 4LYNA 4UB7A 4J7BA 2P0CA 2J90A 4FV9A 4XOZA 3T3UA 2WZJA 5HORA 4PP7A 5ITAA 3QKKA 2QOQA 1UKHA 4XLVA 4QQTA 3MIAA 2GPHA 1L8TA 3D14A 2WKMA 3R1QA 4QMPA 3MB6A 4XS2A 1PRYA 2FH9A 4IAYA 4XHKB 3AC1A 4R1YA 3TV6A 4L44A 3DKGA 4FYOA 5E8UA 3A99A 2IVUA 3D0EA 4FOCA 3T9TA 1SYKA 5M44A 5LXMA 4O7SA 4IDVA 4KB8A 4H3PA 3SGCA 5C4LA 3BPRA 3H0ZA 4EORA 3CTHA 1UNLA 4GW8A 3V5QA 4PMSA 2CNUA 4E6CA 3OZ6A 4AQCA 4F7NA 3DJ6A 4IHPA 1YWNA 1K2PA 2UVZA 3QYWA 4JAIA 4L68A 4R3PA 4IX5A 5EM5A 4ZTLA 3BIZA 4BHZA 1SVEA 2CCIA 3OWKA 4TZRA 2VWUA 2UZBA 4RJ4A 1MQBA 3EMGA 3G9LX 4WRSA 3PXQA 5C03A 5D11A 4ZTRA 4D0WA 2B53A 5HCZA 5KCVA 4R3RA 3W2RA 3OT8A 4O6LA 2X9FA 4AA5A 4XRLA 5A4TA 1S9JA 4C7TA 2VWZA 2OJIA 3QX4A 1WBOA 4UBAA 3V6RA 3D94A 5E1EA 5CEMA 5CEPA 3HKOA 1FPUA 5AX3A 4MWIA 5CVFA 1YXVA 4HVDA 4F7SA 1WMKA 2G2FA 1G8AA 2XB7A 1M2QA 2YAKA 3QQJA 4E5WA 2ETKA 3GQIA 4FIHA 5IH6A 2C47A 5CEQA 1MRVA 5CSHA 4NUSA 3NYVA 3EQBA 3OWJA 4O86A 3Q6WA 4CT1A 3EYGA 3IW8A 4B4LA 4F1OA 1NA7A 1QPJA 3GEQA 2QR7A 4GFOA 3OF0A 4XV1A 1WAKA 4N57A 3LHJA 4QMTA 5CU6A 5GJFA 3U87A 3PE2A 3HVCA 4DCEA 2R7BA 4WG5A 5F20A 3KMUA 4NM5A 4M14A 1OL7A 5DR6A 5AP0A 3PSBA 3E7OA 2X4ZA 3O7LD 3SLSA 4I6FA 1RDQE 1WBSA 4D55A 3RALA 2VTHA 3R8MA 4DEBA 4JDIA 3HRBA 4YURA 3MFRA 4L45A 3EFLA 2IVVA 5EQYA 4UX9A 4TYGA 1XBBA 2UZTA 3R8ZA 2BALA 3DBQA 3IO7A 3IW4A 5CU2A 4WRGA 2C4GA 2VWYA 1ZARA 3NRMA 4JDJA 5C1QB 1PYEA 4QMUA 4N4SA 1SNXA 2ITVA 4FTQA 1PMUA 3OW4A 4J52A 4WBOA 4A07A 1U46A 2W1EA 5ETAA 3KKVA 1B38A 5I0BA 3BV2A 2XF0A 4RVLA 3MY0A 5FXQA 4A9TA 4E6AA 3LJ0A 4OBPA 3QYZA 3E8CA 3VBWA 4BIEA 3CLYA 4BHNA 5A4EA 4R5SA 2IW6A 3V8SA 4CNHA 4QTCA 3I60A 3KRWA 4DHFA 3OFMA 4TXCA 5HVKA 1OBGA 2OJGA 3C50A 3M11A 2OK1A 5AIRA 4XG4A 5IQEA 3NUUA 1JOWB 5FM3A 4EHVA 3LXKA 4AF3A 4HYUA 4MNEA 1UU8A 4E6QA 2FYSA 5B0XA 4CV9A 3BZ3A 3Q9XA 4RJ8A 4ZS0A 3A60A 3DZOA 4CQEA 4FIFA 4DLJA 3DCVA 4I94A 3KK8A 4FKPA 4R1VA 3W55A 2XK3A 2VZ6A 2OZAA 2PSQA 3C4EA 3H10A 3FDNA 4L46A 4V0GB 4X7QA 4YR8A 3OXTA 4KWPA 2UW9A 4OTDA 4Y46A 4GIIA 2X2LA 3ROYA 4A9SA 5M4UA 3CS9A 2GNIA 4BCIA 4JXFA 2BRHA 5TO8A 3ZRKA 5CEOA 5HNGA 2HWPA 5EYDA 4BBEA 4J99A 3TT0A 4Y83A 2ITUA 2QO7A 2IW9A 3DJ5A 3R8PA 3DBCA 1OPKA 3QRJA 4XEYA 3HV6A 3CBLA 4LUEA 2GNGA 4ITHA 2XCHA 5CU0A 4FV8A 4XLIA 4CG9A 2YEXA 3C4ZA 3Q9WA 1A06A 4PMTA 2W99B 3O2MA 3QQHA 2ITNA 3I7BA 3PWDA 4BCQA 4B7TA 3W0SA 4AZFA 1E1VA 5CQWA 2HY81 4NT4A 4C4GA 3UOHA 3VS6A 5AMNA 1W7HA 4LL5A 1S9IA 4GYIA 4BCPA 4CCBA 5DA3A 5JFWA 4DEIA 5HIEA 2PHKA 1HCLA 2C6OA 2KULA 5D9HA 1Q61A 4JX7A 5HBEA 5HE3A 4P4CA 3RTPA 2WIHA 3UZPA 2VWBA 3Q3BA 3ZM9A 3KN6A 4MVFA 1W84A 3AMBA 2YACA 3QUEA 3FJQE 2BZHB 2XEYA 4YJNA 4TW9A 5CYIA 5AV3A 4IIRA 3R7EA 4EK8A 2R3MA 2WMRA 2W06A 4FKOA 4O0XA 2P55A 4USDA 4BTJA 5E8XA 4XCUA 5TF9A 3OC1A 3OOGA 5BVNA 4CZTA 1MQ4A 5EHYA 4F1TA 2WTVA 4TYJA 2VO7A 4ZEGA 1ZMUA 5HLNA 4RJ7A 1J7UA 2EU9A 3NDMA 3FLQA 4ANSA 4O21A 2WOUA 3FZOA 2B9HA 4PL5A 5EHOA 2C6DA 3ZFXA 2OO8X 4G5JA 5ACBC 2P2IA 4G6LA 3VHEA 2RL5A 3UNJA 3EQDA 2ITZA 4UZDA 3VS4A 3R9HA 1O9UA 4FICA 3RJCA 4C3RA 5IUHA 3EWHA 1MP8A 4QMVA 4XYFA 1R1WA 4IAIA 1STCE 2OFVA 5H8EA 4F9BA 3K3IA 3NSZA 3E92A 3MW1A 5E7RA 4HCUA 2YDJA 2BRGA 3KRJA 4RA5A 3FMEA 4QQCA 2WTKB 4YGAA 4FKQA 5ANJA 4IDTA 5AP6A 2JIVA 5KZ0A 4WUAA 2PVRA 5HBHA 3HMPA 1H25A 1PXLA 3EL7A 3HRFA 4LG4A 5EDQA 4YP8A 3RCJA 3VW6A 4G6OA 1OITA 1U54B 5A54A 5IQCA 2ERZE 3FEGA 4L52A 2C30A 3AGMA 4F0IA 1FBNA 4KIOA 2R3OA 1OIYA 3WZKA 3SXSA 2QVSE 3EZRA 2OF2A 4PTEA 3V3VA 3E8DA 5EQPA 3RPVA 3GNIB 4ANBA 4EOKA 3LFBA 4FV5A 3LJ1A 3R73A 3MH0A 1GZ8A 3WBLA 3FMKA 5BVFA 2W1GA 5EYKA 4DFZE 4YU2A 1JSUA 5IA1A 4P5QA 4V01A 3GCUA 3OOMA 5AV1A 4DFUA 4BB4A 4G2FA 4WUNA 2YWVA 2Q0BA 1JVPP 2W1ZA 4MX9A 2PY3A 2YISA 4YJOA 3ZM4A 3AC4A 4HCTA 2RG5A 3G0FA 1PXJA 1JKKA 1OI9A 4NKAA 3S95A 3EFWA 4HYHA 4KKGA 2W9FB 1U4DA 3Q2JA 5EG3A 2QLUA 3VBXA 2RF9A 3KF4A 5M4FA 3A8WA 4ZJVA 2B9JA 3KXNA 2ITQA 4A9RA 4O22A 5I9UA 4FZAB 1P4FA 5IQGA 1Z5MA 4IWDA 3OBJA 4I0TA 1RJBA 3DBFA 3LVPA 5AP5A 4FV7A 2IZUA 4C3PA 5M09A 4YHJA 4BC6A 3FBVA 4XH6A 3WZEA 4CFXA 4K6ZA 4ZZMA 5DT3A 1H0WA 4S34A 2CNQA 3FL5A 4FTIA 3KULB 2C6EA 4R7HA 2UUEA 4QOXA 1KV2A 1OKWA 2J50A 2QODA 2YJSA 4H1JA 4YHFA 5HLWA 3U6HA 3D7TA 3I1AA 3L1SA 2PMNX 4B6LA 3NLBA 3RI1A 4BYJA 1FVRA 2OI4X 4EBWA 5AADA 1JKTA 4GG7A 4O7RA 4FEXA 4WSYA 4FG9A 4FNXA 2JGZA 4FTMA 4UZHA 3RK7A 2OIQA 1IAJA 5CX9A 5BVDA 1M14A 2E9OA 2R5TA 2HYYA 3QTIA 3NCGA 4XV2A 5EOLA 3H3CA 2AC3A 2IG7A 2OXYA 4EOQA 3GI3A 4F9WA 3HV7A 3ULIA 3U4UA 3I5NA 4YZMA 3DFCB 3RM7A 1J7IA 3WZDA 4D9UA 3W0MA 5M53A 1YDRE 2BAQA 3DXNA 3FI2A 3DLSA 3FXWA 3PY3A 3R7IA 1IEPA 4XP0A 4GK4A 4S33A 1CKIA 4GEOA 4O0SA 2O63A 3DAKA 3KQ7A 2PZYA 4AGDA 3OWPA 5CVHA 4Z3VA 2PUUA 2X81A 4RIWB 5C27A 5LCJA 1OL6A 3LM5A 5HTBA 3EN4A 3R9OA 4BICA 5M57A 4PNIA 4ORKA 4KIPA 3I6WA 4YZCA 3W16A 5ICPA 1YI6A 1OB3A 1GIHA 1FMKA 3ET7A 2WMTA 1YXTA 3HA8A 4O7WA 5DEYA 4FZFB 4QYEA 2XKEA 3NAYA 4G17A 1PXKA 3HDMA 3NEWA 3QKMA 4R7BA 5DH3A 5FQDC 5FTQA 4IC7A 4GL9A 3OWLA 4GUBA 4V0GA 4XBUA 4JJRA 3ALOA 3LPBA 2WTDA 4J98A 2YIXA 4MKCA 4TWCA 3ZBFA 3ZTXA 4DFLA 3HUBA 4H1MA 5KE0A 4EL9A 1OZ1A 2R3FA 1P2AA 4AE9A 4FIGA 3LMHA 3RINA 4RIYA 2ZM4A 2XBJA 1P4OA 3DFAA 4NYEA 4RBLA 4TNDA 5CENA 3JUHA 2W9ZB 2WXVA 2YM8A 3NCZA 4OBOA 5IUIA 1H1SA 5AJQA 1PY5A 2YCSA 1BI7A 2ITOA 5A4CA 4FKGA 3BBWA 3CD8A 3ROCA 3QQUA 3N4VA 4U79A 2PULA 4ONAA 4NM7A 3ZUUA 5JGBA 2OZOA 2G15A 4CLIA 3OY3A 4ZTQA 3HMOA 3Q6UA 3F6XA 4YC6A 3EN7A 4JBVA 4ZIMA 3DBDA 3P1AA 3TM0A 4BDFA 3JVRA 1LR4A 3ZHPC 3IK3A 1K9AA 2JDVA 4R6VA 2WQOA 3AMYA 2XS0A 3IW5A 5B7VA 2JAVA 2CGWA 3U8WA 4EZ5A 4EK4A 5I4NA 3KEXA 2ZAZA 2J7TA 3ORNA 4QP2A 3WF5A 3ZH8A 4FSMA 2Y7JA 2Z2WA 4FSNA 4G3CA 4QMMA 4CVAA 2WQNA 4IAFA 4QO9A 3ZXZA 4KKEA 4IWQA 4PDYA 2OIBA 1IA9A 3C0IA 3CY3A 2GMXA 1ZYDA 3K2LA 3ZSHA 3UC4A 3RWPA 2VO0A 4G16A 5DWRA 3ORLA 3IDBA 1M17A 2WIPA 5DOSA 4NKSA 2FGIA 2PMOX 4YO4A 4IBMA 4MYGA 4AT5A 3U55A 4KKHA 1M7QA 5I9ZA 1PXPA 5G6VA 3BRBA 2W4KA 3OCTA 4ACDA 5CZIA 4YJSA 3VS3A 4JRVA 4JBPA 5LCKA 2JDTA 4F7JA 3F2AA 4CFNA 3E3BX 4DFXE 3QRTA 5AP7A 3RVGA 4ZLOA 3NVKI 2BHHA 4FZDB 4GG5A 5FDPA 1QL6A 4I5MA 2QO9A 5HU9A 2W4JA 3LZBA 2CSNA 5IQFA 5CEKA 4CCUA 4ASZA 3LOKA 4FEQA 4DEHA 4JG6A 4EJ7A 3R28A 5EH0A 5IH5A 2VAGA 5D7VA 5ANKA 1BKXA 3UODA 4XG9A 5AP1A 4D9TA 3VJNA 4O7YA 3S0OA 2XM8A 3TNHA 4BDDA 1U54A 4PNKA 3W2PA 1O6KA 1Q3WA 4FT9A 5FLFA 3R7VA 1WBNA 5EW3A 2YFXA 5BYLA 2UV2A 2JKOA 4GU9A 4TNBA 2W17A 4F0FA 1GIJA 3FPMA 2BZKB 1YVJA 4IZYA 5CU3A 2PVKA 4MXCA 3DDQA 4J53A 4QRCA 1L3RE 2QLQA 3KK9A 1WBWA 2NRYA 2WB8A 3KGAA 5HO8A 4O2ZA 3C5UA 3LFSA 2OJFE 3PDTA 4QTDA 2YERA 4X3FC 1MRYA 4YJUA 4AUAA 3MJ1A 3TKIA 5E1SA 3EN5A 1NVSA 4C36A 4JQ7A 2CDZA 4K1BA 4UXLA 5FEDA 3DK3A 5LVMA 4RSSA 1Z57A 4H36A 4YPSA 3L9MA 5DGZA 3DS6A 4M67A 4DGNA 5LMKC 3Q53A 2FSMX 3OCBA 1TQIA 5CU4A 2HZ4A 3R0TA 2C5OA 3K3JA 1CKPA 2ZDUA 3O7LB 1OECA 4HGEA 3VUGA 4RVTA 4R77A 3ZMMA 2P3GX 3CPCA 5KMLA 3ZDIA 3DJ7A 4L8MA 2YAAA 3POOA 5L2WA 2GS7A 3BU3A 3HECA 4DLIA 1BUHA 5FG8A 4O7TA 5F9EA 3B2WA 1ZLTA 2NPQA 3R8LA 4Z16A 3H9RA 3SV0A 5JZJA 2CGXA 4BI2A 2ITXA 3ID6C 1YDTE 1M2RA 4L7FA 3VAPA 2RKUA 2O0UA 3RAWA 1YKRA 2BTSA 3DDPA 4AA0A 2CN5A 3QRUA 3E7VA 5AA9A 5B2LA 5TOZA 3F5UA 3FXZA 1MUOA 2VGPA 4G3GA 4IJ9A 2QD9A 3IS5A 4FTCA 2ZB1A 4E7WA 4ID7A 1Q8WA 2HK5A 3Q4UA 5KHWA 1H08A 5FXSA 3W18A 3BGZA 5HLPA 3HMNA 4BCMA 4BF2A 2JEDA 5GIPE 2QQ7A 4FNZA 2WMQA 4J97A 4F09A 3AC5A 5DFPA 4DAWA 3NIEA 4XV9A 3ZDUA 1I09A 5KKRC 2FSLX 4PRJA 3VF8A 5JMSA 1SVHA 1Y91A 3MIYA 5HQ0A 3ZRLA 4MBJA 4G34A 3PG1A 4X3FA 5E8VA 4F63A 3PXFA 3UG1A 4IX4A 4RFYA 5JEBA 4PL3A 2J0KA 4HVSA 4Y95A 4ZTNA 2PVNA 4U98A 3LFDA 3QZFA 4H3BA 2QKWB 3GB2A 4IAKA 3ZBXA 3MB7A 3GC8A 4FTKA 5C01A 3PIZA 5IU2A 4O7ZA 3F3UA 1GZNA 3ENMA 1RE8A 3Q96A 2V7AA 3F7ZA 2R2PA 4HNIA 2PZRA 4OTFA 1YXXA 4TRLA 5CLPA 4CKIA 3RZBA 4F99A 4XP2A 4QMXA 2A2AA 2UZLA 2JAMA 2R3QA 2VWWA 2WMSA 4YNEA 4FC0A 3DGKA 3NUYA 1BMKA 4QTBA 3FV8A 3G33A 4Z9LA 5A4LA 3EZVA 2X8DA 3QZHA 1Q41A 3NPCA 4UV0A 2V7OA 3R8VA 3N9XA 3K5VA 3UO6A 5L2TA 2UW0A 5CALA 4I5HA 4FT7A 2ZV9A 1XH8A 4DITA 4KSQA 3R9DA 3CEKA 4K33A 4BBFA 1RW8A 3C4FA 3LIJA 2XNGA 4XMOA 4G5PA 4XJ0A 2IVSA 4E73A 2UW6A 4U9AA 3ELJA 2GQSA 3IOPA 3RMFA 4AU8A 3R04A 4Y73A 1PW2A 2ZV7A 3JS2A 1TKIA 3PZHA 4TWPA 1V0PA 3QRIA 3TYKA 3DXPA 1J91A 2GFSA 1ZYJA 2PVHA 4ZJJA 2XA4A 4CTCA 4EKLA 3FSFA 4J96A 4AE6A 2PUPA 1REKA 2C1BA 2ITYA 4JBQA 3V8TA 4C4JA 2X7FA 4CLJA 3F88A 2Y6MA 1NW1A 4FV1A 2R0IA 5E90A 3TV7A 1AD5A 3HDNA 3DY7A 3EQHA 4FSQA 4NCTA 3MPMA 3DTWA 4M3QA 3Q9ZA 1Y8YA 4N0SA 4GS6A 2WNTA 4FT5A 4YJQA 2V5QA 3AOXA 4IJPA 2VTLA 3ZO2A 4ZSAA 3UPZA 3N4UA 4QMWA 4UY9A 2BDWA 3BX5A 2XNPA 4JS8A 5IF1A 3ZXTA 2WMWA 4DGOA 2RG6A 4GJ3A 4PMMA 3PXYA 5CZHA 3OBGA 4U3ZA 4C33A 4RJ6A 3FC2A 3KC3A 4C0TA 3S00A 5CSXA 2XKDA 5F1ZA 2BROA 4LOQA 3GXLA 4FKVA 4X6QC 3MH3A 4ANMA 5KMNA 3HP5A 3ZUVA 2O5KA 3DV3A 2CKOA 4I20A 5H8BA 3EQGA 3QC9A 3VBQA 4EZ7A 2LGCA 2WTJA 5HICA 4IB0A 4RVKA 4EJNA 2R7IA 4I6HA 4NSTA 3TV4A 3CJGA 3C0HA 3IQ7A 4FEVA 4RJ3A 2WHBA 2ESMA 2PTKA 4I21A 4NIFB 4BTFA 1KE9A 3OS3A 2QOCA 2X9EA 5LARA 1CDKA 5CSPA 3R7UA 3UMWA 3QCYA 4FIIA 3BE9A 4LMNA 4FUYA 2FA2A 1TVOA 4ZSLA 3QD2B 3R02A 4BGGA 3MJ2A 3PLAE 4NW6A 1M52A 3FLNC 4BI1A 5LMBA 1DM2A 5HVJA 3NZ0A 4IM0A 4XG3A 2UZEA 3OMVA 4YO6A 3WI6A 4O82A 3TI1A 1YW2A 4KUJA 4FEUA 1APME 3UTOA 3TKUA 4C37A 3WYYA 5LQFA 2YCRA 3E8NA 3ATTA 3I79A 3H4JA 3OEFX 1PXMA 3QZGA 4FNWA 4C3FA 4WZYA 2R3GA 2VTTA 3KXMA 3ZCLA 3AD5A 4F0GA 5ETFA 1ZYSA 5J95A 4U5JA 5DI1A 1T46A 3GC0A 2ITTA 4FV4A 4YJPA 3EQFA 3NNXA 3UMXA 3W10A 4NM0A 4TYHB 4EC8A 3UZRA 4JX3A 3UP2A 4JQEA 2Y9QA 3ANQA 5J9YA 3KCKA 4X6RA 2E2BA 2CLQA 2CMWA 4M15A 1MRUA 1G3NA 3PXZA 4DGMA 3QCSA 1H01A 1SNUA 4IAAA 3CGOA 4OT6A 3DAJA 1OUYA 4FTAA 1IAHA 4FG7A 3ZZEA 1EH4A 2GS6A 4GT4A 1PHKA 3DU8A 3IGOA 3NYNA 1DAWA 1H1RA 4JIKA 5HEZA 3TACA 3ZSIA 2ACXA 3CPBA 3CJFA 3DAEA 5FBOA 3D2KA 4DA5A 3EJ1A 3G90X 4D5HA 3FLSA 4FKIA 5GJGA 1YHWA 2XIKA 2Y4IB 4MXZA 4D4VA 5BPYA 1AGWA 3CP9A 2F7ZE 4RLLA 2XBAA 2OICA 3KN5A 5J9LA 4OLIA 4O0UA 1JSTA 5HCXA 5IDPA 2CN8A 3MYGA 2A19B 4EH9A 3C51A 2XK9A 3AD4A 1YDSE 2BMCA 1F3MC 3COKA 2GNJA 4L00A 3SW7A 2X6DA 4HJOA 4M84A 3GU5A 3FQEA 3ZC6A 3DA6A 4K8AA 4OGRA 4QP7A 4AW5A 2REIA 3PJ2A 3W32A 3PJCA 2QOLA 5KMKA 4BN1A 3E88A 2WMUA 3QGYA 4AZSA 4L3PA 3ZOSA 5LVPA 4FV3A 4NH1A 3HP2A 3MS9A 4FTNA 4K77A 4AOIA 4MF1A 2Z02A 2A1AB 5DT0A 3TZ9A 3SXFA 3R1SA 4ZZNA 3O23A 2F2CB 4NFNA 3PPZA 5DT4A 3AG9A 5HU3A 1OUKA 3U9NA 4DINA 1UWJA 2BZIB 3R7OA 2C3KA 3O51A 4DGLC 4GU6A 3PJ3A 5HG9A 2C0TA 1YXUA 2HW7A 4YMJA 2VTPA 3QALE 1GOLA 2G1TA 3BGQA 4B9DA 2GCDA 3P23A 3MFSA 4OTRA 4YTHA 2HAKA 3OCSA 3ZS5A 5A6NA 3BYVA 3ZLYA 2Z7RA 5FD2A 4KS8A 4GMYA 4O84A 3RPOA 4GVJA 4FTRA 3ENHA 1A9UA 4BI0A 3RK9A 4KRCA 4DG2E 2ZMDA 3V8WA 2GSFA 2R9SA 2BUJA 4F9YA 1OGUA 5HD4A 5M07A 2O65A 4YSJA 5EYMA 4F7LA 5BYYA 4QPSA 4APCA 4QQ5A 3IDPA 5AV2A 3SG8A 2C6KA 2GNLA 3BV3A 2QOOA 3DTCA 5AUWA 4FL2A 1IASA 3KU2A 3QUDA 4JQ8A 5CAUA 2W5BA 3TNIA 1OIQA 2QI8A 3VNTA 4EOPA 1ZY4A 1H4LA 3Q52A 4JVGA 4M68A 4FT3A 2UVXA 3LXNA 1Q8ZA 4IWOA 4WNMA 1IRKA 1KOBA 2OGVA 2YJRA 3FQSA 1T45A 2IZRA 2BFXA 3VO3A 2XRUA 4HZSA 2ZV8A 3DBEA 5G1XA 4GV1A 2WTCA 3GT8A 2WO6A 3QTXA 4CMUA 4EQUA 3AT3A 2OH0E 2QKRA 3DLZA 5DLSA 5EI8A 4AWIA 2UZOA 3UNZA 2B9IA 3QHWA 4GIHA 2IN6A 1U5RA 1NVQA 3LJ2A 1WFCA 4ZY6A 4UXQA 3ZU7A 2JKQA 2KTYA 4MD8E 5JFSA 3QF9A 3C4WA 3TZ8A 5B2MA 4ZZOA 1CTPE 2H8HA 4CFVA 3TZ7A 3VS5A 2J0IA 4EEVA 2O3PA 4L7SA 1OVEA 3V5TA 3ORPA 2OJJA 4EOMA 4EOSA 4HYSA 3A8XA 4O96A 4EH8A 2ZM1A 5IQDA 2OWBA 3NNWA 4RWIA 4NWMA 4RRVA 5CAVA 3PLSA 4AX8A 4QMSA 4IVBA 1PMNA 3FE3A 4FGBA 4IAZA 2YZLA 4M7IA 4XNEA 5FM2A 2BILB 1Q8TA 4GT5A 5HCYA 2BKZA 3ODZX 4AT3A 3G5DA 4E8AA 3WZJA 4UEUA 5E8TA 5DPVA 4W4YA 2XIYA 3GFWA 3H30A 3VBTA 3QTZA 4KBKA 4ZY5A 4U8ZA 4HGTA 2C5YA 5HVYA 5ANEA 4K2RA 5GJDA 4JDKA 5E92A 2QOHA 2PE1A 4W4VA 5J8IA 5L8JA 3SKCA 3QQGA 2XNOA 4IH8A 1F5QA 4CGAA 4QMZA 4WHZA 5HBJA 5FDXA 2GHLA 3NWWA 4KBCA 5KBQA 5IQAA 3MH2A 2GNHA 5EDRA 2PVYA 3B8RA 3UE4A 4I5PA 1Q8YA 1OIRA 3DNDA 3PA5A 4TWNA 5BMMA 2JIUA 3SAYA 1P5EA 4ANLA 4JNWA 3V5JA 5IUGA 2R64A 1VYWA 3DT1A 3GC7A 2J6MA 4EYJA 3UQGA 4OR5A 4PUZA 5DR9A 2DUVA 5L2SA 1JPAA 2XJ1A 4J8NA 5EI2A 4DEGA 2X4FA 1J1BA 4TTHB 4WG3A 5LVLA 2HOGA 2JKKA 1M2PA 2AC5A 3RPYA 4BYIA 5HNIX 3II5A 4PDOA 4FV0A 2P2HA 5E9EA 5B2KA 5AV4A 2VN9A 4FT0A 4I23A 3MH1A 4ZSEA 4MXAA 2YM6A 5HG5A 4Y85A 3HGKA 3VUIA 4RFMA 4MQ1A 2VX1A 2WTWA 4ACGA 4U6RA 3AXWA 4JR3A 2NO3A 2VX3A 3PTGA 4YJRA 4NFMA 3T9IA 3S4QA 3UPXA 2VTJA 2I7QA 3F3WA 4BCNA 1R3CA 3OHTA 4L43A 3IG7A 3LFQA 2W1HA 4M97A 1GIIA 3PRFA 5CF5A 3MFTA 5CTPA 5JGAA 3Q4ZA 4UWYA 4TYEA 4EOJA 3FMNA 2ITWA 3QTUA 4HYIA 3UIMA 2OFUA 4S32A 5IA4A 4LRMA 3F61A 2B9FA 4FK3A 4DC2A 2YIRA 5J9ZA 3U6IA 2PL0A 3QTQA 3M2WA 2UW4A 3G2FA 3O17A 4IB5A 3ACKA 1Y8GA 2X8EA 1CSNA 4IVCA 4KS7A 3Q5IA 1Q97A 2R3RA 2X2KA 2PZPA 4FKJA 3L8SA 4HPTE 2XCKA 2WTIA 4EH4A 1GAGA 5D10A 3UIUA 3D9VA 4O0VA 4FA2A 3NUSA 3E3PA 4BZNA 5CXHA 3BHTA 4QTEA 2YM4A 3OXIA 3OUNB 4IQ6A 5AFVA 3UGCA 5CAQA 3RP9A 2OJ9A 2O64A 4Z7HA 3AGLA 4Q2AA 2YIWA 3SQQA 5DHJA 2C3JA 4ERWA 5DG5A 4WNPA 4FGRA 1PMEA 2R3LA 2YITA 4EHGA 2A4LA 4BDKA 2ZOQA 4YTFA 2I0HA 2H34A 4FOBA 1U59A 3UC3A 1Q5KA 4H58A 4XG2A 4A4XA 4CFFA 3L8VA 4QYYA 4L3LA 4YZ9A 2ZM3A 2WELA 4AW1A 4IM2A 3GOPA 3TNPC 4UYAA 3DPKA 4RIOA 2ZJWA 4FSRA 3UBDA 2PK9A 2G01A 4ARKA 5AUYA 3G51A 3FC1X 4QNYA 4QQJA 3SDJA 3U54A 3W0PA 3UIBA 1YOJA 4B8LA 4UALA 2O2UA 3RK5A 1H1QA 3FAAA 3CKXA 3FI8A 3SRVB 4RIXB 3LMGA 2GDOA 4CXAA 3P79A 1Y6BA 4IWPA 1U5QA 3ZC5A 5AAFA 4D28A 4AZEA 2HCKA 3QU0A 4FSYA 4HNFA 3K54A 5EM6A 4C38A 1TQMA 4NZWB 4BDHA 1I44A 1IR3A 5D1JA 4FG8A 3P7BA 4M8TA 4EK6A 3PPKA 4UWCA 4EWHA 4KAOA 4BDEA 3GOKA 2WTKC 4X0MA 3VRZA 2VTRA 3AQVA 4AP7A 4GUEA 2VTQA 3I5ZA 4WT6A 2QO2A 3RPSA 4D0XA 2G2HA 4QP3A 1NXKA 3TNQB 3PYYA 1SZMA 3RCDA 2BHEA 5KO1A 4CKJA 1UNHA 3JXWA 3R1NA 3BELA 4O38A 5CF4A 5F94A 3A7JA 2QNJA 3MV5A 3C4CA 3KMMA 3OD6X 5H3QA 4F08A 3EHAA 1AQ1A 2P33A 3I4BA 4CZUA 4F64A 3PVUA 1PXOA 4HVIA 1ZMVA 3GQLA 2JKMA 3EQCA 4GYGA 2HIWA 3VVHA 4HVHA 4A9YA 4FTUA 4E1ZA 2EUFB 1P14A 1XWSA 2IPXA 5CF6A 4DEDA 2BRNA 4YBKA 3K5UA 2QU5A 3AC2A 3W0NA 5EHLA 3F7WA 4O2PA 3DB8A 5FTOA 2YHVA 4C62A 3QD4A 5E91A 2BDFA 1DAYA 4FUXA 2JBOA 5JZNA 1YOLA 2WU7A 3KB7A 5KKRB 3QZIA 3QTSA 4U97A 5BVOA 3E64A 3V04A 4ITJA 3V5LA 4ZY4A 5D7AA 3QWKA 3N4TA 4JIAA 5JK3A 2ERKA 2VNWA 4EWQA 5IQIA 1RQQA 2B7AA 3ACJA 3KXXA 3UYSA 4U81A 4AA4A 5AP2A 5EOBA 5I9VA 4V05A 5FEEA 1QPEA 3H9OA 4KIQA 5IA0A 2YM7A 2RIOA 3R71A 4IZ5A 1Q4LA 4UYNA 3ZYAA 4CRSA 4PDPA 3VN9A 4BDGA 1LUFA 4QTAA 3IOKA 1Y6AA 3QWJA 5DR2A 5ACKA 1BL6A 3P7CA 3ZUTA 3FSKA 4DH1A 2H6DA 2YDKA 4RPVA 5I9XA 1KSWA 4DFNA 4J71A 4U3YA 1ERKA 4AGUA 4BGHA 3G15A 3LCTA 3C1XA 4S30A 2P4IA 2R3JA 3EN6A 3A7IA 4M13A 5HTCA 3WIKA 3EB0A 3Q4CA 3SXRA 2Z7LA 4GSBA 4DYMA 4A4OA 4RVMA 5C9CA 4FTLA 3QGWA 3OCGA 2C1AA 4RZVA 1SVGA 1YQJA 3RKBA 2UZVA 5E8SA 3F5XA 2CJMA 3VJOA 3RHKA 4BCJA 5K5XA 3R9RA 2FUMA 4G6NA 4W4XA 4FBXA 4I41A 5AUUA 2B0QA 3B2TA 4MBIA 3O0GA 3RAHA 3U6JA 2CCHA 1Q3DA 5AX9A 3HEGA 4I93A 4N70A 3F69A 4F70A 2OBJA 4YUQA 5CT7A 4ZMFA 3E5AA 3DQXA 2Z8CA 4BCOA 3VS1A 2IJMA 4FK6A 3F2RA 4C4FA 4X2NA 4MEDA 4E5AX 3GU4A 2R3KA 3EQPA 3LCOA 4S2ZA 3NW7A 3W2SA 4C2VA 4NU1A 4NK9A 4RC3A 3UDBA 4D4RA 3QTRA 3LLAA 3MESA 4FSZA 3QLGA 3CTQA 4LV5A 3IPHA 4OT5A 2Q0NA 3UO5A 1FVVA 3F3ZA 5C8NA 4L67A 3IW7A 1IG1A 3HV5A 1PF8A 3ORIA 4IX6A 5IA2A 4AZVA 5IA3A 2VO6A 2ZVAA 4Z7GA 5KHXA 1URCA 3IECA 2CLXA 2RFEA 4K0YA 2WD1A 1W82A 3OROA 3P78A 4I5CA 4DE4A 5T3QA 3V01A 4JLCA 3KA0A 4A06A 2HENA 2ZYBA 1OKVA 4JAJA 5H2UA 5EKOA 4HVGA 4DBNA 3MY1A 3KRLA 3PSDA 3VS2A 2BFYA 2CNVA 3KULA 2XNEA 3MVMA 3FWQA 4FL3A 2UVYA 2GS2A 1H8FA 4GFMA 4UWBA 3CC6A 3D2IA 1OIUA 3FMMA 4FTJA 5DNRA 4KD1A 3GU7A 3WYXA 3TDVA 3QA8A 4HOKA 4RWLA 5D12A 4ASEA 5KMIA 4BTMA 1YRPA 2R3PA 4JRNA 4G3DA 3EL8A 3PVGA 5A46A 4QMQA 3UVQA 2F7XE 4JBOA 2PZIA 3L9LA 2UW7A 1OKYA 5E8WA 3OTUA 4XRJA 4F9AA 4Q9ZA 4FZ6A 4WOVA 1E9HA 3FZ1A 3EOCA 3KXGA 3L9PA 4Y72A 3BEAA 3EFJA 2HW6A 4X2KA 3WOWA 3JYAA 4MCVA 1ND4A 3E93A 4NCTC 4FZ7A 3NUPA 5CWZA 3KVXA 2WGJA 4I1ZA 1V0BA 2PE0A 1FINA 4RC4A 1QMZA 4E93A 5DBXA 4KNBA 2ZV2A 3PY0A 5BUIA 4ALWA 2C6IA 3A4OX 2YCFA 4ZK5A 4ALVA 5ANIA 4HPUE 3TUCA 4DCAA 3ODYX 3BEGA 3IW6A 2A0CX 3HZTA 4RIWA 2CHLA 4FTOA 4ITIA 1VEBA 3GC9A 5IH4A 2Q83A 3O71A 3O8TA 1JQHA 5CNNA 5CNOA 3RWQA 4MNEB 1UU3A 3LQ8A 1H1PA 2W5AA 3GUBA 3VF9A 1XH5A 1OL1A 1VYZA 1YI3A 4FVQA 1ZZ2A 4O27B 3REPA 1GZOA 2C68A 1GJOA 3HX4A 3R2BA 5AAGA 2YM3A 4RQKA 2XK4A 3KRRA 3TUBA 2PVJA 2GQRA 1OM1A 3A7FA 3ZZWA 3VUDA 2ETMA 2OZAB 4IVAA 4KABA 4TYIA 3FMLA 3ZFYA 5BUEA 4RJ5A 1YHSA 3TKHA 4CFUA 4D1ZA 4EK3A 5CF8A 3OVVA 5J7HA 2F2UA 3C13A 4K9YA 3SX9A 5IQHA 3QHRA 4USFA 2XK6A 4MBLA 4BBMA 5AEPA 4LGGA 4B0GA 4IFCA 3GFEA 5L3AA 1PMVA 4BTKA 3DKOA 3KRXA 2QC6A 1JLUE 5J87A 5FRIA 3QA0A 2YDIA 3W2QA 4PMPA 5CSVA 3OEZA 2JBPA 4RQVA 1WVYA 4WD5A 1VZOA 4ZJIA 3EQRA 3AT2A 4WNOA 5AM7A 2V0DA 3ZONA 2YCQA 3POZA 4PDSA 5AIKA 3VUMA 3LFAA 4OBQA 4I92A 3N51A 3TXOA 2O8YA 4AN2A 5ETIA 3TZMA 4IB1A 3GCPA 4B8MA 1PYXA 3VIDA 3BWFA 2PZ5A 4GCJA 4E4XA 4E5BA 2BPMA 4NJ3A 5AUVA 5BVWA 3DNEA 3TUDA 3BWJA 3FUPA 2QHMA 2WU6A 3FMHA 3KF7A 4FSWA 2J2IB 4MK0A 4WA9A 5FBNC 4F6WA 4DH5A 5JT2A 5LJJA 2XH5A 3NAXA 4C61A 4BY9E 2YA9A 3MVJA 4Q9SA 3PVBA 4YLJA 4M0YA 2F4JA 3Q32A 4ZSJA 3DKFA 3RM6A 3GCSA 2JDSA 3ORZA 3CQEA 1O6LA 4XBRA 4BDBA 3ERKA 1BI8A 3SW4A 3W0RA 2VTSA 4AGWA 5HHWA 3GBZA 1CMKE 2FO0A 1PXIA 5HKMA 1BX6A 2X1NA 2XEZA 3JVSA 5JRSA 3MDYA 5C8KA 3AC8A 2B55A 4ZMEA 1XBCA 3MFUA 2GQGA 3IGGA 4G3EA 3F5PA 2J0JA 3QL8A 4L6QA 1XH4A 4N6YA 5KMJA 3RHXA 3ATSA 4FKSA 3BLHA 4AT4A 4BZOA 4JG8A 5L6PA 2CGUA 4EUTA 2CKEA 2V22A 1WBPA 2Z60A 3LE6A 4P5ZA 4C4IA 4F1MA 3BYOA 3ZFMA 5FXRA 3C4XA 3HAMA 2W4OA 4YSMA 3OG7A 4ACMA 5M56A 3PA4A 2XK8A 1JKLA
chains in the Genus database with same CATH superfamily
4EOLA 2YM5A 2WQMA 3C9WA 2I0YA 3L9NA 4PY1A 5EK7A 4OTQA 3COHA 3TWJA 3BBTB 2J0MB 4MNFA 1PKGA 4CFWA 5CAOA 5JSMA 2B1PA 4C34A 3VW8A 1WCCA 3OY1A 2FSTX 4AOTA 3O50A 4FVPA 4WO5A 2OW3A 4D1XA 4ASXA 5IEYA 4ZAUA 2C5VA 4E4LA 1BYGA 3P7AA 3R83A 5DRDA 1R39A 5HE2A 3COIA 4AW2A 4I3ZA 2OU7A 1W83A 5DE2A 4ZSGA 5E8YA 2FVDA 2EXCX 2UZDA 4BRXA 4BZDA 4QP9A 3UOJA 5J1VA 2HZIA 4YC3A 2DQ7X 4BDAA 4LV8A 4RMZA 3DK6A 3OP5A 4XV3A 3VHKA 4CSVA 4F4PA 3OXZA 2GTMA 3C0GA 2VTNA 5KNJA 5CI6A 3E62A 3BLAA 2ONLA 3MTLA 1KV1A 1X8BA 2HXQA 2WEIA 3TIYA 3PJ1A 2XJ2A 2JC6A 4RX7A 4EOOA 3BU5A 2W96B 5DIAA 4EBVA 1OPJA 5HIBA 4EH7A 3KXHA 4TWOA 4CV8A 2I6LA 4FE2A 2J0LA 3WE4A 2PVFA 5KMMA 2UZUE 3HNGA 3IKAA 5M08A 2F49A 4ACHA 4FKUA 3EH9A 3FI4A 3P08A 4YJVA 2UZNA 5J5SA 4TY1A 3G6GA 5EW9A 3MVLA 5AP4A 3HUCA 3HV3A 1JBPE 3ETAA 3VUHA 1KUTA 3GU8A 4O7PA 3NNVA 4MHAA 3SC1A 3LW0A 2JDOA 4UN0C 5KMOA 5EI6A 1H26A 3CD3A 3FHRA 3KMWA 5EW8A 3ORXA 3EKKA 2XVDA 3F3TA 3FI3A 4RC2A 2VO3A 3U9CA 4D1SA 1KOAA 2C3LA 1UNGA 3CE3A 5IEXA 3ZO1A 5HIDA 3EFKA 2BCJA 4M12A 2DS1A 4MXYA 2C5XA 4AZWA 4GFGA 4MD9E 3BHYA 2IZTA 3COMA 4LRJA 1BLXA 3A61A 3DOGA 3HL7A 3KY2A 5BYZA 4KA3A 3QQKA 1WVXA 1H1WA 1XKKA 4G31A 5T68A 3D7TB 3VULA 2VWIA 2UW8A 5AM6A 4AAAA 3DZQA 1G8SA 2FB8A 4AXAA 4RX9A 3FPQA 4WG4A 3IDCA 2BTRA 4BCFA 5IMXA 2BAKA 3W8LA 1IA8A 2WMVA 3O5AA 1H28A 2YABA 1ZWSA 4H05A 1GZKA 3EN9A 3MN3A 4KINA 4Y5HA 2X39A 5JN2A 3BLRA 2XIZA 2CKPA 2XJ0A 5BUJA 4BIBA 2A27A 3PVWA 3QTWA 1OGYA 2XYNA 3O8UA 2PVMA 4FYNA 4X21A 2XKFA 3BI6A 5DVRA 4U94A 2BRBA 4L01A 1URWA 5AAEA 3E87A 3NYOA 3WZUA 5LWNA 3ORTA 3ALNA 2QURA 5TR6A 4DTAA 2PVLA 2R3HA 1ZMWA 2UW3A 1WBVA 2VX0A 1NVRA 1UU9A 3ORMA 4LQMA 3JPVA 4TPTA 4AFJA 4ENYA 4DT8A 4C4HA 3S2PA 3UQCA 2X2MA 2OG8A 3Q2MA 1OKZA 4XOYA 1G5SA 1UKIA 3KCFA 3GENA 5FP6A 2I1MA 3CIKA 4BCGA 1YHVA 4BR3A 5CAPA 4MUQA 4OTIA 2Z7SA 4I6QA 2WMXA 2XIRA 2C0IA 4EUUA 5IZFA 3SOAA 3GCVA 2C6MA 4QYHA 3ZO4A 5ETCA 2B54A 1ZAOA 2DYLA 3HMMA 3NX8A 4LFIA 2Y8OA 5I9WA 2J9MA 5FGKA 5L8KA 2PYWA 5CS6A 1J1CA 3A62A 4FMQA 3GVUA 5C26A 2OIDA 4G1WA 4RIYB 2PMLX 2QU6A 3BHHA 5JQ5A 1JAMA 2I0VA 3AKKA 4V04A 3KXZA 2JFMA 3NNUA 3PRIA 3ZLXA 1JSVA 3LAUA 2PWLA 3LQ5A 4TT7A 4AS0A 2J4ZA 4AW0A 4CT2A 3E63A 5BMSA 3O8PA 4JOAA 4TN6A 4AXCA 2WFYA 4NTTA 2XAMA 5K5NA 1XO2B 3VQHA 4I4EA 5HE0A 4QP1A 3AMAA 3W0OA 1E1XA 3EQIA 2NP8A 5FUTA 4YLLA 5LMAA 4IANA 4CFMA 4FKRA 2WEVA 4U45A 3SVVA 4GK2A 5BVEA 2JIIA 5I5ZA 4YZDA 4YTIA 5HG8A 3WF6A 5IG1A 5M55A 3UDZA 4D2RA 4LOPA 3UJGA 2AUHA 3V5PA 2XIXA 3CGFA 3FXXA 4OW8A 4EHZA 3PA3A 4RG0A 3O96A 1XH7A 2ETRA 2PUNA 4ASDA 3HAVA 3I7CA 2UW5A 4DFYA 4ZP5A 4WNKA 5BQ0A 3F66A 3LFNA 4DEAA 4YZBA 5FEQA 4QMNA 2BKKA 2HZNA 3PY1A 2BVAA 4R78A 1ZYCA 3PFQA 2Z7QA 1OL5A 5LWMA 4X2JA 4EH6A 2F7EE 5A3XA 4LMUA 3WE8A 3QAME 3BYUA 5M4CA 1JNKA 2AYPA 3D15A 1UV5A 2SRCA 3IONA 1VLRA 2Y4IC 4K18A 3F9NA 3D5VA 3CQWA 4WKQA 2WOTA 3NW5A 5KZIA 2R3IA 3PXRA 4B99A 4I0SA 4OTWA 1V0OA 1BL7A 1GY3A 4PP9A 5HGIA 4AGCA 4CD0A 4KRDA 4DEEA 3A7GA 5C4KA 3KVWA 4MXOA 5L6OA 3QCQA 3D83A 3ITZA 4I22A 3PZEA 2W5HA 4KBAA 2ZDTA 4LM5A 4U7ZA 5H8GA 4BGQA 2QG5A 3P4KA 2VTOA 5GINE 4GH2A 4OTGA 3ZSGA 3MPTA 5J1WA 2PMIA 3F5GA 5F4NA 4IC8A 3PWYA 1FVTA 5AUTA 3R1YA 4FIEA 2J5EA 3BLQA 3TG1A 4BDCA 5HG7A 3PXKA 4I6BA 4F6UA 4MD7E 4HZRA 1FMOE 5JGDA 3BGPA 3VBVA 4EH2A 3CR0A 3UP7A 3JY0A 4EH5A 4ZTMA 4O83A 3QXPA 4C58A 1Q99A 2C0OA 3GCQA 4FJVA 4RFZA 2XUUA 4C4EA 1WVWA 3FLZA 3CXWA 4S31A 1Y57A 3I6UA 2PUIA 3Q04A 1ZOEA 4TYHA 5JFXA 3ZEPA 3PFYA 3FQHA 4NTSA 2XP2A 3W33A 5TKDA 2JD5A 4DN5A 4II5A 4C35A 3BE2A 3GGFA 4O81A 4FKLA 2C6LA 1K3AA 2WMAA 3PG3A 5CEIA 4AG8A 4F78A 2QHNA 3SD0A 1UA2A 4FV2A 3Q5ZA 4D5KA 3SOCA 2BDJA 2EXMA 3CKWA 5I9YA 4FSUA 1Q24A 1CKJA 2I0EA 2X7GA 4QYGA 1NY3A 3MGYA 4FIJA 5JKGA 3R01A 1QPCA 2X7OA 1ST4A 4WIHA 3F3VA 5KUPA 3WF8A 1H27A 2CKQA 3BYSA 1JKSA 1GNGA 3ULZA 3KREA 3TEIA 3E8EA 5D41A 4BDJA 3BU6A 2BAJA 5ANDA 4HW7A 4RX5A 4YNOA 4DT9A 4FR4A 5KX8A 5AUZA 4USEA 3PSCA 3QCXA 3MI9A 1YWRA 2RFSA 4O0YA 3ORKA 3UVPA 5IDNA 3CSVA 4CRLA 4J95A 2V62A 3DQWA 4RA4A 2FSOX 2IZSA 1WZYA 3HYHA 2F57A 5DRBA 2OXXA 3QUPA 3F82A 1G8JA 2VRXA 1ATPE 2X8IA 4FVRA 4O7NA 2OXDA 4ZS4A 4U0IA 1KE6A 3VUKA 5EM7A 3ZLSA 1V1KA 4FODA 2OLCA 4H39A 5HD7A 1M7NA 3BYMA 1J3HA 4G3FA 2QOIA 3DKCA 3PP0A 5CASA 4GKIA 1Q8UA 1FQ1B 4QPAA 1H24A 3R21A 4AFEA 3QX2A 2VWXA 2QG7A 3R30A 1PXNA 5HE1A 2HXLA 4HGSA 5IPJA 3LXPA 2VTMA 5ANGA 3VS7A 3M1SA 4CG8A 4X3FB 4DFBA 4MWHA 3SHEA 4ZLZA 3NMUF 2CGVA 4W4WA 5EYCA 4EZ3A 3NUXA 1R78A 4IEBA 4MAOA 4D4YA 1H07A 5ANOA 4OTHA 3FHIA 3LCDA 4F6SA 4K11A 1F0QA 2VU3A 4U41A 1HOWA 4O0RA 3C5IA 2H9VA 1J7LA 3FZSA 5HESA 2XNNA 5CI7A 3NVMB 5K4JA 3QQLA 4YZNA 3Q60A 1ZYLA 2VNYA 3G0EA 3HLLA 4EK5A 3D5XA 2YIYA 4D4SA 4J1RA 4YLKA 4AZTA 4O6EA 4EI4A 1LEZA 3MVHA 4LI5A 4QP6A 4FV6A 4YTCA 3R2YA 1ZXEA 1ZZLA 4QP8A 1SM2A 5EDPA 5FP5A 4EH3A 5DN3A 4CEGA 4X2GA 4W8DA 2HWOA 5LVOA 3CCNA 2C6TA 5HO7A 2QR8A 5EQEA 2R0UA 2E9PA 4Y8DA 5CANA 4IZAA 3C7QA 3VRYA 4XG7A 2GHMA 4E26A 2W1CA 3QLFA 1R0EA 3CTJA 3MTFA 3UIXA 4AXFA 2OSCA 4PTGA 3FZTA 3QC4A 4NJDA 1VR2A 4QYFA 3DXQA 4BDIA 4XP3A 3SG9A 4N6ZA 2QOBA 5CSWA 1R0PA 1QCFA 4IADA 4U44A 2OF4A 3U4WA 1FGIA 4PF4A 1FOTA 1Z9XA 2GTNA 3HMIA 5DYJA 4RWJA 4U80A 3D5UA 3QD0A 3ZEWA 4OUCA 5AP3A 4RT7A 3BKBA 3BL9A 2C3IB 5EM8A 2C69A 5TT7A 3I0QA 3MBLA 3PPJA 4IB3A 3M42A 4QMLA 4EOIA 2QOKA 2GNFA 4DGGA 4KSPA 4I24A 1XBAA 2VUWA 5A14A 1H00A 1YOMA 4AOJA 4TKSA 3UYTA 3AD6A 4LL0A 3G6HA 4FSTA 4IM3A 1DI8A 2E9UA 3D4QA 2W0JA 4D2SA 4PV0A 3FY0A 2I40A 3LCSA 3FZPA 4EC9A 1XJDA 4X2FA 4Y5QA 4YC8A 5DEWA 4I0RA 4QMOA 3LFFA 3PIYA 2W1IA 3A2CA 4I4FA 1FGKA 5IA5A 4M0ZA 1LP4A 4PTCA 4JG7A 3JY9A 3SA0A 2IW8A 3EYHA 3KL8A 3LXLA 4RZWA 3TL8A 4DTKA 3HV4A 1SMHA 1OMWA 2BRMA 3NIZA 4XUFA 3QFVA 3I81A 4CTBA 2Y4PA 4GK3A 5K4IA 2VTAA 3OUKA 3LM0A 3GP0A 5E8ZA 3D7ZA 4JI9A 1REJA 4O7VA 2LAVA 3TNWA 4EKKA 4AN9A 3W2CA 2G2IA 4NW5A 1XHAA 3I0OA 4FKTA 3UQFA 2VV9A 1B39A 1TFFA 2CPKE 4O7LA 4CKRA 2W1FA 4X3JA 4BJJB 4IE9A 1YI4A 2JFLA 1CM8A 5CXZA 2XNBA 2HELA 3PP1A 3FLWA 4IACA 1UVRA 2WAJA 2XZSA 4GJ2A 2OKRA 4EQMA 2QONA 4BIDA 5IMEA 2QOFA 4CMTA 5L8LA 3NUAA 4C2WA 3THBA 5E4HA 5K9IA 2F9GA 2EB3A 3DB6A 2IO6A 3S3IA 3MSSA 4IFGA 4TL0A 2JDRA 3T8OA 1KE7A 4LOOA 4MXXA 3V51A 4FTTA 3W1FA 4W8EA 4IVDA 4L3JA 2NRUA 3FMDA 3UOKA 2EWAA 3FZRA 5L2IA 2B52A 5IEVA 3FKNA 4EYMA 3BQCA 3PE1A 4U40A 1KE5A 5BVKA 4AXEA 4ZOGA 3B8QA 1W98A 3OT3A 4NL0A 3ZO3A 2YZAA 3P0MA 5A4QA 3BQRA 5KBRA 2WPAA 2R4BA 2J5FA 4EQCA 2WQEA 4BVUA 2PPQA 4ACCA 3RPRA 1NT2A 4R5YA 3ZRMA 4DF3A 4DHIB 3L8XA 4ERKA 3LMIA 3MY5A 3WARA 4ZLYA 2EB2A 4J8MA 3T3VA 2X6EA 2RFDA 5CY3A 2GFCA 3LFCA 3VS0A 3TIZA 5C8MA 5K3YA 1PKDA 2IVTA 2UZWE 2YWPA 3MA3A 3PUPA 3Q4TA 3R6XA 4FKWA 4MTAA 4GRBA 3L8PA 4XX9A 3TN8A 3TTIA 1ZRZA 4E4MA 4R7IA 3AT4A 4Q5EA 3MA6A 1KWPA 4E6DA 2VD5A 2RFNA 3P5KA 3NUNA 4FEWA 4ZXTA 3VC4A 5A9UA 3OW3A 4FX3A 4L53A 4YPDA 2H96A 2HZ0A 4IZ7A 2NNWB 4PL4A 2WQBA 3ZLWA 2W05A 1O6YA 1B6CB 4QNAA 4LUDA 5LOHA 4YHTA 4QMYA 2VTIA 2ZB0A 3QRKA 3TJDA 1OL2A 3QQFA 3NR9A 3HA6A 3UOLA 2PU8A 5CT0A 5M06A 3RAKA 2JITA 5GNKA 3V6SA 4JR7A 3UNKA 2YIQA 1WBTA 5T6KA 3EIDA 3LLTA 4FI1A 4BKJA 1LPUA 3ANRA 4CMOA 4JL9A 3LQ3A 3R8UA 3RGFA 2XRWA 2BIYA 5GHVA 4RWKA 4L9IA 4H3QA 5L6WL 3F2NA 4BCHA 3VQUA 4F9CA 3H9FA 5H9BA 2PE2A 4DDGA 3H0YA 3EKNA 3JR1A 3Q9YA 1YWVA 4HCVA 2W7XA 3BHUA 5HX6A 3LFEA 4DG0E 1ZOGA 5HI2A 1OPLA 4YJTA 3WIGA 5M51A 2OH4A 3FMJA 5M4IA 3P5JC 2BZJA 2E9NA 4ZTHA 5BX0A 4AN3A 3D5WA 1UWHA 4GVAA 2R3NA 3CQUA 3FYJX 1PJKA 4A9UA 4A7CA 4ENXA 3FLYA 3SRVA 4DH3A 1ZOHA 4GT3A 4RIXA 1XQZA 4DTBA 4M69B 1XH6A 4NM3A 4ZTSA 3R9NA 4WBBB 4DHJA 3WF7A 2B4SB 1JWHA 2WMBA 3P9JA 3VWAA 4D58A 5IISA 4LGHA 2QCSA 3FYKX 4RLKA 3BCEA 4C02A 1A48A 4Q5HA 4O91A 4BCKA 2XYUA 3A7HA 2J51A 5JQ8A 5LMKA 1Q62A 1YXSA 1XH9A 5CVGA 3BHVA 3KFAA 3MWUA 2YN8A 1W8CA 3R7YA 1DS5A 1ZY5A 4DH7A 3RAIA 3WILA 1OBDA 3TDWA 4PX6A 4C59A 3FY2A 4JT3A 3OTVA 4RX8A 3MPAA 4P2KA 1W0XC 1KE8A 3A4PA 4AACA 5AV0A 3LKMA 5HX8A 2GHGA 4MQ2A 2JLDA 2XKCA 3QD3A 5F95A 5HZNA 2V55A 2XALA 4PWNA 4L42A 2XK7A 5CQUA 3NGAA 5JRQA 2X0GA 5JH6A 3QKLA 5BNJA 3QBNA 5IQBA 2RGPA 3CY2A 2EVAA 4P90A 3DK7A 4QT1A 3R63A 4FL1A 1VJYA 3R22A 1XMMA 4IX3A 2W1DA 3UG2A 3NYXA 4R3CA 4DDIA 3W8QA 3S1HA 5AUXA 2ZFYA 2BIKB 2DWBA 2XM9A 3FKOA 3NS9A 3U51A 2XNMA 5JFVA 2C5NA 4E20A 3G9NA 4APPA 4O0TA 3W0QA 4O0WA 4Z55A 3UVRA 3R00A 2VGOA 2ONLC 4EONA 5FTGA 4FNYA 4YBJA 5HNBA 1UU7A 4EHEA 3KIOC 4O7OA 1H0VA 2IWIA 4G9RA 2XARA 4A4LA 4E4NA 2ZMCA 1QPDA 4LV7A 3NW6A 1HCKA 4IMYA 2GU8A 3P86A 4HGLA 5EKNA 1TQPA 3TJCA 4XG6A 3UZTA 1LEWA 2HY0A 2XMYA 3TTJA 4U42A 5GIOE 3VBYA 4LRKA 4QP4A 5AA8A 1XR1A 4DBXA 3PJ8A 3QXOA 4DH8A 5EFQA 3WF9A 3FL4A 5LVNA 3PIXA 4ALUA 4F65A 2E9VA 4MH7A 3W2OA 2BR1A 3GU6A 2Y6OA 4U43A 4ANQA 2G9XA 2ITPA 4DG3E 4IW0A 5A6OA 4G9CA 3V5WA 1DI9A 4P7EA 1G8KA 4GKHA 4RGJA 5AWMA 4DHZA 3HRCA 2VWVA 3FKLA 3TCPA 3LCKA 3RNIA 4XG8A 3AC3A 2Y0AA 4PQNA 3UO4A 4JDHA 4LYNA 4UB7A 4J7BA 2P0CA 2J90A 4FV9A 4XOZA 3T3UA 2WZJA 5HORA 4PP7A 5ITAA 3QKKA 2QOQA 1UKHA 4XLVA 4QQTA 3MIAA 2GPHA 1L8TA 3D14A 2WKMA 3R1QA 4QMPA 3MB6A 4XS2A 1PRYA 2FH9A 4IAYA 4XHKB 3AC1A 4R1YA 3TV6A 4L44A 3DKGA 4FYOA 5E8UA 3A99A 2IVUA 3D0EA 4FOCA 3T9TA 1SYKA 5M44A 5LXMA 4O7SA 4IDVA 4KB8A 4H3PA 3SGCA 5C4LA 3BPRA 3H0ZA 4EORA 3CTHA 1UNLA 4GW8A 3V5QA 4PMSA 2CNUA 4E6CA 3OZ6A 4AQCA 4F7NA 3DJ6A 4IHPA 1YWNA 1K2PA 2UVZA 3QYWA 4JAIA 4L68A 4R3PA 4IX5A 5EM5A 4ZTLA 3BIZA 4BHZA 1SVEA 2CCIA 3OWKA 4TZRA 2VWUA 2UZBA 4RJ4A 1MQBA 3EMGA 3G9LX 4WRSA 3PXQA 5C03A 5D11A 4ZTRA 4D0WA 2B53A 5HCZA 5KCVA 4R3RA 3W2RA 3OT8A 4O6LA 2X9FA 4AA5A 4XRLA 5A4TA 1S9JA 4C7TA 2VWZA 2OJIA 3QX4A 1WBOA 4UBAA 3V6RA 3D94A 5E1EA 5CEMA 5CEPA 3HKOA 1FPUA 5AX3A 4MWIA 5CVFA 1YXVA 4HVDA 4F7SA 1WMKA 2G2FA 1G8AA 2XB7A 1M2QA 2YAKA 3QQJA 4E5WA 2ETKA 3GQIA 4FIHA 5IH6A 2C47A 5CEQA 1MRVA 5CSHA 4NUSA 3NYVA 3EQBA 3OWJA 4O86A 3Q6WA 4CT1A 3EYGA 3IW8A 4B4LA 4F1OA 1NA7A 1QPJA 3GEQA 2QR7A 4GFOA 3OF0A 4XV1A 1WAKA 4N57A 3LHJA 4QMTA 5CU6A 5GJFA 3U87A 3PE2A 3HVCA 4DCEA 2R7BA 4WG5A 5F20A 3KMUA 4NM5A 4M14A 1OL7A 5DR6A 5AP0A 3PSBA 3E7OA 2X4ZA 3O7LD 3SLSA 4I6FA 1RDQE 1WBSA 4D55A 3RALA 2VTHA 3R8MA 4DEBA 4JDIA 3HRBA 4YURA 3MFRA 4L45A 3EFLA 2IVVA 5EQYA 4UX9A 4TYGA 1XBBA 2UZTA 3R8ZA 2BALA 3DBQA 3IO7A 3IW4A 5CU2A 4WRGA 2C4GA 2VWYA 1ZARA 3NRMA 4JDJA 5C1QB 1PYEA 4QMUA 4N4SA 1SNXA 2ITVA 4FTQA 1PMUA 3OW4A 4J52A 4WBOA 4A07A 1U46A 2W1EA 5ETAA 3KKVA 1B38A 5I0BA 3BV2A 2XF0A 4RVLA 3MY0A 5FXQA 4A9TA 4E6AA 3LJ0A 4OBPA 3QYZA 3E8CA 3VBWA 4BIEA 3CLYA 4BHNA 5A4EA 4R5SA 2IW6A 3V8SA 4CNHA 4QTCA 3I60A 3KRWA 4DHFA 3OFMA 4TXCA 5HVKA 1OBGA 2OJGA 3C50A 3M11A 2OK1A 5AIRA 4XG4A 5IQEA 3NUUA 1JOWB 5FM3A 4EHVA 3LXKA 4AF3A 4HYUA 4MNEA 1UU8A 4E6QA 2FYSA 5B0XA 4CV9A 3BZ3A 3Q9XA 4RJ8A 4ZS0A 3A60A 3DZOA 4CQEA 4FIFA 4DLJA 3DCVA 4I94A 3KK8A 4FKPA 4R1VA 3W55A 4AAYA 2XK3A 2VZ6A 2OZAA 2PSQA 3C4EA 3H10A 3FDNA 3AKLA 4L46A 4V0GB 4X7QA 4YR8A 3OXTA 4KWPA 2UW9A 4OTDA 4Y46A 4GIIA 2X2LA 3ROYA 4A9SA 5M4UA 3CS9A 2GNIA 4BCIA 4JXFA 2BRHA 5TO8A 3ZRKA 5CEOA 5HNGA 2HWPA 5EYDA 4BBEA 4J99A 3TT0A 4Y83A 2ITUA 2QO7A 2IW9A 3DJ5A 3R8PA 3DBCA 1OPKA 3QRJA 4XEYA 3HV6A 3CBLA 4LUEA 2GNGA 4ITHA 2XCHA 5CU0A 4FV8A 4XLIA 4CG9A 2YEXA 3C4ZA 3Q9WA 1A06A 4PMTA 2W99B 3O2MA 3QQHA 2ITNA 3I7BA 3PWDA 4BCQA 3W0SA 4B7TA 4AZFA 1E1VA 5CQWA 2HY81 4NT4A 4C4GA 3UOHA 3VS6A 5AMNA 1W7HA 4LL5A 1S9IA 4GYIA 4BCPA 4CCBA 5DA3A 5JFWA 4DEIA 5HIEA 2PHKA 1HCLA 2C6OA 2KULA 5D9HA 1Q61A 4JX7A 5HBEA 5HE3A 4P4CA 3RTPA 2WIHA 3UZPA 2VWBA 3Q3BA 4JMQA 3ZM9A 3KN6A 4MVFA 1W84A 3AMBA 2YACA 3QUEA 3FJQE 2BZHB 2XEYA 4YJNA 4TW9A 5CYIA 5AV3A 4IIRA 3R7EA 4EK8A 2R3MA 2WMRA 2W06A 4FKOA 4O0XA 2P55A 4USDA 4BTJA 5E8XA 4XCUA 5TF9A 3OC1A 3OOGA 5BVNA 4CZTA 1MQ4A 5EHYA 4F1TA 2WTVA 4TYJA 2VO7A 4ZEGA 1ZMUA 5HLNA 4RJ7A 1J7UA 2EU9A 3NDMA 3FLQA 4ANSA 4O21A 2WOUA 3FZOA 2B9HA 4PL5A 5EHOA 2C6DA 3ZFXA 2OO8X 4G5JA 5ACBC 2P2IA 4G6LA 3VHEA 2RL5A 3UNJA 3EQDA 2ITZA 4UZDA 3VS4A 3R9HA 1O9UA 4FICA 3RJCA 4C3RA 5IUHA 3EWHA 1MP8A 4QMVA 4XYFA 1R1WA 4IAIA 1STCE 2OFVA 5H8EA 4F9BA 3K3IA 3NSZA 3E92A 3MW1A 5E7RA 4HCUA 2YDJA 2BRGA 3KRJA 4RA5A 3FMEA 4QQCA 2WTKB 4YGAA 4FKQA 5ANJA 4IDTA 5AP6A 2JIVA 5KZ0A 4WUAA 2PVRA 5HBHA 3HMPA 1H25A 1PXLA 3EL7A 3HRFA 4LG4A 5EDQA 4YP8A 3RCJA 3VW6A 4G6OA 1OITA 1U54B 5A54A 5IQCA 2ERZE 3FEGA 4L52A 2C30A 3AGMA 4F0IA 1FBNA 4KIOA 2R3OA 1OIYA 3WZKA 3SXSA 2QVSE 3EZRA 2OF2A 4PTEA 3V3VA 3E8DA 5EQPA 3RPVA 3GNIB 4ANBA 4EOKA 3LFBA 4FV5A 3LJ1A 3R73A 3MH0A 1GZ8A 3WBLA 3FMKA 5BVFA 2W1GA 5EYKA 4DFZE 4YU2A 1JSUA 5IA1A 4P5QA 4V01A 3GCUA 3OOMA 5AV1A 4DFUA 4BB4A 4G2FA 4WUNA 2YWVA 2Q0BA 1JVPP 2W1ZA 4MX9A 2PY3A 2YISA 4YJOA 3ZM4A 3AC4A 4HCTA 2RG5A 3G0FA 1PXJA 1JKKA 1OI9A 4NKAA 3S95A 3EFWA 4HYHA 4KKGA 2W9FB 1U4DA 3Q2JA 5EG3A 2QLUA 3VBXA 2RF9A 3KF4A 5M4FA 3A8WA 4ZJVA 2B9JA 3KXNA 2ITQA 4A9RA 4O22A 5I9UA 4FZAB 1P4FA 5IQGA 1Z5MA 4IWDA 3OBJA 4I0TA 1RJBA 3DBFA 3LVPA 5AP5A 4FV7A 2IZUA 4C3PA 5M09A 4YHJA 4BC6A 3FBVA 4XH6A 3WZEA 4CFXA 4K6ZA 4ZZMA 5DT3A 1H0WA 4S34A 2CNQA 3FL5A 4FTIA 3KULB 2C6EA 4R7HA 2UUEA 4QOXA 1KV2A 1OKWA 2J50A 2QODA 2YJSA 4H1JA 4YHFA 5HLWA 3U6HA 3D7TA 3I1AA 3L1SA 2PMNX 4B6LA 3NLBA 3RI1A 4BYJA 1FVRA 2OI4X 4EBWA 5AADA 1JKTA 4GG7A 4O7RA 4FEXA 4WSYA 4FG9A 4FNXA 2JGZA 4FTMA 4UZHA 3RK7A 2OIQA 1IAJA 5CX9A 5BVDA 1M14A 2E9OA 2R5TA 2HYYA 3QTIA 3NCGA 4XV2A 5EOLA 3H3CA 2AC3A 2IG7A 2OXYA 4EOQA 3GI3A 4F9WA 3HV7A 3ULIA 3U4UA 3I5NA 4YZMA 3DFCB 3RM7A 1J7IA 3WZDA 4D9UA 3W0MA 5M53A 1YDRE 2BAQA 3DXNA 3FI2A 3DLSA 3FXWA 3PY3A 3R7IA 1IEPA 4XP0A 4GK4A 4S33A 1CKIA 4GEOA 4O0SA 2O63A 3DAKA 3KQ7A 2PZYA 4AGDA 3OWPA 5CVHA 4Z3VA 2PUUA 2X81A 4RIWB 5C27A 5LCJA 1OL6A 3LM5A 5HTBA 3EN4A 3R9OA 4BICA 5M57A 4PNIA 4ORKA 4KIPA 3I6WA 4YZCA 3W16A 5ICPA 1YI6A 1OB3A 1GIHA 1FMKA 3ET7A 2WMTA 1YXTA 3HA8A 4O7WA 5DEYA 4FZFB 4QYEA 2XKEA 3NAYA 4G17A 1PXKA 3HDMA 3NEWA 3QKMA 4R7BA 5DH3A 5FQDC 5FTQA 4IC7A 4GL9A 3OWLA 4GUBA 4V0GA 4XBUA 4JJRA 3ALOA 3LPBA 2WTDA 4J98A 2YIXA 4MKCA 4TWCA 3ZBFA 3ZTXA 4DFLA 3HUBA 4H1MA 5KE0A 4EL9A 1OZ1A 2R3FA 1P2AA 4AE9A 4FIGA 3LMHA 3RINA 4RIYA 2ZM4A 2XBJA 1P4OA 3DFAA 4NYEA 4RBLA 4TNDA 5CENA 3JUHA 2W9ZB 2WXVA 2YM8A 3NCZA 4OBOA 5IUIA 1H1SA 5AJQA 1PY5A 2YCSA 1BI7A 2ITOA 5A4CA 4FKGA 3BBWA 3CD8A 3ROCA 3QQUA 3N4VA 4U79A 2PULA 4ONAA 1ST0A 4NM7A 3ZUUA 5JGBA 2OZOA 2G15A 4CLIA 3OY3A 4ZTQA 3HMOA 3Q6UA 2NYAA 3F6XA 4YC6A 3EN7A 4JBVA 4ZIMA 3DBDA 3P1AA 3TM0A 4BDFA 3JVRA