4AXFA

Insp5 2-k in complex with ins(3,4,5,6)p4 plus amppnp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
435
structure length
410
Chain Sequence
EMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICREGRPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 134
structure length 410
sequence length 435
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axfA01
2XAMA 2XAOA 4AXDA 3UDSA 3UDZA 4AXCA 4AXEA 4LV7A 2XARA 2XALA 4AXFA 3UDTA 4AQKA 2XANA
chains in the Genus database with same CATH superfamily
4KBCA 2JDVA 4Q5HA 1RE8A 3F5PA 5EQPA 1VYZA 4RRVA 3MPTA 4O22A 4GS6A 4DGLC 4HVHA 1OL2A 4ORKA 4PV0A 5HKMA 4FKVA 3OEZA 3UZRA 4XV2A 4H3PA 5AP0A 2IW9A 4DFBA 4EQUA 1MUOA 2UUEA 4QMUA 4CD0A 4HCVA 3KFAA 3MFRA 4R5SA 4QNAA 3R7YA 3VBWA 3SW7A 1OECA 3UQFA 4L67A 3DT1A 4D4VA 5HU9A 4P5ZA 3V5LA 4BI1A 4NUSA 2VD5A 4QTEA 5AUTA 1XJDA 4YZDA 4AT3A 4AOJA 3SXSA 4FG9A 2FSTX 3LMHA 2I7QA 3D7ZA 5FM2A 1YXXA 4L6QA 3RINA 5AFVA 3V8SA 3V5TA 3VF9A 4QP2A 4PTGA 4EC8A 4NM0A 3VUIA 3DKOA 3R01A 4P5QA 4CVAA 4TXCA 1H27A 4I5PA 1B38A 1Y57A 4K0YA 4W4YA 4QMQA 3V5PA 3FC1X 4XV9A 3E87A 4FIEA 2QU5A 1CM8A 5DG5A 4C38A 4ZSJA 2UW9A 4F9YA 2Z7QA 5AV2A 3W33A 2QG5A 4OBQA 4KWPA 4O0TA 5E8ZA 5EI2A 4YTIA 3IONA 4LDTA 4P90A 4UN0C 3F2RA 4QMYA 4ZOGA 4IX6A 4H36A 3AMAA 3PXFA 4B7TA 4FKJA 3UP7A 3ZC6A 4M12A 4BBMA 3JS2A 4TRLA 4AW2A 2ZMDA 3EIDA 3GCVA 3HDMA 4IB3A 3RMFA 3COMA 2JAVA 3PE1A 3VULA 5KNJA 4ACGA 3EN7A 4F9BA 2RFNA 5JMSA 3G5DA 2J9MA 4ZTRA 5HG5A 3G9NA 4D0XA 2JDOA 2O63A 4QOXA 1U54B 4D1XA 4BHZA 4FTLA 3AT3A 2DQ7X 2SRCA 3R73A 3H4JA 1S9JA 5EQEA 1OKYA 3DPKA 2HENA 1ST4A 2YEXA 3HAVA 3HV4A 4Q9SA 1Q3DA 3F5GA 5CU3A 2PUNA 5L8KA 4BF2A 4QYHA 1PMEA 3KRRA 4EOOA 1LEZA 1NT2A 3JXWA 1CKJA 3ZLXA 5IQGA 2HELA 3ERKA 4LMUA 4BIDA 3ZUTA 3DS6A 1CKPA 4CV9A 4C2WA 3A7IA 1HCLA 2CN5A 2PVFA 5CEIA 3VS0A 2Z2WA 1GZ8A 2QC6A 3GB2A 4R77A 4YO4A 1DM2A 3ORKA 5LMKA 3RPSA 2C6LA 4AW5A 2ETRA 3W55A 4IIRA 5KMOA 3FDNA 3HGKA 5KX8A 2PVHA 5A46A 2W1GA 1OKVA 2ZV9A 3FMDA 3VQHA 3RK9A 3MJ2A 3LOKA 2HAKA 4EUTA 2YACA 5J95A 3TV7A 1PXJA 5H8BA 4FKRA 3CXWA 3TXOA 3WZJA 3E8EA 3TM0A 3OCGA 3PE2A 3IGOA 3W16A 5FDXA 4NJDA 4WNPA 4D1SA 3PFYA 1H26A 3OEFX 4IWDA 5EYKA 2YZAA 4EH5A 5LQFA 4X2FA 3PXZA 4GU6A 2B53A 4Y5QA 4OTFA 2CGWA 4GUEA 4QYYA 4RLKA 2BROA 3R02A 2C3IB 2R3KA 3AKJA 1OBGA 2A19B 3MVJA 4GMYA 4JAJA 4YJNA 5M07A 2C3KA 4JDJA 3VUHA 3TZ9A 2IPXA 2DS1A 4PUZA 5EI8A 3F7ZA 1URCA 3F5XA 3ZZWA 1L8TA 5BVOA 4QEBA 1T46A 2FSMX 2I1MA 1GZKA 4BDKA 4MXYA 5E9EA 4FKOA 5HX8A 3QGYA 1CTPE 2WU7A 3HA8A 4OTQA 5AV3A 3N51A 2BRNA 3N4UA 3PIZA 4JG8A 4C36A 1J91A 2R3LA 1H24A 4XEYA 3Q60A 4FK3A 2F2CB 3LJ0A 3LFFA 3TT0A 3WILA 1QPEA 4C34A 4YMJA 3JR1A 4XMOA 3GC9A 3UE4A 2J0LA 5FEDA 4EONA 3Q2JA 5KZ0A 4NM7A 2OG8A 2V0DA 5CWZA 4DTKA 1VEBA 4A9YA 2QO7A 3Q4CA 4AF3A 5CU0A 4WG4A 3M1SA 4E7WA 4S30A 4JDKA 3BHTA 3ENMA 3PRIA 4IAIA 2WEVA 4P7EA 3GU8A 3GFWA 5FP6A 3R7IA 4DBNA 1CDKA 4Y72A 4TTHB 3OWJA 1ATPE 4IZ5A 4G31A 2B54A 3DZQA 4EH2A 4GVJA 4I24A 4ZLYA 3OW3A 4FNZA 5BVWA 2NRYA 1OI9A 2P2HA 3F3ZA 3R6XA 2WTIA 5DNRA 5AX9A 3UOHA 3OTVA 2VGOA 4DEIA 4JL9A 3KF7A 3UQCA 3DAEA 2GQSA 4QMSA 4D9TA 5AAFA 5DIAA 3B8RA 3KXNA 3MTFA 4MCVA 4TL0A 5J7HA 3CTJA 2AUHA 3COHA 2ZV8A 4C59A 3ZFMA 3BLAA 5AUWA 4OT5A 5KZIA 4ZS4A 3RM7A 2W5BA 3V5WA 4KD1A 1OBDA 4FX3A 3ORIA 4U45A 1VZOA 4AZEA 3KEXA 2ZAZA 5IQEA 3QCSA 1Q4LA 4FT9A 1YKRA 5HNIX 4FSRA 2BDFA 3FSKA 2XEYA 2XF0A 4MKCA 4FJVA 3H30A 1KE5A 5H2UA 5CEMA 3LCTA 5E8WA 3MN3A 4FIIA 4FV8A 4YLJA 5JQ5A 3DJ6A 3CS9A 5ANOA 3NNWA 4LOOA 3MESA 4FT3A 5E92A 4U97A 1W82A 5FRIA 3NYNA 4AZTA 1V1KA 2WTCA 2Q83A 3GC7A 3LPBA 3MIAA 4WBOA 4XCUA 4ZS0A 3UPXA 4BZNA 4AW0A 3O0GA 2BRHA 2WQMA 4W8DA 5DBXA 1UA2A 2G1TA 2ITQA 3T9TA 5A6OA 3EN5A 5HQ0A 2IW6A 4NSTA 2A2AA 3RTPA 5C8KA 4EH3A 4QQJA 4EK5A 4O83A 4UV0A 4TW9A 2WMSA 3VRYA 3Q04A 3EFJA 2AC3A 5BV3A 2X1NA 4IE9A 4EUUA 2XZSA 4JNWA 1J1BA 4FV6A 4FL2A 5IQIA 3MGYA 3NW7A 2XBAA 4O27B 4L3LA 3ZUVA 5HCZA 5HG7A 3C50A 2PE1A 3Q3BA 4XV1A 4FL3A 2UZNA 3F69A 4IAKA 4GFGA 4DHJA 3N4VA 2XMYA 2XVDA 1IR3A 2UW7A 3QUEA 4D55A 3UZTA 2V22A 5CT0A 3LJ2A 4BVUA 1W0XC 2I40A 2J50A 2XALA 2QI8A 5BNJA 3P5KA 5JT2A 5EM6A 4I23A 3EYHA 5A9UA 2F7EE 4F1TA 4GV1A 3G0EA 4MBJA 4L8MA 4LGHA 5HIEA 3QKKA 4WRGA 5ANEA 4FTAA 4E73A 4ANMA 2WMBA 3GCUA 2J0IA 4B8LA 4DG0E 3MVLA 3OHTA 4QPAA 2I0YA 4EQMA 2YERA 3QRIA 4MK0A 3NW5A 3PSBA 4E6QA 2RG5A 2WXVA 3BLQA 5BVFA 4ZZOA 5LVPA 1YXVA 3L8XA 3OBGA 3GQLA 3ORLA 4LOQA 4R6VA 5CNOA 3MVHA 3W2CA 3F3WA 4BY9E 3C0HA 5AAGA 4XG2A 4MF1A 2OZAB 3RM6A 3NFGB 3DV3A 4QDVA 3QQLA 3VBYA 3NUAA 4RIXA 4A4XA 5DEYA 1S9IA 3ORXA 3FLSA 3MB7A 4V01A 3O51A 2JLDA 5KHXA 3L8SA 4E4MA 4WOVA 4XOZA 4BCPA 2Y4IB 1R3CA 2HWOA 3RKBA 2REIA 2E9PA 4WNKA 3R8VA 3SRVB 3SW4A 1PXKA 5L6OA 3QD4A 4L00A 2WMXA 2UVZA 4MAOA 3GGFA 4ZZNA 3QGWA 2Y6OA 4J96A 4PWNA 1Q5KA 2IZTA 5KKRC 4RC3A 3GU4A 5DFPA 2XNNA 3R00A 1M2PA 3UNZA 1WMKA 3R63A 4USFA 4FT5A 5M4IA 4PDYA 1SMHA 4G9RA 5BYYA 4NT4A 3ATSA 3QCXA 5FDPA 4AZVA 4IVAA 3FBVA 4DT9A 4D9UA 2VTRA 4J53A 5JQ8A 4I92A 3TUBA 5LARA 4GK4A 1O6KA 4F0GA 3EQIA 3QTUA 1A06A 2GS7A 3FLWA 4OGRA 3QLGA 4TWCA 5J87A 5AA9A 2GQGA 3QD2B 2W5AA 4I6BA 4OT6A 4RMZA 4DG3E 4A4OA 1SVHA 5IMEA 2JGZA 1Q8UA 1ZAOA 5BX0A 2W1EA 5B7VA 2B9HA 2XM8A 3SG9A 5AMNA 4JDIA 2OW3A 4FA2A 1WCCA 4C4EA 4ZSGA 2X7FA 3R7UA 2XJ1A 3JVSA 2W06A 2PVNA 5T68A 3FEGA 3DKCA 4RZVA 4QMLA 4ASDA 5HBEA 1V0BA 4E6DA 4MD9E 3TUCA 4X21A 1W8CA 4AA4A 3G6GA 5DRDA 3NX8A 5DEWA 5AUVA 4BCIA 2GNHA 2VWBA 2CGXA 4ANSA 5BUEA 2BAQA 4WKQA 1SYKA 2UW6A 1OZ1A 1DI9A 3G51A 1APME 4I6QA 4JAIA 2CMWA 2DYLA 2ITZA 5GIPE 4YHTA 3KULA 4RJ3A 4IADA 4XRLA 4AWIA 3E8NA 2XNEA 2W1FA 4OTIA 4ZTSA 3EZVA 4MQ2A 5HCXA 5FXRA 2W99B 2P55A 4MYGA 3ITZA 5CEKA 1B6CB 5EDRA 5IQBA 4U0IA 5CU2A 4GYGA 2GDOA 2O2UA 5GHVA 4CRLA 3W2PA 4UWYA 4X3FA 3MSSA 4L9IA 4BYIA 4E4NA 2J0MB 2WMQA 4RA5A 4BCOA 1STCE 2JKOA 3WZUA 3TDWA 3ZFXA 3V5QA 2EUFB 3BE2A 1WBWA 2F9GA 4R7IA 3GQIA 3AD4A 3SD0A 4J95A 3UQGA 4XX9A 4A9TA 5GJGA 4DF3A 3Q9WA 5AA8A 1G8JA 4ANLA 3QFVA 3E92A 5F1ZA 1Q41A 2X8DA 4YSMA 5KBQA 1YQJA 4FTJA 4MEDA 3LFEA 4BDIA 1F3MC 4DHZA 4R3RA 3U51A 4FZ7A 3CQEA 3PSCA 4ZTNA 4TN6A 3VS6A 3KU2A 4LRMA 1ZYSA 2J0JA 2EB3A 4GK2A 4PF4A 3Q52A 2YM5A 2GNLA 3BWJA 3A60A 4JX7A 4CGAA 4D4YA 4FGBA 2BDJA 1M2QA 3ORPA 4GT5A 3QTIA 4EK4A 5CSVA 3BE9A 2QONA 3I1AA 4Z16A 4Z7GA 1HOWA 4JLCA 4MVFA 4RIOA 3ODZX 2HZNA 4GL9A 2CLQA 2OF4A 4U43A 4V0GB 1O6LA 2J5FA 5A4CA 5EK7A 5CASA 2OK1A 3PY3A 4PL5A 4DHFA 2C1BA 3FXZA 4F1MA 1O6YA 1Q97A 3C4FA 5AP6A 1E1XA 2UZDA 5H3QA 1XMMA 4DN5A 5CSPA 3FHIA 3PVUA 5DVRA 3EZRA 2VNWA 4V04A 2XIKA 5CEQA 2PUUA 4I0SA 5IQAA 3V6RA 4QP4A 3EFWA 5C27A 4ZY5A 5FG8A 3QF9A 1XO2B 4QTBA 3VAPA 3ZOSA 3F66A 3QC9A 2C6TA 3ZXTA 3AD5A 4RIWB 2Z60A 1PJKA 2WMAA 4JVGA 4RGJA 4ZJIA 3ZUUA 2Y7JA 2QVSE 4CFNA 2HY81 1OL1A 2VWUA 3NUPA 1U59A 2YCFA 3QX4A 4XG9A 3RWQA 4D2RA 4QQCA 3DFCB 1ZXEA 3I4BA 2J2IB 2PZRA 2WFYA 2XYUA 5KMJA 1R39A 3UOLA 3HRBA 3C4XA 3KRLA 5H8EA 4EQCA 1PMNA 2WNTA 2YM3A 3HV3A 3GC8A 5LVLA 4FEXA 4BJJB 4NCTC 5KBRA 3FMJA 4JR7A 5C03A 3BI6A 3NDMA 1GAGA 4EJNA 1UVRA 2XM9A 3DLZA 3SXRA 5C4KA 2E9VA 1G5SA 2FH9A 3CKXA 2GPHA 2VGPA 3QA8A 3VO3A 5AM6A 4BDJA 2QOQA 2VRXA 3E63A 3QZGA 5HG8A 5BYZA 3ZM4A 3Q5IA 2R3PA 2CNQA 2R3MA 2WTDA 3DK7A 4BCHA 4EOKA 3NVKI 1O9UA 4XS2A 3VRZA 5D11A 4W4XA 2JD5A 2XA4A 2RFSA 3FZ1A 2XANA 4I6FA 2NNWB 4BCJA 3DBCA 1XBBA 3F3TA 3OBJA 4UXLA 5EYDA 1FGIA 4FK6A 3R9RA 2PZYA 5HO8A 3BL9A 3O23A 4FKLA 5DWRA 4M68A 4ALWA 4BTFA 4J52A 2PK9A 3CGOA 5J1VA 2XK4A 3H10A 4GJ3A 4ZY4A 3RNYA 4CNHA 3PY1A 3IDPA 4IM0A 4QP6A 4RZWA 1MRYA 4XG7A 2J4ZA 3F2AA 5CU6A 4MUQA 5HE3A 2H8HA 4GIHA 5CSWA 3PXQA 2X2MA 3MFSA 3PTGA 4RWLA 3KMMA 5L3AA 4UZDA 2Y4IC 4FODA 4X2KA 4XOYA 3FSFA 4PRJA 4DH5A 4C4JA 4FSZA 4L68A 2EWAA 3WF8A 4YR8A 4DEHA 4RX5A 2IVTA 1DS5A 4CFFA 2ITWA 5JGAA 1GIHA 3QUDA 3LKMA 3IOPA 2IWIA 3P86A 4BCFA 4C62A 4QDEA 4DT8A 2HK5A 2OH4A 4C4GA 4M8TA 5M09A 4BGQA 2YDJA 4FIGA 4U6RA 4DEGA 4RWIA 4DFXE 1W83A 4I22A 1GIIA 1Q8TA 4DEAA 1XHAA 3FY2A 3VONA 1H08A 2GHGA 3OP5A 3PVGA 4FG8A 4HGTA 4L01A 3LFBA 4Y46A 3FKLA 5AUUA 4XG4A 5AWMA 5D12A 5JFVA 3UP2A 2W0JA 3NGAA 3CC6A 4RPVA 3HA6A 2ZMCA 2CN8A 3LM0A 4M67A 4EOSA 3FMHA 2PVYA 2YAAA 1IAHA 3S95A 4AN3A 3RPRA 1JKKA 3UDZA 3A62A 5DRBA 4RVMA 4JS8A 2C0OA 2WPAA 5T6KA 2PZIA 2X7OA 4I94A 5D9HA 5FXQA 4CRSA 5IZFA 3HP2A 4L3JA 4RFZA 3KXMA 3CP9A 4I5CA 5CEPA 4N57A 3IQ7A 3CPCA 1Q61A 3LFSA 3PVBA 2VNYA 3RAHA 3SHEA 1MP8A 4CZTA 4XNEA 3IDBA 4S33A 3CIKA 3FJQE 5FTGA 4ENXA 4K11A 4I20A 2ZYBA 5IDNA 2UZLA 3P78A 5CEOA 3Q53A 2OH0E 2XNBA 2GHMA 1CMKE 4ARKA 4XBUA 4MNEA 5EYMA 1JSTA 4JR3A 3R1SA 2CKQA 1PF8A 4XP0A 5FEQA 2JIUA 2QOKA 4GUBA 5GNKA 3TKIA 5IF1A 5IH4A 2H6DA 2J51A 4NYEA 4JG7A 2H34A 4B9DA 5ETAA 2F49A 4U7ZA 3R83A 1WFCA 2JBPA 2G2FA 4G5JA 1SNXA 3S1HA 3H9FA 2QO2A 4M14A 4IQ6A 4QMNA 4ITIA 4Z3VA 4HPTE 4AGUA 2BZJA 3QQJA 4QMPA 3CQUA 2Z7LA 4FTQA 5EM7A 2ONLC 3VBXA 3OT3A 4OTWA 4RLLA 3LLAA 2WMUA 2BPMA 2OLCA 2FUMA 4LMNA 4LM5A 3ZEPA 2VTPA 1YDTE 5DT0A 3MWUA 3SQQA 5CF5A 3E8DA 3QD0A 2CCHA 1QMZA 5DI1A 4ALVA 4L43A 2VX0A 5HLWA 5IA3A 1FOTA 2XIYA 3SXFA 2O8YA 3D14A 3TCPA 4FV7A 5A4EA 4NWMA 4NTSA 3DB6A 4FEWA 1BL6A 3U6HA 4I3ZA 4UEUA 2XEZA 2YDKA 3LMIA 4LI5A 4F08A 4FVRA 3RHKA 3C4CA 4BN1A 3CD3A 4G3CA 5CSXA 2VWZA 3AGMA 3C5UA 1U46A 4YLKA 3UIXA 1OITA 4AAYA 3L8PA 3T3UA 3KCKA 2YCSA 5EHOA 4DFLA 1P5EA 4KS8A 4R3CA 4G3EA 3P4KA 3ZO1A 4ZAUA 3NUNA 5DPVA 1RDQE 3R7OA 4DCAA 2OIQA 3ZRMA 4IAZA 4EKKA 5ETFA 5ITAA 2X2KA 2XK9A 1IRKA 3NWWA 1UWJA 4NFNA 1KWPA 1LP4A 3GBZA 4QP7A 2NYAA 2C6EA 3IW4A 2WU6A 5H8GA 4B8MA 4EHEA 4EK8A 2W17A 1ERKA 5LVMA 4PMTA 4DDGA 4LL0A 3HP5A 2PMOX 4BIBA 3PG3A 3W2QA 3EH9A 3V5JA 3EQRA 1ZMWA 3BV2A 4I6HA 3UPZA 3L8VA 3JYAA 4C7TA 5EYCA 4LYNA 1UU7A 3OVVA 3PZEA 5HG9A 2ERZE 4JG6A 3RP9A 3ZZEA 5HNBA 5IA1A 1JPAA 4JQEA 5FGKA 5A4TA 2JEDA 2OJFE 4KB8A 3S4QA 5M4UA 2R0IA 2C5VA 3FQHA 3UYSA 4GH2A 5L8JA 3ZU7A 4C35A 2ZV2A 3UBDA 2YIRA 3NR9A 3BZ3A 4OR5A 1G8KA 3OCTA 4FKSA 4YBKA 2PMNX 4IX4A 4WD5A 1YXUA 4GG7A 5E4HA 5G6VA 2W4JA 1M17A 3E88A 3FC2A 3II5A 3DAKA 2I0HA 4FNXA 1K9AA 3EQBA 4RBLA 4MQ1A 4Y83A 3NIEA 5EDPA 3DGKA 3PFQA 3PXKA 3SG8A 4FKGA 5CZIA 4AAAA 1MQ4A 4BCQA 4PL3A 4RIXB 5M53A 4OTDA 4NKSA 4Y5HA 4Z9LA 3MI9A 3UOJA 4FV4A 4YPDA 3T9IA 3KF4A 3KC3A 1WZYA 3RAIA 5FUTA 3OFMA 3B2TA 1EH4A 4PNIA 1PKDA 2JKKA 4OUCA 5EHLA 3AMYA 3TZ8A 1A48A 1PHKA 3DCVA 3O2MA 4RJ7A 4K1BA 3FWQA 3R22A 4WA9A 5IPJA 3DJ7A 4KAOA 2P0CA 3BYOA 1DAYA 3ROCA 4RIYA 3W18A 3C4EA 1QPJA 4P4CA 3D5UA 1GNGA 4CLJA 2QOOA 2ERKA 1YHVA 1ZMVA 3GUBA 4TYHA 5B0XA 3PJ1A 3PJ3A 4YURA 2UZEA 3MV5A 4JT3A 5ETIA 2JFMA 4FNYA 1FBNA 1FMKA 3OTUA 4GCJA 4QP1A 3FLYA 1UNGA 2G01A 3V8WA 3T8OA 2YIQA 3O7LD 4N4SA 4U9AA 4NM3A 3BPRA 1AQ1A 2RGPA 4G6NA 1ZZ2A 3CTHA 4EZ3A 1PY5A 2PVJA 4ZY6A 3MH1A 1UU8A 3PPZA 3ZRKA 2R3HA 2W1CA 1L3RE 4IB0A 3GU5A 4MXAA 3LLTA 4CT2A 1V0PA 2VWWA 2BCJA 3NFFB 3OWKA 3OS3A 4D1ZA 2CJMA 4O7VA 2QHNA 4ZXTA 3TMOA 2FSLX 3RJCA 4A4LA 4QT1A 4BTKA 4IACA 4KINA 5E91A 3NNUA 2HCKA 4YC8A 3FPQA 4YZBA 1XBAA 3EL8A 2UW0A 1GOLA 4RWJA 4IC7A 4ANQA 2VTQA 2C0IA 4YHFA 3UNKA 3UVPA 2BALA 3POOA 2PVLA 4OTHA 3UYTA 4RT7A 4RJ4A 4ERWA 4DLIA 2XH5A 2JDSA 2BVAA 3I5ZA 1TKIA 4FI1A 4TYIA 3A7HA 4CTBA 3WI6A 4DYMA 3D5VA 3R8LA 1PXNA 2PSQA 4S32A 4HGEA 4X2GA 3BLRA 3GEQA 2ZB0A 4JQ8A 3BU3A 2QOFA 3UMWA 3P0MA 1Q8YA 4MBLA 1SNUA 3QCQA 3BBTB 4BDCA 1OL6A 1XR1A 3FV8A 4H58A 4MNFA 1FPUA 2X39A 4YC3A 5EQYA 4ZSEA 3RVGA 3TWJA 3TYKA 3HRCA 3WARA 5GINE 2IZSA 2JKMA 5HI2A 2BUJA 4CCUA 5FLFA 3PPKA 2GNFA 4FT0A 4X3FB 1KOAA 3R1QA 4X2JA 4U3ZA 4DDIA 4RX9A 5CXHA 5BYLA 3D7TB 4AW1A 2Y9QA 3FY0A 4Q2AA 3EQFA 3TNPC 2ZM4A 4L42A 4ONAA 4WUNA 4CEGA 3LQ5A 3AXWA 5KMMA 3UODA 3VVHA 4FZ6A 4UZHA 2VO7A 4KIOA 2X4ZA 2WELA 2XB7A 3ZONA 2ZV7A 4CKJA 3BGPA 4K9YA 1ZY5A 4PTEA 5IUGA 1OIRA 1REJA 3NYOA 2BTRA 3DKFA 3MY0A 4IC8A 4APPA 2R3FA 4MXXA 1YVJA 3AQVA 2B9FA 2CSNA 3OD6X 4FTKA 3CLYA 4ZTHA 4H3QA 3LFAA 2UW4A 2R3QA 3MTLA 3BCEA 3GT8A 1UU3A 4DFUA 3EJ1A 3BU5A 4LV8A 4JMQA 4F1OA 3DNDA 3MDYA 4PTCA 1IEPA 3Q9YA 4HGLA 2BIKB 3EMGA 5FM3A 5JRQA 3KK9A 2XNPA 5ACKA 4IB5A 1K2PA 4O84A 4TWPA 1P4OA 4J7BA 5L2IA 3DXPA 4CV8A 4E5BA 4XLVA 2YWPA 4QTAA 2R3OA 2WQNA 4JQ7A 5E90A 2XS0A 3PIXA 4I41A 1E9HA 1REKA 2AC5A 2V55A 3QC4A 1PKGA 4ALUA 5CALA 4DH7A 3OWLA 5I9YA 1OIUA 4S34A 2ZJWA 4D4SA 2YITA 3D5WA 1ZZLA 5EFQA 5CNNA 3TUDA 4FV5A 4IDTA 4ZZMA 4QNYA 2BR1A 3HECA 4AN9A 3LXPA 5K3YA 4FC0A 4USDA 3L9NA 3P7BA 4QYGA 1QL6A 4YJUA 3KGAA 4O91A 4RVKA 3M42A 2ACXA 3GCPA 2HZIA 2W1DA 3NYVA 4WG3A 4H1MA 4F6SA 4EBVA 3ZCLA 5JH6A 1H8FA 2UZUE 4MWIA 2HIWA 4F63A 4X0MA 1G8SA 1H1QA 4A9RA 4G3FA 4R78A 3OXTA 4FIFA 4IWOA 4ACHA 3ZFYA 2P4IA 5HU3A 4FNWA 5HVYA 3PPJA 2WTKB 1IA9A 4DFYA 3NCGA 5J9YA 2ZDUA 1CKIA 5IDPA 4JDHA 3DA6A 4EC9A 4XV3A 2VTMA 4NW6A 3WE4A 2IO6A 2ETMA 3O17A 3TJDA 1JKTA 2GTMA 1JLUE 4G3GA 4O7LA 3R9HA 3DKGA 4EJ7A 2XCKA 2LGCA 3KA0A 4FKWA 2F7XE 3TTIA 1JWHA 4AX8A 4V05A 3QTRA 3AG9A 3PZHA 4ERKA 4ZP5A 2PZ5A 2X9EA 1Y6AA 2UZBA 4X2NA 5FQDC 4CMOA 2IG7A 4O6LA 2W1HA 3MFUA 1BI8A 2XBJA 2QR8A 3BHUA 4WSYA 5KMNA 5H9BA 5EI6A 5HEZA 4DINA 4EORA 4O7YA 3UO4A 4BIEA 5CXZA 4N6YA 4TT7A 3OF0A 5LJJA 3U4WA 5CX9A 4YJSA 5D7VA 2YIWA 3U6JA 3O7LB 5DLSA 5AUZA 4I1ZA 3ET7A 1WBVA 3D0EA 3Q5ZA 3FZPA 3QD3A 5HLPA 3F3UA 3IW6A 3DBFA 3UDTA 3CD8A 1MQBA 5EKOA 3LHJA 3LXKA 3VS1A 4HJOA 4FBXA 4IX5A 3OCBA 4C58A 1WVXA 3IG7A 4AE6A 4BBEA 3KMWA 4IEBA 2VTOA 3R1NA 3SLSA 2Y8OA 3RK7A 5C1QB 3EN9A 5KUPA 2YIYA 3SOCA 5HHWA 3QRUA 4JBOA 3HMIA 3UG1A 5D41A 1KV1A 2ITVA 3HZTA 3QRTA 5I9XA 5AX3A 1BMKA 3ZSGA 3MFTA 3E8CA 4ACCA 2WMRA 4BTJA 2VTLA 2ZM3A 4M69B 3C7QA 3WE8A 5EW9A 3FI8A 5M57A 3C1XA 2HXLA 1XQZA 2P2IA 2YM4A 3A4PA 3FXWA 3ETAA 3OXIA 3HUBA 4IZAA 1J1CA 1Y6BA 2PUIA 4TWOA 5CU4A 3GU6A 2R5TA 2E9OA 4FV2A 4BCGA 3VBVA 1ZYCA 2O5KA 4DGGA 3DDQA 5AP7A 3EQGA 3SC1A 3RNIA 3P79A 3ANQA 5BUIA 4QYEA 4HZRA 3ACKA 4FTRA 1VR2A 3U6IA 4MD8E 3HL7A 1TFFA 1NVSA 2FYSA 3OG7A 4I5MA 4YO6A 3D4QA 1PXOA 5FTOA 4EEVA 4UX9A 2QOLA 4G3DA 5M51A 3OCSA 3P08A 2WTWA 2NRUA 5CF6A 4BICA 3G9LX 1PXLA 2R7BA 4FTIA 4JI9A 3ZSHA 4EK3A 4ZJJA 3HUCA 5TT7A 3TG1A 4AG8A 2PTKA 1YRPA 4FVQA 1U54A 5I4NA 4DEEA 2PL0A 3UG2A 3E64A 3CPBA 3G90X 3MH3A 3A2CA 3I79A 4IZ7A 4M13A 3QHRA 3V04A 4AZFA 4P2KA 2C1AA 1PMUA 1PXIA 5EKNA 4AXCA 2R3RA 4E6AA 4DH8A 4MH7A 3QYZA 4E20A 5AAEA 3DXNA 3KN5A 5GIOE 2YCQA 4PMMA 5FP5A 3U4UA 3NUSA 3BHYA 5CAVA 3LQ3A 2PVKA 4NU1A 3TZ7A 3U9NA 3UC3A 3UIMA 3FL5A 1LEWA 2ITTA 4AN2A 2FSOX 4QMMA 5LVNA 3VS3A 3VS2A 4AT4A 5IA0A 3IECA 3Q4TA 3Q6WA 3QAME 2WHBA 4XG3A 5EW3A 2C69A 3EQHA 1ZMUA 4N0SA 5B2MA 1U5QA 1WVYA 3I0QA 4MD7E 2F57A 2KTYA 5LCKA 3TJCA 5C4LA 5GJDA 1OUYA 3RI1A 3U87A 3W0PA 5HBHA 2X2LA 4QMZA 2BAKA 3F61A 4FT7A 5A4QA 3U8WA 2PZPA 2P33A 2WQEA 4F7LA 4ZLZA 4XHKB 2EVAA 1TQIA 3NRMA 2ITYA 5KMLA 5FBNC 3ZDIA 2J5EA 3POZA 1SM2A 3WF5A 3BIZA 4DTAA 1FINA 3O8UA 1TQPA 1KE8A 4F7NA 1KOBA 2PHKA 4OBPA 5C8MA 4IJ9A 5EH0A 2UVYA 3A7GA 3NAYA 4CFMA 4D0WA 5CAQA 2YM8A 5TR6A 1J3HA 1BUHA 2C6OA 4BTMA 3PJCA 1YOJA 3W0RA 3EOCA 1OVEA 4FZDB 4BZOA 1RQQA 2O64A 2YISA 4IVBA 4ZTLA 2JAMA 3LIJA 3HRFA 4XLIA 3RCJA 2YM7A 3PWYA 2J7TA 5DT3A 4E1ZA 2UZVA 3AC4A 4U44A 4YZNA 4F99A 1DAWA 2IN6A 4BC6A 3BL7A 3QQUA 3EQDA 4L44A 1YWNA 4FSQA 3RALA 1ZOHA 1H0WA 2RFEA 5M06A 5CQWA 3COIA 3E5AA 3F2NA 2F4JA 2VWIA 1RW8A 3BGQA 4AA0A 3ALNA 2VU3A 2C4GA 5HVKA 2R3IA 3L9LA 3FAAA 4C37A 2X6EA 3PJ8A 4EK6A 3TIZA 3WIKA 1ZLTA 2VWVA 2RIOA 2RKUA 2Z7RA 3QXPA 2PE2A 4CTCA 2WTKC 1F0QA 5D10A 1NVRA 4W4VA 4GFOA 4E4LA 4EBWA 4LV5A 5M4CA 2PULA 3GOKA 5CAUA 4UWCA 4CFWA 3W2RA 3LFQA 4PNKA 4RFMA 3GCSA 5BQ0A 3FHRA 5F94A 3W0MA 2XK6A 3W0NA 1U5RA 2XJ2A 3TZMA 4APCA 4NFMA 4AQCA 2OIBA 1NXKA 5F20A 1GZOA 3VS7A 4CQEA 3EQCA 3P5JC 4HYIA 3FI3A 4YTCA 5JFWA 4IM3A 2ITUA 3PA4A 4FEUA 3ZLWA 4CZUA 2RF9A 4LFIA 4TYEA 1IA8A 3E3BX 2OXXA 4FIHA 4IFCA 4RIYB 2C68A 1ST0A 2OXYA 1JVPP 5D7AA 3KN6A 3VN9A 2OKRA 4WBBB 3PLAE 1ZYJA 3E7VA 2VZ6A 3GC0A 3TV4A 5LVOA 2R3NA 3PXYA 3ROYA 5DR9A 2X8EA 3OC1A 4HNFA 4IW0A 4O81A 4WNOA 4WO5A 5AP3A 4F7SA 4O21A 4L52A 1JNKA 1TVOA 3TKHA 3C0GA 3W0OA 2R3GA 3KRJA 4L3PA 4ACMA 4QO9A 2UVXA 4FTUA 3LE6A 5HX6A 2Q0BA 2WD1A 4D5HA 2BMCA 2C5OA 3FL4A 5CY3A 3UTOA 3VC4A 3HAMA 2HZ4A 4FSNA 5CQUA 4G1WA 4YTFA 2XKDA 2WIPA 1RJBA 2OICA 1T45A 3NPCA 3ZC5A 2EB2A 5HZNA 2PMLX 4O7TA 1PW2A 2WAJA 2W05A 3VUDA 5TKDA 3QHWA 4C2VA 1XWSA 3BX5A 4CFUA 4KKHA 4O7WA 4UALA 3O96A 5LWNA 3NCZA 2HOGA 3TEIA 3W2OA 4LUDA 5L6PA 4R5YA 1MRUA 1WAKA 3MA6A 2ZVAA 3A8WA 3KREA 5HLNA 4L7SA 5HE0A 4IANA 3A8XA 5I9VA 3SA0A 4FGRA 4EOQA 3S3IA 4M3QA 2QG7A 4J97A 4YJOA 4PDOA 4HVIA 4ZMEA 5EG3A 5C8NA 2WQOA 5ANGA 3VUMA 4QMXA 3RCDA 3B8QA 3BELA 1MRVA 1YXSA 3KY2A 4AFEA 3KL8A 2HY0A 3W0SA 1I09A 2ESMA 2VWXA 3IPHA 3R0TA 4K77A 1BKXA 2UW3A 3QQKA 3QQFA 4ASXA 4B4LA 1BYGA 4DAWA 5JEBA 5FD2A 4EL9A 3OUNB 4FV0A 4EWQA 4KIPA 3DU8A 4II5A 4YJPA 4BDHA 3FE3A 4IH8A 2JBOA 3HLLA 3WYXA 2ITNA 2QU6A 4EOLA 2C6IA 2VO3A 4FSMA 2OGVA 2Z8CA 4A9SA 2Z7SA 3C5IA 3WOWA 3M2WA 3QRJA 2YCRA 2BRBA 3IW5A 3C13A 3OXZA 5T3QA 4RQKA 4HVSA 5IEVA 3PRFA 2BDWA 2W1ZA 2C5XA 4NCTA 5A4LA 3MIYA 3OUKA 3FLQA 3KXHA 1PXPA 5E1EA 3IW8A 3QLFA 2OU7A 3U55A 5KMIA 1J7UA 4QTCA 4GKHA 2UZTA 2XRUA 2PMIA 5HIDA 4U8ZA 3ID6C 4BCKA 4RJ8A 4NW5A 4ITJA 4XP3A 4CFXA 5A14A 2VTTA 1FVVA 4DGNA 3FYKX 3KQ7A 4D2SA 4K8AA 4HYSA 1YW2A 2G9XA 3OW4A 1OB3A 5B2KA 4BCMA 3KCFA 1LUFA 4CSVA 2OI4X 3CY3A 3LAUA 4TY1A 4EI4A 3Q9ZA 2I0VA 4I5HA 4U80A 4FZFB 1OL5A 2ETKA 3E7OA 3DBEA 2OZAA 2NP8A 4XUFA 2XAMA 4I4EA 1SZMA 4XP2A 3JY9A 2R64A 2GTNA 3D5XA 1Q8WA 5CLPA 3UDSA 2VN9A 2P3GX 4I6LA 4AXAA 1M14A 3BBWA 4NJ3A 1P4FA 3KIOC 4CFVA 3UVQA 3ZH8A 4D58A 2X4FA 5FBOA 4LGGA 4HCTA 3DQWA 1TQMA 3SRVA 4FYNA 4DE4A 4JIAA 3I7CA 4U5JA 4E4XA 2QO9A 3PVWA 4JJRA 4DC2A 3IOKA 4BB4A 2W1IA 4QTDA 2B1PA 2YZLA 5DH3A 2Z02A 4NM5A 5LWMA 3ZMMA 3IS5A 1UWHA 5AV1A 2LAVA 2BTSA 3UO5A 5I9ZA 3R7EA 3FLZA 2XYNA 4OTRA 4C3PA 1W98A 2OFUA 3QRKA 4UBAA 3REPA 4AACA 5AV4A 1DI8A 4A06A 5CAOA 5KHWA 5L2SA 5C01A 2BHEA 1FGKA 2HXQA 4IVCA 5CTPA 1Q3WA 2QOIA 3C4WA 3QWKA 5CS6A 2FA2A 2QNJA 2RG6A 5AP5A 3O50A 3KXGA 4WNMA 5CVGA 4DGMA 4FTTA 1OPLA 3WF6A 4D5KA 3DOGA 5CZHA 1JSUA 3LCDA 5CI6A 4FEVA 2E2BA 2JKQA 2XK7A 4GSBA 4JBQA 4R7HA 2QKRA 3ZDUA 5LMBA 2Y0AA 3QZIA 3ORZA 2VV9A 4NTTA 3V51A 3AKKA 4O0XA 4PDSA 5CYIA 4O0UA 3PYYA 3MW1A 3ULIA 2XCHA 5HO7A 5J9LA 5E8XA 1Y8GA 2R7IA 4GEOA 4K18A 4XRJA 5HE1A 4AXDA 3CSVA 4RA4A 3KXXA 3QTSA 2X0GA 1URWA 4ZEGA 2PWLA 3P7AA 4AUAA 1ZY4A 4EKLA 4IAAA 3R04A 3GFEA 5BVNA 4IJPA 3COKA 3KVWA 4ACDA 1YOLA 2GFCA 2JITA 5EOLA 3CTQA 3BLHA 4FIJA 4J8MA 4L53A 3QYWA 5JN2A 5BMSA 1Q8ZA 5BMMA 1OIQA 4Q9ZA 1UKIA 2O0UA 4JRVA 3ZXZA 2R3JA 5DA3A 4RVLA 3RGFA 1Y91A 2WEIA 3WYYA 3KVXA 3H0ZA 3DZOA 3MYGA 3R30A 3SOAA 4YLLA 4FKPA 3DY7A 3TI1A 3A7FA 4EZ7A 5K5XA 4TYGA 2VUWA 1FVRA 4HVDA 3G6HA 3Q32A 4F65A 4PDPA 2AYPA 3ENHA 4FSYA 2QD9A 3VW8A 3VIDA 3O8TA 2AEGA 4DH1A 2G2IA 4O0YA 5FTQA 2HYYA 4DCEA 3RWPA 3TNHA 4H05A 2B55A 4IAFA 3PP1A 3SAYA 3LCOA 3GU7A 2ONLA 4IAYA 2YWVA 5LMKC 4RQVA 5HTCA 1YWRA 2W5HA 4EWHA 1U4DA 1JAMA 3NYXA 4NKAA 3CBLA 4QMTA 5E1SA 3UVRA 3EWHA 3AOXA 4HZSA 3TV6A 4AGDA 3OOMA 3FZOA 3O5AA 4F70A 3PY0A 4CXAA 3QQHA 2V62A 5ETCA 2GNGA 1W84A 3F6XA 4BDEA 4CKRA 2WQBA 1M7NA 3DFAA 3CEKA 4PQNA 4QRCA 2JC6A 1Q62A 3V6SA 2VTAA 3CY2A 2Y4PA 3ACJA 2FVDA 5CI7A 5DN3A 2CNUA 3FMMA 2BFYA 3WZKA 5E8UA 4BDFA 3GXLA 4IVDA 3U9CA 4DG2E 1YHSA 1ZARA 3HMPA 3SDJA 3TACA 3UGCA 4EOJA 3VBTA 1XH9A 5C26A 2QODA 1YI3A 3LQ8A 3QKLA 1XH4A 4KBAA 4FVPA 4WUAA 3W8LA 5BPYA 4JX3A 4V0GA 3NS9A 3R2YA 5L8LA 2OJGA 3NNVA 4G9CA 3PLSA 4FZAB 2OZOA 4QMWA 1H4LA 2JIVA 3E93A 2BZIB 2GMXA 3I81A 2IJMA 3UO6A 5A6NA 5E8TA 3LCSA 5HD4A 2GSFA 4BHNA 1JBPE 4Y95A 3F5UA 3MB6A 4JOAA 2WOUA 3R9NA 4BGGA 4DA5A 2R4BA 4Y8DA 4DTBA 3EHAA 3VBQA 3MVMA 4RIWA 4F09A 4CG9A 4GYIA 4IX3A 2UZOA 3JY0A 2XKCA 4UYNA 5F4NA 4EOPA 4M15A 4O7ZA 3R21A 4GW8A 5IUHA 1VJYA 3AC2A 4GRBA 2VWYA 1OPKA 1JKSA 2EU9A 2JDTA 2QURA 3IDCA 3DTWA 3QXOA 3F9NA 3NUUA 4K6ZA 3KXZA 3L9MA 3A61A 4BJJA 3ZO4A 2F2UA 1Z57A 3LXNA 4FSTA 3H9RA 5JZJA 1FMOE 2VX3A 3LCKA 4EHZA 2R9SA 3P7CA 2IVVA 3Q4UA 2X9FA 5CENA 5CANA 3VJNA 3MH0A 5IEYA 2G15A 2ZOQA 2R0UA 3AT4A 4DITA 1BLXA 4O86A 3BYUA 3BV3A 3GP0A 3PSDA 4X6RA 4C33A 2UV2A 1OUKA 1NW1A 4FICA 1ND4A 3CKWA 3KULB 4KS7A 4Z55A 3NW6A 5ANIA 3IGGA 2VTJA 4NL0A 2CKEA 3ML1A 3OMVA 4MXOA 1UV5A 1ZRZA 2B9JA 2E9NA 4N70A 3ELJA 5DYJA 4F9AA 4HW7A 3EKKA 5AUXA 3BYMA 3I5NA 5LOHA 2BKZA 4YGAA 5JFSA 3FUPA 1QPDA 2CNVA 3HNGA 4HNIA 2VX1A 5AP1A 5M55A 5KKRB 3AGLA 3BYSA 5TOZA 3ULZA 3VUKA 2ITXA 2XKEA 4YU2A 1IG1A 4MX9A 4FTMA 5ICPA 3CR0A 3MS9A 2XAOA 3ANRA 4KSQA 3ZBXA 2C30A 3BEAA 3Q2MA 1UKHA 1Y8YA 4BI2A 1H1RA 1YDSE 2R2PA 1FQ1B 1GIJA 1JSVA 5IMXA 3M11A 4FEQA 1CSNA 2QQ7A 4RFYA 1OGUA 1KE6A 4DGOA 2C6MA 5AJQA 1Q99A 4QP8A 4X6QC 2H96A 2JIIA 4YC6A 3D94A 4IFGA 3ZLSA 4R1YA 5JZNA 4AS0A 3DBDA 4AA5A 3Q96A 4B0GA 5J9ZA 3EL7A 3QBNA 1JQHA 1VLRA 3H0YA 5FEEA 3WZDA 2A0CX 2BFXA 4FTNA 5KCVA 5ANDA 3PA3A 3CJFA 3HX4A 3QZHA 4TKSA 4AT5A 1XH6A 3R8PA 4LUEA 3F82A 4ZJVA 1ZOEA 1I44A 3NLBA 4JIKA 3QKMA 4LG4A 3KKVA 5HTBA 4HVGA 4F9CA 5L2WA 3JUHA 4GT3A 4UY9A 2CHLA 4I0RA 2YABA 3GOPA 2GU8A 4I21A 1SVEA 4TZRA 2VTIA 4AGCA 4RC4A 4YZMA 5IQHA 4EOMA 5ACBC 2WMWA 3VW6A 3AC1A 2PPQA 4J71A 4KA3A 4IB1A 1UU9A 2QKWB 3HMNA 3A4OX 4MHAA 5IA5A 4BDDA 3EB0A 2XARA 5E7RA 3WBLA 3IKAA 3TL8A 4GG5A 3C0IA 4RWKA 3UJGA 4C3RA 2XP2A 4PL4A 1IASA 2BRGA 3QTZA 4QPSA 2A4LA 3MA3A 4J99A 4RX8A 4OTGA 4XJ0A 4XH6A 3VQUA 3W1FA 4F0IA 2QOCA 4RG0A 3ZEWA 2EXCX 3MY1A 4RJ6A 2CLXA 5HNGA 4E5WA 2YIXA 5DHJA 4MXCA 4O82A 2WOTA 4PMPA 1WBTA 4Q5EA 3UZPA 2UZWE 3AC5A 4J1RA 1BL7A 2W4OA 3CGFA 3RZBA 3OT8A 4AQKA 4ZTMA 3R28A 1XH5A 2ITPA 3MJ1A 1M52A 3FYJX 1LPUA 4O0RA 5BVEA 4X3JA 2XNGA 2XIZA 1G8AA 1OKWA 1OMWA 2YJRA 3WF9A 2OJ9A 1AD5A 2X7GA 4XYFA 4ZSAA 4A9UA 2UW8A 4FKUA 2Y6MA 3NVMB 4HYHA 4QP3A 5A54A 4UXQA 4QMOA 3LM5A 2E9UA 5CVFA 1YHWA 3DTCA 4AZSA 4L7FA 2OF2A 3S2PA 1J7IA 2X81A 4BR3A 4EH8A 2QLUA 3LFCA 5EOBA 3ZTXA 3LFNA 3ORMA 4USEA 4AOIA 3ORNA 3BYVA 4TNDA 4FE2A 4WHZA 3FMNA 3OY3A 4S2ZA 5EM5A 4K2RA 1WBOA 5HE2A 4BKJA 4IWPA 4ZTQA 3V8TA 3DLSA 1H1PA 5IQFA 5KO1A 3HMOA 2W4KA 3R9OA 2CCIA 1YI4A 2I0EA 2DUVA 3HV5A 3QCYA 4KRDA 5EW8A 2WO6A 1W7HA 4F6WA 5DR2A 3S00A 3D9VA 2C6DA 1XH8A 4BCNA 3FKOA 4O2ZA 4AE9A 3G33A 3KB7A 3C4ZA 4QQ5A 3QX2A 4O7NA 3K2LA 5ANKA 3CE3A 4RVTA 5M08A 2VTNA 1R1WA 4FG7A 4KKEA 3F7WA 3ATTA 1M7QA 2X8IA 2C5NA 3O71A 4FTCA 1JOWB 2O3PA 3QQGA 4NK9A 4UWBA 5AV0A 3TDVA 5J8IA 5BUJA 2PVMA 2C6KA 3L9PA 3FQEA 3I6UA 3RHXA 1NA7A 5AP4A 2VO6A 2JFLA 1M2RA 3ZBFA 2PY3A 3ZM9A 3U54A 3FLNC 3R8MA 4U81A 2QLQA 3DAJA 1G3NA 3DNEA 4EH9A 2OIDA 5AIRA 5EM8A 3GI3A 4S31A 4BRXA 1OIYA 4YJQA 4DBXA 3NUYA 2VTHA 4BZDA 4EHVA 3T3VA 3EKNA 2CGUA 3W10A 2YM6A 1ZYLA 4IMYA 5GJFA 5HIBA 4AZWA 5JKGA 5HBJA 5AIKA 3RPOA 4IHPA 1PRYA 3HVCA 4ID7A 4YP8A 4KRCA 3H3CA 3VUGA 1Z5MA 3D2IA 1R0PA 2F7ZE 4O2PA 4YHJA 4KABA 3GCQA 4KKGA 2W7XA 4DHIB 4B6LA 4GVAA 3CQWA 3FXXA 4E8AA 4O6EA 4UYAA 3RK5A 5JFXA 4EH4A 2FGIA 4J8NA 4EOIA 5IQCA 4CT1A 2G2HA 2XNOA 1F5QA 1UNHA 5ANJA 3JPVA 4M7IA 4YJVA 2OJJA 1OPJA 3BQRA 2OO8X 4W4WA 2GNJA 4HGSA 2BZKB 4FOBA 5K5NA 1KE9A 5EDQA 3S0OA 3R8ZA 4YZCA 3FZSA 4MNEB 1H00A 2XIXA 4D4RA 3AT2A 3VNTA 1NY3A 1KE7A 4FV3A 5K4JA 3VJOA 1R78A 3QTXA 3FMEA 3RPYA 4MWHA 5E8YA 5JK3A 5I9WA 3EFLA 3QL8A 4HCUA 4O0WA 2IW8A 1PXMA 2B9IA 4FR4A 4FUXA 3FKNA 4FOCA 3LZBA 1GZNA 4I0TA 4GFMA 4HYUA 4X3FC 3DQXA 2YN8A 4E93A 2ITOA 3LW0A 1GJOA 4KIQA 2ZB1A 1H07A 5IG1A 3RAWA 2IZRA 4QQTA 5DR6A 2FB8A 4G16A 3PIYA 1QPCA 2XJ0A 3FQSA 3BU6A 4LQMA 4XBRA 5LMAA 4AXEA 3WIGA 5CF4A 4LRKA 3DBQA 5IA4A 4DFZE 3AMBA 4FSWA 5TO8A 3ZYAA 2OJIA 2YJSA 5AUYA 3LJ1A 3BQCA 4LL5A 4OBOA 2QOHA 3I60A 3Q4ZA 3TKUA 4C4FA 2WTJA 4C3FA 2QHMA 2YHVA 4PY1A 3ALOA 1XMLA 3R9DA 2X6DA 5IISA 4CG8A 3D83A 4R1VA 3G0FA 2A27A 4FTOA 5K4IA 2CKOA 4G6OA 3TIYA 3TN8A 4Y73A 2W9ZB 4RC2A 3ZSIA 1PYXA 3QTQA 4YJRA 5DGZA 1Q24A 4Y85A 5HD7A 3BHVA 4YNEA 4A7CA 4FKIA 2C47A 4I93A 3DK3A 1KUTA 3PA5A 3TTJA 3AC3A 3N9XA 3JVRA 3UC4A 1YWVA 2BHHA 4CCBA 3I0OA 5M44A 3FI4A 1E1VA 3H9OA 1AGWA 3BKBA 1HCKA 3NUXA 4FSUA 3K3IA 2JDRA 2KULA 3N4TA 2BAJA 3HEGA 1H1SA 4ZIMA 3KMUA 4YTHA 4ZK5A 2XIRA 4ZLOA 3AD6A 4X7QA 3W8QA 3G15A 4ITHA 1P14A 4Z7HA 2NPQA 3MBLA 3PDTA 3QZFA 4M84A 2WMTA 4LV7A 2XRWA 3THBA 3LXLA 2WGJA 4NIFB 4AU8A 4GT4A 4F9WA 2CPKE 3PUPA 4LOPA 4F4PA 2VAGA 4TWNA 3NSZA 2ZFYA 3DDPA 4BI0A 4C4IA 4QMVA 2DWBA 3OY1A 3OROA 1B39A 3CCNA 2C3JA 1YOMA 2CGVA 1X8BA 2HW7A 4BDBA 1OGYA 1H0VA 4PP9A 1GY3A 3F88A 5HICA 3AKLA 3I7BA 3D7TA 4N6ZA 5HVJA 4ZMFA 3K5VA 5I0BA 5C9CA 5IQDA 4BDAA 4WT6A 1OM1A 1R0EA 3EN6A 3BWFA 3QUPA 4JBPA 4FUYA 4IBMA 2GHLA 1PYEA 3MPAA 5IU2A 4XG8A 2ZM1A 5BVKA 1PMVA 3W32A 3FZTA 3P9JA 5JSMA 2WTVA 4AP7A 1ZOGA 1K3AA 2PE0A 4BYJA 3W2SA 4E26A 3HKOA 4H3BA 4GJ2A 5L2TA 4RJ5A 5EHYA 3SX9A 4W8EA 4CKIA 5E8SA 1BI7A 3BHHA 4F6UA 4R3PA 1WBSA 1SVGA 3DJ5A 4FKTA 1WBNA 4H39A 4MXZA 4O7RA 3DK6A 4G34A 4FL1A 3BEGA 3UDBA 2XNMA 3KRWA 4R7BA 3DB8A 2W9FB 4U3YA 5CVHA 3HV7A 5DOSA 2NO3A 3TNIA 4DH3A 2YFXA 3G2FA 4KBKA 4M0ZA 2V7OA 2C3LA 2GNIA 1H28A 3UOKA 5G1XA 4TYHB 1UNLA 3BRBA 3HDNA 2WB8A 1V0OA 2O65A 4EYMA 1YXTA 4YUQA 3LFDA 5F95A 3BGZA 4JBVA 4YSJA 3UNJA 5FXSA 3NZ0A 2BRMA 4E6CA 1H1WA 5F9EA 2OBJA 3A99A 4BBFA 3ZLYA 4EYJA 3MH2A 3FI2A 4KNBA 3GVUA 4KSPA 2PYWA 4IZYA 4JXFA 4ANBA 3SV0A 2IZUA 3NEWA 3ZS5A 4F64A 4NH1A 5IH5A 4AFJA 4EH6A 2GCDA 3R8UA 2BIYA 3LMGA 4KUJA 3FMKA 2EXMA 4O0VA 4ZSLA 4EH7A 1H25A 3OWPA 3QALE 2B4SB 2V7AA 4K33A 5IEXA 2OWBA 1VYWA 4G5PA 4FKQA 1A9UA 1JKLA 3O8PA 4OLIA 1P2AA 3GENA 2J90A 3TNWA 3HV6A 3PWDA 1KV2A 5CSHA 3UMXA 3FPMA 3ORTA 5K9IA 4GU9A 5CF8A 3NMUF 3Q9XA 2OFVA 3D2KA 2IVSA 4RSSA 5E8VA 4E5AX 5KE0A 3V3VA 4L46A 3FZRA 4DEDA 2C0TA 2HW6A 4CMTA 4MBIA 2HZ0A 3K3JA 2VTSA 3C51A 3E62A 1XH7A 2IVUA 3NNXA 4PX6A 4PP7A 5IA2A 3LVPA 4GIIA 3R71A 3WZEA 4BDGA 4U42A 4C4HA 5J5SA 5L6WL 3EFKA 4HOKA 5HESA 1ZWSA 4EHGA 3VS5A 3ZO2A 2RL5A 3W0QA 5DT4A 4M0YA 4G6LA 2BZHB 3UIUA 5DE2A 2OSCA 4F7JA 1LR4A 3UIBA 3P1AA 3VF8A 3SGCA 2B52A 3ZRLA 4D28A 3KK8A 3K5UA 2CDZA 2YDIA 2J6MA 5TF9A 5CAPA 4O96A 5JGBA 4U79A 3MPMA 4FV1A 4IM2A 4B99A 2VO0A 4GK3A 2BILB 3QU0A 3HMMA 4UB7A 4TYJA 3RAKA 4BGHA 5M56A 3GNIB 5AEPA 2GQRA 3K54A 2W96B 2XK3A 3AC8A 4XG6A 3QTWA 2YA9A 4F78A 5JGDA 4GKIA 5JRSA 5HCYA 4FYOA 2I6LA 4G2FA 4H1JA 5LCJA 3PJ2A 4AXFA 4WIHA 3IW7A 4F0FA 3MY5A 1IAJA 3TNQB 5LXMA 3E3PA 4WG5A 2OXDA 2QCSA 3A7JA 3QWJA 3FMLA 4FMQA 4FV9A 4QP9A 3P23A 4YJTA 5D1JA 4G17A 2QR7A 1BX6A 3HYHA 3WF7A 3PP0A 5BVDA 2QOBA 3IK3A 4AGWA 1J7LA 5CT7A 3VS4A 3D15A 3OOGA 1XKKA 3V01A 5B2LA 1QCFA 3IO7A 1H01A 2FO0A 4U41A 2RFDA 4M97A 1NVQA 3VHKA 4LRJA 4AOTA 3PXRA 2V5QA 3RPVA 4DFNA 2B0QA 2XKFA 4L45A 4O0SA 4YPSA 3KRXA 4ASZA 3F3VA 3VWAA 5J1WA 4DLJA 4DEBA 3QA0A 1XBCA 4HPUE 4A07A 5HGIA 4O38A 4MTAA 3PG1A 2UW5A 2C5YA 2WIHA 2WKMA 2WZJA 4JRNA 3R7VA 3Q6UA 2BKKA 1YI6A 4ENYA 2PUPA 3EN4A 5IH6A 4C0TA 5KMKA 3R1YA 3CJGA 4YZ9A 4YNOA 1FVTA 4U40A 4I4FA 4PMSA 4RX7A 5AADA 4TPTA 2PVRA 3OZ6A 3PUFC 5AP2A 5I5ZA 5AM7A 1YDRE 2A1AB 4YBJA 3EQPA 4J98A 5IUIA 3VHEA 2Q0NA 1ZYDA 2XK8A 4WRSA 4IDVA 4O7SA 2GS6A 3NAXA 3SVVA 3L1SA 4ASEA 3ZO3A 3ZHPC 3ODYX 4TNBA 4C02A 2B7AA 4NZWB 2GS2A 3DXQA 5I9UA 4OW8A 3NIZA 4C61A 2GFSA 2ZDTA 1OL7A 3SKCA 4QYFA 2XUUA 2HWPA 5HORA 2YAKA 3R2BA 2CKPA 5A3XA 4CMUA 1KSWA 2J0KA 3C9WA 4IWQA 3EYGA 1Z9XA 1OKZA 2H9VA 4CLIA 2WMVA 4EZ5A 1WBPA 3B2WA 2PU8A 3I6WA 5M4FA 1WVWA
chains in the Genus database with same CATH topology
4KBCA 2JDVA 4Q5HA 1RE8A 3F5PA 5EQPA 1VYZA 4RRVA 3MPTA 4O22A 4GS6A 4DGLC 4HVHA 1OL2A 4ORKA 4PV0A 5HKMA 4FKVA 3OEZA 3UZRA 4XV2A 4H3PA 5AP0A 2IW9A 4DFBA 4EQUA 1MUOA 2UUEA 4QMUA 4CD0A 4HCVA 3KFAA 3MFRA 4R5SA 4QNAA 3R7YA 3VBWA 3SW7A 1OECA 3UQFA 4L67A 3DT1A 4D4VA 5HU9A 4P5ZA 3V5LA 4BI1A 4NUSA 2VD5A 4QTEA 5AUTA 1XJDA 4YZDA 4AT3A 4AOJA 3SXSA 4FG9A 2FSTX 3LMHA 2I7QA 3D7ZA 5FM2A 1YXXA 4L6QA 3RINA 5AFVA 3V8SA 3V5TA 3VF9A 4QP2A 4PTGA 4EC8A 4NM0A 3VUIA 3DKOA 3R01A 4P5QA 4CVAA 4TXCA 1H27A 4I5PA 1B38A 1Y57A 4K0YA 4W4YA 4QMQA 3V5PA 3FC1X 4XV9A 3E87A 4FIEA 2QU5A 1CM8A 5DG5A 4C38A 4ZSJA 2UW9A 4F9YA 2Z7QA 5AV2A 3W33A 2QG5A 4OBQA 4KWPA 4O0TA 5E8ZA 5EI2A 4YTIA 3IONA 4LDTA 4P90A 4UN0C 3F2RA 4QMYA 4ZOGA 4IX6A 4H36A 3AMAA 3PXFA 4B7TA 4FKJA 3UP7A 3ZC6A 4M12A 4BBMA 3JS2A 4TRLA 4AW2A 2ZMDA 3EIDA 3GCVA 3HDMA 4IB3A 3RMFA 3COMA 2JAVA 3PE1A 3VULA 5KNJA 4ACGA 3EN7A 4F9BA 2RFNA 5JMSA 3G5DA 2J9MA 4ZTRA 5HG5A 3G9NA 4D0XA 2JDOA 2O63A 4QOXA 1U54B 4D1XA 4BHZA 4FTLA 3AT3A 2DQ7X 2SRCA 3R73A 3H4JA 1S9JA 5EQEA 1OKYA 3DPKA 2HENA 1ST4A 2YEXA 3HAVA 3HV4A 4Q9SA 1Q3DA 3F5GA 5CU3A 2PUNA 5L8KA 4BF2A 4QYHA 1PMEA 3KRRA 4EOOA 1LEZA 1NT2A 3JXWA 1CKJA 3ZLXA 5IQGA 2HELA 3ERKA 4LMUA 4BIDA 3ZUTA 3DS6A 1CKPA 4CV9A 4C2WA 3A7IA 1HCLA 2CN5A 2PVFA 5CEIA 3VS0A 2Z2WA 1GZ8A 2QC6A 3GB2A 4R77A 4YO4A 1DM2A 3ORKA 5LMKA 3RPSA 2C6LA 4AW5A 2ETRA 3W55A 4IIRA 5KMOA 3FDNA 3HGKA 5KX8A 2PVHA 5A46A 2W1GA 1OKVA 2ZV9A 3FMDA 3VQHA 3RK9A 3MJ2A 3LOKA 2HAKA 4EUTA 2YACA 5J95A 3TV7A 1PXJA 5H8BA 4FKRA 3CXWA 3TXOA 3WZJA 3E8EA 3TM0A 3OCGA 3PE2A 3IGOA 3W16A 5FDXA 4NJDA 4WNPA 4D1SA 3PFYA 1H26A 3OEFX 4IWDA 5EYKA 2YZAA 4EH5A 5LQFA 4X2FA 3PXZA 4GU6A 2B53A 4Y5QA 4OTFA 2CGWA 4GUEA 4QYYA 4RLKA 2BROA 3R02A 2C3IB 2R3KA 3AKJA 1OBGA 2A19B 3MVJA 4GMYA 4JAJA 4YJNA 5M07A 2C3KA 4JDJA 3VUHA 3TZ9A 2IPXA 2DS1A 4PUZA 5EI8A 3F7ZA 1URCA 3F5XA 3ZZWA 1L8TA 5BVOA 4QEBA 1T46A 2FSMX 2I1MA 1GZKA 4BDKA 4MXYA 5E9EA 4FKOA 5HX8A 3QGYA 1CTPE 2WU7A 3HA8A 4OTQA 5AV3A 3N51A 2BRNA 3N4UA 3PIZA 4JG8A 4C36A 1J91A 2R3LA 1H24A 4XEYA 3Q60A 4FK3A 2F2CB 3LJ0A 3LFFA 3TT0A 3WILA 1QPEA 4C34A 4YMJA 3JR1A 4XMOA 3GC9A 3UE4A 2J0LA 5FEDA 4EONA 3Q2JA 5KZ0A 4NM7A 2OG8A 2V0DA 5CWZA 4DTKA 1VEBA 4A9YA 2QO7A 3Q4CA 4AF3A 5CU0A 4WG4A 3M1SA 4E7WA 4S30A 4JDKA 3BHTA 3ENMA 3PRIA 4IAIA 2WEVA 4P7EA 3GU8A 3GFWA 5FP6A 3R7IA 4DBNA 1CDKA 4Y72A 4TTHB 3OWJA 1ATPE 4IZ5A 4G31A 2B54A 3DZQA 4EH2A 4GVJA 4I24A 4ZLYA 3OW3A 4FNZA 5BVWA 2NRYA 1OI9A 2P2HA 3F3ZA 3R6XA 2WTIA 5DNRA 5AX9A 3UOHA 3OTVA 2VGOA 4DEIA 4JL9A 3KF7A 3UQCA 3DAEA 2GQSA 4QMSA 4D9TA 5AAFA 5DIAA 3B8RA 3KXNA 3MTFA 4MCVA 4TL0A 5J7HA 3CTJA 2AUHA 3COHA 2ZV8A 4C59A 3ZFMA 3BLAA 5AUWA 4OT5A 5KZIA 4ZS4A 3RM7A 2W5BA 3V5WA 4KD1A 1OBDA 4FX3A 3ORIA 4U45A 1VZOA 4AZEA 3KEXA 2ZAZA 5IQEA 3QCSA 1Q4LA 4FT9A 1YKRA 5HNIX 4FSRA 2BDFA 3FSKA 2XEYA 2XF0A 4MKCA 4FJVA 3H30A 1KE5A 5H2UA 5CEMA 3LCTA 5E8WA 3MN3A 4FIIA 4FV8A 4YLJA 5JQ5A 3DJ6A 3CS9A 5ANOA 3NNWA 4LOOA 3MESA 4FT3A 5E92A 4U97A 1W82A 5FRIA 3NYNA 4AZTA 1V1KA 2WTCA 2Q83A 3GC7A 3LPBA 3MIAA 4WBOA 4XCUA 4ZS0A 3UPXA 4BZNA 4AW0A 3O0GA 2BRHA 2WQMA 4W8DA 5DBXA 1UA2A 2G1TA 2ITQA 3T9TA 5A6OA 3EN5A 5HQ0A 2IW6A 4NSTA 2A2AA 3RTPA 5C8KA 4EH3A 4QQJA 4EK5A 4O83A 4UV0A 4TW9A 2WMSA 3VRYA 3Q04A 3EFJA 2AC3A 5BV3A 2X1NA 4IE9A 4EUUA 2XZSA 4JNWA 1J1BA 4FV6A 4FL2A 5IQIA 3MGYA 3NW7A 2XBAA 4O27B 4L3LA 3ZUVA 5HCZA 5HG7A 3C50A 2PE1A 3Q3BA 4XV1A 4FL3A 2UZNA 3F69A 4IAKA 4GFGA 4DHJA 3N4VA 2XMYA 2XVDA 1IR3A 2UW7A 3QUEA 4D55A 3UZTA 2V22A 5CT0A 3LJ2A 4BVUA 1W0XC 2I40A 2J50A 2XALA 2QI8A 5BNJA 3P5KA 5JT2A 5EM6A 4I23A 3EYHA 5A9UA 2F7EE 4F1TA 4GV1A 3G0EA 4MBJA 4L8MA 4LGHA 5HIEA 3QKKA 4WRGA 5ANEA 4FTAA 4E73A 4ANMA 2WMBA 3GCUA 2J0IA 4B8LA 4DG0E 3MVLA 3OHTA 4QPAA 2I0YA 4EQMA 2YERA 3QRIA 4MK0A 3NW5A 3PSBA 4E6QA 2RG5A 2WXVA 3BLQA 5BVFA 4ZZOA 5LVPA 1YXVA 3L8XA 3OBGA 3GQLA 3ORLA 4LOQA 4R6VA 5CNOA 3MVHA 3W2CA 3F3WA 4BY9E 3C0HA 5AAGA 4XG2A 4MF1A 2OZAB 3RM6A 3NFGB 3DV3A 4QDVA 3QQLA 3VBYA 3NUAA 4RIXA 4A4XA 5DEYA 1S9IA 3ORXA 3FLSA 3MB7A 4V01A 3O51A 2JLDA 5KHXA 3L8SA 4E4MA 4WOVA 4XOZA 4BCPA 2Y4IB 1R3CA 2HWOA 3RKBA 2REIA 2E9PA 4WNKA 3R8VA 3SRVB 3SW4A 1PXKA 5L6OA 3QD4A 4L00A 2WMXA 2UVZA 4MAOA 3GGFA 4ZZNA 3QGWA 2Y6OA 4J96A 4PWNA 1Q5KA 2IZTA 5KKRC 4RC3A 3GU4A 5DFPA 2XNNA 3R00A 1M2PA 3UNZA 1WMKA 3R63A 4USFA 4FT5A 5M4IA 4PDYA 1SMHA 4G9RA 5BYYA 4NT4A 3ATSA 3QCXA 5FDPA 4AZVA 4IVAA 3FBVA 4DT9A 4D9UA 2VTRA 4J53A 5JQ8A 4I92A 3TUBA 5LARA 4GK4A 1O6KA 4F0GA 3EQIA 3QTUA 1A06A 2GS7A 3FLWA 4OGRA 3QLGA 4TWCA 5J87A 5AA9A 2GQGA 3QD2B 2W5AA 4I6BA 4OT6A 4RMZA 4DG3E 4A4OA 1SVHA 5IMEA 2JGZA 1Q8UA 1ZAOA 5BX0A 2W1EA 5B7VA 2B9HA 2XM8A 3SG9A 5AMNA 4JDIA 2OW3A 4FA2A 1WCCA 4C4EA 4ZSGA 2X7FA 3R7UA 2XJ1A 3JVSA 2W06A 2PVNA 5T68A 3FEGA 3DKCA 4RZVA 4QMLA 4ASDA 5HBEA 1V0BA 4E6DA 4MD9E 3TUCA 4X21A 1W8CA 4AA4A 3G6GA 5DRDA 3NX8A 5DEWA 5AUVA 4BCIA 2GNHA 2VWBA 2CGXA 4ANSA 5BUEA 2BAQA 4WKQA 1SYKA 2UW6A 1OZ1A 1DI9A 3G51A 1APME 4I6QA 4JAIA 2CMWA 2DYLA 2ITZA 5GIPE 4YHTA 3KULA 4RJ3A 4IADA 4XRLA 4AWIA 3E8NA 2XNEA 2W1FA 4OTIA 4ZTSA 3EZVA 4MQ2A 5HCXA 5FXRA 2W99B 2P55A 4MYGA 3ITZA 5CEKA 1B6CB 5EDRA 5IQBA 4U0IA 5CU2A 4GYGA 2GDOA 2O2UA 5GHVA 4CRLA 3W2PA 4UWYA 4X3FA 3MSSA 4L9IA 4BYIA 4E4NA 2J0MB 2WMQA 4RA5A 4BCOA 1STCE 2JKOA 3WZUA 3TDWA 3ZFXA 3V5QA 2EUFB 3BE2A 1WBWA 2F9GA 4R7IA 3GQIA 3AD4A 3SD0A 4J95A 3UQGA 4XX9A 4A9TA 5GJGA 4DF3A 3Q9WA 5AA8A 1G8JA 4ANLA 3QFVA 3E92A 5F1ZA 1Q41A 2X8DA 4YSMA 5KBQA 1YQJA 4FTJA 4MEDA 3LFEA 4BDIA 1F3MC 4DHZA 4R3RA 3U51A 4FZ7A 3CQEA 3PSCA 4ZTNA 4TN6A 3VS6A 3KU2A 4LRMA 1ZYSA 2J0JA 2EB3A 4GK2A 4PF4A 3Q52A 2YM5A 2GNLA 3BWJA 3A60A 4JX7A 4CGAA 4D4YA 4FGBA 2BDJA 1M2QA 3ORPA 4GT5A 3QTIA 4EK4A 5CSVA 3BE9A 2QONA 3I1AA 4Z16A 4Z7GA 1HOWA 4JLCA 4MVFA 4RIOA 3ODZX 2HZNA 4GL9A 2CLQA 2OF4A 4U43A 4V0GB 1O6LA 2J5FA 5A4CA 5EK7A 5CASA 2OK1A 3PY3A 4PL5A 4DHFA 2C1BA 3FXZA 4F1MA 1O6YA 1Q97A 3C4FA 5AP6A 1E1XA 2UZDA 5H3QA 1XMMA 4DN5A 5CSPA 3FHIA 3PVUA 5DVRA 3EZRA 2VNWA 4V04A 2XIKA 5CEQA 2PUUA 4I0SA 5IQAA 3V6RA 4QP4A 3EFWA 5C27A 4ZY5A 5FG8A 3QF9A 1XO2B 4QTBA 3VAPA 3ZOSA 3F66A 3QC9A 2C6TA 3ZXTA 3AD5A 4RIWB 2Z60A 1PJKA 2WMAA 4JVGA 4RGJA 4ZJIA 3ZUUA 2Y7JA 2QVSE 4CFNA 2HY81 1OL1A 2VWUA 3NUPA 1U59A 2YCFA 3QX4A 4XG9A 3RWQA 4D2RA 4QQCA 3DFCB 1ZXEA 3I4BA 2J2IB 2PZRA 2WFYA 2XYUA 5KMJA 1R39A 3UOLA 3HRBA 3C4XA 3KRLA 5H8EA 4EQCA 1PMNA 2WNTA 2YM3A 3HV3A 3GC8A 5LVLA 4FEXA 4BJJB 4NCTC 5KBRA 3FMJA 4JR7A 5C03A 3BI6A 3NDMA 1GAGA 4EJNA 1UVRA 2XM9A 3DLZA 3SXRA 5C4KA 2E9VA 1G5SA 2FH9A 3CKXA 2GPHA 2VGPA 3QA8A 3VO3A 5AM6A 4BDJA 2QOQA 2VRXA 3E63A 3QZGA 5HG8A 5BYZA 3ZM4A 3Q5IA 2R3PA 2CNQA 2R3MA 2WTDA 3DK7A 4BCHA 4EOKA 3NVKI 1O9UA 4XS2A 3VRZA 5D11A 4W4XA 2JD5A 2XA4A 2RFSA 3FZ1A 2XANA 4I6FA 2NNWB 4BCJA 3DBCA 1XBBA 3F3TA 3OBJA 4UXLA 5EYDA 1FGIA 4FK6A 3R9RA 2PZYA 5HO8A 3BL9A 3O23A 4FKLA 5DWRA 4M68A 4ALWA 4BTFA 4J52A 2PK9A 3CGOA 5J1VA 2XK4A 3H10A 4GJ3A 4ZY4A 3RNYA 4CNHA 3PY1A 3IDPA 4IM0A 4QP6A 4RZWA 1MRYA 4XG7A 2J4ZA 3F2AA 5CU6A 4MUQA 5HE3A 2H8HA 4GIHA 5CSWA 3PXQA 2X2MA 3MFSA 3PTGA 4RWLA 3KMMA 5L3AA 4UZDA 2Y4IC 4FODA 4X2KA 4XOYA 3FSFA 4PRJA 4DH5A 4C4JA 4FSZA 4L68A 2EWAA 3WF8A 4YR8A 4DEHA 4RX5A 2IVTA 1DS5A 4CFFA 2ITWA 5JGAA 1GIHA 3QUDA 3LKMA 3IOPA 2IWIA 3P86A 4BCFA 4C62A 4QDEA 4DT8A 2HK5A 2OH4A 4C4GA 4M8TA 5M09A 4BGQA 2YDJA 4FIGA 4U6RA 4DEGA 4RWIA 4DFXE 1W83A 4I22A 1GIIA 1Q8TA 4DEAA 1XHAA 3FY2A 3VONA 1H08A 2GHGA 3OP5A 3PVGA 4FG8A 4HGTA 4L01A 3LFBA 4Y46A 3FKLA 5AUUA 4XG4A 5AWMA 5D12A 5JFVA 3UP2A 2W0JA 3NGAA 3CC6A 4RPVA 3HA6A 2ZMCA 2CN8A 3LM0A 4M67A 4EOSA 3FMHA 2PVYA 2YAAA 1IAHA 3S95A 4AN3A 3RPRA 1JKKA 3UDZA 3A62A 5DRBA 4RVMA 4JS8A 2C0OA 2WPAA 5T6KA 2PZIA 2X7OA 4I94A 5D9HA 5FXQA 4CRSA 5IZFA 3HP2A 4L3JA 4RFZA 3KXMA 3CP9A 4I5CA 5CEPA 4N57A 3IQ7A 3CPCA 1Q61A 3LFSA 3PVBA 2VNYA 3RAHA 3SHEA 1MP8A 4CZTA 4XNEA 3IDBA 4S33A 3CIKA 3FJQE 5FTGA 4ENXA 4K11A 4I20A 2ZYBA 5IDNA 2UZLA 3P78A 5CEOA 3Q53A 2OH0E 2XNBA 2GHMA 1CMKE 4ARKA 4XBUA 4MNEA 5EYMA 1JSTA 4JR3A 3R1SA 2CKQA 1PF8A 4XP0A 5FEQA 2JIUA 2QOKA 4GUBA 5GNKA 3TKIA 5IF1A 5IH4A 2H6DA 2J51A 4NYEA 4JG7A 2H34A 4B9DA 5ETAA 2F49A 4U7ZA 3R83A 1WFCA 2JBPA 2G2FA 4G5JA 1SNXA 3S1HA 3H9FA 2QO2A 4M14A 4IQ6A 4QMNA 4ITIA 4Z3VA 4HPTE 4AGUA 2BZJA 3QQJA 4QMPA 3CQUA 2Z7LA 4FTQA 5EM7A 2ONLC 3VBXA 3OT3A 4OTWA 4RLLA 3LLAA 2WMUA 2BPMA 2OLCA 2FUMA 4LMNA 4LM5A 3ZEPA 2VTPA 1YDTE 5DT0A 3MWUA 3SQQA 5CF5A 3E8DA 3QD0A 2CCHA 1QMZA 5DI1A 4ALVA 4L43A 2VX0A 5HLWA 5IA3A 1FOTA 2XIYA 3SXFA 2O8YA 3D14A 3TCPA 4FV7A 5A4EA 4NWMA 4NTSA 3DB6A 4FEWA 1BL6A 3U6HA 4I3ZA 4UEUA 2XEZA 2YDKA 3LMIA 4LI5A 4F08A 4FVRA 3RHKA 3C4CA 4BN1A 3CD3A 4G3CA 5CSXA 2VWZA 3AGMA 3C5UA 1U46A 4YLKA 3UIXA 1OITA 4AAYA 3L8PA 3T3UA 3KCKA 2YCSA 5EHOA 4DFLA 1P5EA 4KS8A 4R3CA 4G3EA 3P4KA 3ZO1A 4ZAUA 3NUNA 5DPVA 1RDQE 3R7OA 4DCAA 2OIQA 3ZRMA 4IAZA 4EKKA 5ETFA 5ITAA 2X2KA 2XK9A 1IRKA 3NWWA 1UWJA 4NFNA 1KWPA 1LP4A 3GBZA 4QP7A 2NYAA 2C6EA 3IW4A 2WU6A 5H8GA 4B8MA 4EHEA 4EK8A 2W17A 1ERKA 5LVMA 4PMTA 4DDGA 4LL0A 3HP5A 2PMOX 4BIBA 3PG3A 3W2QA 3EH9A 3V5JA 3EQRA 1ZMWA 3BV2A 4I6HA 3UPZA 3L8VA 3JYAA 4C7TA 5EYCA 4LYNA 1UU7A 3OVVA 3PZEA 5HG9A 2ERZE 4JG6A 3RP9A 3ZZEA 5HNBA 5IA1A 1JPAA 4JQEA 5FGKA 5A4TA 2JEDA 2OJFE 4KB8A 3S4QA 5M4UA 2R0IA 2C5VA 3FQHA 3UYSA 4GH2A 5L8JA 3ZU7A 4C35A 2ZV2A 3UBDA 2YIRA 3NR9A 3BZ3A 4OR5A 1G8KA 3OCTA 4FKSA 4YBKA 2PMNX 4IX4A 4WD5A 1YXUA 4GG7A 5E4HA 5G6VA 2W4JA 1M17A 3E88A 3FC2A 3II5A 3DAKA 2I0HA 4FNXA 1K9AA 3EQBA 4RBLA 4MQ1A 4Y83A 3NIEA 5EDPA 3DGKA 3PFQA 3PXKA 3SG8A 4FKGA 5CZIA 4AAAA 1MQ4A 4BCQA 4PL3A 4RIXB 5M53A 4OTDA 4NKSA 4Y5HA 4Z9LA 3MI9A 3UOJA 4FV4A 4YPDA 3T9IA 3KF4A 3KC3A 1WZYA 3RAIA 5FUTA 3OFMA 3B2TA 1EH4A 4PNIA 1PKDA 2JKKA 4OUCA 5EHLA 3AMYA 3TZ8A 1A48A 1PHKA 3DCVA 3O2MA 4RJ7A 4K1BA 3FWQA 3R22A 4WA9A 5IPJA 3DJ7A 4KAOA 2P0CA 3BYOA 1DAYA 3ROCA 4RIYA 3W18A 3C4EA 1QPJA 4P4CA 3D5UA 1GNGA 4CLJA 2QOOA 2ERKA 1YHVA 1ZMVA 3GUBA 4TYHA 5B0XA 3PJ1A 3PJ3A 4YURA 2UZEA 3MV5A 4JT3A 5ETIA 2JFMA 4FNYA 1FBNA 1FMKA 3OTUA 4GCJA 4QP1A 3FLYA 1UNGA 2G01A 3V8WA 3T8OA 2YIQA 3O7LD 4N4SA 4U9AA 4NM3A 3BPRA 1AQ1A 2RGPA 4G6NA 1ZZ2A 3CTHA 4EZ3A 1PY5A 2PVJA 4ZY6A 3MH1A 1UU8A 3PPZA 3ZRKA 2R3HA 2W1CA 1L3RE 4IB0A 3GU5A 4MXAA 3LLTA 4CT2A 1V0PA 2VWWA 2BCJA 3NFFB 3OWKA 3OS3A 4D1ZA 2CJMA 4O7VA 2QHNA 4ZXTA 3TMOA 2FSLX 3RJCA 4A4LA 4QT1A 4BTKA 4IACA 4KINA 5E91A 3NNUA 2HCKA 4YC8A 3FPQA 4YZBA 1XBAA 3EL8A 2UW0A 1GOLA 4RWJA 4IC7A 4ANQA 2VTQA 2C0IA 4YHFA 3UNKA 3UVPA 2BALA 3POOA 2PVLA 4OTHA 3UYTA 4RT7A 4RJ4A 4ERWA 4DLIA 2XH5A 2JDSA 2BVAA 3I5ZA 1TKIA 4FI1A 4TYIA 3A7HA 4CTBA 3WI6A 4DYMA 3D5VA 3R8LA 1PXNA 2PSQA 4S32A 4HGEA 4X2GA 3BLRA 3GEQA 2ZB0A 4JQ8A 3BU3A 2QOFA 3UMWA 3P0MA 1Q8YA 4MBLA 1SNUA 3QCQA 3BBTB 4BDCA 1OL6A 1XR1A 3FV8A 4H58A 4MNFA 1FPUA 2X39A 4YC3A 5EQYA 4ZSEA 3RVGA 3TWJA 3TYKA 3HRCA 3WARA 5GINE 2IZSA 2JKMA 5HI2A 2BUJA 4CCUA 5FLFA 3PPKA 2GNFA 4FT0A 4X3FB 1KOAA 3R1QA 4X2JA 4U3ZA 4DDIA 4RX9A 5CXHA 5BYLA 3D7TB 4AW1A 2Y9QA 3FY0A 4Q2AA 3EQFA 3TNPC 2ZM4A 4L42A 4ONAA 4WUNA 4CEGA 3LQ5A 3AXWA 5KMMA 3UODA 3VVHA 4FZ6A 4UZHA 2VO7A 4KIOA 2X4ZA 2WELA 2XB7A 3ZONA 2ZV7A 4CKJA 3BGPA 4K9YA 1ZY5A 4PTEA 5IUGA 1OIRA 1REJA 3NYOA 2BTRA 3DKFA 3MY0A 4IC8A 4APPA 2R3FA 4MXXA 1YVJA 3AQVA 2B9FA 2CSNA 3OD6X 4FTKA 3CLYA 4ZTHA 4H3QA 3LFAA 2UW4A 2R3QA 3MTLA 3BCEA 3GT8A 1UU3A 4DFUA 3EJ1A 3BU5A 4LV8A 4JMQA 4F1OA 3DNDA 3MDYA 4PTCA 1IEPA 3Q9YA 4HGLA 2BIKB 3EMGA 5FM3A 5JRQA 3KK9A 2XNPA 5ACKA 4IB5A 1K2PA 4O84A 4TWPA 1P4OA 4J7BA 5L2IA 3DXPA 4CV8A 4E5BA 4XLVA 2YWPA 4QTAA 2R3OA 2WQNA 4JQ7A 5E90A 2XS0A 3PIXA 4I41A 1E9HA 1REKA 2AC5A 2V55A 3QC4A 1PKGA 4ALUA 5CALA 4DH7A 3OWLA 5I9YA 1OIUA 4S34A 2ZJWA 4D4SA 2YITA 3D5WA 1ZZLA 5EFQA 5CNNA 3TUDA 4FV5A 4IDTA 4ZZMA 4QNYA 2BR1A 3HECA 4AN9A 3LXPA 5K3YA 4FC0A 4USDA 3L9NA 3P7BA 4QYGA 1QL6A 4YJUA 3KGAA 4O91A 4RVKA 3M42A 2ACXA 3GCPA 2HZIA 2W1DA 3NYVA 4WG3A 4H1MA 4F6SA 4EBVA 3ZCLA 5JH6A 1H8FA 2UZUE 4MWIA 2HIWA 4F63A 4X0MA 1G8SA 1H1QA 4A9RA 4G3FA 4R78A 3OXTA 4FIFA 4IWOA 4ACHA 3ZFYA 2P4IA 5HU3A 4FNWA 5HVYA 3PPJA 2WTKB 1IA9A 4DFYA 3NCGA 5J9YA 2ZDUA 1CKIA 5IDPA 4JDHA 3DA6A 4EC9A 4XV3A 2VTMA 4NW6A 3WE4A 2IO6A 2ETMA 3O17A 3TJDA 1JKTA 2GTMA 1JLUE 4G3GA 4O7LA 3R9HA 3DKGA 4EJ7A 2XCKA 2LGCA 3KA0A 4FKWA 2F7XE 3TTIA 1JWHA 4AX8A 4V05A 3QTRA 3AG9A 3PZHA 4ERKA 4ZP5A 2PZ5A 2X9EA 1Y6AA 2UZBA 4X2NA 5FQDC 4CMOA 2IG7A 4O6LA 2W1HA 3MFUA 1BI8A 2XBJA 2QR8A 3BHUA 4WSYA 5KMNA 5H9BA 5EI6A 5HEZA 4DINA 4EORA 4O7YA 3UO4A 4BIEA 5CXZA 4N6YA 4TT7A 3OF0A 5LJJA 3U4WA 5CX9A 4YJSA 5D7VA 2YIWA 3U6JA 3O7LB 5DLSA 5AUZA 4I1ZA 3ET7A 1WBVA 3D0EA 3Q5ZA 3FZPA 3QD3A 5HLPA 3F3UA 3IW6A 3DBFA 3UDTA 3CD8A 1MQBA 5EKOA 3LHJA 3LXKA 3VS1A 4HJOA 4FBXA 4IX5A 3OCBA 4C58A 1WVXA 3IG7A 4AE6A 4BBEA 3KMWA 4IEBA 2VTOA 3R1NA 3SLSA 2Y8OA 3RK7A 5C1QB 3EN9A 5KUPA 2YIYA 3SOCA 5HHWA 3QRUA 4JBOA 3HMIA 3UG1A 5D41A 1KV1A 2ITVA 3HZTA 3QRTA 5I9XA 5AX3A 1BMKA 3ZSGA 3MFTA 3E8CA 4ACCA 2WMRA 4BTJA 2VTLA 2ZM3A 4M69B 3C7QA 3WE8A 5EW9A 3FI8A 5M57A 3C1XA 2HXLA 1XQZA 2P2IA 2YM4A 3A4PA 3FXWA 3ETAA 3OXIA 3HUBA 4IZAA 1J1CA 1Y6BA 2PUIA 4TWOA 5CU4A 3GU6A 2R5TA 2E9OA 4FV2A 4BCGA 3VBVA 1ZYCA 2O5KA 4DGGA 3DDQA 5AP7A 3EQGA 3SC1A 3RNIA 3P79A 3ANQA 5BUIA 4QYEA 4HZRA 3ACKA 4FTRA 1VR2A 3U6IA 4MD8E 3HL7A 1TFFA 1NVSA 2FYSA 3OG7A 4I5MA 4YO6A 3D4QA 1PXOA 5FTOA 4EEVA 4UX9A 2QOLA 4G3DA 5M51A 3OCSA 3P08A 2WTWA 2NRUA 5CF6A 4BICA 3G9LX 1PXLA 2R7BA 4FTIA 4JI9A 3ZSHA 4EK3A 4ZJJA 3HUCA 5TT7A 3TG1A 4AG8A 2PTKA 1YRPA 4FVQA 1U54A 5I4NA 4DEEA 2PL0A 3UG2A 3E64A 3CPBA 3G90X 3MH3A 3A2CA 3I79A 4IZ7A 4M13A 3QHRA 3V04A 4AZFA 4P2KA 2C1AA 1PMUA 1PXIA 5EKNA 4AXCA 2R3RA 4E6AA 4DH8A 4MH7A 3QYZA 4E20A 5AAEA 3DXNA 3KN5A 5GIOE 2YCQA 4PMMA 5FP5A 3U4UA 3NUSA 3BHYA 5CAVA 3LQ3A 2PVKA 4NU1A 3TZ7A 3U9NA 3UC3A 3UIMA 3FL5A 1LEWA 2ITTA 4AN2A 2FSOX 4QMMA 5LVNA 3VS3A 3VS2A 4AT4A 5IA0A 3IECA 3Q4TA 3Q6WA 3QAME 2WHBA 4XG3A 5EW3A