4AXFA

Insp5 2-k in complex with ins(3,4,5,6)p4 plus amppnp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
435
structure length
410
Chain Sequence
EMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICREGRPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 134
structure length 410
sequence length 435
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axfA01
4AXDA 2XAOA 4LV7A 4AXCA 2XAMA 3UDSA 4AQKA 4AXFA 4AXEA 2XARA 2XALA 3UDTA 2XANA 3UDZA
chains in the Genus database with same CATH superfamily
4U9AA 3AQVA 2C30A 1GIIA 2OFVA 4MXCA 2JKMA 3RVGA 2ZB0A 4ZTQA 2BIKB 2Y6OA 2B9JA 3Q5ZA 4ITIA 5KZIA 2PHKA 3MPAA 4Z7GA 3M11A 2BTRA 2R3IA 2FUMA 4FV1A 2GHGA 2OJGA 4F1OA 3SHEA 3TNWA 5EM6A 1ZMVA 1FVTA 3LFEA 4L7FA 4UB7A 1XH7A 4RIWB 3AKLA 5KMLA 2C1AA 4RRVA 3IKAA 2CMWA 3EOCA 5DEYA 4JT3A 4KNBA 2HAKA 2VZ6A 4OT6A 5AP4A 5B2KA 3KXMA 3VS7A 5CEPA 1XH8A 3TNPC 4QTBA 2UV2A 1Q8YA 2XARA 4KD1A 3GC0A 4YHFA 5CAUA 2VU3A 3EFJA 5LQFA 2I0EA 1TQPA 3FZRA 3RKBA 3C0IA 3PZEA 5T6KA 4XP0A 4XG8A 3WZEA 2C0IA 5DT3A 4ZEGA 3R73A 2Q83A 5CLPA 4YTCA 3UQCA 1ND4A 4NSTA 3G0FA 1PMUA 1PY5A 5CF8A 3TMOA 1Y8YA 3C7QA 4PF4A 3VAPA 3QGYA 4TYJA 2C3KA 2X1NA 2ZM3A 1Z5MA 3OWPA 4JBQA 3UQGA 4AE9A 2OXDA 3NRMA 3COMA 3KVWA 4XHKB 2UW6A 3C0HA 3QU0A 5DFPA 4FGRA 4E6CA 4H39A 4HYIA 5M08A 1PW2A 4Q5EA 4FIIA 4O7WA 5AP2A 5FBNC 5HLPA 3P79A 2WGJA 3UZRA 3VBWA 1G8KA 5CTPA 3AT3A 3P7CA 3MY1A 1YOJA 4ALWA 1M7QA 2WTWA 1SNUA 4AW2A 3QKKA 2OU7A 4EZ5A 5EI6A 2VTRA 4MHAA 4BCMA 3FV8A 3DGKA 2YHVA 2W05A 4O0YA 3UQFA 5AV2A 2R3JA 4O84A 5B7VA 2WO6A 2JLDA 4IAZA 3BE9A 5C8MA 4CFUA 5CT7A 3E87A 3W10A 4FT0A 3QZFA 2XKCA 1VYZA 1YW2A 4RC2A 3TWJA 3ZUVA 3ZM4A 2PZ5A 2JITA 4XUFA 4ZLZA 1VJYA 3EIDA 3GFWA 4PRJA 3EN5A 1JKSA 2J9MA 3F82A 4QP7A 4C3FA 5DOSA 1KSWA 4NJ3A 3WZKA 4YSJA 2R2PA 1L3RE 1PRYA 4LV5A 1URCA 4B8LA 4U42A 3IPHA 3WILA 1FBNA 4AU8A 2YZAA 4TZRA 2I6LA 5ANOA 3UMWA 4ACCA 1Q97A 3CS9A 1HCKA 2RIOA 4APPA 4BDAA 4OTFA 3FUPA 3UZPA 2F57A 3WF5A 4J96A 2VUWA 4EH8A 3PLSA 4TY1A 4KBAA 5ANDA 5F4NA 4ZTRA 1Z57A 4MK0A 3SX9A 3UYTA 4TKSA 4ITHA 1ZYLA 2OZOA 1PXPA 3GBZA 2BZHB 4YHJA 2GNFA 3H0ZA 4I93A 3AGMA 5HEZA 4QQ5A 3PFQA 3VS1A 1R0EA 4IBMA 2X8IA 5H2UA 3Q9WA 4QMNA 4TYHB 4F6SA 4CV8A 5B2LA 3UPXA 3DCVA 5JFWA 3AD6A 3RK7A 3GU6A 4IX6A 5IEXA 1UU8A 1CKJA 4FT7A 3UG2A 3DK3A 5C1QB 5C27A 4EORA 2WU7A 5HG9A 3EH9A 1DI9A 5HICA 5IUGA 2C5XA 2CKQA 1JSTA 3K5VA 1KV1A 1YXXA 2FH9A 2QU5A 4IVBA 4ZTNA 5EW3A 2CKEA 2E9NA 2WIHA 3W2CA 4UXQA 3V5PA 4IZYA 4F09A 3DAKA 4NUSA 1PYXA 3GCQA 4USFA 5EYCA 5BVDA 5J5SA 3JVRA 3DQXA 4FSRA 4L46A 3Q2JA 4BCQA 4BTKA 4Y95A 2OXXA 1B38A 4O81A 5AUXA 3VN9A 1F5QA 4M15A 4AA5A 5BVNA 3MV5A 4L44A 3FMDA 4N6ZA 4AOJA 4JRNA 1GZ8A 2CCIA 4CQEA 1MQ4A 4FSYA 2XIZA 4I1ZA 3HX4A 3G6GA 3LIJA 5DEWA 3FLSA 4R7IA 4DEIA 1WBWA 4R7BA 4FICA 4XLVA 2R3KA 2VTSA 4MNEA 3NAXA 3GCVA 1BL7A 3AMBA 4QMQA 4F6WA 1U5QA 1XMMA 3PPJA 2ZDUA 1S9IA 4AW5A 1H1WA 5IQCA 4BDIA 3L9MA 5KMMA 4GFOA 3LMGA 3NUUA 3DBQA 4F9WA 3RHKA 5AFVA 3EQDA 4KIPA 4FNZA 2GQGA 4ZS0A 4IC8A 5FEDA 1YDTE 2A0CX 2BROA 5CEOA 2BR1A 5AP5A 5JSMA 4N0SA 4E4XA 1K3AA 4C2VA 1YHSA 5HE0A 2OF4A 1UNLA 4QRCA 5HBHA 3QQFA 4ZSJA 3ZYAA 4AZTA 1YXUA 3UNKA 3DQWA 4XG2A 5CSPA 4FKPA 5KO1A 4O7SA 4GFMA 4QTEA 4DINA 4W4VA 4F7LA 2W5HA 3QA8A 1W98A 3G15A 4CZUA 3TZ8A 4FEXA 2Z02A 4A9UA 2YISA 4XS2A 4AE6A 4XBUA 4AN2A 4C4JA 4K2RA 4QTAA 3F69A 4WD5A 5DVRA 1XBCA 3R01A 3KXGA 1OGUA 3NUYA 4AN9A 1XWSA 4YLJA 5H3QA 1OIRA 2JFMA 3RGFA 5EQEA 3U54A 2YWVA 5DYJA 3MESA 1FGIA 4UWYA 5EHYA 4L45A 3MA6A 3SKCA 5AJQA 3LKMA 5J9ZA 3WE4A 2AC5A 1G5SA 2GTNA 2ITQA 2VO0A 5EI2A 3TT0A 4BI2A 3W8LA 1Q3DA 3KK9A 3RPSA 5M53A 4C62A 3PRIA 3PVUA 3QD4A 4O7VA 1AD5A 5AV3A 5FEEA 3HV6A 4WUNA 5DGZA 3IO7A 3OEZA 4JIAA 3ORKA 4QMOA 5CI6A 4YJPA 4CSVA 3SC1A 4BCGA 3QTRA 2F4JA 2ITTA 5HBJA 4DEDA 4EH7A 1V1KA 4K77A 2WMXA 2QURA 5I9VA 2XAOA 3O5AA 3PJ2A 5AAEA 3CXWA 2WHBA 4QQCA 3OOMA 1FVRA 1QCFA 1TQMA 2J0IA 4OBPA 3FI3A 5JT2A 4AOTA 3M2WA 1OL7A 4G31A 4FBXA 1OIUA 4EH4A 3PY1A 3LMHA 5AA9A 3FMNA 3H4JA 4DC2A 3JY9A 2NPQA 1STCE 4AW0A 4NH1A 4E26A 2XYUA 2Z8CA 3PUPA 3ZH8A 4E93A 5JFSA 4JL9A 3WARA 4IDVA 4M68A 4OGRA 3MI9A 4IWOA 4YJQA 5ANGA 5AV1A 3CC6A 4Q5HA 4YGAA 4Y83A 2PVNA 2CHLA 3R04A 5I0BA 1OECA 4X21A 3UO4A 4C4FA 3PY0A 1A9UA 2QO2A 2ZOQA 4FMQA 2V62A 2W17A 3ZC6A 4I24A 4CKJA 2QR8A 2OWBA 1O9UA 3QTQA 3FL5A 1MQBA 4FSMA 4G6NA 1PXMA 2Y4IB 3S95A 4MBIA 3QCQA 4XV2A 3F5UA 3GXLA 3P08A 4S32A 3P9JA 2GSFA 5A6NA 3KRJA 4BDBA 3V3VA 4PTCA 1J3HA 2UZNA 2GDOA 4YLLA 4H36A 2PE0A 4JDKA 4NFMA 3DJ6A 3ZO2A 1YOMA 4LQMA 3FJQE 2X2KA 4ZLYA 5E8WA 2W1IA 3UG1A 2JBOA 5ETFA 4RGJA 2J0KA 3DAJA 3E64A 2XNEA 4ZTMA 5KX8A 2VTIA 3LFBA 3F3WA 4XLIA 2ACXA 4PDYA 2PVLA 4YSMA 2YCFA 3G9LX 1ZYSA 3QTXA 4X3FB 2HZ0A 4C35A 5JRQA 3NVMB 2E9UA 3HL7A 4MH7A 5KMNA 3I7CA 3QZGA 4IANA 3MPMA 4FKTA 3R8MA 4EYMA 3EHAA 4USEA 4O0WA 4FZ7A 3ZLSA 4IFCA 4EOLA 2Q0BA 2CKOA 1OUYA 2PY3A 1KE8A 3R9HA 2PE1A 3VS6A 3ZBXA 2OKRA 4YPDA 4DGNA 4JIKA 3VQUA 3TL8A 2WOTA 2C3JA 1U46A 1PXJA 3QC9A 4K9YA 4FT3A 3R9OA 3DK7A 2W9FB 3BKBA 3I81A 4IW0A 4CV9A 4DA5A 3EN7A 4IWPA 2RFEA 2GFCA 1SVHA 3AG9A 3Q53A 4E73A 5FGKA 1W0XC 4QMVA 4D5KA 3P23A 3VRYA 5CEIA 3D14A 4U97A 3C4CA 4FT9A 4E8AA 2BPMA 3OS3A 3IW4A 4FA2A 4YUQA 2YM6A 4RWKA 3DXPA 4PMMA 4BDGA 2ITOA 5KUPA 5M4FA 3CE3A 3F5GA 4X3JA 4HZRA 3PJ3A 2OJJA 3TJDA 4RQVA 3ETAA 4E1ZA 4DG0E 1UV5A 4MWIA 5HCXA 4GT5A 3S00A 5JZNA 5CAOA 2GNIA 4LRMA 4MXAA 4WNOA 5HIBA 3OCTA 2UVXA 4FVRA 4HYUA 4O0RA 4CG8A 3LFFA 4ZZOA 2F49A 5FTGA 4RJ7A 1XKKA 3WZUA 2VRXA 3LXNA 2XH5A 3W55A 2WTDA 4HVGA 3ZO1A 3QYWA 4FKLA 3W0MA 4CFFA 5LWNA 4QMPA 4AZWA 4HVDA 4D0XA 2XM9A 4GKIA 4RA4A 1ST4A 4M84A 3S3IA 4U3YA 3DXQA 3ORZA 1M2RA 3OD6X 5D41A 4ZAUA 5M06A 5M44A 4ASEA 2VWZA 4UX9A 3OEFX 3QWKA 4BY9E 5HG7A 4GUEA 4IEBA 4O0SA 4OW8A 1YQJA 2A27A 2IVUA 4FI1A 3HP2A 3Q04A 3RWPA 3F6XA 5IA4A 1ZOEA 2BRBA 3DK6A 2QG7A 4FV2A 3ACKA 3HMMA 4V0GB 2YIYA 5F1ZA 1BI8A 3K2LA 2G1TA 2XJ0A 2PZYA 5AV0A 4EZ7A 3GP0A 4OUCA 1QPEA 1GNGA 1BI7A 3VS3A 2NRUA 3EFKA 3VONA 3COHA 3MN3A 4YC6A 2X6EA 2O2UA 3F66A 2HW6A 4K11A 1EH4A 3EKNA 4A4LA 4D9UA 4E5WA 4FYOA 4UYAA 3VBQA 3PWYA 3VRZA 3ZC5A 4EUUA 2Z60A 5EI8A 4GH2A 3N4VA 1B39A 2OI4X 5IQFA 3P86A 2P0CA 4X2FA 3I6UA 4IZ7A 3IW8A 1MUOA 4DF3A 3ORLA 4ALUA 1OL1A 3KU2A 4G5JA 4QMSA 4G34A 1GOLA 2R3MA 5ETAA 3HMOA 5H9BA 1LR4A 4RQKA 3KULA 3FXXA 3PXQA 4O96A 3KL8A 2A2AA 1QPCA 5KMJA 3RJCA 1GJOA 2W1EA 4RWJA 4BC6A 4USDA 4WKQA 5DPVA 4EH3A 4LL0A 4HCVA 1MP8A 5M4CA 1J1BA 4DHFA 4K8AA 4RLLA 1GY3A 3F2NA 3NX8A 4FV3A 4ASDA 4DT9A 4ZLOA 2ZM1A 4FKQA 2I1MA 4FV4A 3ORNA 2YCRA 2OSCA 2BILB 4LUEA 3VJNA 3QRTA 4NZWB 2VD5A 3EQRA 4G6OA 4I6FA 4XX9A 2GQRA 3R71A 4G6LA 4H58A 4NKAA 4XP3A 5IA5A 3W0SA 3A99A 3OXIA 2GNHA 2VTOA 1UA2A 3DT1A 5EYMA 1ZMWA 5TOZA 4EC9A 4QYHA 3LFSA 4G3GA 5HESA 3VS4A 4H3BA 1OI9A 1DAWA 5JK3A 1WBVA 4D1ZA 4FIGA 3BHUA 3NDMA 4DFXE 4EOSA 5LWMA 3D5VA 3FMMA 3R7YA 3O2MA 3EFLA 5FTOA 4LDTA 2W9ZB 4K33A 4V01A 4F99A 2YAAA 4O7LA 3DLSA 1ZYDA 3FHRA 3QQHA 4BHNA 5KKRB 1U59A 5AM7A 5GIPE 3BGQA 5IQHA 3OZ6A 1Y8GA 2BAKA 4YHTA 3RAHA 3MVLA 4L43A 5DBXA 4QMLA 4HGEA 2IWIA 4FTNA 4AZEA 4A4OA 1NA7A 4OTIA 1PYEA 2P55A 4FTJA 4EOOA 5HLNA 5DRBA 4DH3A 5HE3A 3IK3A 2Q0NA 4IC7A 2IW8A 4TPTA 3FZSA 2PU8A 4QYFA 4ZSEA 4BCKA 2QO9A 3CR0A 4LG4A 4O27B 5GINE 2Y7JA 4MD7E 4A7CA 2CSNA 4QP1A 2WMAA 1R0PA 1MRUA 1F0QA 2NRYA 3T9TA 1U54A 4FX3A 3FLWA 4UWCA 3JY0A 5IZFA 2BUJA 3BU5A 3IECA 4E4NA 3KGAA 5CZHA 2XNOA 3LFAA 3GC8A 4OR5A 2ZJWA 2EWAA 4AN3A 4C59A 2X39A 5AUWA 2ZV7A 4LL5A 2PYWA 1LP4A 2WMVA 4KS7A 4QT1A 4ZZMA 2GS2A 3NUPA 4A06A 3Q9YA 4ZTSA 5TF9A 1OIYA 1DI8A 3LOKA 2ETKA 3PTGA 3FDNA 3GQLA 2JC6A 3UODA 3KFAA 2XYNA 4FKGA 4BGGA 4D4SA 3SQQA 3DB8A 2ITWA 3SV0A 2JBPA 5EDRA 3BYOA 4O6LA 2QOCA 2UZVA 3FC2A 3BEAA 3BGPA 3FQHA 1WAKA 4L3LA 5AX3A 1BUHA 3F3UA 1H08A 3I4BA 3GC7A 5FXRA 2WU6A 3R8ZA 5BVFA 4GV1A 4D4VA 4FL1A 3FXWA 4QP2A 4HPUE 2PSQA 4DBXA 4L3JA 4ZTLA 3W2OA 2QOOA 4I4FA 4XP2A 1Y6AA 4IB3A 2BRHA 3OROA 2GMXA 3NCGA 5M09A 4RIOA 4I6HA 3VF9A 2OFUA 4QYYA 3BU3A 5IQAA 5L2TA 5CNNA 4BVUA 4O82A 1ZXEA 4U43A 4XCUA 3NUAA 4LGHA 3HP5A 3FMEA 4S30A 1UU7A 5EH0A 1SMHA 2YA9A 2ZB1A 4FKWA 3KVXA 4Y72A 4QMTA 2ITYA 4WBBB 2IN6A 4B4LA 2CJMA 3THBA 5IA0A 4UWBA 4GG7A 5FUTA 3D2IA 3LQ8A 4CCUA 2P2IA 5FBOA 3UOLA 3VQHA 4DFUA 3GFEA 4CLJA 3ZRKA 2UW5A 1OM1A 3E8EA 3QXOA 2JAVA 3EN9A 4LUDA 4RSSA 4BTMA 4F70A 4RPVA 2HCKA 5L8LA 5DG5A 4XNEA 2J50A 5H8GA 2YITA 3B2WA 4PDOA 4UZDA 4FNXA 1PMVA 3EQHA 5D1JA 4L9IA 5H8BA 2WEIA 3NLBA 3HKOA 4FKUA 3TUDA 2GS6A 2BIYA 3QUPA 1UWHA 5D7AA 4HVHA 4MTAA 4WBOA 2G9XA 3EL7A 1PXKA 5T3QA 3QQJA 3COIA 3A7JA 4X3FC 5CY3A 5DT0A 4YC8A 4JDIA 4AX8A 4YZBA 4BRXA 3P7BA 4RJ4A 4ZS4A 3LM0A 4EH5A 4M69B 4YTIA 4XV9A 3ULZA 4C0TA 4Q9ZA 4BCOA 4BIEA 1JWHA 3QD3A 3CCNA 3FZ1A 5E8SA 2XMYA 4Z9LA 3NUSA 3VNTA 3WIKA 4YO4A 5HO7A 3FQSA 3QXPA 4ANQA 4HNIA 4NTTA 4YMJA 4IJPA 5E9EA 4EOPA 4B0GA 4WNPA 3BL7A 3SG8A 3FY2A 5J9LA 3O50A 5CNOA 3R28A 5CI7A 3FKNA 2XJ2A 3C1XA 1B6CB 1ZMUA 1P14A 2CLQA 5LVPA 4AGCA 4ZMEA 5E92A 3TKUA 3RINA 4FZ6A 3PYYA 5KHXA 4Q2AA 4HPTE 3QBNA 2UZUE 3D7ZA 3KB7A 4ZP5A 2B52A 3CPBA 3TXOA 2EB3A 3UC4A 1KV2A 3L8VA 4FL2A 2J6MA 4R3RA 3UJGA 2IZTA 4BI1A 4ERKA 4X6QC 3NZ0A 1QMZA 3KA0A 3KY2A 5A4EA 3ZM9A 3BU6A 1ZZLA 4C36A 2QKWB 3ODZX 2OZAA 3VC4A 3H9OA 4KKHA 5AP1A 3U4WA 2ITVA 4GS6A 4CKRA 4TNDA 5D9HA 4F0IA 4Z16A 1TKIA 4XV3A 4KWPA 3TEIA 5AA8A 4JDJA 3R21A 2R7BA 3POZA 3HYHA 4FIHA 4KABA 4XH6A 2X2LA 3R8VA 2PTKA 3RPVA 3KULB 1M2PA 4EK5A 3U4UA 5KNJA 1NT2A 5JRSA 4C58A 3H9FA 3C5IA 3OXZA 4DCAA 1OBGA 4L52A 3TTIA 4P4CA 4DG2E 5FG8A 3ZS5A 5I9ZA 3PIXA 4G3CA 4DH7A 4HGSA 3E92A 4RX7A 3QTIA 4R7HA 3KK8A 3MTFA 3OF0A 3CSVA 3R2YA 5CVFA 3A2CA 4K0YA 2X2MA 4NYEA 3SAYA 4MWHA 3V6RA 4B99A 2QOBA 4EZ3A 5E8UA 4EOMA 2UZTA 3ODYX 1REKA 4IFGA 1GAGA 2O0UA 2C5NA 3LQ3A 4JRVA 1Z9XA 5KE0A 3R7VA 4LOQA 4U5JA 4J52A 3BYMA 4MXYA 5HX6A 2YAKA 2YM4A 2QONA 3LHJA 4TWNA 3ZHPC 2V0DA 4CT2A 3WF6A 4L01A 4CVAA 5HTBA 3GU8A 5BV3A 2WPAA 2C6LA 4XV1A 3RP9A 2ITZA 4GFGA 4BI0A 4O2PA 4I0TA 1CTPE 3OT8A 3RWQA 4FODA 3SXRA 4Y85A 5J8IA 3PLAE 3LCKA 5DWRA 4HZSA 4IAKA 1Q8ZA 2J0LA 5HZNA 2HXQA 4P5QA 2XCKA 4X3FA 4FKSA 4ZY6A 3VF8A 4FZFB 3Q32A 4C7TA 5JFVA 1P4FA 1JKKA 4DGMA 4FEWA 3C4EA 1JNKA 3NYXA 4PL5A 5C03A 4G3EA 4BYJA 2YACA 5LVNA 5DN3A 3CQUA 2RF9A 3OW4A 3PA4A 4ZJIA 5ACKA 3SRVB 3UDBA 4PDPA 3LXKA 4ANSA 4RLKA 3QGWA 4YZNA 5FLFA 5E8ZA 5FEQA 1KOAA 4AT3A 1OL6A 4DE4A 3H30A 3FLZA 5GHVA 5BUEA 3ZUUA 4GCJA 1DS5A 4EK6A 4MXZA 3MWUA 3TNHA 2EVAA 3C5UA 3ML1A 3P78A 4F1TA 4F9YA 3R30A 3CKXA 4E6AA 3Q4CA 3UOJA 3D0EA 4XG3A 1U54B 3JXWA 4D0WA 3I6WA 3MB7A 4RVTA 3QRJA 3QYZA 4O0XA 3MVMA 5DLSA 5E91A 3HUCA 2W5BA 2UVYA 4HOKA 4ANMA 1R3CA 4C33A 4LMNA 5LMAA 5M4IA 3KEXA 5ANKA 3NS9A 4U7ZA 4BB4A 4IJ9A 3AC8A 5AM6A 2PZIA 3QTSA 4FE2A 1UKIA 3UE4A 4BCIA 5AAFA 3QFVA 4XYFA 2VTAA 3FBVA 5HVKA 3QTZA 5KKRC 2LGCA 3ANRA 4F7NA 2J90A 4MBJA 2XALA 4FT5A 2R3LA 2QODA 3COKA 3EN6A 3HGKA 3TI1A 4NW5A 5EKNA 2FSLX 2GNGA 3EQIA 2QOLA 4FR4A 4BBFA 1ERKA 2C6DA 3D5WA 3MY0A 3A7IA 1OKYA 3VO3A 2XBAA 5BMSA 2BKKA 3AMYA 3GT8A 3LAUA 5C4KA 5K4IA 3PA5A 2XEYA 3RPOA 2CDZA 2ESMA 1R39A 3KRXA 2R7IA 3AC5A 4X7QA 5EK7A 3E5AA 4GK3A 4HCUA 3LPBA 4RMZA 4XG9A 5HVJA 3VJOA 1WBPA 5GNKA 4GL9A 5CF6A 3HVCA 3C4FA 3FSKA 5HG8A 2GPHA 2R3RA 3R83A 5HQ0A 4LV8A 4V0GA 4YZCA 4DFYA 4FVQA 3P4KA 1RW8A 2OBJA 3OUNB 4OTHA 4RC4A 5E8VA 3A7FA 3DJ7A 4ZOGA 1VYWA 4MUQA 1OUKA 4G5PA 3SOCA 4DEEA 4F65A 3DY7A 3GENA 3RAWA 3RK9A 1BYGA 2PWLA 4Q9SA 4R5SA 3L9LA 3D5XA 4QQTA 3BZ3A 3R8PA 4PMPA 5J9YA 3U6IA 2BVAA 2G15A 5CEQA 4FG8A 4QP6A 5LVLA 3PXFA 3VUKA 4DGGA 2B9FA 2PZRA 3OG7A 3GEQA 4IM3A 4EL9A 3A62A 1W82A 2BRGA 2XB7A 2ZDTA 4HJOA 1V0PA 2VX3A 4I23A 5EDPA 4CLIA 3SXSA 3WZJA 2I0HA 2WOUA 1FMOE 4QMMA 4FV7A 5IEVA 2J51A 3DV3A 4E4MA 1YI3A 4QYGA 3KXXA 5EDQA 3O17A 5CU6A 4AZVA 3ID6C 4YC3A 1PXLA 4N6YA 3L1SA 4O7YA 4U79A 3UNZA 4DDIA 4NTSA 4QP3A 4GT4A 3VUIA 3MIYA 1OB3A 5CASA 4FUYA 3EN4A 4NFNA 3RAIA 2VTLA 4JNWA 3KXZA 3CQWA 3R02A 4RVMA 1Q8WA 2XIKA 2XP2A 4F6UA 2GTMA 3UYSA 2UZWE 4U0IA 3W0RA 5J1VA 3KQ7A 4BF2A 4ORKA 2VTTA 3V5JA 3EZRA 2OW3A 4J97A 3V6SA 5B2MA 2E9PA 1TFFA 5E1SA 4C2WA 2X4FA 4FKIA 4PDSA 4OTDA 3BHVA 2YIQA 4R77A 1GIJA 1HOWA 2GCDA 2RFNA 1UKHA 3NYOA 4RJ6A 3W8QA 3ZTXA 4JAJA 4ZSAA 2B54A 1FOTA 1R1WA 3HZTA 3ET7A 5IUIA 3R1YA 1V0OA 2E2BA 2H9VA 2PVFA 2YIRA 3NYVA 4M7IA 4EC8A 4O7ZA 1W84A 3UP7A 4HGLA 3LM5A 3RCDA 4TYEA 4FIFA 4BZDA 3ORTA 5IF1A 2B7AA 5LXMA 3P1AA 4DFZE 2VTJA 3R2BA 3V01A 4O21A 2KULA 3CGFA 5GJFA 3OY1A 4RX8A 4YJOA 4AGDA 1CDKA 4NM5A 1RQQA 3FMLA 4B9DA 3ATSA 2XZSA 1H26A 4WO5A 3WZDA 1NW1A 3HV3A 5T68A 4ACMA 4DHIB 1H1PA 1XH5A 5EM7A 4I20A 4ASZA 1YXTA 3R1QA 4PWNA 3PP0A 4AUAA 1VEBA 4AT5A 3FL4A 4AA0A 4FKVA 4JX3A 3LZBA 5DR2A 3Q96A 3DKGA 3GI3A 4DHJA 1S9JA 2X81A 3DKFA 3WF7A 3PSBA 4FG9A 1LPUA 5FTQA 1XH6A 3TNQB 4ASXA 3HUBA 3AOXA 3KREA 4R3PA 2UZOA 2OZAB 4FTOA 3R7EA 3R1SA 4DITA 3E88A 4PMSA 2XK8A 4L00A 4U8ZA 4BTFA 2Y0AA 3BV2A 4BIDA 5BUIA 2C68A 3A4OX 2F7XE 1YVJA 4I41A 3TTJA 2QNJA 2WNTA 1DM2A 3Q2MA 4K1BA 1WMKA 2QU6A 4QP9A 5CT0A 4RC3A 5F94A 1JQHA 4O22A 4DBNA 4GJ3A 3ZDIA 2WMQA 1WCCA 3FLNC 5ETCA 5CEKA 2C1BA 1DAYA 2HY0A 1ZOHA 5CS6A 3O96A 4EHZA 2P33A 5D11A 5DRDA 2OLCA 4WHZA 3QQLA 4G16A 3BWFA 4J8NA 2OG8A 4J7BA 2RKUA 3FPMA 4QTCA 2PL0A 2DYLA 3U9NA 3V5WA 5A4CA 3IQ7A 2UVZA 5EOLA 3LJ0A 3ORIA 4X6RA 3QWJA 1BMKA 4EK8A 4I5HA 4QO9A 3LCSA 4IAFA 3GUBA 3E3BX 4DFLA 2HOGA 4IB5A 1AQ1A 1GZKA 2BDJA 2QOKA 3G5DA 4PQNA 1JKTA 2XK7A 4GIIA 4J71A 3RNYA 3QL8A 4NK9A 4JQEA 2RG5A 4IWDA 3L9NA 4FV8A 2PUPA 2PUIA 4MX9A 4D58A 3ZFYA 3GGFA 3L8SA 3WYYA 2ZV2A 3F7ZA 4UALA 5DIAA 5AMNA 5A9UA 1JSUA 2BRNA 2F2UA 4AW1A 4W8EA 4FSTA 3Q52A 2YM3A 3LW0A 3VUMA 1GIHA 4QTDA 4O0TA 2YDKA 3MS9A 5ITAA 5A54A 3TZ9A 2Z7SA 3DKOA 2I7QA 3CY2A 3HMPA 1Y57A 2IO6A 3VS2A 3TKHA 2IJMA 4NKSA 5IH6A 3W18A 5DI1A 2VN9A 4UV0A 2BAJA 4JR7A 5CYIA 2XJ1A 5ETIA 5BMMA 5IH5A 4F63A 4Z3VA 2PVHA 3QHWA 4E4LA 4FG7A 4FUXA 3UPZA 4RT7A 2IVSA 3KCKA 3Q3BA 5LARA 3UVPA 2AC3A 5IDNA 4AFEA 1Q61A 4LM5A 3WE8A 5L6PA 2O8YA 3UZTA 2HW7A 2JDTA 3BE2A 2UW3A 4BTJA 4GK4A 3OBGA 3BLRA 3ZSIA 1GZOA 2VNWA 2O64A 3OMVA 2CN8A 3UVRA 3DFAA 4IVDA 3PXKA 1H24A 2UW7A 5LMBA 2NP8A 3SDJA 4I21A 2WQBA 4DDGA 4W4WA 3FKLA 5A4QA 2YWPA 5IA3A 2R3OA 3DPKA 2QOFA 4WRSA 5E8YA 3BHTA 3DNDA 4YP8A 2XCHA 5CSHA 4O2ZA 1JSVA 2IW9A 3RHXA 4BKJA 4TN6A 1OZ1A 1ZYCA 4GW8A 4AXEA 3NNWA 1Q8TA 2PMOX 1YRPA 2QLQA 3NNUA 1JBPE 2QHNA 3QA0A 2Z2WA 4BJJB 3Q6WA 2FSMX 2I0YA 3R6XA 3O8TA 4HYHA 4GT3A 4FV0A 4BIBA 2V7OA 4WG3A 2XK6A 4QMYA 2WMRA 2B9HA 4FIJA 3GB2A 1IASA 2W7XA 5TT7A 1J7IA 4RZWA 4ARKA 3KMWA 4FTKA 2W1CA 3PY3A 4FEQA 4BCPA 5A4LA 1XH9A 4NJDA 4CRLA 2Z7QA 4R6VA 5IQDA 3T9IA 4C3RA 3U6HA 4ZIMA 3HRFA 4IAIA 4B7TA 5L2SA 4MQ2A 4FNWA 2PMLX 3OCGA 3QX2A 2Y9QA 3CLYA 1H27A 3AD4A 1P4OA 3W2QA 4XG4A 3LXPA 4V04A 3FMKA 1WVXA 3RM7A 3UO5A 2ITUA 4CFVA 5ANIA 2AEGA 2ETRA 1WBSA 1YI4A 3EYHA 3OOGA 4BZOA 2C6IA 3Q4UA 3OXTA 3W0NA 2UZBA 5LVMA 4ZY4A 3KRLA 4BDKA 3TUCA 1V0BA 4QMWA 4XG6A 2XK4A 3ZRLA 4NIFB 5G1XA 3G9NA 2VWWA 3JUHA 4FOBA 2JKOA 4M67A 1PXIA 3S0OA 4LYNA 2QKRA 2ZAZA 3QLGA 2UW9A 1H28A 4IVAA 3JVSA 4HVIA 3ZFMA 2PZPA 4J53A 3U55A 5M07A 3UMXA 4GK2A 5CXZA 3LVPA 4I4EA 1A06A 3LCDA 3CGOA 1Q4LA 3FWQA 1RJBA 3D94A 4MAOA 2VAGA 1PMEA 2RFDA 3ORMA 3ENMA 4IX3A 3NMUF 4WUAA 3ACJA 1OL2A 5CAQA 1XR1A 1YHVA 2G2IA 2X4ZA 3E3PA 3MBLA 4GU6A 4II5A 4KAOA 4YNOA 2HY81 3LXLA 4C02A 4YBKA 4JDHA 4BICA 2YABA 3R0TA 3ZXZA 1H00A 3LQ5A 3PJ8A 4G9CA 1ZY5A 1A48A 1SVEA 2OH0E 2PVJA 3MY5A 4X2KA 5CXHA 3I5NA 1OL5A 4LOPA 3QCSA 1CKPA 4NWMA 5KMKA 4MF1A 4QMZA 5FP5A 3OTVA 4PNIA 3BCEA 3IG7A 4ENXA 3VHEA 3BV3A 3TZ7A 1M7NA 2ERKA 4NCTC 5HVYA 3W2SA 2CNQA 3GU4A 3HRCA 4GVJA 3HDMA 4L68A 4IAYA 3DDQA 5FM3A 3T8OA 4F0FA 1UU9A 3EJ1A 3OVVA 4GVAA 4IADA 2G2HA 3BEGA 4NU1A 1I44A 4ZSGA 3BL9A 4ACDA 3S4QA 3Q5IA 4YNEA 4YPSA 4CTBA 4J8MA 1M17A 3PJCA 4TWCA 3D83A 2HZIA 2YJRA 1H07A 4EOJA 3R00A 2IW6A 3BI6A 4JMQA 4QPSA 4EOKA 1Y91A 2UZLA 5HHWA 4D9TA 3E8CA 5EQPA 4EEVA 2HZNA 3SRVA 5FM2A 5JEBA 3UVQA 3P7AA 2J7TA 4BDCA 5CF4A 5I9XA 4U45A 2BHEA 2C6TA 1KE6A 3VW6A 5B0XA 3VUGA 3F5XA 4RBLA 3UBDA 3V04A 2C3IB 5HTCA 3BYVA 1ZLTA 2B55A 3AD5A 3FI4A 4JBPA 4DTBA 3VBYA 5FDPA 5FXQA 3UP2A 2JKKA 4QPAA 4IH8A 3RNIA 3RPYA 3NGAA 4UY9A 4RJ3A 4YURA 4FNYA 2VTQA 3TYKA 2HWOA 2YCQA 3UDZA 4IACA 5JGDA 1IA9A 3GQIA 4R78A 4QMUA 3AC3A 3DBCA 1OKWA 4HGTA 3ERKA 3ZLYA 4PP9A 4RA5A 5M57A 2A19B 3C50A 2PVRA 3C4WA 5CSVA 3UNJA 2PPQA 3EYGA 3BRBA 3D2KA 3R63A 4H1JA 3B8QA 4RWLA 3JR1A 4CFXA 4UBAA 2OXYA 5KMIA 3PA3A 4BDJA 1KE9A 2VWYA 2CGUA 1YWRA 3EL8A 4OTQA 4EONA 2CLXA 2XM8A 1ST0A 4P2KA 4AAAA 4AGUA 2WEVA 3MFUA 4YJTA 3FQEA 1LEZA 3IOPA 3F3TA 4AF3A 3H0YA 4ENYA 4ZK5A 5IA2A 3CD3A 1IR3A 3PJ1A 2X0GA 3V8TA 2ZV8A 4FZDB 4I6LA 1NVQA 4TL0A 4IAAA 3AT2A 1H0VA 3P5KA 4M12A 2QLUA 5KMOA 3H9RA 5K3YA 3ZDUA 4A9RA 2VX0A 4G9RA 1J7LA 2JFLA 1MRVA 3R9NA 3OC1A 3JS2A 3GVUA 4DN5A 2H96A 4NCTA 2R0UA 5HCZA 4ITJA 3R1NA 1SM2A 1TQIA 2ZVAA 4FK3A 1YXVA 4GYGA 2C69A 4FKRA 4FL3A 1ZAOA 2I0VA 3ROCA 2VNYA 3QD2B 2XVDA 3F2RA 4I0SA 3UO6A 5TKDA 4EHVA 3KCFA 3QD0A 1J7UA 3I60A 2QHMA 5CAPA 3BPRA 3TM0A 5IQEA 4I92A 4TRLA 4BBMA 3JYAA 3SOAA 4GMYA 5HD4A 4RIXA 4BN1A 2FA2A 3QRUA 1YXSA 3E63A 3PXYA 4AA4A 4G3FA 2GNLA 4AG8A 3U51A 2F2CB 3E8DA 2VO7A 1BLXA 3QKLA 4PV0A 2XKFA 1ZY4A 1UU3A 3PP1A 2UW8A 3MW1A 3VS0A 4DTKA 1APME 3L8PA 1RE8A 4AQCA 3FZPA 4U3ZA 3OWJA 4RX9A 3ENHA 5HG5A 1H0WA 3G6HA 3GNIB 1PKDA 3CKWA 1JPAA 2KTYA 5DHJA 3PSCA 4MKCA 2PMNX 4A4XA 5M55A 3RALA 3IDPA 5LCKA 4BCJA 3RAKA 4HVSA 3BHHA 4O0UA 2OJFE 2R9SA 4AFJA 3ZLXA 4FTLA 1OPKA 2GHMA 1URWA 1ZWSA 5BPYA 5J87A 3ZO4A 2WMTA 3A4PA 3CTHA 4XRJA 5FDXA 1SZMA 2UW4A 4PL3A 5C26A 3O23A 4F78A 2PUNA 3W33A 4KIQA 2VWUA 5C9CA 5CU0A 3MVJA 1H1RA 1T45A 3KXHA 4RJ5A 4AWIA 3QALE 3SD0A 2YDJA 4DLIA 2XNPA 5FD2A 2IPXA 2WB8A 2F7EE 4HNFA 4R1VA 2WMSA 5IG1A 4R5YA 4FTRA 5IUHA 3Q60A 3GU7A 3CQEA 3F7WA 3CIKA 4NM7A 1YI6A 2HWPA 2YZLA 2XS0A 4IIRA 5E7RA 5K5NA 2AYPA 3ZEWA 4PNKA 4CMOA 4JG7A 4D28A 5IISA 3BELA 4TNBA 3ORXA 4NM0A 5CANA 3OUKA 1O6YA 3NW7A 4F64A 4AXCA 1PHKA 4QNAA 1XJDA 2BKZA 2OK1A 4FIEA 1Q5KA 4D55A 3KRRA 3QUEA 4CMUA 4DLJA 4O83A 4C61A 4Y73A 2YM7A 4TW9A 4MYGA 2XF0A 3CD8A 3DB6A 5J7HA 2ZM4A 4EUTA 4D2RA 4EH2A 1QL6A 3HECA 2C5VA 5E8TA 5A3XA 4ALVA 3KMMA 3HAVA 3KIOC 4BDEA 1TVOA 4CFMA 4PUZA 2JIVA 4M97A 2W1DA 3R7UA 4EI4A 4X2GA 2ZV9A 3ZLWA 5D10A 4DT8A 2BDWA 3QX4A 3LJ2A 1PXOA 4EQUA 1M2QA 5F20A 1ATPE 3WOWA 4S31A 2XBJA 3AT4A 2YDIA 4EKLA 4H3QA 2JGZA 3A8WA 3EB0A 3MYGA 3QKMA 2OIQA 4PL4A 1ZZ2A 3VUDA 5KHWA 4PP7A 4ANLA 3IGGA 4QYEA 5CALA 2R3FA 5AEPA 1XO2B 3F9NA 5FP6A 3AC4A 2QVSE 3ZOSA 3I5ZA 3UDSA 5JFXA 3O8PA 4LMUA 3BQRA 4H3PA 3B2TA 1WVYA 2B9IA 3G90X 3LFQA 1XQZA 3BGZA 4JBVA 2V7AA 2OGVA 2GFSA 3GOKA 4FTUA 3T3UA 2RG6A 3HMIA 2WTVA 1OPJA 3KC3A 3V5QA 3WBLA 1WVWA 1FVVA 5CSXA 2BZJA 3GOPA 2X8EA 5HGIA 1WBOA 2WMUA 5CVGA 4F0GA 4I0RA 3C9WA 1K9AA 3GCSA 4I94A 4BR3A 3MH1A 4M0ZA 4QP8A 2LAVA 4FYNA 5JQ8A 3DBDA 2R3HA 4FSUA 4IDTA 4N70A 4FSZA 1NXKA 5D7VA 4ZJJA 5KCVA 4CGAA 3I1AA 3HEGA 5EHOA 2WZJA 3DAEA 4QEBA 4E6QA 1ZRZA 2SRCA 4LI5A 3UDTA 3QUDA 3D9VA 4YTFA 2WKMA 4RVKA 5EHLA 2G2FA 4ID7A 4L7SA 4F4PA 5BYYA 3K5UA 3D15A 2W1ZA 3LFCA 4CRSA 3KN5A 4E5BA 2E9VA 3H10A 4WT6A 2C5YA 5DT4A 2BCJA 2JDOA 2OJIA 2UZDA 3PZHA 4M0YA 3UIMA 4YR8A 3AMAA 3I0OA 4PX6A 4FV6A 3UGCA 1OITA 4C38A 3LCTA 4AACA 3CJGA 4RG0A 5HORA 3DKCA 4UEUA 3I79A 3QQKA 2P4IA 5H8EA 4DFNA 2VWIA 3S2PA 4EWQA 3DA6A 3RCJA 5G6VA 2EU9A 5JGAA 5JN2A 5CENA 4C4IA 1PJKA 1YHWA 1W83A 4E5AX 4MCVA 3VHKA 4AZSA 4XRLA 5AP6A 3ORPA 4K18A 3RZBA 5IQGA 3D5UA 4DH8A 2C4GA 3NIEA 5IA1A 2A1AB 2Y4PA 3NSZA 4ZSLA 2VGOA 4Y46A 4XEYA 4C4EA 5CVHA 4YJRA 1LEWA 3FLYA 3OY3A 3MVHA 4MNFA 3V8SA 3E7VA 1P2AA 2BZIB 3HV4A 4FJVA 3TDVA 2PVYA 4ACGA 2Z7LA 4AXFA 5CF5A 5M4UA 3BYSA 3QRIA 3NCZA 5BUJA 1OKVA 2XUUA 4JG8A 3VBVA 3DTCA 2IZSA 2ZFYA 2C6KA 1U5RA 1OPLA 5EW8A 5LMKC 4BJJA 4S33A 3ZONA 4KS8A 3QRKA 3C0GA 2WD1A 3MJ1A 4IQ6A 5KZ0A 4KUJA 3TG1A 3W2PA 5AUZA 5IU2A 1YKRA 3LFDA 3SXFA 2ONLC 2UW0A 4H1MA 5DR6A 4JS8A 2X6DA 4S34A 1G3NA 2Y8OA 4YZMA 4F9AA 1BKXA 5IDPA 3TIZA 4AT4A 3EWHA 3JPVA 4MBLA 5DA3A 4L8MA 1XBBA 3IW7A 4EK3A 2OO8X 2V5QA 3H3CA 3OBJA 2JEDA 3PPKA 2OJ9A 2NO3A 3PWDA 4TTHB 4AQKA 4EK4A 1KWPA 4U80A 5IEYA 1M52A 5LOHA 4RIYA 3Q4ZA 4DEBA 3ATTA 3V5LA 2PVMA 2B4SB 3IDCA 2UZEA 4FV5A 4YZ9A 2VTPA 4MEDA 3IW6A 2ZYBA 4NL0A 5HI2A 4IHPA 4ZY5A 3R9RA 3V5TA 2XRUA 5A6OA 5JMSA 4EH6A 5K4JA 2WTKC 2O63A 4CT1A 4KKGA 3TDWA 5HE2A 3NFGB 4G3DA 3BQCA 2VTMA 3G51A 3HMNA 4YLKA 3QQGA 3MFRA 3AC2A 1GZNA 3ZBFA 4RIXB 3O7LB 1W7HA 4GUBA 2VTHA 2B0QA 4IVCA 3Q9XA 4IE9A 1VLRA 3QTWA 3TN8A 2CN5A 4UXLA 3EQBA 3MFTA 1KUTA 3L9PA 3ZZEA 3ZSHA 2P2HA 5JKGA 2CNVA 2Y6MA 3TUBA 2OF2A 3F88A 4EJ7A 3U87A 4LOOA 3L8XA 3SGCA 4B6LA 1OBDA 2B53A 1PMNA 1SVGA 4NT4A 4F9BA 3EFWA 3E93A 1CSNA 1XBAA 4V05A 5J95A 4FTIA 5DH3A 2BFYA 2WTIA 3LE6A 4CG9A 3ZEPA 1O6KA 3D7TB 4J95A 2XEZA 4TYGA 4XG7A 2J5FA 3PE1A 2IVTA 1KE5A 2X7OA 4FTQA 4RX5A 2VV9A 3EKKA 4ZTHA 3TCPA 4RJ8A 5A4TA 2WAJA 3V51A 1OMWA 3MA3A 4BZNA 4U81A 4PTEA 1AGWA 1XMLA 2WQMA 3NFFB 5CWZA 4Y5QA 5L8KA 5CQWA 5BVOA 4QDVA 1Q3WA 3DLZA 4KINA 2P3GX 2WXVA 3GC9A 3HLLA 2VO3A 4M3QA 1LUFA 2QC6A 4WNKA 3NEWA 3FKOA 4EWHA 3IONA 4I5PA 1Q41A 4UZHA 2VWVA 1REJA 3EMGA 3NW5A 3MH2A 4L67A 4IX5A 3N4TA 3QC4A 5HE1A 4UN0C 4GU9A 1VZOA 3NWWA 2QCSA 3BIZA 4JAIA 4P7EA 2HYYA 3O7LD 4TWOA 1U4DA 5CX9A 3VIDA 3OCBA 3W1FA 1WBTA 3QZIA 3ROYA 4LV7A 4KBCA 4FTTA 3C13A 3CBLA 4HYSA 5AUYA 1PF8A 1J91A 3W0PA 5JZJA 3SA0A 2JDVA 2ZMCA 2XNGA 4D1SA 2Z7RA 2ONLA 3BLQA 5BVKA 2WMWA 2DUVA 3G33A 5AUVA 2XANA 4DHZA 4K6ZA 2G01A 4C34A 1IEPA 5LCJA 2OH4A 4QQJA 5ACBC 4YZDA 3ELJA 4IB1A 3PRFA 5E1EA 4DTAA 3UOKA 2PUUA 4BDFA 3MJ2A 4FV9A 5I9YA 1XH4A 3SW4A 1WZYA 2REIA 3NYNA 3OWKA 4P90A 4YBJA 2DWBA 5HCYA 3LFNA 4AAYA 1PXNA 2EXCX 2VX1A 3BHYA 3QCXA 5E4HA 4ACHA 4X2JA 4DGOA 5GJDA 2OICA 2X9FA 4QP4A 3W2RA 4F9CA 4UYNA 5CSWA 3IDBA 3DTWA 2PK9A 4MD9E 3PIYA 2VWBA 1E1VA 1WFCA 4OT5A 2H34A 4WRGA 4LFIA 2HIWA 4D4RA 1NVRA 4CTCA 4WNMA 4D2SA 4ONAA 3FYKX 5JH6A 3RM6A 2R3QA 3OP5A 5AUTA 1R78A 2IVVA 2ERZE 2YM8A 2XIYA 4KA3A 2XK3A 4KB8A 4L3PA 2W1FA 4ERWA 5BYZA 2PMIA 1IA8A 2QOIA 2R4BA 3PPZA 2J0JA 3SLSA 2BFXA 2W5AA 3BX5A 1UNHA 3AGLA 4EQMA 5EKOA 3Q4TA 4RFZA 5AUUA 3NR9A 3I0QA 5KBRA 3II5A 4I5MA 1CMKE 3RK5A 3MIAA 3ALNA 4FKOA 2CGWA 1OVEA 3P0MA 1QPJA 3F61A 2O5KA 2E9OA 3CPCA 3G2FA 1JAMA 4BBEA 3E7OA 3ZMMA 4CD0A 3E62A 4QOXA 4LRKA 2XNBA 3CP9A 4JX7A 3DNEA 5DE2A 2JD5A 2JDSA 3MB6A 4YTHA 3OFMA 1OGYA 5BVWA 3QLFA 2IG7A 2W06A 4JLCA 4GG5A 1F3MC 2R64A 2O3PA 3DZQA 2WQOA 2HENA 4OTRA 1FPUA 3HV7A 3DS6A 2FSTX 2C5OA 4CNHA 5HIEA 4TWPA 2X9EA 2YCSA 5EQYA 5AIRA 2WQEA 2WTCA 4O0VA 1NVSA 4O86A 5CU2A 2YN8A 3QQUA 2C0TA 4JG6A 3OHTA 5HNBA 5TO8A 4I6QA 2HELA 3VBTA 3DJ5A 3I7BA 3A61A 3VUHA 4E7WA 3DBEA 3BLHA 4DG3E 3WF9A 5HNIX 3W0QA 3KRWA 4GKHA 3VWAA 3O8UA 4CFNA 3ZRMA 4EHGA 3GU5A 4EOIA 4MVFA 4W8DA 2YJSA 4U44A 4FSWA 3BBTB 3OWLA 3POOA 3ZO3A 3UIXA 4IZAA 5CU4A 3MPTA 2IZUA 5JQ5A 4OTWA 3KXNA 2XA4A 4CXAA 3EZVA 3GCPA 1E9HA 1WBNA 2CGXA 4TXCA 4EKKA 5L2IA 4KBKA 1QPDA 4CMTA 3FLQA 3VULA 3IS5A 3CY3A 3UOHA 5EYDA 2W96B 3IGOA 4DCEA 3TNIA 4JJRA 3PVWA 3FI8A 4XOZA 4CKIA 2ITXA 2WQNA 1FGKA 2YIWA 4O91A 4FSQA 4AOIA 3EQGA 4U6RA 2QOQA 4I22A 3S1HA 1G8JA 3U6JA 4GRBA 3P5JC 5AP0A 3MH3A 5AAGA 2BDFA 2W99B 3A8XA 4PMTA 3ZFXA 3DU8A 5ANEA 1SNXA 3BLAA 1ZOGA 3TJCA 4E6DA 4HW7A 1BL6A 2W4OA 3R8UA 2CCHA 4EH9A 4JQ8A 2X7GA 1Q24A 3NUNA 4FZAB 4FTCA 3TV4A 1FINA 1K2PA 3HDNA 4PY1A 4EOQA 2XKEA 3D4QA 4GIHA 4FEVA 4W4YA 4WOVA 2R3GA 4RIYB 2WMBA 3R7OA 3OW3A 3MGYA 3ZXTA 3UIUA 3R7IA 3TKIA 1OIQA 3FC1X 2PVKA 2QOHA 4FGBA 3EQCA 3NUXA 3HAMA 4ZZNA 2HK5A 2HXLA 4WIHA 3RMFA 4A07A 3OT3A 4G2FA 5M56A 1I09A 4GYIA 3ULIA 4QMXA 3FE3A 3QTUA 5AP7A 3SW7A 3QAME 2WELA 4JBOA 1FMKA 1UVRA 3PE2A 4MNEB 2C6EA 4KIOA 3WYXA 3RPRA 2GS7A 1O6LA 3KF4A 5CU3A 5M51A 4X2NA 2XNNA 4BDHA 2BZKB 5IMXA 3NNXA 4RIWA 5I9WA 4AXDA 3C4ZA 3OCSA 2FSOX 5J1WA 1YWVA 3PXZA 3RI1A 3QZHA 3MSSA 3K3JA 2ETMA 2QR7A 3O51A 3VS5A 1Q8UA 2RL5A 4QDEA 2GNJA 2AUHA 3REPA 4B8MA 3W0OA 3NW6A 4D4YA 3LMIA 1UWJA 5HU3A 1JLUE 2C3LA 4YJNA 4CCBA 1L8TA 2FVDA 3HNGA 1IAJA 4WG5A 5F95A 1X8BA 3ANQA 4EQCA 2JAMA 3ZSGA 4PTGA 5EM5A 2J5EA 4CFWA 5KBQA 5CEMA 3AC1A 4YJSA 4WSYA 3FXZA 5IQIA 3VVHA 4A9TA 3PIZA 3R22A 2VO6A 3KKVA 4GSBA 1Y6BA 2GQSA 2UUEA 3IOKA 3LJ1A 2GU8A 3NIZA 4KRDA 4MD8E 4BCFA 3K54A 4JVGA 3NPCA 4L42A 3CEKA 4I3ZA 4D5HA 1HCLA 1Q99A 5FXSA 2PE2A 3PG3A 4W4XA 5HU9A 4N4SA 5BYLA 5A46A 1BX6A 4IM0A 4BHZA 2BAQA 2X7FA 3QHRA 3FZOA 2J4ZA 3VW8A 5HX8A 5EFQA 3FYJX 3M42A 4EBWA 1E1XA 2RFSA 1CM8A 5L6OA 2C6MA 5C8NA 2EXMA 2RGPA 3T3VA 3TV6A 4YJUA 5I5ZA 4F08A 1YDRE 3A7GA 2XK9A 2J2IB 3DDPA 1H25A 3DXNA 4R1YA 5ANJA 4C4HA 2IZRA 1H01A 2YIXA 3BWJA 4FOCA 3FEGA 4RFMA 4Y8DA 3PUFC 4JR3A 5HKMA 4O7NA 4BYIA 4R3CA 1G8SA 2VGPA 4C37A 2EB2A 4JQ7A 3LLAA 2GHLA 1NY3A 5AP3A 5HNGA 5L3AA 4EYJA 4JOAA 4AZFA 2JDRA 1XHAA 3FHIA 3ALOA 3RTPA 2F9GA 3AKJA 2FB8A 2WIPA 4BCNA 3ZZWA 4ZJVA 5AV4A 1T46A 3LCOA 4ZXTA 2YM5A 3N51A 4OBQA 1P5EA 3F5PA 3NAYA 2H8HA 4BGQA 4L6QA 4M13A 4MXXA 4U41A 3O0GA 4DFBA 4RVLA 2ZMDA 2X8DA 3W32A 2YERA 2R3PA 2BALA 3Q6UA 4YO6A 4C4GA 4CZTA 4CEGA 3DOGA 2JKQA 3U8WA 4F7JA 3E8NA 1J1CA 3ITZA 3AKKA 3KMUA 4O38A 2J0MB 2XNMA 4DEAA 5EYKA 3VBXA 4BGHA 3A7HA 5EOBA 2B1PA 5AADA 5L2WA 3DFCB 3TIYA 4NM3A 1YWNA 1IG1A 5K5XA 1IRKA 2FYSA 3HA8A 3F3ZA 5CAVA 5HO8A 3FPQA 3C4XA 4H05A 4AGWA 1H1QA 3BBWA 5C01A 3WIGA 5D12A 4RFYA 2WTKB 3FZTA 4XBRA 5CQUA 1OKZA 2YFXA 4MQ1A 5IPJA 4G17A 3PXRA 2ITPA 4KSPA 4TYHA 3R8LA 3UTOA 5JGBA 3KN6A 3AXWA 3QF9A 1YDSE 1JVPP 4Z55A 5BNJA 5C8KA 4GEOA 3HV5A 3BYUA 3PVGA 4G1WA 3WF8A 2W4JA 4YU2A 5GIOE 4ANBA 4A9SA 2C0OA 4AP7A 4O7TA 4ZMFA 3PG1A 3C51A 3DZOA 5I9UA 4DEHA 4HCTA 3R9DA 5EM8A 4APCA 1YOLA 2ITNA 2V22A 4KSQA 5FRIA 2QD9A 5IMEA 3TV7A 4BDDA 3CTQA 2R3NA 5HIDA 2EUFB 4L53A 5IH4A 5K9IA 3OTUA 3TZMA 4FTMA 5A14A 3SG9A 4JI9A 5HBEA 2PULA 4IMYA 1JOWB 4TT7A 4AXAA 1PKGA 3M1SA 4E20A 5LMKA 3NVKI 2C6OA 2NYAA 4LRJA 3IW5A 2XIRA 4XOYA 3FSFA 1H4LA 2BHHA 3FY0A 3MFSA 4O6EA 5E90A 2R0IA 5E8XA 3FI2A 4N57A 1RDQE 2CKPA 4DH1A 5L8JA 3KF7A 5L6WL 3FMHA 3EQPA 5EW9A 4OBOA 1M14A 3UIBA 4C3PA 5GJGA 2CPKE 4D1XA 5CZIA 4IM2A 4M8TA 5ICPA 3ZCLA 4EBVA 3TACA 4DH5A 4S2ZA 2JIIA 4A9YA 1G8AA 4EHEA 2W1HA 3NNVA 4RWIA 5F9EA 3CJFA 4YJVA 4MXOA 4J98A 4LGGA 3HRBA 3K3IA 3PVBA 4GJ2A 2O65A 2XIXA 2WTJA 1FQ1B 3Q9ZA 2CGVA 3UC3A 2CNUA 2W1GA 3HA6A 1CKIA 4EJNA 4KKEA 1MRYA 3FMJA 4OLIA 5LJJA 3ZUTA 2W0JA 1H1SA 2Y4IC 2OIBA 4DEGA 5BX0A 2QG5A 4WG4A 5BQ0A 4I5CA 2BRMA 2DS1A 5I4NA 1VR2A 4U40A 4M14A 1Q62A 3DBFA 3MH0A 3B8RA 2DQ7X 2FGIA 2H6DA 4BCHA 5LVOA 2F7ZE 3D7TA 3PSDA 4FEUA 4JXFA 1ZARA 3W16A 3CTJA 4TYIA 2BTSA 2W4KA 4RZVA 1H8FA 3WI6A 3ZU7A 4I6BA 3FAAA 4XMOA 3MTLA 4J1RA 3N9XA 2YEXA 2V55A 3N4UA 4IB0A 5FQDC 4DYMA 2QO7A 4DAWA 1ZYJA 4Z7HA 3QCYA 1W8CA 2VTNA 1JKLA 2R5TA 4FSNA 2VWXA 5DNRA 2QQ7A 3EQFA 2OIDA 2BMCA 3PFYA 4KRCA 3V8WA 5AX9A 5BVEA 4IX4A 4NW6A 2FO0A 1SYKA 4FC0A 4WA9A 4FKJA 4IWQA 5IQBA 4AS0A 4FK6A 5C4LA 5AWMA 3GCUA 2QI8A 2HZ4A 3F3VA 5TR6A 1UNGA 1IAHA 2XRWA 4FVPA 4P5ZA 5EG3A 5AIKA 1KE7A 3PDTA 4IZ5A 1KOBA 2JIUA 2XKDA 4QNYA 4X0MA 2XAMA 4Y5HA 5DR9A 3U9CA 5HLWA 2A4LA 2WFYA 3G0EA 3SVVA 2C47A 3LLTA 3MDYA 3O71A 4FTAA 4XJ0A 4J99A 4OTGA 4O7RA 3A60A 3F2AA 4F7SA 2I40A 2NNWB 4F1MA 5HD7A 4DGLC
chains in the Genus database with same CATH topology
4U9AA 3AQVA 2C30A 1GIIA 2OFVA 4MXCA 2JKMA 3RVGA 2ZB0A 4ZTQA 2BIKB 2Y6OA 2B9JA 3Q5ZA 4ITIA 5KZIA 2PHKA 3MPAA 4Z7GA 3M11A 2BTRA 2R3IA 2FUMA 4FV1A 2GHGA 2OJGA 4F1OA 3SHEA 3TNWA 5EM6A 1ZMVA 1FVTA 3LFEA 4L7FA 4UB7A 1XH7A 4RIWB 3AKLA 5KMLA 2C1AA 4RRVA 3IKAA 2CMWA 3EOCA 5DEYA 4JT3A 4KNBA 2HAKA 2VZ6A 4OT6A 5AP4A 5B2KA 3KXMA 3VS7A 5CEPA 1XH8A 3TNPC 4QTBA 2UV2A 1Q8YA 2XARA 4KD1A 3GC0A 4YHFA 5CAUA 2VU3A 3EFJA 5LQFA 2I0EA 1TQPA 3FZRA 3RKBA 3C0IA 3PZEA 5T6KA 4XP0A 4XG8A 3WZEA 2C0IA 5DT3A 4ZEGA 3R73A 2Q83A 5CLPA 4YTCA 3UQCA 1ND4A 4NSTA 3G0FA 1PMUA 1PY5A 5CF8A 3TMOA 1Y8YA 3C7QA 4PF4A 3VAPA 3QGYA 4TYJA 2C3KA 2X1NA 2ZM3A 1Z5MA 3OWPA 4JBQA 3UQGA 4AE9A 2OXDA 3NRMA 3COMA 3KVWA 4XHKB 2UW6A 3C0HA 3QU0A 5DFPA 4FGRA 4E6CA 4H39A 4HYIA 5M08A 1PW2A 4Q5EA 4FIIA 4O7WA 5AP2A 5FBNC 5HLPA 3P79A 2WGJA 3UZRA 3VBWA 1G8KA 5CTPA 3AT3A 3P7CA 3MY1A 1YOJA 4ALWA 1M7QA 2WTWA 1SNUA 4AW2A 3QKKA 2OU7A 4EZ5A 5EI6A 2VTRA 4MHAA 4BCMA 3FV8A 3DGKA 2YHVA 2W05A 4O0YA 3UQFA 5AV2A 2R3JA 4O84A 5B7VA 2WO6A 2JLDA 4IAZA 3BE9A 5C8MA 4CFUA 5CT7A 3E87A 3W10A 4FT0A 3QZFA 2XKCA 1VYZA 1YW2A 4RC2A 3TWJA 3ZUVA 3ZM4A 2PZ5A 2JITA 4XUFA 4ZLZA 1VJYA 3EIDA 3GFWA 4PRJA 3EN5A 1JKSA 2J9MA 3F82A 4QP7A 4C3FA 5DOSA 1KSWA 4NJ3A 3WZKA 4YSJA 2R2PA 1L3RE 1PRYA 4LV5A 1URCA 4B8LA 4U42A 3IPHA 3WILA 1FBNA 4AU8A 2YZAA 4TZRA 2I6LA 5ANOA 3UMWA 4ACCA 1Q97A 3CS9A 1HCKA 2RIOA 4APPA 4BDAA 4OTFA 3FUPA 3UZPA 2F57A 3WF5A 4J96A 2VUWA 4EH8A 3PLSA 4TY1A 4KBAA 5ANDA 5F4NA 4ZTRA 1Z57A 4MK0A 3SX9A 3UYTA 4TKSA 4ITHA 1ZYLA 2OZOA 1PXPA 3GBZA 2BZHB 4YHJA 2GNFA 3H0ZA 4I93A 3AGMA 5HEZA 4QQ5A 3PFQA 3VS1A 1R0EA 4IBMA 2X8IA 5H2UA 3Q9WA 4QMNA 4TYHB 4F6SA 4CV8A 5B2LA 3UPXA 3DCVA 5JFWA 3AD6A 3RK7A 3GU6A 4IX6A 5IEXA 1UU8A 1CKJA 4FT7A 3UG2A 3DK3A 5C1QB 5C27A 4EORA 2WU7A 5HG9A 3EH9A 1DI9A 5HICA 5IUGA 2C5XA 2CKQA 1JSTA 3K5VA 1KV1A 1YXXA 2FH9A 2QU5A 4IVBA 4ZTNA 5EW3A 2CKEA 2E9NA 2WIHA 3W2CA 4UXQA 3V5PA 4IZYA 4F09A 3DAKA 4NUSA 1PYXA 3GCQA 4USFA 5EYCA 5BVDA 5J5SA 3JVRA 3DQXA 4FSRA 4L46A 3Q2JA 4BCQA 4BTKA 4Y95A 2OXXA 1B38A 4O81A 5AUXA 3VN9A 1F5QA 4M15A 4AA5A 5BVNA 3MV5A 4L44A 3FMDA 4N6ZA 4AOJA 4JRNA 1GZ8A 2CCIA 4CQEA 1MQ4A 4FSYA 2XIZA 4I1ZA 3HX4A 3G6GA 3LIJA 5DEWA 3FLSA 4R7IA 4DEIA 1WBWA 4R7BA 4FICA 4XLVA 2R3KA 2VTSA 4MNEA 3NAXA 3GCVA 1BL7A 3AMBA 4QMQA 4F6WA 1U5QA 1XMMA 3PPJA 2ZDUA 1S9IA 4AW5A 1H1WA 5IQCA 4BDIA 3L9MA 5KMMA 4GFOA 3LMGA 3NUUA 3DBQA 4F9WA 3RHKA 5AFVA 3EQDA 4KIPA 4FNZA 2GQGA 4ZS0A 4IC8A 5FEDA 1YDTE 2A0CX 2BROA 5CEOA 2BR1A 5AP5A 5JSMA 4N0SA 4E4XA 1K3AA 4C2VA 1YHSA 5HE0A 2OF4A 1UNLA 4QRCA 5HBHA 3QQFA 4ZSJA 3ZYAA 4AZTA 1YXUA 3UNKA 3DQWA 4XG2A 5CSPA 4FKPA 5KO1A 4O7SA 4GFMA 4QTEA 4DINA 4W4VA 4F7LA 2W5HA 3QA8A 1W98A 3G15A 4CZUA 3TZ8A 4FEXA 2Z02A 4A9UA 2YISA 4XS2A 4AE6A 4XBUA 4AN2A 4C4JA 4K2RA 4QTAA 3F69A 4WD5A 5DVRA 1XBCA 3R01A 3KXGA 1OGUA 3NUYA 4AN9A 1XWSA 4YLJA 5H3QA 1OIRA 2JFMA 3RGFA 5EQEA 3U54A 2YWVA 5DYJA 3MESA 1FGIA 4UWYA 5EHYA 4L45A 3MA6A 3SKCA 5AJQA 3LKMA 5J9ZA 3WE4A 2AC5A 1G5SA 2GTNA 2ITQA 2VO0A 5EI2A 3TT0A 4BI2A 3W8LA 1Q3DA 3KK9A 3RPSA 5M53A 4C62A 3PRIA 3PVUA 3QD4A 4O7VA 1AD5A 5AV3A 5FEEA 3HV6A 4WUNA 5DGZA 3IO7A 3OEZA 4JIAA 3ORKA 4QMOA 5CI6A 4YJPA 4CSVA 3SC1A 4BCGA 3QTRA 2F4JA 2ITTA 5HBJA 4DEDA 4EH7A 1V1KA 4K77A 2WMXA 2QURA 5I9VA 2XAOA 3O5AA 3PJ2A 5AAEA 3CXWA 2WHBA 4QQCA 3OOMA 1FVRA 1QCFA 1TQMA 2J0IA 4OBPA 3FI3A 5JT2A 4AOTA 3M2WA 1OL7A 4G31A 4FBXA 1OIUA 4EH4A 3PY1A 3LMHA 5AA9A 3FMNA 3H4JA 4DC2A 3JY9A 2NPQA 1STCE 4AW0A 4NH1A 4E26A 2XYUA 2Z8CA 3PUPA 3ZH8A 4E93A 5JFSA 4JL9A 3WARA 4IDVA 4M68A 4OGRA 3MI9A 4IWOA 4YJQA 5ANGA 5AV1A 3CC6A 4Q5HA 4YGAA 4Y83A 2PVNA 2CHLA 3R04A 5I0BA 1OECA 4X21A 3UO4A 4C4FA 3PY0A 1A9UA 2QO2A 2ZOQA 4FMQA 2V62A 2W17A 3ZC6A 4I24A 4CKJA 2QR8A 2OWBA 1O9UA 3QTQA 3FL5A 1MQBA 4FSMA 4G6NA 1PXMA 2Y4IB 3S95A 4MBIA 3QCQA 4XV2A 3F5UA 3GXLA 3P08A 4S32A 3P9JA 2GSFA 5A6NA 3KRJA 4BDBA 3V3VA 4PTCA 1J3HA 2UZNA 2GDOA 4YLLA 4H36A 2PE0A 4JDKA 4NFMA 3DJ6A 3ZO2A 1YOMA 4LQMA 3FJQE 2X2KA 4ZLYA 5E8WA 2W1IA 3UG1A 2JBOA 5ETFA 4RGJA 2J0KA 3DAJA 3E64A 2XNEA 4ZTMA 5KX8A 2VTIA 3LFBA 3F3WA 4XLIA 2ACXA 4PDYA 2PVLA 4YSMA 2YCFA 3G9LX 1ZYSA 3QTXA 4X3FB 2HZ0A 4C35A 5JRQA 3NVMB 2E9UA 3HL7A 4MH7A 5KMNA 3I7CA 3QZGA 4IANA 3MPMA 4FKTA 3R8MA 4EYMA 3EHAA 4USEA 4O0WA 4FZ7A 3ZLSA 4IFCA 4EOLA 2Q0BA 2CKOA 1OUYA 2PY3A 1KE8A 3R9HA 2PE1A 3VS6A 3ZBXA 2OKRA 4YPDA 4DGNA 4JIKA 3VQUA 3TL8A 2WOTA 2C3JA 1U46A 1PXJA 3QC9A 4K9YA 4FT3A 3R9OA 3DK7A 2W9FB 3BKBA 3I81A 4IW0A 4CV9A 4DA5A 3EN7A 4IWPA 2RFEA 2GFCA 1SVHA 3AG9A 3Q53A 4E73A 5FGKA 1W0XC 4QMVA 4D5KA 3P23A 3VRYA 5CEIA 3D14A 4U97A 3C4CA 4FT9A 4E8AA 2BPMA 3OS3A 3IW4A 4FA2A 4YUQA 2YM6A 4RWKA 3DXPA 4PMMA 4BDGA 2ITOA 5KUPA 5M4FA 3CE3A 3F5GA 4X3JA 4HZRA 3PJ3A 2OJJA 3TJDA 4RQVA 3ETAA 4E1ZA 4DG0E 1UV5A 4MWIA 5HCXA 4GT5A 3S00A 5JZNA 5CAOA 2GNIA 4LRMA 4MXAA 4WNOA 5HIBA 3OCTA 2UVXA 4FVRA 4HYUA 4O0RA 4CG8A 3LFFA 4ZZOA 2F49A 5FTGA 4RJ7A 1XKKA 3WZUA 2VRXA 3LXNA 2XH5A 3W55A 2WTDA 4HVGA 3ZO1A 3QYWA 4FKLA 3W0MA 4CFFA 5LWNA 4QMPA 4AZWA 4HVDA 4D0XA 2XM9A 4GKIA 4RA4A 1ST4A 4M84A 3S3IA 4U3YA 3DXQA 3ORZA 1M2RA 3OD6X 5D41A 4ZAUA 5M06A 5M44A 4ASEA 2VWZA 4UX9A 3OEFX 3QWKA 4BY9E 5HG7A 4GUEA 4IEBA 4O0SA 4OW8A 1YQJA 2A27A 2IVUA 4FI1A 3HP2A 3Q04A 3RWPA 3F6XA 5IA4A 1ZOEA 2BRBA 3DK6A 2QG7A 4FV2A 3ACKA 3HMMA 4V0GB 2YIYA 5F1ZA 1BI8A 3K2LA 2G1TA 2XJ0A 2PZYA 5AV0A 4EZ7A 3GP0A 4OUCA 1QPEA 1GNGA 1BI7A 3VS3A 2NRUA 3EFKA 3VONA 3COHA 3MN3A 4YC6A 2X6EA 2O2UA 3F66A 2HW6A 4K11A 1EH4A 3EKNA 4A4LA 4D9UA 4E5WA 4FYOA 4UYAA 3VBQA 3PWYA 3VRZA 3ZC5A 4EUUA 2Z60A 5EI8A 4GH2A 3N4VA 1B39A 2OI4X 5IQFA 3P86A 2P0CA 4X2FA 3I6UA 4IZ7A 3IW8A 1MUOA 4DF3A 3ORLA 4ALUA 1OL1A 3KU2A 4G5JA 4QMSA 4G34A 1GOLA 2R3MA 5ETAA 3HMOA 5H9BA 1LR4A 4RQKA 3KULA 3FXXA 3PXQA 4O96A 3KL8A 2A2AA 1QPCA 5KMJA 3RJCA 1GJOA 2W1EA 4RWJA 4BC6A 4USDA 4WKQA 5DPVA 4EH3A 4LL0A 4HCVA 1MP8A 5M4CA 1J1BA 4DHFA 4K8AA 4RLLA 1GY3A 3F2NA 3NX8A 4FV3A 4ASDA 4DT9A 4ZLOA 2ZM1A 4FKQA 2I1MA 4FV4A 3ORNA 2YCRA 2OSCA 2BILB 4LUEA 3VJNA 3QRTA 4NZWB 2VD5A 3EQRA 4G6OA 4I6FA 4XX9A 2GQRA 3R71A 4G6LA 4H58A 4NKAA 4XP3A 5IA5A 3W0SA 3A99A 3OXIA 2GNHA 2VTOA 1UA2A 3DT1A 5EYMA 1ZMWA 5TOZA 4EC9A 4QYHA 3LFSA 4G3GA 5HESA 3VS4A 4H3BA 1OI9A 1DAWA 5JK3A 1WBVA 4D1ZA 4FIGA 3BHUA 3NDMA 4DFXE 4EOSA 5LWMA 3D5VA 3FMMA 3R7YA 3O2MA 3EFLA 5FTOA 4LDTA 2W9ZB 4K33A 4V01A 4F99A 2YAAA 4O7LA 3DLSA 1ZYDA 3FHRA 3QQHA 4BHNA 5KKRB 1U59A 5AM7A 5GIPE 3BGQA 5IQHA 3OZ6A 1Y8GA 2BAKA 4YHTA 3RAHA 3MVLA 4L43A 5DBXA 4QMLA 4HGEA 2IWIA 4FTNA 4AZEA 4A4OA 1NA7A 4OTIA 1PYEA 2P55A 4FTJA 4EOOA 5HLNA 5DRBA 4DH3A 5HE3A 3IK3A 2Q0NA 4IC7A 2IW8A 4TPTA 3FZSA 2PU8A 4QYFA 4ZSEA 4BCKA 2QO9A 3CR0A 4LG4A 4O27B 5GINE 2Y7JA 4MD7E 4A7CA 2CSNA 4QP1A 2WMAA 1R0PA 1MRUA 1F0QA 2NRYA 3T9TA 1U54A 4FX3A 3FLWA 4UWCA 3JY0A 5IZFA 2BUJA 3BU5A 3IECA 4E4NA 3KGAA 5CZHA 2XNOA 3LFAA 3GC8A 4OR5A 2ZJWA 2EWAA 4AN3A 4C59A 2X39A 5AUWA 2ZV7A 4LL5A 2PYWA 1LP4A 2WMVA 4KS7A 4QT1A 4ZZMA 2GS2A 3NUPA 4A06A 3Q9YA 4ZTSA 5TF9A 1OIYA 1DI8A 3LOKA 2ETKA 3PTGA 3FDNA 3GQLA 2JC6A 3UODA 3KFAA 2XYNA 4FKGA 4BGGA 4D4SA 3SQQA 3DB8A 2ITWA 3SV0A 2JBPA 5EDRA 3BYOA 4O6LA 2QOCA 2UZVA 3FC2A 3BEAA 3BGPA 3FQHA 1WAKA 4L3LA 5AX3A 1BUHA 3F3UA 1H08A 3I4BA 3GC7A 5FXRA 2WU6A 3R8ZA 5BVFA 4GV1A 4D4VA 4FL1A 3FXWA 4QP2A 4HPUE 2PSQA 4DBXA 4L3JA 4ZTLA 3W2OA 2QOOA 4I4FA 4XP2A 1Y6AA 4IB3A 2BRHA 3OROA 2GMXA 3NCGA 5M09A 4RIOA 4I6HA 3VF9A 2OFUA 4QYYA 3BU3A 5IQAA 5L2TA 5CNNA 4BVUA 4O82A 1ZXEA 4U43A 4XCUA 3NUAA 4LGHA 3HP5A 3FMEA 4S30A 1UU7A 5EH0A 1SMHA 2YA9A 2ZB1A 4FKWA 3KVXA 4Y72A 4QMTA 2ITYA 4WBBB 2IN6A 4B4LA 2CJMA 3THBA 5IA0A 4UWBA 4GG7A 5FUTA 3D2IA 3LQ8A 4CCUA 2P2IA 5FBOA 3UOLA 3VQHA 4DFUA 3GFEA 4CLJA 3ZRKA 2UW5A 1OM1A 3E8EA 3QXOA 2JAVA 3EN9A 4LUDA 4RSSA 4BTMA 4F70A 4RPVA 2HCKA 5L8LA 5DG5A 4XNEA 2J50A 5H8GA 2YITA 3B2WA 4PDOA 4UZDA 4FNXA 1PMVA 3EQHA 5D1JA 4L9IA 5H8BA 2WEIA 3NLBA 3HKOA 4FKUA 3TUDA 2GS6A 2BIYA 3QUPA 1UWHA 5D7AA 4HVHA 4MTAA 4WBOA 2G9XA 3EL7A 1PXKA 5T3QA 3QQJA 3COIA 3A7JA 4X3FC 5CY3A 5DT0A 4YC8A 4JDIA 4AX8A 4YZBA 4BRXA 3P7BA 4RJ4A 4ZS4A 3LM0A 4EH5A 4M69B 4YTIA 4XV9A 3ULZA 4C0TA 4Q9ZA 4BCOA 4BIEA 1JWHA 3QD3A 3CCNA 3FZ1A 5E8SA 2XMYA 4Z9LA 3NUSA 3VNTA 3WIKA 4YO4A 5HO7A 3FQSA 3QXPA 4ANQA 4HNIA 4NTTA 4YMJA 4IJPA 5E9EA 4EOPA 4B0GA 4WNPA 3BL7A 3SG8A 3FY2A 5J9LA 3O50A 5CNOA 3R28A 5CI7A 3FKNA 2XJ2A 3C1XA 1B6CB 1ZMUA 1P14A 2CLQA 5LVPA 4AGCA 4ZMEA 5E92A 3TKUA 3RINA 4FZ6A 3PYYA 5KHXA 4Q2AA 4HPTE 3QBNA 2UZUE 3D7ZA 3KB7A 4ZP5A 2B52A 3CPBA 3TXOA 2EB3A 3UC4A 1KV2A 3L8VA 4FL2A 2J6MA 4R3RA 3UJGA 2IZTA 4BI1A 4ERKA 4X6QC 3NZ0A 1QMZA 3KA0A 3KY2A 5A4EA 3ZM9A 3BU6A 1ZZLA 4C36A 2QKWB 3ODZX 2OZAA 3VC4A 3H9OA 4KKHA 5AP1A 3U4WA 2ITVA 4GS6A 4CKRA 4TNDA 5D9HA 4F0IA 4Z16A 1TKIA 4XV3A 4KWPA 3TEIA 5AA8A 4JDJA 3R21A 2R7BA 3POZA 3HYHA 4FIHA 4KABA 4XH6A 2X2LA 3R8VA 2PTKA 3RPVA 3KULB 1M2PA 4EK5A 3U4UA 5KNJA 1NT2A 5JRSA 4C58A 3H9FA 3C5IA 3OXZA 4DCAA 1OBGA 4L52A 3TTIA 4P4CA 4DG2E 5FG8A 3ZS5A 5I9ZA 3PIXA 4G3CA 4DH7A 4HGSA 3E92A 4RX7A 3QTIA 4R7HA 3KK8A 3MTFA 3OF0A 3CSVA 3R2YA 5CVFA 3A2CA 4K0YA 2X2MA 4NYEA 3SAYA 4MWHA 3V6RA 4B99A 2QOBA 4EZ3A 5E8UA 4EOMA 2UZTA 3ODYX 1REKA 4IFGA 1GAGA 2O0UA 2C5NA 3LQ3A 4JRVA 1Z9XA 5KE0A 3R7VA 4LOQA 4U5JA 4J52A 3BYMA 4MXYA 5HX6A 2YAKA 2YM4A 2QONA 3LHJA 4TWNA 3ZHPC 2V0DA 4CT2A 3WF6A 4L01A 4CVAA 5HTBA 3GU8A 5BV3A 2WPAA 2C6LA 4XV1A 3RP9A 2ITZA 4GFGA 4BI0A 4O2PA 4I0TA 1CTPE 3OT8A 3RWQA 4FODA 3SXRA 4Y85A 5J8IA 3PLAE 3LCKA 5DWRA 4HZSA 4IAKA 1Q8ZA 2J0LA 5HZNA 2HXQA 4P5QA 2XCKA 4X3FA 4FKSA 4ZY6A 3VF8A 4FZFB 3Q32A 4C7TA 5JFVA 1P4FA 1JKKA 4DGMA 4FEWA 3C4EA 1JNKA 3NYXA 4PL5A 5C03A 4G3EA 4BYJA 2YACA 5LVNA 5DN3A 3CQUA 2RF9A 3OW4A 3PA4A 4ZJIA 5ACKA 3SRVB 3UDBA 4PDPA 3LXKA 4ANSA 4RLKA 3QGWA 4YZNA 5FLFA 5E8ZA 5FEQA 1KOAA 4AT3A 1OL6A 4DE4A 3H30A 3FLZA 5GHVA 5BUEA 3ZUUA 4GCJA 1DS5A 4EK6A 4MXZA 3MWUA 3TNHA 2EVAA 3C5UA 3ML1A 3P78A 4F1TA 4F9YA 3R30A 3CKXA 4E6AA 3Q4CA 3UOJA 3D0EA 4XG3A 1U54B 3JXWA 4D0WA 3I6WA 3MB7A 4RVTA 3QRJA 3QYZA 4O0XA 3MVMA 5DLSA 5E91A 3HUCA 2W5BA 2UVYA 4HOKA 4ANMA 1R3CA 4C33A 4LMNA 5LMAA 5M4IA 3KEXA 5ANKA 3NS9A 4U7ZA 4BB4A 4IJ9A 3AC8A 5AM6A 2PZIA 3QTSA 4FE2A 1UKIA 3UE4A 4BCIA 5AAFA 3QFVA 4XYFA 2VTAA 3FBVA 5HVKA 3QTZA 5KKRC 2LGCA 3ANRA 4F7NA 2J90A 4MBJA 2XALA 4FT5A 2R3LA 2QODA 3COKA 3EN6A 3HGKA 3TI1A 4NW5A 5EKNA 2FSLX 2GNGA 3EQIA 2QOLA 4FR4A 4BBFA 1ERKA 2C6DA 3D5WA 3MY0A 3A7IA 1OKYA 3VO3A 2XBAA 5BMSA 2BKKA 3AMYA 3GT8A 3LAUA 5C4KA 5K4IA 3PA5A 2XEYA 3RPOA 2CDZA 2ESMA 1R39A 3KRXA 2R7IA 3AC5A 4X7QA 5EK7A 3E5AA 4GK3A 4HCUA 3LPBA 4RMZA 4XG9A 5HVJA 3VJOA 1WBPA 5GNKA 4GL9A 5CF6A 3HVCA 3C4FA 3FSKA 5HG8A 2GPHA 2R3RA 3R83A 5HQ0A 4LV8A 4V0GA 4YZCA 4DFYA 4FVQA 3P4KA 1RW8A 2OBJA 3OUNB 4OTHA 4RC4A 5E8VA 3A7FA 3DJ7A 4ZOGA 1VYWA 4MUQA 1OUKA 4G5PA 3SOCA 4DEEA 4F65A 3DY7A 3GENA 3RAWA 3RK9A 1BYGA 2PWLA 4Q9SA 4R5SA 3L9LA 3D5XA 4QQTA 3BZ3A 3R8PA 4PMPA 5J9YA 3U6IA 2BVAA 2G15A 5CEQA 4FG8A 4QP6A 5LVLA 3PXFA 3VUKA 4DGGA 2B9FA 2PZRA 3OG7A 3GEQA 4IM3A 4EL9A 3A62A 1W82A 2BRGA 2XB7A 2ZDTA 4HJOA 1V0PA 2VX3A 4I23A 5EDPA 4CLIA 3SXSA 3WZJA 2I0HA 2WOUA 1FMOE 4QMMA 4FV7A 5IEVA 2J51A 3DV3A 4E4MA 1YI3A 4QYGA 3KXXA 5EDQA 3O17A 5CU6A 4AZVA 3ID6C 4YC3A 1PXLA 4N6YA 3L1SA 4O7YA 4U79A 3UNZA 4DDIA 4NTSA 4QP3A 4GT4A 3VUIA 3MIYA 1OB3A 5CASA 4FUYA 3EN4A 4NFNA 3RAIA 2VTLA 4JNWA 3KXZA 3CQWA 3R02A 4RVMA 1Q8WA 2XIKA 2XP2A 4F6UA 2GTMA 3UYSA 2UZWE 4U0IA 3W0RA 5J1VA 3KQ7A 4BF2A 4ORKA 2VTTA 3V5JA 3EZRA 2OW3A 4J97A 3V6SA 5B2MA 2E9PA 1TFFA 5E1SA 4C2WA 2X4FA 4FKIA 4PDSA 4OTDA 3BHVA 2YIQA 4R77A 1GIJA 1HOWA 2GCDA 2RFNA 1UKHA 3NYOA 4RJ6A 3W8QA 3ZTXA 4JAJA 4ZSAA 2B54A 1FOTA 1R1WA 3HZTA 3ET7A 5IUIA 3R1YA 1V0OA 2E2BA 2H9VA 2PVFA 2YIRA 3NYVA 4M7IA 4EC8A 4O7ZA 1W84A 3UP7A 4HGLA 3LM5A 3RCDA 4TYEA 4FIFA 4BZDA 3ORTA 5IF1A 2B7AA 5LXMA 3P1AA 4DFZE 2VTJA 3R2BA 3V01A 4O21A 2KULA 3CGFA 5GJFA 3OY1A 4RX8A 4YJOA 4AGDA 1CDKA 4NM5A 1RQQA 3FMLA 4B9DA 3ATSA 2XZSA 1H26A 4WO5A 3WZDA 1NW1A 3HV3A 5T68A 4ACMA 4DHIB 1H1PA 1XH5A 5EM7A 4I20A 4ASZA 1YXTA 3R1QA 4PWNA 3PP0A 4AUAA 1VEBA 4AT5A 3FL4A 4AA0A 4FKVA 4JX3A 3LZBA 5DR2A 3Q96A 3DKGA 3GI3A 4DHJA 1S9JA 2X81A 3DKFA 3WF7A 3PSBA 4FG9A 1LPUA 5FTQA 1XH6A 3TNQB 4ASXA 3HUBA 3AOXA 3KREA 4R3PA 2UZOA 2OZAB 4FTOA 3R7EA 3R1SA 4DITA 3E88A 4PMSA 2XK8A 4L00A 4U8ZA 4BTFA 2Y0AA 3BV2A 4BIDA 5BUIA 2C68A 3A4OX 2F7XE 1YVJA 4I41A 3TTJA 2QNJA 2WNTA 1DM2A 3Q2MA 4K1BA 1WMKA 2QU6A 4QP9A 5CT0A 4RC3A 5F94A 1JQHA 4O22A 4DBNA 4GJ3A 3ZDIA 2WMQA 1WCCA 3FLNC 5ETCA 5CEKA 2C1BA 1DAYA 2HY0A 1ZOHA 5CS6A 3O96A 4EHZA 2P33A 5D11A 5DRDA 2OLCA 4WHZA 3QQLA 4G16A 3BWFA 4J8NA 2OG8A 4J7BA 2RKUA 3FPMA 4QTCA 2PL0A 2DYLA 3U9NA 3V5WA 5A4CA 3IQ7A 2UVZA 5EOLA 3LJ0A 3ORIA 4X6RA 3QWJA 1BMKA 4EK8A 4I5HA 4QO9A 3LCSA 4IAFA 3GUBA 3E3BX 4DFLA 2HOGA 4IB5A 1AQ1A 1GZKA 2BDJA 2QOKA 3G5DA 4PQNA 1JKTA 2XK7A 4GIIA 4J71A 3RNYA 3QL8A 4NK9A 4JQEA 2RG5A 4IWDA 3L9NA 4FV8A 2PUPA 2PUIA 4MX9A 4D58A 3ZFYA 3GGFA 3L8SA 3WYYA 2ZV2A 3F7ZA 4UALA 5DIAA 5AMNA 5A9UA 1JSUA 2BRNA 2F2UA 4AW1A 4W8EA 4FSTA 3Q52A 2YM3A 3LW0A 3VUMA 1GIHA 4QTDA 4O0TA 2YDKA 3MS9A 5ITAA 5A54A 3TZ9A 2Z7SA 3DKOA 2I7QA 3CY2A 3HMPA 1Y57A 2IO6A 3VS2A 3TKHA 2IJMA 4NKSA 5IH6A 3W18A 5DI1A 2VN9A 4UV0A 2BAJA 4JR7A 5CYIA 2XJ1A 5ETIA 5BMMA 5IH5A 4F63A 4Z3VA 2PVHA 3QHWA 4E4LA 4FG7A 4FUXA 3UPZA 4RT7A 2IVSA 3KCKA 3Q3BA 5LARA 3UVPA 2AC3A 5IDNA 4AFEA 1Q61A 4LM5A 3WE8A 5L6PA 2O8YA 3UZTA 2HW7A 2JDTA 3BE2A 2UW3A 4BTJA 4GK4A 3OBGA 3BLRA 3ZSIA 1GZOA 2VNWA 2O64A 3OMVA 2CN8A 3UVRA 3DFAA 4IVDA 3PXKA 1H24A 2UW7A 5LMBA 2NP8A 3SDJA 4I21A 2WQBA 4DDGA 4W4WA 3FKLA 5A4QA 2YWPA 5IA3A 2R3OA 3DPKA 2QOFA 4WRSA 5E8YA 3BHTA 3DNDA 4YP8A 2XCHA 5CSHA 4O2ZA 1JSVA 2IW9A 3RHXA 4BKJA 4TN6A 1OZ1A 1ZYCA 4GW8A 4AXEA 3NNWA 1Q8TA 2PMOX 1YRPA 2QLQA 3NNUA 1JBPE 2QHNA 3QA0A 2Z2WA 4BJJB 3Q6WA 2FSMX 2I0YA 3R6XA 3O8TA 4HYHA 4GT3A 4FV0A 4BIBA 2V7OA