5GINE

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ginE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ginE02
4OT6A 1HCKA 2ZWVA 2ONZA 2BRHA 4BI2A 2RFDA 5CQUA 3CJRA 3FZTA 3I0OA 1ZYCA 4RG0A 3P86A 4JX7A 3KXZA 4HGTA 1YVJA 5L2TA 3D7TA 5FWDA 2YJRA 5BVEA 5HIJA 5AAFA 1WZYA 1YDSE 5BX0A 4GS6A 4Z55A 1WCCA 2PUIA 1MP8A 1KV1A 2YDKA 5D7AA 3FLYA 3BGIA 3DBEA 1W0XC 3OU2A 4F6UA 4WG5A 4DFLA 4KIQA 2CKPA 3LDUA 5HTBA 3WIKA 5ITAA 2ZOQA 4U5JA 2XIKA 1ZY5A 2E2BA 1OVEA 5AUTA 5FRIA 2R3LA 4PCAA 4WBBB 1NW3A 3ROYA 3FXZA 5C9ZA 2E5WA 3SX9A 3H3CA 1APME 4KABA 4MBJA 4E26A 1IM8A 4EHZA 4EZ7A 2XP2A 2YM3A 2ZYBA 2YM8A 1OZ1A 4NECA 1M14A 4CXAA 3T3VA 5LQFA 4EQMA 3BIZA 2OF4A 3V04A 2YUIA 3C7QA 3E3BX 4IACA 3HMIA 3WARA 5L6WL 5A6OA 1RJGA 3PVWA 3EKNA 3MH1A 3C6KA 4HGSA 2BMCA 3QWKA 3NGAA 2WA1A 1GIHA 3MAGA 4EK8A 3HV4A 1Q3WA 3IS5A 4ZSLA 1DI8A 4GYGA 5FEEA 2X1NA 2Y0AA 2GCDA 3I58A 1I4WA 5CVFA 4PYQA 4EOIA 4GVJA 2ZWAA 3ZRMA 5M07A 3IK3A 4MYGA 2OJFE 4U6RA 3C4ZA 4EZ3A 2WGJA 2W4OA 3VUKA 3FLSA 4C4JA 2Y1WA 3EEYA 3QHRA 2E9VA 4TYEA 2WU6A 1PMVA 3FMEA 3EMGA 2EWAA 4MX9A 4NK9A 3VUHA 4MKCA 2BHEA 3Q2MA 5DTMA 2CGXA 1Q61A 1AV6A 3QUDA 3UBDA 4MQ4A 4IHPA 3R8PA 3P4KA 4D4YA 5HEKA 1PXJA 3R9RA 4S2ZA 4X6RA 3AY0A 4EH4A 4ER0A 2Y6OA 3TG1A 3NVKI 3IECA 4GK4A 3BPRA 4PGHA 2BRGA 3DFCB 4G6LA 4C3PA 3IW5A 3W1FA 2ACXA 4BIEA 4O96A 1YFJA 4BDGA 2X2LA 1UNLA 1TKIA 3ZO2A 1URCA 1SMHA 1VIDA 3KXNA 2ORED 1A48A 3OT8A 2UVYA 1NW1A 4ITHA 3L9MA 3Q60A 2C5YA 3NLBA 3E7OA 1IA9A 5LMBA 4L7FA 4YZCA 4KIFA 4J96A 4YJQA 4XUEA 5EMJA 2G70A 1KE8A 2ZVJA 3R7UA 4U43A 3ZLWA 3R30A 1OKVA 3P7AA 3JWJA 4NM5A 2BRMA 4CV9A 4LOQA 4F7JA 4IQ6A 2GHMA 3BYVA 2QVSE 2WMXA 3F3TA 3EMDA 1W83A 4RRVA 4AGDA 3A7DA 5IUIA 4LECA 2CCHA 4WNOA 1ZG3A 3PPKA 3R6XA 4RTPA 5E91A 4IVBA 3GCUA 3QD2B 3TNQB 2Z6QA 3MI9A 5DXAA 5T6KA 3E62A 5CWZA 1R0EA 5ICFA 3ZHPC 3C50A 5DEYA 5HO7A 3EN5A 2YISA 3EOCA 1JSZA 4PP7A 4E6DA 2UYQA 2CMWA 3ZBFA 2AOWA 2VDWA 3BYUA 4EOKA 4BDKA 3OEFX 4NWMA 4IVCA 2FSMX 3CEKA 4DQ0A 3E5AA 3GRRA 2HTEA 2Y7JA 2YM7A 1FGKA 2BKKA 3KK8A 4GFMA 2GQSA 3O4FA 4FIEA 4D2RA 4ANMA 4YV2A 3U6JA 4YNOA 3BEAA 4JNWA 3GC7A 4GUBA 4GU9A 4GQBA 5CNNA 2XKCA 3P8ZA 2VAGA 4I3ZA 4TZRA 4TYHA 2G71A 5H3QA 3IOPA 2X6DA 3TFWA 5EOBA 2GTNA 2OSCA 4MD8E 3U81A 3NVMB 4I5CA 5DPMA 2IW6A 2JDVA 4YMHA 1KOAA 5DTRA 3ITZA 5EHGA 2R7IA 3Q4TA 3S68A 3VUIA 3ORMA 4O7LA 4BGQA 2C6EA 3M6WA 4ACCA 3TTJA 3HEGA 3UYSA 2FYSA 3RP9A 3I5UA 5IG1A 3ERKA 2VRXA 4L44A 1WMKA 5EMLA 2YZAA 5IEVA 3G0FA 4AE6A 4E4LA 2F4JA 3GFWA 4HCUA 2YM4A 3QLFA 2QQ7A 3PRFA 3GRUA 2ITVA 4G56A 5K05A 3FC2A 3NW6A 2ZZKA 3EN4A 3R0QA 3LGAA 2IDJA 3RK7A 1A06A 5F20A 3EN9A 2Z7RA 3WIGA 4XMOA 3T9IA 1IEPA 3QOWA 2ZM4A 1LUFA 2QOBA 3ORPA 4L6QA 3TKIA 4HPTE 3OW3A 2FSTX 4QMTA 5ANGA 1BX6A 4BP1A 3CLYA 2OK1A 1D2CA 3GIWA 3UA4A 4PTCA 4MQ2A 2Y4PA 5DM4A 3EQHA 3UJBA 5I9XA 4BZOA 5J1WA 3VW6A 4UOEA 3EVDA 4AS0A 5HVJA 4UZDA 1YWVA 2HENA 4CMOA 2YCFA 5BVOA 2DUVA 3B3FA 3TJCA 4LL0A 5KVAA 3UIUA 3W2OA 2QOIA 1JVPP 3D14A 2PK9A 4DFXE 4WUNA 2Z6AA 2C6LA 3AQVA 5CAOA 1GY3A 4QPAA 3A7HA 3KCFA 3LKZA 4AFJA 2XK9A 2AYPA 3MVJA 4QNYA 4X61A 3RGFA 1AGWA 4HCVA 3T8OA 3BGQA 1PMNA 5KMMA 3FMLA 5I9VA 4BDAA 5IPJA 2PWYA 4R3CA 3CBGA 4LL5A 4WNMA 5BUJA 4L46A 2OB1A 3SGCA 1CDKA 3H30A 3PE2A 4AN3A 1BYGA 5D9HA 2WMSA 4F9WA 4WRGA 4EUTA 4PIPA 4KKHA 3LFEA 4X3FA 3PIXA 5HU9A 1W82A 3HMPA 4FGBA 3FLNC 5HVYA 1PXMA 4WRSA 3KA0A 1N7JA 4FZFB 2VWXA 5E2BA 3BYOA 4D28A 5LARA 1Q8TA 2BDWA 5LJJA 3F5GA 3ANQA 4EH5A 4PX6A 3VJNA 2JDSA 2J7TA 1RE8A 4AQCA 5GJGA 3NYNA 5G02A 4IKPA 3KQVA 3UPXA 4D5HA 2JLDA 4AFEA 4EH6A 4P4CA 2JGZA 4CD0A 3U9CA 5U4XA 3R71A 5EM7A 3ROCA 2P55A 5BQ0A 3Q87B 4OT5A 4X21A 2VTTA 2W1IA 5EDPA 3LLTA 3RINA 5FHQA 2BZHB 4CFNA 5EDRA 2OPBA 2X7FA 4QQJA 4EQUA 3MBLA 3SD0A 3O2MA 5EM6A 1G5SA 3P0MA 4UYNA 1BKXA 4C36A 1R00A 2IW9A 3FZ1A 2GNFA 3EVCA 3M33A 2PVRA 4BDFA 3CKWA 4O0VA 2LAVA 4QQTA 4EBVA 3D5VA 4L67A 4R7IA 4YJSA 3FL5A 4H3PA 2G8NA 5CT0A 5FEQA 4AN2A 2P3LA 4DEAA 2C0TA 5DT3A 4R7BA 2PHKA 4CMUA 3GENA 2GLUA 2GNGA 2QG7A 3M70A 3AT4A 3AC4A 4W4VA 4OUCA 4GW8A 5AIRA 3FRHA 3A99A 2ONLA 2HZ4A 4CG9A 3BZ3A 5KHWA 2QHNA 2QOCA 4JDKA 3R73A 3BKBA 1N2XA 2KW5A 4YTIA 4DZRA 4R5SA 2VU3A 1Q8ZA 3HCEA 3UJAA 2ZLBA 1YDRE 2WMWA 3FAAA 4RA4A 3ORTA 2HK5A 4FYNA 5FBNC 3TUBA 5LQCA 1V0BA 4X2KA 3IDCA 4IC7A 3DY7A 5LWMA 4IX3A 2XIXA 4O29A 4F9CA 4EKIA 3QC4A 4B17A 3DBCA 2VTHA 3PDTA 4BHZA 3VYWA 5FULA 4GC9A 3G2QA 3T7SA 5CVDA 2C7OA 2W4KA 3RCJA 3RJCA 2CPKE 3C13A 2PWLA 2X7OA 4N70A 4C58A 2IVUA 2HV9A 4NIFB 4A4LA 4ZTMA 1JQHA 2OB2A 3DH0A 3PP0A 2R3SA 2GS9A 3CGFA 3PY1A 5EEGA 4XG9A 2WEIA 1EJ6A 5B1SA 2EXMA 1UU7A 3DZQA 4AOIA 4R7HA 3GU3A 3SKCA 5IA4A 2BDFA 1OI9A 1L3BA 2WK1A 2XNOA 4QMVA 4XV1A 3PJ1A 5IQIA 4F64A 3DS6A 3F2AA 2EXCX 4LUEA 3A4OX 4IX6A 3BQCA 4O2PA 5DHJA 3T7TA 4O7NA 4CFVA 3LQ8A 4CEGA 4HOKA 5KZ0A 4LM5A 5B0XA 5LVOA 3P78A 1B38A 4BIDA 3NMUF 3LXNA 2WTWA 5HE1A 3REPA 1AQIA 5J8IA 3A8XA 2RF9A 5L2SA 3FEGA 4XG4A 5E8UA 1QZZA 3GRVA 3D2IA 1WXXA 2JFMA 3ENMA 5ICGA 2QLQA 3MFRA 1YI6A 5H8BA 3TUDA 2QU5A 4WKQA 3DU8A 4QMYA 3P9IA 2JH9A 5J9LA 4F1OA 5BPYA 1GZNA 4K6ZA 1KXZA 2WOTA 4GUEA 5FD2A 4E33A 4QYEA 1OUYA 2I6GA 4D1ZA 4HH4A 4YU2A 4FSMA 3SG9A 1UA2A 1DS5A 3MTLA 3U9NA 4DE4A 3ORKA 4MAOA 2XIYA 3FUWA 1H24A 1NA7A 1FVRA 2AVDA 4X7QA 3COKA 5DVRA 1ZYJA 4LGHA 3UQCA 3PTGA 5DX8A 1FOTA 1L8TA 4DAWA 3G90X 2EU9A 2XA4A 2WB8A 5IH6A 4JOAA 3TR6A 5HIBA 5LR6A 1XTPA 3MGGA 4IAFA 4GU6A 4MHAA 3QX2A 4W4WA 4YBJA 4DTKA 5C0OE 2JHPA 5EQJB 3VHEA 4QP8A 4LRKA 4HNFA 3PIYA 1OBGA 4R6WA 1JSUA 3T9TA 4ZZNA 4B4LA 5EHYA 4J8NA 1FP1D 3K5VA 1YW2A 4FNYA 4ZJIA 4XG3A 2QODA 2WA2A 1OPKA 4IEBA 3JWGA 3AWIA 2IG7A 3O50A 4PDYA 3TKAA 2CNVA 3HV5A 2A27A 2PVNA 2Y8OA 4XYFA 1QPCA 4GIIA 3R9XB 5EI2A 4ALVA 4OR5A 3SRVB 1JG2A 4OBOA 2XKFA 4FKGA 4GSBA 3C4FA 3MY1A 4EUUA 1J3HA 5CEQA 3DLCA 4QMOA 3OWPA 1GZKA 1ZQ9A 3LIJA 2C7PA 1PYXA 3ZCLA 3IQ7A 3GU5A 4PNIA 3OFMA 3CIKA 2WMRA 4OTRA 1L3RE 3GRYA 1OL1A 4ITJA 1FVVA 4D55A 4QOXA 2ZIFA 5LXMA 3MV5A 4I0SA 2AVNA 5HICA 3G5DA 3MB6A 4WSYA 3LW0A 4IADA 5FM3A 2G1PA 3LFNA 1K3AA 3GCVA 5C03A 3KU1A 4OTQA 3QTSA 3K0BA 3QGYA 5KUPA 4ATNA 3GNIB 1VL5A 2V7EA 3K2LA 5DR9A 3JPVA 2OH4A 5BMSA 3HNRA 2OGVA 1BC5A 2V74B 3HTXA 2O63A 2J0IA 4EH3A 2B52A 5DT2A 4O21A 5TO8A 2UZUE 4WUAA 3SR4A 3BWMA 3OZRA 1H1RA 4HTFB 3FHRA 1XJ5A 1OL2A 4XH6A 4F0IA 4IE9A 3SVZA 4USEA 4AOTA 3LKMA 2C6OA 3KB7A 3BU3A 2G1TA 3F5PA 4L52A 4PYMA 2V7OA 2JDOA 5CANA 2P0CA 4ZEGA 5M55A 4C61A 5C4LA 2FSLX 3OWJA 4QVKA 3OW4A 2C7QA 3SXJA 4QT1A 5BW4A 2NPQA 2B3TA 3GQIA 4J53A 5HE2A 4FV7A 2PV0A 1REJA 3WSTA 4CV8A 3QRKA 2V22A 3E87A 1KP9A 5CX9A 2C47A 5EC8A 2K4MA 1E1VA 3NJRA 3MTEA 2NRUA 4ANQA 2XJ0A 4LOOA 5HG5A 2YXLA 5AADA 3GC8A 4IX5A 2JDTA 2R3OA 3F4KA 3KPWA 3IW4A 5F1ZA 3WZUA 3NIZA 4RWJA 2WD1A 2W5BA 2H1RA 5FTGA 1ZWSA 3BUSA 4QQKA 4ZTLA 4EOSA 1KE6A 5K0EA 2HY81 5TT7A 3FRIA 1CKPA 3W2PA 1JG1A 3C5IA 4V0GB 3MCZA 5GNKA 1PJKA 2JFLA 2IZRA 3FMJA 1WBSA 4K9YA 3UO5A 3RPOA 3DZOA 1Y57A 3EZRA 2GFSA 1NT2A 3VF9A 1X1CA 2WTIA 3CJGA 4X2GA 3TJDA 4FTOA 2OJIA 2HW6A 2IIPA 2FUMA 5E1BA 3E63A 4YLJA 2PVHA 3SMQA 4FVQA 4AF3A 4F0FA 2UYCA 3UMWA 2NYUA 4C34A 4B9DA 3VS2A 4GC5A 1M7NA 3DUWA 1VBFA 3LQ3A 3DAJA 2JAVA 3OE4A 4FKQA 1L3CA 2FB8A 3TKUA 1JKLA 4BKJA 5AUUA 2P3GX 1D2HA 4BIBA 3O17A 2B0QA 4JRVA 3IONA 4G5PA 4XX9A 2R3NA 3ERCA 5EG5A 2CSNA 4JDIA 1ZMWA 2W1CA 1MUOA 3LQ5A 4XG8A 2VGPA 1AD5A 1VJYA 4X41A 3FYJX 4RVHA 2VWIA 5ACKA 3HCFA 3TZ7A 3UPZA 4O84A 1SVHA 4O91A 5HLPA 1UU9A 3F3ZA 5KMJA 4CFUA 1OKWA 5C8KA 4FV8A 3MFUA 4D4RA 3I53A 1Z5MA 1SQGA 2WO6A 3Q7EA 3KF7A 2C6DA 3NTVA 4D0WA 3QZFA 4E1ZA 5E9JA 3CR0A 2PYWA 3HX4A 3CTJA 3VQUA 4Z3VA 3TACA 4XBUA 3F2RA 3LMHA 3PRIA 3NEWA 3NUXA 2KTYA 2XK6A 3JY9A 3LCKA 3GU8A 1GJOA 2ZB1A 5HIDA 1SUIA 2V62A 4UV0A 3OXZA 2FPOA 5L6PA 2X0GA 4TNDA 4WBOA 4A9SA 1XH4A 3SXFA 4LWOA 1Q3DA 3CGOA 5AX9A 3EGIA 4RIYA 3KREA 2JKMA 4R3RA 1QAMA 5EM8A 4MCVA 2XVAA 4JIKA 4C62A 1S9IA 3DPKA 3IOKA 4IC8A 3VBTA 4C02A 2I6LA 3N4VA 3GO4A 1KPGA 4RIXB 1ZZ2A 2JKOA 1YZ3A 3W8LA 2UW8A 3BHVA 4HVSA 2UZNA 1P1BA 3ZFYA 4ALUA 3R1NA 1IY9A 3ZU7A 5DBXA 4GOND 5A4EA 5EW3A 2XEYA 5LQUA 1R18A 4BLWA 3RALA 1L1EA 1I09A 3DXNA 2REIA 4I5MA 4EK6A 1M6YA 4NTTA 4AGWA 4YZBA 3KR0A 5CXZA 1TVOA 4DGNA 4AZTA 2Q41A 4FSTA 3DKFA 2Z60A 4WO5A 4KS8A 5CYIA 1JG3A 3QQJA 2FGIA 3Q9WA 5KBRA 3H4JA 3UOLA 4AT3A 3D83A 3IHTA 3MH2A 3UZRA 3PY0A 1PHKA 3KR9A 5AV3A 3ATTA 1QMZA 2BALA 3V6RA 2FK7A 5AP2A 1KR5A 3R8LA 2W05A 4G6NA 3HP7A 4BN1A 3DBQA 4BP3A 5FG8A 1OB3A 1VYZA 4A6DA 2RFEA 1SUSA 3C0HA 4XOYA 2AOTB 4FV5A 4UWBA 3TM5A 2H6DA 4POOA 5DSXA 3UNZA 1PY5A 3GFEA 3KK9A 4DH7A 3GCSA 1KUTA 2A14A 2AR0A 4BZNA 4D5KA 5DXJA 1H07A 4I92A 3DMGA 4PTGA 4NM7A 1KE9A 3I1AA 2UW7A 4EOQA 5KX8A 4XLIA 5HX8A 1JQ3A 3ELJA 4TL0A 3CCNA 3IEIA 3HA5A 1JTEA 5IEXA 3PJCA 5CI6A 1QL6A 2YEXA 4WOVA 3HVJA 2PL0A 4U45A 1DM2A 3EN7A 3OCTA 4LFIA 2HNKA 3TL8A 2ITWA 5HIEA 3JVSA 2PSSA 3QYWA 5DRDA 5FP5A 2OI4X 1U54B 4RJ5A 5HOQA 4NH1A 4EL9A 1R3CA 3GI3A 4KRDA 2OIBA 5DLYA 1OIQA 4PYLA 2IZTA 3I6WA 3KGAA 4WD5A 4E4MA 2XNNA 3IDBA 3EQRA 4NZWB 2WQMA 3FQSA 4YSMA 4F6SA 4PTEA 5AV2A 5JKGA 3PA3A 3MSSA 4QQNA 3U55A 3WF5A 4I4FA 1H01A 3VUGA 5JSMA 3LM0A 5AP5A 5AM6A 4AOJA 2DPMA 5M08A 2WQOA 4ERKA 4YUYA 5CF4A 3LHJA 3IW6A 3OOMA 1X8BA 2YIYA 4ZY6A 4RC4A 4NJ3A 1JR4A 2X8DA 3AC8A 5EEHA 5LQAA 3LCUA 2VO3A 4HPUE 4MD9E 4JBQA 3QV2A 3HV7A 3QCQA 3CE3A 5CVEA 3DAEA 4ZP5A 3GU7A 2P40A 4ZTBA 4R1YA 3U54A 3KQWA 3PG3A 2VDVE 4DA4A 3JUHA 5M09A 5IEYA 4WG3A 2PLWA 1YZHA 5GP1A 3NDIA 1UVRA 3RHKA 3DAKA 1ZRZA 2AOVA 4AU8A 3HA7A 2NP6A 2H9VA 4X2FA 1TQPA 1WY7A 3KRRA 2V5QA 4F63A 4J8MA 4PMPA 1H26A 1EIZA 2WOUA 3BCEA 5AAGA 4YUXA 4IV0A 3UTOA 5E1SA 4KAOA 2RIOA 3O71A 3OBGA 1ZXEA 5K0CA 4YTCA 4TXCA 5CAUA 4KDCA 4FV2A 4FV1A 3QUEA 4R78A 4G6OA 4C7TA 1NBHA 4JXJA 3BHHA 5HLNA 4ZMFA 3E8DA 3GNLA 3ZUUA 4IB0A 5A54A 5DIAA 3ZLSA 3FPGA 3TM4A 4E2YA 2FO0A 3U87A 4ZMEA 4YC6A 4L3JA 4O0XA 3POOA 1RI5A 5ANEA 4M13A 5HBHA 4BDBA 5ICEA 1M2PA 2PZRA 4QP1A 5T68A 1Y6BA 4Q9SA 4LMUA 4RGJA 3U6IA 3B3JA 4F9BA 3OXIA 3P9KA 3IGOA 1RDQE 5JRSA 3F5UA 1XH9A 4APPA 2IBTA 4CNHA 4CVAA 2UW4A 3IW8A 5E8TA 5IDPA 2X8IA 3DDQA 4QMZA 2B9JA 3SSNA 4I6QA 4BC6A 1R8YA 3KRLA 1Q0TA 1R8XA 2XEZA 3LCCA 1EH4A 3KF4A 4I41A 2J5FA 4O7RA 4J52A 4Y95A 3EVAA 4FIFA 4PUZA 5LQNA 1R1WA 4QP2A 1BMKA 5H2UA 3LFCA 2JD5A 1SG9A 3K5UA 4IAKA 2QOFA 3LXLA 1ZY4A 4U7PB 1U59A 1UU3A 4YPSA 4FZDB 4M15A 1VYWA 1JSVA 3S3IA 4MIKA 4E32A 5JGAA 2UZDA 3D94A 2ZV2A 4QQ5A 3OCGA 1Y6AA 2KULA 4DH8A 3FMNA 5H02A 4AP7A 1U5RA 2XNMA 3MCTA 4I22A 3G7UA 2FSOX 3VS5A 5CF6A 2CKQA 2GPHA 3TV6A 2XBMA 3R8UA 4MWIA 4XOZA 4TYJA 4EKKA 4RTJA 4D9TA 2YCQA 4G17A 3F82A 1XHAA 3D7TB 3F61A 4RTOA 2X4ZA 2P3QA 5LMKA 1YXVA 2J51A 2ZV8A 4MTLA 2GAFA 2BRNA 1AQJA 4IM2A 4G9CA 4EOJA 2JHAA 1T43A 4FUYA 3M42A 3DULA 1P4OA 3UJ6A 3E05A 3CPBA 4XCXA 3SW7A 2B54A 2VNWA 4FV4A 2BR1A 3MHTA 3FMHA 4YJUA 1Z57A 4BCIA 5K9IA 5ANKA 3DKOA 3KKVA 5HCYA 4AWIA 4UXLA 2ZMCA 4XV9A 2BUJA 2QG5A 3KXHA 4AW1A 2XCHA 3NUSA 2OXXA 5ETFA 3NWWA 3HVKA 4G1WA 4M12A 1T45A 2ZULA 3LFSA 5GWXA 1OIYA 4FT7A 4HGZA 3DJ6A 4TT7A 1ZARA 3DNDA 1JTFA 4GYIA 5D10A 1Q99A 3OC1A 1X1AA 2ITTA 2CLXA 2PXXA 3KXXA 3EKKA 1ZAOA 3G5TA 5M4CA 5I0BA 4XV2A 4FTKA 3HZTA 1J1CA 2X9EA 1RJBA 1WFCA 4DT8A 4EQZA 4FZAB 4U0IA 4MXYA 1KWPA 5E8WA 5EI8A 4JBOA 1SQFA 4GT5A 3NWBA 4IH8A 4XUFA 2QY6A 4IFCA 5L8KA 5EOLA 4AG8A 2OKCA 8MHTA 2ITXA 3FQEA 4Y72A 2C6MA 4QTUB 4B7TA 5D1NA 4ERWA 3OCSA 3OS3A 4MTAA 1SNXA 1D2GA 4C37A 4I5PA 4EVIA 3Q9XA 4E6CA 3FYCA 3PFQA 3O7WA 1I44A 4QP4A 2C0IA 3VSEA 4HZRA 1PXPA 2OWBA 3QKKA 2UW9A 1FINA 4CFWA 2Q0BA 2YX1A 10MHA 4OW8A 3H9OA 1FBNA 1BL6A 3A26A 5DOSA 3QGWA 2QM3A 4DG0E 3NRMA 3ID6C 5EOVA 3NNXA 2JITA 3BE9A 5L2IA 4BDCA 1TQIA 3QTZA 2EJUA 3BQRA 4CG8A 2VZ9A 4X60A 3VC2A 4A4XA 3RAWA 5AA8A 4TW9A 3KR1A 3DT1A 1YHVA 2VTLA 3TIZA 4XLVA 1VPTA 3AMYA 1BHJA 3MTIA 3CJFA 5CEIA 4CCUA 2ITZA 5AP1A 5AFVA 1VQ1A 4PIMA 3FMMA 3DOUA 1Q97A 2OO8X 4MQ1A 3OHTA 4GFOA 4CWAA 5CVUA 5DI1A 4ASXA 5I9YA 4EHEA 3PZHA 4GT3A 1Q41A 3VW8A 2BR4A 4ACGA 2YDIA 2GNIA 5F2OA 4GF5A 4TRLA 5TKDA 2O06A 4C3RA 4FEXA 3EVBA 2HZIA 3OMVA 4TWPA 3FPJA 2B7AA 1NY3A 2QOKA 1OL5A 1PKDA 3MGYA 4BHNA 3TXOA 4E31A 3NCZA 3RAIA 5K03A 3BWFA 2O3PA 2WTVA 2W9FB 4K8AA 3V5JA 2C0OA 2WMBA 4RLKA 1JPAA 5CQWA 1OBDA 3NS9A 2O0UA 3R0TA 3OE5A 3G8BA 5HVKA 3C4XA 2AOUA 4BBFA 4HYUA 2YWPA 4R8SA 3BLQA 4RVTA 4YTFA 5EM5A 1P91A 4I21A 4ACMA 1UNHA 5FGKA 4M36A 5H8GA 3VUMA 2O64A 4KRGA 1KYZA 5CASA 3E7PA 2QNJA 3LCSA 5M56A 3LCOA 2ADMA 1M0EA 1MJFA 3DOGA 2O05A 2VO7A 3B8QA 3ATSA 3LPBA 2H11A 4YNEA 5DGZA 5IQDA 5FDXA 1H25A 5FQNA 2JH8A 2IDKA 3L8XA 2XH5A 3H0ZA 5CZIA 2Y9QA 3PPJA 5KBQA 3QTXA 2O07A 4LV5A 3A7EA 1UWJA 2C68A 3TZMA 3A7IA 3OOGA 4O0UA 2B2CA 4WIHA 5D1HA 4ER5A 3LOKA 2R3GA 3CCFA 3QZGA 3FUPA 4KSPA 3ZEWA 3FKOA 4TYHB 3ULIA 4ASZA 2PULA 4X3FC 5DX1A 3PE1A 2O2UA 1KE7A 2AC5A 1SVEA 4OLIA 4HVDA 2WMTA 5CUQA 2PX2A 5BW5A 1H1PA 2IH4A 4ENXA 3UG1A 4PDSA 2ESRA 3H9FA 2NO3A 4PYIA 4RX1A 2C5NA 1AF7A 5CENA 2GU8A 1R39A 4PY1A 5HU3A 4FICA 4XP3A 1WG8A 5K5XA 3MYGA 3AXTA 2VWBA 3QCYA 4W8DA 4KINA 2HELA 5B2KA 3FDNA 4ZOGA 4RBLA 5FEDA 1YF3A 5EHOA 1JNKA 2OLCA 4QPNA 4N4SA 1OKYA 5AWMA 4FSNA 2VP3A 4RJ6A 5LVMA 2GFCA 3DXXA 3BI6A 3KQOA 5EVJA 4M84A 3LKDA 3R1SA 2I9KA 1P2AA 3LFBA 3GCQA 2JHCA 3EYGA 3EB0A 2BZIB 1YRPA 2VX1A 3KVWA 2YITA 4MXZA 3H2BA 1XCJA 4O7YA 3DLIA 5DNRA 4F4PA 4FSZA 4RWZA 1SVGA 3F88A 1Y91A 3K3IA 4BR3A 2YFXA 5HZMA 4K77A 5DR2A 4QMQA 2X39A 4MNFA 3G9NA 4ACDA 1ZHFA 2CJMA 2C6KA 5AUVA 3HAVA 5FQOA 4C4GA 5EHIA 3FZRA 1R74A 3NDMA 2CKDA 3W33A 3DA6A 2G2IA 1PXOA 4G9RA 3W2RA 2E9UA 5ANDA 2WU7A 3D5XA 3EFJA 2ONLC 4ZTRA 2I7CA 3RW9A 4IB1A 4QO9A 2I0HA 4P7KA 4PDPA 3M1SA 3BEGA 4BYIA 4YUQA 2YIWA 4ACHA 1NV8A 5HE3A 5BP7A 3FC1X 2XJ1A 2VTSA 2ZVAA 4F9YA 1GZ8A 3CY3A 4E7WA 4L01A 3R9OA 3PLSA 3C51A 3C4CA 3GCZA 2RG5A 3QTIA 2B1PA 4QYHA 1XH8A 1ZOEA 4UZHA 4MXOA 4WXHA 3R7OA 2UZLA 1INLA 1ZLTA 5D12A 4YUZA 2VWYA 3EQGA 5J87A 3QL8A 3NNWA 5EKNA 4BCQA 2CNQA 2EB2A 3WI6A 1Q8WA 4X3FB 2Q0NA 4FV3A 4EMSA 5HD7A 4FC0A 2PUUA 2ITUA 3TZ9A 5A4QA 3V5WA 5FWAA 3AXWA 2QI8A 4CGAA 2OXDA 4FEQA 2BROA 5K0GA 4YHTA 4A07A 4MK0A 1YHWA 3AMBA 2F57A 5CEPA 5KMKA 4N0SA 2PMIA 4EH8A 3CTHA 1J91A 5CLPA 2Z6UA 5D11A 3FTEA 4BCMA 3GGDA 1WAKA 3BELA 1SM2A 4I6FA 2ZV7A 2OJ9A 3V8TA 4ARKA 5ERGB 3GP0A 3I7CA 3B89A 3ZO3A 4MNEA 4YLLA 2XYQA 2P33A 3TNIA 4K0YA 3S0OA 2HOGA 5EW9A 5DR6A 4X63A 3ZFMA 2WIPA 4O7WA 1YOJA 2FH9A 3RPSA 1EG2A 5LOHA 1TPYA 2R2PA 3FTDA 3BLHA 3Q96A 4X0MA 3PXRA 4RMZA 4U97A 3AT3A 2C1BA 3B8RA 5JN2A 1XVAA 4FKSA 5BVDA 3ZBXA 3MPTA 3UJGA 4CT1A 5DE2A 3WF7A 5K0NA 3UG2A 3HDMA 3DB8A 4I6BA 3P08A 3E8CA 1XKKA 3UNKA 2JJQA 3FMDA 1OKZA 5E8YA 3TN8A 4O6EA 3N51A 1KYWA 2B9HA 2HAKA 4AUKA 4PNKA 4BCPA 2F8LA 4CFFA 3BXOA 1MQBA 2H8HA 4QTBA 3KXGA 2PU8A 3FYKX 3K6RA 2VNYA 4PL3A 1W8CA 2IN6A 4WVLA 4RVDA 2EJTA 2GQGA 4QYYA 3OZSA 5D41A 3ULZA 5M51A 3BZBA 2BH2A 2C3JA 3DKGA 4QMUA 4EK5A 4OTGA 1PF8A 3OTUA 5GIOE 2YXDA 4AN9A 3OFJA 5DRTA 4P7GA 3LBFA 3FI3A 5IQHA 4NTSA 2PXCA 3PJ3A 5J1VA 3EFWA 2YCSA 1YI3A 4RLLA 2OIQA 5E1DA 3KCKA 4YO6A 2VTQA 3KU2A 4HC4A 4NFNA 3PWYA 1CMKE 5K0FA 2BZJA 5EFQA 5HFJA 4G5JA 3H9RA 4OQDA 4AZFA 4KB8A 1OL6A 2DYLA 4RTKA 3I79A 4R5YA 3R01A 5J9ZA 4CLIA 3I81A 4IJPA 2CN5A 4DGGA 5JGBA 4TYGA 4RTSA 1U4DA 2B9IA 4EI4A 3I9FA 5IH3A 2JBOA 3OU6A 4DINA 5M57A 1ZMUA 4P7JA 4FIHA 3LX6A 2N47A 3NW7A 3ORIA 5IUHA 2QYOA 1PKGA 4ONAA 2G2HA 3QHWA 4DFZE 4K18A 3CSVA 1E1XA 3DDPA 1H0VA 5EG3A 4L43A 3O7LD 4S30A 5E2AA 2AN4A 2RFNA 4NSTA 3UIMA 4AAAA 2PUPA 2RFSA 3Q52A 3VO3A 1K9AA 5C01A 3LXPA 4XG2A 3L8PA 4BI0A 2VWUA 5IA2A 4OX9Y 2PZIA 2SRCA 4P90A 3HCDA 1RJFA 1X19A 3UFBA 4FTUA 2AZTA 2UZTA 7MHTA 3Q53A 4U81A 1ERKA 3R7VA 3ELWA 3P79A 4GEKA 3ANRA 4XHKB 2UV2A 4YC3A 3QYZA 5HI2A 1W7HA 3FBVA 4PQNA 4FL2A 2QCSA 2W96B 1XCLA 2VX3A 3Q6WA 3SXRA 3V8WA 2R3JA 3SLSA 5TR6A 4AGUA 2B4SB 4C2VA 3ACKA 4ENYA 4KW7A 5HO8A 5F9EA 4EJNA 3EEOA 5A4TA 4C59A 5JZNA 1JKTA 4FX3A 4JL9A 4KA3A 4GFGA 1H08A 3S1HA 5J7HA 2I62A 3FY2A 4RWKA 4HJOA 1F3MC 3G2MA 5EKOA 4W4XA 3P97A 4YV0A 4Q9ZA 4FTTA 4V01A 4FEWA 2BDJA 4ITIA 1M7QA 1J7IA 1B42A 3SG8A 4EWQA 3DCVA 5JGDA 4Y8DA 4IAYA 1IR3A 1XH7A 5F4NA 4F9AA 3EFLA 1PMEA 2PVJA 4EC8A 5K0BA 3KPYA 3QD0A 4BF2A 1OL7A 1KE5A 3MB7A 3TPZA 3LFFA 3BV2A 4BDHA 1STCE 5DH3A 2R3HA 4BYJA 3RWQA 5EQEA 5AV0A 3C9WA 3I5NA 1MRVA 3KR2A 3DBFA 5JQ5A 3F3VA 4IZAA 4RJ7A 3EZVA 4V0QA 4KUJA 4G3DA 5EQYA 3HVCA 2RKUA 4RJ4A 2J0LA 4OA8A 4GIHA 4BTJA 4DCAA 4PMMA 3A2CA 3ZLYA 1OUKA 2NXNA 2RL5A 1RI1A 3ME5A 4HW7A 2O0LA 5IDNA 4ZLYA 4YHJA 4U40A 3BYSA 3BX5A 3E64A 1NVQA 4M3QA 1WZNA 3NUAA 4H39A 3VUDA 4ZJJA 2QR8A 2ZAZA 2GDOA 1EQAA 4A9RA 4CTJA 3D5UA 3UDBA 3MDYA 4RVFA 3NYVA 2OU7A 3QXOA 1Y8GA 4PL4A 4AZSA 3P1AA 2P2HA 3TZ8A 1ND4A 3AD5A 3LFAA 4PRJA 2ZM3A 3GU4A 3HCCA 4MXAA 2QR7A 4J71A 4ZSGA 2FK8A 3OT3A 1Q0SA 4ZTHA 2WEVA 2PE1A 2VGOA 3DJ5A 4BCGA 3BGZA 5LVNA 3MY5A 1XO2B 4II5A 4JR3A 4IWNA 2XK3A 4BDIA 4XNEA 3SHEA 3EMBA 3B7PA 2JC6A 1X1DA 3ORZA 5HHWA 2VDUE 4O2ZA 2VWWA 3PSDA 3KQPA 3COMA 4UB7A 4ZLOA 2E9NA 3RCDA 5C9CA 3D5WA 1F0QA 3G2PA 2F2CB 3R21A 3S00A 2W99B 1O54A 3QRJA 5FQDC 3QTRA 1OIRA 3V97A 2BFYA 2JIIA 2ZBPA 4BICA 3W2CA 2X2KA 4J1RA 1V1KA 4F6WA 4QP3A 5A9UA 4RT7A 2W9ZB 3S95A 4F0GA 4GKIA 3NZ0A 2G2FA 3EH9A 3THSA 2O57A 5DEWA 5IZFA 3BYMA 2XK4A 4MHTA 5JR3A 2BCJA 1UFKA 3KPUA 2J2IB 2AUHA 3MERA 3QALE 2C3LA 5B2MA 4EK9A 1RI3A 2YACA 3IG7A 3JVRA 5DPVA 2PVFA 3HL7A 5CCBA 2XRWA 3VS3A 3VBVA 3KQTA 4ZSJA 4GUAA 2XVDA 4WHZA 2YR0A 5JUWA 2WMAA 3LSTA 4G31A 5HE0A 5K0LA 1VR2A 4BTKA 4FKPA 5HGIA 5KO1A 1UKIA 3TM0A 5E9EA 3NAYA 3AC1A 4FKTA 4O7TA 4JAJA 3SV0A 4OQEA 3I7BA 3BKWA 3GU6A 1O6YA 4AA0A 3DK3A 2R3RA 3HLLA 1XH5A 1UWVA 1UV5A 1CSNA 3BLRA 4G3CA 3D2LA 1LEZA 3R00A 5FCDA 4M14A 1VE3A 4IWDA 3IPHA 4TY1A 3QTWA 3ORHA 1GNGA 5KMNA 1DL5A 3OY1A 4GBED 2BKZA 4RTQA 4EH7A 4FSDA 5AV4A 1L3IA 1DAYA 2FHPA 4XV3A 4DA5A 3KRWA 2I1MA 4AACA 4A4OA 4E2XA 5JH6A 1QAQA 2O65A 3QCSA 5ICPA 2PKWA 2QKRA 5KZIA 1H28A 4CSVA 4XUDA 1Y8YA 2V7AA 5KQRA 5LVPA 4DM3A 4O7VA 5GOZA 4M97A 2NXJA 2YM5A 4IVAA 3UJCA 5EYDA 5HBEA 3A4PA 1O9HA 3L8VA 1DCTA 5AP4A 2OYRA 2VO6A 3R02A 2WPAA 3GT8A 4LUDA 4PWNA 3FLQA 5JFWA 4NU1A 4U8ZA 1OPJA 4B99A 2VTRA 2Z2WA 2FCAA 5CEOA 4DKJA 5AMNA 2FRXA 3HRFA 3R7IA 2XKDA 4BZDA 3KPVA 3SC1A 3EGVA 4BVUA 5GIPE 3LXKA 2OICA 4GKHA 1Q62A 5I9WA 4LQMA 3ZC6A 2AS0A 2HR1A 5K01A 5E8ZA 2C7RA 3OROA 2YM6A 2XUUA 3LMIA 3X0DA 2QRVA 5AEPA 3LE6A 3W8QA 1BI7A 3ZSGA 2OG8A 5BVKA 4O83A 2HIWA 4BCFA 5L2WA 1FMOE 2PMNX 4FG9A 4ANBA 1L9KA 5EPEA 3W18A 4O0RA 4DMGA 1DUSA 3W2QA 4MEDA 4Z7HA 2WNTA 1YWNA 3DXZA 3BGPA 3MQ2A 5C1QB 4F1TA 4RIYB 2PWPA 4BLUA 3KKZA 2ZIGA 4KBAA 1QPDA 2ZM1A 4D4VA 5CU4A 1TW3A 2R3QA 5C1IA 2AN3A 5A6NA 5ICCA 4UY9A 3HA6A 4NKSA 3AG9A 3MA6A 3RVGA 1RW8A 4ZK5A 4EBWA 4HYHA 3FMKA 3TI1A 3VS4A 4IAIA 3TQSA 3DLZA 4CKRA 3GB2A 3QFVA 2J6MA 3DK7A 4RTLA 2QO7A 4O38A 4AZVA 2JEDA 4UWYA 5G6VA 4QNAA 4TKSA 2O8YA 4E4NA 3EPPA 1YXSA 2IBSA 3Q4UA 2EFJA 3Q4CA 4G3GA 2BRBA 3A61A 3KN5A 3R24A 2YABA 3VBXA 2CNUA 4QDJA 4O86A 4FK6A 1NW5A 3DTNA 2J0MB 2QO9A 1YOMA 3D2KA 5EYCA 1Q5KA 3TNWA 4H05A 4EK4A 4CFMA 3KQQA 5HILA 3WZJA 4ZZMA 5HNIX 5LQJA 3P7BA 4FTCA 3RHXA 4PONA 1K2PA 5B7VA 3HYHA 2Z02A 2J90A 2W4JA 3BWJA 4Y73A 2JDRA 1IA8A 3HVHA 3OCBA 3UP7A 2AC3A 2ZDTA 5H8EA 1NW7A 4YZDA 3V51A 4BCOA 3A27A 4JBPA 3C0KA 4C4FA 2HZNA 3PTAA 2XRUA 5AIKA 4RTRA 2ZW9A 5FXRA 3W2SA 4JJRA 4DF3A 3EL7A 5IA1A 2WTJA 4YLKA 2IO6A 3CQWA 3EHAA 3ZLXA 5IQGA 3WE8A 3HP2A 4M67A 5ANJA 3ZDIA 2GQRA 4RJ3A 4FKRA 3ODZX 5I9ZA 3N4UA 4FR4A 3K3JA 4QMLA 2WIHA 4ZXTA 3NDJA 3G9LX 5L3AA 3ER9A 4A7CA 3R9DA 4FNZA 1PRYA 1ORHA 3JY0A 3KMWA 2ZB0A 2GS6A 3PT9A 5EMMA 4GL9A 3LJ1A 5DM1A 1CM8A 5CIYA 2B55A 4KNBA 1IG1A 5GJFA 4L7SA 5IH5A 2PUNA 4FMQA 3C4WA 4EZ5A 4C03A 3MJ1A 5AV1A 3FPHA 5FA5A 3W32A 4RIOA 3UGCA 2UZ4A 4APCA 4CTCA 1ZYDA 3QA8A 4JRNA 2C5XA 2FYTA 5L6OA 1M6EX 5AUXA 2GHGA 2PVYA 3FKNA 3EIDA 5IA0A 1S9JA 3VBYA 2DULA 3B2TA 4DEBA 3V5LA 2XYUA 3OWLA 1WXWA 3O31A 3VHKA 1G8AA 2XNEA 1U46A 2DQ7X 3POZA 5F2NA 4Y5QA 4K11A 4PP9A 2YERA 1XJDA 2GSFA 5LMKC 2CN8A 4FKLA 3QUPA 1ZGAA 2IVTA 5AJQA 3MFSA 4AT4A 3ALOA 3QQGA 4OBXA 2XMYA 3ZEPA 5KMLA 3VF8A 3U4WA 5A3XA 1LP4A 3UJDA 5E8VA 4RTMA 4U41A 2X8EA 3NCGA 1M17A 4OA5A 4LRJA 4RQVA 4DFYA 2QOQA 4JAIA 2EG5A 4DGOA 4M0ZA 4JDHA 2PVCA 4WNKA 2GH1A 3P2IA 5AUZA 4OTIA 2WTKC 5DRBA 3V8SA 4Q5HA 5AP6A 3FI8A 4ZTNA 3SW4A 2IH2A 3O23A 2CGWA 4FT9A 4DFNA 3NYOA 4CRSA 3B3GA 4AW5A 3VBWA 5DWRA 4RC2A 3U6HA 4BDDA 4M68A 2IWIA 5HD4A 4FOCA 4D0XA 3TNHA 3ZTXA 3A60A 4FODA 3MPMA 4RX5A 4ZJVA 3FTFA 2RG6A 2B78A 4YZMA 3DB6A 3OZTA 4AXAA 2A4LA 5H9BA 5JFSA 5AP7A 2C4GA 4EHGA 5JT2A 3OEZA 3GEQA 3TKYA 2IW8A 4DHFA 4N57A 4BDJA 1JQEA 4BBMA 5AAEA 1GIIA 3TNPC 4R1VA 4DEIA 3W10A 3ZFXA 4Z9LA 2GPYA 5E9WA 5EIWA 1UNGA 2YIQA 3PXQA 3QQLA 3NUNA 3BBTB 5DA3A 3CTQA 3R8VA 1O9GA 3JXWA 2ERZE 2VTAA 2ITNA 2NXCA 4LV8A 4XCUA 4GT4A 1U5QA 4XG6A 3UJ7A 3TT0A 4FT0A 3N4TA 3FTCA 4B0GA 1NVSA 5EHLA 5M5BA 4M8TA 1G60A 1QAOA 3O8PA 3QQUA 3P2EA 3VRYA 1KIAA 1FJXA 3WF8A 3PIZA 1VLMA 4IFGA 5CSXA 4R6VA 3FLZA 5IU2A 3A62A 5KQSA 4XRLA 1JQDA 3B2WA 1OIUA 1XXLA 2GTMA 2Z8CA 1KPIA 2WZJA 3PYYA 5DRYA 4YSJA 3UC4A 2YIXA 2RGPA 3GJYA 1MRUA 2Z7SA 1FGIA 3UOKA 3Q5IA 2BFXA 4D58A 4ZY4A 3GXOA 1P1CA 3SOAA 3HCBA 3QKMA 4FYOA 3QF9A 3GOPA 4Q5EA 3M2WA 4IJ9A 3RPYA 4NCTA 5HIIA 3EYHA 3H0YA 2YTZA 5CEMA 2VWZA 4CRLA 2BAJA 2QC6A 2WTKB 4TTHB 4WG4A 1IAHA 5JFVA 4XG7A 5EQPA 4X1OA 2PSQA 3DQWA 4E70A 3VS0A 2BZGA 2J0KA 3FYDA 4YMJA 3R3HA 2BM8A 3AD4A 4RPVA 3L1SA 3MVHA 3T3UA 2QLUA 3DJ7A 2WQBA 4DG2E 1EJ0A 5IQAA 1KSWA 2P2IA 3OUNB 4AGCA 5HG8A 3A7FA 4ZS0A 3VQHA 5IQCA 2PY3A 4R05A 2BHHA 4DH1A 3FZGA 5BYYA 3PLAE 3OFKA 2A0CX 2B9EA 3ENHA 3LZBA 3QBNA 3SXSA 2CMHA 2F2UA 1Q4LA 4H3BA 3BV3A 1XR1A 4KVZA 5LQKA 4LG4A 5T3QA 4BCKA 4DEDA 3VAPA 2PMOX 4JS8A 4IBMA 3BGVA 2LGCA 1H4LA 3HNGA 2BAKA 3MB5A 3OP5A 5A46A 4ZTQA 1B6CB 5JMSA 1F5QA 2C5OA 4RWIA 1VZOA 5G1XA 3KY2A 4BGGA 4AT5A 4I24A 3C0GA 3PA5A 4FNWA 2BVAA 3L9NA 1PYEA 3MVMA 5KNJA 4FGZA 3DGKA 3O8UA 3EWHA 4QMWA 3ZS5A 2HWPA 5AP3A 3DTWA 4IANA 3HUBA 2XBAA 5AP0A 2PT6A 1HCLA 3CY2A 5BYZA 4FT4A 5IQEA 2IP2A 3WF9A 1MQ4A 4LRMA 2P41A 1SVUA 4FSWA 4IB3A 4HGYA 4TWOA 1G6Q1 4CKCA 5CVGA 3PFGA 4P7FA 4H58A 4RFZA 4J99A 3RPVA 2EB3A 3PXFA 1REKA 4XUCA 3DXPA 1BKYA 1NXKA 4CFXA 2FA2A 3DNEA 3BU6A 4F84A 4O0YA 4FBXA 3V01A 2PZPA 4RIWA 5EKXA 3UQFA 4C0TA 3M11A 3AT2A 3KMMA 4LWPA 4A06A 2R3PA 2UW5A 4EKGA 5F95A 4CT2A 3COIA 1W98A 3P7CA 2XIZA 5DN3A 3Q2JA 1GAGA 4FKJA 1YHSA 3HV3A 3BHTA 4EH9A 2VD5A 3TV7A 1YXXA 2Z7LA 2GB4A 4QDKA 3G88A 3MY0A 3KULA 4ZIMA 3SSOA 2AOUB 5GHVA 4M38A 3UVPA 1JSXA 4UBAA 5GM1A 3U8WA 3W16A 2BZKB 2YA9A 5P8WA 4GOLD 5IF1A 1IAJA 4ZLZA 4E73A 3HMOA 5ETCA 9MHTA 4P2KA 3RTPA 3AXSA 2OZAA 2ITQA 3ACJA 2C5VA 2IGTA 1H1DA 4NL0A 3R83A 3F2NA 5BVFA 5E1MA 5D7VA 4RSSA 3CXWA 2GNHA 2NP7A 2W5AA 5E9QA 3ET7A 2IZUA 3FUVA 2HXLA 2PBFA 4V05A 4PYOA 3FXXA 2C6TA 3RPRA 2ETKA 1VP9A 4KBCA 4GRBA 4AZWA 4E20A 2OJGA 2OW3A 2P7IA 3UO4A 4ID7A 3OPNA 3UIBA 2OXTA 1QCFA 4FOBA 1BLXA 4F09A 4KBKA 4BTMA 3MTFA 3PFHA 4FV6A 5CI7A 4YC8A 3UODA 3ZRLA 5CU2A 1B39A 4DTBA 5HIMA 1BOOA 3FLWA 4EYMA 3L9LA 3PX3A 3NW5A 2P8JA 3ZRKA 3LHDA 1H8FA 2W1HA 4EYJA 3IV6A 5DSTA 2CHLA 3C0IA 2VWVA 3G5LA 3V8VA 1H0WA 1OMWA 2VTIA 3RAHA 2W1EA 2XNBA 5DTQA 3OTVA 4EKLA 4AX8A 3THBA 4IWQA 4F86A 2OKRA 2QOOA 4FTJA 2WELA 1P39A 3MESA 4JBVA 4YGAA 2R7BA 3HUCA 2PX5A 4MWHA 4FZ6A 3TEIA 3DR5A 4C08A 5AA9A 3QRTA 4HYSA 3BBWA 3KMUA 1Q8YA 5K4IA 4U7ZA 3ZSHA 3AC5A 4NM0A 4NW5A 4NYEA 4QTEA 3R7YA 2XS0A 5CZHA 2VS1A 5KCVA 3LJ2A 3QCXA 5KYGA 3VWAA 3ZYAA 2R4BA 3ZZWA 1KOBA 5DM0A 5BUEA 5T6BA 5T64A 1FPQA 3QX4A 4E5BA 1XDZA 4IAAA 2P3OA 3C1XA 2YXEA 4FIIA 1JSTA 2IJMA 4G3EA 3O8TA 2XYNA 2QONA 2YN8A 5J5SA 5EW8A 4OTHA 2OJJA 4GG5A 3L9PA 3NAXA 3O96A 4S31A 5CVJA 4DBXA 4EOLA 4J95A 4N6YA 1SZMA 3PUPA 4PMSA 1YXUA 2J0JA 2F49A 4OBWA 2A2AA 3N9XA 5EZSA 1U2ZA 2PT9A 3E8NA 4YJOA 4RVMA 3B5IA 2VTJA 3DTCA 4DT9A 3PWDA 3SOCA 4QVGA 5BXYA 2R5TA 2ZJWA 5GJDA 3DMFA 4X6QC 5I9UA 2BIKB 4HCTA 3T7RA 4DITA 3I60A 2W5HA 3OUKA 1UIRA 4KWCA 2HWKA 3UO6A 4L8MA 2OFUA 3H10A 3P9NA 1NKVA 1YFLA 3ZONA 3HM2A 1F38A 2R6ZA 4NM3A 2PX4A 2R3KA 4C05A 1BUHA 4HRAA 4RTNA 1YXTA 4Y85A 3PSCA 3PJ8A 4DEEA 2XYVA 2YIRA 4J7BA 5TF9A 3R8MA 2BPMA 4BGHA 2UYHA 1QPEA 2EUFB 2XKEA 3QD4A 1WBVA 3UIXA 3VRZA 3LECA 2PX8A 3FZOA 3UVRA 3PA4A 3NW9A 1G3NA 2PGXA 3RODA 3QWJA 3FPQA 3OD6X 4L3PA 3KQSA 3AC3A 5E8SA 5K0JA 4H1MA 3CKXA 5IA3A 1RJEA 4PYJA 3GC0A 3M4XA 5KE0A 5CSWA 3RK5A 3LM5A 4E2WA 5FP6A 2A1AB 3UZUA 3RK9A 5LWNA 3QA0A 4BY9E 3MVLA 1XWSA 3KRJA 2YAKA 2C3IB 4BBEA 2X6EA 5ACBC 4YV1A 3GRZA 3LLAA 5HX6A 4FVRA 4F08A 4MNEB 2AOXA 3G8AA 2QURA 2JG3A 5FUBA 3E23A 2WMVA 5BVNA 3DXYA 4E6QA 2UZBA 2XVMA 4PF4A 3CS9A 2QOHA 3D15A 3F5XA 2DWBA 5EKUA 3KXMA 3QC9A 3WZDA 3COHA 5HNBA 4UEUA 4FEVA 4HG2A 3OY3A 4E93A 3G15A 1M52A 3CGGA 4I1ZA 4O81A 3UA3A 4MXCA 5CTPA 2HY0A 4QMPA 5FTQA 4I20A 3EGEA 3PPZA 3S4QA 3Q4ZA 1PW2A 3FPEA 3UYTA 1UWHA 4DCMA 2GHLA 4PWYA 2UZWE 4C4AA 4HYIA 3IYLW 3TIYA 4O27B 1BI8A 2I7QA 3JWIA 3FSFA 5BMMA 2X9FA 3IO7A 4YZNA 2R0UA 4FG8A 2CLQA 2F7ZE 3NX8A 3T0IA 2UW0A 3EQFA 5K4JA 2B9FA 4FSUA 2E9OA 5IQFA 1O6KA 4RJ8A 4FE2A 4GCJA 3VS6A 1URWA 2BILB 2PZ5A 4CLJA 4DEHA 3ETAA 4C04A 2ETMA 4BCHA 1XDSA 2JAMA 4USFA 3KVXA 4AW2A 3KEXA 3QTQA 4OBQA 2ERKA 2WAJA 3F7ZA 3EVEA 4YURA 4LGGA 3KFAA 4FA2A 4F65A 2UZOA 4GG7A 4TYIA 3CD3A 2ITPA 3WYXA 3GQLA 2YHVA 4G34A 1Q8UA 4HSGA 3ZXTA 3A8WA 4A9UA 2QO2A 4RZWA 4PCLA 4X2NA 1R78A 2W7XA 5M53A 5J95A 4YP8A 3WF6A 1QANA 5HIKA 2IVVA 3PXKA 4UWCA 3FE3A 5M4UA 3HA3A 4QPSA 2IH5A 2J5EA 4CKJA 3UZPA 3VS7A 5CCXA 1KV2A 4BI1A 2HW7A 3NPCA 5BYLA 3UE4A 5EH0A 2VZ6A 4S34A 4LG1A 3GCPA 5FM2A 3M6VA 4K1BA 4S32A 3NSZA 4I0TA 3G51A 2VUWA 4GV1A 4M0YA 4H1JA 2JKKA 3PJ2A 3KHKA 4G16A 4FK3A 3CJTA 3EQBA 4I5HA 3QRUA 2VO0A 2VTMA 3HMNA 2X2MA 4CZTA 3P5KA 4EOPA 4YUWA 4KD1A 2ZCJA 3D9VA 3EJ1A 2NXEA 3E3PA 3G2OA 3NUUA 2G72A 3ALNA 2I0YA 3QQKA 5HEZA 3VC4A 3BWCA 4O0SA 1IXKA 1LR4A 5C4KA 3ZUTA 1G8SA 2YVLA 1NE2A 3MIYA 4J97A 2R9SA 1OPLA 2Y4IC 1VEBA 1WBOA 3OU7A 1RI2A 1MHTA 5DWQA 5CSPA 2ZZMA 4L9IA 4DCGA 3RWPA 3A7GA 4BRXA 5L8LA 5F94A 3VJOA 4NJDA 3ELUA 4IVDA 2YDJA 1PXNA 4JR7A 4EORA 5A14A 3LVPA 2CDZA 3PP1A 3TRKA 4JG6A 4QTTB 3E93A 4IWOA 5K5NA 3G6HA 4UYAA 3CKKA 2ZMDA 3FI4A 4ZAUA 5IH4A 2X7GA 4D4SA 3L8DA 4UX9A 3HAMA 3AC2A 3G33A 2ITOA 4ZSAA 2PY6A 5HTCA 3CC8A 2E9PA 3LDGA 4J98A 4JVGA 3FPFA 4DH3A 3F9NA 1PJZA 4DH5A 2WQNA 3VS1A 4F1MA 3SM3A 4U9AA 4JLCA 3HA8A 3R63A 5KMIA 3CQUA 4DBNA 4K2RA 1V0OA 3FSKA 3HMMA 5CSHA 5EDQA 3FUUA 3NR9A 4ER3A 3Q04A 3E8EA 2C1AA 2WTDA 2QE6A 4PYKA 4QPPA 2EVAA 2OZOA 3O51A 4DFBA 3F7WA 3ZMMA 3UOJA 2XCKA 4N6ZA 3P71T 4QP9A 4FEUA 4Y30A 3IGGA 3A25A 3L8SA 3BKXA 3AGLA 3EVFA 4OBPA 3AJDA 5CD1A 3U4UA 5CXHA 5JQ8A 4FIJA 3UC3A 1RQQA 2XBJA 4HVIA 2PE0A 2UW3A 1XBBA 4ASDA 3F66A 1FP2A 3P2KA 4L53A 4I94A 3ZC5A 3BGDA 3WILA 3ORNA 4P58A 3WE4A 3QU0A 2YZLA 4ISCA 3FPMA 5GM2A 4FUXA 3FJQE 5CNOA 1OITA 4FG7A 3BWBA 4YJTA 5LVLA 3AGMA 1JOWB 4O82A 3TV4A 3KQ7A 5CU3A 3GC9A 1AQ1A 4GK3A 3QRIA 5MHTA 4B6LA 3WZKA 2WFYA 4IAZA 1ZMVA 3TCPA 4C07A 1FVTA 1O6LA 4R77A 4FT2A 3NWEA 2Y4IB 5M06A 2PPQA 1SKMA 5C27A 2VN9A 4HZSA 4IM0A 2WTCA 4FGRA 5DG5A 3FQHA 2GMXA 3QZIA 1XDUA 3C5UA 4FIGA 2IZSA 4DLIA 1V39A 3II5A 3NIEA 3EQPA 3LBYA 2OIDA 4IZYA 2EX4A 4BCJA 4F85A 4IB5A 4USDA 5DX0A 4TNBA 3VBQA 2C69A 2GS2A 2WKMA 3HKOA 1LPUA 1XQZA 2XNPA 3EVGA 4DEGA 3QZHA 4ZSEA 3AD6A 3ZM4A 5E8XA 2R64A 1WVYA 4Z16A 2OY0A 4EJ7A 1RI4A 2Y6MA 4IDTA 3GWZA 1YKRA 5HNGA 4DN5A 4Y83A 2PVLA 4QTAA 3G89A 5I5ZA 3R6TA 4P5QA 5FUTA 3ZOSA 3PXYA 3NYXA 3R2YA 3CP9A 2VX0A 1W84A 4O7ZA 2XYRA 4PL5A 3C3PA 5M4FA 4EQCA 2X81A 2QKWB 3ANXA 4ANLA 4JG7A 3FZPA 5KS2A 5ANOA 2VTOA 1GIJA 5CF5A 4CCBA 3GDHA 3G2FA 2XK8A 2R3FA 4AE9A 1JG4A 3E92A 4NW6A 4AZEA 4UN0C 4E8AA 4H0NA 3BWYA 3EQIA 2B53A 3RNIA 4KSQA 5E4HA 3EQDA 4MXXA 4EHVA 4CQEA 3SVVA 4L7VA 4DGLC 2ONYA 1ATPE 1OGUA 4UALA 4FKUA 4Z7GA 3MW1A 3TLJA 4W8EA 2NP8A 5DFPA 4GOOD 2OZVA 1FPUA 4I4EA 2CGUA 4U44A 4EWHA 4H3QA 4FKWA 2ERCA 4IX4A 5CT7A 3HGKA 3RZBA 3OWKA 4E2ZA 4KIPA 3QAME 2BM9A 3VNTA 3TMAA 3F3WA 2YQZA 1BL7A 3F3UA 4YPDA 4ZZOA 4PDOA 4EOMA 5EGSA 3HEMA 2I40A 5TOZA 1R0PA 3HP5A 3JR1A 1DAWA 4F7LA 4K6MA 3TTIA 4R6XA 2QHMA 4YUVA 3TOSA 2XIRA 4U79A 5DYJA 5AM7A 4CXMA 4IZ5A 4B8MA 2XF0A 4P5ZA 1X1BA 3ZDUA 4BDEA 1F3LA 4RV9A 5E8RA 5LSAA 3TKHA 2ZFUA 3ZUVA 3S2PA 3UZTA 4RVKA 4YO4A 3IKAA 2ZBRA 3SX0A 4FZ7A 2ZTHA 5HG9A 4E5AX 1Q24A 2V0DA 2HZ0A 4E6AA 4M69B 5CALA 2I0VA 4U3YA 4YJVA 5HZNA 3QTUA 2B25A 3KRXA 4HGEA 2QRVB 1I1NA 3MN3A 3NNUA 1YB2A 2W06A 1IRKA 1XBCA 1Z9XA 4A9YA 1JAMA 5DT4A 4FP9A 4YJPA 5JFXA 1ZKDA 1HOWA 2Y1XA 3DP7A 4FSYA 2OFVA 3KQMA 3CD8A 3KPJA 3SGLA 1JKKA 3M6XA 5E1EA 3HCAA 5EIFA 4RX8A 3UVQA 5CVHA 4DG3E 3SA0A 4F70A 3D7ZA 4U7TB 4EEVA 4I93A 5FDPA 4XBRA 3BT7A 2JIVA 4FKVA 3E88A 3NUPA 5JRQA 2UVZA 3MJ2A 4QMXA 4IV8A 3I64A 4FT5A 2R3MA 4XEYA 2R3IA 4PNEA 3KN6A 4FL3A 2OBFA 1CTPE 3PXZA 2CGVA 4QTCA 4CTBA 1DI9A 4C06A 4O22A 3CPCA 2X4FA 4QMNA 3QD3A 4TN6A 1KHHA 3NNVA 2BTRA 2H34A 3I4BA 5A4CA 4NKAA 5EZQA 3MFTA 4C35A 4FV0A 4G3FA 3SRVA 5IMXA 1ZOHA 4FKIA 5C8MA 5HORA 2WXVA 5E92A 4AA5A 4RX7A 4RFMA 5LCKA 3FZSA 5B2LA 4UXQA 5KKRC 4PMTA 4DFUA 4DTAA 4AA4A 2NRYA 2CL5A 4EC9A 3OCJA 2PVMA 1J7UA 4GMYA 2OBJA 1I9GA 3TUCA 2Q83A 4DLJA 1G38A 2WMQA 3OBJA 4MWZA 4R8RA 4FZVA 3QOXA 3OVVA 4O7SA 3DLSA 3RIEA 4QYFA 2QD9A 4FL1A 1M2RA 5EK7A 4C33A 3CQEA 3JS2A 1WBTA 4FR0A 4EK3A 3DFAA 2JIUA 4WA9A 2ZZNA 3HVIA 1IASA 2XK7A 2GNJA 1NW6A 5FXQA 5HLWA 3V5TA 3ZM9A 5FADA 4MBLA 3R22A 3MIAA 3K54A 2PXAA 5IKMA 4FS8A 3A4TA 2CKEA 4EH2A 3LFQA 4HTFA 5IQBA 5L8JA 1CKIA 1E9HA 3ZO4A 3OF0A 3RAKA 2BIYA 3PY3A 5FBOA 3PSBA 3PVBA 3OZ6A 4NFMA 4RWLA 4C38A 4JQ8A 3LPMA 3TDVA 3CC6A 2ZDUA 3I5ZA 5LMAA 5EYMA 4KKEA 5HCXA 2YAAA 2PTKA 4L45A 4XP0A 3WOWA 4YZ9A 2IVSA 5C26A 4XJ0A 3RM7A 4PINA 3DV3A 3R2BA 3MWUA 2UUEA 4IDVA 2CWWA 5LCJA 1PXIA 4FTQA 4JT3A 3GOKA 4FKOA 2JKQA 1P14A 3QQFA 4BTFA 4V0RA 1XBAA 4WT6A 3JWHA 3CBLA 1H1QA 2GS7A 2ZV9A 1WVWA 3FUTA 4O6LA 5JZJA 3ZSIA 3ER8A 2PVKA 4FTRA 1PXKA 2HWOA 4O0WA 2PZYA 5GINE 1R6AA 4KIGA 2WHBA 3ZH8A 3RM6A 4C3FA 4PGGA 1OM1A 3DBDA 1EAMA 4I6HA 4JQ7A 4Z2YA 2UYOA 2C6IA 1V0PA 4LOPA 4V0GA 5CM2Z 2W17A 1YOLA 2ZBQA 5CAPA 4E5WA 2CMGA 4M37A 3I6UA 4PYNA 1FQ1B 3JYAA 3SQQA 3ZZEA 2UZVA 3GBZA 5CU6A 3AMAA 3EL8A 5E1OA 4KDRA 4EONA 2IPXA 2UZEA 4FSRA 4I23A 4V04A 3MPAA 3V5PA 3E8SA 5C8NA 3QLGA 4XRJA 5KKRB 2OH0E 4C4HA 1JKSA 4FTAA 3CVOA 3BHUA 4ALWA 4NCTC 2P1DA 1YWRA 3RKBA 3LCTA 3V5QA 3P9CA 4P7EA 4WNPA 4IWPA 5K09A 2O5KA 3D4QA 3C3YA 3KL8A 4ASEA 4YJRA 4YJNA 5CSVA 1WS6A 2W1FA 3HRCA 5HQ0A 3P9JA 2XNGA 2HXQA 3LCVB 1HMYA 1VP3A 1YUBA 4QP7A 1MRYA 3Q9ZA 5IISA 4RZVA 2J4ZA 3PVUA 2GNLA 2W0JA 1FMKA 3R9HA 2QOLA 5BNJA 1OECA 1GOLA 4ANSA 1NVRA 2H00A 3MS9A 3UBTA 3FWQA 2V55A 2BTSA 4R3PA 3FUXA 4L68A 3ODYX 1A9UA 3R1YA 4JIAA 3A7JA 5HG7A 4U3ZA 4FTLA 4JX3A 3ORLA 2PJDA 3MH3A 4JI9A 3PVCA 4E4XA 4OGRA 2YJSA 4YR8A 4U42A 4U80A 4CMTA 4CZUA 4HVHA 2C30A 3VN9A 4RQKA 2J50A 4IZ7A 5E7RA 5EMKA 1T46A 3WZEA 5K8VA 4A6EA 4XS2A 3R28A 3PG1A 4FSQA 4QQCA 1PMUA 2HYYA 4OTWA 3ZXZA 5CU0A 4QRCA 5FA8A 1YQJA 4TWNA 2UVXA 3G0EA 4MD7E 3FI2A 3C6MA 4QP6A 4CKIA 4K33A 3AOXA 3G6GA 3Q3BA 3OXTA 4BB4A 3DK6A 2PMLX 3FKLA 4GK2A 4YTHA 3SAYA 3I0QA 4RIXA 3FV8A 4M7RA 4CTKA 5BVWA 3UQGA 2P4IA 4D9UA 4FI1A 4RSRA 4G2FA 3BHYA 3BRBA 4F7SA 3DMHA 3V6SA 4Q2AA 1TQMA 4LI5A 1P4FA 3SSMA 5IUGA 3VULA 4Y46A 2XJ2A 3FXWA 4KWPA 4C2WA 5K3YA 1NBIA 3OG7A 2FVDA 4ER6A 5ETIA 5CAVA 4ZTSA 3PVGA 2W1GA 3LFDA 2NNWB 5F2KA 5CEKA 4HGLA 3UWPA 3ORXA 3BU5A 3QXPA 2ZIEA 4QMSA 1ZZLA 3R04A 3LCDA 2ITYA 3UJ9A 4RVLA 4M7IA 3EVZA 4HNIA 1TW2A 1P5EA 2JBPA 4KKGA 4C4EA 2AN5A 4GEOA 2G01A 2OO3A 2WQEA 1WBNA 3R7EA 5I4NA 3PB3A 5HESA 4D2SA 4O0TA 2AOTA 4GJ2A 3TWJA 3UJ8A 5M44A 5KHXA 3VVHA 4L00A 3Q5ZA 3DKCA 1OR8A 1J1BA 4RA5A 4NT4A 2W1ZA 1O9UA 4JG8A 2BR5A 3EN6A 4C4IA 4FT3A 1H27A 2F7EE 5JK3A 3BE2A 1J7LA 2VTPA 2XZSA 2WMUA 2F9GA 1UKHA 4ZY5A 4DGMA 3HRBA 5IMEA 3TDWA 4D1SA 5DLSA 1GZOA 3LJ0A 3QKLA 3WYYA 2LD4A 2BAQA 3C4EA 3SDJA 1ORIA 4TPTA 2OF2A 4PV0A 5EI6A 2OXYA 3UMXA 4QMMA 1H1SA 4S33A 5JEBA 4FTMA 4E30A 3UOHA 5M4IA 3FL4A 2UW6A 1ZGJA 1QPJA 3PZEA 4W4YA 1Z3CA 3RI1A 2BR3A 2PE2A 4MF1A 4IM3A 4F99A 4ZS4A 1G55A 4JDJA 5CY3A 1U54A 3D0EA 3UP2A 4ER7A 3HDNA 3GUBA 1XH6A 3V3VA 1NV9A 2CKOA 1YI4A 2F7XE 3HV6A 2H96A 3CJQA 3FY0A 4NUSA 4X3JA 1UU8A 1HNNA 4RYLA 3NUYA 3UNJA 4H36A 4JQEA 3EFKA 1JLUE 2XM8A 5E8JA 4X2JA 5AX3A 5CF8A 3U51A 1ZYSA 3W55A 5LQRA 4HVGA 1PXLA 3RMFA 2I0EA 3M6UA 1ZOGA 2G15A 3Q32A 4B8LA 4FSXA 3O7LB 2YWVA 4YHFA 2ZSUA 3FHIA 2YCRA 5FLFA 4LYNA 4AUAA 5CVVA 4KS7A 3MA3A 4TWCA 3LDFA 4JXFA 3IDPA 4RVGA 3KQYA 2C3KA 3QQHA 5ANIA 3PS9A 5T67A 4IMYA 5HBJA 3HECA 5EYKA 5ETAA 2W1DA 4RIWB 4FVPA 5D1JA 1YDTE 5FTWA 4GH2A 4BLVA 1WVXA 4QTDA 1LEWA 4A9TA 4IW0A 4YMGA 5FTOA 4DCEA 4L3LA 4KIOA 1M2QA 5DM2A 4OTFA 1SYKA 4F7NA 3E7VA 2R0IA 4YBKA 3ZO1A 2P35A 4RX9A 5CS6A 4DC2A 3KULB 4I0RA 4MVFA 5A4LA 3EQCA 4KRCA 4FV9A 4RC3A 3KC3A 2VV9A 4IIRA 4GOMD 5CAQA 5HKMA 3DXQA 1N7IA 2ETRA 5AUWA 4AW0A 4Y5HA 2OZAB 5DT0A 3Q6UA 4MBIA 4OTDA 3R1QA 4CKEA 1H00A 4CKBA 2IFTA 3R8ZA 4Y2HA 4FTNA 3LAUA 1RJDA 4ORKA 1WBWA 2DS1A 5E90A 2GA9A 3F6XA 2CCIA 3VIDA 2A19B 3DQXA 2VTNA 1Y8CA 5FXSA 3PX2A 4L42A 3THRA 5AUYA 1SNUA 5FHRA 3GVUA 2J9MA 2G9XA 4D1XA 4EOOA 1CKJA 5KMOA 5BUIA 2XB7A 4DYMA 3LMGA 3ELYA 2XM9A 1JBPE 2HMYB 1H1WA 2Z7QA 4BCNA 2QU6A 4MH7A 1WBPA 3P23A 3Q9YA 1QYRA 1NW8A 3GXLA 3LL7A 3GGFA 3IW7A 3VC1A 4GJ3A 3O0GA 3F69A 3MH0A 4FTIA 5HCZA 1JWHA 4LMNA 4RFYA 2HCKA 4QYGA 3R9NA 2P7HA 1KPHA 4FNXA 3REOA 4XP2A 3WBLA 3ELDA 4GVAA 5IA5A 2ESMA 5J9YA
chains in the Genus database with same CATH superfamily
4CCYB 3FFWA 2RFDA 3TI9A 5J9FA 3TLEA 5JAMA 4RG0A 3VXKA 4HFNA 4LJKA 1OH7A 3OSZA 4TVOA 2PT5A 3CO0S 3I1FA 2NYRA 3D7TA 5DFAA 3H2ZA 5FWDA 3ZCTA 1LK5A 2YJRA 5HVNA 4B2LA 1WZYA 1FSFA 2HT6A 4LXUA 4GS6A 4J0FA 2ID7A 2JRLA 3ETJA 4XTRA 1MP8A 1VSTA 3C3AA 1JQKA 1G21B 2R25B 4HEQA 3DBEA 1W0XC 1XTZA 5JAHA 1N2CA 2RGEA 3IAM6 3P9RA 2ZOQA 3BMCB 3JQAB 3ZJTA 4LVOA 5AUTA 1Y3BE 1BIFA 2CXXA 2A88A 2R3LA 2Q3HA 1RC0A 1XVLA 3ROYA 3H5IA 4G0PA 3FXZA 1NZDA 5C9ZA 1PNVA 3O8OA 1QIEA 5JJKA 1IIRA 1GUZA 3SX9A 1DIGA 2VPZA 1G2OA 5AI5A 2ALJA 2VPPA 4B2YA 2WB4A 1IM8A 4EHZA 1OXSC 1ZGGA 5JBQA 4ALMA 1GFIA 2ZYBA 2ONKA 2QXTA 3VPSA 1RKQA 4NECA 1M14A 4GGMX 3TSYA 1OV6A 5LQFA 4AXEA 4XGRA 1PNQA 5DHRA 3LOUA 4IACA 3D54D 3PPXA 2CF5A 1MO3A 2I7XA 2XGSA 4FONA 2H57A 2AG1A 3E48A 3I5YA 1FX1A 3SD7A 1ULUA 2P6NA 2QG6A 3QWKA 2HDNB 2WA1A 4DMHA 4PM4A 4OY3A 3IXLA 4EK8A 4N4AA 5ICSA 4JUFA 3HFJA 4LSMA 2YXNA 2PLNA 3CPHA 2Y0AA 5K6AC 4TL7A 5TIIA 3C16C 2GF0A 4FMCB 4WXYB 4EOIA 5IFLA 2PL5A 2HA6A 2RSLA 3KP1A 3P9XA 1OB5A 1PHRA 3ASVA 4CMCA 1U7WA 4B85A 4LZPA 4PHCA 2C2OA 1H85A 4MYGA 1BH6A 2PFSA 2OJFE 4MQLA 1PV1A 4EZ3A 2SCUA 3EA5A 2W4OA 3C24A 3VUKA 4C4JA 2OYCA 2Z9CA 4BWGA 4MKCA 3G8YA 5KDDA 1YL6A 3Q2MA 2R6FA 1V5WA 2CGXA 3VR4D 1JFRA 3IPLA 1D1QA 5DEOA 4N8EA 2H9AA 1P6XA 1PXJA 3QMVA 4QECA 4MVWA 1LBQA 4X6RA 3AY0A 4J90A 4ER0A 3HR4A 3P0HA 5AJXA 2PANA 1R10A 2ZJFA 4ZDKA 1LBEA 2CEKA 5CB4B 3BPRA 3SJZA 1SBZA 2LVBA 1TJ4A 4XGQA 3LX8A 1QIMA 2R87A 3IW5A 2QN9A 2ACXA 4MWBA 1O0SA 3BXPA 4MWOA 3HXOA 3PHGA 1TKIA 1KP2A 3UQZA 1ND5A 5TPZA 1KEEB 1M10A 2ORED 2W6JA 4DLUA 3Q60A 2C5YA 4Z8YA 2WQ6A 4JUDX 3NLBA 2BBOA 3T06B 3E7OA 4TLMB 1ULZA 1X7WB 4NDNE 2QT0A 1V8DA 4XUEA 5EMJA 2FX5A 5CLLA 1LQUA 2G70A 1FRVA 5IJAA 4U43A 3R30A 5ADWA 1PR3A 4MI9A 2GJAA 5ILOA 2XRYA 3MRTA 2NTNA 1KI1A 5BV0A 1PK9A 1Z16A 3JWJA 4NM5A 1NAHA 2C84A 4CV9A 4LOQA 4H9GA 1G7RA 3C48A 4QU9A 4RVSA 2QVSE 2EXXA 3F3TA 3EMDA 5KREA 1X3SA 5AJUA 3SEQA 4QEDA 3A7DA 1B6TA 3SLRA 4QDOA 4QTYA 4OLAA 4RTPA 3GCUA 3MI9A 3KTOA 5DXAA 2PKQP 3E62A 1R0EA 3OLXA 2R7AA 3VQTA 2ZWPA 2P6PA 4BATA 1EHIA 1E9SA 1YE5A 1M34B 3MMNA 1GT6A 4E6DA 2UYQA 4FJVA 1PG5A 5KOJA 1DWQA 2AOWA 4PU0A 1YJ5A 3OFND 2VDWA 1BA3A 5BV2P 4AN0A 4HD8A 2FP4A 5E6SA 4JEHA 3QNMA 4IVCA 3MUNA 1NXPA 4O63O 2C00A 1XAHA 2GKSA 3TSAA 4XZ3A 1O08A 3RT1A 2B98A 1XZHA 2HTEA 3FX2A 2BKKA 2NYAA 1DU4A 4MW7A 2GD2A 2HCTA 2XMCA 3NOQA 3I62A 4AJ4A 3IJ5A 2OCLA 2W93A 2CLEB 5DBIA 3P2YA 1T0JB 2QX4A 4XVHA 4GD3Q 3KSRA 1UAYA 4DSNA 3BEAA 4JNWA 1IXZA 3TGPA 1Y5MA 2P2LA 1PVDA 4TYHA 4RYDA 3R23A 5H3QA 3IOPA 4M89A 2X6DA 5E4TA 1CUYA 1MX3A 3ORRA 3CEPB 5TLSA 2MSEB 4LNUA 2P2SA 5DTRA 2CLSA 5CCDA 3G0HA 3LVQE 3F47A 1OZ0A 1V7PC 1T2NA 1CX9B 4ACCA 1OXUA 3X43A 1R64A 2FYSA 1M1YE 4DWOA 3RP9A 1GPJA 3I5UA 2CK3A 4EPXA 2VRXA 4Y7CA 4HN9A 4TTJA 2R96A 5GADl 4TZ0A 5B7PA 1VE6A 1IBLB 2YZAA 3CMCO 3QLFA 1MXFA 1U5BA 2GXSA 5DTIA 2PCLA 3I04A 3STUA 1FC0A 4UEOA 2X58A 1ULTA 5JZBA 4UOQA 2ZZKA 1PFYA 2KS6A 2IDJA 3LC1O 5BORA 3RK7A 3EN9A 2QAGB 3AERA 1AXGA 3PQ5A 4PTYA 2XSZA 3T9IA 1IEPA 4TYWA 3QOWA 4K3VA 3ZDCA 2FRVA 2ZM4A 3ETDA 4HAUA 1A1VA 4BUCA 1EX9A 3TKIA 1PR0A 3OOWA 4HPTE 3OW3A 4ALJA 1FFAA 3ZQJA 5JECA 4PAQA 2VSXA 3CLYA 3ENKA 3GIWA 2Y4PA 1L7RA 3EQHA 4QC2A 4MGZR 4UNSA 4BZOA 3VW6A 1MOPA 1YQ9A 4RIFA 3FSJX 5HVJA 3SM9A 1ZVJA 1I7SB 4D7AA 5JFGA 2DUVA 2WU1A 3KVNA 1BWSA 3TJCA 2VTKA 3QNUA 2C9CA 3W2OA 2CYAA 1CDDA 4RF5A 5DNCA 4UDYX 4DFXE 4FFPA 4WUNA 1CUXA 4EG3A 3AQVA 4ISBA 3NHPA 1X70A 2QP9X 2NM0A 3G5AA 2QDKA 4LQLA 5IZCA 3QBEA 3AIOA 3ZXYA 2P30A 3MXTA 3LXUX 2I4NA 2XGOA 2E82A 3VHQA 5LLTA 4AMZA 4CIYA 4R3CA 4RPGA 2ZEJA 1Y6FA 1L0BA 5JXWA 3GVPA 4DM4A 2QL9A 3JRXA 1DX4A 3K1JA 4XKJA 1N36B 1F7VA 5HIAA 3O82A 4F9WA 2YCLA 3V7WA 1LX7A 1QJCA 4X3FA 3OWXA 4LE2A 4KO8A 3QJGA 3EZLA 1E77A 4WRSA 3KA0A 3N07A 2JK1A 3EDYA 2JCYA 2HM7A 4C78A 5E2BA 3KAJA 4EHBA 2KM1A 3BYOA 4D28A 3TRIA 2L19A 3KT0A 2D5CA 3P5BA 1RE8A 4H31A 3ISJA 1EFTA 3S1LA 2R1TB 2XMSA 3AEKB 3KQVA 1ZXXA 4AKEA 4LDAA 4B4OA 4AFEA 3DCNA 5HKLA 4P4CA 2JGZA 4CD0A 1IHDA 3R71A 3ROCA 5KCMA 3QW4B 1PJSA 5ALLA 5BQ0A 3RHZA 1YRLA 4AFNA 1KQPA 4MWEA 5KVCA 4J0CA 2RGYA 3NC4A 2NMVA 5EDPA 4RS4A 1LF0A 5ALPA 2PUEA 2A3NA 5FHQA 3MWYW 1N8KA 4AUEA 1ZNWA 3HCNA 1WCYA 5HK9A 3WYDA 4EQUA 3MBLA 1IBSA 5KNCA 1OX4B 4TMXA 1CEEA 3P0MA 4AM8A 2YMMA 5B36A 2H5LA 2J0VA 1H1TA 3BMCA 3IAM1 5I9MA 1GGEA 1T1RA 1G4UR 1I2MA 2GNFA 1GCOA 4A0FA 3LT0A 1IZYA 3M33A 4NV1A 4Z0NA 4BDFA 4O0VA 1N34B 2LAVA 3LTNC 2HA7A 1EX6A 5FEQA 2FFBA 4MH0R 5I47A 1UMDB 5IAJA 2C0TA 3E84A 5DT3A 2C5EA 4E7PA 4L6CA 1UK7A 2C2KA 2RHWA 1S96A 2DPHA 5JPDA 4FOSA 2GLUA 4KSYA 2VHEA 1PE0A 2QG7A 3AT4A 5IYZF 3AC4A 3OZDA 4PZEA 3VX3A 4WESA 1DPGA 1VI6A 4G5SA 3G8CA 2GGSA 1C9JA 5KHWA 5FV7A 2QOCA 3M1LA 5FOWA 4JDKA 2C5AA 2IRWA 2QMUA 1I9CA 1S1CA 2KW5A 4PRYA 1YC5A 1JDNA 4DZRA 4R5SA 2VU3A 3NIWA 3QY9A 3ROXA 3OPMA 3K71B 3QRWA 3LYLA 1YDRE 1VE1A 1H65A 3H6HA 3S2SA 2B5WA 3ORTA 4QPCA 2ZI4A 5FBNC 3K0CA 2ZRIA 2Q3FA 1UANA 3A4MA 4FYXA 3A4LA 3IDCA 4IC7A 3DY7A 5LWMA 2YJZA 1XPOA 4IX3A 4A91A 4D9GA 1EI9A 2XIXA 3LHKA 4GQIA 4EKIA 4NYJR 1Y3IA 1CR4A 4TMKA 4TQAA 3QC4A 3N5CA 3GEIA 2NU8A 3DBCA 1YE3A 2VTHA 3PDTA 4BHZA 1HOXA 1H2YA 5FULA 3CUUA 4MV7A 2BFFB 4YMVA 3G2QA 2VCHA 3T7SA 3Q0IA 3KT3A 5CVDA 1JA0A 5J5CA 2W4KA 5KNBH 1Z6ZA 4O4LA 2Q8QA 2PWLA 4KQKA 4ZEOA 2HV9A 4CDGA 4NIFB 5EHNA 2OB2A 4E4YA 5CJPA 3OT1B 2VRCA 1S4MA 1S2LA 2WEIA 3W3ZB 1EJ6A 3ZWWA 3AM1A 1OI9A 4G5QA 1CQZA 2WK1A 1N5IA 3G0CA 4N3CA 4MUIA 3ENQA 3SKVA 5IQIA 1FL9A 4NONA 3BQCA 5DHJA 3T7TA 4CF4A 4DHWA 3MD9A 2E1RA 1KF0A 2O0HA 3H1AA 2OAP1 2WHQA 4CEGA 1EBUA 5BVGB 2Z57A 1F0NA 4FXOA 4ZOLB 4FZ3A 5HE1A 1Q19A 3WBKA 3RF7A 3FHJA 4GR4A 5L2SA 1R50A 3GCXA 3R77A 1P2SA 4GKKB 5E8UA 5AUOB 3DMTC 3HUEA 1A77A 5KTRA 3LPCA 4EPRA 3PIIA 4Q24A 2WKRA 3KTAB 2XEDA 3NX4A 2JFMA 3ENMA 1Z18A 4TKUB 3VTKA 3MFRA 1YI6A 5LDDC 4ND1A 1S8AA 2QU5A 1FPMA 3DU8A 1YA8A 2I5PO 2VZLA 3P9IA 1M8PA 2BEWB 2N1BA 2YWCA 5BPYA 1H2HA 2WHEA 5AQ1A 3D5TA 4GUEA 3O3MB 4K6CA 5JRDS 5JSQA 1IG0A 4YU2A 3RREA 3SG9A 1UA2A 2YY6A 2O59A 3MTLA 3VR5H 3PDWA 3F5FA 3FUWA 4D0GA 1WAMA 1H24A 3RU2A 4I50B 2M9MA 4Y67A 1SKYE 1E1DA 3A14A 4X7QA 1T9KA 2ATIA 3COKA 4IHQA 1DZ3A 3PTGA 1FOTA 4AKSA 1YR9A 3QXHA 2D0OB 5IH6A 4GXQA 5CA1B 1I3OA 3IIMA 4YRAA 3SK0A 1GITA 1ODIA 1ONOA 4W4WA 3QX2A 1Y1QA 4DTKA 1L6RA 4LRKA 1RAGA 3EZYA 3T9TA 4CT4B 5AVRA 2QORA 2JKZA 4B4LA 3H65A 5EHYA 4J8NA 2IOFA 5LKRA 1KH1A 4L28A 2WFMA 4XLZA 2QR3A 1PUXA 4C0LA 1I1QB 4G85A 1OPKA 2VQEB 3O50A 2VP9A 5CW1A 5HR5A 3HV5A 2ZJZA 2A27A 2BKXA 1HT1E 5D01A 2QMQA 2Y8OA 4GIIA 5EI2A 4ALVA 4OR5A 5ES3A 4BLRA 2XKFA 4FKGA 5AW2A 4GSBA 4ERNA 5BXQC 4GECA 4QMOA 4C7KA 3KE8A 1ONNA 2L0XA 3U4QB 2C7PA 1PYXA 3ZCLA 3IQ7A 3E9RA 4AY4A 4NDZA 4GUDA 1L7AA 4N76A 4OTRA 4K0RA 3GT4A 3BRSA 4MMYB 5JH7A 3D6HA 2EZ9A 1TLTA 1R0LA 4D55A 4BFLA 4BPRA 2OMKA 4Q4HA 4QOXA 2ZIFA 4Q9LA 3E18A 5LXMA 2AXQA 1RWPA 3G5DA 3MB6A 4WSYA 4IGKA 3LW0A 2A1UB 3HVRA 2G1PA 4NYMR 3KU1A 4OTQA 3QTSA 3ZK8A 4L9AA 3EAFA 3BMXA 3STYA 4CR7A 1VL5A 2V7EA 2YJ6A 1LFAA 2OQVA 2PZBA 4GDFA 1N33B 2OH4A 4N18A 3S40A 4KE9A 1A2BA 3EFOB 4BFWA 1BC5A 4FGSA 4YRSA 1O77A 3G8DA 3O83A 4D8XA 4CTNA 3KSAC 4EH3A 2QGNA 3DWFA 4TLBA 4O21A 5D00A 3BWMA 1R6XA 2ZJ3A 2XAAA 4CKZA 1AOXA 1UBGA 1OL2A 4XH6A 4F0IA 2E4WA 1V8OA 5IARA 3PNYA 3KB7A 2KYRA 4TVSA 2QR5A 1N9ZA 3F5PA 4L52A 2JGEA 4PYMA 2V7OA 1JZQA