5GINE

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ginE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ginE02
3BWBA 2ITQA 3EWHA 1BUHA 2QOBA 2WEIA 3CIKA 4U3ZA 5H9BA 3S4QA 2IWIA 5CF6A 2VWZA 4GUAA 3BWCA 3C6KA 2O5KA 5EC8A 3RCDA 2HCKA 4O83A 3PWDA 3OHTA 3U87A 4L01A 3VF8A 5A4CA 2V7EA 4BZDA 1XH6A 1NW1A 3AT4A 1SVUA 2QY6A 1YI6A 2PE1A 3CQWA 3W33A 2A2AA 5D1JA 5CSPA 2A1AB 2RF9A 3O71A 5CU3A 3RK5A 3UPXA 1KYWA 4TKSA 4ER6A 5EDPA 5HVJA 4GH2A 2QOHA 3SW4A 3ULZA 2GPYA 5DTQA 5ICEA 2PULA 4PY1A 5HU9A 1SM2A 2WQEA 2CN5A 4GG7A 4QMZA 4YC6A 1VR2A 3EN5A 3MB7A 4JX7A 3F3VA 4RSSA 4DE4A 3L9PA 1SQFA 4R7BA 4HTFB 2CMHA 4YUWA 5CAOA 5FUBA 3HAVA 4EQZA 2NP7A 3TM4A 5KKRC 3GCQA 3MN3A 1REJA 2V0DA 4IX5A 4RC3A 4YUYA 4CKIA 2C1AA 3I4BA 5JQ8A 2F2CB 3MCZA 3E8CA 3LOKA 4GOLD 5HOQA 1OL1A 2ONLA 3FLZA 3K3JA 2B9JA 2HXLA 5AAEA 1H08A 3V8SA 3ZRMA 4EH9A 3W55A 4Y5QA 4CGAA 1VJYA 5KMJA 3EGIA 2VAGA 3MIAA 2GA9A 2ITOA 2J51A 2W0JA 3R1NA 3DAEA 3WARA 1TW2A 4PYLA 5LQKA 3SSMA 4AT4A 2X2LA 5CEQA 3S95A 5J9YA 2HMYB 3CD3A 3EVCA 3VSEA 2QO2A 3VNTA 1Z5MA 1H1QA 3ZO4A 2FHPA 5U4XA 2VS1A 5I9WA 3R01A 4ZS0A 2XIRA 1CDKA 1NE2A 1RI4A 2VTHA 4I6BA 2F4JA 5CENA 3ZCLA 2BH2A 5AP1A 3ROYA 3A99A 5ANIA 1XJ5A 2ZBPA 3GRUA 2H34A 3F5PA 4WIHA 4RV9A 4O2ZA 1YHSA 2K4MA 3I7CA 3MH1A 5JZJA 3EYGA 5LMKA 4RQVA 5D1NA 2ONZA 3HRBA 4QMWA 2Z7SA 5I5ZA 5M56A 3DDQA 3A7GA 3FTFA 3PJ2A 5BYLA 4C07A 4JDKA 3UOKA 4DAWA 3UDBA 4CFFA 2C6OA 5K0FA 5K0BA 3DBDA 2XNPA 3AMYA 4QYFA 4F6WA 2UVYA 4FIGA 5IUHA 5JK3A 3LDGA 1JTFA 4KINA 4BB4A 2XYVA 2YEXA 4GMYA 3NRMA 3MIYA 4F0IA 3MTIA 3PP0A 4FVPA 3VS1A 5HE3A 3TDVA 4F7LA 2BTSA 1ZOHA 4CG9A 1UWJA 2RG6A 4IC7A 3JYAA 5GP1A 4R1VA 4X1OA 4PDPA 3EQDA 5TR6A 1EAMA 4OTIA 5CSWA 5ICFA 4FT2A 4QQNA 2G01A 3FKOA 3IW7A 4E8AA 1UU8A 1YDTE 3HNGA 4GFOA 5EG3A 5C4LA 1D2CA 4BTFA 3DBQA 4RFMA 4KD1A 3RI1A 5HORA 4HGLA 2CKQA 5H8BA 4FV5A 1GNGA 2VUWA 3EZRA 3QZHA 3D14A 4JG6A 4KBCA 5EOLA 3ROCA 5CEMA 1PYXA 2PVMA 3PUPA 3GCPA 4X2GA 4YZDA 3UIBA 4ENXA 5AUUA 4YTHA 3ZFYA 5I9ZA 5KMNA 1ZKDA 5M4FA 2Y8OA 5CQUA 4BTKA 3AY0A 5G02A 3U6IA 3H2BA 3BLRA 3ZRLA 2UW3A 2Q41A 3FUXA 3NTVA 2VDUE 5HZNA 5LARA 3MB5A 4ZP5A 1KV2A 2Z8CA 4R7HA 4XG2A 1LPUA 3DBCA 4EC9A 5HG9A 1M17A 3GC8A 3RJCA 4OA5A 3MBLA 4FYOA 3HV5A 4AU8A 4D2SA 4DYMA 1G60A 3OFJA 4QTTB 3LBYA 3NW5A 4G3DA 2HNKA 1M2PA 2PT9A 4FTIA 2O63A 5EHOA 3RM6A 3U55A 3MCTA 1YVJA 2WMVA 2ZM3A 1G8SA 5FEEA 3TUDA 3KR2A 2XVMA 4X60A 4PF4A 2PMNX 4BIEA 4GC9A 3FRHA 1RI5A 1VP3A 5IQCA 3JVSA 3VBWA 1KP9A 4GOND 2XK9A 4FS8A 4QP4A 3PRIA 2HWOA 3MH0A 3TMAA 3G8AA 5TF9A 4ER0A 4WRSA 3EVAA 2UZWE 3NUXA 1OKZA 4FTNA 2PX4A 1ZYJA 3E5AA 3U51A 3MY5A 2JKKA 2J50A 4IX3A 2WTCA 5BUJA 1R74A 4FSZA 4CMTA 4M69B 3B89A 3ANXA 2GNGA 5CVJA 2Z60A 1HMYA 3I5NA 4IBMA 4MD8E 4XBRA 3VJOA 3I58A 4NCTC 3SGLA 5AFVA 4HZRA 4BN1A 4IE9A 4CTBA 3WSTA 3D5XA 3VS2A 3ZXZA 3W2QA 5ETCA 4RIYB 3AXWA 5IF1A 3PDTA 1EJ0A 4MXOA 2BRMA 3DGKA 3HDMA 3PSBA 4ARKA 2ZV7A 3ERKA 4QTBA 4A4OA 3V6RA 5HLWA 5JT2A 2PWLA 3IV6A 3ORNA 5HO8A 1M6YA 4EHVA 4Z9LA 3HRCA 3LKMA 3G8BA 4HG2A 4C4AA 2IJMA 2PU8A 2R3OA 5F95A 2UW9A 4IJ9A 2C47A 3R7UA 1PXLA 5HD4A 1OBGA 3QQGA 3BXOA 3Q7EA 3FYJX 3UQGA 4MWZA 5L6PA 4V0QA 1GJOA 5E4HA 4OW8A 5JQ5A 3GNLA 3X0DA 2H9VA 1OL6A 1WBWA 1AD5A 1YXXA 2JBOA 3EQBA 5I9VA 3ATTA 4O0WA 1VLMA 4USEA 5FXQA 1SG9A 3NWBA 1H07A 5KMLA 2NXJA 3DKOA 4GS6A 3HX4A 4JQ8A 4YJPA 3ZS5A 4D0XA 5HIBA 3AT3A 4X7QA 2CLQA 5EKNA 4FSXA 4UBAA 2HWKA 5LMAA 1HOWA 2JLDA 2W9ZB 4GVJA 4LRKA 3M42A 5AA8A 4ZTLA 3ANRA 4DBXA 3C0HA 3PXYA 1UNGA 4CEGA 2Y1WA 3THRA 1PXJA 3TWJA 1TQMA 3FRIA 4KRCA 4C59A 4ERWA 3UG1A 3HP7A 4M8TA 2PUNA 3BU5A 4N4SA 4DFBA 3MWUA 1PXOA 3EQPA 4IHPA 4USFA 3S1HA 2XVAA 3ACJA 3TT0A 1ATPE 4U7ZA 5CM2Z 5KZIA 1JOWB 4B17A 3HA5A 3UOLA 3UIXA 3R8ZA 4CRSA 3G0EA 1Y57A 3LKDA 4UY9A 3U9CA 2CKDA 3KHKA 3SLSA 4ZZOA 2FH9A 4FZFB 1R39A 4EK3A 4RVHA 4HYHA 5BVDA 3JR1A 4ZMFA 3Q53A 4QQCA 4JRNA 3SV0A 3KKVA 2DULA 1PXPA 2P4IA 5FWDA 4AE9A 2JC6A 1LEZA 2CNUA 3GT8A 5AUYA 1RQQA 5J8IA 4QRCA 3KU1A 1BL7A 2IPXA 4IAAA 5CEPA 1Y8CA 2BR3A 2VTQA 1GZNA 4PL3A 2BAQA 3WF7A 2NXCA 4OBQA 1M52A 3GC0A 4UALA 3I7BA 4QMYA 4FT7A 3FKLA 4BGQA 1Q8TA 4FV4A 3TZ9A 4LGHA 2OO8X 4IFCA 4O7YA 5AV2A 4QTEA 4MXAA 2B25A 5LMKC 3EVEA 4PYOA 3QQJA 4C36A 5CF4A 3BEGA 1XJDA 2NYUA 3BLHA 2BDJA 2C3JA 4IX4A 3Q04A 5CVGA 4DEAA 3KN6A 4L9IA 2X0GA 1W0XC 1V39A 1XDSA 3NR9A 2P3OA 4C4IA 4V0GB 3R6XA 4N70A 3TRKA 1R18A 4FX3A 3GC9A 3RPRA 3VUHA 2YERA 1IM8A 4RX9A 4BLWA 3GRYA 4RMZA 5EYCA 3GU3A 4PGHA 2IH5A 4ITIA 4QTAA 3KCFA 4OQEA 3TI1A 1VBFA 2GFSA 4QP8A 5GM2A 3QC4A 3TLJA 1KE7A 3HV7A 5AX3A 2R3NA 4AWIA 4YV0A 3VHKA 1KWPA 5IA1A 4CKEA 3FC2A 3KPVA 4Y2HA 4V04A 3ZONA 4CTJA 2WIPA 3P7AA 3POOA 3KRLA 3Q52A 2RL5A 2I0EA 4TTHB 2IZTA 4B0GA 4CLIA 1IG1A 4FV1A 4PDOA 2PL0A 4EH6A 2R4BA 4EZ3A 2ZV8A 1PMNA 3C4CA 3OD6X 4GUBA 4OTGA 4TY1A 3TKUA 2UZ4A 4F70A 2IVVA 3FMDA 5D41A 2JHAA 4F9WA 3K0BA 2ZVAA 3UC3A 4M84A 1IA8A 1YKRA 3BV3A 4IDTA 2IGTA 5IKMA 4RIWA 3CC8A 1XO2B 5E2AA 2O0UA 2P35A 4RVDA 4M36A 4G9CA 2AC5A 3LBFA 3AMAA 2GTNA 3E3BX 4FV0A 2LAVA 4GJ3A 4DEGA 3ORIA 2EUFB 3LQ5A 4FYNA 4X2KA 3R9RA 4HGYA 4RIYA 3O8UA 3BYMA 4RQKA 3U54A 4X3JA 3G33A 4W4VA 3QTZA 3C4EA 5D9HA 3KMWA 4DH5A 2QE6A 5AV1A 3F3ZA 2UZUE 3KPYA 1TVOA 1M14A 4MNEB 4Y5HA 2WELA 3MTEA 4IAFA 4JOAA 4AN3A 4EQMA 3DQXA 2I1MA 3FHIA 3EL8A 3ORMA 1ZLTA 5DRDA 3VUDA 4DLIA 4UB7A 1NW8A 4U5JA 1J1BA 4YO6A 2DS1A 2Q83A 5D10A 5I9YA 1GIJA 4H3QA 1JLUE 4NFNA 4BY9E 3UNJA 4YBJA 3UJ8A 2WU7A 3PTGA 3NUNA 4BDEA 3TQSA 3E3PA 3ZFXA 2QOIA 3E05A 2OU7A 4F9YA 3EHAA 1IAJA 1F0QA 2QODA 1B39A 4LRMA 3RW9A 4O7ZA 2W1EA 4HPUE 4LMNA 5KO1A 3Q4CA 4C35A 3ORPA 3POZA 4J8NA 4RWKA 2XEZA 3C0GA 4M0YA 1MP8A 4EK9A 1JKTA 2B2CA 2HR1A 2ACXA 2OJFE 4RTLA 5C01A 4XCXA 4JRVA 2CKOA 4LL5A 5DLYA 4LOQA 4IZYA 4QYGA 2FK8A 2I62A 2IVUA 3NDJA 3O2MA 2QYOA 3UE4A 4KB8A 4XV3A 4D5HA 1M0EA 3OP5A 3OEZA 3WBLA 1J7UA 4H36A 1Z3CA 5EMKA 1XH9A 3LXLA 3R2YA 4TYJA 4XP3A 3PT9A 3FPEA 1BC5A 3R2BA 4XV1A 2CLXA 3NWWA 4KVZA 4QNYA 4FZ6A 5K0JA 1VE3A 4W4WA 5AAGA 5EZQA 4IW0A 4BDCA 2KW5A 3CVOA 1KOAA 2WXVA 2XIKA 4XUCA 5LVNA 3S3IA 2UZDA 3JWHA 2CGXA 3FZSA 4IACA 4RFYA 4JX3A 2GU8A 2CDZA 3I60A 2BKKA 1KE9A 1O6LA 4NJ3A 1CMKE 4A06A 3BT7A 3SC1A 3KXMA 1LP4A 1PF8A 2G2IA 3ANQA 3MFSA 3BKWA 1RDQE 5HG7A 5LQFA 4L46A 4S34A 3DJ7A 3O7LD 4FGBA 4BZNA 5E9JA 4CFNA 3Q4ZA 3UNZA 3BHYA 4C38A 3PE1A 4GCJA 3ZUVA 1YOMA 2PVLA 3QTSA 3C5UA 4G3CA 4PGGA 1QL6A 5E1EA 4FVRA 4EH5A 2IP2A 4P7FA 2XCKA 3OFMA 1OVEA 4L3JA 3DXPA 4NH1A 4DTBA 4EOQA 5KBQA 2E5WA 3D5UA 1D2HA 4RZWA 2PGXA 4K6ZA 4MXZA 5CNOA 3BZ3A 3WZKA 1SYKA 2Z2WA 3KRXA 5CF5A 5KNJA 1TW3A 3BUSA 1YHWA 2ZYBA 3P9CA 4P7GA 1OGUA 3DXNA 2XF0A 2E9NA 2WB8A 3O51A 4FSWA 3NUPA 4V01A 3R7YA 3KRRA 4J95A 1P5EA 3T9IA 3I5ZA 5EYMA 3OFKA 1FVVA 4E26A 4ER7A 3P4KA 5DGZA 3BX5A 2WOTA 4TN6A 4ANLA 3IOKA 3M6WA 3G51A 2WMTA 4RYLA 4PL5A 2AOTB 3OOGA 3CGOA 5IQBA 2QOQA 1Q4LA 4AE6A 4PNEA 3Q9ZA 1EIZA 2Y9QA 3LECA 4I94A 2ZB1A 3ZM9A 2Y4IC 3R04A 4JLCA 5IMXA 3LW0A 1YB2A 4KABA 3CJGA 5FP6A 3ZUTA 2J0IA 2OFVA 4CQEA 3QRUA 4ACCA 3OBJA 4LQMA 3VAPA 4ORKA 1NW7A 2XM8A 2OY0A 3ORTA 4D58A 2YXEA 4J98A 2C7RA 4J97A 2FUMA 5AA9A 4JIAA 5HICA 3KF4A 3RWQA 4DFXE 3HA7A 4HH4A 4S31A 4GSBA 4FTOA 3W10A 4ZY4A 3ZSHA 3GRZA 1DM2A 2BIYA 3KREA 5JKGA 2PVNA 4Y95A 2YAAA 5GJFA 2B78A 4BHNA 3NCZA 5CF8A 4FV6A 4I22A 2R3QA 2WTVA 3W16A 1ORHA 1R3CA 5EM6A 3WZEA 3JWJA 5CZIA 4F9CA 5IH3A 1OPKA 1H24A 3UYTA 3P9KA 4PV0A 4C2WA 2QKRA 1CKJA 4TNDA 4ZK5A 1OB3A 3ZU7A 5KMMA 3R83A 1FPQA 1V0PA 2RFSA 4TNBA 4H1JA 4AXAA 2ZM1A 2V7AA 3AJDA 3EQGA 3BE9A 5DXAA 3RHKA 4FEVA 4ZIMA 1AQJA 3HEMA 5EOBA 1IY9A 3ODYX 4GU6A 4IB0A 4DH7A 4H3PA 4IAYA 4Q9ZA 2GB4A 1ZOEA 2ITNA 4KRGA 3IW5A 2BM8A 3LXPA 2I7CA 2XUUA 3IECA 2XKFA 5M09A 5L3AA 3BKXA 2FYTA 3LLAA 3PJ3A 4DGNA 3KMUA 5H02A 5CU2A 5AP2A 3VRZA 3KQWA 4J71A 5HCYA 5E9WA 4S33A 1R0PA 1SNXA 4WVLA 4IZ7A 5LQRA 1DS5A 4ACMA 2X2MA 3RPVA 1Q3DA 5EHGA 4MHTA 4FTRA 4JT3A 1EH4A 1H1DA 3FHRA 4JDHA 3G2OA 4EEVA 1I4WA 3GBZA 3UVPA 2XRWA 2PYWA 3M1SA 4RWLA 3K2LA 3GCUA 2JGZA 5CSVA 5AP6A 3BWYA 1L8TA 4OBPA 2FA2A 3A7JA 4PMTA 4FNZA 1CKPA 4D4YA 4C05A 4RJ4A 2GTMA 2X6DA 4K18A 4U0IA 4S2ZA 3IYLW 3CKKA 1PMVA 1WVWA 3DJ5A 3JUHA 3VRYA 1QANA 2OGVA 5IA2A 2ZFUA 3W2CA 3DXZA 2W17A 3NCGA 2P7HA 4APCA 1R8XA 2OSCA 4J7BA 4EUUA 5ICCA 3IDCA 1B6CB 4NECA 3BWJA 3L8DA 3CSVA 3KR1A 3LXNA 4PINA 3QFVA 3PIXA 4FT5A 3P97A 5L8JA 4MF1A 3Q5IA 3SXRA 3B3JA 4G31A 3HVKA 3UZRA 2VWIA 3MGYA 2WGJA 4JS8A 4AZWA 3IDBA 3A7FA 4IQ6A 3AD6A 4EQCA 2R3JA 4PTEA 5EG5A 4ID7A 4QQ5A 3B8RA 4ZY6A 5C27A 5L2SA 1BHJA 1O54A 3TV6A 1RI2A 4AW2A 2BRBA 5HCZA 4EVIA 3TKIA 2GDOA 3KULB 4DA5A 5F2OA 2WHBA 3HA6A 4RJ6A 4R6VA 2ITWA 3V5LA 4PP7A 1W84A 4D1XA 3MTFA 1NW5A 3C9WA 4XUFA 2QO9A 4IC8A 3BIZA 1WBPA 4KKGA 5H8GA 5LQJA 5HX8A 1CTPE 2GHLA 3KXXA 2IW9A 3UGCA 3RCJA 3V8WA 4APPA 2B9IA 4RGJA 3DFAA 4WKQA 1VQ1A 2UYCA 4PUZA 1X1CA 5BVOA 1P1BA 4LYNA 5B2LA 3FUUA 2OZVA 3TKYA 2ITVA 1XCLA 2VN9A 3K5VA 3RIEA 2O65A 1RJGA 3BHVA 4JG7A 2I0YA 3NEWA 3JVRA 3QTWA 4HPTE 1QYRA 3R7IA 4Z55A 3R63A 4A07A 4KKEA 5KMIA 3EJ1A 4EKIA 2YWVA 4EZ5A 1VEBA 1PXMA 1M7NA 2XK7A 4H1MA 5CXHA 3R7VA 4CMOA 4V05A 1GZ8A 4AF3A 4L7SA 4QMTA 4EKLA 2IW6A 5M06A 2OXXA 4YMJA 1GAGA 1JPAA 3R7EA 4BKJA 5JFSA 4FG7A 4K11A 4N6ZA 4PIPA 5K0CA 2QM3A 3UJGA 3FPMA 3LM5A 3GOPA 4IMYA 4GEKA 3QUPA 4GT3A 3ZLWA 4QP9A 3ORZA 4PDSA 5LWNA 4TL0A 2VU3A 5LQCA 2UW6A 2RKUA 4D2RA 3LXKA 2YXDA 4KSQA 1JWHA 3T3UA 2IFTA 4DEHA 3DKFA 2EWAA 4ZSLA 3QXPA 2ZJWA 4DGLC 5I9UA 3JXWA 5BMMA 4QP7A 5AP7A 3TNQB 3FWQA 2HY81 4QMQA 3HVCA 4O7WA 5AX9A 3MA6A 3HV4A 4R78A 2Y7JA 3Q6UA 3ACKA 2Z7LA 3FI4A 4MBIA 5CS6A 3NGAA 2F49A 3KCKA 4TWPA 5IQGA 1N7JA 4EH3A 3COMA 3FKNA 4C3RA 3HVHA 4UN0C 4BDDA 3EZVA 2Y1XA 1J91A 1ZY5A 3GO4A 3LVPA 2VTSA 2PWYA 4A6DA 3HZTA 2UYHA 2X2KA 4LL0A 2QU6A 4DINA 4EH4A 4RG0A 4DITA 4F0GA 4FSDA 1GIHA 4QMMA 3SXJA 4X21A 2B54A 3C6MA 4A9TA 4MK0A 2WQBA 2P7IA 3B2WA 4FNYA 4BI2A 1W82A 3BGVA 4MQ2A 2AS0A 4O96A 3IW6A 4GIHA 3K54A 2CPKE 3UBDA 3UTOA 1FMKA 5K3YA 4YTFA 2RFNA 1YZHA 4BBEA 2ITXA 2OIDA 2FYSA 3PA4A 4DGMA 4G3EA 3HECA 5IISA 4ER5A 4HCUA 4IANA 3S2PA 8MHTA 3OTVA 3GCSA 2YABA 3FXZA 2OB1A 4R1YA 3KXGA 3P7CA 5DT0A 3T9TA 4BDKA 1B42A 3EVDA 4FKJA 2CSNA 3LFFA 4QT1A 2OXYA 4M14A 2JHCA 3UG2A 3ZEPA 3CGGA 3PS9A 4PWNA 4FZVA 3E7OA 4BCNA 5M55A 5LOHA 1R8YA 3NYNA 3DA6A 1PKDA 4P4CA 4ZY5A 3KR9A 4K2RA 2XYRA 5B2MA 3U4WA 4QMSA 3QYZA 5GWXA 2Z6UA 2OW3A 3V5PA 1OI9A 3HUBA 4ZTMA 4MYGA 2XIZA 3O4FA 3TEIA 2F57A 2PVFA 2XNNA 4KIGA 1IAHA 4OUCA 1WBOA 2BDWA 2XNOA 3HA8A 5IQDA 5EGSA 2ZAZA 4YUQA 3TKHA 3UWPA 2JDVA 2XVDA 3SGCA 2QOKA 4PMPA 1X1BA 5EQYA 3R73A 3FXWA 4M67A 1G3NA 3G7UA 5DI1A 4UX9A 3BGPA 5GJDA 3R3HA 4DGGA 3FMLA 5IDNA 5KMOA 1Y6BA 3QCQA 4HJOA 4E4MA 1QAOA 2PLWA 2W5BA 2XBJA 3EMGA 4JDJA 4EH2A 3R21A 4FZAB 1I9GA 4F4PA 4BCQA 5IDPA 2QRVA 3L8VA 5DM2A 2J6MA 2PHKA 2ZTHA 4M7RA 3MYGA 3LDUA 4I93A 2CWWA 2YM8A 2O64A 5K0EA 3UP7A 3R0TA 3LHJA 3ZYAA 3OCSA 4BI0A 1DUSA 2PMIA 4GBED 3LJ1A 3G9NA 2YM3A 3AD4A 4OT6A 4TPTA 4A9RA 4ZSJA 2VTRA 3EMDA 1U54B 3SQQA 3QGYA 1V0OA 3CKXA 1YF3A 4CT2A 1YWRA 3EN9A 2WTKB 2HIWA 2C6IA 3FMKA 3D5VA 2R3LA 2OBFA 5DSXA 5DXJA 3QZGA 5JR3A 1SZMA 3EQCA 3QRIA 4QP3A 4V0RA 1YDRE 3A61A 2VV9A 3O50A 4AUAA 2H8HA 3QGWA 1R78A 3F7ZA 3Q87B 4B4LA 4RVKA 3TNPC 5GIPE 3C4FA 3KY2A 3ZHPC 1W98A 2EJTA 3REOA 3R9HA 4ZTQA 3B7PA 5CU0A 2R5TA 4IKPA 2HZ4A 5HESA 4CRLA 3NMUF 1F38A 3T7TA 2B0QA 2WNTA 1FGKA 2WO6A 3A2CA 3MJ1A 1H25A 3QA8A 4UZHA 2WKMA 4BVUA 2FRXA 3EVGA 2ERZE 4DQ0A 2C4GA 4XX9A 5F94A 3BPRA 4QDJA 3R9NA 4FKWA 3VVHA 2QLUA 5DE2A 1M2RA 3C50A 4ZMEA 1JG4A 5M07A 3VW6A 3DY7A 2P3QA 4JR7A 5E1SA 4F7JA 4YJVA 5EVJA 5HTBA 5M5BA 2B9HA 2JH8A 3RTPA 2V55A 4E5AX 2WA1A 2WTKC 3QTIA 3MW1A 5BMSA 3U4UA 4MVFA 1S9IA 2W1IA 1QPEA 4ONAA 4TZRA 1P1CA 5FTGA 3MVHA 4FT4A 5AUWA 3UJ7A 4HCTA 5LMBA 1X8BA 4J52A 2ZMDA 4YR8A 5A54A 2AN4A 3E8SA 4CCBA 2XS0A 5FTQA 3V5JA 5C0OE 2PUPA 3D2KA 4RTNA 2R64A 4I5PA 3KF7A 1HCKA 1WCCA 2C30A 2HK5A 2ITYA 2X8EA 4FEQA 4HNIA 4NTSA 4WBBB 5C03A 1AGWA 1A9UA 3DTCA 4EOSA 4EZ7A 1GY3A 2J0JA 5HBEA 5BVWA 2Q0BA 2YIWA 3KQTA 3RODA 1Q8WA 4WNPA 2C3KA 1H1RA 1XQZA 4ACDA 3G2FA 2E2BA 4R6XA 3FUPA 3K3IA 3HMMA 3RAIA 1VPTA 3LQ3A 3HA3A 3ELJA 2CKPA 3GU5A 3QTUA 3BELA 3W18A 4C06A 4ZOGA 4FEUA 3VC4A 4XEYA 4FKVA 2W1CA 4F0FA 2XM9A 3FMNA 1JSXA 3C3YA 2HAKA 4HGZA 2WFYA 3PVGA 2X9FA 2VWYA 4MD7E 4Y8DA 4L68A 1EG2A 1Q97A 3BYUA 4FC0A 4RJ7A 4OTRA 4RC2A 4X6RA 4JAIA 3DXYA 3M4XA 4LWOA 4YJTA 4BDAA 3AG9A 3LIJA 4IVDA 3W2PA 4DCAA 3UOJA 3LHDA 4HGTA 3MTLA 2Q0NA 3ZM4A 3PJ1A 4CG8A 5HLNA 3GIWA 3RPSA 5DSTA 3NX8A 4TYHB 4HTFA 2ETMA 4QVGA 5FHQA 3UFBA 3LL7A 2E9VA 3ZOSA 5I9XA 1ZOGA 3G2PA 3ENHA 3QKLA 1WXWA 4GV1A 1YXSA 2GQGA 4G16A 3LFNA 4YHTA 5C1IA 4FKQA 3TZ7A 1VIDA 4TWOA 3ULIA 3IW4A 1YI4A 3CP9A 3ELUA 2Z7RA 2PXXA 3OG7A 4FT9A 4ZJIA 3UP2A 4XOYA 5EQPA 2HTEA 1WG8A 4MAOA 4V0GA 3ELWA 3UYSA 5FM3A 5BW4A 4R5SA 4EORA 4LMUA 4EUTA 4E1ZA 2XH5A 3DKCA 2PE2A 2PVHA 3GU8A 4IWDA 4O21A 4G5PA 3UC4A 2H96A 1KPGA 1XVAA 4DEBA 3Q6WA 4RJ3A 2CNVA 1N2XA 4EBWA 2ZCJA 1TKIA 4XLVA 1ERKA 4GK4A 3LFBA 4G17A 4NU1A 2BZIB 4ISCA 3PY1A 4XMOA 1U59A 4LM5A 5AUTA 2IZSA 1YRPA 2QKWB 2WMBA 2X6EA 1YI3A 4POOA 3O0GA 4ITHA 2QHMA 3FPHA 3DOGA 4WNOA 3TNWA 3RWPA 3LKZA 2I9KA 3C51A 5LSAA 4F09A 4UWBA 3GU6A 5F4NA 3FLSA 5EFQA 1VP9A 2IG7A 5DBXA 2ESMA 1ZXEA 5IEYA 2YA9A 5K09A 5BYZA 4JBVA 3QD3A 1G6Q1 4AA0A 3F61A 3K6RA 4DFNA 2R3RA 4XJ0A 1R6AA 3GRVA 3DU8A 3ALNA 3VBTA 1Q5KA 3LJ0A 4FEWA 2J7TA 1R0EA 2B53A 5IQEA 1YWVA 2XEYA 3ZMMA 3RMFA 2OJIA 3C7QA 3FZGA 4Y73A 3CE3A 3R24A 3GB2A 3D94A 3QA0A 3W8QA 2HZIA 4PX6A 1XHAA 4RRVA 4U79A 5C9CA 4P7EA 3L9NA 4S30A 5K0NA 1O6KA 4E73A 4QYYA 1QCFA 5DR6A 3CPBA 4CZUA 4XYFA 1L9KA 5ANDA 2YACA 5A14A 1XH8A 1P4FA 3AQVA 4EC8A 4TW9A 3CPCA 4QTDA 4E6AA 4KBKA 5M4IA 2YXLA 3GENA 3E23A 4O7TA 4IV8A 4D4RA 4C02A 1Q61A 3WE4A 3LCVB 4JXFA 4PDYA 5HG5A 3ZDUA 3PB3A 3I6WA 3BBTB 2PPQA 3N4UA 4TXCA 2YM6A 2C68A 3QQHA 3PJCA 3FZPA 4EK5A 2OJJA 1YUBA 3BI6A 2VTNA 4MD9E 1Q8YA 2HY0A 3L9LA 4IB5A 4PP9A 3QQUA 3G0FA 4KAOA 3MQ2A 2XBAA 4DT9A 4AT3A 4K9YA 5A3XA 5M08A 3KQSA 4RLLA 2FO0A 4GKIA 4NWMA 1WMKA 4U81A 5LVPA 4GC5A 4S32A 5CTPA 3ALOA 3TOSA 4K77A 3GWZA 3VC2A 3F2RA 2VGOA 3G9LX 3C4WA 4RX1A 3HKOA 2NRUA 5ICPA 3S0OA 4WSYA 2PUUA 2JKQA 4G6LA 4EWQA 2P1DA 1PMEA 3BGIA 4FKOA 3AC8A 5HFJA 4FSQA 3SRVA 4D1ZA 3L8PA 2C7QA 2ITZA 1SNUA 3P23A 4FOBA 4YLJA 3QQFA 2X8DA 4WUNA 2FSOX 4FP9A 4WNKA 4AOTA 1AQIA 3FQHA 4Y83A 2VTJA 5J9ZA 4MTLA 3MY0A 4E70A 4DBNA 3PY0A 3R9DA 3E7VA 1YHVA 3WYYA 4JL9A 3O96A 3QALE 2B55A 3FI3A 4DFLA 4CKRA 5KVAA 4MWIA 4JBPA 5EHIA 4MKCA 4CFMA 4EJNA 1FP1D 3CS9A 1MHTA 2YZLA 2YIQA 3GDHA 3CJTA 4NJDA 4R6WA 2VWWA 3QBNA 5ITAA 5P8WA 2JEDA 4OTHA 4RSRA 1YDSE 3DXXA 1OKYA 3P9IA 3SX0A 1KPIA 5L2IA 4MXXA 4EHEA 3OC1A 3SG9A 4ASZA 4DCEA 1NT2A 3PA5A 1RW8A 4IZ5A 3TV4A 4YSJA 2C7PA 5EEGA 4UWCA 3ITZA 3L1SA 5EYKA 1FP2A 2VTOA 3AXSA 2WOUA 5FBOA 2YZAA 5DHJA 4JDIA 2ITPA 4D28A 4G1WA 4G34A 4Z16A 2GQRA 2I6GA 4A6EA 3TDWA 5F2NA 3P2EA 10MHA 2YM7A 3ZZEA 3OCTA 1IR3A 2PVKA 2QOLA 4I6FA 4IIRA 5IUGA 3FDNA 1KXZA 3DT1A 2OPBA 3FZRA 5HG8A 1HCLA 3EFLA 3F82A 4QYEA 3TIZA 3A25A 4OBWA 2G2FA 2BROA 3F7WA 3E88A 3B2TA 5FQDC 1YXVA 1NBIA 3DTWA 2X8IA 2IH4A 3O7WA 4MQ4A 4F9AA 3OY1A 3B8QA 1P39A 2YX1A 3NZ0A 3DP7A 1J7IA 2WTIA 4RIWB 5ACKA 5CVVA 1YXUA 3UPZA 5M44A 2GCDA 2WMWA 2XNBA 4XNEA 4C37A 5LXMA 3G89A 3EGVA 4FODA 1EQAA 3ZRKA 5M4UA 4LUEA 2OKRA 2W05A 2BVAA 4Q2AA 3DLZA 4FUYA 3V5TA 4YLKA 5HBJA 1OR8A 4K8AA 3A26A 4P7JA 2WMXA 2H00A 3FE3A 3V8TA 3BGZA 3PZHA 3OBGA 1OECA 3A8WA 3LFCA 5DFPA 4IVBA 2PZIA 3I9FA 3DFCB 2ITTA 4QQKA 5IA4A 1VYWA 2OF2A 4E93A 1ZG3A 3D5WA 4F1MA 4C2VA 5A9UA 2VWXA 2J5FA 1PYEA 1ZAOA 2X9EA 4IVCA 4BYJA 4P5QA 5JEBA 3FPJA 1XR1A 3HP2A 1MRYA 4I6QA 2O07A 3OZRA 4Z3VA 4PONA 2HV9A 1UNHA 5H8EA 1JG3A 1MUOA 4O91A 4HSGA 1V1KA 2Y4IB 4FL1A 4FT0A 4IAZA 5FA8A 1SVHA 4PQNA 2YDKA 2ZLBA 3GXLA 3TJCA 2OH0E 2CNQA 5HEZA 3TL8A 5IH5A 4R7IA 1QZZA 3KQMA 2HZ0A 3A4TA 3R8VA 4FSRA 5FDPA 2GS9A 3QXOA 3DMFA 5EIFA 3QYWA 5BVFA 3VJNA 2C6MA 1OIRA 2ETKA 4WG3A 2IZRA 5DYJA 4C4EA 4DGOA 4CSVA 3CJFA 3HV6A 3PPJA 3IHTA 4D55A 3GVUA 1RE8A 2UZBA 3KXHA 4HGSA 4Y85A 1PRYA 5CXZA 5DWQA 5FTOA 2P2HA 2GQSA 2WZJA 1UWHA 3BQCA 2QQ7A 3CD8A 3FLQA 3GI3A 4FTCA 3DNEA 5DN3A 1L1EA 3FPGA 5J5SA 4AA4A 2P41A 2P3GX 1WVXA 4QP2A 1BMKA 4CFVA 4DH1A 1XXLA 2PVCA 1GZOA 4F7SA 2PVYA 3W2OA 3PG1A 3RHXA 2I0VA 3BLQA 2EJUA 2ZSUA 2R7BA 4C3PA 3SRVB 1H1SA 3RAKA 4WT6A 5ANGA 3IGOA 4C0TA 2RFDA 4N6YA 4LG1A 2V5QA 5K0GA 4F6SA 3QLFA 2BR4A 1JQEA 2UW0A 4RX7A 2AOVA 2P40A 2JITA 1JG2A 1D2GA 3W1FA 3UJ6A 2PSSA 5AWMA 5K03A 3QZIA 3EFKA 2GS2A 4PCAA 1DI9A 3MY1A 2UYQA 1KIAA 5CT0A 3VUGA 3EQRA 4TYHA 3EEYA 2EXMA 4I4FA 3W8LA 4DFYA 4BCOA 4YJRA 2X7FA 5CAVA 3M6UA 1FQ1B 1XKKA 4HC4A 2YIXA 3P86A 1QPDA 1CSNA 2BCJA 5DVRA 3D7TB 4FIEA 4F1OA 3DB6A 2VO3A 2VX0A 3II5A 3BKBA 4FV7A 4XP0A 2F7ZE 4FG9A 4MNEA 3P7BA 2H11A 5I4NA 3I81A 5K0LA 3VBVA 3TM5A 1T46A 4ZXTA 2JD5A 3W2RA 3OE5A 4ZZMA 4M3QA 3Q4TA 3QRTA 1U5RA 5CALA 5IQFA 3NNUA 4FI1A 3T3VA 5GIOE 2WA2A 2BHHA 3WF8A 4TYIA 3UMWA 4X6QC 2V74B 3QU0A 2QVSE 1G8AA 4UXQA 5HKMA 2QR7A 5E8SA 4AA5A 4Z7HA 4F86A 5LQAA 4FR4A 5A4LA 1YOLA 5F9EA 2GS6A 4AGCA 5T6KA 5FGKA 3LCUA 2B9FA 3VHEA 2IW8A 3V51A 5KS2A 4L7FA 4J8MA 3QF9A 5DLSA 2ZBQA 3THSA 3HVJA 1ZZ2A 3AC1A 3LCSA 4KSPA 3A7EA 4MIKA 2AOTA 5DOSA 3BV2A 4HGEA 5AUXA 2ZZNA 4YNEA 2RGPA 1PHKA 3ATSA 2QG5A 2NPQA 3OS3A 3ZSGA 4ATNA 3MERA 3C4XA 2FVDA 4L53A 4AS0A 1HNNA 1UWVA 4KDCA 3QKMA 2VP3A 3H30A 2PZPA 4HCVA 3TXOA 2J90A 3LCTA 3PA3A 2BZKB 4YJSA 3QV2A 2JFLA 2YAKA 4XG9A 1ZMUA 3Q9XA 1H28A 3RZBA 2IO6A 2R3KA 4NFMA 3SG8A 4UYNA 3WZJA 5IUIA 4DN5A 5K9IA 1X1DA 3VUIA 1JSTA 4F85A 2KULA 4FGRA 2G2HA 3PG3A 4WRGA 2J0KA 3LMHA 2C5YA 3FTEA 3SVVA 4FNXA 5L8KA 5J1WA 3CTQA 3OWLA 3UJCA 2NNWB 3EL7A 5AP3A 4O29A 2YR0A 2J0LA 1SMHA 2W1GA 4RA5A 3CC6A 3MPMA 5KQRA 3QWJA 4BCKA 5BVKA 4LI5A 2XRUA 5C8MA 1GIIA 4ZAUA 3QCXA 3DTNA 3V8VA 4XCUA 1ZMVA 5AUVA 5JZNA 3RPOA 3AMBA 2X4ZA 3Q2JA 3KFAA 4GL9A 4B8MA 4EK6A 2JAVA 3FYKX 4K1BA 4EOLA 3P2KA 3ENMA 2BALA 1OL7A 3IOPA 1H0VA 2UZNA 5A6OA 4WHZA 3EEOA 5LQUA 4FMQA 3VQHA 2Z02A 3ZLYA 3V5WA 2O06A 2Y6MA 3F5XA 3TNIA 5BVEA 3P5KA 4JXJA 2B1PA 3PFQA 1UU7A 4RA4A 2H1RA 3GGDA 4AN9A 4F6UA 2JG3A 3I53A 2YCSA 5EDRA 5HEKA 4BP3A 4DF3A 2JBPA 2XBMA 1KOBA 3GXOA 2BRNA 4KWCA 4AOJA 2XJ1A 4IWQA 4DG2E 5B1SA 3GFEA 2BAKA 3OT3A 4P90A 1T43A 2FB8A 2AOUB 4EMSA 2Y6OA 4AZVA 4YV1A 4RTJA 4NW5A 4O7LA 4KRDA 1APME 2QC6A 4O7SA 5E8VA 3ELYA 1ZHFA 3R6TA 4QDKA 3MPTA 3RKBA 3EN4A 4IADA 4X2FA 5KZ0A 3PLAE 3HUCA 5H2UA 2NXNA 3NNWA 2V7OA 4LUDA 2C6KA 3CY3A 2C6TA 5HD7A 4DHFA 2W1FA 5EI8A 2WQOA 4QP6A 4XG7A 5JGAA 2ZULA 4CTKA 3LPBA 3PJ8A 4PL4A 1RJDA 4P7KA 4RVTA 5EW9A 3KGAA 5HIIA 3ZTXA 3FLYA 4FIFA 4PNIA 3DBEA 4CMUA 3UOHA 3H9FA 3NW7A 3KR0A 5ETFA 3DNDA 4QMOA 1KUTA 1NY3A 4O22A 5HE0A 4L8MA 4O0YA 2QOFA 2WAJA 3WI6A 2OFUA 1UIRA 3FTCA 3DCVA 3U8WA 3PVCA 4RZVA 4J53A 3JS2A 4UXLA 4P2KA 4AACA 1EJ6A 3DH0A 5HVYA 3F4KA 5K8VA 2YHVA 3BHUA 5LJJA 4DFUA 2W1HA 4TYEA 4HW7A 2A14A 4CTCA 3ZO2A 3UO5A 4C33A 3PLSA 5ACBC 3PFHA 5AV4A 3UO4A 5M51A 4E32A 3I64A 3SXSA 4NZWB 3SR4A 2QRVB 1PY5A 4ERKA 3HMIA 1ZQ9A 4DCGA 5BW5A 3OW3A 4I21A 5CVEA 3LCCA 4EHGA 4HYSA 2WMQA 3SA0A 5T64A 3HCBA 4RX8A 3QQLA 3FLWA 4FZ7A 3G5LA 4DH3A 5E9EA 4BBMA 1N7IA 4O0TA 1U54A 3FYDA 1KE6A 3BU3A 2W5HA 1P14A 3I0OA 4RTPA 2C6LA 3OWPA 4JBQA 3Q32A 2ONYA 4I20A 2C3IB 3FQEA 1FOTA 1PXKA 3FMJA 2UZLA 3F66A 3OXIA 5HNIX 1JR4A 3HCCA 2P3LA 3HVIA 4YUZA 3WZDA 3NDIA 1Q0SA 1W83A 4UEUA 3NJRA 2CCHA 3NUAA 4WO5A 5L6WL 2Y4PA 2F7XE 5AP5A 4M12A 4ALWA 3L8SA 1ZGAA 2ZWVA 1VL5A 4CT1A 4RWIA 3N51A 2CCIA 4QMPA 2PY6A 5C4KA 3TZMA 2ZIFA 4ZSEA 5ICGA 5JFXA 4ALUA 3BYOA 3EIDA 3FAAA 3R8MA 4ZJJA 5B7VA 3M70A 3NWEA 5CVDA 2XJ2A 4RVLA 2UZOA 5B0XA 3ER8A 3HCEA 4ACGA 1X1AA 3O7LB 4H05A 2WD1A 5EHLA 5GINE 4EWHA 2P33A 2GAFA 2QURA 3AC3A 4Y72A 5E8WA 1FVTA 4AAAA 4I0SA 4W4YA 2JJQA 3EPPA 3G15A 4C7TA 3WILA 5EIWA 5CLPA 3C1XA 2OWBA 4L45A 4RBLA 3UO6A 4LWPA 4X2NA 2JDSA 3ZXTA 4AZFA 1Z57A 1U5QA 1K3AA 2NO3A 1Y8YA 3IK3A 4EOJA 4G2FA 3C4ZA 1GZKA 4HZSA 1UU3A 4FKPA 2BZHB 4BR3A 2G1TA 3V04A 2B4SB 5KCVA 1KR5A 3VN9A 3OWKA 4USDA 3OPNA 4QMNA 3P9NA 2Y0AA 3C5IA 4HYIA 1I44A 4F84A 3R7OA 3V3VA 4RVFA 2PMOX 1DI8A 5HBHA 4QTUB 2XNMA 3BQRA 3TTJA 4Z2YA 5L6OA 4R3RA 3KULA 2UYOA 2C1BA 3TFWA 5AMNA 2C6DA 3MSSA 2XP2A 4D4SA 4I6HA 5F2KA 3VS4A 4DTKA 3LX6A 4QPPA 5EHYA 3DLCA 3KRWA 4D5KA 4E2XA 3EN6A 4YZBA 4P58A 2PK9A 2XIYA 4RFZA 2UZTA 3R8UA 3TG1A 2PUIA 4BCMA 3IG7A 4FL3A 5IMEA 4M97A 5GHVA 4F1TA 3JY0A 3A7DA 4PNKA 3ZEWA 3HV3A 5DEWA 1RJEA 5CI7A 4EK8A 1QAQA 4RTOA 4E6CA 4ALVA 4KDRA 3OEFX 4PYJA 3ZBFA 4O27B 3VYWA 3U9NA 4U7PB 3PYYA 4PMMA 5ERGB 4Z7GA 3NIEA 5AIRA 2CMWA 2VNYA 5IH4A 2ORED 3PXKA 4BLUA 1OPJA 3D7TA 5KHWA 5CAQA 3UZPA 5CEKA 3KL8A 4W4XA 2GHMA 2OXTA 4JNWA 4F7NA 3F2AA 4Q9SA 2C5VA 3AGMA 1L3IA 4M37A 4E4NA 5EEHA 1SUSA 2WQNA 5IA3A 4PCLA 4ZTHA 4G9RA 4HRAA 4R5YA 4U80A 1U4DA 4YZMA 2BM9A 3TR6A 3LDFA 3CQUA 4K0YA 3AGLA 1LUFA 3MI9A 3UJBA 1UKIA 3DLIA 2OZAA 3Q60A 5EKOA 3EQHA 4AGDA 2HOGA 3OF0A 4F08A 4FSNA 3D83A 2V22A 4K33A 5IQHA 3OZ6A 3PXZA 2IDKA 3RK7A 1BI8A 1H8FA 5FEQA 4B99A 2OJGA 3GUBA 4FKIA 4G6NA 3VBYA 2I40A 4HVGA 3FL4A 4BCPA 4J96A 3UA4A 5EI2A 5M57A 2PY3A 4EH7A 4EOOA 4CKJA 4H58A 2XYQA 4ANQA 3HCFA 3V97A 1J3HA 2R3HA 2PX5A 2BPMA 3QOXA 2UVZA 1OIUA 3PX3A 2C0IA 3EB0A 3VBQA 5EW8A 5K01A 3PPKA 5HGIA 4HVSA 2GH1A 4PWYA 2E9UA 2O3PA 3FEGA 4KA3A 2YCRA 1WBNA 2C6EA 3CQEA 3R71A 5G1XA 3QUEA 5L2TA 3ELDA 3BGDA 3OUKA 4KS7A 4RTKA 3O8TA 2YQZA 3EVBA 4DFZE 4ITJA 4R3CA 3TIYA 3GJYA 5DWRA 1O9UA 4E33A 1ZYCA 4FA2A 5JMSA 3UIUA 3QOWA 5HHWA 3QHWA 4BIDA 1ZYDA 3DOUA 4ZTRA 4R8SA 4R8RA 2BFYA 3QTRA 4NM3A 5L8LA 5E8XA 2PX8A 4ASXA 5BP7A 3RNIA 2JDRA 1A06A 1PXIA 3F3WA 4FKUA 3EQIA 4DCMA 4BCJA 3Q5ZA 1XDUA 5EMLA 1XWSA 2V62A 3ZH8A 4WUAA 2G71A 3G2QA 4MX9A 3KQYA 4PYQA 2JIUA 3KMMA 3K5UA 5C26A 4RTQA 1IASA 3A7HA 3G6HA 1O9HA 2ESRA 4GEOA 1Y91A 3ZDIA 1XDZA 2ADMA 4GRBA 5DTMA 4BI1A 1UNLA 4D1SA 3O23A 5K5NA 3OZTA 4XG4A 3HMPA 3PZEA 4NT4A 4AFEA 3RPYA 2ZWAA 2JDTA 1BKXA 4QNAA 4RWJA 1IA9A 5CSHA 3UODA 1G55A 5D1HA 2QLQA 3GGFA 3O17A 5EYDA 3ER9A 1Q0TA 4IEBA 5T68A 3HM2A 4JAJA 2QD9A 1FBNA 2XK8A 4GFGA 1YQJA 4MEDA 3IQ7A 3CTJA 1JSUA 2VO7A 3GEQA 4NIFB 3VWAA 2Z6QA 3QX2A 3R02A 4FSTA 3SOCA 2XYNA 5CNNA 4YSMA 3CBGA 2R3SA 4O6EA 3WOWA 3R0QA 1S9JA 4DZRA 4CVAA 4FGZA 1BYGA 3A4OX 5E90A 2F9GA 2ONLC 3UVQA 1E1VA 4RJ8A 5AP4A 5ANEA 1O9GA 2PWPA 1MRVA 1QPJA 3KEXA 2JFMA 3H0YA 2GHGA 2VRXA 3LMGA 2YN8A 3MS9A 4Q5EA 4EL9A 3H0ZA 3LQ8A 4QQTA 2QG7A 4C03A 4WA9A 3HGKA 3CR0A 4ASEA 2QI8A 3OT8A 3TTIA 2AOXA 2AC3A 5EPEA 2WMUA 3OXTA 4L42A 3S68A 2G8NA 2HZNA 2BFXA 3DZQA 2XYUA 3PVUA 4NL0A 4U97A 3ZBXA 4BRXA 4C3FA 4LOPA 3VS7A 4A9UA 4IDVA 4L67A 4D9TA 3KB7A 1ZRZA 5CZHA 2QOCA 2VTMA 2ITUA 3R1QA 2N47A 1OMWA 2W4OA 3FQSA 2C3LA 5JRSA 2FCAA 4FEXA 3HCAA 4EYMA 1K9AA 4IZAA 3ZO1A 4X63A 2R2PA 3DBFA 2XJ0A 1WFCA 3FZTA 4FSUA 3MH2A 4I23A 4IFGA 4YJUA 3NYVA 3COIA 3I79A 1WAKA 3IO7A 2RIOA 3R22A 4C4FA 3G5TA 4C04A 4U41A 2PZRA 5A4QA 3A60A 4J99A 4TT7A 4YGAA 4GK2A 3F3TA 2QOOA 4Q5HA 4CFXA 5A6NA 1JTEA 3QD4A 5FRIA 3GNIB 5EKUA 3FPQA 3BCEA 4XOZA 5FADA 3QD0A 1U2ZA 4RTRA 4EONA 3FLNC 2CL5A 3DLSA 1SUIA 4I3ZA 2C7OA 5FHRA 1G38A 1O6YA 4C4JA 4YZ9A 3AWIA 2JIVA 4QPSA 4IJPA 3F88A 4MXCA 4YBKA 2G70A 3JY9A 4LRJA 4YPSA 2WTDA 3QLGA 5DR9A 3HDNA 3SOAA 5CASA 3TUCA 2PBFA 4XLIA 4ANSA 5JFWA 2BUJA 5IQIA 3OROA 4NUSA 5DT2A 4OX9Y 3DMGA 4FKLA 2J0MB 4NW6A 2OK1A 3F69A 3HYHA 3QRKA 4PIMA 3BEAA 5LR6A 4DM3A 2VD5A 3E87A 1Z9XA 2WMAA 5B2KA 1JKSA 2ERKA 3WIGA 5J9LA 3EVZA 3D0EA 5JUWA 2UUEA 4XBUA 3W2SA 3B3GA 1STCE 2G15A 3EFWA 2HW6A 1YWNA 3N9XA 4KBAA 5H3QA 1MQ4A 1OIYA 4O81A 4ZLZA 4E2WA 4GT5A 1ZGJA 3TN8A 3QCSA 3VF9A 2HELA 4TYGA 3WE8A 3QKKA 2DQ7X 4YHJA 4ZSGA 3FTDA 3KPWA 1DAYA 2HXQA 5CEOA 4FKRA 3LM0A 3ZFMA 2VWBA 1OBDA 5AV3A 4OLIA 5HLPA 4OTDA 4YTIA 1PJKA 4XP2A 3D15A 3KPJA 5HIMA 3UBTA 2BDFA 2YIYA 5CVHA 3ZZWA 2ZIGA 2VTIA 1MQBA 1NXKA 3Q9WA 3EVFA 4O0RA 4AW1A 4DTAA 1NBHA 5IQAA 1H1PA 1V0BA 3W32A 1P91A 2XKDA 2WK1A 4G6OA 3GCZA 3I1AA 3DAKA 3P0MA 4J1RA 3RINA 3OTUA 2WMRA 3OZSA 3ORXA 4FTLA 3HMOA 3IKAA 4RWZA 4U7TB 4G3FA 2YISA 4PYIA 4U42A 3EOCA 2JIIA 4KWPA 4XV2A 3N4TA 2UZEA 3RK9A 2OF4A 5FXRA 3KU2A 3VBXA 5HX6A 4X3FB 2FPOA 2OZOA 3KK8A 3CKWA 2GFCA 3R9OA 4BCIA 4OQDA 4KW7A 4RTSA 3UNKA 3PVBA 2F2UA 7MHTA 3E7PA 2O0LA 4EOKA 4HVDA 1SKMA 2HYYA 3F9NA 4BTJA 3NUUA 4F63A 3FUVA 2VO0A 4BZOA 4EQUA 4NSTA 2PT6A 4C61A 3QCYA 4FIJA 4IV0A 5EMJA 3RGFA 3R9XB 2VWUA 3NUYA 3OE4A 1FPUA 4EKGA 3KQ7A 1FJXA 3O8PA 3LE6A 3NNXA 3GCVA 5LQNA 4KIFA 3V5QA 4GF5A 4DA4A 5EK7A 4D0WA 4FV8A 4L52A 3Q3BA 3R1SA 4FV2A 3R8LA 4G5JA 2O05A 3OUNB 4HOKA 3RAHA 4AN2A 4YHFA 4E20A 3NLBA 2VDWA 1DAWA 5KMKA 4IM3A 4MCVA 2BZJA 5E7RA 4YZNA 5DX0A 3QZFA 2PE0A 1UVRA 2XKCA 3ORKA 1UFKA 3E8DA 3OXZA 3COKA 2JH9A 5CUQA 4CFUA 9MHTA 3LCDA 3IDPA 2XK4A 4CV9A 4L7VA 1OKWA 3SAYA 4WG4A 4H0NA 1JSVA 3MDYA 4LFIA 4ZTNA 3DULA 5HE1A 3REPA 4D4VA 5GJGA 1OUKA 4RJ5A 4FUXA 3TACA 1BX6A 2CHLA 5HNBA 4JIKA 5FDXA 3ORHA 3SXFA 4ACHA 1UU9A 5T6BA 4WBOA 5ANJA 3L8XA 5EM5A 4U44A 5IA5A 5EOVA 4RLKA 2OYRA 1AV6A 2GNJA 5ETIA 3BRBA 3QTXA 2YIRA 5DH3A 2R3FA 3SHEA 4RIXB 5DM0A 4YUVA 2VX3A 1JKKA 3PXRA 5D7AA 5GOZA 3LCOA 1YFJA 1Q41A 3LFDA 2W06A 3D4QA 2YJSA 3CCNA 4NTTA 3LCKA 2LD4A 3DKGA 4B8LA 5CVUA 3VS5A 4A9YA 2VTLA 4FR0A 4KUJA 4G56A 1UKHA 5HNGA 1CKIA 1RJBA 4AG8A 3T7RA 2BRHA 3MH3A 3UVRA 2XZSA 5EQEA 3KC3A 3UA3A 4WXHA 5FG8A 1WBTA 3BE2A 3E64A 3FZOA 1U46A 3NPCA 1KE5A 1H00A 1JNKA 2GPHA 2UW5A 4BDGA 3SMQA 3HP5A 3NAXA 4KKHA 5EZSA 4ZJVA 3A27A 5JRQA 3OU2A 5HVKA 4IX6A 3EKNA 3MVJA 5LCKA 3HL7A 1YW2A 3R8PA 1TPYA 3HCDA 1BI7A 3ZSIA 4PRJA 5J7HA 3GOKA 5D11A 4DMGA 3A8XA 4BDBA 3TJDA 3KK9A 3JWIA 5FXSA 1OM1A 2W4KA 2PV0A 1L3CA 3LFSA 4FV3A 3DK7A 4MH7A 4YJOA 3D2IA 3EGEA 5HIDA 4O38A 3COHA 4MBJA 4E6QA 5HZMA 2PSQA 2EXCX 3P08A 4E2ZA 4X0MA 4BIBA 3BZBA 2P0CA 4R3PA 1JQDA 5EMMA 4U3YA 5FQNA 1W7HA 2R7IA 4FTUA 3WF9A 2OI4X 3IW8A 3QTQA 4X3FC 4HVIA 4C08A 4L44A 5LCJA 3TUBA 2R6ZA 3OCGA 2R0UA 1R00A 2NXEA 2GSFA 5A4TA 1M6EX 2LGCA 2C5OA 2HWPA 2F8LA 2VTAA 2XKEA 3H9OA 4QQJA 4U8ZA 4F64A 1OPLA 2A27A 5FD2A 5CEIA 3KVWA 3MFRA 4TWCA 4BLVA 4C4GA 2BILB 3P2IA 4BGGA 4BDJA 1Q8ZA 2IZUA 2W4JA 4FTMA 3FPFA 4EYJA 2BZGA 4FIIA 3ZLSA 2E9PA 5L2WA 4OBOA 2DWBA 4MQ1A 5DX8A 5A46A 2UVXA 3ORLA 3BYSA 1FMOE 5DIAA 4I0TA 1ZMWA 4YC8A 5E8YA 5HQ0A 2CMGA 2DPMA 2BKZA 5E1DA 3BWFA 3HAMA 5E1OA 5HIJA 5TO8A 4GW8A 2ZDTA 2AOUA 4O7RA 3ET7A 3MJ2A 4I5MA 2OICA 4YTCA 4KIQA 3FY0A 1BLXA 4L00A 4MNFA 4F9BA 3F6XA 4CD0A 5K4IA 5E9QA 1BKYA 4TRLA 2XMYA 2YM5A 4PTCA 3TZ8A 1PKGA 1F5QA 3DB8A 2PVRA 1P2AA 4NM0A 1BOOA 3H3CA 4BTMA 4CXAA 4IH8A 4AP7A 2SRCA 2AVNA 1XCJA 2YUIA 3PP1A 1Q8UA 4O84A 5DR2A 4ZTSA 4BCFA 5BVNA 5HE2A 3JWGA 3FYCA 2Z7QA 3MFUA 2VZ9A 5CX9A 2NP8A 1JBPE 2AUHA 2CN8A 1Q99A 2QCSA 1Y8GA 3WYXA 1LEWA 3CY2A 4MTAA 5I0BA 1QPCA 5EW3A 4EI4A 4RVGA 2OBJA 4L3LA 1OZ1A 4O7NA 3IPHA 3DK3A 4O82A 4FTQA 4EH8A 5E8UA 3CTHA 2OIQA 3UJAA 5AUZA 5G6VA 5LWMA 2IDJA 3D2LA 3PFGA 2W96B 1E9HA 3MHTA 3BGQA 4DG3E 4IB1A 3L9MA 4HYUA 4NYEA 2XNEA 4FKGA 1REKA 3RALA 5LVMA 3LGAA 2B7AA 4FKSA 4M15A 4FBXA 4OTWA 3DXQA 1CM8A 3ETAA 5JFVA 3LFEA 4FICA 4D9UA 5J1VA 2BMCA 2FK7A 3RP9A 4YC3A 1INLA 4PYMA 4M7IA 2CKEA 3PWYA 2YTZA 1KSWA 2FSLX 4JQEA 3TPZA 4BC6A 3MPAA 3FI8A 2OIBA 1MRUA 3FI2A 3FV8A 4DEEA 4E30A 4RT7A 4XG3A 4RC4A 3GU4A 1SQGA 3OU6A 4IWNA 3HTXA 4EOMA 5JGDA 2A4LA 4FTJA 3UZUA 1H27A 4RTMA 4B7TA 1TQIA 3OW4A 2Z6AA 1M2QA 5EI6A 3Q9YA 3R30A 4NKSA 5DNRA 3QWKA 4RIOA 5BPYA 5C8KA 4YNOA 5KHXA 1XBAA 3SM3A 5CCXA 2R9SA 5K4JA 4X61A 3WF5A 2H6DA 4AZTA 4BDHA 5CYIA 5LVOA 2NRYA 1W8CA 2OLCA 3OWJA 4N0SA 4X2JA 2XCHA 4XG8A 4O6LA 4RPVA 5E92A 3RAWA 1NV8A 1XTPA 2PMLX 3KKZA 3O31A 1MJFA 4XG6A 5DM4A 1A48A 2PZYA 5DT4A 2XK6A 5AAFA 4ZLYA 4Y30A 5FULA 4E31A 2EU9A 2ZBRA 4DC2A 3F5GA 2PTKA 4YURA 4I41A 1J1CA 3WIKA 3VIDA 1AQ1A 3F3UA 5DPMA 1RJFA 3N4VA 3R28A 2GNIA 2X1NA 3PY3A 4I5CA 3NVMB 4O0XA 4UWYA 1RI3A 2EFJA 4ANBA 2VGPA 3EQFA 3NSZA 3M6VA 4BP1A 3PTAA 4IWOA 3I5UA 3NYXA 3Q4UA 3G90X 3G6GA 2C5XA 3NAYA 4F65A 3IGGA 5E91A 3DV3A 4OT5A 1Y6AA 2W7XA 5EM7A 3T8OA 3V6SA 2IN6A 2YWPA 3CBLA 3E93A 2ZMCA 4NCTA 4E4XA 5IEVA 4GVAA 5HCXA 1OUYA 2AVDA 1M7QA 4DEDA 1NW6A 5CIYA 5M53A 5EKXA 4IAKA 5E8ZA 2VTTA 2FSTX 2WTWA 3LJ2A 3M11A 5AADA 1OL2A 3IS5A 4EK4A 4IM0A 1PXNA 2AYPA 4LOOA 2X81A 4QP1A 4O0UA 4QYHA 3E92A 2ZDUA 3E62A 4Y46A 4FL2A 5HILA 3ID6C 3QD2B 4CZTA 4ZS4A 3CCFA 1NVSA 4EOPA 4I5HA 4GJ2A 2C5NA 3LLTA 4M68A 4NKAA 4KS8A 4PYKA 5BX0A 3MGGA 2EB2A 3M33A 2QR8A 2PKWA 2YVLA 5E2BA 4IB3A 3WZUA 4DKJA 3PVWA 2YM4A 5AEPA 3HRFA 5CANA 4UV0A 3SW7A 2BIKB 5E8RA 2UW7A 3GP0A 3FSFA 3MA3A 5DRYA 5LVLA 2QONA 2FGIA 4OR5A 4XHKB 5HI2A 2DYLA 3FXXA 3NNVA 4YU2A 4G3GA 2EX4A 5FQOA 2ETRA 4LG4A 2AN5A 3UJ9A 5CU6A 3SSNA 1LR4A 2W99B 3P78A 5CQWA 1NVQA 3AT2A 3C0IA 4EOIA 1XH7A 3PX2A 4GOMD 2WU6A 1P4OA 3NVKI 1L3BA 4MWHA 5IU2A 4PYNA 4YP8A 4GIIA 4CLJA 1J7LA 3M6XA 3PRFA 2ZZMA 3WF6A 4GKHA 4O7VA 3EKKA 1JAMA 1DL5A 4PMSA 4YZCA 2BTRA 4LGGA 4YJNA 2REIA 3HMNA 3LFQA 3G2MA 3OCJA 2IVTA 3FMHA 1YFLA 5TT7A 3H10A 5TOZA 5BNJA 2P2IA 2C0OA 4GT4A 3UJDA 1Q24A 4EHZA 2IIPA 2PXCA 3BWMA 4I4EA 4E5WA 2BAJA 2UZVA 1WS6A 2PVJA 1JSZA 3P8ZA 5F20A 5FUTA 2EG5A 1BL6A 1URWA 1YOJA 4QOXA 5AIKA 1JVPP 4LECA 4A9SA 3BU6A 4H39A 4TWNA 4BDIA 2ERCA 2ZIEA 4OTFA 3CJQA 5FM2A 2VWVA 1ZY4A 3FL5A 4NK9A 4DH8A 3MVMA 4AQCA 3KQPA 3VC1A 4RIXA 1XH4A 3OU7A 4CCUA 3R1YA 4MBLA 5FCDA 3NIZA 2OO3A 2NP6A 5ANKA 2OB2A 1QMZA 4YUXA 2XB7A 4UZDA 5JH6A 5AM7A 4O2PA 3NUSA 4A4LA 2JDOA 4AX8A 3SVZA 3C0KA 2B9EA 4CXMA 4BYIA 3QQKA 5J87A 3FUWA 2ZZKA 3KVXA 4NM5A 1R1WA 3OY3A 3CGFA 3E8EA 4CFWA 2WQMA 3VW8A 2C69A 5KQSA 2R3GA 2YJRA 4QMUA 1JKLA 4I24A 5FBNC 4CNHA 5TKDA 4AT5A 4GUEA 4EBVA 3LMIA 2G1PA 1ZYSA 4B6LA 3M2WA 3VQUA 5HIEA 2OH4A 4FTTA 3TCPA 3VS0A 4BHZA 3NDMA 3FZ1A 5BUEA 2B52A 4ZTBA 3EH9A 4AOIA 4CV8A 3THBA 3CJRA 3BHHA 5IA0A 3FJQE 2EVAA 3PXQA 3VUKA 2YCQA 4GG5A 4UOEA 5BQ0A 3FBVA 2ZV2A 3E8NA 4C62A 5GM1A 3LAUA 3T7SA 3UZTA 5DM1A 1I09A 2QHNA 2QO7A 3ZLXA 2BRGA 1WBSA 2F7EE 4FOCA 4P5ZA 5BXYA 3P71T 2O8YA 3BYVA 3EN7A 3PIZA 2JAMA 2C0TA 2VO6A 2I6LA 4ASDA 2CGUA 4CKBA 3SDJA 2W5AA 2XIXA 5IPJA 5KUPA 2JKMA 3A4PA 3F5UA 4O86A 4E4LA 1KE8A 4L3PA 3UQFA 5E1BA 2PXAA 4U45A 1Q62A 2ZM4A 4LV5A 5DEYA 4ER3A 2A19B 5J95A 4ZSAA 5C9ZA 2J9MA 1Q3WA 2PX2A 1RI1A 1G5SA 4QPAA 4FG8A 4QTCA 4U6RA 4YPDA 1OITA 3I6UA 3EMBA 3D7ZA 1SVGA 4FZDB 4KIPA 4GFMA 5EH0A 3TM0A 4BBFA 4AW0A 2X4FA 4E7WA 3VUMA 1AF7A 3OVVA 1X19A 3LSTA 4W8EA 2GLUA 4LV8A 3KXZA 3U6HA 2O2UA 3GFWA 3R00A 4XS2A 4JI9A 5EM8A 3B3FA 1KPHA 4OBXA 2VTPA 5KBRA 1WY7A 4GU9A 4IAIA 1WVYA 1ZZLA 3BHTA 4I92A 4M0ZA 4HNFA 1ND4A 1KYZA 4FT3A 3UMXA 3IEIA 1FGIA 5FLFA 5FTWA 1WZYA 2XK3A 3LFAA 4H3BA 4N57A 5JGBA 4ANMA 3B5IA 4XV9A 4YJQA 1IXKA 3LPMA 2W1ZA 5AM6A 5IG1A 4L6QA 4X41A 1JQ3A 1UV5A 3DPKA 3PPZA 1XBBA 5ANOA 1WBVA 1OIQA 3GQIA 2WIHA 2KTYA 4KNBA 3AD5A 5CVFA 5E8TA 4A4XA 2JHPA 2X7GA 3LZBA 3DAJA 2ZV9A 3KRJA 3ZUUA 2VZ6A 1WZNA 2X39A 3P79A 3CXWA 4U9AA 5DTRA 3PSDA 5D7VA 4MXYA 1IEPA 2E9OA 3KXNA 3FMMA 5CU4A 3SKCA 1H4LA 3D9VA 2J4ZA 4FSMA 4XRJA 1I1NA 5DG5A 1L3RE 2PJDA 3CEKA 3KA0A 4GYGA 4M38A 3ERCA 3DUWA 3A7IA 4U43A 3ZC6A 2HENA 4YO4A 2G9XA 3QC9A 2R3PA 2YDJA 4YLLA 1YZ3A 5EQJB 5HIKA 3FC1X 4XUEA 3MV5A 2EB3A 2GNLA 1E1XA 1GOLA 1H26A 3GU7A 3MFTA 3DJ6A 4OGRA 3SD0A 3TNHA 3VS6A 2GS7A 3ZO3A 5IZFA 5A4EA 3U6JA 4JG8A 4CKCA 4WG5A 4FTKA 4UYAA 3PSCA 5AV0A 2HW7A 3G5DA 4ZEGA 3SSOA 2GNFA 5MHTA 2J5EA 4DT8A 3UQCA 1UA2A 3P1AA 3F2NA 3QHRA 4BCGA 1NVRA 3HLLA 4GOOD 4AFJA 5DRTA 2FSMX 5HO7A 1OKVA 2BHEA 3NW9A 5KYGA 5HU3A 1NKVA 3VULA 3DS6A 4AZEA 2VNWA 5M4CA 3BBWA 1PW2A 4U40A 2DUVA 2W1DA 3AC5A 3DDPA 3H4JA 4XRLA 4DEIA 1H1WA 3FMEA 2AZTA 2WTJA 3ODZX 3HEGA 4GYIA 2RFEA 2UW8A 3GRRA 4RVMA 5FP5A 1OL5A 4QMXA 4ZZNA 3DQWA 1KV1A 1URCA 5HTCA 2YCFA 2YFXA 1VYZA 2J2IB 3AOXA 4GK3A 3PIYA 3MESA 3EYHA 3OMVA 2JKOA 3OCBA 5FA5A 3MAGA 2P8JA 5IEXA 4E5BA 5IH6A 5DT3A 1XH5A 4KIOA 1FINA 1YXTA 2QU5A 3E63A 2AOWA 4QVKA 3T0IA 2W9FB 3VO3A 5KE0A 4WD5A 5KX8A 2BR1A 4IWPA 4CWAA 3DK6A 3TV7A 4RX5A 3NS9A 4A7CA 4ZLOA 4WNMA 2R0IA 5CI6A 2WPAA 2WMSA 4C4HA 1JQHA 5T67A 4JJRA 5EDQA 4FE2A 3EFJA 3KQOA 3SX9A 1VZOA 3KQQA 4R05A 3QUDA 4O0VA 2R3IA 3RVGA 5K5XA 1ZARA 5CAUA 3NYOA 4C58A 2OKCA 5CY3A 2VDVE 4JR3A 2I0HA 3IONA 2X7OA 1SVEA 4FV9A 5FEDA 4E6DA 3KQVA 4R77A 5CT7A 2IH2A 2ZOQA 2O57A 3FUTA 5JN2A 2IVSA 3AC2A 3MVLA 2YITA 3QAME 4I1ZA 4C34A 2R3MA 1WXXA 3HNRA 3CLYA 4WOVA 2GNHA 5JSMA 1ORIA 4GQBA 4OA8A 4M13A 4AUKA 1DCTA 4QPNA 1IRKA 3AXTA 3UIMA 4K6MA 3FSKA 2OJ9A 4XH6A 4YV2A 2P55A 4ENYA 4DLJA 1PJZA 2IBSA 4NM7A 3H9RA 4BICA 3C3PA 5BUIA 2GMXA 5CWZA 2G72A 2CGWA 4HVHA 1KHHA 3TKAA 3PE2A 4AGUA 4FK3A 2WEVA 2XA4A 2A0CX 3A62A 2ZB0A 2OXDA 3OOMA 3QRJA 3QX4A 4JQ7A 4JVGA 5KKRB 4X3FA 3Q96A 3NW6A 3RM7A 2VX1A 3QL8A 5C1QB 1H01A 2UV2A 4FSYA 4L43A 4BCHA 2OZAB 4E2YA 1TQPA 2XNGA 4AZSA 4FIHA 2QNJA 4I0RA 2B3TA 4YMGA 2RG5A 4O0SA 4QO9A 5CCBA 5DX1A 2UW4A 3V01A 2PZ5A 4II5A 5K05A 3GQLA 2AR0A 5CSXA 4AW5A 4BGHA 3DR5A 5CD1A 3P9JA 2OG8A 1B38A 1QAMA 3DZOA 4B9DA 3MB6A 5T3QA 4QMVA 1F3LA 1NA7A 1F3MC 4EJ7A 1JG1A 1NV9A 5AP0A 2ZVJA 3I0QA 3ME5A 3S00A 3FY2A 3Q2MA 4BDFA 3KN5A 2I7QA 4YMHA 4FKTA 2ZW9A 4QMLA 4IVAA 3KPUA 2AN3A 3JPVA 1T45A 2IBTA 5DPVA 4AGWA 4FTAA 4OTQA 1XBCA 3GC7A 4EKKA 5ETAA 5BYYA 1H0WA 3C13A 4MHAA 4JBOA 5CAPA 5FWAA 3U81A 1K2PA 4FNWA 4FVQA 4IM2A 5GNKA 4DG0E 5E8JA 3PXFA 2CJMA 4F99A 4BF2A 3AC4A 3G88A 5AJQA 2CGVA 2YDIA 5C8NA 1PMUA 3ZC5A 4FK6A 4PTGA 5DRBA 1NW3A 5D12A 3VS3A 2BR5A 3DMHA 4XUDA 4W8DA 5DA3A 1ZWSA 5F1ZA 5E1MA 1FVRA
chains in the Genus database with same CATH superfamily
3S4QA 3WGZA 5KSWB 1Y1RA 2FPKA 1JI0A 3R6DA 3C6XA 5IBQA 5CSPA 5CU3A 3RK5A 2FW9A 5DTQA 3WGTA 5ICEA 1RYZA 3PLNA 3ZYCA 1XVIA 1TF2A 2M1ZA 1VR2A 2E87A 3F3VA 4HTFB 2QLNA 5BOSB 4RS4A 5BNIA 3JZMA 4OO3A 2HK9A 4ZV9A 3TVYA 1JB9A 4Q9DA 3IP3A 2X3YA 3WK8A 4J2OA 5A5VA 3CRRA 7REQA 4EG4A 5LXTB 2YWJA 1Z5MA 3ZO4A 4BEWA 5BMOA 3CUWA 3E0XA 1CDKA 4OV6B 3MSXA 1XJ5A 4WIHA 5KYTA 4OXQA 4O2ZA 4OHCA 3CTMA 1A9XB 1ZYLA 4C6HA 5JK3A 2GX6A 5CGZA 4I1OA 5FBLB 4F0IA 2H17A 3S8EA 3PP0A 1FRNA 2EDCA 4M9UA 4U5XA 3M4ZA 4BNLA 1XZFA 1QP0A 2G01A 4M9QA 5F2OA 1PEYA 5ALKA 1ZKDA 1ZN7A 1AHHA 2R68A 2C2HA 1MXHA 4ZP5A 2IODA 4F8JA 3VYUB 4YN3A 1HYBA 2QVBA 3U55A 2R1TA 3SY8A 4ZDKA 1Z4LA 3H9UA 1RI5A 5IQCA 4FS8A 2WVAA 4ADSG 3MH0A 3U1VA 1OKZA 5LYYA 2OCDA 3TLKA 3HABA 3B89A 3C3DA 2DHRA 1L4MA 1E4OA 1U1IA 3AXWA 4OKIA 2BRMA 4ARKA 1K66A 5ALRA 4HYQA 1CR0A 5JT2A 3NOOA 1FSGA 4IJ9A 6NULA 4MICA 4V0QA 2WF6A 4MGYR 4X7QA 4FYIA 4GHWA 2Q4RA 2BELA 4F92B 4OQNA 4LV7A 4USFA 1YCFA 5A0VA 3K8OE 2OOSA 2QMOA 5CM2Z 5IAKA 4UY9A 3U9CA 2DUWA 2KHZA 3BMOB 3ZVLA 2WD7B 2JLUA 4CUJA 3IT3A 2P4IA 3FAZA 1CW2B 4CEHB 3WF7A 1VG1A 2YV5A 4FT7A 3S44A 1XK7A 1YS1X 1TVMA 5A2QA 3D7LA 5TLSA 3SICE 5AHWA 2J6BA 4V0GB 5HBRA 3VUHA 1W88B 2W6PA 4BZXA 4KQXA 1KEWA 4RGYA 3POOA 3VC3A 2J9ZB 2UZ4A 2IVVA 5D41A 2JHAA 2FPPA 3ZCPA 2ZVAA 1IA8A 1RCFA 4JNKA 1Q1BA 4GJ3A 3ORIA 4D26A 5J4KA 4X3JA 5CW1A 3ES9A 4BTLA 4BKPA 1ZM7A 5DP1A 2HJHA 1CETA 4U5JA 3KEOA 1I0ZA 5D10A 3ND9A 3INYA 4BDEA 2XDYA 3E3PA 1O95D 2QOIA 1MIHA 4UVHA 4BVFA 4F9YA 1G21A 4PZZA 2J30A 1B93A 1ATZA 4IUYA 3FDIA 1B14A 4TTTS 3H6GA 4XGNA 3ZWNA 5I8WA 2ZB7A 2QE7A 4G3XA 2DOKA 3ROQA 4F4IA 2IS1A 1P1RA 4KX5A 3NIFB 3R2BA 1RHMA 4UBNA 1AUVA 2BHLA 3GHHA 5GONF 4D9BA 1WDKA 3ZLJA 3RS7A 5H3LA 2LCQA 1DUIA 5KQGA 4GCJA 3ZKWB 4GMFA 3QQ5A 4OBWA 5IMSA 5KNJA 2XZTA 4WZ6A 2BTEA 1QH8B 3NUPA 1DPGA 3T9IA 1RQPA 3I5ZA 4E26A 2R4UA 2G07A 4TN6A 3K6SA 3OOGA 1QC5B 4XAQA 4AE6A 1HQYE 4KGXA 1YB2A 1CUAA 1Z47A 1REQB 2WSLA 1KK3A 4KP7A 4ZV4A 1OKKA 2Y99A 5CF8A 1QH1A 2R3QA 1ORHA 2FA9A 2ZIXB 4DV5B 2VH5R 4RIGA 5BMVA 2VK1A 1GPH1 4FEVA 1C1DA 3ITNA 1AURA 1THZA 2WSMA 2CXHA 2VUUA 3V6MA 5DBHX 1E9BA 3WLHA 1USVA 5G1NA 1IL0A 1MZPA 1IHDA 1PFQA 3GCUA 2FA2A 4URUR 4FNZA 4PZ0A 2OA0A 4LZWA 3ADCA 1F0KA 1R8XA 4LOKA 4J0QA 3IDCA 5LNK6 4LRQA 3B3JA 4AZWA 3IS3A 4ZQEA 1WVIA 5FA6A 2I6TA 3PKIA 2Z8XA 2X3UA 2OC9A 4I9GA 1NW5A 4PLWA 3ENZA 4NQRA 2OZVA 4KHZA 2PSJA 1P4SA 4RYDA 2UDPA 1YH3A 4HPTE 1IWOA 3ZU2A 4L7SA 1GAGA 2W6MA 2BEUB 2QN6A 3UMCA 2PLRA 2G4CA 1J0CA 1J25A 1QVAA 3PC8C 1MMFB 4TL0A 2VU3A 2RKUA 2M6RA 4ZSLA 3UMJA 4B81A 5I9UA 5C52B 4UU0A 3G5AA 3MC1A 1VPWA 1J91A 4XRGA 4A6DA 4EH4A 1ND5A 3I9OA 4PX3A 3IAUA 5KZMB 5IJZA 4MK0A 2MSWA 2RH5A 4NYMQ 3UTOA 4BBEA 2GPTA 2HJWA 5DT0A 4BDKA 4M14A 1V1RB 3PS9A 3E7OA 1FQJA 1OB2A 3IVCA 1PT6A 5B2MA 3DAHA 3JD0A 3PR2B 4RAQA 2Z6UA 2AKAB 1HNXB 2I22A 5JO9A 4LYAA 3FHJA 3IA7A 3R73A 1P7WA 5GJDA 2HA2A 4IYRA 4OJMX 4UHHA 2YM8A 4IRMA 3ZYAA 4YQYA 4F72A 2FR8C 4ZSJA 2VTRA 1YWRA 5L9AA 3CNHA 3TF5A 1W98A 4LBZA 5EXXA 4M3NA 1ORRA 5G1OA 4PRLA 4E5YA 2B0QA 2DU8A 4G85A 2A33A 4EW2A 2ZRCA 1KZHA 2BYTA 3U4QB 2ZRKA 3EY4A 1OUMA 2JH8A 4R0NA 4PFSA 1V5EA 4GNRA 1L7QA 2IYUA 1MNAA 5FTGA 3DO6A 3V7YA 1HCKA 1VE9A 2QRQA 3NHKA 2A3NA 1VPTA 1XZDA 5LQMA 3EIEA 1RJWA 4FKVA 3QXJA 4IDNA 1XHFA 5A62A 5HFAA 3ASUA 3UOJA 3IEMA 5G1PA 5AUOB 2EATA 4X1KB 1G5FA 3CVVA 2E9VA 2X8WA 4MAFA 4D80A 4H7KA 2Y1FA 2NZYA 2EQ5A 4FKQA 5DGCA 4PCVA 1QDEA 1R6UA 4KVAA 3UP2A 2IYLD 3A6EA 4V0GA 3IPYA 5ALOA 1ZH0A 4LFCB 1PG5A 5KVSA 4DEBA 3Q6WA 1N2XA 2C83A 4XM2A 3NCTA 2VYCA 1ISGA 1NTRA 4XMOA 1AVTA 3NO4A 4B33A 3FPHA 3W1WA 1PFVA 4IDGA 3WV4A 5L3RA 5F4NA 3OWOA 4R7ZA 3WQHA 2WSBA 4OHYA 1U0LA 1Q5KA 3IHKA 3ZMMA 2O3RA 3RMFA 2OJIA 4AP6A 2CE7A 1XHAA 4B8WA 1Z73A 3M1LA 3FI9A 4WKCA 3GENA 1ZM9A 5DGXA 3I42A 3LT5A 4JXFA 1Z7EA 3W9UA 4H08A 3QYAA 4BGVA 3WNQA 2O5RA 4EFNA 4GKIA 2ISSD 3ALOA 4IVPA 4LV6A 2VGOA 4GT1A 4TT3A 5AW8A 4IMIB 4I6JA 3IO5A 5FF9A 2WFMA 5EHIA 4MKCA 3RSCA 2EKZA 3AK4A 5P8WA 3QBNA 2PD3A 3ABRB 3MOSA 3VU3A 4FMPA 1NYQA 3H1FA 3SDZA 1H94A 1S2GA 3ITZA 2VTKA 3QPUA 4A6EA 1T2UA 3ZZEA 8LDHA 3NHWA 1HDYA 2Y2VA 3REQA 4EYKA 5JJIA 3TQFA 5EJIA 2ZANA 2VPTA 5TS2A 2Q5LA 3ABZA 2ILVA 5AW7A 4A36A 1XV5A 2XNBA 5DF1A 4UNRA 3R7LA 1IONA 1GUFA 3WG9A 5IA4A 3WYBA 5EJMA 5D3ZA 1KY5A 5A9UA 1QBGA 4BU0A 5JSQA 4GG1A 3RT1A 3WA6A 1J23A 3PXDA 4WG3A 1ZHOA 2IZRA 3VU9B 4UM9D 3GVUA 1HA3A 4GI1A 2VOJA 4AA4A 2O8FB 2OCPA 1M0TA 4Q9AA 4C3PA 3LUDA 3L6CA 4IMPA 4LG1A 3P5BA 4N3CA 1ZOOA 1NNI1 1FZTA 4FFLA 1FQ1B 4Y9SA 2JGDA 3DLTA 2R6AA 4MAMA 4TKLA 3BA6A 4D96A 5K0LA 4EW6A 5HJEA 2ZJ7A 4GPTA 2C2YA 4FI1A 1RBZA 2QVSE 5KTOA 4BOYA 1TK9A 1N1EA 1L5HB 3KLNA 3DS8A 1DCMA 4QU9A 5F7XA 2RGPA 1B3RA 2PMKA 4BS9A 5ECWA 3AIMA 1LTHR 1AE1A 4XB2A 3PA3A 3SS7X 1QCDA 2YAKA 3ON5A 1A50B 2KULA 4ENUA 3NYWA 1KEEA 2YNMC 2GKSA 3CTQA 3OWLA 1Q0LA 4C88A 5DT9A 4PX5A 2NTNA 1C8KA 2CFIA 2GT1A 3QLVC 4U3JB 1E2UA 5FPYA 2XMZA 4AJHA 2R25B 3WL4A 4EFKA 3WTBA 5FNZA 4D4JA 2ZETA 3UB4A 4CFSA 3IPLA 2JBPA 2CV2A 2VRNA 1NA5A 4AOJA 2HY7A 4B3RB 1DC7A 2B5OA 1OBHA 4CCSA 1A1SA 3H1AA 5KC9A 3EN4A 3EF0A 4RETA 1DIBA 4G2TA 2ZYHA 4RANA 4QGHA 3RBXA 1H6DA 3QWFA 2V0CA 2HXGA 3UHJA 3VSAA 3KR0A 3JRXA 2QOFA 1PJ8A 1RRMA 4CDNA 2YHIA 4E2FA 4ZVLA 4BRZA 3UO4A 5M51A 4LJ8A 4DJFC 1CZHA 1JGTA 1DBRA 4FZ7A 4G09A 4BP8A 4DH3A 1MB2A 3FYDA 4DEXA 4N12A 4B80A 2K7ZA 4F0JA 1N6NA 5A2GA 4LZJA 2H7VA 2OAP1 3LI2A 3T06B 4NXMB 4WO5A 2F7XE 5BQFA 4RLHA 4JC8A 2W83A 4RWIA 2RK3A 2ZIFA 3R74A 3EZNA 2Y68A 2D8AA 1G9XA 4YT5A 4EWHA 1FVTA 1DUVG 7GPBA 3NGMA 1K3FA 3WLTA 3LCRA 1FVOA 4HYIA 3W90A 1EVIA 4AZ3A 4R1TA 4YQEA 4FOTA 5EN4A 3BQRA 1FRQA 3E7XA 3KJIA 4UTOA 1L4UA 1Y6RA 3ZCVA 2O8CB 4BX0A 3HYTA 2EGUA 2GEVA 4NDAA 1AGNA 3R7AA 1GPAA 1P7VA 2PPLA 4TS1A 1RJEA 3PHGA 3TGPA 1QAQA 2J09A 5F2EA 4A5OA 2Q46A 2RONA 3QKRA 3L7YA 4BFYA 2B61A 3TRKA 4A9AA 1EINA 4U80A 3AUJB 2PL9A 4HVAA 3AGLA 2YKGA 2OZAA 4BO8A 5IQHA 1ZISA 3AHEA 4E03A 4KV9A 3WICA 4J96A 1U8XX 4DDMA 4FCCA 4H58A 3LCJA 4R1OA 1RLMA 3L5KA 2YV3A 1JDTA 5K01A 4PWYA 2E9UA 4JZKA 1ODIA 3O47A 1F17A 1FYDA 3TIYA 3FGNA 4EGSA 3IP9A 4R8SA 3QHWA 2OYSA 2FSSA 3QF4B 1XVVA 3D1JA 4FKUA 2Z2JA 5JYEA 4A26A 4MYCA 5F3DA 4GRIA 3G6HA 5K4GA 2JCSA 1I7DA 1XTSA 3RPYA 3F90A 3ZV3A 1O87A 4AO6A 2GRJA 3AHCA 4ZYWA 3D0OA 2EFGA 3RVJA 4RHUA 3L8YA 1TCUA 1QPJA 2PU5A 4EL9A 2IITA 1GAJA 2G63A 2AC3A 3D6AA 3S68A 3HP4A 4ZAZA 4C3FA 2QPAA 3TDMA 4IDVA 4C4YA 3HUEA 5G41A 4DWOA 1B6RA 4FOOA 1EFPB 4IFGA 4RX5A 4GBMA 2Q27A 4TSKA 4D0GA 1QYXA 4C04A 3A36A 3VX3A 3K5HA 4YRMA 4ZQFA 1SUIA 5BNZA 3C1OA 1DFHA 3KDSE 1UKYA 2GD2A 3OT4A 1TUEA 2JF0A 1L8OA 4GU5A 4DXDA 1MRNA 1BEEA 1W36D 1FSZA 4A3SA 3QFRA 4RD2A 2VOEA 4OI2A 2C94A 5COQA 3F6EX 5KWVA 1E9DA 3FTDA 4RFLA 4XDGA 4YTIA 1J0DA 5A4MS 1JHDA 1Z2NX 2ZIGA 1VI5A 2XNKA 1OBCA 1H1PA 2PT7A 4O1MA 4CNQA 3KKKA 3H5WA 4B3BA 1AA9A 1K8RA 4JSTA 5K3CA 2Y4OA 3PVZA 1UBHS 2C4UA 3O8RA 4S35A 3NWOA 4I4TF 4C61A 4LF8B 3IQXA 1D2RA 3CF4A 4BJ3A 3ENVA 2O05A 4XQCA 2XANA 1AKRA 3QZFA 5DW0A 1UFKA 5F5NA 4CV9A 1EGQA 2HXYA 1LSJA 1VA4A 3N2YA 4YIHA 4LRWA 3H2KA 4BO6A 5DH3A 1BGVA 1YFJA 2ZG6A 4G1VA 1H4VB 3AKJA 2OBMA 4NJOA 2VL7A 3EZXA 3ZNOA 3M9WA 4ZJVA 1OGYA 5JRJA 5KWIA 2VLBA 4BDBA 5LU8A 3TJMA 3AVYA 1OVMA 4J0DA 4MBJA 1CZNA 3TOZA 4D02A 5HZMA 2WE7A 3H1PA 3P08A 3DFUA 1OX4A 2P0CA 2DTEA 4Q82A 1BXKA 4NYJQ 3WF9A 1AKTA 2VRCD