5GINE

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ginE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ginE02
3FMKA 5J1VA 4A6EA 5AM6A 3R24A 3P8ZA 2A2AA 4MD7E 5TO8A 1W0XC 3NUUA 2VTJA 1WBNA 5KZ0A 4IDTA 5CUQA 4KBKA 5AUWA 1UWHA 4ASEA 3NDJA 3OBJA 3EVFA 4QT1A 3CLYA 3UPXA 1QMZA 2IZRA 2P2IA 4V04A 2OLCA 3GCZA 3OXZA 4Y30A 4O0WA 3OWLA 4GQBA 4KW7A 4FSTA 4ORKA 1D2GA 1SYKA 4FZ6A 5EI8A 4E2WA 4QNAA 4MQ4A 2C68A 5LWMA 2WOTA 4M0YA 4Q5HA 2QOFA 3ZRLA 4OTGA 3HP2A 4AW0A 4F9AA 3CQUA 3EH9A 4GT5A 3QQKA 2LAVA 1G8SA 3F5GA 4HYSA 3ALNA 4IB3A 1XH8A 2YR0A 2ITZA 5ERGB 3DV3A 4I5PA 4E7WA 2FA2A 4RTRA 3HA3A 4FI1A 3COHA 2V7AA 5A54A 2AZTA 4O0UA 4FKLA 3QWJA 3DAEA 5CTPA 4HVHA 2AC5A 1JSUA 2W1HA 4BGQA 5KX8A 4QMTA 4GCJA 4QQJA 2R3GA 3LJ1A 1DUSA 4MAOA 5FULA 5F2OA 2GS7A 3OU7A 1WVWA 2Q0NA 3G90X 5IQGA 1SG9A 5B0XA 4RZVA 3RKBA 2O05A 3BYSA 5DTRA 5ANGA 2P40A 2ZAZA 4J52A 2F9GA 1QANA 3ZLYA 4FIJA 3OCJA 4EHZA 3LCTA 1EJ6A 5DR9A 4XJ0A 3O8TA 5GHVA 2VNYA 1O54A 4KVZA 2BAKA 2ADMA 3Q2JA 1JLUE 4R7IA 3OF0A 4GC9A 5HX8A 4G1WA 5BQ0A 1IRKA 2JDRA 4HRAA 3OW3A 2PVKA 5CVGA 3HUCA 4DN5A 2G2FA 3NYNA 2J6MA 2OZAB 2VAGA 5AAFA 2FK8A 1V0PA 3D2LA 2QHNA 4KRCA 3OZ6A 4FICA 2P55A 2ZULA 1D2CA 3QD3A 1H1PA 5EGSA 1XDUA 3ZLXA 4ZMFA 1REJA 3LCKA 4AZWA 1WVYA 2YIYA 5LOHA 4TYGA 3GC8A 3NNVA 5HIEA 5HNBA 4DBXA 5DR2A 3QGYA 5DRYA 5LVPA 1JTEA 1QYRA 4FV8A 2XA4A 2QY6A 3EMGA 2HW6A 4LUEA 4KIPA 3ORNA 3B3FA 3DBEA 4ANBA 1XH5A 2LD4A 2YDIA 3SC1A 3UG2A 5ANKA 5K0BA 4FSUA 2XS0A 3NW7A 3FEGA 4P2KA 4GVAA 5M57A 4UOEA 4ER0A 3CCNA 3WF9A 4FSWA 3DK6A 3U6IA 1OL6A 3ZO1A 1BYGA 4M3QA 1MHTA 4FKOA 3PRFA 3G6HA 2IG7A 2XP2A 3C0HA 3QUEA 1KOBA 3NVMB 2XJ2A 1QAOA 4YGAA 4IV0A 4K2RA 4BIEA 4CFFA 4BLUA 2PX8A 3IONA 3TDVA 3R8MA 2WQNA 2QLQA 1OI9A 1Q99A 1YF3A 5JT2A 5EVJA 3BEGA 3OXIA 3TG1A 4L3LA 3DZQA 3W18A 4ZTQA 1FPUA 3VF9A 1JKLA 4WBOA 3VC4A 4FIFA 3R71A 5KCVA 4PYKA 3LAUA 1FP1D 3VUGA 3C6MA 4FKIA 3E7PA 4X61A 4I5HA 3FUXA 1PF8A 4EC9A 1KPGA 4NKAA 4FKWA 4APPA 3NCGA 5F2KA 2W5AA 3PXRA 3LPBA 2QG7A 4DFBA 2AOUB 3NTVA 4D1XA 3E7OA 2P2HA 5E8JA 3PIXA 1OPJA 2OO8X 4ZLYA 2GPYA 3GCUA 1PKGA 2CDZA 3A2CA 5E8SA 1SZMA 4IV8A 3LQ3A 3DKFA 5FEEA 5LWNA 4GBED 2PE1A 4MNEA 5E8YA 4RQKA 2WMBA 3WIGA 4U5JA 3OHTA 1NA7A 2EFJA 2ZVJA 4QYGA 2BUJA 4UEUA 5IA3A 1AV6A 5ACBC 5HLPA 5CAPA 4J99A 4HYIA 5CSVA 3LXNA 3HMMA 3WSTA 3FMDA 3OTUA 4MKCA 5EC8A 4CKRA 1VYWA 3ZO3A 4ZTSA 5CY3A 5E1EA 2XNGA 3FKOA 5J7HA 1JG1A 3V8TA 4XEYA 3KL8A 1Q8WA 2OF4A 4L45A 5CF8A 1Q5KA 5I9VA 4W4WA 4N0SA 3G6GA 5LQJA 4O84A 4AW1A 3OFKA 4UZHA 3SGCA 2V7EA 5HICA 4ZEGA 4ERKA 1H0VA 4L68A 3KRLA 2HV9A 3FDNA 1N7JA 4BDCA 3ZDIA 3GU6A 2W1DA 3BIZA 3RGFA 3SD0A 2HY0A 1ZOEA 3QTZA 2EJUA 4BKJA 5EIWA 2WTKC 1FJXA 4HH4A 2OK1A 3LFFA 3NUYA 3OY3A 5ANJA 3FYJX 4FTNA 4CFWA 3C1XA 3B7PA 4WA9A 5KBQA 3AGMA 4OTHA 5DPVA 3CPBA 4ZK5A 2ETKA 3C4EA 2YM7A 4EVIA 5FADA 5KUPA 1S9IA 5CALA 3S1HA 3VS6A 4YTIA 1I9GA 4XUEA 5K9IA 5JR3A 3MFTA 2JHAA 4J96A 3TR6A 4X63A 3BUSA 4Y72A 3G89A 3F2RA 4D4SA 3NJRA 3N4VA 4Q9SA 5L8JA 5EMJA 5DA3A 4R6WA 3NWEA 4PTCA 3ZZWA 4OTRA 2ZBQA 1N2XA 3ZZEA 4Q9ZA 4MF1A 4XP2A 3H4JA 1IM8A 3HAVA 5AP7A 1Q3WA 2BDFA 3MTLA 2GNIA 4DGNA 3MIYA 2YXEA 1ZAOA 4L52A 3REOA 3KRJA 2P8JA 2NRYA 4FGBA 3FL5A 3VN9A 2J50A 4ACHA 4HCTA 4CFMA 2Y6MA 5DT3A 4BDAA 3DS6A 3R1NA 1FBNA 5DRDA 4YJNA 3I53A 1CM8A 5HEKA 4G3GA 4RFZA 5BNJA 3O31A 3B2TA 2PVHA 3UPZA 2OJ9A 4Y46A 2QNJA 1IEPA 3EQRA 4MEDA 2GSFA 4TYJA 3F61A 3BHTA 3O7LB 4O0YA 4FTUA 4IVDA 4RWZA 3CEKA 4KAOA 4E20A 3JYAA 3NCZA 1UU3A 1QL6A 4KIQA 3KVXA 4QMLA 1KE8A 3D5VA 3R00A 1A06A 5LQRA 5EM8A 4MBJA 3HM2A 4EOPA 1R6AA 3LXPA 2YM4A 3IW7A 1YZ3A 3WILA 2EB3A 4GEOA 3QC4A 4K33A 4C34A 2BDJA 3UNJA 4FKQA 2PZYA 4MD9E 1H26A 1YHWA 4Z55A 2ORED 3SMQA 5AV4A 4IE9A 3RM7A 4ID7A 2H00A 5J9LA 5F94A 2E2BA 4EWQA 2UUEA 5AUVA 4BTFA 5HIMA 4HGSA 3DQWA 4UWCA 4R6VA 3GRRA 3PWYA 2WAJA 4PWNA 1MRUA 4R1VA 3UZRA 1QAMA 5HG9A 2GTNA 2B52A 5HIIA 2CLXA 1JNKA 3UQGA 4C37A 3VSEA 4YTCA 2CKQA 2VNWA 3S0OA 5FGKA 1NW8A 3M6VA 2PJDA 1CTPE 3GP0A 5IA2A 2B9EA 4GF5A 3VS5A 5CD1A 4Z9LA 3QQUA 4WT6A 4EMSA 2CHLA 3CR0A 3MJ2A 4BCHA 2UZDA 4PINA 4CT1A 4OBQA 1XXLA 5K5NA 1NW7A 4AGCA 3UOJA 4RC4A 2P3LA 3I1AA 5B1SA 4EOLA 5DG5A 3CGFA 2PZPA 4YNEA 2JEDA 4IADA 3BQCA 4CT2A 4YLJA 2OYRA 5D12A 5DX1A 1XH6A 2YM5A 3RW9A 5BVWA 3T3UA 1NV8A 3IGGA 3QX2A 3BHHA 3UFBA 1H24A 2XK7A 4ZIMA 3TI1A 5JFXA 1GIIA 4AQCA 5JGAA 3BPRA 1OL7A 2RGPA 4ZJJA 1Q8ZA 5IQIA 2OBJA 4XS2A 3A27A 3UYSA 4IBMA 3QQGA 1KYZA 2CN5A 5I4NA 3WIKA 3V5TA 1NW6A 3FTCA 3GC0A 5D1HA 2OIQA 1SVHA 4B9DA 4E26A 3F3ZA 3CJQA 1J91A 4P5ZA 3TZ7A 4U80A 3THBA 3HAMA 3DXYA 5K05A 4C38A 4DG0E 2QHMA 2J5FA 3FUUA 5K8VA 4N4SA 3TV7A 2IVTA 4IAIA 4X60A 2PWYA 2Y4IB 4CKCA 8MHTA 1O9UA 3HRBA 3R6TA 3VS7A 2W4OA 5K0CA 5K0EA 1ZHFA 4ANQA 3H9RA 4EORA 5AAGA 3LQ8A 3UJ8A 1YOMA 2GHLA 1MUOA 1RJFA 3GNLA 4GT3A 2ZV7A 4M68A 4UBAA 5A3XA 2I6GA 4D1ZA 2X39A 3EL8A 5EW8A 3F2AA 1XO2B 3SA0A 2I0EA 5M53A 1G55A 2BALA 2UVXA 4A4XA 4TRLA 3KR2A 3HCAA 3M6UA 2QQ7A 2UW8A 3OTVA 4XG4A 4E70A 3BGZA 4RWKA 5BUJA 4ITHA 2W5BA 3MAGA 5CIYA 4RTSA 2HW7A 3CJGA 3D2IA 5CEOA 3POOA 2CKPA 4LWPA 5HZMA 4AOIA 2JIVA 4EOMA 3CJRA 2CGWA 3MVHA 3S2PA 4CRSA 3TNWA 4FKJA 4XRJA 5HO8A 4ZSLA 3GNIB 4L7FA 2C4GA 2GNHA 4HZSA 2GPHA 5EI2A 3UVQA 5GINE 3MESA 3H3CA 2QO2A 4GUBA 5EM7A 4TY1A 4OQDA 5CLPA 3F82A 4M37A 1FMKA 5DEYA 4F1OA 2A14A 4QTAA 3ME5A 3QCQA 5CX9A 2BPMA 3LM5A 3JR1A 4OTIA 2JFLA 3FTFA 4MQ1A 4EUUA 4P7FA 4NTSA 4EI4A 3QKLA 3KGAA 3QAME 4QPAA 2J2IB 5DIAA 2DS1A 3TDWA 5FWDA 2QYOA 4P58A 4FG7A 3OOMA 4QDJA 3CJFA 4BZOA 1YUBA 3GUBA 3OD6X 3E93A 3FLWA 4GW8A 2O57A 4PONA 5F2NA 5C1QB 4E6QA 5FTOA 3H30A 4YPDA 5AP1A 4BZNA 3EN6A 5DWRA 4FEWA 3F5PA 4JG8A 2ZBPA 4E5WA 2J0MB 3TQSA 5HBHA 1PXLA 3CC6A 4U3YA 4GL9A 3PT9A 4U45A 4R3RA 2OXDA 1OKYA 2JC6A 5D10A 5KMJA 4FUXA 1QAQA 4K0YA 3UE4A 4PF4A 2NP6A 3R9NA 3R02A 2C6LA 3V6SA 4DQ0A 4Y73A 4CXMA 2R7BA 3BT7A 1NKVA 3M11A 1E1VA 4E4MA 5KMIA 3O7LD 2HMYB 5HU9A 1KUTA 3GO4A 1R8YA 2QU5A 4AFEA 5KMNA 5ICCA 3MPTA 3PPJA 1V39A 2VN9A 3NW9A 4H36A 3JWIA 4MXXA 3KB7A 2W1FA 4GS6A 2Z02A 4GEKA 4CFXA 4DFYA 3AC1A 1M0EA 5HIBA 4XOZA 3ODYX 5IH5A 2WHBA 3NW5A 4NSTA 4OTFA 4FKTA 3GIWA 3TPZA 4KABA 3VHEA 5K0NA 4USFA 4LV5A 4YSMA 2CCIA 2CKEA 2YX1A 4IB1A 4QYYA 3PPZA 4TWNA 3EZVA 3R1SA 4X21A 3UYTA 3W33A 1KV1A 3EQPA 3NNXA 2XKCA 4JQ7A 5FM2A 4QPPA 1OIQA 4U40A 4FTOA 3F9NA 4XX9A 1YDRE 3ER8A 4WVLA 3FUWA 3R01A 2R9SA 5E8UA 1P5EA 2ZWVA 4JAIA 3E5AA 5M06A 4O6EA 4ENXA 3OFMA 3ACJA 5GIPE 2C5NA 1IA8A 3PG1A 4KUJA 1KE6A 5EYCA 5EDRA 3MVJA 3KR0A 3GJYA 4O0TA 1R0EA 2CL5A 4MXOA 3FI3A 4G2FA 3F5UA 2AVNA 5G02A 3T9IA 3QYWA 5FP5A 4O6LA 5IQEA 2XIXA 2OJIA 4I0TA 1BL6A 3IEIA 5IDPA 5KMKA 4XCUA 3Q9YA 5L2TA 3EQIA 3D5XA 1QPDA 2XYVA 3BKBA 5E8TA 4PIPA 4MYGA 5G6VA 4GRBA 3SX9A 3FPEA 4FTRA 2JDVA 4NCTA 4JRNA 3AT3A 3MB7A 3FMHA 4EC8A 2X8IA 3U9CA 4OBXA 4FZ7A 4FSYA 1YW2A 3LCUA 4RTQA 4CGAA 2NP8A 2RFSA 4IB0A 4IVBA 4MXAA 5IEXA 2W0JA 3FPFA 2XNEA 4AA5A 5E2BA 4DEDA 4EK5A 4I5MA 1XBAA 4M12A 4CKEA 3EVBA 4S34A 3TCPA 1CKIA 3LM0A 2JHPA 2VTPA 3QHWA 4JRVA 2CNQA 5FDXA 3R7VA 2YJSA 5I5ZA 2R3RA 4MWHA 3LE6A 4M36A 2XB7A 4BZDA 2OGVA 2QO9A 3VF8A 2GB4A 1RJDA 3NDIA 2VP3A 3DNDA 3LLTA 3ANQA 4LG1A 4L6QA 3L8VA 2IH5A 1TVOA 4FV6A 4K6MA 2Z7RA 3I0OA 3THSA 3TUBA 3TRKA 4FSQA 4C62A 3W16A 4FKSA 4M0ZA 1GZ8A 5HCXA 3E8SA 4EK4A 2UW3A 4X2FA 4FVRA 2R3FA 2XYUA 2WMQA 3W2SA 1AGWA 4FTIA 4G3FA 1Q4LA 3LQ5A 5CF5A 3MYGA 3BLQA 3ZLWA 4DFZE 3NAYA 2PVNA 2ITXA 4IX6A 3BBWA 5HI2A 1YWNA 3TLJA 3K3IA 4MVFA 2EU9A 5IISA 4ANSA 1YWVA 1MP8A 4BC6A 3MGYA 3FXXA 5CNOA 5DEWA 4H1MA 4CFUA 4AFJA 3VRZA 1W7HA 3C5UA 2R3LA 4BRXA 5FXSA 2OSCA 4F64A 3PTAA 5TF9A 1J1CA 3CS9A 3GGFA 3BZBA 3MY0A 2OIBA 2B9HA 4MQ2A 4AX8A 4O0RA 4R8RA 4G3DA 3GT8A 5KBRA 2BTRA 3TJDA 4KS7A 4FBXA 4QTDA 3Q5IA 2XF0A 4U97A 4JR7A 3CP9A 4YHFA 3BU6A 4XG7A 1NBHA 2VO3A 2IW6A 5IF1A 1G38A 4QTBA 2G8NA 4RJ8A 3KQVA 4M15A 1RJGA 1X1BA 4J7BA 4RLKA 2YCSA 1L1EA 5D11A 5LARA 3ELYA 4HNFA 4KWPA 1CSNA 2VX3A 3ORPA 4S32A 2PXXA 4Z7GA 4YNOA 4ER5A 4RC2A 3UMXA 3NYVA 3S68A 3ORZA 2VUWA 2OKCA 1H1QA 2GA9A 3MCTA 2WTDA 4F9CA 3GOPA 3X0DA 2QOBA 3EHAA 2PX4A 5DTMA 4F85A 5LCKA 1XTPA 4PUZA 5GOZA 4XRLA 5E9QA 4FEQA 1W82A 1MRVA 3DNEA 4PMMA 4CRLA 2QO7A 5JK3A 4C05A 2YFXA 4NYEA 2A0CX 3PFHA 4JL9A 3EPPA 4BP1A 5ICEA 5BYZA 4FOBA 2XIRA 5ETFA 3PZEA 3R7EA 3O71A 5IH3A 4QPNA 2C5YA 3NRMA 4MWIA 2PK9A 5D7AA 3ZEPA 4A4LA 4NT4A 2ESRA 4G6OA 4M38A 4UY9A 4FT2A 2F4JA 2VRXA 5C4KA 2GNLA 3D94A 4KA3A 3BWFA 1V0OA 4FVQA 1T45A 3T7SA 4JIKA 3NW6A 2N47A 1FGKA 2R3SA 4E31A 3G0FA 1W84A 4P5QA 5A4TA 5C9ZA 3EQGA 5TOZA 3VBQA 5DE2A 4JIAA 3P2IA 3HVKA 1LP4A 5AP5A 3M6WA 3HCBA 3M42A 4XUFA 4AWIA 3F3WA 4EYMA 4WRGA 1W98A 5HG5A 4J98A 2C3LA 2O2UA 3AC3A 2ONZA 3PA3A 4HSGA 5C8KA 5I9XA 1OUKA 3VQHA 4QYEA 4MTAA 3O7WA 3ERCA 2CLQA 4EHVA 4PMTA 4H3QA 5CAOA 4G6LA 4YURA 3KF7A 4FT9A 4K77A 3G15A 5DWQA 4NW6A 5E1BA 4DH5A 2HZIA 3KQPA 5A46A 4FVPA 3D15A 3U4UA 1OKWA 2F7EE 5HTCA 4GU9A 3UC3A 3BU5A 3D2KA 3ZDUA 1KPHA 2JHCA 3C5IA 3PVWA 3SXRA 2YABA 2F57A 1YRPA 2BH2A 3C9WA 4Y95A 4FA2A 5AA9A 4JT3A 2X9FA 4GFOA 4C33A 3FKNA 2I7CA 4TPTA 4F9YA 4J8NA 3RP9A 1PXKA 2P3QA 4BBMA 4RVFA 3ORMA 3ZXTA 5KKRC 1B6CB 4NZWB 4FTAA 3DUWA 5HU3A 4BCQA 4C04A 3NYOA 3HNGA 4QMVA 5HOQA 3DK7A 3QWKA 2ZWAA 1U59A 2X6EA 1ZYDA 2HZNA 4X2NA 3HP5A 3FHIA 1NE2A 4E6CA 3TNHA 1VQ1A 5EW9A 3M6XA 3DK3A 3P08A 1UKIA 4YC6A 5KZIA 2UZBA 2ZVAA 3IOPA 5EOBA 3ZC5A 4PYIA 3KXGA 5ETIA 3WI6A 4UWBA 5C1IA 5JEBA 3I58A 1B42A 2FVDA 4RIWA 1KXZA 5IUGA 3WYYA 3FV8A 1YHSA 4FL2A 3VUKA 3R7YA 3AXTA 5GJDA 3BHVA 3QTSA 4FSZA 2WU7A 3FQHA 1WMKA 2BVAA 2JKOA 3ZHPC 3EN4A 2IDJA 1WS6A 4FT0A 4F0FA 2KTYA 1ZY4A 5K3YA 3I81A 3G5TA 4FV4A 4E6AA 2PE2A 4L7SA 3HLLA 5HTBA 4GG7A 2YXLA 1KSWA 3HYHA 2YDKA 2PY6A 1GAGA 2C5XA 4F1MA 3OP5A 1Y91A 4FTJA 3LJ0A 3FWQA 4BICA 4QMPA 2IZSA 4GFMA 5IKMA 5DTQA 4ASZA 2ZV2A 3WZEA 2OFUA 5K09A 3E92A 5EDQA 3C7QA 3NWWA 3B5IA 3LFEA 5L8LA 1INLA 3K5VA 2XBMA 4R5SA 3UA4A 4K18A 3CBGA 5HQ0A 3NUAA 3QGWA 4IZ5A 3A99A 4KIGA 3P9IA 1XDZA 3PXKA 3GCSA 4EK3A 3I5UA 2C6DA 5AUZA 4HGEA 4BCOA 5AMNA 5DN3A 4DA4A 2YCRA 3R9RA 5I9ZA 3NYXA 2X2MA 5B7VA 3P7CA 2JG3A 2WFYA 2YQZA 2VS1A 3R6XA 5CNNA 2PMLX 1YKRA 3LFCA 4S30A 4JXJA 1WBTA 1Q8UA 2CMGA 1Q8YA 1YXVA 3QOWA 2Z7LA 5IQDA 2JD5A 1XCJA 4BI0A 3D5UA 3DB6A 2ZV9A 5FTGA 4PMSA 2WK1A 4FKUA 2C3JA 3GEQA 4OTQA 2OXYA 2QOLA 5KQRA 2YITA 4QP8A 4N6ZA 4EBWA 2AR0A 3CQEA 2VTTA 4Q2AA 3V8SA 3ITZA 5LQUA 5JGBA 4HCUA 5AV3A 3HNRA 2WMAA 4L43A 3EVDA 4PYOA 2ZZMA 2P7IA 2GMXA 3SHEA 4Z3VA 1H1DA 4LUDA 3GRVA 3QLGA 3ZYAA 4EH6A 5HNGA 3N4TA 4WNMA 2W1EA 4RVDA 3RIEA 3RVGA 3GC9A 3QXOA 4YJQA 3RWQA 2UYOA 3BBTB 4IAKA 3SX0A 5JQ8A 5KNJA 4KDRA 4P7JA 1PMUA 2R2PA 3G33A 3MY1A 4CLIA 4NIFB 3AMAA 4E73A 4PTEA 3GXOA 2C0OA 1Y8CA 4X3FC 3B89A 4BDKA 5CVFA 4BHNA 3VS1A 5HESA 4B8LA 4R3CA 2NO3A 2QR8A 4BTJA 2WEVA 2R5TA 4FG9A 3NNWA 4AZSA 2QD9A 3NAXA 3R22A 4I1ZA 1YOLA 3ZTXA 3SGLA 4QO9A 5C26A 4B0GA 2J90A 2KW5A 5C03A 1R78A 5CF4A 3MCZA 2XEYA 4IAFA 3V04A 5DX8A 3MWUA 3OCSA 3M33A 4HJOA 3DH0A 4ZS0A 3LL7A 1JWHA 3MHTA 3IW4A 1R3CA 3O23A 3TN8A 2UYQA 2WXVA 2PVCA 3DJ5A 4B4LA 5CZHA 5CWZA 5HVKA 2X8EA 4PIMA 3DXQA 4ACMA 5L2SA 3V51A 5CQUA 1FOTA 3OZTA 3R9XB 4XYFA 4CCUA 1RJEA 2RG5A 4IEBA 1H00A 5H8GA 3VW6A 1GJOA 3ATSA 3AT2A 2IPXA 5M09A 4YBKA 4U79A 3AWIA 1YZHA 1OIUA 3HA8A 5E7RA 3P9NA 3PE1A 5M56A 3SXSA 1OZ1A 4TYIA 2R0IA 3EZRA 4XUDA 3VAPA 4H3BA 4BBFA 4RT7A 4EZ3A 1Z9XA 2YN8A 3G2PA 4AZVA 4AA0A 1NW1A 3A8WA 3UIUA 5LR6A 4XUCA 2ZM4A 3RMFA 5EYDA 5C01A 2XK4A 5I9UA 2R6ZA 5DFPA 2W9ZB 4LRJA 5KS2A 5DVRA 4FC0A 3QZHA 4D0WA 4DCAA 1FPQA 4FOCA 1Y6AA 5EZSA 1YB2A 3P23A 1NVRA 4O7YA 3FYCA 4BR3A 2C5OA 4X1OA 1JQEA 2CGVA 4BB4A 4C3PA 4OBOA 4P7GA 3UNZA 2ZYBA 1RE8A 2J0KA 3T9TA 1E9HA 3PP1A 4YSJA 5T3QA 3FLZA 2PUIA 4MBIA 5HE0A 3W1FA 1YOJA 3JVRA 3WF5A 2VO6A 4U42A 1WAKA 2NXJA 3FI4A 3NVKI 4PYQA 2C6KA 4YU2A 1E1XA 5FXRA 3GGDA 3OUNB 3R30A 2WZJA 2PVJA 3MH0A 5I9YA 2BM9A 4O2PA 3EKKA 3R21A 4I6BA 2C7OA 2QOOA 5AUXA 1PXNA 5K01A 1JTFA 3C50A 4FV9A 4NM5A 3GDHA 3ZC6A 3A7JA 3MIAA 5CSXA 5A4LA 3DGKA 2CWWA 3LKZA 4W8DA 3NNUA 4XG6A 3LX6A 4UV0A 4RRVA 3JVSA 10MHA 1X8BA 4R05A 3KRXA 3QZGA 4M97A 2VWZA 1ERKA 5K4JA 4JVGA 3VUIA 2ZM1A 1KOAA 4CMUA 3OW4A 1U5RA 2C3IB 3KK9A 3R83A 3VIDA 2H96A 3KQMA 1ZQ9A 4FNXA 4AN3A 2R3KA 1U54A 3A26A 1XBCA 4DH1A 3G9LX 5GNKA 3JWJA 3NZ0A 5GWXA 5J87A 3BYVA 2HXLA 4CSVA 4YJSA 2HENA 4KRDA 3CTQA 5EQEA 3KY2A 5JGDA 3O2MA 2UVZA 3UP7A 3DKCA 2UYHA 4RX5A 3PWDA 4LOOA 4DZRA 4YP8A 3OZRA 4XCXA 4E4NA 1RW8A 2NNWB 4BI2A 5ANDA 3EQCA 4KNBA 4WUAA 3DA6A 5CVHA 3WZUA 4C4AA 4RTKA 3LW0A 3AMYA 4F99A 3V5JA 4ZLOA 3K6RA 5E8WA 3KXHA 3JS2A 4IB5A 1GY3A 2GLUA 3OEZA 4FTKA 3UG1A 3SG9A 3QD4A 1XWSA 5JZJA 4MCVA 3R73A 3A4OX 4DMGA 4IWDA 4RGJA 5IEVA 2UZLA 4QRCA 4BDHA 3OXTA 3E05A 4ZTNA 3A61A 2WO6A 3KPVA 3OEFX 5CI6A 2AUHA 2X0GA 4HOKA 3N9XA 3MY5A 4FNZA 2PZRA 1ZGJA 2JKKA 5DRBA 1F38A 4ITIA 3OG7A 3DBFA 4D4YA 4ZTMA 4I23A 3EYHA 2WTWA 2ZIFA 3PY1A 4X6QC 2EUFB 5LCJA 3KULB 2DULA 4LMNA 3U9NA 2I40A 3A4TA 5DLYA 2B9JA 1UNGA 4D28A 3LKDA 3HV6A 1XDSA 3ORHA 3G8BA 3ZFYA 2J0IA 2BR5A 2PXAA 5AP6A 4GUAA 4C4JA 3T7TA 3ID6C 3KU1A 4E1ZA 4C06A 4EHGA 2ZMCA 3CC8A 2BR3A 3ORLA 4C4IA 1ZZ2A 4KWCA 3FSFA 2FCAA 3MVLA 2WELA 3PXYA 3ZUUA 4YUYA 2BRMA 1JSXA 2YJRA 3LFSA 2PBFA 1BMKA 5DHJA 3ALOA 3I6UA 3IV6A 4EH9A 1ZOGA 4F08A 3MA3A 2RIOA 3DLIA 5HZNA 3Q60A 5KQSA 2B7AA 2V62A 3A4PA 2ONYA 4HPTE 4L8MA 1REKA 4UWYA 1CKJA 3ATTA 5LXMA 4EZ7A 3N4UA 4YMHA 4EOKA 1B39A 3IYLW 2FSOX 1ZOHA 1NW3A 3PIYA 3CGOA 9MHTA 4W4XA 2FK7A 2PY3A 4TZRA 3LCSA 5H02A 5IDNA 4F1TA 2ITUA 2VTQA 1L3CA 2YIQA 3D14A 4O7NA 1U5QA 5K0FA 4I24A 3UIBA 4BDEA 4YJVA 3LDGA 4HG2A 2A1AB 5G1XA 1NVQA 4QQNA 4IC7A 1QCFA 4R1YA 3Q4UA 4CVAA 1NVSA 4QP3A 3I7BA 5F20A 3KPJA 3FI2A 3HV5A 3HEMA 5CU3A 2ZDTA 3NPCA 3DBDA 4CZTA 5HO7A 2PMOX 4D2SA 2B25A 1KR5A 3H10A 2W4JA 1XH7A 2V5QA 2OKRA 3EOCA 5HG7A 3EIDA 2W4KA 3DY7A 2UYCA 4N70A 3OT3A 4C4EA 3DKGA 1ZXEA 2G15A 2ONLC 2JDSA 3I7CA 4YUZA 1F5QA 3HL7A 4FV2A 4RJ3A 2G1PA 4G9RA 4J1RA 3DJ7A 4AUKA 4XG8A 4WG5A 4ASDA 4YUQA 2HWPA 4IAAA 4QMWA 1V0BA 5FBNC 1Z5MA 3DFCB 3UIXA 4YC8A 3DXNA 5LVMA 4BF2A 4G5JA 4YTFA 1N7IA 3RK7A 2O06A 3A7IA 3TWJA 5EQJB 5FQNA 5IUIA 5A14A 2V7OA 4YUWA 2O63A 3DMGA 5C9CA 4QYFA 3QA0A 5IQFA 4LGHA 3PB3A 1WBVA 4FL1A 2GNFA 4IACA 5EHGA 4RJ7A 3QUPA 5J95A 3BXOA 2CNUA 1TQPA 3WE4A 4V01A 3NIEA 4UXLA 3TZ8A 3QC9A 2BIYA 4BCJA 4FODA 1M6EX 3FQSA 3R04A 2IVVA 3HGKA 5M4IA 4FV7A 2XH5A 5DM4A 5EEHA 2VWBA 3R28A 2VGOA 4HGYA 4OUCA 2OZOA 3DT1A 4AN2A 1JSZA 3IQ7A 1D2HA 5F9EA 3ZONA 1X1CA 4XG2A 4IJPA 2H1RA 4ERWA 3Q4CA 3QTIA 3LXKA 4USDA 3HZTA 3KXMA 4JDJA 5EH0A 3PPKA 4BYIA 2X7GA 4FV3A 4L01A 3CGGA 4EH7A 2OZVA 3C0KA 3PX3A 2FYSA 1ORIA 5KVAA 3IO7A 5DGZA 3Q9XA 5DI1A 1KPIA 4KDCA 4RC3A 3KMMA 1ZYSA 3QF9A 3HTXA 2PSQA 5TKDA 3FUPA 4CG8A 4EQMA 4LOQA 4EH8A 5BPYA 3S3IA 4PNIA 5LVOA 1VPTA 2NXCA 2R3QA 2UZVA 4U6RA 4APCA 1HOWA 4DKJA 3TKYA 4A4OA 3EJ1A 4BGHA 3V6RA 4I22A 3UJ9A 5EZQA 2WTJA 4GC5A 5KMLA 3Q87B 4BDIA 3DBQA 4IWQA 2HNKA 2RFDA 5JUWA 1EIZA 3BWBA 4MD8E 5DSXA 2RFEA 3W8LA 5CSHA 3O4FA 3NIZA 2GS2A 1YDSE 3AQVA 1Y8GA 4BCMA 4E5BA 3R8UA 3P9KA 5CSWA 3COIA 2F8LA 4M8TA 3PS9A 2JBOA 3ZUVA 2ITVA 2PTKA 2Z6QA 1I1NA 3FE3A 1YI4A 3F7ZA 3TKAA 4ZS4A 4A06A 3U4WA 4IX5A 4IMYA 4EH3A 2C7PA 5HILA 4EQCA 2VD5A 3IG7A 4PDYA 1XVAA 3KMUA 1Q3DA 1EG2A 2R64A 4AS0A 3DMFA 2DPMA 2W1CA 2ZV8A 1UNHA 3TT0A 4EH5A 4Y5QA 4F86A 4AT4A 2BMCA 2HK5A 4YR8A 5HD4A 1UNLA 2ZBRA 5H2UA 2BZGA 3PJCA 2QCSA 4IWNA 4QYHA 2WGJA 4QPSA 1U2ZA 3BYOA 2HAKA 2P33A 5CM2Z 2UZTA 4FV0A 3A7FA 5F1ZA 5DOSA 3W55A 5CEKA 2P41A 2IJMA 4RVKA 4ALWA 3GI3A 3CY3A 1OR8A 3O8PA 5K0LA 1FQ1B 4EQUA 3HEGA 4JX3A 2IO6A 4RWLA 1J7UA 4FK3A 4WG3A 5KE0A 2OI4X 3MA6A 1K2PA 4O27B 1P1BA 3PFQA 5K03A 3IW5A 4RX7A 4IX3A 4HZRA 3REPA 4XV1A 4IC8A 5BMMA 4LI5A 4AGDA 3S00A 5BUIA 3I79A 3FQEA 4HVIA 4PV0A 4XBUA 1PXJA 2UW6A 4U81A 1ZY5A 3FBVA 4JG7A 1M7QA 1H0WA 5CS6A 4MWZA 5HEZA 5DT2A 3FSKA 3OU2A 3KFAA 2XJ1A 3OROA 5FLFA 3SRVB 4AZEA 4DFXE 1SUIA 3UO5A 3P2EA 4HNIA 4KBCA 5HE1A 5CXZA 4U7TB 2XKDA 3I5ZA 1U4DA 3GRZA 3EWHA 3KXNA 3ZO4A 3RAHA 3QHRA 3BX5A 2V74B 4AACA 2OZAA 4G3EA 3R9OA 4BVUA 2VX0A 3PFGA 1SNXA 4RSRA 2OH4A 5F4NA 4TWCA 4H1JA 2FSMX 4E6DA 2XNNA 3FC1X 3K2LA 1CKPA 3DPKA 3H0ZA 2I6LA 3V5QA 3KR9A 5L8KA 2QC6A 3GU5A 2BDWA 2OFVA 1O9HA 4LM5A 4WNPA 3PYYA 4NL0A 2W1IA 2QVSE 2WU6A 4ZSGA 3CY2A 4XLVA 3EVZA 4NFNA 4IVCA 2PMIA 4DF3A 1APME 3RPVA 2WMTA 3ET7A 2I0HA 4YJUA 2B2CA 5MHTA 5IPJA 4X41A 4XLIA 3DDQA 3G2OA 4ZXTA 1WXWA 4NFMA 4XG3A 1MJFA 5IA4A 3F5XA 2UW5A 2UW7A 4D5HA 2R3JA 3F7WA 4HCVA 4XNEA 5EKXA 3PA5A 4PNEA 5EW3A 1P4OA 1SKMA 5ETCA 3HA5A 2HWKA 5LQKA 3LFBA 1RQQA 2OO3A 4HW7A 1F0QA 2E9VA 2VWYA 3IW6A 3MS9A 3GU7A 3VQUA 2G1TA 4FT5A 4WBBB 3A25A 1Q8TA 2IW9A 2P4IA 3HVJA 3LZBA 3O0GA 5A9UA 4O0SA 2YERA 2XK3A 1ZMWA 3SM3A 1OPKA 4Z7HA 5TR6A 3TNPC 4Y85A 1ZYCA 3ZCLA 4LECA 2PVFA 3IDBA 3OY1A 2E5WA 3CSVA 4I5CA 4EOQA 2VWUA 2BHEA 2GCDA 5DXAA 4YHJA 2JITA 4K9YA 1JKKA 2ITWA 2OIDA 3EQDA 4O7RA 4ALVA 2VO7A 2XNMA 5GM2A 3KXXA 3UJ6A 3K54A 5HHWA 2WTKB 4CEGA 3BI6A 4U43A 3ZS5A 3UJBA 1FVTA 3A8XA 2AOUA 2QOQA 2ZMDA 5M44A 4E4LA 3EEOA 1JKTA 3EVCA 4J95A 1UWVA 5FHRA 4C36A 1U46A 4BLWA 4O83A 3G5DA 2BR4A 2G2IA 2IW8A 2E9UA 2X7OA 3R63A 3W32A 2QRVA 4YC3A 2C0IA 4FE2A 3ZH8A 3E63A 1AQJA 3LXLA 5BVEA 4IVAA 2FSLX 5JQ5A 3TIZA 2I0VA 5E8ZA 1QPEA 4LFIA 2XEZA 5JSMA 4UALA 2C6EA 3EGEA 3ZM9A 3Q96A 3LDFA 5K5XA 4YZCA 1BKXA 2J5EA 4QMMA 3HUBA 2NPQA 3RAWA 5IQCA 4GIHA 3EFKA 4RBLA 5CVJA 3RPRA 3WF8A 4EKLA 3TM4A 3FYDA 1ZYJA 4W8EA 5E9JA 1Y6BA 4DCMA 2B53A 5CAQA 4ZY6A 1PYXA 5D9HA 5K0JA 2O5KA 2WQOA 3GBZA 3KQ7A 1WXXA 4RA5A 2WTIA 2GS6A 3RI1A 4A9UA 3O17A 2XCHA 4KB8A 2IFTA 3FRHA 4PL5A 4X2GA 3TACA 5IA1A 2JH9A 3L8DA 2PGXA 2YCQA 4B8MA 2OBFA 2VDUE 2EB2A 4JQ8A 1Q0SA 4O7LA 1SQGA 4JBOA 2W1ZA 4YLLA 2VWIA 3QCSA 1AQ1A 4C4FA 4F63A 4IFCA 3MH1A 5DPMA 3LJ2A 3E8CA 2XM9A 3D7TA 5ANEA 3DXXA 1PRYA 3AGLA 2WA2A 2ESMA 4AA4A 4GMYA 4FV1A 5EKUA 3E8EA 3MVMA 2WMXA 4O7VA 3MGGA 3KVWA 5EM5A 2KULA 2G70A 3AXWA 5T68A 3RPSA 2UZUE 3LCDA 4RX9A 4F09A 2P1DA 2X81A 3DZOA 2AN4A 1MQ4A 4XOYA 5FQDC 5I0BA 2Y6OA 2BM8A 2FB8A 4I6QA 1PMEA 2ETRA 3FMLA 4YO4A 3MDYA 4D1SA 3OE4A 4CFNA 4OW8A 4QMYA 2P0CA 3QQFA 2GNGA 2VTRA 2F2CB 3B2WA 2BROA 4NWMA 1H07A 4LYNA 5M07A 2VTSA 3B3JA 3VC1A 3CTJA 3L9PA 2X1NA 3Q04A 2JJQA 3D0EA 2QE6A 3KXZA 3W10A 4XH6A 5AIRA 4D58A 5LMKA 4YJPA 3UIMA 4S33A 2PZIA 3ZRKA 5E91A 2BILB 4RVLA 3GVUA 2E9NA 3DP7A 2W1GA 4QQCA 3PP0A 4WXHA 3COKA 4IW0A 3FLNC 3GWZA 3QCXA 5K4IA 3UBTA 3R8LA 3KHKA 1OIYA 2BCJA 4QTTB 3PZHA 3S4QA 3SSMA 4H0NA 2YEXA 4GOLD 1NY3A 4C3RA 3MTEA 3PLAE 4AW5A 4V0GB 3LOKA 2CCHA 3ULZA 1XR1A 1UFKA 4OX9Y 4IQ6A 1P39A 4O7WA 1AQIA 4E33A 1MRYA 3LBYA 3V97A 4FIGA 1JVPP 2ZLBA 1STCE 5CU0A 2XUUA 1I09A 5AX3A 3PX2A 4AOTA 1GZOA 5IU2A 2WPAA 4PYNA 3QLFA 1PXIA 1BLXA 3MFSA 2VTLA 5CT0A 1YXXA 4O29A 2QLUA 3SKCA 3A62A 1XCLA 3BE2A 5IEYA 2NXEA 4NU1A 4AGWA 3TUCA 3DAJA 3Q6WA 1H4LA 1I44A 2YWVA 3GQLA 4BCFA 2YXDA 4TTHB 1WVXA 4TYHB 3RTPA 1TW3A 1FINA 3R3HA 3L8SA 3L9NA 3C4CA 1R1WA 3QKMA 2HCKA 2EXCX 2IGTA 4GYIA 1OVEA 5AWMA 2OJFE 3DFAA 2HTEA 5AUYA 4UN0C 4FKGA 4DE4A 3HA7A 3HVCA 2GHGA 3RINA 4RIXB 1GIHA 4DTAA 4ACGA 1L8TA 2O0LA 2X2LA 2CN8A 3LFNA 1TQIA 4JOAA 2BHHA 2ZZNA 4OTWA 3C51A 2X7FA 3JY0A 3BGDA 4QP2A 3OOGA 1OB3A 3SQQA 5ETAA 4E2XA 3Q2MA 5E1DA 2SRCA 4D5KA 3KKVA 4HPUE 2AYPA 1ORHA 3DXPA 3EFWA 5C27A 3QBNA 4FSRA 3GU3A 4CTBA 4II5A 4YZDA 1OL5A 3KN6A 4EKKA 3HCFA 2R3MA 3CTHA 5M5BA 3I5NA 3EEYA 4FSXA 3ELDA 1XHAA 4F7NA 4JAJA 1JAMA 4R5YA 1PXOA 3C4XA 5ANOA 2XMYA 4ZSAA 4GKIA 4YUVA 3K0BA 3MSSA 2XVAA 5LQCA 3ZU7A 4FSDA 2BRGA 5L3AA 3PJ1A 3FY0A 1DI8A 2WTVA 4O81A 4PNKA 2OH0E 1H28A 5DRTA 4ZSEA 2FHPA 2EXMA 4F9WA 5ICFA 3WZDA 2DUVA 2ITTA 5AP3A 4DFUA 4TNDA 4HVGA 2PVMA 2ZIGA 3AMBA 4ACCA 4AZFA 4WIHA 4FT7A 2YIXA 4C0TA 2O0UA 1DAWA 3R2BA 3LCVB 5L6WL 3PJ3A 2EX4A 3FUTA 3NWBA 4BDDA 4RWIA 1QZZA 4X0MA 2UZWE 5FTQA 3VS4A 4MNFA 2ITQA 3C4WA 4FZVA 3DB8A 3VS0A 2UV2A 4WSYA 1YDTE 4BLVA 2XRUA 4L67A 5JFSA 4IKPA 3BYUA 2RG6A 4PP9A 3C6KA 5AADA 2H34A 3JWHA 4C07A 5J8IA 1NT2A 4IX4A 3FXWA 5ITAA 2BRBA 1FMOE 1DAYA 2JKQA 3R8VA 2Z60A 3RM6A 3CBLA 5DYJA 4RTJA 1K3AA 3OCTA 3U55A 5IUHA 1O6YA 5CZIA 5E8VA 4ZTHA 4DC2A 3BYMA 4X3FA 4ZTBA 4CV8A 4GJ2A 5E9WA 3DTCA 3ANRA 4QTUB 4QP6A 1WZNA 5A6OA 4G9CA 3HDNA 2ACXA 2XIKA 2PHKA 2NXNA 5T6KA 3BQRA 4I93A 1YFLA 3KQWA 4MHTA 1PW2A 1J7LA 3BLHA 2Z6UA 4FIEA 3AD5A 2Z8CA 5JRQA 4G17A 3DJ6A 2B1PA 4QP1A 5KHWA 3V01A 3LFAA 3L8XA 4EL9A 3P97A 2A4LA 3TKUA 4O21A 4AE6A 3IDCA 4FT4A 5CU6A 3QV2A 1JQHA 2C7RA 3HECA 4A6DA 3LMIA 1PJKA 3TTIA 1J7IA 5CVVA 1M14A 1K9AA 3TOSA 1H1SA 4M7IA 4CKIA 4C35A 2NYUA 4AP7A 2PYWA 5HCZA 2VO0A 3P4KA 3K3JA 2FRXA 1URCA 2ITYA 2F7ZE 3LBFA 2PVLA 1L3IA 3EMDA 3PJ2A 1H08A 4F0GA 2GQGA 2BKZA 4C7TA 1YXTA 4DAWA 2C47A 2QKRA 1R39A 2AC3A 4FKVA 4F9BA 5H9BA 3FZPA 4NM3A 4ZLZA 1OPLA 1PKDA 1PY5A 4U8ZA 4EJ7A 3CKKA 3R8PA 1OITA 3SOCA 3SOAA 3SAYA 1VE3A 4JDHA 5KYGA 5C0OE 1WBOA 4W4YA 4ZY5A 4WHZA 3ELJA 4QQ5A 5EIFA 1X1AA 4MBLA 1L9KA 4E5AX 4C08A 2Z7SA 4OBWA 3CXWA 4IM3A 1W83A 2PX5A 4BDFA 4PWYA 2XCKA 3P71T 4RIYA 3ELWA 3O8UA 2F49A 2HXQA 3EFLA 2JGZA 3PSBA 4S31A 5JFVA 1GOLA 2PULA 4BN1A 2CSNA 4MNEB 2BZJA 4QNYA 3AC8A 4WOVA 1HMYA 3T7RA 1NW5A 4DGGA 2DQ7X 2R3OA 3QA8A 2Q0BA 3WF6A 3UOHA 2JBPA 3E3PA 4MTLA 3ORIA 4RMZA 2IBTA 1UWJA 5FTWA 2O3PA 4OLIA 1X19A 3BKWA 4R3PA 4JR3A 5FRIA 4GV1A 3TKHA 5CVDA 3Q3BA 5HIKA 3KRRA 2JLDA 4PGGA 2JKMA 1BKYA 4RSSA 4C4GA 2HOGA 3MJ1A 5TT7A 3O96A 4NTTA 4RX1A 3MV5A 3FPJA 4Y2HA 5EFQA 1O6LA 4Y83A 1TPYA 2JDTA 2X4ZA 2HIWA 2O65A 2Y1XA 1G5SA 3OT8A 1VLMA 4O91A 4DEHA 3FZOA 3RZBA 5LQAA 3GXLA 4KIOA 5DT4A 4PY1A 1IG1A 4XMOA 3PSDA 2H6DA 3EB0A 2VWWA 4QMSA 4ZTLA 4CTCA 5E1SA 3MERA 4ZZOA 2VTAA 4FKPA 3VBWA 4PDOA 1UU7A 2CKOA 4HYUA 5BVDA 3W8QA 4TL0A 5L6PA 1H8FA 3RHXA 4U7ZA 3DCVA 3VULA 2FH9A 3U87A 4UZDA 3FLYA 2OXXA 3ZRMA 3L9MA 3T0IA 5H8EA 4NJ3A 3G7UA 4GJ3A 4C3FA 1YI3A 1TW2A 4FG8A 2WMUA 2ZZKA 1NV9A 4Y8DA 1PJZA 2PVYA 1QPCA 1KHHA 3A7DA 2QRVB 5B2KA 3LGAA 3KPWA 3TNQB 3LHJA 1G8AA 3IKAA 5JH6A 3ZFMA 4DYMA 4KKEA 2BFXA 4QMOA 4OA8A 2B55A 4DT9A 3UVPA 3D5WA 4B6LA 5H8BA 5LQFA 3GRUA 4RPVA 4GG5A 4AW2A 5IMXA 2QKWB 4EK8A 2R0UA 5LJJA 3RAIA 2AOXA 5DSTA 4F6WA 5IQHA 4FNYA 3PSCA 4GH2A 3HCEA 3TZMA 3GQIA 3NMUF 3A7EA 4FR4A 1EAMA 5FWAA 2AN3A 4P7KA 3GENA 5CEMA 2B4SB 2EG5A 1JBPE 4EWHA 3RWPA 4OT5A 3CVOA 3CKXA 2CKDA 1DL5A 1M52A 3JXWA 3TTJA 4H05A 1BI7A 4DH7A 2XIZA 4D9UA 5AUTA 3U8WA 3TFWA 3UZPA 2C1AA 4ENYA 1IA9A 2XBJA 5DBXA 2AOTA 4U9AA 4TXCA 3G0EA 5HE2A 1KE9A 4O22A 2WIPA 4ZTRA 2QI8A 4XBRA 4GOMD 2W99B 4QMXA 2W17A 3ULIA 4RTMA 2ITNA 4YHTA 2ZIEA 3SW4A 2B54A 4M84A 2IP2A 3HVHA 3ZMMA 1IY9A 2UZEA 3D7TB 2GTMA 3WZJA 2YIRA 5IQBA 4FGRA 3KRWA 3AXSA 4DM3A 4WRSA 5CAVA 3GCPA 3KF4A 3PTGA 3ELUA 2OU7A 2X9EA 3P2KA 5HIJA 3FY2A 3UP2A 4IZAA 1EH4A 5AJQA 3RODA 3MPAA 5HBEA 3BWYA 3WZKA 3FL4A 5BVKA 2VU3A 2XNBA 4A9SA 1JOWB 5BMSA 2PUPA 2YTZA 1KYWA 2P3OA 3OC1A 3VC2A 4LWOA 4YJRA 2E9OA 4FZFB 2ZDUA 4EJNA 2PXCA 3DAKA 4QP7A 4X6RA 1Z57A 3FMEA 1DCTA 2P3GX 4HTFA 3II5A 1WY7A 4GFGA 2ZB0A 5C8MA 3S95A 5A4EA 2ZTHA 5CASA 4FP9A 3LECA 2E9PA 3EL7A 3QRTA 3RPOA 4DGOA 2X8DA 4LOPA 3UMWA 5LMKC 1ZWSA 4ER3A 2ONLA 2W06A 4TWPA 4FL3A 5IA0A 2UZOA 1T43A 3MB6A 3EYGA 4DFNA 3EVEA 4BCPA 3MW1A 1JSVA 5P8WA 4L9IA 5DXJA 1V1KA 3HA6A 3QXPA 3KMWA 4HGTA 1H27A 1XBBA 5EDPA 2EJTA 2OJJA 5LVNA 3RK9A 5KKRB 2BFYA 5DM0A 3FJQE 3OZSA 3Q52A 2W05A 4KIFA 1YHVA 4U0IA 4YJTA 4KD1A 4PTGA 1M17A 3E8DA 4DEGA 2ERCA 2G72A 3Q6UA 3AD4A 4GUEA 3VS3A 3FKLA 3MI9A 4RTNA 2R3PA 2VTIA 4BIDA 3EGVA 3ACKA 1OL1A 4ONAA 3FZGA 2I62A 4YO6A 5BW4A 5A6NA 4EYJA 5FG8A 5CAUA 5FDPA 2PWPA 5L6OA 3EVGA 3TV6A 4ALUA 2R7IA 4XG9A 2UW0A 2ZJWA 2Z6AA 2VX1A 4LL5A 2CMWA 3D4QA 5CT7A 1L3BA 1RJBA 3E62A 2VDWA 3BCEA 1O9GA 3MH2A 3IDPA 5HD7A 3DU8A 5ACKA 4GSBA 2R3NA 1AD5A 4I4EA 1YQJA 2J51A 3HRFA 3NGAA 1KV2A 5AV0A 4AOJA 3VNTA 2QG5A 5CU4A 3R8ZA 4C03A 4L53A 3FMJA 3P9CA 3P7BA 3UZTA 3OFJA 3VS2A 3H9OA 3TEIA 3Q9WA 3OCBA 3NR9A 3OWKA 1H01A 1KP9A 3DOUA 3FXZA 4FSMA 1XQZA 4CMOA 4ZMEA 4PCAA 3G5LA 2B78A 4JXFA 2I7QA 1UA2A 4YZBA 2CPKE 4F65A 5HORA 2WOUA 3VBTA 2XRWA 3LCOA 3DBCA 4JBPA 3ZO2A 2B9IA 2HWOA 5H3QA 3ZSIA 4QMZA 5BXYA 5LVLA 4BHZA 3EQHA 4KBAA 3IHTA 4DTKA 4WD5A 3TKIA 4XV3A 3FPHA 4NECA 3F3UA 2WIHA 4PP7A 1RI5A 3QRJA 1VR2A 4RFYA 5AUUA 2OICA 4EOIA 2Q83A 4I0SA 2BRNA 4JDKA 4CTJA 4IAZA 3KEXA 2P7HA 2WMWA 1XH9A 3VRYA 3UWPA 3P86A 3POZA 4NJDA 3EFJA 4TN6A 3TM5A 3EVAA 4FSNA 3I64A 4Q5EA 5IMEA 4UX9A 5HVYA 2PT6A 5T67A 3Q4TA 5E92A 2A19B 2C3KA 2Y4IC 4FV5A 3CPCA 3ROCA 5HIDA 5CVEA 1A9UA 3FLQA 4FX3A 1FVVA 3PRIA 3GB2A 3QQJA 3VYWA 3DLZA 3FZ1A 4AE9A 4I92A 5B2MA 2HELA 3ZFXA 1KE7A 3NSZA 2XNOA 1PHKA 4MX9A 3I0QA 3VBYA 3BRBA 4RJ5A 3V5LA 4FTCA 4FK6A 4FGZA 5BVNA 4V0RA 4FEUA 2BAQA 4TYEA 3FTEA 4PGHA 4ASXA 5AM7A 3FRIA 1WG8A 5M4UA 4D55A 3ZLSA 2R4BA 3OPNA 5CYIA 4I6FA 4CLJA 4U3ZA 5F95A 5EMKA 3SR4A 4PDPA 4X3FB 4YV0A 4ARKA 3LSTA 4PYMA 3RNIA 4K8AA 2C6OA 2F7XE 2C30A 4QTCA 3AD6A 5AP0A 2W7XA 2W9FB 3W2RA 1G60A 5HKMA 4DH8A 2YAAA 3F3VA 4G31A 5EMLA 4TWOA 2ETMA 4FTQA 4KS8A 4DITA 4I94A 3GCVA 4FIHA 3QX4A 2RFNA 4CXAA 4FMQA 4BDGA 3PVGA 5E8XA 3UOLA 3UZUA 3OCGA 3CQWA 4ZAUA 3ORXA 3MQ2A 5HLWA 4DINA 3D7ZA 3NS9A 2UW4A 4D0XA 1IR3A 5BVFA 5E90A 1VZOA 2P35A 1ZGAA 4WKQA 3FI8A 3DKOA 3L8PA 3MPMA 5BYLA 4CV9A 2C6TA 3ZBFA 3UQCA 4G6NA 3HV7A 5EM6A 4ANLA 3M4XA 2WB8A 2X2KA 3HVIA 1M7NA 3PE2A 2PT9A 2NP7A 4XP3A 3O50A 2XJ0A 3TNIA 4RG0A 2IZUA 1UV5A 4C2WA 4FTMA 4O7TA 3UTOA 3FZTA 5EKOA 4HGZA 4IWOA 2PLWA 3U81A 2QOHA 1BX6A 2YIWA 4B7TA 1KWPA 2OW3A 5EMMA 4DGLC 5GIOE 5E2AA 3UJ7A 1Q41A 3BV2A 4IAYA 4EOOA 3KU2A 2DYLA 1M2QA 4EH4A 3DMHA 3HKOA 4V05A 2VGPA 4ANMA 4YTHA 3U51A 3FMNA 3Q7EA 4FZDB 4GOOD 3UNKA 4DEAA 3R9DA 3HDMA 3SLSA 5EG5A 4EZ5A 2VWXA 5AA8A 4FEXA 4RX8A 3OS3A 2BRHA 4CNHA 4O0VA 1L3RE 3L1SA 5E9EA 1LEZA 2BZKB 5AV2A 1I4WA 4YJOA 3WF7A 5BYYA 2CGUA 4CQEA 1GNGA 3QRUA 1GZKA 3SSOA 4TKSA 4TW9A 4RIYB 4OQEA 5HBJA 2ZSUA 3G2MA 4M69B 3HV4A 2JAVA 3SVVA 5CQWA 3R1YA 2BIKB 4AZTA 4BCKA 4AGUA 2PX2A 2WA1A 3KKZA 3THRA 2OB2A 2PE0A 3BGQA 4O7SA 3WYXA 3PDTA 2C1BA 3GRYA 2EWAA 3RHKA 1JG4A 3Q4ZA 4FYNA 3G2QA 2QM3A 3RALA 4EKIA 3R9HA 5BP7A 3F2NA 5FD2A 2XYNA 5EHYA 3LVPA 2WD1A 3IPHA 2R3HA 1YWRA 3Q9ZA 1M2PA 2HY81 2QOCA 3PXZA 3VUDA 2DWBA 5KHXA 5M4CA 3R7IA 3KQSA 3HCDA 3ERKA 2VZ6A 3KN5A 4PX6A 4UYAA 3FPMA 3QTXA 2GFSA 1LPUA 2BTSA 3AY0A 1ZMUA 2V55A 5JN2A 3KQQA 2ERKA 3QUDA 4RTLA 4YMJA 1EQAA 3AJDA 3E7VA 4I6HA 4QTEA 2IWIA 1DS5A 4M14A 4AN9A 4DH3A 4EK6A 5FP6A 5EHIA 4HVDA 4N6YA 4IWPA 4LMUA 3TXOA 3H9FA 4O2ZA 2ZB1A 2QURA 3TV4A 4I0RA 3QTQA 3DDPA 4E4XA 2YWPA 2J0JA 4DEBA 4FZAB 3GU4A 3KQYA 3FZSA 5JZNA 4J71A 4FIIA 4RLLA 1OKZA 4MHAA 4IZ7A 1PYEA 4MXYA 5DR6A 1BL7A 4IFGA 1J3HA 1LUFA 4OR5A 3LCCA 4BIBA 3LDUA 4F4PA 1S9JA 3GC7A 1BHJA 4D4VA 3FPQA 3IOKA 4RYLA 4K11A 5JRSA 1H1WA 5FUTA 2BZIB 5M55A 1Z3CA 3K5UA 3NUSA 2YZLA 4CWAA 1Q97A 3HP7A 2I9KA 1XH4A 3MFUA 3VJOA 2Y8OA 4ZP5A 2GS9A 4D4RA 2XKFA 4X7QA 2XKEA 1TQMA 2Y9QA 5IH6A 2J4ZA 3SXJA 3T3VA 1OBGA 4EBVA 3OMVA 5C8NA 4XHKB 4EUTA 4I41A 5AP2A 1CDKA 4BCGA 2O64A 4H39A 4ACDA 4NM7A 1OMWA 4GOND 5FCDA 4JQEA 4YV1A 2AOTB 4G34A 4F6SA 1P91A 3VBVA 2PUUA 4UYNA 3FLSA 4DGMA 2PL0A 3TL8A 3P5KA 4WUNA 2JIIA 4FNWA 3ODZX 3QTWA 3CD8A 3MN3A 3HRCA 4ISCA 3V8WA 5ICPA 3Q32A 4TT7A 4MIKA 2RL5A 4O7ZA 1PXMA 1R0PA 1JG3A 3E88A 4C02A 3UJCA 3UODA 4FEVA 4KSPA 4YZNA 3SG8A 3RCDA 2GU8A 3HCCA 1R74A 4QOXA 3GU8A 3QZFA 1WBWA 4JNWA 4P7EA 5GP1A 3COMA 4LRKA 5FA8A 1LEWA 3PUPA 2ZW9A 3PVCA 2OXTA 4JJRA 4IHPA 3F66A 3RCJA 3KULA 4NW5A 2RF9A 2QOIA 4PQNA 3JY9A 2PZ5A 4E93A 1KE5A 4GYGA 4QQTA 4Y5HA 1OUYA 4R8SA 2R3IA 1OBDA 3LMHA 4R7HA 3BWCA 1T46A 4HTFB 2I1MA 3ZSGA 4ZJIA 2XK8A 2A27A 3ZXZA 3PVUA 4H58A 3NUNA 5CCXA 5CVUA 3RAKA 3NDMA 4CG9A 1UIRA 1JPAA 4QDKA 3D9VA 3UVRA 3BGIA 2UZ4A 4YPSA 3U6JA 5KO1A 5T64A 1SVEA 5ICGA 1CMKE 3MBLA 3R7OA 3HV3A 1XKKA 4XV2A 4X2KA 3KR1A 4F7SA 1P4FA 1WZYA 4M7RA 2WEIA 3EQBA 3G51A 4ZZNA 5M51A 5EI6A 3I60A 3HMOA 4ZY4A 1QPJA 3QD0A 2W96B 5GM1A 3R0QA 3QTRA 3LHDA 3FUVA 4BP3A 2GQRA 5M08A 1YI6A 3BLRA 4FTTA 1VJYA 2QODA 4A9TA 3DTNA 5LQNA 3E87A 1A48A 3LKMA 5AX9A 3Q53A 4BI1A 1WFCA 3KPYA 2H8HA 4GKHA 4OT6A 2UW9A 2Q41A 4S2ZA 1RI3A 7MHTA 1HCKA 2ITOA 5EQYA 3KPUA 3U54A 2YUIA 3ENHA 2LGCA 2J7TA 4JI9A 3DLSA 1ZLTA 2HYYA 2AS0A 4BGGA 4O86A 3PIZA 5L2WA 1ZMVA 4Z2YA 5BUEA 4JBVA 4WNKA 2FO0A 4LRMA 4DTBA 3HMNA 2YM3A 4RIWB 4U7PB 5JMSA 1OGUA 3R2YA 3E23A 5J9ZA 2XK6A 4F7LA 1NXKA 3QQHA 3G9NA 5AFVA 3NEWA 2AVDA 5DM1A 3NUXA 4CKJA 1ZZLA 3FPGA 4DLJA 4JX7A 3FTDA 3BZ3A 4DFLA 1DM2A 2J9MA 3CJTA 3SVZA 1FGIA 3G8AA 1YFJA 4L44A 3BWMA 1JQDA 3P79A 4AU8A 3WBLA 4EKGA 4IH8A 3PVBA 4BTKA 1P14A 4ER6A 3QZIA 4DA5A 1PXPA 2OWBA 4BY9E 2BZHB 4DCEA 4RJ4A 3SW7A 4AT5A 1JR4A 2WMSA 4EEVA 3WOWA 3UJGA 1FP2A 2HZ0A 4WNOA 5IH4A 2WQMA 4G16A 2NRUA 3P0MA 3TMAA 4C2VA 3IK3A 2YAKA 5CXHA 4RVGA 2G9XA 3E8NA 1LR4A 2PSSA 5EKNA 2Y4PA 3EN9A 1VIDA 4L46A 5IA5A 2ITPA 5BW5A 3HX4A 1JSTA 4CFVA 3UJAA 2CJMA 4DBNA 4RVTA 2PWLA 3RK5A 4FR0A 4MK0A 4JLCA 4PYJA 3FHRA 3VHKA 2PMNX 2YA9A 3LIJA 2VTNA 3IECA 3C0IA 5DH3A 1BOOA 2V22A 2XVDA 4G5PA 3D83A 4MH7A 3AC5A 2G2HA 3P9JA 2IH4A 2VTMA 1TKIA 2ZOQA 2XVMA 4AAAA 1WBPA 5FEDA 2BKKA 3UO6A 2OJGA 3R1QA 2WNTA 5JKGA 4KSQA 3PA4A 4EHEA 3NX8A 5T6BA 5AIKA 2CNVA 2K4MA 4LL0A 3AG9A 2WTCA 1ZG3A 2H11A 4DHFA 1G6Q1 4RIOA 3CIKA 2GAFA 3AOXA 4I3ZA 2EVAA 3UGCA 3VBXA 4RA4A 5AP4A 4C4HA 5CEQA 4JDIA 3VUMA 3L9LA 4E2ZA 4L42A 4TNBA 3QRIA 5CANA 2BAJA 1G3NA 4H3PA 5EOLA 2GNJA 4QVGA 1F3MC 1ZKDA 5LMBA 2YZAA 4F6UA 5BVOA 5HFJA 2JDOA 4IM2A 4OBPA 4PDSA 4DG3E 3KA0A 3QYZA 4JG6A 4O82A 3C3PA 1BUHA 3FYKX 2AOWA 3IS5A 4GK2A 4A9RA 3MTIA 3BGPA 3BWJA 1YXUA 3LFQA 1ZARA 2C7QA 3QOXA 3ORKA 2VWVA 3H0YA 3PG3A 3WARA 3HMPA 4IJ9A 1HCLA 3BKXA 1B38A 5HG8A 3H2BA 3R0TA 4CKBA 3G2FA 4FS8A 1GIJA 5CSPA 3W2QA 2BR1A 4J8MA 1EJ0A 5E8RA 4DCGA 3ETAA 4DG2E 4Z16A 3ZBXA 3GCQA 5JFWA 3DQXA 2JIUA 2YHVA 5E1OA 5DNRA 5FA5A 4C61A 4L3PA 4QMUA 1BC5A 3QRKA 3ZM4A 2O07A 1JG2A 1BI8A 1Q62A 1XJDA 3OUKA 4CCBA 3M70A 4LG4A 4L7VA 3SV0A 3U6HA 5FEQA 5IQAA 5AEPA 2C5VA 3V5PA 3OBGA 4A7CA 4MXZA 4M67A 4FT3A 3QCYA 2AOVA 4GVJA 3VO3A 3ORTA 1DI9A 4QP9A 5FHQA 3VJNA 3IGOA 2PU8A 2OB1A 4PL3A 5EHOA 5EYKA 3V5WA 4DT8A 1ND4A 1OKVA 3OVVA 3GFWA 4M13A 5EG3A 2IVUA 4POOA 4AT3A 1PMNA 3TM0A 4K6ZA 4RWJA 3C4ZA 5FM3A 3CE3A 4EK9A 2XM8A 3EN5A 1F3LA 1H1RA 3DULA 2PKWA 3VWAA 3BEAA 4PMPA 3RPYA 2H9VA 2IBSA 2YVLA 2AN5A 2VV9A 3SXFA 3PY0A 1OL2A 1R00A 4O38A 5EK7A 1IAJA 2WKMA 5D1JA 3C3YA 4RTPA 5C4LA 1WCCA 4V0QA 2FPOA 3UO4A 2XYRA 4G3CA 4PL4A 3QL8A 3MFRA 3UA3A 1MQBA 4GU6A 4EONA 1IXKA 5AAEA 3ENMA 3C4FA 1M6YA 5EHLA 3OWJA 4OGRA 2ZCJA 3SRVA 4X2JA 2GQSA 4QQKA 3SDJA 5ANIA 1OIRA 4DEEA 2IIPA 1O6KA 3NLBA 2YM6A 2QR7A 3F4KA 1Q0TA 3BU3A 4R7BA 3KQOA 4E32A 3AC2A 4AF3A 3FAAA 1VL5A 2Y7JA 2FGIA 4AG8A 3JUHA 3EQFA 2QU6A 5J5SA 2VTHA 4RTOA 1KIAA 5E4HA 3QQLA 4K1BA 4CTKA 3F88A 3UBDA 2X6DA 3ANXA 5LMAA 4HGLA 4CZUA 4BBEA 2QOKA 2WQBA 4XV9A 5EYMA 5EQPA 3E64A 4D9TA 2XIYA 3ZSHA 2VZ9A 3MB5A 3VW8A 4KRGA 1OECA 3LMGA 4I4FA 2IH2A 5DM2A 4F0IA 4A9YA 4E2YA 4HVSA 4LV8A 3MH3A 2GH1A 2RKUA 3N51A 3DOGA 4NUSA 4RVMA 4GK4A 4CD0A 4OTDA 3I4BA 4LGGA 5D41A 2XK9A 2WMVA 3TJCA 1U54B 3FMMA 2J0LA 4EH2A 3F3TA 4IANA 3QKKA 4QMQA 3DTWA 4JS8A 3DXZA 4YUXA 2VTOA 5KMMA 3ER9A 1W8CA 5M4FA 4XP0A 3EN7A 2JAMA 4X3JA 2HR1A 2IZTA 4PCLA 3KC3A 2C6MA 3PLSA 5L2IA 4FKRA 4PRJA 2GHMA 4IM0A 3DLCA 4ZZMA 1X1DA 2YCFA 2ZM3A 3O51A 2G01A 4E8AA 3KK8A 4NCTC 3PJ8A 4FYOA 2XYQA 3PXFA 1Q61A 5HE3A 3TIYA 4LQMA 3W2OA 1Y57A 1VBFA 4CMTA 4IDVA 3BGVA 3BV3A 1RDQE 2VDVE 3F69A 4WO5A 2OG8A 4ZSJA 5E1MA 3V8VA 2YM8A 3V3VA 1VP9A 2OF2A 3Q5ZA 5FXQA 3DR5A 1AF7A 5CEPA 1FVRA 2OPBA 5EPEA 3AC4A 1UKHA 2PVRA 4QMNA 3KCFA 4IZYA 3VVHA 4GT4A 4BDBA 5HGIA 4N57A 2GDOA 2B9FA 3F6XA 4B99A 2X4FA 3M1SA 3CCFA 5EOVA 3QTUA 3UDBA 1HNNA 3CD3A 3HMIA 3VUHA 3WE8A 5I9WA 4RZWA 3BHYA 3ZOSA 2PUNA 4R78A 4A07A 4O96A 1SVGA 4ZJVA 3UQFA 2JFMA 5FBOA 4GIIA 2GFCA 1VP3A 1ZRZA 3QALE 2YACA 4YLKA 1IAHA 4NKSA 5KMOA 2PPQA 4BDJA 1SNUA 1YXSA 2Y1WA 4R6XA 2HZ4A 2I0YA 5D1NA 3TZ9A 1PMVA 1IASA 4AXAA 2C0TA 5HNIX 3UOKA 2YDJA 2ERZE 3BELA 4U41A 1SQFA 2WQEA 1SM2A 4EQZA 4YZ9A 4I21A 4YMGA 3NUPA 4FUYA 4W4VA 3UJDA 5LSAA 2FYTA 1P2AA 2O8YA 5HX6A 2REIA 3G88A 4BCNA 5J1WA 4P4CA 5AV1A 4MXCA 3LFDA 1NBIA 4QVKA 3OU6A 2CMHA 3FC2A 3ZUTA 1H25A 1YVJA 5DX0A 2G71A 2OY0A 4U44A 3W2PA 2UVYA 2ZFUA 2PV0A 2XNPA 1J1BA 3BHUA 3KREA 3W2CA 4KKHA 5D7VA 3LLAA 2B0QA 1RI2A 2Z2WA 3ROYA 5IG1A 5CI7A 1SVUA 3RJCA 1UU8A 1Q24A 4YV2A 4D2RA 3R7UA 3M2WA 4YBJA 1SUSA 4RFMA 2B3TA 2YISA 3JWGA 2UZNA 4P90A 4RV9A 5IZFA 3TUDA 5BX0A 1RI1A 5J9YA 2V0DA 5GJFA 4RJ6A 2F2UA 4OA5A 1JKSA 3EGIA 4BCIA 2W5HA 4BYJA 2IDKA 2XBAA 4L00A 3P7AA 1R8XA 5FUBA 4E30A 4JBQA 4J97A 5FQOA 2C6IA 4YZMA 2IN6A 4L3JA 3KQTA 4NH1A 4USEA 3FZRA 1JQ3A 1GZNA 5CF6A 3P78A 3EKNA 3OWPA 4HYHA 4ITJA 4UXQA 4EOSA 3CKWA 4J53A 1XJ5A 5U4XA 4RQVA 3ZEWA 4ZOGA 4F70A 1VEBA 2JH8A 2IVSA 3I6WA 4I20A 1RI4A 3P1AA 3PY3A 4NK9A 3LPMA 1R18A 1SMHA 3MTFA 2FSTX 3SSNA 2WMRA 2C69A 5CCBA 3GOKA 4F84A 3GFEA 4C59A 4V0GA 4O0XA 3IW8A 5DT0A 5CENA 3UC4A 4C58A 4WG4A 5A4QA 3C0GA 3JPVA 3BE9A 3PXQA 3E3BX 1UU9A 4PYLA 4F7JA 3QD2B 4FTLA 1Y8YA 4G56A 4AUAA 4B17A 1ATPE 5B2LA 4EOJA 3KCKA 5HVJA 3A7HA 5HLNA 5EEGA 4KKGA 3EMBA 5A4CA 1P1CA 3B3GA 3A60A 5HCYA 4KINA 1WBSA 3QFVA 3I9FA 4TYHA 4NM0A 4IIRA 1URWA 4HC4A 5CU2A 2Y0AA 3C13A 4DEIA 1VYZA 3A7GA 3B8RA 5DLSA 2Z7QA 3T8OA 4UB7A 4ER7A 3OE5A 5K0GA 4RIXA 2CGXA 2XZSA 4RVHA 3AT4A 1UVRA 4R77A 4ATNA 2QONA 2FUMA 4GK3A 4DLIA 1M2RA 5GJGA 3QU0A 4BTMA 5CEIA 1OM1A 4QP4A 3B8QA
chains in the Genus database with same CATH superfamily
3FMKA 3SC4A 3MPOA 3DDUA 4BP8A 1U2PA 1JMVA 3NUUA 3VRHA 4IDTA 4WECA 3F7OA 3U56A 4Z3OA 5I4BA 1ZMXA 1GKLA 5AJXA 1O6GA 3R6LA 1FFEA 3EVFA 4QT1A 3CLYA 1T0IA 1DX6A 3DMTA 3T4UA 3MAJA 4K9OA 2VJNA 4C6TA 3F6RA 4P08A 5KVCA 1GIAA 4Z1MD 3TZBA 1I2BA 5EIHA 1Y8QA 1U4SA 3GCZA 1TAQA 2DWUA 3OJFA 3JATA 1DXHA 4RSGA 1D2GA 4FZ6A 1UJBA 4E2WA 3KAPA 2HSEA 2WOTA 2Y0PA 4Q5HA 2F8TA 3VR6A 3ZRLA 2X19A 4XUGB 1FTNA 3G2LA 3V2UA 4AW0A 4MUQA 4B8YA 1U4OA 4TRNA 1XYVA 1TRHA 4Z7OB 1UDRA 4L4XA 1WW2A 4TYQA 4HYSA 2W2OA 4BIIA 4MINA 3L5KA 3ODGA 5J47A 3DEJA 4TX1A 5ERGB 4I5PA 5JAUA 4HGPA 4AKHA 2RIPA 4JYPA 2V7AA 3LXMA 4A0HA 4FKLA 4URZR 3QYFA 4I8IA 3DAEA 5CTPA 1B76A 1JSUA 4BGQA 5HM8A 3FN4A 4QMTA 4LE1A 4GCJA 3I2HA 2QM0A 3AZOA 4AFNA 3LJ1A 5JU6A 2GS7A 5JNSA 1WVWA 3G90X 3V4SA 3NGMA 1ZXBA 1F17A 1Y9ZA 4RESA 4O4LF 2O05A 3RG8A 1M1ZA 3LUCA 2P40A 2ZAZA 1QANA 4FIJA 2QL5A 3OCJA 4EHZA 5HTOA 5TMBA 2EWWA 4XJ0A 4BZWA 3GGOA 1O54A 2VSXA 4OQQA 4DT1B 3EIHA 2XYHA 2ADMA 1F8GA 1JLUE 4R7IA 4FM9A 4DDWA 1H3EA 4JJ8A 1XJWA 1RAEA 2XUJA 3VR4D 1D2AA 3B9PA 3WRXA 1B6RA 1RBMA 4NR0A 2XDAA 1MDBA 2PVKA 5CVGA 3TW0A 1V95A 1IIBA 1F2VA 3D2LA 4ZQGA 2QHNA 1LWNA 2FZ5A 5HF6A 3RJ9A 3A9WA 4F78A 3WO0A 4PX9A 3QKWA 3HSSA 2J5KA 4YCJA 3FFBA 1LSOA 2ZULA 1PJAA 2YH2A 1TVKB 3ZLXA 3LCKA 4AZWA 5CG1A 3JZAA 5J4KA 3KKLA 3LG2A 1ENZA 1EQUA 1LDBA 1EP3B 3WNVA 2H29A 3HJFA 2C4HA 1T3SA 3QGYA 3H42B 3AEUB 1QYRA 4JKYA 3EAQA 2NYAA 4FV8A 3M5DA 3O4GA 4LUEA 1A8QA 5DKFA 2E7ZA 1G19A 1M2VB 1E2EA 3Q3VA 3ORNA 5AMXA 3R75A 4ANBA 5FJIA 2LD4A 5EE1A 4QXAA 4M55A 5K0BA 1YC5A 2XS0A 1F4LA 1C9DB 4QREA 2RHCA 3KWFA 1TCAA 1OLOA 1PW7A 4ER0A 2YHIB 3UAWA 4ZV9A 3CCNA 3WKBA 1XHLA 4KUHA 5MN6A 1ZBQA 3DK6A 3LVFO 2XYPA 3W04A 4D4IA 3R5KA 2BEUB 3TTTA 4RV4A 3P20A 4LCBA 1K1EA 4NBRA 4F71A 3RV3A 2OFWA 4NAVA 3L4BC 3H1BA 2PX8A 3LUBA 4RKRA 1T3ZA 2Q1UA 4NY1A 1C3JA 3P52A 1OI9A 3UAZA 4ZK6A 3W0MA 1GAXA 1THTA 4R01A 2Y4NA 4F46A 1KU6A 2RCYA 2QM8A 3B1FA 4DB2A 1OX4A 5KCVA 1J9GA 3DE4X 3AR8A 3VUGA 4WKBA 3F2IA 4X61A 2BFEA 2QAGC 3FUXA 2D13A 4CPDA 3F7MA 3SLRA 1KPGA 3GN1A 3SXUA 4APPA 4M89A 5KYYB 2OHHA 3I5AA 1LBHA 3LPBA 3D2BA 3NTVA 1LLDA 3MTQA 4Z0TA 2CUKA 3A06A 3GCUA 4HWRA 4HWGA 3QWHA 1JECA 3BE8A 4NULA 1SEVA 2VRNA 1PJTA 3LQ3A 5LWNA 3UQZA 3JSAA 4P4SB 2YY7A 2FB9A 2PDAA 4F8JA 4MNEA 2VDPB 4JUCA 2JGKA 4ID3A 3FBGA 2G1JA 3I42A 2UYGA 3U37A 4Y2QA 2OLJA 1NA7A 4ZJPA 1SWWA 4P54A 1VFPA 4J99A 1T3TA 3PNMA 2WTBA 3HMMA 1L4GA 3RC9A 3FMDA 1T4CB 3NBFA 1YR6A 5JYCA 3OQNA 1VYWA 3ZO3A 3DBOB 3E7FA 1Y1RA 2N1MA 4ZOBA 5AVQA 8GPBA 1SHKA 3EB9A 1H4SA 3RRYA 2BFPA 4E88A 3NRJA 2F2TA 1TA9A 2FFBA 4XEYA 1BYUA 4R1LA 2HMWA 4UBMA 5BN4A 2OF4A 4L45A 4X20B 2H2DA 3G6GA 4O4JA 2ABWA 2XQKA 2GAJA 2ZUDA 2V7EA 1Q0UA 4L68A 3KRLA 2HV9A 4BDCA 1SZCA 4HN4B 1BE0A 2VVTA 3SD0A 1ZOEA 1CEQA 1YJXA 3F2VA 3IIMA 3QVSA 5MF6A 4WNYA 2HIHA 2CFOA 2WTKC 3REQB 4AB1A 4DABA 4HH4A 1GWNA 3LFFA 1CUFA 4ZDJA 5ANJA 3FYJX 4CFWA 2ANBA 3C1XA 3BD7A 1W8DA 1NFRA 1P2SA 3F9IA 3CPBA 2YV5A 3SC2A 3C4EA 2B7BA 5FADA 4BIMA 1PFKA 2ZBEA 4ICIA 4FYJA 4EPTA 1G3QA 3VX4A 1YVUA 2OWEA 3HXPA 3MZ0A 1I9GA 1P9OA 3IALA 1HG0A 3TR6A 3BUSA 4RADA 2QT1A 1FFCA 2BBWA 1XEXA 1G20A 3G89A 4CMJA 5C31A 3N4VA 5L8JA 3WNCA 5DA3A 3IOBA 3RANA 4AJJA 3NWEA 4G6ZA 3TE6A 4LX8A 5JFGA 4FYXA 2B0CA 2WUFA 2D54A 1JHPA 4XP2A 4WLVA 3H4JA 5IBQA 5AP7A 1Q3WA 4PXYA 5EY5B 2C82A 3BYZA 2VQEB 2GNIA 4DGNA 4V2IA 2GTIA 3KRJA 1V25A 4LE2A 1AKVA 1Q44A 5D5QA 2I1QA 4TT8A 3RYTC 3ZCPA 5DT3A 1E1QD 4OK3A 2W6IA 3R1NA 3AQ4A 4YJNA 3VUEA 1VIVA 3N75A 3QSGA 4B4DA 4CL3A 2E4UA 4TV9A 5BNJA 3O31A 5FOXA 3KVNA 4F91B 2LPMA 3UPZA 3CPSA 2OJ9A 3EQRA 4G5FA 3F61A 4G1MB 4LHWA 3O7LB 2HQOA 4D2IA 1U7WA 4CMEC 4E20A 3NCZA 3CRQA 3QSYA 3G9XA 3IMFA 4CETA 5JJLA 1FQOA 3RHFA 3PGMA 4TLLB 5TARA 1GGEA 3C16C 5LQRA 2HCFA 4MBJA 4C21A 5IXYA 3FMFA 3Q2KA 3ZZ1A 2YM4A 3IW7A 1S2NA 1YZ3A 1Q5PA 1NQOA 5LZ4A 3DDWA 4K7JA 2EB3A 2VTBA 2DERA 2HU7A 2PWAA 4NCKA 3QC4A 4C34A 3FJ1A 1NN1A 1T24A 3P0FA 4MD9E 1H26A 1YHWA 2UZ0A 4Z55A 3PD0A 1K63A 5IBRA 4AJ4A 1JA0A 4YIHA 3Q0EA 2GN4A 1PQPA 5J9LA 2UUEA 1C0EA 3BN3A 2BP7B 5LZ5A 4UAJA 4EQ6B 3TIFA 4HRXA 3Q40A 2O2GA 3A1EA 1H22A 4N5NA 3PWYA 1MABA 2WJIA 5GZ6A 1AXEA 1YOVA 1C0LA 1Q84A 4N0DA 1J0EA 2OBMA 3GRKA 2QI9C 4URFA 5G3YA 3VSEA 1PWEA 2VNWA 2UXCB 3M6VA 4ND4A 5IA2A 2VNAA 3FYUC 2C95A 2B9EA 1ORDA 2IIBA 3AVUA 5KIAA 1PT7A 4EMSA 3OHPA 4Q37A 1WHTB 3E22B 2CHLA 3CR0A 3MJ2A 5JSFA 1ZVQA 4GHWA 1E59A 5K5NA 3AB8A 3I9JA 4FIZA 4PPFA 2P3LA 3I1AA 1R0LA 2QU7A 2RFLA 3VHXB 2A57A 4IADA 1ECBA 1LSUA 4OUDB 2BLNA 1D7OA 5DX1A 3RW9A 3UFBA 1H24A 2XK7A 4ZIMA 3BSYA 4MJLA 4AQCA 3FLBA 2QX8A 2A33A 3EXAA 4BFWA 3M82A 2HLPA 2F62A 2C29D 3NBYC 5ECDA 5HWSA 2VATA 2Y2VA 4ZJJA 2BGKA 4FDAA 1SKAA 521PA 2OBJA 1DVRA 1PJBA 2R1VB 2IT1A 1R66A 3DFZA 2WIFA 3UYSA 3QQGA 2NXWA 1KYZA 2RGNC 4HGRA 5KSZA 3BWVA 3G17A 3ZV5A 3R3JA 3WGIA 3D5EA 4KXNA 5CMLA 4KN6A 4LDNA 2OIQA 1SVHA 4UKDA 3L0OA 2J0UB 2ZTMA 1TMKA 2A6PA 1SA0B 4YO8A 2V4UA 3TZ7A 4X65B 3P9YA 4JIGA 1J2RA 4U80A 4CIXA 3GEEA 5AKYA 3O8RA 1XRMA 3DXYA 1E60A 5K05A 4C38A 4DG0E 3C8DA 2J5FA 3CKLA 2WC1A 4LW8A 5F9MA 3WRYA 1YD7A 1N3YA 3GDOA 3TV7A 3GLFA 3V46A 1M72A 1XLTA 3R0JA 2IVTA 4IAIA 4X60A 3RASA 5JRZA 1WOMA 1U3VA 3I0NA 2Y4IB 4HN2A 8MHTA 4M86A 3FHLA 4R5MA 1RRFA 3VS7A 2WKRA 2GO1A 3EVNA 3NIFB 1V26A 1ZHFA 3HFGA 3U3ZA 4EORA 4OMUA 3LQ8A 1KEZA 1MUOA 3QKRA 4F1JA 4ACAA 1RJFA 1KRXA 1EX7A 2ZV7A 2ZRAA 4M68A 1JQ5A 4UBAA 2J31A 1EM6A 3K2IA 4F8YA 3L2OB 5HE8A 3QKSB 2IL1A 3F6CA 2QQGA 2I0EA 2QX6A 2PYZA 4Y6GB 2FEAA 3K0AB 3KR2A 2Q5CA 3PUIA 1W88B 3K0EA 4Y2JA 2MMGA 1RKVA 4E70A 4P1ZA 1U1IA 3TNYA 3MAGA 2XF2A 5CIYA 3K0SA 3G1UA 4RTSA 1ZJ5A 2CKPA 2JIVA 3CJRA 2LW7A 3WGKA 1TECE 5AW0A 1M8KA 4DS3A 1K6IA 1BMFA 3GNIB 3R3XA 4CCYB 4L7FA 2C4GA 3VYRB 2C8JA 4B79A 2GPHA 5EI2A 3AKZA 5GINE 3TH5A 3MESA 2QO2A 1JEQB 2Q27A 4EDFA 1DUIA 4TY1A 5G1OA 1IUKA 1XZ8A 4M37A 4RHFA 2GF2A 3CXRA 2FSIA 3LM5A 4HI0E 4D57A 1STOA 1EFCA 3F8WA 5D8DA 4QYXA 2W2PA 4TTJA 5C8XA 5PNTA 1T29A 4NTSA 2H7YA 3DC2A 2J2IB 4HX9A 4ZQIA 1MHPA 1W0JA 3WV4A 3T9EA 4QDJA 5A0VA 2H52A 1J9EA 3RKUA 4GW8A 4I50B 3Q7RA 5C1QB 5FTOA 3VH4A 3EN6A 3PT5A 2PE5A 4ADSG 2BFBA 1VE9A 3IR7A 3WV5A 1WVMA 4P0QB 4KBYA 4E5WA 2J0MB 2QSZA 5HBHA 1OW3B 1SRQA 3DKIA 4YROA 4KDEA 4OF4A 4G2TA 3UQYS 2XUOA 4ZYLA 3ENKA 2OXDA 1OKYA 5BWBA 2JJ2A 4K0YA 3UE4A 2J6CA 2NP6A 3QE3A 4K81B 4CXMA 2WWFA 2J0QA 3BT7A 4RPLA 2DOKA 1E1VA 3LPAA 4QTZA 2XNKA 3O7LD 5KSPA 5ICCA 5AR1A 1SC6A 3NHUA 1V39A 1KI6B 2E1RA 3HXTA 4D96A 1P2TA 4EUSA 3H1EA 2W1FA 3HKBB 4NCBA 2WHEA 2DGDA 1JIUA 2R8BA 1F4VA 4LFAB 5F21A 1P7CA 1G8MA 3AWDA 1V8ZA 3NW5A 2GYYA 4QGHA 1NBWB 4RELA 1L5GB 3W05A 3D1JA 2J3KA 4JA2A 2ODEA 5DI3A 3UICA 2DU8A 5LKRA 3COYA 4MV6A 4TWNA 4IKEA 2NM0A 5L4LA 4X21A 5JXGA 3GRPA 1Y48E 3MB8A 3EQPA 2XKCA 4HKTA 2WSLA 5FM2A 4QPPA 2C3UA 3OFND 1C9KA 3S81A 4XX9A 1YDRE 5JISA 1UMCB 3NWJA 3H4IA 3EUWA 2ZWVA 2D0PB 2IZOA 4EEKA 3E5AA 3NTQA 4FI3F 5M06A 4C89A 4O6EA 3TXAA 1XKXA 2AWOA 1KQ3A 1NBAA 1DWUA 1A71A 4JC5A 4KUJA 5EDRA 4Z53A 4YONB 1REQB 2CL5A 4JBWA 2VAPA 3GLHE 4HAUA 4JI3B 3T9IA 2AR9A 3R0XA 3P0IA 1FY2A 2BD0A 3C98A 4PLPA 1YHNA 1U94A 2XIXA 2CLHB 4ZXPA 4UE3S 3DD5A 4I0TA 5KMKA 2EAUA 4XCUA 3OPMA 4FYMA 1N3IA 1UDWA 3D5XA 4L75A 3G85A 4AMVA 2WHPB 1AB6A 3BKBA 3TD6A 1C14A 1FVOA 1G8GA 3ROQA 4MYGA 3H0EA 1HYHA 2UVPB 1QG2A 4B76A 1MTZA 4NCTA 2ZVDA 4BNGA 3U3MA 1RQPA 1N1G