5GINE

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
b'ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ginE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ginE02
5JFWA 2P4IA 3ZO1A 1IASA 2FB8A 4RTOA 4BGQA 4BTMA 2JKKA 4DBNA 2GQGA 3FMHA 4KSPA 2XK4A 4DAWA 2QRVB 4OR5A 3FI2A 2AOTB 4JX3A 5EI8A 3DPKA 1Q0SA 4ERKA 3QX4A 5HLNA 3ZM4A 3SOCA 5KBQA 4GVJA 3UIBA 1KP9A 4CKBA 2OB1A 4A9RA 4R3CA 2PUPA 3KF7A 3FPFA 3EFWA 4FSDA 2RFNA 3ZUTA 5EVJA 4WNKA 5HNIX 3E88A 1JQDA 3MFSA 4C04A 3EFJA 3VUDA 3RTPA 1CMKE 5ANIA 4D4RA 2IBTA 1SVHA 2BZGA 2UZBA 2DULA 2P35A 1B6CB 2PXAA 1LUFA 3H10A 3GQIA 3UIUA 3P2IA 2VV9A 1EJ6A 3B3GA 2OI4X 4G9RA 2B9IA 1DL5A 2PWPA 3EYGA 4Y95A 5JRSA 2YXLA 1MRUA 3LDFA 3FLSA 4EWHA 3WZKA 4I21A 3ENHA 4OBXA 4JIAA 3DA6A 3AT3A 3I5UA 2UW7A 2X9EA 4AQCA 5EEHA 4IVDA 5K0BA 2OG8A 4M3QA 4AGDA 4NSTA 4G16A 3PLSA 5EIFA 4Y5HA 4MXAA 1IG1A 3KXXA 4RLLA 3PWYA 2P33A 3GU6A 4FKIA 4GUEA 3TXOA 3DBEA 4R6VA 3OE5A 3MY0A 3I79A 1OITA 1UV5A 5CU3A 1VP9A 1V0BA 4BIDA 4KBCA 4ZXTA 3FEGA 1K3AA 2QG7A 5HBJA 4U9AA 3VUIA 3UMXA 1LEZA 1D2GA 2B7AA 3G8AA 2X8DA 3V5JA 4BBEA 4D55A 5DX0A 4CZUA 3AOXA 2CKDA 2RFDA 2Y4IB 4CFUA 4BDGA 3O17A 5BMMA 5DSTA 4YJPA 1FBNA 2QE6A 3R28A 3U9CA 2J0IA 3CD8A 2QOCA 3NSZA 3W2PA 3SC1A 2VTQA 3C1XA 2XK7A 1KSWA 4CKEA 2GHMA 4ALVA 1UWHA 3UWPA 1EH4A 5HIEA 4X2GA 3MAGA 4AA4A 5IMEA 1YF3A 5BP7A 3E05A 3UP7A 1PXMA 2XYNA 4Z9LA 3P79A 4AZTA 5GOZA 2PE2A 3RODA 3F6XA 4J7BA 3CP9A 5FRIA 2QR8A 5HIJA 1DM2A 2B25A 4FKTA 3KVWA 4M7IA 1XVAA 1RJEA 3HMNA 1U54A 2ESRA 2J9MA 4DFXE 1LPUA 5C8KA 3HCAA 4WNOA 5BVNA 3GGDA 5CEPA 4IW0A 3DGKA 2WOTA 5IPJA 2C6LA 3HVJA 3FQHA 3C7QA 2W05A 1JKKA 3Q87B 3DLZA 3F2AA 4RTSA 3GDHA 1INLA 4EK8A 4F70A 4AZVA 5HZNA 1SVEA 3MB5A 4M37A 5JH6A 4NK9A 5DT4A 3C4WA 5CAPA 4KWPA 5DNRA 4I6FA 3I60A 3GOKA 5L2IA 3IDCA 4D9TA 3QTSA 3QZGA 2I0VA 4B8MA 4YJSA 4RTNA 1VEBA 3VNTA 1PXLA 4YC3A 3PVBA 3TKYA 3HV4A 2BKZA 3FI8A 4JDIA 3KQMA 3NAYA 2W4JA 3UMWA 4N57A 4XH6A 1YHWA 1MQBA 3FYKX 3L8DA 3P86A 1WBNA 1JSXA 5LCJA 2PMLX 2AOXA 2O05A 5M4IA 1XDZA 5HGIA 4BP3A 1FQ1B 1IAJA 4X2NA 4F09A 4L3JA 1TW2A 4CFFA 3ERKA 4WUNA 3K3IA 3SQQA 3HM2A 3EVDA 4IDTA 3VW6A 2PUIA 2GTMA 2ZOQA 4B99A 4XCXA 5JZNA 3ZFYA 2J0LA 1ZKDA 4GF5A 4B7TA 4TPTA 4YJVA 5AV0A 1FP2A 1UNHA 2XKEA 3DQXA 3R7IA 4QT1A 2IZSA 3RAKA 3BLQA 4JBPA 3EL7A 2PVHA 2BDFA 4O0RA 3BE2A 5A3XA 5HLWA 4U42A 4PDSA 4CT2A 5CZIA 2WO6A 4FL3A 1M7NA 1Q41A 3UZPA 3R7YA 2RF9A 1YXSA 4RVKA 3G9LX 4ZLYA 4QMYA 3OZRA 3I5ZA 2NRYA 4AT4A 4C08A 2OIBA 3UJCA 5LR6A 1VR2A 5AEPA 4LL0A 4G6LA 1O6LA 2JEDA 3GP0A 3AG9A 5I9YA 2JHAA 3EB0A 5C0OE 3QWKA 1ORHA 4U45A 3KQOA 3IOPA 2JDOA 4K6MA 2GB4A 2O2UA 5AP6A 1ZMVA 2HWPA 3TWJA 2YQZA 3CTJA 4DM3A 3LXPA 2FRXA 5T67A 5E1DA 2VO7A 2E9OA 1YKRA 4RTRA 2BALA 4UALA 2B9FA 1L3RE 4QMOA 5CVJA 5K0GA 4L7SA 4MAOA 5A6NA 4YPDA 5CEQA 3UJ6A 3H9FA 4FTMA 3U9NA 4M36A 4G5JA 5F1ZA 3HDNA 3HNGA 2X7GA 4FBXA 2PMIA 4EOIA 5L6OA 3ORXA 3B7PA 3Q4CA 5CU0A 3AC8A 2Q41A 1YI3A 2QG5A 2QI8A 1X8BA 2EFJA 1XH4A 4V04A 2PYWA 4LMNA 3GI3A 3QRIA 3WOWA 3UOJA 1V39A 3FL5A 4K33A 5EW8A 1WXXA 4KINA 1OKYA 2VTAA 3LOKA 3FPEA 2EJUA 2XNMA 4DG3E 4JNWA 4EWQA 3FLQA 5DBXA 3U81A 2G2IA 5E1SA 2OZAA 4L7VA 3C4FA 3AMYA 4D58A 4HTFB 3ETAA 3TNPC 1J7IA 1ZYSA 2CMHA 3DTCA 2J50A 4QMXA 2HZIA 4GKHA 1I1NA 2WTJA 2X6DA 3IW8A 3R2YA 3TJDA 4DH5A 3LIJA 3DCVA 3NUSA 3HZTA 3Q96A 5HTCA 3C51A 3DNEA 5FA8A 1VBFA 4FT3A 3W2QA 3LFCA 3MESA 3ZUUA 2B52A 4WUAA 3LE6A 3KF4A 2WPAA 4BZDA 1G55A 4RX8A 2QU6A 5DR9A 3I7BA 4PYQA 3MYGA 2DS1A 3FLWA 3RNIA 4U6RA 3RHKA 3UGCA 5DOSA 5EQYA 3SG8A 2P1DA 5BUIA 4RTQA 2B78A 5F4NA 3VW8A 5HD4A 4IX4A 3TDVA 2B53A 2WMBA 3D94A 4QPNA 2PE0A 5DGZA 2ONLC 4OTIA 3E23A 4ZTHA 2YVLA 3ORPA 1Z3CA 3E7PA 5BUJA 3W16A 3KL8A 4BP1A 1YI6A 5KZ0A 4IX6A 4L3LA 2YIQA 3ZMMA 4EZ3A 1YOMA 5JT2A 3QOXA 1MJFA 1EG2A 4YJTA 1WBPA 4IHPA 4QMWA 3GXOA 2F7ZE 5CF4A 5AWMA 3F2RA 1DI8A 1SM2A 2XF0A 3DAJA 2ONYA 3AC1A 2BFXA 3DUWA 2HIWA 1ZYDA 2ITVA 2YCFA 2I0YA 3ZC6A 3BV2A 4QYGA 3MB7A 5TKDA 2PVRA 2ZB0A 1UKHA 4POOA 4A9UA 1WG8A 1ZARA 3RW9A 4FG7A 3GUBA 2IZRA 2H00A 2WTVA 3GC7A 1G38A 1GZ8A 4V01A 4PY1A 3G5TA 4BLVA 1KV2A 1TKIA 4X41A 5EZQA 4OX9Y 5IH6A 4HYUA 1JG4A 3SG9A 2V7EA 4TXCA 4TY1A 3ODZX 2Y4PA 2DYLA 4BCMA 7MHTA 3OXZA 1Z5MA 3M6XA 4AX8A 2VTTA 4C0TA 5E8WA 3DV3A 4G3EA 2XMYA 5IUIA 4BBMA 4PGGA 1GZNA 1OPLA 2G1TA 3G15A 3QD0A 4FOCA 2HCKA 3W10A 3QA0A 1IY9A 3SRVB 1WAKA 4O22A 3G0FA 3HV7A 4F0FA 3CPCA 3LQ3A 4F65A 5EQJB 4KDRA 1ZMUA 4UWYA 2XIXA 3SMQA 1IRKA 4YZ9A 4ZTSA 2XEYA 4YNOA 1YDSE 4I4EA 2BCJA 3LMIA 1WVWA 5EHYA 2Q0NA 3P9KA 1O6KA 2IO6A 5I4NA 3KQPA 1XR1A 2R3MA 4FYNA 4FT0A 5T68A 3LECA 4NH1A 4LYNA 2XIRA 2BM9A 2F4JA 2PXCA 3DLCA 2UUEA 3UO6A 3CGGA 4MK0A 2ZMCA 3S1HA 5DTMA 4O7RA 2ITZA 4F9BA 2J90A 3QYWA 3IDBA 4D2SA 4HG2A 4NFNA 5A54A 3EKKA 4L46A 3K5UA 3Q2MA 4X21A 3RM6A 1DS5A 4DE4A 5JGDA 3R7UA 3VJOA 2PZPA 4LWPA 4M7RA 1GJOA 5BVOA 1UU7A 2PVMA 4GOOD 2XNGA 2CKEA 1H0VA 2IFTA 4NTSA 3FZOA 5EGSA 3JY0A 3UJ9A 4OQDA 3R8PA 3MFRA 2ZM1A 4FL2A 1I4WA 1OIRA 5E7RA 5LOHA 1Z9XA 5D41A 4BDHA 3CBLA 5CNNA 4KIOA 4GFMA 4C7TA 4FEWA 3OE4A 4C4GA 3QA8A 2WTIA 1PMVA 2JLDA 3C13A 3CQEA 4KRGA 1U4DA 4AE6A 4ZEGA 4CG9A 3CJRA 3HTXA 2XKCA 2UYCA 4X3FB 3D14A 3DKFA 3AD4A 2VWVA 5M09A 2GFCA 5JMSA 3VS0A 4TYHB 4ZAUA 3L8PA 2YR0A 5LWMA 2JKOA 5HZMA 3ZFMA 2PKWA 3QUPA 2OF2A 4A7CA 3G9NA 4PINA 3D2IA 4JDHA 1MUOA 4ZSJA 5AUZA 3UJDA 3KMMA 4DHFA 5BVDA 3O8TA 2ZV7A 4E93A 3QFVA 3R24A 2JAMA 3FMDA 4PWNA 4NTTA 4FX3A 5DT2A 4PNIA 3TN8A 3OUNB 4AN3A 4K6ZA 4FIHA 5GINE 2ZW9A 4PUZA 2BRNA 4UX9A 4EK5A 4XLVA 3RP9A 4FSZA 1PHKA 4TT7A 4FT5A 2C5OA 3I81A 3DOGA 5DYJA 4LM5A 3G7UA 4HCUA 5KNJA 3OCBA 4YO6A 5P8WA 3R73A 3N4TA 5ETAA 4EQZA 1J7UA 3O7LB 4D9UA 4V0QA 2XJ0A 3R1YA 2VWXA 5FP5A 4EQCA 3F5PA 4JBVA 2I62A 1APME 4FOBA 4IM3A 2YABA 1XDSA 4AOJA 2C3KA 3LGAA 4FSWA 2BR3A 5HO8A 5TR6A 5T64A 5LVPA 1H00A 4E2WA 4CRLA 4O7LA 2PL0A 2E9UA 5H02A 4U8ZA 5FXSA 1SUSA 3WF8A 1KXZA 4DGNA 2I0EA 2CSNA 5KMMA 1L3BA 5KE0A 3W1FA 4JL9A 2C0IA 5BVWA 4ER7A 4PF4A 5EMJA 3VS4A 1VLMA 3AJDA 4G3FA 3DH0A 3A7HA 3ZRKA 3RPOA 5DPVA 3V04A 3I0OA 4H0NA 3UZUA 2C7PA 3MDYA 4FK6A 2B1PA 3PG3A 2QRVA 3CKKA 2AOTA 4FP9A 4ZTLA 5A6OA 3S68A 3FTFA 2CN8A 2YERA 5DRBA 3W2OA 4AXAA 4RFMA 4WIHA 3PS9A 4E73A 4GEKA 3THRA 1KYWA 3ZSHA 2C0TA 3E92A 3UVPA 4A06A 2W1HA 4GCJA 1H8FA 4CFMA 3TOSA 4M0ZA 1JG1A 3ZZEA 2CKOA 3VYWA 3KR0A 1M7QA 3CS9A 5U4XA 5ITAA 3HECA 4E4NA 3EQFA 4L6QA 5A4QA 1B39A 4ZTBA 3EVGA 2BDWA 4BN1A 3V5WA 2PSQA 2FO0A 2Y9QA 3DXZA 3Q9ZA 5HG7A 3T3UA 5KQSA 1U5RA 4RVHA 2ITOA 4RZVA 3RWPA 5CLPA 1Q8ZA 4G6OA 5J8IA 2EB3A 4ERWA 4CLIA 3OU2A 3COKA 4KKEA 3R3HA 4GRBA 3PFHA 2HWOA 3QC9A 5CNOA 5M57A 4GG7A 4O84A 4E30A 2UZNA 3R30A 3HA3A 3C3YA 3TFWA 5F9EA 5DRYA 1FVRA 4JR7A 3DBFA 4XV9A 1N7IA 3LX6A 2YZLA 3U6JA 4YMHA 5EHGA 2XNEA 3FPJA 4V0GB 3OWPA 1YZ3A 4JBQA 4CCBA 4D0WA 5HE3A 3EVAA 4BTJA 4NECA 4HYSA 4EC8A 2GLUA 4O7SA 3CC6A 4MD7E 2PUNA 4FGZA 3HV6A 3QTIA 4GJ2A 1JPAA 3HAVA 2XJ1A 5D11A 4J8MA 4F7SA 2ITYA 4R78A 3COMA 4G6NA 2P2HA 3V5LA 3B8QA 4XRLA 4E32A 3KULB 2WTDA 3DK7A 3ZLSA 3TV6A 4H3PA 4QQNA 4P4CA 3T3VA 4EQMA 5CF8A 4IADA 2R6ZA 1YXXA 4RSSA 2BUJA 2GS7A 5IA3A 5BYLA 2ESMA 4XV2A 1YDRE 5E90A 1WZNA 2C5YA 1XJDA 3D4QA 1M52A 4O27B 3TZ7A 4II5A 4GH2A 4G56A 4ZS4A 3LCKA 4ORKA 5H8GA 2C6IA 2PWLA 4G3GA 4P5ZA 2DPMA 2QCSA 3Q9XA 3EZVA 3LM0A 3NDJA 5K0FA 4RZWA 3JXWA 2PWYA 5EMMA 2Y1XA 5JUWA 4YU2A 1ZXEA 4XOZA 1I44A 4MTLA 3FKNA 3HA6A 4C4FA 4DLIA 5D7AA 3UYTA 1BUHA 4ZJIA 4MYGA 4YUZA 4G3DA 1T45A 2FYTA 5LVOA 3V5QA 5IUGA 1JWHA 1UNGA 4PGHA 2V22A 2J4ZA 3BQRA 3E7OA 4RX9A 3ZDIA 4GC9A 3UQFA 4GK2A 5KKRB 3ER8A 5IMXA 1KIAA 4OTFA 3VN9A 4QPAA 4GT5A 2R3QA 3EWHA 1KPGA 5DM4A 3QV2A 2UW4A 3PY0A 3U51A 2Z2WA 1N2XA 4MWIA 3QC4A 4MBJA 1OL2A 4RJ3A 3NLBA 2BDJA 2ITXA 4IIRA 1ZLTA 4PP7A 4BDIA 5CAQA 3ZEWA 3EN6A 4G9CA 3O23A 5LSAA 5K0NA 3FLNC 4IFCA 2YITA 2GQRA 3QQHA 4M38A 2W1EA 5CF6A 1AQJA 4ZSLA 3IPHA 3EPPA 4FIGA 3K6RA 4IFGA 3OFJA 3KN6A 4DA4A 1R0PA 3W2RA 3JWJA 3F4KA 3IOKA 4FZAB 4KAOA 4Y2HA 3VQHA 2OPBA 3WIGA 4AUKA 2EUFB 3GT8A 4DGGA 1I09A 5CAVA 5KKRC 2HNKA 1PKGA 4TYJA 1OR8A 4WA9A 1JG3A 2OBJA 3OROA 1X1AA 1Q4LA 5CANA 4UZHA 1JQ3A 4AOIA 5M4FA 4BF2A 5BVKA 3MPMA 4QO9A 3Q32A 5B2KA 4TWPA 3L8SA 3WBLA 4XOYA 2BZKB 4LGHA 2BZHB 3F7ZA 3FC1X 3FUPA 4FT4A 2E2BA 2GDOA 4IAFA 4L00A 2E5WA 3BHHA 5AUYA 5E8JA 4U3YA 3MTIA 3MVMA 2UW3A 3NCGA 4WD5A 5AUVA 4FVRA 4I0TA 5M07A 1J91A 2WA2A 2PVCA 1PRYA 3PA4A 4CFVA 2ZIEA 2QURA 2YX1A 2VTHA 3G2FA 5FUBA 4FYOA 2GHGA 3V6RA 2ORED 1SKMA 4KS8A 2XJ2A 3F2NA 3FSFA 4BZNA 4FTUA 5D1JA 5IQAA 5F2OA 4O81A 4KRCA 1CSNA 2QOFA 4F99A 1XH5A 1KE7A 2R3HA 2C7QA 3QKKA 3Q6WA 2ZCJA 2H9VA 3ACKA 2ZZMA 4PL5A 2JFLA 5HE1A 4P90A 2XVDA 4K2RA 4PMMA 4FKOA 4DEBA 2QONA 2HZ4A 2ONLA 4XP0A 4NM0A 4DTAA 4DZRA 4YUYA 3OWJA 2A19B 1Q3DA 3I9FA 5CU2A 5EZSA 2IDJA 3ELWA 4EI4A 3M1SA 3JY9A 4RWLA 2UZWE 2VTIA 3ORKA 3TDWA 4EBVA 2YXDA 5ANDA 5K05A 4ZSAA 2KTYA 4BI1A 4QP4A 5HBHA 2C6OA 3I5NA 1PJKA 3AD5A 3FMJA 2NP6A 1UNLA 5H9BA 5E91A 4E2ZA 1BI7A 4MF1A 4MXYA 2PV0A 5BUEA 5CU4A 5GM1A 2HTEA 4L44A 4RJ6A 3N9XA 2CGWA 3NUNA 4Q5EA 4RFYA 4EHZA 4GG5A 2YCQA 3F3ZA 3TJCA 2C3LA 3UA4A 5DM0A 5DPMA 4DGMA 1NBHA 4J97A 5KZIA 3AC5A 2JD5A 3P9JA 4RVLA 2YHVA 2ITWA 1X19A 3FUUA 2PE1A 2EG5A 4QP2A 4YC8A 3C5IA 3O8PA 4RTKA 4QRCA 3LJ1A 5FXQA 3B5IA 5FLFA 5HEZA 4BIBA 2IVTA 4BKJA 2JAVA 3PJ1A 5K5XA 3VS6A 4EONA 4JQ7A 3DFAA 5EW9A 3DQWA 1G60A 3NTVA 3O4FA 5FHRA 2B9HA 3ORHA 3ZTXA 2X81A 1KE6A 4PTGA 5EG3A 4U43A 1KR5A 4E2XA 5D9HA 3FPHA 1VE3A 3OY3A 2XRWA 4EHEA 3DULA 4PTCA 5CT0A 2WTKB 4AE9A 5DLYA 4XRJA 2E9PA 3ZRLA 1WCCA 5DRTA 3PYYA 5C8NA 5KUPA 5CQUA 3DXNA 3CKXA 4XHKB 4LG1A 2PZRA 4CG8A 3IGGA 3W8LA 5FEQA 4FKVA 3EEOA 3TIYA 3IYLW 4BDAA 5DI1A 3S95A 2EXCX 3C5UA 3DZOA 3SOAA 5JN2A 3HCCA 1RI5A 4HCTA 1W98A 2UW9A 3TTIA 2EX4A 5KX8A 4PWYA 5M55A 4YPSA 5LVLA 3HAMA 4U80A 2WMAA 3LKDA 4PYMA 3I53A 3RM7A 4QTEA 4D5KA 2QHNA 3I4BA 2HXLA 4X1OA 1Y57A 4DITA 2HZ0A 5LJJA 5K9IA 3UTOA 2O07A 3RHXA 2WMUA 3P7CA 5HCXA 4R3PA 3RPRA 2X4ZA 4BY9E 3KXMA 3G5LA 1RE8A 3KKVA 5IU2A 4OTGA 4FGBA 3Q4ZA 1W8CA 4FEQA 1XH8A 4MQ4A 4AW5A 3PIYA 3V97A 4CQEA 3ANRA 5HHWA 3IW5A 4M84A 2QODA 2PZIA 3CGFA 2QO9A 5EKNA 1SG9A 3I6WA 3KR2A 5B2MA 2HK5A 5IQEA 2G1PA 4NW6A 3TLJA 2LD4A 1R8YA 4R7IA 2IBSA 3BKBA 3R9DA 4TW9A 3MCZA 4RFZA 5CVHA 4IZAA 5E2BA 3UJ8A 4CZTA 2C0OA 3DDPA 3NWWA 3NWBA 4RA4A 1U5QA 1TW3A 2Z6AA 2PX8A 3OEFX 3HNRA 1QL6A 1KE8A 5E9QA 1R78A 4K18A 3OCTA 5M53A 1PXPA 3CKWA 4DEGA 4EYJA 5E8VA 5DHJA 4KVZA 3B8RA 2OZVA 3B3JA 4EQUA 4YLKA 4TYEA 1OMWA 2GNIA 2G72A 4KA3A 4MQ2A 4R5SA 2Q0BA 1ZMWA 1OKWA 2QQ7A 3P0MA 3NYNA 2ZVJA 4X3FA 4R05A 5FBOA 2OJJA 5CASA 4E6AA 4CVAA 4TKSA 4MEDA 3HMIA 2ZB1A 3OVVA 2ITQA 4U40A 3TV7A 1O9HA 3KEXA 2AC3A 3GU3A 4GBED 3JS2A 1V0OA 5TF9A 2R5TA 5AUTA 5T6KA 4FKPA 3DB8A 2ERZE 2I40A 3NX8A 3PB3A 3NPCA 3IK3A 3HRFA 4QMSA 3RK5A 4UZDA 5C8MA 1BX6A 2XNOA 5JQ5A 2WMVA 4MXXA 4IZ5A 3ET7A 4NKSA 1WY7A 3K2LA 3P78A 3BWCA 4RC4A 5EW3A 4LMUA 4HVDA 2O65A 3F5UA 3UJGA 3M6VA 4IE9A 3KREA 4M14A 1OB3A 4QP1A 1GOLA 5TT7A 4DT8A 3HUCA 2ETKA 5B2LA 4S2ZA 2GCDA 3MA3A 2YM8A 4GOND 3TUCA 4FE2A 4AU8A 4FKGA 2XKFA 5L8JA 4YP8A 2X39A 4L3PA 3PZEA 4IWDA 2BFYA 5BVFA 3P1AA 3W32A 1M0EA 1FJXA 3IECA 4O91A 1YWRA 2W4KA 5FTGA 3BHUA 2VO3A 2YUIA 2OH4A 3LDGA 4R3RA 2O8YA 1SMHA 3D7TB 4ZTMA 2CMWA 4C4IA 4ZTNA 3QKMA 2AOVA 3MTFA 1JQHA 1YW2A 1RI2A 3GCPA 3ZLYA 5FADA 2R4BA 4OBQA 3AC3A 2FPOA 2BHEA 2WELA 5AP7A 4M68A 3ROYA 4QMNA 3P5KA 4DG0E 4IH8A 2Z7SA 3WZJA 3I64A 4YLLA 3EVBA 3BPRA 5L8KA 2W5HA 2Z02A 2IZTA 4CV8A 5KO1A 5HICA 3OXTA 1OBGA 2NXNA 1R8XA 4CKRA 3RPSA 1TPYA 1Q24A 3CE3A 1AV6A 3R22A 4NW5A 3OBJA 2VAGA 4F08A 1OL5A 2WGJA 4CCUA 2J51A 3CJQA 1G8AA 2BKKA 3C4CA 3H3CA 4KSQA 5AM7A 3R9NA 3UO4A 3NUYA 1GZKA 3COIA 5AP2A 3C4XA 3P9NA 2VTPA 4NZWB 3ALOA 2QM3A 2ACXA 2ETMA 4E5BA 3VS7A 3TCPA 2O64A 1ZOHA 3DKCA 3D15A 4KDCA 3LQ8A 3POZA 1GIJA 4QYEA 3LBYA 3PE2A 4E1ZA 4YSJA 3I7CA 4I5HA 4O82A 2C3IB 4MX9A 5B1SA 3R21A 5CAOA 3BYMA 4E4LA 3BIZA 3GBZA 3EN7A 2HMYB 2G2HA 5HOQA 3C0HA 3CC8A 4C2WA 4AOTA 1QCFA 2ZTHA 4KIGA 3ORIA 3SX0A 4LQMA 2GNLA 4NUSA 2BRMA 1MHTA 4BZOA 2A4LA 2H34A 3FRHA 4R6XA 4IWNA 4S30A 4O0YA 4AP7A 2ZULA 3FMKA 2HV9A 1ZQ9A 4FS8A 4ZLZA 4WSYA 4PYKA 1YQJA 3UJ7A 3EQIA 3OZ6A 3CEKA 1WS6A 1Q0TA 4RRVA 5AUWA 3E62A 4DFLA 3TPZA 3VQUA 1F5QA 4ZS0A 3V8VA 1ZOGA 5AMNA 4O83A 4EOQA 4BDJA 2X7FA 4EZ5A 2HOGA 3ORZA 2VDVE 1V1KA 3BLHA 4WNPA 4MNEA 3HA7A 4NYEA 5E9JA 4V0GA 4BDEA 1NVRA 3KRRA 3V6SA 2WMRA 5EM5A 5HBEA 1TQMA 3BHVA 5J7HA 4E20A 3QHRA 4D0XA 4KWCA 3LKMA 3D5UA 1ZYJA 5KS2A 2CCIA 2CNQA 1XHAA 3ORNA 2ZVAA 2EU9A 5IDPA 4H36A 1F0QA 4IZ7A 4FTNA 2HZNA 2O3PA 2JDTA 3QQKA 1KOAA 3KULA 3LJ2A 4YTCA 4QTUB 3CR0A 2ZV9A 4L7FA 1RW8A 1O9UA 2VDWA 2BRGA 3FI4A 5CSXA 3ZCLA 4RIYA 2PBFA 1PXNA 4A4OA 4PMPA 2XYRA 5FWAA 1URWA 3H0YA 3OCJA 5F20A 3ELUA 4YZBA 4O7WA 3TKAA 2C68A 3LFFA 4I41A 4ITHA 1Q8WA 2FGIA 3OFKA 2BAQA 3HGKA 4F85A 2BIKB 5ICCA 3OFMA 4P7FA 5CVDA 2WIHA 3LM5A 5CCBA 4XCUA 1KHHA 2ZAZA 4RGJA 4EMSA 2VWUA 2YWVA 3P2KA 3Q3BA 4K11A 3UIMA 2QHMA 3GEQA 1B38A 4EK3A 2V0DA 1YOLA 4KBKA 3T0IA 5IH4A 1U2ZA 2QNJA 4RJ4A 5HIMA 2PULA 2B9EA 4GU6A 1GZOA 3QGWA 5EOVA 5DR6A 4MBLA 3PPKA 3KQTA 5D10A 1STCE 4LRMA 4QNAA 1AGWA 3PA5A 1DCTA 4Y73A 2FUMA 4RIWA 4WVLA 2C69A 5F94A 4FTJA 4FTOA 3UNJA 4YO4A 4YJQA 3E3BX 4H05A 1A06A 3IDPA 1OZ1A 3AD6A 5HESA 1NW3A 5KMLA 2EWAA 4FZDB 4GUBA 4YUXA 3HCEA 5L8LA 2GNGA 2CCHA 3B89A 2WKMA 2X8IA 3U4WA 4FMQA 3UJAA 3DJ6A 5ANOA 3KPJA 3TIZA 2PVLA 3P71T 1YDTE 3HMOA 4XNEA 2X0GA 5GWXA 4JS8A 1NW7A 4RVGA 2YM4A 2GAFA 3WIKA 4G2FA 5AADA 5DE2A 4DH1A 1OL1A 5E8RA 5AAGA 3AT4A 4CSVA 5KYGA 3LPMA 2QOBA 2YIXA 4M97A 5A4LA 4F9CA 3ANXA 5EMKA 1ZGAA 4OA5A 3ZXZA 4CNHA 4TWNA 5E9EA 3E5AA 3UP2A 1J1BA 2BTRA 2UVZA 3ODYX 3A27A 3N51A 4DEHA 4IB0A 3A26A 4LRJA 1FMKA 2IP2A 4NFMA 2ZBRA 5E1EA 1BI8A 4Q2AA 1WXWA 2VTJA 2GS9A 1NW8A 1JSVA 3LW0A 2OXTA 1XBAA 4P7EA 1SVGA 4P5QA 4FIJA 5CWZA 2BR4A 3CXWA 2VZ6A 4U7PB 4E7WA 2C1AA 4JDKA 1BKXA 1ZGJA 3A61A 2GS6A 4CEGA 3ERCA 3RAIA 3WARA 2JHCA 1S9IA 5ICGA 2YWPA 3PFQA 1WBTA 2R0UA 5DXJA 5DLSA 3KPUA 1SVUA 4FEVA 1VPTA 3L8VA 5CEOA 3GOPA 3UE4A 3EL8A 3OD6X 4QTDA 4X6QC 1XBBA 3A7IA 1BL6A 5AIRA 4DCMA 3ZO3A 2VTOA 3PY1A 4M8TA 5CVVA 3Q9WA 2UYOA 5HQ0A 4Q9SA 3KPYA 2IW9A 3BKWA 4M12A 4EKIA 4F4PA 2BAKA 2WOUA 3ZXTA 3FUVA 5M5BA 4FV6A 4M67A 2P8JA 5IEYA 1PMEA 5I9WA 2XBMA 3FDNA 4MH7A 5M44A 4NCTC 4PMTA 4E31A 3TACA 3PPJA 3SXRA 3DR5A 1Q8UA 3BEAA 4AACA 1ZOEA 5HTBA 4AGCA 2BILB 5DX1A 3QBNA 2R3LA 1GY3A 2ZBPA 1R0EA 4FKSA 3SV0A 4X2FA 3OBGA 3AXSA 1QPDA 2WMQA 2DUVA 3GJYA 3LL7A 5C27A 4OTQA 5IKMA 2B55A 2XRUA 3FUXA 2UYHA 3ENMA 3UNKA 3WYYA 3A8XA 4E4MA 4F0GA 5F2NA 5AP3A 2GH1A 4GQBA 4F84A 4HH4A 4QP3A 3A7DA 5J87A 3PY3A 3OXIA 3FPMA 5IQHA 4XUDA 1P91A 3PVCA 3HMPA 2ZSUA 2OZOA 3PX3A 1WFCA 1BOOA 4G31A 4ACMA 4PTEA 2V62A 4HGEA 1YOJA 4F1TA 2R2PA 4PV0A 3T9TA 4IWOA 2QLQA 3GU4A 5I9UA 3KFAA 1VIDA 1D2HA 5E2AA 3DAKA 3PPZA 3SLSA 4EH9A 1XWSA 4DFYA 8MHTA 4X0MA 1MQ4A 3UVQA 1JKSA 3G2QA 3A2CA 2PT6A 2PX5A 3JVRA 5E9WA 4JRNA 2DWBA 1S9JA 4Z16A 3FV8A 2WU6A 5IQFA 4DFNA 3QQUA 4YHJA 3W2SA 5EKXA 4E2YA 3HA5A 4LV5A 2PY6A 3P8ZA 4XG8A 2OKCA 3PXQA 5DT0A 5FG8A 1W82A 3VUMA 3KR1A 3R8VA 2IH2A 3TNWA 4QTAA 5B7VA 5J1WA 2F2CB 3VSEA 3NMUF 2P40A 2FSOX 3LFQA 4LECA 4GVAA 5CTPA 3HA8A 3V8SA 4X61A 4A9YA 2IH4A 3FSKA 3HCDA 4FTTA 1XXLA 1OKZA 2V55A 4HGZA 3QCSA 2BH2A 5KHWA 3MPTA 5DA3A 3FLZA 5BW5A 2JH9A 3EMDA 4IKPA 3ITZA 3A4OX 2IJMA 2VWIA 2AZTA 3QX2A 3R9OA 1BMKA 4EOSA 5KCVA 2ZZNA 2QOLA 3VBTA 4DF3A 3OW4A 1ZAOA 4F6UA 4F9YA 4F64A 4GIHA 5HU3A 1XCLA 3GC8A 4CLJA 4UEUA 5IQDA 3LSTA 3QALE 3HUBA 1ATPE 4QDJA 3C9WA 3HRCA 3RKBA 3W55A 2FSLX 3BGIA 1ZZ2A 4D5HA 4IVBA 2ZIGA 4ACHA 3OWLA 1JTEA 3LMHA 4FR4A 3K3JA 5ANGA 2W96B 4DT9A 4AS0A 4YBKA 4ZY5A 5C9ZA 4QMTA 3TEIA 4I3ZA 3BU5A 4W4YA 4G5PA 5IA4A 4EOLA 2R3GA 1CKPA 4I0RA 4P7JA 2REIA 3NWEA 4DQ0A 1XJ5A 4QYHA 3C4ZA 3PSDA 4F6WA 4W8EA 5H8EA 2Z8CA 5FXRA 3QQJA 4K1BA 3HMMA 4TWCA 3G8BA 4PL4A 3DBCA 4XG9A 3HVKA 1IM8A 2CGVA 4ER0A 2I6LA 2XK9A 4EOOA 4C62A 1T43A 2H96A 3D9VA 4D1SA 4AGWA 4QTTB 2OU7A 3KB7A 3KXGA 4BVUA 1OL7A 2PMNX 3L8XA 5A14A 5AP5A 5CEIA 2UZDA 3UC3A 4R7BA 5FTWA 4PDOA 4R8SA 4OUCA 4BCQA 4L42A 4MD8E 4DYMA 2O57A 4QVGA 2CN5A 3VS1A 3WSTA 4CMUA 4CWAA 2XB7A 4AN2A 1XO2B 2JDVA 4XBRA 4FG8A 3PDTA 4AWIA 3AXTA 1F3LA 2UZUE 3OCSA 2XM8A 4XG3A 3UC4A 4M69B 4KIFA 1QANA 3SGCA 3SX9A 2ZIFA 2AN3A 4JJRA 4FKQA 4FICA 5DR2A 3QL8A 4LOOA 3U87A 1L3CA 2XEZA 3V01A 3NS9A 5IZFA 4IM2A 2Z6QA 3EVCA 2WXVA 3HLLA 3R2BA 1FPQA 3JWHA 1OI9A 5AUXA 4FSQA 3O71A 5C03A 5J9ZA 3R83A 2AOUA 4PIPA 3BYOA 3DLIA 2YM6A 3KN5A 4KUJA 3FWQA 1J3HA 2BAJA 4HGSA 4CXAA 3K54A 3BWMA 3R0TA 2BTSA 3E7VA 3DP7A 4QP6A 1U46A 2FH9A 2HWKA 4XG2A 3D2KA 3E8NA 2C5VA 2Z6UA 3Q4TA 3TNQB 5EOBA 2C6KA 1P2AA 2W5BA 3BGPA 1YHSA 1CDKA 3NW6A 5AAFA 3PZHA 4IQ6A 2BR1A 4CTBA 4LFIA 3HP7A 3EVEA 4XMOA 3WF7A 4DEDA 4FSRA 1TVOA 4E6CA 4XG7A 4RIXA 4W4VA 3G6HA 4O0VA 2YAAA 3NNUA 1Q5KA 3MH0A 3ROCA 4EK4A 2HW6A 4AAAA 5DXAA 3Q53A 3NVMB 2OIQA 3D7TA 3NRMA 1H01A 3RJCA 2C3JA 4CTKA 3OTVA 4C59A 3FY2A 3NUUA 5AJQA 5LVMA 3GCSA 4QP8A 3FRIA 3LCUA 2Q83A 3DXYA 4O86A 3TRKA 3W2CA 4YJUA 2PT9A 2XNNA 2Y1WA 3A8WA 4ZK5A 2B3TA 2PU8A 1YXUA 2H11A 2F8LA 1H1WA 4BLUA 1NV8A 3R8ZA 3QHWA 5CALA 1P39A 2VU3A 3VAPA 3Q52A 3CCFA 2B0QA 3P4KA 3SSMA 3G90X 2W9FB 3GQLA 3FI3A 1OL6A 2R9SA 5FP6A 3PXZA 3R6XA 4YMJA 3JWGA 3P7BA 5G02A 3QD2B 2JBPA 1CTPE 3M42A 3NUXA 1O9GA 3ZOSA 4O6LA 3KK9A 4HVSA 4JT3A 4V0RA 2JDRA 3O2MA 1Y91A 5EQPA 3A7GA 5FQDC 5DX8A 4ENXA 2ZBQA 4EBWA 3BYSA 3MVLA 4X3JA 5EIWA 3KXZA 3TT0A 4BCJA 2YCSA 4P2KA 4XEYA 3JYAA 5A4CA 5EHLA 2X2MA 3AMAA 4PQNA 1NW1A 2F2UA 3EKNA 5ETIA 5HU9A 4Z7HA 3WILA 4EOPA 3QUDA 3A62A 3SD0A 5ICPA 3G5DA 4RWJA 4C2VA 2IG7A 4KIPA 3C0KA 4TTHB 1KE5A 4BDKA 3FLYA 3GFEA 3MW1A 4HSGA 3ANQA 4FSYA 2H8HA 4LOQA 4IX5A 3G2PA 5AM6A 3FYDA 3WE8A 3VBWA 3PSBA 3QUEA 1OIQA 2YA9A 5CENA 5LQFA 5C1QB 4FKUA 5HX8A 4C33A 3JR1A 1H25A 3Q60A 1LR4A 3MVHA 4O96A 1JG2A 4IJPA 3W33A 1RJGA 4JAJA 3CD3A 1PKDA 3ZYAA 4YZCA 2XK8A 4FUYA 3HKOA 3OT3A 5AV4A 5J1VA 4FGRA 1KPHA 4ZP5A 1QPCA 3AY0A 3K0BA 3BKXA 4IAKA 5HG9A 3LQ5A 3L9MA 2F49A 3KU2A 3GRUA 2VTLA 3C0GA 4DMGA 2A14A 1M6EX 2AN4A 4EH2A 4IMYA 1KOBA 3BELA 2CNVA 2K4MA 3H30A 3M6WA 5AIKA 4PDPA 3G6GA 3R9HA 2OBFA 4PYJA 4CMOA 2QC6A 4I24A 2N47A 3R7VA 4UWBA 3KY2A 1Y8CA 3D5VA 3UA3A 3TM4A 5BYYA 2UZTA 2F57A 2F7EE 4XG6A 4GK3A 2J0KA 2UVYA 4TN6A 4J53A 5I9ZA 4YJNA 4FIIA 4UWCA 2XM9A 3AT2A 2UZLA 3P23A 4RPVA 3EIDA 5FCDA 3PVUA 3W18A 4D1ZA 2ZJWA 4EKGA 4F1OA 2Z60A 4DFZE 1E1VA 3V5TA 4AGUA 2VZ9A 3MI9A 4FT9A 4O7ZA 3ZHPC 3V3VA 2O06A 4ZY4A 4C36A 3MJ1A 5EEGA 1Y6BA 5EYCA 2QOOA 4KKGA 2XNBA 1J1CA 3E8DA 1W84A 4C3PA 3OZSA 3P2EA 2PX2A 4BCKA 3IGOA 3VWAA 3KGAA 2KW5A 4U81A 4F9WA 4QMQA 2AS0A 4RTPA 5CZHA 2UW0A 3IEIA 4FKRA 4JG7A 3OEZA 4O7NA 4FV2A 4ASXA 3EMGA 4D2RA 1H27A 3EVFA 1R6AA 4AZWA 2IVUA 4HYHA 2UYQA 5GP1A 4ENYA 3FTDA 4R1YA 3FXWA 3WZEA 2YDJA 4I6BA 5CVEA 4Y83A 4BHNA 3U54A 5ANJA 3CY2A 5KMIA 2WEIA 2FK8A 2W4OA 1WBVA 4KKHA 2R3PA 4GMYA 5E8SA 4GFGA 1X1BA 5M08A 2EVAA 3IO7A 4AT5A 3F3WA 4MNFA 5HNBA 1E9HA 4MXOA 5DH3A 3QU0A 4FSNA 3JPVA 4LUEA 2VX0A 1A48A 1V0PA 2VGOA 4JI9A 1JSTA 2WFYA 5ANKA 4I5PA 3QXOA 5IQCA 3HX4A 2OK1A 3JVSA 3FUTA 4CXMA 3FZGA 4H58A 4IZYA 3BBTB 3T7RA 4RWKA 4G34A 2YISA 2PVYA 1UVRA 3REOA 4DG2E 3BI6A 3DZQA 3SDJA 3EJ1A 3OCGA 3BGQA 5CI7A 4JRVA 3GVUA 3LXKA 1H07A 3VS5A 5IEXA 3O8UA 1JSZA 5LMKC 3D5WA 2OLCA 5FDPA 2IN6A 3ZBFA 4B9DA 3F3UA 4RVFA 4TNDA 4RBLA 3V8WA 2FYSA 4DC2A 4Y85A 4C38A 4I22A 3BZBA 3QCQA 4NCTA 2A2AA 3OZTA 4GJ3A 4HPUE 5CSVA 4DCEA 4DH8A 4FVQA 4C3RA 3LLTA 4YTHA 2GHLA 2OB2A 4MIKA 2GNHA 4N6ZA 3L1SA 4AA5A 5LMBA 5IQIA 5CXHA 3RPVA 2FA2A 5HFJA 1WZYA 1Q8TA 4AW2A 3M2WA 5EHIA 3KQQA 4A4LA 1M17A 3I58A 1R1WA 4XP3A 4ZJJA 3KXNA 3DKGA 3BBWA 2G9XA 3TNIA 1D2CA 5AV2A 5KHXA 2YIYA 2HR1A 3QZHA 3CJFA 3FQSA 2RL5A 4APPA 3FXXA 4PNKA 4HYIA 4J52A 1VYZA 3BCEA 2PGXA 2R3FA 3RALA 2FSMX 2YAKA 2W1ZA 5DN3A 3MWUA 1R39A 4MVFA 4GYIA 5G1XA 1H24A 2C6EA 3F61A 4ONAA 4RTLA 3FMMA 1NV9A 5JSMA 4L67A 4ZTRA 3GC9A 5EFQA 3RCDA 4L53A 4QQCA 2BZJA 2PMOX 5K0EA 4RTJA 4GYGA 2Y0AA 1HMYA 5B0XA 1OUYA 4QVKA 3QAME 4X60A 3QXPA 3FPQA 4USEA 3SHEA 2CDZA 1KE9A 1GIIA 4FEXA 3HEGA 1F38A 4UBAA 2WZJA 1VZOA 1SYKA 4XBUA 4ZTQA 1MRVA 4OBOA 2UZVA 4FG9A 1FP1D 2ZLBA 2PJDA 5IDNA 3N4UA 2QOKA 1PXKA 2BPMA 4USFA 4JDJA 2GSFA 3R71A 2YXEA 3BQCA 3Q04A 3IS5A 3QD4A 4EUUA 5E8TA 4Q5HA 4PIMA 3M4XA 3UBDA 2O63A 4FT7A 2R3KA 4R1VA 4DLJA 2WQOA 2EXMA 1G8SA 1REJA 5IQBA 3U6HA 4FSXA 5TO8A 2R0IA 1NKVA 5I9XA 4N6YA 3VHKA 4QPPA 2BRBA 2H6DA 1NE2A 3BWBA 2VTSA 3FQEA 4B4LA 2R3IA 4JOAA 2VO0A 3RIEA 3WYXA 4L45A 5HG5A 3KXHA 2O0LA 1BKYA 4I4FA 3P7AA 1LP4A 1XCJA 4EJ7A 3FPGA 2XH5A 4OGRA 5F2KA 4RC2A 4MNEB 2IZUA 5BXYA 2YEXA 1DAWA 2WD1A 3DY7A 4FIEA 4CFNA 1W83A 1YXTA 2WMXA 3QF9A 2CKQA 2R3OA 4MBIA 3UPZA 2OO3A 2J5EA 1PYXA 4WXHA 2IGTA 1LEWA 4DEAA 5IG1A 5HVKA 4GS6A 3C50A 3TMAA 2JGZA 4DEIA 2PVFA 3NW9A 4EL9A 4YNEA 4UOEA 4LRKA 4RIYB 3UOLA 4FV3A 2QO7A 3U6IA 2YDKA 4DCGA 2UW6A 4ISCA 3FMLA 4UXQA 5AV3A 3BWFA 3UDBA 5J9YA 4OTRA 1FMOE 2VUWA 4U5JA 2Y4IC 2QOHA 1OVEA 4CMTA 1UKIA 4C4EA 3HP5A 4C05A 1RJBA 2WQMA 4FV4A 2P7HA 3REPA 3DB6A 3OU7A 4J71A 4CV9A 3GRZA 3KKZA 1NA7A 5IA5A 3TZMA 3QRJA 4DA5A 3MH1A 4IC7A 4QYFA 1KYZA 3LVPA 4FTLA 3PXKA 4F9AA 2JDSA 4C58A 4GK4A 4OT5A 1JOWB 4UXLA 2P2IA 2IWIA 4UN0C 2YDIA 5GHVA 2XUUA 4J1RA 3DMFA 4UV0A 1JSUA 3BHYA 4GIIA 5HKMA 2GMXA 4BDFA 4RIWB 1O54A 2RKUA 1K9AA 4FI1A 1DUSA 3KR9A 3NVKI 4K9YA 2J2IB 3OS3A 1Y8YA 2OH0E 3P97A 3MERA 3SSOA 5AX3A 5M4CA 4K8AA 2OSCA 2CWWA 3DXPA 4LOPA 2PVKA 4WT6A 3PRIA 3BGZA 2VX1A 3VRZA 3ID6C 5DM2A 2YACA 2RGPA 3TUDA 4Y46A 3DT1A 3SXFA 4AFEA 1Q8YA 3SXSA 2G71A 4ANQA 3C6MA 3V5PA 3MIAA 3DU8A 4FNXA 3QKLA 4J99A 1E1XA 5EDPA 3GRVA 2WQEA 5LXMA 4WHZA 2AR0A 4U44A 2OF4A 1YZHA 5L3AA 1I9GA 4YTFA 4QMMA 4GC5A 2GQSA 4MD9E 4ZJVA 3ZSGA 3MHTA 1WBSA 1Q99A 3CY3A 4RSRA 1KV1A 1PW2A 3GXLA 5AP1A 2IIPA 4BCOA 3Q4UA 3VUGA 4XUFA 3UZRA 3QZIA 2A27A 2I6GA 5FQNA 5AA8A 3KHKA 4GKIA 3G51A 4H3BA 4QMZA 3MJ2A 3QTWA 2W0JA 5HVYA 1OIYA 4HVGA 3QTQA 5A4EA 5EKOA 5FHQA 2Y7JA 3FYJX 4AN9A 3C0IA 4IWPA 4C4HA 3AC4A 4GW8A 1XH9A 2FHPA 4IBMA 4U41A 4C34A 4TL0A 3UZTA 3UG1A 4A07A 3SKCA 5LARA 3I6UA 3VRYA 4P7GA 3II5A 5L6PA 2OY0A 4ZSGA 3FKLA 4QTBA 2RG6A 4NKAA 2XVAA 3VHEA 4L68A 5DM1A 4PNEA 4ACGA 4HZRA 1BLXA 4ER6A 4B17A 3M70A 3LZBA 3L9LA 4X63A 4BB4A 5EMLA 4AF3A 5HE0A 3LCCA 4HNIA 4FSTA 3DXQA 4IC8A 4U79A 3RI1A 4WRSA 2YN8A 1H1SA 5BVEA 4G3CA 3FC2A 4OTDA 4QMUA 5IISA 4R7HA 4EHGA 4BRXA 1XDUA 3LFNA 4HJOA 4G1WA 4N70A 2C6MA 1ZWSA 4S31A 4Y30A 4LWOA 4UY9A 2W17A 2LGCA 4QDKA 2C5NA 4YJOA 4KIQA 4OBPA 3MGYA 5HIDA 5CF5A 3AC2A 1IEPA 3NIEA 1EAMA 1RI1A 4APCA 3CTHA 4EOJA 3RZBA 3EQDA 1OIUA 3EHAA 2CGXA 4EZ7A 4MKCA 4ASDA 4DGLC 5J95A 1RI3A 4MHAA 5IF1A 2C7OA 4IACA 3EGIA 2PUUA 5ANEA 3TUBA 3KRWA 1UU3A 2AOWA 3AXWA 4GT3A 3MH3A 3EFLA 3EOCA 3OUKA 1PMNA 3QGYA 3F7WA 3PJCA 4XUCA 1OPJA 4DTKA 4ZOGA 3EQPA 3QLFA 5M06A 5GIOE 2YJRA 5K5NA 2WTWA 5AV1A 4CFXA 3C4EA 4FTKA 4FTQA 2WTCA 1R18A 5AUUA 3LFAA 1AD5A 3NNVA 5CU6A 2WQNA 4DCAA 4E70A 5HORA 2VTMA 4Q9ZA 4NIFB 5M56A 3VUHA 3ZO4A 5FEDA 5HO7A 3E8EA 1PJZA 4FNZA 2W1IA 5FBNC 2ZDUA 3AWIA 2XZSA 2R3JA 3KCFA 4YLJA 4MWHA 4EK6A 4HGLA 1VJYA 3ZUVA 2W9ZB 2UW5A 2P3OA 3DBQA 1L9KA 1PMUA 1PF8A 4RVMA 3KQVA 4CKIA 3LPBA 4R5YA 4O0XA 2YM5A 4YUWA 3QQFA 1H0WA 4PX6A 4BTKA 4ANMA 2AUHA 4BR3A 1M2QA 1IA9A 4TZRA 1R00A 1NW5A 2HENA 1OPKA 4EOMA 3QTZA 3D2LA 3MQ2A 4YMGA 5LVNA 5IA0A 4B8LA 1TQIA 5CM2Z 3EEYA 3VBVA 3HCBA 2P3LA 4OA8A 3DOUA 3BEGA 4S32A 3PJ3A 5FTQA 5EC8A 2ITUA 1QMZA 4AZFA 3AQVA 3LCOA 3DTNA 3WF9A 2GPYA 4HGYA 4O0UA 5I5ZA 2P3GX 3RPYA 4C4AA 1TQPA 3O0GA 1ND4A 4KD1A 3ULZA 3IONA 3PE1A 4PYNA 3VF9A 2G8NA 1HOWA 3HV5A 2PTKA 5K8VA 1YHVA 4U7TB 2RFEA 3R8LA 4ANSA 4LUDA 4LGGA 4BDDA 5DTRA 2OXYA 3MY5A 5E1OA 1H1RA 4D4YA 4RIOA 2R3SA 3EVZA 3PTGA 1G6Q1 2PVJA 4FC0A 5L2TA 5HE2A 4R8RA 4WBOA 1JVPP 5BYZA 1YI4A 4H39A 2VWBA 2VRXA 2NXEA 3SW4A 4IB1A 5D12A 3TR6A 2UW8A 3NUPA 4CT1A 5CVGA 5HIIA 4YURA 2OJIA 3UJBA 5HG8A 3TM5A 2XCKA 3I1AA 4PL3A 2VD5A 4FV9A 1SQFA 3OHTA 3FZSA 4IV0A 3RAWA 3VULA 2OIDA 4QMPA 4BCIA 3G2MA 4BGHA 4GOLD 1T46A 2WK1A 4LG4A 4QPSA 2VWZA 2NXJA 4O29A 3FTCA 1FINA 5FTOA 5IA1A 4YUVA 4KW7A 3NZ0A 2VN9A 5L6WL 1HNNA 3BE9A 2HW7A 4TNBA 4JX7A 4RVDA 4TYGA 2XBJA 4B6LA 4AW1A 2QOQA 3VF8A 5FA5A 2ZWVA 5JZJA 1H1PA 4W8DA 3NNWA 4YZMA 5JGAA 3PG1A 4RX5A 4O2PA 2NYUA 3CSVA 1EQAA 3BV3A 4IAIA 2QLUA 5DFPA 2P7IA 5LMKA 2Y8OA 4MWZA 3AGMA 3S2PA 1BYGA 3OWKA 4QTCA 2J5FA 3VC2A 3JWIA 4FUXA 3B2TA 5EI2A 3TKIA 4WOVA 4RV9A 1R74A 3CLYA 2Z7RA 4WG5A 3RCJA 3OT8A 2GNFA 4XUEA 3MPAA 4ZZMA 3R00A 3MS9A 5K0CA 3KC3A 2YIWA 5DTQA 2BVAA 3V51A 3KU1A 2OYRA 2I1MA 5GJFA 5LMAA 2BIYA 2B54A 2AVDA 4U7ZA 3GNLA 4MTAA 5JRQA 2AOUB 3JUHA 2OXDA 2J7TA 3UYSA 3LFDA 1ZY4A 4BLWA 4DKJA 5GJDA 3KMWA 3OG7A 5EKUA 3ZEPA 1QAQA 3ULIA 4BCPA 2QOIA 3SXJA 5HVJA 3OP5A 3VUKA 3A4PA 5E1BA 4U3ZA 4FTCA 3T9IA 3ER9A 4F1MA 4DEEA 5LQAA 4FV5A 1SQGA 3QLGA 5JR3A 1H28A 4I0SA 4A6DA 4ID7A 4X3FC 4RTMA 2QU5A 2VDUE 3LJ0A 5E8YA 4XYFA 1DI9A 5LQJA 3ZM9A 4RIXB 4ANLA 5LQRA 5K4JA 2E9NA 3ORLA 4FT2A 2VNYA 1UWVA 1XQZA 3MV5A 2PVNA 3DDQA 3D0EA 3MFUA 4FZVA 4GFOA 2X7OA 3KVXA 4BI2A 5FGKA 4GOMD 4YR8A 2QKWB 1U59A 2JC6A 3ELJA 4I93A 3NCZA 3F9NA 1QPJA 4FV1A 4NU1A 1SZMA 1Y8GA 2PZYA 2CKPA 2VGPA 3UVRA 2YIRA 3FZ1A 4KNBA 4ZLOA 4Z2YA 5K03A 2IH5A 4JG6A 3QTXA 2W99B 1AQ1A 5C9CA 1YFJA 2HELA 2I7CA 3LXLA 2NNWB 4E8AA 3G89A 5GIPE 3GGFA 4PP9A 4EH6A 4LI5A 5K01A 5CS6A 4OTHA 3BGVA 2YCRA 4O0WA 4RLKA 1KWPA 3BWJA 4A4XA 5DT3A 3R8MA 2QD9A 2FSTX 2ITNA 1JKLA 5EM7A 1JQEA 4QQKA 3Q5ZA 3PA3A 4RMZA 5BX0A 2B2CA 4M13A 5CAUA 3QOWA 3LHDA 1HCKA 2CLXA 2X1NA 4XP2A 1IA8A 2R3NA 4YSMA 4EH4A 5AAEA 3HP2A 5CI6A 3LCDA 4CGAA 4WG3A 1J7LA 3RAHA 4F0IA 3CJGA 3ZDUA 2ZMDA 3NUAA 2CHLA 2ITPA 3FL4A 3N4VA 3DMHA 2G15A 1VQ1A 2JIVA 2QYOA 5J9LA 2ZV2A 3FY0A 3TKHA 2CL5A 3GENA 3LDUA 4EH7A 4EYMA 3CQWA 3PXFA 3A99A 3NW5A 4D4VA 3CQUA 4ATNA 3FMNA 3FKOA 2OJFE 3QTRA 3QCYA 5ICFA 3E3PA 1XKKA 1KPIA 4ANBA 3DFCB 2VWYA 3VBYA 2GTNA 2OFUA 4FODA 3QRUA 3I0QA 3EN9A 3ELDA 4EK9A 1SUIA 5E8UA 4JQ8A 3SAYA 2ETRA 4CTJA 5ICEA 4XLIA 4EKKA 3ZO2A 1UWJA 3KMUA 4JLCA 3DK6A 3OMVA 1EJ0A 5E92A 4BICA 4RJ7A 3VJNA 1N7JA 1QYRA 4L52A 3THBA 3PIXA 3A60A 4WO5A 2YTZA 3A7JA 4JR3A 2OW3A 2R7BA 5LQCA 4QMLA 1QAOA 2YM7A 2VO6A 3MGGA 1FGKA 4BDBA 3P08A 1ZG3A 4PCAA 4V05A 1H4LA 3CBGA 3GFWA 4FTRA 4FEUA 4Y5QA 2J6MA 3H9RA 2I9KA 2V5QA 1KUTA 1K2PA 1PXOA 3C6KA 2OJGA 1Q62A 2OKRA 1H1QA 3NDIA 1HCLA 2PZ5A 4HVHA 3OY1A 1Y6AA 3DJ5A 1OM1A 1RJDA 3ATSA 3KQ7A 5HNGA 4ZIMA 2O0UA 3GCZA 3EQCA 3KRXA 4HW7A 3HCFA 3O96A 4O6EA 3F66A 4CFWA 3QD3A 4BIEA 3KCKA 5DEYA 4A9SA 3NR9A 3B3FA 3TL8A 4QNYA 5E8ZA 4WG4A 5K3YA 3UIXA 5DWQA 4EORA 3SSNA 2ERCA 2VTRA 4O0TA 4DFUA 3NIZA 5TOZA 1YRPA 3HRBA 3GB2A 2P41A 1XBCA 4RJ8A 3KRLA 4AZEA 4E5WA 3ZFXA 1CM8A 3HL7A 2E9VA 2X8EA 2XKDA 4YGAA 2EB2A 3ATTA 5CX9A 5LCKA 4PCLA 3H0ZA 4EUTA 5AA9A 5EQEA 4BCNA 4GV1A 4N0SA 2R64A 3A7EA 5EOLA 2PX4A 1L1EA 4RX7A 1R3CA 3UBTA 4QOXA 4I20A 4BTFA 4PDYA 2C1BA 2C6DA 5ACBC 4CTCA 2W5AA 3RMFA 3GCVA 1QAMA 3WZUA 3VC1A 2C6TA 3CIKA 4BYIA 4RQVA 4IWQA 4C02A 5EI6A 1W7HA 3FYCA 4X2KA 3QQGA 2SRCA 3T7TA 4CD0A 3GWZA 3UQCA 3EQBA 4ER5A 5IUHA 4ZZOA 4I94A 4EC9A 4FSMA 2QO2A 5BW4A 1MP8A 4J98A 4FV0A 3Q2JA 1SNXA 1WVXA 4D1XA 4Y72A 3P9CA 3EH9A 5M51A 4J8NA 2BHHA 2VNWA 4KRDA 3VBXA 4WBBB 4L43A 3NDMA 4YHTA 3R7OA 4ER3A 4LV8A 4JXJA 3LBFA 4IDVA 4JXFA 3GU8A 5HCYA 1P14A 4C61A 2FVDA 4ZSEA 1P4FA 4H3QA 4F63A 3EN4A 2WHBA 4O2ZA 3PXRA 4JQEA 4RYLA 3ZRMA 4EEVA 3IHTA 4OW8A 2WMTA 3SA0A 1WVYA 5T6BA 4GT4A 3R9RA 3GRRA 3ZONA 5JEBA 4XX9A 3RK7A 3H4JA 4EKLA 1OGUA 2WEVA 1CKIA 4U0IA 5E1MA 4F7JA 3UG2A 3A4TA 4YTIA 3HV3A 1JR4A 3R1NA 2WNTA 2O5KA 2Z7LA 3MVJA 5KMKA 1JNKA 2ZDTA 2NO3A 4RG0A 3BYVA 3KRJA 4I6QA 4E6DA 4IVAA 5CUQA 4AG8A 5J5SA 5C4LA 3D83A 3PX2A 3R6TA 4FNYA 4KABA 3BYUA 4FZ7A 3RVGA 3IW7A 1JTFA 1M2PA 4HGTA 2NXCA 1EIZA 2C47A 2W1DA 2GU8A 3K5VA 4RC3A 1MRYA 3FJQE 2GFSA 4E5AX 3R04A 5FM3A 5D7VA 1ZHFA 3EGEA 9MHTA 5LQNA 2BM8A 3OOMA 1PXJA 4XJ0A 3TQSA 3GIWA 3QZFA 2XA4A 3LFBA 3GC0A 4L8MA 3OF0A 4Z7GA 3EGVA 1M14A 4A9TA 2HAKA 4HZSA 3UFBA 2BROA 3ZU7A 4L01A 4BYJA 1W0XC 3TM0A 4JIKA 5K09A 5EG5A 4Z55A 3PP0A 3LCVB 4CKCA 3HYHA 2NP8A 3S00A 3TKUA 4Z3VA 3MTLA 3QRKA 5GNKA 2VWWA 3KPWA 3R0QA 3FZRA 2OGVA 5BQ0A 3FAAA 5HX6A 2QVSE 3D5XA 4OLIA 2B9JA 3NEWA 5EYKA 5DWRA 3WF5A 4HTFA 5K0LA 4IVCA 3IW4A 3ORTA 3DAEA 1P1CA 2UZOA 3UQGA 3CTQA 4B0GA 3OU6A 3O7WA 4I23A 1CKJA 5DVRA 3UODA 1IAHA 3IG7A 1UA2A 4AA0A 2GA9A 2XP2A 2NRUA 5HLPA 5C4KA 2V7AA 3NYOA 5LQUA 3NYXA 3PWDA 3AGLA 2X6EA 4BHZA 4XV3A 4I1ZA 2EJTA 3HDMA 2P55A 5HILA 5KMNA 3B2WA 2JIIA 2RFSA 3UO5A 1O6YA 3TNHA 3CCNA 4AW0A 2ADMA 1OKVA 4MXCA 5K0JA 1AQIA 2JFMA 4W4XA 5H2UA 3GU7A 3ZC5A 3KQSA 2PY3A 4YZDA 2W1GA 1A9UA 3PRFA 2WIPA 3ZS5A 3CPBA 5EDRA 2ZYBA 5FM2A 1NY3A 5EYDA 4PONA 4YJRA 1XTPA 5EDQA 1QZZA 4C4JA 3R02A 3DKOA 4EH3A 2JBOA 2C5XA 3F5GA 3OTUA 4MQ1A 5M4UA 1JBPE 2ZV8A 4GEOA 3VBQA 1L3IA 4HRAA 3LHJA 4IM0A 4NJ3A 4IB5A 5I0BA 3HEMA 3EZRA 3A7FA 4NM5A 3MCTA 1UFKA 3E8SA 4E4XA 4FTAA 3MA6A 1XH6A 2WMWA 4Y8DA 4YHFA 5AX9A 1G3NA 1U54B 3ME5A 4XS2A 5KBRA 4EVIA 3KQYA 4OT6A 2XIYA 2CGUA 5FD2A 4JG8A 3HVHA 4KBAA 4NWMA 4K77A 4W4WA 2QR7A 3BLRA 5C26A 3EQHA 3W8QA 3VVHA 4BGGA 4PRJA 3DLSA 5CSPA 2P0CA 1IR3A 1BC5A 1WMKA 4AFJA 2G01A 4RVTA 3VC4A 4AZSA 5IH3A 1M6YA 2R7IA 3BXOA 4ASZA 2UZ4A 3ORMA 4RA5A 3PJ2A 1X1CA 4N4SA 3LCTA 3DK3A 2P3QA 2JHPA 4S34A 4D28A 5C1IA 3IKAA 3BUSA 2DQ7X 4ITJA 5EM6A 2XVMA 2WB8A 5EHOA 2V7OA 3MBLA 4U97A 3FHRA 3SRVA 1G5SA 2F9GA 4DGOA 3EYHA 4F6SA 4O7VA 3LCSA 3FXZA 1JLUE 2OFVA 1NBIA 2OO8X 4FL1A 3TZ8A 4X6RA 4IV8A 3PTAA 3F69A 2YFXA 1NVQA 1FVVA 3PP1A 3LXNA 5FQOA 4FKLA 1OBDA 3VS3A 3UOKA 2C30A 5LQKA 3PJ8A 5JFSA 2IVSA 5I9VA 2WTKC 1NVSA 2HYYA 1IXKA 4UYNA 3VIDA 5AP0A 4BCFA 5IA2A 4K0YA 1YUBA 3FHIA 3F82A 4DH3A 3GCUA 2I7QA 4LL5A 1M2RA 3NAXA 1PXIA 4I5CA 1QPEA 3NGAA 3DMGA 5A9UA 1BL7A 1WBOA 4L9IA 4QYYA 4TYIA 4H1MA 3G88A 2XS0A 2XIKA 3UPXA 4IEBA 3BT7A 2HXQA 1UIRA 4WKQA 3BGDA 5BMSA 1ORIA 1VYWA 1YB2A 4F7LA 4RQKA 5DSXA 3U8WA 3F5XA 5EH0A 3KQWA 3QCXA 4BDCA 2QKRA 3S4QA 3O50A 2PSSA 2OJ9A 3M33A 4E33A 3VS2A 1RDQE 2YM3A 2UV2A 3LFSA 3QRTA 4A6EA 5CEMA 3H2BA 3DNDA 2NP7A 4CRSA 1Q97A 3NNXA 4NM7A 4IX3A 4O38A 4AUAA 2PK9A 2JG3A 1YVJA 3QTUA 4C06A 4GL9A 4C35A 2ZZKA 1RQQA 4HC4A 4TYHA 4FA2A 5FULA 2IW8A 3LLAA 4X2JA 2W7XA 4QP7A 3SVZA 2ZM4A 3R7EA 4O21A 4D4SA 5KVAA 3Q9YA 1NT2A 4YUQA 5HCZA 3OC1A 3Q6UA 3R63A 3O51A 4USDA 3SW7A 4YZNA 4RWZA 4FSUA 3ZZWA 5G6VA 4QP9A 3LAUA 3ACJA 5CVFA 4IAZA 2Z7QA 5EPEA 2X9FA 4BC6A 5KMOA 1YWVA 4EJNA 4F86A 2J0JA 3PXYA 5E4HA 4KB8A 2OICA 3DS6A 3EN5A 3PSCA 5CSHA 3LKZA 4ACCA 1L8TA 4DBXA 2J0MB 2X4FA 5E8XA 1P1BA 1B42A 1PYEA 1ZZLA 4DH7A 1OECA 4DN5A 3BZ3A 2JITA 4BCHA 3S3IA 5CEKA 3TZ9A 4CKJA 3WI6A 5L2SA 3TI1A 3NJRA 2JIUA 2CPKE 2VX3A 3QYZA 1H08A 5CIYA 3BHTA 1NW6A 3FZPA 4RT7A 5ETFA 5IH5A 4XV1A 2OZAB 3E8CA 3BU6A 3IV6A 3R1QA 4TWOA 4EH8A 4DFBA 2I0HA 3U4UA 2G70A 3D7ZA 5DEWA 2NPQA 4OBWA 4FR0A 4TRLA 5FEEA 1URCA 2YZAA 3ZLWA 3OW3A 3MIYA 2GNJA 10MHA 4QMVA 4C07A 3THSA 4ITIA 4JAIA 4BI0A 3GRYA 3TG1A 1H1DA 2W1CA 3DJ7A 4ALUA 4IANA 2BRHA 1X1DA 4KS7A 4J96A 2PXXA 2RG5A 3AMBA 3BRBA 5CVUA 4QQ5A 2WA1A 5FUTA 3E93A 2OXXA 3LMGA 2VS1A 5KMJA 1FVTA 3S0OA 3L9PA 4JVGA 4WNMA 3F88A 3KK8A 3ZBXA 3L9NA 1ZY5A 4MCVA 3FUWA 4ACDA 5L2WA 5CQWA 3COHA 2GPHA 4ZY6A 2KULA 5GM2A 5CCXA 2XCHA 4C37A 2C7RA 2ZWAA 5HIKA 3ZH8A 3EMBA 2IVVA 4YC6A 1ZRZA 5GJGA 4I6HA 5DG5A 5ERGB 5D1NA 3ZSIA 2VP3A 1UU9A 4X7QA 2AVNA 4JBOA 3FTEA 4HPTE 4QQJA 3DBDA 2C4GA 3EQRA 5CYIA 4ZMEA 2QY6A 4RJ5A 2YJSA 4GUAA 4WRGA 3PFGA 2BR5A 3F3VA 4QQTA 4OQEA 5EYMA 2PPQA 1REKA 4GU9A 4UYAA 5HEKA 1Z57A 4ALWA 4EHVA 4EH5A 5CT7A 3G2OA 1VL5A 3SVVA 4FV8A 2UVXA 3GU5A 1YFLA 5BNJA 4O0SA 4P58A 5JFVA 4HCVA 3MFTA 3M6UA 5EK7A 5HIBA 4PYLA 3G0EA 4ASEA 5KQRA 3IW6A 4FZ6A 3KPVA 3QQLA 2IW6A 2W1FA 3OOGA 3PVWA 4XG4A 1SNUA 2LAVA 3BWYA 3DTWA 1FGIA 3PUPA 4NM3A 4BCGA 2RIOA 2CMGA 4FNWA 3MH2A 2ONZA 5CY3A 1DAYA 2JKMA 2PHKA 3BX5A 4RX1A 5D1HA 2OWBA 4E26A 4NT4A 3QWJA 4HNFA 3FE3A 2BMCA 5BPYA 1AF7A 3UNZA 3MSSA 4FKJA 2FK7A 3E64A 4OTWA 1H26A 4HVIA 3POOA 2Y6OA 4I5MA 1GIHA 3IQ7A 4DINA 3GO4A 2XNPA 2X2KA 4IAYA 4M0YA 2F7XE 1JKTA 5A46A 4FZFB 5K4IA 3R9XB 2XIZA 5A4TA 4MHTA 4AT3A 3EFKA 2ZM3A 3PT9A 4J95A 4HOKA 2XYQA 3TV4A 3HVIA 3T7SA 2XK3A 3X0DA 3HVCA 1ERKA 5H3QA 3MTEA 2ZFUA 3R01A 4ZMFA 4DTBA 1P5EA 4NJDA 1WBWA 3E87A 5HI2A 3MY1A 3O31A 3ALNA 5CSWA 3TTJA 4P7KA 2A1AB 2XYUA 5ETCA 3Q5IA 3O7LD 3EQGA 4C3FA 3SM3A 1YWNA 4FTIA 5C01A 1PY5A 1FOTA 2B4SB 4M15A 4FV7A 2CJMA 4MXZA 3PLAE 3T8OA 2IDKA 4RWIA 2CNUA 4YV0A 3WF6A 3RINA 3ELYA 2G2FA 1Q3WA 3RWQA 5CD1A 5IEVA 5EM8A 2X2LA 3RK9A 3VO3A 5JQ8A 3NYVA 1NXKA 4ZZNA 2JH8A 2JKQA 2WU7A 2ERKA 4UB7A 2IPXA 5FWDA 3A25A 4YV1A 3GCQA 1YXVA 2ITTA 2H1RA 3RGFA 1F3MC 4I92A 2WAJA 3F3TA 4G17A 2A0CX 2W06A 3KA0A 4H1JA 3SR4A 2XYVA 3CGOA 2GS2A 5ACKA 1GAGA 3U55A 4O7TA 3P9IA 3PVGA 5MHTA 4FIFA 1ZYCA 3R1SA 4NL0A 4YBJA 5LWNA 2AYPA 3M11A 1JAMA 3V8TA 1GNGA 4IAAA 3UOHA 5FDXA 1BHJA 2VTNA 4E6QA 3G33A 3DXXA 2UZEA 1FPUA 4R6WA 2JJQA 2BZIB 4IB3A 2PLWA 5AP4A 5JGBA 4S33A 3H9OA 4R77A 3FBVA 2R3RA 1RI4A 3GNIB 2XBAA 3PIZA 5DRDA 3NW7A 4C03A 2HY81 3ZLXA 3SGLA 5IQGA 4F7NA 5H8BA 3C3PA 5F95A 2Y6MA 3WZDA 5JK3A 3Q7EA 3CVOA 2WMSA 1P4OA 1RJFA 3E63A 3LFEA 3WE4A 4O7YA 5HD7A 3MN3A 1OUKA 2V74B 4ARKA 5JKGA 5AFVA 1XH7A 1VP3A 3OPNA 1UU8A 4PYOA 4YV2A 4FK3A 2XK6A 3CJTA 4IJ9A 5JFXA 3BU3A 2AC5A 5T3QA 3FMEA 5CXZA 1Q61A 4EOKA 4FKWA 4FVPA 3MB6A 4PMSA 2AN5A 2HY0A 4BBFA 3R8UA 2CLQA 4GSBA 2WQBA 5DIAA 2FCAA 3FZTA 4PYIA
chains in the Genus database with same CATH superfamily
1M8KA 2BD0A 4DV0B 2H2HA 3PA8A 3ZO1A 4ZOBA 4B47A 4O63O 4BGQA 1EDZA 4BTMA 4DPMA 2PBLA 2WUGA 3LOUA 3FMHA 2XK4A 3DV2A 2XCSB 2QRVB 2RGYA 4OR5A 3UKJA 2AOTB 5A3QA 5EI8A 3DPKA 3V1YA 3KXKA 3QX4A 5EJ2A 5HJEA 1Y6FA 3UIBA 2O3SA 4CKBA 3V8EA 5GADl 5L6MB 5KYVA 4M7PA 2L17A 1UC4B 2O1SA 2Z30A 3OEED 3L1IA 3AERA 2EIXA 3EFWA 1V0JA 1XXHB 3U4MA 1RXCA 5HNIX 5C1BA 1L5RA 4CJXA 1X7XA 3FGNA 3OUUA 1SD1A 1KF0A 3RTPA 4TLBA 2FPIB 1LBQA 2VRBA 1RZRD 3RWBA 3SPXA 5G1NA 2IBTA 2F43B 4JDPA 2E49A 1S3GA 5F73A 2Z56A 1NUTA 4PR3A 2R86A 2G9VA 2QRPA 1DAHA 3UIUA 3GAZA 3ZGNA 1I2BA 4E5NA 1WHTA 2PWPA 2ORVA 1IZ9A 3KZ1E 3SHOA 2YXLA 4EFKA 1RJWA 4Q9IA 4ZDWA 1Z7YA 3WZKA 3QHAA 4ITRC 4PANA 4DPKA 3MINA 1WZUA 3NEPX 5GQSA 1KO4A 2PCJA 5GONA 2BISA 4Q3NA 3ZX5A 2EJVA 4IVDA 1MIOA 4NSTA 4MXAA 1A8QA 1W29A 4FKIA 3TW8A 2AEEA 1J21A 3O94A 5DT9A 1HDZA 1UDBA 2FY8A 3HXLA 1TQ2A 4GQIA 3FEGA 4U9AA 2FE4A 4F5WA 4X1KB 3UMXA 1LEZA 2B7AA 3T95A 4MKZA 1Y6ZA 2VLIA 3CZPA 3KLBA 5JIBA 2CKDA 2RFDA 4I8DA 3LFUA 4TV8F 4CFUA 3MRVA 2VJMB 4RJKA 1DHTA 3L4KA 3O17A 2FSVC 3PUKA 2EZ4A 2IQ5A 4NAUA 2QXUA 4XVCA 3P4XA 5ESRA 1AO0A 3KTDA 1E5VA 3SC1A 5KQLA 1JFFB 4R98A 2XK7A 1JSCA 2G88A 3Q5DA 4IS3A 1MPXA 3RS4A 1YF3A 3E9YA 1P29A 2UZ3A 3FE2A 1YBVA 2OEPA 5CNKA 2VAWA 4YRFA 5EIAA 4AZTA 2PE2A 4NIMA 2XWSA 4J7BA 4DBZA 4DLXA 2R6DA 4M7IA 1U54A 2ESRA 1M10A 1QUEA 1U3CA 4U3JB 3HCAA 2UUOA 3RS7A 4JSYA 3UAVA 3AO0B 5L9AA 2FTKE 1YIOA 2QT1A 1VJCA 4EG5A 4DWWA 2C6LA 1ZOPA 3CPSA 1GQYA 4PHFA 2FR1A 1A5BB 5JXGA 1ETHA 2MHCA 4RTSA 5TPZD 1K8XB 4D98A 3H1EA 1INLA 3PQEA 3KK0A 1PTJC 4AZVA 5HZNA 1SVEA 2A33A 2I99A 2ZIXA 4TUYB 1CVRA 4I6FA 1UBUS 4GKKB 3LRPA 5J2TB 3M6AA 5L2IA 3IDCA 4D9TA 4BGUA 1PZFA 4YQEA 1G21A 1UJNA 1V45E 2I0VA 4B8MA 3FYHA 3VNTA 1UDCA 3W5VA 4YC3A 3PVBA 3RSQA 1MG0A 4J0QA 2VNKA 1P0IA 1UDWA 3B36A 3NAYA 1YI0A 4N57A 3LQ1A 1CE8A 1YKGA 4Q00A 5LCJA 2O05A 4MKRA 2ZS7A 4IH9A 3IO3A 4KK3A 1L7NA 4B3BA 1A27A 2X13A 4WUNA 3NHMA 3K3IA 3K6SA 5TVKA 3EG9B 3U80A 4EUSA 1RKVA 3DBVO 2C7VA 1BO6A 2BI7A 5FEMA 1JILA 2FMXA 4XCXA 3V2UA 1ZKDA 4QYWA 4GF5A 4JHXA 3VXKA 1E0SA 3Q6NA 4UUOA 1RWWA 4YJVA 5AV0A 4IHQA 1FP2A 3R7IA 3G0IA 2FSUA 2J3HA 4ITVA 1XR3A 4JBPA 3EL7A 3L0YA 2H4FA 3LSYA 3BE2A 1ZM7A 5A3XA 4QJ5A 4LV8B 4X44A 2HSJA 2ZXEA 2M1XA 1KEEA 3T7KA 1J20A 1W59A 3ADPA 3R7YA 4WLVA 1E4OA 3OZRA 2ZM6B 1FW6A 4AT4A 2OIBA 3UJCA 5EXTA 1YKFA 4R71A 1VR2A 1L5YA 3FYTA 2PQ2A 4YRNA 2C95A 2JDIA 4XTRA 1JF8A 3ANYB 2JHAA 2Q4RA 3EB0A 1AUOA 1GPUA 4NE2A 3Q5EA 1N2EA 5FBVB 4RNCA 4LBWA 1T9BA 1K7XB 4LBVA 1QHNA 4BWFB 4O2BF 4KNWA 3QYFA 4CIDA 1RCFA 1ZMVA 3KE8A 5JFOA 2Q2OA 1WUHS 1JDZA 4GVXA 3CTJA 3LXPA 1A4XA 2Q6KA 5E1DA 2GPJA 4WAUA 3ZDRA 2B9FA 3RKRA 4ARIA 1VG1A 1NPDA 5TPWB 2JGAA 1MC4A 1YMQA 3LC1O 3TNFA 4L7SA 4MAOA 4AMYA 1P0PA 3VC7A 3GLGA 1KJ9A 2PJRA 1VGRA 3ZJ5A 1TJYA 4M36A 4LXTA 4G5JA 1QH1A 3F6CA 2G07A 1WP9A 4N3CA 4FBXA 2J7PA 1Q6YA 3NORA 4EOIA 4UUMA 3B7PA 1YRLA 3D4LA 3GOQA 3PFFA 4YRGA 4IUDS 2NO6A 1GTVA 1R0SA 2Q41A 3JYLA 2G83A 3AHJA 2OM2A 3QRIA 1E60A 2J45A 3BGSA 5CYGA 1NY5A 5EW8A 4GOXA 4KWHA 3LOKA 3RTBA 4TMVA 4AY3A 3FLQA 1U5BA 4L7VA 4TV9B 1POWA 1ZYSA 4Q12A 4XRRA 4B32A 3AFHA 1ZLYA 3AKLA 4QMXA 1OLSA 2HZIA 2NW6A 1W5TA 3GEDA 4BDSA 1LF0A 4DH5A 3IW8A 3R2YA 3LIJA 3DCVA 1QQBA 1NOIA 3MYYA 1YNOA 5AHOA 1PR6A 4QXAA 1VJ1A 2XD9A 1BROA 4RWEA 2REOA 3PXGA 2C3OA 2FZ4A 3G2IA 1TA4A 3VTFA 4KQMA 1WPQA 1FLAA 1UZNA 4RX8A 2QU6A 5DR9A 3PI6A 1GG9A 4W9NA 2WNIA 3IV9A 3RNIA 4ZYUA 4YRMA 2P1DA 4IH4A 4MVJD 4W1PA 4R7ZA 1Y33E 1AGXA 4NJOA 5JJCA 2B78A 4P36A 1OJ7A 4LUCA 4FE4A 2B0JA 3OZCA 4QEBA 4XOUA 1M2JA 4BB0A 3FGPA 2PE0A 5EMNA 1IQRA 1T5TA 5K0TA 1GL6A 4P80A 2AQKA 1Z3CA 3E7PA 4GWGA 5BUJA 3W16A 3KL8A 1YI6A 1AMOA 5LMNB 2PIAA 4GSKA 4LF9B 2IUEA 4ANFA 1YOMA 3QOXA 4YJTA 2QU8A 1WBPA 4QMWA 5CF4A 2M9MA 1MA0A 3WIOA 1DI8A 3HRIA 2C1XA 1WABA 2VDKB 2BFXA 5KQMA 1F0YA 2I0YA 1T9GS 1OGIA 4TOIA 1U6JA 2JLSA 1DX9A 3MB7A 3BB1A 1IVSA 1KFEB 4MGZR 4H1HA 2AD1A 1UKHA 5CLQA 1T3TA 1WG8A 3EA0A 4C3ZA 1A1SA 5C4GB 1IHDA 2H00A 2WTVA 1CUXA 2FPSA 4E0BA 3GC7A 4B3FX 3GLHE 1N2HA 1G38A 4NMHA 4A9AA 2HPHA 5JFGA 4PY1A 1FU8A 4QU0A 1PTKA 1AZLA 4IGFA 3QKTA 1JRLA 3GEIA 1TKIA 5FYDA 4OX9Y 4AVYA 1EX6A 4M0FA 4RO0A 3IJEB 1L7XA 4TXCA 1V41E 4TY1A 2BBOA 2Y4PA 3GPIA 2PZ8A 1Y5RA 4P4SA 4BCMA 4X93A 1DKOA 1TQHA 1P8JA 3EK2A 3M6XA 4AX8A 5JV5A 2CMFA 1TI7A 5E8WA 1EFTA 5IUIA 1VHJA 4PGGA 1GZNA 1OPLA 1E2IA 2ES4A 3MCWA 3L1JA 3QA0A 2QSJA 1C3VA 1IY9A 1YHYA 5C18A 3G0FA 1RSZA 4FYXA 2VHTA 1NQAO 2VHQA 3D1LA 1AK1A 5EQJB 1NL3A 3UK6A 3L93A 1ADGA 1JPJA 2EZTA 4O4IB 4ZTSA 4YNOA 1YDSE 5KOYA 3QPBA 3LMIA 5EHYA 2CVPA 2Q2NA 2IO6A 2I22A 4WJKB 3DONA 2H16A 4XWTA 4FT0A 2UVDA 1SIWA 5T68A 3LECA 4MB6A 4NH1A 4LYNA 1VLJA 2XIRA 2PXCA 1QZXA 4YNBA 3UO6A 2YHBA 4MK0A 2ITZA 3IDBA 2O3UA 1PV1A 5L3ZA 4NFNA 3JSXA 2BM1A 4L46A 3S2GA 3K5UA 4G0WA 3JARA 3Q2MA 4X21A 3RM6A 1DS5A 4L16A 3RRZA 3VJOA 5KNDH 2PZPA 1OILA 4AYXA 3PNPA 4DDHA 1GJOA 3BS4A 1UU7A 2N1MA 3ESAA 2IIBA 1T3LA 1XC7A 1QBKC 5LA6B 2ZAOA 5H59A 3FNHA 3HE3A 1Y89A 4UTRA 3WNDA 2ZM1A 3VC3A 4PIVA 2CK3D 4EMBA 3KHSA 2GZ3A 4X1IB 2CHFA 4KQXA 4BDHA 3CBLA 4KIOA 2AJ8A 4XIGS 4OBBA 3OE4A 2PVPA 3KVRA 3QA8A 3SR0A 2WTIA 1U4DA 3FPCA 1LA2A 3U48A 3A4YA 3SKVA 5LYJA 3RSCA 3DZDA 3CLTD 3QBVA 2V9CA 5AW1A 1NVKA 1NMQA 1Z4MA 3QLJA 5JZVA 4RUKA 5HZMA 3ECAA 3K70B 3QUPA 4A7CA 1UBTS 3K0FB 2IQIA 1IHPA 4IY1A 2AF4C 4UNIA 2WLTA 1U0LA 3WBKA 1K9VF 4LY3A 3O5AA 2WD9A 2D1QA 3PQ2A 4QDUA 2FPUA 4AO8A 4YXFA 3ML1A 3B85A 3LQ2A 2OXEA 4CHGA 1AHHA 3H7IA 3PXXA 2W2MA 3QFVA 1P77A 4BKQA 1Y3HA 3U13A 4G0ZA 2WJ6A 1EFHA 2X86A 5DT2A 4WY5A 3TN8A 4IJ5A 4AN3A 4JJGA 3WICA 1U1EA 2JJYA 3OLQA 4AXFA 2RAPA 1Z0IA 3HB5X 2BRNA 4DNPA 2FZEA 4FSZA 1W1IA 4TT7A 3DZGA 3DOGA 1Z2PX 4LISA 3R3UA 4J0CA 4LM5A 1UCFA 2WF6A 3VPGA 3G7UA 5KNJA 3H9GA 4Q1VA 5P8WA 3N4TA 1P2VA 5ETAA 3PGVA 3E6AA 1YL7A 1J7UA 4UDOA 3K6JA 3O7LB 4JI3B 4D9UA 2XJ0A 2WKPA 1WY5A 3DT6A 2VWXA 3H6HA 3RB8A 5FPQA 1SWVA 2J0EA 1U8AA 4V1CB 3I12A 4QREA 4X65B 1JFSA 5JXJA 3R77A 1X94A 3AM5A 5HO8A 2QPAA 4DLTA 1X7YA 2QQEA 3W0MA 1TCCA 1GM5A 4O7LA 2QZJA 5K5EA 2Y1EA 1GTRA 5H02A 4DA8A 1SUSA 3WF8A 4DGNA 3T1TA 2I0EA 4YRZA 2CSNA 5C5CA 1L3BA 1C3OB 1XHEA 4OL9A 3OLVA 1X8KA 2IEZA 4PF4A 4LX0A 2RKOA 5EMJA 3W5DA 2V5AA 3DH0A 4I55B 1M75A 2WABA 4UHBA 1ZAYA 4U7FA 1DV1A 2C7PA 2JRCA 3C45A 3PG3A 3CKKA 3Q4GA 4D9HA 4FP9A 1E66A 1RS0A 5A6OA 1PAUA 3FTFA 5ALWA 1IATA 5DRBA 3DL4A 3PJRA 1XTJA 3C4JA 4MYDA 4YQZA 2FZKA 1V25A 4DHZA 4JJIA 1K3FA 2IKSA 5IN4A 4CF5A 3AQ4A 4TLEA 3TL2A 2XQVA 4BRSA 3KOYA 1GZVA 4R2JA 5LXTF 2W1HA 1PQYA 4QGAA 3ODPA 1H8FA 3MWGA 3AM1A 2D1SA 3W0RA 4XQGA 3ZZEA 2NVBA 5E0OA 3IAS6 2W2NA 3KR0A 1QVVA 1AY0A 2O3JA 4BAUA 2HH9A 3ZOZA 4HB0A 4ZTBA 2QTVA 5HRAA 1G5RA 3MJSA 1BA2A 4NFLA 2QTGA 4H3VA 4BN1A 3AF4A 4EW1A 5ED0A 3OPQA 2FZ5A 1V4BA 5EGNA 3ZUPA 1KMQA 1JFLA 4PZDA 2FO0A 4FOLA 2AX4A 2CB9A 2X3YA 1KZGB 4UAUA 5DI9A 3LQYA 5FEUA 1WP4A 5J8IA 1NBME 3WIUA 2HHJA 1T2DA 4KH0A 4J0JA 3OU2A 3COKA 4NHEA 5JAHA 4KKEA 4M0KA 4GRBA 1QX3A 5B7GA 5EYPB 2C2GA 2WJZB 1JJVA 4MLDA 2R85A 4R1OA 5GV8A 1Y5NA 4ND5A 4FSHA 3I45A 2UZNA 2H3EA 4BPBA 5FBLB 4DV1B 4GKVA 4Q4JA 1KEWA 3HO1A 5EP4A 4J43A 1NI3A 4XV9A 1N7IA 3OZDA 2AK2A 4X3OA 2XNEA 3FPJA 3K15A 4V0GB 4RKEA 3OWPA 4JBQA 3TBKA 4D0WA 2NVWA 4BU1A 5HE3A 3LUPA 4BTJA 2NGRA 1NSTA 1GIAA 3HV6A 3RV4A 5JH7F 1RHKA 3QTIA 3HAVA 5CGZA 4N03A 3R7AA 4C4RA