5GINE

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ginE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ginE02
2F4JA 4AW2A 1MP8A 2JHPA 3WZJA 2GFSA 4WUNA 2XBJA 3OD6X 2NRYA 4CFVA 3IS5A 1H8FA 3KXGA 3PY3A 5K09A 2C5VA 1B42A 4C07A 4OBPA 5E92A 2GPHA 5DSTA 3FZ1A 1OKWA 2JAMA 4H05A 4HCTA 3DMFA 1YHWA 3OW4A 4I6FA 3GQLA 5HVYA 4X2KA 2JG3A 3OU2A 1ZGJA 4BCOA 3VWAA 3LPBA 1M17A 3HMOA 2QY6A 1SUIA 2BIKB 2PX8A 3MJ1A 2BR1A 3CKKA 4JXJA 3ANQA 1IASA 2CN8A 2BROA 5CF5A 3GWZA 3ZZWA 4K33A 3VBTA 3GB2A 2XK7A 3UP7A 1YWVA 2R3QA 5E2AA 1R00A 5DBXA 1Y57A 2K4MA 1AGWA 3LHJA 4CT2A 2C7OA 4OTIA 1JG4A 2UYOA 2R3HA 4RVTA 4EJ7A 2JITA 3COIA 5KZIA 4YC8A 4ER0A 5AUYA 1T45A 1Y6AA 4RTJA 1UU8A 3I4BA 2E9VA 3I5ZA 5E91A 3G2OA 4P7JA 4EEVA 1KE6A 4FV8A 3Q9XA 4WNMA 4QVKA 5GWXA 2XEZA 4JLCA 5KMOA 2W96B 3COMA 4PCLA 3AT2A 3QC9A 4LFIA 3WIGA 1P39A 5E8TA 5BP7A 5EK7A 4N4SA 3RM6A 3UYSA 4GC9A 2I40A 4JQEA 4L45A 2EG5A 1EJ0A 3RPRA 3T8OA 3K5UA 2YCFA 3Q53A 2ZDUA 4FTAA 2NRUA 2C5XA 2OICA 3R0TA 4XS2A 4M38A 5FWDA 3BIZA 3SR4A 1HOWA 4FGRA 4RZWA 4AN2A 2B3TA 2GS9A 3DR5A 5HIIA 1JSZA 3SSMA 2VTJA 3WIKA 2UW9A 3EQRA 5DEYA 4GK4A 4JT3A 3QF9A 4YZCA 1GZKA 2CPKE 4G6OA 1PKGA 2CNQA 4J7BA 4QMTA 4YLLA 2IVTA 4ANLA 4K77A 4BRXA 4WKQA 1UNGA 1O6KA 4F0IA 2ITYA 3VF8A 5ITAA 4F70A 1LUFA 3H10A 1F3MC 4GEOA 5E1MA 4Z9LA 4ZEGA 4K0YA 3HECA 3U51A 2ZAZA 3LW0A 3Q52A 4NM7A 2XB7A 3F5PA 3HMNA 3U55A 1AQIA 3FSKA 5B0XA 4C35A 3FWQA 5L3AA 3CVOA 4X61A 2X2MA 3NUXA 5B2KA 2VO6A 4ZZNA 1PXNA 2AC3A 3UMXA 4Y72A 4GCJA 1ZG3A 5LCJA 2IGTA 3PVCA 4QPNA 5DLSA 3G2PA 5KZ0A 1SYKA 2PZPA 2XM9A 3TACA 3LCVB 3OC1A 3RINA 1ND4A 3IG7A 3ZDIA 1BKYA 1N7IA 5E4HA 3VW6A 3HDMA 5E7RA 5KX8A 5IQEA 3H4JA 4WXHA 4V0QA 3DB6A 3FC1X 4RC4A 4RMZA 4NH1A 3TNPC 1P14A 1CKJA 3ENMA 4O7YA 4TN6A 3MGYA 2FUMA 4GIHA 4FZFB 5EH0A 3F4KA 2UW3A 1XHAA 2B53A 2Q0BA 4RIXB 3LXNA 2FB8A 4V04A 4AN3A 2SRCA 2X8DA 2IZRA 2X7FA 2JLDA 4RIXA 4X3FB 3R9HA 3V5TA 1NVQA 3KQWA 5H02A 2B1PA 4B8LA 3PJ2A 4K2RA 4EC8A 2G72A 1QCFA 4ZTRA 3JY0A 4BDDA 4C4EA 3FUVA 4XRJA 4JQ7A 5M5BA 3TOSA 4CV8A 2B7AA 1MRVA 2DS1A 3BU5A 3R8ZA 3TKHA 2WFYA 3TZMA 2I1MA 4RSSA 3TDWA 5C1IA 4DFZE 1GIHA 4MHAA 2WTIA 4JX7A 4CFFA 5HQ0A 4GU9A 1V0OA 4HTFB 3QZGA 3M6VA 2ZM4A 3ETAA 3KKVA 4AZEA 4N6YA 1UU9A 3D7TA 4X2JA 3NVKI 3B5IA 3Q4UA 4JAIA 2XJ1A 3C5IA 2XVDA 2PSQA 4JVGA 4F65A 3O4FA 3TEIA 3EQPA 3KXHA 2A0CX 4WBBB 2XNMA 3LCKA 4MTAA 5HNGA 2C3KA 3LFEA 5GJFA 4D28A 2NP8A 3ZSIA 3QTIA 3R3HA 2EXCX 3PXYA 4FK6A 4FL3A 4KDRA 4C62A 3OWKA 5HILA 3ZM9A 4EK9A 5F94A 3VBXA 3PA3A 4DFLA 4QP2A 4GJ2A 2OK1A 3C3PA 2R4BA 2JBOA 3BU3A 5J87A 4RVLA 4ACHA 5EHLA 3FMLA 3BZ3A 4JG8A 5IDNA 1G60A 3IV6A 3Q6UA 3ZDUA 3PSBA 2REIA 5E8RA 4AOJA 4F9CA 3F3WA 3QCSA 4U97A 3HVKA 4IDTA 2PSSA 2AOWA 2XKEA 4RTKA 3AMBA 1KHHA 3P7AA 4QMXA 4O21A 5CVGA 5LCKA 5CI7A 3CKXA 3S2PA 2GFCA 3LKZA 4DZRA 1PMUA 4ZLYA 3GXOA 2QD9A 3I81A 3DB8A 1OPLA 5P8WA 3R71A 4FTOA 2BCJA 4RJ6A 4A4LA 4AU8A 3UQCA 4EOSA 1OZ1A 3PYYA 4RIWA 4ZSLA 1WZNA 2PXAA 3DT1A 2ONLC 3QUPA 1BUHA 2VWBA 4ITIA 4ZSJA 5JZNA 3RTPA 5BYYA 4KW7A 4NK9A 4CQEA 1KE7A 4FTLA 3IW7A 1MQBA 5C26A 3EYGA 4C02A 3GOPA 1I4WA 5AV1A 4RVFA 3PRFA 5K0GA 4RFMA 3R7EA 4D2RA 1J3HA 3MA6A 4RWJA 2H1RA 4C34A 3AWIA 4EUUA 2UZ4A 5MHTA 2V62A 4I3ZA 2UW6A 5FG8A 4E4XA 5CY3A 4U40A 4CCBA 3CJQA 3Q7EA 2NP7A 4EJNA 4FKJA 4NW6A 2NXEA 2C6OA 1J7UA 2BVAA 5EYCA 5KHWA 4AZSA 4FKTA 5LQAA 2HIWA 3ELJA 3EL8A 4GJ3A 3KQPA 4Z3VA 3MTEA 4YC3A 4DFBA 3T0IA 2QOKA 3G15A 3F6XA 1HNNA 2YCRA 3R7OA 4IWQA 3IK3A 2IVSA 4XP3A 2GS6A 4BDBA 2CGXA 4WBOA 2B9HA 3UO4A 4FSMA 5FEDA 4RIWB 4M37A 4BR3A 4FT9A 5FADA 3H9OA 4L46A 3TNIA 1OIYA 1QPCA 3OWLA 5EQJB 5F2KA 5KKRC 2X0GA 3KEXA 4FV7A 3QHRA 1ZQ9A 3VC4A 3D7TB 5GHVA 5JFSA 2CLQA 4U43A 3UMWA 2JHCA 4MHTA 4KBCA 4NCTC 4HNIA 1ZY4A 3QZHA 1AQJA 4HZRA 4RX5A 4AAAA 4FEQA 5AUWA 3SHEA 3U87A 4YMHA 2ITNA 4RFYA 2C6EA 5FP5A 3IECA 2BHEA 5EM7A 2O3PA 1L8TA 4L7SA 2J0IA 2VTIA 3LE6A 4ALUA 4G1WA 3EH9A 2OJGA 5DLYA 4D0WA 2WQEA 3V51A 3DK7A 4CT1A 1G5SA 5AIKA 1E1XA 2J0LA 4HC4A 5BPYA 5M44A 3JVSA 5TF9A 3TDVA 4B8MA 2HXQA 3LFCA 4F7LA 5A4QA 3JXWA 4HNFA 4NUSA 4XJ0A 4I6QA 3HCEA 3R73A 1VYZA 4HZSA 2XK9A 2QR7A 1YDTE 2P2HA 4FTNA 1NKVA 3FPJA 1XBAA 3IDBA 4AP7A 4PMSA 2WMBA 2O05A 1AQ1A 3QYZA 3MTIA 1GIJA 2ZV2A 4CTBA 2ZBRA 4X3JA 4YO6A 4I24A 3E23A 4ER6A 3UPXA 4O2PA 2ZV7A 2E9UA 4XLIA 5JH6A 2AN4A 5EC8A 3LLAA 4XV3A 1JKSA 3BBWA 3QTRA 3PZEA 4PDYA 4YUQA 3UO5A 2PBFA 5CU2A 3ZS5A 3VHEA 4KNBA 4RX9A 4DH3A 2V74B 4B7TA 1KOBA 2Y9QA 4KABA 2C0OA 2PVHA 3FYKX 4LI5A 3FKOA 5AV2A 4EH4A 4NTSA 1INLA 3I5UA 3TUCA 3GJYA 2R9SA 2FK7A 3TLJA 4M67A 1W0XC 2C4GA 5E1SA 5BVKA 2OF4A 3CTQA 3DOUA 4HVGA 2Z6UA 1MHTA 4ZTHA 2PLWA 3QZFA 5KE0A 3EVGA 5ICFA 3LCUA 2YX1A 2C3JA 2UVYA 1MRUA 3K2LA 3PP1A 4PYMA 3UPZA 3LCOA 2YM4A 1XVAA 4HYUA 4RJ7A 4PYNA 3D2IA 2X9FA 3I5NA 4L7FA 4D2SA 3TV7A 3FTEA 1OL6A 4BDKA 4BDAA 1JQ3A 4M0YA 4ZZOA 4ER3A 2PU8A 3IGGA 3JUHA 3WF5A 4EH8A 3I64A 4TKSA 4F1MA 4EKKA 3H3CA 3KXNA 3ROCA 3QV2A 4MXAA 1VBFA 3AC5A 3OT3A 1RDQE 3UVQA 1YUBA 2P7HA 5CD1A 5KMLA 2I6GA 5KQRA 2YAAA 1RJGA 4II5A 2OBFA 2VO0A 4LM5A 5HKMA 3ER8A 4A4OA 3UZUA 4K1BA 5EHYA 2ZVJA 2CN5A 3ZUUA 4FR4A 3R8VA 3BE9A 4QNYA 4IAIA 2HY81 1REKA 4I94A 5KMJA 4O0WA 4MQ2A 4I23A 5DE2A 1NVSA 3F3TA 4BHNA 4E7WA 1CDKA 1JSTA 3UC4A 3ANXA 1Q8ZA 4JIAA 1KYWA 4QP7A 4IAYA 4WO5A 4EOKA 4KS7A 5BW4A 3ZLXA 3NYNA 3RWPA 3P9NA 3UGCA 5LQKA 4ZY5A 5CF8A 1ZY5A 2C6TA 2CGUA 3QAME 3R04A 4FNZA 4ASEA 4BI2A 5C4KA 4PGGA 1PXLA 4R3PA 4P5ZA 5IG1A 3KKZA 1FVTA 3R2YA 2ZB1A 3FE3A 3T7RA 1O9UA 3DFAA 2VNWA 5DVRA 4BI1A 1H26A 3AC8A 3FRHA 4MNEA 4RBLA 4AUAA 2NXCA 3QU0A 3MVHA 3QFVA 3EJ1A 4O86A 1XR1A 3LSTA 1M7NA 3A60A 3LZBA 4GK2A 4LRJA 1UNHA 1LP4A 4FP9A 1P4FA 1UV5A 5EI8A 4BTMA 5JQ5A 5H8BA 1DI9A 5LQJA 1WBWA 5M06A 1DI8A 4C06A 1W7HA 4FT5A 4P90A 3RCJA 3UNZA 3UO6A 3MPAA 2UVZA 2WEIA 3ORXA 5HBEA 4E30A 1R6AA 1PYEA 3JPVA 3KULA 2VTQA 2PE0A 4HH4A 3G89A 4X3FA 2PMIA 3FQHA 4ZTNA 2YVLA 4XUDA 4FV9A 3R8MA 3UE4A 3FZGA 4EBWA 3WSTA 4RX7A 4CKBA 4R78A 3BZBA 3KREA 3VC2A 2AR0A 3FMKA 2OZOA 3Q4TA 4FKRA 5DG5A 5E90A 4DT9A 2PWLA 5AP7A 2NPQA 3NNXA 2P55A 2OIBA 3EVCA 2VTLA 4YLKA 3V6SA 3SM3A 2C1BA 2I0VA 3LQ5A 4GT3A 5CASA 3TXOA 3LDUA 5ICCA 1W83A 4U3YA 3COHA 3VSEA 5DEWA 3SXRA 4RWIA 3HVCA 3I7CA 3FMHA 4ZY4A 2FHPA 3EL7A 3KHKA 4R6WA 4CLIA 3Q4ZA 1I44A 5AAGA 1WFCA 4F4PA 5KMIA 3I9FA 5ICEA 3RP9A 3BYVA 5LWMA 2B0QA 2PZYA 2ZV8A 3ALOA 3ERKA 2F2UA 1URCA 4ANBA 2B25A 5EHGA 1R0PA 3KMMA 2YM5A 3CP9A 3E62A 3KRRA 1DL5A 3THSA 3QQGA 1FJXA 3OWJA 4EK8A 4MNFA 4E8AA 4QTEA 4M7RA 3PUPA 2ZSUA 3BV2A 3UZRA 4PV0A 2BRHA 2BRMA 3UIXA 2GHGA 5G02A 1OUKA 2QOIA 3MFSA 4FKIA 3MTFA 5EI6A 1PW2A 4TXCA 2OZAA 3BWJA 5FQDC 1Q4LA 4BB4A 4ENXA 3OROA 4X2FA 1DM2A 1VYWA 2Z7RA 3QD0A 4NFNA 3E8SA 5M55A 1VZOA 1YB2A 4TYHB 3GU3A 1ATPE 3GC7A 4RTRA 1PRYA 5JEBA 3VS4A 3QLFA 3HEGA 4PP7A 1DAYA 5F9EA 2HZNA 3G2MA 5FD2A 5BYZA 2XYQA 2QHNA 5HEKA 5J9YA 3VUMA 3UBTA 1QL6A 2XK6A 3GO4A 2OIDA 3ZO3A 4M36A 4HYSA 4TY1A 3I1AA 5IQGA 4P7FA 2Z6AA 4Q9ZA 2CL5A 2FK8A 4ER5A 2ITQA 4AS0A 2WMTA 4BBMA 1EAMA 2GNHA 2JDSA 3BHYA 3C3YA 3ELUA 4WNOA 1JTFA 3HZTA 3UYTA 2J90A 3V5LA 2XIYA 4IZ5A 5E8SA 5K5XA 4X21A 4U8ZA 3P97A 5KYGA 2ITVA 4EK5A 4I4EA 4UWYA 5FM3A 4IVCA 4F9AA 4PYJA 2VTRA 3TN8A 4XEYA 5G1XA 2PXXA 2WO6A 4O22A 3T7TA 2BKKA 1WVXA 2X6DA 3LIJA 1BLXA 2QG5A 3FPMA 3Q9ZA 3FDNA 1PXJA 2QNJA 3AG9A 1UKHA 1K9AA 4PDPA 1RI2A 2FRXA 5DM1A 3P86A 4E6QA 4OA8A 4FKQA 4YJVA 4PL3A 3ELWA 4WT6A 2YQZA 1M2PA 1H00A 4LUEA 5EQEA 5EW9A 3CJGA 1FVRA 3GCVA 5KMKA 4F08A 2AVNA 2PX5A 2XYRA 2OYRA 1SKMA 5EPEA 3IW4A 3MFTA 3IYLW 3MPTA 2IO6A 2RL5A 1VPTA 3K6RA 4R6XA 1B6CB 4P2KA 3FRIA 5JKGA 4IVDA 3OCSA 1PXIA 2PUPA 1H1WA 4H58A 3EVZA 4JRNA 5EEGA 2QR8A 2YHVA 3ORNA 3ORHA 4AZFA 4E5AX 5J9LA 4FSUA 4IFGA 4M3QA 1SM2A 3FMEA 1M2QA 2WKMA 4FIJA 1Y91A 2OZAB 3N51A 2IZTA 4FNYA 4DFYA 4I5PA 5CWZA 3PT9A 4PP9A 3QTSA 5KBRA 4YV1A 2G1TA 2W1IA 4O91A 2GTMA 2YCQA 4LL5A 3QQLA 1XH4A 2YZLA 3KK8A 3BWFA 4HGSA 5M4FA 1KR5A 3TR6A 2UYQA 2CHLA 5HLWA 5ICPA 2GCDA 2PHKA 4IX4A 4MXCA 3MAGA 5DFPA 3HNGA 3R1YA 4NECA 2ZVAA 3BEGA 2AOXA 4FTQA 1F3LA 4HYIA 5KVAA 2UV2A 3FLSA 4RRVA 5ANDA 3QYWA 1XKKA 2R3GA 4FTKA 5FRIA 3FC2A 3RHXA 3OEZA 3LFNA 4G5JA 1OL1A 3JWJA 3VUGA 3OHTA 3TJCA 3PWDA 4ORKA 4FV2A 4YURA 4OTFA 2VTOA 1RE8A 1YI3A 4R1YA 2VTTA 3E3BX 5IQDA 3M2WA 4N57A 3RAIA 3ORZA 2H11A 3P9IA 3R8PA 4QP4A 4CGAA 5A46A 3CGFA 5BUEA 1ZOGA 3H2BA 2BFXA 4LQMA 1OIUA 1Q5KA 4NFMA 3V8WA 3OFKA 2P33A 3DLSA 5FEQA 2PVMA 2QOLA 4OBWA 4RJ3A 4UBAA 2X39A 4HVIA 3NDJA 4O7SA 4WOVA 2CCIA 3A26A 2UZLA 3FUPA 3H9FA 2BRGA 4HSGA 5CU0A 2YIRA 2PUNA 3DGKA 4FSTA 3WI6A 3G2QA 2X7OA 2R3NA 4XCXA 2IPXA 4UXLA 5DXJA 5FHRA 4D1SA 1WY7A 1WAKA 5FXRA 5FTQA 3GU8A 4GT5A 3D2KA 4IB0A 1BOOA 4YTHA 3EGVA 5DRYA 4M13A 1WBOA 2VTHA 3V8SA 2HWKA 4DM3A 4YV0A 4RQKA 1EH4A 5EEHA 2XF0A 3E87A 3F3UA 3QQUA 2VD5A 4W4VA 4GIIA 5AUZA 3C4FA 5IH5A 3SSOA 4DITA 3DUWA 2DPMA 4ATNA 1NW7A 3DS6A 4XX9A 3D15A 4KRDA 3FZPA 5M57A 2ZB0A 3IW5A 4FX3A 2ETKA 4WG4A 4F0FA 5IEYA 4MXYA 4IVAA 4F6SA 4JR3A 2AOUB 4MWZA 2AOTA 4Y8DA 4RVHA 4N0SA 4H0NA 1FINA 4JAJA 4KBKA 2OIQA 3MVMA 4I0SA 4F99A 1JLUE 3C4ZA 3DTCA 3VBQA 3GGFA 5EKXA 2LGCA 2X1NA 4DFNA 3FLWA 5KS2A 3AT3A 3C50A 3HP5A 3MFRA 5A3XA 4C2WA 4EKLA 3VW8A 3JWHA 4NYEA 3UIBA 4IMYA 5KNJA 1JR4A 4RWZA 2W1EA 3BKXA 4FKOA 3OOGA 1U2ZA 2OXYA 4XOYA 4W8DA 2YM8A 4G6NA 3QXPA 2B52A 2B78A 2WOUA 4YZBA 1Q24A 3FMNA 3FXXA 4EH2A 5KBQA 2OB2A 1KPIA 4RTQA 2XS0A 2ZULA 4J97A 3TCPA 1JKLA 4V05A 4K11A 4EH3A 3G7UA 3GCPA 4L3JA 2IDKA 2H6DA 4L52A 2UZEA 3E5AA 3IW8A 4H3PA 5AA9A 2J5FA 2OH4A 5EKNA 3U6HA 2HYYA 3CXWA 4CMOA 3FLYA 3ORMA 4UWCA 3VF9A 4CKRA 3JWGA 4EUTA 4HG2A 5IKMA 1FMOE 3RPOA 1H1DA 1FP1D 3IKAA 2E9NA 5CTPA 4R1VA 3ZRLA 5FDPA 3G6HA 3ATSA 4AE9A 2UZDA 4QP3A 4E26A 2XIXA 1F0QA 3FMDA 4BYIA 1QAOA 1TW2A 1SQFA 2O06A 2R3OA 4E31A 5HIKA 3E3PA 5AP5A 3P0MA 4PTGA 5EZQA 4FSXA 4ZSAA 3AD5A 5I4NA 1ZWSA 2G01A 4ZTMA 3I0OA 4KRCA 4ZTLA 5GNKA 1P1CA 1YWNA 1V0PA 2EVAA 3EGEA 3PIXA 4QQKA 1H1SA 3FJQE 3GU5A 3O8UA 1U54B 2JGZA 4HYHA 4H3BA 4K6ZA 1H07A 3KF7A 4O0YA 3ZXTA 4APPA 3NWWA 3HMIA 4BCGA 4FA2A 5A9UA 5IEVA 2XKFA 5IDPA 2G8NA 4G56A 3DMGA 5DRTA 1WBSA 3OZTA 3FI8A 4G5PA 5U4XA 1IM8A 3ZFXA 2GNLA 4FV0A 1M2RA 5AP6A 1VP3A 4O7ZA 5EQYA 2XJ0A 2YIQA 4WIHA 3ZEWA 2G15A 1OBGA 2ITWA 2QOHA 4IACA 2FYTA 1YDSE 3UIMA 3CGGA 5IU2A 5AEPA 2ADMA 1KUTA 5DWQA 8MHTA 3QKKA 2X4FA 3IDPA 3PLSA 3I6UA 4WG5A 2PTKA 2UZOA 3QD2B 2IP2A 2P2IA 3RJCA 5ANIA 3PG3A 2VTPA 1PXMA 2O5KA 3CSVA 3SVZA 3R1SA 2HOGA 3EFKA 2AS0A 4MBIA 3GC0A 2BR3A 5DT2A 3ME5A 2ONLA 2XBMA 2ZFUA 4FIGA 4EH7A 2WEVA 4GH2A 4XBUA 5LQNA 3P4KA 3A99A 4P5QA 2EB2A 5HU3A 3KQQA 3OTVA 4BCQA 4D0XA 5JGBA 4O7LA 5CEKA 2ONZA 4A9UA 2YXEA 9MHTA 4IC8A 3PY1A 3LX6A 5EGSA 3P9KA 5CLPA 3ORLA 4IB1A 3D7ZA 3OCTA 1SVEA 3HP2A 4O0RA 5CVEA 1SG9A 4IWPA 3FHIA 3HV7A 3QRJA 3ZU7A 2W9ZB 2F2CB 4YJUA 3M70A 2Z7QA 4OTWA 3NWEA 3KR9A 5IH4A 4E1ZA 2QKWB 4DMGA 4DTKA 4OLIA 4V0GB 4FIIA 5AA8A 3KPYA 2NO3A 4X6QC 4JBQA 4PWNA 3FY0A 4G16A 5HGIA 4DEGA 4IB3A 4GT4A 2XZSA 1YOLA 3LJ0A 2WGJA 2YDJA 3O7LB 4FT3A 4JIKA 4R3RA 4MK0A 4Y5HA 5H9BA 4BF2A 4UY9A 4CZUA 3DOGA 5IA2A 4KVZA 4OTRA 3P71T 4AT3A 3TKUA 3KC3A 4CMTA 2P3QA 3MVLA 5CSXA 3IONA 5DX0A 1H27A 1MUOA 3R00A 4JX3A 4G3EA 4F9BA 2GSFA 5CSHA 2HV9A 4D4VA 2G2IA 2PUUA 2QVSE 2AZTA 2W0JA 3I7BA 2ZTHA 2BAQA 4YZMA 2ZCJA 2BM9A 2NXNA 3FY2A 1JG3A 1BKXA 3F88A 4O7WA 4U44A 3KMWA 4A9RA 5CAUA 4FVRA 2FSTX 3V5QA 2PZ5A 2XIKA 1AF7A 3E92A 3FMJA 3ORIA 2BDFA 4FKWA 3HCAA 4QMOA 2X2LA 4GG7A 4XUEA 4QMNA 4IM3A 2C0IA 3B3FA 5C03A 2ZM1A 2PVYA 5JRSA 3JYAA 4NL0A 5FTGA 3B8RA 4I5CA 1OR8A 2VO3A 5ANOA 4BIBA 3UWPA 5HEZA 2O8YA 4PYKA 3Q2MA 4S31A 2QCSA 3MI9A 4QMYA 4YPDA 4CKIA 1SQGA 3U4UA 4RLKA 5T64A 3GOKA 3P23A 4RG0A 1FMKA 3HYHA 3PZHA 4F64A 3V01A 2A2AA 3GNIB 4KKHA 2ZYBA 2XBAA 3NSZA 4I20A 2W4KA 5T3QA 4WA9A 3DKFA 4C4HA 4C4IA 4YHFA 5C1QB 1XXLA 2AOTB 3O8PA 2I7CA 4ZS4A 4KS8A 5K0CA 3MHTA 3ZFYA 5L2TA 1OIQA 4EH5A 5BVOA 4RVDA 4QDJA 3KRWA 4ZAUA 5BUJA 4FSZA 2OO8X 4EOPA 4LRMA 3BLQA 1TVOA 1YXTA 2JFMA 3DCVA 4ANMA 5C9ZA 4O7NA 1R0EA 2UVXA 2O2UA 3NLBA 4PY1A 3OY3A 5GIPE 1ZARA 1NV9A 1XDSA 1OIRA 4M7IA 4TYHA 2OFUA 3HAVA 5CVFA 3TI1A 4CTCA 3D2LA 3OVVA 5E1BA 4AW1A 3R6XA 4IB5A 3EPPA 3KK9A 2AN5A 5FBOA 2ZZMA 3QUEA 4RSRA 3L1SA 4BCFA 2P1DA 2P4IA 2G1PA 4DEDA 4G3FA 4BHZA 5FA8A 2JDVA 2JDOA 4FICA 4FSWA 1Y8CA 1U5RA 1ZZLA 5FUTA 3L8DA 4Y2HA 5CVUA 4BZNA 5AADA 2C5YA 3QCYA 2WOTA 3SW4A 4C3FA 3FLQA 4DEAA 3GVUA 3NYVA 2V7OA 4H3QA 4I0RA 4E20A 4POOA 3EQCA 5D9HA 3PXQA 4RTLA 4GK3A 3V5JA 2ITZA 3CY3A 3G2FA 4I93A 4JS8A 4P7KA 2Z02A 5M09A 1AV6A 2HAKA 4G9RA 2IBTA 4R05A 3E8NA 1OL7A 3D5VA 4RTNA 2B55A 4DN5A 4AZVA 3FKNA 5I0BA 5LQUA 3D0EA 3QQKA 5AMNA 3L9PA 3LKMA 1UKIA 4AFJA 3EOCA 3KN5A 1L1EA 3HVHA 3LHDA 5EMLA 5CCBA 1PJZA 1YXVA 4FEWA 3BYMA 3MCZA 5M4IA 3TKYA 2GMXA 3HM2A 3MESA 2N47A 5E8XA 3CQWA 3R6TA 5CAOA 5GINE 3VUIA 4XG6A 3B2TA 4M0ZA 4O84A 5DR2A 3NYXA 4YUXA 1NT2A 4LYNA 5KCVA 3BGZA 3R1QA 3UBDA 1XH6A 3EN4A 3TIYA 3DXQA 5M4CA 2YXLA 2IDJA 1KSWA 1YFJA 2ZLBA 1NVRA 4EMSA 3ZRKA 4J99A 3CS9A 4BCPA 5HZMA 2FA2A 4RTPA 5E9JA 2EJTA 4JBVA 5E1EA 5FDXA 2I7QA 4D4SA 4PTEA 4BTJA 3V5WA 3NS9A 5CS6A 3GCZA 1FPQA 3KQOA 5FTWA 3C13A 4DKJA 1LEWA 3C6MA 4FG9A 4RIYB 4TZRA 3UVPA 3QD4A 3MJ2A 3ZHPC 5LWNA 4Q5HA 4HTFA 2UZNA 2F57A 3GI3A 4GU6A 1CM8A 2VRXA 1UNLA 3ZUVA 1VE3A 5CM2Z 3UJBA 3JR1A 3KPJA 3GNLA 3MIAA 4W4WA 4P7GA 4USFA 4KKGA 2C68A 3SV0A 2IH4A 3DFCB 3POZA 2HENA 4RA4A 3UQFA 2VZ9A 4DH8A 4S2ZA 4OGRA 4KSQA 4EQZA 4DH7A 1OKVA 2JKKA 4U3ZA 1GIIA 3KMUA 3L8SA 4F1TA 4YMJA 5LMAA 1G6Q1 1JQHA 2W1CA 4Q5EA 4OT6A 5J8IA 4K6MA 4DCGA 3WARA 4DEHA 3NMUF 2GNIA 2UZWE 4IKPA 4O7RA 5BYLA 4D1ZA 2KW5A 4UYNA 2PL0A 2ESMA 2PPQA 3DMHA 2BR4A 4IAAA 1CTPE 4RA5A 2JKMA 5CT7A 4DEIA 2GB4A 2HR1A 2UYCA 2GH1A 5K0FA 4FNWA 4E93A 5DX1A 2ZZNA 4J8NA 4R77A 4U6RA 4W4YA 3C5UA 4ANQA 1VIDA 4GBED 1NXKA 2I0YA 4I5MA 1SMHA 5TKDA 4FIEA 2R3KA 2GPYA 1RI4A 2V7EA 2PWYA 1OPKA 2OXTA 2PVRA 5IUHA 1FVVA 1R3CA 3E63A 3OXIA 3AD4A 2Y1XA 3EN7A 4QMPA 1PXOA 5BVNA 1NW6A 2CMWA 2E9OA 4GFGA 4O7VA 4ZY6A 2FYSA 4R7IA 3G0EA 2QC6A 2C7PA 3OWPA 4L00A 2Y1WA 4GOMD 3A7FA 4PNEA 3JWIA 4GVAA 3VJOA 2PKWA 2GNGA 2WAJA 4K9YA 5JFVA 1JG2A 1GZ8A 1YDRE 2WMSA 2YZAA 3LL7A 1IXKA 4FC0A 3NIEA 3DXZA 3DY7A 4E4MA 4U79A 5D7AA 4M8TA 4EI4A 3M42A 3M6UA 5FTOA 4FVQA 5HTCA 1TQIA 2PMOX 4FG7A 3ZBXA 3KR0A 3CPCA 3FL4A 3WF9A 3QOXA 3ZC6A 3LDFA 3A4PA 1D2HA 1GOLA 5GM2A 3O7LD 5HCYA 2UW0A 3Q3BA 2WMWA 3FYDA 3HA5A 2J0KA 3GU6A 2O65A 4FK3A 5CT0A 4J96A 2I0HA 4M15A 5DGZA 3QWJA 2F9GA 2W5BA 1FGIA 2PE2A 4NSTA 2G70A 3MY5A 3FBVA 5IA4A 3F69A 3TZ9A 3FTDA 2QOBA 4IQ6A 3OS3A 4DCMA 2PVFA 2V7AA 2YDIA 1GZNA 5GOZA 3NVMB 5KQSA 4YBJA 4R5YA 3RAKA 1M6YA 4O96A 4RJ5A 4GMYA 1ORIA 4EZ7A 1U46A 1Q3DA 3HEMA 3D5XA 2YM6A 1W82A 2UW5A 2WZJA 3L8VA 4B9DA 1X19A 2KTYA 3QKLA 3ZBFA 2B54A 3KQTA 4MQ1A 4G3DA 3FXZA 5KMNA 5EI2A 4CFXA 3GRVA 5T67A 1F5QA 3F2RA 3IW6A 2OJIA 3CJTA 2XUUA 1HCKA 2QLQA 2RIOA 3A62A 2OB1A 4YUZA 1IR3A 2IN6A 1CKIA 1S9IA 1XJDA 3MIYA 3OCBA 4AW5A 1XH7A 1YHSA 3DBFA 4UN0C 1W84A 4O82A 3UVRA 5KO1A 2XRWA 5FULA 5E2BA 1GAGA 3R24A 5E8VA 3EVDA 1IRKA 3GBZA 2QOFA 5LMBA 1EJ6A 3UG2A 5CAPA 2H34A 2VWXA 4G2FA 1RJBA 2Z8CA 5CU3A 3WOWA 2WQNA 4OBXA 4CTKA 5ACKA 2WMAA 3PX2A 5LSAA 3GC8A 4ALVA 2HWOA 2J5EA 4EK4A 2QOCA 3KN6A 2IBSA 2OGVA 3U81A 2A27A 4CMUA 3KULB 4ZTBA 3T9TA 1V1KA 4BLWA 4WRGA 2RFDA 4QYYA 3L9MA 3HCCA 4KWPA 4E4LA 2PZRA 3K0BA 1KPHA 2Z2WA 2OJ9A 3VNTA 5FQNA 4LOPA 3NWBA 3HV3A 3SGCA 5IISA 5EIFA 2NNWB 1Y8YA 4PMMA 4RZVA 3UJ9A 4EWQA 1ZLTA 5DI1A 3GC9A 4IAFA 2ITXA 3B89A 3DXYA 3BHHA 3ORTA 3TKIA 5H3QA 2ETMA 4X3FC 4KKEA 4PIMA 1JG1A 2YM7A 5EKOA 5DXAA 3HA6A 3T3UA 2VWIA 4IE9A 2VWVA 3VS1A 3HX4A 2W5HA 2XKDA 4NTTA 3SRVA 4Z55A 2ZZKA 3QUDA 3FYCA 3P2EA 2WTKB 3REOA 3PTAA 4QTAA 5IPJA 2QURA 3P79A 4USDA 5HG5A 3RVGA 2RFEA 3BGIA 4R8SA 4DF3A 3V6RA 1H28A 5C27A 5A4CA 2X6EA 4OA5A 5AUXA 2XVAA 4PTCA 2AVDA 4FZVA 3R01A 3FMMA 3M1SA 3ZFMA 1WCCA 3HLLA 2Y4PA 4F09A 2R6ZA 3ZLSA 4D4RA 3QCQA 5EG5A 4YHTA 4AACA 2OH0E 1BI7A 4F7NA 3EVAA 4Y73A 5CSPA 4DG2E 3KU2A 4MWHA 3VO3A 3HP7A 2YTZA 3GRUA 5FHQA 5HLPA 4F0GA 2ZWAA 2H96A 3GCSA 4A4XA 3DJ7A 3DJ6A 3N4TA 3O71A 3Q6WA 4QQJA 3DXXA 4KIFA 2ZIGA 3WBLA 2VX0A 4WSYA 1AD5A 4E5WA 2UW7A 4AXAA 2IW9A 3Q9YA 3SG8A 4AOTA 5FBNC 4R7BA 1PMVA 3RWQA 2YM3A 3Q9WA 4ZLOA 1Q8YA 4ZOGA 3MN3A 4HGYA 3A7JA 2XNBA 1Q61A 5HU9A 3OZSA 1Q97A 5EDQA 3AXWA 4DGLC 1A06A 3HTXA 4IJ9A 3U6IA 4QTTB 2WPAA 2I0EA 5IQFA 3N9XA 2BRNA 4BIEA 3KR1A 1JOWB 1J1BA 3R1NA 4I92A 4C36A 3OFJA 4HOKA 3GU4A 5HO7A 3HVJA 3LKDA 4IIRA 4XUCA 4U81A 2VO7A 2IH5A 1M52A 5J7HA 3PJ8A 3VC1A 5M4UA 1Q99A 4BZOA 1KV1A 4FE2A 1YI4A 2XMYA 4F9WA 1I09A 5EM8A 4RFZA 3T3VA 5EVJA 3CTJA 3K5VA 4ASDA 4IX6A 1ZYSA 2JKQA 3LFQA 5DNRA 4E6DA 3SXFA 5AX9A 2BM8A 4MD8E 4F1OA 5E8WA 5GJGA 3CCNA 4ERWA 1OL5A 2YACA 1G8AA 2V55A 4YZDA 4UWBA 3LJ1A 5I9ZA 1FBNA 3TKAA 4BCKA 3RIEA 3DZOA 4EOLA 2ZWVA 3R8LA 10MHA 4MTLA 4C4JA 4CTJA 2J6MA 3V04A 4CVAA 3OPNA 4C03A 1YQJA 3LOKA 5IZFA 4EHVA 4XG7A 1BMKA 4NM0A 3BXOA 3EKKA 2P0CA 4JJRA 5D11A 3COKA 3DQXA 1YKRA 3NW6A 4NM3A 2PWPA 4QP8A 3C4EA 4FZDB 5CANA 3TQSA 1ZYDA 5K3YA 2J50A 4DA5A 3NDIA 1DS5A 3V8TA 4AGWA 3IQ7A 3DAKA 4QYHA 3P2IA 4E2ZA 4AZTA 1GZOA 5DTRA 1PHKA 5I9XA 4NW5A 1R18A 1ZOHA 3PRIA 4I22A 4DEEA 3PJCA 1F38A 3F5GA 4KSPA 3E8DA 4AT5A 5HORA 3NX8A 1G38A 5L6PA 3FPHA 2GLUA 5EYKA 3AC2A 3LFDA 2B9IA 3F61A 3G90X 3RPVA 2ZIFA 5M07A 5D10A 1QPEA 4KD1A 3UJAA 4PMTA 1QPJA 2XM8A 5DM4A 1BL6A 3TRKA 3F82A 3F66A 4IX3A 4YNOA 4H36A 3DA6A 4BYJA 4LG1A 4MXXA 4O83A 3HRBA 5BVDA 5CQUA 4QTUB 3POOA 3IPHA 3HL7A 3QL8A 3TT0A 3KPWA 4GUEA 1YHVA 2HW7A 2R7IA 2QQ7A 4KIPA 4L6QA 4LG4A 5DT4A 3BUSA 3ZM4A 2PE1A 4KIQA 2ZV9A 3KRJA 3LMHA 4HCVA 3BHUA 3QHWA 4ZXTA 2XIRA 3BWYA 3LM5A 4Y5QA 2C6KA 4AUKA 2YA9A 4YLJA 2R64A 5IEXA 3RMFA 3PVUA 1D2GA 5A14A 1YOMA 3GCQA 3NR9A 4P7EA 4RV9A 5EOVA 5HCXA 2PVCA 5LQCA 3ODYX 4IM2A 2VTNA 4C33A 4CRLA 5BVFA 3ZEPA 4J52A 3VN9A 4X63A 5EYDA 2WQOA 3MA3A 1VQ1A 4U42A 1KV2A 3TFWA 5EW3A 4QTDA 3AT4A 3NW9A 4RJ4A 4FV4A 2GDOA 2AUHA 4RIOA 3QRUA 2OO3A 4FZ7A 4M84A 3W1FA 4MF1A 5HX6A 2R3FA 3KQYA 3AQVA 4LUDA 4FV1A 4JXFA 3A7DA 5F95A 2IW8A 5CF4A 1PXKA 1L3RE 4DYMA 5EHIA 4PRJA 2W17A 4GKHA 4O81A 4I6BA 4EL9A 3ROYA 2QYOA 3VVHA 3HCDA 1YRPA 4JDHA 2R7BA 2UUEA 5LMKA 4BDCA 3KXZA 2Y4IC 5EW8A 4GC5A 4DEBA 4UEUA 3TPZA 3EFWA 2V0DA 1BI8A 5HIMA 4A07A 2Q41A 3G5DA 5CEOA 2BDJA 2RGPA 5E1DA 2P3GX 4R6VA 3O51A 3BPRA 5LARA 4BZDA 1XCJA 1NBHA 2V5QA 3QRIA 3SAYA 4HVDA 5CSVA 3JY9A 1TQMA 3IOKA 3RW9A 4PNIA 2XK3A 4EQCA 1K3AA 5HX8A 5IMXA 2Z60A 3ORKA 4G3GA 5HE3A 4CFWA 3EYHA 4CNHA 4D55A 1XDUA 3DNDA 4PUZA 5DR9A 3CBLA 3M11A 5HD7A 3Q04A 3FUUA 4EVIA 5CZIA 3DKGA 3ULZA 3BEAA 2OKRA 4L8MA 2XRUA 4QMSA 5JRQA 4QPAA 2UW4A 1KE8A 2AOUA 3K54A 3FI3A 3KF4A 3CPBA 2KULA 2YJSA 4LV8A 2JD5A 1YW2A 3LPMA 4LWPA 4TWOA 4EYJA 4FZAB 4HVHA 2J51A 4V01A 3PIYA 5IMEA 4KBAA 4KAOA 2RFNA 5DH3A 3PE1A 4RC2A 4ZJIA 3VS7A 1ZKDA 3TMAA 4Z16A 4GUAA 4FSNA 2HTEA 4L7VA 4MAOA 4TYGA 3LCDA 3NPCA 4XRLA 4LOOA 2BRBA 1U59A 5JFXA 2GQGA 5FQOA 1DCTA 4FSQA 5HCZA 3ULIA 4DTAA 4EOJA 2P8JA 1H08A 4RTSA 3SX9A 3OXTA 4CFMA 4GYGA 3MBLA 5AP1A 1R74A 2HY0A 1QAMA 2PYWA 1XBBA 4TWPA 3ZUTA 2XVMA 2VDVE 2YIYA 4GOOD 4C2VA 2QRVA 1A48A 3NTVA 4OQDA 3WYXA 3C0IA 3FV8A 5HTBA 3P78A 4QQNA 3BQRA 3P7CA 3R7YA 4IV8A 5LVNA 4NJDA 2P7IA 4WRSA 2BH2A 4G17A 2BZIB 1UFKA 3OBJA 2GAFA 2FSOX 2W1GA 4X2NA 5F20A 2JEDA 5EYMA 3NYOA 4AOIA 1PJKA 4CEGA 2VP3A 1U5QA 1WXXA 4AE6A 3QTXA 3ZSHA 2ZJWA 5LR6A 4BVUA 1ZYJA 4RPVA 4A7CA 4JR7A 4BTKA 4CCUA 3OOMA 3QC4A 4FVPA 4GSBA 3PA4A 4U0IA 4FSYA 5CXHA 5EG3A 3U9NA 4BKJA 1EQAA 3BELA 2VNYA 5IQAA 4F6WA 3ELDA 3MWUA 3NUYA 5EZSA 4RYLA 2W99B 1SNUA 2R3MA 3ZZEA 5HVJA 5G6VA 4FL2A 4F7SA 1L3CA 4MXOA 4YBKA 3R28A 5I9UA 3MVJA 2JAVA 3FQEA 3FZSA 3UJCA 2BDWA 3BLRA 4EH6A 1Z9XA 3D5UA 3DH0A 1UWJA 4O0TA 5C9CA 5E8JA 3GIWA 1DUSA 2J9MA 4YPSA 2R3IA 4H1JA 4RVGA 2QLUA 4APCA 4U80A 3UJGA 4CG8A 5K0BA 1ZZ2A 3C6KA 2AC5A 1ZMUA 3I79A 2XNNA 3BGQA 3DK6A 3UIUA 2BIYA 2I6LA 4QDKA 4IFCA 5DHJA 4BBFA 1VLMA 5I9YA 3BKWA 5E1OA 5J95A 3QTQA 4E73A 4Y46A 5K5NA 3OU7A 4PCAA 3PWYA 4YJOA 4AZWA 3KXMA 2H8HA 2X81A 4FTIA 4MCVA 1ERKA 1H25A 1PMEA 2CSNA 2X7GA 4ZJJA 5BNJA 3G33A 5JQ8A 3V8VA 2O64A 4FTTA 5CEMA 4OR5A 5IQBA 5AP4A 3SXSA 5LVPA 2GTNA 3ET7A 4LGHA 3RPSA 4RVMA 4FODA 3BYUA 3LFFA 5BVWA 2GNJA 2WTKC 2CDZA 3CC6A 4AN9A 2JIIA 3VUDA 2CKEA 2B9EA 4IZ7A 5GP1A 4X0MA 5LVLA 4OX9Y 1JVPP 4FV6A 3MH1A 4JRVA 4YNEA 1KIAA 2Y6OA 4FEUA 4BGQA 4EONA 1EG2A 2BR5A 2EX4A 4RX1A 4DCAA 1OB3A 1RI5A 3EEOA 5FGKA 1E1VA 3MQ2A 2X8IA 3BGVA 5EMJA 4GF5A 5CVVA 4DGGA 5E8UA 1H24A 5IUGA 3SA0A 5E9QA 1X1CA 4PYOA 4QQ5A 3FYJX 3HV4A 1I1NA 5IUIA 1YZHA 5IA3A 3DAEA 1GY3A 4AG8A 4EOOA 2C6DA 3OUNB 3S00A 4FBXA 2GA9A 3FPFA 3SMQA 3BT7A 4EOQA 4TNBA 1BX6A 3EZRA 3RPYA 1ZHFA 2CJMA 2O63A 2VZ6A 5FEEA 1VR2A 5ETAA 5D41A 5HG7A 5EKUA 2YERA 5CSWA 2QOOA 3KCKA 5HBHA 4E2WA 3OU6A 4OW8A 4KB8A 5JR3A 4YR8A 4LV5A 4CKEA 4C37A 2P3LA 3DKCA 4RWLA 3LAUA 3UOHA 3WE4A 2R2PA 3A2CA 3HV5A 4DE4A 1R8YA 3LFBA 1OUYA 4RJ8A 3LQ3A 3ZSGA 3UOJA 1T43A 3A7HA 2W1DA 3MGGA 4ITJA 5IQIA 3NUSA 2DUVA 1Q8UA 2WTVA 3OTUA 3S4QA 3ZYAA 4D1XA 2OF2A 3BYOA 2OU7A 3AOXA 4XUFA 3CTHA 5BX0A 4PF4A 2YABA 5AM6A 2R0IA 5EFQA 4YHJA 2VS1A 3I6WA 4HGEA 3DDQA 5IA1A 2EXMA 4XLVA 5HICA 2OG8A 3BKBA 5DR6A 5LMKC 5EQPA 1UA2A 3WE8A 5LXMA 4I5HA 4WUAA 4DFXE 4DTBA 2O0LA 4FT4A 3FLNC 4QVGA 4E32A 4TWNA 3QRKA 4FTCA 5CI6A 5CVJA 4F86A 3LCSA 4EHEA 4RT7A 2VX3A 5FUBA 4O0VA 3PXKA 4ZP5A 3TM0A 4ACMA 1J7LA 2C1AA 5L6OA 3VJNA 2F7EE 2IFTA 3QLGA 2OPBA 3TNHA 3QTWA 3PFHA 1IA9A 4LGGA 3UZPA 1RJEA 1ZMWA 4O6EA 1X1AA 4YZ9A 4YGAA 3FPEA 1MRYA 3FI2A 3MH3A 5HIEA 1HMYA 1UIRA 1OMWA 3S0OA 4DT8A 4Z7HA 3KL8A 1Q62A 4FGBA 3AGLA 2OI4X 3LM0A 2ACXA 2C69A 4UB7A 2CKOA 2W1FA 5FM2A 4C59A 3FSFA 3D5WA 4BI0A 4RLLA 4NKSA 5HG8A 2YN8A 5BMMA 4DC2A 2A14A 5A54A 2AYPA 3A7EA 4R8RA 4O2ZA 3RALA 1NW3A 1OKZA 4JL9A 2GS7A 4AT4A 2VGPA 1V0BA 3QBNA 4UZDA 4BDHA 4MIKA 4L01A 3EIDA 5CU6A 4ZSEA 5EMMA 4NU1A 3DDPA 4ASXA 2ERZE 3TWJA 3NRMA 3BWMA 3R7IA 2WA2A 4MKCA 4TWCA 4IANA 4ZZMA 4B0GA 2XCKA 4ISCA 2X8EA 3BE2A 5K0JA 3A7IA 5DPVA 4OUCA 4O0UA 5T6BA 4C38A 4D4YA 2PVNA 1J91A 3I58A 5BUIA 4UXQA 5HG9A 4QT1A 3RHKA 3KA0A 3ZO1A 4EOMA 4P4CA 3OFMA 2QO9A 5B7VA 5JFWA 4OTGA 1YZ3A 4QYFA 3DQWA 3EVFA 4C4AA 3VBVA 4BY9E 3GRRA 1RI3A 5JMSA 4YJTA 5J1WA 4K18A 3R0QA 5DM0A 2DULA 4JOAA 3QX4A 5K4JA 3WF8A 4YUVA 3ER9A 3GT8A 3S68A 1Z5MA 5TT7A 2YAKA 3IGOA 3HCFA 2O57A 4GEKA 5LQRA 5GM1A 3NW5A 2YIXA 4GOND 2WB8A 5HHWA 3WF7A 2JHAA 2R3JA 4QMLA 4ZLZA 1Q0SA 1KOAA 3FZTA 5DPMA 3VQUA 3EQHA 5K0NA 1WZYA 3FXWA 4E6AA 4D9UA 1IAJA 1ZGAA 3R9RA 3VQHA 3PS9A 4CWAA 2UZTA 4X60A 4GFMA 1H1PA 4FYNA 2VWZA 4TPTA 2FSMX 1Q8TA 2GQSA 2YIWA 3QX2A 3UQGA 2OSCA 4BCIA 5JK3A 1SZMA 3PE2A 2HK5A 2E2BA 4FV3A 5IA5A 3TTIA 1NE2A 4JG6A 4QOXA 4DAWA 1R8XA 4PWYA 5C0OE 2VN9A 3EB0A 4XG4A 3C51A 3U4WA 3B2WA 3HDNA 5AUUA 5F2NA 3HAMA 2R3LA 1OKYA 2FGIA 5M08A 1TQPA 3JS2A 5K01A 2YEXA 5H8GA 2BKZA 3ZO2A 4EWHA 4MYGA 1QPDA 1ZMVA 4UX9A 2J0MB 5B2LA 2XH5A 2ZMDA 2G9XA 3OW3A 3NW7A 2BZGA 5DIAA 4X6RA 4C0TA 4OT5A 4C3RA 1Q3WA 3CR0A 4ITHA 5FP6A 5HESA 5JUWA 3BBTB 5JSMA 4F85A 4DFUA 3VRYA 2X2KA 5LVOA 3RI1A 3DBQA 4QNAA 2ONYA 3RK9A 5A6OA 3OT8A 4FKVA 1VJYA 2PK9A 3RK7A 3E7VA 4WNPA 5CNNA 2VDWA 3OE4A 2BHHA 4U7PB 2CLXA 2JC6A 4Q2AA 2UYHA 4DA4A 5EDRA 4HRAA 1E9HA 3ACJA 2VU3A 2F7XE 4KWCA 1S9JA 5GIOE 3GRYA 1SVGA 5D7VA 3EQFA 2WQMA 3PY0A 3BX5A 4K8AA 3DP7A 3THRA 2WTWA 3FTCA 2PT9A 3GU7A 3F3ZA 2GQRA 3C4CA 3QXOA 2OJJA 1JAMA 3D9VA 4LECA 4ONAA 1DAWA 3KQ7A 2F49A 2CKQA 2ZDTA 4FOCA 4PDOA 4Y30A 5JT2A 2ZIEA 3VS5A 3E88A 5L6WL 3GGDA 4XMOA 2FH9A 3SLSA 3NIZA 4BDJA 3PFQA 5CEPA 3PXZA 2W9FB 4FIFA 2EJUA 3RM7A 1QMZA 5ANKA 5HOQA 4FMQA 5CAVA 5E8ZA 5AP0A 2HCKA 4EZ5A 4Q9SA 3LMIA 4FIHA 5EOBA 5KMMA 3HNRA 4MBLA 3EN9A 1YXXA 2GHLA 3E7PA 3W16A 5JZJA 3GP0A 1URWA 1WS6A 1H01A 2C3LA 3UG1A 4XHKB 3MY0A 2FSLX 3TG1A 4QMMA 4JG7A 3RGFA 4E4NA 1KPGA 3IEIA 4FR0A 4FV5A 2BZJA 3G5TA 3EFLA 1OM1A 4G34A 4YZNA 3UZTA 2XYVA 3HMPA 4QP6A 3ACKA 3TM4A 3IO7A 2Y8OA 4J53A 4IHPA 3SOAA 3GFWA 2PX2A 5ETCA 2R0UA 3KFAA 5AUVA 3D14A 3G5LA 3L9NA 3PDTA 1XDZA 2FCAA 3RAHA 1MQ4A 3F9NA 3G51A 3H30A 4L44A 4U45A 5DYJA 3SG9A 2Z7SA 2P3OA 2ERKA 1OL2A 4S34A 2IJMA 1ZXEA 3EQBA 2DYLA 3HUCA 4E5BA 3UNKA 3ZXZA 4ER7A 5E9EA 2BUJA 2QU5A 4C3PA 1PMNA 5HD4A 3M6WA 3BQCA 1SVUA 2C7QA 4O0SA 3ZO4A 4CLJA 2YR0A 4QMQA 1JSXA 2B4SB 1JNKA 3EEYA 3CE3A 4XG2A 1XH5A 1UU7A 2XA4A 4AQCA 2HWPA 4FGZA 4JI9A 3EWHA 4FI1A 2QRVB 3EFJA 1JQEA 3RNIA 3MCTA 3WZEA 3WYYA 3FZRA 3EZVA 2XNEA 4ZS0A 3B3GA 5F2OA 2GS2A 3DNEA 2QODA 2P40A 4FT2A 4YJSA 5CCXA 3O2MA 5CZHA 3VULA 3VUHA 3P8ZA 3A27A 3FLZA 4DBNA 4MWIA 3NCGA 3PVGA 3BHTA 2CCHA 3G0FA 2C30A 4FSDA 3O96A 3G8BA 4RTMA 4NM5A 3JVRA 3KVXA 4FTJA 4MD7E 3UOLA 3UP2A 4A9TA 5LQFA 4P58A 3P08A 4AW0A 3NDMA 4FSRA 2YWVA 7MHTA 2JH9A 1A9UA 2HZ4A 4FKPA 2B2CA 1XCLA 3HRFA 3EVBA 3QA8A 3UNJA 4IC7A 4GOLD 3PA5A 5AV0A 2GNFA 3ZC5A 4IZYA 4ZTQA 4AGDA 3OCJA 3W18A 3E05A 4DGNA 4B17A 1JBPE 3CGOA 3AXTA 2JIUA 3B8QA 2ZOQA 5GJDA 5C01A 3NUAA 3QQHA 2PVJA 4MNEB 4DLIA 3QD3A 5HIBA 3D4QA 3C9WA 3W2QA 3ID6C 2PJDA 2XJ2A 2NYUA 4G6LA 2QM3A 2BFYA 1TKIA 3P5KA 3DLIA 3PB3A 3PFGA 5LJJA 2FVDA 3NUNA 2IG7A 4EHGA 3FI4A 2W7XA 3DV3A 3HV6A 2OJFE 4DH1A 3QA0A 2XK8A 2PZIA 2RKUA 1KE9A 2C47A 3LFAA 3R30A 4KUJA 4ERKA 3GRZA 2YITA 3O7WA 3BYSA 2VAGA 3BRBA 1O6YA 4RGJA 3FPGA 3BLHA 3KRLA 4RWKA 3S1HA 3PSDA 5HVKA 4BIDA 2W1HA 4USEA 1L3BA 3BGDA 4I21A 3TV4A 5EOLA 5HE2A 3O17A 3BWBA 4JBPA 5L2WA 2G2HA 2ITUA 3LCTA 1WG8A 4QQCA 2PVLA 3QCXA 3QQJA 3OZRA 1WBTA 1TPYA 2I62A 1OECA 2BILB 1Q0TA 4L53A 3UODA 2YWPA 4FKUA 1U54A 3PTGA 1M0EA 3LLTA 3PPJA 2JH8A 4X7QA 3MFUA 3PIZA 2IIPA 4YP8A 2W05A 3EMGA 1M6EX 2ZBPA 2QONA 4XV9A 4U7TB 4C4GA 3SW7A 4PL4A 4M97A 5AM7A 3CD3A 4BLUA 3E8EA 4PMPA 5CNOA 1VEBA 4J95A 4QMWA 4KIOA 3LMGA 4HW7A 4N6ZA 5KKRB 3UOKA 3TUBA 4PONA 5M56A 2QI8A 4CV9A 5FCDA 1OI9A 5JGDA 3UA4A 3ZH8A 4BP3A 3F5UA 1YF3A 3GUBA 2O0UA 4EOIA 3OXZA 4M69B 4L3PA 3A4OX 5L2IA 2PGXA 4O29A 3LXKA 5ANEA 2WHBA 3NUUA 4JDKA 3QTZA 3U9CA 4F7JA 1IAHA 2IWIA 3TJDA 2J0JA 3FL5A 3ENHA 4C05A 2XNPA 3GDHA 4EORA 1REJA 3W8LA 3KQMA 5K0EA 2QKRA 3FEGA 3ELYA 4MH7A 3QRTA 4EKIA 2R3SA 3GFEA 3RKBA 1W8CA 1NV8A 3R7VA 4NT4A 2PUIA 3Q5ZA 2C6MA 4CSVA 4D5KA 3EHAA 5CVDA 2PT6A 4HGLA 1M14A 4EK3A 4KIGA 4O0XA 4A9YA 3O50A 1XJ5A 1WBNA 3W33A 1PXPA 2QHMA 5AJQA 4G31A 2PY6A 1WBPA 3A61A 3CLYA 1JSVA 3PSCA 4AF3A 4H39A 2QO2A 4TTHB 2LAVA 3R9DA 4CFUA 4E2YA 4FEXA 2OW3A 3BHVA 2BZKB 4FG8A 4PQNA 4BDEA 4C61A 1Q41A 4IWOA 3N4UA 3LGAA 2A4LA 4WNKA 3OMVA 3DK3A 3HUBA 3FUTA 4LWOA 5AV4A 4PYLA 1NY3A 4ANSA 4UYAA 4Z2YA 4FZ6A 5K03A 4R5SA 2P41A 4TW9A 3A7GA 2C0TA 3DBCA 4FUXA 4Y95A 4XP2A 3SC1A 2VWYA 4A9SA 4I1ZA 1JPAA 4QP9A 2IZUA 4OBOA 4U9AA 3PLAE 1L9KA 2AN3A 3AY0A 4IAZA 4FYOA 4YSJA 3M4XA 3CBGA 4EQUA 3KGAA 3NZ0A 4YTIA 1T46A 3KY2A 1UVRA 2CGVA 3G9NA 3EMBA 3CCFA 1CSNA 4I41A 5C4LA 3SX0A 2VTMA 4S30A 2ZMCA 5HIJA 4DH5A 3O0GA 5EM6A 3G9LX 4FKGA 2IVUA 4LMUA 3VAPA 3HA3A 1CKPA 4E6CA 4IWNA 2WK1A 3TV6A 1RI1A 1PYXA 1OBDA 2CNVA 2PY3A 2X4ZA 5TOZA 4B99A 3AC4A 3MERA 5D1NA 3DPKA 2VTAA 4CZTA 4D5HA 2JKOA 3ALNA 3O8TA 4QRCA 3OBGA 2P35A 4TL0A 1Q8WA 1U4DA 3VYWA 1APME 4E70A 3K3IA 3OF0A 4MD9E 1WVYA 3VRZA 2H00A 4M14A 2J7TA 4DHFA 5B2MA 3BU6A 3P9CA 3PVBA 1YXUA 3ZRMA 4RVKA 3KPUA 5BW5A 2Y0AA 5D12A 1H1QA 4IDVA 3EN6A 4S33A 2B9JA 4M12A 4AFEA 3C0KA 2WNTA 4HJOA 1IEPA 2WQBA 4TYIA 4BN1A 2B9FA 4YUYA 1N2XA 3W2OA 3GEQA 4FKLA 4FTRA 4XCUA 3A4TA 4F84A 4R3CA 4YMGA 4YJQA 3W2PA 4DCEA 2PV0A 4KRGA 5CU4A 4QTCA 4WG3A 4IJPA 4X41A 1JQDA 5K05A 3LCCA 2C5NA 4EZ3A 3UA3A 1BC5A 2RFSA 2CMHA 1IY9A 3DU8A 4ALWA 4ACGA 5ANJA 1VP9A 1OITA 2X9EA 3I0QA 4NIFB 4V0RA 4IV0A 3Q2JA 3ORPA 3SRVB 5A6NA 5EIWA 4EKGA 1X1BA 4CXAA 5L2SA 1KXZA 4QMZA 3BCEA 4EYMA 4JQ8A 4HVSA 5AX3A 1GNGA 4G9CA 1N7JA 3E93A 3R22A 3EQDA 2A19B 4YJPA 3E64A 4ZSGA 3KQVA 4UV0A 3WILA 2YISA 2WMQA 4EHZA 3EQGA 3MPMA 4RIYA 3DBDA 3HKOA 1G3NA 2RG6A 2Y7JA 3F3VA 1WMKA 2XK4A 3R63A 2EUFB 5HI2A 5AAEA 3G8AA 2OZVA 4ARKA 4KDCA 5CEIA 2XNOA 2PULA 4OTQA 2YXDA 3MTLA 3CJFA 4BCHA 2XEYA 2IZSA 3E8CA 3GQIA 3PPKA 5HBJA 5CEQA 3AGMA 3Q32A 2FPOA 1WVWA 5IA0A 2XP2A 3I53A 5D1JA 3LFSA 1FGKA 4ZIMA 5HE0A 3CIKA 4CFNA 2ORED 3CKWA 3OZ6A 3PVWA 3QGWA 1Z3CA 1QAQA 5HIDA 4MEDA 5F1ZA 1H0WA 3C4WA 1H4LA 3TIZA 2A1AB 3VHKA 4ACDA 1P91A 2HELA 4WD5A 4E33A 1TW3A 1CMKE 5TO8A 4B4LA 3TTJA 1O54A 3R7UA 1XWSA 5EDPA 3SKCA 2LD4A 4IWDA 3CQEA 4YU2A 3DKOA 5HO8A 4EQMA 3KU1A 4I0TA 2WMUA 2BALA 4QYGA 2E9PA 5DWRA 3ZOSA 4QQTA 3O31A 3QQFA 5AUTA 4ENYA 2CKDA 3M6XA 3K3JA 4JDIA 3QTUA 4GUBA 5CVHA 4NJ3A 5FXQA 4CKJA 3LXLA 4XV1A 4A6EA 3CJRA 4DGMA 3WF6A 4NZWB 1NBIA 4QTBA 1BYGA 3FZOA 2Q0NA 4FTUA 3PG1A 4L67A 3S3IA 4ZMEA 2CMGA 3MH2A 5ERGB 2JDTA 2Q83A 2WTDA 4MXZA 1OGUA 1SVHA 4RX8A 5IH6A 3NAXA 3M33A 2CNUA 3DLZA 4HCUA 4DQ0A 4L9IA 3CC8A 4AA5A 4GL9A 4XV2A 1PKDA 4BGHA 3KVWA 2GU8A 5T68A 4U5JA 1RJDA 1P4OA 4C08A 5LVMA 3LDGA 3DJ5A 3DTWA 4BDGA 1FQ1B 3PXRA 4O27B 4UOEA 1BL7A 3MB7A 2CWWA 5DTMA 3OY1A 4QPSA 4YV2A 3C4XA 3ATTA 5BMSA 3C0HA 3NJRA 2R3PA 3HCBA 5DSXA 3CD8A 3AXSA 3UJ8A 4G3CA 4TRLA 4YO4A 3FQSA 3IHTA 5FA5A 3LBYA 4LMNA 3F2AA 4GW8A 4IEBA 4O7TA 3WZUA 4BBEA 1O9HA 5D1HA 4CD0A 2ETRA 3VBYA 4X1OA 3F5XA 3FUWA 3V97A 2J2IB 3BI6A 3DBEA 3LBFA 2NP6A 4XOZA 2ERCA 3PX3A 1GJOA 3NCZA 1H0VA 2XNGA 2EFJA 2QO7A 3Q60A 4PIPA 2R3RA 4Y85A 1MJFA 1NW8A 3MSSA 3UTOA 2ITTA 3F2NA 5C8MA 4L42A 3IOPA 4ZJVA 2OWBA 3R9OA 2GHMA 3FAAA 4ZMFA 1IG1A 1PY5A 3R83A 3UJDA 2FO0A 1EIZA 3W2SA 3Q4CA 3AC3A 2CGWA 4KA3A 1OVEA 4DBXA 1KE5A 2J4ZA 4IX5A 5C8NA 3W10A 3AMYA 4U41A 5ICGA 4XNEA 1B38A 1J7IA 1O9GA 4YJNA 2EB3A 5EHOA 3VS3A 1LR4A 3MV5A 3R9NA 4F6UA 3AJDA 4FKSA 1Z57A 2WMXA 5AP2A 5BQ0A 3LVPA 3A8XA 3RCDA 3EGIA 3T7SA 5IH3A 2CKPA 3G6GA 3TZ7A 5HNBA 2VUWA 2BTSA 5TR6A 4NCTA 5CYIA 3EVEA 2HZIA 2OFVA 2ESRA 4TNDA 2ITOA 3FUXA 2JIVA 4MQ4A 3OG7A 2VTSA 3VBWA 3VS6A 1NW5A 4TT7A 4DG3E 1OPJA 3MDYA 3H9RA 4AWIA 5CALA 1W98A 5DTQA 2W4OA 1YWRA 5CAQA 3SGLA 3MB5A 4DG0E 5CUQA 2PXCA 3ODZX 4GS6A 4HGTA 4QMUA 3EKNA 3WZDA 1D2CA 4FOBA 4GYIA 5DX8A 1LEZA 4YC6A 3QWKA 1STCE 3N4VA 3OP5A 4IZAA 1PF8A 3IDCA 4RQVA 3NNWA 1RW8A 4ASZA 4BDFA 3F7WA 3NNUA 1RQQA 4GG5A 3QZIA 2BAKA 4QO9A 3MYGA 3NUPA 2VDUE 2XYNA 3FKLA 2PMLX 2PMNX 3QGYA 3W8QA 5KUPA 3MY1A 2Z6QA 3DXPA 4XYFA 1QZZA 1FPUA 2F8LA 3A25A 5ETIA 5DRBA 2EU9A 3F7ZA 4XG8A 2JJQA 2ZM3A 4GFOA 4YJRA 1ZYCA 5DT3A 5J1VA 1G8SA 4HPUE 3GENA 1L3IA 3TUDA 2WD1A 5F4NA 2BTRA 3RK5A 2VGOA 1VL5A 3OE5A 5AFVA 3SD0A 3ZLYA 4QPPA 3A8WA 5M53A 3SXJA 3FPQA 3GCUA 4IADA 4ACCA 4B6LA 2HMYB 5FWAA 3UFBA 3UDBA 5I9WA 2OBJA 3L8PA 2QE6A 2BPMA 4YUWA 5I5ZA 1HCLA 4TYEA 5CIYA 1YOJA 1IA8A 3C1XA 4FEVA 4XBRA 3EMDA 2C3IB 2OLCA 3EQIA 2XCHA 1R78A 4EH9A 2XYUA 2YDKA 2C6LA 2WXVA 4XH6A 4FL1A 4BLVA 3DXNA 3ZLWA 4OTDA 4XP0A 2WMVA 1SUSA 2ZBQA 1SNXA 4C04A 4IAKA 1YVJA 2EWAA 5AWMA 5CENA 3W32A 4I6HA 3UC3A 4ZK5A 3LJ2A 3V5PA 4CG9A 3H0YA 4L68A 3P7BA 4O6LA 4UALA 4BICA 4HGZA 4MVFA 4NWMA 3SVVA 3LECA 3AC1A 3KB7A 2VV9A 1ORHA 3VIDA 4AX8A 2I9KA 1R39A 3EN5A 3DULA 1H1RA 1JKTA 5A4EA 2H9VA 3TNWA 2IW6A 4XG9A 5T6KA 4EK6A 4C58A 5L8KA 4GQBA 2HZ0A 3RAWA 3MB6A 2NXJA 2VWUA 5HLNA 2UZUE 2JBPA 2W06A 2WELA 2E5WA 4M68A 4IM0A 2YJRA 4O38A 3Q96A 2WTJA 4KINA 4YTFA 3UJ6A 5I9VA 5HZNA 5HFJA 1WBVA 1RJFA 3ERCA 1XO2B 4OTHA 4FTMA 4F9YA 5ANGA 3OCGA 4JNWA 3WZKA 4AGCA 3B3JA 5IF1A 2C6IA 4OBQA 3U8WA 4E2XA 4J98A 3SQQA 2WIHA 4BCMA 2JFLA 2O07A 3FTFA 2WA1A 4D9TA 4RTOA 3E7OA 3ITZA 4JDJA 4QMVA 5M51A 4PYQA 5A4TA 4C7TA 3SSNA 5J9ZA 4X2GA 3NGAA 3Q87B 2C5OA 1ZAOA 1QANA 2XKCA 4GKIA 5AAFA 2DWBA 3TL8A 3PP0A 4A06A 1JKKA 3C0GA 2VX1A 3Q5IA 2QU6A 3II5A 4L3LA 3S95A 4AA4A 4BCNA 3QOWA 4BP1A 2R5TA 3H0ZA 5H8EA 3OEFX 1KYZA 2HXLA 1XQZA 4RC3A 4TYJA 4LOQA 4BTFA 4PNKA 4JBOA 3PXFA 3RZBA 2YCSA 2WTCA 4FUYA 2DQ7X 4GVJA 3SOCA 4D58A 1FP2A 2UZBA 5FXSA 5H2UA 3TM5A 3R02A 3BWCA 2AOVA 4DLJA 2C7RA 3BGPA 3MW1A 5DOSA 4BCJA 2HW6A 4I4FA 4BGGA 5L8JA 4DINA 3T9IA 2Z7LA 5DT0A 1XTPA 4A6DA 3AMAA 5K9IA 3GXLA 1ZRZA 3D94A 1JSUA 1UWHA 5DN3A 4ZTSA 4BDIA 3HA7A 4CXMA 5IQCA 3SDJA 3W55A 3ZTXA 2G2FA 4U7ZA 4HPTE 2W1ZA 1ZOEA 5EM5A 5ETFA 3HGKA 5HE1A 2RF9A 1JWHA 3TZ8A 5CXZA 2OKCA 4OQEA 4V0GA 1XH8A 2PVKA 3R2BA 1G55A 3U54A 5LOHA 1BHJA 5B1SA 5AIRA 3THBA 1LPUA 1Y8GA 4PINA 4AGUA 4PGHA 2PX4A 4PYIA 2ITPA 1B39A 3KQSA 1I9GA 2V22A 1X8BA 3W2RA 4FNXA 3I60A 2W5AA 4QP1A 4BC6A 1J1CA 3HMMA 2OXXA 3PJ3A 1NA7A 4QYEA 5ACBC 4EBVA 5KHXA 2HNKA 1JTEA 3CEKA 5EMKA 3CQUA 3R9XB 3AD6A 4W4XA 3HVIA 4AA0A 3LQ8A 3MS9A 4J71A 3P9JA 3P1AA 1QYRA 1K2PA 5DRDA 1UWVA 3KR2A 1P5EA 4L43A 1O6LA 2VWWA 4MX9A 3ZCLA 3BV3A 2UZVA 4LL0A 5E8YA 3O23A 5E9WA 2QG7A 5J5SA 2WU6A 3HRCA 4Z7GA 1KWPA 4NKAA 4H1MA 1YFLA 5CQWA 3VS2A 5CF6A 4GRBA 3UJ7A 2IH2A 3KCFA 2WMRA 3DZQA 2BAJA 5AV3A 4EC9A 4F63A 2F7ZE 4XG3A 4YSMA 2G71A 1Y6BA 3PJ1A 2W4JA 3ZONA 3OUKA 4Y83A 4PX6A 2IVVA 4WHZA 5L8LA 5HNIX 2YUIA 3REPA 3NAYA 4UZHA 3U6JA 2OY0A 3V3VA 3R21A 3D83A 2RG5A 4J1RA 2JDRA 4CRSA 4FS8A 3RODA 3C7QA 3FHRA 4IVBA 4PL5A 5DA3A 3CY2A 1YXSA 2Y6MA 1XH9A 2WU7A 1X1DA 2YFXA 3KRXA 4FT7A 3VUKA 3ANRA 4IBMA 2BMCA 4S32A 3ZMMA 1WXWA 4PDSA 3MH0A 5C8KA 5K0LA 2OXDA 3NEWA 3PPZA 1P2AA 1P1BA 1YI6A 3TNQB 3DAJA 5CX9A 2XIZA 2UW8A 2QOQA 3W2CA 3DTNA 4R7HA 5FLFA 3L9LA 3G88A 3X0DA 5IQHA 2ZW9A 1R1WA 1XBCA 3VS0A 4WVLA 3QALE 3R8UA 1NW1A 3P2KA 3NNVA 5K8VA 2WIPA 5JN2A 4J8MA 4IW0A 3QKMA 1UU3A 4GV1A 4ID7A 4MBJA 3B7PA 2BZHB 3L8XA 2Y4IB 4IH8A 4N70A 4W8EA 5DM2A 5BXYA 4DGOA 3DLCA 4C4FA 5K4IA 3KPVA 4CKCA 1M7QA 3LXPA 3KXXA 4LRKA 1V39A 1FOTA 3HA8A 5BVEA 5A4LA 4YTCA 1KP9A 5JGAA 5AP3A 4FT0A
chains in the Genus database with same CATH superfamily
2CFCA 4GZ5A 2JHPA 5G1NA 3H17A 4D56A 5EZ6B 1NR7A 1K2VN 4G24A 4D81A 4AMUA 2GPHA 1DAGA 3AR9A 1YHWA 3RFFA 5IWCA 2VA8A 3HMOA 3E2PA 3ZZNA 3DE4X 2WHPA 3NBQA 1GTMA 1NI4B 3UK2A 5BYBA 5CJJA 4Z0TA 3RJZA 2J31A 2VP4A 2FZKA 1ZWLA 3A6LA 4JLCA 4MRPA 1GGHA 3AT2A 1XTKA 5C1DA 3AUXA 4G4SO 1I2CA 4AIRA 3SE0A 2CLCX 3COJA 3DMTA 2QL6A 5ECDA 3EQRA 4X60A 2CNKA 4PQYA 2I29A 4WKQA 3FFWA 2VJYA 3C97A 1X1SA 4ZEGA 3F5PA 2JDID 1GN9A 3S55A 3FSKA 5L3AA 2GBIA 4J0CA 4B3HA 2AC3A 4HFJA 2Q9UA 2B35A 5E7RA 4HR7A 2IGBA 1JKXA 4J6FA 1XHAA 1QLHA 1MJ5A 4E5KA 3HV0A 4YHHB 1NVQA 1GTJ1 2DU8A 4BDDA 2QU7A 3S7ZA 4XR9A 3ZYZA 4DFZE 2UDPA 3ZW7A 2ADFA 1CZLA 2HXSA 4H7DA 4AZEA 4BWYA 2GDJA 3Q4UA 3MELA 2UZ1A 4I9FA 2EXCX 5HILA 5F94A 1TX4B 1GGNA 3BZ3A 2REIA 1NASA 1CIJA 2W37A 2R8PA 2ORIA 4CN8A 3I8XA 2HPAA 3R71A 5TQ0A 1XQ1A 2ONLC 5AV1A 3MA6A 3PIIA 4NW6A 3THOA 4RA6A 4EJ0A 2PRYA 2HXYA 2XWJI 1RLOA 2C96A 1N32B 1SIOA 1YIDA 1UXGA 5FP5A 3O0TA 1FUUA 1HXHA 4UE3S 2QTWB 1J8DA 4OU5A 4JYBA 1CEYA 4JHLA 3TW0A 3WGVA 1CNEA 3VZSA 2N9UA 1G5QA 2Z2JA 4O2PA 4XLIA 2J3EA 2XH8A 1ZU5A 2DOKA 5TVKA 2XOXA 1TD1A 4RADA 4U9UA 3ORRA 1L5VA 5I9NA 3PHHA 5KE0A 1TIPA 1IN7A 4GZLA 1MRUA 3PP1A 1DIOB 3KXLA 4RJ7A 3PEWA 1TKRA 1DRJA 4XIGS 3WF5A 3JYLA 3OT3A 2P7HA 1RDQE 4MO2A 4Q6BA 4NY1A 4YMVA 1DBSA 4LJ4A 4K1BA 2CN5A 1L5HA 2GTIA 3L01A 2DFLA 3RYHA 2X22A 3AM1A 2EJCA 3HKBB 1M8JA 4NS1A 5DCYA 3QAME 4PGGA 4U39A 3I01A 4EP1A 4FINA 4IP0A 3LZBA 4ZCSA 2I6TA 5H8BA 4JELA 4C06A 1CY6A 2BZ0A 2D62A 4X1YA 1EK0A 4X97A 2BN4A 4HH4A 1VKHA 4ZTNA 4O4JA 1MABA 3VC2A 2RJNA 4GM1A 1X9GA 4X6LA 4GT3A 2Z5FA 3AP3A 5J63A 3ERKA 1KDTA 1URCA 1GSOA 3IHKA 1R0PA 2BTEA 5FBHA 5FPPA 5LMCA 1VHQA 4XGQA 2ZJ3A 3GCGA 1PYGA 3J7TA 1W2WB 1VYWA 3KZ1E 3CNHA 5JEBA 3VS4A 4PP7A 5LZ4A 4EGSA 2F17A 4UDOA 1G8MA 3HKEA 3RBVA 2ATVA 3C1OA 4AS0A 2BHRA 2GNHA 4RNDB 2J90A 3LUKA 2ITVA 1XZPA 5DTEA 3R1IA 4O22A 1WVXA 1BLXA 4FYKA 4PDPA 2J9XB 4KPFC 2UZ1B 4YJVA 4WT6A 1N6LA 1ZJ6A 2OYRA 1F8UA 2AF4C 2PUPA 1SM2A 1K0UA 1P9WA 3LCRA 1T2UA 2OL4A 4OYLA 3WX0A 4BFXA 4WDRA 1SKAA 3R40A 4R4JA 3FLSA 1SVKA 4O2RA 3W0PA 3PWDA 2VTOA 3DJFA 2WJGA 2FPIB 2G07A 2PQMA 4Q7MB 2GZDA 2AYXA 3CXUA 2UZLA 3FUPA 3DGKA 2IPXA 5IM4F 3CX7A 3SN6A 3B2NA 3F3UA 4EW2A 3LQ2A 2AOUB 3FBTA 4F6SA 4JR3A 5B57C 4EA7A 3NU1A 1QTQA 4H0NA 2OIQA 3MFRA 4C2WA 3ABIA 3WAKA 4WA8A 1PJSA 4YZBA 2ZULA 2IDKA 5EIEA 2CEAA 1PK9A 3H9EO 3O2NA 1MFPA 5HTOA 2PSEA 3WIBA 1F0QA 5HIKA 2C9ZA 2HA7A 4ZSAA 3Q7TA 1ZW1A 4CEIB 4ZTLA 3TG2A 2EVAA 5DN6A 2P6OA 4E21A 3GJRA 2YFKA 1N33B 1L4EA 4ZO7A 3C1UA 2XJ0A 1YI0A 1T2AA 4JLWA 2PQ0A 1S9DA 4WA7A 1GCAA 1SB8A 1DC5A 4MWCA 1PK8A 3O2SB 4A0GA 4B32A 2BFFA 3K09A 4P5QA 3OTVA 1N92A 3JU3A 1IY0A 5CVEA 3NHKA 2PT5A 5AVOA 3ZU7A 3KSDO 3O3NB 5IM5A 2I55A 1MQ9A 4G16A 2DHQA 3O7LB 4R3RA 5H9BA 1DO2A 5LZ9A 4KVZA 2WMDA 1FU8A 5IAJA 3WISA 3VJKA 5C8YB 2G2IA 3LUHA 5B4UA 4DLNA 2FEWB 2BCJQ 2PZ5A 1TVEA 3ET4A 1AK2A 4QMNA 4IM3A 2IP4A 3QEBZ 1Z15A 2OBXA 3HYHA 3PZHA 3L7YA 4TXMA 1Q74A 1OIQA 4EH5A 4AG6A 4ZAUA 1KSHA 4R83A 3E5NA 5HUJA 4LRMA 5A9TA 3NHPA 2ZYRA 2O2UA 4PY1A 3OUUA 4L8GA 2YHIA 3D2LA 3J7AC 3EY4A 3MWEA 1ZUNA 4DEDA 4J7UA 4FSWA 1Y8CA 4Y2HA 5CVUA 3S1AA 1CJVC 4OP2A 3QCYA 2WOTA 4F72A 2Z02A 3E8NA 3RVKA 2M1XA 3P4YA 3GEEA 5D86A 3VR6A 3HVHA 2HCJB 3CUKA 2CBXA 4TV9A 1A9XA 1SD2A 2I1LA 3DFKA 1NT2A 3QM1A 4YJ2A 3PGA1 2BI7A 4AXBA 2IDJA 4BCPA 4Q9DA 4PTEA 3V5WA 4IDPA 1LEWA 1OYWA 1UNLA 5HUQA 5AKZA 4RORA 3DO8A 4DJAA 3L7DA 4UVIA 2HENA 4W7HA 2QLJA 3FMIA 3T1YB 5EIBC 4LMPA 1M2OB 2P2ZA 1E3WB 2HT1A 2AQIA 1CTPE 2JKMA 3L8ZA 5J2UB 1NXKA 2I0YA 2QTTA 3BK7A 4PO8A 5JZ9A 2E4VA 1RJWA 5L3QB 5KUTA 4P4GA 4MKIA 3OQNA 4PLWA 3ZY6A 1IONA 1WP4A 4POAA 2WLTA 2FFBA 1DOAA 4FC0A 4AUEA 1YA8A 4D9JA 3HPRA 4MINA 5IASA 3FYDA 3WKEA 1JIKA 1NVXQ 2I2AA 5I4BA 5KX5A 4YBJA 4O96A 3ICCA 3C70A 4MAFA 3HEMA 1WL8A 1ZM4A 3IQGX 1TJ5A 4QX6A 2FGKA 4P83A 4PBSA 1ZNYA 3AFHA 2AE2A 3HHPA 4GPZA 3OCBA 3KT0A 1W84A 5FULA 5ALSA 2YZKA 4KN6A 4FGLA 1E2FA 4I5EA 1J9GA 2YYSA 3KN6A 3TGLA 3RNYA 1V1KA 5M3BA 4KLAA 3HCCA 4E4LA 1HURA 3IB6A 2P9EA 1ORDA 4C7OA 4RZVA 2QU8A 1G21E 2X1MA 4X3FC 3IJ5A 3VKVA 2JIDA 3K0FA 5EXTA 4X3CA 4DDUA 5FH9A 3LXMA 3ZLTA 3DVRX 4NXMB 4N49A 3L7MA 4Y73A 2YZNA 5HUHA 2ODWA 4RMIA 1NY5A 2J59A 2B82A 2ST1A 1DPFA 2YHUA 3BTOA 5FP0A 3U1BA 6REQA 3VMMA 1Q97A 4JEHA 4BIEA 1JNYA 1G2IA 3GELA 4LY9A 5E3IA 1W4BA 5M4UA 1C3VA 2GHIA 5DF1A 2LWIA 2QGNA 1ZYSA 3SKYA 2OLEA 1E58A 2GBPA 3NTXA 4WCFB 3CZ4A 3VHXA 1ZN2A 2VAWA 3P2OA 3Q1KA 4DUGA 4C03A 2RIPA 1Z28A 4JUAA 3L07A 3ZE0B 1W34A 4ZI7B 2ZTSA 4EYEA 3GXBA 3V32A 4FQ5A 1VMIA 4MXDA 2OVFA 2WOOA 5GADl 4RVGA 2HW7A 1UM9B 1H6AA 3BHUA 2XIRA 4B33A 2ZIAA 3WO1A 3PVUA 3HL4A 2B1RA 5DNAA 3X43A 5EYDA 3Q10A 2OAP1 4KFRA 3AT4A 3WYNA 4DLLA 2OO3A 1RHKA 1XFDA 2NUPA 5BUZA 4Q7QA 2R7BA 3V80A 1ZK4A 2BDJA 4BZDA 3TE6A 2V5QA 1OI4A 4PUZA 1XD8A 3HCPA 4L8MA 1VRVA 4LOLA 1HDCA 4XYMA 3GJ5A 3RU2A 3K9BA 6LDHA 2QTAA 2J51A 2HJRA 2AZ4A 5KWSA 1VJRA 4FSNA 4BO3A 4MAOA 3BHJA 1PT9A 1K6EA 4EOJA 4RTSA 1CU1A 1P7ZA 3ECCA 2HY0A 1C7EA 2XVMA 3DM9B 4D4GA 4DAEA 2QRVA 4CR7A 1VBNA 4IV8A 2XGGA 1EXDA 4NBLA 1LGYA 3P0EA 3L84A 3ZSHA 3AU8A 1A4XA 2PMCA 2QRZA 4CCUA 3QC4A 4CRWB 4DDKA 4D0LB 3DMHA 1HT1E 2IY7A 4HAUA 3PITA 1H2HA 1TTQB 3H7IA 3L1HA 4F1WA 1J25A 4Z9FA 1YCDA 1UWKA 4D02A 2X81A 4ZJJA 1OIVA 4LGHA 2FMHA 2XLCA 2Q5FA 3SFZA 3NOVA 1KIAA 3HV4A 4I8XA 4AG8A 2X0DA 1ETUA 5CTAA 1TI7A 5HG7A 4OW8A 2VJCA 1OT3A 3UOHA 3BF7A 4TMXA 4RJ8A 2AQHA 2ZSAA 3GB9A 1KI1A 4EPYA 1IHOA 1G1MA 1Q1QA 4NV1A 3MAJA 4AKHA 4EL0A 3VH3A 3FNBA 2AA3A 3VVBA 2IFTA 1DOHA 1IA9A 2GZ1A 4C9BA 3U19A 5AM1A 3MH3A 1UIRA 4CTNA 5E4TA 3AGLA 1D0IA 3N5CA 4EM6A 5ANRB 1IOWA 4WNAB 5IVPA 1HLGA 1NW3A 5ER6A 2WHYA 2PMKA 2OHHA 4RK4A 4DZZA 3L7JA 1KI8A 1CFJA 5HG9A 3JVVA 1SXJB 2ZAYA 3KLPX 4CV3A 5JFWA 1MPXA 4MRMA 2JCXA 2BHSA 2EEPA 3HCFA 5E0KB 1I30A 3ZV6A 4ABYA 1XKQA 3I61A 3TQFA 2O1WA 3DTVB 2OSCA 5IA5A 1LSSA 2YUTA 3RTDA 3KWFA 1XRQA 2FJUA 4WK6A 1OKYA 3GLUA 2WFAA 4MYGA 3PHJA 1CYDA 3DE1X 1YCGA 4X6RA 4JB0A 1IEWA 1DFIA 2I9PA 1VJYA 1QYCA 4U7PB 2VU3A 3GRYA 5GVRA 1RVDA 2WE8A 2AG6A 4RQBA 2A58A 4FOCA 4Y30A 3IB3A 3ZDRA 1RHQA 4N3AA 1DIAA 5LDDC 1ODLA 3GP5A 2VXCA 2W9FB 4FIFA 1ETHA 4IXWA 5HOQA 4MBLA 4JJIA 3HI4A 3IERA 5HS4A 2A88A 5BSTA 3FWZA 1TO1E 2C2MA 3EWNA 1LSUA 5ETCA 3G49A 3PDTA 3F9NA 1RS0A 3RSFA 4IW3B 2XTAA 1TGVA 3HLTA 3DAOA 2PZBA 1ABFA 2Y99A 2B4SB 1Y1QA 3CE3A 2YS7A 2NU8B 3KC2A 1JQEA 1TK3A 3WYYA 2KJQA 2WD8A 4NHEA 3VULA 1XMJA 1N4AA 1B0AA 4G81A 3UP2A 4OOFA 2CCKA 2B2CA 3G9QA 1JHAA 3ZC5A 1XA3A 5CNMA 1FSGA 1C4WA 2IW1A 2XNCA 4HCJA 4FFPA 4TT3D 2IELA 1P62B 1H4VB 5ARBA 4GBGA 3FI4A 3R30A 4ERKA 3QLVA 4NABA 1U5BB 3W5DA 1LFDB 2GOYA 3R7AA 5HVKA 4TOIA 3WIEA 1LUAA 4MRRA 1U1EA 1M0EA 4ZIRA 3F9RA 3DOJA 2W05A 3ZZ0A 1J8MF 1KBQA 3EAQA 5EZ5A 3DHWC 5E4JA 3VU1A 1Y8QB 1ULZA 4KIOA 3DMDA 4IRUB 1Z74A 3WYFA 3DHVA 4BP3A 5JALA 4HLUA 4JDKA 3U9CA 1HDIA 1UKZA 4RJTA 1KK2A 2C2KA 3FEGA 3KYCA 3JQ7A 2YC2C 2B9VA 1ZVJA 3GPDG 1M14A 2RG7A 1CF4A 3H86A 5LM3A 1H2AS 3IOBA 3N4UA 2A4LA 1XJCA 4NBNA 3WAJA 3OG9A 2QZZA 3DBCA 3PLAE 1CRPA 3FSJX 2AN3A 5WRFA 3FOFC 4L08A 1Y7HA 2VOEA 5TMBA 3OX4A 1M8GA 3RI3A 3DPKA 5PNTA 2H65A 3QY9A 3K3IA 5E6UA 2ZRBA 2X2FA 4F78A 3GUZA 2D59A 4TYIA 4RJKA 4R3CA 2AMLA 3KE9A 3HV2A 1TA0A 3LCCA 3TJRA 1N6HA 5GGYA 3ICWA 1KIMA 2ODTX 5A3VA 4IV0A 3DLBA 3ZIAD 4QMZA 2ZR8A 5KJ6A 2XQFA 4KLCA 1P4SA 4FOTA 4EHZA