5GINE

Crystal structure of box c/d rnp with 12 nt guide regions and 9 nt substrates
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords C/D box methylation guide ribonucleoprotein complex aNOP56 s
publication title Box C/D guide RNAs recognize a maximum of 10 nt of substrates
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 67
structure length 227
sequence length 227
chains with identical sequence F, M
ec nomenclature ec 2.1.1.-:
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ginE01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ginE02
3C1XA 4NTTA 4RTSA 3VUMA 3BHVA 1J1CA 4BTKA 2OJIA 4I6FA 5K0GA 4J1RA 3TKUA 3MA6A 4EWQA 4DG0E 3KRRA 4IH8A 4BBFA 4KKEA 5EDQA 5AP4A 4YNEA 2R7IA 2BR3A 3FI2A 4IZAA 1X19A 3R2YA 2VTSA 4QTCA 1XHAA 5ANKA 3C0KA 5IUGA 2GNJA 2OO8X 2R3OA 3QKKA 4OW8A 2ZB0A 4E6CA 4KRGA 3P7CA 2OBFA 3QTIA 3UP7A 1Y8CA 1PXOA 3NDJA 5CEQA 4L46A 4OA5A 2W9ZB 5IA2A 4Z16A 4AT5A 2B55A 4P58A 3D5WA 4HGEA 2WIHA 3MY5A 1M14A 2C1BA 4RV9A 3WI6A 5HX8A 4XG9A 1J1BA 1XKKA 5ETIA 3A27A 3LM5A 3QQUA 4JQEA 2XVMA 3IGGA 3E8NA 4HRAA 3RAHA 5CQWA 3PIYA 3SXRA 4TWPA 3FTCA 5EHGA 4GOMD 4FKWA 5M08A 1PMEA 3R9RA 3BKWA 4K77A 2QNJA 4JL9A 4C04A 4ZK5A 2F57A 1JSVA 3RP9A 2HZIA 1M6YA 2V62A 2YIQA 4E33A 4NECA 5M55A 3EQRA 5CF6A 2PBFA 2Y7JA 4CRLA 5CENA 3P8ZA 2WQEA 5LWNA 3I0OA 2E9UA 4UWCA 3FZSA 3D0EA 3ITZA 4EHVA 4R8RA 5CEPA 3HMNA 1YOMA 3AC5A 2ZVJA 4FIFA 1R39A 3R8MA 4BDFA 4LG1A 2Q0BA 3FLSA 2ZOQA 4QP7A 5IKMA 2QY6A 2BR4A 2VWXA 1IA8A 4QMSA 3I4BA 2B53A 2XKEA 1M7QA 1OM1A 4PYQA 2F7ZE 3OCGA 3P9KA 2KTYA 2O07A 4U7TB 4FZDB 1QMZA 2ACXA 4EQCA 4CLIA 4MVFA 4RVDA 4Q9ZA 1NW7A 1MQBA 2ZLBA 2QRVA 2YIXA 1R0PA 3V6SA 3OFKA 4DZRA 3K6RA 3ZHPC 3NX8A 1U54A 3Q9YA 2XIKA 1PF8A 3DTWA 1X1AA 3OT8A 2AR0A 1J91A 2AC3A 2X1NA 2FO0A 2W1HA 1NBIA 4B9DA 4DBNA 3UC3A 3CY2A 4GV1A 1EH4A 3BX5A 4YUVA 2PK9A 5EZSA 2Z6QA 5LJJA 3EYHA 2WQMA 1AQIA 4V05A 1WZNA 1ZZLA 2PZIA 3KQTA 1J7IA 1NW1A 5EFQA 4QNYA 3L8PA 3DOGA 1BKXA 1WBVA 4IWDA 4DH1A 5ICPA 4JR7A 4HGYA 3ANRA 3MS9A 5FXQA 4X2JA 3QZIA 4JR3A 3HLLA 3VUGA 5AWMA 4PONA 3MW1A 4XG6A 2C6KA 4PTGA 3UBDA 2X6EA 2J0JA 1S9IA 3HL7A 4IZ7A 4U9AA 3R22A 5ERGB 1WBOA 3NGAA 3F3ZA 8MHTA 4DLIA 3E7VA 3EVEA 3DDPA 3PG3A 1HOWA 3KU2A 3MPTA 3VS2A 3G89A 3E8DA 3W32A 1YWVA 2YM3A 1P5EA 2EB2A 1Y8YA 3O96A 3KPYA 4CCUA 2UYOA 3JR1A 1OL6A 3BCEA 1BOOA 3U87A 3GRZA 2VZ6A 2AUHA 3S3IA 3QUPA 2OSCA 1PKGA 3CS9A 3E88A 3ORXA 3HKOA 3ELDA 4TWCA 3WIKA 4O84A 3DBCA 4IM2A 4A06A 3AOXA 4FSRA 2O63A 4AGDA 3PS9A 1NKVA 3HA7A 3NNWA 4U3YA 3C4XA 3OE4A 3E3BX 5J95A 4KBAA 2JEDA 1XCLA 3BGVA 3EFJA 1HCLA 3QYWA 4DFBA 4EKLA 3HCAA 4DH5A 5EOVA 1PXPA 3ROCA 4X2KA 2JHCA 4Y5QA 5GM2A 4EK4A 2HNKA 4FG8A 2ONLC 2VTLA 3UVQA 4ACGA 4C61A 4DINA 4RC2A 3V5WA 5IH6A 1KV1A 3IDPA 5CSPA 5JH6A 2Y4IC 3BWJA 3NJRA 3P23A 1FGIA 5EQYA 3R7EA 1DL5A 1KHHA 2XCHA 4RFYA 4O0RA 2NRYA 2UW5A 3F69A 2BDJA 2XK8A 4YBKA 4YJRA 5ACBC 5E8YA 3DXPA 5IQEA 3EGVA 3FJQE 4YJPA 3DXQA 2XRWA 3MVHA 4HYIA 3ZXTA 1YF3A 3R04A 2PVHA 2WNTA 5T68A 1TVOA 4BCKA 4L9IA 5CASA 1OL5A 2A0CX 3TR6A 2UZ4A 3FMDA 5IISA 3E8SA 5FXSA 4FTNA 4CFMA 2R3GA 3KVWA 4WVLA 2R64A 5CAQA 5CUQA 3OEZA 4CEGA 4C36A 4C4IA 5CEKA 3SC1A 4CCBA 2G70A 2B3TA 2JDRA 1G55A 1M2PA 5CTPA 4BHNA 3R01A 1OIQA 4V0GB 1JQHA 3KPWA 5HBEA 4GFMA 5CVHA 2VTPA 4Z55A 4RTJA 2R3NA 2UVZA 3MIYA 1MRYA 2IH4A 1ZHFA 2A2AA 3MA3A 4QMVA 5TKDA 2GA9A 3RM6A 3T7TA 2QO2A 4O7ZA 3FAAA 1L3BA 2Y6MA 4NCTA 2XRUA 2PPQA 5AJQA 3EQBA 2VNYA 2HXLA 1XDZA 4RVFA 4AUAA 5EKUA 2KW5A 4JDKA 4RX7A 4FV3A 5E8UA 1TW3A 3FLQA 3JWGA 4I23A 3EQGA 3F2NA 3IQ7A 3QD3A 4XS2A 3W18A 3F3TA 2C6DA 1UU8A 3IHTA 2W1IA 2X2LA 3R9HA 3O8TA 1LEZA 1OKVA 3T3UA 4EL9A 5HIIA 4BYIA 1OUKA 4QPAA 3VS4A 2YJSA 1OUYA 3QF9A 4Z9LA 2CMHA 4YC8A 3E8CA 2ETKA 4IB1A 2WTWA 2FYTA 4A7CA 3II5A 4XG3A 3UZRA 3BT7A 4M69B 4EOPA 3GOKA 5ICCA 3DNDA 4FV2A 5DRBA 5CNNA 4D4SA 3O7LD 5CAVA 3MGYA 1R0EA 4ZOGA 4MD7E 2C6LA 2Y9QA 1OKZA 3G0FA 2ZVAA 1H1SA 3GP0A 3DLSA 2I6GA 1KSWA 4HSGA 5JQ5A 3RODA 5H8EA 5CEOA 2W1GA 3TUBA 2FSMX 2CNUA 2ZB1A 4L01A 3HA8A 5HQ0A 2RG6A 4FZAB 4X21A 5AADA 3HV7A 4I20A 3CEKA 2QOFA 2PL0A 3I79A 4OQEA 1SVHA 2ZYBA 4FV6A 3C4FA 2XK6A 4O7NA 1H4LA 5HX6A 1SVEA 1UWJA 2F7EE 5AUVA 5DPVA 3I9FA 4TXCA 5EM7A 4FTLA 1B6CB 2GFCA 5F94A 2XNBA 4YZ9A 5FUBA 4DEDA 3A7JA 5EYDA 3LKDA 4BCIA 3LECA 3WF5A 3FLNC 1BHJA 5AUUA 1OECA 4ZSAA 5DR2A 3HP7A 5HEZA 4OTFA 3WYXA 4PNIA 4HYSA 4UALA 4MQ4A 3ZUUA 5KKRB 5CM2Z 4XBRA 4G16A 4MD9E 5U4XA 4FK3A 5LR6A 5EI6A 4RJ7A 5D11A 3QTUA 4AU8A 2C5YA 3D14A 1XH7A 4I41A 4F6SA 1YXUA 4NM7A 3R63A 3PE1A 3NTVA 4OA8A 3ENMA 5KUPA 2QOLA 4NZWB 3PPJA 1Q8UA 1K3AA 3EL8A 4U7PB 4IM3A 5KMJA 2NP7A 4ITIA 2WTIA 1H1QA 3AD5A 3CY3A 3BXOA 3DMFA 4CFXA 4QPNA 4OBXA 3ZSGA 1JOWB 2ZWAA 2NP8A 3S00A 2HK5A 5KMIA 3ZDUA 4YLJA 3AT3A 3LFAA 4Q5EA 1DAYA 4QP6A 1RQQA 1X1DA 4FEUA 4E2XA 4ZZNA 4QMNA 3TCPA 4ER3A 3U81A 3LLAA 4Q9SA 1L8TA 2UW8A 4GVJA 5HKMA 5IQHA 3ORZA 3E87A 2QKWB 3TACA 3VC4A 4J7BA 3QZGA 4FT0A 3CJTA 4NM5A 4JIAA 1PXKA 4XOZA 1GZ8A 4IEBA 2IDKA 5DSTA 1MJFA 3C6KA 3FL5A 2PUIA 4LM5A 3MESA 4FZ6A 3R71A 3ZLXA 5D7AA 3GBZA 2VTQA 4AOTA 2FSTX 5BUJA 4PL3A 4EYJA 3UBTA 2WU6A 3HUCA 4ZTBA 1YHWA 1YXSA 5FHQA 5GOZA 4UXQA 4O0UA 5GIOE 4JAIA 2WMRA 3M70A 2XYVA 3SOCA 4PDPA 1Y6AA 4X41A 1F3LA 3EKKA 4RTPA 3VBWA 3G90X 4C0TA 1FQ1B 4FSMA 4LGHA 4NKAA 3UJ6A 3U51A 3NVKI 4JX7A 3MI9A 5FCDA 2ZCJA 4S32A 2EX4A 3EKNA 2VUWA 3ULIA 4MXZA 4PYNA 1T43A 1H28A 4O7SA 4KVZA 4JQ7A 3R9OA 4KDRA 1GOLA 3C13A 1XVAA 3P79A 2P55A 4LG4A 3FZPA 2R3FA 5EOBA 2I0EA 1YUBA 5GNKA 2UYHA 3RPOA 1YB2A 3D5VA 1G5SA 2WMXA 4NM3A 1XQZA 3SAYA 3LDFA 4UV0A 2C68A 1JSZA 4NH1A 5E8VA 2RFNA 2IO6A 1BI8A 1WG8A 4PNEA 1YDSE 1W0XC 4F1MA 4Y95A 2OZVA 1XJ5A 5T3QA 2CMGA 2XK4A 3MERA 3TTJA 1VE3A 5HG5A 2J50A 1JSUA 2EU9A 4RVMA 4IVBA 5GINE 2J0LA 5IA0A 4LI5A 2PVRA 3FL4A 3GRRA 4G56A 1XO2B 3PPKA 4C35A 3T8OA 2JKMA 4WO5A 2P3LA 4Y73A 2PYWA 4IZ5A 3OF0A 2VO0A 3C5IA 2C3KA 1VYWA 2O64A 4KIOA 4L6QA 5DX1A 1STCE 5FA8A 2YN8A 4IZYA 5KNJA 1XBBA 5KE0A 3HP2A 1G3NA 4Z2YA 3BEGA 3NPCA 4F9CA 2JAVA 2CCIA 4CSVA 2XBJA 2W9FB 3BV2A 3CR0A 3F9NA 4HPUE 1UFKA 1GNGA 2IJMA 4PIMA 5HCYA 3MQ2A 4FMQA 4Y30A 2VTRA 3LDUA 4FICA 2YEXA 5DI1A 3V5QA 5AP7A 2PVYA 4EH6A 2VNWA 3MH2A 3OOGA 3RAIA 4CKEA 5M5BA 4LL5A 2VU3A 3R2BA 3OW4A 4UBAA 3ZTXA 3HRBA 3R1QA 4PY1A 2XUUA 4RIWA 3OWLA 5D12A 3A2CA 3IO7A 3FRHA 4EZ5A 3RK9A 4IB5A 2OICA 5JFVA 3EVBA 3KR2A 1UA2A 5EZQA 4G6NA 3GT8A 4ACHA 1ZARA 5DM2A 4RVTA 3V01A 5M51A 3R00A 5ANJA 1YWNA 4GG7A 2OZOA 2C5XA 3TZ7A 4TWOA 2B9FA 5EYCA 2CKOA 4PRJA 4TYHB 3RPRA 3TDVA 5IF1A 4PL5A 4MBIA 3P9NA 4KKGA 3NUXA 4MBJA 2RIOA 3FE3A 4ZS0A 3GC0A 4FSTA 2JKOA 3OFMA 4KSQA 2IZTA 3T9IA 4EBWA 3G2OA 3PXYA 2W1CA 2X7GA 3G33A 4CKIA 2QLQA 2XK7A 4RVKA 1ZOEA 2BZJA 2C69A 3CXWA 4I0SA 4LQMA 4H58A 4QP9A 1SNUA 3A25A 2BCJA 3EN9A 3BHUA 3RINA 5AAFA 4A9TA 4MNEB 1KE7A 3BHTA 4TY1A 4YPSA 4RA4A 3TNWA 5LWMA 4RWJA 2B9JA 3C4EA 3KR1A 5K3YA 5IQDA 3BZBA 3O7WA 4M15A 3W2RA 5E1OA 3TI1A 3E62A 3F82A 3HCFA 3CGOA 4ZTQA 1I44A 3MTLA 3WZEA 3SVVA 2UW6A 3EFKA 3MY0A 1H8FA 3SXFA 4GEOA 2H8HA 1ZAOA 4D28A 5E92A 1DAWA 3HMOA 3ZOSA 3C7QA 4D5HA 3RMFA 1CKJA 5H2UA 2DS1A 2JD5A 5AAEA 5A9UA 1RJEA 1RDQE 4FOCA 3BELA 2YERA 4IACA 3QOXA 3RAKA 4OTIA 5M56A 3CCNA 3DB6A 2GFSA 4M12A 5HU9A 3OZRA 4IVDA 3DK3A 4JI9A 5E1DA 3KQVA 3BI6A 4QQCA 1P1CA 2O0UA 4RX9A 3UNKA 4UOEA 2HENA 3OZTA 4U97A 5HO8A 5EI8A 3GC8A 2PE2A 4IIRA 5CAUA 1JG3A 3UJGA 4FNZA 5M53A 4TN6A 5DR9A 5HD7A 1JNKA 2ERZE 5CZIA 5LOHA 3VHEA 2YCQA 4FSDA 2R3RA 3POOA 2GLUA 2ZAZA 3EQDA 5CU2A 2XEZA 5BYLA 3TKYA 4J98A 2J5FA 4FA2A 3HGKA 2UZTA 5FLFA 3ALNA 2EB3A 5C1IA 1JQEA 2HW7A 2HWKA 3DKGA 4FSNA 4WIHA 1JR4A 4C4EA 2HZ4A 2VWIA 3MFSA 4NK9A 1RI4A 3VF8A 4LRKA 5EK7A 4L3PA 3QTXA 3G9LX 4ZZOA 1G8SA 5IH3A 3NUAA 3ZBFA 2HTEA 4CWAA 4NW5A 2W5AA 3FMEA 3FMJA 4TWNA 1M2QA 5A4CA 2ITPA 3RNIA 5CS6A 5CNOA 4C2VA 2OZAA 3HECA 5CALA 3W2SA 4Q5HA 3HCDA 3HNRA 3H9RA 4C38A 3DR5A 2WTKB 2CGVA 5BVEA 4PDSA 4BTMA 5M07A 2ZV8A 4TW9A 2C7OA 3VJNA 4O6EA 2NXJA 4XP3A 3CKXA 2OJJA 4G17A 5BMSA 4RC4A 2YZAA 2AOWA 3OWKA 2UZUE 4BGQA 3FRIA 4D9TA 5CU3A 4YU2A 2P33A 4O91A 4RVHA 5P8WA 3QA8A 4QMQA 5AV4A 2OIQA 4FV7A 3UQGA 4FNXA 3OE5A 3F5XA 3PXZA 3TQSA 3CQUA 2AN5A 2AN3A 5AEPA 1SYKA 4AGCA 4V0RA 2ZIGA 4MHTA 3KMWA 3IOKA 3RK5A 5C9ZA 1KV2A 4YMJA 4IDVA 5HFJA 1AQ1A 1NW6A 4RWZA 1G6Q1 5M44A 4RIOA 1R1WA 2WQNA 4KUJA 2CKPA 4M84A 4C4GA 2XJ1A 4RLKA 5BW5A 1WCCA 5HGIA 3W2PA 1P91A 4FEWA 2EXMA 3ZUVA 4S33A 1OKWA 3BGQA 4I93A 2Z7RA 3P4KA 3EJ1A 4O86A 3ZZWA 4OTGA 4QMLA 5C4LA 2O0LA 4D9UA 2ZM4A 4F1TA 3A8WA 4WUAA 4QMTA 4AZWA 3HP5A 2IW8A 4YJNA 1W83A 2XYRA 3EOCA 4FUYA 3EPPA 3U6HA 4YJVA 1O54A 4X2GA 5ITAA 3WZUA 3PT9A 4FK6A 2QC6A 3K5VA 4MQ1A 1PJZA 4QQJA 3G6HA 4TTHB 2PJDA 2OB2A 1KR5A 2B9EA 4DEAA 4OX9Y 1JQ3A 5A4LA 1MP8A 3JS2A 2PZYA 5EIWA 4Z7GA 4YZDA 4D4YA 5T6BA 1P14A 3EGEA 3KY2A 5HBHA 3IW6A 4ANQA 3NAYA 3A7DA 4DG3E 1KXZA 5IUHA 3KU1A 4EK5A 2XVDA 3LPBA 3OFJA 3CSVA 2VTIA 3DKCA 2NNWB 2X7FA 2C3JA 2YDKA 5I9XA 3NEWA 2OF4A 2O57A 4E6AA 3NDIA 4IV8A 2BROA 4P4CA 5FP5A 1U54B 4YTFA 3VRZA 5M09A 4O38A 4F7LA 2BHEA 4OBOA 3PY3A 2BAQA 3VW8A 5CF4A 3L9LA 4DAWA 4DTBA 5ANGA 1Y91A 4TYIA 1PY5A 4LOQA 2LGCA 2H96A 4YO4A 2FA2A 3SW7A 4IAKA 3H0YA 3BGDA 3TRKA 3AC4A 5LQJA 2GQGA 4JRNA 5AV0A 4GFOA 3BU3A 3JYAA 3RJCA 3AT4A 2CN8A 5LMAA 4P7GA 1IR3A 3UA3A 1R8XA 3QTSA 2WGJA 1JQDA 2NYUA 4MBLA 3ZFYA 3HMPA 3I64A 5E1EA 4CD0A 5CVVA 1YDRE 4ZTNA 4XP2A 2V7EA 2IN6A 3R83A 5IEVA 4UZHA 4F65A 3F7WA 3LXKA 5AV1A 5EHIA 4FIJA 4BCGA 2P35A 2CJMA 3AMYA 5CSVA 3GXOA 4XRLA 5JR3A 2KULA 1SZMA 3V97A 1DI8A 1YI6A 3R9XB 1DM2A 4F86A 4IKPA 3MPAA 5EM6A 2VTMA 4ZIMA 1WZYA 1YXXA 4XHKB 4FTJA 4MTLA 5AA9A 4AN2A 3MVLA 4FKRA 4ONAA 2YDIA 1INLA 2JAMA 4MKCA 5FQDC 1ZLTA 3NWEA 3MYGA 3BHHA 4EQMA 3DJ7A 4OTRA 5EMMA 3MB6A 4BZDA 4GS6A 4H3PA 3LKZA 5CF8A 5HI2A 5AM6A 2VAGA 3E63A 3BWFA 3EHAA 4AZVA 4ANLA 2ONLA 4GK2A 5M06A 4FP9A 3EVCA 5AUWA 5IG1A 1FMOE 1ZGJA 2BMCA 4JG6A 3TEIA 4DEBA 3ULZA 3BKXA 4I94A 4PF4A 5KBQA 4I6BA 2BALA 1WBTA 4TL0A 3AC3A 4G3FA 2Z7SA 2ITWA 4AOJA 3QRJA 2X6DA 4XG2A 4M67A 4BKJA 3L8SA 3DXZA 4ER7A 3BQCA 2R3KA 4NFNA 1JG1A 2PSSA 4CMTA 1MQ4A 3P9JA 1A48A 2WKMA 3TJCA 4M36A 4TNDA 3FLZA 4QQNA 4J71A 5E9EA 2OKCA 3LJ2A 3R8PA 3RKBA 2JLDA 3CC6A 5DXJA 4RTNA 3PSCA 5BMMA 3O8PA 3VN9A 1UV5A 4W4XA 4QMXA 3NAXA 4MD8E 3R3HA 1SKMA 4ENYA 3EFWA 1P1BA 2QOBA 5E8TA 4O82A 3W1FA 4ISCA 3FTDA 1Q62A 3C9WA 1OPLA 4KDCA 2C7QA 2YM4A 4A6DA 3CQEA 4MWZA 4MXOA 1QANA 3G15A 4OT5A 4QTTB 3IK3A 5E8RA 1OL1A 3ZM4A 2C30A 2PY3A 5EQPA 5CT7A 2QHNA 2VO6A 3H4JA 4BCPA 4RTOA 2JDOA 3QCXA 2EJUA 4BTJA 4R3CA 3WE8A 2C4GA 3MTEA 2ERCA 1ND4A 3SG9A 4XG8A 5I9UA 1Q8ZA 2GDOA 1O6YA 3ORMA 3LL7A 3NWWA 3TZMA 1JG2A 2VGPA 3RAWA 4QPSA 4HYUA 3UWPA 1ATPE 3G51A 5FM2A 4ZJVA 4B6LA 4FKJA 2X9EA 1XH9A 3KXGA 3MBLA 1OPJA 4L45A 5AP3A 4QTAA 1IG1A 5DXAA 3LCOA 3LFCA 4ORKA 4ASEA 1VQ1A 2YIWA 3LMHA 4M68A 4N57A 4QTBA 5D41A 2X39A 1S9JA 2HV9A 4YV0A 3ORLA 4PX6A 5JZJA 4LRMA 2EJTA 4BY9E 3UOJA 3U4UA 3NRMA 4FZ7A 2ESMA 4XX9A 3UMXA 1V0PA 4ASDA 5A4TA 1D2GA 5C8KA 3MTIA 2UZDA 3FYJX 1PYEA 2CKQA 4H3BA 4YZCA 4DEIA 1YVJA 3I6WA 5H3QA 4UZDA 4YUZA 4OTWA 3FQEA 4AZTA 4HPTE 3ALOA 5C01A 1WMKA 3NR9A 4TRLA 4KRDA 1GAGA 4FNWA 1YFJA 2R3JA 1OZ1A 4FKVA 2YCFA 3I7BA 2ZZNA 4USDA 3LGAA 3O4FA 5CSHA 5E9JA 3EWHA 3ZXZA 2E9VA 4W4YA 4E4LA 2W4OA 4C4JA 3KXZA 1V0OA 4X3FC 2X2MA 4QP4A 4P5QA 4U7ZA 1UU3A 2P7IA 1WVWA 3EVDA 4GH2A 4HVDA 1VZOA 4B8LA 4IJ9A 3IONA 4O0YA 1JKKA 2CGWA 5J1VA 3KHKA 5CI6A 1EQAA 4M7RA 5J87A 3FZOA 4FTUA 3GU7A 3ACKA 3OWPA 4GCJA 3KN6A 2UZVA 2UZOA 3THSA 4E70A 4O21A 4L42A 4Z3VA 2DQ7X 4LMNA 3I58A 3ORTA 5IDNA 4RTRA 2H11A 4F9YA 2JH9A 3BUSA 3BV3A 2VWZA 2UVXA 1ZG3A 1ZGAA 1YFLA 4A9YA 1QAQA 3KMMA 3QRKA 4LUDA 2HY0A 3UOHA 2C7RA 3BLQA 5DWRA 3TM5A 2PX4A 4RZVA 2W0JA 3OT3A 3NCGA 4L8MA 4I4FA 3O7LB 3BE9A 3FBVA 3WZJA 2ZMDA 5FADA 3SQQA 3DOUA 3F5UA 2I0HA 4L44A 3DNEA 3DB8A 4IVCA 2P7HA 5GWXA 2HCKA 5C26A 2ITVA 2WXVA 1QAOA 4YHFA 3NYXA 5BVNA 3R8UA 3S4QA 3QL8A 3KXNA 4AT3A 2AOXA 4V04A 3WSTA 4WNMA 4F6UA 5EGSA 2O05A 1K9AA 2HW6A 3KQ7A 5CAOA 4BCQA 5BNJA 3TXOA 1M6EX 3QUEA 3PVUA 2RF9A 3UODA 4RJ5A 3HA5A 2JDTA 2VP3A 5JRQA 3DH0A 3NUYA 4C37A 1R3CA 3F3UA 4D1XA 2YM6A 4YMHA 3LCKA 1KWPA 5HE1A 2ETMA 3HMIA 4TKSA 2HELA 2GCDA 3L1SA 3PY0A 3F88A 5ANOA 3O31A 3WOWA 4MQ2A 4AP7A 5CAPA 1F3MC 4JG7A 1OPKA 3Q9ZA 4KSPA 3FDNA 4PYOA 4C4AA 2G2IA 4J96A 5EM8A 4HGZA 3QQFA 3LXPA 3RALA 1DI9A 3O51A 3FZRA 3ZLSA 2QM3A 4U42A 5J7HA 2VTNA 3M6VA 2IVTA 5DR6A 1CMKE 3ZC6A 3MJ2A 1V1KA 4YBJA 5HESA 3SD0A 5EKXA 4QRCA 3KF4A 4KS7A 5B2KA 3FYKX 2PE1A 1FP2A 5I9YA 3FTEA 5KMMA 4L7VA 3IDCA 3QQLA 4QMPA 3UP2A 3OU6A 5LVLA 1ZKDA 3OZSA 1IA9A 4YP8A 4USFA 4X61A 1NXKA 5B2MA 4M8TA 1IM8A 3LMIA 4U40A 1QZZA 4O6LA 5CZHA 4D0XA 3RM7A 4DGNA 4YLKA 4BDEA 5HNIX 4WHZA 3F5GA 2BIYA 1RJFA 5CSWA 2ITUA 4DC2A 3OPNA 1SUIA 2Q83A 4PP7A 4PWNA 5DWQA 4J97A 4WNOA 4AA0A 4ZJJA 1YOJA 3FUTA 3PLAE 4RSSA 3ZONA 3DULA 4YZNA 3K3IA 3CGFA 4FT9A 3FPHA 3DJ6A 1N2XA 4BDBA 4ZMEA 2ITTA 3A26A 3D94A 4GOLD 1O9GA 1UNGA 4QNAA 1QPJA 5IEYA 3F5PA 4B17A 4RZWA 5AV2A 3FMKA 4YZMA 4C4HA 4O7WA 4C33A 3OEFX 4K6ZA 5EYKA 2BDFA 2QR7A 3RCDA 3JVRA 5LSAA 2G01A 2WTKC 3TG1A 1ZOHA 3DZOA 2R5TA 5BPYA 3IG7A 5G1XA 2VO7A 1YWRA 4JAJA 5CX9A 3VUDA 4GC5A 4JBPA 4YC3A 3VUIA 2BKKA 1ORIA 2BUJA 3WBLA 3EQIA 3QTZA 1KYWA 4RGJA 1UKIA 2GQSA 1IASA 3N4TA 4F0GA 1VYZA 4FSXA 1PMUA 1UNLA 4EH4A 4R7HA 4BDKA 1WBNA 3WF6A 3ACJA 4KKHA 5E4HA 3IDBA 3BWYA 3C6MA 2CNQA 4G9RA 4RVGA 2GU8A 3C50A 4DLJA 3SX9A 4O81A 2QHMA 1NBHA 1VIDA 3H3CA 4B0GA 4FKIA 4C02A 4WNPA 2WA2A 5IQCA 4JBQA 5DTRA 5KQRA 2PWPA 2BTRA 3TFWA 3FWQA 4FVRA 4APCA 2XNGA 2OH0E 3FXXA 3VBYA 3QXOA 4G3CA 3QRUA 3P0MA 4UYNA 1D2HA 4JS8A 4B7TA 2QODA 3FMLA 3PB3A 5IMXA 4QTEA 4K11A 4DEHA 5E1SA 4AGUA 5HU3A 5HIMA 4BLUA 1I1NA 2CSNA 4G3GA 5KMNA 1TQIA 2UV2A 1Y57A 4MXYA 4YHJA 1Z9XA 1E1VA 4DF3A 5A6NA 4FV0A 4KAOA 4TYEA 4RIWB 1QPCA 2A19B 5DM4A 4YUXA 1XH6A 4RX8A 1OGUA 1VJYA 3L8DA 5FG8A 3TDWA 3OWJA 3BU5A 1YHVA 2WFYA 4HOKA 2XNNA 3PZEA 4QT1A 1EAMA 4PCAA 5DE2A 2B25A 3PE2A 3TV4A 1X8BA 3ELWA 3ID6C 3IS5A 1UNHA 3IW4A 3RGFA 4PQNA 3Q4UA 2G15A 3GFWA 3LQ8A 4C34A 3LFQA 1MHTA 3ENHA 4GUEA 3TL8A 3BU6A 1R74A 2ZWVA 4FVPA 5IA3A 5DYJA 5D9HA 2HMYB 4LWOA 3ODZX 1HNNA 2PULA 3NIZA 3HA3A 1UVRA 2ZBRA 4DA5A 5L3AA 4NFMA 4YUWA 3RCJA 2C0TA 4BI0A 3S0OA 5I9WA 3VULA 3MFRA 4XLVA 5LVOA 4FVQA 1APME 5E2AA 3FPEA 4PINA 3QQHA 2JIVA 2OW3A 2FHPA 1FJXA 3GNLA 4QQTA 2QKRA 3W8LA 1Q97A 5LVPA 1KIAA 2I40A 5LQCA 2XYNA 2OXDA 3E05A 3TUCA 2C6TA 4ZTRA 3BBWA 2ZTHA 4HH4A 2Z6UA 4ZP5A 4F4PA 4BDGA 1VP9A 1PJKA 3QD4A 4DFXE 3ZMMA 3Q4ZA 3DXNA 4YTIA 2YXEA 3OTUA 4I22A 4G31A 5D10A 3R7OA 5KX8A 5EVJA 5HIKA 2IW9A 4CKRA 2GTNA 4FSUA 5EDRA 3W55A 4ASZA 4OTHA 4DGOA 2RKUA 3RPYA 2J5EA 1SQFA 4RTKA 4CTBA 4FX3A 2UW0A 4RT7A 3D4QA 3G6GA 3SG8A 2JHPA 3K3JA 2FPOA 2J0KA 4AGWA 4DCEA 2I9KA 3PVWA 2VWVA 2R3IA 4XMOA 3GCSA 2YTZA 4ALWA 5E7RA 3OS3A 5CYIA 2JG3A 3QUDA 3RWQA 1FBNA 5HIDA 4F7JA 4FI1A 4H1JA 4HCTA 2OY0A 3PJ2A 4O0VA 2UUEA 3DAKA 2AYPA 3BYVA 2B0QA 3NVMB 3FXZA 4WUNA 3WYYA 3GU4A 4BDIA 2W5HA 1GIHA 2XM9A 3CKWA 4RFMA 3QZFA 3UE4A 2CLXA 4EMSA 4O0SA 1Z57A 1NVQA 2ZV7A 4ATNA 1PRYA 3SXSA 4X0MA 4EORA 2O5KA 3P97A 5L2TA 4YTHA 3EMDA 5AP2A 5EHOA 3D2LA 5AP1A 5HORA 3D5XA 2OZAB 1ZMUA 3HMMA 4IDTA 1PW2A 5T6KA 3PLSA 3G5TA 2BZIB 4BZNA 2FUMA 2UZWE 1K2PA 3FZTA 4JRVA 2CHLA 4BBMA 4MYGA 3FMNA 2VX3A 3ZLWA 1IXKA 3LZBA 5L6OA 1W82A 2WELA 1W8CA 3WF7A 3E5AA 5K0BA 1OIYA 3VNTA 2YXLA 3LE6A 2OPBA 4IAYA 4N0SA 4HVIA 1VLMA 3VBVA 4E26A 4D4VA 4ZLZA 2EVAA 3BWMA 3FC1X 4KNBA 2GPYA 4QMYA 4HG2A 4L7FA 3UG2A 4EYMA 4AG8A 2ETRA 5FWAA 3VAPA 4E2YA 2BFYA 3GCPA 3S1HA 2WMBA 3B5IA 4R7BA 4KB8A 2BVAA 3U6JA 2JBOA 3ZEPA 2CGUA 5L2WA 4BDCA 4DITA 4F9BA 3BYUA 2QI8A 4QO9A 4NJDA 5CU4A 1H1PA 5HVJA 3P2IA 1M0EA 4O29A 3L9MA 1BLXA 4F9WA 3E8EA 5CXZA 3ZH8A 4QP3A 3KA0A 3OBJA 1UWHA 5CWZA 5FQOA 5AMNA 4O0WA 2R3LA 5A54A 3VUHA 2YR0A 3OTVA 2PV0A 3LM0A 1DCTA 2R7BA 4ANMA 4MXCA 5JK3A 3TUDA 3UJCA 4BB4A 4F0IA 5HG8A 4YSMA 4G5PA 2Z2WA 4Y46A 2C7PA 3DA6A 3GRVA 2PX8A 3QX2A 4PP9A 5EHLA 4EOOA 5E8SA 4AE6A 1XWSA 2QU5A 4WNKA 3HVIA 3FI4A 4ZZMA 4YHTA 4AA5A 5ICGA 4B99A 3EQHA 1BC5A 3DAJA 4FEQA 3W16A 3IW5A 4NM0A 3BWBA 4E73A 4CT1A 4RJ3A 3KRJA 4FKTA 3M6XA 3LCDA 3GNIB 3C4CA 4JVGA 4QMUA 1N7JA 1GJOA 4DBXA 5DLYA 3GVUA 3PXKA 3L9NA 2VX0A 3ZZEA 3QC4A 3HDNA 4CZTA 5AP6A 3R7VA 3NUNA 4F99A 3QYZA 3K0BA 2B9IA 3G2MA 2V55A 2OH4A 5HLNA 2VWUA 2E5WA 1Q0SA 3GRUA 4WRGA 5K4JA 2ITZA 3EVGA 4KBCA 2CPKE 4BHZA 2PXXA 1JSXA 3AGLA 4DGGA 4EWHA 5IQIA 3AC8A 2QOKA 4FKOA 3LMGA 2IBSA 3KQSA 4H0NA 3OY3A 5KHWA 4TYGA 5K0CA 3TT0A 3GO4A 4EEVA 2IG7A 4S34A 3HV5A 2I6LA 4FL3A 4FS8A 4XCUA 4M37A 2BRHA 1J3HA 3EQCA 2P0CA 3SGCA 1VEBA 1R6AA 4X2NA 4X60A 3RTPA 4CT2A 1JPAA 5LQRA 1VBFA 2ORED 4RFZA 3WF9A 1UKHA 3QOWA 2OXTA 2WTDA 1IY9A 3MJ1A 5EMKA 5JMSA 4E1ZA 2OJ9A 4DCMA 5AUYA 3OZ6A 1REJA 4XUCA 1VPTA 5FTGA 4HGTA 3TWJA 2QR8A 2V7OA 4V01A 3DUWA 2J0MB 2ZM1A 5KO1A 4ZJIA 4FTQA 3LFEA 3H10A 4EH2A 1LUFA 4M0YA 2PY6A 2ZDUA 2DUVA 3W2CA 2PZ5A 5C8NA 1FGKA 4YMGA 4AOIA 5CIYA 3F61A 5CVGA 3VQHA 3VS7A 2NXNA 2G2FA 3HCBA 3LBYA 4FIGA 4HTFA 4DTKA 4F7SA 5E8JA 1OBDA 2C3IB 1MUOA 3LKMA 4I6HA 4YNOA 3PVGA 3Q2MA 3A7FA 2RL5A 1YZ3A 4UXLA 4AW5A 3RPSA 3FKOA 3ZYAA 4FGZA 4NT4A 4AXAA 4GEKA 4XLIA 4HVHA 2G1TA 3NYVA 4CNHA 3TZ9A 2JFMA 5K0EA 2XNEA 3NUPA 2Y4IB 3RW9A 2GS6A 4RTQA 3CD3A 3KPVA 3Q6WA 4OT6A 4UYAA 2JJQA 1GIJA 2I62A 1NT2A 4IWOA 4EH9A 2GNGA 3G7UA 3NZ0A 4MK0A 4XG7A 1WXWA 5DX0A 4A9SA 1WVYA 1UWVA 2I7CA 1R00A 2WHBA 3DY7A 3N4VA 4MIKA 3QV2A 1ZOGA 4P5ZA 3REOA 5IA5A 5AX9A 3QKMA 2XBMA 3PUPA 4QP2A 5BVFA 5D1NA 4ZTLA 3SSNA 2WK1A 4YUQA 3GCUA 3DU8A 2XIRA 4I4EA 4QQKA 4EK6A 1Q3DA 4FEXA 2CMWA 1JTEA 2H6DA 4NYEA 4TT7A 4U81A 3CKKA 3DXXA 3V04A 3L9PA 3ORIA 2B4SB 5EG3A 4P7FA 4KD1A 4YURA 3VRYA 1KPIA 4JNWA 5HVKA 2VN9A 4AF3A 3ZO4A 1KUTA 3UZUA 3DBDA 2XNMA 3PSDA 3FYDA 4H36A 4EBVA 5J8IA 4BP3A 4USEA 4YPDA 4DFUA 4LRJA 4XYFA 5AUTA 4ID7A 5KZ0A 3R28A 3C0IA 3BWCA 4JBOA 5DNRA 3DJ5A 1YXTA 3VS0A 4D2RA 1X1CA 2UVYA 4M0ZA 3UNJA 2WMVA 3B8QA 4YJTA 4A9RA 4R7IA 1W7HA 5FEEA 3DXYA 2AOTA 2IBTA 1YZHA 1B38A 4O7RA 3VF9A 4BC6A 1Q8WA 3E92A 4E5WA 1WBWA 3OCJA 5C0OE 4R1VA 4W4WA 4FV9A 1RW8A 3DK6A 3KRWA 5FUTA 4F70A 4FEVA 3WARA 3G8BA 4M38A 4XNEA 4DTAA 5B1SA 4R78A 5GJGA 3NWBA 3MFTA 2VTAA 4EOJA 2UZEA 3ELJA 1FVTA 3KL8A 4FT4A 4M7IA 5IQBA 1MRUA 3QGYA 2IH2A 4UB7A 5HCXA 2PX5A 4GU6A 3KPUA 3FKLA 3Q52A 4B8MA 4IBMA 5K5XA 1R78A 2OB1A 4GG5A 3HEMA 4I0RA 4L43A 4FKUA 1UIRA 4X6RA 3EZRA 4LV5A 4YZBA 3SSOA 3CE3A 4NL0A 1TW2A 3QHRA 4BCFA 1SM2A 3HVJA 4NWMA 4KBKA 2W06A 5TF9A 4EQUA 4X3FA 3W2QA 2WTVA 3LFDA 2BAJA 3M11A 2CKDA 4K33A 2GAFA 3CC8A 2CCHA 4FUXA 4F85A 4D2SA 3FUWA 5EMJA 4C05A 2BFXA 4AUKA 4PDOA 2WTJA 1R8YA 5LCKA 4IC8A 3LCVB 3KXMA 4DHFA 5K0LA 3AXSA 3PWYA 4HZRA 2WMUA 3KULA 1WS6A 3H9FA 3MSSA 2WPAA 5ANDA 5DX8A 3THRA 3C3YA 3AXWA 2YX1A 3IOPA 1OI9A 1PMVA 3MFUA 1PMNA 2ZMCA 4EHZA 2OO3A 3COIA 3B3FA 1RJDA 3OUNB 3COHA 3B8RA 2IH5A 3JVSA 5TOZA 4RSRA 5AP0A 4U6RA 3UIBA 3Q32A 5L8KA 3BGPA 4J99A 4QMOA 4K1BA 1U5QA 3DBFA 4P7KA 3DQWA 3PY1A 2HWPA 2ERKA 2O3PA 2QO9A 1LPUA 3KCKA 4K6MA 1ZYCA 3R0QA 1JAMA 3U4WA 4I5HA 1AD5A 4ZY4A 4D4RA 3R8ZA 1BYGA 1H1RA 3KR0A 2Z7LA 5F2OA 2A14A 3HA6A 5J9ZA 4K8AA 4L67A 2YUIA 4P7JA 3ORPA 5CVUA 1L9KA 3FSFA 3MH3A 4FYOA 4L52A 1NW5A 2QU6A 5EEHA 3LAUA 3CJQA 5DTQA 4R5SA 4QDJA 3JPVA 3ZSIA 1ZRZA 5A3XA 4TPTA 2GS7A 3DP7A 3HCCA 3I0QA 4BCHA 4DG2E 3PWDA 2C6OA 4NJ3A 5HE3A 3VYWA 2XZSA 3SSMA 4RC3A 1BL7A 3HTXA 2BKZA 3PP0A 2IWIA 1D2CA 2Y1WA 5HNBA 1FVVA 2C0OA 1JBPE 3LFBA 3ZO3A 3QQKA 3UO4A 3DMHA 4WG5A 4A4LA 5K0NA 4Y83A 2OFUA 2PT9A 3SVZA 2CGXA 2OIDA 1M52A 1CKPA 3R02A 4NSTA 2VV9A 4NTSA 5JKGA 1OITA 4PGHA 5AAGA 5HE0A 2BHHA 2WMWA 3MWUA 3TNQB 1FP1D 4WA9A 4BCNA 3TV6A 1I09A 4BZOA 3EEOA 4CTJA 3B2TA 2CDZA 3O17A 3AD6A 4U5JA 5HE2A 5HCZA 3BLRA 4ANBA 5JGBA 2VTOA 5BVKA 3ZSHA 3MDYA 3R7UA 5A46A 5IH5A 3TPZA 4FG7A 4EJNA 3DLCA 4IX5A 5BXYA 3KPJA 5DHJA 1PXJA 4IAIA 4U8ZA 5EH0A 3SM3A 4KA3A 5K8VA 4YJUA 4MHAA 1YOLA 4K2RA 1KOBA 2PMIA 4FTOA 5EM5A 4BYJA 3DPKA 4O2ZA 4U45A 1OR8A 3PYYA 2V74B 3LFSA 4Y72A 3ZRLA 3V8TA 4QPPA 2C3LA 2EUFB 3B89A 4JXJA 5EW8A 3NW6A 4JT3A 5FEDA 4BBEA 3U9CA 5LQUA 4HC4A 3P7BA 3A4OX 4XOYA 4K18A 1EG2A 4DA4A 1O9HA 5CU0A 4C58A 4RPVA 4O0XA 3RHXA 4N6YA 3JWJA 3ER8A 1YQJA 4IFGA 4XUFA 2PWYA 4OGRA 2IFTA 3NNUA 1VP3A 4GSBA 4DT8A 1BL6A 3TN8A 2EG5A 1SVUA 2YABA 4RVLA 5F95A 2FVDA 3OCBA 4HGLA 2YM7A 3B3JA 2PVMA 3JY0A 4PMPA 3M1SA 2FGIA 1G60A 3G5DA 1QPDA 1EIZA 4X63A 3VIDA 3JWIA 3QBNA 3QA0A 4E31A 4ZMFA 1P4OA 2WQOA 3FI8A 5H8GA 4EUUA 2C5NA 4ALVA 4EONA 3GCZA 1Y8GA 2PXAA 2B7AA 2UZLA 5IH4A 5GM1A 3OU7A 1JTFA 3R7YA 1OKYA 5I9ZA 3Q4TA 3ZRMA 2FSLX 1QCFA 4IAAA 1A9UA 3O71A 3I6UA 2B9HA 2J2IB 2OBJA 4CLJA 5CEIA 4LL0A 2PHKA 3DV3A 4JIKA 3PX3A 3HNGA 3M6UA 2XEYA 4I0TA 4XRJA 1TQMA 5G6VA 5FBOA 5A6OA 4JLCA 3QTQA 4RX1A 2VGOA 3UC4A 5GHVA 2CWWA 2E2BA 3EIDA 3P2KA 5HHWA 1JKSA 5TO8A 2ITYA 3SW4A 5K0FA 5E8XA 1OIRA 3EN6A 4FTAA 5FTOA 5K9IA 3QX4A 3KR9A 2BRNA 1HMYA 3PFGA 3N51A 3E7OA 3QLGA 1UU7A 1JSTA 4IW0A 5KBRA 4IADA 2C5VA 4HW7A 2E9PA 3P5KA 5IQGA 3GU5A 3VHKA 3UYTA 3FY2A 1UU9A 3SMQA 1NV8A 4FTIA 1XJDA 3SKCA 2FRXA 2ZULA 2BZGA 5J5SA 4FL2A 3F66A 4AE9A 5CVFA 4QYGA 2RFEA 2W17A 2WIPA 4QTDA 4ERWA 3ANQA 2PMNX 1HCKA 2G9XA 1ZZ2A 4FSYA 5HTBA 3FPMA 3REPA 3DKFA 2BPMA 4C07A 1P4FA 2YITA 4EUTA 4X2FA 2P40A 2YM8A 2DWBA 3ME5A 2OK1A 4MX9A 1PYXA 5DT4A 2B52A 3NUUA 5IDPA 2B2CA 4IX3A 3EVAA 2HWOA 4DYMA 3LBFA 5ETFA 2OXXA 2OXYA 2HZNA 3C3PA 4I5PA 3CLYA 4FSWA 5LVNA 5T67A 2VWBA 5IPJA 2V22A 4ZEGA 2WMQA 4GOOD 4C06A 5IU2A 5HIJA 2BR5A 3AMAA 3EN7A 1AV6A 3GU8A 4YO6A 2OIBA 5M4CA 1H25A 4E30A 4P90A 3OHTA 3R21A 2JIUA 2R4BA 4EHGA 4QYEA 1IRKA 5CT0A 1QAMA 1RJBA 4F08A 3KRLA 4MXXA 3NYNA 4AA4A 3G2PA 3P78A 1LEWA 3JUHA 2GH1A 3QWKA 2R3QA 4PDYA 4E8AA 4O2PA 2C6IA 1OBGA 3C5UA 3OMVA 3QHWA 3C4ZA 3UIUA 3PVCA 2XKCA 5E91A 1YI3A 4CFUA 2UYQA 4PTEA 2BRMA 3F2AA 4C08A 4O7LA 1FOTA 4EOSA 4QVGA 1O9UA 3WZDA 4IQ6A 4ACMA 3EN4A 3EZVA 4OBPA 1SNXA 3DZQA 5DT2A 1I4WA 3PIXA 1BKYA 9MHTA 1N7IA 4AW1A 5DIAA 1EJ6A 2WQBA 2QG7A 2XH5A 4G5JA 5ETCA 2J9MA 4BDJA 4RBLA 2Y4PA 3IKAA 3WILA 1P39A 3LCTA 5FHRA 5DRDA 4JBVA 3OU2A 5IMEA 2JKQA 4UEUA 5EI2A 3GOPA 2O06A 2VS1A 4DMGA 3PSBA 2JBPA 4DCGA 3HEGA 3Q9XA 3OBGA 5DSXA 1WFCA 4CZUA 4AQCA 1M2RA 5L6WL 2YWVA 3PVBA 3ORNA 1OB3A 4BVUA 2BIKB 3OG7A 3SR4A 3LJ1A 4NW6A 4C62A 4R3RA 2OJGA 4MNFA 4E4NA 4S2ZA 2NP6A 3RK7A 3OXTA 3F3VA 5J9YA 4J53A 3CJRA 3Q5ZA 4I21A 5E8ZA 2WMTA 2R6ZA 2ZW9A 3AT2A 3PA3A 4F6WA 4BR3A 4L7SA 5K0JA 4TYJA 3LFNA 2IGTA 2A1AB 2WB8A 4QQ5A 3TIZA 2X8IA 4N6ZA 3ZO2A 5I5ZA 2PUPA 3RPVA 4ASXA 3V5LA 2QO7A 3FPQA 4ZSGA 3CQWA 4O7VA 1L1EA 5DLSA 3V8VA 2VDVE 5JUWA 3PJCA 3TLJA 4M14A 4TNBA 4EC8A 2UW9A 3HV4A 5JZNA 4JDJA 1E9HA 3QRTA 3FUVA 1LP4A 2F49A 4DGLC 5AFVA 4JQ8A 3TM0A 2GNIA 4EKGA 4BGHA 4FV8A 4PMMA 5EQJB 3PTAA 4XP0A 1SQGA 3B7PA 3OUKA 4LOOA 3Q9WA 3I5UA 3UMWA 5ETAA 3NNXA 3E23A 3ORKA 2IVVA 4FIEA 4S31A 3V3VA 3U8WA 4E5AX 2RG5A 3JXWA 2WA1A 3POZA 4AFEA 4FT7A 2R3PA 1SVGA 4YUYA 4PMTA 5MHTA 3IW7A 5JT2A 4G2FA 3BLHA 2QRVB 2J0IA 1CTPE 3CTJA 2ZM3A 3TTIA 3AWIA 5AUXA 5CXHA 4CMOA 3GFEA 2BR1A 3OP5A 2BDWA 2UZBA 2P8JA 3KN5A 2OLCA 3A61A 3KREA 4A9UA 5I0BA 4WKQA 2C6MA 4PL4A 4C3RA 4EQZA 3BKBA 4ACDA 4DE4A 4FT2A 2HAKA 5ICEA 3KRXA 1Z5MA 1JG4A 2IVSA 2OI4X 3GDHA 3LJ0A 5HNGA 4U79A 1IEPA 3CTQA 4BCMA 4IC7A 4FTTA 2H9VA 3IEIA 3LPMA 2ONZA 4ZAUA 4R6VA 1YW2A 2F2CB 2YVLA 1FMKA 3PRIA 4ER5A 3D15A 2IZRA 3UA4A 3SRVA 4G1WA 5E8WA 5ANIA 4FGRA 5JRSA 5DBXA 3PFHA 3MVMA 2W1DA 1R18A 3NYOA 5FD2A 4BN1A 3BRBA 2PE0A 3G2FA 4LOPA 4DFYA 5LXMA 2J6MA 3VC1A 4JXFA 4L68A 4FT5A 1H1WA 5KKRC 3BE2A 2W7XA 5A4QA 4FKGA 3UGCA 3N4UA 3CJFA 5L8LA 3V5JA 3CIKA 4XV2A 3BGIA 3FXWA 5D1JA 4RQKA 1W84A 4I92A 3D2IA 3D7TA 4QDKA 1OL7A 4HNFA 4CV8A 2AOVA 2PSQA 4CKBA 5F2NA 4CTKA 3A8XA 4CQEA 3G2QA 3R9DA 4DGMA 3VC2A 1KPGA 1B39A 4A07A 3HVKA 3NCZA 3KKVA 3BEAA 3I60A 2F4JA 2XF0A 3UJ9A 3ET7A 1G38A 5BW4A 3CGGA 2V0DA 1A06A 3MGGA 2W1FA 3HUBA 3H0ZA 2ZIEA 3I7CA 3U55A 4EKKA 2NPQA 4FGBA 2ITNA 4D58A 4AZEA 3CBLA 4HCUA 3BHYA 2XKFA 2HY81 3MCZA 4D1ZA 4BI2A 5FQNA 3SXJA 3DDQA 3B2WA 4BDDA 3UIMA 1GY3A 4HZSA 3P9IA 1PXNA 2IW6A 2UYCA 3O8UA 2HZ0A 3DT1A 3QCYA 2V5QA 3NNVA 2YAAA 4EHEA 4DFZE 3PX2A 1Q41A 3QAME 5H02A 3CVOA 5DVRA 3H2BA 3NDMA 4EH5A 3R30A 3S68A 3A7EA 1H27A 2AOUA 2PMOX 3MAGA 1DUSA 2BRGA 3KB7A 3FMHA 3QWJA 1NW8A 2PVCA 4OUCA 5A4EA 4HTFB 2QOQA 3MH1A 5LMKC 3OW3A 2PUNA 3Q2JA 3ZLYA 4IFCA 4FZFB 3ERKA 4PWYA 2G1PA 1KE8A 3GXLA 2JFLA 4KS8A 2PWLA 3D5UA 3GRYA 2JIIA 4WT6A 2WU7A 3UJAA 3D7ZA 2VD5A 2IZUA 4ACCA 1AGWA 4XH6A 5DG5A 3CCFA 1ZMWA 3EN5A 4J8NA 4R6WA 4WG3A 2YAKA 4CRSA 4X6QC 2YACA 2FB8A 3CJGA 5CSXA 1H26A 2BH2A 3TNHA 2PZRA 4O83A 3TNPC 2Z02A 4OTDA 3R6XA 3QGWA 5E90A 3BYOA 4EJ7A 1F0QA 5M4IA 1JWHA 2JITA 4MXAA 4KRCA 3ODYX 1ZXEA 3SOAA 3P1AA 3I5NA 5KQSA 5KZIA 2IPXA 4EVIA 5EPEA 4QYHA 2X4ZA 3F3WA 3W10A 4LV8A 3QTRA 3VS3A 4PYMA 2YIYA 3K54A 2RFDA 3DFAA 3FY0A 4D1SA 4PTCA 1Q5KA 4G6LA 4K9YA 2UZNA 3VS5A 3PJ8A 3AXTA 4IM0A 2VTHA 4P2KA 5M4UA 4XV3A 4MF1A 4UWYA 3LSTA 4CG8A 4HVSA 5AA8A 2GHMA 3FUPA 4A4OA 2GS9A 1Q61A 3ZCLA 2O8YA 4OBQA 4AW2A 4R1YA 4U80A 3RI1A 2AVNA 2ZIFA 4GQBA 3AC1A 3P7AA 2YFXA 2GHGA 3FTFA 4MEDA 3R7IA 4HYHA 4PYLA 2DPMA 5ANEA 2Z7QA 3UJBA 2GNHA 3DK7A 3IYLW 4Y8DA 4YJOA 4GW8A 3ANXA 5KCVA 2PZPA 3TIYA 10MHA 4AWIA 2AOTB 3SX0A 2JDVA 3HDMA 1J7UA 1V0BA 4ZLYA 3SDJA 5FDPA 3EEYA 1Q8TA 2YXDA 3MCTA 4BCJA 1H08A 4AS0A 4LWPA 1TQPA 3T0IA 3QCSA 3OOMA 1WXXA 4IX4A 2EFJA 3R8VA 2X0GA 4AX8A 1KYZA 4RWKA 5K4IA 4PYIA 5AX3A 3FPGA 4L3JA 4J95A 4KIGA 4DM3A 3JWHA 1WBSA 3ZEWA 4GT4A 1PHKA 2WOUA 2NO3A 3KXXA 3HM2A 5AIRA 4RA5A 3AMBA 4A6EA 4FTKA 4QP8A 5DH3A 4ER0A 2F8LA 2YWPA 5F20A 4U3ZA 1I9GA 3LVPA 4X3FB 1CSNA 3UO6A 5G02A 5GJDA 3DCVA 3DKOA 2HIWA 5CANA 5C27A 1RE8A 5LQKA 5EG5A 2GNLA 1JLUE 3G5LA 3ZFMA 2QYOA 2P3GX 2VDWA 4UX9A 2IVUA 1OIUA 4DCAA 3U54A 5AM7A 3A4PA 3AY0A 1H1DA 3FZ1A 3KULB 2ZV9A 3O23A 2FK8A 5DOSA 1YI4A 3UO5A 5LARA 1IAJA 3AQVA 2ZBPA 5EKNA 3KC3A 3PXQA 4FZVA 1SUSA 3DLZA 3R1YA 2BZKB 3PRFA 3BIZA 3IECA 2H00A 5TR6A 4E93A 5CLPA 4L53A 3PFQA 3OY1A 4GRBA 3DGKA 1SMHA 4BIEA 4CFNA 4WBBB 4MCVA 2YCRA 4ZTSA 2J51A 5EKOA 4WG4A 2C0IA 5DGZA 3UPZA 1ZYSA 3SA0A 4W8EA 3H9OA 4CXAA 4FKSA 3RIEA 2W4KA 3QQGA 3FI3A 4G6OA 4EOMA 4XV9A 3B3GA 4YJSA 3G9NA 5DRYA 3ORHA 4IAFA 2EXCX 1ERKA 2OFVA 1QL6A 3NW7A 2QOHA 3QTWA 4XJ0A 3COMA 5HLWA 4KINA 3T7SA 4E5BA 3QD0A 4C59A 4BI1A 2R3MA 4E4MA 4S30A 3KQMA 5BX0A 4Z7HA 2W96B 3AD4A 4LECA 2C47A 3HRCA 5KMKA 2XNOA 4YC6A 4GUBA 4U41A 4CGAA 4X7QA 3DTCA 5CQUA 5FULA 3GGFA 2V7AA 1REKA 4N4SA 1GZKA 4L00A 5DT0A 3UIXA 1BI7A 2Y8OA 1Q99A 2BILB 1ZQ9A 4ER6A 3FYCA 4RIXA 3MPMA 3EH9A 2ZDTA 4ZY6A 3WE4A 2OF2A 2ZJWA 4RIYA 4R5YA 2Y1XA 5JFSA 2CL5A 3DBQA 1WBPA 3C0HA 4JX3A 5FM3A 2WAJA 2YQZA 1KE6A 4ZTMA 3QU0A 5HG7A 3LCUA 1Z3CA 1PXLA 5EHYA 2OU7A 4YV1A 2NRUA 5BYYA 2ESRA 3UPXA 3VO3A 4U44A 2REIA 5LCJA 5TT7A 3QKLA 5CCXA 2RGPA 3FV8A 4C03A 3M2WA 5C8MA 4R77A 4U0IA 3EQPA 2WO6A 4JOAA 4QMMA 5JN2A 5LVMA 3E64A 4ENXA 2CLQA 3OCSA 3UNZA 4FTMA 1V39A 2BM8A 4JG8A 2OG8A 4BLWA 3FMMA 4DFLA 4EK3A 5HEKA 4CFFA 5C1QB 3VBXA 5DM0A 1WVXA 5DPMA 4IB0A 4QP1A 4WRSA 5HILA 4KABA 2OWBA 4DN5A 1XH5A 3QRIA 2PVNA 3TNIA 5F9EA 4PIPA 4C2WA 2Y6OA 5DFPA 3DQXA 2QONA 3Q7EA 4FE2A 2WOTA 2YDJA 5DRTA 3W2OA 5AIKA 3FLYA 2B54A 3E93A 3RWPA 1PKDA 2JC6A 5C4KA 3WF8A 4RQVA 4POOA 3LW0A 3MH0A 3HRFA 2F2UA 4H05A 1U46A 5DA3A 5IA1A 3L8VA 1YHSA 5HLPA 4YR8A 5IUIA 4UN0C 4D5KA 3SV0A 4E4XA 5KMOA 1ZYJA 4RX5A 4E32A 4O22A 1ZY4A 4GT5A 1X1BA 5CVDA 3V51A 3TM4A 4FKLA 2F7XE 1FPQA 4RG0A 2AC5A 1H01A 1Q0TA 3RZBA 3T7RA 2IP2A 4GJ3A 3HVCA 2YCSA 1NVRA 1SG9A 3FKNA 3C4WA 4BRXA 2G8NA 3HV3A 2WEVA 1J7LA 3OVVA 5CVEA 4NIFB 3COKA 2EWAA 4R05A 2XKDA 1RI3A 4W4VA 2WTCA 4WSYA 1XH8A 2GS2A 2R0UA 4R8SA 5M4FA 3QZHA 5CVJA 1NW3A 4FL1A 4RJ8A 2DULA 1WY7A 5C9CA 3NS9A 1AQJA 4FNYA 3A99A 3Q5IA 2ZZKA 3PTGA 2PXCA 4KIQA 2HOGA 3LXLA 3G88A 3D83A 2IZSA 4IV0A 5FA5A 3I5ZA 2P3QA 3LXNA 1H24A 3GWZA 2AS0A 2PVJA 5EMLA 5FTQA 3PXRA 1L3CA 2O65A 4OQDA 4KW7A 2CNVA 2OJFE 5HZNA 1ORHA 4XCXA 2XJ0A 4AACA 5I4NA 5L2IA 4EZ3A 2P2IA 5D7VA 5CD1A 4QMZA 3ATTA 3VS1A 2GB4A 1RI1A 2X4FA 1GZNA 3CPBA 4PGGA 4PMSA 5FBNC 2Z60A 3WIGA 2HR1A 3MV5A 4AT4A 1YRPA 2GNFA 3LQ5A 5K05A 2BTSA 5EOLA 1F38A 3GQLA 2OKRA 5HTCA 1E1XA 3CPCA 4FSQA 3ROYA 4F64A 5JGAA 2ADMA 1AF7A 2ITOA 2XBAA 2OYRA 1NY3A 5IQAA 2YHVA 2FCAA 2PLWA 2B78A 4GVAA 4D55A 4P7EA 4WXHA 3OXIA 2XCKA 3EL7A 1Y6BA 3LQ3A 1TPYA 4IJPA 4I5CA 4FIHA 4H1MA 1XBAA 3R1NA 5HICA 1ZWSA 2W99B 3ZC5A 4EH3A 3K2LA 4HGSA 5FWDA 5HZMA 4EH7A 1W98A 2W4JA 3R8LA 2JKKA 4EOIA 5HG9A 3GJYA 1FINA 1H07A 4HCVA 5FTWA 3U9NA 4CKCA 2ZZMA 3ZFXA 4CVAA 3KXHA 1CKIA 2R0IA 2UW3A 3EQFA 3PJ1A 3ZBXA 3ERCA 3GU3A 2GHLA 3DAEA 5EDPA 4GF5A 3EVFA 5F1ZA 5K01A 3ZO1A 2GPHA 3UVRA 1U59A 3MTFA 4BP1A 4Q2AA 3RHKA 4MWIA 1FVRA 4BIDA 4R6XA 3PA5A 5FRIA 2PTKA 3T3VA 3BPRA 3OD6X 5EIFA 2X2KA 4RTMA 3F2RA 5EW9A 2P2HA 3NIEA 2YA9A 5HOQA 4G34A 3EMGA 4CKJA 3KGAA 5ICFA 3PG1A 2X8EA 3LX6A 5E1BA 3ETAA 2Z8CA 4ZLOA 2PVKA 4O96A 3A7HA 5E9QA 3GC7A 5DM1A 3LCSA 3FHRA 4FV5A 3EVZA 4GIIA 2XMYA 3OROA 4RWIA 4FT3A 2WMAA 5HIEA 3IW8A 1YXVA 4V0GA 3KFAA 4EI4A 4ITHA 1BMKA 1XXLA 3FPFA 1CDKA 3GB2A 4OTQA 4MAOA 3Q87B 2XYUA 5DTMA 3P86A 3D2KA 3LFFA 4NUSA 4XEYA 4Y2HA 2XK9A 4BGGA 4M13A 3UOLA 4U43A 2XJ2A 2C1AA 4G9CA 4F1OA 1GZOA 4TZRA 1XDSA 3PPZA 3FLWA 1Q4LA 3TV7A 3S2PA 5AUZA 3M4XA 2FSOX 4ALUA 4JDIA 2I0YA 5LMBA 4DH8A 4CFVA 3THBA 5GJFA 3ELYA 3KQOA 4YTCA 4KIPA 5BUEA 3MY1A 4GT3A 3VBTA 3MB7A 4FTCA 5CU6A 2XIYA 3R6TA 2BAKA 4IWPA 1DS5A 1JVPP 4XUEA 4NCTC 4GKIA 5FGKA 5DEWA 3PZHA 4L3LA 3SGLA 3NMUF 2FK7A 5FP6A 1T45A 4QMWA 3AGMA 2BZHB 5CY3A 3HCEA 3GIWA 4IAZA 1Q24A 2XIZA 3HAVA 3UQFA 2R3HA 4DEGA 3GCQA 2PVLA 1ZY5A 3FPJA 2E9OA 3PIZA 2QQ7A 5H9BA 2J7TA 3G8AA 2WMSA 5GP1A 5E9WA 4I24A 5L8JA 3OC1A 4W8DA 2PX2A 2A4LA 3LIJA 3VS6A 4GBED 4G3DA 4PV0A 4ZSJA 3F7ZA 3QLFA 4EC9A 5EEGA 3ER9A 4C7TA 2XK3A 3CD8A 1WAKA 4FYNA 3FZGA 4BIBA 3DFCB 3M42A 3MIAA 3V5PA 4Y85A 4ZTHA 5FXRA 4EK9A 4RWLA 3KF7A 4UWBA 2FH9A 2XM8A 4O7YA 4MTAA 4ANSA 1JKLA 3MHTA 1U5RA 3KK9A 4MH7A 3DBEA 4ZSEA 1XCJA 2Y0AA 2VWWA 2Z6AA 2X81A 4IVAA 1P2AA 4GIHA 5AV3A 4CFWA 2VX1A 3R24A 3VWAA 5E2BA 2VO3A 4RRVA 5K09A 3U6IA 1QPEA 5HBJA 5H8BA 3MVJA 1NE2A 3A4TA 4PUZA 4DT9A 2Q41A 1OMWA 2A27A 2ITQA 2GMXA 3BYSA 1GIIA 3A60A 3EGIA 4YLLA 4C3FA 1KE9A 3GU6A 2I7QA 3ZDIA 3PJ3A 3KEXA 3V6RA 5B0XA 3PDTA 3SRVB 2XP2A 2PU8A 3NSZA 3UDBA 3V5TA 2PVFA 2NXEA 4A4XA 1ZYDA 5CF5A 3UJ7A 1NVSA 3DMGA 3VUKA 4IB3A 4R3PA 3FQHA 3PP1A 3FQSA 2K4MA 1URWA 4FODA 5LQNA 3KQPA 3A7IA 4RYLA 4F63A 4GYIA 2VDUE 4DKJA 4CTCA 3LCCA 3W33A 4GU9A 2BRBA 4FR0A 3CP9A 4ERKA 2QD9A 3Q60A 3NW9A 5DT3A 3D7TB 3EFLA 3UVPA 3R9NA 4DQ0A 2WEIA 5LQAA 3OXZA 5IQFA 4KIFA 3LOKA 3OCTA 4EOKA 2Q0NA 5EYMA 3P71T 4GK3A 3HX4A 3WZKA 4N70A 4GK4A 4DH3A 2PKWA 3FHIA 1XH4A 1CM8A 2AN4A 5EQEA 3A7GA 2SRCA 1O6LA 5D1HA 3TZ8A 5IZFA 2XA4A 4OLIA 3UJDA 4IANA 5AP5A 2OGVA 4XUDA 4OR5A 3QCQA 3N9XA 4BICA 2XVAA 1YDTE 2B1PA 2UW4A 4FV1A 3JY9A 5L2SA 3HAMA 2QURA 5ACKA 2WD1A 4FBXA 2P4IA 4M3QA 3GQIA 4YV2A 3GENA 2GSFA 1M17A 2DYLA 5JFWA 5J1WA 3FC2A 4AAAA 4PCLA 3QFVA 3R73A 5LMKA 5CCBA 5HO7A 3F6XA 3S95A 4C4FA 1B42A 4B4LA 4E2WA 4EOQA 2AOUB 3IV6A 2YISA 3BGZA 2QOCA 5BYZA 3KMUA 4F0FA 4JJRA 3UFBA 1VR2A 4FV4A 4DFNA 2R9SA 1PXIA 4PNKA 1U4DA 3CTHA 3TKHA 3QXPA 5I9VA 3I1AA 2N47A 3Q53A 3TMAA 4E6DA 4PYKA 2X7OA 4UY9A 3P9CA 4LFIA 2NXCA 1PXMA 3DTNA 3Q3BA 4Y5HA 1OL2A 4ZY5A 4M97A 3VSEA 1URCA 2LAVA 4F84A 2ZFUA 4KWPA 3NUSA 3I81A 4QYYA 4O27B 2WZJA 3V8SA 4LYNA 4O0TA 3AG9A 5JSMA 3X0DA 5M57A 2PGXA 4DEEA 4ZS4A 3AJDA 5LQFA 5EW3A 5K5NA 1VL5A 3EMBA 4I5MA 4FC0A 2P41A 2RFSA 3ZUTA 2R2PA 3ZRKA 3VJOA 4GUAA 3KCFA 2JHAA 3BBTB 3HV6A 4H39A 4MWHA 3DS6A 5EC8A 4RTLA 4YJQA 3D9VA 4J8MA 3BZ3A 4AZSA 4BDAA 4XBUA 2P1DA 2GTMA 3KKZA 2H34A 4C3PA 4ARKA 3UJ8A 3E7PA 5BVOA 1RJGA 5KMLA 2UW7A 4AZFA 2ONYA 4YGAA 3C51A 2X9FA 2C6EA 1MRVA 3EB0A 3VW6A 4HJOA 3O0GA 1H0WA 2YJRA 5L6PA 4EZ7A 3E3PA 2XIXA 3CBGA 2IIPA 5BVDA 3I53A 1KOAA 3ELUA 4RMZA 3R1SA 3TKAA 3UYSA 2O2UA 3Q04A 5B7VA 2CN5A 4LMUA 4I3ZA 2G2HA 3GCVA 5A14A 2JDSA 4WBOA 3Q4CA 2XB7A 4BF2A 2QG5A 5E1MA 5HIBA 4JDHA 3VQUA 1M7NA 4IMYA 2P3OA 1KE5A 3M33A 2ZV2A 3SHEA 3KVXA 4EOLA 3FSKA 3HVHA 2XNPA 3TJDA 1QYRA 1L3RE 4BTFA 1YKRA 4QOXA 2QLUA 4FR4A 3G0EA 5C03A 5J9LA 2XS0A 4F7NA 3FUXA 5FEQA 3LLTA 1XTPA 2J4ZA 3HZTA 3FEGA 2QCSA 1L3IA 1Q3WA 2PT6A 5DN3A 5JGDA 5KHXA 3R0TA 3PA4A 2J90A 3IGOA 3MB5A 3P08A 2QE6A 4YSJA 4GL9A 2IDJA 3GGDA 4IE9A 2R3SA 2ZBQA 1RI2A 3VVHA 2VRXA 4QYFA 4EK8A 3GEQA 1NV9A 4FG9A 5CEMA 1ZMVA 4GYGA 4IWQA 4WOVA 3GI3A 4KWCA 4OBWA 2YIRA 5DEYA 1NA7A 4AFJA 4H3QA 2W5BA 3EYGA 3KQYA 5KS2A 2LD4A 4ZXTA 5F4NA 4FTRA 2BM9A 1JKTA 3AC2A 4TYHA 3VBQA 4GKHA 4IX6A 4DH7A 3KK8A 4X3JA 5BQ0A 3QC9A 3QALE 4HNIA 3O50A 3ZM9A 5FDXA 5T64A 5KVAA 3SLSA 5GIPE 4XG4A 3GC9A 3H30A 1T46A 2VTJA 4GOND 3UQCA 1XDUA 2QOOA 1TKIA 4AN3A 4WD5A 4I6QA 1EJ0A 4II5A 1KP9A 5K03A 3LHJA 2C5OA 4RJ6A 3ZS5A 4MNEA 3RVGA 4LGGA 5F2KA 4CG9A 3MN3A 3NLBA 5JQ8A 2JH8A 2VWYA 4IWNA 3UZPA 2VZ9A 4AN9A 2E9NA 4FKPA 4PYJA 1LR4A 1XBCA 1G8AA 4GFGA 2YM5A 3PXFA 4GMYA 2I0VA 3UOKA 2ITXA 3IPHA 1XR1A 2X8DA 3BYMA 2H1RA 2HYYA 4BLVA 3TOSA 1BUHA 3K5UA 4F09A 2JGZA 1O6KA 5BUIA 2YZLA 4CXMA 4ZSLA 2HXQA 1KPHA 2ZSUA 4IHPA 3A62A 4FSZA 4ITJA 1IAHA 4AW0A 2QVSE 4GJ2A 3KQQA 3HYHA 4O7TA 4LUEA 3GUBA 2GQRA 3ZU7A 3DLIA 4FKQA 4QVKA 1F5QA 3O2MA 3ATSA 5KYGA 2I1MA 7MHTA 5HVYA 4EH8A 4FOBA 5BP7A 3P2EA 4CMUA 4CV9A 2W1EA 3LDGA 2G72A 3UZTA 2PMLX 5B2LA 4HVGA 4GC9A 3T9TA 4E2ZA 4NU1A 3FUUA 2W05A 4BDHA 1BX6A 3Q96A 3LHDA 4QTUB 3BQRA 4XV1A 3F4KA 2F9GA 4NKSA 5IA4A 2CKEA 1Q8YA 3TKIA 3V8WA 1H00A 4RLLA 1OVEA 3L8XA 4K0YA 3NW5A 2XYQA 3UG1A 3QD2B 3W8QA 4G3EA 5IEXA 2G71A 4E7WA 2QOIA 2VTTA 1RI5A 2AZTA 1FPUA 4E20A 5HD4A 2AVDA 4EKIA 5CI7A 3QQJA 4RIXB 4BCOA 4V0QA 3M6WA 3KQWA 1U2ZA 5JEBA 5BVWA 4RIYB 4D0WA 2FYSA 2W1ZA 3C0GA 5JFXA 3Q6UA 4FIIA 4I1ZA 4X1OA 4J52A 3UTOA 2PUUA 4E6QA 4F9AA 4APPA 4RJ4A 1H0VA
chains in the Genus database with same CATH superfamily
2SECE 4AWXA 4GSLA 4RTSA 4U9HS 1X39A 1ECFA 3L40A 1HV8A 4UQPA 4J1RA 2LVBA 3K2IA 3MA6A 2SICE 4EWQA 5IRCD 1UZUA 3W7VA 4EECA 3KRRA 5EDQA 3AJAA 3ZDFA 5ED0A 4EPWA 2JLRA 3IAM1 2FEPA 5B58T 2DHEA 3BCRA 3R2YA 5HQ3B 5ANKA 1TE2A 1XA3A 3EZGA 4Q18A 5C4IA 4GPBA 1HLDA 4E6CA 1XK7A 2F1OA 4O4HA 5DHAA 5C1DA 5K8TA 2J6CA 3WK8A 3QHQA 2MMGA 3LS2A 4PW0A 1UINA 2WIHA 1R0YA 3K32A 2H0QA 2C5SA 4Q0MA 3IGGA 4CMAA 4HRAA 3NCHA 1K7XB 4ZT2A 4FGUA 3PIYA 3FTCA 3IJPA 1G1AA 4FKWA 4I4TF 1PMEA 4K77A 2QNJA 4NG4A 1D9ZA 4JL9A 4C04A 1TYZA 2BMJA 2FKNA 1P75A 2ZATA 2JI6A 1XZNA 2HZIA 2IQ5A 2O8CA 5FIUA 2W6OA 1P3DA 3NV7A 1PK7A 3BCHA 1K6XA 2QRMA 2K87A 4MRMA 1N2GA 3SP1A 2A4KA 3AIKA 4QARA 1KI6A 4EGFA 1IVSA 2R7LA 2RIRA 5CENA 1YOVA 2E82A 4ZTZB 3NU1A 2JBWA 4UWCA 4AC9A 3FZSA 1FIUA 1A76A 4IH9A 1Z4QA 1AY0A 4MI3A 5CEPA 4IOJA 3AC5A 2ZVJA 1EXMA 3TTVA 5LMNB 2FQXA 2JIDA 1DLIA 2GJAA 3TMKA 1J8VA 1CUDA 2VAWA 4AXEA 1LJLA 3EEFA 3HYRA 4Q1DA 3QEAZ 3QEKA 2ZOQA 5IKMA 1IA8A 3L1VA 3I4BA 1G8MA 4RHUA 1O0BA 1M7QA 2A0YA 3MLEA 4MUIA 3OCGA 3BH7A 3STHA 2KTYA 2O07A 4FZDB 1QMZA 3ZVKA 2ACXA 1JS1X 1YA8A 1YJXA 4RVDA 1KWGA 4LBYA 4ZYVA 1MQBA 2QRVA 1TFUA 5CW2A 2CE2X 4NC9A 4TSFD 3L7NA 3R5FA 3V6SA 4F2PA 1GGJA 4AWAA 3SXPA 5HF9A 5GY7A 5C51B 1DC7A 3NX8A 3LQYA 5AI6A 4Q16A 4ENWA 4V24A 3NHAA 1AQLA 4IPTA 2AR0A 2X1NA 1GFWA 2NYRA 3L7YA 3CY2A 1XLWA 4LZWA 4Q1FA 2A6PA 3BX5A 4YUVA 5EZSA 4Y67A 2BN4A 2OGZA 5LJJA 2PIAA 4V05A 1AQ6A 4U2CA 5K3AA 2PZIA 1Z5WA 3KSZO 4YI5A 3L8PA 3DOGA 4YJHA 4DH1A 1A2QA 4HWGA 4ZO7A 4HGYA 4RVSA 5FXQA 1F17A 3BSWA 4GLOA 3HLLA 1W2GA 1SWVA 3SKVA 2J0JA 3E9DA 2H31A 5ITSA 1WP4A 5AI9A 3SF0A 2IIBA 5ERGB 1P73A 3NGAA 2N46A 3JATA 2C4KA 1RZVA 4WPGA 3AKLA 5E2IA 3PG3A 1C7JA 2VSNA 1JDSA 5LU9A 3E8DA 4ZQHA 1EE2A 1PUXA 5LDGA 4EFKA 1E77A 3PPWA 4TN5A 3KPYA 4CCUA 2UYOA 2Y6UA 1UBHS 1U3WA 5JBQA 3GRZA 5FWYB 4JYBA 1N6LA 2QN1A 4XM1A 2Q4DA 2HF9A 3M81A 3U13A 1MZPA 3S3IA 3VR5H 1PKGA 4PHHA 3CS9A 4B74A 3HKOA 4KMRA 5L40A 3ELDA 5DEIA 4TWCA 4L8WB 1ETUA 2ZEJA 1OWMA 1KDPA 1FUUA 5KNBH 4MWCA 4O5AA 1CSEE 3D6NB 1UOOA 3AVYA 4IM2A 3W2EA 1FLDA 1UADA 4AGDA 1G6HA 1MFPA 3CKLA 3IDAA 2ECPA 3DZCA 4QNRA 5AXBA 1GPJA 4D02A 3C4XA 1Y6GA 2V7WA 3GXBA 1EDOA 1QQ5A 2DHCA 4BNHA 2Z1NA 3DM5A 2JEDA 1XCLA 3EFJA 2Z2IA 4I9HA 1HCLA 4GLFA 4DH5A 1FFSA 1TYEB 3FWPA 1E61A 3RG2A 4Y5QA 5GM2A 3ZY4A 2ZYDA 1GTMA 3EFEA 2ONLC 2YC4C 3UVQA 2A7XA 4RC2A 5IH6A 1ZYUA 1QHYA 3MMPA 3MWEA 3IDPA 5J9FA 5CSPA 3ZI7A 3KVRA 4M0KA 3T7IA 1QHIA 5DYYA 3T6KA 2DQYA 1KH3A 2OLJA 2PA0A 2PRKA 1DL5A 2BGNA 4RFYA 1KZ7B 5G0WA 5AVYA 3M5DA 4M98A 5ALLA 2VPIA 4BNVA 5C34B 4YJRA 5IFLA 2IU6A 3V46A 3EGVA 4QGGA 4P54A 3OLXA 2FR8A 3HCRA 5IBQA 2G4VA 1GXSA 1PS8A 3A6PC 5T68A 1TVOA 5F77A 4FK8A 1OL5A 5DEOA 2DF8A 1X15A 2HK7A 3FZNA 3BJEA 5IISA 1EG7A 5GV8A 1VB5A 1TA0A 2PUEA 4LHVA 1OXXK 2R64A 5CUQA 2G40A 4C36A 4C4IA 3SC1A 5JBNA 4CCBA 5JC8A 2JANA 3S2GA 3PDIA 4KMOA 2JDRA 5CTPA 4S2EA 1ISHA 1X38A 2HK9A 4HDOB 5CVHA 4CCYA 2APJA 3MIYA 3PX7A 1P33A 4RKEA 2J3MA 1EUYA 5DCYA 1B74A 4E6EA 1ZHFA 2Q21A 2H4WA 2A2AA 5B1IA 5TKDA 2GA9A 5DHPA 3R75A 1L3BA 2PUTA 4KIJA 5LFAA 4NCTA 1RT9A 4JBLA 2XRUA 2PPQA 1LVHA 1RWNA 3EQBA 2VNYA 2WUVA 4RVFA 1UBNA 2WYUA 4AUAA 2WVHA 1HOXA 4JDKA 3FMOB 3IUSA 1UBRS 3NHUA 2H92A 4OXRA 5E8UA 3HUTA 4H1VA 4I23A 4V1CB 3T3HA 3F2NA 2BCJQ 1Z15A 3ONVA 3DW1X 4HS9A 5CCDA 3W18A 5DNDA 2O7NA 4F93B 2C6DA 4LVUA 1UU8A 2W1IA 2XE4A 3JARB 3ROXA 2G9UA 4TSRA 4EL9A 1IWOA 4QPAA 3RYHA 3OO1A 3TQFA 3QF9A 2NPIA 1U1IA 4U7GA 3E8CA 4IB1A 4B31A 2MINB 4OG2A 4NYIQ 2CVFA 4Y2SA 4F4DA 4MVCA 4MUQA 2ATCA 5I9LA 2NADA 5DRBA 5CNNA 4NDAA 3ECCA 3VH4A 4QC2A 3QOFA 4MD7E 1Z0UA 2BL4A 2H2FA 2Y9QA 4P5EA 1JIJA 1D1SA 2ZVAA 5BQPA 2PUAA 4DS3A 1KSWA 2AFHE 2WUDA 2IHJA 4GP6A 5CEOA 2W1GA 2AG6A 1KI1A 2FSMX 2CNUA 5ALPA 1KFEB 1H0SA 4L01A 5K8JB 2RG6A 1D4AA 4FZAB 2D2EA 3UTCA 4X21A 5AADA 3E4CA 3DE0X 1JBKA 2AJCA 2P2CA 1J06A 4JXXA 2OLKA 5KNCD 3M6IA 3RYCA 1SVHA 3QUBA 2ZWPA 1UIMA 2XK6A 3WJ1A 1Q2UA 3U4QA 1UWJA 4L5CA 2R5NA 3I9FA 5IM5A 5NULA 3QX8A 5DNVA 4CQMB 2WUEA 1B6CB 2GFCA 4PGAA 1L5MA 4PLFA 1TJNA 2WE8A 4KSBA 4QYMA 4AS1A 1JKIA 4YZ9A 1U0LA 4GICA 1H42A 1ML3A 3A7JA 3FLNC 1BHJA 3PHBE 3C48A 3TQOA 4CG0A 5DR2A 4XYLA 3INYA 4Z51A 3W1VA 2CEKA 4PNIA 4N0PA 3KWFA 4MQ4A 5JCOC 4MD9E 3BMCB 5U4XA 4QQRA 1KI3A 2VYVD 4LVOA 1C14A 4PXSA 3PEVA 5ER6A 2PUGA 1B6GA 3SI7A 1GL7A 1PK9A 1HX7A 3D14A 1Z5PA 1XH7A 4I41A 4EQ6B 1AJEA 4UUBA 4CDMA 3K71B 5D5QA 1M2JA 3QUSA 5KUPA 3WNCA 3BIOA 3LUFA 3ETJA 4JJ7A 2YN4A 4UKDA 5HKOA 4PC3A 2WTIA 3AR5A 3AD5A 2GWRA 1OYWA 4JJFA 3IEPA 2JGKA 4BLTA 4I5GA 1KJZA 1K6MA 5CVTA 2ZWAA 1J5PA 2RHHA 1RBMA 1MOSA 1OLOA 1Y6RA 1RS0A 2DY0A 3ZDUA 2H5EA 4HR7A 3X43A 1ZIOA 1Z37A 1JAXA 1LBTA 5TF0A 4COOA 1V7CA 2ON6A 4QP6A 1W6RA 1M1YA 6PFKA 4NP6A 2GYYA 3CIFA 5LDDC 5EN4A 4BQFA 1QHGA 1Q83A 4ER3A 2EX1A 4Q9SA 3QEMA 2Q5HA 1F0KA 1OC4A 3ZCQA 4TUYA 3E87A 2CJYA 3LW7A 2QKWB 1YL5A 3NUQA 3TACA 1PWHA 3CH5A 4J7BA 5MGBA 2OZLB 3BM5A 1T6NA 1XNGA 3QZGA 2WJWA 5GV7A 3QPDA 1PFQA 3DO8A 2C77A 3D64A 4JIAA 3O8OB 1JX6A 2IDKA 5J4LA 1T91A 1TJPB 4GE0A 2VVTA 2E4WA 4CUZA 3KE9A 4O8ZA 2PUIA 3ZE0B 1C3LA 5ICMA 4FZ6A 4S0ZA 3GBZA 4IDCA 2VTQA 4JK3A 4WNAB 3UBTA 1LSOA 3HUCA 4ZTBA 1WZEA 4IEEA 2F6RA 1ZA1A 2NQ2C 4JAIA 4B34A 2ZJ1A 2WMRA 2N9UA 4RA9B 3M70A 1Y6AA 1G18A 2NZ2A 1IG3A 5B37A 3VBWA 4C0TA 3LGSA 3U4CA 3VZSA 1PS0A 4BBZA 2E6UX 2FMIA 3PEEA 2NUPB 4E5KA 1QZ3A 1I3CA 4ZAZA 1V8BA 2IYVA 4IJ6A 5HUQA 5G0VA 3NVKI 1SZJG 5K4AA 3AVXA 2VUWA 2R4QA 3CPSA 4JYZA 3VNBA 4M7WA 2C2OA 1H28A 4O7SA 4HEA1 4OYYA 1E2GA 4MUEA 3R9OA 3MJEA 1I2BA 2B36A 1XVAA 5H81A 2P55A 3COYA 5JJIA 1Q5PA 1T8UA 1RIIA 3B52X 5EOBA 3Q2OA 1YUBA 1SBCA 2O8DA 3BTSA 2VF4X 2WMXA 2A9QA 1JH8A 3IFSA 3CPJB 3H2KA 3VPDA 1JUDA 2C68A 5SYNA 3RJ5A 3ZUPA 3DCIA 4ARUA 5JSHA 4H15A 3IBSA 4GO1A 3ADOA 1W0XC 2VHEA 1XJ5A 3UXMA 4O4LB 5D01A 2V3CC 4OLAA 3MERA 3TTJA 1VE3A 5HG5A 2EU9A 4RVMA 3UKOA 5KU7A 3VFDA 2J0LA 4PAWA 3EJ6A 3OIDA 2H9YA 2G3YA 4UCFA 3ROFA 3VRHA 3FL4A 3VKUA 1XO2B 4C35A 3ZCVA 4OUDA 4H4EA 2JKMA 5F23A 4IZ5A 3DV2A 4J7UA 3OF0A 2VO0A 4FONA 3C5IA 1E5DA 3NBKA 4EHNA 5JZ9A 4L6QA 2ATEA 3NLLA 3F46A 1S89A 2YN8A 4Z8XA 5KNJA 1XBBA 1ZEJA 1G3NA 5B1YA 2JAVA 1N33B 1UAGA 3UH1A 1UFKA 1GNGA 4FIDA 1Y7IA 4PIMA 1D1PA 1UFOA 3TSYA 4S35A 1YZYA 2VTRA 2QQEA 3LDUA 4B47A 1U99A 4BDSA 3CLTD 2X58A 1AOXA 3MH2A 1DZIA 2R7MA 1YZVA 4M88A 1OT3A 1G5RA 5M5BA 4C3ZA 3DBRA 5AW4A 3PXGA 3FJOA 3E22B 3QLUA 3L6OO 3ZTXA 3HRBA 3R1QA 2CJWA 1RYHA 1XKLA 3A2CA 3RK9A 2EERA 2OICA 3PQ3A 5JFVA 5AKLA 3KR2A 3Q10A 5EZQA 3P32A 3N74A 2VJMA 4G6NA 2EKPA 2WM3A 4DGSA 5DM2A 3U17A 3MD9A 4RVTA 4AL4A 2C2ZA 3GJ0A 1YWNA 4GG7A 2WFAA 1Q0LA 2QV0A 1P4HA 3B1ZA 4TWOA 5A9TA 1CB0A 1FMTA 3EQ7A 1FDIA 3E9QA 2G5PA 1T1JA 1OH6A 3TDVA 4BP9A 2VTDA 3HDGA 3N0VA 2ORVA 3P9NA 4S12A 4L15A 4JLNA 1MORA 3WGGA 4BP8A 2AC7A 4GI2A 3FE3A 2IXGA 3GC0A 2JKOA 4W1SA 4OJYA 2HMTA 3L6EA 3T9IA 4EBWA 5IVPA 2QLQA 3HKCA 4RVKA 5CHEA 1VHDA 3EZ2A 3CVVA 4OGGA 3I9KA 3UWDA 3L6UA 3WWYA 2BCJA 3EN9A 3RINA 1ZITA 2QE7A 4A9TA 4KAXA 3BHTA 4EHAA 3ZDXB 2WR8A 4H7IA 1RWXA 1OLSA 1V45E 2B9JA 5AESA 4RK7A 3DOFA 4M0MA 4JJGA 1CK4A 4KO2S 1C0LA 2PS3A 1Q1AA 3O7WA 4YXWA 3PGVA 1G3UA 3E62A 4ZTQA 2GVZC 1I44A 3CSUA 3SD7A 3MTLA 1NBME 1ISRA 4BQQA 3TCKA 2UW6A 1LCIA 3QVLA 3QKUA 4IP0A 5JV5A 4GEOA 1GTJ1 2GRUA 5EE1A 5E92A 3HMOA 4D5HA 4EYEA 3C7QA 4MJ3A 3QEBZ 1PJTA 1JHYA 1PFGA