3AKLA

Crystal structure of a helicobacter pylori proinflammatory kinase ctka
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
294
structure length
281
Chain Sequence
PTIDFTFCEINPKKGFGGANGNKISLFYNNELYMVKFPPKPNGCFSEYVACHIVNSLGLKVQETLLGTYKNKIVVACKDFTTHQYELVDFLSLKNTMIELEKSGKDTNLNDVLYAIDNQHFIEPKVLKCFFWDMFVADTLLGNFDRHNGNWGFLRAEYQIAPIFDCGSCLYPQADDVVCQKVLSNIDELNARIYNFPQSILKDDNDKKINYYDFLTQTNNKDCLDALLRIYPRIDMNKIHSIIDNTPFMSEIHKEFLHTMLDERKSKIIDVAHTRAIELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ctka
publication title Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 88
structure length 281
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07804 HipA_C HipA-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.20 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 3aklA02
3.30.200.120 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3aklA01
3AKJA 3AKKA 3AKLA
chains in the Genus database with same CATH superfamily
2XIYA 3UYSA 2R3KA 3E93A 5JRQA 1NVSA 1YRPA 3A99A 3KK9A 4FSWA 3SXFA 1BYGA 5J87A 4DFLA 1IAHA 3DBQA 2IJMA 4Q2AA 1UNHA 2GNIA 4GB9A 2BRNA 4HZRA 4JDHA 4JDKA 4V04A 2CNQA 4LL0A 5L3AA 2Y4IB 5F4NA 3RWPA 3FE3A 4CRLA 4U0IA 2F7EE 4A9SA 5A54A 3Q2MA 3P7CA 4QT1A 3BEAA 4I6QA 2QOFA 4QOXA 3NAYA 3VONA 1KE8A 3LVPA 4RJ5A 3R8ZA 1J7LA 2VWIA 2X8DA 4FKIA 2ZM1A 2IZRA 3AT3A 4MUQA 3KA0A 2PHKA 2W1HA 4FJYA 3PRFA 4RJ7A 4L52A 4GFGA 5CEIA 1W84A 4DGOA 4EZ3A 3AMAA 4OTIA 3AKLA 4BDGA 3Q2JA 4RPVA 1HCLA 1H8FA 3CE3A 4N4SA 3WF7A 3MJ1A 4OTWA 3GGFA 2QD9A 3BV3A 3TI1A 5M53A 3TNQB 2YABA 3K5UA 2HW6A 4MWIA 4QMLA 4DINA 5C4LA 3KULB 5HORA 4AGUA 5HE3A 1ZMVA 3ZSIA 1H4LA 2F49A 5ETCA 4ANBA 4LOQA 3W0RA 2BRHA 4G9CA 5D9HA 3ACKA 1DAWA 2VTIA 5KX8A 3OG7A 5ICPA 3BPRA 3AC4A 2B53A 3LMGA 4Y8DA 5CEMA 1RW8A 4AWIA 5LWMA 2QO7A 1P2AA 1Q3DA 3C0GA 3GCVA 5HVJA 5E8TA 4YTIA 4CV8A 2VTPA 3GT8A 3KXGA 4RSSA 3PG1A 3MPTA 2QU5A 4R78A 4L1BA 2UVZA 2PVRA 4S30A 5L2WA 3ML1A 2C6IA 5G2NA 2QG5A 3R22A 3UTOA 5DIAA 2OJIA 4WAFA 4FLHA 4YGAA 3A62A 5M08A 2JDOA 4BJJB 5HZNA 3TL8A 1UU8A 3SVVA 2UW0A 3NYNA 4ACHA 4JLCA 4RX8A 4JVGA 4AXEA 4RA5A 3CQUA 4FEQA 4E73A 5GIOE 1PXLA 3FZ1A 3P1AA 3SHEA 2PWLA 3V5TA 3BYMA 4CNHA 2JBOA 5FXSA 1Y8YA 2WMXA 4II5A 1U54B 3TKUA 4HNIA 3OMVA 2WMVA 4ONAA 4OBPA 4XH6A 2V62A 1U46A 4NJ3A 3PXKA 3K5VA 3R7YA 4IM2A 4XX9A 5HI2A 3THBA 1W83A 4GEOA 4L6QA 3F5GA 5TOZA 3ALOA 5DR9A 4W8DA 3MS9A 1X8BA 4FSRA 1Y8GA 1HCKA 2DQ7X 3W0QA 2R3NA 3FLWA 5A4LA 4G11A 1JSUA 3L17A 2VTTA 4HVHA 3D5VA 5FD2A 3RZBA 2YWVA 1YOJA 4C3RA 3QRIA 2RFSA 4X3JA 3ZEWA 4JDJA 3R8PA 4KIPA 3ET7A 4BB4A 1RJBA 3JY9A 3R02A 4WG3A 3ORNA 4YP8A 4C36A 4YJRA 1GZ8A 4IH8A 3RKBA 4PY1A 3TTIA 1WMKA 4YUQA 3BCEA 3OXIA 2H34A 2I0VA 4RIYA 3RM7A 3FPMA 3VHEA 1OKZA 4ZSAA 4XHKB 5I9YA 3GBZA 2C5OA 4RWLA 3F2AA 1UWHA 4H1JA 2UVYA 5CU3A 4KBKA 1XBCA 3QRKA 3VBQA 3L8VA 4EH9A 5FEEA 2C3IB 2E9UA 3NZUA 3FSFA 2FSLX 2DWBA 5JZNA 2V7OA 4L7FA 4FV7A 1Q8TA 3U4WA 4BDEA 3KMUA 4FKQA 1FOTA 3ZZWA 4E6DA 1H1SA 3QWKA 5CX9A 1MQBA 4UY9A 3QCXA 4JAIA 4I22A 3OW3A 3MGYA 3KCKA 3QKLA 3NUNA 4ID7A 4ZAUA 4QDEA 4ACMA 3LFBA 4GJ2A 1WBOA 3T9TA 3H9RA 3REPA 4KABA 1H1RA 3BU3A 4YO4A 3Q9XA 3NUPA 1PXNA 4R6VA 5D1JA 3VBXA 3TL5A 4FMQA 2B4SB 2QONA 2JDVA 3DOGA 3CBLA 1G8JA 3FMNA 1GOLA 3NZ0A 4FTTA 2OKRA 4Y83A 2Z7QA 3R00A 4AX8A 2JIVA 2OJFE 3HMNA 4FG9A 4QNYA 4R3PA 3FPQA 4Z3VA 3ML9A 4M7IA 4C2WA 2XUUA 5LMBA 3OZ6A 2E9OA 4IX4A 1XHAA 4QTCA 2C3JA 4WKQA 3LCOA 4QTAA 4UWFA 3AT2A 1PYXA 2VO7A 4PH4B 1UA2A 3DQXA 5BNJA 2QURA 4QO9A 3Q6WA 3ORTA 3ULZA 4I0RA 3TZ8A 1YDRE 4FSMA 4M3QA 4CFUA 2BAKA 5ANGA 4AAAA 3UIXA 3CR0A 4YTFA 3ZBFA 2ZDTA 3PPJA 5EK7A 3RHXA 3SG8A 3WZKA 2OJ9A 4EWQA 3LFDA 3QX2A 2WTKB 4U6RA 4JS8A 3O2MA 2UZNA 1SM2A 2RGPA 3NUXA 3ORXA 3PFYA 4YZ9A 3UG2A 4TW9A 4IDVA 2C5YA 4O0YA 3V6RA 4RIWA 4BDDA 5BQ0A 3LLTA 3IDBA 4JQ8A 3UC4A 1BL6A 2EB2A 4EEVA 3IQ7A 4IAYA 3Q60A 3HEGA 1OVEA 5E4HA 5ANJA 5D11A 3R7RA 2OIBA 2GU8A 3NEWA 3VULA 5AIKA 5F1ZA 3LM5A 2IWIA 4L68A 4AG8A 4AS0A 4ZLYA 2R7IA 5FGKA 4F64A 3FDNA 2FH9A 4J99A 3WIKA 3VQUA 2BFXA 2YCFA 1HE8A 2QI8A 2CGUA 2QOOA 2CKOA 4F9AA 3PVUA 2OXXA 4QMWA 4A4LA 3NYVA 1SZMA 4FYNA 3DGKA 4XYFA 1NW1A 3DS6A 4Q5EA 5IQIA 4XCUA 3K54A 4BI0A 4QMQA 1Q5KA 2C3LA 2J4ZA 4FNYA 4RGJA 2HWOA 3CP9A 1H0WA 4OBOA 3EYHA 4BTMA 3CEKA 3PZEA 2PZ5A 4CFWA 3LFNA 4KS8A 4PNKA 3CD3A 3G90X 4ZJVA 5CZIA 5HNIX 3Q4ZA 5IQHA 1H07A 1PMVA 3UPXA 2VO3A 4G9RA 3VUMA 4EHGA 2ZV9A 5HTCA 1G3NA 5FP6A 2JITA 3OFMA 2WMRA 3KN5A 5C01A 1IASA 1PYEA 3COKA 5H9BA 4DFNA 2ITZA 4RX5A 4LRJA 2PMIA 3BYVA 4J96A 3RI1A 5D41A 2ACXA 5ENNA 4AXAA 2F9GA 3FWQA 3KB7A 3C13A 3I7CA 3M1SA 2IVTA 3MESA 3NAXA 3NCGA 3LW0A 4X0MA 1YWNA 4Z7HA 1DI9A 4PDPA 3S1HA 1R0EA 1JVPP 2V7AA 3RMFA 4B99A 1H27A 4Y72A 4HZSA 5CU0A 1UWJA 4EH4A 2OU7A 4HLEA 4X3FA 5FTGA 3QLGA 3DXPA 3R7IA 4GIHA 1V0PA 4BI1A 5J7HA 4B9DA 3LFEA 4FNWA 1XMMA 4PL5A 5JHBA 3PJ3A 4FGRA 4DH8A 4MD9E 4K2RA 3MFRA 5IZFA 2XYUA 4R7IA 3VIDA 4FL1A 4EK4A 4Q5HA 4XP0A 3KKVA 2WELA 3NYOA 4K1BA 5M06A 2PMLX 3AOXA 5IA1A 1UNGA 3UBDA 3F3UA 4JBVA 4MQ1A 5CALA 4ARKA 3ZFYA 4YJTA 4HVSA 2ZV8A 2WXQA 2WU7A 3PREA 3MY5A 4IVBA 5EM5A 2YACA 2VX0A 5C9CA 5FP5A 1IA8A 1ZZLA 3DT1A 4KWPA 3Q4UA 3WE8A 4YHJA 4AW5A 4NCTA 1W82A 1KUTA 4IIRA 4NM0A 2WMWA 3RWQA 3PTGA 1NXKA 5DR2A 1YI4A 4AF3A 4ENYA 3COHA 4FGBA 4Y85A 4F0GA 2HZ0A 1IA9A 3SKCA 3OVVA 4G1WA 5EHLA 4UZHA 5EH0A 3E5AA 4QPSA 2WTIA 1RDQE 2OZOA 4XBUA 3HVCA 2EXMA 4XP3A 4CMOA 3KGAA 3II5A 1E90A 5IQAA 2C6DA 4BICA 4AP7A 4Y5QA 3FSKA 4IJ9A 3EYGA 3PY0A 2VTNA 4ZSGA 5I9XA 1YXTA 3B8RA 4D4RA 5J1WA 3LXLA 4FICA 4PP9A 3PDTA 1ATPE 3FEGA 1TQIA 1CKPA 2R9SA 5K4JA 4E6AA 3MV5A 2X9FA 3LFSA 3D7TB 1OB3A 3FYKX 4FIIA 3W0NA 3NNVA 4C7TA 4AZTA 4E20A 3L9NA 2YM6A 4FT7A 2FA2A 2BRGA 2BVAA 4LOOA 3P9JA 1Q99A 4EORA 2JD5A 5CXZA 5HIEA 3ZHPC 4EUUA 2PUNA 3F2RA 4ZTMA 2JLDA 1NA7A 3VBWA 5D10A 3IKAA 1IAJA 2C6OA 5LWNA 3UNJA 2HW7A 1Q8YA 3NR9A 1J3HA 1GZOA 3FY2A 1KE5A 4R3CA 2A5UA 4OGRA 3QCSA 4BCGA 1K2PA 1NY3A 4CFFA 5LVNA 5LVLA 4XE0A 1Q24A 4K18A 4O22A 5KMJA 3BE2A 2PY3A 2JFLA 1DI8A 4DAWA 3TCPA 5LQFA 2WXNA 2OZAA 1OIUA 2WQBA 2BZJA 2E9PA 3I1AA 3MFSA 3RAWA 5CAVA 3NIEA 4FV3A 2Z7LA 2ZYBA 5BX0A 3Q52A 4XV1A 1OIQA 3PSCA 5AX3A 5AAGA 3DPDA 1WBSA 2WTCA 3DB6A 5GJFA 3RK9A 1H08A 3ODYX 3VF8A 4CQEA 4BBMA 3GC9A 2FYSA 3FLYA 2VRXA 4AW1A 3I81A 4E4LA 1M14A 3GFWA 5H8EA 3ROCA 3R6XA 5DFPA 3VUIA 4PX6A 4TUUA 4WWPA 3ZVVA 1KV1A 2ERZE 1ZY5A 2VNWA 3DJ6A 3EFLA 3FUPA 3Q96A 4IM0A 4AA5A 4X6QC 4F4PA 3PUPA 3H10A 3TZMA 4JI9A 3F61A 2WOTA 1V0OA 3D0EA 2XAOA 3BYOA 1VYZA 2QCSA 3DJ5A 4RC4A 4TWNA 4XJ0A 5DYJA 4DFZE 3DBFA 5FDXA 5T6KA 5M57A 5CNOA 3L08A 4L2YA 3JUHA 3QKKA 3FI3A 3LE6A 1XH8A 1H26A 3HZTA 3LJ0A 4E26A 3UOJA 2RG5A 3E63A 5FTQA 3CJFA 4ASDA 2PVNA 4NM3A 4KSQA 2BZIB 2GQRA 2HELA 4NTTA 2WTWA 4YJOA 2W1EA 4ERWA 3LQ8A 3VUKA 3APFA 5M09A 1UVRA 4DH5A 4K0YA 4QPAA 2IPXA 3ERKA 2W1DA 3E8EA 4OW8A 1J91A 4HVBA 3P08A 4KKHA 4ZZNA 3FZSA 5CEKA 2WXKA 5HQ0A 4G31A 4FC0A 4ANVA 3TKIA 3UIUA 3VRYA 1GY3A 1G8KA 2BIYA 2ZM3A 5LXMA 1J7UA 1JAMA 2OW3A 2A27A 2YCQA 4RIXA 1YW2A 3UVPA 4BGGA 2UW4A 5CF8A 4K9YA 4FTMA 1DM2A 5C8NA 2FSOX 2R3JA 1OM1A 5B0XA 5LCKA 4TWCA 4CFVA 1O6YA 3BGQA 5E8WA 4PTGA 2QVSE 4FIJA 5FRIA 4QMVA 1FBNA 1ZYCA 5IA2A 2PTKA 4F1MA 4MBIA 3UO6A 1UU3A 2XAMA 4O7SA 3KFAA 5JEBA 3DNEA 2JAVA 4MQ2A 4B8LA 4ERKA 5IPJA 1UKIA 3ORPA 2WOUA 4AOFA 4YZMA 4MEDA 1YXVA 1A48A 1E1VA 4TT7A 3OCSA 2GS7A 4KINA 3Q3BA 4P5QA 5EQPA 5C03A 4GT4A 5LOHA 4USEA 4L46A 4W4YA 3LJ1A 5LCJA 5BMMA 2JKMA 4CZTA 3HRFA 3R9OA 5A4QA 2PVFA 2QQ7A 5KKRB 4OVVA 1V1KA 4B0GA 4X7QA 2DUVA 2UZTA 3JY0A 2IZUA 3HECA 4O81A 3GFEA 5M56A 4QYGA 5HLPA 2XK6A 2A19B 2PE0A 2DYLA 3A7GA 5KO1A 3BWFA 2C4GA 2GNFA 2YM7A 1UU7A 1GIIA 2WAJA 4ITHA 2OIDA 4YJNA 2C1AA 3ZXTA 5JT2A 3PJ8A 3JVRA 4IACA 3I6WA 3LXKA 3FMMA 1OPKA 3D5WA 2IVUA 1WBWA 3QHRA 4O0RA 3W2RA 4BCOA 4IQ6A 3F5UA 4L67A 2P55A 1GNGA 5HU3A 1P14A 3FMLA 3V8SA 4D55A 4MXZA 2UVXA 4ZS4A 3OC1A 4RIYB 3DK6A 3HMIA 2XKCA 4RA4A 2QOKA 3SAYA 2CHWA 5KHXA 3D2IA 3EQIA 4UWCA 3W8QA 1TKIA 5CAUA 5E7RA 5C26A 5M51A 4M84A 4XMOA 2XJ0A 4BFRA 1FPUA 4HGSA 4QMXA 3NRMA 3H4JA 3UZPA 4BF2A 3G9NA 4O2ZA 4KZ0A 4BCFA 2X38A 5G55A 1CM8A 3NVMB 2X2MA 3ORLA 4H1MA 5HG7A 3TTJA 3ZZEA 4DGGA 5AP1A 2VWBA 4TN6A 3RAKA 2GFCA 2JKKA 5IMXA 3MY1A 3FL4A 2X4FA 3ORZA 4EQCA 4C62A 5JH6A 4FIEA 4M0YA 1BL7A 2VTOA 3GOPA 4FSUA 4QP2A 3FMDA 4XOYA 2EB3A 5HBHA 5JHAA 4FV1A 5EYCA 4JPSA 3FXXA 3QRJA 2W96B 2WXGA 5EYMA 5J5SA 4FODA 3NNXA 1E9HA 4I0TA 4CT2A 2KTYA 1OECA 4YLJA 2JIUA 5AP7A 1LP4A 2CSNA 4NFMA 4PUZA 1SYKA 3PPKA 2BKKA 4FV0A 3FKOA 2IZSA 3EN5A 4F63A 3UVRA 4W4WA 4DEIA 1W8CA 4QMNA 4H36A 4K6ZA 2V0DA 3CQWA 3VUHA 1XH7A 4BN1A 3Q9YA 4O7NA 4EQUA 2OIQA 2ZV2A 3AKJA 2Y6OA 3P4KA 4EYJA 3R21A 2X9EA 1JQHA 4EZJA 5AP0A 1JWHA 3LMHA 5FBOA 3SX9A 4OLIA 3NMUF 3S2AA 4FIHA 4CFMA 1Y6AA 1QL6A 4K33A 2J5FA 3EWHA 3CY2A 1STCE 4HVIA 2QO2A 2BTRA 5AM7A 4TV3A 1IR3A 2Y0AA 2VTQA 5JZJA 4FHKA 4D1SA 5IH5A 4WNKA 2VO6A 2RG6A 2FVDA 4N57A 2RF9A 3OBGA 1OI9A 4FIFA 3DQWA 3ZFMA 4A9YA 3CPCA 4N0SA 4DEHA 3QD4A 2YCSA 4R1YA 1E1XA 2HWPA 5DVRA 4QMTA 4WNOA 3PS6A 1PXMA 4C4GA 5EFQA 4M67A 3NDMA 2OFVA 3QTZA 4JG7A 3F2NA 4MKCA 4M0ZA 1Q8WA 3CGFA 4USDA 5C27A 3WF5A 5M07A 5BVOA 2XA4A 3HKOA 3Q5IA 4RIWB 4YHFA 5HE2A 2B9JA 4J8NA 3BI6A 4KUJA 2UW3A 3MY0A 2ZV7A 3DZQA 4FTRA 4YNEA 3R8LA 1OITA 3UE4A 4DEEA 4EL9A 3P5KA 5H3QA 2A0CX 3N9XA 3N4VA 4I23A 3PJCA 3JR1A 5ITAA 3JXWA 4ZXTA 2WU6A 2OWBA 3FQSA 4FZ6A 3BELA 4IAIA 4NYEA 2UZDA 4YZBA 3V8TA 4ZLZA 1M2PA 4EOPA 4FSTA 4L3JA 3IG7A 2Y9QA 3ITZA 4YPDA 4EH2A 4QNAA 2VTLA 3E8DA 5IU2A 4G2FA 2ZM4A 5M55A 4FTJA 4ITJA 3R7UA 4ANSA 5KBQA 3C5IA 5E9EA 4GG7A 3TEIA 3W8LA 4XX5A 1OL5A 3MTLA 1J1BA 4LRKA 4E7WA 2JDTA 4EK8A 3MTFA 4ALUA 2ITTA 4AXFA 2XM8A 4FSNA 4O0WA 5IQFA 1URWA 2CHLA 5EG3A 4RVMA 3UDZA 4ALWA 3L8PA 3KMWA 4G3GA 4J1RA 3R1QA 3EZRA 4CFNA 3AQVA 3QYZA 3HRBA 5DE2A 4S2ZA 4D1ZA 3Q6UA 4OTQA 2WKMA 3BL7A 5F20A 4V0GA 4ZS0A 2CNVA 2HY81 4E93A 4P4CA 4A9TA 4G3FA 2VNYA 1H25A 2Y4IC 3DBEA 2WXMA 3GC8A 3IW6A 3CKWA 3LHJA 4IADA 4IB3A 1I44A 4I0SA 4XG8A 5AX9A 3OHTA 3DLZA 3UDBA 4W4XA 3VS5A 5I4NA 1XO2B 4FUXA 5EW3A 3BYSA 3OTUA 4O7VA 5BVDA 3C4EA 5AP6A 4ZZMA 3RVGA 3V6SA 5FQDC 3AC1A 3QQUA 3VN9A 3ZO2A 1CTPE 4LI5A 3FMJA 2F57A 2VTHA 4O6EA 3NZSA 3V04A 1OGUA 4X3FB 5F95A 5EDQA 4UALA 4O91A 2XIRA 4C3PA 2YWPA 4AACA 4E5WA 3W2QA 5E91A 4FYOA 5AP2A 2JKOA 1FVVA 4A7CA 4O0VA 4FKLA 3BQRA 4EH8A 2AYPA 4FL2A 4D5HA 2BCJA 2XVDA 3Q9WA 5IMEA 1E8YA 2HZIA 3O8TA 4GUEA 2C0OA 3BKBA 3Q04A 1XBBA 2CCIA 2B52A 3A7FA 2CKEA 4UB7A 3EN9A 5DRDA 4ZTLA 3TDWA 4AZSA 4BDHA 4RFMA 3OOGA 5HNBA 3WYYA 2UW7A 4OTDA 4JBOA 4XOZA 3POOA 5E1SA 4EOLA 4DEAA 2BAJA 3MIAA 3U6HA 2BALA 3TWJA 2YITA 1M7QA 5L2IA 2QOIA 2AC5A 5EKOA 4YR8A 1H1WA 2XNNA 2ZB1A 3BL9A 5CS6A 3IBEA 4AGDA 5JK3A 3OROA 3N4UA 2NRUA 4GYIA 3UZTA 2C6KA 4YC3A 5EYDA 1CJAA 3P5JC 4RFZA 3OAWA 4YBKA 2HIWA 4PQNA 2R3FA 3EN7A 2QOBA 2VX1A 2XKEA 3FHRA 3SA0A 5FLFA 4AW0A 2X6FA 5HCZA 5HKMA 3JS2A 4C4FA 5HCYA 1KV2A 1WBPA 3MH1A 4ITIA 2J9MA 5AV1A 2W4OA 4FSZA 3R7EA 3WF9A 3SW7A 3IDCA 4I4FA 3QLFA 5E8SA 1GIHA 1VEBA 2B7AA 3FQHA 5EQEA 5H8GA 2GQGA 3KXZA 4NK9A 4F7NA 4DYMA 4TZRA 3MPMA 4QQCA 1OPLA 3V5WA 4RRVA 4BDFA 4F09A 5DBXA 2PE1A 5ETIA 3EOCA 2ETMA 4BI2A 4BCMA 1MRVA 2C1BA 4DE4A 2PL0A 4DEBA 4JBQA 5LMKC 4O84A 1U5RA 3TNPC 4C4HA 2Z8CA 2C0TA 2WB8A 4I5PA 5I9VA 4EC8A 3E92A 3LLAA 5DEYA 4AXCA 4DHIB 4A07A 5GNKA 2X2KA 4FJVA 4QYHA 2X6KA 4L01A 3ZXZA 4E1ZA 4I20A 1R0PA 3TXOA 2Z7SA 4WD5A 3WIGA 4L9IA 4ACCA 2BFYA 1ZAOA 4J71A 4AZVA 3TJDA 1G8SA 4PDYA 2CHXA 1B6CB 2B54A 2XEYA 3D94A 3ATSA 3F3VA 3MB7A 2XANA 3I60A 3VVHA 3R71A 3R2BA 2G2HA 4YJPA 2A1AB 1YOMA 2OZAB 3EH9A 3PY1A 4O0XA 5AFVA 2JDSA 3UYTA 4ACGA 5B7VA 1OUKA 3GU5A 4H39A 3TV7A 1O9UA 2BUJA 2FO0A 1BI7A 4YTCA 1J7IA 4G5PA 4CMUA 3F7ZA 3SQQA 3E64A 4RT7A 1L8TA 2NO3A 3ZUVA 4G5JA 3TUDA 4GU9A 1IEPA 3NW7A 4OTRA 2I0EA 3IW5A 2EUFB 2YM3A 4YO6A 4F08A 2BAQA 1ERKA 2X6DA 4M8TA 5TF9A 5KZ0A 5JFSA 5JN2A 3S3IA 4LV8A 2XCKA 3GEQA 2XZSA 3TIYA 5KMKA 4MXXA 2G2FA 3C4WA 2XS0A 2W1GA 5G6VA 4Y46A 3W2SA 2VV9A 3CTHA 4URKA 3R1NA 4ASEA 2GNGA 4GMYA 3D5UA 4GJ3A 4R7HA 5HVYA 4APPA 4EHEA 5CYIA 3EL7A 3NUAA 5CSHA 4D0WA 4ZY5A 1V0BA 3W1FA 3FC2A 3EQHA 3I0QA 3OD6X 3ZO3A 5HBJA 2PVLA 2WMSA 3NS9A 4G34A 3TYKA 3ZRLA 3ZSGA 4D5KA 2X6JA 3SDJA 4UBAA 2WQEA 3GU4A 3QCQA 4FSQA 5B2KA 4BDCA 3EB0A 4O96A 4WHZA 5IA3A 3U6JA 2Y8OA 5HG5A 3QQJA 5K3YA 5CSVA 4TKSA 3UVQA 3PG3A 1WAKA 4FT0A 5ETAA 1VYWA 3DJ7A 5CZHA 1JKSA 3R0TA 3LMIA 2B9FA 4R3RA 4M13A 4UEUA 2GTMA 2VZ6A 3H0YA 3O51A 3R83A 4HYSA 3RK5A 4PMPA 4XG3A 1OKWA 2UZBA 4X2GA 5D12A 5DEWA 5IEYA 4DFUA 3TIZA 3ANRA 4MNFA 4XG6A 4IZAA 3C5UA 3Q9ZA 4AN9A 1Z57A 4EOOA 3E7VA 4RIXB 3O5AA 1AQ1A 1TQPA 4YZDA 2YA9A 3IW7A 3RALA 4C0TA 5LJJA 5EM8A 3VBYA 2UW9A 2GMXA 4QP1A 4J6IA 1LUFA 3QAME 4H05A 3OBJA 3ZU7A 1Q97A 4RJ8A 3G15A 4GL9A 3TG1A 3DB8A 4EH5A 3I7BA 5KMNA 4DITA 5BUIA 3AC5A 3I6UA 3BLAA 3HP5A 4ZZOA 3ZIMA 3Q4TA 4I94A 3HMOA 3NFFB 3A61A 4IZ7A 4AOIA 3ZDUA 2PUIA 4ANMA 3MYGA 2NRYA 4LV7A 2HY0A 4E5AX 5E90A 1Y91A 1K9AA 1OGYA 2PZIA 4AQCA 3I5ZA 4GIIA 3TT0A 4AT3A 4GRBA 4DG3E 2GTNA 3QZGA 2G1TA 4L42A 3SRVA 3VUGA 2YJRA 4ASZA 4A4OA 1WZYA 3O23A 4JT3A 4G3CA 5AV3A 2SRCA 4IFCA 3UMWA 3BRBA 5J9YA 2CLXA 3CSVA 3D5XA 1YXXA 3A8WA 1ZMWA 2YHVA 4HNFA 2QOCA 4FTIA 3HGKA 5IA5A 4EJ7A 3P79A 2J50A 2WQMA 3B2WA 1TVOA 3NSZA 4O7TA 4IDTA 3MJ2A 3ENHA 3DBCA 1FQ1B 5BVFA 1JOWB 5JKGA 2PUUA 3IS5A 3BHYA 4GK3A 2A4ZA 1RE8A 3BLHA 4CD0A 5AUXA 5HVKA 4WIHA 3C1XA 5CENA 4LGHA 4Y5HA 4QQTA 2FB8A 3UOKA 4J95A 2C30A 3HLLA 4WNMA 4FTKA 1SVEA 3FJQE 4TY1A 3Q5ZA 5DT0A 3WZJA 2X1NA 2XK4A 3KMMA 4IWPA 2XP2A 2ITXA 1A9UA 5ANOA 4B4LA 4Y73A 4TL0A 5EI6A 5A46A 3V8WA 3R1SA 4F78A 4QTBA 3G51A 1KOBA 3U9CA 2X81A 3TZ9A 2YEXA 4DH7A 4F65A 5HESA 2WXJA 4RG0A 2XM9A 2QKRA 3L54A 1H24A 4WG4A 3QHWA 4IJPA 4R7BA 4FZFB 3W33A 3A8XA 4UV0A 4EZ7A 3GU8A 2GSFA 3N4TA 3VBTA 3QU0A 3C0HA 3D4QA 1MUOA 5J9ZA 1JNKA 4FV6A 4BGQA 3PXFA 2W4JA 2XALA 3G9LX 3TM0A 4PDOA 4RX7A 2HAKA 4F99A 4G3EA 3P7BA 2XRWA 5AIRA 2R3GA 3BLRA 5CY3A 4KKGA 4F1SA 1CMKE 3F3ZA 3U87A 2WEVA 4G6NA 3S2PA 3ZOSA 1TQMA 3EQDA 3FV8A 2YDJA 4MX9A 5J8IA 3ZRMA 1G5SA 2GNLA 4DH1A 4CKJA 1PF8A 5DGZA 2WMTA 3PZHA 3AD6A 4IAKA 4IZ5A 2XMYA 3VWAA 2WO6A 2GHGA 3FLNC 1ZARA 2QKWB 4BCKA 2R3LA 1WFCA 2VU3A 4LM5A 3MH0A 3CC6A 3APDA 4O82A 4UN0C 5A6OA 5DT3A 3R1YA 4MAOA 4WRSA 2BDWA 1M2QA 5HBEA 2GCDA 4FEVA 4GSBA 2HENA 2QHNA 4F1OA 4I3ZA 4CEGA 1Q3WA 2W4KA 3NWWA 4GKIA 1QCFA 3PYYA 4QQ5A 1PXJA 4BDAA 4IB5A 2WIPA 4JRVA 5HEZA 2A2AA 4JOAA 4BIEA 4U3YA 3UJGA 4FULA 3EQPA 3HDMA 3O0GA 5GJDA 1ZYSA 3HAVA 5IEXA 5GIPE 4ZIMA 5A4CA 3RPYA 4NUSA 1E7UA 2UUEA 2P33A 3R7OA 3W55A 4DT8A 2IVVA 2GFSA 1H01A 4XEYA 2WXLA 4O7RA 4QMSA 3S4QA 4KD1A 4W8EA 4OT5A 1J1CA 1E8WA 2V4LA 3GENA 3OXTA 4GU6A 3UODA 3UQGA 5ANKA 4XP2A 4USFA 3FXWA 3VNTA 3FZPA 3TUCA 5FXQA 2UZWE 4D4VA 2GDOA 2IO6A 2J0JA 4H58A 2XK8A 1XH6A 4BCIA 1PJKA 3L1SA 2YZLA 5JQ5A 1DAYA 3DKFA 1WVXA 4XS2A 4TYEA 4YJQA 5ACBC 3RPOA 3TZ7A 2O3PA 4BCQA 3UMXA 3QX4A 3FBVA 4FKVA 1NVRA 2X6IA 3CIKA 3GU6A 5FM2A 3AXWA 4MYGA 3KY2A 4UWHA 4D9TA 1PY5A 4MCVA 2OXYA 2BTSA 3SXSA 4K11A 4K8AA 4FZAB 2CGXA 2F2CB 5FEDA 2PZRA 3TV4A 3LZBA 2JFMA 3PVWA 2C5NA 4FKJA 4AGCA 5KMOA 2ITNA 4FKGA 2EXCX 1E7VA 4KAOA 5BUEA 3MA3A 1Q41A 5DPVA 4V0GB 4RZWA 1PW2A 3QZIA 4QTEA 4OR5A 4QMOA 4UYNA 3PIXA 3U54A 4QMMA 5AV0A 2F7XE 5LMAA 4OVUA 5AUTA 3DAEA 2PMNX 2YIXA 3K3JA 3NCZA 2R3RA 1PHKA 2UZUE 3DBSA 4FEUA 4FTUA 3R9HA 4MWHA 4G17A 1JSVA 4HOKA 3BGZA 2WMQA 3QQHA 3R73A 4IX6A 3BU6A 3EQGA 4DDIA 1MQ4A 3CKXA 5CVFA 3LFFA 3VS7A 4JL9A 3R7VA 3U9NA 3QXPA 4AAYA 2WXIA 4XG7A 3P7AA 4RVKA 5IISA 5T3QA 1PMEA 4J7BA 4N70A 4GFOA 1YI3A 4BHZA 4FKUA 3FKLA 4PWNA 2Y3AA 4QQJA 4EK5A 5CVHA 4ANLA 3QKMA 1Y57A 4FKRA 4NFNA 3I79A 3R9NA 3HL7A 4YZCA 3W2PA 2CPKE 2R3MA 3GNIB 3HMMA 5DI1A 3QTRA 5EM7A 1LPUA 2UW6A 5HTBA 4L3LA 4RJ6A 1WVWA 3DFAA 5LMKA 4EK3A 1OZ1A 3NVKI 4I6BA 2QR7A 4ZTNA 4DHJA 4A06A 5KUPA 4DBXA 5KHWA 4NW5A 1GZNA 1ST4A 5M4FA 3E8CA 2R3OA 4AT5A 2UZEA 3L9MA 3KN6A 4BZNA 3QTIA 4EBVA 1WCCA 4KRCA 2CHZA 1ZOHA 1FMOE 2WZJA 3MA6A 2ZMCA 1ND4A 4UZDA 4UWBA 4XV2A 2PZPA 3CLYA 2X8IA 4FV4A 3WI6A 1GIJA 4HW7A 2O64A 3NPCA 3HUCA 1S9IA 4N6ZA 4QDVA 4V01A 5DG5A 2X6HA 3LOKA 2BROA 3AMBA 4HVGA 3SGCA 4D58A 5AAEA 2KULA 3M11A 1PKGA 2ZAZA 3DAJA 3NNUA 4UX9A 5L6OA 4QMYA 4JRNA 2VWYA 3AG9A 2X4ZA 3EL8A 3ULIA 4EI4A 5GJGA 3SLSA 5GINE 4MVFA 2XYNA 4KBCA 3E62A 4ZJIA 3QTUA 3NUSA 1P4OA 2YFXA 1YDTE 3HNGA 3QTXA 4FEWA 4WWNA 4TPTA 2UV2A 2I6LA 2R64A 4U41A 3NX8A 3T8OA 3VW6A 4AFEA 4A55A 1IG1A 3CS9A 3KQ7A 3MVHA 4FKTA 5IUHA 3LCKA 2RIOA 4EJNA 1SNUA 2WXRA 3LS8A 1BX6A 5KKRC 1JKTA 2WGJA 4MD8E 2BHHA 2ZOQA 4JMQA 4BBEA 1Q4LA 2YJSA 3GCSA 3HV5A 4E6QA 3ANQA 4TYHA 2PVMA 1F0QA 3SV0A 4HCVA 2BMCA 3P86A 3VS4A 2XB7A 2XF0A 2OJJA 4WT6A 1BLXA 1Y6BA 2WXFA 4ENXA 4BYJA 4KB8A 3BU5A 2XJ1A 3KXNA 4M15A 4BY9E 4BBFA 3SOAA 5FTOA 2LGCA 3HYHA 1S9JA 3AD5A 4C4JA 1FGIA 4LOPA 3BQCA 3DTWA 4FVRA 3ZFXA 3QARA 2BR1A 2OG8A 4OTFA 1MRYA 1VLRA 2WMUA 2OI4X 2R5TA 2X8EA 3GQLA 4XV3A 5T68A 4QP8A 4DEDA 3AMYA 1SNXA 2H96A 1M52A 2J0LA 4PTEA 3SOCA 4DGNA 4Z55A 5IF1A 5IH6A 5HD7A 5AA9A 2QHMA 4MF1A 4EKKA 3C4XA 4BRXA 3TN8A 1JLUE 2VN9A 2ESMA 4NZWB 2Z7RA 5FXRA 3MB6A 3BHTA 5AJQA 3WYXA 4BDJA 2W05A 3T9IA 4NU1A 2PVHA 4KZCA 5L6WL 5K9IA 3HRCA 4HPTE 5L2TA 3QRTA 1UKHA 3R28A 3KK8A 4J97A 4MH7A 4X2JA 5AV4A 3MN3A 2C6TA 3POZA 1H0VA 5JMSA 3OUKA 5KMMA 4GT3A 5CT0A 3EHAA 3QF9A 4PRJA 4GVJA 3U4UA 4EZ5A 4MXOA 1OKYA 2QODA 4NJDA 5L8JA 3V01A 3K3IA 4O0UA 5CVGA 4TYGA 3F7WA 5J9LA 2C0IA 3I0OA 4XNEA 1TFFA 1W0XC 3COMA 5ACKA 4DFYA 2JBPA 2R4BA 5EI2A 4P5ZA 5A4EA 3C4FA 3QQLA 2YM8A 3GC0A 3QA8A 4OTHA 4TRLA 3PIZA 4LMNA 5AUZA 4F9YA 4QYEA 3DV3A 4MD7E 2EWAA 3E3PA 2OGVA 2O2UA 3D83A 4GVAA 4IVDA 4BZOA 4ORKA 4KBAA 3TNIA 1GZKA 2IG7A 3A7HA 4QMPA 3ZC5A 1ZY4A 5EI8A 1SVGA 1JPAA 5IUIA 5E92A 2VGOA 3LJ2A 3GP0A 3FC1X 3L8SA 4IE9A 1T46A 4J53A 4L44A 3UC3A 1O6LA 1I09A 4MNEA 5JSMA 4I6LA 3UOLA 4XG4A 1CKIA 3R7QA 1Q8ZA 5DA3A 5HE0A 4I93A 4HCUA 5B2MA 5LVPA 5IUGA 3QL8A 3PA4A 3PWYA 5HO7A 3KRJA 2J51A 4FZ7A 4KSPA 2W17A 2Y7JA 5TR6A 3NYXA 4QP9A 5CAOA 4FA6A 4AJWA 4CZUA 3C7QA 3LKMA 5DNRA 3SRVB 4GK4A 4GKHA 4DFXE 4HCTA 4ANQA 3AC3A 3BGPA 4M14A 3CY3A 2VTJA 5ANIA 1U59A 2YDKA 2W99B 2GHMA 3KU2A 5CANA 5HG8A 4GUBA 2C5VA 2YIRA 2YCRA 3DXQA 3K2LA 4PDSA 4ZTQA 2ZMDA 2J90A 5HHWA 4D9UA 2PYWA 4EOKA 5HNGA 1PKDA 3RNIA 3ZW3A 4U45A 3RINA 4XZ4A 2I40A 3PP0A 4Z16A 3OOMA 2VTSA 1U5QA 1YXUA 2VTAA 3AC8A 5DN3A 5HIDA 3HX4A 4IWDA 1PXOA 2GNHA 3QGYA 3RM6A 5BVEA 3G6GA 3HMPA 3SXRA 3VAPA 3WILA 4CLJA 5HD4A 3FYJX 4IC7A 4E5BA 5EDSA 4Y95A 4DHZA 4DBNA 4Q9ZA 1OKVA 3FZOA 3RTPA 4TYJA 4FVPA 3TKHA 1ZWSA 4FE2A 1R1WA 4H3PA 4GYGA 4U3ZA 3PIYA 2BZKB 3KXXA 2W5HA 3UP2A 3G33A 2VTRA 4XRLA 5DH3A 4X3FC 3VJOA 4AZWA 2O8YA 4O38A 1P5EA 4QP7A 4UXLA 4WO5A 3MVLA 3PUFC 4FT5A 5CNNA 2OBJA 2XK3A 4FKWA 2WXVA 1YHSA 4ZSEA 2VAGA 4DH3A 2WHBA 2G2IA 1E8ZA 2W9ZB 1ZMUA 4KIOA 4FI1A 4IAFA 5J95A 4BIBA 2AEGA 4HYIA 2B0QA 1SVHA 2C47A 2P2IA 2C69A 3FY0A 1CKJA 4KRDA 2X0GA 1WBTA 3MSSA 2ZFYA 3H9OA 2YIWA 3O8UA 5IDNA 4CCBA 1ZZ2A 1REKA 2CMWA 4U9AA 4F0FA 3L13A 2C3KA 3BHVA 3EN6A 4FHJA 2VO0A 3IGOA 3C4CA 3T3VA 3ORMA 3KCFA 3VF9A 2XJ2A 2YERA 3ZO4A 2NP8A 2E9VA 2XIKA 3PJ1A 2YIYA 2RKUA 3QTWA 4WBBB 3D14A 2C6EA 3W16A 4XBRA 5FEQA 3NUUA 4XLVA 5K5NA 1MP8A 4U79A 3B8QA 3R63A 4FK3A 4EOSA 5EDPA 4RWKA 2X2LA 2AC3A 3F5PA 2HXQA 3OWLA 4NM7A 3VS0A 3DLSA 5AP5A 3MIYA 4XUFA 3QUEA 3E7OA 3DKOA 2ONLC 4Q9SA 3QALE 4JBPA 2YAAA 1KE9A 3QC9A 2QR8A 2B9HA 2B9IA 2PSQA 3PRIA 3QTQA 2OICA 4FL3A 4FADA 3R9DA 5A14A 2F4JA 1YHWA 3CGOA 3SW4A 4R5YA 5HU9A 4WSYA 4I6FA 3MVMA 4U80A 1PMUA 4X2NA 4AU8A 5CF5A 1H28A 1RQQA 3TV6A 4XV9A 3G5DA 4BCJA 3IONA 3DK7A 3SC1A 4F9WA 2VWZA 1KSWA 3KRXA 4LV5A 3NW5A 3WOWA 4MBLA 3QCYA 4H3QA 4TWPA 3DCVA 4IMYA 1OPJA 4HYHA 3A7JA 2Z2WA 4UXQA 3ZH8A 4AOJA 1XQZA 2CLQA 2WXPA 5ANLA 5EW9A 3GU7A 2CNUA 1JSTA 4XG2A 3V5PA 4WUNA 4M69B 4YZNA 4O83A 1ST0A 2XNBA 3F88A 2W1CA 4KA3A 4D1XA 3W2CA 3DZOA 5C8KA 3ACJA 3C4ZA 1CDKA 4G6LA 5AAFA 2HK5A 2ZJWA 1UNLA 4GV1A 4NH1A 1CSNA 4IM3A 4FG8A 4NW6A 4DA5A 5BV3A 3IO7A 2UZVA 4JX7A 3FAAA 3QWJA 2WMAA 5IDPA 5BUJA 4D2RA 2CKPA 1OUYA 4PL3A 3KL8A 4YURA 1YKRA 3UIMA 3FMHA 5CU4A 4C4IA 1YVJA 5LVOA 3T8MA 2I0YA 5HE1A 5CU2A 3LFCA 2OH0E 4BDKA 3DK3A 3QFVA 3EQRA 3W0PA 2VGPA 1BUHA 2PVKA 3LPBA 4JAJA 4E8AA 3DBDA 3ZC6A 4EH6A 4ZLOA 2XIZA 5I9ZA 4PMTA 3UDSA 3WZDA 4BDIA 2XRUA 2GPHA 1URCA 3CTJA 4JQEA 4QYFA 2YDIA 3G0FA 3KIOC 4MXYA 1OL2A 3QUDA 3RGFA 3F69A 4EKLA 3QJZA 4HPUE 5K4IA 2UW8A 2G15A 4S33A 4L00A 2EU9A 2WEIA 4KKEA 4I41A 3RAHA 1OIRA 2VWUA 4RIOA 3VS1A 4B7TA 3MH3A 4ZP5A 3E8NA 4GH2A 3B2TA 3DDPA 3R01A 2ZVAA 1O6KA 5HO8A 4RC2A 3FLQA 3R9RA 4DFBA 2F2UA 5CSWA 4F9CA 5JGBA 4BVUA 4UWYA 3I4BA 3VUDA 3CTQA 1QPDA 3QYWA 1PXKA 4MK0A 4P2KA 4IB0A 4EOJA 3NNWA 3F3WA 5L8LA 3M2WA 3P78A 5BPYA 2RD0A 3OXZA 4JG6A 3FMKA 4FX3A 5AUWA 3R8VA 5A6NA 4L53A 4RQVA 4ZMFA 3OW4A 1F5QA 3HV6A 4S31A 2YM5A 4LG4A 4BTFA 3FLZA 5BVNA 3CXWA 1E8XA 4JQ7A 4FSYA 3GUBA 2NPQA 4CXAA 3S0OA 4RWJA 4U40A 5E1EA 5I9WA 3OWPA 2PVJA 5KMIA 3PA5A 4LYNA 2P4IA 4AZEA 5JGAA 4PS8A 5DRBA 3T3UA 3DU8A 1ZYLA 3CD8A 2R7BA 4FVQA 3ZEPA 3EFKA 2HXLA 4L45A 4L3PA 1XMLA 2JIIA 3PXQA 1XJDA 4IVCA 4S34A 3WZUA 4E4NA 3PWDA 3UNKA 5K5XA 4N6YA 1Q8UA 4DCEA 2OH4A 3BX5A 3HA8A 4FKOA 4WNPA 2R0UA 2XIXA 2YN8A 4O7LA 3AGMA 3RPRA 4AOTA 4AT4A 2PZYA 4V05A 5IEVA 4K77A 3O96A 3FI4A 5M44A 4ZMEA 5CSPA 3CJGA 4BCHA 3BBTB 2W9FB 2XNPA 3MI9A 3MVJA 4JG8A 4ANUA 4GCJA 4AZFA 3GQIA 4FIGA 4X6RA 4NWMA 4YHTA 3RHKA 3W18A 3UO5A 2V5QA 3RCJA 4IAAA 4CMTA 2W1IA 3BYUA 2RFDA 4Z9LA 2BRBA 4C35A 4E6CA 2BDJA 3OT3A 2ITYA 1APME 3DPKA 3TUBA 5A4TA 3PLSA 5CQUA 3W0MA 2C5XA 3ETAA 3PSBA 3ALNA 2IVSA 1Z5MA 4AFJA 3BHHA 2CDZA 1ZRZA 3IECA 3LCTA 1XH4A 3TNWA 2QLUA 4D4SA 5IA4A 3LCDA 2WTKC 2ETRA 1VJYA 5HCXA 4AXDA 4CSVA 4TNBA 3KVWA 4TYHB 2Q0BA 3EFJA 2XBAA 3HAMA 2GHLA 2WTDA 4C37A 4DGMA 2YAKA 2HZ4A 4A9RA 3ENMA 1A06A 4PMMA 3RPSA 2OF4A 3KXMA 5JGDA 4L23A 4KS7A 2W5AA 3AC2A 3ZMMA 4DLJA 1QMZA 3LM0A 3W10A 5C4KA 5DHJA 4RZVA 2ZDUA 4EONA 4DHFA 1YI6A 5EOBA 3LQ5A 4CVAA 2C6LA 3WF8A 3LXPA 3QD3A 2OLCA 3ZO1A 2I1MA 1WVYA 2WFYA 3D9VA 3FHIA 3FZRA 4MBJA 4O7WA 3TNHA 5HLWA 5IQDA 2G01A 2X7OA 2R3PA 3QK0A 3FLSA 3VO3A 3ZTXA 3D15A 3WZEA 1REJA 3OY1A 3GCQA 3FI8A 4FBXA 5EHOA 3RP9A 3ORIA 3PXRA 4O7YA 3C0IA 4FNXA 4EC9A 5L2SA 4AN3A 4U42A 4DC2A 4CGAA 4UYAA 3RK7A 3AKKA 1SMHA 3OF0A 3N51A 3UGCA 2ITQA 3OS3A 2QOQA 4FV9A 5EKNA 3OWKA 4GS6A 1P4FA 1AGWA 3LAUA 3IGGA 3HUBA 5EYKA 3JYAA 4WOVA 2PUPA 4OBQA 5CEQA 1OL1A 3QTSA 4I1ZA 4TTHB 4YLLA 1M2RA 3AD4A 2PMOX 3F5XA 4NT4A 4CLIA 3E3BX 3GCPA 1H00A 2GNJA 2WTJA 2REIA 5I9UA 3OCTA 2WIHA 1IRKA 1B39A 3E87A 4EQMA 1YOLA 3HIZA 1FVRA 3QD0A 4U81A 4B6LA 2WTVA 2X6EA 1ZOEA 2RL5A 2BIKB 1EH4A 2V55A 4CV9A 3HV4A 4CG9A 4B8MA 3H0ZA 2H8HA 5IH4A 2IW8A 4XRJA 2FSTX 2OO8X 2WNTA 3OT8A 4WG5A 1ZXEA 2BRMA 3PFQA 5TT7A 4NL0A 2AUHA 2ERKA 1H1QA 4FEXA 4YBJA 3P23A 4X2KA 3A4OX 4RJ4A 4I5CA 3RJCA 1XWSA 4YJVA 4IX5A 2VUWA 3LIJA 3UZRA 4DT9A 3QAQA 4I92A 5HIBA 4FKPA 4IBMA 2IZTA 5TKDA 3HHMA 5I5ZA 4EWHA 4EHVA 3QQGA 2BDFA 3IOKA 4MTAA 4ZTHA 4FV8A 2BPMA 3F3TA 4AN2A 3A4PA 2E2BA 4FA2A 4MXCA 4AA4A 2W1ZA 5HG9A 2YIQA 3ZLXA 4IWOA 5M4UA 3V5LA 4FTAA 4FT3A 5CU6A 3ENEA 5F94A 4C34A 4CTBA 2Y4PA 1WBVA 3TJCA 2V22A 1VZOA 4M68A 4YC6A 2XARA 4PS7A 3E88A 3V5JA 3OCGA 4NSTA 5BVKA 4EHZA 3L9PA 4NTSA 1OBGA 3IHYA 2X7GA 4MNEB 4PV0A 3VRZA 4I5HA 3R8UA 4FJZA 2QU6A 4O27B 5CAQA 2VWWA 3O71A 3FXZA 3FKNA 3GXLA 3NGAA 2R3IA 4I24A 2HOGA 3P0MA 4PTCA 4QP3A 1YWVA 4OUCA 1WBNA 2X7FA 2XNGA 2CGVA 3ELJA 5F9EA 4QEBA 4RVTA 1YHVA 1ZLTA 2VTMA 5G1XA 4FOCA 3ZUUA 2XH5A 2Q0NA 5M4CA 1VR2A 3RAIA 5L8KA 4O21A 3Q53A 3ML8A 1ZYDA 3OEZA 4QMZA 5EOLA 5CWZA 4OTGA 3F9NA 4LL5A 4FTNA 3QC4A 3TJPA 5HICA 3BBWA 2YZAA 4GK2A 3KXHA 5EHYA 3GVUA 4AA0A 4PS3A 5HLNA 3ZM9A 4OT6A 3R8MA 4HGLA 1KE6A 4L8MA 3U8WA 3UP7A 5GHVA 2F7ZE 4S32A 4RLLA 4AW2A 4LUEA 3IOPA 4BCPA 3KC3A 4R5SA 4FKSA 4F7SA 5T8IA 3MPAA 4NKSA 3U51A 3W0SA 1OBDA 2O65A 2XKDA 2YM4A 1W7HA 3ZDIA 3COIA 5LVMA 4GG5A 3W2OA 3ZLWA 4C2VA 3QBNA 3IW8A 1YQJA 3ORKA 2P3GX 3FQEA 1KE7A 5M4IA 3LFQA 4FZDB 4O7ZA 4ASXA 2ITVA 3CCNA 3KULA 2WD1A 4MXAA 5AP4A 3DDQA 4I21A 4DTAA 3FI2A 2ONLA 3EN4A 3QA0A 4BTKA 4U7ZA 5CF4A 3PE2A 2QO9A 4JIKA 4EH7A 4RFYA 4PF4A 2WPAA 3EFWA 4RBLA 5CQWA 2QLQA 4IC8A 5IQBA 2JDRA 2GS6A 3A7IA 3KREA 1FGKA 3C9WA 4BR3A 3SD5A 3WE4A 3QRUA 4YJSA 3OCBA 1W98A 3BV2A 5KNJA 3OWJA 2H6DA 4WRGA 2W06A 1Q62A 4WBOA 1JBPE 5H8BA 3DAKA 3R30A 3UPZA 4BYIA 2H9VA 3BWJA 4U8ZA 2HCKA 4ZY6A 4E4XA 2WQOA 3KRLA 4QTDA 1LEZA 4P90A 3GB2A 1OL7A 4G6OA 3FL5A 4F7JA 1KOAA 3DKCA 4UWKA 5BYZA 4ALVA 3JVSA 3PVGA 3QD2B 4GW8A 4HYUA 2I0HA 3SD0A 4AUAA 4LFIA 4BJJA 3UO4A 4BDBA 2WXHA 2J2IB 4F0IA 2PK9A 4FTCA 4YMJA 4JR3A 3S00A 2EVAA 1M7NA 2R3QA 5CTPA 4APCA 4WA9A 5AWMA 2IN6A 4O6LA 4X2FA 3OTVA 3UDTA 2ITUA 2R3HA 4R1VA 1U54A 4O2PA 3S95A 1GJOA 5DOSA 4YSMA 4ZSJA 3RNYA 4CFXA 5IQCA 1U4DA 3QUPA 1BMKA 4C59A 3KRWA 4FNZA 5AA8A 3LJ3A 3HV7A 3Q4CA 5BYLA 4O0TA 3ROYA 4CT1A 3ZLYA 2C6MA 4ZTRA 2JEDA 4BIDA 3O7LB 4H3BA 5AUUA 1PXPA 4ZSLA 2HZNA 4TWOA 5CEOA 3KF4A 3Q32A 3OP5A 3PXZA 2O0UA 5ANDA 4RQKA 3BLQA 4EZKA 5FG8A 2UZOA 5C8MA 5IA0A 2J0MB 4EOIA 2W1FA 1G8AA 2OK1A 3MFUA 4RWIA 5AM6A 4C3FA 3O17A 4F6UA 3PY3A 2W0JA 4U43A 4WUAA 3ZYAA 3O8PA 4RVLA 3C51A 4M97A 2GS2A 1YXSA 5L6PA 4R77A 4YPSA 4HVDA 2PU8A 3H9FA 4IFGA 2R2PA 4JDIA 4EOQA 4F7LA 3QQKA 5DWRA 4C61A 1F3MC 2VD5A 5JFVA 2FSMX 4UWLA 3ZBXA 1UU9A 1XR1A 3WBLA 4BCNA 1AD5A 4EK6A 4YSJA 1ZOGA 2I7QA 3EKNA 4RX9A 2XNOA 2FGIA 5J1VA 2WQNA 2XCHA 4IEBA 2UZLA 4ANXA 1OMWA 3U55A 4JR7A 4FTQA 4ANWA 4FTLA 5E8UA 3OEFX 4JIAA 3UIBA 4DTKA 2G9XA 3IK3A 4F6WA 3EMGA 4FV2A 3PJ2A 4J52A 5DT4A 3CQEA 1KWPA 3SG9A 4HGEA 4TNDA 5CF6A 5A9UA 4A4XA 5EM6A 2JKQA 2A4LA 3EKKA 4AE6A 1UV5A 4M12A 2P0CA 5FDPA 2ZB0A 2GQSA 3KRRA 5E8YA 2Z60A 3HV3A 3OUNB 5KE0A 3IW4A 2NYAA 2CN8A 3LCSA 3VQHA 4Z7GA 4EUTA 4EZLA 5CASA 5HX8A 4WWOA 2ITOA 4NIFB 3PPZA 3UOHA 3MW1A 4DTBA 4DG0E 3ZRKA 5IG1A 3ATTA 4QMUA 2VWVA 3PP1A 2BZHB 5IQGA 5CLPA 4YJUA 4AGWA 4ZEGA 3P2BA 3TMOA 4BC6A 4QP6A 2OF2A 1ZYJA 4ZY4A 5EQYA 2B1PA 3CPBA 4D28A 5E8VA 3EJ1A 3GOKA 2IW9A 2FUMA 5AUVA 2CKQA 3BEGA 3BHUA 3W32A 3VS3A 5AV2A 5HGIA 1QPJA 3EZVA 4O0SA 4C4EA 5JFXA 4IHPA 3PVBA 3ZM4A 2O5KA 1GAGA 2J6MA 4OYSA 4PNIA 4TYIA 4AQKA 5ANEA 4MHAA 5TO8A 3RCDA 5AADA 4ZJJA 2BILB 1YDSE 2CGWA 3BZ3A 5BMSA 5KZIA 5I0BA 3IDPA 3GC7A 5AEPA 5D7AA 1LEWA 4XG9A 1OL6A 4DGLC 4P7EA 5D7VA 3UQFA 4YU2A 2OXDA 1JKLA 2R0IA 4RLKA 4CKRA 3IPHA 3HDNA 3R2YA 4IAZA 2CN5A 1DS5A 3GI3A 4C02A 1B38A 3KF7A 3PE1A 4NKAA 2X39A 3PSDA 4GFMA 4LRMA 4LGGA 4W4VA 3ZS5A 1QPEA 3H30A 2JC6A 3DA6A 3V3VA 1XH9A 3V51A 4DK5A 5E8XA 1YWRA 5CAPA 3MJWA 3G6HA 2ITWA 3ZLSA 3FZTA 3F6XA 3CSFA 2RFEA 4LQMA 5CI7A 4NM5A 3D7ZA 1OIYA 3KEXA 2OSCA 1FVTA 3ID6C 4EBWA 3PXYA 3BIZA 4ZK5A 2NNWB 4C33A 5JFWA 5KMLA 4L43A 3HA6A 3NUYA 4G3DA 5B2LA 3QZFA 1M17A 5KBRA 3EQBA 5CSXA 3C50A 1BI8A 1Q61A 2JAMA 4YTHA 3VBVA 1FINA 3EQCA 4D0XA 1PRYA 3APCA 5FBNC 3UNZA 3O50A 4O86A 3WARA 4LMUA 3G0EA 1XKKA 3DNDA 3VS6A 2XK7A 4PMSA 4U44A 3UG1A 5H2UA 4KIQA 3ZSHA 2XK9A 3OY3A 3ZONA 1T45A 4QRCA 5BYYA 1NVQA 2YISA 4L7SA 5IQEA 2CJMA 4ZTSA 3PA3A 4EYMA 4JJRA 3UQCA 3MH2A 4FT9A 4DF3A 4D4YA 2WXOA 4YNOA 3VC4A 2J5EA 2QG7A 4JNWA 4DCAA 5CEPA 3MWUA 2BKZA 3PRZA 1R78A 4CKIA 2WMBA 2Y6MA 3BE9A 2PULA 4J98A 5CT7A 4AE9A 2C68A 5HX6A 3A60A 4IB1A 3F82A 4FR4A 4I4EA 5LARA 3D2KA 3WF6A 3CSTA 3QGWA 3VHKA 2JGZA 4FV5A 4G16A 4QP4A 4F1TA 5JQ8A 3L9LA 4RMZA 1R3CA 1XH5A 2XNEA 2VWXA 5KCVA 3V5QA 5FM3A 3QZHA 5E8ZA 4GT5A 2J0IA 2OFUA 3LQ3A 3NIZA 3HP2A 4TXCA 4A9UA 4CCUA 1LR4A 3O7LD 5BVWA 1Z9XA 1HOWA 2PVYA 1K3AA 4DG2E 1PXIA 4IANA 4IWQA 3ZUTA 1H1PA 2ITPA 3DKGA 4IZYA 4DN5A 3U6IA 3GCUA 2W7XA 4C58A 4DDGA 3TDVA 2DS1A 4BHNA 3W0OA 3LFAA 1JKKA 3PLAE 5CI6A 5AP3A 3L8XA 2IW6A 4X21A 3NLBA 3DY7A 4C38A 4F70A 3VJNA 4QYYA 5EDRA 3DFCB 4RC3A 5FUTA 3LXNA 1MRUA 3QXOA 3RPVA 4FUYA 2QNJA 4BZDA 4IX3A 4JXFA 2J0KA 5AMNA 5C1QB 2OJGA 2HYYA 3M42A 3I5NA 4I5MA 2PE2A 2UW5A 4IVAA 4JX3A 1NT2A 2QC6A 3A2CA 4HJOA 3NW6A 3MFTA 1QPCA 2RFNA 5JRSA 3F66A 5A3XA 2E9NA 4KNBA 5EW8A 2XNMA 2XKFA 2XEZA 3H3CA 1PMNA 4HGTA 3EIDA 3DTCA 4YLKA 4CTCA 3G2FA 1XBAA 3ODZX 4EOMA 2QOHA 2BHEA 3AGLA 4PP7A 2CCHA 4CG8A 4FG7A 4LDTA 4BGHA 4DLIA 1BKXA 3D7TA 3EQFA 4J8MA 1L3RE 4CRSA 3TACA 2O63A 1FMKA 2J7TA 3NFGB 5DR6A 3QQFA 4LUDA 2LAVA 3DXNA 4FOBA 4NCTC 3ZCLA 4EH3A 5AUYA 5CXHA 2P2HA 2VX3A 3MBLA 4U97A 3L16A 3MDYA 1R39A 2PPQA 2ETKA 4IW0A 4FTOA 3R04A 4F9BA 4D2SA 4U5JA 4ACDA 4PL4A 5DLSA 2XBJA 4ZOGA 3JPVA 2QOLA 3VW8A 4YC8A 2Z02A 4F6SA 4XLIA 2Q83A 4BTJA 4RJ3A 4DEGA 4I6HA 4FK6A 2B55A 3AT4A 3FMEA 2W5BA 5ETFA 4UWGA 3KVXA 4BKJA 3VS2A 4E4MA
chains in the Genus database with same CATH topology
2XIYA 3UYSA 2R3KA 3E93A 5JRQA 1NVSA 1YRPA 3A99A 3KK9A 4FSWA 3SXFA 1BYGA 5J87A 4DFLA 1IAHA 3DBQA 2IJMA 4Q2AA 1UNHA 2GNIA 2BRNA 4HZRA 4JDHA 4JDKA 4V04A 2CNQA 4LL0A 5L3AA 2Y4IB 5F4NA 3RWPA 3FE3A 4CRLA 4U0IA 2F7EE 4A9SA 5A54A 3Q2MA 3P7CA 4QT1A 3BEAA 4I6QA 2QOFA 4QOXA 3NAYA 3VONA 1KE8A 3LVPA 4RJ5A 3R8ZA 1J7LA 2VWIA 2X8DA 4FKIA 2ZM1A 2IZRA 3AT3A 4MUQA 3KA0A 2PHKA 2W1HA 3PRFA 4RJ7A 4L52A 4GFGA 5CEIA 1W84A 4DGOA 4EZ3A 3AMAA 4OTIA 3AKLA 4BDGA 3Q2JA 4RPVA 1HCLA 1H8FA 3CE3A 4N4SA 3WF7A 3MJ1A 4OTWA 3GGFA 2QD9A 3BV3A 3TI1A 5M53A 3TNQB 2YABA 3K5UA 2HW6A 4MWIA 4QMLA 4DINA 5C4LA 3KULB 5HORA 4AGUA 5HE3A 1ZMVA 3ZSIA 1H4LA 2F49A 5ETCA 4ANBA 4LOQA 3W0RA 2BRHA 4G9CA 5D9HA 3ACKA 1DAWA 2VTIA 5KX8A 3OG7A 5ICPA 3BPRA 3AC4A 2B53A 3LMGA 4Y8DA 5CEMA 1RW8A 4AWIA 5LWMA 2QO7A 1P2AA 1Q3DA 3C0GA 3GCVA 5HVJA 5E8TA 4YTIA 4CV8A 2VTPA 3GT8A 3KXGA 4RSSA 3PG1A 3MPTA 2QU5A 4R78A 2UVZA 2PVRA 4S30A 5L2WA 3ML1A 2C6IA 2QG5A 3R22A 3UTOA 5DIAA 2OJIA 4YGAA 3A62A 5M08A 2JDOA 4BJJB 5HZNA 3TL8A 1UU8A 3SVVA 2UW0A 3NYNA 4ACHA 4JLCA 4RX8A 4JVGA 4AXEA 4RA5A 3CQUA 4FEQA 4E73A 5GIOE 1PXLA 3FZ1A 3P1AA 3SHEA 2PWLA 3V5TA 3BYMA 4CNHA 2JBOA 5FXSA 1Y8YA 2WMXA 4II5A 1U54B 3TKUA 4HNIA 3OMVA 2WMVA 4ONAA 4OBPA 4XH6A 2V62A 1U46A 4NJ3A 3PXKA 3K5VA 3R7YA 4IM2A 4XX9A 5HI2A 3THBA 1W83A 4GEOA 4L6QA 3F5GA 5TOZA 3ALOA 5DR9A 4W8DA 3MS9A 1X8BA 4FSRA 1Y8GA 1HCKA 2DQ7X 3W0QA 2R3NA 3FLWA 5A4LA 1JSUA 2VTTA 4HVHA 3D5VA 5FD2A 3RZBA 2YWVA 1YOJA 4C3RA 3QRIA 2RFSA 4X3JA 3ZEWA 4JDJA 3R8PA 4KIPA 3ET7A 1RJBA 3JY9A 3R02A 4WG3A 3ORNA 4YP8A 4C36A 4YJRA 1GZ8A 4IH8A 3RKBA 4PY1A 3TTIA 1WMKA 4YUQA 3BCEA 3OXIA 2H34A 2I0VA 4RIYA 3RM7A 3FPMA 3VHEA 1OKZA 4ZSAA 4XHKB 5I9YA 3GBZA 2C5OA 4RWLA 3F2AA 1UWHA 4H1JA 2UVYA 5CU3A 4KBKA 1XBCA 3QRKA 3VBQA 3L8VA 4EH9A 5FEEA 2C3IB 2E9UA 3FSFA 2FSLX 2DWBA 5JZNA 2V7OA 4L7FA 4FV7A 1Q8TA 3U4WA 4BDEA 3KMUA 4FKQA 1FOTA 3ZZWA 4E6DA 1H1SA 3QWKA 5CX9A 1MQBA 4UY9A 3QCXA 4JAIA 4I22A 3OW3A 3MGYA 3KCKA 3QKLA 3NUNA 4ID7A 4ZAUA 4QDEA 4ACMA 3LFBA 4GJ2A 1WBOA 3T9TA 3H9RA 3REPA 4KABA 1H1RA 3BU3A 4YO4A 3Q9XA 3NUPA 1PXNA 4R6VA 5D1JA 3VBXA 4FMQA 2B4SB 2QONA 2JDVA 3DOGA 3CBLA 1G8JA 3FMNA 1GOLA 3NZ0A 4FTTA 2OKRA 4Y83A 2Z7QA 3R00A 4AX8A 2JIVA 2OJFE 3HMNA 4FG9A 4QNYA 4R3PA 3FPQA 4Z3VA 4M7IA 4C2WA 2XUUA 5LMBA 3OZ6A 2E9OA 4IX4A 1XHAA 4QTCA 2C3JA 4WKQA 3LCOA 4QTAA 3AT2A 1PYXA 2VO7A 1UA2A 3DQXA 5BNJA 2QURA 4QO9A 3Q6WA 3ORTA 3ULZA 4I0RA 3TZ8A 1YDRE 4FSMA 4M3QA 4CFUA 2BAKA 5ANGA 4AAAA 3UIXA 3CR0A 4YTFA 3ZBFA 2ZDTA 3PPJA 5EK7A 3RHXA 3SG8A 3WZKA 2OJ9A 4EWQA 3LFDA 3QX2A 2WTKB 4U6RA 4JS8A 3O2MA 2UZNA 1SM2A 2RGPA 3NUXA 3ORXA 3PFYA 4YZ9A 3UG2A 4TW9A 4IDVA 2C5YA 4O0YA 3V6RA 4RIWA 4BDDA 5BQ0A 3LLTA 3IDBA 4JQ8A 3UC4A 1BL6A 2EB2A 4EEVA 3IQ7A 4IAYA 3Q60A 3HEGA 1OVEA 5E4HA 5ANJA 5D11A 3NEWA 2OIBA 2GU8A 3VULA 4AG8A 5AIKA 5F1ZA 3LM5A 2IWIA 4L68A 4AS0A 4ZLYA 2R7IA 5FGKA 4F64A 3FDNA 2FH9A 4J99A 3WIKA 3VQUA 2BFXA 2YCFA 2QOOA 2QI8A 2CGUA 2CKOA 4F9AA 3PVUA 2OXXA 4QMWA 4A4LA 3NYVA 1SZMA 4FYNA 3DGKA 4XYFA 1NW1A 3DS6A 4Q5EA 5IQIA 4XCUA 3K54A 4BI0A 4QMQA 1Q5KA 2C3LA 2J4ZA 4FNYA 4RGJA 2HWOA 3CP9A 1H0WA 4OBOA 3EYHA 4BTMA 3CEKA 3PZEA 2PZ5A 4CFWA 3LFNA 4KS8A 4PNKA 3CD3A 3G90X 4ZJVA 5CZIA 5HNIX 3Q4ZA 5IQHA 1H07A 1PMVA 3UPXA 2VO3A 4G9RA 3VUMA 4EHGA 2ZV9A 5HTCA 1G3NA 5FP6A 2JITA 3OFMA 2WMRA 3KN5A 5C01A 1IASA 1PYEA 3COKA 5H9BA 4DFNA 2ITZA 4RX5A 4LRJA 2PMIA 3BYVA 4J96A 3RI1A 5D41A 2ACXA 4AXAA 2F9GA 3FWQA 3KB7A 3C13A 3I7CA 3M1SA 2IVTA 3MESA 3NAXA 3NCGA 3LW0A 4X0MA 1YWNA 4Z7HA 1DI9A 4PDPA 3S1HA 1R0EA 1JVPP 2V7AA 3RMFA 4B99A 1H27A 4Y72A 4HZSA 5CU0A 1UWJA 4EH4A 2OU7A 4X3FA 5FTGA 3QLGA 3DXPA 3R7IA 4GIHA 1V0PA 4BI1A 5J7HA 4B9DA 3LFEA 4FNWA 1XMMA 4PL5A 3PJ3A 4FGRA 4DH8A 4MD9E 4K2RA 3MFRA 5IZFA 2XYUA 4R7IA 3VIDA 4FL1A 4Q5HA 4XP0A 3KKVA 2WELA 3NYOA 4K1BA 5M06A 2PMLX 3AOXA 5IA1A 1UNGA 3UBDA 3F3UA 4JBVA 4MQ1A 5CALA 4ARKA 3ZFYA 4YJTA 4HVSA 2ZV8A 3MY5A 2WU7A 4IVBA 5EM5A 2YACA 2VX0A 5C9CA 5FP5A 1IA8A 1ZZLA 3DT1A 4KWPA 3Q4UA 3WE8A 4YHJA 4AW5A 4NCTA 1W82A 1KUTA 4IIRA 4NM0A 2WMWA 3RWQA 3PTGA 1NXKA 5DR2A 1YI4A 4AF3A 4ENYA 3COHA 4FGBA 4Y85A 4F0GA 2HZ0A 1IA9A 3SKCA 3OVVA 4G1WA 5EHLA 4UZHA 5EH0A 3E5AA 4QPSA 2WTIA 1RDQE 2OZOA 4XBUA 3HVCA 2EXMA 4XP3A 4CMOA 3KGAA 3II5A 5IQAA 2C6DA 4BICA 4AP7A 4Y5QA 3FSKA 4IJ9A 3EYGA 3PY0A 2VTNA 4ZSGA 5I9XA 1YXTA 3B8RA 4D4RA 5J1WA 3LXLA 4FICA 4PP9A 3PDTA 1ATPE 3FEGA 1TQIA 1CKPA 2R9SA 5K4JA 4E6AA 3MV5A 2X9FA 3LFSA 3D7TB 1OB3A 3FYKX 4FIIA 3W0NA 3NNVA 4C7TA 4AZTA 4E20A 3L9NA 2YM6A 4FT7A 2FA2A 2BRGA 2BVAA 4LOOA 3P9JA 1Q99A 4EORA 2JD5A 5CXZA 5HIEA 3ZHPC 4EUUA 2PUNA 3F2RA 4ZTMA 2JLDA 1NA7A 3VBWA 5D10A 3IKAA 1IAJA 2C6OA 5LWNA 3UNJA 2HW7A 1Q8YA 3NR9A 1J3HA 1GZOA 3FY2A 1KE5A 4R3CA 4OGRA 3QCSA 4BCGA 1K2PA 1NY3A 4CFFA 5LVNA 5LVLA 1Q24A 4K18A 5KMJA 4O22A 3BE2A 2PY3A 2JFLA 1DI8A 4DAWA 3TCPA 5LQFA 2OZAA 1OIUA 2WQBA 2BZJA 2E9PA 3I1AA 3MFSA 3RAWA 5CAVA 3NIEA 4FV3A 2Z7LA 2ZYBA 5BX0A 3Q52A 4XV1A 1OIQA 3PSCA 5AX3A 5AAGA 1WBSA 2WTCA 3DB6A 5GJFA 3RK9A 1H08A 3ODYX 3VF8A 4CQEA 4BBMA 3GC9A 2FYSA 3FLYA 2VRXA 4AW1A 3I81A 4E4LA 1M14A 3GFWA 5H8EA 3ROCA 3R6XA 5DFPA 3VUIA 4PX6A 3DJ6A 2ERZE 2VNWA 1KV1A 3EFLA 1ZY5A 3FUPA 3Q96A 4IM0A 4AA5A 4X6QC 4F4PA 3PUPA 3H10A 3TZMA 4JI9A 3F61A 2WOTA 1V0OA 3D0EA 2XAOA 3BYOA 1VYZA 2QCSA 3DJ5A 4RC4A 4TWNA 4XJ0A 5DYJA 4DFZE 3DBFA 5FDXA 5T6KA 5M57A 5CNOA 3QKKA 3JUHA 3FI3A 3LE6A 1XH8A 1H26A 3HZTA 3LJ0A 4E26A 3UOJA 2RG5A 3E63A 5FTQA 3CJFA 4ASDA 2PVNA 4NM3A 4KSQA 2BZIB 2GQRA 2HELA 4NTTA 2WTWA 4YJOA 2W1EA 4ERWA 3LQ8A 3VUKA 5M09A 1UVRA 4DH5A 4K0YA 4QPAA 2IPXA 3ERKA 2W1DA 3E8EA 4OW8A 1J91A 3P08A 4KKHA 4ZZNA 3FZSA 5CEKA 5HQ0A 4G31A 4FC0A 3UIUA 3TKIA 3VRYA 1GY3A 1G8KA 2BIYA 2ZM3A 5LXMA 1J7UA 1JAMA 2OW3A 2A27A 2YCQA 4RIXA 1YW2A 3UVPA 4BGGA 2UW4A 5CF8A 4K9YA 4FTMA 1DM2A 5C8NA 2FSOX 2R3JA 1OM1A 5B0XA 5LCKA 4TWCA 4CFVA 1O6YA 3BGQA 5E8WA 4PTGA 2QVSE 4FIJA 5FRIA 4QMVA 1FBNA 1ZYCA 5IA2A 2PTKA 4F1MA 4MBIA 3UO6A 1UU3A 2XAMA 4O7SA 3KFAA 5JEBA 3DNEA 2JAVA 4MQ2A 4B8LA 4ERKA 5IPJA 1UKIA 3ORPA 2WOUA 4YZMA 4MEDA 1YXVA 1A48A 1E1VA 4TT7A 3OCSA 2GS7A 4KINA 3Q3BA 4P5QA 5EQPA 5C03A 4GT4A 5LOHA 4USEA 4L46A 4W4YA 3LJ1A 5LCJA 5BMMA 2JKMA 4CZTA 3HRFA 3R9OA 5A4QA 2PVFA 2QQ7A 5KKRB 1V1KA 4B0GA 4X7QA 2DUVA 2UZTA 3JY0A 2IZUA 3HECA 4O81A 3GFEA 5M56A 4QYGA 5HLPA 2XK6A 2A19B 2PE0A 2DYLA 3A7GA 5KO1A 3BWFA 2C4GA 2YM7A 2GNFA 1UU7A 1GIIA 2WAJA 4ITHA 2OIDA 4YJNA 2C1AA 3ZXTA 5JT2A 3PJ8A 3JVRA 4IACA 3I6WA 3LXKA 3FMMA 1OPKA 3D5WA 2IVUA 1WBWA 3QHRA 4O0RA 3W2RA 4BCOA 4IQ6A 3F5UA 4L67A 2P55A 1GNGA 5HU3A 1P14A 3FMLA 3V8SA 4D55A 4MXZA 2UVXA 4ZS4A 3OC1A 4RIYB 3DK6A 3HMIA 2XKCA 4RA4A 2QOKA 3SAYA 5KHXA 3D2IA 3EQIA 4UWCA 3W8QA 1TKIA 5CAUA 5E7RA 5C26A 5M51A 4M84A 4XMOA 2XJ0A 4HGSA 1FPUA 4QMXA 3UZPA 3NRMA 3H4JA 4BF2A 3G9NA 4O2ZA 4BCFA 3NVMB 1CM8A 3ORLA 2X2MA 4H1MA 5HG7A 3ZZEA 3TTJA 4DGGA 5AP1A 2VWBA 4TN6A 3RAKA 2GFCA 2JKKA 5IMXA 3MY1A 3FL4A 2X4FA 3ORZA 4EQCA 4C62A 5JH6A 4FIEA 4M0YA 1BL7A 2VTOA 3GOPA 4FSUA 4QP2A 3FMDA 4XOYA 2EB3A 5HBHA 4FV1A 5EYCA 3FXXA 3QRJA 2W96B 5EYMA 5J5SA 4FODA 3NNXA 1E9HA 4I0TA 4CT2A 2KTYA 1OECA 4YLJA 2JIUA 5AP7A 1LP4A 2CSNA 4NFMA 4PUZA 1SYKA 3PPKA 2BKKA 4FV0A 3FKOA 2IZSA 3EN5A 4F63A 3UVRA 4W4WA 4DEIA 1W8CA 4QMNA 4H36A 4K6ZA 2V0DA 3CQWA 3VUHA 1XH7A 4BN1A 3Q9YA 4O7NA 4EQUA 2OIQA 2ZV2A 3AKJA 2Y6OA 3P4KA 4EYJA 3R21A 2X9EA 1JQHA 5AP0A 1JWHA 3LMHA 5FBOA 3SX9A 4OLIA 3NMUF 4FIHA 4CFMA 1Y6AA 1QL6A 4K33A 2J5FA 3EWHA 3CY2A 1STCE 4HVIA 2QO2A 2BTRA 5AM7A 2Y0AA 1IR3A 5JZJA 2VTQA 4D1SA 5IH5A 4WNKA 2VO6A 2RG6A 2FVDA 4N57A 2RF9A 3OBGA 1OI9A 4FIFA 3DQWA 3ZFMA 4A9YA 3CPCA 4N0SA 4DEHA 3QD4A 2YCSA 4R1YA 1E1XA 2HWPA 5DVRA 4QMTA 4WNOA 4C4GA 1PXMA 5EFQA 4M67A 3NDMA 2OFVA 3QTZA 4JG7A 3F2NA 4MKCA 4M0ZA 1Q8WA 3CGFA 4USDA 5C27A 3WF5A 5M07A 5BVOA 2XA4A 3HKOA 3Q5IA 4RIWB 4YHFA 5HE2A 2B9JA 4J8NA 3BI6A 4KUJA 2UW3A 3MY0A 2ZV7A 3DZQA 4FTRA 4YNEA 3R8LA 1OITA 3UE4A 4DEEA 4EL9A 3P5KA 5H3QA 2A0CX 3N9XA 3N4VA 4I23A 3PJCA 3JR1A 5ITAA 3JXWA 4ZXTA 2WU6A 2OWBA 3FQSA 4FZ6A 3BELA 4IAIA 4NYEA 2UZDA 4YZBA 3V8TA 4ZLZA 1M2PA 4EOPA 4FSTA 4L3JA 3IG7A 2Y9QA 3ITZA 4YPDA 4EH2A 4QNAA 2VTLA 3E8DA 5IU2A 4G2FA 2ZM4A 5M55A 4FTJA 4ITJA 3R7UA 4ANSA 5KBQA 3C5IA 5E9EA 4GG7A 3TEIA 3W8LA 1OL5A 3MTLA 1J1BA 4LRKA 4E7WA 2JDTA 4EK8A 3MTFA 4ALUA 2ITTA 4AXFA 2XM8A 4FSNA 4O0WA 5IQFA 1URWA 2CHLA 5EG3A 4RVMA 3UDZA 4ALWA 3L8PA 3KMWA 4G3GA 4J1RA 3R1QA 3EZRA 4CFNA 3AQVA 3QYZA 3HRBA 5DE2A 4S2ZA 4D1ZA 3Q6UA 4OTQA 2WKMA 3BL7A 5F20A 4V0GA 4ZS0A 2CNVA 2HY81 4E93A 4P4CA 4A9TA 4G3FA 2VNYA 1H25A 2Y4IC 3DBEA 3GC8A 3IW6A 3LHJA 3CKWA 4IADA 4XG8A 4IB3A 1I44A 4I0SA 5AX9A 3UDBA 3OHTA 3DLZA 3VS5A 4W4XA 4BB4A 5I4NA 1XO2B 4FUXA 5EW3A 3BYSA 3OTUA 4O7VA 5BVDA 3C4EA 5AP6A 4ZZMA 3RVGA 3V6SA 5FQDC 3AC1A 3QQUA 3VN9A 3ZO2A 1CTPE 4LI5A 3FMJA 2F57A 2VTHA 4O6EA 3V04A 1OGUA 4X3FB 5F95A 5EDQA 4UALA 4O91A 2XIRA 4C3PA 2YWPA 4AACA 3W2QA 5E91A 4FYOA 5AP2A 2JKOA 1FVVA 4A7CA 4O0VA 4FKLA 3BQRA 4EH8A 2AYPA 4FL2A 4D5HA 2BCJA 2XVDA 3Q9WA 5IMEA 2HZIA 3O8TA 4GUEA 2C0OA 3BKBA 3Q04A 1XBBA 2CCIA 2B52A 3A7FA 2CKEA 4UB7A 3EN9A 5DRDA 4ZTLA 3TDWA 4AZSA 4BDHA 4RFMA 3OOGA 5HNBA 3WYYA 2UW7A 4OTDA 4JBOA 4XOZA 3POOA 5E1SA 4EOLA 4DEAA 2BAJA 3MIAA 3U6HA 2BALA 3TWJA 2YITA 1M7QA 5L2IA 2QOIA 2AC5A 5EKOA 4YR8A 1H1WA 2XNNA 2ZB1A 3BL9A 5CS6A 4AGDA 5JK3A 3OROA 3N4UA 2NRUA 4GYIA 3UZTA 2C6KA 4YC3A 5EYDA 3P5JC 4RFZA 4YBKA 2HIWA 4PQNA 2R3FA 3EN7A 2QOBA 2VX1A 2XKEA 3FHRA 3SA0A 5FLFA 4AW0A 5HCZA 5HKMA 4C4FA 3JS2A 5HCYA 1KV2A 1WBPA 3MH1A 4ITIA 2J9MA 5AV1A 2W4OA 4FSZA 3R7EA 3WF9A 3SW7A 3IDCA 4I4FA 3QLFA 5E8SA 1GIHA 1VEBA 2B7AA 3FQHA 5EQEA 5H8GA 2GQGA 3KXZA 4NK9A 4F7NA 4DYMA 4TZRA 3MPMA 4QQCA 1OPLA 3V5WA 4RRVA 4BDFA 4F09A 5DBXA 2PE1A 5ETIA 3EOCA 2ETMA 4BI2A 4BCMA 1MRVA 2C1BA 4DE4A 2PL0A 4DEBA 4JBQA 5LMKC 4O84A 1U5RA 3TNPC 4C4HA 2Z8CA 2C0TA 2WB8A 4I5PA 5I9VA 4EC8A 3E92A 3LLAA 5DEYA 4AXCA 4DHIB 4A07A 5GNKA 2X2KA 4FJVA 4QYHA 3ZXZA 4L01A 4E1ZA 4I20A 1R0PA 3TXOA 2Z7SA 4WD5A 3WIGA 4L9IA 4ACCA 2BFYA 1ZAOA 4J71A 4AZVA 3TJDA 1G8SA 4PDYA 1B6CB 2B54A 3F3VA 2XEYA 3D94A 3ATSA 3MB7A 2XANA 3I60A 3VVHA 3R71A 3R2BA 2G2HA 4YJPA 2A1AB 1YOMA 2OZAB 3EH9A 3PY1A 4O0XA 5AFVA 2JDSA 3UYTA 4ACGA 5B7VA 1OUKA 3GU5A 4H39A 3TV7A 1O9UA 2BUJA 2FO0A 1BI7A 4YTCA 1J7IA 4G5PA 4CMUA 3F7ZA 3SQQA 3E64A 4RT7A 1L8TA 2NO3A 3ZUVA 4G5JA 3TUDA 4GU9A 1IEPA 3NW7A 4OTRA 2I0EA 3IW5A 2EUFB 2YM3A 4YO6A 4F08A 2BAQA 1ERKA 2X6DA 4M8TA 5TF9A 5KZ0A 5JFSA 5JN2A 3S3IA 4LV8A 2XCKA 3GEQA 2XZSA 3TIYA 5KMKA 4MXXA 2G2FA 3C4WA 2XS0A 2W1GA 5G6VA 4Y46A 3W2SA 2VV9A 3CTHA 3R1NA 4ASEA 2GNGA 4GMYA 3D5UA 4GJ3A 4R7HA 5HVYA 4APPA 4EHEA 5CYIA 3EL7A 3NUAA 5CSHA 4D0WA 4ZY5A 1V0BA 3W1FA 3FC2A 3EQHA 3I0QA 3OD6X 3ZO3A 5HBJA 2PVLA 2WMSA 3NS9A 4G34A 3TYKA 3ZRLA 3ZSGA 4D5KA 3SDJA 4UBAA 2WQEA 3GU4A 3QCQA 4FSQA 5B2KA 4BDCA 3EB0A 4O96A 4WHZA 5IA3A 3U6JA 2Y8OA 5HG5A 3QQJA 5K3YA 5CSVA 4TKSA 3PG3A 1WAKA 4FT0A 5ETAA 1VYWA 3DJ7A 5CZHA 1JKSA 3R0TA 3LMIA 2B9FA 4R3RA 4M13A 4UEUA 2GTMA 2VZ6A 3H0YA 3O51A 3R83A 4HYSA 3RK5A 4PMPA 4XG3A 1OKWA 2UZBA 4X2GA 5D12A 5DEWA 5IEYA 4DFUA 3TIZA 3ANRA 4MNFA 4XG6A 4IZAA 3C5UA 3Q9ZA 4AN9A 1Z57A 4EOOA 3E7VA 4RIXB 3O5AA 1AQ1A 1TQPA 4YZDA 2YA9A 3IW7A 3RALA 4C0TA 5LJJA 5EM8A 3VBYA 2UW9A 2GMXA 4QP1A 1LUFA 3QAME 4H05A 3OBJA 3ZU7A 1Q97A 4RJ8A 3G15A 4GL9A 3TG1A 3DB8A 4EH5A 3I7BA 5KMNA 4DITA 5BUIA 3AC5A 3I6UA 3BLAA 3HP5A 4ZZOA 3Q4TA 4AOIA 4I94A 3HMOA 3NFFB 3A61A 4IZ7A 3ZDUA 2PUIA 4ANMA 3MYGA 2NRYA 4LV7A 2HY0A 4E5AX 5E90A 1Y91A 1K9AA 1OGYA 2PZIA 4AQCA 3I5ZA 4GIIA 3TT0A 4AT3A 4GRBA 4DG3E 2GTNA 3QZGA 2G1TA 4L42A 3SRVA 3VUGA 2YJRA 4ASZA 4A4OA 1WZYA 3O23A 4JT3A 4G3CA 5AV3A 2SRCA 4IFCA 3UMWA 3BRBA 5J9YA 2CLXA 3CSVA 3D5XA 1YXXA 3A8WA 1ZMWA 2YHVA 4HNFA 2QOCA 4FTIA 3HGKA 5IA5A 4EJ7A 3P79A 2J50A 2WQMA 3B2WA 1TVOA 3NSZA 4O7TA 4IDTA 3MJ2A 3ENHA 3DBCA 1FQ1B 5BVFA 1JOWB 5JKGA 2PUUA 3IS5A 3BHYA 4GK3A 1RE8A 3BLHA 4CD0A 5HVKA 5AUXA 4WIHA 3C1XA 5CENA 4LGHA 4Y5HA 4QQTA 2FB8A 3UOKA 4J95A 2C30A 3HLLA 4WNMA 4FTKA 1SVEA 3FJQE 4TY1A 3Q5ZA 5DT0A 3WZJA 2X1NA 2XK4A 3KMMA 4IWPA 2XP2A 2ITXA 1A9UA 5ANOA 4B4LA 4Y73A 4TL0A 5EI6A 5A46A 3V8WA 3R1SA 4F78A 4QTBA 3G51A 1KOBA 3U9CA 2X81A 3TZ9A 2YEXA 4DH7A 4F65A 5HESA 4RG0A 2XM9A 2QKRA 3W33A 1H24A 4WG4A 3QHWA 4IJPA 4R7BA 4FZFB 3A8XA 4UV0A 4EZ7A 3GU8A 2GSFA 3N4TA 3VBTA 3QU0A 3C0HA 3D4QA 1MUOA 5J9ZA 1JNKA 4FV6A 4BGQA 3PXFA 2W4JA 2XALA 3G9LX 3TM0A 4PDOA 4RX7A 2HAKA 4F99A 4G3EA 3P7BA 2XRWA 5AIRA 2R3GA 3BLRA 5CY3A 4KKGA 1CMKE 3F3ZA 3U87A 2WEVA 4G6NA 3S2PA 3ZOSA 1TQMA 3EQDA 3FV8A 2YDJA 4MX9A 5J8IA 3ZRMA 1G5SA 2GNLA 4DH1A 4CKJA 1PF8A 5DGZA 2WMTA 3PZHA 3AD6A 4IAKA 4IZ5A 2XMYA 3VWAA 2WO6A 2GHGA 3FLNC 1ZARA 2QKWB 4BCKA 2R3LA 1WFCA 2VU3A 4LM5A 3MH0A 3CC6A 4O82A 4UN0C 5A6OA 5DT3A 3R1YA 4MAOA 4WRSA 2BDWA 1M2QA 5HBEA 2GCDA 4FEVA 4GSBA 2HENA 2QHNA 4F1OA 4I3ZA 4CEGA 1Q3WA 2W4KA 3NWWA 4GKIA 1QCFA 3PYYA 4QQ5A 1PXJA 4BDAA 4IB5A 2WIPA 4JRVA 5HEZA 2A2AA 4JOAA 4BIEA 4U3YA 3UJGA 3EQPA 3HDMA