3AKLA

Crystal structure of a helicobacter pylori proinflammatory kinase ctka
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
294
structure length
281
Chain Sequence
PTIDFTFCEINPKKGFGGANGNKISLFYNNELYMVKFPPKPNGCFSEYVACHIVNSLGLKVQETLLGTYKNKIVVACKDFTTHQYELVDFLSLKNTMIELEKSGKDTNLNDVLYAIDNQHFIEPKVLKCFFWDMFVADTLLGNFDRHNGNWGFLRAEYQIAPIFDCGSCLYPQADDVVCQKVLSNIDELNARIYNFPQSILKDDNDKKINYYDFLTQTNNKDCLDALLRIYPRIDMNKIHSIIDNTPFMSEIHKEFLHTMLDERKSKIIDVAHTRAIELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ctka
publication title Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 88
structure length 281
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07804 HipA_C HipA-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.20 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 3aklA02
3.30.200.120 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3aklA01
3AKLA 3AKKA 3AKJA
chains in the Genus database with same CATH superfamily
2QHNA 3VWAA 4DFUA 5JK3A 2XBAA 2ZOQA 1OMWA 4FJZA 2H9VA 4FV4A 4IVAA 1GIHA 4RVTA 2B7AA 4W4YA 5DT4A 2CMWA 3R02A 4MQ2A 1ZYJA 3OXIA 5EYDA 2NP8A 2X6KA 2CNUA 5HNGA 2J0KA 4KWPA 4O91A 3PYYA 2OZAA 2UW5A 4I41A 3QD0A 4K9YA 5CLPA 1GAGA 3PS6A 1H27A 3KL8A 3LFAA 3NIZA 1JQHA 2PE1A 3KF7A 2PVNA 4IAZA 3A4OX 4PMPA 2VTRA 4FR4A 3FZSA 3L08A 3NCZA 3PA5A 5EQPA 5CWZA 4B99A 3VUKA 2X1NA 3S3IA 4AAAA 3MA3A 5CT0A 4KNBA 1S9JA 2OZOA 5LMAA 3RAKA 4C4IA 4CFMA 4NM3A 2W05A 3R2YA 3ZUUA 4IJPA 5HU9A 3FMDA 3QXOA 2EU9A 2ZDUA 3A4PA 4CKRA 3DKFA 3V8SA 4KB8A 4IWDA 4Q5HA 4C58A 4FSTA 2I1MA 4AOTA 3FZTA 2CNQA 2E2BA 4ZEGA 4L6QA 4PDPA 5IG1A 2X7OA 3LE6A 2FSOX 4GKIA 5CSVA 5EHYA 3QL8A 4S31A 3WARA 5GINE 2YM6A 4GFMA 2FGIA 3PPZA 4FIJA 1W7HA 5H8GA 3P0MA 3CY2A 5AUVA 4ZAUA 1ST0A 2H8HA 2W17A 3HMPA 3JUHA 5I9VA 3Q3BA 4FNZA 4M8TA 4CFFA 4DE4A 1U5QA 2PMNX 5JZNA 3ID6C 1SM2A 2ZB0A 3DLZA 2GS7A 4RFZA 2XNMA 5E9EA 5HG9A 3D94A 3VS1A 3Q4CA 2XJ0A 3VRZA 3E8DA 3E62A 2J7TA 2WMVA 3AT3A 3MDYA 3MYGA 3NVMB 3OZ6A 2QONA 2WXFA 3CD8A 4NL0A 4QTCA 3LFNA 3GUBA 2GDOA 4UWFA 3OXZA 4JG6A 2BDWA 5DIAA 3W2QA 5IA1A 3PY3A 5FXRA 2XALA 3UOKA 1E90A 1M14A 1WMKA 5AAEA 3QRUA 3DDPA 3IHYA 3VS4A 5HO8A 5ETAA 4DHJA 4AFJA 3LM0A 2XA4A 3FI3A 2VWBA 4GS6A 4W4VA 4M0ZA 4EH4A 4V05A 4AE9A 3OD6X 4RIXB 4ASEA 3HA6A 5JKGA 2V55A 3OY3A 1OKVA 4L68A 4L7SA 4TWOA 4UWCA 4FZDB 4GJ3A 5M56A 4GT5A 5FEDA 3VVHA 3AMAA 2JIUA 3HA8A 4FZAB 4QQJA 4RX9A 4UXQA 4BZOA 3VJOA 5HBHA 2VWZA 2W4OA 4Y73A 3KCFA 1Q5KA 2YIYA 3HKOA 2VO3A 5BUEA 1NT2A 4AWIA 4C2WA 4FZFB 3C0GA 5FQDC 3ZRMA 2FYSA 2WTKB 4XV3A 4XZ4A 3FHRA 5G1XA 3FAAA 1OL2A 2YM4A 3ODYX 2X6DA 3PUFC 3ROYA 4RIOA 3ANQA 3IW5A 3FKLA 4I24A 5IQIA 5KUPA 1RW8A 4JVGA 4YJPA 4AZWA 3DB6A 3PIXA 4DFNA 3TMOA 4O7TA 2XAMA 4M84A 2ZFYA 5D41A 5AA9A 2XYNA 3DXNA 1JKTA 4BDAA 4X2FA 4DA5A 1MRYA 3UODA 4XUFA 5B7VA 3FZPA 3CSTA 2YDJA 4LOPA 4AUAA 3OWLA 4AT4A 4AW5A 1QMZA 4F4PA 3WZUA 5BMSA 3VS2A 3HMOA 2ZVAA 3QA0A 1H0WA 3R9OA 4EWHA 3CTQA 3QKLA 1MRVA 2C6TA 4KBKA 4M0YA 1OB3A 3QZIA 2PUNA 2FH9A 4G16A 3CLYA 3LFDA 4FNWA 3QAME 4OTGA 3ZXTA 4IMYA 4EK3A 5EH0A 4QMNA 5C8NA 3GXLA 2BALA 1XHAA 4OTFA 3T3UA 3BYSA 3DAKA 3WOWA 2F2CB 1AGWA 2C3LA 4OTRA 4IVCA 4K77A 3E3PA 4HVBA 3Q2MA 5F4NA 3CEKA 5BVKA 3SXFA 2OBJA 3U6HA 2IO6A 4QYHA 2X9EA 4BCPA 2QC6A 2HZ0A 3CPBA 5I9UA 5EG3A 2VWXA 4QP6A 1ST4A 4QEBA 5AX9A 4J99A 5FBOA 3PVUA 5M07A 3R1YA 5J9YA 3R30A 2OH4A 1GJOA 4LRKA 4BGHA 2R3JA 2I0VA 3BEAA 4F70A 2C6IA 1ZZ2A 2CGUA 4QYFA 3W1FA 5I4NA 3C0HA 4FIEA 5IQAA 1SMHA 4FMQA 3W0SA 2DYLA 4F64A 4OTDA 1WAKA 5J9LA 4U0IA 4FKTA 2C0OA 3SHEA 4JQ8A 4BC6A 3MVLA 4EOLA 4ANVA 4EQUA 4WBOA 3NMUF 3TZ8A 2RG6A 2HZ4A 2J4ZA 1K3AA 3QHRA 3D83A 4UY9A 4O21A 5DNRA 4JQ7A 5DWRA 5T6KA 3ORTA 2VD5A 4H1JA 4Y72A 5EHOA 2XF0A 1J1CA 4G11A 2ESMA 4WD5A 4RLKA 5BQ0A 4FYOA 5F94A 4IC8A 3FPMA 2YJRA 3CE3A 3IOKA 3V6SA 3MB7A 5DPVA 4Z16A 2CNVA 4LRJA 4BI2A 3A7IA 4PTGA 3TT0A 2ZYBA 5A6NA 2YN8A 3U87A 5C9CA 3S1HA 3QTIA 4TN6A 1YXUA 1PF8A 3OROA 4TYGA 3ZSGA 4EKKA 3LLTA 3DBFA 5I9WA 1XMLA 5E8ZA 3Q9ZA 2PVLA 4YJVA 2OJJA 4FSMA 4FV7A 4KUJA 1OECA 3BQCA 5AIKA 4TNBA 1FVVA 3C5UA 4RSSA 2R3RA 2YM7A 4I3ZA 3RK5A 5KCVA 4QDEA 3IGGA 4FVQA 5DN3A 3IONA 1W0XC 4KKHA 1ZY5A 2WHBA 3HVCA 4QNAA 3R04A 1OM1A 2GTNA 3PXYA 4N6YA 3OEFX 3DPDA 2HOGA 3KGAA 4QP8A 4AW1A 4RA5A 3FLYA 4EK5A 2FSLX 4IFCA 4EZLA 2BZKB 4O7RA 5LCJA 4JDKA 1G8SA 1ZYLA 2F9GA 2AEGA 2X7FA 5H8BA 2WIPA 4LOOA 3KRXA 2QKRA 2YCSA 4FX3A 2B9FA 3S00A 4L1BA 4R6VA 2JKKA 3MGYA 4DT9A 2R4BA 3H0ZA 3HRFA 4II5A 3MVHA 4EH6A 1MP8A 4P5ZA 4CTBA 5F1ZA 1Q41A 2YA9A 3IKAA 4EHZA 4D28A 2ITTA 5JQ5A 5FM3A 5HD7A 1IA9A 1XH6A 4OT5A 4U41A 5D7VA 3R8PA 2G1TA 3G9LX 5ANLA 3HV5A 1JWHA 3UMWA 3ZO3A 3WIGA 3FV8A 2GFSA 4GK2A 1KE9A 5G6VA 1CKPA 2XIZA 4EOKA 5A6OA 3KIOC 1YHWA 1PXLA 2GPHA 4BHZA 3D15A 4D2SA 3PSBA 2BR1A 2B9JA 3R63A 4LOQA 5ACBC 5CAVA 3VRYA 1WBWA 1R0PA 3EN5A 3QQGA 2OK1A 3OUKA 4Y8DA 4XG9A 3ETAA 3MFUA 3K3IA 1K2PA 4WRSA 3ZFYA 4EQMA 2UZBA 3JPVA 5CVHA 5JT2A 5IA3A 5M4UA 3PLSA 4NT4A 2OFUA 4YSMA 4U45A 4JNWA 2X4ZA 3QD4A 3N51A 4DAWA 5H3QA 4UWBA 3F2RA 4RZVA 1YHVA 5AIRA 5ETCA 4DH1A 4BIDA 4GIHA 3R7OA 1M2PA 2WXRA 4IAYA 4AACA 3FQHA 3NNUA 2I0HA 1E1VA 2WXQA 1VZOA 2BKZA 3OOMA 2UZVA 4TZRA 1IRKA 3CQUA 2JAMA 2VTTA 4F6UA 4FG7A 3UP7A 3L1SA 5JGBA 2A0CX 3GCVA 4BY9E 4FTOA 5EW8A 3V5LA 3SGCA 3TV4A 3DBQA 3I6UA 3EH9A 4FEVA 3QHWA 4I0TA 2J0JA 4IDTA 3CXWA 4PMSA 1W82A 5KZIA 5LMKA 4XV1A 1JPAA 2XKDA 4PF4A 2R3FA 4O38A 3QQJA 4JAIA 1TFFA 3VW8A 1H00A 4FICA 3E3BX 4O7NA 4PMMA 4LL0A 3BYMA 2ONLA 3MFSA 4ZTNA 1LPUA 3M42A 3ZTXA 4LUDA 3EQDA 3P5JC 3O71A 2UW3A 3TG1A 5DH3A 4G9RA 2W1EA 4DN5A 4BDFA 5E8SA 4KA3A 3W8QA 3PJ3A 3C4ZA 2VX3A 2XEZA 4QOXA 3R7VA 2QU6A 5E8XA 4QYYA 4KS8A 5HEZA 3HLLA 1Q8TA 1OL7A 3LLAA 4YC8A 4YHJA 5JEBA 3F6XA 5JH6A 2VO7A 5IUHA 2W9FB 2X0GA 5FD2A 1RQQA 3ZLYA 3EN4A 3UJGA 2IVTA 3TJCA 3TV6A 2HK5A 3K3JA 2GHGA 5BNJA 3EZRA 1M7NA 2X2LA 3SA0A 5FLFA 1R39A 4M15A 3NPCA 4AOFA 4YP8A 5HO7A 5AP2A 4AS0A 3Q9XA 2OFVA 4IWOA 1OGUA 2QOLA 3BLHA 5DBXA 4QMXA 1PKDA 5AWMA 2YIRA 3W16A 5FDPA 4EORA 4O0YA 5IA5A 3TDVA 3U6JA 1VLRA 3OEZA 3UO4A 2GS6A 2XK4A 2HWPA 4IAIA 4ZXTA 1Z57A 5EI2A 3FMLA 5CAOA 2XARA 3FWQA 1G8KA 3PY0A 3RI1A 3DAEA 5AP4A 4UBAA 4HYSA 4GU6A 5FUTA 4O0WA 3RAWA 2JDSA 3PVGA 3G2FA 3SAYA 3EYHA 3QQLA 1WFCA 2WGJA 3B8RA 1P2AA 2B9IA 3H30A 3OTUA 3P5KA 2GQSA 3F3WA 5DE2A 5EW3A 3VN9A 2WXOA 5KX8A 3MS9A 5AP3A 4X3FB 3QBNA 2YM8A 2IPXA 4RRVA 3CQEA 4O7VA 2F4JA 3L9NA 4BCOA 1M7QA 4YJRA 2BMCA 5HBEA 4CKIA 3ZMMA 2VUWA 4A4OA 4YNOA 3TIYA 3LOKA 5HE1A 2YIQA 3GI3A 5E4HA 2YISA 3GBZA 4I92A 5FXSA 2ZM4A 5KMNA 2PE2A 4R78A 3Q9YA 4YLKA 3LCDA 4UZHA 4AQCA 2YJSA 4RQKA 1KE8A 4D5KA 3ERKA 2LAVA 4F65A 3H10A 2XUUA 4X2GA 4GRBA 5CVFA 5CI7A 2WXMA 4PWNA 3PUPA 3ZEWA 3C5IA 4FSQA 2B9HA 3PRIA 3NZ0A 4ZZOA 2ITOA 2O0UA 3WYYA 2BHEA 4AG8A 4ARKA 4A06A 4BGGA 1PMEA 1VYZA 3P4KA 4LMUA 5HIDA 5LQFA 3K5UA 4D4VA 4QO9A 5E8YA 4E4NA 1W84A 3ANRA 4ITIA 4DEIA 3VBYA 5JZJA 1XBAA 1MQ4A 3QQHA 4UWYA 4FSWA 3ZSHA 5L3AA 4OBPA 2IVUA 3L8SA 5D10A 3ENEA 3E7OA 3QUEA 4M68A 3B2TA 5EM5A 1YQJA 3WI6A 1DAWA 2GNHA 2XYUA 4AXFA 5CEOA 3VW6A 4GU9A 4XX9A 3LMIA 2EB2A 3V5QA 3DS6A 4BCIA 2JDOA 5CT7A 2CCHA 3NUNA 4Z7GA 3MFRA 4IAKA 5DOSA 3VF9A 3WF7A 4GYIA 3V6RA 3M2WA 2C6LA 3SG9A 3IG7A 1WVXA 5J87A 2WQEA 2ZM3A 1R3CA 3GGFA 4LMNA 3SRVA 4ASXA 1Z9XA 2OF2A 1O6KA 4NIFB 4LV7A 1H1SA 1SZMA 3FYJX 3ACKA 3GU4A 4YURA 4IB3A 3H9RA 5CEKA 3HRCA 4AZEA 4HGEA 3H0YA 2O5KA 3E64A 4L67A 3FSFA 5CEQA 5AV0A 4EEVA 4EL9A 4E26A 3TZMA 2HY81 3QTXA 4D4SA 4X2KA 1APME 3ODZX 2PUIA 1BL6A 4IJ9A 4M7IA 4XNEA 5AM6A 3DJ5A 5C4LA 2VO0A 2RFNA 4GT4A 4EZJA 4G6LA 4ZSEA 5KKRC 2X8IA 3D0EA 3ZONA 2A5UA 4V04A 4ANMA 3CQWA 3PLAE 2XS0A 3O51A 2CHXA 4WG5A 5CSXA 4F7SA 3K54A 3KEXA 4YGAA 5FEQA 2XJ1A 4BIEA 2W06A 5A14A 1NVSA 3R8LA 1QPJA 2VWUA 3L8XA 3MW1A 4GKHA 3AD5A 4JG8A 5LWNA 3HZTA 3MVMA 5T8IA 2GSFA 3LFSA 1H4LA 5L6OA 2YM3A 3AMBA 5EM8A 1UKIA 3E8NA 4EOSA 2B0QA 4I6QA 3R8UA 3UVQA 3CP9A 1UWJA 4G34A 3LIJA 5FP6A 5EYKA 3O23A 4YR8A 3KCKA 3Q5IA 5LARA 4HGSA 3WF6A 3S4QA 4CT2A 4U3YA 3F66A 1X8BA 4LUEA 2YACA 3LZBA 4R1YA 2W4KA 5CY3A 1PXMA 1W83A 4WOVA 4C61A 3QUDA 3N4UA 1FMKA 4DTKA 5BVNA 3P7CA 2QCSA 1Q8WA 2O65A 2R3QA 1URCA 4FTUA 5CU4A 3JXWA 3W2RA 4DGGA 2XK8A 5HNIX 1UKHA 4UV0A 4W8DA 5IEXA 2ITNA 4FC0A 4RX8A 5AM7A 4PP9A 5F9EA 2BAJA 3R0TA 4L43A 4AGWA 4MYGA 3E5AA 4FTQA 4YJTA 1IAJA 4YBJA 1YI3A 4BN1A 4DH5A 3BU5A 3IS5A 3UYTA 4EZ7A 3SXSA 4AGCA 5G2NA 4AN2A 4IB1A 4NKSA 4GH2A 4L23A 2P3GX 2RFEA 4I93A 3TTIA 4XH6A 3G90X 5ETFA 4E1ZA 3ZEPA 4YZ9A 3UC4A 1Q8ZA 2W96B 2I7QA 3OP5A 4F0GA 5LVNA 5ITAA 5BVWA 4TYIA 4FKJA 4GK4A 4G5PA 5CTPA 4UX9A 4K1BA 4QYGA 1TVOA 3BV3A 2RGPA 2R3HA 3NUPA 4FKPA 3RZBA 1KE5A 4D9UA 4FKIA 1Y91A 3GFWA 4MK0A 3TNPC 1YDTE 1I44A 3UDBA 1ZRZA 1FPUA 2ITUA 3OW3A 5D1JA 5AP6A 3RJCA 4NU1A 4ZSLA 3UG1A 5CZIA 3BGZA 4AX8A 1M52A 3OAWA 3IW6A 2YERA 3AGMA 3CPCA 5CF4A 3MFTA 2NNWB 3ZVVA 2E9VA 3NW6A 3VS0A 3ACJA 3FY0A 2CCIA 3NUXA 3PG1A 5CF6A 3VJNA 3O8PA 3QAQA 4R3PA 1UU3A 1ZAOA 2C47A 5AP1A 3ZRKA 3ALOA 2XIRA 2G01A 2WTDA 4HZSA 4M69B 3PIZA 1U4DA 4YC3A 3KY2A 3RAIA 2YIXA 4YNEA 5K4IA 4CMTA 1B39A 3IO7A 5KMIA 3WZDA 3FMNA 4J52A 3AC2A 2C5NA 2J5FA 3Q5ZA 3R22A 2UW0A 2WKMA 2HELA 2W0JA 3TZ7A 4MD8E 5CZHA 3V51A 4EQCA 3BYVA 3R2BA 4KD1A 2QODA 4EOPA 4JIAA 5E1SA 2GS2A 3W0MA 1P14A 3BGPA 2R3IA 4ZJJA 4Z9LA 2J9MA 2X8DA 3MH2A 4J7BA 4QQ5A 4XBRA 3HDNA 3COHA 3DQWA 4BVUA 4O6LA 4C3RA 3NFGB 3OCGA 5HBJA 3MESA 4QTBA 1PXKA 1XO2B 2CGVA 2OXDA 2WQOA 2WU7A 3B2WA 3C51A 3Q4ZA 4HGTA 3HUCA 4UEUA 4ZZMA 4NW5A 4E4XA 3EOCA 2VX0A 4O6EA 4QPSA 4USEA 1U59A 3MTLA 3A7HA 1A48A 5M4FA 1G5SA 3DNDA 3ORPA 3KF4A 4MXCA 4ALWA 3VQHA 4GG7A 1JKSA 3QTZA 5L8LA 5EKOA 2ZDTA 2WXGA 2VTOA 1XBBA 2X8EA 4G1WA 4BDEA 2PZPA 4MD7E 4ZSGA 4FZ6A 2F49A 3GCSA 3TWJA 4M14A 1IG1A 2AC5A 2V7AA 5JMSA 1SYKA 2P2IA 3MPAA 3R6XA 2P33A 3DK7A 4YLLA 1J7UA 3DA6A 2PVJA 3KA0A 4AGUA 3KXZA 3W8LA 2JC6A 4DCAA 5M06A 4TYHA 4G6OA 3W10A 2ACXA 2FB8A 3HX4A 1ZYDA 3UVRA 5AP0A 3VAPA 2W1FA 4EHGA 3LCTA 5IZFA 3GP0A 2HXLA 2UUEA 1Q99A 4QMLA 5CU3A 3QQFA 2WMAA 4NH1A 4QMMA 4Y83A 3ORLA 2XK6A 3PDTA 3APFA 3IBEA 4IAFA 4LM5A 4NUSA 3ZRLA 2GTMA 1QCFA 4E4MA 3P23A 2EUFB 4AA0A 3HIZA 1F3MC 2JDRA 4DEBA 4QTAA 2BROA 1BX6A 3ML8A 3D5VA 3EQRA 3R00A 3PP0A 4CNHA 3HV3A 4OYSA 3UGCA 2XAOA 4YHFA 3LJ3A 3HYHA 3W0QA 3C4WA 1OPLA 1PXJA 2Y4IB 5JRQA 4PV0A 1H1WA 4LGHA 4BTKA 4EK4A 3G0FA 2WXVA 4WA9A 4L7FA 4MD9E 2CN8A 5HQ0A 3CS9A 4GCJA 4C4EA 3FC2A 4IX5A 4E6QA 4Y46A 5A9UA 2OIQA 2XMYA 4D1SA 2BTSA 5CNOA 4NCTA 4A7CA 4BI1A 2B55A 4GMYA 5AJQA 4ITHA 4I21A 3HV7A 3IQ7A 2O2UA 3LMGA 1PXIA 4JX7A 4MWHA 4EZ5A 5HNBA 2C3JA 2GFCA 3RPVA 4DDGA 4PL3A 4OTWA 3HAMA 5AFVA 3FMJA 5J1VA 4FKUA 4BDJA 4C7TA 4LFIA 4XJ0A 3FXZA 3QQUA 1SNXA 3QLGA 5E1EA 3H4JA 3M11A 4A9SA 4EOJA 4R5YA 4B8LA 4IVDA 2WD1A 3PVWA 2Z7RA 3OT8A 1UWHA 3S0OA 3TL8A 4TRLA 4RC4A 5TOZA 3R9DA 4OVVA 2QOFA 4FTKA 4HGLA 3MIAA 3FLWA 2CPKE 4NM5A 4OVUA 3OOGA 4MUQA 4ZJIA 4JJRA 5IQHA 4XP2A 3OVVA 3HP5A 4FV3A 4V0GA 3GQIA 4EJ7A 4IAAA 4MCVA 4ONAA 3R1NA 3EB0A 3I5ZA 4CLIA 3GVUA 4E6AA 4FKWA 1H28A 4GVJA 4EH7A 4O0TA 3L9PA 3PXZA 2V22A 1NXKA 1Q97A 3F5UA 4HYHA 2VRXA 2I40A 4U40A 2WMRA 1OKYA 4Y5QA 4O7SA 4EH2A 2Y0AA 1OKZA 2VO6A 1H25A 3OWKA 4RWIA 1WVYA 3W2SA 1OITA 3ZS5A 3QTQA 1LEWA 3SXRA 4FVRA 4ACCA 4ZTHA 3BHVA 5DG5A 5EYMA 3MI9A 1Q62A 2EB3A 1TQIA 4KAOA 4ZLOA 4CFXA 3FKOA 4LRMA 1DAYA 5DT0A 2B53A 1XH7A 1ZARA 2PY3A 3LHJA 4IWQA 5I0BA 5CF8A 1OZ1A 2X39A 4F7NA 2AUHA 3NYNA 4XMOA 3SOAA 2G9XA 3SKCA 3O50A 5GIPE 4KKGA 3AC8A 3UZRA 3TUBA 4RJ3A 1XH8A 5DRBA 4G3FA 5AUTA 1H24A 1T46A 3MJWA 3GU5A 4WIHA 2E9OA 3EQHA 4CT1A 4YUQA 4CVAA 2UZLA 2V0DA 2XK9A 3LQ3A 3HHMA 4JXFA 3T3VA 3ZC5A 3SG8A 4YJSA 2B52A 1RE8A 2QO2A 4QMZA 3RM6A 5D12A 4L52A 1URWA 2UVXA 3RMFA 4IM2A 5HX8A 4JAJA 1JSTA 4NWMA 3FXXA 3G33A 3S95A 2JFMA 4XP0A 3T9IA 4WNMA 3ZBFA 3AKKA 3P2BA 3CCNA 3GC0A 4FBXA 2XM8A 4IM0A 4L42A 4DFBA 2BUJA 4E20A 1PW2A 2C6MA 3UQFA 2Z7QA 4BCGA 1VJYA 3A8WA 3AT2A 3IK3A 3TTJA 1DI9A 2XP2A 1VR2A 4C37A 4FSYA 5I9XA 3BLAA 3I60A 3DGKA 4F08A 3L13A 1OIUA 2EVAA 4FT7A 5B2LA 5LVPA 5HTCA 3C4EA 1W98A 3G0EA 2WXJA 4HCVA 4HJOA 4RIWB 1HE8A 1MQBA 4DF3A 3TUDA 3Q32A 3MTFA 1V0PA 4NFMA 4G6NA 4U3ZA 4FGRA 3BGQA 3SQQA 4BCNA 4WWOA 3COIA 4LDTA 3D5UA 2BFYA 2W99B 4TT7A 4E5WA 5A4EA 4AXEA 4C34A 4ZZNA 3QX2A 1V0OA 3UG2A 4APCA 1YXSA 5FRIA 4U9AA 3TNIA 3OCSA 5JHBA 2XNNA 2WO6A 4WUAA 5JQ8A 4O2ZA 4I6BA 4JT3A 1KE6A 4L00A 3V04A 4DH3A 2R64A 3ZO2A 4HVDA 4Z3VA 5CALA 4O7WA 3ML9A 5E8UA 3LCKA 2YDIA 4TPTA 4O81A 4EOQA 3UOJA 3QRJA 2WELA 5GJDA 1OUYA 5LCKA 3FUPA 4UWLA 2YITA 1ZOGA 2J6MA 1R1WA 2PWLA 3COKA 5GIOE 4XX5A 2UZDA 4TNDA 4FSRA 1XH5A 4MNEA 4JR7A 3EKNA 5M55A 5IMEA 2VTNA 3HMIA 3ORIA 5AUWA 4BTJA 4C4GA 3NUUA 3PJ2A 1XJDA 4NJ3A 4U81A 3EQPA 3ZZWA 4ZSAA 3P86A 4JRVA 3MN3A 3PREA 4PH4B 2VWYA 2XK7A 2XNPA 5IQEA 2H6DA 1L3RE 2X38A 1KWPA 2XEYA 4ANSA 3R8ZA 2PK9A 3VO3A 3CJGA 4QDVA 4AOJA 3L9MA 3PA4A 3HL7A 2QOHA 2W1IA 4WG3A 4EOIA 3ET7A 1YWVA 3RGFA 2ZB1A 4QP3A 3I1AA 4IIRA 5CEPA 3I0OA 3PXKA 4UWGA 2CLQA 2QQ7A 4FTLA 4EBWA 5DFPA 2WXNA 3DJ6A 4EJNA 1WBTA 1IA8A 2P0CA 3CC6A 2C5OA 2VTPA 3MPMA 3KU2A 3PPJA 3QK0A 3SX9A 5BVDA 4R1VA 2WXLA 3PP1A 4YU2A 1H01A 5ANKA 2HY0A 3R73A 4CRSA 4DHIB 3QJZA 2R2PA 1KOBA 3ML1A 4AW0A 4TV3A 1KUTA 2Y4PA 4FV8A 3BLRA 5DVRA 3MJ1A 3C50A 2V62A 5JFWA 2HIWA 2W1DA 5BMMA 5CI6A 1FVTA 4JX3A 4B4LA 5JSMA 3RNYA 1YXTA 5GNKA 1CSNA 3W0RA 4HPUE 3TNHA 2LGCA 3ENHA 5EM7A 1OL6A 4FHKA 3ZUVA 3KFAA 4Y5HA 4FT0A 2YABA 1UNLA 3NAYA 3EQBA 2XCKA 3FMHA 4DH8A 5M44A 1FOTA 2KULA 3NNWA 3OG7A 3UOLA 1OPKA 4OTQA 4ANXA 4TYEA 4DGOA 1CDKA 2JKOA 4ZSJA 2OWBA 3C13A 5EHLA 4CMUA 4RGJA 4DHZA 1PYXA 2BAQA 2QOCA 2UZNA 2YZAA 4P5QA 2AYPA 3VC4A 4EOOA 4ITJA 2G2HA 3FZ1A 2ETRA 3OBJA 2B1PA 4GSBA 3DPKA 2ZV9A 2R9SA 3MBLA 3THBA 4TL0A 1PMNA 2RF9A 4QYEA 1H0VA 3VS6A 3TUCA 3JR1A 2C30A 3R7QA 2XB7A 1V0BA 4I5HA 4IX6A 3NVKI 3SOCA 2HCKA 1H1RA 4DFYA 1GZNA 4QTEA 4L01A 4GFGA 4I4FA 3TN8A 4QMPA 4IB0A 4ZY5A 2EXCX 4BB4A 5AX3A 3G6GA 5J95A 2RKUA 4JBVA 4MAOA 3BX5A 1GIIA 3BHYA 3R9HA 3VHEA 3TDWA 4ZP5A 5HCYA 2JIVA 2BCJA 4PS3A 1UU8A 2BRGA 3QUPA 3O0GA 3UO6A 3JVSA 3HEGA 4AAYA 5HLWA 5IISA 3KRJA 4CRLA 2QG5A 3A62A 4CEGA 4QP9A 3OY1A 1E7VA 4BDDA 4DDIA 2OI4X 3C1XA 3DU8A 4PMTA 5HD4A 3RM7A 5I9ZA 2ITWA 4JDIA 3CY3A 4IVBA 3F2NA 3QU0A 5T68A 5C4KA 4RIWA 3S2AA 4IZAA 1V1KA 3KULA 4QQTA 4L44A 4BIBA 2BZJA 3R01A 1DM2A 2FA2A 4O7YA 4OUCA 3W18A 3UO5A 4J8NA 3O7LB 3VNTA 3NUYA 4AJWA 1F5QA 2ZV2A 3CR0A 4JDHA 4QMSA 4S2ZA 3ZDUA 4EHVA 4QRCA 5D7AA 4S30A 5AMNA 3GU6A 5CQWA 3SRVB 4CXAA 2WQNA 4FIHA 4KKEA 5FBNC 4JS8A 4MXXA 5DEYA 5HTBA 3DFCB 4MBJA 4RVMA 4YZBA 3LFCA 2UZUE 2VZ6A 3VHKA 5EI6A 3BIZA 4YZNA 3RHKA 4HPTE 5CAQA 3BZ3A 2DQ7X 3EFLA 4LYNA 4FKQA 3V3VA 4CZTA 4R5SA 4AZVA 2WTVA 5HGIA 4FI1A 5KBRA 4GL9A 5T3QA 4QNYA 3GU8A 2GCDA 3DKGA 4FEWA 2GNFA 4K18A 3DBCA 4ASDA 3ZZEA 4KIQA 4CG9A 1YDRE 3ZFXA 2ZV8A 4JBPA 2C3KA 4U7ZA 1XH9A 4UYNA 4LGGA 3PJ8A 5KNJA 2A4ZA 1FQ1B 2PZIA 3LM5A 3VONA 4J71A 5FDXA 4NJDA 2CKOA 3FKNA 3FMKA 4DTAA 2Z8CA 5C27A 4HNIA 4OW8A 4UZDA 4CFWA 1AD5A 3CJFA 3FI4A 4ZY4A 3D4QA 5CXZA 1FGIA 3CKWA 4B8MA 2DWBA 2OG8A 1S9IA 2C6OA 5HCZA 1LUFA 4PTCA 4PNKA 1J7LA 2OIDA 3WE4A 1BYGA 4BYIA 3N9XA 5BV3A 2JKMA 1YI6A 4EC9A 2CKEA 4RC2A 1NVQA 1GOLA 4N0SA 3ULZA 3R7RA 4M67A 4FKGA 4H36A 1LEZA 5K4JA 2WQBA 1Q24A 2BZHB 2YHVA 3JVRA 3JY9A 4ANLA 3OCTA 4X21A 3KB7A 4J98A 4TY1A 3NUSA 2RD0A 2C1AA 4QMTA 2ITQA 2BDFA 3IECA 3GQLA 4D58A 5DR9A 4JR3A 1Q61A 2XVDA 4FTIA 2ZMCA 4L8MA 3AGLA 4D2RA 5IEYA 5AUZA 4QPAA 4RQVA 4ZK5A 2VGOA 3MA6A 5HCXA 3MY5A 5M4CA 2PZ5A 1BMKA 3ZM4A 4KSQA 4Y95A 3PE2A 3LFQA 1H1PA 5EW9A 4C0TA 2WTIA 1CKIA 3KMWA 4FEQA 2A2AA 5LVMA 4AXAA 5EK7A 1UNGA 1B38A 5J8IA 2WMSA 2OJ9A 2X9FA 4FV5A 5DLSA 5A4LA 3AD6A 4M12A 1JBPE 3EQFA 4RJ5A 2JDVA 4C3PA 3E87A 1R0EA 5HG5A 5BVEA 1FGKA 2XBJA 4WO5A 4E6DA 2Y7JA 5C01A 1BI8A 2F2UA 2GQRA 3FLSA 2CKQA 2OJGA 4ERKA 4X6RA 3JY0A 3IW8A 2J90A 4X2JA 1IAHA 3QC4A 4G17A 4ASZA 4E8AA 1ZMWA 5IF1A 4F9WA 4DEGA 3R83A 4A9RA 4FE2A 5K5NA 4F6SA 5J7HA 3NFFB 5K3YA 3UMXA 4MNFA 4JLCA 2HZIA 3QYZA 2ERZE 3O5AA 2OSCA 4J97A 4FNXA 3IDCA 3PXFA 4QP4A 4C2VA 5HE0A 2PU8A 2QOKA 4O86A 3ALNA 3UDTA 5ICPA 3VUIA 4FKVA 4G9CA 5HHWA 5CEMA 4O96A 3NAXA 5DI1A 2YCRA 2YAKA 3QKMA 4PDSA 4I5PA 5BYLA 4LV5A 5AA8A 1QL6A 2PUPA 1CMKE 1U54A 3OFMA 3W33A 4G2FA 2Z7SA 3BHUA 1UV5A 5JGAA 2B4SB 3QC9A 3BQRA 4HLEA 2VTJA 5DRDA 3RAHA 4FKSA 4FEXA 3GB2A 3KQ7A 3KRWA 5KBQA 1CKJA 4O83A 5EOBA 3AKLA 4ANWA 3GENA 4NFNA 5EDRA 4FNYA 3W0NA 4G31A 1QPCA 3BU3A 4H3BA 3G51A 4FT5A 5ANOA 4V01A 4QP2A 2WTKC 4BDGA 4H58A 4F1TA 4FULA 1REJA 1H1QA 4QMUA 5I9YA 1O6YA 1Y8YA 1NA7A 1GIJA 4O0XA 4RJ7A 3IW7A 2JFLA 4GW8A 4JRNA 2OIBA 3BI6A 4MVFA 4EC8A 4U80A 4APPA 4B0GA 3S2PA 2ZMDA 2QHMA 4ANUA 1YW2A 3P7BA 4ALUA 5BX0A 1CJAA 2OKRA 3RPSA 4JI9A 4MWIA 5JHAA 4NK9A 4D9TA 4J6IA 1OPJA 4FK6A 4PS7A 3ATSA 4N57A 1H26A 3BHHA 1YOMA 3DQXA 3Q6WA 2CHWA 1YKRA 2WOUA 3MB6A 5KE0A 3ZC6A 3A61A 1UVRA 3LCSA 5AV2A 4O0RA 4HCTA 2XNGA 2PVHA 3KXXA 3QGYA 1E8WA 3QCQA 1OKWA 1ZMVA 1PY5A 3NYOA 1JKLA 4PDOA 4YO6A 2GNLA 3QGWA 3PTGA 5CSHA 3RWPA 4YJQA 4OBOA 4TYHB 1AQ1A 2WMUA 4WSYA 1KV1A 2NO3A 3E92A 5M4IA 3EKKA 2R3MA 4FV1A 3CGOA 4KBCA 3DBEA 4W4XA 4XG8A 4F1MA 5FTGA 1JOWB 3BELA 2VWIA 3C9WA 4BDKA 3WBLA 2X6JA 4BDCA 1Q8UA 4IHPA 4FA6A 1PHKA 3RNIA 5LWMA 1YOJA 3MSSA 4IZ5A 4RIYA 4HVHA 4IE9A 3LW0A 4RVKA 4I94A 3A7FA 3COMA 1YHSA 5AADA 3FXWA 5DT3A 1E8ZA 5HIEA 2WIHA 3F82A 3FMEA 3G5DA 4H3PA 3V5WA 4D4RA 5LMKC 4O2PA 4PL5A 4DH7A 3NWWA 4TYJA 5A54A 5AV4A 5FP5A 3RKBA 5A46A 5C1QB 3FLZA 2YIWA 3NEWA 3FLQA 2WNTA 4F9AA 3SW7A 2FVDA 2PVRA 2PE0A 4AQKA 4URKA 2X2MA 3FY2A 3BE2A 2YFXA 4DC2A 3ZHPC 4FL2A 4ZMEA 3I7CA 3I5NA 4XYFA 3NLBA 4ZTLA 4D0WA 4OGRA 3UC3A 1ZY4A 2QO9A 2W5BA 3F69A 2YWPA 4E73A 4IBMA 4EZKA 3ZCLA 3ATTA 2QO7A 3T9TA 2A27A 2RG5A 4ZMFA 3CTJA 3UNJA 3VS7A 1E7UA 3TNQB 3D14A 3V5PA 4C4FA 2R0IA 4HNFA 2BHHA 3KXGA 3QTRA 3DDQA 2JEDA 4F9CA 4JOAA 5ANEA 1FBNA 5IH4A 1XMMA 3B8QA 1RJBA 2QLUA 3Q4UA 1M2RA 4FL1A 2B54A 3LJ1A 4IACA 4R77A 4XRLA 5IA0A 3V8WA 1XKKA 4CMOA 4JQEA 3CSVA 2VTIA 2C3IB 4P7EA 5HI2A 4N6ZA 5AUUA 1M2QA 3L8PA 4KINA 5FXQA 4QMWA 3WZEA 2Y3AA 4NM0A 3KK9A 3RPYA 5HESA 4USDA 4V0GB 4KS7A 4BDBA 5M09A 5AV3A 3KKVA 2IJMA 5BYYA 2HW7A 4XBUA 2HENA 3QKKA 4OLIA 4WG4A 3OCBA 5CU6A 4I1ZA 5ETIA 3DAJA 3D7TA 4PQNA 3UIUA 3R21A 2GNJA 3UP2A 2C0IA 4CFNA 4A4XA 2YEXA 2HAKA 2QURA 3F2AA 3P79A 5BUIA 3BHTA 1WBNA 4AP7A 3Q2JA 4CQEA 4JBOA 1LR4A 2NPQA 1PXNA 1IR3A 1OIQA 2X7GA 3G6HA 3OMVA 4UB7A 4U97A 3UE4A 4DGNA 5J1WA 4ACGA 3PXQA 5HX6A 2Z02A 2QOOA 5KZ0A 3T8OA 4DFLA 3O7LD 2EWAA 1QPDA 5HG8A 3RK7A 2W1CA 2XJ2A 3UIXA 2I0YA 3L54A 2IVVA 2WMBA 4FKLA 1YVJA 4DCEA 4XOYA 3NW5A 2VTSA 4XV9A 5CNNA 5ANJA 1G8JA 3TI1A 4IFGA 4DHFA 4FV0A 4MEDA 1XR1A 4IX4A 4BFRA 1OI9A 4CD0A 3QQKA 3BEGA 3BBWA 3R7EA 4RPVA 4BCQA 2RL5A 2IW8A 3AT4A 4HCUA 3SD5A 1LP4A 3F9NA 4GV1A 3Q4TA 4PY1A 4A4LA 4EK6A 2OW3A 3I7BA 3RWQA 4C62A 2IVSA 4H3QA 5GHVA 4ZS0A 2VTLA 2RIOA 2PZRA 2P4IA 3ORNA 3W2OA 4KZCA 3QWKA 4N70A 3U4UA 3UYSA 4DBNA 4UXLA 2VNWA 5FTQA 2PVMA 4FSNA 2ETMA 3VBTA 3TXOA 3AC5A 2W4JA 3A7JA 4AZFA 3TKUA 3WZJA 2X6EA 4FHJA 4MH7A 4AF3A 3GOPA 2XNBA 3QTSA 3EFKA 4L3JA 2O3PA 4WUNA 5CU2A 3U55A 1OL1A 5AV1A 2XRWA 4BR3A 3L8VA 3OBGA 3NIEA 4FSZA 4AN9A 4YO4A 4YTIA 3FI8A 4CFUA 5I5ZA 4FGBA 5E8WA 3R9RA 1A06A 2JGZA 3CD3A 4KSPA 4GUBA 3EN9A 3PRFA 4FUXA 4K0YA 4YZCA 4WWPA 4NTTA 5CASA 4PX6A 3EN7A 5IPJA 2O63A 4ZS4A 5IDPA 1ZLTA 4CGAA 1Y8GA 3GNIB 1E9HA 1U5RA 2BVAA 2NRUA 1J91A 3IDBA 4L45A 3FPQA 4ZJVA 2WU6A 2CHZA 5FTOA 1OBGA 4XV2A 4D0XA 4CTCA 3FBVA 4E6CA 4XG4A 2JD5A 5HG7A 3R7IA 4B7TA 4UWKA 3W55A 1SVEA 3ULIA 3QRIA 5EKNA 4MNEB 5E90A 3NRMA 3DTWA 2ITYA 3NCGA 3I6WA 5CX9A 2C1BA 3R1QA 4MKCA 3GEQA 4L53A 3OTVA 3LQ5A 4YJOA 4BBEA 4BF2A 2XNOA 3E8EA 3EQCA 3AC3A 5L2WA 3PRZA 5BUJA 2BDJA 2WXIA 5IUIA 4B6LA 4Q2AA 4AGDA 3EL7A 4S33A 4B9DA 2REIA 4UALA 2OICA 3W0PA 1OUKA 3QCSA 2QG7A 1ZZLA 2VU3A 3G15A 3Q04A 5IQCA 3BWJA 5M53A 3UPZA 5IH6A 3R7UA 4QMYA 4OT6A 4N4SA 4GEOA 4O0UA 1WBSA 3PZHA 3QRKA 3R28A 4WNOA 3WYXA 4U44A 4CV9A 5KHXA 2ERKA 4CFVA 4BYJA 4AZSA 3D5XA 3I0QA 3ZOSA 3E93A 3FE3A 4K8AA 2I6LA 3KVWA 3OUNB 1P4FA 3BPRA 4ZTSA 4JMQA 3VBQA 4KIPA 4YTCA 2BTRA 2PYWA 4I22A 4KRDA 1KOAA 3QFVA 4PL4A 4KZ0A 4TXCA 3UVPA 4BCHA 1BL7A 3WE8A 3NGAA 3W2CA 5E8TA 3FDNA 3FZRA 5AUYA 5AAGA 4Z7HA 3LXPA 1ZXEA 4ACDA 4C38A 5CXHA 4YJUA 3LVPA 5A4TA 5DYJA 2OJFE 1ZMUA 2V7OA 2W7XA 3TM0A 3GT8A 1PJKA 2QI8A 4FTNA 1YXXA 5CYIA 3TV7A 3EQGA 3NYXA 3FL4A 4D1XA 5FEEA 2CKPA 3UNZA 4EKLA 2ZJWA 2HW6A 3QYWA 3ZLXA 2PVYA 4IDVA 2CSNA 1VYWA 3RALA 4YLJA 3AD4A 3PWYA 5GJGA 4AFEA 4DEHA 3NSZA 3CKXA 4JIKA 5AEPA 2YM5A 4QTDA 2J0LA 3A8XA 2R3GA 3DNEA 4G3CA 4X3FC 4U79A 5CVGA 2WTCA 2J2IB 5M57A 5CANA 2YAAA 4G3GA 2PVFA 4XRJA 4PNIA 2FSTX 5BPYA 3LFFA 2WZJA 4AE6A 3PWDA 4RA4A 4F6WA 3O2MA 4RC3A 2AC3A 3I79A 1JVPP 4GG5A 4YPSA 5KMKA 5A4CA 5F95A 1JAMA 1E8XA 2WPAA 4EYJA 3GC9A 3IGOA 2JDTA 5LJJA 3FHIA 4EZ3A 3NZSA 3DKOA 3QALE 4FTMA 1YOLA 4R7IA 4YPDA 2ZV7A 3QD3A 4C4JA 1ZYCA 2OJIA 2XM9A 2WB8A 4XE0A 4O0VA 5ANIA 4F9YA 1P4OA 2E9NA 1Q3DA 5TF9A 4AW2A 5L6PA 2QR7A 3F5GA 3UBDA 4BTMA 4BICA 4EHEA 3VUDA 2BRMA 3TEIA 3GFEA 3BBTB 3FL5A 3SD0A 3EMGA 4HW7A 5DHJA 2VTQA 4I5CA 2PMLX 4FKOA 3PJCA 3PFYA 5J5SA 3ZXZA 3U51A 4BZDA 3E63A 3ZM9A 3OHTA 4AXCA 3BYUA 1MUOA 3OW4A 4HZRA 1Q4LA 4HYUA 4FZ7A 3PA3A 4J95A 2GQGA 1Y6BA 3PJ1A 4QP1A 3ZU7A 3C4XA 3DKCA 3KULB 2W1GA 4K6ZA 4FK3A 4DG3E 3OWPA 4BZNA 3PXRA 3O8UA 3U6IA 2O8YA 2R3NA 3AKJA 1J1BA 4DFZE 4ENXA 1NVRA 3P1AA 2WOTA 2RFSA 4GFOA 2X81A 4FV9A 4J53A 4XCUA 5HE2A 4DGLC 2C5VA 5HVYA 4BJJA 5CSPA 4HVSA 3ZW3A 4G5JA 3UIMA 5KKRB 2KTYA 3D5WA 3QZFA 3Q9WA 2Z7LA 3UQGA 2W5AA 5C26A 1T45A 4CCUA 4BBMA 5F20A 4I0RA 2W1HA 1U46A 2PUUA 2WXKA 4M97A 3LS8A 5AUXA 3HAVA 4OR5A 3SC1A 3RK9A 4XG2A 2SRCA 4AU8A 4WAFA 2WEIA 4MQ1A 5EQEA 1OIRA 2XCHA 1M17A 1Q8YA 2WQMA 4TW9A 5HE3A 4E5AX 3N4TA 3ZO4A 3DJ7A 3FYKX 4P90A 4GYGA 3HV4A 5C03A 2XNEA 3H9FA 2PSQA 1BI7A 4BTFA 3NUAA 5K9IA 3L17A 5GJFA 4H05A 2R3PA 3MJ2A 4FTRA 1WBOA 2GNIA 1UU7A 3F7WA 4ENYA 2VTMA 3R71A 5EDSA 4TWNA 4F7JA 4RVLA 4EBVA 4QT1A 5DEWA 2BILB 3IW4A 4U8ZA 1F0QA 4I6HA 4F9BA 3RPRA 2A1AB 2UVYA 2ZM1A 3DZOA 3E8CA 5HZNA 3REPA 4C35A 3WF8A 3LFBA 5JFXA 3QLFA 2Y9QA 4F78A 1L8TA 3NDMA 5BVFA 3VS5A 1YDSE 4JL9A 4EONA 1O6LA 4FIGA 3KXNA 5DR2A 3R8MA 3P9JA 4MTAA 3NX8A 5IQGA 2F7EE 3VUGA 4FJYA 3HUBA 2WEVA 4YTHA 4DGMA 3LMHA 4DINA 5CEIA 4HVGA 3DFAA 2J50A 2V5QA 3F3TA 3QCYA 3QA8A 4OTIA 1XWSA 2FSMX 2Z60A 4CKJA 4FG9A 3ENMA 3P78A 4LI5A 5CAPA 3A2CA 4DBXA 3O8TA 2GNGA 4NCTC 5IUGA 5LOHA 3DBDA 4RX7A 4L46A 1TKIA 5KHWA 5AP7A 4DEAA 1GZKA 2OLCA 1TQPA 2BPMA 2PL0A 3ORMA 4ORKA 4USFA 1FVRA 1O9UA 4AXDA 2VTHA 4E4LA 3GOKA 2ITZA 1PKGA 1J3HA 3Q52A 1H08A 4K11A 2H96A 4PTEA 2CGWA 2G2IA 2JITA 4XOZA 1OIYA 1B6CB 2BFXA 3QZGA 4QMOA 4RLLA 3EFJA 4RZWA 4ZLYA 4RG0A 4Q9ZA 4IZYA 4CLJA 1FMOE 4A9TA 3LXLA 2VX1A 3C4FA 3V5TA 3I4BA 4C4HA 1ZWSA 1BLXA 3EIDA 4YJNA 3RVGA 2NYAA 1G8AA 1JNKA 3SDJA 3D2IA 1GNGA 5IQFA 3U9NA 2R7IA 2OH0E 3HMMA 4KRCA 3F3ZA 5EFQA 5TKDA 3R7YA 4CZUA 4D4YA 1ZYSA 2IZUA 4MF1A 4F63A 2X6FA 3MY1A 4S32A 4WKQA 4NW6A 4L2YA 3QXPA 4XG6A 3U8WA 4F0FA 4DEDA 4BCMA 4ZIMA 3ORZA 3PVBA 4IQ6A 4F99A 4EH3A 4U6RA 4UN0C 3ROCA 4RIXA 1PXOA 1OVEA 4NSTA 4IANA 1KE7A 3MY0A 2J51A 4LG4A 4UYAA 1YRPA 3KN6A 3HDMA 3QARA 2FUMA 3R9NA 3TIZA 4ACHA 4BCKA 4HYIA 3ZUTA 3CIKA 4BDHA 4E7WA 3UIBA 1U54B 1GZOA 2QNJA 4EWQA 5JN2A 4WNPA 2E9UA 4FEUA 5M08A 2IZTA 4WWNA 2Q0BA 4D1ZA 2WMXA 3CBLA 3JS2A 4MBIA 2OGVA 3NNVA 5LVLA 3DBSA 1GY3A 5FM2A 1YWRA 2XKFA 2X6HA 1PRYA 4U5JA 4AT5A 4BHNA 4IC7A 4QP7A 2OO8X 3DXQA 2WMQA 2UW7A 3QCXA 4YC6A 3MWUA 2Y8OA 2Z2WA 3BLQA 3LFEA 4J96A 3UTOA 3MH1A 2YZLA 3BL9A 2PHKA 3DOGA 3G9NA 3D2KA 4P2KA 4RJ8A 3CSFA 2R3OA 3WF9A 4QMVA 4R3CA 4EH9A 3ZDIA 4F1SA 2CN5A 1KV2A 4ANQA 4IADA 5JFSA 4RBLA 4TTHB 4C59A 2XKCA 4XG7A 4O7LA 2IW9A 1BUHA 5ENNA 3GCPA 3DCVA 4C33A 2OF4A 1WZYA 5C8MA 4RWLA 3O96A 4M3QA 4TKSA 4L9IA 4IWPA 1YWNA 2BKKA 3QZHA 4WHZA 4RT7A 3H9OA 4LV8A 3AMYA 2NRYA 1STCE 3EQIA 4IB5A 5EI8A 3TCPA 3TKIA 4BKJA 1K9AA 3BYOA 3VBWA 2R7BA 2JKQA 2ZAZA 2DS1A 1WVWA 1ZOEA 3E88A 3VUMA 3LQ8A 3L16A 4L3LA 3GCQA 3KREA 4C3FA 4S34A 2DUVA 5KMJA 2ITXA 3Q53A 4XG3A 4XP3A 4YHTA 4XLVA 4EUTA 3TL5A 2IN6A 3EZVA 5EQYA 3FEGA 3KXMA 2EXMA 2F57A 5KMOA 3TACA 2YCFA 4EH8A 5AAFA 1J7IA 3UNKA 2CHLA 4ERWA 3MV5A 4RIYB 3LKMA 4ZY6A 4PS8A 3NYVA 3KC3A 5BVOA 3OS3A 2QKWB 2GHLA 2CJMA 4FA2A 5AP5A 4C36A 1H07A 3DV3A 1DS5A 3EHAA 4IX3A 3RCJA 4ACMA 4EH5A 2W1ZA 2W5HA 3KMUA 2X6IA 1ND4A 4FODA 5HU3A 2P2HA 3WILA 2YDKA 2QD9A 4XLIA 3ZO1A 1IEPA 5D11A 3NR9A 5L2SA 2WXPA 2UZWE 3SLSA 2WMTA 4GVAA 3VF8A 3O17A 4MXYA 2J0MB 5H2UA 5TO8A 4BDIA 3TNWA 4FOBA 5B2KA 2Y4IC 4FIIA 3F88A 4D55A 2CGXA 5DA3A 3DLSA 1P5EA 4KBAA 2PMIA 3VQUA 4FSUA 2JIIA 2GHMA 4FYNA 4MX9A 4W4WA 3WF5A 4BBFA 3CTHA 4QQCA 5CSWA 4XS2A 5TR6A 2HXQA 4A07A 4WT6A 3EFWA 4F7LA 3HECA 5LMBA 3AC4A 4J8MA 5A4QA 1G3NA 1JKKA 4W8EA 3UOHA 1HOWA 3VIDA 2XH5A 4TUUA 4O22A 2X2KA 3PZEA 1JSVA 1SVHA 3N4VA 3UDZA 3PFQA 5L2TA 2UZTA 2C4GA 4FIFA 2WAJA 3RPOA 3VUHA 3TKHA 5E91A 2HYYA 3KVXA 2UZOA 4R7BA 4PRJA 4EYMA 2QOQA 5IH5A 3ZLSA 5EYCA 3IDPA 4F09A 5JGDA 1UU9A 2BAKA 4A55A 2UW6A 4G3EA 4IEBA 3F7ZA 4AOIA 2C5XA 3D9VA 2X4FA 3PY1A 3EYGA 4GUEA 3PIYA 2UW4A 4PUZA 4JPSA 3LXKA 5CF5A 3D7TB 1W8CA 3MVJA 3ORKA 3UQCA 1MRUA 3GC7A 2ITPA 4RWKA 4NTSA 4OBQA 3OF0A 1Q3WA 4O7ZA 4RMZA 5DR6A 4ZTRA 4CCBA 3ITZA 1NW1A 2J0IA 2Y6OA 3VBXA 3SV0A 5DGZA 1UNHA 2R5TA 3BV2A 3K5VA 5HORA 5IA2A 1Y57A 3AQVA 4RWJA 4ANBA 3EWHA 3HNGA 3KRLA 4RFYA 5H8EA 4GJ2A 5E7RA 3JYAA 4K33A 1XBCA 4D5HA 3R1SA 2GMXA 3SW4A 5B2MA 5IQBA 3LXNA 3UPXA 5B0XA 3I81A 2F7XE 3POOA 1RDQE 4Q9SA 2Q0NA 4FV2A 2WFYA 5HIBA 3IPHA 1XH4A 3T8MA 2C6KA 3DZQA 2IZRA 3NZUA 4Y85A 3C0IA 5ANDA 4AN3A 4ALVA 1PYEA 2JBOA 2PULA 3F61A 3NW7A 5E8VA 4ZTMA 3KRRA 4QMQA 1R78A 3ZH8A 2C6DA 4U43A 3LAUA 4AA5A 5L6WL 1GZ8A 2XZSA 5A3XA 5EM6A 2IWIA 2JBPA 2IZSA 3FC1X 4I5MA 2XK3A 4WNKA 3U9CA 2F7ZE 3P08A 3WIKA 5HLPA 5LVOA 5C8KA 2XRUA 2VGPA 1YXVA 2QVSE 3PE1A 1ZOHA 1E8YA 4EI4A 3OXTA 5CAUA 5KMMA 3PSDA 3UZTA 4BI0A 2XANA 4I20A 4YZMA 2UV2A 2BRBA 3DTCA 5H9BA 4I4EA 4TWPA 5HLNA 3W32A 4P4CA 3WZKA 4ZOGA 4AA4A 4DEEA 4RFMA 3KK8A 5CENA 3VS3A 3L9LA 3TJPA 4FTTA 3BE9A 3LPBA 4NKAA 4YBKA 4AZTA 4GK3A 5IDNA 2WTWA 3AOXA 5IMXA 2OXYA 5IA4A 1OL5A 4GB9A 1I09A 3V01A 4XEYA 2BRNA 2GU8A 4NZWB 2VNYA 3DB8A 1KSWA 2WMWA 3FSKA 3QX4A 4OTHA 4L3PA 4I0SA 2QOBA 2VAGA 3KN5A 2I0EA 4H1MA 4MXAA 4Z55A 4YMJA 4RX5A 4WRGA 5HVJA 3HGKA 3M1SA 3A7GA 1A9UA 4X7QA 3EL8A 3PSCA 4IM3A 1NY3A 3ZFMA 2BRHA 2CLXA 1SVGA 4GT3A 4KABA 2ONLC 3DK3A 4YZDA 3V5JA 3OWJA 1PMUA 4JDJA 3FI2A 4NYEA 4O0SA 5D9HA 3K2LA 4ZTQA 3UDSA 4DLJA 3FQEA 4R3RA 2A19B 2UVZA 1DI8A 2VV9A 1WCCA 2C69A 2BZIB 3KMMA 3LCOA 4J1RA 4WBBB 2UW8A 3HP2A 4HOKA 5ANGA 5TT7A 5LXMA 2C0TA 2OXXA 2OZAB 2PZYA 4FOCA 5EDPA 1UA2A 3PG3A 4M13A 4FLHA 2HZNA 1ERKA 5CS6A 1H8FA 3F5PA 2G2FA 1FINA 3ZBXA 4DITA 4E5BA 3Q60A 3ZIMA 2Q83A 3EJ1A 4UWHA 3QD2B 4O27B 3BU6A 1QPEA 4FKRA 1XQZA 2QR8A 2H34A 1PXPA 3FMMA 4X2NA 3RCDA 2XIYA 3II5A 5CQUA 4A9UA 3MH3A 4K2RA 4DT8A 4X6QC 4I6FA 4E93A 2VWVA 3HRBA 3POZA 4FTCA 2BIYA 1CM8A 2QLQA 4LL5A 3ZSIA 4YSJA 3W0OA 4DFXE 4Q5EA 5L2IA 3OC1A 3QF9A 4JG7A 1Z5MA 4MXZA 4R7HA 3D7ZA 3DT1A 3C7QA 2C68A 3F3VA 3KXHA 4FADA 4BCFA 1SNUA 5EOLA 2YWVA 2G15A 3V8TA 4F1OA 4F0IA 2BIKB 3RP9A 4X3FA 4ID7A 4LQMA 5E92A 4DG0E 3RHXA 4FL3A 3HV6A 2C6EA 3Q6UA 5FG8A 3A60A 1Y6AA 3F3UA 2VTAA 3ZYAA 3APDA 2V4LA 4BCJA 2RFDA 2ETKA 4O82A 2XKEA 1REKA 4A9YA 4RJ6A 4FVPA 5IQDA 5K5XA 1OGYA 4FUYA 3DK6A 3HMNA 4AT3A 2R3LA 2VN9A 3U54A 1VEBA 2JAVA 2VWWA 5HICA 3FZOA 5BYZA 4EK8A 4FG8A 3RTPA 4GIIA 1E1XA 5HVKA 3FJQE 4O84A 3Q96A 2IW6A 3BRBA 1JSUA 2ITVA 4MXOA 1TQMA 3H3CA 1WBPA 4TWCA 3BL7A 3TYKA 3VBVA 4ZLZA 5JFVA 5KMLA 3SVVA 3AC1A 1YI4A 5CU0A 4EUUA 5G55A 2PMOX 2R3KA 4YTFA 2FO0A 5L8KA 4IH8A 3FQSA 4CSVA 2C5YA 4XHKB 2R0UA 3QTWA 4FV6A 1IASA 4BGQA 5J9ZA 3DXPA 3ELJA 4CV8A 5L8JA 4FT9A 3PPKA 3OT3A 5KO1A 2OU7A 3AG9A 4JBQA 3QRTA 4IW0A 5M51A 3UZPA 3MH0A 3TZ9A 3BWFA 3QTUA 3QWJA 4EOMA 1PMVA 4HVIA 3BCEA 3EN6A 4CG8A 2CDZA 2XIXA 3MPTA 3BKBA 1WBVA 1BKXA 3FLNC 4KIOA 4G3DA 2UZEA 3R8VA 3C4CA 4H39A 1HCLA 3LJ2A 4MBLA 2WXHA 3E7VA 4DTBA 4RJ4A 2IG7A 3NS9A 3TJDA 4FTJA 5ACKA 3GU7A 4FJVA 3GC8A 5FGKA 2XIKA 2J5EA 3U4WA 2YCQA 3ORXA 3IOPA 4FT3A 2HWOA 5IEVA 3ZLWA 4I23A 3DY7A 3F5XA 1JLUE 1HCKA 1CTPE 4I6LA 4NM7A 3W2PA 2O64A 2E9PA 3LJ0A 5IU2A 4BJJB 4C02A 4PP7A 4DLIA 2PPQA 3RINA 3P7AA 4U42A 2A4LA 2QU5A 2QOIA 2W9ZB 2PTKA 4BRXA 3MIYA 3NNXA 2Y6MA 4DG2E 2UW9A 4IZ7A 5JRSA 4DYMA 2P55A 2JLDA 1EH4A 1ATPE 1OBDA 3A99A 4PDYA 5HKMA 3APCA 3AXWA 4X3JA 5EDQA 4DK5A 2WTJA 3CGFA 4X0MA 3VULA 4FTAA 2PVKA 3GCUA 4MHAA
chains in the Genus database with same CATH topology
2QHNA 3VWAA 4DFUA 5JK3A 2XBAA 2ZOQA 1OMWA 2H9VA 4FV4A 4IVAA 1GIHA 4RVTA 2B7AA 4W4YA 5DT4A 2CMWA 3R02A 4MQ2A 1ZYJA 3OXIA 5EYDA 2NP8A 2CNUA 5HNGA 2J0KA 4KWPA 4O91A 3PYYA 2OZAA 2UW5A 4I41A 3QD0A 4K9YA 5CLPA 1GAGA 1H27A 3KL8A 3LFAA 3NIZA 4PMPA 1JQHA 2PE1A 3KF7A 2PVNA 4IAZA 3A4OX 2VTRA 4FR4A 3FZSA 3NCZA 3PA5A 4B99A 5EQPA 5CWZA 3VUKA 2X1NA 3S3IA 4AAAA 3MA3A 5CT0A 4KNBA 1S9JA 2OZOA 5LMAA 3RAKA 4C4IA 4CFMA 4NM3A 2W05A 3R2YA 3ZUUA 4IJPA 5HU9A 3FMDA 3QXOA 2EU9A 2ZDUA 3A4PA 4CKRA 3DKFA 3V8SA 4KB8A 4IWDA 4Q5HA 4C58A 4FSTA 2I1MA 4AOTA 3FZTA 2CNQA 2E2BA 4ZEGA 4L6QA 4PDPA 5IG1A 2X7OA 3LE6A 2FSOX 4GKIA 5CSVA 5EHYA 3QL8A 4S31A 3WARA 5GINE 2YM6A 4GFMA 2FGIA 3PPZA 4FIJA 1W7HA 5H8GA 3P0MA 3CY2A 5AUVA 4ZAUA 1ST0A 2H8HA 2W17A 3HMPA 3JUHA 5I9VA 3Q3BA 4FNZA 4M8TA 4CFFA 4DE4A 1U5QA 2PMNX 5JZNA 3ID6C 1SM2A 2ZB0A 3DLZA 2GS7A 4RFZA 2XNMA 5E9EA 5HG9A 3D94A 3VS1A 3Q4CA 2XJ0A 3VRZA 3E8DA 3E62A 2J7TA 2WMVA 3AT3A 3MDYA 3MYGA 3NVMB 3OZ6A 2QONA 4NL0A 3CD8A 4QTCA 3LFNA 3GUBA 2GDOA 3OXZA 4JG6A 5IA1A 2BDWA 5DIAA 3W2QA 3PY3A 5FXRA 2XALA 3UOKA 1M14A 1WMKA 5AAEA 3QRUA 3DDPA 3VS4A 5HO8A 5ETAA 4DHJA 4AFJA 3LM0A 2XA4A 3FI3A 2VWBA 4GS6A 4W4VA 4M0ZA 4EH4A 4V05A 4AE9A 3OD6X 4RIXB 4ASEA 3HA6A 5JKGA 2V55A 3OY3A 1OKVA 4L68A 4L7SA 4TWOA 4UWCA 4FZDB 4GJ3A 5M56A 4GT5A 5FEDA 3VVHA 3AMAA 2JIUA 3HA8A 4FZAB 4QQJA 4RX9A 4UXQA 4BZOA 3VJOA 5HBHA 2VWZA 2W4OA 4Y73A 3KCFA 1Q5KA 2YIYA 3HKOA 2VO3A 5BUEA 1NT2A 4AWIA 4C2WA 4FZFB 3C0GA 5FQDC 3ZRMA 2FYSA 2WTKB 4XV3A 3FHRA 5G1XA 3FAAA 1OL2A 2YM4A 3ODYX 2X6DA 3PUFC 3ROYA 4RIOA 3ANQA 3IW5A 3FKLA 4I24A 5IQIA 5KUPA 1RW8A 4JVGA 4YJPA 4AZWA 3DB6A 3PIXA 4DFNA 3TMOA 4O7TA 2XAMA 4M84A 2ZFYA 5D41A 5AA9A 2XYNA 3DXNA 1JKTA 4BDAA 4X2FA 4DA5A 1MRYA 3UODA 4XUFA 5B7VA 3FZPA 2YDJA 4LOPA 4AUAA 3OWLA 4AT4A 4AW5A 1QMZA 4F4PA 3WZUA 5BMSA 3VS2A 3HMOA 2ZVAA 3QA0A 1H0WA 3R9OA 4EWHA 3CTQA 3QKLA 1MRVA 2C6TA 4KBKA 4M0YA 1OB3A 3QZIA 2PUNA 2FH9A 4G16A 3CLYA 3LFDA 4FNWA 3QAME 4OTGA 3ZXTA 4IMYA 4EK3A 5EH0A 4QMNA 5C8NA 3GXLA 2BALA 1XHAA 4OTFA 3T3UA 3BYSA 3DAKA 3WOWA 2F2CB 1AGWA 2C3LA 4OTRA 4IVCA 4K77A 3E3PA 3Q2MA 5F4NA 3CEKA 5BVKA 3SXFA 2OBJA 3U6HA 2IO6A 4QYHA 2X9EA 4BCPA 2QC6A 2HZ0A 3CPBA 5I9UA 5EG3A 2VWXA 4QP6A 1ST4A 4QEBA 5AX9A 4J99A 5FBOA 3PVUA 5M07A 3R1YA 5J9YA 3R30A 2OH4A 1GJOA 4LRKA 4BGHA 2R3JA 2I0VA 3BEAA 4F70A 2C6IA 1ZZ2A 2CGUA 4QYFA 3W1FA 5I4NA 3C0HA 4FIEA 5IQAA 1SMHA 4FMQA 3W0SA 2DYLA 4F64A 4OTDA 1WAKA 5J9LA 4U0IA 4FKTA 2C0OA 3SHEA 4JQ8A 4BC6A 3MVLA 4EOLA 4EQUA 4WBOA 3NMUF 3TZ8A 2RG6A 2HZ4A 2J4ZA 1K3AA 3QHRA 3D83A 4UY9A 4O21A 5DNRA 4JQ7A 5DWRA 5T6KA 3ORTA 2VD5A 4H1JA 4Y72A 5EHOA 2XF0A 1J1CA 2ESMA 4WD5A 4RLKA 5BQ0A 4FYOA 5F94A 4IC8A 3FPMA 2YJRA 3CE3A 3IOKA 3V6SA 3MB7A 5DPVA 4Z16A 2CNVA 4LRJA 4BI2A 3A7IA 4PTGA 3TT0A 2ZYBA 5A6NA 2YN8A 3U87A 5C9CA 3S1HA 3QTIA 4TN6A 1YXUA 1PF8A 3OROA 4TYGA 3ZSGA 4EKKA 3LLTA 3DBFA 5I9WA 1XMLA 5E8ZA 3Q9ZA 2PVLA 4YJVA 2OJJA 4FSMA 4FV7A 4KUJA 1OECA 3BQCA 5AIKA 4TNBA 1FVVA 3C5UA 4RSSA 2R3RA 2YM7A 4I3ZA 3RK5A 5KCVA 4QDEA 3IGGA 4FVQA 5DN3A 3IONA 1W0XC 4KKHA 1ZY5A 2WHBA 3HVCA 4QNAA 3R04A 1OM1A 2GTNA 3PXYA 4N6YA 3OEFX 2HOGA 3KGAA 4QP8A 4AW1A 4RA5A 3FLYA 4EK5A 2FSLX 4IFCA 2BZKB 4O7RA 5LCJA 4JDKA 1G8SA 1ZYLA 2F9GA 2AEGA 2X7FA 5H8BA 2WIPA 4LOOA 3KRXA 2QKRA 2YCSA 4FX3A 2B9FA 3S00A 4R6VA 2JKKA 3MGYA 4DT9A 2R4BA 3H0ZA 3HRFA 4II5A 3MVHA 4EH6A 1MP8A 4P5ZA 4CTBA 5F1ZA 1Q41A 2YA9A 3IKAA 4EHZA 4D28A 2ITTA 5JQ5A 5FM3A 5HD7A 1IA9A 1XH6A 4OT5A 4U41A 5D7VA 3R8PA 2G1TA 3G9LX 3HV5A 1JWHA 3UMWA 3ZO3A 3WIGA 3FV8A 2GFSA 4GK2A 1KE9A 5G6VA 1CKPA 2XIZA 4EOKA 5A6OA 3KIOC 1YHWA 1PXLA 2GPHA 4BHZA 3D15A 4D2SA 3PSBA 2BR1A 2B9JA 3R63A 4LOQA 5ACBC 5CAVA 3VRYA 1WBWA 1R0PA 3EN5A 3QQGA 2OK1A 3OUKA 4Y8DA 4XG9A 3ETAA 3MFUA 3K3IA 1K2PA 4WRSA 3ZFYA 4EQMA 2UZBA 3JPVA 5CVHA 5JT2A 5IA3A 5M4UA 3PLSA 4NT4A 2OFUA 4YSMA 4U45A 4JNWA 2X4ZA 3QD4A 3N51A 4DAWA 5H3QA 4UWBA 3F2RA 4RZVA 1YHVA 5AIRA 5ETCA 4DH1A 4BIDA 4GIHA 3R7OA 1M2PA 4IAYA 4AACA 3FQHA 3NNUA 2I0HA 1E1VA 1VZOA 2BKZA 3OOMA 2UZVA 4TZRA 1IRKA 3CQUA 2JAMA 2VTTA 4F6UA 4FG7A 3UP7A 3L1SA 5JGBA 2A0CX 3GCVA 4BY9E 4FTOA 5EW8A 3V5LA 3SGCA 3TV4A 3DBQA 3I6UA 3EH9A 4FEVA 3QHWA 4I0TA 2J0JA 4IDTA 3CXWA 4PMSA 1W82A 5KZIA 5LMKA 4XV1A 1JPAA 2XKDA 4PF4A 2R3FA 4O38A 3QQJA 4JAIA 1TFFA 3VW8A 1H00A 4FICA 3E3BX 4O7NA 4PMMA 4LL0A 3BYMA 2ONLA 3MFSA 4ZTNA 1LPUA 3M42A 3ZTXA 4LUDA 3EQDA 3P5JC 3O71A 2UW3A 3TG1A 5DH3A 4G9RA 2W1EA 4DN5A 4BDFA 5E8SA 4KA3A 3W8QA 3PJ3A 3C4ZA 2VX3A 2XEZA 4QOXA 3R7VA 2QU6A 5E8XA 4QYYA 4KS8A 5HEZA 3HLLA 1Q8TA 1OL7A 3LLAA 4YC8A 4YHJA 5JEBA 3F6XA 5JH6A 2VO7A 5IUHA 2W9FB 2X0GA 5FD2A 1RQQA 3ZLYA 3EN4A 3UJGA 2IVTA 3TJCA 3TV6A 2HK5A 3K3JA 2GHGA 5BNJA 3EZRA 1M7NA 2X2LA 3SA0A 5FLFA 1R39A 4M15A 3NPCA 4YP8A 5HO7A 5AP2A 4AS0A 3Q9XA 2OFVA 4IWOA 1OGUA 2QOLA 3BLHA 5DBXA 4QMXA 1PKDA 5AWMA 2YIRA 3W16A 5FDPA 4EORA 4O0YA 5IA5A 3TDVA 3U6JA 1VLRA 3OEZA 3UO4A 2GS6A 2XK4A 2HWPA 4IAIA 4ZXTA 1Z57A 5EI2A 3FMLA 5CAOA 2XARA 3FWQA 1G8KA 3PY0A 3RI1A 3DAEA 5AP4A 4UBAA 4HYSA 4GU6A 5FUTA 4O0WA 3RAWA 2JDSA 3PVGA 3G2FA 3SAYA 3EYHA 3QQLA 1WFCA 2WGJA 3B8RA 1P2AA 2B9IA 3H30A 3OTUA 3P5KA 2GQSA 3F3WA 5DE2A 5EW3A 3VN9A 5KX8A 3MS9A 5AP3A 4X3FB 3QBNA 2YM8A 2IPXA 4RRVA 3CQEA 4O7VA 2F4JA 3L9NA 4BCOA 1M7QA 4YJRA 2BMCA 5HBEA 4CKIA 3ZMMA 2VUWA 4A4OA 4YNOA 3TIYA 3LOKA 5HE1A 2YIQA 3GI3A 5E4HA 2YISA 3GBZA 4I92A 5FXSA 2ZM4A 5KMNA 2PE2A 4R78A 3Q9YA 4YLKA 3LCDA 4UZHA 4AQCA 2YJSA 4RQKA 1KE8A 4D5KA 3ERKA 2LAVA 4F65A 3H10A 2XUUA 4X2GA 4GRBA 5CVFA 5CI7A 4PWNA 3PUPA 3ZEWA 3C5IA 4FSQA 2B9HA 3PRIA 3NZ0A 4ZZOA 2ITOA 2O0UA 3WYYA 2BHEA 4AG8A 4ARKA 4A06A 4BGGA 1PMEA 1VYZA 3P4KA 4LMUA 5HIDA 5LQFA 3K5UA 4D4VA 4QO9A 5E8YA 4E4NA 1W84A 3ANRA 4ITIA 4DEIA 3VBYA 5JZJA 1XBAA 1MQ4A 3QQHA 4UWYA 4FSWA 3ZSHA 5L3AA 4OBPA 2IVUA 3L8SA 5D10A 3E7OA 3QUEA 4M68A 3B2TA 5EM5A 1YQJA 3WI6A 1DAWA 2GNHA 2XYUA 4AXFA 5CEOA 3VW6A 4GU9A 4XX9A 3LMIA 2EB2A 3V5QA 3DS6A 4BCIA 2JDOA 5CT7A 2CCHA 3NUNA 4Z7GA 3MFRA 4IAKA 5DOSA 3VF9A 3WF7A 4GYIA 3V6RA 3M2WA 2C6LA 3SG9A 3IG7A 1WVXA 5J87A 2WQEA 2ZM3A 1R3CA 3GGFA 4LMNA 3SRVA 4ASXA 1Z9XA 2OF2A 1O6KA 4NIFB 4LV7A 1H1SA 1SZMA 3FYJX 3ACKA 3GU4A 4YURA 4IB3A 3H9RA 5CEKA 3HRCA 4AZEA 4HGEA 3H0YA 2O5KA 3E64A 4L67A 3FSFA 5CEQA 5AV0A 4EEVA 4EL9A 4E26A 3TZMA 2HY81 3QTXA 4D4SA 4X2KA 1APME 3ODZX 2PUIA 1BL6A 4IJ9A 4M7IA 4XNEA 5AM6A 3DJ5A 5C4LA 2VO0A 2RFNA 4GT4A 4G6LA 4ZSEA 5KKRC 2X8IA 3D0EA 3ZONA 4V04A 3PLAE 4ANMA 3CQWA 2XS0A 3O51A 5CSXA 4WG5A 4F7SA 3K54A 3KEXA 4YGAA 5FEQA 2XJ1A 4BIEA 2W06A 5A14A 1NVSA 3R8LA 1QPJA 2VWUA 3L8XA 3MW1A 4GKHA 3AD5A 4JG8A 5LWNA 3HZTA 3MVMA 2GSFA 3LFSA 1H4LA 5L6OA 2YM3A 3AMBA 5EM8A 1UKIA 3E8NA 4EOSA 2B0QA 4I6QA 3R8UA 3UVQA 3CP9A 1UWJA 4G34A 3LIJA 5FP6A 5EYKA 3O23A 4YR8A 3KCKA 3Q5IA 5LARA 4HGSA 3WF6A 3S4QA 4CT2A 4U3YA 3F66A 1X8BA 4LUEA 2YACA 3LZBA 4R1YA 2W4KA 5CY3A 1PXMA 1W83A 4WOVA 4C61A 3QUDA 3N4UA 1FMKA 4DTKA 5BVNA 3P7CA 2QCSA 1Q8WA 2O65A 2R3QA 1URCA 4FTUA 5CU4A 3JXWA 3W2RA 4DGGA 2XK8A 5HNIX 1UKHA 4UV0A 4W8DA 5IEXA 2ITNA 4FC0A 4RX8A 5AM7A 4PP9A 5F9EA 2BAJA 3R0TA 4L43A 4AGWA 4MYGA 3E5AA 4FTQA 4YJTA 1IAJA 4YBJA 1YI3A 4BN1A 4DH5A 3BU5A 3IS5A 3UYTA 4EZ7A 3SXSA 4AGCA 4AN2A 4IB1A 4NKSA 4GH2A 2P3GX 2RFEA 4I93A 3TTIA 4XH6A 3G90X 5ETFA 4E1ZA 3ZEPA 4YZ9A 3UC4A 1Q8ZA 2W96B 2I7QA 3OP5A 4F0GA 5LVNA 5ITAA 5BVWA 4TYIA 4FKJA 4GK4A 4G5PA 5CTPA 4UX9A 4K1BA 4QYGA 1TVOA 3BV3A 2RGPA 2R3HA 3NUPA 4FKPA 3RZBA 1KE5A 4D9UA 4FKIA 1Y91A 3GFWA 4MK0A 3TNPC 1YDTE 1I44A 3UDBA 1ZRZA 1FPUA 2ITUA 3OW3A 5D1JA 5AP6A 3RJCA 4NU1A 4ZSLA 3UG1A 5CZIA 3BGZA 4AX8A 1M52A 3IW6A 2YERA 3AGMA 3CPCA 5CF4A 3MFTA 2NNWB 2E9VA 3NW6A 3VS0A 3ACJA 3FY0A 2CCIA 3NUXA 3PG1A 5CF6A 3VJNA 3O8PA 4R3PA 3ZRKA 1UU3A 1ZAOA 2C47A 5AP1A 3ALOA 2XIRA 2G01A 2WTDA 4HZSA 4M69B 3PIZA 1U4DA 4YC3A 3KY2A 3RAIA 2YIXA 4YNEA 5K4IA 4CMTA 1B39A 3IO7A 5KMIA 3WZDA 3FMNA 4J52A 3AC2A 2C5NA 2J5FA 3Q5ZA 3R22A 2UW0A 2WKMA 2HELA 2W0JA 3TZ7A 4MD8E 5CZHA 3V51A 4EQCA 3BYVA 3R2BA 4KD1A 2QODA 4EOPA 4JIAA 5E1SA 2GS2A 3W0MA 1P14A 3BGPA 2R3IA 4ZJJA 4Z9LA 2J9MA 2X8DA 3MH2A 4J7BA 4QQ5A 4XBRA 3HDNA 3COHA 3DQWA 4BVUA 4O6LA 4C3RA 3NFGB 3OCGA 5HBJA 3MESA 4QTBA 1PXKA 1XO2B 2CGVA 2OXDA 2WQOA 2WU7A 3B2WA 3C51A 3Q4ZA 4HGTA 3HUCA 4UEUA 4ZZMA 4NW5A 4E4XA 3EOCA 2VX0A 4O6EA 4QPSA 4USEA 1U59A 3MTLA 3A7HA 1A48A 5M4FA 1G5SA 3DNDA 3ORPA 3KF4A 4MXCA 4ALWA 3VQHA 4GG7A 1JKSA 3QTZA 5L8LA 5EKOA 2ZDTA 2X8EA 2VTOA 1XBBA 4G1WA 4BDEA 2PZPA 4MD7E 4ZSGA 4FZ6A 2F49A 3GCSA 3TWJA 4M14A 1IG1A 2AC5A 2V7AA 5JMSA 1SYKA 2P2IA 3MPAA 3R6XA 2P33A 3DK7A 4YLLA 1J7UA 3DA6A 2PVJA 3KA0A 4AGUA 3KXZA 3W8LA 2JC6A 4DCAA 5M06A 4TYHA 4G6OA 3W10A 2ACXA 2FB8A 3HX4A 1ZYDA 3UVRA 5AP0A 3VAPA 2W1FA 4EHGA 3LCTA 5IZFA 3GP0A 2HXLA 2UUEA 1Q99A 4QMLA 5CU3A 3QQFA 2WMAA 4NH1A 4QMMA 4Y83A 3ORLA 2XK6A 3PDTA 4IAFA 4NUSA 4LM5A 3ZRLA 2GTMA 1QCFA 4E4MA 3P23A 2EUFB 4AA0A 4DEBA 1F3MC 2JDRA 4QTAA 2BROA 1BX6A 3D5VA 3EQRA 3R00A 3PP0A 4CNHA 3HV3A 3UGCA 2XAOA 4YHFA 3HYHA 3W0QA 3C4WA 1OPLA 1PXJA 2Y4IB 5JRQA 4PV0A 1H1WA 4LGHA 4BTKA 4EK4A 3G0FA 2WXVA 4WA9A 4L7FA 4MD9E 2CN8A 5HQ0A 3CS9A 4GCJA 4C4EA 3FC2A 4IX5A 4E6QA 4Y46A 5A9UA 2OIQA 2XMYA 4D1SA 2BTSA 5CNOA 4NCTA 4A7CA 4BI1A 2B55A 4GMYA 5AJQA 4ITHA 4I21A 3HV7A 3IQ7A 2O2UA 3LMGA 1PXIA 4JX7A 4MWHA 4EZ5A 5HNBA 2C3JA 2GFCA 3RPVA 4DDGA 4PL3A 4OTWA 3HAMA 5AFVA 3FMJA 5J1VA 4FKUA 4BDJA 4C7TA 4LFIA 4XJ0A 3FXZA 3QQUA 1SNXA 3QLGA 5E1EA 3H4JA 3M11A 4A9SA 4EOJA 4R5YA 4B8LA 4IVDA 2WD1A 3PVWA 2Z7RA 3OT8A 1UWHA 3S0OA 3TL8A 4RC4A 5TOZA 3R9DA 4HGLA 2QOFA 4FTKA 3MIAA 3FLWA 2CPKE 4NM5A 4MUQA 3OOGA 4ZJIA 4JJRA 5IQHA 4XP2A 3OVVA 3HP5A 4FV3A 4V0GA 3GQIA 4EJ7A 4IAAA 4MCVA 4ONAA 3R1NA 3EB0A 3I5ZA 4CLIA 3GVUA 4E6AA 4FKWA 1H28A 4GVJA 4EH7A 4O0TA 3L9PA 3PXZA 2V22A 1NXKA 1Q97A 3F5UA 4HYHA 2VRXA 2I40A 4U40A 2WMRA 1OKYA 4Y5QA 4O7SA 4EH2A 2Y0AA 1OKZA 2VO6A 1H25A 3OWKA 4RWIA 1WVYA 3W2SA 1OITA 3ZS5A 3QTQA 1LEWA 3SXRA 4FVRA 4ACCA 4ZTHA 3BHVA 5DG5A 5EYMA 3MI9A 1Q62A 2EB3A 1TQIA 4KAOA 4ZLOA 4CFXA 3FKOA 4LRMA 1DAYA 5DT0A 2B53A 1XH7A 1ZARA 2PY3A 3LHJA 4IWQA 5I0BA 5CF8A 1OZ1A 2X39A 4F7NA 2AUHA 3NYNA 4XMOA 3SOAA 2G9XA 3SKCA 3O50A 5GIPE 4KKGA 3AC8A 3UZRA 3TUBA 4RJ3A 1XH8A 5DRBA 4G3FA 5AUTA 1H24A 1T46A 3GU5A 4WIHA 4CT1A 2E9OA 3EQHA 4YUQA 4CVAA 2UZLA 2V0DA 2XK9A 3LQ3A 4JXFA 3T3VA 3ZC5A 3SG8A 4YJSA 2B52A 1RE8A 2QO2A 4QMZA 3RM6A 5D12A 4L52A 1URWA 2UVXA 3RMFA 4IM2A 5HX8A 4JAJA 1JSTA 4NWMA 3FXXA 3G33A 3S95A 2JFMA 4XP0A 3T9IA 4WNMA 3ZBFA 3AKKA 3CCNA 3GC0A 4FBXA 4IM0A 2XM8A 4L42A 4DFBA 2BUJA 4E20A 1PW2A 2C6MA 3UQFA 2Z7QA 4BCGA 1VJYA 3A8WA 3AT2A 3IK3A 3TTJA 1DI9A 2XP2A 1VR2A 4C37A 4FSYA 5I9XA 3BLAA 3I60A 3DGKA 4F08A 1OIUA 4FT7A 2EVAA 5B2LA 5LVPA 5HTCA 3C4EA 1W98A 3G0EA 4HCVA 4HJOA 4RIWB 1MQBA 4DF3A 3TUDA 3Q32A 3MTFA 1V0PA 4NFMA 4G6NA 4U3ZA 4FGRA 3BGQA 3SQQA 4BCNA 3COIA 4LDTA 3D5UA 2BFYA 2W99B 4TT7A 4E5WA 5A4EA 4AXEA 4C34A 4ZZNA 3QX2A 1V0OA 3UG2A 4APCA 1YXSA 5FRIA 4U9AA 3TNIA 3OCSA 2XNNA 2WO6A 4WUAA 5JQ8A 4O2ZA 4I6BA 4JT3A 1KE6A 4L00A 3V04A 4DH3A 2R64A 3ZO2A 4HVDA 4Z3VA 5CALA 4O7WA 5E8UA 4EOQA 3LCKA 2YDIA 4TPTA 4O81A 3UOJA 3QRJA 2WELA 5GJDA 1OUYA 5LCKA 3FUPA 2YITA 1ZOGA 2J6MA 1R1WA 2PWLA 3COKA 5GIOE 2UZDA 4TNDA 4FSRA 1XH5A 4MNEA 4JR7A 3EKNA 5M55A 5IMEA 2VTNA 3HMIA 3ORIA 5AUWA 4BTJA 4C4GA 3NUUA 3PJ2A 1XJDA 4NJ3A 4U81A 3EQPA 3ZZWA 4ZSAA 3P86A 4JRVA 3MN3A 2VWYA 2XK7A 2XNPA 5IQEA 2H6DA 1L3RE 1KWPA 2XEYA 4ANSA 3R8ZA 2PK9A 3VO3A 3CJGA 4QDVA 4AOJA 3L9MA 3PA4A 3HL7A 2QOHA 2W1IA 4WG3A 4EOIA 3ET7A 1YWVA 3RGFA 2ZB1A 4QP3A 3I1AA 4IIRA 5CEPA 3I0OA 3PXKA 2QQ7A 2CLQA 4FTLA 4EBWA 5DFPA 4EJNA 3DJ6A 1WBTA 1IA8A 2P0CA 3CC6A 2C5OA 2VTPA 3MPMA 3KU2A 3PPJA 3SX9A 5BVDA 4R1VA 3PP1A 4YU2A 1H01A 5ANKA 2HY0A 3R73A 4CRSA 4DHIB 2R2PA 1KOBA 3ML1A 4AW0A 1KUTA 2Y4PA 4FV8A 3BLRA 5DVRA 3MJ1A 3C50A 2V62A 5JFWA 2HIWA 2W1DA 5BMMA 5CI6A 1FVTA 4JX3A 4B4LA 5JSMA 3RNYA 1YXTA 5GNKA 1CSNA 3W0RA 4HPUE 3TNHA 2LGCA 3ENHA 5EM7A 1OL6A 3ZUVA 3KFAA 4Y5HA 4FT0A 2YABA 1UNLA 3NAYA 3EQBA 2XCKA 3FMHA 4DH8A 5M44A 1FOTA 2KULA 3NNWA 3OG7A 3UOLA 1OPKA 4OTQA 4TYEA 4DGOA 1CDKA 2JKOA 4ZSJA 2OWBA 3C13A 5EHLA 4CMUA 4RGJA 4DHZA 1PYXA 2BAQA 2QOCA 2UZNA 2YZAA 4P5QA 2AYPA 3VC4A 4EOOA 4ITJA 2G2HA 3FZ1A 2ETRA 3OBJA 2B1PA 4GSBA 3DPKA 2ZV9A 2R9SA 3MBLA 3THBA 4TL0A 1PMNA 2RF9A 4QYEA 1H0VA 3VS6A 3TUCA 3JR1A 2C30A 2XB7A 1V0BA 4I5HA 4IX6A 3NVKI 3SOCA 2HCKA 1H1RA 4DFYA 1GZNA 4QTEA 4L01A 4GFGA 4I4FA 3TN8A 4QMPA 4IB0A 4ZY5A 2EXCX 4BB4A 5AX3A 3G6GA 5J95A 2RKUA 4JBVA 4MAOA 3BX5A 1GIIA 3BHYA 3R9HA 3VHEA 3TDWA 4ZP5A 5HCYA 2JIVA 2BCJA 1UU8A 2BRGA 3QUPA 3O0GA 3UO6A 3JVSA 3HEGA 4AAYA 5HLWA 5IISA 3KRJA 4CRLA 2QG5A 3A62A 4CEGA 4QP9A 3OY1A 4DDIA 4BDDA 2OI4X 3C1XA 3DU8A 4PMTA 5HD4A 3RM7A 5I9ZA 2ITWA 4JDIA 3CY3A 4IVBA 3F2NA 3QU0A 5T68A 5C4KA 4RIWA 4IZAA 1V1KA 3KULA 4QQTA 4L44A 4BIBA 2BZJA 3R01A 1DM2A 2FA2A 4O7YA 4OUCA 3W18A 3UO5A 4J8NA 3O7LB 3VNTA 3NUYA 1F5QA 2ZV2A 3CR0A 4JDHA 3ZDUA 4QMSA 4S2ZA 4EHVA 4QRCA 5D7AA 4S30A 5AMNA 3GU6A 5CQWA