3AKLA

Crystal structure of a helicobacter pylori proinflammatory kinase ctka
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
294
structure length
281
Chain Sequence
PTIDFTFCEINPKKGFGGANGNKISLFYNNELYMVKFPPKPNGCFSEYVACHIVNSLGLKVQETLLGTYKNKIVVACKDFTTHQYELVDFLSLKNTMIELEKSGKDTNLNDVLYAIDNQHFIEPKVLKCFFWDMFVADTLLGNFDRHNGNWGFLRAEYQIAPIFDCGSCLYPQADDVVCQKVLSNIDELNARIYNFPQSILKDDNDKKINYYDFLTQTNNKDCLDALLRIYPRIDMNKIHSIIDNTPFMSEIHKEFLHTMLDERKSKIIDVAHTRAIELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ctka
publication title Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
pubmed doi rcsb
source organism Helicobacter pylori
total genus 88
structure length 281
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07804 HipA_C HipA-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.20 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 3aklA02
3.30.200.120 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3aklA01
3AKLA 3AKJA 3AKKA
chains in the Genus database with same CATH superfamily
3QJZA 3DFAA 2FB8A 3AC3A 1GIJA 5ANLA 5J5SA 5EM8A 2G15A 2P2IA 3BX5A 3LLTA 5AV1A 5CQUA 3BEGA 4CFMA 4QTEA 3KXXA 4LV7A 4ZS0A 4LOOA 5L2WA 1XBCA 3NNWA 4F78A 3ET7A 3OW4A 3VBVA 5J1VA 3IOKA 3G6GA 4FJYA 3NAXA 4O0VA 2NRUA 1XH9A 4QT1A 4ZMFA 3LCDA 5M4IA 4AACA 2HWPA 5L8LA 5HE3A 3R7YA 3ALOA 4KB8A 3ZLSA 5DBXA 4OBQA 3CKXA 2WAJA 1W98A 1Q99A 4MNEB 4ACGA 4XG4A 3SGCA 5AUUA 3I79A 5LVPA 1OIUA 3ZIMA 3QHWA 4HYUA 3UYTA 2OH4A 3Q4ZA 3EKKA 2JFMA 3KF7A 4FGRA 3RNYA 3QRUA 1YHSA 2WHBA 3A7FA 4I5MA 4BDDA 3BYOA 4RG0A 4CG9A 4DCAA 2VWYA 3PXYA 3GCSA 2W4JA 4CFNA 4O38A 1UU3A 4FOCA 1R78A 2Y6OA 1OL1A 3AC4A 3NUNA 4O2PA 4Z7HA 2B9HA 3FKOA 3HECA 4IJPA 4U3ZA 4EH4A 2BTSA 2XRWA 2Z60A 4Y46A 4F7JA 4ZSGA 4DYMA 3SXRA 2BIYA 2XJ1A 2PL0A 2XF0A 4E6CA 3WYXA 1HE8A 3CPCA 3I0OA 2PVMA 4IDVA 4FADA 3A4OX 4OLIA 1MQBA 4RWLA 5CAUA 2OK1A 4PP7A 4OTQA 2CHZA 3Q5IA 3IW8A 4L7FA 4O22A 3GXLA 2BAJA 4KS8A 2VWZA 2OXYA 3U4WA 4B4LA 2PYWA 2JEDA 3QQUA 3OWLA 4LMUA 3BLQA 4EQMA 3KULA 1OBDA 2JDRA 2IW6A 4MD8E 3CSTA 1M52A 4BICA 1YOJA 5CEPA 3ANRA 4LV5A 4JXFA 2AUHA 2OFVA 3P79A 4FG8A 4N4SA 5EKOA 2WIPA 4O7RA 4ZTNA 4BTKA 5K4IA 3WE8A 4FNZA 2UVXA 1YW2A 2XUUA 4OTIA 3HDMA 4BDIA 3EFJA 2W9ZB 4AAYA 3OBJA 4F1TA 3DBCA 1YKRA 3TN8A 3D0EA 3G9LX 4DTAA 3N4TA 5M07A 4EK8A 4I6HA 3PFYA 1OM1A 3HP2A 2QU6A 1J1BA 2I0VA 2R2PA 2W1DA 3IGGA 3KXMA 1AQ1A 4FOBA 2BHHA 5HGIA 4M67A 3W16A 2WXRA 3NGAA 3D2IA 5EDQA 3KN5A 3MJ2A 4QTAA 3BE9A 4DLJA 3RCDA 4ZZOA 2WMQA 2O8YA 4IZAA 4IM2A 3BIZA 3KQ7A 5DR2A 4ZSAA 5M4FA 5BVWA 1BLXA 2OIDA 3G6HA 3D5UA 2C6TA 3SAYA 3F7ZA 4MHAA 2ZV2A 5JSMA 5EI2A 5CZHA 5AV3A 4RIYB 4FKJA 4RIOA 3IDBA 3LKMA 3QWJA 4FIJA 5AJQA 4MK0A 4G2FA 3ZEPA 3BLRA 4FG7A 1TQMA 4HW7A 3RHKA 5CWZA 4DG2E 3JVSA 3FYJX 2PVYA 3FHIA 4K11A 4TW9A 4RA5A 4C36A 3KVXA 1YDRE 4FV0A 4EYMA 2BFXA 4EH2A 4XH6A 3ZDIA 4I4EA 1YXTA 3FMJA 3C9WA 4CCUA 3BQCA 3E7VA 5CAPA 5EYMA 2ONLC 3HL7A 4ANBA 3E92A 3L8PA 4XYFA 3CBLA 2R64A 5EQEA 3R8ZA 3DAEA 3V8SA 4FV6A 2J5FA 4GFGA 5D41A 4EONA 3Q4CA 2OJJA 4C61A 4UB7A 4F9WA 3T9TA 4TL0A 2W5HA 3MW1A 5M4CA 2RD0A 3O5AA 3QUEA 1G8KA 5CY3A 3NW5A 4IBMA 4ZSLA 5C9CA 4I92A 4CTBA 2H8HA 4P2KA 3FPQA 4DFBA 4EORA 3F3UA 3TUDA 3TYKA 3I5NA 4LL5A 3LVPA 4Y95A 3W2OA 4HNFA 4O96A 2YCRA 3EL8A 2W4OA 2WXJA 1GIHA 2JKKA 1ZMVA 4MD9E 1TFFA 2XM8A 5D10A 3A99A 2C6OA 1XR1A 1SMHA 4UWHA 3R9NA 3L17A 2PVLA 3RP9A 2W17A 3VUDA 4QP3A 5EDSA 5FUTA 4FTQA 3R22A 4U9AA 4X3FB 4YU2A 2XNOA 3DXPA 3H30A 3HVCA 4K1BA 1JAMA 3EQRA 2VTAA 4KS7A 5E90A 4QMSA 2IJMA 3TDWA 5CANA 5HIDA 1DI9A 3BYVA 3P0MA 4KKHA 3B2TA 5A4QA 2QOOA 4C02A 1AGWA 1UA2A 3L9NA 2AC5A 3LCTA 1GJOA 2B9JA 2Z7SA 4M13A 3EH9A 4EOJA 2XEZA 3DPKA 4D0WA 4EEVA 3Q2JA 2Z7LA 2Y8OA 3VS7A 3WI6A 3HEGA 1BI7A 4G17A 3RI1A 2F57A 3OWKA 3NNXA 3HMMA 3FLNC 4V0GA 2JLDA 1CMKE 2XKEA 3JVRA 4GU9A 4TPTA 2H9VA 4BGGA 3L8XA 2HCKA 4IWOA 3OTUA 3ZRMA 2W5BA 4ZTQA 5JRSA 2CJMA 2R3IA 3A60A 4N0SA 4NW5A 2X6IA 3HV4A 3R1QA 3HUBA 3OY3A 3PZHA 3QTQA 5IEYA 2WMUA 2UW0A 4A06A 5JK3A 2WMRA 1FVVA 4O27B 2XMYA 4GIHA 5CYIA 1Z5MA 5FQDC 5FTQA 5IQBA 3EMGA 2BILB 1GAGA 2PVJA 2W96B 3DTCA 3PXFA 5GIOE 2C6DA 4EUUA 3QQJA 4XG7A 3TZMA 1BMKA 5FDPA 3RPRA 3ZMMA 2YCQA 5AX3A 5L6PA 1W84A 3NNVA 2PVHA 4O7VA 5HBJA 3OP5A 3FY2A 3QWKA 5HG9A 2BRHA 2BROA 2JDSA 3BZ3A 4FSYA 4JRVA 4DG3E 1YQJA 5JFVA 3FZSA 3U6IA 3LFDA 1ZYDA 3QALE 2XK9A 3PUFC 2YISA 1V0OA 1WBWA 2B0QA 1VR2A 3EHAA 1UNHA 3KRXA 3R8VA 4EC8A 3SA0A 4YO6A 2ERKA 4F7NA 2XNGA 3NLBA 5C03A 5A6NA 4N57A 3V5JA 4ZY4A 5LJJA 3ZFXA 5AM6A 1A9UA 3ODZX 1W82A 4K2RA 3UO4A 3AMBA 4IX4A 2W99B 3ZU7A 4HOKA 4L43A 4XCUA 5JGAA 2PUIA 2YCSA 2ETKA 4FSWA 4UALA 3LFSA 2QG7A 1HCKA 2R3NA 5DEYA 1WVXA 1VYWA 1E7VA 4D2RA 4YJQA 2W06A 3KIOC 3ZLWA 3U54A 1U59A 1QMZA 3EQCA 3D2KA 2A0CX 1YXVA 4WRSA 3SKCA 4BDEA 3THBA 4C4FA 2C3KA 3R9RA 4YZNA 4OVUA 5HNGA 3TL8A 4JX3A 5AAFA 3VHEA 3C0HA 2VTMA 3OWJA 3WYYA 3ZZEA 5AP5A 2CHXA 2X9FA 3MFTA 2XK8A 4WNKA 3T3UA 5FXQA 4EH7A 1PMEA 2J6MA 4J53A 5AUZA 2GNLA 1KSWA 5CENA 3F5XA 3CJFA 2CCIA 3NW6A 4FSZA 4WWNA 5FDXA 2WMAA 4EK3A 2VX1A 2XIKA 4QDVA 4NFNA 5HKMA 3E5AA 4RIWB 4XV9A 4NCTA 4TZRA 5CASA 3FE3A 3QQKA 4J95A 4DEGA 1JLUE 5IQCA 4KBAA 3UODA 1WBSA 3CJGA 5M06A 2O3PA 3DS6A 4F4PA 5DHJA 4QTCA 4WWPA 4I22A 4R5YA 2OJFE 4I6QA 3OC1A 3FMLA 4FTTA 4O83A 4YJOA 5DFPA 3AC2A 3E88A 3SV0A 3FZ1A 4DT8A 5LMKC 1XQZA 4I21A 5LWNA 4FSRA 3N4VA 3EZVA 3P08A 1WCCA 3GU5A 4UYAA 2WMSA 4F1MA 3ULZA 3KXNA 4U79A 3M11A 4GVAA 4X0MA 5J9ZA 3O96A 4FKQA 3VVHA 4WUAA 4CKIA 1U4DA 3C0IA 3HV3A 4FTLA 4DHFA 2BMCA 4KA3A 4TTHB 5DNRA 3DJ7A 3NFGB 4URKA 2B1PA 2CN5A 3R7QA 4JAJA 3TNIA 4F6WA 1FINA 4RT7A 3Q3BA 3MVHA 3WZJA 1H1PA 4ALUA 4YSJA 3KRJA 4AOTA 4JMQA 2C68A 3KREA 3R7UA 2JBPA 3IO7A 3S2PA 5AUYA 3BHUA 4UX9A 5HIBA 4AOJA 2ZM1A 4TYIA 5JH6A 4L46A 3TTIA 4FUXA 4BDJA 3BBWA 4EOQA 3BU3A 3EN4A 3R2BA 3ZVVA 1TQIA 4IZYA 5G55A 4L3JA 4AP7A 2JGZA 5DN3A 4FTJA 5L2IA 4IX3A 2FSTX 4QMTA 4IQ6A 4KNBA 4XV3A 1WFCA 3TUBA 3R0TA 4QMMA 2YEXA 5AWMA 4O0XA 4YTFA 4J8NA 5CU6A 4OYSA 2X38A 2Z02A 2C69A 4M14A 2V7AA 4UXQA 3ZXTA 5KKRC 3O7LD 3DT1A 4E6QA 5C27A 4PUZA 1Q3DA 3UC3A 2J0JA 3WE4A 5BVDA 5J9LA 3WOWA 1JKLA 1OL7A 5FBOA 2VO0A 4BHZA 4C3PA 3O7LB 4CV9A 3LS8A 1BI8A 5CAVA 1I44A 4MF1A 3BV2A 4BIEA 5IA5A 4FHKA 3DOGA 5FEEA 5HE0A 3JS2A 3R28A 4FT5A 3KULB 4O7NA 4FKPA 2GU8A 3RK9A 4A9TA 4ZTLA 1TQPA 3FKLA 3MSSA 1XHAA 3BGQA 3A62A 4MXZA 4FTOA 5HESA 4K0YA 5KBQA 3ZZWA 3MY1A 2UZTA 4PMMA 3UNKA 3GC8A 3NEWA 1Y6AA 1P4OA 2JDTA 2HENA 4Z55A 3LCKA 2W5AA 3CLYA 5BQ0A 2Y4PA 2V5QA 4WG3A 2OZOA 3E87A 2JDVA 3EWHA 2WQMA 3UDBA 1KV2A 1E8XA 4U5JA 4QP9A 4TYGA 3SRVA 3FJQE 4AF3A 3UP7A 3MIAA 4LV8A 3RTPA 1ST0A 3ZTXA 2PSQA 2XZSA 2VWIA 4AN2A 3MWUA 4Y72A 2YM8A 4G9CA 3MPMA 4DTKA 2DWBA 3ZRLA 3CY3A 3FMKA 3RKBA 3DQXA 1G3NA 4O7WA 1BL7A 2BKZA 2X4FA 1JSTA 5CNNA 1E8WA 5M57A 1XO2B 3Q9WA 4CZUA 3UO5A 4WG4A 4LUDA 4J96A 5AV4A 5IA4A 4PTEA 4CLIA 4ZSJA 4G31A 2J0MB 4HVSA 4MYGA 4FVQA 3VONA 5FTOA 3RINA 1YDSE 3R71A 3EZRA 4MBJA 3FQHA 4AFJA 3DLZA 3LFNA 4KWPA 4J98A 5E92A 2E9NA 2G9XA 2QR8A 2Y4IB 2QNJA 3QA0A 2OG8A 4AZWA 2YN8A 4FTUA 4KIPA 1F0QA 4DHZA 2RFNA 3BLHA 3KKVA 2J7TA 3TV6A 4FODA 2B4SB 4KIOA 2YM4A 3ZSIA 3BQRA 5BVKA 4R1YA 3MVMA 5BYLA 1FQ1B 2ITQA 4PMTA 3CTQA 4A9UA 5JFSA 1OIYA 2W1IA 5L6OA 5F94A 1KE8A 4GUEA 4F64A 5DA3A 1ATPE 1PXIA 5EM7A 3IONA 2RFSA 2YITA 3LQ3A 4DK5A 2VO7A 3PS6A 3PPKA 4FR4A 4J7BA 1TKIA 2WQBA 4JDKA 5ANJA 3UGCA 4MXXA 4MXAA 1NXKA 3RAWA 3I0QA 3ZO1A 1XMMA 4FKRA 4QPAA 2BZHB 2C1BA 3DU8A 5IDPA 3BHHA 4FULA 2X7FA 3NUSA 3HRCA 3KMUA 3OS3A 4DE4A 2PK9A 4PDSA 1J91A 5LCKA 4TWPA 2Z8CA 4OR5A 2FGIA 3HA6A 3D9VA 4J99A 3DBDA 3TG1A 4E4MA 1Q3WA 2P0CA 4R6VA 4EOSA 3AKKA 4D9TA 3RAHA 2X4ZA 2XAMA 5JRQA 4GK2A 3W0PA 4LDTA 2WXVA 4KBKA 3I4BA 3IDPA 4XBUA 3CGOA 2F9GA 3OCGA 4Y73A 5DT3A 2GNHA 5EOBA 1UV5A 3RK5A 3EOCA 4ZP5A 3PPZA 3S00A 5A14A 1Q8YA 3L8SA 4LGHA 4ZTMA 3A7IA 5E1SA 2ZAZA 4HZRA 4U3YA 4BDFA 5C01A 4ZY5A 5ICPA 1UVRA 2H34A 4L1BA 5IUHA 5F4NA 5BV3A 1OPKA 4IB1A 4RFYA 4ASXA 5J1WA 2VN9A 1LUFA 4R1VA 4H05A 2BAKA 5CZIA 4IAIA 4JAIA 4IX6A 1LPUA 4QO9A 4DT9A 4UZHA 1T46A 1KOBA 2PZYA 4JR3A 3KF4A 2B7AA 4NM3A 3CXWA 4V0GB 3OHTA 4C0TA 2EB3A 4YZCA 2XNMA 2R3KA 1OMWA 2A27A 3UIXA 1I09A 4CCBA 4PS3A 4HPUE 4YGAA 3VN9A 3WF6A 2WXFA 2GSFA 3TXOA 3H9FA 4L01A 3NRMA 2R5TA 4NU1A 4AS0A 4CMTA 1G8AA 4XE0A 3A8XA 4IVBA 2NNWB 1Q41A 3HX4A 5JQ8A 4O91A 5AUTA 4NW6A 1YOLA 3MJWA 2IVUA 5HLNA 3QD2B 3VBTA 5B2LA 2R3LA 5CNOA 1PXJA 4PS8A 3ORKA 3FL5A 4E4LA 3FZTA 1P5EA 5L2SA 2C1AA 4RX7A 4EBVA 2PUPA 4FT0A 2R4BA 2OU7A 2FH9A 4EOOA 2C47A 4IACA 4NT4A 3PIXA 1P2AA 4P7EA 5FEDA 3TDVA 3F66A 5C8KA 5CXZA 3CP9A 3CQWA 3MH1A 5HG7A 2X6JA 4I0RA 3V6RA 4D1ZA 5L3AA 5ANKA 2CLXA 1UNGA 4ACCA 1B38A 3MGYA 3NAYA 2WOTA 3FHRA 3PVWA 4JDJA 3SLSA 4PNKA 1UKHA 2R3FA 3UZRA 2WTJA 3FBVA 1YWNA 1B39A 2WXOA 4FKUA 3LLAA 3ZONA 3FXXA 4M3QA 4OTHA 2R3GA 4BVUA 3E8DA 3F2RA 3HMOA 4FSMA 1ZWSA 1ZY5A 3QD0A 2HOGA 5GHVA 3W2SA 4YMJA 4RZVA 4O21A 3P86A 3QFVA 4PX6A 2YM5A 4O82A 4QQ5A 3Q52A 3MI9A 5CU4A 2W05A 4BBMA 4AW2A 2J4ZA 4ERKA 4AT4A 3QZHA 2GFCA 2Y7JA 4K9YA 3VS0A 4G6NA 3GCUA 3M1SA 3C4ZA 2C6KA 3TM0A 4IEBA 4QMZA 4YBKA 4U81A 4YUQA 3E7OA 4YC8A 1R1WA 4F0IA 3HMIA 4QP8A 2AYPA 3LFAA 4A7CA 4EZ7A 4JOAA 4GKIA 1S9JA 3VBXA 1H01A 3ENHA 4U44A 5IQIA 2VGPA 5AP2A 4W8EA 4DHIB 2PZIA 4JVGA 2WGJA 1ZXEA 4DH8A 5AIRA 2BVAA 4S31A 3IS5A 4YTCA 3P9JA 5I9ZA 4TWCA 5JEBA 1GZOA 4G3EA 2W1CA 4D1XA 3GEQA 5LQFA 1YOMA 4YC3A 3OVVA 5EG3A 4F65A 4ANLA 1OGYA 1XH8A 4QNYA 4RRVA 1BUHA 2ITZA 4IWPA 3ZLXA 1NW1A 1OZ1A 4ZS4A 5M55A 2C30A 3V5QA 5BMMA 5LXMA 3GC9A 4BCJA 3LCSA 4FYOA 4I1ZA 3BV3A 3VO3A 4AQCA 3IECA 4BBFA 4NUSA 3Q60A 3IGOA 3FMMA 1UWJA 2OBJA 2A2AA 2ZV7A 3PXZA 5BUIA 4QQJA 4XJ0A 1FPUA 2B53A 2UZUE 2X7GA 2GTNA 2PVRA 3CQUA 3EB0A 3MBLA 5IA1A 1JVPP 2CLQA 4ZXTA 5M51A 4G34A 1ZARA 2VD5A 4G1WA 5BPYA 3PVUA 5CXHA 3ZM4A 4OGRA 5HQ0A 1KUTA 2WQOA 3FUPA 3V5TA 2XAOA 4OTFA 2BDJA 3L9PA 4YC6A 4D28A 2BKKA 3I5ZA 4MWIA 3FMHA 2X6DA 4I5PA 4W4XA 4J71A 2GS2A 5E8ZA 1MRVA 3E64A 4QEBA 3W2CA 1ZOHA 3ITZA 3G0EA 5CT0A 2O63A 4RX9A 5ANIA 2XKDA 3OOMA 4BDGA 3WF9A 3KMWA 4RC2A 5AP3A 4EOPA 3LFFA 3O2MA 5H3QA 4J52A 3K54A 3REPA 2X8IA 4GJ2A 4RIXB 2EXMA 4AT5A 4KKEA 5CSVA 3HA8A 4JQEA 3R7VA 3PIYA 3SHEA 3BELA 2E9VA 2GHMA 3OY1A 4JNWA 4A07A 4AW1A 4B8LA 4RJ5A 4EYJA 3BLAA 3H10A 4IVDA 4C59A 4EH3A 4H36A 2UW6A 4DHJA 3JR1A 3OG7A 3QCQA 4IAFA 2X2LA 3EFWA 3FZRA 4UZDA 4OT5A 4HVGA 4ANVA 1YI4A 2YM3A 4RZWA 2UW5A 3CSFA 2QD9A 2WXNA 4M0ZA 1DI8A 3B8RA 4O86A 5H8EA 3PE1A 3UQGA 1XH6A 2WTKB 3BYSA 5ETIA 5D7VA 3CQEA 3RAIA 4W4WA 1OBGA 5I9VA 2YIRA 4CRLA 4I6FA 4QQTA 4A9RA 2CHWA 4ZLOA 2Y4IC 5ACBC 3OWPA 4F09A 2Y0AA 3LCOA 2WTWA 2IW9A 4CZTA 2FSMX 2I0YA 2R3RA 3DNEA 3LAUA 3IBEA 4S2ZA 3Q32A 2B55A 3UIUA 3MTFA 3K5VA 4HPTE 3VW6A 3GUBA 2NRYA 3QX2A 3KFAA 2WD1A 3HV7A 3F82A 3DBEA 3W18A 4AZTA 4BI1A 3OT3A 4PL3A 5LWMA 3QYZA 2WO6A 2CGVA 2XK4A 4CV8A 5LVNA 2DYLA 3SRVB 5LMBA 4RPVA 4G9RA 3C1XA 4FZ6A 2BRNA 3E62A 3JYAA 2C3LA 3KXHA 4DAWA 3UPXA 3AT2A 2WU6A 4O7ZA 3OUKA 2OO8X 4FZ7A 1J1CA 2VTQA 4CT1A 4WA9A 5EM6A 5JN2A 2BRMA 3TL5A 4G11A 2BR1A 5AUXA 2CDZA 4BYIA 4ZZNA 3VC4A 2GNJA 1GNGA 3OBGA 4XV2A 3SW7A 5BVEA 4FV5A 4PDYA 4IE9A 2EVAA 1DAYA 5TKDA 4GL9A 3U9CA 3NYVA 5EFQA 4HYIA 4J1RA 2X2MA 4ASDA 1KE6A 5DEWA 1GZNA 3QD4A 3R30A 5HLWA 3SVVA 4YHFA 2WTCA 3QXOA 1OIRA 3G15A 1L3RE 3PP1A 4PDPA 2XA4A 5I9XA 1FOTA 3ATSA 4LOPA 3NZSA 3E8NA 3A7HA 3P7CA 3TTJA 3T8MA 4BGHA 5IQFA 3EIDA 4FI1A 2F49A 1FBNA 1YXUA 3AT4A 3PPJA 4XLIA 4C38A 3ML1A 3UE4A 2C6EA 4PH4B 2OF2A 2V62A 3AGLA 3C13A 3U6JA 2WEVA 5LMAA 2PMNX 2VWBA 3MPAA 3DDPA 4YJSA 3TZ7A 3NWWA 4C58A 4E93A 4BDKA 4ZIMA 2CSNA 4TY1A 5CSWA 2QU5A 2YIXA 2HZ0A 4UWBA 4BCKA 4UWGA 4A55A 3CY2A 4Q2AA 4EH9A 3CTJA 2REIA 1YRPA 3A4PA 1H1RA 3QGYA 4MUQA 3RM6A 4YLJA 3TWJA 2DQ7X 3KU2A 2HIWA 3VULA 3GU7A 1XH4A 3P23A 5FXSA 4BBEA 4FEWA 2YWVA 2V7OA 4QTBA 4GUBA 3HKOA 4YJNA 4RX8A 2PE0A 1Y57A 3NUYA 3W8LA 1WVYA 4TKSA 3ZUVA 3DK6A 3S3IA 5C8NA 5I0BA 1OKZA 4APCA 5EK7A 2BAQA 4XEYA 2P55A 3GCPA 4ACDA 5AV2A 2XCHA 4EZJA 1PXOA 3BBTB 3O50A 3OAWA 1AD5A 4QDEA 3UDSA 3KXZA 3FMNA 4M84A 2J90A 2R3QA 4NYEA 4O0SA 1XWSA 3I60A 3U4UA 3UIMA 4P5QA 1IAJA 5AX9A 4RX5A 4DG0E 2EU9A 4JX7A 4FL3A 4KABA 3SG9A 4AQKA 4EQCA 2QOLA 1FGIA 3OXZA 3L54A 3AD4A 3P78A 3LFCA 3QYWA 4J8MA 3W0RA 4DGNA 2EUFB 4D58A 2OKRA 3MY0A 4CFVA 1W8CA 2JD5A 1H08A 1H1WA 2QCSA 4IFCA 5BVNA 4FV1A 5AP4A 4QP1A 1JKSA 2BZKB 4HYHA 5M08A 3I7BA 2DS1A 3Q6UA 5KMMA 3I7CA 3TNPC 3VUHA 4JIAA 2BRGA 3BL9A 1EH4A 3PRZA 1E9HA 1U54A 3P7BA 2XVDA 3ML9A 3BPRA 3MYGA 4BCFA 3I6WA 4PS7A 5HNIX 5A9UA 2W1FA 1KOAA 3M42A 3ZCLA 3EQPA 4AFEA 1QPDA 4FKVA 3LXPA 4JBVA 4YBJA 3NUAA 5FP5A 3LJ1A 4I6LA 2WXMA 4YJPA 2LAVA 3UJGA 4PL5A 4DF3A 5IUGA 4OTDA 1HOWA 2PMOX 2OIQA 3KEXA 1E7UA 3HGKA 3MS9A 5B2MA 4XBRA 4DFUA 3QARA 1H0VA 3VS6A 4DCEA 2BDFA 1KE9A 5K9IA 2XJ0A 2RG5A 4QP6A 1PW2A 4JT3A 4UWKA 4O6LA 5EDRA 1WZYA 2W1GA 3BL7A 1PKDA 3DZQA 4RWKA 2QVSE 1H28A 1UKIA 1W0XC 2XS0A 3CGFA 2YDIA 3P7AA 4JJRA 2X2KA 5AMNA 4R3RA 3OMVA 2ESMA 4AT3A 2VTRA 3DTWA 3ORNA 3ORZA 4EOKA 2FSOX 2C6IA 2G1TA 4YPSA 3HDNA 3OFMA 2VTHA 5KX8A 5HICA 5HCZA 1URWA 2PVNA 4I3ZA 3QCXA 4RWJA 4ASZA 2XNEA 4MD7E 3UOKA 2O64A 1P14A 2W0JA 1RQQA 3OZ6A 2PZRA 2X7OA 3VBYA 4D2SA 2JAVA 5DGZA 4L44A 5M53A 4XX9A 5K4JA 3V5WA 4BFRA 3F9NA 4FE2A 3SQQA 2YAKA 5CSPA 3T3VA 2JC6A 3LQ8A 4YJUA 3W33A 5HNBA 3F5UA 1WBPA 4QMYA 4Y5QA 3W0NA 3OOGA 4ANQA 4BTJA 2R7BA 4W8DA 3LOKA 5BYYA 5LVLA 1YDTE 2HW7A 4H58A 2W1EA 4JL9A 1JKKA 3QQFA 4USFA 1ZYCA 2E2BA 3TIYA 3A61A 3SXFA 4A9YA 2QR7A 4AGWA 4HVBA 2QOKA 2XB7A 3LFBA 1J7IA 1GIIA 3C0GA 3MA6A 3W0QA 2XANA 3LQ5A 3M2WA 3DZOA 4AGUA 2ONLA 3AQVA 2OJ9A 3MPTA 5E8WA 4AXCA 4RA4A 3PLSA 4I94A 4I41A 4G5JA 1SZMA 1Q5KA 2Q0BA 3KN6A 3FLWA 3UOLA 2QKWB 2Z2WA 2Y3AA 3HHMA 4NKSA 4HVHA 5GIPE 5CU3A 3IK3A 3IDCA 5IUIA 2VZ6A 4BCGA 5TF9A 4E8AA 3RPOA 4EWQA 2SRCA 2PE1A 2YFXA 4XHKB 3VS1A 4FLHA 2UW7A 3TNWA 3EFKA 2VTNA 2XNNA 4X2KA 4ARKA 3JUHA 4JS8A 3FZPA 2QLUA 3MB6A 3U51A 5E4HA 2BZJA 3COHA 5HO8A 3LMIA 2X6EA 2X39A 5JT2A 4DFZE 2YDKA 4U42A 3QTRA 4MWHA 4BCMA 3ZC6A 4BI2A 1RE8A 1ZMUA 4CQEA 5E8YA 3HRFA 5H9BA 3UDZA 3ZUUA 4WNPA 4A9SA 2UW4A 3PREA 2O65A 4BCIA 5LVMA 3NUUA 3FLYA 3L16A 3S95A 3ACJA 3ID6C 4CTCA 2JBOA 4FX3A 4KAOA 5D1JA 4AA5A 4E4NA 4CG8A 3EJ1A 4FSUA 3QQHA 5FEQA 1BKXA 3R8MA 2EWAA 3FEGA 1Y8YA 4FNYA 3OXTA 4FL1A 5K5XA 4BTMA 2V55A 3QZGA 4FKLA 3ZSHA 4I20A 4C2WA 4C4JA 4L42A 2VRXA 1JKTA 1U5RA 2E9PA 2F2UA 3NDMA 4XMOA 4XP2A 3UIBA 4K6ZA 5IF1A 1WBTA 4R7BA 5JZJA 4QOXA 3NVKI 4C4IA 4XOZA 5HIEA 3PLAE 5AP0A 4RSSA 1SM2A 4GYIA 4EHVA 4UY9A 4DC2A 2PMLX 3F2AA 5CQWA 1OL5A 3CR0A 3AKLA 2P2HA 4H3QA 4WSYA 3UQCA 3O71A 2YIYA 4ACMA 4C34A 2ZB0A 3PJ8A 4ZEGA 2UZEA 5AEPA 4QMPA 3FYKX 2XH5A 4BZOA 5KUPA 3S2AA 3RJCA 4BZNA 1OUYA 2QO2A 4F6UA 3MH3A 4RIXA 4C35A 1OECA 4AA0A 5AA9A 3DK7A 2ZFYA 4KRDA 1G5SA 4EHZA 3A7GA 3JY9A 4EOLA 4R7IA 3W8QA 3COIA 4A4OA 4O0RA 3IG7A 2O5KA 4C3RA 4EK5A 4NZWB 2RG6A 3FL4A 3QBNA 5I5ZA 5T3QA 4TUUA 4H1JA 3O8UA 4LYNA 1Q97A 4U80A 5FGKA 1H4LA 2C0IA 4G6OA 2VTOA 3E93A 1S9IA 2A4ZA 4D4YA 4F63A 2VWWA 3GOKA 1Z9XA 3DAJA 2B9FA 1UU8A 5E8TA 3TJCA 1CKPA 4DFYA 4XOYA 1IA9A 4U7ZA 3VS3A 4QTDA 2OJIA 3PWYA 2FVDA 4F0GA 3W1FA 4AXAA 5B7VA 4AE6A 4O7SA 4EH8A 2CKEA 2ZDUA 2UW3A 3FAAA 3KVWA 3V51A 2ZVAA 1XMLA 4FZDB 3V5PA 3QD3A 3R9HA 4YTHA 3VIDA 4GK4A 2VWVA 4IB5A 4LMNA 3R1SA 3R21A 3E3BX 1QL6A 2PWLA 3QL8A 4IMYA 3LM5A 4TWNA 2Q83A 2PUUA 3CPBA 2R3HA 3FI3A 2BCJA 3DKOA 4DITA 5TT7A 4EK4A 5E8XA 4FIFA 2YZLA 4FEXA 4UN0C 4F9CA 3L13A 4DGMA 3EQGA 1Q62A 2ZYBA 5CU0A 1M2PA 4ZMEA 4JI9A 3Q9XA 4NTTA 4PRJA 3BWFA 4E26A 1M2QA 3AG9A 4N6ZA 5EW9A 3E3PA 4BCOA 3CS9A 3H4JA 4PF4A 4RJ8A 5G6VA 3SXSA 5JFWA 3VJOA 5CVHA 1Q8UA 2XYNA 5IEVA 3QC4A 2C5NA 4O7TA 4XUFA 1Q61A 1PMNA 5JHBA 4GT3A 5JQ5A 3QLFA 4X6RA 4FKWA 4Q9SA 4ENXA 1H07A 2IG7A 4IADA 4FC0A 3HMNA 3PXQA 4C2VA 2CKQA 1QPJA 3QQLA 2BDWA 3RK7A 4RLKA 4DEAA 4IC8A 1XBBA 3L1SA 2RGPA 3AC5A 5L8KA 4GVJA 4LRMA 2QHMA 1MRYA 3R8UA 5BX0A 3LIJA 4EOIA 4B99A 2QC6A 3EN7A 3P5KA 4X3FC 3POZA 4PTCA 1O6YA 2XEYA 5B0XA 5FXRA 5IU2A 3G9NA 3E8EA 4IM3A 4QYEA 3AKJA 2RKUA 3OXIA 4RBLA 1KE5A 4BIBA 1KV1A 3A7JA 4IC7A 5CU2A 1Z57A 5GJDA 3RALA 3SD0A 2YHVA 3UVRA 4XG6A 5CVFA 3PE2A 4GW8A 4KIQA 3PA4A 2VUWA 1H1SA 4TNDA 4CGAA 3DBSA 4FHJA 1ZMWA 2GFSA 2WZJA 4FK6A 4DTBA 4ZJJA 5GNKA 2CHLA 3R8LA 4UWYA 4F0FA 2O0UA 3D5VA 4HZSA 2WNTA 3ZHPC 1OUKA 4MKCA 2VWXA 1CSNA 4I93A 4E5AX 4A4LA 4RFZA 4AOIA 3PSCA 1IAHA 3JXWA 2PVFA 4C37A 3GU6A 3OROA 3D7TA 5E7RA 4EK6A 5I4NA 2OXXA 2R9SA 3EQFA 4PTGA 2OLCA 2UZVA 5J8IA 4ITJA 4I23A 4JPSA 1H24A 4CLJA 4ZK5A 4IAYA 4YNOA 4AZEA 3IOPA 3PRIA 3ZUTA 3F6XA 4DH7A 1R0PA 2NPQA 4HGTA 2WXHA 4YNEA 3DNDA 3ORMA 1U54B 1O6KA 3Q5ZA 5DRDA 3PA5A 2XYUA 4DEIA 1Y8GA 4H39A 5AUWA 3HMPA 2ZV8A 5DI1A 5FG8A 4C3FA 4KUJA 5IQEA 5KMJA 3D15A 3DPDA 3SC1A 3EN6A 1K3AA 2XK3A 3KY2A 4GYGA 2BFYA 4XNEA 1DAWA 3LPBA 3PDTA 5CAOA 1FVTA 4X7QA 4APPA 5A4EA 3F3VA 4QQCA 4AZSA 4D4SA 4RJ3A 3F88A 4FEVA 2BHEA 3QRIA 2R0IA 4JG6A 2HY0A 4BCPA 2ITUA 5ANOA 3FPMA 4OW8A 2J9MA 1PMUA 1GY3A 3FSKA 3EFLA 4OBPA 4KINA 2OF4A 4K8AA 3HV6A 3S4QA 4AZVA 2RFEA 3ETAA 5ETFA 1SVEA 4IAKA 3R1NA 2VNYA 4QMVA 5L8JA 4PMPA 3WZEA 4L7SA 4M97A 5TR6A 4QMOA 4Y85A 3WZUA 3QKMA 4FIEA 4QRCA 3U8WA 2F2CB 3RGFA 2UW8A 2BIKB 2ITPA 4ERWA 2I7QA 3RPYA 5DT0A 5ETCA 2OZAA 3HYHA 4MXYA 3ZBXA 2QLQA 4YZ9A 4JDIA 3UZPA 4O2ZA 4QMLA 4YP8A 2WIHA 2JDOA 3QKLA 4WWOA 2RFDA 1SYKA 2UVYA 2VX0A 5HCXA 2B9IA 3V01A 3W2PA 1YWVA 3FI8A 5KBRA 4ASEA 2UW9A 3BU6A 4DBNA 4NM5A 4B0GA 2ZB1A 3VF8A 5HEZA 3UOJA 2HXQA 1E1XA 4FJVA 1H27A 1G8JA 4KSQA 5CEIA 5IH4A 5IQHA 1ZYJA 3Q53A 1BX6A 3GT8A 4FA6A 4M69B 5HG8A 2W1ZA 1KE7A 4DEBA 2J50A 2BZIB 5AUVA 4AOFA 3VQUA 1APME 2UV2A 3NZ0A 3WBLA 5BVFA 3BHTA 2P4IA 2ZMDA 3ORXA 2X8DA 5FD2A 3F69A 3O17A 2ITXA 3UVQA 1PXLA 4Y83A 3ZO2A 2YZAA 3C4WA 1ERKA 3AC8A 3PA3A 4NWMA 4HGEA 2ITNA 1W7HA 5CEOA 3UTOA 3NW7A 5F1ZA 3U87A 3R6XA 4AU8A 2C5VA 4DDGA 1UNLA 4EBWA 4O0WA 5IPJA 3DJ5A 1VEBA 3ERKA 4ANXA 3VBQA 1GZ8A 4OT6A 3CTHA 3Q9YA 5G2NA 3QTXA 4BB4A 3LE6A 1CKIA 2WMWA 2YAAA 4NIFB 4QP7A 3SOAA 4G16A 4GFMA 1OL2A 2XIXA 2GQSA 3KCFA 5GJFA 3VS5A 5CF8A 2C6MA 2V4LA 1Q8TA 4TV3A 5BVOA 3ORTA 3TJDA 4BYJA 4CFWA 4ENYA 4QYFA 2FSLX 3UMXA 4YLLA 2HZ4A 4FV2A 4F1OA 3FI4A 3ZEWA 4FG9A 3DB8A 4YTIA 2WKMA 4OTWA 2RF9A 2VAGA 5HX6A 3QAME 4AN9A 4EI4A 4LUEA 2YABA 3TJPA 4MCVA 2YIQA 5EYKA 4EUTA 5CI6A 5C26A 5CALA 4F9BA 2I1MA 2XK7A 4NJ3A 1H25A 2JKQA 3JPVA 3C7QA 3LW0A 5DG5A 1H0WA 3I1AA 5FLFA 5K3YA 4USEA 2GHLA 3QK0A 4F7SA 4FV4A 5E91A 2AC3A 4I6BA 4ONAA 3TV4A 3MA3A 1IA8A 2XM9A 3LJ0A 4R77A 3BHVA 1IRKA 4FV9A 2QQ7A 1H26A 5C8MA 1ZY4A 4DDIA 4M0YA 2ZMCA 3DFCB 2PVKA 4HJOA 4F7LA 4USDA 5C4KA 4E4XA 5IA2A 4QMXA 1Y91A 3P1AA 3VAPA 4HVIA 5IZFA 3Q96A 3DKGA 3RWQA 3W0MA 4RMZA 3SG8A 4DEEA 5JHAA 4O0YA 5LARA 4FICA 1U5QA 2WFYA 5A46A 2QURA 2VTSA 4FIIA 4N70A 3ENEA 4PNIA 5IEXA 4YO4A 3OTVA 3FC2A 3DKCA 2Y9QA 1JQHA 4O6EA 3RM7A 1ST4A 2ZJWA 3LZBA 3PVGA 4BI0A 1MP8A 4AWIA 3VUKA 1SVGA 2CN8A 4W4YA 2HK5A 3NYOA 5JGBA 3OW3A 4YSMA 4DN5A 4ANMA 3B2WA 2QOHA 3ORPA 1CJAA 5HVKA 4XG8A 2PY3A 2XK6A 4YZDA 5ANGA 5T68A 2G2FA 5EHOA 1JBPE 3TKHA 4D5KA 4U45A 2V0DA 2GDOA 4O7LA 4ZTRA 2OSCA 3HZTA 1K9AA 5F95A 1ND4A 2CNVA 1VZOA 2VTLA 2WU7A 2YA9A 3MV5A 4FGBA 4FTMA 4EC9A 1OGUA 2IVTA 3PJCA 4IVAA 3W2RA 2YWPA 3C50A 3ZXZA 4BDAA 4QMWA 1WVWA 4X3JA 3V04A 3FC1X 1WBNA 3ZRKA 5ANEA 5HVYA 3ZSGA 3P2BA 4XV1A 5BYZA 2ZOQA 3KRWA 4HCTA 4Q5EA 2JIUA 4GFOA 3U55A 2QO9A 3APFA 2F7XE 2ITWA 5CX9A 3ZBFA 2PZPA 2QOBA 3JY0A 4HGLA 4WNOA 3ZO4A 3QZIA 3HP5A 4ORKA 3ZW3A 5GINE 5HU3A 2WQNA 3BCEA 5JKGA 4EKKA 4V05A 4L23A 5HG5A 3D7ZA 3NIEA 2FYSA 3IW6A 2C0OA 2UZWE 5EM5A 3TNQB 4BN1A 2HYYA 3HV5A 3UZTA 4GKHA 4AJWA 4L3LA 5TOZA 4AX8A 4X2GA 4GEOA 3T9IA 1IEPA 3CE3A 3CD8A 2YCFA 5KHXA 4R3PA 3W0SA 2C4GA 2HZNA 3N51A 4JLCA 3GU8A 3GI3A 4TXCA 3ML8A 4IH8A 5HTBA 1ZYLA 4FMQA 5CI7A 4YPDA 5DLSA 4M7IA 1CKJA 2VO3A 5DPVA 4QYHA 3GQIA 4HVDA 4ZY6A 4BY9E 1FMKA 3FLQA 3VWAA 1ZAOA 2OWBA 1OKVA 4U6RA 4PY1A 1ZLTA 1JSUA 2J51A 2Q0NA 4L67A 1JNKA 3QUDA 4FTAA 4JDHA 3PJ2A 4XG9A 4IB3A 5EQPA 2OFUA 2VV9A 2BPMA 4TNBA 3O0GA 3PY3A 5J95A 5CSXA 3R00A 4J97A 3ORIA 3BRBA 3V5LA 4PQNA 5KZIA 1A06A 3R02A 2ITVA 1SNXA 4ITIA 1G8SA 3DBQA 4H3BA 5EQYA 1X8BA 2AEGA 2WMXA 1R39A 3LJ3A 4PV0A 4S33A 5KCVA 1Q8ZA 3CKWA 5DR9A 5KZ0A 4B9DA 5M44A 1V0PA 3R1YA 2R3JA 3PJ3A 4BZDA 4GMYA 5CF5A 4CVAA 3KRLA 5IQDA 2J2IB 4O84A 4DFNA 3K5UA 3PZEA 2EXCX 4XX5A 4FIHA 3L8VA 5HE1A 3D83A 1XBAA 3PJ1A 3ZLYA 3KB7A 5AP1A 3D7TB 3IW7A 3FWQA 5HE2A 1OITA 1SVHA 2WEIA 3OCSA 2UZNA 2H96A 3RHXA 2VO6A 3UMWA 1JSVA 3W10A 4C33A 3VBWA 2X1NA 2WXLA 4IVCA 4KBCA 2YJRA 2C5XA 4ANWA 3MTLA 4F1SA 3Q2MA 5FRIA 3MJ1A 3VS4A 4TRLA 4FYNA 4C62A 5KKRB 4WAFA 5A4TA 3NYNA 2HXLA 1U46A 2WMVA 1WMKA 4TYEA 3FSFA 4Z16A 3A8WA 3QKKA 3BWJA 3MH2A 4YR8A 5KMIA 5EYDA 4QP4A 4QMUA 4PDOA 4GS6A 3GP0A 4L53A 4AE9A 1XH5A 2GHGA 4AZFA 5HO7A 4YZBA 2QOFA 1OPLA 4S34A 4BJJA 4FVPA 2R7IA 3G33A 3QUPA 3WIGA 1QPEA 1L8TA 1ZOGA 2IPXA 1CM8A 3OEFX 3R01A 4WD5A 1JWHA 2LGCA 3DY7A 2XIZA 3QTWA 5DWRA 4ALVA 3IPHA 4U43A 1H00A 1YHWA 4I4FA 5E1EA 4DGOA 5JFXA 3TIZA 5EW8A 2R0UA 3CD3A 3UBDA 1URCA 1Q24A 2WPAA 4FBXA 4JRNA 4EHGA 4IWDA 2GPHA 2YDJA 3ACKA 3QCYA 1YWRA 4BCHA 4O7YA 1IG1A 2HY81 1ZZ2A 3FMEA 4FSTA 1T45A 2GNGA 4XP3A 5CSHA 3UNJA 5A4LA 2GNFA 2R3OA 5D11A 2R3PA 2A19B 4GB9A 3E63A 3LHJA 3VUIA 2OZAB 2I6LA 3WF5A 3PSBA 1V1KA 4DFLA 3MH0A 3MN3A 4V01A 4U8ZA 3Q6WA 3I81A 1RJBA 4FT3A 4HCUA 4XRJA 4KZCA 5D9HA 3VQHA 4XS2A 3VJNA 3HLLA 4RVMA 5KE0A 4RFMA 5ITAA 1ZYSA 1E8YA 3UVPA 1REJA 1Q8WA 2OXDA 2VWUA 4G3FA 4NCTC 2GQRA 2FO0A 4G3DA 2CCHA 4WRGA 3BYMA 3DDQA 3G0FA 3EL7A 3QX4A 3PTGA 1K2PA 2WQEA 2QKRA 3C51A 5LCJA 2VTJA 2HZIA 3AMAA 4MVFA 2A1AB 4V04A 2X9EA 5CT7A 2IZRA 4DH1A 2O2UA 2UVZA 5HD7A 4FSNA 3R63A 4BCNA 4OBOA 2QO7A 5ENNA 2IVSA 4BGQA 3P5JC 3GNIB 4IWQA 4IW0A 4NJDA 3DXNA 1O9UA 4S32A 3FZOA 4TT7A 5AAEA 3TACA 1J7LA 4QYYA 2WXPA 5HCYA 3ZYAA 3NMUF 2GMXA 1DS5A 5T8IA 2W7XA 3TCPA 4AW5A 4X2FA 2JIIA 2QOIA 2CGWA 4I0TA 4GU6A 4WHZA 2F7EE 4R3CA 5EI6A 3DXQA 4GT4A 5D12A 1Q4LA 5HU9A 3CEKA 1M2RA 4L2YA 2NO3A 2J0LA 1Y6BA 2XKCA 4CRSA 4E20A 5BNJA 4ZTSA 5CS6A 1F3MC 4GJ3A 3VUMA 5T6KA 4AXEA 3F2NA 4H3PA 3ROCA 3MFSA 2QI8A 4G3GA 3T8OA 3ODYX 4EZLA 5AP6A 2A4LA 2KULA 4UWFA 5AM7A 3GCQA 4HYSA 4CD0A 5AA8A 3APCA 3HAVA 2CMWA 5HORA 4U41A 4AGCA 2WELA 2W9FB 3QRJA 1REKA 3EQHA 5H8BA 4C4HA 3ALNA 4WKQA 3R9DA 3DB6A 4LI5A 3TNHA 4II5A 3LM0A 4YJRA 4IAAA 2UZOA 4LL0A 4IANA 3R9OA 4D0XA 5IMEA 4UYNA 5L2TA 3OEZA 5KMOA 2XKFA 3GU4A 1QPCA 3W0OA 3KC3A 5M56A 3ZH8A 3NZUA 4FKIA 2WTKC 4FNXA 3GC0A 4E5WA 3ORLA 4EKLA 4PMSA 3SX9A 2HAKA 4L8MA 3O8PA 4D9UA 2PPQA 4IIRA 1PXMA 1PYXA 4LM5A 2UZLA 4GIIA 2KTYA 4LFIA 4OTGA 1PHKA 3F3TA 3RWPA 4A4XA 1YHVA 4JG7A 3V8TA 4QPSA 3NNUA 5AFVA 4LOQA 5ANDA 4KZ0A 4JQ7A 2PZ5A 4MEDA 4TYHA 1YXSA 1H8FA 3FV8A 4FTKA 3RPSA 5D7AA 3CIKA 4K33A 4AAAA 2F7ZE 3QHRA 4WBOA 4XG3A 4XG2A 2ITYA 2C3IB 5HLPA 4RQVA 4PP9A 3F5PA 3ZS5A 4AW0A 3NSZA 3UDTA 4EOMA 3NCGA 4U97A 4YURA 4ANUA 4NFMA 3QTIA 4R7HA 3VRYA 4NKAA 5J87A 1PKGA 5TO8A 4RC3A 1E8ZA 4FT9A 3N9XA 3CC6A 3QTUA 1OL6A 2PMIA 4RWIA 4DBXA 1UWHA 4LRKA 4DEDA 2IW8A 2J0KA 4YHTA 4AN3A 3Q4UA 3WIKA 3HUCA 4ZZMA 4FJZA 4P90A 4FTCA 3QC9A 2JITA 3NS9A 3LFEA 4F6SA 4WUNA 1JPAA 3FQEA 3K2LA 3I6UA 3FQSA 2VU3A 2ZDTA 3EQDA 4MBIA 4EZ5A 2ZV9A 4GSBA 3II5A 3EQBA 4JBQA 3SOCA 3FXZA 3NVMB 2GS7A 3QGWA 4BDCA 3PWDA 5CF6A 3QQGA 5EHYA 5FP6A 2C5OA 3HIZA 2PU8A 4BR3A 1LR4A 1M14A 1PXNA 4FUYA 4FA2A 3BI6A 3G5DA 2BTRA 5LOHA 1SNUA 3H0YA 3UC4A 4GV1A 4RGJA 2WXKA 2ITOA 4CKRA 4L3PA 5A4CA 1TVOA 4I5HA 2WTVA 4FV3A 3RMFA 5G1XA 4BF2A 2WTIA 2X81A 4MQ1A 3PY1A 1NVRA 5E8UA 3V6SA 4F08A 3EN5A 3C4XA 5J9YA 1YVJA 4MXCA 4MNFA 4DH5A 3B8QA 4IFGA 2XJ2A 5EH0A 3TEIA 1XKKA 2R3MA 3FLZA 4O0TA 1IR3A 5BUEA 4ZTHA 4UEUA 4ZJVA 3O23A 2CGXA 5CLPA 4EL9A 3DV3A 3HNGA 2OW3A 1OKWA 2ITTA 3CSVA 4GCJA 2BRBA 4CMOA 4D1SA 4X21A 1NY3A 4JR7A 3F3ZA 3FXWA 4HNIA 3ZC5A 4YJTA 2QOCA 5JMSA 5HZNA 3MIYA 3PYYA 4AUAA 5B2KA 3RVGA 3AOXA 4BDHA 3MVLA 1FGKA 3GBZA 4FTIA 3UP2A 3UG2A 4MH7A 2QHNA 2JAMA 3GCVA 4XP0A 1V0BA 3QA8A 2H6DA 4Y5HA 5DVRA 4D55A 5M4UA 4ID7A 4QMQA 3BEAA 3Q4TA 4E6AA 3GFEA 4C4EA 5IQGA 5DR6A 1B6CB 2ETMA 4H1MA 1OB3A 2Z7QA 5AADA 3UPZA 5FTGA 1OVEA 3EKNA 3KA0A 2WXGA 4RVKA 3TUCA 2GCDA 4LQMA 4CFFA 2PE2A 4BDBA 5H2UA 3GFWA 1J7UA 2VTPA 3L9MA 3FY0A 3QAQA 4FTNA 5A6OA 3BE2A 4MAOA 4FSQA 4MNEA 4I0SA 5HVJA 2X0GA 1UU9A 2B54A 3PXRA 4KRCA 4QNAA 3ULIA 2QG5A 3PY0A 5I9WA 4L6QA 4FKGA 3WARA 4BTFA 2YM6A 1OKYA 3KMMA 3TZ9A 3PIZA 3PXKA 4EZ3A 5KMLA 3R7RA 2NP8A 5IQAA 3ZO3A 4AXDA 4BCQA 3NFFB 5DOSA 1GZKA 1E90A 3UG1A 2W1HA 2UZBA 2X6HA 2C0TA 4FZFB 4MQ2A 1KWPA 1QCFA 1LP4A 3HRBA 4E7WA 3U6HA 4GT5A 3MESA 5CEMA 5HHWA 2OICA 2WXIA 3L9LA 2XNBA 3TV7A 4XRLA 4Z9LA 4RJ7A 3MY5A 4CSVA 3R8PA 5LMKA 4JQ8A 4CEGA 3G2FA 4E6DA 3WILA 1STCE 4U40A 2HW6A 2P33A 1R3CA 3G51A 5AP7A 4F9YA 3LXKA 4IDTA 4D4RA 4CNHA 3C4EA 4MTAA 1LEWA 4CT2A 4WNMA 4E73A 3FKNA 3GB2A 4G3CA 2JFLA 2IN6A 3IKAA 3AD6A 2ZM4A 3POOA 3QXPA 1XJDA 4CMUA 4ZLZA 2B52A 5DE2A 4UWCA 2E9OA 3ZFMA 4PWNA 4Z3VA 2WMTA 4CXAA 3IQ7A 2VX3A 3GENA 2OI4X 3KCKA 3DA6A 2GNIA 4B8MA 4EJ7A 2JIVA 1A48A 4IJ9A 4IZ7A 4C7TA 1HCLA 4C4GA 2WTDA 4YZMA 3AXWA 3LMGA 3EN9A 3UQFA 3WZDA 3QU0A 2JKMA 4FV8A 1XH7A 4BJJB 4ACHA 1ZOEA 4NH1A 2P3GX 1PMVA 3WF7A 3PSDA 3BU5A 3FMDA 4KD1A 3PFQA 2FUMA 2CNUA 2GTMA 4HLEA 4M15A 3R7IA 3WZKA 5I9YA 3R7OA 3TKUA 1MRUA 5IA0A 3MDYA 3LXNA 4IX5A 2IZTA 3RCJA 1J3HA 3UYSA 1M7NA 2YERA 4G5PA 2IVVA 4S30A 1NVQA 4X2JA 3VW8A 5EHLA 3EYHA 4F70A 4M8TA 4GG5A 4N6YA 3D14A 3D94A 3W2QA 5IDNA 3ELJA 4IM0A 5E8VA 5FBNC 1YXXA 5IA3A 3LXLA 4ANSA 2CKOA 1R0EA 1VYZA 4WG5A 2OGVA 3H9RA 4KSPA 4J6IA 3DLSA 3KRRA 4GK3A 3KL8A 3KK8A 4NK9A 2ERZE 3KGAA 3EQIA 5FM2A 4DLIA 4RIYA 3PUPA 4ALWA 2X6FA 4KKGA 2HWOA 4QYGA 3DAKA 5CEQA 3O8TA 2PTKA 4MXOA 3AGMA 3PRFA 4L45A 3F3WA 5AAGA 2VGOA 3MVJA 3H0ZA 3MB7A 5GJGA 3ZOSA 1PF8A 4EH5A 3OD6X 1P4FA 3UOHA 1M17A 4NL0A 3RAKA 3RPVA 4Z7GA 2JKOA 4X2NA 5FM3A 4CFXA 3ROYA 5CEKA 2V22A 5C1QB 1OI9A 3OUNB 5HTCA 5LVOA 5J7HA 4AA4A 5K5NA 4IHPA 3C5IA 4YHJA 2Y6MA 2GQGA 4UV0A 3S1HA 2ZM3A 3ENMA 5E9EA 3U9NA 4GRBA 3RZBA 1NVSA 3ANQA 2ACXA 4FEQA 1BYGA 1CDKA 2XCKA 1WBVA 3R7EA 3SD5A 4BKJA 5EYCA 4FZAB 4EHEA 3AC1A 3AT3A 3QLGA 5HX8A 1LEZA 5BUJA 2XIRA 1OPJA 3K3JA 4EH6A 4IB0A 3QZFA 4F99A 1JOWB 2XARA 2YJSA 2IZUA 3W32A 4ITHA 3V3VA 4FNWA 1PYEA 2XNPA 4GG7A 2VNWA 3R83A 2OH0E 3C4FA 2WOUA 4EWHA 4K77A 4DGLC 2YACA 3NR9A 2YIWA 3PVBA 4WOVA 3ZDUA 2RIOA 2F4JA 2A5UA 3DK3A 4JBPA 4AGDA 3FLSA 3NUXA 3QTSA 4EZKA 2WMBA 3PG3A 4LGGA 5H8GA 5L6WL 4BRXA 3C4CA 4WIHA 2PHKA 3NIZA 4LG4A 1GOLA 4E5BA 4I5CA 5DT4A 3GVUA 4EJNA 2C5YA 4MBLA 1PXPA 4YLKA 4QMNA 4X3FA 5EI8A 4JG8A 3AMYA 3TI1A 3COMA 2OJGA 3Q04A 4Q9ZA 4OVVA 4QP2A 4D4VA 3DJ6A 3BKBA 3LFQA 4FV7A 1OIQA 4LRJA 4NM0A 2I40A 4UBAA 4F9AA 4M68A 2ETRA 5EOLA 4D5HA 3ATTA 2PULA 4ZLYA 1PRYA 1IASA 1O6LA 1F5QA 3BGPA 3DCVA 3PG1A 4RJ4A 3RNIA 3V8WA 3F7WA 1H1QA 1RDQE 2VTTA 4FKOA 4AXFA 1PJKA 3R73A 2NYAA 1VJYA 1MQ4A 4FL2A 4DA5A 2CGUA 3Q9ZA 3QTZA 3UNZA 3MFRA 3IHYA 2DUVA 2PUNA 3K3IA 3QCSA 2GS6A 4L9IA 3BGZA 4ZJIA 4ZOGA 4BC6A 5A54A 5KMKA 2BUJA 5AIKA 2E9UA 4L68A 2OIBA 2WXQA 3DGKA 5IISA 3HAMA 2W4KA 5JGDA 5CVGA 4RLLA 5EKNA 5IH5A 4UXLA 3H3CA 3ZFYA 2BALA 2WB8A 1WAKA 2G2IA 3TKIA 4MX9A 1NA7A 2XRUA 3F5GA 3FI2A 2XIYA 5I9UA 5ACKA 3C5UA 5BMSA 2CPKE 2I0HA 4DEHA 1PXKA 3MFUA 4G6LA 3D5XA 3OCBA 5F20A 4TYHB 4BHNA 4R78A 3TMOA 5KHWA 4FIGA 4FVRA 4WBBB 1YI6A 4ZSEA 2RL5A 4NTSA 3COKA 1W83A 4AG8A 4I24A 3KK9A 4L00A 4RC4A 1FVRA 4B7TA 4FTRA 4RVTA 4BIDA 5M09A 5EW3A 5CF4A 5IG1A 2QODA 4L52A 3GC7A 3DKFA 4TYJA 4B6LA 5KNJA 3R04A 1YI3A 3IW5A 4XLVA 3A2CA 2G2HA 3N4UA 4X6QC 3PP0A 1VLRA 3F61A 5DH3A 3UO6A 3VRZA 3GQLA 4DH3A 5EDPA 4UWLA 2IWIA 3QRKA 4FT7A 2UUEA 5CTPA 4IZ5A 2CNQA 4M12A 4U0IA 2UZDA 3R2YA 5C4LA 4JIKA 4HCVA 3EYGA 5HBEA 3FDNA 4NSTA 2C3JA 3AD5A 3NUPA 3TT0A 3VUGA 4RVLA 3QRTA 5IMXA 3OT8A 2X6KA 3DBFA 2HELA 5DIAA 3E8CA 4DFXE 4EQUA 2QONA 3L08A 5AV0A 4NM7A 5JZNA 2XBJA 5DRBA 3NYXA 5HBHA 2XALA 5KMNA 4DGGA 4RJ6A 4TWOA 5DYJA 4GH2A 5HD4A 3LJ2A 1ZZLA 4HGSA 2C6LA 4RQKA 2XBAA 2CKPA 3KXGA 3LMHA 2G01A 2QOQA 4W4VA 5F9EA 4XZ4A 3GOPA 3IW4A 2FA2A 1UU7A 1DM2A 4FKSA 4YJVA 4WO5A 5A3XA 2Z7RA 3W55A 3OCTA 2VTIA 4K18A 4O81A 1M7QA 2IO6A 3NCZA 3BYUA 3D4QA 4P5ZA 3VHKA 1WBOA 2EB2A 2J5EA 1RW8A 4FK3A 4DINA 4FEUA 4CKJA 3NX8A 4Q5HA 4IAZA 1FMOE 2I0EA 3GGFA 4RIWA 3VS2A 5HI2A 3VF9A 3P4KA 4O0UA 4OTRA 3TZ8A 4E1ZA 3S0OA 3D5WA 3WF8A 3OF0A 4PL4A 4P4CA 4WT6A 3CCNA 5KO1A 3APDA 1NT2A 4ZAUA 2X8EA 1PY5A 1E1VA 3ZM9A 3O51A 1MUOA 2J0IA 3BHYA 4JBOA 1BL6A 2IZSA 3NPCA 3DQWA 4OUCA 4R5SA 5ETAA 3VNTA 1CTPE 4Y8DA 4TN6A 3SDJA 2XP2A 1ZRZA 5IH6A 5E8SA 3H9OA 5CAQA 2YM7A 4FKTA 3G90X 3QF9A 3SW4A 4CFUA
chains in the Genus database with same CATH topology
3DFAA 2FB8A 3AC3A 1GIJA 5J5SA 5EM8A 2G15A 2P2IA 3BX5A 3LLTA 5AV1A 5CQUA 3BEGA 4CFMA 4QTEA 3KXXA 4LV7A 4ZS0A 4LOOA 5L2WA 1XBCA 3NNWA 4F78A 3ET7A 3OW4A 3VBVA 5J1VA 3IOKA 3G6GA 3NAXA 4O0VA 2NRUA 1XH9A 4QT1A 4ZMFA 3LCDA 5M4IA 4AACA 2HWPA 5L8LA 5HE3A 3R7YA 3ALOA 4KB8A 3ZLSA 5DBXA 4OBQA 3CKXA 2WAJA 1W98A 1Q99A 4MNEB 4ACGA 4XG4A 3SGCA 5AUUA 3I79A 5LVPA 1OIUA 3QHWA 4HYUA 3UYTA 2OH4A 3Q4ZA 3EKKA 2JFMA 3KF7A 4FGRA 3RNYA 3QRUA 1YHSA 2WHBA 3A7FA 4I5MA 4BDDA 3BYOA 4RG0A 4CG9A 4DCAA 2VWYA 3PXYA 3GCSA 2W4JA 4CFNA 4O38A 1UU3A 4FOCA 1R78A 2Y6OA 1OL1A 3AC4A 3NUNA 4O2PA 4Z7HA 2B9HA 3FKOA 3HECA 4IJPA 4U3ZA 4EH4A 2BTSA 2XRWA 2Z60A 4Y46A 4F7JA 4ZSGA 4DYMA 3SXRA 2BIYA 2XJ1A 2PL0A 2XF0A 4E6CA 3WYXA 3CPCA 3I0OA 2PVMA 4IDVA 3A4OX 4OLIA 1MQBA 4RWLA 5CAUA 2OK1A 4PP7A 4OTQA 3Q5IA 3IW8A 4L7FA 4O22A 3GXLA 2BAJA 4KS8A 2VWZA 2OXYA 3U4WA 4B4LA 2PYWA 2JEDA 3QQUA 3OWLA 4LMUA 3BLQA 4EQMA 3KULA 1OBDA 2JDRA 2IW6A 4MD8E 1M52A 4BICA 1YOJA 5CEPA 3ANRA 4LV5A 4JXFA 2AUHA 2OFVA 3P79A 4FG8A 4N4SA 5EKOA 2WIPA 4O7RA 4ZTNA 4BTKA 5K4IA 3WE8A 4FNZA 2UVXA 1YW2A 2XUUA 4OTIA 3HDMA 4BDIA 3EFJA 2W9ZB 4AAYA 3OBJA 4F1TA 3DBCA 1YKRA 3TN8A 3D0EA 3G9LX 4DTAA 3N4TA 5M07A 4EK8A 4I6HA 3PFYA 1OM1A 3HP2A 2QU6A 1J1BA 2I0VA 2R2PA 2W1DA 3IGGA 3KXMA 1AQ1A 4FOBA 2BHHA 5HGIA 4M67A 3W16A 3NGAA 3D2IA 5EDQA 3KN5A 3MJ2A 4QTAA 3BE9A 4DLJA 3RCDA 4ZZOA 2WMQA 2O8YA 4IZAA 4IM2A 3BIZA 3KQ7A 5DR2A 4ZSAA 5M4FA 5BVWA 1BLXA 2OIDA 3G6HA 3D5UA 2C6TA 3SAYA 3F7ZA 4MHAA 2ZV2A 5JSMA 5EI2A 5CZHA 5AV3A 4RIYB 4FKJA 4RIOA 3IDBA 3LKMA 3QWJA 4FIJA 5AJQA 4MK0A 4G2FA 3ZEPA 3BLRA 4FG7A 1TQMA 4HW7A 3RHKA 5CWZA 4DG2E 3JVSA 3FYJX 2PVYA 3FHIA 4K11A 4TW9A 4RA5A 4C36A 3KVXA 1YDRE 4FV0A 4EYMA 2BFXA 4EH2A 4XH6A 3ZDIA 4I4EA 1YXTA 3FMJA 3C9WA 4CCUA 3BQCA 3E7VA 5CAPA 5EYMA 2ONLC 3HL7A 4ANBA 3E92A 3L8PA 4XYFA 3CBLA 2R64A 5EQEA 3R8ZA 3DAEA 3V8SA 4FV6A 2J5FA 4GFGA 5D41A 4EONA 3Q4CA 2OJJA 4C61A 4UB7A 4F9WA 3T9TA 4TL0A 2W5HA 3MW1A 5M4CA 3O5AA 3QUEA 1G8KA 5CY3A 3NW5A 4IBMA 4ZSLA 5C9CA 4I92A 4CTBA 2H8HA 4P2KA 3FPQA 4DFBA 4EORA 3F3UA 3TUDA 3TYKA 3I5NA 4LL5A 3LVPA 4Y95A 3W2OA 4HNFA 4O96A 2YCRA 3EL8A 2W4OA 1GIHA 2JKKA 1ZMVA 4MD9E 1TFFA 2XM8A 5D10A 3A99A 2C6OA 1XR1A 1SMHA 3VUDA 3R9NA 3RP9A 2PVLA 2W17A 4QP3A 5FUTA 4FTQA 3R22A 4U9AA 4X3FB 4YU2A 2XNOA 3DXPA 3H30A 3HVCA 4K1BA 1JAMA 3EQRA 2VTAA 4KS7A 5E90A 4QMSA 2IJMA 3TDWA 5CANA 5HIDA 1DI9A 3BYVA 3P0MA 4KKHA 3B2TA 5A4QA 2QOOA 4C02A 1AGWA 1UA2A 3L9NA 2AC5A 3LCTA 1GJOA 2B9JA 2Z7SA 4M13A 3EH9A 4EOJA 2XEZA 3DPKA 4EEVA 3Q2JA 2Z7LA 2Y8OA 3VS7A 3WI6A 3HEGA 1BI7A 4G17A 3RI1A 2F57A 3OWKA 3NNXA 3HMMA 3FLNC 4V0GA 2JLDA 1CMKE 2XKEA 3JVRA 4GU9A 4TPTA 2H9VA 4BGGA 3L8XA 2HCKA 4IWOA 3OTUA 3ZRMA 2W5BA 4ZTQA 5JRSA 2CJMA 2R3IA 3A60A 4N0SA 4NW5A 3HV4A 3R1QA 3HUBA 3OY3A 3PZHA 3QTQA 5IEYA 2WMUA 2UW0A 4A06A 5JK3A 2WMRA 1FVVA 4O27B 2XMYA 4GIHA 5CYIA 1Z5MA 5FQDC 5FTQA 5IQBA 3EMGA 2BILB 1GAGA 2PVJA 2W96B 3DTCA 3PXFA 5GIOE 2C6DA 4EUUA 3QQJA 4XG7A 3TZMA 1BMKA 5FDPA 3RPRA 3ZMMA 2YCQA 5AX3A 5L6PA 1W84A 3NNVA 2PVHA 4O7VA 5HBJA 3OP5A 3FY2A 3QWKA 5HG9A 2BRHA 2BROA 2JDSA 3BZ3A 4FSYA 4JRVA 4DG3E 1YQJA 5JFVA 3FZSA 3U6IA 3LFDA 1ZYDA 3QALE 2XK9A 3PUFC 2YISA 1V0OA 1WBWA 2B0QA 1VR2A 3EHAA 1UNHA 3KRXA 3R8VA 4EC8A 3SA0A 4YO6A 2ERKA 4F7NA 2XNGA 3NLBA 5C03A 5A6NA 4N57A 3V5JA 4ZY4A 5LJJA 3ZFXA 5AM6A 1A9UA 3ODZX 1W82A 4K2RA 3UO4A 3AMBA 4IX4A 2W99B 3ZU7A 4HOKA 4L43A 4XCUA 2PUIA 2YCSA 2ETKA 4FSWA 4UALA 3LFSA 2QG7A 1HCKA 2R3NA 5DEYA 1WVXA 1VYWA 4D2RA 4YJQA 2W06A 3KIOC 3ZLWA 3U54A 1U59A 1QMZA 3EQCA 3D2KA 2A0CX 1YXVA 4WRSA 3SKCA 4BDEA 3THBA 4C4FA 2C3KA 3R9RA 4YZNA 5HNGA 3TL8A 4JX3A 5AAFA 3VHEA 3C0HA 2VTMA 3OWJA 3WYYA 3ZZEA 5AP5A 2X9FA 3MFTA 2XK8A 4WNKA 3T3UA 5FXQA 4EH7A 1PMEA 2J6MA 4J53A 5AUZA 2GNLA 1KSWA 5CENA 3F5XA 3CJFA 2CCIA 3NW6A 4FSZA 5FDXA 2WMAA 4EK3A 2VX1A 2XIKA 4QDVA 4NFNA 5HKMA 3E5AA 4RIWB 4XV9A 4NCTA 4TZRA 5CASA 3FE3A 3QQKA 4J95A 4DEGA 1JLUE 5IQCA 4KBAA 3UODA 1WBSA 3CJGA 5M06A 2O3PA 3DS6A 4F4PA 5DHJA 4QTCA 4I22A 4R5YA 2OJFE 4I6QA 3OC1A 3FMLA 4FTTA 4O83A 4YJOA 5DFPA 3AC2A 3E88A 3SV0A 3FZ1A 4DT8A 5LMKC 1XQZA 4I21A 5LWNA 4FSRA 3N4VA 3EZVA 3P08A 1WCCA 3GU5A 4UYAA 2WMSA 4F1MA 3ULZA 3KXNA 4U79A 3M11A 4GVAA 4X0MA 5J9ZA 3O96A 4FKQA 3VVHA 4WUAA 4CKIA 1U4DA 3C0IA 3HV3A 4FTLA 4DHFA 2BMCA 4KA3A 4TTHB 5DNRA 3DJ7A 3NFGB 2B1PA 2CN5A 4JAJA 3TNIA 4F6WA 1FINA 4RT7A 3Q3BA 3MVHA 3WZJA 1H1PA 4ALUA 4YSJA 3KRJA 4AOTA 4JMQA 2C68A 3KREA 3R7UA 2JBPA 3IO7A 3S2PA 5AUYA 3BHUA 4UX9A 5HIBA 4AOJA 2ZM1A 4TYIA 5JH6A 4L46A 3TTIA 4FUXA 4BDJA 3BBWA 4EOQA 3BU3A 3EN4A 3R2BA 1TQIA 4IZYA 4L3JA 4AP7A 2JGZA 5DN3A 4FTJA 5L2IA 4IX3A 2FSTX 4QMTA 4IQ6A 4KNBA 4XV3A 1WFCA 3TUBA 3R0TA 4QMMA 2YEXA 5AWMA 4O0XA 4YTFA 4J8NA 5CU6A 4M14A 2Z02A 3ZXTA 2C69A 4UXQA 2V7AA 5KKRC 3O7LD 3DT1A 4E6QA 5C27A 4PUZA 1Q3DA 3UC3A 2J0JA 3WE4A 5BVDA 5J9LA 3WOWA 1JKLA 1OL7A 5FBOA 2VO0A 4BHZA 4C3PA 3O7LB 4CV9A 1BI8A 5CAVA 1I44A 4MF1A 3BV2A 4BIEA 5IA5A 3DOGA 5FEEA 5HE0A 3JS2A 3R28A 4FT5A 3KULB 4O7NA 4FKPA 2GU8A 3RK9A 4A9TA 4ZTLA 1TQPA 3FKLA 3MSSA 1XHAA 3BGQA 3A62A 4MXZA 4FTOA 5HESA 4K0YA 5KBQA 3ZZWA 3MY1A 2UZTA 4PMMA 3UNKA 3GC8A 3NEWA 1Y6AA 1P4OA 2JDTA 2HENA 4Z55A 3LCKA 2W5AA 3CLYA 5BQ0A 2Y4PA 2V5QA 4WG3A 2OZOA 3E87A 2JDVA 3EWHA 2WQMA 3UDBA 1KV2A 4U5JA 4QP9A 4TYGA 3SRVA 3FJQE 4AF3A 3UP7A 3MIAA 4LV8A 3RTPA 1ST0A 3ZTXA 2PSQA 2XZSA 2VWIA 4AN2A 3MWUA 4Y72A 2YM8A 4G9CA 3MPMA 4DTKA 2DWBA 3ZRLA 3CY3A 3FMKA 3RKBA 3DQXA 1G3NA 4O7WA 1BL7A 2BKZA 2X4FA 1JSTA 5CNNA 5M57A 1XO2B 3Q9WA 4CZUA 3UO5A 4WG4A 4LUDA 4J96A 5AV4A 5IA4A 4PTEA 4CLIA 4ZSJA 4G31A 2J0MB 4HVSA 4MYGA 4FVQA 3VONA 5FTOA 3RINA 1YDSE 3R71A 3EZRA 4MBJA 3FQHA 4AFJA 3DLZA 3LFNA 4KWPA 4J98A 5E92A 2E9NA 2G9XA 2QR8A 2Y4IB 2QNJA 3QA0A 2OG8A 4AZWA 2YN8A 4FTUA 4KIPA 1F0QA 4DHZA 2RFNA 3BLHA 3KKVA 2J7TA 3TV6A 4FODA 2B4SB 4KIOA 2YM4A 3ZSIA 3BQRA 5BVKA 4R1YA 3MVMA 5BYLA 1FQ1B 2ITQA 4PMTA 3CTQA 4A9UA 5JFSA 1OIYA 2W1IA 5L6OA 5F94A 1KE8A 4GUEA 4F64A 5DA3A 1ATPE 1PXIA 5EM7A 3IONA 2RFSA 2YITA 3LQ3A 2VO7A 3PPKA 4FR4A 4J7BA 4JDKA 4UWYA 1TKIA 2WQBA 5ANJA 3UGCA 4MXXA 4MXAA 1NXKA 3RAWA 3I0QA 3ZO1A 1XMMA 4FKRA 4QPAA 2BZHB 2C1BA 3DU8A 5IDPA 3BHHA 2X7FA 3NUSA 3HRCA 3KMUA 3OS3A 4DE4A 2PK9A 4PDSA 1J91A 5LCKA 4TWPA 2Z8CA 4OR5A 2FGIA 3HA6A 3D9VA 4J99A 3DBDA 3TG1A 4E4MA 1Q3WA 2P0CA 4R6VA 4EOSA 3AKKA 4D9TA 3RAHA 2X4ZA 2XAMA 5JRQA 4GK2A 3W0PA 4LDTA 2WXVA 4KBKA 3I4BA 3IDPA 4XBUA 3CGOA 2F9GA 3OCGA 4Y73A 5DT3A 2GNHA 5EOBA 1UV5A 3RK5A 3EOCA 4ZP5A 3PPZA 3S00A 5A14A 1Q8YA 3L8SA 4LGHA 4ZTMA 3A7IA 5E1SA 2ZAZA 4HZRA 4U3YA 4BDFA 5C01A 4ZY5A 5ICPA 1UVRA 2H34A 5IUHA 5F4NA 5BV3A 1OPKA 4IB1A 4RFYA 4ASXA 5J1WA 2VN9A 1LUFA 4R1VA 4H05A 2BAKA 5CZIA 4IAIA 4JAIA 4IX6A 1LPUA 4QO9A 4DT9A 4UZHA 1T46A 1KOBA 2PZYA 4JR3A 3KF4A 2B7AA 4NM3A 3CXWA 4V0GB 3OHTA 4C0TA 2EB3A 4YZCA 2XNMA 2R3KA 1OMWA 2A27A 3UIXA 1I09A 4CCBA 4HPUE 4YGAA 3VN9A 3WF6A 2GSFA 3TXOA 3H9FA 4L01A 3NRMA 2R5TA 4NU1A 4AS0A 4CMTA 1G8AA 3A8XA 4IVBA 2NNWB 1Q41A 3HX4A 5JQ8A 4O91A 5AUTA 4NW6A 1YOLA 2IVUA 5HLNA 3QD2B 3VBTA 5B2LA 2R3LA 5CNOA 1PXJA 3ORKA 3FL5A 4E4LA 3FZTA 1P5EA 5L2SA 2C1AA 4RX7A 4EBVA 2PUPA 4FT0A 2R4BA 2OU7A 2FH9A 4EOOA 2C47A 4IACA 4NT4A 3PIXA 1P2AA 4P7EA 5FEDA 3TDVA 3F66A 5C8KA 5CXZA 3CP9A 3CQWA 3MH1A 5HG7A 4I0RA 3V6RA 5L3AA 4D1ZA 5ANKA 2CLXA 1UNGA 4ACCA 1B38A 3MGYA 3NAYA 2WOTA 3FHRA 3PVWA 4JDJA 3SLSA 4PNKA 1UKHA 2R3FA 3UZRA 2WTJA 3FBVA 1YWNA 1B39A 4FKUA 3LLAA 3ZONA 3FXXA 4M3QA 4OTHA 2R3GA 4BVUA 3E8DA 3F2RA 3HMOA 4FSMA 1ZWSA 1ZY5A 3QD0A 2HOGA 5GHVA 3W2SA 4YMJA 4RZVA 4O21A 3P86A 3QFVA 4PX6A 2YM5A 4O82A 4QQ5A 3Q52A 3MI9A 5CU4A 2W05A 4BBMA 4AW2A 2J4ZA 4ERKA 4AT4A 3QZHA 2GFCA 2Y7JA 4K9YA 3VS0A 4G6NA 3GCUA 3M1SA 3C4ZA 2C6KA 3TM0A 4IEBA 4QMZA 4YBKA 4U81A 4YUQA 3E7OA 4YC8A 1R1WA 4F0IA 3HMIA 4QP8A 2AYPA 3LFAA 4A7CA 4EZ7A 4JOAA 4GKIA 1S9JA 3VBXA 1H01A 3ENHA 4U44A 5IQIA 2VGPA 5AP2A 4W8EA 4DHIB 2PZIA 4JVGA 2WGJA 1ZXEA 4DH8A 5AIRA 2BVAA 4S31A 3IS5A 4YTCA 3P9JA 5I9ZA 4TWCA 5JEBA 1GZOA 4G3EA 2W1CA 4D1XA 3GEQA 5LQFA 1YOMA 4YC3A 3OVVA 5EG3A 4F65A 4ANLA 1OGYA 1XH8A 4QNYA 4RRVA 1BUHA 2ITZA 4IWPA 3ZLXA 1NW1A 1OZ1A 4ZS4A 5M55A 2C30A 3V5QA 5BMMA 5LXMA 3GC9A 4BCJA 3LCSA 4FYOA 4I1ZA 3BV3A 3VO3A 4AQCA 3IECA 4BBFA 4NUSA 3Q60A 3IGOA 3FMMA 1UWJA 2OBJA 2A2AA 2ZV7A 3PXZA 5BUIA 4QQJA 4XJ0A 1FPUA 2B53A 2UZUE 2X7GA 2GTNA 2PVRA 3CQUA 3EB0A 3MBLA 5IA1A 1JVPP 2CLQA 4ZXTA 5M51A 4G34A 1ZARA 2VD5A 4G1WA 5BPYA 3PVUA 5CXHA 3ZM4A 4OGRA 5HQ0A 1KUTA 2WQOA 3FUPA 3V5TA 2XAOA 4OTFA 2BDJA 3L9PA 4YC6A 4D28A 2BKKA 3I5ZA 4MWIA 3FMHA 2X6DA 4I5PA 4W4XA 4J71A 2GS2A 5E8ZA 1MRVA 3E64A 4QEBA 3W2CA 1ZOHA 3ITZA 3G0EA 5CT0A 2O63A 4RX9A 5ANIA 2XKDA 3OOMA 4BDGA 3WF9A 3KMWA 4RC2A 5AP3A 4EOPA 3LFFA 3O2MA 5H3QA 4J52A 3K54A 3REPA 2X8IA 4GJ2A 4RIXB 2EXMA 4AT5A 4KKEA 5CSVA 3HA8A 4JQEA 3R7VA 3PIYA 3SHEA 3BELA 2E9VA 2GHMA 3OY1A 4JNWA 4A07A 4AW1A 4B8LA 4RJ5A 4EYJA 3BLAA 3H10A 4IVDA 4C59A 4EH3A 4H36A 2UW6A 4DHJA 3JR1A 3OG7A 3QCQA 4IAFA 2X2LA 3EFWA 3FZRA 4UZDA 4OT5A 4HVGA 1YI4A 2YM3A 4RZWA 2UW5A 2QD9A 4M0ZA 1DI8A 3B8RA 4O86A 5H8EA 3PE1A 3UQGA 1XH6A 2WTKB 3BYSA 5ETIA 5D7VA 3CQEA 3RAIA 4W4WA 1OBGA 5I9VA 2YIRA 4CRLA 4I6FA 4QQTA 4A9RA 4ZLOA 2Y4IC 5ACBC 3OWPA 4F09A 2Y0AA 3LCOA 2WTWA 2IW9A 4CZTA 2FSMX 2I0YA 2R3RA 3DNEA 3LAUA 4S2ZA 3Q32A 2B55A 3UIUA 3MTFA 3K5VA 4HPTE 3VW6A 3GUBA 2NRYA 3QX2A 3KFAA 2WD1A 3HV7A 3F82A 3DBEA 3W18A 4AZTA 4BI1A 3OT3A 4PL3A 5LWMA 3QYZA 2WO6A 2CGVA 2XK4A 4CV8A 5LVNA 2DYLA 3SRVB 5LMBA 4RPVA 4G9RA 3C1XA 4FZ6A 2BRNA 3E62A 3JYAA 2C3LA 3KXHA 4DAWA 3UPXA 3AT2A 2WU6A 4O7ZA 3OUKA 2OO8X 4FZ7A 1J1CA 2VTQA 4CT1A 4WA9A 5EM6A 5JN2A 2BRMA 5AUXA 2BR1A 2CDZA 4BYIA 4ZZNA 3VC4A 2GNJA 1GNGA 3OBGA 4XV2A 3SW7A 5BVEA 4FV5A 4PDYA 4IE9A 2EVAA 1DAYA 5TKDA 4GL9A 3U9CA 3NYVA 5EFQA 4HYIA 4J1RA 2X2MA 4ASDA 1KE6A 5DEWA 1GZNA 3QD4A 3R30A 5HLWA 3SVVA 4YHFA 2WTCA 3QXOA 1OIRA 3G15A 1L3RE 3PP1A 4PDPA 2XA4A 5I9XA 1FOTA 3ATSA 4LOPA 3E8NA 3A7HA 3P7CA 3TTJA 4BGHA 5IQFA 3EIDA 4FI1A 2F49A 1FBNA 1YXUA 3AT4A 3PPJA 4XLIA 4C38A 3ML1A 3UE4A 2C6EA 2OF2A 2V62A 3AGLA 3C13A 3U6JA 2WEVA 5LMAA 2PMNX 2VWBA 3MPAA 3DDPA 4YJSA 3TZ7A 3NWWA 4C58A 4E93A 4BDKA 4ZIMA 2CSNA 4TY1A 5CSWA 2QU5A 2YIXA 2HZ0A 4UWBA 4BCKA 4EH9A 3CY2A 4Q2AA 3CTJA 2REIA 1YRPA 3A4PA 1H1RA 3QGYA 4MUQA 3RM6A 4YLJA 3TWJA 2DQ7X 3KU2A 2HIWA 3VULA 3GU7A 1XH4A 3P23A 5FXSA 4BBEA 4FEWA 2YWVA 2V7OA 4QTBA 4GUBA 3HKOA 4YJNA 4RX8A 2PE0A 1Y57A 3NUYA 3W8LA 1WVYA 4TKSA 3ZUVA 3DK6A 3S3IA 5C8NA 5I0BA 1OKZA 4APCA 5EK7A 2BAQA 4XEYA 2P55A 3GCPA 4ACDA 5AV2A 2XCHA 3O50A 1PXOA 3BBTB 4QDEA 1AD5A 3UDSA 4D0WA 5HTCA 3KXZA 3FMNA 4M84A 2J90A 2R3QA 4NYEA 4O0SA 1XWSA 3I60A 3U4UA 3UIMA 4P5QA 1IAJA 5AX9A 4RX5A 4DG0E 2EU9A 4JX7A 4FL3A 4KABA 3SG9A 4AQKA 4EQCA 2QOLA 1FGIA 3OXZA 3AD4A 3P78A 3W0RA 3LFCA 3QYWA 4J8MA 4DGNA 2EUFB 4D58A 2OKRA 3MY0A 4CFVA 1W8CA 2JD5A 1H08A 1H1WA 2QCSA 4IFCA 5BVNA 4FV1A 5AP4A 4QP1A 1JKSA 2BZKB 4HYHA 5M08A 3I7BA 2DS1A 3Q6UA 5KMMA 3I7CA 3TNPC 3VUHA 4JIAA 2BRGA 3BL9A 1EH4A 1E9HA 1U54A 3P7BA 2XVDA 3BPRA 3MYGA 4BCFA 3I6WA 5HNIX 5A9UA 2W1FA 1KOAA 3M42A 3ZCLA 3EQPA 4AFEA 1QPDA 4FKVA 3LXPA 4JBVA 4YBJA 3NUAA 5FP5A 3LJ1A 4I6LA 4YJPA 2LAVA 3UJGA 4PL5A 4DF3A 5IUGA 4OTDA 1HOWA 2PMOX 2OIQA 3KEXA 3HGKA 3MS9A 5B2MA 4XBRA 4DFUA 1H0VA 3VS6A 4DCEA 2BDFA 1KE9A 5K9IA 2RG5A 2XJ0A 4QP6A 1PW2A 4JT3A 4O6LA 5EDRA 1WZYA 3BL7A 2W1GA 1PKDA 3DZQA 4RWKA 2QVSE 1H28A 1UKIA 1W0XC 2XS0A 3CGFA 2YDIA 3P7AA 4JJRA 2X2KA 5AMNA 4R3RA 3OMVA 2ESMA 4AT3A 2VTRA 3DTWA 3ORNA 3ORZA 4EOKA 2FSOX 2C6IA 2G1TA 4YPSA 3HDNA 3OFMA 2VTHA 5KX8A 5HICA 5HCZA 1URWA 2PVNA 4I3ZA 3QCXA 4RWJA 4ASZA 2XNEA 4MD7E 3UOKA 2O64A 1P14A 2W0JA 1RQQA 3OZ6A 2PZRA 2X7OA 3VBYA 4D2SA 2JAVA 5DGZA 4L44A 5M53A 4XX9A 5K4JA 3V5WA 3F9NA 4FE2A 3SQQA 2YAKA 5CSPA 3T3VA 2JC6A 3LQ8A 4YJUA 3W33A 5HNBA 3F5UA 1WBPA 4QMYA 4Y5QA 3W0NA 3OOGA 4ANQA 4BTJA 2R7BA 4W8DA 3LOKA 5BYYA 5LVLA 1YDTE 2HW7A 4H58A 2W1EA 4JL9A 1JKKA 3QQFA 4USFA 1ZYCA 2E2BA 3TIYA 3A61A 3SXFA 4A9YA 2QR7A 4AGWA 2QOKA 2XB7A 3LFBA 1J7IA 1GIIA 3C0GA 3MA6A 3W0QA 2XANA 3LQ5A 3M2WA 3DZOA 4AGUA 2ONLA 3AQVA 2OJ9A 3MPTA 5E8WA 4AXCA 4RA4A 3PLSA 4I94A 4I41A 4G5JA 1SZMA 1Q5KA 2Q0BA 3KN6A 3FLWA 3UOLA 2QKWB 2Z2WA 4NKSA 4HVHA 5GIPE 5CU3A 3IK3A 3IDCA 5IUIA 2VZ6A 4BCGA 5TF9A 4E8AA 3RPOA 4EWQA 2SRCA 2PE1A 2YFXA 4XHKB 3VS1A 2UW7A 3TNWA 3EFKA 2VTNA 2XNNA 4X2KA 4ARKA 3JUHA 4JS8A 3FZPA 2QLUA 3MB6A 3U51A 5E4HA 2BZJA 3COHA 5HO8A 3LMIA 2X6EA 2X39A 5JT2A 4DFZE 2YDKA 4U42A 3QTRA 4MWHA 4BCMA 3ZC6A 4BI2A 1RE8A 1ZMUA 4CQEA 5E8YA 3HRFA 5H9BA 3UDZA 3ZUUA 4WNPA 4A9SA 2UW4A 2O65A 4BCIA 5LVMA 3NUUA 3FLYA 3S95A 3ACJA 3ID6C 4CTCA 2JBOA 4FX3A 4KAOA 5D1JA 4AA5A 4E4NA 4CG8A 3EJ1A 4FSUA 3QQHA 5FEQA 1BKXA 3R8MA 2EWAA 3FEGA 1Y8YA 4FNYA 3OXTA 4FL1A 5K5XA 4BTMA 2V55A 3QZGA 4FKLA 3ZSHA 4I20A 4C2WA 4C4JA 4L42A 2VRXA 1JKTA 1U5RA 2E9PA 2F2UA 3NDMA 4XMOA 4XP2A 3UIBA 4K6ZA 5IF1A 1WBTA 4R7BA 5JZJA 4QOXA 3NVKI 4C4IA 4XOZA 5HIEA 3PLAE 5AP0A 4RSSA 1SM2A 4GYIA 4EHVA 4UY9A 4DC2A