3NFGB

Crystal structure of dimerization module of rna polymerase i subcomplex a49/a34.5
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
GYQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISETARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA49
publication title RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex.
pubmed doi rcsb
source organism Candida glabrata
total genus 16
structure length 120
sequence length 120
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.140 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nfgB00
3NFGB 3NFFB
chains in the Genus database with same CATH superfamily
2XNMA 3E92A 3LM5A 4EC9A 4ZJIA 3CSVA 3VIDA 1LPUA 3WZJA 3ZCLA 4LV8A 3K5UA 1M2RA 2UW5A 1R78A 3QUPA 4P5QA 4ZSGA 3W2OA 4LYNA 1YKRA 2BILB 4GKIA 4RVMA 3R8PA 5IA1A 5HCXA 3DBDA 4BB4A 4FKVA 5CANA 4KKHA 5AP4A 5AP3A 3ZXTA 5FXRA 4YZBA 3FMMA 4E6DA 4W4VA 2NO3A 3IECA 4MD7E 4WNOA 4U6RA 3MI9A 3OWLA 4L68A 4ZJVA 4ACGA 1URCA 2R3JA 4D1ZA 4YURA 2UZOA 4RLLA 2ZAZA 4YC3A 2XRUA 3PIXA 4X2NA 5CZHA 4D55A 4FV5A 2WAJA 3SOAA 5IDNA 3LQ8A 4I0RA 3VJNA 3ZO2A 4CFVA 2FVDA 4IH8A 4O7WA 4RX9A 3CKWA 4JBOA 3WE8A 4X3FB 1PW2A 4GH2A 3E87A 3SOCA 4ZZNA 5IH4A 3NUPA 1M17A 5FGKA 4C4GA 4CGAA 2E9NA 4IX6A 3KIOC 4R1YA 3ZDUA 3R1QA 4RVKA 3RALA 1B38A 4IBMA 4W8DA 4P5ZA 3HMOA 3EMGA 4FSRA 4U8ZA 4O0RA 5JZNA 3VS4A 3Q96A 2OZAB 4DEDA 4R5SA 5A54A 2R3QA 4TNDA 3KRWA 4I5PA 2UVXA 3MH0A 3WF9A 4DH5A 2JAMA 1OL7A 3HUBA 4O83A 4CFMA 1R39A 4XV1A 3SXFA 3UOKA 2WPAA 3MSSA 2AUHA 4NK9A 5A4CA 3GB2A 5L3AA 3DK7A 5E1EA 3NSZA 3RPYA 4UBAA 3R8ZA 3IPHA 2QU6A 2XBAA 5J9ZA 4Q5HA 4TN6A 4I23A 4XEYA 2G9XA 1IASA 3I5NA 4YHJA 4FT7A 2UZWE 4KKEA 2HZIA 4LGGA 4ANSA 4R5YA 3ZZWA 3MWUA 4BCPA 4DT8A 4OBPA 2ZV8A 4APCA 5M53A 5EYKA 1GOLA 2XBJA 1GIHA 4MD8E 1O6YA 5JH6A 2FO0A 4F9CA 3HKOA 3GU4A 4YTCA 2PVYA 2W17A 2FSTX 3TDVA 2PUPA 4J71A 2W1DA 3WI6A 3UO5A 5J87A 3P1AA 2RIOA 3RTPA 3DXNA 3TYKA 4DA5A 2PYWA 4QNAA 4C4FA 1Q61A 2RG5A 4UZDA 2XYUA 5GJFA 3UIUA 4CFNA 3CY3A 3C4XA 2W5HA 3PXRA 2VZ6A 2R3LA 3TZMA 3EFWA 4E20A 3IS5A 3U6IA 4JAJA 2WQBA 3Q5IA 3H10A 1CKIA 2OXYA 1WBSA 4Q9SA 4ACHA 5DVRA 2OJFE 4MWHA 5EKOA 4QRCA 4AA5A 1TQIA 2BTRA 3VS7A 1W7HA 3MB7A 3RM7A 3C4ZA 4AG8A 4OTFA 3I0QA 5E8XA 4MTAA 1UNGA 5DWRA 3AC8A 4EUUA 2OIQA 2WMSA 3R02A 3OXIA 4AXAA 5AV2A 4AOJA 3QHRA 4IWPA 5AA8A 4RIYB 5EHOA 1H1RA 5IEYA 4WD5A 2A0CX 4XV9A 4MQ1A 1M52A 3MW1A 4ZSEA 5EK7A 2R0IA 2Y9QA 4J53A 4ERWA 5F9EA 3QL8A 5CSHA 5EM5A 3ZRMA 3BPRA 2C3IB 4I5MA 2JFMA 3EQGA 1PMNA 3BL9A 3FEGA 5DLSA 4HVGA 3BZ3A 2IPXA 5HQ0A 3UIBA 2BRNA 5HE3A 3VBQA 4GK4A 1YOJA 3MA6A 1FGKA 1OITA 3UP2A 3CS9A 3IQ7A 1J3HA 2WTCA 3WILA 2QOIA 3EB0A 3HX4A 1TQMA 3IK3A 4L42A 4NWMA 3UDSA 3RPSA 3ATTA 3EOCA 4FSQA 1UA2A 4IIRA 5EOBA 5HE2A 5KO1A 2JEDA 2GHGA 4FKGA 2P3GX 4ASZA 2PE2A 3WIKA 5FTOA 5CEKA 3I6UA 3BHVA 4YLKA 2J51A 3IOPA 1JKSA 5DRDA 4BZDA 4O2PA 3WZEA 1WZYA 2PVNA 3QA8A 3EQFA 2WELA 1TFFA 2Z60A 4BTMA 3TI1A 1MRUA 4NFNA 3FY2A 2W4KA 2Y4IB 2Z2WA 4L01A 5AJQA 3S0OA 4IC8A 4CD0A 3A61A 3ZM4A 4FMQA 3U8WA 4R3CA 4YTIA 4QMOA 4JDIA 2P0CA 2XRWA 4G5JA 2C5YA 4LOQA 5IA3A 5E9EA 2QOQA 2GSFA 4OBQA 5IA2A 2VO7A 4S2ZA 3UOJA 5AP5A 3ZFXA 4D5KA 2CNVA 3BWJA 3PDTA 3FI3A 3PP0A 2FSOX 4G3GA 4NCTA 5BYZA 4CMTA 5I5ZA 1F0QA 4JVGA 3TKIA 2QR8A 2XNEA 1BL7A 3I81A 3ELJA 4D28A 3HECA 3N4UA 4FTJA 4BIEA 4EH5A 2OK1A 4ZTHA 3PJ8A 3BLAA 2WMBA 2O65A 3OD6X 2W06A 4FICA 4JG8A 4PX6A 4YZMA 1R0PA 4QYHA 4EH9A 3UVPA 3HRBA 1P4FA 4F7LA 1IRKA 5TF9A 1FQ1B 4Q2AA 3R8LA 5AV0A 4NM3A 4QYEA 1OB3A 4RIWA 4ZZMA 5CAQA 4LL5A 4F99A 3F7WA 2YEXA 3LOKA 2XIZA 2ETMA 4O22A 4OTGA 3QCXA 4MYGA 3UNJA 3B8QA 4BIDA 2YM6A 4FR4A 2PMIA 1AQ1A 4RG0A 1XH9A 4OBOA 2W96B 4PDOA 2ITYA 4OTDA 3DU8A 3TT0A 2HENA 2R7IA 3DT1A 2VV9A 3OW3A 4KSPA 1OPLA 5FP6A 5HKMA 3KRJA 5IDPA 1H4LA 5TT7A 3JVRA 2QHNA 3QQHA 5L2WA 3HMMA 4E6CA 5KMLA 4TRLA 3R30A 3NYOA 4ACMA 5IQHA 3CTQA 3PVGA 3ZS5A 5HVJA 3QXPA 2YZLA 4D9TA 4GFOA 1ZYJA 4BBMA 5K4IA 3Q53A 4JQ7A 3P78A 2C6KA 1NXKA 1RJBA 4DFZE 5BUEA 3SV0A 4BCIA 1A9UA 4CLJA 4S34A 2XKEA 3GU8A 3ORLA 4AWIA 3ODYX 1H28A 5HG9A 3LZBA 3NEWA 4XV3A 5F20A 2V7OA 3R8UA 3EQPA 3ZEPA 1OKWA 3COIA 4J98A 3W2CA 3PTGA 3M2WA 1OGUA 2Z7QA 3Q52A 4QP6A 1QPDA 2I40A 4U81A 3WYYA 4BZOA 2VTLA 4C3FA 5CQWA 3IGOA 4MWIA 3FE3A 3QBNA 2Z7SA 4U80A 3UQFA 4Q5EA 4BIBA 4FTLA 1O6LA 5AUVA 5DIAA 1REJA 2REIA 3I4BA 4UYNA 4ZSJA 2NPQA 5CASA 5JQ8A 4WHZA 3PLAE 4EYMA 1W83A 1CKJA 3F3TA 3VUDA 5ANEA 4RBLA 4CFUA 3C4EA 5CI7A 1CSNA 3U51A 2V7AA 4I4EA 3VNTA 5JFXA 4U9AA 1XBCA 2WMRA 3E5AA 3R9OA 2X7GA 3BE2A 5EHLA 4DH8A 2BUJA 4IDVA 1V0PA 4APPA 5ACKA 4IJ9A 4K6ZA 3UZRA 2EU9A 2GNJA 3LMHA 1YW2A 4WNKA 4QTEA 2WKMA 5LVMA 2C3LA 2YAKA 3PVBA 3VUMA 5D9HA 2RKUA 4IZYA 4LUDA 3MN3A 3RPRA 4O7ZA 5M09A 4BDDA 2YWPA 4FG8A 2X9FA 3O71A 4W4WA 3U55A 5FBOA 4FV0A 5EI6A 2HXLA 2ZYBA 2C69A 3GP0A 3T3VA 5T6KA 3EZRA 4UB7A 3ZLWA 2ZMDA 2GS2A 4RWLA 3UG1A 1XMLA 4PNKA 4MBJA 2OBJA 4TPTA 4BCNA 3AKKA 4FSMA 2J0IA 3ODZX 2BZKB 4L00A 3ZO4A 2UZUE 5BPYA 4ZLOA 2X8DA 3F69A 1ZZLA 2OF4A 4GMYA 3GU6A 1H08A 3ZLSA 4GG7A 3UO6A 4XS2A 4D0XA 4KAOA 4U97A 5FEDA 4O7RA 4E6AA 2XCKA 5FRIA 4PRJA 4XYFA 4DCAA 2VWZA 1OVEA 3EFKA 3LFSA 3OWJA 3E93A 4R7HA 3DLSA 3T3UA 4IZ7A 3PWDA 4F7SA 2PVRA 4W4XA 3EN7A 3IW7A 4JQ8A 4MXZA 5AIRA 3C5IA 3NNXA 4RJ7A 3QRUA 5HX6A 5FD2A 3GEQA 3MIYA 3GGFA 2OXXA 5JT2A 2R7BA 2VO3A 3D2KA 3TNQB 5KX8A 4PDSA 1YXTA 3ZOSA 4BR3A 4WG3A 5KMKA 3C13A 3VS0A 1FGIA 3NGAA 3QTRA 3FXZA 5CAPA 3MJ2A 4FZDB 4IB5A 2V0DA 3UC4A 2AEGA 3SGCA 5A6OA 5D10A 4IAKA 5LWNA 5GJDA 3ZC6A 3GCVA 2PZIA 3DBFA 3P79A 3TJDA 2H96A 3EN9A 3FDNA 4RFMA 2GU8A 2QD9A 1JQHA 4XOYA 5BYLA 3AMAA 4U44A 2O3PA 4MNFA 4YZNA 1NVQA 4NU1A 4FV4A 3G6GA 4F7JA 5I9YA 1VJYA 3HV4A 4HVHA 1U46A 2HZ0A 4KS8A 4KRDA 3OUNB 2UW6A 4DGOA 3COKA 4V04A 3FZSA 2OFUA 3E88A 2IVTA 3IW5A 1BMKA 2ITNA 4L43A 2VO0A 2J6MA 3R7EA 3S95A 5HBHA 2Q0BA 3G51A 5CSWA 2CGXA 3ULIA 1Z57A 3GCUA 4OT6A 3PXFA 4R1VA 3F9NA 3UP7A 4N6ZA 4FZAB 3QU0A 3V5TA 4BGQA 4CZTA 4JBPA 3TG1A 1ATPE 3W16A 4DINA 2VWUA 4WSYA 4M7IA 1JLUE 4RLKA 3OUKA 2QKRA 1WBPA 3WZUA 4ANBA 3IW4A 3PIZA 1U54B 4FK6A 2Y8OA 3OCSA 4IHPA 1M2PA 2IZTA 3UMXA 4YC8A 5L6PA 4FV2A 4RWJA 5L6OA 3GCPA 3LCKA 4JXFA 2O0UA 4S32A 2F57A 3LFFA 3BU3A 4PL3A 2OZAA 3KN6A 4RX8A 1OMWA 3GQIA 4FIHA 4A4XA 4D4YA 3ZO3A 3WYXA 1WMKA 1KE8A 5BMMA 3TEIA 4JX3A 2GNFA 4W8EA 1NVSA 3BU5A 3KVWA 4BTFA 4DHFA 4EHVA 2CCHA 1IA8A 1OI9A 2OXDA 4BHZA 3VF8A 2X1NA 3I0OA 3JS2A 3OT3A 4AT4A 2ZJWA 3FKLA 2PMNX 2X7OA 3IDBA 3KN5A 4KWPA 4X2JA 1J7LA 3A2CA 1K2PA 5CAOA 2GTMA 2OH4A 3PPJA 2XYNA 5J8IA 5HU3A 3FLZA 5FM3A 1JSTA 3CPCA 3FLQA 3V5JA 2IW8A 3WBLA 1YDTE 3CGOA 1FOTA 5CSXA 4YTHA 2WEIA 2QU5A 4XG4A 3OC1A 4ZMFA 2UW4A 2ZOQA 3MYGA 4IACA 4G6NA 2R3MA 2W1FA 4P7EA 4BI0A 4IX3A 4JJRA 4YHTA 2QQ7A 4E26A 3DK3A 5LMKA 1PXLA 3DJ5A 3KEXA 4YBKA 4N6YA 1SYKA 2C47A 2PVMA 5G1XA 2Q0NA 1XH8A 2BZJA 2BRMA 4XJ0A 2A1AB 3VWAA 4PDYA 5E8TA 4BHNA 4KSQA 3MY1A 5TOZA 4BTJA 1PXOA 2YIRA 3BX5A 4TYEA 4Z9LA 4DHZA 5CEPA 4FK3A 4QDEA 1F3MC 3PP1A 4NM5A 3ENHA 3EQIA 5AA9A 2ZMCA 3DA6A 4WBBB 4EH2A 5D12A 4BI2A 2RG6A 4IZAA 1PXKA 4G5PA 2YACA 3UOLA 4FA2A 1QPEA 2ZV7A 3CCNA 5A14A 4I0SA 4E73A 4RC3A 3CEKA 4IANA 5HNGA 4RFYA 3PPZA 4QMTA 4DFNA 2UW0A 4DDGA 3IONA 4EH8A 3RM6A 4GG5A 1PXJA 4TL0A 3HDMA 2CJMA 4MH7A 4KB8A 4XMOA 3F3WA 4FI1A 4JIAA 5CS6A 5CU4A 5FTQA 1MQBA 5KZ0A 3TTJA 4EOLA 3KFAA 4FTQA 4H36A 2J50A 3EN6A 4FUXA 4CQEA 2FSMX 3NUUA 3AOXA 5EG3A 3UE4A 3ID6C 3W2SA 3KCFA 3V8TA 4NTTA 3ZSIA 4MX9A 1STCE 5CENA 3FLYA 3H9RA 2JKOA 2PVHA 4H3BA 4H05A 4U3ZA 2W05A 3FMLA 4K9YA 4AOIA 4AAAA 4AQCA 5L8KA 3O7LB 2B9HA 4MNEA 2JIUA 5FG8A 3R63A 3B8RA 3DCVA 3W0NA 3TN8A 4BDHA 5BV3A 2QURA 4FKOA 4RJ3A 4CVAA 3DKGA 4OUCA 3NUXA 5M4CA 3S4QA 3D7TB 3TIZA 4QMMA 1KE6A 2HY0A 2YDJA 3VBVA 1GZOA 3D5UA 2OG8A 1X8BA 3AC4A 3PJCA 5CEIA 4BDCA 4BDIA 1WCCA 4MD9E 4YZCA 4ORKA 3FMHA 3NUNA 4D5HA 4DAWA 2WQOA 2WMQA 3CTJA 3NVMB 4PMPA 1J7UA 2QOLA 3MESA 5DYJA 4C35A 1PJKA 4TNBA 4RFZA 1BX6A 2BMCA 4O7LA 3UDZA 4B8LA 3H9FA 4B99A 2WU7A 4BYIA 5AEPA 5HNIX 1IEPA 3E8NA 2J0LA 3QQLA 5IQGA 3W8QA 5E92A 3ROYA 4FBXA 3V5WA 4YMJA 4ZY6A 4ZTSA 5AFVA 4I6HA 3HMIA 2VTOA 3SKCA 2WQEA 4QYYA 4MF1A 4XLVA 4MXCA 3NS9A 4BDJA 4EKLA 4Y85A 2GQGA 3KMUA 4JDHA 3FY0A 3PXKA 4FYOA 4RIXA 5H8EA 4YJTA 4RMZA 5HCZA 4C2VA 2GMXA 3Q9XA 1OL2A 3C51A 4JQEA 2O64A 5JK3A 2WOTA 3EYHA 4P4CA 4RVTA 5C26A 5C4KA 1BLXA 4PUZA 4H58A 1PYEA 4L45A 3H3CA 1H01A 3G0EA 1UWJA 3BQCA 1YRPA 3G5DA 4GIHA 3CR0A 4JDKA 2CN5A 3BHYA 1OKVA 3COHA 2ERKA 4B9DA 2VTMA 5E91A 4BCJA 3EZVA 4NM0A 3LJ2A 5C9CA 4LL0A 2ITUA 3FMDA 3MVLA 4XLIA 4IAZA 3JYAA 4LMUA 3KXHA 5AV3A 1JSVA 4LRMA 5I0BA 2XA4A 1ZAOA 4RJ4A 1ZZ2A 5AM6A 3R7IA 4WKQA 3UYSA 4AOTA 1ST0A 2UZBA 4XRJA 1MQ4A 4I6LA 3W0SA 5IISA 3AD6A 3HNGA 2QOOA 2I7QA 2CNUA 3FSKA 1M7NA 5H8GA 4QP2A 5KBQA 3TUCA 3JY0A 5IA4A 2XM9A 4O0WA 4EK6A 1VR2A 5G6VA 2XAOA 4PMSA 5BX0A 3OEFX 3KXMA 1A48A 4K2RA 5AMNA 4FTTA 2RF9A 4JMQA 3ZZEA 4V0GA 1OPKA 3ZM9A 5HLWA 2CGVA 2UW9A 1ND4A 4FL3A 3I6WA 1G8KA 1WBOA 3L8PA 2WIPA 3RPVA 4D2RA 5FXQA 4B7TA 3FKOA 5CF4A 3BKBA 2HCKA 4E7WA 5E1SA 5HG8A 1YHSA 1BKXA 3QFVA 1KUTA 4X2FA 4E1ZA 2QODA 2BCJA 3D83A 1OECA 2C5OA 5CZIA 1JVPP 5AP1A 3F82A 1QMZA 2H6DA 2JLDA 4FIGA 4QO9A 3PVUA 4QMPA 3T9IA 3K3IA 4BDKA 2E2BA 3MH2A 2OU7A 2CGUA 1OM1A 3PE1A 4E4MA 3VBXA 4DDIA 4QMSA 3TJCA 3GNIB 5EM7A 4XG8A 4D2SA 5M57A 5LMAA 2W9ZB 3GCQA 4HCTA 2WNTA 4DBNA 4O0SA 3LFAA 2P33A 2R3HA 4RPVA 4FSNA 2GPHA 2AC3A 3PXQA 3N4VA 3WF5A 1NVRA 3M1SA 2CMWA 4AGWA 4FE2A 3KRLA 4C58A 5BUJA 3CBLA 2OO8X 3UBDA 4F9WA 1REKA 2CLQA 4EOQA 2UW8A 4Y83A 5EKNA 4NKSA 2O5KA 4CG8A 4QTBA 3QD0A 4AGDA 3MVHA 3I7CA 3WF8A 4O84A 3D5WA 1CMKE 3Q9WA 2C0OA 4IB3A 5ETFA 4CV9A 3NYXA 4FIJA 4TXCA 4AN9A 4U79A 4BDEA 2YWVA 1YWNA 5CU3A 4I5HA 3KA0A 4QP3A 1OKYA 3NVKI 2R3FA 4IM2A 2IWIA 4D0WA 1T45A 1ZMUA 4F4PA 4Z7GA 3AGMA 5FDPA 3BIZA 4I5CA 3HYHA 2BTSA 4XP3A 1JKLA 4GT3A 3DJ7A 2C6TA 2G2FA 3MFUA 5EYCA 2YDKA 3OOGA 4JRNA 3FLNC 2OF2A 5AUYA 1JAMA 2DQ7X 3VS3A 4UY9A 5KHWA 2HIWA 3SA0A 4RA5A 1B6CB 2ZDTA 3DKCA 2PVLA 2Q83A 4BGGA 5KCVA 3ZDIA 2VTIA 3U6JA 2VRXA 2XP2A 4NT4A 1RDQE 4WBOA 4CLIA 4PL5A 2VX0A 3CY2A 4KRCA 5FDXA 1KE5A 4TTHB 5CF6A 2F7ZE 4GYIA 2B54A 4KNBA 4S30A 3ORIA 5CNNA 4FVPA 1UU9A 4YPDA 4C61A 3CD8A 1J1CA 5IQFA 4LV5A 1YWVA 1UU7A 3P9JA 4FKJA 2A2AA 3IW8A 1U59A 2BHHA 5KMJA 3SRVA 3E3PA 1MUOA 4FTNA 2ZM4A 3CQUA 4CRLA 4IJPA 3ALNA 5DI1A 4E4XA 2I0VA 4F9BA 5JKGA 3BRBA 2J2IB 5IEXA 1UU8A 3DBQA 4CG9A 2XIXA 5K9IA 3VRZA 4LFIA 4RZWA 4FV8A 1ZWSA 3NUAA 4DEBA 5AUUA 4AW1A 5IQCA 2WTDA 4BDBA 5A4EA 3BGQA 3VW8A 4JG6A 4O0TA 4C34A 1W98A 4I3ZA 2C3JA 2XS0A 2JBOA 4P2KA 1ST4A 2VUWA 4U7ZA 3HZTA 3VUKA 1V1KA 2QOHA 4FTMA 4GUBA 4AUAA 4EKKA 5LOHA 4E6QA 4QQCA 2WHBA 3BE9A 3OT8A 4WRGA 3VS1A 1UWHA 3G90X 3HVCA 2QO9A 4ZP5A 2BKZA 4QMYA 5IQBA 4C0TA 2FB8A 4R78A 4EBVA 5E8SA 4DGGA 5K3YA 4BICA 3F2AA 1FVRA 3SW7A 2PY3A 5M55A 4YO4A 3QD3A 2YM3A 2IW9A 5J1WA 3H4JA 2E9PA 4FKSA 4BF2A 4FVRA 3SG9A 3AC2A 4HZSA 4L52A 1QL6A 4FODA 4L67A 3Q6WA 1WBNA 4O86A 4QP9A 2H9VA 5FXSA 3RNYA 2XK7A 3ZO1A 4JAIA 4M8TA 4NTSA 2YERA 2OH0E 3MFTA 4Y46A 3O23A 1MP8A 4ZSAA 4FEUA 4ZTQA 2YHVA 5K5NA 3LHJA 3UIXA 2ZDUA 2PU8A 2W5AA 3BHHA 3TKHA 2Y0AA 3QZGA 3QRIA 3MA3A 3KC3A 4QMNA 3NNWA 1BYGA 1L3RE 4RC4A 2I0YA 1TVOA 2R3PA 5HVKA 3ZC5A 5HE0A 2Z7RA 2ETRA 4QQ5A 4FGBA 1CM8A 3TUDA 4ENXA 3QX4A 5M44A 4JOAA 1S9JA 4PY1A 1XMMA 3Q9ZA 3KVXA 4FKTA 5DNRA 5DPVA 3BLQA 2OI4X 3QZFA 3RKBA 4CSVA 3KB7A 1OZ1A 3EQCA 4DLJA 3DAJA 4HYSA 2XJ1A 2Y7JA 4PF4A 3R7VA 2R4BA 3BYSA 5EDQA 4AA0A 4OLIA 3LFEA 4K77A 4ANLA 5CT0A 4MXYA 4FGRA 3JR1A 3TZ9A 3RCJA 4NJDA 2GS7A 1OL1A 5D1JA 3RK9A 5ANDA 4XG7A 4F63A 3UNZA 4BBFA 3KRRA 1FMKA 3CIKA 2WMAA 3DZQA 4I20A 3VBTA 3BI6A 2ZFYA 3CE3A 5ICPA 2ITOA 3FQSA 3R6XA 3EH9A 4FC0A 4OTHA 1PYXA 2FYSA 2H8HA 3RWQA 2LAVA 4Y5HA 2UZNA 2VTJA 3W33A 2VAGA 4HYIA 3G6HA 2R64A 5HE1A 3PG1A 4J1RA 5LXMA 5HVYA 2PMOX 2X2KA 1BI8A 5BVDA 2GS6A 4YUQA 5AAGA 3Q3BA 4JLCA 2ITPA 3AKJA 5CVHA 4B8MA 1GAGA 2EB2A 4AA4A 3O7LD 3F2NA 3QX2A 4U3YA 2W1HA 4AT5A 3BEGA 3Q2MA 2PUNA 1LEZA 3MIAA 4L3LA 2YISA 4UN0C 1YXVA 4Y72A 3FPMA 4AXCA 5IZFA 4EH6A 1ZXEA 4BVUA 1OIRA 2X4ZA 5DHJA 3TDWA 2IO6A 4KINA 3WARA 3C4WA 1OUYA 3ORTA 2JKKA 3BLRA 4XBRA 1VLRA 2OJJA 5I9XA 2I0HA 2GHMA 5BVFA 1UU3A 2WTKC 4RSSA 3ROCA 4FSUA 2ITTA 3MH3A 4O38A 5T3QA 3RP9A 4FIEA 4L3PA 3NWWA 5HESA 3LAUA 4NKAA 1JKTA 3AC3A 3P5KA 1YXUA 1SZMA 4DYMA 3D94A 5IPJA 4EL9A 3G9LX 1Q5KA 3U9NA 4FKQA 3MY5A 4ZTLA 3DGKA 3HV6A 4AQKA 2CHLA 3EWHA 3QTIA 2C6DA 3B2WA 3KRXA 5ANKA 3PXZA 3N51A 3FZTA 3QYWA 3PFYA 2YFXA 1R0EA 4B4LA 3DBCA 3SLSA 3QC4A 2B1PA 2G01A 4MUQA 3VULA 3KXGA 4OR5A 3MDYA 3LMIA 4XCUA 3POOA 3NZ0A 3RWPA 4ITIA 1KV2A 3F61A 5GJGA 4ZTMA 4FTRA 4Q9ZA 5A9UA 3P86A 3ZYAA 2JDRA 5CX9A 3QD4A 2CGWA 2OSCA 4TW9A 5IA5A 3OZ6A 1XO2B 4GKHA 2UV2A 2JDTA 5EI2A 4DHIB 2PZRA 2C3KA 2QLUA 3NW7A 4HCUA 3RVGA 4IWQA 5KNJA 3N4TA 2YN8A 3CQWA 3KULA 4QOXA 1GIIA 4BCFA 4AZEA 4HOKA 3C4FA 3QQGA 4YNEA 4EH4A 3A7FA 5EYDA 3UC3A 1Q97A 4WG5A 4LUEA 4CKJA 1M7QA 4JNWA 2XCHA 5EOLA 3E8DA 4BKJA 5J5SA 2YIQA 4KUJA 4UALA 4A07A 5LMBA 1KE7A 4MHAA 3EHAA 2WD1A 1SNXA 4TYHB 1VEBA 2C68A 4ZOGA 5E8YA 4GK2A 4G9RA 3RAIA 2F2UA 2PZ5A 4C4EA 4AN3A 4USDA 1Y8YA 1KOAA 2VWBA 1WVXA 3MS9A 4QMVA 1FBNA 3Q04A 2X2MA 3FHIA 2VU3A 3FYJX 4CT2A 5JEBA 4Y8DA 2X6EA 3D0EA 3KF4A 4A9TA 4YSJA 4I22A 4QQTA 3H9OA 2E9VA 2VNWA 2F4JA 4ZLYA 2UZVA 5DRBA 3FAAA 2P4IA 4EOMA 4J52A 3Q32A 3C0GA 4OTRA 4RIOA 3FI2A 3G15A 4M3QA 1K3AA 5DBXA 4QYFA 3HRFA 3TV6A 1H8FA 1G8JA 2OJGA 4YJQA 3ZRKA 5JRQA 4NCTC 3F88A 3BBWA 4W4YA 2YIWA 3P5JC 3H0ZA 4PWNA 4HCVA 3R0TA 2PVFA 4M0YA 4YJVA 4M14A 5DEWA 4KD1A 3HP2A 4EZ7A 2VTNA 1PXPA 4LDTA 4HZRA 2OIBA 2GDOA 1AD5A 4PMTA 2QOBA 3R9DA 3WOWA 5A46A 3R2BA 4FTKA 2OFVA 3TZ8A 1GJOA 3DAEA 3NMUF 5AUXA 5TO8A 5CTPA 4FZ7A 3RZBA 4EHEA 5CAUA 1P4OA 1ZRZA 5E7RA 4DTBA 3DKOA 3P0MA 2UVZA 2X0GA 1JBPE 3Q4CA 1H00A 2UW7A 4F64A 3PG3A 2DYLA 1M2QA 2QOFA 4DN5A 3KQ7A 3D5VA 3NLBA 3Q4UA 2JKMA 3GI3A 4EK3A 4L6QA 3S2PA 3DLZA 5CAVA 4H39A 3Q4TA 4FTUA 3MPMA 2OGVA 2SRCA 4A9UA 4CXAA 4DFXE 3VF9A 2W1EA 3QQKA 3ZSHA 3MBLA 3QLGA 5CXZA 1Q8TA 5HGIA 4Z3VA 4CCBA 5FEEA 2JFLA 4OGRA 4D4RA 5AV1A 3RK5A 3JVSA 4IZ5A 4EC8A 1SVGA 2BRGA 3VQHA 3VBWA 3QKLA 4AGCA 1U5RA 4ITJA 4OTWA 3EN4A 5AP0A 5KKRC 2KTYA 1PMEA 5M51A 4QMLA 2V62A 2YM7A 1IAJA 5HBEA 4IFCA 2WGJA 3UPXA 1XBAA 4GVAA 2QHMA 3PA3A 3FZOA 3IW6A 3R83A 4XX9A 4FL1A 3GXLA 4L44A 3AT2A 2YCSA 3F5UA 1ZYCA 5FM2A 2VX1A 4Z7HA 3UQGA 1DI9A 5CVFA 2ZM3A 2BAKA 2C6LA 2R3RA 5CF8A 5JZJA 3VBYA 4EQMA 2OWBA 1ZOEA 3F3VA 4O2ZA 4YZDA 5C8KA 4MQ2A 2PMLX 5DT4A 2GTNA 4JBQA 3W1FA 4XNEA 3O2MA 4GT4A 1YQJA 3EYGA 5I9VA 4DBXA 4FJVA 4UXLA 5ETCA 3QRKA 4O96A 5IQIA 4CEGA 1W0XC 1XKKA 5EI8A 3LXNA 4AZSA 3OEZA 4I92A 2XNGA 5HNBA 1GZNA 3UYTA 3LIJA 4WO5A 5KMMA 5IMXA 2V5QA 4M12A 2XNOA 1Q4LA 3DV3A 5AP2A 4F0GA 3PVWA 3QHWA 1ZMWA 4XBUA 3PSCA 2P2HA 3CKXA 2W1GA 3QQUA 4FOCA 4WRSA 4X3FA 4AGUA 3H0YA 3E63A 1ZYLA 4LV7A 4I24A 4O21A 4BCGA 4DGNA 2HZNA 4E5AX 3EQBA 2OJ9A 3GFWA 1LEWA 5CSVA 3TUBA 4G17A 2VD5A 5ANIA 5B2MA 2HY81 4IW0A 5FP5A 3FQHA 4R77A 3IKAA 2PK9A 3PJ1A 3ZXZA 4EOOA 4C02A 4F7NA 1PXIA 3O96A 3MTLA 3PSBA 3R7UA 2VTQA 2PVKA 3PWYA 4BI1A 5A4LA 3GT8A 3A62A 3I1AA 3FMEA 3E8EA 3DDPA 4NM7A 4ZTRA 4M13A 4MXOA 2YIXA 3DQXA 4GU9A 4L46A 5AUTA 2JDOA 4IMYA 4EHZA 2G2HA 3DOGA 3GUBA 5CU2A 3QKMA 1CTPE 3F3UA 4YLJA 4J96A 4XG2A 4AXFA 3BELA 3HDNA 1G8AA 4O81A 4GRBA 4K33A 3ZSGA 3B2TA 1NA7A 2G2IA 4I21A 4EQUA 4DH3A 4TWOA 2ITZA 2XEYA 4GUEA 4LOOA 4TZRA 4AU8A 4ZY5A 5HU9A 3R9RA 4ZTNA 2XF0A 2PTKA 3ZLXA 2HK5A 3GC9A 2GQSA 3DBEA 3ATSA 2NYAA 4HNFA 2C5NA 3FV8A 3D15A 2I6LA 4GW8A 2PSQA 2WTKB 3OF0A 3FZ1A 4X2KA 2J5FA 3R1YA 3ZUUA 4FEVA 4GU6A 4CFXA 2XJ2A 2QC6A 3P23A 2O8YA 4I41A 3GU7A 4HVIA 1WFCA 4CT1A 3UMWA 4FT0A 5E8WA 2YCRA 4BJJB 3MB6A 4N70A 3U9CA 4FEXA 4K1BA 4DLIA 3CPBA 5DE2A 4DTAA 2J9MA 5AADA 1M14A 3NAXA 5F4NA 3CXWA 5CI6A 1Q3WA 5LJJA 1ZMVA 3S1HA 5EM6A 3AT4A 1OKZA 2YABA 3W2QA 3HV7A 3MPAA 2CLXA 2ZVAA 5BYYA 2G15A 4EZ3A 2PZYA 1U5QA 2XANA 1P5EA 1OGYA 5JFSA 4FNWA 2OICA 4RIYA 3TM0A 3ALOA 2IZSA 3GC0A 4LGHA 4O7SA 1JKKA 4TT7A 4F70A 1YHVA 4O7VA 3E8CA 4C4HA 2BDJA 3LFDA 4XG3A 4BDAA 5IU2A 3NW6A 3OY3A 4QPAA 5D11A 2C6MA 3ANRA 3TV7A 2IZRA 3V8WA 4DG2E 5JSMA 3QTWA 3QCSA 4I4FA 2R3NA 4PV0A 4TKSA 2BDWA 3O17A 4MXAA 4IVAA 3OS3A 4YTFA 3SVVA 2VGOA 4DTKA 1H26A 5DFPA 2VN9A 4QMXA 3OXTA 3F6XA 2RL5A 5HLNA 2DWBA 5HTCA 1KOBA 1J91A 2W0JA 1MRVA 3PYYA 4O82A 2ITWA 2PUUA 5LCKA 2XK9A 3R21A 3V01A 4YNOA 4CZUA 4C38A 3GC8A 1H1PA 4ZY4A 2QI8A 3NYVA 2QOCA 3O51A 3AMBA 3R8VA 2XEZA 3QXOA 2XB7A 4JIKA 4PTEA 4K8AA 5ANGA 3L8VA 2ITXA 3L1SA 4PQNA 5I9UA 4O0UA 3HAMA 4KBAA 5CXHA 2CN8A 3FJQE 3LVPA 3T8OA 3UDTA 5LMKC 2J0MB 1E1XA 1PRYA 1ZYDA 4G2FA 4EK5A 3UQCA 3EFJA 4WG4A 5BNJA 2WOUA 1Y57A 4Y5QA 3UNKA 3KXZA 3JY9A 3TXOA 4DITA 5CT7A 3V04A 3OBJA 4BN1A 3TNIA 5AAEA 3TV4A 5M06A 2OIDA 4FTIA 4KIPA 1JPAA 3C9WA 4J99A 4PP9A 2XUUA 4YLLA 2JIIA 3II5A 4YHFA 4EONA 2WMUA 1W82A 4FIFA 2ONLA 4QMUA 3PE2A 4RC2A 4FZ6A 3VO3A 1W84A 3MVJA 4WUAA 3K2LA 4FV1A 3W0MA 4C59A 2HXQA 3U87A 3CC6A 3E7VA 3EQDA 4JS8A 2BIYA 3BEAA 4RIWB 4RWKA 3R9HA 4C3RA 3LXLA 3I79A 5HICA 3AKLA 2GQRA 3AGLA 2BDFA 4DT9A 3L9NA 3POZA 3QTXA 3W8LA 1HOWA 4FKUA 3TKUA 1H25A 4AN2A 4ZEGA 2IVSA 3ZBFA 4ZIMA 2GFCA 3OROA 5JGBA 4FEWA 3AMYA 2Y4PA 4DEIA 4KABA 1H1QA 4XUFA 3A7JA 1ZOGA 3CTHA 3QTZA 3UTOA 2X6DA 4FKLA 3BQRA 3NIZA 4JI9A 4QNYA 3QZIA 5D41A 3HUCA 5I4NA 1L8TA 4IDTA 3KREA 4D9UA 4M97A 2C5XA 2CNQA 5C8MA 3LQ5A 3DPKA 5EQPA 5KKRB 2Y6MA 4IAAA 3PY1A 4ITHA 1XH6A 3QKKA 2VTRA 2WTWA 4EQCA 4N4SA 3ZFYA 4ACDA 5FBNC 3ZRLA 4FIIA 3SXSA 3DFCB 3HMPA 4TYIA 3FXXA 4MVFA 2VGPA 1YHWA 3C50A 3DAKA 3OY1A 5AWMA 3W18A 5HZNA 3BV3A 5L2TA 4XP2A 4WIHA 2QKWB 4A9RA 4BCQA 1OPJA 3AXWA 3LCOA 3M42A 3V5LA 4EWQA 4ZS0A 4ANMA 4Y95A 4KS7A 4FNYA 3OCBA 1CDKA 3L9PA 2DS1A 1KSWA 4RGJA 5H9BA 4GV1A 2JIVA 3KMMA 1DS5A 3QTUA 4QTCA 5H8BA 3PIYA 4IX4A 4XG6A 4IAFA 5L2SA 5GIOE 4UX9A 4C2WA 2IW6A 3W0RA 5I9WA 5FUTA 3R71A 4KIOA 3LM0A 5ANOA 2J0KA 2X39A 1XBBA 1YOLA 2G1TA 3S3IA 3VAPA 4NIFB 3VONA 1TQPA 5HI2A 4FL2A 5C8NA 2R2PA 5BVEA 4LOPA 5CF5A 2CKEA 1G5SA 2YAAA 5DGZA 4Z55A 1ERKA 2R9SA 1XWSA 4I0TA 4RX5A 1KWPA 2R0UA 2VWWA 4LRKA 4QTDA 3U4UA 3SW4A 5J9YA 3GC7A 4GYGA 3SG8A 2PE1A 4NYEA 3R7YA 1OL5A 4DE4A 3MH1A 1NT2A 3QTSA 3GCSA 5LARA 2JDVA 3DQWA 4O27B 4FUYA 3AD4A 4USEA 3QGYA 1FVTA 2IVUA 1IA9A 5HTBA 2C4GA 1Q8YA 5CYIA 5FQDC 1BUHA 4BGHA 3RHKA 2WXVA 1ZY5A 4L7FA 3LFNA 3VS5A 3RAKA 2XZSA 4ZK5A 4YJPA 3IDPA 3P7AA 4O91A 4YC6A 5BQ0A 3R04A 2BFYA 4PDPA 4YJSA 2C5VA 2I1MA 2ETKA 4E4LA 4FKPA 4UWBA 5HIEA 4JDJA 3ORMA 2BPMA 2YITA 4KA3A 4I93A 4U5JA 4H1MA 1RW8A 1RE8A 2PULA 3QLFA 4FT3A 2O2UA 5KE0A 4BY9E 4F6SA 3ZLYA 1CKPA 3DNEA 3G2FA 4G6LA 3KMWA 3BHUA 3H30A 3RPOA 3TL8A 5F1ZA 4DFLA 5KBRA 2BZHB 3DXPA 3UDBA 2BKKA 2W1CA 4EORA 2C6OA 1O6KA 4RJ8A 3FZPA 4EK8A 5LWMA 4C62A 1PF8A 3VUGA 3PA5A 4C37A 5HO7A 3FBVA 2OW3A 5HD7A 4AW0A 3NRMA 4EOPA 3QC9A 4OT5A 5CEQA 1XR1A 2GNLA 5CEMA 3U6HA 2X8IA 4G1WA 4L9IA 5K5XA 2JKQA 4J7BA 2F49A 2C6EA 3PUPA 3QUDA 2C0IA 3QWKA 4F65A 2BR1A 3Q5ZA 3C7QA 4TY1A 2BALA 1Y91A 2CKOA 4AW2A 2B55A 4O6EA 5GNKA 3VRYA 3V5PA 5JGAA 3D2IA 2DUVA 1QCFA 2X9EA 4FSWA 3EKNA 2FH9A 3V5QA 1SVEA 3S00A 3R22A 2XIYA 3V6RA 4G6OA 3LXPA 4UWYA 5I9ZA 3AQVA 2HW6A 4FEQA 1R3CA 4I6BA 4FT9A 3ORPA 3MGYA 1XJDA 1U54A 2B53A 5IH5A 3KKVA 3N9XA 3WF6A 2WTVA 4R7IA 3PJ2A 5IA0A 1IR3A 4BBEA 1G8SA 1HCKA 2WQMA 3AC5A 3JUHA 3DXQA 4DGMA 4FV7A 5C01A 2XAMA 5M56A 3GU5A 3OCGA 1DAYA 1HCLA 3LXKA 3BYUA 2HWPA 2EXMA 4U41A 5J95A 4J8MA 5E90A 4BDGA 2E9UA 3QZHA 5AIKA 4ASDA 1Q62A 2R3IA 1PKDA 3QD2B 4B0GA 3ZFMA 3PY3A 4IE9A 3O5AA 3PUFC 1U4DA 4EHGA 4FV6A 5M4FA 3BGPA 1OIQA 1WBVA 3LPBA 3W2PA 5LVPA 3LLTA 3L9LA 4FSZA 5DR9A 3WF7A 2X4FA 4IQ6A 5AAFA 4UV0A 4YPSA 3DB8A 4LG4A 3L8XA 2NRUA 5IF1A 3NDMA 4KBCA 2UVYA 2GNHA 2KULA 3LCSA 4E93A 3PZHA 2QG7A 4DF3A 3QCYA 2CDZA 4N0SA 1GIJA 1LP4A 3OMVA 3RHXA 4U42A 4G3EA 4DEEA 5J7HA 1BI7A 5KMOA 3OP5A 4DFBA 3FLWA 5EW3A 4BJJA 4AZTA 3IGGA 4PTCA 2XIKA 1JWHA 2RFDA 4U0IA 5JFVA 1Y6BA 3HA6A 3FI8A 3K3JA 3QUEA 2ERZE 3PFQA 1BL6A 3FI4A 4QEBA 4YJNA 3NX8A 4EH3A 3AG9A 2JD5A 3F2RA 5DN3A 1QPJA 2VTTA 5L8JA 4YZ9A 3BYVA 2XARA 3HLLA 4FTOA 2BROA 4EI4A 5GIPE 3FPQA 4E5WA 4UWCA 3W10A 2HWOA 2B0QA 2WTIA 3ZEWA 5EM8A 4A9YA 2XK4A 2PUIA 3CJFA 4QMWA 5FLFA 3QGWA 4YO6A 2WB8A 4FTCA 2XK3A 2YDIA 5HHWA 3PY0A 4AW5A 4JG7A 4EOKA 2XNNA 4GFGA 3ACJA 3DKFA 4H3QA 2JBPA 2QVSE 4DC2A 2VWIA 3LE6A 4RRVA 2YM4A 3TCPA 3BGZA 3CLYA 3FMKA 2J4ZA 2VX3A 4R6VA 5IQAA 2AYPA 3PRIA 3FXWA 2GHLA 3HV5A 4HGTA 3PZEA 3FZRA 1YI3A 2NNWB 1WVWA 3FQEA 1GY3A 2YM5A 4FX3A 4IEBA 3W0OA 3NUSA 2FA2A 4FSYA 4GJ3A 5IUIA 3TWJA 5LVOA 3R9NA 4C4IA 3HRCA 5GINE 4FYNA 4ZMEA 4ZLZA 2B9IA 2PWLA 3LFBA 2YCQA 5KZIA 4MNEB 2ZB0A 3FWQA 3OBGA 4ENYA 4EOIA 1I44A 2BVAA 3MJ1A 3MVMA 5E8VA 4F08A 1S9IA 3D7TA 4II5A 4WNMA 5HEZA 3F3ZA 3MFSA 4E8AA 5AV4A 4ZJJA 4U45A 3EQHA 2ESMA 2FGIA 3BBTB 3PRFA 4YJOA 1OL6A 4IVDA 4V01A 1P14A 3TNWA 5CWZA 5DT3A 1Q99A 4GCJA 4BCHA 3TACA 4GS6A 1Q41A 3ZUTA 4YR8A 4G3DA 4M15A 4M68A 4FV3A 1YVJA 2P55A 2NRYA 3AD5A 5H3QA 4ALUA 4GL9A 3HMNA 3OHTA 4JX7A 2J90A 5HIBA 3O50A 3O0GA 4CKIA 2HYYA 2BRHA 4F0FA 4GFMA 4MAOA 2ZV2A 2QOKA 3W0QA 5CSPA 1Y8GA 3W32A 2UW3A 5CEOA 4CFFA 5A4TA 4D1SA 4GEOA 4FZFB 2XK8A 3FLSA 1H1WA 5FEQA 3A7IA 1JOWB 3OG7A 3PSDA 3SX9A 4IM0A 4ANQA 4CMUA 4EOJA 3BLHA 4QMQA 4U43A 1Q24A 3MFRA 2WFYA 4RIXB 4GJ2A 4JRVA 4GK3A 4O0YA 2QO7A 2BAJA 3NNUA 3VHKA 2ZM1A 3NR9A 5EDPA 1OBGA 2YCFA 4O6LA 1PY5A 2IVVA 2UZDA 5HBJA 1GNGA 4QP1A 5GHVA 3HGKA 1R1WA 4FKIA 3VW6A 3QQJA 4KKGA 2Z8CA 3ORKA 3F66A 3HL7A 3QA0A 3QYZA 4PMMA 3DJ6A 4FKWA 4NFMA 1ZLTA 5EQEA 4B6LA 1G3NA 1DAWA 2YM8A 3ACKA 2W4OA 5AUZA 2E9OA 3ZTXA 4ALVA 5HO8A 4XV2A 4GVJA 1OUKA 3Q2JA 4NL0A 4RWIA 5DR2A 3R7OA 3ZMMA 3ORXA 3QWJA 3R8MA 3OWPA 5AP7A 3M11A 3G33A 3UZTA 2QO2A 1XH7A 2WU6A 2HOGA 2WO6A 2QCSA 5D7VA 3T9TA 3TIYA 4YU2A 4FTAA 1FINA 5J1VA 5HG5A 2BIKB 2YA9A 3R73A 3SAYA 4E4NA 5LVNA 4K11A 5A6NA 3W55A 4V0GB 3P7BA 5CY3A 3REPA 2FSLX 4A4LA 1JSUA 3NYNA 3I60A 3DK6A 3VUIA 3HEGA 4G3CA 2B52A 2CSNA 2C30A 4JT3A 3RINA 3PXYA 4QDVA 4GIIA 4X2GA 3ITZA 4CNHA 4IWDA 3LLAA 1F5QA 5M07A 1PXNA 5EDRA 3VVHA 4C3PA 2PHKA 4LI5A 2WIHA 4UEUA 1T46A 4M67A 2A27A 3WIGA 1OIUA 1EH4A 2OLCA 3RAWA 3A4PA 1FMOE 4AE6A 1J7IA 3DB6A 4RVLA 4NH1A 4C7TA 2VTHA 4MBIA 1H27A 2W99B 3PJ3A 5L8LA 3GOPA 4OW8A 5DEYA 3UPZA 5C4LA 1FPUA 5EW9A 2VNYA 5H2UA 2VWYA 2HAKA 1PMVA 2R5TA 2VWXA 2B7AA 2XVDA 3HA8A 3OW4A 4UYAA 4DG3E 2GCDA 1XHAA 2Z7LA 4Z16A 1JNKA 3EFLA 3E64A 1GZ8A 3DS6A 3NIEA 5DA3A 2XMYA 4I6QA 4F9AA 4IM3A 4CMOA 4D4SA 3TTIA 3ZU7A 5IG1A 5DOSA 3GQLA 4JR3A 1LR4A 4PP7A 4CRSA 2HELA 4LMNA 2WZJA 1YDSE 4MK0A 4ONAA 4MBLA 4F1TA 2PL0A 4KIQA 4WUNA 5B2LA 2CKQA 4F6WA 3LJ1A 2WMVA 3FL5A 3LQ3A 5C03A 1DI8A 5ETIA 4A7CA 2B9JA 2RFEA 3THBA 3EKKA 5IUGA 1UNHA 3BL7A 3FMJA 2X8EA 4IB1A 2CCIA 4DH1A 3U4WA 2JAVA 2VTAA 4YBJA 3E7OA 5AP6A 4AFJA 3LMGA 3LW0A 5B2KA 3RJCA 4KBKA 3RNIA 3D14A 1SM2A 4IAYA 3U54A 4AX8A 3RAHA 3P7CA 3CGFA 4H1JA 5IQDA 4BCOA 4XH6A 4S33A 1SNUA 3LCTA 4AZWA 1ZARA 2VWVA 4CCUA 4D4VA 4EOSA 4A06A 1Z9XA 3LFCA 2YJSA 2X81A 1W8CA 2BFXA 3EN5A 3BV2A 3Q9YA 2F9GA 5B7VA 3KF7A 1OBDA 4NW5A 2WMWA 3ORNA 3OVVA 3SC1A 3SRVB 1UNLA 3NFGB 2R3GA 4RJ6A 4WA9A 2OJIA 4HGLA 2XKCA 4UXQA 3NCGA 5HCYA 3UJGA 4F1MA 3RK7A 4IADA 4TWPA 5C27A 2EVAA 2JDSA 2YZAA 3A4OX 3UVRA 2F7EE 3DTWA 2BZIB 4AACA 3SHEA 1YOMA 3K54A 5HIDA 4G3FA 3CP9A 3R28A 2JITA 2OKRA 3QQFA 3PA4A 2BHEA 1V0OA 3QTQA 3VUHA 2ITVA 3UVQA 2X2LA 3FHRA 4JBVA 3HAVA 3A7HA 2BRBA 2ZB1A 1E9HA 4S31A 2C1AA 3MTFA 1VZOA 2YJRA 1Q3DA 4EBWA 1P2AA 3BYOA 1K9AA 4USFA 5D7AA 4IAIA 4DG0E 5IH6A 4QP4A 1Q8WA 4ZXTA 4FNXA 2RGPA 2V55A 4RA4A 4BCMA 4UZHA 4EZ5A 5IMEA 4AF3A 5KMNA 3OTUA 3COMA 4WNPA 3E62A 3R2YA 4X6RA 4HGSA 5E8ZA 4EYJA 1NW1A 3TNHA 3BCEA 4G31A 3DFAA 2EXCX 2WTJA 4BZNA 5JN2A 3NPCA 3F7ZA 4DGLC 3FC1X 4L7SA 5K4JA 1XQZA 3EL8A 4A9SA 5DH3A 2IG7A 4BRXA 4FV9A 2QG5A 4AT3A 5HX8A 4HW7A 3WZKA 1PKGA 2UUEA 2XJ0A 1URWA 2XK6A 3UGCA 1IAHA 4N57A 1Q8ZA 3UG2A 5T68A 3QCQA 4IVCA 2C1BA 4WOVA 4YJRA 4F09A 3NFFB 3TZ7A 5IEVA 5KMIA 4ZAUA 1PMUA 3SDJA 2W9FB 4IX5A 4G16A 2J0JA 2XM8A 2C6IA 2IN6A 3L9MA 4AFEA 4EWHA 3P4KA 5B0XA 3KU2A 2UZLA 4NW6A 3ERKA 3AT3A 5BVWA 4E5BA 4MKCA 3R01A 1WVYA 1YI6A 4AXDA 5KUPA 1WAKA 3HP5A 4EEVA 3NAYA 4HGEA 3OOMA 3QRTA 4K0YA 1GZKA 4BCKA 3FYKX 4X3FC 4IC7A 3ZH8A 4ZS4A 3V6SA 5AX3A 3FKNA 2YIYA 1H07A 1MRYA 5CU0A 3MPTA 4F6UA 1KE9A 1WBWA 5F95A 4MCVA 4EH7A 2QR7A 3GOKA 4HVSA 2GFSA 2WMTA 2PE0A 3KGAA 4DCEA 2A4LA 4ACCA 4CKRA 3VN9A 3KXXA 1UVRA 3DNDA 3NCZA 2XKDA 3RMFA 4C4JA 3VS6A 5A4QA 2RFSA 1VYZA 2VTPA 2W7XA 3C4CA 2EUFB 2XNPA 4J95A 4PTGA 5ACBC 2XALA 3LKMA 3W2RA 2GNGA 3KCKA 4HYHA 4RQKA 3V51A 4LM5A 4ALWA 4IVBA 4ZSLA 5CALA 3G0FA 2B9FA 4FNZA 4XHKB 4CV8A 4XG9A 5E8UA 4J97A 3A60A 4RJ5A 5DT0A 2O63A 4FOBA 5EHYA 4AAYA 1YDRE 4DEGA 4F9YA 5ITAA 5FTGA 4DH7A 3ETAA 1FVVA 3IO7A 4R7BA 3UODA 2CKPA 1H1SA 3D9VA 3ZONA 3KL8A 2VTSA 3D5XA 4HJOA 4MXXA 4X7QA 5AX9A 2Z02A 4LRJA 4AZFA 4L3JA 1VYWA 5C1QB 1QPCA 2J5EA 3ZBXA 4Y73A 3EJ1A 3GFEA 5BVOA 4O7TA 3VS2A 3ML1A 3OXZA 3ORZA 4RT7A 5DR6A 3RCDA 2PPQA 3A7GA 4GSBA 5AM7A 3RGFA 4L8MA 4FT5A 5JQ5A 5DG5A 1YXXA 3TMOA 3FC2A 1XH5A 4HPTE 1H0WA 2OZOA 2B4SB 4J8NA 2HW7A 2CPKE 2RFNA 4EJ7A 1V0BA 5BVNA 2HZ4A 3I5ZA 3QRJA 3DY7A 3OWKA 3KK9A 5BMSA 2PZPA 3OCTA 4O7NA 5HG7A 3V3VA 1WBTA 3EL7A 4YP8A 4I94A 3GENA 3IOKA 4LQMA 1KV1A 4L53A 1DM2A 3F5GA 2IZUA 1YXSA 3Q6UA 2QNJA 4YJUA 3ZUVA 4TWNA 3Q60A 1YWRA 4TYJA 4F0IA 4NJ3A 2EB3A 3DTCA 5LVLA 4IB0A 5JGDA 1O9UA 2F2CB 3QF9A 2WEVA 5JMSA 1SVHA 5EYMA 4M84A 3W0PA 4AZVA 4AS0A 3QAME 3SXRA 3FMNA 3P08A 2ACXA 2X7FA 3KXNA 2JGZA 1UV5A 4OTQA 5JFWA 2XKFA 2J7TA 4BTKA 4CTCA 4M69B 4IFGA 5BUIA 4FKRA 3KULB 4YGAA 3ZHPC 2P2IA 3UZPA 5HORA 5M08A 4D1XA 3AC1A 3BWFA 4D58A 2XIRA 2UZEA 4XRLA 4EK4A 3ANQA 5CNOA 3VQUA 4XP0A 3EQRA 4TYGA 4QMZA 4QYGA 5TR6A 3R1NA 4F78A 2BAQA 3A8XA 3O8UA 5TKDA 5ANJA 4G9CA 5CLPA 1SMHA 3LCDA 2UZTA 3F5XA 4R3RA 5L2IA 4TYHA 5CVGA 3FL4A 5EH0A 3ULZA 3OTVA 4H3PA 4RX7A 1AGWA 2W4JA 4PL4A 5HD4A 5M4IA 1TKIA 1ZOHA 5BVKA 3FUPA 3MV5A 4RZVA 2PVJA 3UOHA 3VHEA 4X3JA 2WQNA 4U40A 3SD0A 4ARKA 3HV3A 1UKIA 4DHJA 3CQEA 1H24A 4QTAA 2Y4IC 3ENMA 3G9NA 3F5PA 4QQJA 3E3BX 1LUFA 1RQQA 3BHTA 4R3PA 3JXWA 1I09A 4DFYA 3ET7A 5LQFA 2IJMA 3KY2A 3V8SA 4A4OA 2R3KA 2NP8A 4FG9A 4HPUE 4OTIA 1ZY4A 2C0TA 2GNIA 2JC6A 3VJOA 5JRSA 4O0VA 5CQUA 3KK8A 5ETAA 3L8SA 4DFUA 4WT6A 1NY3A 4ASXA 4QPSA 4DEHA 4XOZA 3R1SA 4ID7A 2ONLC 4K18A 4HVDA 5IUHA 3UO4A 4O7YA 5E4HA 2H34A 5HLPA 4MEDA 3FSFA 2W5BA 3R00A 2EWAA 3WE4A 2ZV9A 4QT1A 1YI4A 4DEAA 1B39A 3C1XA 3CJGA 4PNIA 4JL9A 4ERKA 4ZZOA 3NNVA 1PXMA 2A19B 4CTBA 3IDCA 4X6QC 4C33A 3C0IA 4RQVA 2LGCA 4NUSA 1IG1A 3OFMA 4I1ZA 4X21A 2QLQA 3O8PA 3EIDA 3GVUA 1OIYA 2VO6A 4V05A 5EFQA 4JR7A 3I7BA 3D4QA 5J9LA 3A8WA 4AP7A 4BDFA 2AC5A 4EUTA 4C36A 4QP7A 2FUMA 3IG7A 4BYJA 1XH4A 1Z5MA 1E1VA 3LFQA 3JPVA 1ZYSA 2W1ZA 1PHKA 5F94A 2R3OA 2XH5A 1UKHA 5L6WL 5M4UA 4AE9A 5AUWA 4X0MA 3WZDA 3BYMA 4QP8A 4TWCA 3DZOA 2V22A 3GBZA 4NSTA 5KHXA 4P90A 3O8TA 4HYUA 4ASEA 3C5UA 5EW8A 4AXEA 4FSTA 3MY0A 3NUYA 1APME 3BU6A 5CU6A 1A06A 4I6FA 3CD3A 3QALE 1Q8UA 3PLSA 4IWOA 3C0HA 4HNIA 2F7XE 2XNBA 3A99A 4FG7A 2I0EA 3K5VA 3Q4ZA 4O0XA 3RI1A 3SQQA 1J1BA 1H0VA 3LJ0A 3UIMA 4GT5A 4FVQA 4F1OA 2Y6OA 3D7ZA 2ITQA 3NW5A 3PPKA 4YSMA 4NZWB 5A3XA 1Y6AA 5LCJA 2W1IA 5EQYA 2WMXA 3TNPC 2QONA 3VC4A 4BC6A 4CFWA 5IQEA 4EJNA 4G34A 3DDQA 4M0ZA
chains in the Genus database with same CATH topology
2XNMA 3E92A 3LM5A 4EC9A 4ZJIA 3CSVA 3VIDA 1LPUA 3WZJA 3ZCLA 4LV8A 3K5UA 1M2RA 2UW5A 1R78A 3QUPA 4P5QA 4ZSGA 3W2OA 4LYNA 1YKRA 2BILB 4GKIA 4RVMA 3R8PA 5IA1A 5HCXA 3DBDA 4BB4A 4FKVA 5CANA 4KKHA 5AP4A 5AP3A 3ZXTA 5FXRA 4YZBA 3FMMA 4E6DA 4W4VA 2NO3A 3IECA 4MD7E 4WNOA 4U6RA 3MI9A 3OWLA 4L68A 4ZJVA 4ACGA 1URCA 2R3JA 4D1ZA 4YURA 2UZOA 4RLLA 2ZAZA 4YC3A 2XRUA 3PIXA 4X2NA 5CZHA 4D55A 4FV5A 2WAJA 3SOAA 5IDNA 3LQ8A 4I0RA 3VJNA 3ZO2A 4CFVA 2FVDA 4IH8A 4O7WA 4RX9A 3CKWA 4JBOA 3WE8A 4X3FB 1PW2A 4GH2A 3E87A 3SOCA 4ZZNA 5IH4A 3NUPA 1M17A 5FGKA 4C4GA 4CGAA 2E9NA 4IX6A 3KIOC 4R1YA 3ZDUA 3R1QA 4RVKA 3RALA 1B38A 4IBMA 4W8DA 4P5ZA 3HMOA 3EMGA 4FSRA 4U8ZA 4O0RA 5JZNA 3VS4A 3Q96A 2OZAB 4DEDA 4R5SA 5A54A 2R3QA 4TNDA 3KRWA 4I5PA 2UVXA 3MH0A 3WF9A 4DH5A 2JAMA 1OL7A 3HUBA 4O83A 4CFMA 1R39A 4XV1A 3SXFA 3UOKA 2WPAA 3MSSA 2AUHA 4NK9A 5A4CA 3GB2A 5L3AA 3DK7A 5E1EA 3NSZA 3RPYA 4UBAA 3R8ZA 3IPHA 2QU6A 2XBAA 5J9ZA 4Q5HA 4TN6A 4I23A 4XEYA 2G9XA 1IASA 3I5NA 4YHJA 4FT7A 2UZWE 4KKEA 2HZIA 4LGGA 4ANSA 4R5YA 3ZZWA 3MWUA 4BCPA 4DT8A 4OBPA 2ZV8A 4APCA 5M53A 5EYKA 1GOLA 2XBJA 1GIHA 4MD8E 1O6YA 5JH6A 2FO0A 4F9CA 3HKOA 3GU4A 4YTCA 2PVYA 2W17A 2FSTX 3TDVA 2PUPA 4J71A 2W1DA 3WI6A 3UO5A 5J87A 3P1AA 2RIOA 3RTPA 3DXNA 3TYKA 4DA5A 2PYWA 4QNAA 4C4FA 1Q61A 2RG5A 4UZDA 2XYUA 5GJFA 3UIUA 4CFNA 3CY3A 3C4XA 2W5HA 3PXRA 2VZ6A 2R3LA 3TZMA 3EFWA 4E20A 3IS5A 3U6IA 4JAJA 2WQBA 3Q5IA 3H10A 1CKIA 2OXYA 1WBSA 4Q9SA 4ACHA 5DVRA 2OJFE 4MWHA 5EKOA 4QRCA 4AA5A 1TQIA 2BTRA 3VS7A 1W7HA 3MB7A 3RM7A 3C4ZA 4AG8A 4OTFA 3I0QA 5E8XA 4MTAA 1UNGA 5DWRA 3AC8A 4EUUA 2OIQA 2WMSA 3R02A 3OXIA 4AXAA 5AV2A 4AOJA 3QHRA 4IWPA 5AA8A 4RIYB 5EHOA 1H1RA 5IEYA 4WD5A 2A0CX 4XV9A 4MQ1A 1M52A 3MW1A 4ZSEA 5EK7A 2R0IA 2Y9QA 4J53A 4ERWA 5F9EA 3QL8A 5CSHA 5EM5A 3ZRMA 3BPRA 2C3IB 4I5MA 2JFMA 3EQGA 1PMNA 3BL9A 3FEGA 5DLSA 4HVGA 3BZ3A 2IPXA 5HQ0A 3UIBA 2BRNA 5HE3A 3VBQA 4GK4A 1YOJA 3MA6A 1FGKA 1OITA 3UP2A 3CS9A 3IQ7A 1J3HA 2WTCA 3WILA 2QOIA 3EB0A 3HX4A 1TQMA 3IK3A 4L42A 4NWMA 3UDSA 3RPSA 3ATTA 3EOCA 4FSQA 1UA2A 4IIRA 5EOBA 5HE2A 5KO1A 2JEDA 2GHGA 4FKGA 2P3GX 4ASZA 2PE2A 3WIKA 5FTOA 5CEKA 3I6UA 3BHVA 4YLKA 2J51A 3IOPA 1JKSA 5DRDA 4BZDA 4O2PA 3WZEA 1WZYA 2PVNA 3QA8A 3EQFA 2WELA 1TFFA 2Z60A 4BTMA 3TI1A 1MRUA 4NFNA 3FY2A 2W4KA 2Y4IB 2Z2WA 4L01A 5AJQA 3S0OA 4IC8A 4CD0A 3A61A 3ZM4A 4FMQA 3U8WA 4R3CA 4YTIA 4QMOA 4JDIA 2P0CA 2XRWA 4G5JA 2C5YA 4LOQA 5IA3A 5E9EA 2QOQA 2GSFA 4OBQA 5IA2A 2VO7A 4S2ZA 3UOJA 5AP5A 3ZFXA 4D5KA 2CNVA 3BWJA 3PDTA 3FI3A 3PP0A 2FSOX 4G3GA 4NCTA 5BYZA 4CMTA 5I5ZA 1F0QA 4JVGA 3TKIA 2QR8A 2XNEA 1BL7A 3I81A 3ELJA 4D28A 3HECA 3N4UA 4FTJA 4BIEA 4EH5A 2OK1A 4ZTHA 3PJ8A 3BLAA 2WMBA 2O65A 3OD6X 2W06A 4FICA 4JG8A 4PX6A 4YZMA 1R0PA 4QYHA 4EH9A 3UVPA 3HRBA 1P4FA 4F7LA 1IRKA 5TF9A 1FQ1B 4Q2AA 3R8LA 5AV0A 4NM3A 4QYEA 1OB3A 4RIWA 4ZZMA 5CAQA 4LL5A 4F99A 3F7WA 2YEXA 3LOKA 2XIZA 2ETMA 4O22A 4OTGA 3QCXA 4MYGA 3UNJA 3B8QA 4BIDA 2YM6A 4FR4A 2PMIA 1AQ1A 4RG0A 1XH9A 4OBOA 2W96B 4PDOA 2ITYA 4OTDA 3DU8A 3TT0A 2HENA 2R7IA 3DT1A 2VV9A 3OW3A 4KSPA 1OPLA 5FP6A 5HKMA 3KRJA 5IDPA 1H4LA 5TT7A 3JVRA 2QHNA 3QQHA 5L2WA 3HMMA 4E6CA 5KMLA 4TRLA 3R30A 3NYOA 4ACMA 5IQHA 3CTQA 3PVGA 3ZS5A 5HVJA 3QXPA 2YZLA 4D9TA 4GFOA 1ZYJA 4BBMA 5K4IA 3Q53A 4JQ7A 3P78A 2C6KA 1NXKA 1RJBA 4DFZE 5BUEA 3SV0A 4BCIA 1A9UA 4CLJA 4S34A 2XKEA 3GU8A 3ORLA 4AWIA 3ODYX 1H28A 5HG9A 3LZBA 3NEWA 4XV3A 5F20A 2V7OA 3R8UA 3EQPA 3ZEPA 1OKWA 3COIA 4J98A 3W2CA 3PTGA 3M2WA 1OGUA 2Z7QA 3Q52A 4QP6A 1QPDA 2I40A 4U81A 3WYYA 4BZOA 2VTLA 4C3FA 5CQWA 3IGOA 4MWIA 3FE3A 3QBNA 2Z7SA 4U80A 3UQFA 4Q5EA 4BIBA 4FTLA 1O6LA 5AUVA 5DIAA 1REJA 2REIA 3I4BA 4UYNA 4ZSJA 2NPQA 5CASA 5JQ8A 4WHZA 3PLAE 4EYMA 1W83A 1CKJA 3F3TA 3VUDA 5ANEA 4RBLA 4CFUA 3C4EA 5CI7A 1CSNA 3U51A 2V7AA 4I4EA 3VNTA 5JFXA 4U9AA 1XBCA 2WMRA 3E5AA 3R9OA 2X7GA 3BE2A 5EHLA 4DH8A 2BUJA 4IDVA 1V0PA 4APPA 5ACKA 4IJ9A 4K6ZA 3UZRA 2EU9A 2GNJA 3LMHA 1YW2A 4WNKA 4QTEA 2WKMA 5LVMA 2C3LA 2YAKA 3PVBA 3VUMA 5D9HA 2RKUA 4IZYA 4LUDA 3MN3A 3RPRA 4O7ZA 5M09A 4BDDA 2YWPA 4FG8A 2X9FA 3O71A 4W4WA 3U55A 5FBOA 4FV0A 5EI6A 2HXLA 2ZYBA 2C69A 3GP0A 3T3VA 5T6KA 3EZRA 4UB7A 3ZLWA 2ZMDA 2GS2A 4RWLA 3UG1A 1XMLA 4PNKA 4MBJA 2OBJA 4TPTA 4BCNA 3AKKA 4FSMA 2J0IA 3ODZX 2BZKB 4L00A 3ZO4A 2UZUE 5BPYA 4ZLOA 2X8DA 3F69A 1ZZLA 2OF4A 4GMYA 3GU6A 1H08A 3ZLSA 4GG7A 3UO6A 4XS2A 4D0XA 4KAOA 4U97A 5FEDA 4O7RA 4E6AA 2XCKA 5FRIA 4PRJA 4XYFA 4DCAA 2VWZA 1OVEA 3EFKA 3LFSA 3OWJA 3E93A 4R7HA 3DLSA 3T3UA 4IZ7A 3PWDA 4F7SA 2PVRA 4W4XA 3EN7A 3IW7A 4JQ8A 4MXZA 5AIRA 3C5IA 3NNXA 4RJ7A 3QRUA 5HX6A 5FD2A 3GEQA 3MIYA 3GGFA 2OXXA 5JT2A 2R7BA 2VO3A 3D2KA 3TNQB 5KX8A 4PDSA 1YXTA 3ZOSA 4BR3A 4WG3A 5KMKA 3C13A 3VS0A 1FGIA 3NGAA 3QTRA 3FXZA 5CAPA 3MJ2A 4FZDB 4IB5A 2V0DA 3UC4A 2AEGA 3SGCA 5A6OA 5D10A 4IAKA 5LWNA 5GJDA 3ZC6A 3GCVA 2PZIA 3DBFA 3P79A 3TJDA 2H96A 3EN9A 3FDNA 4RFMA 2GU8A 2QD9A 1JQHA 4XOYA 5BYLA 3AMAA 4U44A 2O3PA 4MNFA 4YZNA 1NVQA 4NU1A 4FV4A 3G6GA 4F7JA 5I9YA 1VJYA 3HV4A 4HVHA 1U46A 2HZ0A 4KS8A 4KRDA 3OUNB 2UW6A 4DGOA 3COKA 4V04A 3FZSA 2OFUA 3E88A 2IVTA 3IW5A 1BMKA 2ITNA 4L43A 2VO0A 2J6MA 3R7EA 3S95A 5HBHA 2Q0BA 3G51A 5CSWA 2CGXA 3ULIA 1Z57A 3GCUA 4OT6A 3PXFA 4R1VA 3F9NA 3UP7A 4N6ZA 4FZAB 3QU0A 3V5TA 4BGQA 4CZTA 4JBPA 3TG1A 1ATPE 3W16A 4DINA 2VWUA 4WSYA 4M7IA 1JLUE 4RLKA 3OUKA 2QKRA 1WBPA 3WZUA 4ANBA 3IW4A 3PIZA 1U54B 4FK6A 2Y8OA 3OCSA 4IHPA 1M2PA 2IZTA 3UMXA 4YC8A 5L6PA 4FV2A 4RWJA 5L6OA 3GCPA 3LCKA 4JXFA 2O0UA 4S32A 2F57A 3LFFA 3BU3A 4PL3A 2OZAA 3KN6A 4RX8A 1OMWA 3GQIA 4FIHA 4A4XA 4D4YA 3ZO3A 3WYXA 1WMKA 1KE8A 5BMMA 3TEIA 4JX3A 2GNFA 4W8EA 1NVSA 3BU5A 3KVWA 4BTFA 4DHFA 4EHVA 2CCHA 1IA8A 1OI9A 2OXDA 4BHZA 3VF8A 2X1NA 3I0OA 3JS2A 3OT3A 4AT4A 2ZJWA 3FKLA 2PMNX 2X7OA 3IDBA 3KN5A 4KWPA 4X2JA 1J7LA 3A2CA 1K2PA 5CAOA 2GTMA 2OH4A 3PPJA 2XYNA 5J8IA 5HU3A 3FLZA 5FM3A 1JSTA 3CPCA 3FLQA 3V5JA 2IW8A 3WBLA 1YDTE 3CGOA 1FOTA 5CSXA 4YTHA 2WEIA 2QU5A 4XG4A 3OC1A 4ZMFA 2UW4A 2ZOQA 3MYGA 4IACA 4G6NA 2R3MA 2W1FA 4P7EA 4BI0A 4IX3A 4JJRA 4YHTA 2QQ7A 4E26A 3DK3A 5LMKA 1PXLA 3DJ5A 3KEXA 4YBKA 4N6YA 1SYKA 2C47A 2PVMA 5G1XA 2Q0NA 1XH8A 2BZJA 2BRMA 4XJ0A 2A1AB 3VWAA 4PDYA 5E8TA 4BHNA 4KSQA 3MY1A 5TOZA 4BTJA 1PXOA 2YIRA 3BX5A 4TYEA 4Z9LA 4DHZA 5CEPA 4FK3A 4QDEA 1F3MC 3PP1A 4NM5A 3ENHA 3EQIA 5AA9A 2ZMCA 3DA6A 4WBBB 4EH2A 5D12A 4BI2A 2RG6A 4IZAA 1PXKA 4G5PA 2YACA 3UOLA 4FA2A 1QPEA 2ZV7A 3CCNA 5A14A 4I0SA 4E73A 4RC3A 3CEKA 4IANA 5HNGA 4RFYA 3PPZA 4QMTA 4DFNA 2UW0A 4DDGA 3IONA 4EH8A 3RM6A 4GG5A 1PXJA 4TL0A 3HDMA 2CJMA 4MH7A 4KB8A 4XMOA 3F3WA 4FI1A 4JIAA 5CS6A 5CU4A 5FTQA 1MQBA 5KZ0A 3TTJA 4EOLA 3KFAA 4FTQA 4H36A 2J50A 3EN6A 4FUXA 4CQEA 2FSMX 3NUUA 3AOXA 5EG3A 3UE4A 3ID6C 3W2SA 3KCFA 3V8TA 4NTTA 3ZSIA 4MX9A 1STCE 5CENA 3FLYA 3H9RA 2JKOA 2PVHA 4H3BA 4H05A 4U3ZA 2W05A 3FMLA 4K9YA 4AOIA 4AAAA 4AQCA 5L8KA 3O7LB 2B9HA 4MNEA 2JIUA 5FG8A 3R63A 3B8RA 3DCVA 3W0NA 3TN8A 4BDHA 5BV3A 2QURA 4FKOA 4RJ3A 4CVAA 3DKGA 4OUCA 3NUXA 5M4CA 3S4QA 3D7TB 3TIZA 4QMMA 1KE6A 2HY0A 2YDJA 3VBVA 1GZOA 3D5UA 2OG8A 1X8BA 3AC4A 3PJCA 5CEIA 4BDCA 4BDIA 1WCCA 4MD9E 4YZCA 4ORKA 3FMHA 3NUNA 4D5HA 4DAWA 2WQOA 2WMQA 3CTJA 3NVMB 4PMPA 1J7UA 2QOLA 3MESA 5DYJA 4C35A 1PJKA 4TNBA 4RFZA 1BX6A 2BMCA 4O7LA 3UDZA 4B8LA 3H9FA 4B99A 2WU7A 4BYIA 5AEPA 5HNIX 1IEPA 3E8NA 2J0LA 3QQLA 5IQGA 3W8QA 5E92A 3ROYA 4FBXA 3V5WA 4YMJA 4ZY6A 4ZTSA 5AFVA 4I6HA 3HMIA 2VTOA 3SKCA 2WQEA 4QYYA 4MF1A 4XLVA 4MXCA 3NS9A 4BDJA 4EKLA 4Y85A 2GQGA 3KMUA 4JDHA 3FY0A 3PXKA 4FYOA 4RIXA 5H8EA 4YJTA 4RMZA 5HCZA 4C2VA 2GMXA 3Q9XA 1OL2A 3C51A 4JQEA 2O64A 5JK3A 2WOTA 3EYHA 4P4CA 4RVTA 5C26A 5C4KA 1BLXA 4PUZA 4H58A 1PYEA 4L45A 3H3CA 1H01A 3G0EA 1UWJA 3BQCA 1YRPA 3G5DA 4GIHA 3CR0A 4JDKA 2CN5A 3BHYA 1OKVA 3COHA 2ERKA 4B9DA 2VTMA 5E91A 4BCJA 3EZVA 4NM0A 3LJ2A 5C9CA 4LL0A 2ITUA 3FMDA 3MVLA 4XLIA 4IAZA 3JYAA 4LMUA 3KXHA 5AV3A 1JSVA 4LRMA 5I0BA 2XA4A 1ZAOA 4RJ4A 1ZZ2A 5AM6A 3R7IA 4WKQA 3UYSA 4AOTA 1ST0A 2UZBA 4XRJA 1MQ4A 4I6LA 3W0SA 5IISA 3AD6A 3HNGA 2QOOA 2I7QA 2CNUA 3FSKA 1M7NA 5H8GA 4QP2A 5KBQA 3TUCA 3JY0A 5IA4A 2XM9A 4O0WA 4EK6A 1VR2A 5G6VA 2XAOA 4PMSA 5BX0A 3OEFX 3KXMA 1A48A 4K2RA 5AMNA 4FTTA 2RF9A 4JMQA 3ZZEA 4V0GA 1OPKA 3ZM9A 5HLWA 2CGVA 2UW9A 1ND4A 4FL3A 3I6WA 1G8KA 1WBOA 3L8PA 2WIPA 3RPVA 4D2RA 5FXQA 4B7TA 3FKOA 5CF4A 3BKBA 2HCKA 4E7WA 5E1SA 5HG8A 1YHSA 1BKXA 3QFVA 1KUTA 4X2FA 4E1ZA 2QODA 2BCJA 3D83A 1OECA 2C5OA 5CZIA 1JVPP 5AP1A 3F82A 1QMZA 2H6DA 2JLDA 4FIGA 4QO9A 3PVUA 4QMPA 3T9IA 3K3IA 4BDKA 2E2BA 3MH2A 2OU7A 2CGUA 1OM1A 3PE1A 4E4MA 3VBXA 4DDIA 4QMSA 3TJCA 3GNIB 5EM7A 4XG8A 4D2SA 5M57A 5LMAA 2W9ZB 3GCQA 4HCTA 2WNTA 4DBNA 4O0SA 3LFAA 2P33A 2R3HA 4RPVA 4FSNA 2GPHA 2AC3A 3PXQA 3N4VA 3WF5A 1NVRA 3M1SA 2CMWA 4AGWA 4FE2A 3KRLA 4C58A 5BUJA 3CBLA 2OO8X 3UBDA 4F9WA 1REKA 2CLQA 4EOQA 2UW8A 4Y83A 5EKNA 4NKSA 2O5KA 4CG8A 4QTBA 3QD0A 4AGDA 3MVHA 3I7CA 3WF8A 4O84A 3D5WA 1CMKE 3Q9WA 2C0OA 4IB3A 5ETFA 4CV9A 3NYXA 4FIJA 4TXCA 4AN9A 4U79A 4BDEA 2YWVA 1YWNA 5CU3A 4I5HA 3KA0A 4QP3A 1OKYA 3NVKI 2R3FA 4IM2A 2IWIA 4D0WA 1T45A 1ZMUA 4F4PA 4Z7GA 3AGMA 5FDPA 3BIZA 4I5CA 3HYHA 2BTSA 4XP3A 1JKLA 4GT3A 3DJ7A 2C6TA 2G2FA 3MFUA 5EYCA 2YDKA 3OOGA 4JRNA 3FLNC 2OF2A 5AUYA 1JAMA 2DQ7X 3VS3A 4UY9A 5KHWA 2HIWA 3SA0A 4RA5A 1B6CB 2ZDTA 3DKCA 2PVLA 2Q83A 4BGGA 5KCVA 3ZDIA 2VTIA 3U6JA 2VRXA 2XP2A 4NT4A 1RDQE 4WBOA 4CLIA 4PL5A 2VX0A 3CY2A 4KRCA 5FDXA 1KE5A 4TTHB 5CF6A 2F7ZE 4GYIA 2B54A 4KNBA 4S30A 3ORIA 5CNNA 4FVPA 1UU9A 4YPDA 4C61A 3CD8A 1J1CA 5IQFA 4LV5A 1YWVA 1UU7A 3P9JA 4FKJA 2A2AA 3IW8A 1U59A 2BHHA 5KMJA 3SRVA 3E3PA 1MUOA 4FTNA 2ZM4A 3CQUA 4CRLA 4IJPA 3ALNA 5DI1A 4E4XA 2I0VA 4F9BA 5JKGA 3BRBA 2J2IB 5IEXA 1UU8A 3DBQA 4CG9A 2XIXA 5K9IA 3VRZA 4LFIA 4RZWA 4FV8A 1ZWSA 3NUAA 4DEBA 5AUUA 4AW1A 5IQCA 2WTDA 4BDBA 5A4EA 3BGQA 3VW8A 4JG6A 4O0TA 4C34A 1W98A 4I3ZA 2C3JA 2XS0A 2JBOA 4P2KA 1ST4A 2VUWA 4U7ZA 3HZTA 3VUKA 1V1KA 2QOHA 4FTMA 4GUBA 4AUAA 4EKKA 5LOHA 4E6QA 4QQCA 2WHBA 3BE9A 3OT8A 4WRGA 3VS1A 1UWHA 3G90X 3HVCA 2QO9A 4ZP5A 2BKZA 4QMYA 5IQBA 4C0TA 2FB8A 4R78A 4EBVA 5E8SA 4DGGA 5K3YA 4BICA 3F2AA 1FVRA 3SW7A 2PY3A 5M55A 4YO4A 3QD3A 2YM3A 2IW9A 5J1WA 3H4JA 2E9PA 4FKSA 4BF2A 4FVRA 3SG9A 3AC2A 4HZSA 4L52A 1QL6A 4FODA 4L67A 3Q6WA 1WBNA 4O86A 4QP9A 2H9VA 5FXSA 3RNYA 2XK7A 3ZO1A 4JAIA 4M8TA 4NTSA 2YERA 2OH0E 3MFTA 4Y46A 3O23A 1MP8A 4ZSAA 4FEUA 4ZTQA 2YHVA 5K5NA 3LHJA 3UIXA 2ZDUA 2PU8A 2W5AA 3BHHA 3TKHA 2Y0AA 3QZGA 3QRIA 3MA3A 3KC3A 4QMNA 3NNWA 1BYGA 1L3RE 4RC4A 2I0YA 1TVOA 2R3PA 5HVKA 3ZC5A 5HE0A 2Z7RA 2ETRA 4QQ5A 4FGBA 1CM8A 3TUDA 4ENXA 3QX4A 5M44A 4JOAA 1S9JA 4PY1A 1XMMA 3Q9ZA 3KVXA 4FKTA 5DNRA 5DPVA 3BLQA 2OI4X 3QZFA 3RKBA 4CSVA 3KB7A 1OZ1A 3EQCA 4DLJA 3DAJA 4HYSA 2XJ1A 2Y7JA 4PF4A 3R7VA 2R4BA 3BYSA 5EDQA 4AA0A 4OLIA 3LFEA 4K77A 4ANLA 5CT0A 4MXYA 4FGRA 3JR1A 3TZ9A 3RCJA 4NJDA 2GS7A 1OL1A 5D1JA 3RK9A 5ANDA 4XG7A 4F63A 3UNZA 4BBFA 3KRRA 1FMKA 3CIKA 2WMAA 3DZQA 4I20A 3VBTA 3BI6A 2ZFYA 3CE3A 5ICPA 2ITOA 3FQSA 3R6XA 3EH9A 4FC0A 4OTHA 1PYXA 2FYSA 2H8HA 3RWQA 2LAVA 4Y5HA 2UZNA 2VTJA 3W33A 2VAGA 4HYIA 3G6HA 2R64A 5HE1A 3PG1A 4J1RA 5LXMA 5HVYA 2PMOX 2X2KA 1BI8A 5BVDA 2GS6A 4YUQA 5AAGA 3Q3BA 4JLCA 2ITPA 3AKJA 5CVHA 4B8MA 1GAGA 2EB2A 4AA4A 3O7LD 3F2NA 3QX2A 4U3YA 2W1HA 4AT5A 3BEGA 3Q2MA 2PUNA 1LEZA 3MIAA 4L3LA 2YISA 4UN0C 1YXVA 4Y72A 3FPMA 4AXCA 5IZFA 4EH6A 1ZXEA 4BVUA 1OIRA 2X4ZA 5DHJA 3TDWA 2IO6A 4KINA 3WARA 3C4WA 1OUYA 3ORTA 2JKKA 3BLRA 4XBRA 1VLRA 2OJJA 5I9XA 2I0HA 2GHMA 5BVFA 1UU3A 2WTKC 4RSSA 3ROCA 4FSUA 2ITTA 3MH3A 4O38A 5T3QA 3RP9A 4FIEA 4L3PA 3NWWA 5HESA 3LAUA 4NKAA 1JKTA 3AC3A 3P5KA 1YXUA 1SZMA 4DYMA 3D94A 5IPJA 4EL9A 3G9LX 1Q5KA 3U9NA 4FKQA 3MY5A 4ZTLA 3DGKA 3HV6A 4AQKA 2CHLA 3EWHA 3QTIA 2C6DA 3B2WA 3KRXA 5ANKA 3PXZA 3N51A 3FZTA 3QYWA 3PFYA 2YFXA 1R0EA 4B4LA 3DBCA 3SLSA 3QC4A 2B1PA 2G01A 4MUQA 3VULA 3KXGA 4OR5A 3MDYA 3LMIA 4XCUA 3POOA 3NZ0A 3RWPA 4ITIA 1KV2A 3F61A 5GJGA 4ZTMA 4FTRA 4Q9ZA 5A9UA 3P86A 3ZYAA 2JDRA 5CX9A 3QD4A 2CGWA 2OSCA 4TW9A 5IA5A 3OZ6A 1XO2B 4GKHA 2UV2A 2JDTA 5EI2A 4DHIB 2PZRA 2C3KA 2QLUA 3NW7A 4HCUA 3RVGA 4IWQA 5KNJA 3N4TA 2YN8A 3CQWA 3KULA 4QOXA 1GIIA 4BCFA 4AZEA 4HOKA 3C4FA 3QQGA 4YNEA 4EH4A 3A7FA 5EYDA 3UC3A 1Q97A 4WG5A 4LUEA 4CKJA 1M7QA 4JNWA 2XCHA 5EOLA 3E8DA 4BKJA 5J5SA 2YIQA 4KUJA 4UALA 4A07A 5LMBA 1KE7A 4MHAA 3EHAA 2WD1A 1SNXA 4TYHB 1VEBA 2C68A 4ZOGA 5E8YA 4GK2A 4G9RA 3RAIA 2F2UA 2PZ5A 4C4EA 4AN3A 4USDA 1Y8YA 1KOAA 2VWBA 1WVXA 3MS9A 4QMVA 1FBNA 3Q04A 2X2MA 3FHIA 2VU3A 3FYJX 4CT2A 5JEBA 4Y8DA 2X6EA 3D0EA 3KF4A 4A9TA 4YSJA 4I22A 4QQTA 3H9OA 2E9VA 2VNWA 2F4JA 4ZLYA 2UZVA 5DRBA 3FAAA 2P4IA 4EOMA 4J52A 3Q32A 3C0GA 4OTRA 4RIOA 3FI2A 3G15A 4M3QA 1K3AA 5DBXA 4QYFA 3HRFA 3TV6A 1H8FA 1G8JA 2OJGA 4YJQA 3ZRKA 5JRQA 4NCTC 3F88A 3BBWA 4W4YA 2YIWA 3P5JC 3H0ZA 4PWNA 4HCVA 3R0TA 2PVFA 4M0YA 4YJVA 4M14A 5DEWA 4KD1A 3HP2A 4EZ7A 2VTNA 1PXPA 4LDTA 4HZRA 2OIBA 2GDOA 1AD5A 4PMTA 2QOBA 3R9DA 3WOWA 5A46A 3R2BA 4FTKA 2OFVA 3TZ8A 1GJOA 3DAEA 3NMUF 5AUXA 5TO8A 5CTPA 4FZ7A 3RZBA 4EHEA 5CAUA 1P4OA 1ZRZA 5E7RA 4DTBA 3DKOA 3P0MA 2UVZA 2X0GA 1JBPE 3Q4CA 1H00A 2UW7A 4F64A 3PG3A 2DYLA 1M2QA 2QOFA 4DN5A 3KQ7A 3D5VA 3NLBA 3Q4UA 2JKMA 3GI3A 4EK3A 4L6QA 3S2PA 3DLZA 5CAVA 4H39A 3Q4TA 4FTUA 3MPMA 2OGVA 2SRCA 4A9UA 4CXAA 4DFXE 3VF9A 2W1EA 3QQKA 3ZSHA 3MBLA 3QLGA 5CXZA 1Q8TA 5HGIA 4Z3VA 4CCBA 5FEEA 2JFLA 4OGRA 4D4RA 5AV1A 3RK5A 3JVSA 4IZ5A 4EC8A 1SVGA 2BRGA 3VQHA 3VBWA 3QKLA 4AGCA 1U5RA 4ITJA 4OTWA 3EN4A 5AP0A 5KKRC 2KTYA 1PMEA 5M51A 4QMLA 2V62A 2YM7A 1IAJA 5HBEA 4IFCA 2WGJA 3UPXA 1XBAA 4GVAA 2QHMA 3PA3A 3FZOA 3IW6A 3R83A 4XX9A 4FL1A 3GXLA 4L44A 3AT2A 2YCSA 3F5UA 1ZYCA 5FM2A 2VX1A 4Z7HA 3UQGA 1DI9A 5CVFA 2ZM3A 2BAKA 2C6LA 2R3RA 5CF8A 5JZJA 3VBYA 4EQMA 2OWBA 1ZOEA 3F3VA 4O2ZA 4YZDA 5C8KA 4MQ2A 2PMLX 5DT4A 2GTNA 4JBQA 3W1FA 4XNEA 3O2MA 4GT4A 1YQJA 3EYGA 5I9VA 4DBXA 4FJVA 4UXLA 5ETCA 3QRKA 4O96A 5IQIA 4CEGA 1W0XC 1XKKA 5EI8A 3LXNA 4AZSA 3OEZA 4I92A 2XNGA