3NFGB

Crystal structure of dimerization module of rna polymerase i subcomplex a49/a34.5
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
GYQPPSDYKQCKHLKSFPVSELKGDNKELWLMKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISETARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA49
publication title RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Transcription
total genus 16
structure length 120
sequence length 120
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.140 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nfgB00
3NFFB 3NFGB
chains in the Genus database with same CATH superfamily
1XMLA 3I7BA 4XG4A 4DGLC 4H3QA 4I3ZA 2VO7A 3EIDA 1PXMA 5BMSA 3UNZA 1WBNA 4YNOA 3MI9A 3UMXA 4NWMA 4L3PA 4RIWA 1CKIA 5E8ZA 5DI1A 4MQ1A 4O0UA 4A9YA 3IGOA 4FV4A 5AP2A 2PVYA 3QD0A 1JSTA 2R3KA 4I0RA 5CSXA 3VUHA 4MXXA 3D2IA 2PSQA 2WOTA 3VBVA 3BLQA 2YZAA 1H0VA 3HAMA 4DT9A 4R1VA 5HI2A 4DTKA 3Q4CA 3L9NA 5FP5A 3IW8A 2W5HA 2XF0A 4CFVA 2XH5A 4PWNA 4MX9A 2ESMA 2W4JA 1HCKA 2WMRA 1P2AA 1ZOHA 4ZLYA 3LIJA 1KE7A 5BVNA 1FGKA 4EOKA 4BDAA 3JR1A 2JAVA 4DYMA 3FQHA 1CM8A 1UWHA 3RGFA 3LPBA 3OHTA 5KKRB 3ZONA 4OBPA 2GHLA 3TUCA 2FA2A 2ZV2A 1XBCA 4QYHA 3F61A 3P78A 1OKYA 2WMUA 4MAOA 1MRUA 3BWFA 1PXIA 4O7NA 3DKCA 1M2QA 2HW7A 3G0EA 5LQFA 2PZRA 5E8WA 4GK2A 5AUXA 4X2JA 2YIYA 3NR9A 3GXLA 5F94A 4C4JA 5CSPA 3F5UA 4HGTA 5D11A 2XRWA 5J8IA 3QGYA 3SX9A 3ZDUA 4DTAA 3PLAE 2YCFA 3FMMA 3KF7A 3RAIA 5A4CA 4R1YA 4CCUA 3ZO2A 5CI7A 2YM5A 3DXQA 3HKOA 3LFQA 4G31A 4U80A 3MH2A 3VC4A 4B9DA 2Z7RA 5IDPA 4QNAA 3OD6X 3OWJA 4O82A 4XLVA 4FVPA 5AUYA 5GNKA 4DH8A 1OKZA 4I41A 3BHVA 4FEWA 1P4OA 2EXCX 5FQDC 3FZRA 4F0FA 4A07A 2XKFA 4JLCA 2ACXA 3GI3A 4GK4A 2ITNA 4FZ6A 4K18A 1E9HA 2IW6A 5J1WA 2IVTA 1EH4A 3TCPA 4CFNA 4EOLA 4YTCA 3D94A 5BPYA 4JDJA 4QTCA 3FLQA 2OJJA 2ITPA 5HCZA 4RJ6A 5E90A 1CMKE 2IVUA 3GU6A 3ZYAA 4L44A 5JN2A 4LGGA 3PJCA 5EDRA 3PJ1A 1ZAOA 3IW5A 3VF8A 5LJJA 2OJIA 4BDIA 3RHXA 3MA6A 1YW2A 4QMSA 4K9YA 4NM0A 3F5XA 2QG7A 3TNQB 2C5VA 3TL8A 1SYKA 2Y0AA 4WBOA 4BZNA 3FPQA 2IVSA 3FKOA 3VS5A 3W8LA 4QP8A 3OMVA 3LOKA 3NUAA 3UMWA 5HG9A 2XIXA 4IZ7A 4E6AA 5JGBA 5KMKA 4FK6A 1R39A 4PNIA 1O9UA 3PPJA 4DGMA 3BLRA 4G5JA 3ZZEA 2IO6A 3BLAA 5CF6A 2XNNA 2XYUA 2O64A 4Y5HA 1VJYA 4C34A 3DXPA 2O2UA 5K5NA 4BCJA 1WMKA 4FV3A 4IE9A 4ZS0A 2B9HA 1H1PA 4FTKA 4G34A 1YXTA 3MBLA 3OUKA 3WOWA 5A4QA 1O6LA 2FVDA 3KGAA 4QEBA 3HDNA 4ZEGA 3EYGA 4A4LA 3SHEA 4BF2A 4BJJA 2XK8A 4FKQA 5L2WA 3E8EA 5BVDA 2QNJA 3IO7A 2BAJA 4O38A 3D5WA 4IWDA 3C13A 4H36A 3D5XA 4KKHA 3OTUA 5HO7A 2EXMA 2IZUA 2UW8A 3UG1A 3SA0A 3MSSA 4ZSAA 3TIZA 3W10A 3ZM9A 1WVYA 4GUBA 2P4IA 4YZMA 2WB8A 2PUNA 1RE8A 5LMKA 3QHWA 1IA9A 3IKAA 3AMAA 3E92A 3ET7A 4FUXA 5HHWA 4Q5EA 1G5SA 5K3YA 3MVHA 4HCUA 4K33A 3UE4A 4KIOA 3WZUA 1DM2A 5HIDA 1XH7A 2B1PA 4FKOA 3FLYA 4LV7A 5IA1A 2W1CA 2C6LA 2EWAA 3ACKA 4XS2A 5D9HA 2X7GA 4XRJA 3QCXA 4GFMA 1QMZA 3P23A 2CKOA 2OO8X 2PK9A 4IAAA 1OPKA 2QCSA 4WHZA 2BRMA 4QP4A 1R0PA 1Z57A 5FTQA 5GHVA 2GFCA 2HWOA 2XEYA 2J5FA 4PX6A 4RFYA 4AT4A 1TVOA 2CGUA 5KNJA 4CGAA 2OI4X 5C9CA 4GV1A 3SQQA 5EH0A 4W8DA 5HBHA 3NW6A 2I40A 3OOGA 3VVHA 2XIYA 2JEDA 4L3LA 4O7VA 5KZ0A 5EKOA 1E1VA 2QODA 1DAYA 1PJKA 3LCTA 3N51A 4JT3A 4KBKA 5EI2A 5HVKA 4J71A 3V5QA 4BDDA 5LMBA 3VUMA 3SXSA 5EW3A 4APPA 4TYHB 2VO0A 3OCGA 1T46A 4LGHA 2QD9A 4RRVA 4XYFA 5A46A 2HCKA 3OG7A 4C3PA 4BBMA 4ENXA 2R2PA 4V01A 4UYNA 1ZWSA 2J0JA 4O7SA 3C7QA 4OT6A 2VTNA 2PVMA 3QUEA 3HRBA 5H9BA 2J50A 4LRJA 1CTPE 3BEGA 5IUGA 1JQHA 2C5OA 3B8QA 3UOHA 5M57A 1ZOEA 1DI8A 4OBOA 4D9TA 4RVMA 3QQHA 1IAJA 3D7ZA 4C38A 4F9YA 3DTWA 4AA4A 4S2ZA 4AGWA 1Q41A 5AV1A 5JT2A 4JOAA 4D1ZA 4G3GA 2A19B 3BCEA 3FHIA 2WMTA 3MN3A 3LJ1A 3NZ0A 4YJRA 3HL7A 3UDSA 4BDCA 3KL8A 3M11A 3OBJA 4J8MA 4QMVA 2QOHA 3IS5A 4M0ZA 5HIEA 4FTMA 4ANMA 3CR0A 1JLUE 3LVPA 3EFLA 4BGQA 5EYKA 4A7CA 1U54A 2F49A 2W1HA 5JZJA 3A7FA 3O23A 3MB7A 3PVWA 3U55A 4DDGA 4DGNA 2QI8A 4F1MA 5BVOA 2QR7A 5LWNA 2YIQA 3SW7A 1ZYJA 3QYWA 4OTGA 2YCRA 4BTJA 2O5KA 4JX3A 3GC9A 1Y6AA 3SC1A 3LKMA 4F08A 1P5EA 1P4FA 4J95A 4FGRA 3UIMA 3RM6A 1YDSE 2PUPA 4HYSA 3KXGA 4WUNA 3MGYA 4IM3A 1UU9A 2E9PA 4B8MA 3QD3A 1XMMA 5HLWA 3Q9WA 3DAEA 2YERA 1NY3A 3P4KA 5L6PA 3VRYA 4AFEA 4FT9A 5M53A 4YC3A 2H34A 1V0BA 4A06A 3VBTA 3CKWA 2J9MA 4QYYA 1YQJA 2P0CA 1BKXA 2XNGA 4DITA 3OCSA 4E5BA 4BCHA 2PYWA 5CZHA 3ZM4A 4QMWA 2ETRA 4QP7A 3D7TA 4PDPA 2R3HA 5DOSA 1PKGA 1KE6A 5AP3A 3ORKA 3T9IA 5IDNA 2FH9A 4ZSJA 4YZ9A 4MCVA 4BTFA 4RX9A 2UW9A 3UVPA 4CMTA 3ML1A 4S32A 3P7AA 4NT4A 2ETKA 4OTRA 2C3JA 4IEBA 1SM2A 4FV6A 4II5A 2CKPA 5CSVA 3F5GA 4IAKA 5I9VA 4USFA 4FV9A 2C0OA 4O86A 1B39A 2YDIA 3CLYA 1G8KA 2ITQA 3W2QA 2I7QA 2X81A 5ETFA 1RQQA 2V55A 3PYYA 4EYMA 4DEAA 5CALA 4AAYA 4EJ7A 5DT0A 5ETCA 3I79A 4O83A 4QTEA 1OIQA 3HUCA 1F0QA 4EHEA 1OIRA 4QQCA 3OBGA 2X9FA 4MTAA 3SLSA 1RW8A 3FQSA 3C4WA 4USEA 2X2LA 2XK7A 3R9OA 1XO2B 5JK3A 1PXLA 3BGZA 3DKOA 3QX2A 4DGGA 3Q4ZA 4H39A 1YHSA 3S4QA 5LXMA 3D7TB 3OT8A 3QTRA 4E6QA 1IEPA 2XCKA 3COIA 5CT7A 3NNXA 1PMEA 4R7HA 2CSNA 4PL3A 5LMKC 5FBNC 3JPVA 4AGCA 1G3NA 3F6XA 2W1EA 3VO3A 2XAMA 5CNNA 3FYJX 4TXCA 4U0IA 3VF9A 2W9FB 4DF3A 4I0SA 3DOGA 4U42A 4E93A 4DINA 3BHTA 2W1ZA 1ZYDA 2C6KA 3Q2JA 1KSWA 3VW6A 4XV9A 2BALA 4LYNA 3CKXA 3D5VA 2R3MA 3EQBA 4I6HA 4BVUA 2FYSA 3DJ6A 3NYNA 4YBKA 2R7BA 2DS1A 4OTFA 3IDPA 4N70A 4ASDA 3EZVA 4AE6A 1YHVA 4BCKA 3BL9A 4NL0A 5ANGA 1LPUA 4DAWA 4DEBA 4G3DA 5A14A 4JL9A 3KRLA 1Q99A 3AD5A 2I0YA 4XNEA 2B9IA 4F0GA 3OOMA 5FM2A 3A7JA 3K3IA 4RG0A 4BRXA 3COHA 4IVCA 3QD2B 4DH7A 4MBJA 4PL5A 4EQCA 1M2RA 4EH5A 1DAWA 3VONA 4FL1A 3DK6A 5DYJA 3ZO4A 4XV2A 3UVRA 2B54A 2HXLA 1AQ1A 2UVZA 2CGVA 3CTQA 5FEDA 4BI1A 5AM7A 2OG8A 3GU7A 2OICA 5ANIA 4D9UA 3S2PA 2BDJA 4MNEB 4CMUA 1Q5KA 3CGFA 4EK4A 1M7QA 3EMGA 3PWDA 5IMEA 2IZSA 3AT4A 3GFEA 4ZZMA 5DNRA 2W4OA 5KBRA 5HESA 4IX3A 4JIKA 1YDRE 3R00A 4FIFA 2JLDA 2R3OA 3TIYA 4YC6A 4R5YA 5I9YA 5CQWA 3UGCA 3RJCA 4E4XA 4Y85A 3HX4A 3PXZA 1SMHA 1H4LA 3QKKA 4U79A 3VNTA 4F7SA 4IB3A 2ZYBA 3TACA 3H9RA 5TOZA 5DR2A 2GTNA 3WF9A 4BBFA 4C36A 3ZRMA 2BMCA 3NX8A 3C50A 1L8TA 1H01A 2W9ZB 4QP9A 4XG3A 2H9VA 4D1SA 4AZEA 3I6UA 4HNFA 3GCQA 1MQ4A 2O0UA 4BC6A 4L00A 5I9WA 3AXWA 3OWKA 4KIPA 1NVSA 4I4FA 4Y46A 3SOCA 2XBAA 4J98A 4G3FA 4IX6A 4XG7A 4YLKA 2J51A 4RA4A 4DCEA 4QOXA 4ZSLA 1OGUA 3CE3A 3N9XA 2QOKA 2SRCA 1BI7A 2CPKE 4GK3A 4JQ7A 4C4IA 4D4YA 3DAJA 4EOOA 1G8JA 2VTHA 4X21A 3G5DA 4LUDA 3VWAA 4DFLA 3DS6A 1JWHA 3RALA 5M4IA 3MY5A 4XV1A 3O5AA 2ZM3A 3LJ0A 5BUJA 3KULA 4UB7A 4P5ZA 4BYJA 2JITA 4JDHA 3UZRA 1HOWA 4BDEA 2ERZE 4ANBA 3OCBA 4QTBA 1VEBA 3LQ8A 2JBOA 2UZTA 4Q5HA 4PMPA 2R0UA 5CEIA 3RZBA 4A4OA 3GVUA 4K11A 3A7GA 3ULZA 4DEDA 3V5JA 1JSVA 3P79A 4GSBA 3GGFA 3QFVA 3V8TA 3W2CA 2XIRA 2OJ9A 3R1YA 4O7ZA 5CU2A 4QDVA 4MXYA 1YI3A 2J4ZA 3S1HA 4IC7A 3H9OA 3U51A 4EH6A 4EJNA 2UW4A 1SVGA 4QTDA 4CRSA 5L8KA 2Z2WA 2XK6A 3OC1A 3R04A 4WSYA 3RNYA 1VYWA 4GT3A 4AXEA 2OWBA 3V04A 4B4LA 4ZSEA 2PVHA 4LOQA 4ITHA 3CCNA 2WTJA 3OXIA 3VS0A 2IZTA 4U3ZA 4HVIA 5IG1A 4FK3A 4CFXA 1YDTE 3CSVA 3NUXA 3ORZA 4KA3A 1Q3DA 4GG5A 4D55A 4FKPA 4KWPA 3AQVA 3U6JA 2BAKA 4TWOA 3I4BA 1AD5A 2HIWA 1OBGA 2XM9A 4HCTA 5HNGA 4C3RA 4BDFA 3R8MA 3CPCA 3VJOA 3Q4TA 1FGIA 3LMHA 1J91A 3ZS5A 4FOBA 3BYVA 4FZFB 3TV7A 2W5AA 3ZSHA 4XEYA 3IG7A 1OGYA 3TJCA 5IA0A 1XH9A 3PSBA 4YZNA 4I94A 5JZNA 1GAGA 1PRYA 3PVUA 4C58A 3I0OA 3KIOC 4FSYA 3GC8A 3VULA 2PMNX 4GMYA 4LI5A 1M2PA 3FXWA 5J95A 2PVRA 5CNOA 4PDYA 5G1XA 2F2UA 4RJ4A 1SNXA 3BL7A 4R78A 5FUTA 4EOIA 4OR5A 1MRYA 2WTIA 5KHXA 1ZY5A 2YITA 3DB8A 5IA2A 4N57A 3F66A 1KE8A 2GCDA 2GS2A 3EKKA 4RFZA 1CKPA 1YWNA 5JGAA 4PMSA 5KMMA 3EFJA 3WYXA 2H6DA 4FV7A 4FZAB 2XIKA 4IWQA 4AF3A 3MIYA 4NM7A 3R7IA 2W99B 2E9VA 3FEGA 2JDRA 4NU1A 2B9JA 2HZIA 2UUEA 3TDVA 4IAZA 1GNGA 4MXOA 4QMZA 4WG3A 1JKTA 2QHMA 4S33A 5CEKA 5IQGA 3FMJA 4RWKA 1NVQA 4DT8A 4APCA 4GYIA 4C35A 5HX8A 1GZOA 1OB3A 2FSMX 4JAJA 2CNQA 4XH6A 4DN5A 4B99A 5CF5A 3HRCA 5B7VA 5JEBA 4X2GA 1A06A 3FBVA 2GU8A 3ORPA 2YIRA 3NYOA 2YACA 4DG2E 3LE6A 3BX5A 4MD7E 5TT7A 3VS7A 4ZTMA 5AP5A 5JFXA 1JKSA 4G2FA 3U9NA 5ETIA 5B2KA 4F4PA 2WOUA 3QCSA 1Q24A 3II5A 4FZDB 4O7WA 1OL6A 2DWBA 5ACBC 3MJ1A 1Q97A 2WQEA 4L45A 3C4XA 4MXZA 3P7BA 5CU0A 4YUQA 2X1NA 4LV8A 4C37A 3MH0A 2VTQA 3WBLA 5KBQA 2OIBA 4ALVA 4EQUA 4XOZA 5D12A 2P33A 4BDKA 4CZTA 3SG8A 5HD4A 5JFWA 4FSNA 5DT4A 4I4EA 2WU6A 3KQ7A 2EB2A 3FL4A 3PIXA 5IISA 3C5IA 3AC1A 1VLRA 3HDMA 3ORMA 4AN2A 5CSHA 5K9IA 4O7TA 4JDIA 2WMAA 3W0NA 4EKKA 4KINA 3FI4A 2J90A 4ZTLA 3EZRA 4OLIA 4IHPA 4AT3A 4EK3A 1W83A 2VX3A 3D9VA 2BZHB 1U4DA 3GBZA 4O0VA 3H3CA 5HD7A 5CVHA 4PP7A 1KE5A 3PSCA 5CAPA 4IADA 3VHKA 2PZYA 3EHAA 2XJ0A 2CCHA 2B55A 3FDNA 3FV8A 4FTAA 4B6LA 4YO6A 1WFCA 4FKJA 3D14A 1W0XC 3QUPA 4M97A 3LFFA 2VWYA 2IVVA 1LEWA 3QHRA 3Q9XA 3QRTA 4R5SA 2R3NA 3CQUA 4AN9A 3WF5A 2VUWA 3WZEA 2X8EA 2VRXA 1ZY4A 4TNBA 2JDVA 3KXNA 5CS6A 2EB3A 5FGKA 5JRQA 4KKGA 3U8WA 5JMSA 5KMLA 3UYSA 1BI8A 5AV4A 1Q62A 2GNFA 1FMKA 3C0IA 3R6XA 4WRSA 5L6OA 4A9UA 4UEUA 2BTRA 4AAAA 3F3TA 5KZIA 4AXCA 3ZC5A 3PVBA 3TYKA 4UN0C 1KWPA 3LHJA 4XP3A 5DN3A 4IJ9A 4D4VA 5FRIA 2VD5A 4OT5A 4FKVA 3FXZA 3OEZA 4QMXA 3BYSA 4IIRA 4W4WA 5M4FA 3P08A 3TKHA 3Q53A 4KD1A 4H1JA 5ANEA 3SKCA 3R01A 4A9SA 3R8ZA 2NPQA 4D4RA 4CLIA 4GU6A 4YJTA 1I09A 2BZIB 3PZHA 1J1BA 4HNIA 3QU0A 4BTMA 1PMUA 4TZRA 2X7OA 3BI6A 3R7OA 3FC2A 4FYNA 1NT2A 1OIYA 2F2CB 4FG7A 3UZPA 4QMTA 3GCVA 4GVAA 5HEZA 4YZDA 4DEIA 5JFSA 4RC3A 1VZOA 2WMQA 4TTHB 2OW3A 3HNGA 1PKDA 4UZHA 4I20A 2CJMA 2XMYA 3VS4A 2XKEA 5AADA 3F2RA 3ZRLA 3DDQA 2P2HA 3E63A 3NDMA 5EHOA 3EFWA 3EN6A 4FVRA 2JGZA 3RAKA 2XB7A 2JIIA 4TYJA 3L8VA 4CTBA 2WD1A 3LM0A 4RIXA 4NJ3A 4UY9A 3ZLSA 4IFCA 3ZO1A 4XG6A 3R02A 4PDSA 2VTAA 4FTNA 1OPJA 3PXFA 2UZEA 4PMTA 3EFKA 2GQSA 4IX5A 3R63A 3GQLA 4MWHA 3ZSGA 2PHKA 4O0TA 2Y4IB 3ZEWA 2YWVA 3SG9A 4B0GA 3BWJA 3EQIA 3PP0A 5HO8A 3NUNA 4RVTA 3ROYA 3AG9A 3SW4A 4L01A 5EYCA 3TXOA 2ZOQA 4BIDA 3QCYA 4YC8A 2RKUA 3FMHA 1FOTA 1YKRA 2O3PA 2W1GA 4QRCA 5L6WL 2X4ZA 2PE1A 4Y5QA 5DVRA 4FKWA 4ZZNA 4F7JA 2BCJA 5E4HA 3ORTA 4GG7A 4L9IA 4P7EA 3S0OA 4RIWB 4AQCA 2JD5A 5LARA 4BHZA 2EVAA 3AC8A 2VWXA 4IDVA 1H1SA 4KRDA 2C1AA 4RIYA 4L7FA 4LRMA 3I5ZA 5C8MA 4A9TA 4OTQA 3F82A 4AOJA 4RIXB 5IF1A 4WT6A 1IASA 3ENMA 3OZ6A 4RLLA 4FTRA 5TF9A 4DG3E 4R3CA 3SAYA 4AACA 2GNGA 5HLNA 3AGMA 3POZA 3LFEA 3HYHA 3IW4A 4ZJIA 4UX9A 4O81A 1XH5A 2JDSA 4BICA 4G9RA 2NRYA 3S95A 2Q83A 3Q9YA 3A99A 5AAFA 4LMNA 3QTUA 4X3FA 4FKLA 3NVMB 4YBJA 2UZLA 1Q8ZA 4FNZA 4L53A 4DA5A 2HZNA 4EC8A 3WIGA 3KFAA 2CGWA 4NM5A 4TY1A 3KU2A 2CLXA 3P9JA 3GOPA 4FT0A 5EW8A 1KOAA 2WQMA 1LEZA 2YIXA 4RIYB 3UYTA 2W1FA 1H27A 5M08A 5CXHA 3C0GA 4QP3A 4ACCA 5EYDA 1ST4A 4IB0A 5FXQA 5CVFA 3MV5A 4AU8A 4BDBA 2BRHA 4KUJA 4YZBA 5G6VA 5CT0A 4GKIA 4I92A 1YWVA 1XH4A 1PYXA 3DQWA 3NUYA 3ODYX 5JQ8A 3QUDA 2RFNA 4NM3A 4GW8A 2AC5A 4YP8A 3ZLXA 3VBYA 4EH2A 4D5HA 4BDHA 2UZWE 5JKGA 2VWBA 4FSWA 4FIJA 3PY1A 3UOKA 3SXFA 4ZXTA 3FLWA 4QQ5A 1TQMA 4M7IA 4X3FB 5FG8A 5BQ0A 2QO9A 2YM8A 4FKGA 2I1MA 4MWIA 4RQKA 4AX8A 2J0MB 4AN3A 3MTFA 4C4FA 3QAME 5AP7A 3COKA 3FZPA 5LMAA 2JKKA 4EWHA 3EN9A 4FV0A 4DH5A 2VZ6A 4QP1A 1IRKA 5BVKA 3LFBA 4GCJA 4XUFA 4CXAA 4LUEA 3O50A 4JS8A 4HYUA 4QPAA 3NAXA 1F5QA 4OUCA 2UZVA 2NNWB 2XJ2A 2WMXA 5CQUA 4FKTA 5E1EA 5BUIA 3G15A 4BCMA 5DPVA 4X3JA 2GHMA 4AOIA 4AW2A 4M12A 4BTKA 3FKNA 3TV4A 2YAAA 5CSWA 5FEQA 5LWMA 3BGPA 4FICA 3RP9A 2QOFA 2ITZA 4BCGA 2C68A 5CF8A 2PMIA 5AP4A 1NXKA 4R77A 4EHZA 2QO2A 2WKMA 3DLSA 3DXNA 3W16A 2BKKA 1GY3A 3DFAA 5EOBA 4DGOA 4CKRA 4ANLA 4JXFA 4DLJA 3MFRA 5HQ0A 4I5PA 1PY5A 4V0GA 1Y91A 4WO5A 5IEVA 3W33A 2Y4IC 4FTQA 3LXPA 3AMBA 3FQEA 4I6FA 2J2IB 2PE0A 4RIOA 4E4MA 4BCFA 3N4TA 5HVYA 4F6WA 3RNIA 4EYJA 2ZFYA 2WTVA 2O65A 1UV5A 2G2FA 1H28A 5IQIA 3OY3A 3PXKA 4ZY6A 1A48A 3UQGA 4BJJB 4IM2A 3AC3A 2GMXA 2VX0A 1WZYA 2V0DA 3Q4UA 2G9XA 3G6GA 4F64A 3L8SA 5D7AA 2JDOA 3VUKA 3ZLWA 3UDBA 1R3CA 3FI2A 5AFVA 4EBVA 3PPKA 3WYYA 2AEGA 3KMUA 5HIBA 4M69B 1MUOA 4LL0A 4CFUA 3V51A 4FNXA 4CFWA 4CQEA 5BYLA 2WTWA 5T68A 4F1TA 3FZOA 4O6EA 3MA3A 2A2AA 1QL6A 4P5QA 4MNFA 4L42A 3MVJA 3PUPA 1GIJA 3PJ8A 3RPYA 4CTCA 4V0GB 4BI2A 4AOTA 2B7AA 4FV8A 3LCDA 2AUHA 2UZDA 4I5MA 2HYYA 3QTSA 4IZAA 4LL5A 4MH7A 4E7WA 5IA4A 5EM7A 3VBXA 4DEGA 4FA2A 3UOJA 3JS2A 5KE0A 5B2MA 2IN6A 4ZTQA 5H8BA 2WTDA 4PTCA 4JG8A 5JRSA 3PIZA 2XNOA 3LFSA 3UO6A 1V1KA 1OECA 2YM3A 5IPJA 2CNVA 3MPTA 4NYEA 2ITTA 3PRFA 5HTBA 5DE2A 4QMQA 4UXQA 3DCVA 3EQPA 3OXZA 4F99A 2BFYA 2ERKA 2OXDA 3T9TA 3HV4A 3W0PA 3PFYA 4KIQA 5LCJA 3GU8A 4EOQA 4EK5A 3GENA 3NNUA 4O21A 4U43A 3W18A 3KXXA 4FV2A 5BVWA 4F6UA 5BYYA 3F69A 2QU5A 4R6VA 3RAHA 2JIVA 4G5PA 4QTAA 3DV3A 3KMWA 3NNWA 1JKLA 5FDPA 5KCVA 3QXOA 4HJOA 4ZK5A 2VTRA 3S3IA 4ARKA 2PUUA 4KS7A 3EQDA 4IANA 4RZWA 4AW1A 3U54A 4MXAA 5GIOE 3HV5A 4FR4A 5HCXA 4I6QA 2ZAZA 1ZARA 3TUDA 5BYZA 1L3RE 2XIZA 4WNOA 1YVJA 2JKOA 1TFFA 2ZB1A 1W84A 4FIGA 3F3VA 1JBPE 2C6OA 3LFNA 4JJRA 3PTGA 4X3FC 2PVKA 5FEEA 3FJQE 3AC4A 3UNKA 4ZY5A 2X8IA 2XUUA 3CBLA 3NGAA 3KRXA 3R22A 2WMBA 3ELJA 4UZDA 2R0IA 4FBXA 4YMJA 5IEYA 4JG6A 4QMMA 4Y83A 3SV0A 1G8AA 4FTOA 2PE2A 4FX3A 4R7IA 4DFUA 4CKJA 3K54A 2OZAA 3QCQA 4MD9E 4CFMA 3B8RA 3PE2A 1B6CB 4IQ6A 3ZOSA 3AKLA 2J0LA 3HMPA 3RI1A 4F0IA 3H30A 2VO6A 3DLZA 1XQZA 5K5XA 2YIWA 4GJ2A 4X6QC 1Q8UA 4TN6A 4LQMA 1R78A 3QZFA 3EQHA 3C5UA 3LLAA 2R3QA 3FPMA 3FZSA 4YJVA 3ZFMA 4E4NA 1S9IA 2KTYA 3V5TA 3QLFA 3QTWA 4M0YA 3SVVA 5CYIA 4DFYA 1UU3A 3HZTA 2ZDTA 4CG8A 3LMIA 3OWPA 1APME 3FY2A 3QQKA 4GFOA 1U54B 3EWHA 2JAMA 5CX9A 2VTOA 3VS2A 3ZSIA 4AGUA 3QQJA 5AX3A 3ATSA 5C27A 4EZ5A 3EQGA 5TO8A 1XHAA 2Y9QA 3MS9A 4FGBA 1PF8A 1PXPA 3A60A 5DG5A 5J9ZA 4BCQA 3FMLA 5HGIA 5CEMA 1ERKA 3R8LA 4BN1A 3BPRA 3TTIA 4D2SA 3AOXA 3VIDA 1PXKA 3C4ZA 3PWYA 2IJMA 3HMMA 4X2KA 4IX4A 3HP2A 3ZXTA 2OZAB 1CSNA 2IW9A 4FOCA 4J53A 5TR6A 5D10A 4D5KA 5CEOA 2ZJWA 4O96A 4CV9A 2QU6A 2VTJA 4DBNA 2YISA 5KX8A 5EK7A 3VS1A 4DEHA 4BGGA 2QR8A 5M4UA 2HELA 3ERKA 3KREA 5E8VA 2XCHA 4G9CA 1OL7A 2YCSA 4TWCA 4BYIA 2Y8OA 3ETAA 3RPRA 3JXWA 2NP8A 1ZZLA 4XOYA 4ZP5A 4ERWA 2FSTX 3EL7A 4I22A 4YJSA 5M44A 4IZ5A 1W98A 4DG0E 4OTHA 2GNIA 4ITJA 1YOJA 3EKNA 3IDBA 4RX7A 3WI6A 1PXNA 3WF6A 3T8OA 2JIUA 4XP2A 1XWSA 2OFUA 3F2NA 1PW2A 4LFIA 5I9XA 3E87A 1BUHA 4ZTSA 3D2KA 5E9EA 4U97A 2WU7A 4WKQA 4O27B 2WTKC 5HICA 4D2RA 3Q52A 1YWRA 2Z7QA 3AC2A 5BV3A 4GL9A 5DRBA 1UU8A 4PDOA 4ALWA 3MY1A 4FTCA 4EL9A 2VTLA 4FL3A 3BGQA 3HEGA 3EQRA 5AP6A 5M51A 4D0WA 3RK7A 4CT2A 2VWZA 4ASZA 4CLJA 3FL5A 3ORXA 3UBDA 4KKEA 1H0WA 2XZSA 3BYMA 2VNWA 4L43A 3TMOA 2OH4A 1H07A 2GQGA 2PL0A 2QLUA 3EL8A 5CI6A 3C9WA 1XJDA 4JQ8A 3SGCA 3A2CA 1OI9A 2IPXA 3DFCB 3QWKA 2VNYA 3FMDA 4XBUA 5E8XA 3N4VA 3GC0A 3RPVA 2R9SA 5ACKA 4O91A 4TNDA 2ZVAA 4M68A 4O2ZA 4JMQA 2XA4A 3V8SA 4CD0A 4FI1A 2VAGA 3BQRA 4X0MA 2R7IA 3ID6C 3LXKA 4IAFA 4UWYA 3D4QA 5CAUA 3QF9A 2YABA 4RJ7A 1ZLTA 5L2TA 3GU5A 4QMUA 3P86A 2BUJA 3QC9A 3ANRA 4IAIA 2XRUA 3HA6A 4DFNA 4B8LA 3UQCA 5HE3A 5LVNA 4PL4A 4DBXA 4KSPA 3F7ZA 4JG7A 4O7YA 4YURA 3CY3A 3F3ZA 4IC8A 2GNHA 3OW3A 4WA9A 3L1SA 3LJ2A 5E92A 2YJSA 3MH3A 3A8WA 4AXAA 3UPXA 4AW0A 4D4SA 2VU3A 4I23A 1LUFA 1JAMA 5LVOA 1LR4A 3GUBA 3FMKA 3WE8A 2UZUE 4R7BA 4YTFA 5FDXA 1YXSA 4XHKB 3BEAA 1ZYSA 2VWWA 2GS6A 4MVFA 2GSFA 4EI4A 1WBTA 5CVGA 4KS8A 3NS9A 2PU8A 3NWWA 4FSRA 3P7CA 3ACJA 3PFQA 2BTSA 5DFPA 3BKBA 3ZDIA 3LCKA 4FKRA 1IA8A 3I0QA 4FYOA 3QL8A 4Y8DA 4IDTA 4XLIA 1GZKA 5EQPA 2PPQA 3B2TA 4RJ5A 4ORKA 2JFLA 4YLJA 4L6QA 3QTQA 4FEUA 2I0EA 4FVQA 3EQFA 5CU4A 2G2HA 2ITUA 4IZYA 5DIAA 5AM6A 4EORA 3TWJA 2WO6A 3UVQA 4EZ7A 4ZJVA 4HOKA 2YZLA 3R9HA 3RWQA 3LXNA 2UVYA 5AWMA 3FMEA 1YI4A 3PDTA 4KBCA 1IG1A 1WCCA 3BQCA 2GHGA 3QQLA 3R9DA 3TG1A 4X2FA 3W0RA 4IVDA 5IA3A 5AUZA 3RVGA 3KF4A 3QD4A 4BR3A 3QALE 2BIYA 3FZTA 5DH3A 4E6CA 2CNUA 1ZYLA 4ANQA 4HVGA 2C4GA 4FSMA 3TNPC 4NUSA 3UIBA 5EI6A 4M3QA 3JYAA 3UOLA 2OK1A 3G6HA 3QC4A 2R3LA 3W0QA 1PXOA 2DYLA 5A3XA 3EJ1A 2FGIA 5HNIX 4YPDA 4C59A 4IH8A 3U9CA 2CN5A 3M1SA 2Z8CA 4AE9A 4EEVA 5E8UA 2O8YA 2OH0E 3DBEA 2F57A 3KULB 4Q9ZA 4NCTA 2QO7A 2GNJA 5DBXA 5KUPA 5A4EA 5IQEA 1JKKA 2FB8A 3BYOA 4C2WA 2H8HA 4H1MA 4IWPA 3GCSA 1GIIA 3CD8A 5LCKA 2E9UA 3RAWA 4FT7A 4YO4A 2G15A 2XK9A 2GQRA 4U81A 2PVLA 4K6ZA 4HPUE 4ACDA 5E8TA 4ZTNA 3V5PA 3TZ7A 2XALA 1W8CA 4EH9A 4QMNA 3DTCA 4J97A 2OZOA 3ITZA 2VTSA 5DLSA 5EM5A 2NRUA 1QPJA 2XEZA 2X7FA 4AA0A 2O63A 1U46A 2WFYA 3E3BX 2YM6A 3MY0A 5CANA 3LFCA 3KRRA 1X8BA 2I6LA 4G6LA 2UW7A 3QWJA 1K3AA 4JDKA 4YU2A 4FTIA 4ZOGA 3TI1A 4K1BA 1PMVA 5D7VA 5DT3A 4CV8A 3OVVA 5IEXA 4BB4A 3F5PA 5AUUA 2HOGA 5HBJA 2V5QA 4C0TA 4HW7A 3ENHA 3O96A 4NSTA 4XG2A 5C4LA 2B4SB 4P4CA 3PA3A 4U40A 3PY0A 4C4HA 4GUEA 3R8UA 3DK3A 4QYGA 2EUFB 4WBBB 4FZ7A 4MKCA 1XH6A 3WE4A 3AKKA 5HG7A 3QRUA 3R2BA 5CXZA 2G01A 3VBWA 4DEEA 3U6HA 3I1AA 4GU9A 2FO0A 2ITWA 3K5UA 5DEYA 2I0HA 5BVFA 1YI6A 2BAQA 4Z55A 1SVEA 1JPAA 2BRGA 4J52A 3OFMA 4JAIA 3QTXA 5KMJA 2W1DA 3G9LX 3FSFA 2C6MA 5EW9A 4CG9A 3O71A 3L8PA 4EUTA 1J7UA 4H3BA 5FTOA 3GT8A 1M17A 4UYAA 4YR8A 4Z16A 2PZPA 2R5TA 3DKGA 5B2LA 5JGDA 3HVCA 3VHEA 4TKSA 5AV0A 4C3FA 3MPAA 3CC6A 4PP9A 5T6KA 1H26A 3FE3A 3GEQA 2PTKA 4S30A 5J5SA 2BDWA 3B2WA 1UWJA 3DAKA 3KVXA 3NYXA 5DGZA 1Y8GA 4NKAA 4IW0A 2R3JA 4FMQA 2W05A 4FSQA 3POOA 4FTJA 1PYEA 1QPEA 4BY9E 3OY1A 5DR6A 3DGKA 2BROA 2C1BA 2REIA 3R28A 4HGSA 1MRVA 2G1TA 4BDJA 4JX7A 3IPHA 3NFFB 4AG8A 5EHYA 1K9AA 1VR2A 2OGVA 3TN8A 4DHJA 1FPUA 5M07A 4D0XA 1KV2A 5CU6A 2B53A 4E5AX 2F9GA 3NCZA 3ATTA 3FLZA 5HE0A 4U7ZA 1CKJA 4ALUA 1H8FA 3QKLA 4IB5A 4F70A 1JOWB 3UNJA 4L8MA 3PJ3A 2X8DA 3UDZA 4ANSA 2WMVA 4JRNA 2YFXA 2VGPA 3HMNA 3O8PA 4MUQA 3MPMA 4V04A 2P3GX 5JQ5A 4CNHA 3VS6A 2WNTA 3D83A 4K77A 4PUZA 3ORIA 3UP7A 4BCNA 3VJNA 2AC3A 3TEIA 4IAYA 4GIIA 3KA0A 3FHRA 3HV3A 3ZUUA 3Q96A 3O7LD 3W2PA 2W7XA 3QGWA 4PF4A 1OKVA 4IACA 2BVAA 2C5NA 3KVWA 2ZM1A 4BDGA 3Q6WA 3R1NA 4BGHA 5IQAA 4QNYA 5AV2A 2IZRA 1W7HA 4HVDA 1ZMUA 2YEXA 2LAVA 3R30A 4BBEA 3BZ3A 2ONLA 4KBAA 3BE9A 5L8JA 2XK4A 3L9PA 2PMLX 4V05A 3SXRA 4YJUA 4FV5A 3A4OX 3R8VA 4EH3A 1ST0A 5BMMA 4W4XA 4QQTA 4WD5A 4HVHA 4ASXA 3ZO3A 5IUIA 1YOMA 3NNVA 5AUWA 5C4KA 4TYIA 2RFEA 4YJOA 5DRDA 4YTIA 4IM0A 3VW8A 5BX0A 2C5XA 1U5QA 4ZSGA 4LG4A 3W55A 3W2RA 3HA8A 4WG4A 3TKUA 3TZ9A 4HGLA 5EQEA 4AXDA 4GRBA 4U3YA 1NW1A 1M52A 4AP7A 4YZCA 4JVGA 3KB7A 4G16A 2RFSA 4FEQA 1TQPA 2BR1A 4NTTA 3G90X 1YRPA 1KV1A 3UODA 5CASA 4RLKA 3Q3BA 2V22A 2CKEA 2F7EE 4NCTC 2YCQA 1JVPP 4L3JA 4BIBA 5I9ZA 3HLLA 3OP5A 1PMNA 3LQ5A 4ACMA 4FODA 3BU5A 3VUGA 3RCDA 4BCOA 4Y73A 4PMMA 2ZV7A 5AX9A 4O6LA 2F4JA 4NTSA 4QMPA 5J87A 2V7AA 3ZC6A 4L67A 5F9EA 4JBVA 4IVAA 5I5ZA 5EDQA 1WBWA 4O2PA 4IWOA 2UZBA 4F7LA 3BHUA 1FINA 3DJ5A 4FNYA 3TZ8A 3QBNA 3U87A 4M13A 2VWUA 3QYZA 3R73A 3A7IA 3HMOA 4QMLA 3PRIA 3VS3A 4RZVA 3AMYA 4Q9SA 2CCIA 4Z7HA 3ZBFA 5CLPA 3Q2MA 1Q8YA 2DUVA 4NZWB 2XK3A 3OUNB 5L2IA 3LFAA 3OTVA 4WOVA 4CCBA 3MYGA 3ODZX 3UZTA 3DNEA 3NYVA 1BYGA 1K2PA 2QLQA 5ANKA 2OLCA 3WILA 4EC9A 5I0BA 1TKIA 5M56A 1RDQE 2YDKA 2WMSA 1BL6A 2XM8A 5CZIA 3DNDA 3MFSA 5EOLA 4F63A 3GP0A 3IECA 2OXXA 2X6DA 2OSCA 3LM5A 1OKWA 2OF2A 1XKKA 2BDFA 2UVXA 2WQOA 4FT3A 4N0SA 4YPSA 4ASEA 2HWPA 4GFGA 4F9CA 5JFVA 3GNIB 4L52A 3V6RA 2C3LA 5HE1A 5D1JA 3NFGB 3ZZWA 4BZOA 4FUYA 4I1ZA 3ZRKA 3TM0A 4H58A 3KXHA 3R7VA 4GS6A 3W0MA 3UC4A 4RVLA 2H96A 2EU9A 4F65A 4ZJJA 2XJ1A 3IOKA 4HYIA 2PVNA 3PLSA 2VX1A 1WBPA 2HENA 1OVEA 2XKCA 2QHNA 3GU4A 3KMMA 4RQVA 4YGAA 3VRZA 4LMUA 3OROA 2QONA 2PZIA 4M8TA 4USDA 2QOLA 2X2KA 2XNPA 2QOQA 3LXLA 3SDJA 4O0WA 4JNWA 5K4JA 3CY2A 3Q9ZA 3KN5A 4FIIA 4F9WA 4PTEA 2VTPA 2WQNA 1WBOA 2HY81 3F88A 4RSSA 5FM3A 3FMNA 2C3KA 2WEIA 3BV2A 5C8KA 1Z5MA 2C6IA 4EKLA 3DBCA 1RJBA 5M4CA 2WIHA 4QO9A 3HP5A 2B0QA 5IQBA 5C03A 4L7SA 4WUAA 4DH1A 4J1RA 5ETAA 5A6NA 3ZUTA 2ZV8A 3ZFYA 5EG3A 3ORLA 5ITAA 3AGLA 4W4VA 1R1WA 3NIZA 4FE2A 3WZKA 3RM7A 2XNEA 5ANDA 3THBA 2JDTA 4K8AA 4C2VA 3G33A 4C33A 1KOBA 3W1FA 4IVBA 2VTMA 4FTLA 2WZJA 3R7EA 4E26A 3F2AA 4J7BA 4EQMA 3JY0A 4H3PA 5KHWA 4AS0A 4YJPA 1GJOA 4RX8A 3PIYA 4U41A 3QTZA 2ZMDA 2E2BA 2BILB 4KB8A 3V8WA 3CJFA 4RFMA 3PSDA 3MB6A 4IMYA 4XMOA 5FBOA 3C4CA 3E8CA 5E7RA 3D0EA 5E8YA 4U5JA 2HY0A 1PHKA 4IBMA 5IH6A 3HV7A 3GC7A 1URWA 3FSKA 2W96B 4TRLA 2UV2A 3O7LB 4FSUA 4W4YA 5KMOA 3A7HA 4XG8A 2CGXA 4RT7A 2C5YA 3GFWA 4YLLA 3RKBA 3DQXA 5EQYA 3ZFXA 2X2MA 3QZIA 4QMYA 5HORA 5EYMA 1FMOE 3Q6UA 3V6SA 1QPCA 3NPCA 5IH4A 4HGEA 2BHEA 3T3VA 2W4KA 3H4JA 3P1AA 5F20A 4MD8E 3AD6A 4O0YA 4UV0A 3DJ7A 4EH4A 5HVJA 1NVRA 4PQNA 3FI3A 3BHYA 3G51A 4ITIA 2ONLC 3OWLA 5BNJA 3E62A 4S31A 4X6RA 5AAGA 2QOOA 2OJFE 4YSMA 1QCFA 2NO3A 3CS9A 5CWZA 1H1QA 4LDTA 2CLQA 2Z02A 4O22A 3MIAA 4F9BA 3IW7A 4BCPA 1OIUA 4NH1A 5CF4A 2RL5A 1Z9XA 4O0RA 1DS5A 3WZDA 3KKVA 2J5EA 4G17A 4LRKA 4C61A 4I5HA 4Y95A 3RHKA 1ZXEA 5GIPE 1ND4A 3MFTA 2GFSA 2GDOA 3BRBA 1BMKA 3MDYA 2YWPA 5DHJA 3CIKA 1OZ1A 4XCUA 3RK5A 3O17A 4BHNA 3MVMA 3ORNA 3V5WA 1E1XA 3HV6A 4O7LA 5HU3A 1J7LA 1O6KA 3ZUVA 4TYHA 3NW7A 4WNKA 3NEWA 3OF0A 4FG8A 3E8NA 5F4NA 5AV3A 3MJ2A 1ZZ2A 3WF8A 4B7TA 5AUTA 3PG1A 4C4EA 1GIHA 2VGOA 3FYKX 3UC3A 3NVKI 3DKFA 3EQCA 5AUVA 4F1OA 4CZUA 3PE1A 2OJGA 5HBEA 3ZLYA 3KRJA 2WTKB 4I5CA 1UU7A 2PUIA 5KKRC 3P0MA 4GVJA 1LP4A 1MP8A 4M14A 3VQUA 4KSQA 4KRCA 5AAEA 5A6OA 5IZFA 3DZOA 4YHFA 1BL7A 3ZBXA 5HTCA 3ZHPC 3R7YA 2JKQA 3R7UA 5EM6A 3KK8A 5L8LA 1REKA 4CT1A 3IQ7A 4C7TA 2UW3A 4I24A 3DY7A 2BIKB 1SZMA 2ITYA 3UO5A 3KCKA 3R9NA 4EH7A 3KEXA 3HRFA 5IUHA 2WHBA 3D5UA 3D15A 4JR3A 5FD2A 3QXPA 5FP6A 3LQ3A 4HPTE 3AKJA 4CKIA 3BBWA 3L9MA 2C0IA 3V5LA 4DFZE 1J1CA 4BIEA 3IGGA 3QQGA 1W82A 4G1WA 4RA5A 1HCLA 1U5RA 2HZ4A 3DU8A 3JVRA 4FL2A 3RK9A 4DHZA 4DH3A 2HZ0A 3H0ZA 5KO1A 5AIRA 3PXRA 4CRLA 5C1QB 3PA4A 3PJ2A 2PWLA 4NFNA 2QQ7A 2JC6A 4N6ZA 1H25A 3UQFA 5T3QA 4ENYA 2CDZA 5J9LA 2F7ZE 2IWIA 2XNBA 4XBRA 1SVHA 3ZTXA 2C47A 4K0YA 2ZDUA 1OUYA 4DDIA 2WXVA 3BELA 4WNPA 2RFDA 4UWBA 2CMWA 4TYGA 5IQDA 1VYZA 4EK6A 3VAPA 5L2SA 5HU9A 2OXYA 3QQFA 4YHTA 4AZTA 5FXSA 3CTJA 2OIDA 1JSUA 2V62A 3NUSA 4GJ3A 3WZJA 4RWIA 5EKNA 2YN8A 4E5WA 5AJQA 1ZOGA 4CSVA 2QURA 1O6YA 4J96A 4PNKA 3CQWA 4EUUA 3TNIA 4K2RA 4QQJA 2XVDA 3ALNA 1J3HA 3EB0A 3JVSA 3LZBA 3RCJA 3VUIA 1FVVA 4ZLOA 1P14A 3AT3A 3QA8A 4OGRA 1OPLA 3DA6A 3MH1A 3R9RA 4UALA 4OTIA 3LCOA 3R8PA 5I4NA 4R3PA 3DK7A 3BE2A 3W32A 4A9RA 4AZFA 4JRVA 3EOCA 3P5JC 1GOLA 3EH9A 5F1ZA 3SOAA 5EI8A 4ZY4A 3K2LA 4M15A 4TT7A 4RGJA 1KUTA 5CAQA 5LVMA 1YHWA 3H10A 2QOBA 3SD0A 4D1XA 1STCE 3FLNC 4RBLA 4MK0A 4EHVA 2WIPA 3DBDA 3H0YA 3R1SA 2XP2A 3KRWA 2QKWB 4N6YA 5GJDA 2W0JA 5HG8A 2FSLX 4YNEA 3CXWA 3JUHA 3R21A 4GKHA 3C4EA 4NFMA 3CTHA 4JBQA 4PTGA 3WF7A 3ZEPA 4Z3VA 2JKMA 3EN5A 2RGPA 3EN7A 3NMUF 3O2MA 4M67A 3CJGA 4FC0A 2YDJA 1WBSA 1NA7A 3HMIA 5CEQA 4C62A 4DCAA 3QRIA 2XAOA 3KN6A 2A0CX 2WQBA 4O84A 5HX6A 1YXXA 4BKJA 5H2UA 3Q5ZA 4HCVA 4U6RA 2ZM4A 1OL1A 3F3WA 4P90A 2WGJA 2X9EA 2R64A 1OMWA 3OEFX 3E7VA 3IOPA 3BU6A 2UW5A 2WEVA 4HZSA 2OFVA 3RPSA 2FSOX 4FJVA 3TUBA 2X6EA 4LOPA 2YAKA 3PZEA 4GYGA 4RJ8A 5CAVA 5L3AA 2WAJA 3PUFC 4RMZA 3U6IA 4FV1A 4TL0A 2R4BA 1H00A 5AP0A 4EBWA 1BLXA 5HLPA 1IAHA 1V0PA 3BU3A 2HAKA 3L9LA 2X0GA 3KY2A 3BV3A 3E93A 1YOLA 5F95A 2XBJA 3C4FA 3FZ1A 3KCFA 5H8EA 5A54A 5IMXA 4EK8A 1OITA 2OKRA 2WPAA 3MTLA 5I9UA 4XRLA 1DI9A 4MNEA 3AT2A 3QQUA 4ZMFA 3VBQA 1BX6A 2OF4A 1QPDA 4OBQA 5BUEA 4IB1A 4QYEA 4XX9A 3VN9A 4EHGA 2RG5A 4CFFA 2ZB0A 2WTCA 2HK5A 4WRGA 2E9NA 2JBPA 2ITOA 2VO3A 3CEKA 3OCTA 3IONA 3UJGA 2E9OA 1FBNA 1ZRZA 4HYHA 4QP6A 3LCSA 3COMA 3G0FA 4AQKA 3UPZA 1V0OA 2HXQA 4GT4A 4YJNA 1JNKA 3TDWA 4Z9LA 4ERKA 4MF1A 4PY1A 5CENA 4FIHA 4RJ3A 5D41A 1OL2A 3DBFA 3M2WA 5H8GA 2Q0BA 2QC6A 2C3IB 1WBVA 3WARA 3C1XA 4FTUA 2NYAA 3ROCA 3HAVA 4KAOA 3NUUA 5AP1A 1M14A 5EHLA 1M7NA 3R0TA 5E91A 2P2IA 4I93A 3CPBA 2A4LA 2R3GA 2VTIA 4MHAA 4RC2A 3W2OA 2Z60A 3CP9A 4DHFA 2B52A 3PXQA 3ZXZA 4AGDA 2BHHA 4BZDA 3AC5A 2W5BA 4G3EA 4TPTA 4DC2A 4MBIA 2RG6A 4ACGA 1T45A 4QT1A 4ACHA 4DE4A 4E73A 5DEWA 3E64A 4FKUA 4J99A 1GZNA 4FG9A 3MW1A 2GTMA 3FC1X 1Y8YA 3ANQA 3H9FA 4ID7A 4IJPA 4QYFA 4WNMA 1UKIA 1R0EA 3F9NA 2C6EA 2Q0NA 2PVFA 3UDTA 1OL5A 2QOIA 5ANOA 5DA3A 4ZMEA 5E8SA 2J0KA 1H24A 3E8DA 2ITVA 4YSJA 2HW6A 4BI0A 1UA2A 3LMGA 3R2YA 1TQIA 1KE9A 2YJRA 3TKIA 2YHVA 4OW8A 2VTTA 3FI8A 4EH8A 5HKMA 3IDCA 5FLFA 2F7XE 3TNHA 3W8QA 5FXRA 3O8UA 4MXCA 4A4XA 5IQHA 3OT3A 3UIUA 4ZZOA 5K4IA 3T3UA 4F6SA 4L68A 4EOJA 2XANA 1IR3A 3DDPA 3NSZA 5B0XA 3SRVA 2PVJA 4EOMA 2C30A 2QVSE 2X39A 2XARA 3Q60A 3ULIA 4JI9A 4PV0A 4AZVA 3AD4A 4FIEA 2VWIA 5EDPA 5J7HA 2RF9A 3ZCLA 2Y6OA 4XV3A 5KMNA 2UW0A 5GINE 1H1WA 1Q8TA 4G6NA 3PXYA 3NIEA 4CMOA 4RWLA 4I6BA 4ONAA 3FY0A 3LAUA 3UG2A 4D28A 4DHIB 3TTJA 4FSZA 3UO4A 4BCIA 5M06A 1WVXA 3TNWA 4RC4A 3QZGA 3HECA 2V7OA 2XS0A 4U9AA 4ZIMA 3W0SA 3REPA 3TT0A 4KNBA 5IQFA 2ZV9A 3BIZA 4FKSA 4LOOA 2KULA 3VUDA 3QA0A 4P2KA 5C8NA 2PY3A 3MVLA 5CTPA 4AFJA 2C69A 4DFXE 3SRVB 1H1RA 3I6WA 3GCPA 2XKDA 4W8EA 1WVWA 2A27A 3GOKA 4JBOA 3QKMA 4O7RA 1XR1A 4AXFA 4C02A 2Z7LA 4EZ3A 4Z7GA 3QRKA 4FSTA 1YXVA 3K3JA 2IW8A 4E8AA 5J1VA 2BZKB 2PMOX 4H05A 1XBAA 4ZLZA 3PY3A 4GIHA 3LFDA 4G3CA 5A4TA 2OBJA 4GEOA 3KXMA 4MEDA 1Y6BA 4I0TA 2J7TA 4FEVA 4NIFB 4QPSA 5CAOA 3G9NA 2Y6MA 3Q04A 4XG9A 2UW6A 2R3RA 5DWRA 1OBDA 4CVAA 2QOCA 3QX4A 2YM4A 3KK9A 3CQEA 4GT5A 4L46A 4EOSA 3FXXA 1U59A 2R3IA 5JSMA 4X7QA 3RTPA 4ZTHA 1F3MC 3W2SA 2ZMCA 3KC3A 4UXLA 5FTGA 2W06A 3FWQA 2C6DA 1REJA 3IW6A 5HE2A 2VWVA 4ZS4A 3JY9A 2OIQA 4F78A 3V01A 3S00A 3UP2A 3GQIA 4Q2AA 1I44A 2ETMA 4UBAA 3BBTB 3E5AA 3HGKA 3OXTA 2CKQA 3L8XA 2GPHA 5BVEA 4O0XA 2PZ5A 3KXZA 4RWJA 5HZNA 1FVRA 4OTWA 4WG5A 3O51A 4E1ZA 3HUBA 5GJGA 3GCUA 2BRNA 3RINA 4J8NA 3R71A 1UKHA 2I0VA 3TV6A 3MFUA 4WIHA 3NRMA 2JFMA 4GH2A 3FLSA 5EM8A 1WAKA 1S9JA 3NUPA 5JH6A 3LLTA 5AEPA 4JR7A 2AYPA 2CN8A 4U44A 4RX5A 4FT5A 1UVRA 4NW6A 3I5NA 3PPZA 2XNMA 3N4UA 3C0HA 4ZAUA 5CEPA 3ZH8A 2W1IA 3F3UA 3ALOA 3EYHA 2A1AB 3E88A 4R3RA 3A8XA 3LW0A 3TJDA 3DB6A 4EWQA 2BFXA 2QG5A 4S34A 4AZSA 4AA5A 2C0TA 5ICPA 5E1SA 3RPOA 2VN9A 3UIXA 1FQ1B 4D58A 4U45A 1Y57A 4NKSA 2BKZA 4X2NA 2GS7A 5CU3A 3VQHA 1UNHA 4OTDA 4TYEA 3RWPA 5IQCA 5DR9A 1PXJA 2ITXA 2RIOA 3E3PA 4TWPA 5A9UA 4TWNA 4JBPA 4C4GA 1A9UA 3R1QA 2UZNA 4LM5A 5A4LA 4QP2A 3A62A 2WMWA 5C26A 5IH5A 3DBQA 2GNLA 3G2FA 4LV5A 3I60A 3Q5IA 4MBLA 2IG7A 4PRJA 4YHJA 4M84A 2G2IA 5J9YA 2DQ7X 2BRBA 2C6TA 5LVPA 4E4LA 3FKLA 4I6LA 5TKDA 2QKRA 3OW4A 3I7CA 3QTIA 3ZMMA 3C51A 3QLGA 1XBBA 5IU2A 1MQBA 4AUAA 5IA5A 2FUMA 2LGCA 2B9FA 4NJDA 2J6MA 1YXUA 5AIKA 4E6DA 4N4SA 4TW9A 3RMFA 2W17A 4EOPA 5KMIA 1H08A 4UWCA 3EN4A 4HVSA 3V3VA 4FTTA 4FKIA 4KABA 3P5KA 3Q32A 4AT5A 1G8SA 2R3PA 4ZTRA 4EONA 2OU7A 4U8ZA 4XP0A 3A4PA 3O0GA 4I21A 4JQEA 4QDEA 2WELA 3NAYA 4HZRA 1B38A 5AA9A 2BPMA 4AWIA 2YM7A 4QMOA 3NLBA 5M55A 2YA9A 4F7NA 1Q61A 3U4UA 2CHLA 3PP1A 5CY3A 3DT1A 3I81A 3GB2A 3MWUA 3MESA 4AZWA 2X4FA 4DFBA 3PVGA 4AW5A 2P55A 3ZU7A 3BHHA 3QZHA 4F9AA 1Q4LA 2PULA 3K5VA 1CDKA 3BLHA 1GZ8A 1ZYCA 1AGWA 3QRJA 1ATPE 1SNUA 3M42A 4MQ2A 3O8TA 3NW5A 3DZQA 1XH8A 3NCGA 4CEGA 3E7OA 4YTHA 3W0OA 2Y7JA 4FEXA 1Q8WA 1ZMVA 2Z7SA 3PG3A 4MYGA 4Y72A 3BYUA 3R83A 1URCA 3PA5A 5ANJA 5HNBA 4DLIA 4DTBA 1OUKA 3OS3A 1UNLA 4NW5A 5LOHA 3U4WA 3CD3A 5M09A 5AMNA 5HCYA 3A61A 1J7IA 3FAAA 2BZJA 4YJQA 2UZOA 3CGOA 1FVTA 1Q3WA 5EFQA 5C01A 4E20A 4F09A 1UNGA 3IK3A 5HG5A 2VV9A 4RVKA 2J0IA 3FUPA 3TZMA 3DPKA 1OM1A 4XJ0A 5GJFA 4IFGA 2Y4PA 4RPVA 4O0SA 5H3QA 5AA8A 4G6OA 2XYNA 3F7WA 3WIKA 5LVLA 3UTOA 2R3FA 4FNWA 4JIAA 4NK9A 1ZMWA
chains in the Genus database with same CATH topology
1XMLA 3I7BA 4XG4A 4DGLC 4H3QA 4I3ZA 2VO7A 3EIDA 1PXMA 5BMSA 3UNZA 1WBNA 4YNOA 3MI9A 3UMXA 4NWMA 4L3PA 4RIWA 1CKIA 5E8ZA 5DI1A 4MQ1A 4O0UA 4A9YA 3IGOA 4FV4A 5AP2A 2PVYA 3QD0A 1JSTA 2R3KA 4I0RA 5CSXA 3VUHA 4MXXA 3D2IA 2PSQA 2WOTA 3VBVA 3BLQA 2YZAA 1H0VA 3HAMA 4DT9A 4R1VA 5HI2A 4DTKA 3Q4CA 3L9NA 5FP5A 3IW8A 2W5HA 2XF0A 4CFVA 2XH5A 4PWNA 4MX9A 2ESMA 2W4JA 1HCKA 2WMRA 1P2AA 1ZOHA 4ZLYA 3LIJA 1KE7A 5BVNA 1FGKA 4EOKA 4BDAA 3JR1A 2JAVA 4DYMA 3FQHA 1CM8A 1UWHA 3RGFA 3LPBA 3OHTA 5KKRB 3ZONA 4OBPA 2GHLA 3TUCA 2FA2A 2ZV2A 1XBCA 4QYHA 3F61A 3P78A 1OKYA 2WMUA 4MAOA 1MRUA 3BWFA 1PXIA 4O7NA 3DKCA 1M2QA 2HW7A 3G0EA 5LQFA 2PZRA 5E8WA 4GK2A 5AUXA 4X2JA 2YIYA 3NR9A 3GXLA 5F94A 4C4JA 5CSPA 3F5UA 4HGTA 5D11A 2XRWA 5J8IA 3QGYA 3SX9A 3ZDUA 4DTAA 3PLAE 2YCFA 3FMMA 3KF7A 3RAIA 5A4CA 4R1YA 4CCUA 3ZO2A 5CI7A 2YM5A 3DXQA 3HKOA 3LFQA 4G31A 4U80A 3MH2A 3VC4A 4B9DA 2Z7RA 5IDPA 4QNAA 3OD6X 3OWJA 4O82A 4XLVA 4FVPA 5AUYA 5GNKA 4DH8A 1OKZA 4I41A 3BHVA 4FEWA 1P4OA 2EXCX 5FQDC 3FZRA 4F0FA 4A07A 2XKFA 4JLCA 2ACXA 3GI3A 4GK4A 2ITNA 4FZ6A 4K18A 1E9HA 2IW6A 5J1WA 2IVTA 1EH4A 3TCPA 4CFNA 4EOLA 4YTCA 3D94A 5BPYA 4JDJA 4QTCA 3FLQA 2OJJA 2ITPA 5HCZA 4RJ6A 5E90A 1CMKE 2IVUA 3GU6A 3ZYAA 4L44A 5JN2A 4LGGA 3PJCA 5EDRA 3PJ1A 1ZAOA 3IW5A 3VF8A 5LJJA 2OJIA 4BDIA 3RHXA 3MA6A 1YW2A 4QMSA 4K9YA 4NM0A 3F5XA 2QG7A 3TNQB 2C5VA 3TL8A 1SYKA 2Y0AA 4WBOA 4BZNA 3FPQA 2IVSA 3FKOA 3VS5A 3W8LA 4QP8A 3OMVA 3LOKA 3NUAA 3UMWA 5HG9A 2XIXA 4IZ7A 4E6AA 5JGBA 5KMKA 4FK6A 1R39A 4PNIA 1O9UA 3PPJA 4DGMA 3BLRA 4G5JA 3ZZEA 2IO6A 3BLAA 5CF6A 2XNNA 2XYUA 2O64A 4Y5HA 1VJYA 4C34A 3DXPA 2O2UA 5K5NA 4BCJA 1WMKA 4FV3A 4IE9A 4ZS0A 2B9HA 1H1PA 4FTKA 4G34A 1YXTA 3MBLA 3OUKA 3WOWA 5A4QA 1O6LA 2FVDA 3KGAA 4QEBA 3HDNA 4ZEGA 3EYGA 4A4LA 3SHEA 4BF2A 4BJJA 2XK8A 4FKQA 5L2WA 3E8EA 5BVDA 2QNJA 3IO7A 2BAJA 4O38A 3D5WA 4IWDA 3C13A 4H36A 3D5XA 4KKHA 3OTUA 5HO7A 2EXMA 2IZUA 2UW8A 3UG1A 3SA0A 3MSSA 4ZSAA 3TIZA 3W10A 3ZM9A 1WVYA 4GUBA 2P4IA 4YZMA 2WB8A 2PUNA 1RE8A 5LMKA 3QHWA 1IA9A 3IKAA 3AMAA 3E92A 3ET7A 4FUXA 5HHWA 4Q5EA 1G5SA 5K3YA 3MVHA 4HCUA 4K33A 3UE4A 4KIOA 3WZUA 1DM2A 5HIDA 1XH7A 2B1PA 4FKOA 3FLYA 4LV7A 5IA1A 2W1CA 2C6LA 2EWAA 3ACKA 4XS2A 5D9HA 2X7GA 4XRJA 3QCXA 4GFMA 1QMZA 3P23A 2CKOA 2OO8X 2PK9A 4IAAA 1OPKA 2QCSA 4WHZA 2BRMA 4QP4A 1R0PA 1Z57A 5FTQA 5GHVA 2GFCA 2HWOA 2XEYA 2J5FA 4PX6A 4RFYA 4AT4A 1TVOA 2CGUA 5KNJA 4CGAA 2OI4X 5C9CA 4GV1A 3SQQA 5EH0A 4W8DA 5HBHA 3NW6A 2I40A 3OOGA 3VVHA 2XIYA 2JEDA 4L3LA 4O7VA 5KZ0A 5EKOA 1E1VA 2QODA 1DAYA 1PJKA 3LCTA 3N51A 4JT3A 4KBKA 5EI2A 5HVKA 4J71A 3V5QA 4BDDA 5LMBA 3VUMA 3SXSA 5EW3A 4APPA 4TYHB 2VO0A 3OCGA 1T46A 4LGHA 2QD9A 4RRVA 4XYFA 5A46A 2HCKA 3OG7A 4C3PA 4BBMA 4ENXA 2R2PA 4V01A 4UYNA 1ZWSA 2J0JA 4O7SA 3C7QA 4OT6A 2VTNA 2PVMA 3QUEA 3HRBA 5H9BA 2J50A 4LRJA 1CTPE 3BEGA 5IUGA 1JQHA 2C5OA 3B8QA 3UOHA 5M57A 1ZOEA 1DI8A 4OBOA 4D9TA 4RVMA 3QQHA 1IAJA 3D7ZA 4C38A 4F9YA 3DTWA 4AA4A 4S2ZA 4AGWA 1Q41A 5AV1A 5JT2A 4JOAA 4D1ZA 4G3GA 2A19B 3BCEA 3FHIA 2WMTA 3MN3A 3LJ1A 3NZ0A 4YJRA 3HL7A 3UDSA 4BDCA 3KL8A 3M11A 3OBJA 4J8MA 4QMVA 2QOHA 3IS5A 4M0ZA 5HIEA 4FTMA 4ANMA 3CR0A 1JLUE 3LVPA 3EFLA 4BGQA 5EYKA 4A7CA 1U54A 2F49A 2W1HA 5JZJA 3A7FA 3O23A 3MB7A 3PVWA 3U55A 4DDGA 4DGNA 2QI8A 4F1MA 5BVOA 2QR7A 5LWNA 2YIQA 3SW7A 1ZYJA 3QYWA 4OTGA 2YCRA 4BTJA 2O5KA 4JX3A 3GC9A 1Y6AA 3SC1A 3LKMA 4F08A 1P5EA 1P4FA 4J95A 4FGRA 3UIMA 3RM6A 1YDSE 2PUPA 4HYSA 3KXGA 4WUNA 3MGYA 4IM3A 1UU9A 2E9PA 4B8MA 3QD3A 1XMMA 5HLWA 3Q9WA 3DAEA 2YERA 1NY3A 3P4KA 5L6PA 3VRYA 4AFEA 4FT9A 5M53A 4YC3A 2H34A 1V0BA 4A06A 3VBTA 3CKWA 2J9MA 4QYYA 1YQJA 2P0CA 1BKXA 2XNGA 4DITA 3OCSA 4E5BA 4BCHA 2PYWA 5CZHA 3ZM4A 4QMWA 2ETRA 4QP7A 3D7TA 4PDPA 2R3HA 5DOSA 1PKGA 1KE6A 5AP3A 3ORKA 3T9IA 5IDNA 2FH9A 4ZSJA 4YZ9A 4MCVA 4BTFA 4RX9A 2UW9A 3UVPA 4CMTA 3ML1A 4S32A 3P7AA 4NT4A 2ETKA 4OTRA 2C3JA 4IEBA 1SM2A 4FV6A 4II5A 2CKPA 5CSVA 3F5GA 4IAKA 5I9VA 4USFA 4FV9A 2C0OA 4O86A 1B39A 2YDIA 3CLYA 1G8KA 2ITQA 3W2QA 2I7QA 2X81A 5ETFA 1RQQA 2V55A 3PYYA 4EYMA 4DEAA 5CALA 4AAYA 4EJ7A 5DT0A 5ETCA 3I79A 4O83A 4QTEA 1OIQA 3HUCA 1F0QA 4EHEA 1OIRA 4QQCA 3OBGA 2X9FA 4MTAA 3SLSA 1RW8A 3FQSA 3C4WA 4USEA 2X2LA 2XK7A 3R9OA 1XO2B 5JK3A 1PXLA 3BGZA 3DKOA 3QX2A 4DGGA 3Q4ZA 4H39A 1YHSA 3S4QA 5LXMA 3D7TB 3OT8A 3QTRA 4E6QA 1IEPA 2XCKA 3COIA 5CT7A 3NNXA 1PMEA 4R7HA 2CSNA 4PL3A 5LMKC 5FBNC 3JPVA 4AGCA 1G3NA 3F6XA 2W1EA 3VO3A 2XAMA 5CNNA 3FYJX 4TXCA 4U0IA 3VF9A 2W9FB 4DF3A 4I0SA 3DOGA 4U42A 4E93A 4DINA 3BHTA 2W1ZA 1ZYDA 2C6KA 3Q2JA 1KSWA 3VW6A 4XV9A 2BALA 4LYNA 3CKXA 3D5VA 2R3MA 3EQBA 4I6HA 4BVUA 2FYSA 3DJ6A 3NYNA 4YBKA 2R7BA 2DS1A 4OTFA 3IDPA 4N70A 4ASDA 3EZVA 4AE6A 1YHVA 4BCKA 3BL9A 4NL0A 5ANGA 1LPUA 4DAWA 4DEBA 4G3DA 5A14A 4JL9A 3KRLA 1Q99A 3AD5A 2I0YA 4XNEA 2B9IA 4F0GA 3OOMA 5FM2A 3A7JA 3K3IA 4RG0A 4BRXA 3COHA 4IVCA 3QD2B 4DH7A 4MBJA 4PL5A 4EQCA 1M2RA 4EH5A 1DAWA 3VONA 4FL1A 3DK6A 5DYJA 3ZO4A 4XV2A 3UVRA 2B54A 2HXLA 1AQ1A 2UVZA 2CGVA 3CTQA 5FEDA 4BI1A 5AM7A 2OG8A 3GU7A 2OICA 5ANIA 4D9UA 3S2PA 2BDJA 4MNEB 4CMUA 1Q5KA 3CGFA 4EK4A 1M7QA 3EMGA 3PWDA 5IMEA 2IZSA 3AT4A 3GFEA 4ZZMA 5DNRA 2W4OA 5KBRA 5HESA 4IX3A 4JIKA 1YDRE 3R00A 4FIFA 2JLDA 2R3OA 3TIYA 4YC6A 4R5YA 5I9YA 5CQWA 3UGCA 3RJCA 4E4XA 4Y85A 3HX4A 3PXZA 1SMHA 1H4LA 3QKKA 4U79A 3VNTA 4F7SA 4IB3A 2ZYBA 3TACA 3H9RA 5TOZA 5DR2A 2GTNA 3WF9A 4BBFA 4C36A 3ZRMA 2BMCA 3NX8A 3C50A 1L8TA 1H01A 2W9ZB 4QP9A 4XG3A 2H9VA 4D1SA 4AZEA 3I6UA 4HNFA 3GCQA 1MQ4A 2O0UA 4BC6A 4L00A 5I9WA 3AXWA 3OWKA 4KIPA 1NVSA 4I4FA 4Y46A 3SOCA 2XBAA 4J98A 4G3FA 4IX6A 4XG7A 4YLKA 2J51A 4RA4A 4DCEA 4QOXA 4ZSLA 1OGUA 3CE3A 3N9XA 2QOKA 2SRCA 1BI7A 2CPKE 4GK3A 4JQ7A 4C4IA 4D4YA 3DAJA 4EOOA 1G8JA 2VTHA 4X21A 3G5DA 4LUDA 3VWAA 4DFLA 3DS6A 1JWHA 3RALA 5M4IA 3MY5A 4XV1A 3O5AA 2ZM3A 3LJ0A 5BUJA 3KULA 4UB7A 4P5ZA 4BYJA 2JITA 4JDHA 3UZRA 1HOWA 4BDEA 2ERZE 4ANBA 3OCBA 4QTBA 1VEBA 3LQ8A 2JBOA 2UZTA 4Q5HA 4PMPA 2R0UA 5CEIA 3RZBA 4A4OA 3GVUA 4K11A 3A7GA 3ULZA 4DEDA 3V5JA 1JSVA 3P79A 4GSBA 3GGFA 3QFVA 3V8TA 3W2CA 2XIRA 2OJ9A 3R1YA 4O7ZA 5CU2A 4QDVA 4MXYA 1YI3A 2J4ZA 3S1HA 4IC7A 3H9OA 3U51A 4EH6A 4EJNA 2UW4A 1SVGA 4QTDA 4CRSA 5L8KA 2Z2WA 2XK6A 3OC1A 3R04A 4WSYA 3RNYA 1VYWA 4GT3A 4AXEA 2OWBA 3V04A 4B4LA 4ZSEA 2PVHA 4LOQA 4ITHA 3CCNA 2WTJA 3OXIA 3VS0A 2IZTA 4U3ZA 4HVIA 5IG1A 4FK3A 4CFXA 1YDTE 3CSVA 3NUXA 3ORZA 4KA3A 1Q3DA 4GG5A 4D55A 4FKPA 4KWPA 3AQVA 3U6JA 2BAKA 4TWOA 3I4BA 1AD5A 2HIWA 1OBGA 2XM9A 4HCTA 5HNGA 4C3RA 4BDFA 3R8MA 3CPCA 3VJOA 3Q4TA 1FGIA 3LMHA 1J91A 3ZS5A 4FOBA 3BYVA 4FZFB 3TV7A 2W5AA 3ZSHA 4XEYA 3IG7A 1OGYA 3TJCA 5IA0A 1XH9A 3PSBA 4YZNA 4I94A 5JZNA 1GAGA 1PRYA 3PVUA 4C58A 3I0OA 3KIOC 4FSYA 3GC8A 3VULA 2PMNX 4GMYA 4LI5A 1M2PA 3FXWA 5J95A 2PVRA 5CNOA 4PDYA 5G1XA 2F2UA 4RJ4A 1SNXA 3BL7A 4R78A 5FUTA 4EOIA 4OR5A 1MRYA 2WTIA 5KHXA 1ZY5A 2YITA 3DB8A 5IA2A 4N57A 3F66A 1KE8A 2GCDA 2GS2A 3EKKA 4RFZA 1CKPA 1YWNA 5JGAA 4PMSA 5KMMA 3EFJA 3WYXA 2H6DA 4FV7A 4FZAB 2XIKA 4IWQA 4AF3A 3MIYA 4NM7A 3R7IA 2W99B 2E9VA 3FEGA 2JDRA 4NU1A 2B9JA 2HZIA 2UUEA 3TDVA 4IAZA 1GNGA 4MXOA 4QMZA 4WG3A 1JKTA 2QHMA 4S33A 5CEKA 5IQGA 3FMJA 4RWKA 1NVQA 4DT8A 4APCA 4GYIA 4C35A 5HX8A 1GZOA 1OB3A 2FSMX 4JAJA 2CNQA 4XH6A 4DN5A 4B99A 5CF5A 3HRCA 5B7VA 5JEBA 4X2GA 1A06A 3FBVA 2GU8A 3ORPA 2YIRA 3NYOA 2YACA 4DG2E 3LE6A 3BX5A 4MD7E 5TT7A 3VS7A 4ZTMA 5AP5A 5JFXA 1JKSA 4G2FA 3U9NA 5ETIA 5B2KA 4F4PA 2WOUA 3QCSA 1Q24A 3II5A 4FZDB 4O7WA 1OL6A 2DWBA 5ACBC 3MJ1A 1Q97A 2WQEA 4L45A 3C4XA 4MXZA 3P7BA 5CU0A 4YUQA 2X1NA 4LV8A 4C37A 3MH0A 2VTQA 3WBLA 5KBQA 2OIBA 4ALVA 4EQUA 4XOZA 5D12A 2P33A 4BDKA 4CZTA 3SG8A 5HD4A 5JFWA 4FSNA 5DT4A 4I4EA 2WU6A 3KQ7A 2EB2A 3FL4A 3PIXA 5IISA 3C5IA 3AC1A 1VLRA 3HDMA 3ORMA 4AN2A 5CSHA 5K9IA 4O7TA 4JDIA 2WMAA 3W0NA 4EKKA 4KINA 3FI4A 2J90A 4ZTLA 3EZRA 4OLIA 4IHPA 4AT3A 4EK3A 1W83A 2VX3A 3D9VA 2BZHB 1U4DA 3GBZA 4O0VA 3H3CA 5HD7A 5CVHA 4PP7A 1KE5A 3PSCA 5CAPA 4IADA 3VHKA 2PZYA 3EHAA 2XJ0A 2CCHA 2B55A 3FDNA 3FV8A 4FTAA 4B6LA 4YO6A 1WFCA 4FKJA 3D14A 1W0XC 3QUPA 4M97A 3LFFA 2VWYA 2IVVA 1LEWA 3QHRA 3Q9XA 3QRTA 4R5SA 2R3NA 3CQUA 4AN9A 3WF5A 2VUWA 3WZEA 2X8EA 2VRXA 1ZY4A 4TNBA 2JDVA 3KXNA 5CS6A 2EB3A 5FGKA 5JRQA 4KKGA 3U8WA 5JMSA 5KMLA 3UYSA 1BI8A 5AV4A 1Q62A 2GNFA 1FMKA 3C0IA 3R6XA 4WRSA 5L6OA 4A9UA 4UEUA 2BTRA 4AAAA 3F3TA 5KZIA 4AXCA 3ZC5A 3PVBA 3TYKA 4UN0C 1KWPA 3LHJA 4XP3A 5DN3A 4IJ9A 4D4VA 5FRIA 2VD5A 4OT5A 4FKVA 3FXZA 3OEZA 4QMXA 3BYSA 4IIRA 4W4WA 5M4FA 3P08A 3TKHA 3Q53A 4KD1A 4H1JA 5ANEA 3SKCA 3R01A 4A9SA 3R8ZA 2NPQA 4D4RA 4CLIA 4GU6A 4YJTA 1I09A 2BZIB 3PZHA 1J1BA 4HNIA 3QU0A 4BTMA 1PMUA 4TZRA 2X7OA 3BI6A 3R7OA 3FC2A 4FYNA 1NT2A 1OIYA 2F2CB 4FG7A 3UZPA 4QMTA 3GCVA 4GVAA 5HEZA 4YZDA 4DEIA 5JFSA 4RC3A 1VZOA 2WMQA 4TTHB 2OW3A 3HNGA 1PKDA 4UZHA 4I20A 2CJMA 2XMYA 3VS4A 2XKEA 5AADA 3F2RA 3ZRLA 3DDQA 2P2HA 3E63A 3NDMA 5EHOA 3EFWA 3EN6A 4FVRA 2JGZA 3RAKA 2XB7A 2JIIA 4TYJA 3L8VA 4CTBA 2WD1A 3LM0A 4RIXA 4NJ3A 4UY9A 3ZLSA 4IFCA 3ZO1A 4XG6A 3R02A 4PDSA 2VTAA 4FTNA 1OPJA 3PXFA 2UZEA 4PMTA 3EFKA 2GQSA 4IX5A 3R63A 3GQLA 4MWHA 3ZSGA 2PHKA 4O0TA 2Y4IB 3ZEWA 2YWVA 3SG9A 4B0GA 3BWJA 3EQIA 3PP0A 5HO8A 3NUNA 4RVTA 3ROYA 3AG9A 3SW4A 4L01A 5EYCA 3TXOA 2ZOQA 4BIDA 3QCYA 4YC8A 2RKUA 3FMHA 1FOTA 1YKRA 2O3PA 2W1GA 4QRCA 5L6WL 2X4ZA 2PE1A 4Y5QA 5DVRA 4FKWA 4ZZNA 4F7JA 2BCJA 5E4HA 3ORTA 4GG7A 4L9IA 4P7EA 3S0OA 4RIWB 4AQCA 2JD5A 5LARA 4BHZA 2EVAA 3AC8A 2VWXA 4IDVA 1H1SA 4KRDA 2C1AA 4RIYA 4L7FA 4LRMA 3I5ZA 5C8MA 4A9TA 4OTQA 3F82A 4AOJA 4RIXB 5IF1A 4WT6A 1IASA 3ENMA 3OZ6A 4RLLA 4FTRA 5TF9A 4DG3E 4R3CA 3SAYA 4AACA 2GNGA 5HLNA 3AGMA 3POZA 3LFEA 3HYHA 3IW4A 4ZJIA 4UX9A 4O81A 1XH5A 2JDSA 4BICA 4G9RA 2NRYA 3S95A 2Q83A 3Q9YA 3A99A 5AAFA 4LMNA 3QTUA 4X3FA 4FKLA 3NVMB 4YBJA 2UZLA 1Q8ZA 4FNZA 4L53A 4DA5A 2HZNA 4EC8A 3WIGA 3KFAA 2CGWA 4NM5A 4TY1A 3KU2A 2CLXA 3P9JA 3GOPA 4FT0A 5EW8A 1KOAA 2WQMA 1LEZA 2YIXA 4RIYB 3UYTA 2W1FA 1H27A 5M08A 5CXHA 3C0GA 4QP3A 4ACCA 5EYDA 1ST4A 4IB0A 5FXQA 5CVFA 3MV5A 4AU8A 4BDBA 2BRHA 4KUJA 4YZBA 5G6VA 5CT0A 4GKIA 4I92A 1YWVA 1XH4A 1PYXA 3DQWA 3NUYA 3ODYX 5JQ8A 3QUDA 2RFNA 4NM3A 4GW8A 2AC5A 4YP8A 3ZLXA 3VBYA 4EH2A 4D5HA 4BDHA 2UZWE 5JKGA 2VWBA 4FSWA 4FIJA 3PY1A 3UOKA 3SXFA 4ZXTA 3FLWA 4QQ5A 1TQMA 4M7IA 4X3FB 5FG8A 5BQ0A 2QO9A 2YM8A 4FKGA 2I1MA 4MWIA 4RQKA 4AX8A 2J0MB 4AN3A 3MTFA 4C4FA 3QAME 5AP7A 3COKA 3FZPA 5LMAA 2JKKA 4EWHA 3EN9A 4FV0A 4DH5A 2VZ6A 4QP1A 1IRKA 5BVKA 3LFBA 4GCJA 4XUFA 4CXAA 4LUEA 3O50A 4JS8A 4HYUA 4QPAA 3NAXA 1F5QA 4OUCA 2UZVA 2NNWB 2XJ2A 2WMXA 5CQUA 4FKTA 5E1EA 5BUIA 3G15A 4BCMA 5DPVA 4X3JA 2GHMA 4AOIA 4AW2A 4M12A 4BTKA 3FKNA 3TV4A 2YAAA 5CSWA 5FEQA 5LWMA 3BGPA 4FICA 3RP9A 2QOFA 2ITZA 4BCGA 2C68A 5CF8A 2PMIA 5AP4A 1NXKA 4R77A 4EHZA 2QO2A 2WKMA 3DLSA 3DXNA 3W16A 2BKKA 1GY3A 3DFAA 5EOBA 4DGOA 4CKRA 4ANLA 4JXFA 4DLJA 3MFRA 5HQ0A 4I5PA 1PY5A 4V0GA 1Y91A 4WO5A 5IEVA 3W33A 2Y4IC 4FTQA 3LXPA 3AMBA 3FQEA 4I6FA 2J2IB 2PE0A 4RIOA 4E4MA 4BCFA 3N4TA 5HVYA 4F6WA 3RNIA 4EYJA 2ZFYA 2WTVA 2O65A 1UV5A 2G2FA 1H28A 5IQIA 3OY3A 3PXKA 4ZY6A 1A48A 3UQGA 4BJJB 4IM2A 3AC3A 2GMXA 2VX0A 1WZYA 2V0DA 3Q4UA 2G9XA 3G6GA 4F64A 3L8SA 5D7AA 2JDOA 3VUKA 3ZLWA 3UDBA 1R3CA 3FI2A 5AFVA 4EBVA 3PPKA 3WYYA 2AEGA 3KMUA 5HIBA 4M69B 1MUOA 4LL0A 4CFUA 3V51A 4FNXA 4CFWA 4CQEA 5BYLA 2WTWA 5T68A 4F1TA 3FZOA 4O6EA 3MA3A 2A2AA 1QL6A 4P5QA 4MNFA 4L42A 3MVJA 3PUPA 1GIJA 3PJ8A 3RPYA 4CTCA 4V0GB 4BI2A 4AOTA 2B7AA 4FV8A 3LCDA 2AUHA 2UZDA 4I5MA 2HYYA 3QTSA 4IZAA 4LL5A 4MH7A 4E7WA 5IA4A 5EM7A 3VBXA 4DEGA 4FA2A 3UOJA 3JS2A 5KE0A 5B2MA 2IN6A 4ZTQA 5H8BA 2WTDA 4PTCA 4JG8A 5JRSA 3PIZA 2XNOA 3LFSA 3UO6A 1V1KA 1OECA 2YM3A 5IPJA 2CNVA 3MPTA 4NYEA 2ITTA 3PRFA 5HTBA 5DE2A 4QMQA 4UXQA 3DCVA 3EQPA 3OXZA 4F99A 2BFYA 2ERKA 2OXDA 3T9TA 3HV4A 3W0PA 3PFYA 4KIQA 5LCJA 3GU8A 4EOQA 4EK5A 3GENA 3NNUA 4O21A 4U43A 3W18A 3KXXA 4FV2A 5BVWA 4F6UA 5BYYA 3F69A 2QU5A 4R6VA 3RAHA 2JIVA 4G5PA 4QTAA 3DV3A 3KMWA 3NNWA 1JKLA 5FDPA 5KCVA 3QXOA 4HJOA 4ZK5A 2VTRA 3S3IA 4ARKA 2PUUA 4KS7A 3EQDA 4IANA 4RZWA 4AW1A 3U54A 4MXAA 5GIOE 3HV5A 4FR4A 5HCXA 4I6QA 2ZAZA 1ZARA 3TUDA 5BYZA 1L3RE 2XIZA 4WNOA 1YVJA 2JKOA 1TFFA 2ZB1A 1W84A 4FIGA 3F3VA 1JBPE 2C6OA 3LFNA 4JJRA 3PTGA 4X3FC 2PVKA 5FEEA 3FJQE 3AC4A 3UNKA 4ZY5A 2X8IA 2XUUA 3CBLA 3NGAA 3KRXA 3R22A 2WMBA 3ELJA 4UZDA 2R0IA 4FBXA 4YMJA 5IEYA 4JG6A 4QMMA 4Y83A 3SV0A 1G8AA 4FTOA 2PE2A 4FX3A 4R7IA 4DFUA 4CKJA 3K54A 2OZAA 3QCQA 4MD9E 4CFMA 3B8RA 3PE2A 1B6CB 4IQ6A 3ZOSA 3AKLA 2J0LA 3HMPA 3RI1A 4F0IA 3H30A 2VO6A 3DLZA 1XQZA 5K5XA 2YIWA 4GJ2A 4X6QC 1Q8UA 4TN6A 4LQMA 1R78A 3QZFA 3EQHA 3C5UA 3LLAA 2R3QA 3FPMA 3FZSA 4YJVA 3ZFMA 4E4NA 1S9IA 2KTYA 3V5TA 3QLFA 3QTWA 4M0YA 3SVVA 5CYIA 4DFYA 1UU3A 3HZTA 2ZDTA 4CG8A 3LMIA 3OWPA 1APME 3FY2A 3QQKA 4GFOA 1U54B 3EWHA 2JAMA 5CX9A 2VTOA 3VS2A 3ZSIA 4AGUA 3QQJA 5AX3A 3ATSA 5C27A 4EZ5A 3EQGA 5TO8A 1XHAA 2Y9QA 3MS9A 4FGBA 1PF8A 1PXPA 3A60A 5DG5A 5J9ZA 4BCQA 3FMLA 5HGIA 5CEMA 1ERKA 3R8LA 4BN1A 3BPRA 3TTIA 4D2SA 3AOXA 3VIDA 1PXKA 3C4ZA 3PWYA 2IJMA 3HMMA 4X2KA 4IX4A 3HP2A 3ZXTA 2OZAB 1CSNA 2IW9A 4FOCA 4J53A 5TR6A 5D10A 4D5KA 5CEOA 2ZJWA 4O96A 4CV9A 2QU6A 2VTJA 4DBNA 2YISA 5KX8A 5EK7A 3VS1A 4DEHA 4BGGA 2QR8A 5M4UA 2HELA 3ERKA 3KREA 5E8VA 2XCHA 4G9CA 1OL7A 2YCSA 4TWCA 4BYIA 2Y8OA 3ETAA 3RPRA 3JXWA 2NP8A 1ZZLA 4XOYA 4ZP5A 4ERWA 2FSTX 3EL7A 4I22A 4YJSA 5M44A 4IZ5A 1W98A 4DG0E 4OTHA 2GNIA 4ITJA 1YOJA 3EKNA 3IDBA 4RX7A 3WI6A 1PXNA 3WF6A 3T8OA 2JIUA 4XP2A 1XWSA 2OFUA 3F2NA 1PW2A 4LFIA 5I9XA 3E87A 1BUHA 4ZTSA 3D2KA 5E9EA 4U97A 2WU7A 4WKQA 4O27B 2WTKC 5HICA 4D2RA 3Q52A 1YWRA 2Z7QA 3AC2A 5BV3A 4GL9A 5DRBA 1UU8A 4PDOA 4ALWA 3MY1A 4FTCA 4EL9A 2VTLA 4FL3A 3BGQA 3HEGA 3EQRA 5AP6A 5M51A 4D0WA 3RK7A 4CT2A 2VWZA 4ASZA 4CLJA 3FL5A 3ORXA 3UBDA 4KKEA 1H0WA 2XZSA 3BYMA 2VNWA 4L43A 3TMOA 2OH4A 1H07A 2GQGA 2PL0A 2QLUA 3EL8A 5CI6A 3C9WA 1XJDA 4JQ8A 3SGCA 3A2CA 1OI9A 2IPXA 3DFCB 3QWKA 2VNYA 3FMDA 4XBUA 5E8XA 3N4VA 3GC0A 3RPVA 2R9SA 5ACKA