3AKJA

Crystal structure of a helicobacter pylori proinflammatory kinase ctka
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
294
structure length
275
Chain Sequence
PTIDFTFCEINPNKISLFYNNELYMVKFPPTNGCFSEYVACHIVNSLGLKVQETLLGTYKNKIVVACKDFTTHQYELVDFLSLKNTMIELEKSGKDTNLNDVLYAIDNQHFIEPKVLKCFFWDMFVADTLLGNFDRHNGNWGFLRASNSKEYQIAPIFDCGSCLYPQADDVVCQKVLSNIDELNARIYNFPQSILKDDNDKKINYYDFLTQTNNKDCLDALLRIYPRIDMNKIHSIIDNTPFMSEIHKEFLHTMLDERKSKIIDVAHTRAIELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords CtkA
total genus 92
structure length 275
sequence length 294
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07804 HipA_C HipA-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.20 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 3akjA02
3.30.200.120 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3akjA01
3AKJA 3AKKA 3AKLA
chains in the Genus database with same CATH superfamily
2ITUA 2Z2WA 4LV8A 4WG3A 4WG5A 1FGIA 3SRVA 4AN3A 3LMGA 4XCUA 4QMPA 5CANA 3HX4A 3NZSA 5AP5A 2BIYA 1M7NA 4PF4A 3PRZA 3D15A 3F7ZA 4HPUE 1SNXA 5AV2A 4LL0A 4AOTA 3FHRA 4ZS0A 2LGCA 4BDFA 1H4LA 3QRUA 3DTWA 4IH8A 4TWNA 5CY3A 3AXWA 3RAWA 3QRIA 5C27A 4JQ7A 3PXRA 4AJWA 3AD6A 4JRNA 5KMMA 2DQ7X 4FT9A 1XQZA 1Y6BA 3DXNA 1BMKA 4WA9A 4IAYA 3SV0A 3VS3A 2OSCA 2VTQA 3G6GA 3Q5IA 4BFRA 1UNGA 4XP0A 2BVAA 3G5DA 1B6CB 3LS8A 5K3YA 2BHHA 4BZDA 1A06A 2FO0A 2BALA 3POOA 3LLAA 5HESA 4AQCA 2UW5A 3VWAA 1BL7A 3C9WA 1YXXA 1U54A 4A4XA 4WWOA 3ULZA 3F3VA 3GC7A 4FZFB 4X2FA 2XANA 2G01A 3HMNA 2GSFA 5B2MA 4I1ZA 4YZBA 4TWOA 4FL1A 2UVYA 3HMMA 3FYJX 3SHEA 3SG8A 1JKLA 3VUHA 4MWIA 3SD5A 2UVXA 4WBOA 2GQSA 1GJOA 1P5EA 3QGYA 1BYGA 5D41A 2C69A 1H26A 4D1XA 2BIKB 3LAUA 1TQIA 3IG7A 4DEIA 4PV0A 3UIXA 5LMAA 1OECA 1PYXA 4DH5A 5AV0A 2ITNA 3R9HA 5D11A 2YDJA 3R2YA 3U87A 1ZARA 3UGCA 5A6OA 2OF4A 4RJ8A 3TG1A 4FX3A 4GT5A 5A4CA 3S4QA 5HBJA 3ZBXA 4J8NA 4D55A 1M2PA 4FA6A 3VUGA 4CQEA 3CTQA 3HRCA 3UJGA 3JVRA 1GIIA 2WAJA 3D5WA 3LPBA 4H39A 3UODA 4HNIA 1XBCA 3RAKA 4AAYA 1LR4A 4DCEA 3DBDA 5AFVA 2X0GA 3S0OA 3R30A 1YHWA 1KOAA 4AG8A 4AXFA 4EI4A 3CGOA 3H10A 5D7VA 2G2IA 3E7OA 4YLKA 4N70A 4BDDA 3MY0A 1UU3A 2YM4A 2QI8A 2WXVA 3QKKA 2UZBA 3ZMMA 4ZXTA 3IDCA 2B54A 4PX6A 5H3QA 3UIMA 3ZM9A 2WB8A 2PUUA 4U41A 2VTLA 5FXSA 4AZFA 2ZMCA 3RWQA 1IRKA 2EWAA 3NVMB 4ITHA 5EI6A 5IA4A 2X8DA 4CFMA 4FSRA 2OXDA 3E8CA 2XALA 3AKKA 3QTUA 1PW2A 2XMYA 2IO6A 1LUFA 3PY0A 1TVOA 3MH1A 3VHEA 5CALA 2UZWE 1KE5A 4RIWB 4BGGA 1AGWA 4F1TA 3IBEA 3OTUA 3Q6WA 4XBRA 2YM8A 4FTQA 3NX8A 4KRCA 3NDMA 4UWGA 4Y95A 3ZM4A 3FPQA 3EL7A 4FSZA 3W2RA 4JI9A 4PL4A 5CLPA 2WXQA 4IB1A 2P2IA 4C34A 1PXJA 2Z60A 3GNIB 3IDBA 1SNUA 4E6CA 1OL1A 1YI6A 3QYWA 4D58A 3RINA 2GHGA 4CXAA 4FTCA 4U40A 5DNRA 3PIXA 4FHJA 2NYAA 4L7FA 1YI4A 4QTAA 3FMHA 3R1SA 2EXCX 4LGHA 3G9NA 4NM0A 3PVGA 4ZLZA 2YCRA 4DLIA 3PJ2A 2BMCA 2VGOA 4HZRA 2FGIA 5HCZA 4MNEA 5HO8A 3UG1A 3LHJA 3VULA 3W1FA 4RSSA 5CTPA 2R7BA 4R1VA 2J0MB 4ANXA 3QU0A 3TUDA 4FEWA 3FMMA 4TXCA 4Y8DA 1E8XA 1OIYA 3CD3A 3S2AA 2A0CX 2B0QA 2BILB 4DT8A 2I0VA 1ST4A 3PJ1A 5AP6A 3VBYA 2IPXA 3IKAA 4EH9A 3GCUA 2WMSA 4NJ3A 5C8KA 4XJ0A 4BICA 3BLRA 5LJJA 1VYWA 2VTIA 2VD5A 4F09A 3R9RA 1OIRA 4B9DA 4RWKA 4FICA 1YW2A 2XRWA 4YBKA 3Q4TA 4YJPA 3V5PA 4EK5A 2RFEA 3SXFA 3W33A 4EONA 2ZV2A 4QYEA 3C5UA 2NO3A 1KSWA 3C4ZA 1XBBA 3DXPA 3KC3A 4QRCA 3R6XA 3CIKA 4W4WA 5HO7A 2PUNA 2W99B 4D2SA 2WQOA 5E8YA 5CX9A 4ORKA 4A9RA 4C62A 4TYIA 3HMPA 4L3LA 2H6DA 4XMOA 4RZWA 3TEIA 5AIKA 3OT3A 3WF8A 3KKVA 4ZTRA 4EHZA 2BPMA 3QXOA 1YRPA 2JKQA 3PTGA 5EOBA 1E8ZA 1GZOA 4BIEA 2XK8A 3G90X 4G6OA 4ZTNA 1YOLA 5KZIA 2OJGA 2QCSA 3Q9YA 4RIXB 1ZMVA 2JFLA 2JGZA 4D4YA 2QOQA 3QAQA 2C5VA 3RAIA 3RPVA 3ZDIA 5KCVA 3MYGA 3SA0A 3FXWA 4ZK5A 4AFJA 4K9YA 4WIHA 3UTOA 1IAHA 2GNIA 4C4IA 3FKNA 5E9EA 2OFVA 2Z7QA 3FXZA 1LEWA 2XAMA 3HAVA 3BI6A 3LXNA 3NSZA 4L52A 4PTGA 3VJOA 3U6IA 4BDHA 5E8SA 2J6MA 3K54A 3UMWA 5BNJA 3D4QA 1J3HA 4KAOA 4AUAA 5KBQA 2QHNA 3CP9A 3MA3A 3EYGA 5C8NA 2QOLA 4IBMA 2VO7A 4LOOA 2Z02A 4NYEA 3OUNB 4HVIA 1VR2A 4XEYA 4EOIA 2XIKA 1YXUA 3LQ5A 4Z7HA 5CEKA 2VWUA 4K1BA 5LQFA 3PA5A 4F78A 2JDSA 4RFZA 2VWYA 3BEAA 4MKCA 2X1NA 3E62A 4H3PA 2XH5A 3W32A 5IQHA 4X7QA 4NH1A 1FOTA 4RJ5A 1VYZA 2C6DA 2E9PA 4S34A 4J8MA 4XH6A 1GIJA 3R01A 5CEMA 3OXIA 4DT9A 5C1QB 3D7TB 5JH6A 3V5LA 4WUAA 5HLWA 5E7RA 3PJ8A 3KGAA 4FVRA 5M44A 3DK3A 1FVRA 3BWFA 4OTFA 3F5GA 4FT7A 3FZOA 3NLBA 4RFYA 4E73A 4YJRA 1J1CA 2YFXA 1JVPP 4O6EA 1W8CA 3OWPA 1ZY4A 2OK1A 3PIZA 5HU9A 2LAVA 3NW5A 4QMSA 3EL8A 4NFNA 1RJBA 4ZAUA 3QCQA 1Q4LA 2WTKB 5BYZA 4GFGA 2C3JA 3RK7A 4ANQA 4E5BA 4FIFA 4YSMA 3UPZA 4O7RA 1MQBA 2FSMX 2VO0A 2GHMA 4I93A 5DI1A 2PVRA 4G9CA 4F0IA 2ITZA 5KBRA 2CDZA 3AC4A 4ZTHA 4AWIA 1KWPA 2ONLA 2PU8A 4N6ZA 5FM3A 4BC6A 5C4LA 3PVBA 2J5EA 3AKJA 4M69B 2HZ0A 5HI2A 5CF8A 3U6HA 4EL9A 1HCKA 3KA0A 4TZRA 4O7LA 3PP0A 4QMZA 3ZXZA 4FK6A 4FZ6A 3RWPA 3S3IA 5JN2A 2VX3A 4FOCA 2XK7A 4MTAA 1UKIA 3ZSGA 5B2LA 2VWVA 3MVLA 3IW4A 4D5HA 3KXMA 3SXRA 4USFA 5D10A 2IW9A 2OWBA 3F7WA 3OROA 3W0NA 2OW3A 3EQDA 4WBBB 4XX9A 3P0MA 4NIFB 3WZUA 4WNOA 3A7GA 2J0LA 2PUIA 4KNBA 4RIYB 3FI8A 1K2PA 3CLYA 3UOLA 1W82A 5FD2A 4ACGA 5LVOA 4QMVA 5AM7A 5ETIA 3BE9A 3R71A 3VUIA 1Q8TA 3Q5ZA 3LOKA 5JT2A 3DQXA 3MI9A 4QQTA 3QD4A 4DEEA 3H30A 3Q6UA 2C5YA 2Z8CA 4DLJA 2VWZA 4D4RA 4L44A 4RA4A 4X3FB 4FTOA 4LRMA 4GB9A 3CR0A 2XIYA 3PVWA 3CQEA 2C5NA 3R1YA 3DFAA 5AIRA 3O17A 1DAYA 1SM2A 4G3FA 4TRLA 3RPRA 1VLRA 1ZYSA 3EQCA 5HQ0A 5IQAA 4X3FA 2JDTA 3GBZA 3HAMA 3DKFA 2Z7LA 2WU7A 2XEYA 3OCSA 2VTHA 4EUTA 1UU9A 2GCDA 4IVBA 5M51A 2QONA 4QT1A 4K0YA 3KCKA 1ZOEA 3TZMA 4W4YA 3FPMA 2X2KA 2PULA 4G2FA 2ITVA 4U44A 5CQUA 3DLSA 5ACKA 3GT8A 3PZEA 4EZ3A 4ZP5A 5ANOA 3HYHA 4PRJA 3SD0A 1ND4A 3UZRA 3ZVVA 4XG3A 3SC1A 2CMWA 2PWLA 3ODYX 4U3ZA 3C51A 5EM7A 4BDJA 3A62A 1JNKA 2VX0A 5M4FA 2HW7A 3MPMA 4EQUA 4RIXA 3BE2A 4L68A 4AX8A 1V0OA 4JDKA 3CC6A 5FBNC 4AA0A 4R5SA 5LARA 1QPJA 4F4PA 4BF2A 1Q8UA 3TJCA 2C0IA 4PY1A 4YP8A 2ITTA 4F6SA 2G2HA 2CGUA 3CEKA 4PL5A 2GPHA 1WFCA 2I6LA 2YISA 2W7XA 4UWLA 2Z7RA 4TYHB 2E9NA 3OXZA 4GCJA 4OTRA 1JSUA 3LCKA 2R3PA 2XCHA 4U3YA 2X7OA 3E3PA 4FKOA 3NAXA 4E93A 3L9LA 4GMYA 3FYKX 3SAYA 4P5ZA 1WBSA 3MTLA 2A4ZA 3ZUTA 2X2MA 4BJJB 5G55A 2V4LA 5EG3A 2HELA 5IA2A 4U97A 1TFFA 2RFSA 3PPKA 2J51A 3GC9A 4B4LA 3UVRA 3HV4A 1RQQA 3D14A 3QQGA 4MHAA 2XS0A 2RIOA 4O0YA 5CVFA 3QKLA 4YTCA 4MXYA 1V0PA 3ZLWA 5M06A 2WTIA 1XMMA 2BFXA 5AADA 5BVOA 3T8MA 3BLQA 3MB7A 3PIYA 3ERKA 4O0SA 2ERKA 3PSBA 4QPAA 1Q8YA 5EOLA 4HVBA 4AT4A 1FMKA 5JFXA 3Q53A 2SRCA 3ALOA 4ZIMA 1MUOA 2ZFYA 3TACA 4BIBA 1OIUA 1PHKA 3QTZA 4KKHA 3FAAA 4XP3A 1OUKA 3R9DA 4FSUA 4P7EA 3WYYA 3GOKA 3UOJA 3W2QA 1TKIA 3P78A 3CTJA 1NVRA 4N0SA 3RM7A 2XVDA 3F82A 3HVCA 4G17A 5GNKA 3CTHA 4IZYA 4EHGA 4YTHA 3UQFA 3ML1A 2VX1A 3DPDA 2YJRA 3IONA 5LCKA 2W1EA 1JSTA 3QALE 3KMMA 2YCSA 4IMYA 4A07A 3ULIA 4WOVA 3CY2A 1Q61A 3E8NA 2ZYBA 4GT3A 3E64A 4RQKA 3DBEA 5CSWA 2XCKA 2F49A 3ZXTA 2Y4IC 2UZNA 4IWPA 3NYVA 2WQEA 4D2RA 3AMAA 4PDSA 5K5NA 4L23A 3FZRA 5D1JA 4QTBA 4XNEA 4ZJJA 4F6UA 5EI2A 3BHUA 2Y6OA 2VWXA 4ZSLA 4NJDA 5FTQA 4AXDA 3GQLA 4ZS4A 5L2WA 1PXPA 1HCLA 2XJ1A 5KX8A 4P2KA 4USEA 1H08A 4NM7A 2V7AA 3U9CA 3NNUA 4IVDA 4K11A 3U9NA 3MH0A 4O7TA 1XKKA 3V01A 5CU3A 5I9YA 4X2KA 1Y8GA 3A2CA 2C0OA 2UZTA 2JDOA 4FKPA 4U45A 5LMKA 3C4WA 3NNXA 2R2PA 3HV6A 4GG5A 5BVNA 2R3OA 3R0TA 4I24A 4K33A 2C30A 4WSYA 1XH9A 3RNYA 4DEDA 3AQVA 1CTPE 2ZM4A 3K5VA 4AT5A 4BCKA 5K9IA 3F3WA 4FJZA 1P2AA 5FTOA 4YJSA 4AAAA 4UX9A 4AP7A 4V04A 4EOPA 3D7TA 4IZ7A 5CT7A 3W16A 2B9IA 4AW1A 2GS6A 5L8LA 4QMNA 2X7GA 3HV7A 2W0JA 3IHYA 2ITPA 5FG8A 4BHNA 3UG2A 5KHWA 4EHVA 1W83A 3AC1A 2WQBA 3P9JA 3A4PA 4ZY6A 1QCFA 1JLUE 3ZZEA 2Y8OA 3KK9A 3NPCA 5DLSA 3W0MA 4BIDA 4C3PA 4IM0A 2HXQA 1OITA 3FKOA 5AAFA 1UVRA 4ALUA 4NUSA 2UW8A 4BY9E 4XHKB 4UBAA 2QQ7A 5E8XA 5DN3A 2XAOA 2WKMA 1DS5A 1UV5A 4YLJA 4DE4A 2O5KA 2JD5A 4OGRA 4CFNA 4OBQA 4K6ZA 4ZY5A 4L01A 4YURA 3L9MA 4Y46A 2YZLA 2P3GX 2CCIA 4YTIA 5AMNA 4CTBA 3QTWA 2YM5A 2UW3A 4HCVA 4AW5A 5M4IA 4JX3A 4YJTA 1ZYCA 2XK9A 2J0JA 3O5AA 5J5SA 4RVLA 4XG2A 4IDVA 3EZVA 3HHMA 1NA7A 5J95A 4XLIA 1SMHA 3EJ1A 2A1AB 4BTMA 4IC8A 1SZMA 4XRLA 2QU5A 3GU6A 4GG7A 3TIYA 3PP1A 5D9HA 4BGQA 5EKNA 3QC9A 1UWHA 1YHSA 4TNBA 4BCHA 3VS1A 5IQGA 4GYIA 2VWBA 4FK3A 3Q60A 4QMWA 5HE1A 3VJNA 2PZ5A 2OZAB 3ORZA 3KF7A 4DINA 1REJA 3IOKA 3DU8A 5AP3A 5C4KA 1H1QA 3M11A 5GINE 4J99A 3EQPA 3FLYA 2CPKE 5FLFA 2P55A 3VF8A 3S95A 2VUWA 3GI3A 4HVSA 4ACDA 3VS6A 5IQCA 2IZSA 2PMOX 4BCNA 4LMNA 3RP9A 4EUUA 3ENHA 4ONAA 3UO6A 4FKUA 5BVFA 3ZLYA 3HRBA 3V8TA 3QKMA 3ZRMA 4DN5A 3CBLA 3MY5A 4MQ2A 3VF9A 4HOKA 5EH0A 4DYMA 4RX9A 4XBUA 1OKVA 1GZNA 4FSYA 1S9IA 4RIOA 5GJFA 3DS6A 3ITZA 3WIGA 4O7WA 4IB0A 3HGKA 3EN7A 3F66A 3TNWA 2F57A 4Q5EA 3T3UA 5JRQA 4PH4B 4IWQA 4AS0A 4BBMA 3HKOA 5CU0A 5I9VA 3AC8A 3KMWA 3NUNA 3D7ZA 5A6NA 3HA6A 4RVKA 4A9YA 4PNIA 3IGGA 4Z9LA 4LOQA 4NCTA 5H9BA 3RTPA 3EZRA 3EQIA 5J9YA 2PZYA 2UZEA 4YLLA 2R3FA 3LFQA 4IJPA 4ALWA 1J7IA 3SKCA 4ANBA 4FLHA 1DAWA 3QZIA 4IB3A 4MBIA 3WI6A 5CAOA 5E8UA 3VBXA 5DYJA 5E8ZA 3RMFA 4OR5A 2WQNA 3FQHA 5A3XA 5ANKA 5T6KA 5A4QA 2X81A 4ZSGA 4TYEA 3PXZA 2PSQA 2J50A 3PUPA 5TOZA 3NS9A 2XNNA 3DCVA 3MVJA 3C7QA 4QYGA 4RA5A 5EDRA 3CGFA 1PXNA 2BZKB 3K5UA 4FSWA 2IW6A 3MV5A 1U46A 3EKKA 2YAAA 3ZFMA 4F99A 4GV1A 3DB8A 2J4ZA 4O21A 1PJKA 3PDTA 3BYSA 2YCQA 1OMWA 4IIRA 4TWCA 2HY0A 4DGNA 4TYHA 3WE8A 3GP0A 3UOHA 4CFXA 3R7EA 4GL9A 2JKKA 4AZEA 3NW6A 4FIJA 4J53A 4MXCA 3FSKA 3NUYA 3DXQA 3QLGA 4UWYA 5AP7A 1H1SA 2W1CA 5AUWA 2IW8A 4C36A 4RWIA 4FT0A 1JQHA 5EYKA 2X38A 5CWZA 3GCSA 1R3CA 3COHA 4G16A 2VO6A 2QKWB 4FI1A 1BKXA 3JUHA 3R1NA 4OTGA 1P4FA 4FBXA 5CAUA 4IX4A 4RMZA 2HY81 4PMSA 5CQWA 4R5YA 3TNIA 1M14A 2P33A 3EQBA 2XKFA 4HW7A 1EH4A 2H9VA 2C4GA 3QFVA 3UYSA 4JG6A 2UUEA 3WE4A 5A54A 3MTFA 3QD0A 2VRXA 3UNZA 3FZSA 3M1SA 4ANUA 1RDQE 3KK8A 1PXKA 4YC3A 3UZTA 4F7JA 3I6WA 2JIIA 3LIJA 3QX4A 2X6KA 4FVQA 2WMXA 1APME 3HV5A 4GK2A 3U4WA 4DG0E 3R1QA 5EHLA 5HE3A 1OPLA 4YNOA 5CSXA 5CAVA 2C3IB 2WMUA 4U81A 1L8TA 3F5XA 3LVPA 3MFSA 3OBJA 4FKGA 3ORPA 3E5AA 3ZFXA 5AWMA 3CJFA 2GFCA 4CZUA 1WVYA 4I20A 4JJRA 5LOHA 1VZOA 5DGZA 3OD6X 4NW5A 2X39A 2BKZA 4AXAA 4OLIA 2R0IA 3CXWA 2ZOQA 4FV7A 4LQMA 4FTLA 5HIEA 3DZQA 2WXFA 5L8KA 4WNPA 4TV3A 3OF0A 4BHZA 3Q9WA 1ZYDA 3V5JA 1OKYA 2CHLA 3Q04A 4FTIA 3UPXA 5HX6A 1H0VA 4RX7A 4FG7A 2UZUE 3OW3A 2WXHA 2FVDA 2WTDA 3MH3A 4IB5A 2OFUA 4IHPA 2XKCA 4KKEA 4W4VA 5DIAA 3ZTXA 5HTBA 4Z3VA 1URWA 3FQEA 2CKEA 4C4HA 1OGUA 4O7VA 2HIWA 3PUFC 2UW7A 4L1BA 3RK5A 5C26A 2GNHA 2UZDA 4GJ3A 4Y5QA 5H8GA 4I6HA 2OICA 2YITA 2W1DA 2R3JA 2Y6MA 1KOBA 3N51A 4YZDA 4BCFA 1BX6A 2CGXA 5CEQA 3ANQA 2CNQA 3GU8A 1G8AA 3B2WA 4CCUA 2Y9QA 5D12A 4LDTA 2WIHA 2QOKA 5H2UA 1XH4A 2I1MA 4MQ1A 5JFWA 4ANLA 4EH8A 2B1PA 4EOOA 2H8HA 4A55A 4U80A 3VQUA 1E7UA 4H3QA 4JDJA 4O82A 3ZS5A 4IJ9A 3KREA 3LCDA 3LXLA 4RX8A 3KVXA 5LVNA 1J91A 2NRUA 3POZA 5T8IA 4APPA 4BRXA 2B55A 2XYNA 1YQJA 4XLVA 3TJPA 5EW9A 3B8RA 3LJ3A 3MGYA 3PSDA 3E7VA 1ZMUA 4NSTA 4C58A 4CG9A 3DNEA 2YEXA 3A7HA 3ET7A 3QRTA 4B7TA 4C4JA 5HTCA 1PMVA 2GDOA 4EZKA 4F63A 3CSFA 4MYGA 3KF4A 2V62A 1REKA 3OEFX 4NKAA 3FI3A 3APDA 2AEGA 2F7EE 5AUZA 4FZ7A 4R7BA 3NFFB 2RL5A 3AD5A 4IX6A 5GJDA 3DPKA 2J0IA 4X2JA 5CEOA 4LRKA 5JKGA 3UVPA 3PA3A 3ZC6A 4EH7A 1O6KA 3P5KA 3GU5A 2CKOA 3LQ3A 4UALA 4M12A 5HD7A 4JNWA 5BMSA 2E9UA 1NVQA 1XH8A 3VIDA 3PXKA 1ZOGA 4EOKA 4E20A 1A9UA 3NYNA 4PTCA 5H8EA 2VTMA 3SW4A 2AC5A 4EC8A 4CKRA 3LE6A 2R3KA 3GQIA 3MWUA 2VGPA 4HLEA 4OW8A 1H00A 4MXOA 3LQ8A 5HE2A 4YMJA 2QC6A 4GW8A 4QMQA 3LCSA 3A8WA 2YZAA 2WU6A 3B2TA 3G51A 2ITYA 4KBKA 4AE9A 3ACJA 1YXTA 3FQSA 3P86A 4DH3A 5AUUA 3LFCA 4BI0A 4DEHA 4DA5A 1H27A 1R0EA 4GFMA 3ZOSA 3HLLA 5E8VA 2H34A 1OVEA 3R2BA 3AT2A 5FDXA 3ZW3A 4HYUA 1DI9A 3QARA 3BWJA 4Y83A 4CLJA 5LMBA 3MPAA 1G8JA 3UYTA 2YIWA 4JBVA 4M84A 4CSVA 4O0XA 3GC8A 3FMJA 3DGKA 2A27A 1G8KA 4ENYA 2BAJA 3NZ0A 4U9AA 3TL8A 3GC0A 4LUEA 4FOBA 5HZNA 4CMUA 1XH7A 3BHHA 3QZFA 4ZTSA 3VHKA 1WBTA 3VBTA 2HAKA 2XK4A 4YJUA 4DGOA 3F61A 4X2GA 4Y85A 1GNGA 2O2UA 4II5A 3VRYA 2X2LA 3OS3A 4B8MA 5GIOE 2C6TA 1GOLA 3BL9A 5G2NA 2YIXA 1OKWA 4QMTA 4I4EA 4V0GB 3HNGA 3IW6A 4D9TA 4MVFA 4O0TA 4QYFA 3ENEA 2XNGA 3DBSA 2UZVA 3P5JC 4GFOA 4GK3A 5ANEA 2YDIA 4KWPA 4O96A 4D0WA 2QOFA 4XRJA 2F9GA 3PWYA 5IEVA 1OUYA 2O65A 4GIIA 4IM3A 4M7IA 4RQVA 4WKQA 5ETFA 3BL7A 2QG7A 3THBA 3FLZA 1E1XA 1H07A 3T3VA 4A9SA 3LCOA 5FRIA 5HKMA 3KRRA 2YM6A 3RGFA 4JG7A 4K8AA 1QPEA 2WXNA 4FJYA 2GS7A 2J2IB 4E26A 3E3BX 3WARA 5AV1A 4O91A 3MN3A 3PE1A 5G6VA 3CS9A 4QP6A 5CASA 5EDPA 4XUFA 3R7YA 1UNHA 3CPBA 5BV3A 3BGZA 1H1PA 2ZM1A 3I81A 4L46A 5L6OA 2GNLA 3EFKA 3R8ZA 3MVHA 3VS4A 2PPQA 4ERWA 3FBVA 2X6DA 4RJ3A 5DRDA 4JDHA 4U8ZA 5ITAA 1WBOA 2X6EA 3DAJA 3R7RA 3ZLSA 4IDTA 4XOZA 3O51A 2IVUA 5KMOA 4J97A 4XS2A 2QG5A 3JY9A 4ENXA 4ZLOA 2XNBA 2GTMA 3LLTA 4USDA 4O6LA 4ZSEA 5DWRA 3UDZA 3UOKA 1IA8A 2HZ4A 3BU6A 2WXIA 1AD5A 4I0TA 3R04A 1MRYA 3PYYA 4RWJA 2VV9A 1H25A 2C5XA 5AUYA 2JDRA 3UQGA 4M13A 4CRLA 4MEDA 3FLNC 3TXOA 4WAFA 2X8IA 4FR4A 4KBCA 4ZZMA 4PDPA 3NUUA 2J0KA 4FZAB 5K4IA 2X6HA 2B4SB 2IWIA 4QTDA 4WNMA 2YIYA 2JBOA 3I0OA 3EFLA 4YC6A 3WZKA 4BI1A 5IDNA 2A19B 3ZC5A 5DEWA 2YWPA 3R21A 4L7SA 4HNFA 1YOJA 2WMTA 3DLZA 1KUTA 4LV5A 4OTDA 3VAPA 3OCBA 4ZY4A 3II5A 1GIHA 4G9RA 3LXKA 3DB6A 5JZNA 4GSBA 2RF9A 2B9HA 4HVGA 1A48A 4HGSA 3ZO1A 4E1ZA 2F7ZE 1Q3WA 4I0SA 3H4JA 4ARKA 2JAVA 5CSVA 1T46A 1IEPA 2BZIB 2BFYA 2UV2A 2QO2A 3CQWA 4FSQA 4FYNA 5CEIA 1H0WA 3U8WA 5HGIA 1OI9A 4FGBA 4I6FA 2QR7A 5BUIA 2UW9A 3P7CA 3I5ZA 5E1SA 5IMXA 4UWCA 2W9ZB 4PS8A 2BTSA 3BLHA 3RPOA 4JPSA 2RGPA 3PVUA 3K3IA 1GAGA 1MRUA 1QMZA 3V51A 4ALVA 5IA0A 2R3IA 1UNLA 4FHKA 1J7LA 2Q0BA 4IVCA 1WVXA 3A60A 4R1YA 3DZOA 5AP1A 1XWSA 5BVWA 2PZIA 4GS6A 5A9UA 5TF9A 4PS3A 3R28A 4O7YA 1RE8A 1PKDA 1OL2A 1IA9A 5AP2A 5DR2A 4JBQA 3QA0A 1GZ8A 4GT4A 4EEVA 4RPVA 3DAEA 3BHYA 4R3RA 3H9RA 1MP8A 2RG5A 5IPJA 2X6FA 2C6OA 4S2ZA 1OL7A 3VC4A 3WILA 5ANLA 1G3NA 4ID7A 4EH2A 2R7IA 3U4UA 3MJWA 5HVKA 1DI8A 2W5BA 4IAIA 3ZLXA 4R3CA 2WTKC 4BDGA 3I79A 2HCKA 4FSNA 5HBEA 3MA6A 4ERKA 3BX5A 3DK7A 5IH5A 5JMSA 1ZZLA 2PMNX 2PUPA 4LOPA 5IA3A 3UP2A 3DBQA 3BEGA 1HOWA 4GKHA 2V55A 4TY1A 3DY7A 2Q0NA 4GIHA 5HCYA 2WMVA 5EQPA 1FINA 2XZSA 4YBJA 3L17A 2ZDTA 3QTRA 3P79A 3W2PA 4LG4A 2HXLA 5JHBA 3CKXA 3UIBA 4PUZA 4Y72A 4E8AA 1H1RA 4TPTA 4BCPA 2ONLC 5IA5A 4CKIA 3I7BA 3MIAA 3WYXA 4XG8A 3G2FA 4FKIA 5DR9A 4YJNA 1VEBA 3H0ZA 3WZEA 1M7QA 4FV8A 5IQDA 4HYIA 4JBOA 4YZMA 3OWJA 4J96A 4YZ9A 4AZVA 3FKLA 3EHAA 1YDRE 4IACA 3R7OA 5LCJA 2QR8A 4XE0A 4L67A 4YGAA 3NEWA 4NZWB 2CGWA 2E9VA 2UVZA 5B7VA 2WOUA 3VS5A 2KULA 2I0HA 3ROCA 4BTKA 4O0RA 4BYJA 1KV1A 4L43A 3NVKI 4BCOA 5HORA 3BYOA 1RW8A 5CI7A 5E90A 5DFPA 5M4CA 1XH5A 4BCMA 1E8YA 2QVSE 1M2RA 2PY3A 4FTRA 2OIDA 1LEZA 3K2LA 3GVUA 3D9VA 2XK6A 3OBGA 4BBFA 4BCQA 4OT6A 1OKZA 3LFDA 1M17A 3R7VA 3OWLA 4UYAA 4E5WA 4MXAA 2JAMA 3PZHA 1YWVA 4J52A 4YO4A 5AP0A 4S32A 3L16A 2OJFE 5FQDC 4P4CA 4DGGA 2BTRA 1YDSE 1TQMA 2VTNA 1KE9A 2GHLA 4Y73A 2ESMA 5M56A 4TTHB 3PG1A 5IDPA 2NPQA 5HE0A 4X3FC 3FZTA 4KS7A 3SQQA 2BAQA 5AA9A 3VO3A 2B7AA 2XYUA 3BYUA 3LW0A 4FIIA 1U5RA 4U5JA 5AX9A 1FGKA 4WRSA 4FZDB 2PVFA 4V0GA 2AUHA 4A7CA 4BDKA 2IVVA 2CKQA 5HCXA 3SX9A 3DJ7A 3NR9A 3LCTA 5E1EA 4I22A 2WHBA 3C5IA 2C6LA 2GNJA 5EQEA 5C03A 4R7HA 3R9NA 4O0WA 4ASDA 4F9YA 4G1WA 4C37A 3C0HA 1M52A 5E92A 3QWJA 3C0GA 3KY2A 1CMKE 3R8PA 4ASXA 3GUBA 5CNOA 4YR8A 1Z9XA 2WXKA 5EM8A 4KIOA 4RJ6A 4F7SA 2PK9A 4F7NA 1H1WA 4RG0A 3ZRKA 2WXMA 2W5HA 4HYHA 4QMMA 4MD9E 4O86A 4TYJA 2G9XA 3HV3A 3QYZA 4QYHA 2PVNA 3LMHA 2YWVA 2WTVA 3G15A 1JKKA 5BVEA 4QDEA 3D94A 4EK3A 4EYJA 3VN9A 4O83A 2NP8A 4EOJA 4KSQA 3ZUUA 4F0GA 5EW8A 5E8WA 2ZM3A 4M0ZA 2BDFA 3ZU7A 5LWMA 3AOXA 3OY1A 5DG5A 1G8SA 5FUTA 3KN5A 4TNDA 1NXKA 4HJOA 4L8MA 5IU2A 1YOMA 4M15A 5ACBC 2QO7A 5EW3A 1E90A 4KUJA 3R02A 5CU4A 1BLXA 3ATSA 4I5CA 3GFEA 1O6YA 4DDGA 4QMLA 4A4LA 4DGLC 5EFQA 2QHMA 4K2RA 2OBJA 5L6PA 1B38A 3NMUF 3G9LX 3H0YA 2CKPA 3QK0A 3KRLA 5JHAA 3HP5A 2W06A 3RI1A 3VS0A 3Q4CA 2ZVAA 5CNNA 2WQMA 4MD8E 3QCYA 3IW8A 4IFCA 5A4TA 3PE2A 4QO9A 1CKPA 1YDTE 3F3UA 3A7JA 2ACXA 4ZJIA 2YIRA 4S31A 3TTIA 3FEGA 3Q9XA 3WF5A 4R77A 2JLDA 3DJ6A 1LP4A 3IDPA 2OF2A 5FEQA 2F2CB 2IG7A 2IJMA 2YAKA 5FTGA 4B8LA 2VN9A 4EQCA 2I0YA 2BKKA 4KBAA 4NKSA 4ZTLA 4EHEA 5BQ0A 3JXWA 5HHWA 2R9SA 4FKQA 4ACHA 3UE4A 4LUDA 4CFFA 1M2QA 2Q83A 2XF0A 1G5SA 3TMOA 2RKUA 5KKRB 4K18A 1LPUA 2CGVA 2QURA 2R3HA 4IE9A 2VU3A 2XKDA 3EQRA 4LYNA 5HVYA 4F9BA 4YU2A 4WUNA 2Y7JA 5EYDA 3M42A 4QP1A 5HG8A 5J8IA 3BYMA 4D0XA 4B6LA 2R3MA 5AAGA 4JAJA 5E91A 3BGPA 3KN6A 4D5KA 4FG8A 3WF9A 4ZTMA 3ELJA 3EWHA 1IASA 2G1TA 3KXGA 4OYSA 1Q5KA 3L9NA 4GYGA 3LMIA 5IQFA 1CKIA 2UZLA 4QMOA 3SGCA 2ZJWA 3ACKA 3REPA 3A7FA 3ZO2A 3LZBA 4JDIA 4C4FA 3OXTA 4JX7A 4PWNA 2E9OA 3MS9A 5L2IA 5L3AA 3APFA 4BCIA 4E6DA 3G0EA 1FVVA 4FT3A 3QF9A 2QU6A 3T8OA 3DDQA 4IZAA 4YSJA 3UC4A 5DT4A 4BZOA 3U6JA 4YHTA 2RD0A 4L53A 2OGVA 3CKWA 4C38A 4IVAA 4O38A 2Z7SA 4RBLA 4AF3A 4JMQA 5DHJA 2VTSA 4C2WA 5CSPA 4BTJA 1YI3A 4C35A 4FKSA 5LMKC 2C3KA 5AJQA 4TN6A 4ZSJA 3EQFA 5JGBA 2X4ZA 2BZJA 2PVYA 4O2PA 5M07A 2GFSA 4I92A 3A99A 5B0XA 5K4JA 4AGWA 3TV7A 3QC4A 3COIA 5IEYA 4UEUA 2W96B 2R3LA 4BCJA 1XH6A 3DTCA 2PZPA 5M08A 3VQHA 4C4GA 3JR1A 5HBHA 2R64A 3ZEWA 3EOCA 1PKGA 3WF6A 1IR3A 4C33A 3VW8A 5AV3A 1K9AA 1J7UA 3R73A 5AP4A 3QHRA 4PMMA 4U0IA 3BIZA 4FODA 2BR1A 5LVLA 3NWWA 3QBNA 4X3JA 3TI1A 3FC1X 2OH0E 3EIDA 3O7LB 3TV4A 4CTCA 2FUMA 4LFIA 3AC2A 4U7ZA 1SVGA 3RAHA 3V04A 3DAKA 2J90A 1Y8YA 4ITJA 3ZO3A 3O8PA 3GCPA 4M3QA 4NT4A 3NZUA 2XEZA 2Y0AA 2C6EA 3FUPA 4N6YA 2HZIA 1PXOA 5I9ZA 4Y5HA 3KRWA 4KD1A 2ETRA 4C3RA 2QOHA 2WXGA 5HG5A 3UVQA 3QQUA 1WVWA 3P1AA 1U5QA 2UW4A 2B9FA 3ML9A 4G34A 4ANVA 4HCTA 1QPDA 4L9IA 4RC3A 3W55A 4EH4A 5CI6A 2EB3A 5DH3A 2JBPA 4DFYA 5KMNA 4ZLYA 3QTQA 1ZXEA 4J98A 3HEGA 1H24A 4FV5A 4GKIA 5TT7A 1YWRA 3FL5A 1H8FA 2EB2A 2XM9A 2OZAA 4LL5A 1WZYA 2YM7A 3ZZWA 3E87A 1HE8A 3V6SA 2O3PA 5EHOA 1PRYA 3NW7A 3O7LD 4RIYA 3MH2A 3AT4A 5FBOA 2W1FA 5CF5A 4V05A 5IISA 4CFVA 3BHVA 2JKOA 4DEBA 4RVTA 2PVJA 3BU5A 1YHVA 3TM0A 3QWKA 4FKTA 3AGMA 3QCXA 4PS7A 4QQCA 4MH7A 3PY3A 2ZV8A 3CE3A 5AV4A 2CNUA 2YM3A 3W0QA 3Q4ZA 3TYKA 3UBDA 5IUHA 3V5QA 1XMLA 5AX3A 3JY0A 3QQKA 4F9WA 2C1AA 3MESA 3CY3A 4FNXA 5L2TA 1V0BA 3IGOA 4PDYA 1B39A 4RGJA 4QQ5A 3FMNA 3L8XA 3AT3A 2QLUA 3MJ1A 2XIXA 3EFWA 4FTUA 3IS5A 3QRKA 3GXLA 4B0GA 3Q2MA 4WO5A 4ZMFA 1Q3DA 1Q8WA 3FLWA 3WOWA 4DTBA 3I60A 2XJ2A 4AN2A 3Q32A 4QQJA 3P7AA 3MIYA 2Y4PA 4E5AX 4ANMA 3BPRA 3RHXA 3TZ8A 4KABA 5M09A 3IK3A 4GEOA 4UV0A 4M68A 3DKGA 1X8BA 4R6VA 4WRGA 1PXLA 3MJ2A 3KRXA 3BCEA 2X9FA 4MBJA 4PP9A 2OZOA 4U79A 5IH6A 3VBQA 3PREA 3QCSA 2BAKA 4YO6A 3IPHA 4YJVA 4HZSA 5FDPA 4N4SA 3GCQA 4QP4A 1NVSA 3OG7A 2X6JA 3NYXA 2VTJA 3O8UA 5A46A 3PXFA 4F65A 2YACA 2I7QA 3I1AA 3AMYA 4UZDA 4QP8A 4BDBA 3OCGA 4W8DA 1CJAA 1JAMA 4EZ5A 3BU3A 4IZ5A 4FA2A 4B99A 3KRJA 2G15A 4OVVA 1WMKA 4C61A 3F9NA 3L8VA 3AKLA 5L8JA 5JRSA 3WZJA 3CSTA 2ZAZA 2W17A 1ATPE 3CD8A 4NM3A 4QMXA 3LFSA 4XV9A 5KMJA 3F6XA 4WWNA 4N57A 4W8EA 2XBJA 3GOPA 2OH4A 4BKJA 5CXHA 5FEEA 4RIWA 3Q3BA 5AUXA 4FTAA 3FDNA 4NWMA 3TTJA 3BKBA 4DHJA 1I09A 5IZFA 4OUCA 2X4FA 4I6LA 5ANJA 2CLQA 4AOIA 5AM6A 2XP2A 4UWBA 2QOOA 3W8QA 2OJJA 3PY1A 2AYPA 2GQGA 4DHZA 4J6IA 2PMIA 5F94A 3HZTA 2VO3A 4UZHA 3E93A 3FLQA 4U6RA 5HLPA 2Y3AA 1R78A 4CEGA 4EOLA 4F6WA 3C4FA 4H3BA 4AA4A 2GMXA 1PMEA 5DPVA 1L3RE 3UDTA 3DT1A 1O6LA 3TNQB 4UWKA 3ODZX 3ZH8A 4PP7A 4L42A 1ZMWA 2CN8A 3GEQA 4WWPA 4FL2A 5ETCA 3R9OA 3FHIA 4NK9A 3O50A 4QPSA 4KZ0A 3FY0A 4FV9A 3C4CA 1BUHA 3EQHA 5IA1A 4Q9ZA 4MXZA 2ITXA 2IVTA 2ITOA 3F2RA 4QEBA 4EH6A 3OOMA 2CHXA 2WFYA 1Q8ZA 1NY3A 1YKRA 2BROA 2WTWA 4TW9A 5I4NA 4C0TA 4O2ZA 2W1ZA 2C3LA 4TWPA 1DM2A 3HMIA 4DBNA 4G6NA 3PA4A 3PJCA 3AMBA 2JFMA 2HYYA 1PYEA 4DDIA 5BYLA 4CT1A 2X6IA 4H1MA 2OI4X 3AC5A 3FL4A 4M0YA 4WD5A 3UO5A 4DFBA 3VRZA 4EJ7A 4HGEA 3JS2A 3MFUA 4DTAA 5JQ8A 2WEVA 5AAEA 5IQEA 3P08A 5J7HA 3NNVA 2CLXA 1NT2A 1SYKA 2WOTA 4BJJA 3DV3A 3TKIA 3SDJA 5KZ0A 3ZBFA 4DITA 3TUCA 4E6QA 3FWQA 4FG9A 5I9XA 2JIUA 4FEUA 4I0RA 4EWHA 5C8MA 4UXQA 5J87A 5GIPE 1V1KA 3DBFA 1QPCA 2H96A 4R78A 5A14A 2CN5A 3QUPA 4FSMA 2HWOA 2QOBA 3VS2A 3K3JA 3OP5A 3W2OA 3ORNA 2X9EA 2VZ6A 5CYIA 5LWNA 4FEQA 5IH4A 3TUBA 3ZSIA 1OB3A 4IANA 4OTHA 1XJDA 3P7BA 4JOAA 5A4EA 3OMVA 4FKWA 3TKHA 5FP6A 4QTEA 3PSCA 2OXXA 1OL5A 3FZ1A 4FEXA 3W0OA 1FQ1B 2XIZA 4EJNA 5AA8A 3W2CA 1Z5MA 4X2NA 4EBVA 5I0BA 2GNGA 4RZVA 4IC7A 3O71A 4YNEA 5HIBA 4FC0A 5BVDA 3LJ1A 5EM6A 3ZYAA 1CKJA 3QAME 3KU2A 3Q52A 4FMQA 1GZKA 4AQKA 4YZCA 4C3FA 4FKVA 3UNKA 4QNYA 4BTFA 2PTKA 2BDWA 5KUPA 3QA8A 3QZGA 2NRYA 4JRVA 2V22A 2ITWA 5CZIA 5E4HA 5CEPA 4RWLA 2FSTX 2R3NA 3W8LA 3ZRLA 4XV1A 4BDIA 3F88A 2CCHA 2R4BA 4BDAA 5JEBA 4DEAA 4EWQA 4P5QA 4H58A 1T45A 3W10A 1ZLTA 4D1ZA 2CJMA 4EZLA 3E88A 4M14A 2UZOA 4PMPA 5TKDA 4U43A 3UO4A 3QX2A 2R3QA 2WXPA 3N9XA 3Q2JA 4PMTA 2PL0A 4DF3A 4EC9A 3A61A 3NUAA 5EM5A 2YHVA 3R83A 3DFCB 4AXEA 4RT7A 2BDJA 4L2YA 1ZAOA 2BRHA 2REIA 3PRIA 3MPTA 4DFLA 4AGCA 4FVPA 2XNMA 1I44A 5BMMA 4FNWA 4A9UA 5EYCA 2YJSA 3TT0A 3ML8A 5HX8A 2R0UA 5KMIA 4DH8A 4DFNA 2B52A 2QKRA 2WMAA 3ORTA 4I41A 3VBVA 3RKBA 2VTPA 3OTVA 1Q24A 4PTEA 1BI8A 2B9JA 3QD3A 4BDCA 3BZ3A 4HYSA 4OTQA 3O96A 3GU7A 1PY5A 3D2IA 4OTWA 3PPJA 3TV6A 4CMTA 4DFUA 2XKEA 3KXNA 4O0UA 4L3PA 2W4JA 3E8EA 4AN9A 3SG9A 4E4MA 1OIQA 4YZNA 3ZONA 2YIQA 4JL9A 5BX0A 3APCA 2F7XE 2WD1A 4HGTA 4ZTQA 4YPSA 2EUFB 4FTJA 3SVVA 4OBOA 4KIPA 1K3AA 4JR3A 4AZWA 2FSOX 4IWOA 4OBPA 5HIDA 4GK4A 3RM6A 3C1XA 1J1BA 4GRBA 4IAFA 2R3RA 2PZRA 4DG3E 3PXQA 5TR6A 5DVRA 2WXOA 3FI4A 4NU1A 3JVSA 4IX3A 4JBPA 5ICPA 4FKLA 3U55A 5HU3A 4MK0A 1URCA 4L45A 5IQIA 3TIZA 3M2WA 4E7WA 5L2SA 3VUMA 3NNWA 1JWHA 3CSVA 5KE0A 3NUXA 2VTAA 3W18A 4A06A 3RVGA 4DHIB 4F9CA 3WF7A 4DHFA 1U54B 4FEVA 2OJIA 3NAYA 4I4FA 3L8PA 2XK3A 2C6MA 4CLIA 5KNJA 5M55A 2Y4IB 4Z7GA 1U59A 5CF6A 4URKA 4AA5A 5M57A 4EK4A 1F5QA 5KMKA 4Q2AA 4S33A 5DOSA 4JLCA 4DCAA 4Z16A 5DR6A 2C5OA 4GJ2A 3ETAA 4ITIA 1KE7A 3NIZA 4BZNA 4CNHA 5D7AA 4DBXA 5F4NA 3ZFYA 4UXLA 2WMQA 4TKSA 5KO1A 3AG9A 1KV2A 1PMUA 3GGFA 4FL3A 5ANDA 5CXZA 4EZJA 1QL6A 2QOCA 4G11A 4IEBA 2FYSA 4C02A 4MNFA 3O0GA 3COKA 3ALNA 2JDVA 3MY1A 3FE3A 4F1MA 3QLFA 4IFGA 4F9AA 1XHAA 2W9FB 3QTSA 3QRJA 4I5MA 4YTFA 2FA2A 5DA3A 4CKJA 1Q99A 4DFXE 1OGYA 1XR1A 2J7TA 2QD9A 4CVAA 2WXJA 4MWHA 4EBWA 3SXSA 3H9FA 1OPKA 4RFMA 4LRJA 3EYHA 4L6QA 3HUCA 3QGWA 4JVGA 2WTJA 2XRUA 4BR3A 2V0DA 3HMOA 3GENA 1JPAA 1VJYA 4GVJA 4QTCA 4E4LA 3C0IA 4YPDA 1ST0A 4KSPA 4V01A 4NFMA 3HA8A 4O7NA 3F2AA 3W0RA 3FC2A 3L1SA 3WZDA 3TKUA 4D28A 1ERKA 3DNDA 4JQEA 3SLSA 4AW0A 4CT2A 2YDKA 4A9TA 2P4IA 3PLSA 4JG8A 5EDSA 2HW6A 2VTTA 3FI2A 4I23A 5F20A 5IUIA 3RPSA 5KMLA 1ZY5A 2JKMA 4G3GA 2J5FA 2VAGA 4F1SA 4XG6A 4NW6A 2VTRA 3KFAA 5F95A 5LXMA 5H8BA 2OO8X 4HPTE 3LJ0A 1UKHA 2VWWA 3FZPA 3VUDA 4YHFA 2YCFA 5CU2A 5ENNA 3KL8A 5HNGA 1Q41A 3KQ7A 4Q9SA 2BUJA 4G6LA 5HD4A 2JC6A 4ANWA 3ZUVA 2VTOA 2HK5A 3F5UA 4X6QC 3FY2A 4DC2A 3G0FA 2IZRA 3R7IA 3GFWA 4EK6A 5EK7A 2CHZA 4QP9A 3CPCA 2VWIA 1CSNA 1WAKA 1CM8A 4AU8A 3QUDA 2P2HA 2WMBA 3F5PA 2EU9A 3Q96A 4FNZA 2CNVA 3R00A 5CVHA 5HVJA 5AEPA 2WGJA 4HCUA 4GUEA 3FMKA 3V8WA 2FB8A 5J1VA 4FV0A 2G2FA 3IW5A 4GUBA 4OTIA 1F0QA 3DKOA 3DA6A 2JITA 4WT6A 1OZ1A 4IAZA 4YJOA 3HDMA 3ZCLA 4RX5A 4XX5A 4FULA 4EOQA 4FTTA 4HVHA 4QP7A 1ZYJA 3DKCA 4QP2A 2OXYA 1R1WA 4L3JA 4D1SA 4EK8A 5A4LA 3PLAE 3ORLA 4BCGA 3O23A 5LVMA 3TZ9A 4LGGA 4FV1A 3AC3A 4JQ8A 4XG9A 3HP2A 3BBTB 2JIVA 5BYYA 3CCNA 4IADA 4K77A 4TL0A 4FTNA 4DTKA 4XV3A 3UC3A 3VW6A 5EI8A 1ZZ2A 1GY3A 2RG6A 1Y6AA 4ANSA 5JGAA 4D4VA 4QMYA 5B2KA 3V3VA 4YC8A 4BGHA 4DH7A 2WPAA 4NTTA 4I6QA 4CGAA 4ZOGA 4XV2A 5GHVA 4A4OA 4FKRA 1STCE 3BHTA 5KKRC 4EOMA 2YA9A 3AD4A 2ZDUA 4I5PA 1JKTA 3BYVA 4BDEA 5M4UA 1SVEA 4JR7A 3Q4UA 2DWBA 2JEDA 4G3EA 4AE6A 3FMLA 3WBLA 3LFAA 5EHYA 2YABA 5F1ZA 3JYAA 2PVHA 1KE8A 2GTNA 4CV8A 5EYMA 5E8TA 3R63A 3VNTA 3IOPA 3WIKA 5J9LA 3OEZA 4FV6A 3TNHA 1BI7A 4QYYA 1PF8A 4J71A 5ANGA 3C4EA 3ORMA 3L54A 1AQ1A 3OHTA 3A4OX 2HENA 3KXZA 3HUBA 3KXHA 4FKJA 3R8UA 3D5VA 2A2AA 4BN1A 3IQ7A 3JPVA 1U4DA 3ATTA 3IW7A 2IVSA 4I3ZA 2PMLX 3GB2A 2UW0A 4RC2A 5FM2A 3ZHPC 3OC1A 2DS1A 4G5JA 4KRDA 3EQGA 3KULB 2V7OA 3GCVA 3LFEA 4I5HA 1Z57A 3A7IA 4IWDA 4WNKA 4XG4A 3R7QA 5GJGA 5FXQA 1WCCA 4PNKA 3KULA 4FUXA 2VNYA 3QQLA 3OCTA 3EMGA 3QTXA 5BVKA 3RHKA 1FMOE 4BI2A 4CZTA 4CMOA 5C9CA 4H36A 1ZRZA 4X0MA 4W4XA 4YUQA 3RCJA 1FPUA 4E4XA 1JBPE 3ZSHA 3D5XA 3CQUA 3UZPA 2IN6A 2OU7A 2C6KA 2GNFA 2VNWA 2PE0A 2ZV7A 4LV7A 3ROYA 2PE2A 4GVAA 2W05A 3EN4A 3EB0A 5EKOA 4G31A 3NRMA 3PFYA 4PL3A 4PQNA 5JQ5A 3S1HA 5AUTA 3D83A 3QL8A 2C68A 3LM0A 4FIHA 3RALA 3UQCA 3TZ7A 5I5ZA 1E1VA 4AZTA 4O0VA 4XOYA 2WMWA 2KTYA 3CJGA 4RJ4A 3D0EA 4NM5A 3UDBA 1YWNA 2BCJA 2A4LA 2GS2A 2J9MA 1CDKA 2PVMA 3DOGA 2A5UA 4NCTC 5DT3A 5HG9A 2FSLX 4IX5A 4X21A 3MFTA 5HLNA 5EQYA 2W4OA 3I0QA 2EXMA 4F0FA 4O7ZA 5BUEA 5BPYA 1UU8A 5AUVA 3HECA 3G6HA 2X7FA 3RCDA 5T68A 3RZBA 3FMDA 2BRNA 4QNAA 3ZEPA 4AGDA 4AXCA 2DUVA 4EKKA 4BBEA 2BRMA 3QHWA 2XB7A 1W0XC 4EZ7A 3OUKA 4DH1A 4AOFA 4DAWA 4G3DA 3IO7A 3R8MA 5IG1A 2W4KA 2XNPA 3COMA 3N4TA 4FTMA 4QDVA 4AGUA 4EYMA 3FSFA 1UWJA 4RRVA 4KB8A 1OM1A 2XIRA 4CCBA 4C7TA 3L13A 3KB7A 2WTCA 4TYGA 1XO2B 2WEIA 5HEZA 4JT3A 3S2PA 3U51A 2ERZE 4XG7A 3ZO4A 2HZNA 5FGKA 5DRBA 2WMRA 4XZ4A 3UIUA 5FP5A 4IAAA 3F2NA 2QOIA 3FXXA 3LM5A 2W1GA 2OLCA 5IF1A 3PPZA 4FV2A 4FJVA 4E6AA 4MX9A 5I9UA 4MCVA 4NTSA 4FV3A 4G3CA 4C59A 4D9UA 4XYFA 3N4VA 4I6BA 5HNBA 4F7LA 1Y91A 2HOGA 4P90A 1R39A 4QMUA 1PXIA 3F3TA 2UW6A 3R22A 3H9OA 4FYOA 4HVDA 4Z55A 5EDQA 2YERA 5DEYA 2ETKA 2AC3A 3NFGB 3HRFA 5JK3A 4GH2A 4FUYA 2C1BA 2CHWA 3EN9A 2EVAA 3BELA 4UN0C 2HWPA 4M8TA 3TJDA 3N4UA 4KZCA 1W7HA 3ORKA 2CSNA 4O7SA 2WO6A 3EN5A 3VVHA 2OG8A 4MBLA 4FSTA 4XP2A 2OIBA 4F08A 2PVKA 1UU7A 4AACA 2QODA 4LI5A 4OT5A 3I5NA 2ITQA 3C4XA 4CD0A 5CT0A 3C13A 3BQRA 5CZHA 2BZHB 3TCPA 4YHJA 4MXXA 5CU6A 4MD7E 3DDPA 2XNEA 5M53A 4OVUA 4M97A 2E2BA 5FXRA 5LVPA 2GQRA 2FH9A 2V5QA 2PVLA 1F3MC 4EORA 1W84A 3TWJA 3NCGA 4S30A 4QOXA 2NNWB 4UYNA 3OAWA 3QJZA 2QNJA 3HDNA 3OY3A 3LKMA 3UMXA 3IECA 3PFQA 4CV9A 1E7VA 3LFBA 3QTIA 3U54A 3HIZA 4TT7A 3P2BA 3PS6A 2I0EA 4R3PA 3V5WA 5DE2A 2XNOA 3BQCA 3OW4A 3PG3A 3PXYA 3RK9A 5F9EA 5CAPA 5BUJA 2O8YA 4IM2A 4O27B 5IUGA 4O22A 4C2VA 3V6RA 3KEXA 4JXFA 2O64A 3O2MA 4AW2A 4DG2E 2GU8A 2OIQA 3DBCA 3KCFA 3P4KA 4JIAA 4UY9A 3LFNA 2PYWA 3EFJA 1H28A 4FT5A 2QLQA 4J1RA 3W0SA 1MQ4A 3LXPA 4FE2A 1NW1A 2IZTA 3F3ZA 5DBXA 3ZDUA 5I9WA 4RC4A 4MUQA 1R0PA 3LJ2A 3BGQA 3RPYA 1ZOHA 4CRSA 3ENMA 4D4SA 1WBWA 3ORIA 3MDYA 3C50A 3P23A 3H3CA 3PJ3A 2C0TA 3W0PA 2B53A 3KXXA 4KKGA 3DK6A 3T9TA 3LFFA 4WHZA 2XA4A 4QP3A 2R3GA 5J1WA 4YJQA 4X6RA 4DK5A 5J9ZA 3FV8A 3OOGA 4F1OA 3RJCA 2X8EA 1UA2A 4ASZA 4FIGA 1WBNA 3BLAA 4C4EA 4EOSA 4FV4A 2W1IA 3OZ6A 2C6IA 2ZB1A 3QQJA 3A8XA 4R7IA 3MFRA 4ZEGA 4AFEA 4APCA 4E4NA 3PWDA 5CAQA 3TDWA 5JFSA 4F70A 3ID6C 3VUKA 5JSMA 2WNTA 1YXSA 4HGLA 2DYLA 2ETMA 5C01A 3I7CA 3TL5A 4KIQA 5IQBA 1FVTA 4EQMA 4ZMEA 2XBAA 1OBGA 3ANRA 4TUUA 3O8TA 4H1JA 2WXLA 1OPJA 1WBVA 1P14A 2RFDA 4DGMA 5IMEA 2OKRA 4IW0A 1SVHA 3QZHA 3NUPA 3QD2B 3GU4A 4UWHA 4EH5A 3KIOC 1TQPA 4M67A 4F64A 1PMNA 1XBAA 3BV2A 4RLLA 4KINA 1Q97A 1S9JA 3TDVA 1P4OA 5CF4A 3EH9A 3ZIMA 4ASEA 2ZV9A 5T3QA 2ZB0A 3MSSA 4DEGA 1Y57A 1BL6A 3L9PA 1WBPA 3SW7A 1E8WA 4CG8A 2C47A 2BRGA 3MB6A 2WZJA 4KA3A 3B8QA 3L8SA 3NYOA 3UDSA 1FBNA 5HG7A 3HL7A 4RJ7A 5CS6A 4ZZNA 3R7UA 5CVGA 4BB4A 3V5TA 2O63A 2XUUA 2WIPA 4L00A 3QQHA 5ETAA 4UB7A 3SOAA 5L6WL 4AT3A 4EH3A 4KS8A 1YXVA 4FTKA 3PRFA 3DQWA 3MVMA 4O84A 3I4BA 3ORXA 2R5TA 3NIEA 4UWFA 1JSVA 3MBLA 1IG1A 5IEXA 3Q9ZA 1H01A 2IZUA 1OL6A 4ZZOA 2OJ9A 2PE1A 4RLKA 3L08A 3UNJA 3R8VA 3VS7A 4BVUA 2P0CA 5JGDA 4CFUA 4IQ6A 3D5UA 3OT8A 5JFVA 4H05A 5TO8A 1ZYLA 2F2UA 3BRBA 3I6UA 1JKSA 1IAJA 1PXMA 2XM8A 4LMUA 2YN8A 3T9IA 3QQFA 1E9HA 5ANIA 3E92A 3TN8A 4G5PA 4IAKA 4JAIA 4J7BA 3W2SA 4Q5HA 3VBWA 3AGLA 4FNYA 4ACMA 4FGRA 4ZSAA 5K5XA 3BBWA 2BRBA 4O81A 2W5AA 3FLSA 4WG4A 4CFWA 3KVWA 3VONA 3OFMA 3OWKA 3F69A 3DJ5A 3FMEA 4U42A 3S00A 2O0UA 4NL0A 4MF1A 4JIKA 2XJ0A 3R8LA 1KE6A 4FIEA 3E8DA 3SOCA 5JZJA 3NUSA 4ACCA 3G33A 1O9UA 4EKLA 3NGAA 5KHXA 3OVVA 4BYIA 4AZSA 2I40A 2PHKA 4DFZE 4LM5A 3KMUA 5CENA 4J95A 4MNEB 3RNIA 1JOWB 2BHEA 3QUEA 2W1HA 3TNPC 2RFNA 2XARA 2ZMDA 3FJQE 4MAOA 4PDOA 4ZJVA 1W98A 3NCZA 2WXRA 3EN6A 3QXPA 4JS8A 1MRVA 1YVJA 3D2KA 1Q62A 4I94A 4GU9A 4I21A 5CSHA 4AOJA 3E63A 4GU6A 2QO9A 3EKNA 5G1XA 5DT0A 5FEDA 3BV3A 3UP7A 3SRVB 3V8SA 2F4JA 4FADA 1OBDA 2WELA 5HICA 3MW1A 1ZWSA 4RVMA 5HNIX
chains in the Genus database with same CATH topology
2ITUA 2Z2WA 4LV8A 4WG3A 4WG5A 1FGIA 3SRVA 4AN3A 3LMGA 4XCUA 4QMPA 5CANA 3HX4A 5AP5A 2BIYA 1M7NA 4PF4A 3D15A 3F7ZA 4HPUE 1SNXA 5AV2A 4LL0A 4AOTA 3FHRA 4ZS0A 2LGCA 4BDFA 1H4LA 3QRUA 3DTWA 4IH8A 4TWNA 5CY3A 3AXWA 3RAWA 3QRIA 5C27A 4JQ7A 3PXRA 3AD6A 4JRNA 5KMMA 2DQ7X 4FT9A 1XQZA 1Y6BA 3DXNA 1BMKA 4WA9A 4IAYA 3SV0A 3VS3A 2OSCA 2VTQA 3G6GA 3Q5IA 1UNGA 4XP0A 2BVAA 3G5DA 1B6CB 5K3YA 2BHHA 4BZDA 1A06A 2FO0A 2BALA 3POOA 3LLAA 5HESA 4AQCA 2UW5A 3VWAA 1BL7A 3C9WA 1YXXA 1U54A 4A4XA 3ULZA 3F3VA 3GC7A 4FZFB 4X2FA 2XANA 2G01A 3HMNA 2GSFA 5B2MA 4I1ZA 4YZBA 4TWOA 4FL1A 2UVYA 3HMMA 3FYJX 3SHEA 3SG8A 1JKLA 3VUHA 4MWIA 2UVXA 4WBOA 2GQSA 1GJOA 1P5EA 3QGYA 1BYGA 5D41A 2C69A 1H26A 4D1XA 2BIKB 3LAUA 1TQIA 3IG7A 4DEIA 4PV0A 3UIXA 5LMAA 1OECA 1PYXA 4DH5A 5AV0A 2ITNA 3R9HA 5D11A 2YDJA 3R2YA 3U87A 1ZARA 3UGCA 5A6OA 2OF4A 4RJ8A 3TG1A 4FX3A 4GT5A 5A4CA 3S4QA 5HBJA 3ZBXA 4J8NA 4D55A 1M2PA 3VUGA 4CQEA 3CTQA 3HRCA 3UJGA 3JVRA 1GIIA 2WAJA 3D5WA 3LPBA 4H39A 3UODA 4HNIA 1XBCA 3RAKA 4AAYA 1LR4A 4DCEA 3DBDA 5AFVA 2X0GA 3S0OA 3R30A 1YHWA 1KOAA 4AG8A 4AXFA 4EI4A 3CGOA 3H10A 5D7VA 2G2IA 3E7OA 4YLKA 4N70A 4BDDA 3MY0A 1UU3A 2YM4A 2QI8A 2WXVA 3QKKA 2UZBA 3ZMMA 4ZXTA 3IDCA 2B54A 4PX6A 5H3QA 3UIMA 3ZM9A 2WB8A 2PUUA 4U41A 2VTLA 5FXSA 4AZFA 2ZMCA 3RWQA 1IRKA 2EWAA 3NVMB 4ITHA 5EI6A 5IA4A 2X8DA 4CFMA 4FSRA 2OXDA 3E8CA 2XALA 3AKKA 3QTUA 1PW2A 2XMYA 2IO6A 1LUFA 3PY0A 1TVOA 3MH1A 3VHEA 5CALA 2UZWE 1KE5A 4RIWB 4BGGA 1AGWA 4F1TA 4XBRA 3OTUA 3Q6WA 2YM8A 4FTQA 3NX8A 4KRCA 3NDMA 4Y95A 3ZM4A 3FPQA 3EL7A 4FSZA 3W2RA 4JI9A 4PL4A 5CLPA 4IB1A 2P2IA 4C34A 1PXJA 2Z60A 3GNIB 3IDBA 1SNUA 4E6CA 1OL1A 1YI6A 3QYWA 4D58A 3RINA 2GHGA 4CXAA 4FTCA 4U40A 5DNRA 3PIXA 2NYAA 4L7FA 4QTAA 1YI4A 3FMHA 3R1SA 2EXCX 4LGHA 3G9NA 4NM0A 3PVGA 4ZLZA 2YCRA 4DLIA 3PJ2A 2BMCA 2VGOA 4HZRA 2FGIA 5HCZA 4MNEA 5HO8A 3UG1A 3LHJA 3VULA 3W1FA 4RSSA 5CTPA 2R7BA 4R1VA 2J0MB 3TUDA 3QU0A 4FEWA 3FMMA 4TXCA 4Y8DA 1OIYA 3CD3A 2A0CX 2B0QA 2BILB 4DT8A 2I0VA 1ST4A 3PJ1A 5AP6A 3VBYA 2IPXA 3IKAA 4EH9A 3GCUA 2WMSA 4NJ3A 5C8KA 4XJ0A 4BICA 3BLRA 5LJJA 1VYWA 2VTIA 2VD5A 4F09A 3R9RA 1OIRA 4B9DA 4RWKA 4FICA 1YW2A 2XRWA 4YBKA 3Q4TA 4YJPA 3V5PA 4EK5A 2RFEA 3SXFA 3W33A 4EONA 2ZV2A 4QYEA 3C5UA 2NO3A 1KSWA 3C4ZA 1XBBA 3DXPA 3KC3A 4QRCA 3R6XA 3CIKA 4W4WA 5HO7A 2PUNA 2W99B 4D2SA 2WQOA 5E8YA 5CX9A 4ORKA 4A9RA 4C62A 4TYIA 3HMPA 4L3LA 2H6DA 4XMOA 4RZWA 3TEIA 5AIKA 3OT3A 3WF8A 3KKVA 4ZTRA 4EHZA 2BPMA 3QXOA 1YRPA 2JKQA 3PTGA 5EOBA 1GZOA 4BIEA 2XK8A 3G90X 4G6OA 4ZTNA 1YOLA 5KZIA 2OJGA 2QCSA 3Q9YA 4RIXB 1ZMVA 2JFLA 2JGZA 4D4YA 2QOQA 5KCVA 2C5VA 3RAIA 3RPVA 3ZDIA 3SA0A 3MYGA 3FXWA 4ZK5A 4AFJA 4K9YA 4WIHA 3UTOA 1IAHA 2GNIA 4C4IA 3FKNA 5E9EA 2OFVA 2Z7QA 3FXZA 1LEWA 2XAMA 3HAVA 3BI6A 3LXNA 3NSZA 4L52A 4PTGA 3VJOA 3U6IA 4BDHA 5E8SA 2J6MA 3K54A 3UMWA 5BNJA 3D4QA 1J3HA 4KAOA 4AUAA 5KBQA 2QHNA 3CP9A 3MA3A 3EYGA 5C8NA 2QOLA 4IBMA 2VO7A 4LOOA 2Z02A 4NYEA 3OUNB 4HVIA 1VR2A 4XEYA 4EOIA 2XIKA 1YXUA 3LQ5A 4Z7HA 5CEKA 2VWUA 4K1BA 5LQFA 3PA5A 4F78A 2JDSA 4RFZA 2VWYA 3BEAA 4MKCA 2X1NA 3E62A 4H3PA 2XH5A 3W32A 5IQHA 4X7QA 4NH1A 1FOTA 4RJ5A 1VYZA 2C6DA 2E9PA 4S34A 4J8MA 4XH6A 1GIJA 3R01A 5CEMA 3OXIA 4DT9A 5C1QB 3D7TB 5JH6A 3V5LA 4WUAA 5HLWA 5E7RA 3PJ8A 3KGAA 4FVRA 5M44A 3DK3A 1FVRA 3BWFA 4OTFA 3F5GA 4FT7A 3FZOA 3NLBA 4RFYA 4E73A 4YJRA 1J1CA 2YFXA 1JVPP 4O6EA 1W8CA 3OWPA 1ZY4A 2OK1A 3PIZA 5HU9A 2LAVA 3NW5A 4QMSA 3EL8A 4NFNA 1RJBA 4ZAUA 3QCQA 1Q4LA 2WTKB 5BYZA 4GFGA 2C3JA 3RK7A 4ANQA 4E5BA 4FIFA 4YSMA 3UPZA 4O7RA 1MQBA 2FSMX 2VO0A 2GHMA 4I93A 5DI1A 2PVRA 4G9CA 4F0IA 2ITZA 5KBRA 2CDZA 3AC4A 4ZTHA 4AWIA 1KWPA 2ONLA 2PU8A 4N6ZA 5FM3A 4BC6A 5C4LA 3PVBA 2J5EA 3AKJA 4M69B 2HZ0A 5HI2A 5CF8A 3U6HA 4EL9A 1HCKA 3KA0A 4TZRA 4O7LA 3PP0A 4QMZA 3ZXZA 4FK6A 4FZ6A 3RWPA 3S3IA 5JN2A 2VX3A 4FOCA 2XK7A 4MTAA 1UKIA 3ZSGA 5B2LA 2VWVA 3MVLA 3IW4A 4D5HA 3KXMA 3SXRA 4USFA 5D10A 2IW9A 2OWBA 3F7WA 3OROA 3W0NA 2OW3A 3EQDA 4WBBB 4XX9A 3P0MA 4NIFB 3WZUA 4WNOA 3A7GA 2J0LA 2PUIA 4KNBA 4RIYB 3FI8A 1K2PA 3CLYA 3UOLA 1W82A 5FD2A 4ACGA 5LVOA 4QMVA 5AM7A 5ETIA 3BE9A 3R71A 3VUIA 1Q8TA 3Q5ZA 3LOKA 5JT2A 3DQXA 3MI9A 4QQTA 3QD4A 4DEEA 3H30A 3Q6UA 2C5YA 2Z8CA 4DLJA 2VWZA 4D4RA 4L44A 4RA4A 4X3FB 4FTOA 4LRMA 3CR0A 2XIYA 3PVWA 3CQEA 2C5NA 3R1YA 3DFAA 5AIRA 3O17A 1DAYA 1SM2A 4G3FA 4TRLA 3RPRA 1VLRA 1ZYSA 3EQCA 5HQ0A 5IQAA 4X3FA 2JDTA 3GBZA 3HAMA 3DKFA 2Z7LA 2WU7A 2XEYA 3OCSA 2VTHA 4EUTA 1UU9A 2GCDA 4IVBA 5M51A 2QONA 4QT1A 4K0YA 3KCKA 1ZOEA 3TZMA 4W4YA 3FPMA 2X2KA 2PULA 4G2FA 2ITVA 4U44A 5CQUA 3DLSA 5ACKA 3GT8A 3PZEA 4EZ3A 4ZP5A 5ANOA 3HYHA 4PRJA 3SD0A 1ND4A 3UZRA 4XG3A 3SC1A 2CMWA 2PWLA 3ODYX 4U3ZA 3C51A 5EM7A 4BDJA 3A62A 1JNKA 2VX0A 5M4FA 2HW7A 3MPMA 4EQUA 4RIXA 3BE2A 4L68A 4AX8A 1V0OA 4JDKA 3CC6A 5FBNC 4AA0A 4R5SA 5LARA 1QPJA 4F4PA 4BF2A 1Q8UA 3TJCA 2C0IA 4PY1A 4YP8A 2ITTA 4F6SA 2G2HA 2CGUA 3CEKA 4PL5A 2GPHA 1WFCA 2I6LA 2YISA 2W7XA 2Z7RA 4TYHB 2E9NA 3OXZA 4GCJA 4OTRA 1JSUA 3LCKA 2R3PA 2XCHA 4U3YA 2X7OA 3E3PA 4FKOA 3NAXA 4E93A 3L9LA 4GMYA 3FYKX 3SAYA 4P5ZA 1WBSA 3MTLA 3ZUTA 4BJJB 2X2MA 5EG3A 2HELA 5IA2A 4U97A 1TFFA 2RFSA 3PPKA 2J51A 3GC9A 4B4LA 3UVRA 3HV4A 1RQQA 3D14A 3QQGA 4MHAA 2XS0A 2RIOA 4O0YA 5CVFA 3QKLA 4YTCA 4MXYA 1V0PA 3ZLWA 5M06A 1XMMA 2BFXA 2WTIA 5AADA 5BVOA 3BLQA 3MB7A 3PIYA 3ERKA 4O0SA 2ERKA 3PSBA 4QPAA 1Q8YA 5EOLA 4AT4A 1FMKA 5JFXA 3Q53A 2SRCA 3ALOA 4ZIMA 1MUOA 2ZFYA 3TACA 4BIBA 1OIUA 1PHKA 3QTZA 4KKHA 3FAAA 4XP3A 1OUKA 3R9DA 4FSUA 4P7EA 3WYYA 3GOKA 3UOJA 3W2QA 1TKIA 3P78A 3CTJA 1NVRA 4N0SA 3RM7A 2XVDA 3F82A 3HVCA 4G17A 5GNKA 3CTHA 4IZYA 4EHGA 4YTHA 3UQFA 3ML1A 2VX1A 2YJRA 3IONA 5LCKA 2W1EA 1JSTA 3QALE 3KMMA 2YCSA 4IMYA 4A07A 3ULIA 4WOVA 3CY2A 1Q61A 3E8NA 2ZYBA 4GT3A 3E64A 4RQKA 3DBEA 5CSWA 2XCKA 2F49A 3ZXTA 2UZNA 2Y4IC 4IWPA 3NYVA 2WQEA 4D2RA 3AMAA 4PDSA 5K5NA 3FZRA 5D1JA 4QTBA 4XNEA 4ZJJA 4F6UA 5EI2A 3BHUA 2Y6OA 2VWXA 4ZSLA 4NJDA 5FTQA 4AXDA 3GQLA 4ZS4A 5L2WA 1PXPA 1HCLA 2XJ1A 5KX8A 4P2KA 4USEA 1H08A 4NM7A 2V7AA 3U9CA 3NNUA 4IVDA 4K11A 3U9NA 3MH0A 4O7TA 1XKKA 3V01A 5CU3A 5I9YA 4X2KA 1Y8GA 3A2CA 2C0OA 2UZTA 2JDOA 4FKPA 4U45A 5LMKA 3C4WA 3NNXA 2R2PA 3HV6A 4GG5A 5BVNA 2R3OA 3R0TA 4I24A 4K33A 2C30A 4WSYA 1XH9A 3RNYA 4DEDA 3AQVA 1CTPE 2ZM4A 3K5VA 4AT5A 4BCKA 5K9IA 3F3WA 5FTOA 1P2AA 4UX9A 4YJSA 4AAAA 4AP7A 4V04A 4EOPA 3D7TA 4IZ7A 5CT7A 3W16A 2B9IA 4AW1A 2GS6A 5L8LA 4QMNA 2X7GA 3HV7A 2W0JA 5FG8A 2ITPA 4BHNA 3UG2A 5KHWA 4EHVA 1W83A 3AC1A 2WQBA 3P9JA 3A4PA 4ZY6A 1QCFA 1JLUE 3ZZEA 2Y8OA 3KK9A 3NPCA 5DLSA 3W0MA 4BIDA 4C3PA 4IM0A 2HXQA 1OITA 3FKOA 5AAFA 1UVRA 4ALUA 4NUSA 2UW8A 4BY9E 4XHKB 4UBAA 2QQ7A 5E8XA 5DN3A 2XAOA 2WKMA 1DS5A 1UV5A 4YLJA 4DE4A 2O5KA 2JD5A 4OGRA 4CFNA 4OBQA 4K6ZA 4ZY5A 4L01A 4YURA 3L9MA 4Y46A 2YZLA 2P3GX 2CCIA 4YTIA 5AMNA 4CTBA 3QTWA 2YM5A 2UW3A 4HCVA 4AW5A 5M4IA 4JX3A 4YJTA 1ZYCA 2XK9A 2J0JA 3O5AA 5J5SA 4RVLA 4XG2A 4IDVA 3EZVA 1NA7A 5J95A 4XLIA 1SMHA 3EJ1A 2A1AB 4BTMA 4IC8A 1SZMA 4XRLA 2QU5A 3GU6A 4GG7A 3TIYA 3PP1A 5D9HA 4BGQA 5EKNA 3QC9A 1UWHA 1YHSA 4TNBA 4BCHA 3VS1A 5IQGA 4GYIA 2VWBA 4FK3A 3Q60A 4QMWA 5HE1A 3VJNA 2PZ5A 2OZAB 3ORZA 3KF7A 4DINA 1REJA 3IOKA 3DU8A 5AP3A 5C4KA 1H1QA 3M11A 5GINE 4J99A 3EQPA 3FLYA 2CPKE 5FLFA 2P55A 3VF8A 3S95A 2VUWA 3GI3A 4HVSA 4ACDA 3VS6A 5IQCA 2IZSA 2PMOX 4BCNA 4LMNA 3RP9A 4EUUA 3ENHA 4ONAA 3UO6A 4FKUA 5BVFA 3ZLYA 3HRBA 3V8TA 3QKMA 3ZRMA 4DN5A 3CBLA 3MY5A 4MQ2A 3VF9A 4HOKA 5EH0A 4DYMA 4RX9A 4XBUA 1OKVA 1GZNA 4FSYA 1S9IA 4RIOA 5GJFA 3DS6A 3ITZA 3WIGA 4O7WA 4IB0A 3HGKA 3EN7A 3F66A 3TNWA 2F57A 4Q5EA 3T3UA 5JRQA 4IWQA 4AS0A 4BBMA 3HKOA 5CU0A 5I9VA 3AC8A 3KMWA 3NUNA 3D7ZA 5A6NA 3HA6A 4RVKA 4A9YA 4PNIA 3IGGA 4Z9LA 4LOQA 4NCTA 5H9BA 3RTPA 3EZRA 3EQIA 5J9YA 2PZYA 2UZEA 4YLLA 2R3FA 3LFQA 4IJPA 4ALWA 1J7IA 3SKCA 4ANBA 1DAWA 3QZIA 4IB3A 4MBIA 3WI6A 5CAOA 5E8UA 3VBXA 5DYJA 5E8ZA 3RMFA 4OR5A 2WQNA 3FQHA 5A3XA 5ANKA 5T6KA 5A4QA 2X81A 4ZSGA 4TYEA 3PXZA 2PSQA 2J50A 3PUPA 5TOZA 3NS9A 2XNNA 3DCVA 3MVJA 3C7QA 4QYGA 4RA5A 5EDRA 3CGFA 1PXNA 2BZKB 3K5UA 4FSWA 2IW6A 3MV5A 1U46A 3EKKA 2YAAA 3ZFMA 4F99A 4GV1A 3DB8A 2J4ZA 4O21A 1PJKA 3PDTA 3BYSA 2YCQA 1OMWA 4IIRA 4TWCA 2HY0A 4DGNA 4TYHA 3WE8A 3GP0A 3UOHA 4CFXA 3R7EA 4GL9A 2JKKA 4AZEA 3NW6A 4FIJA 4J53A 4MXCA 3FSKA 3NUYA 3DXQA 3QLGA 4UWYA 5AP7A 1H1SA 2W1CA 5AUWA 2IW8A 4C36A 4RWIA 4FT0A 1JQHA 5EYKA 5CWZA 3GCSA 1R3CA 3COHA 4G16A 2VO6A 2QKWB 4FI1A 1BKXA 3JUHA 3R1NA 4OTGA 1P4FA 4FBXA 5CAUA 4IX4A 4RMZA 2HY81 4PMSA 5CQWA 4R5YA 3TNIA 1M14A 2P33A 3EQBA 2XKFA 4HW7A 1EH4A 2H9VA 2C4GA 3QFVA 3UYSA 4JG6A 2UUEA 3WE4A 5A54A 3MTFA 3QD0A 2VRXA 3UNZA 3FZSA 3M1SA 1RDQE 3KK8A 1PXKA 4YC3A 3UZTA 4F7JA 3I6WA 2JIIA 3LIJA 3QX4A 4FVQA 2WMXA 1APME 3HV5A 4GK2A 3U4WA 4DG0E 3R1QA 5EHLA 5HE3A 1OPLA 4YNOA 5CSXA 5CAVA 2C3IB 2WMUA 4U81A 1L8TA 3F5XA 3LVPA 3MFSA 3OBJA 4FKGA 3ORPA 3E5AA 3ZFXA 5AWMA 3CJFA 2GFCA 4CZUA 1WVYA 4I20A 4JJRA 5LOHA 1VZOA 5DGZA 3OD6X 4NW5A 2X39A 2BKZA 4AXAA 4OLIA 2R0IA 3CXWA 2ZOQA 4FV7A 4LQMA 4FTLA 5HIEA 3DZQA 5L8KA 4WNPA 4BHZA 3OF0A 3Q9WA 1ZYDA 3V5JA 1OKYA 2CHLA 3Q04A 4FTIA 3UPXA 5HX6A 1H0VA 4RX7A 4FG7A 2UZUE 3OW3A 4RJ3A 2FVDA 2WTDA 3MH3A 4IB5A 2OFUA 4IHPA 2XKCA 4KKEA 4W4VA 5DIAA 3ZTXA 5HTBA 4Z3VA 1URWA 3FQEA 2CKEA 4C4HA 1OGUA 4O7VA 2HIWA 3PUFC 2UW7A 3RK5A 5C26A 2GNHA 2UZDA 4GJ3A 4Y5QA 5H8GA 4I6HA 2OICA 2YITA 2W1DA 2R3JA 2Y6MA 1KOBA 3N51A 4YZDA 4BCFA 1BX6A 2CGXA 5CEQA 3ANQA 2CNQA 3GU8A 1G8AA 3B2WA 4CCUA 2Y9QA 5D12A 4LDTA 2WIHA 2QOKA 5H2UA 1XH4A 2I1MA 4MQ1A 5JFWA 4ANLA 4EH8A 2B1PA 4EOOA 2H8HA 4U80A 3VQUA 4H3QA 4JDJA 4O82A 3ZS5A 4IJ9A 3KREA 3LCDA 3LXLA 4RX8A 3KVXA 5LVNA 1J91A 2NRUA 3POZA 4BRXA 4APPA 2B55A 2XYNA 1YQJA 4XLVA 5EW9A 3B8RA 3PSDA 3MGYA 4C58A 3E7VA 1ZMUA 4NSTA 4CG9A 3DNEA 2YEXA 3A7HA 3ET7A 3QRTA 4B7TA 4C4JA 5HTCA 1PMVA 2GDOA 4F63A 4MYGA 3KF4A 2V62A 1REKA 3OEFX 4NKAA 3FI3A 2AEGA 2F7EE 5AUZA 4FZ7A 4R7BA 3NFFB 2RL5A 3AD5A 4IX6A 5GJDA 3DPKA 2J0IA 4X2JA 5CEOA 4LRKA 5JKGA 3UVPA 3PA3A 3ZC6A 4EH7A 1O6KA 3P5KA 3GU5A 2CKOA 3LQ3A 4UALA 4M12A 5HD7A 4JNWA 5BMSA 2E9UA 1NVQA 1XH8A 3VIDA 3PXKA 1ZOGA 4EOKA 4E20A 1A9UA 3NYNA 4PTCA 5H8EA 2VTMA 3SW4A 2AC5A 4EC8A 4CKRA 3LE6A 2R3KA 3GQIA 3MWUA 2VGPA 4OW8A 1H00A 4MXOA 3LQ8A 5HE2A 4YMJA 2QC6A 4GW8A 4QMQA 3LCSA 3A8WA 2YZAA 2WU6A 3B2TA 3G51A 2ITYA 4KBKA 4AE9A 3ACJA 1YXTA 3FQSA 3P86A 4DH3A 5AUUA 3LFCA 4BI0A 4DEHA 4DA5A 1H27A 1R0EA 4GFMA 3ZOSA 3HLLA 5E8VA 2H34A 1OVEA 3R2BA 3AT2A 5FDXA 4HYUA 1DI9A 3BWJA 4Y83A 4CLJA 5LMBA 3MPAA 1G8JA 3UYTA 2YIWA 4JBVA 4M84A 4CSVA 4O0XA 3GC8A 3FMJA 3DGKA 2A27A 1G8KA 4ENYA 2BAJA 3NZ0A 4U9AA 3TL8A 3GC0A 4LUEA 4FOBA 5HZNA 4CMUA 1XH7A 3BHHA 3QZFA 4ZTSA 3VHKA 1WBTA 3VBTA 2HAKA 2XK4A 4YJUA 4DGOA 3F61A 4X2GA 4Y85A 1GNGA 2O2UA 4II5A 3VRYA 2X2LA 3OS3A 4B8MA 5GIOE 2C6TA 1GOLA 3BL9A 2YIXA 1OKWA 4QMTA 4I4EA 4V0GB 3HNGA 3IW6A 4D9TA 4MVFA 4O0TA 4QYFA 2XNGA 2UZVA 3P5JC 4GFOA 4GK3A 5ANEA 2YDIA 4KWPA 4O96A 4D0WA 2QOFA 4XRJA 2F9GA 3PWYA 5IEVA 1OUYA 2O65A 4GIIA 4IM3A 4M7IA 4RQVA 4WKQA 5ETFA 3BL7A 2QG7A 3THBA 3FLZA 1E1XA 1H07A 3T3VA 4A9SA 3LCOA 5FRIA 5HKMA 3KRRA 2YM6A 3RGFA 4JG7A 4K8AA 1QPEA 2J2IB 2GS7A 4E26A 3E3BX 3WARA 5AV1A 4O91A 3MN3A 3PE1A 5G6VA 3CS9A 4QP6A 5CASA 5EDPA 4XUFA 3R7YA 1UNHA 3CPBA 5BV3A 3BGZA 1H1PA 2ZM1A 3I81A 4L46A 5L6OA 2GNLA 3EFKA 3R8ZA 3MVHA 3VS4A 2PPQA 4ERWA 3FBVA 2X6DA 5DRDA 4JDHA 4U8ZA 5ITAA 1WBOA 2X6EA 3DAJA 3ZLSA 4IDTA 4XOZA 3O51A 2IVUA 5KMOA 4J97A 4XS2A 2QG5A 3JY9A 4ENXA 4ZLOA 2XNBA 2GTMA 3LLTA 4USDA 4O6LA 4ZSEA 5DWRA 3UDZA 3UOKA 1IA8A 2HZ4A 3BU6A 1AD5A 4I0TA 3R04A 1MRYA 3PYYA 4RWJA 2VV9A 1H25A 2C5XA 5AUYA 2JDRA 3UQGA 4M13A 4CRLA 4MEDA 3FLNC 3TXOA 2X8IA 4FR4A 4KBCA 4ZZMA 4PDPA 3NUUA 2J0KA 4FZAB 5K4IA 2B4SB 2IWIA 4QTDA 4WNMA 4YC6A 2YIYA 2JBOA 3I0OA 3EFLA 3WZKA 4BI1A 5IDNA 2A19B 3ZC5A 5DEWA 2YWPA 3R21A 4L7SA 4HNFA 1YOJA 2WMTA 3DLZA 1KUTA 4LV5A 4OTDA 3VAPA 3OCBA 4ZY4A 3II5A 1GIHA 4G9RA 3LXKA 3DB6A 5JZNA 4GSBA 2RF9A 2B9HA 4HVGA 1A48A 4HGSA 3ZO1A 4E1ZA 2F7ZE 1Q3WA 4I0SA 3H4JA 4ARKA 2JAVA 5CSVA 1T46A 1IEPA 2BZIB 2BFYA 2UV2A 2QO2A 3CQWA 4FSQA 4FYNA 5CEIA 1H0WA 3U8WA 5HGIA 1OI9A 4FGBA 4I6FA 2QR7A 5BUIA 2UW9A 3P7CA 3I5ZA 5E1SA 5IMXA 4UWCA 2W9ZB 2BTSA 3BLHA 3RPOA 2RGPA 3PVUA 3K3IA 1GAGA 1MRUA 1QMZA 3V51A 4ALVA 5IA0A 1UNLA 2Q0BA 2R3IA 1J7LA 4IVCA 5AP1A 1WVXA 3A60A 4R1YA 3DZOA 1XWSA 5BVWA 2PZIA 4GS6A 5A9UA 5TF9A 3R28A 4O7YA 1RE8A 1PKDA 1OL2A 1IA9A 5AP2A 5DR2A 4JBQA 3QA0A 1GZ8A 4GT4A 4EEVA 4RPVA 3DAEA 3BHYA 4R3RA 3H9RA 1MP8A 2RG5A 5IPJA 2C6OA 4S2ZA 1OL7A 3VC4A 3WILA 4EH2A 1G3NA 4ID7A 2R7IA 3U4UA 5HVKA 1DI8A 2W5BA 4IAIA 3ZLXA 4R3CA 2WTKC 4BDGA 3I79A 2HCKA 4FSNA 5HBEA 3MA6A 4ERKA 3DK7A 3BX5A 5IH5A 5JMSA 1ZZLA 2PMNX 2PUPA 4LOPA 5IA3A 3UP2A 3DBQA 3BEGA 1HOWA 4GKHA 2V55A 4TY1A 3DY7A 2Q0NA 4GIHA 5HCYA 2WMVA 5EQPA 1FINA 2XZSA 4YBJA 2ZDTA 3QTRA 3P79A 3W2PA 4LG4A 2HXLA 3CKXA 3UIBA 4PUZA 4Y72A 4E8AA 1H1RA 4TPTA 4BCPA 2ONLC 5IA5A 4CKIA 3I7BA 3MIAA 3WYXA 4XG8A 3G2FA 4FKIA 5DR9A 4YJNA 1VEBA 3H0ZA 3WZEA