3PFYA

The catalytic domain of human otud5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
129
Chain Sequence
MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU domain-containing protein 5
publication title The catalytic domain of human OTUD5
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 129
sequence length 146
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pfyA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pfyA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
3OR1C 3G1MA 1M52A 1Y91A 4O96A 5E8ZA 2X51A 1PUEE 5EOBA 3FK7A 1STZA 4B8XA 5M3MJ 3EN7A 5ICGA 3K7AJ 2JDOA 2AEGA 3D5SC 3IDPA 1HCKA 4YGAA 3V42A 2WO6A 2RDPA 2O61A 4RX7A 4O7LA 3U54A 2R93J 4O84A 4IVBA 3F9NA 3QUDA 4AYBA 2ZCWA 4QPQA 2Z7SA 4JS8A 2XK6A 2YITA 5HG9A 1ZGAA 1QNTA 2XIYA 1HW5A 5K7ZA 3TBIA 2ZJQF 2GS6A 2BR1A 3F82A 2HQNA 4RFMA 3C13A 4X6RA 1IW7F 2J0LA 5E20A 3G6HA 1HBXG 2P2IA 4HYUA 3FHIA 2XK9A 3LAPA 4RMZA 2R7VA 2KDOA 4BY7J 4FEVA 2VTMA 4BDCA 1PXIA 5F08A 5F1RA 4FTHA 3MPMA 4BIDA 4CV8A 3HXLA 4WXCA 4I01A 2VB6A 4U7BA 1OYWA 2BRNA 3DKFA 4DCEA 4YURA 4C4FA 5IYBJ 1P7IA 5IDNA 3KRJA 4CFMA 3LA3A 1QZYA 4G5JA 3W10A 2NOGA 1D1BA 3Q6WA 3TG1A 3C4EA 5BX0A 5HLWA 3LKMA 3ZZEA 2XRLA 1P6RA 2YDIA 2QC6A 3L7WA 2R5ZA 4RVMA 4FEQA 4HZFA 3HA6A 5L6OA 2EB2A 3W1FA 4JL9A 3QTZA 4HCVA 3KL8A 4XSXF 4Z9LA 3SEZA 3SFZA 4RJ4A 4IJPA 5CZHA 4ERWA 4GH2A 4FL2A 5FGMA 2W99B 2XNOA 3CDIA 2WTWA 4QQJA 2K9LA 3HVCA 3FBVA 3UZTA 5T3QA 3ABMH 3KP2A 3UQGA 2YIQA 4AT3A 3JAMZ 3OTUA 3KEOA 3BHHA 1XMLA 1YOJA 3HKOA 4YUQA 3SX9A 4S0HB 3KETA 1ZG5A 4L53A 5CF8A 2CNQA 3BG3A 3EWHA 1AWCA 2WMTA 4Y52J 2GXGA 4A6EA 4BY1J 2LF7A 4LMUA 4XLVA 4YU2A 2UW8A 4RB3C 3TIYA 4IM3A 3OYAA 4UWYA 2E9NA 3EH9A 2M1BA 5HE2A 1OBGA 3KK8A 4CQEA 4F7SA 3GC0A 4BUPA 1T2KA 4OBPA 2OC6A 4F99A 4WRGA 2HTSA 3PY3A 3O3KA 4IZAA 1U54A 5KZIA 1ON1A 4DZJA 1ZR4A 2VZ6A 3RMFA 4E6CA 2F49A 3LOCA 2KIQA 4EM0B 3EN4A 3L9MA 3A7HA 4H05A 3V3VA 2BY2A 1XO2B 2KISA 3O71A 2DA4A 4WX9A 1XJDA 3F3VA 1JKOC 2GIZA 3RINA 4ENXA 4E8AA 4EK5A 4MNFA 2R5ZB 5DD4A 2W4SA 2FGIA 4RMNA 5BPDA 4EOIA 4QP3A 5EQEA 4WD5A 4W8EA 4DGGA 2KT0A 2W48A 4AG8A 3BKBA 1ZKGA 3H9OA 2F7XE 4OU0A 1JKTA 4E7SA 5EKNA 4UUTA 1G3SA 5BNGA 3UPXA 2PTKA 5CENA 3RYPA 5C27A 2W9ZB 4DYCA 1X1AA 4EH6A 3KA0A 5FTGA 1REJA 3MFUA 4FKSA 5JRQA 1NK2P 3H3VK 3MVJA 3ZDIA 2O5RA 3GU8A 2DJIA 5DUIA 5LVMA 1IRZA 3DQWA 3AXWA 2JWTA 3R2BA 1ZWSA 1DP7P 2FXAA 1KYWA 4D9TA 2E5ZA 3H9FA 2QONA 3C1XA 3JSOA 3F61A 3EZVA 4C9YA 4KJZA 2C6OA 3BEGA 5L3CA 4LUEA 4FT9A 2BAKA 3MFKA 3W2VA 3PSDA 4FZFB 4BACA 5HNBA 1PJRA 4GV1A 4J1RA 2XEYA 3CIKA 1FMVA 4S34A 2B9FA 2KLOA 3BC8A 4R5YA 4FL3A 3R2YA 2CMPA 3J7ZI 3RAKA 2AC3A 5AUZA 1V0OA 3WTYC 4HVIA 4Y4RA 4F93B 1U54B 3CZ6A 3VW8A 4BH9A 1OKWA 4QSHA 3NAUA 3ABLH 5AAGA 4ZZOA 4I41A 3SEQA 2JAVA 3CSVA 5DN3A 5B66C 3LSRA 4YSJA 1WZYA 2QCSA 4RZVA 1XKKA 3PJ8A 2EJRA 1A6QA 1RZ4A 3COAC 2V1UA 2JK3A 5GAEJ 1QA6A 3R28A 2R3QA 2LOOA 1F3MC 5HDGA 4HW7A 4DC2A 5FRIA 2M2EA 3RM6A 3O8UA 4X21A 5HBHA 4YMJA 5CSHA 3EQCA 1R49A 3SDGA 1K9AA 4KIOA 1WBWA 4M67A 1FSHA 3FMEA 4O86A 2BE5F 2ZYBA 4A5NA 2O03A 2VTNA 4FTTA 2B52A 4QTCA 4DTAA 1PXKA 4N9HA 2B55A 2ETKA 2J50A 2YJRA 3SHFA 1KU7A 3CCVI 2VKDA 5H2FC 3ZR8X 3PXFA 4RC3A 2HI3A 2K4BA 5E1XA 4GRBA 3A62A 3L8XA 5HLTA 3F6VA 3OBJA 4UY9A 2YAAA 4TT7A 4AIDA 2WGJA 4XQFA 3CR0A 5FEEA 2XK4A 4F7LA 3CY2A 3AC4A 4C4JA 4FKIA 3WGIA 2RFEA 1WJ5A 4BJTA 1V0PA 4AW5A 4OLIA 3Q4TA 1T33A 9ANTA 3DXJF 4FTUA 1FTTA 3H36A 4JBPA 2HTJA 5J1YA 3BR6A 5K5QA 2PMLX 4U80A 5AUXA 4DA5A 2VRXA 3W0RA 1G8SA 5JLWA 3F72A 3KX2A 4RLFA 3FIWA 2V9KA 4A3IJ 3UIMA 3DTCA 1WJBA 5F1ZA 4MQ2A 2P3GX 3HRUA 4QMUA 4P7EA 2R3NA 3TL8A 3TV7A 2ID3A 3ZBFA 2BFXA 3PUFC 1FC3A 3QX4A 5IQEA 3T0YA 3E63A 5EJCA 4P96A 2OFUA 1H8FA 3TN8A 3TJCA 1YRNA 4BE2A 4BJ5C 4ACDA 4CMTA 1ZZ2A 4XKCA 2ZXIA 3JRFA 3RAHA 5A54A 5IA0A 1V54H 3GEZA 4K11A 5ILSA 2G2HA 3TNWA 2AC5A 4FKQA 4FKJA 1UB9A 4XMYA 2JFMA 3I55I 3LMGA 1JAMA 4ZY6A 2IZSA 1MQBA 2VUMJ 3TO7A 4ENMA 2X2KA 5BMZA 2R3PA 2XIRA 3D15A 5GINE 5KCMA 4JK1X 3VYRB 4K33A 4IADA 2VBZA 3GI3A 3EYYA 3B2TA 4Y95A 1LEBA 1TW3A 5CAQA 1YW8A 2PVKA 4WG5A 3A7JA 2IW5A 1ONVA 1T56A 3R8UA 4LV5A 2C6TA 1U4DA 2BFYA 3BU3A 5LGUA 2XMYA 1G59A 3DKWA 4KBAA 2EFPA 3ZLWA 3RPUA 5EHOA 3LFQA 3GOKA 4P1WA 2MD5A 4DGLC 4BYIA 3R7OA 5HLIA 3S1HA 3TCPA 1W7PD 4EI4A 3SJMA 4G12A 4JDHA 4QP1A 1FLIA 4EH3A 4ZTFA 1QGPA 4MEXF 3P23A 4IQJA 2VPRA 5FQDC 4IO9F 4L3LA 1MMDA 4ZK5A 3Q9WA 5EFQA 3B8QA 5AP7A 2DFEA 3PUFA 4KBKA 4XRFA 3MVLA 4CTBA 1OL6A 4F6WA 1YRNB 1QVTA 3KYDB 4QMPA 3M7GA 2G15A 1MBGA 3TDZC 1G8KA 1FP1D 2HXLA 4R77A 4TYHB 4ZYHA 3DBDA 3PY0A 3HG9A 5H6QA 2I5UA 4IAKA 3DBEA 3PLSA 3SG8A 2R3GA 5HZNA 4ZSLA 4K2EA 3WTUC 2IGKA 3S0OA 4QLCU 4LGWA 2F48A 3LCOA 5LBQA 2NYXA 5HD4A 3BROA 2O5KA 3C5IA 4PJJA 3WZDA 4M3DA 3VUIA 2ZJPF 2R5YA 2YAKA 1LDKB 2PVLA 5ICPA 5KBRA 1YG2A 5FJ8J 4RX9A 2F7ZE 3ATTA 3NIEA 2JPBA 4D9UA 5CT7A 3PPKA 4XOZA 4ZTQA 4HNTA 3NYOA 4QTEA 5CSXA 2LKPA 1IRGA 4HAMA 3DTEA 3QA8A 1WBTA 4BGDA 4M6YA 1J09A 2X2MA 4FKUA 2YEXA 1ETXA 4WXHA 1GJOA 4EK4A 2Z1DA 3PNTA 4FKGA 3OEFX 5KMIA 1OKVA 4HBLA 5JKGA 4FT8A 3AGMA 3DBCA 4LRMA 1U9NA 4XL9A 3VS7A 1BW6A 2W57A 3QU3A 4NQWA 4TYEA 1Y8RB 2MFZA 3QZIA 1ERDA 4EH2A 2QD9A 3CXWA 3JRBA 4ANJA 1P4WA 4M71A 3PE1A 4YJRA 2WMWA 2E1MC 3WE8A 2WMSA 3ZQQA 4AXEA 4PF4A 3MEXA 3ZFYA 4MTEA 2A05A 2P33A 3F7WA 3A4OX 4C2WA 3BTLA 4HCTA 3Q5FA 1Q3DA 1SVHA 3BYMA 3ZCLA 4OUCA 3R9OA 3POZA 4C30A 2IAIA 4TYIA 1R1TA 4H4KC 1OM1A 4EH8A 5CWZA 4C02A 4IMYA 4AM3A 5GAGJ 1MRVA 5DD8A 4D4RA 2YS9A 5CI6A 5TO8A 5AP4A 4MWHA 2BHZA 3COHA 2MA3A 4G6LA 4I6ZA 1GUUA 2YISA 3BHTA 1GT0C 2P4WA 5HG5A 2JIUA 2VASA 2HYYA 3CC2I 1K6YA 2R5YB 1GIHA 4OTFA 5A4QA 1A48A 3WG9A 2N8GA 2BRBA 3EYGA 2QSGX 4RVKA 1RRJA 2YDKA 2CWEA 4MTDA 3EB0A 3W2AA 1S7AA 1IRKA 2DA5A 1W36C 3AFHA 5KE0A 4HVSA 4M6VA 1WJDA 4EGZA 4DEDA 1H1WA 3PXRA 3K10A 5EW8A 4AN2A 4PJMA 4BGGA 3ULQB 5IYDJ 4I20A 4BDEA 4PCQA 1DAWA 3EIDA 2PI0A 4I5CA 3NW5A 3ML1A 5C03A 3KF4A 3OCSA 3CLYA 2C5VA 3Q5IA 4FV2A 2JGZA 2CGPA 2X39A 4NQWB 2WQOA 3FXWA 4AP7A 4IVNA 3CCRI 4GJ2A 4DHFA 5F27A 2PMHA 4QP4A 3U6IA 5CEOA 3H0ZA 2R7QA 3K4CA 5AA8A 3W0OA 3HMPA 4Y85A 4FASD 4C35A 4J53A 2E36A 3RALA 4QMQA 2OXYA 3CY3A 3QUPA 3F9KA 5IEYA 5DR9A 1T0FC 1W0UA 4FT0A 4H36A 5LHHA 4G7ZF 2ADUA 3LSMA 3OCGA 2A1AB 4OT6A 3G6EI 1KV2A 2X81A 4Q4ZF 2FH9A 3E3BX 1VQ9I 1NVQA 1WBPA 2CV2A 3FXLA 1O57A 3LCTA 5J3LA 4UALA 2QQ7A 1D1CA 2EFNA 3RQ4A 3FLSA 4D55A 3GU7A 1ZY4A 4F4PA 1ZMWA 4EC8A 2E1CA 4EHGA 3VIDA 3IG7A 5D5XB 3F7ZA 3B2WA 2X9DA 2JEDA 4FGBA 4RGUA 1J7IA 5FP6A 2Y0MA 4TZRA 5JGBA 5BVKA 3LXKA 4U6RA 2VD5A 3DPUA 2XKCA 2GQGA 2X6YA 5EYCA 3BBWA 3SDBA 3SVVA 5LHGA 4GK3A 3KFWX 3O51A 1VF9A 4AOJA 4YJVA 3IOPA 2IA0A 4FTNA 1ZYRF 4U0YA 5D41A 4XG2A 3GFJA 3KXNA 1URWA 3F3TA 4OIPF 3ZYAA 4DEAA 2F5CA 1YO5C 1YW9A 2GA1A 5TJJA 1RNLA 3I4NJ 4X2GA 1QPCA 3OFMA 1WJCA 4PP7A 2DDAA 2E1MB 3H5RA 3CGFA 2ITYA 4G34A 2FE3A 4BYJA 2UZVA 1TQPA 4BI0A 2CMWA 2C6KA 2O63A 3HRTA 3TZ7A 2VTPA 4IX7A 3FZ1A 4MEYF 2YACA 3OIPA 4FG8A 3VDXA 2L01A 1ZH5A 3QTWA 4ACCA 1D5VA 3DBQA 5FXQA 3HTUA 2XJ2A 2Y0AA 2M5WA 2IPQX 2X6EA 4R1YA 1L8TA 5EZGA 3RIRA 1JT6A 4FEWA 2IEKA 3E3PA 1L3LA 4R3CA 3J7AO 2PVFA 4ON0A 2K9NA 3E64A 3BWFA 3Q4UA 3UR3C 2O8KA 2NXNB 2VQGA 4ZJVA 3BDDA 3LSTA 3PVBA 5D5UB 3OYBA 1BI2A 4QP9A 2ZV9A 3NIZA 2ZC2A 4EV0A 1XS9A 3BTJA 1K4SA 4FSUA 1YQAA 4YG2F 4G3GA 2YWPA 3D4QA 1UFMA 4XBFA 1DI9A 2GQQA 4HF0A 4YJSA 4RQKA 1BI7A 3NR9A 2CSNA 4FZ7A 5J4VA 2PQ8A 4CEGA 5HIDA 4QWQA 4XH6A 2CH0A 4YO6A 3AKZA 1RC9A 4BU2A 3KY2A 2Z9OA 4LV7A 3KP6A 4FT5A 2R3MA 3R0TA 2R5TA 4FA2A 4XRMA 4FTRA 4OWRB 4RC2A 2MH2A 1J75A 1U5QA 1B9NA 1HSJA 3K1PA 4A3FJ 4JXFA 2BZKB 2BOLA 5E3NA 3GCPA 4PQNA 4FUYA 4EK6A 2F5VA 3UE4A 1TBXA 3BCBA 4PDKA 1QPEA 4ZLOA 3FMLA 3DDPA 2IA2A 2XJ1A 3OWTA 4ERKA 4B7TA 5AUTA 2ELHA 3F8BA 3DJ5A 3F21A 3E93A 1RR7A 4ENNA 4CZTA 3PIOF 4O0RA 3CE3A 2LSOA 3B6AA 2Y4PA 4K6ZA 2PJPA 1SVLA 3EDPA 3DU6A 4HEA2 3ZLSA 1G3NA 1JOWB 3CMAI 2R92J 2PFBA 1GNGA 4BXFA 2B9SA 5HDKA 4M12A 3Q0UA 3KFAA 2QBYA 2LGCA 3JS2A 3HDMA 4C0TA 2VNWA 1LB2A 5AFVA 4DQ2A 4EJ7A 2P0CA 3BRBA 2QOFA 1IG1A 2FD5A 1OUKA 4WNKA 3LFUA 2WTCA 3R7YA 2QM3A 3OV8A 4L67A 2UW3A 5AAEA 2YIWA 4MF1A 4BL0B 3HP5A 1ZN2A 2XANA 1OLTA 4BRXA 5HICA 3ZN0A 2GS2A 5E3OA 3G4SI 3UOLA 3AT4A 2DMQA 5DI1A 3KQ7A 3REOA 4BCPA 3P79A 5CF6A 2IW9A 1BBYA 4YZNA 4ZTRA 3OMVA 3P4KA 3WG7H 3LVPA 2KIMA 5L8JA 1ITYA 2I0EA 3KZYA 3BWGA 1K7AA 1B39A 3OROA 1H00A 3SHEA 3Q2MA 3R02A 3K2LA 3C9WA 2QU6A 1RQQA 2R3OA 3FLQA 3PXZA 2JT1A 4Z3VA 3RKXA 1D3YA 1YW2A 4HYIA 4EEFG 1ZXEA 5B1AH 1HKQA 2DMTA 3SXYA 3W2QA 2WTEA 5H2UA 4DEHA 4LITA 2BDFA 4YEJA 2DDBA 3F2NA 2W96B 2HEOA 4IHYA 3D0EA 4K77A 4WKQA 3HOTA 3ALOA 3DV3A 4GT5A 4C4IA 1PP8F 3ORIA 3T8OA 4E4LA 4A3DJ 1XGOA 1WBSA 2DAOA 2JIIA 2FQ4A 4XRSG 2A2AA 4FVPA 5EW9A 2XBJA 3FMQA 2QBYB 2PZPA 1UMQA 3CLQA 5B7VA 2BRMA 4FEXA 3GX4X 3DAJA 3H0GJ 5D11A 2XHKA 2BDWA 4ZSGA 1VQ4I 1NT2A 3LW0A 3VUHA 1IV6A 4TPTA 2E19A 4C37A 4TWPA 3R8PA 4ORKA 1YXVA 1A06A 4BBEA 4KMFA 2VTAA 2UW6A 4HDVA 2VV9A 3S2HJ 2G2IA 3UOHA 2VI6A 4QT1A 3SDJA 3JVSA 3I81A 5J47A 2NNYA 1J1CA 4CYDA 4O7WA 3P9IA 3S3MA 3NYXA 4EUUA 1BOBA 4ITJA 2FRHA 4GUBA 2DMNA 4ZDPA 1BYGA 3LQ5A 4IWDA 3PJRA 4DG2E 4EOMA 4CRSA 4CZZA 2UV2A 3EN6A 4FX4A 2F2CB 5LRSA 5ANKA 4D4VA 3M07A 4IRIA 3UC3A 2BDJA 1Q4LA 3VBYA 3A60A 4HNFA 3RCJA 4QEBA 2W4OA 2P5KA 3ECOA 2KMUA 3DAKA 5HS7A 1A31A 3TMOA 3BIZA 3EN9A 3ZO3A 4YHTA 5F0FA 1JKPC 5H3QA 3ZC5A 4FKTA 4PGGA 5GIOE 1I50J 3RHXA 1IRFA 2KQRA 2X6WA 2IVVA 2XUUA 4IHSA 4CMOA 5HTBA 4NZWB 2NS0A 3FLWA 4QOXA 3M11A 3SOCA 3P5KA 2JKMA 4HNIA 3W2RA 4FIJA 1BA5A 3LQ3A 4W4XA 2GWRA 3DKCA 3UO4A 4IB3A 3E87A 3ZQ7A 2V0DA 4B09A 1P2AA 2BVAA 1KE7A 2FBIA 3IO7A 4XBRA 4YFNF 3ZLYA 3ZRGA 5D4SA 4E5AX 5E8IA 3UNKA 4C7TA 3C7JA 3D0SA 2R3JA 4I98B 3TKYA 3KMWA 1REPC 3F5XA 3LSJA 1TW2A 4TRLA 3HEGA 5K9IA 3V04A 5I9VA 5EM5A 3GZNB 1U59A 5GTIC 3L8SA 2WIHA 4HW0A 5DH3A 4BI2A 5J40A 4F1TA 4QNYA 3IW4A 3IHUA 1QPJA 4EBWA 3Q52A 1KU3A 3LFEA 1UU9A 1XHAA 4J95A 3WF6A 3HGKA 4F7NA 2VKEA 2GNJA 4CT2A 2XF7A 3BY6A 4BCMA 4QPSA 2XPWA 5LHIA 1NHAA 2EFOA 3M42A 3QTIA 1IXRC 1JVPP 2H6CA 2CN5A 1D1AA 2R7SA 4W97A 2L7KA 1KV1A 5ANGA 3GWZA 1Q41A 5H8GA 2FQ3A 4JQ8A 3RNYA 4MXOA 3CJQB 2WQBA 3W55A 3AKLA 3ZBXA 4CMUA 2F4OB 1A35A 1UNLA 5JQ8A 3CMYA 3OW4A 5EDQA 2PMIA 3S1RJ 2GOMA 3UPZA 2VQHA 3QC9A 4UV9A 3OYLA 3TKIA 2ZM4A 1X1PA 5FDXA 1SC7A 5K3YA 4DHIB 5L8KA 5JHUA 3DBHB 4L18B 5FD6A 1CGPA 3HAMA 1PW2A 3OXZA 4O7SA 2H1KA 3GEQA 2QU5A 4A07A 4AW0A 5FB2A 4DIQA 4A0ZA 3CO7C 3QD3A 4CSVA 1X1CA 3KP7A 2EV0A 2HW6A 4WBOA 1O3TA 2R7FA 1JT0A 2I0VA 4EK8A 5AP2A 3FK6A 5C4LA 3R1YA 4E26A 3ZS5A 1OQYA 5AONA 1LDJA 4DDGA 4HVGA 3HHHA 4EZ7A 4XHKB 2CQXA 3HPGA 2A68F 4GVJA 4R6VA 4TY1A 5C8MA 1M7NA 2ACJA 3FPQA 3LQQA 4BCFA 4KRCA 5C8NA 3FZOA 3HSFA 4QP7A 4FV7A 4AC0A 1Y1WJ 3QODA 1YHSA 1QMZA 1FVTA 4H1MA 3F66A 4FKLA 5KHWA 4BQOA 4M73A 2EUFB 4MFEA 2F6CA 4CH7A 2KIFA 1G6NA 3LHJA 5CAVA 4YPDA 4JDJA 3QQKA 4E7WA 2WAQN 4OTWA 2Q1ZB 4ZS4A 5FKKA 3LFNA 2HDDA 5DNRA 4LB6B 3IGOA 4NCTA 1STCE 2X6OA 5K7FA 2Q8KA 2VT3A 5A6NA 4NKSA 1MNDA 4DFXE 3NUYA 4QPOA 3VN9A 3GC9A 3FZTA 4FGRA 3R8ZA 2UUZA 5LVPA 3HRFA 4HGLA 4XV9A 4G16A 1TC3C 3RAWA 5HORA 4C38A 3S1MJ 4H39A 2HU9A 3E6DA 1YTYA 2REIA 5CVGA 2OJ9A 3BR0A 5DLSA 3E7OA 2JUCA 1HLVA 3ORKA 2IWIA 1WI9A 2QR8A 4D7MA 2K9MA 2XNEA 1OCTC 4IX5A 1MDMA 1G5SA 3W6JB 4LLGF 3GU6A 5CSWA 3AOXA 5IY5H 2DYRH 1Z3YA 2UZOA 4FV5A 3RI1A 4PSWA 5K5XA 2XVDA 4IPAA 4RJ6A 3CMEI 5D6EA 1Y6IA 5GADJ 2IVUA 5I9YA 5EDPA 3PXQA 3JCUC 1M14A 3HV5A 2ESHA 2DOEA 2LREA 1T45A 2IVSA 3MH2A 1JKLA 1MD0A 4EEVA 2XSJC 2OGVA 3RWPA 2A69F 1I3AA 2Y0SN 3QWKA 4UUVA 1YOMA 5IEXA 3PIPF 4M0ZA 4LUDA 2XKEA 3DNEA 3G2FA 3O2MA 4DOZA 1XMKA 2UZNA 1S8NA 1ZRFA 4I24A 3ASNH 4W8DA 4EOJA 5J1WA 3OS1A 3B6CA 3DJ6A 2K5CA 4FSRA 1YLFA 1PMVA 3D5WA 2BYVE 4UYAA 3BLHA 4KN4X 3VBWA 4ZTNA 5LVNA 1LNWA 4XG4A 3U8WA 4MNEB 2VN9A 3EQPA 1DQUA 3ORXA 3R83A 3VS5A 4KDPA 3AC3A 5BNJA 3L2QA 4NIFB 2CO5A 4UX9A 3EZRA 3MW1A 3UVQA 3OL3A 4CG8A 3I9V2 1RUOA 2R3FA 4YIRX 3POOA 3WF9A 5FGKA 5CU3A 3R9RA 4YC3A 4B43A 2WELA 4HJOA 1Q3WA 3QTSA 3DCFA 1M17A 4IVDA 3CJNA 2CUFA 3I5UA 4KKGA 4GKHA 3VOEA 3EMGA 1XH6A 2AS5F 1H0VA 1MDMB 3Q5ZA 4XP3A 4IWQA 4YZCA 3W0NA 1NVSA 4A12A 2WV1A 3DEWA 2IW6A 2QKLB 3QCQA 4M9ZA 3NMUF 2DT6A 4Y8DA 3K70C 4I1ZA 3IRRA 3MDYA 3I64A 5K4IA 4F78A 1HA8A 4BKJA 3OYIA 5KNJA 5F20A 2VJJA 3BELA 5CJ9A 4DITA 1EA3A 3ASOH 4QP2A 2VBXA 4C2VA 5LOHA 3ULIA 4IQ6A 3GMEA 4KFCA 3K4LA 2KKOA 1H27A 1MMAA 1WBVA 1I44A 3SXRA 1FT9A 4YTCA 1GHCA 4CGAA 3EKKA 3DXNA 2EVAA 3LIJA 2BXZA 3GTLJ 3FI4A 2GNGA 2HXIA 3Q4CA 4PY1A 1MH3A 3VW6A 4DFBA 2R7ZJ 3DK6A 4BTFA 2VT2A 4BBFA 4ESBA 3MFSA 4GFBA 4L3JA 2QODA 3KK9A 1NK3P 3FXJA 5AADA 1Q8WA 5E1SA 4HVHA 4FC0A 3DU8A 2GIVA 1E3OC 4O27B 3QAME 4LGGA 5EYKA 1N25A 3OUNB 5TRDA 2DWBA 3L2UA 4CTCA 5CYVA 2DN0A 5IQAA 5K1YA 2Z99A 4AACA 1VQNI 5AMNA 2K3PA 4UVAA 3OXIA 2WOTA 3M9AA 5LEKA 2XRWA 1IN7A 2HY81 2KRHA 3FZPA 2FYSA 3I5ZA 3QTXA 4WUNA 2WNTA 3A7IA 4XG6A 4U40A 3R7EA 3T8RA 4KT5C 2R7OA 4XICA 4EL9A 2JZYA 4E73A 1H4LA 5FDPA 1Y6BA 4LI5A 4I93A 5IUHA 5CEIA 4D0PA 4ZSJA 4D2RA 4AFEA 2KHMA 2L9RA 2C6YA 2P6TA 2VJ4A 3U4UA 2GNIA 4NM0A 4CO8A 4FG9A 2IG7A 1WCMJ 5CVFA 3FDYA 3TEIA 3OIQA 3QBNA 2XNNA 2BZTA 4FZAB 3J80K 3GUBA 1U8BA 2QO9A 3R8LA 4TYJA 5EI8A 4O21A 3VFZA 3ZFMA 2J5OA 4G6NA 5LMKC 1RETA 2WQEA 5HE1A 1BLXA 2C5NA 1FP2A 3F5GA 4N4SA 3BZCA 4G94A 4ACGA 4GGGA 5AX9A 2Z2SB 1R36A 5DVRA 2F5EA 4PDYA 2XAUA 1VZOA 3FYJX 5LMBA 4BF2A 3O8TA 1RW8A 2CNUA 1FBNA 5KO1A 5DEWA 1MMGA 4NW6A 3V5QA 2DFFA 3PM1A 5IQFA 4IL6C 1JQHA 4ANQA 3UNJA 3ZMVA 4F1OA 3BJOA 4BDHA 4NB5A 3FDNA 2XASA 1SD5A 4A06A 3I5NA 3EQGA 3ZPLA 1E17A 3SZGA 2VJ5A 2DU9A 2C6MA 4BTJA 1DU6A 1XH4A 2OBPA 3NWTA 3F5PA 3FF5A 1PYVA 2I7QA 4HPQA 3PVUA 1X4OA 2E60A 4JOAA 2HNHA 2IGOA 4K2RA 2QKRA 4U3ZA 4GJ3A 3DZQA 1O6KA 4G8XA 4ZYDA 5JLXA 4Q9ZA 3CUOA 4XKBA 3BPVA 4BDBA 3R9NA 3OWLA 1JUPA 5DG5A 3HRMA 2WTIA 4O7RA 4EKKA 4HLXA 1TL8A 4AX8A 3MFTA 5M57A 3GUDA 4QO9A 4MBLA 3D5VA 4JIAA 5BOXA 3ZRMA 4N0BA 5IDPA 3AC8A 2QO7A 5FBNC 3ORLA 2BV6A 3ZONA 5CU2A 4AN3A 5A2QZ 4IC7A 2JFLA 1FJLA 2BUJA 1UWJA 4P5ZA 3EQDA 3ZRKA 4B9DA 3LJ1A 2ZFUA 2ZNYA 2LBFA 3MS9A 3ORPA 4OTIA 2WQMA 2G01A 2F7EE 1ZYLA 3R6XA 1CDKA 4L68A 5ANIA 2CKOA 3SQNA 3HEFA 4IIRA 3V51A 4AZEA 2LF8A 3EFKA 1NW1A 5AIKA 1LUFA 2BRHA 2X0LA 4XOTA 2NYAA 4LV8A 1SD6A 4U97A 1A04A 2PSQA 3C1DA 3CJTB 4RGXA 3ZQLA 2VKHA 1NY3A 4U44A 3TV6A 5DV5A 4U42A 3HUBA 1HSTA 1J91A 3QZHA 4DEBA 2XBAA 4AU7A 1XWSA 4XR6A 4BDFA 3A8WA 3TDWA 4RC4A 3G6GA 3NPCA 1LPUA 1MBFA 5ETIA 4UB7A 2OZOA 4KN7X 3UC4A 2M8GX 1SZMA 4QDEA 4TNBA 2XB7A 4I99C 4DGWB 2VL8A 3WF8A 2R7WA 1TWCJ 2M0CA 1FSEA 4DE4A 4DTKA 2IXSA 2BZJA 3F3WA 3R1NA 3PG1A 4JVGA 5AIPA 2LP0A 4M68A 4E4NA 3E5AA 4FETA 5DA3A 1ZELA 2MC4A 1GXQA 5I9XA 2C0OA 4BIEA 5C8KA 3FM3A 2G9WA 2A27A 4E93A 2L5QA 3G2BA 3UIXA 4I0RA 3M8FA 2RNJA 3HC7A 2LBFB 5E1EA 3JSPA 5M56A 2RFSA 4QYHA 1I1SA 3MD2A 1P2FA 2R2PA 3KRXA 4OT5A 3H9QA 4YELA 3QOPA 2O8XA 2EIMH 2Z3YA 1XMAA 2W84A 3QFVA 5BVDA 2EB3A 4DFUA 3H92A 5D8KB 3WIKA 4NM7A 3BLYA 2R3LA 3BGZA 3BYUA 1I27A 1SAUA 1FVRA 2JN6A 1N75A 2BY3A 2Y31A 4FE4A 2X4FA 4O0TA 4HQMA 5JT2A 3E5QA 2JDVA 1OL2A 2Z33A 1WMKA 5LGNA 4B8LA 3RJPA 2G7UA 3BHUA 1ZK8A 5GHVA 2TDXA 3OL4A 3SW7A 4EYJA 3R8VA 3J80Z 4FTKA 3WI6A 3C4XA 2DCEA 5B2KA 3VJNA 3CUQC 2C6EA 3SGCA 3O0GA 2VWYA 1GY3A 3ZP5A 2FUG2 3CMMA 4TWOA 1O6LA 4P9FA 2QKWB 2H96A 4CKRA 3UNGC 2WAQA 4O6LA 4H3QA 2NS8A 5CANA 3IW8A 2B63J 3IP4B 3CGOA 4AYBN 1U0JA 1UJ8A 3CEKA 4A6DA 2FMYA 3NAYA 2MBFA 2H6BA 4WRSA 1WJFA 4OTGA 3G71I 5IUIA 4UB6C 1CMKE 3PL8A 5BMSA 3ZUVA 2OQGA 4E6AA 2W5BA 1OKRA 4PL5A 4UBAA 2Z2WA 4YJNA 2ACXA 5E8UA 3R61A 5FFZA 4GYIA 2GHMA 4LG4A 4RS8A 2IP2A 2DO7A 3AC1A 3PA4A 4F9WA 4AZVA 1MBEA 2R7IA 4MBJA 4ENYA 4DH3A 5CTPA 2P81A 1KU9A 2EXCX 3LSPA 3C2GA 2PHKA 4S04A 3JVRA 4EH4A 1XMXA 4PFOA 3EKNA 2WD1A 4YLJA 3SC1A 3BI6A 4IVAA 3QAHA 1W4MA 1EJ9A 5LARA 4GT3A 1YXTA 1MQ4A 4I21A 3FSFA 4ENKA 2QQ9A 4PDSA 5C4XJ 3VSLA 4TXCA 2XA4A 1LFUP 2OZAA 4F70A 4I4FA 5DGZA 5FTQA 1S5LC 4IAIA 2C47A 1FTZA 4PGHA 3L9NA 2R7BA 5IF1A 3GQIA 2Y0SA 4MKCA 3N97A 2KPMA 1WQ2A 1FEXA 3QRIA 5D10A 4ASXA 4O2PA 1NVRA 3BGQA 4RB0A 3IDCA 3ZM4A 3CUQA 1LDDA 3RPVA 3ZGKA 3GC7A 1E0EA 2HAKA 3QPLA 2DK5A 1Q5KA 1H88C 4P55A 4U79A 3WZUA 2HOSA 3TQNA 3BPXA 1XBBA 1Z05A 2GOXB 2HZ4A 2O3FA 3GTMJ 1DPRA 5IQCA 4MO7A 1WVYA 3AT3A 4KMUX 1R5ID 5HG7A 3K4BA 2HWOA 2FU4A 3OIOA 4OAZA 4HX7A 5B3SH 2FNAA 2ITQA 1WJEA 2P2HA 3PDTA 3WTSC 2CV1A 1YOLA 5D7AA 1BC7C 2BCJA 3UIBA 2OTLI 5HVQC 4L5IA 3MKZA 2CKEA 3M3YJ 4YZDA 2PE2A 4KS8A 3KB7A 2K9SA 2HZIA 3LNQA 1BUHA 3KMUA 3FC2A 4BTMA 2M4KA 2ZXHA 1OI9A 2WC2A 4NDLA 3PUPA 3CCQI 2X6XA 2W24A 5DBXA 1IF1A 5F4NA 1E1VA 4L52A 1GIIA 4M9XA 1APME 2PE0A 3HGYA 2UW5A 5IP9J 4R1VA 1Q97A 4JRVA 4AZTA 1BI1A 2JITA 1DI8A 3Q2JA 4Y46A 3W0QA 1BIAA 4ALUA 4II2A 4D5HA 3HUGA 4O0XA 4A3BJ 2LNBA 3RK7A 5E8XA 1Z67A 4EJVA 2RV8A 2AO9A 2IN6A 3DPKA 5M06A 3CTHA 3M4OJ 3QWJA 3CUQB 3DEEA 1BI8A 2LVSA 3OYHA 3KP4A 3MV5A 1H24A 5J1VA 3W18A 5TKDA 3R7IA 3NNXA 3CTQA 2EA4A 2HVQA 3NAXA 1YE9A 3Q6UA 5FLVA 3QRUA 3U51A 2OXDA 4P90A 3PWYA 1TT0A 3QP5A 1ST4A 4JYKA 5CXHA 3DAEA 3IRQA 2ZOQA 1D0ZA 3GCVA 2UZDA 4NC8A 4AUXA 5K5OA 1OR7A 5D9HA 5FXSA 4X6QC 4EBVA 4HG2A 3R04A 4DEEA 3LFSA 4E7JA 5HD7A 5IQIA 1BL7A 3IK3A 2H8RA 5CX9A 2RG5A 1GOLA 5FUTA 5EI2A 1QPMA 1NH3A 5LD2C 5BUIA 5GPCA 1IAJA 5CEPA 3LCDA 3SXFA 4RRVA 2Y30A 4XORA 3G90X 2GSFA 1PDNC 3DPLC 4FCYA 2GZWA 1HF0A 3QUEA 1UHWA 4O38A 4D5CA 5JHFA 1FBUA 5J87A 1YS7A 5C4JJ 2HQAA 2E2HJ 1KSWA 3PO3J 4LLLA 2CGWA 1XG1A 3K0LA 2IO6A 2I0YA 4FIFA 1OCRH 4ANSA 4BGHA 1HQCA 3QYFA 3HUGB 2XIXA 4RIYA 4GK2A 3S3OA 1ZYSA 2HOGA 4A3KJ 3BU6A 1R3CA 3BR1A 4ZTJA 1KQ8A 3O7LB 2V62A 1D5YA 3H9JA 1IRXA 2QKMB 2G9XA 3KVXA 2XUBA 2FSOX 4XRLA 3VUGA 1SANA 1PMUA 4KKHA 3D2KA 4YBJA 3Q9ZA 3R00A 3BG6A 2X85A 3MKWB 3ZHPC 1OBDA 3WU0A 3R22A 4YZMA 4GVAA 1QCFA 1G3YA 3PZHA 2VPLA 1J0RA 3OYMA 3LLAA 5GTHC 3T9IA 4APCA 4GFOA 3WTXC 5JZNA 2XYUA 4YJTA 4E70A 4MH7A 2E9UA 4CV9A 5HLPA 2IS2A 2MH9A 1OGYA 2HDCA 3OY1A 2XIGA 4AXDA 3BEAA 3NW7A 4GFMA 3WOWA 3D5LA 1YW7A 2AQFA 4YNEA 4BE0A 4FTCA 1BX6A 4AIKA 5HX6A 1TP4A 2DOFA 3OWPA 1Q8TA 5L2IA 2M87A 5IZFA 3V4GA 4JQ7A 3LCKA 2OLCA 5E3LA 3RWQA 4RA4A 2JPCA 2YA9A 3LCSA 1S9JA 5L3GA 3EFLA 3R21A 3ZU7A 1WZ2A 4PMTA 4ZYAA 4X3FA 4C34A 3FMHA 2ZM3A 5KMKA 2BIKB 2OK1A 3LFCA 4U7DA 3FQHA 4AXFA 4J8MA 4EH9A 3BU5A 3VBTA 5CQWA 4G9RA 1G8JA 4YIFA 2YN8A 4H58A 4RIYB 5JH6A 3GCQA 4Y5QA 3D83A 4RA2A 3FXUA 3GCUA 4P5OA 1AA7A 4C3PA 3H0DA 3T8TA 4P4CA 1OMWA 1A36A 3KRWA 3PXYA 2CDZA 3P1AA 4RIWA 3KIOC 1XH7A 3KXHA 2J90A 2K27A 2VIXA 2GBYA 3OZ6A 4CFXA 4CCOA 3FMMA 5IA3A 1JHHA 3BHYA 4BCKA 2UW7A 4DN5A 2YR2A 5LJJA 3TWJA 4CFFA 2V7FA 2XAGA 1M2PA 1TNTA 5EDRA 4PMPA 4IRGA 2PVRA 2OF4A 2COMA 2O8YA 1LPQA 1OB3A 1MMSA 2LMDA 4GKIA 2BY0A 4ZC3A 5C9CA 4G6QA 2ONLC 3AD4A 3D2IA 3PA3A 3OYNA 3EFWA 3AL0C 4EOLA 3E6CC 4OGRA 3H5AA 3E6MA 4BHNA 1G2HA 2L7FP 1VQKI 2WMBA 5IT9K 4I94A 2DODA 3Q3BA 1PF8A 4V05A 5J7HA 3CCNA 2LH9A 2OZ6A 5DPVA 4C33A 1MP8A 4ITIA 1J7UA 3BV3A 3E62A 2GXAA 3RVGA 3ZMDA 3S95A 4YZBA 3NYVA 1YI4A 3QYBA 4DDIA 4XP2A 2QUFA 4RX8A 4C3FA 3NGAA 3QKLA 3LJ0A 4ZP5A 4RIWB 3KIOA 3L09A 5L3DA 3T1BA 2OIBA 2V6EA 4ESJA 1EH7A 3GBGA 1QHHD 4LFUA 4NTSA 4B0GA 1H25A 1X19A 3GLLA 3OUKA 4N9IA 2XM8A 2LKXA 2XAOA 5KBQA 3K6GA 4PTEA 3P9KA 4ZZNA 5J1UA 1J3HA 2NRAC 3L2CA 1IAWA 3OG7A 4II5A 4FTIA 5E18F 1S9HA 3ABKH 5CLPA 2OA4A 5C26A 4YC8A 4A9RA 2F57A 2FA5A 2R3KA 3RGFA 4RZWA 1OKZA 5JEBA 4XS2A 2FSMX 2VO7A 3IC7A 4E6KG 3RKQA 3QF9A 4RG0A 2XGXA 4IHVA 1SMHA 4PJNA 2ONLA 2UVYA 1WPKA 3HA8A 3A0HC 4WNOA 4M74A 3AD5A 2HYJA 3ZQGA 1Z7UA 5HOOA 4M72A 2W1IA 3OYKA 5KUPA 3H9GA 1WH7A 1VLRA 2KRFA 3FMRA 4LGHA 4FODA 4M3GA 4QTBA 1K61A 5B0XA 3ZMZA 3ACKA 2WKMA 1TWHJ 3LJ2A 4G17A 2JDRA 3I4MJ 5E3MA 4V19K 3DU5A 3LFBA 4XBUA 3GOPA 2ZDUA 5EZHA 3ROCA 3V5JA 2DMPA 5GPAA 1ZYDA 3QPSA 2W0JA 3I53A 4RB1A 3AC5A 1RESA 3NNUA 1YHWA 2OJJA 4AF3A 3AKJA 3PLAE 1TVOA 5KMJA 3UDSA 1R5GA 3JXWA 3D5UA 3K54A 4DYMA 4I6QA 4FIIA 3LWFA 1OKYA 3NUUA 4X2JA 3BT9A 2GM4A 2ZMEC 1POGA 3WHCA 3UO6A 4F0FA 1WI3A 1CM8A 2W4JA 3ODZX 5E1ZB 2XKFA 4KS7A 3O17A 3JUHA 4YHFA 1GV2A 3FKIJ 3AMAA 3WTTC 2K40A 5KKRC 4I5HA 3C3WA 4RVTA 1R0EA 3FL5A 1QVUA 4M9SA 2XEZA 3AQVA 1GAGA 2WU7A 2C0TA 2VGOA 5GIPE 4FX0A 5JFRA 3JRAA 2CQQA 3KEQA 2ERZE 4DBXA 3ZO1A 5FM3A 1XGMA 4XYFA 5CEQA 4CDGA 2XAQA 4O3MA 2OFVA 4YBKA 4F3QA 3AL0B 3U9CA 3FMNA 4XLHA 2OF7A 4YRVA 4RVLA 5JRSA 4ZDOA 5IU2A 3A4PA 3RK9A 2LR8A 4J96A 5HIBA 2M45A 2OCCH 2ID6A 2V9VA 4MD9E 1Q1HA 4XKWA 3LQRA 1UELB 3ALNA 4R78A 2VWBA 2R0IA 1SFKA 3C4WA 3QALE 3E6BA 2B4SB 4IW0A 4DH8A 2WU6A 4KB8A 3MBLA 4DYRA 4B44A 3NDMA 5EK7A 4EM2A 4FOCA 2R64A 3MVPA 1VQMI 3KXGA 4JI9A 3ENMA 1XB4A 3A2CA 3DDQA 5J1RA 4GEOA 2LAVA 3T3VA 2HFHA 2ZMEA 3E5UA 3RSNA 4KSPA 3RZOJ 2RFDA 2YM5A 4U9AA 3HJEA 3F6XA 2HZDA 4JG6A 3PQKA 4L7SA 2J9MA 3DPTA 2GXBA 2W05A 2XRUA 1JUSA 2P5VA 5IT9Z 4L9JA 4EC9A 1WSUA 2P6SA 4DG3E 1UV5A 3MKLA 4IZZA 5E8GA 4LB5A 3BE9A 4MK0A 4XUFA 4IF4A 3GLXA 3N4MA 1LP4A 1Y56A 2WEVA 4Z55A 4CYCA 3IKVA 2RKHA 5JZJA 3BR5A 2UZLA 5AP3A 3VUKA 5ICFA 1FZPB 3W0SA 4I23A 2WXVA 2YM3A 4YJUA 3ZXTA 2QYOA 3QX2A 4RM2A 3BCAA 5DR6A 1F1ZA 5L3BA 1USSA 2GDOA 4FIHA 4B47A 5E90A 2YCFA 4E5WA 5KHDA 3F23A 5IEVA 2C5OA 3E92A 4UWBA 2PWLA 2UZKA 3IH3A 3C2BA 3EPZA 3S17J 3ID6C 4YJPA 4ASEA 2VTQA 1UG2A 3GTKJ 1Y8YA 3U1KA 2DA3A 4ZTMA 4LJZF 2F4IA 3OP5A 2F4JA 4BYYA 1JJ6C 1XDUA 4FZ6A 4A5MA 5H6RA 3ORTA 1JXSA 3NVMB 2X1NA 4MQVA 5HESA 4XV2A 3KRRA 5J5SA 2BZHB 1JSTA 2HQRA 2QQBA 4PWNA 5CVRA 3A03A 4UV0A 1BJZA 3OF0A 3KEYA 4CCBA 2Y9YA 1WFCA 1FOXA 3PP0A 5ERIA 2BEOA 3GTPJ 2XK7A 4BKXA 3PYYA 2XAMA 4UVBA 2X9FA 2ZMEB 5AUWA 3RZBA 3EQLF 3PIYA 3HSEA 4TTHB 4OOIA 4BHZA 4X2FA 2HOAA 2K85A 2H09A 2M8EA 5KKRB 4AA0A 5D4RA 4F7ZA 4ZAUA 1ST0A 2PMZN 1Y57A 4BBRJ 2F5FA 5BV3A 5M51A 4CYCB 3VS2A 2HK5A 2XKDA 3IKTA 3WF5A 3DBRB 3K4KA 3LAUA 5EQPA 4RBOA 3ENHA 3VYSB 1V0BA 5CU0A 4CGZA 3Q32A 5H8BA 2ITWA 3IH2A 2UZUE 3GF2A 2FSTX 4E4XA 3E8NA 1PXMA 1IGNA 3H35A 3GCSA 1XSXA 2K7LA 4CVAA 2HOEA 5CEKA 4B6LA 1BOAA 2PJRA 5HE3A 1ZRZA 4S32A 5IA2A 4M69B 4UUSA 3GZ6A 4IHXA 2EU9A 3HOXJ 2GS7A 2DI3A 3MFRA 4CCKA 3FV8A 1TWFJ 4QYYA 5L3EA 1Z91A 1WVWA 2IS4A 4IX6A 4I6LA 1HC8A 4AIHA 4A9YA 4RLKA 2Y9QA 3QZFA 2VOPA 1FMWA 5J8CA 5TR6A 3L9LA 3MGYA 5CY3A 4XK4A 4ZMEA 4L43A 3R6SA 3OT3A 4WF2A 2PG4A 2OG8A 3UG2A 1H8AC 4OAYA 2M4GA 2CS3A 4BZNA 2UZTA 3FEGA 3ECHA 2VQLA 5FKLA 3OYFA 4BCGA 3OS3A 5HIEA 3FXXA 2YIRA 4FIGA 2ZVAA 2ITTA 3TW7A 3RI4A 3ZSGA 2E34A 4FOBA 3P9JA 3DTIA 2V7AA 2HY0A 4DLIA 5FD2A 4ASDA 4M13A 4J99A 3N9XA 3ONQA 3W2OA 4Y13A 4QNAA 1PMEA 5JN2A 4L5EA 3Q96A 4QYGA 4HNUA 2PZIA 2Y7JA 1OYYA 4FE7A 5E4HA 5EYDA 3R9DA 2ZV8A 4KAOA 3FYKX 3QGYA 4WK8F 3L2WA 3JY0A 4EOSA 4ZZLA 4O7YA 2OWBA 3BG7A 2D45A 2ZDTA 3VF9A 3L1SA 4RGJA 2XB0X 3OY9A 3GC8A 4EWHA 2CGXA 1U5RA 4NK9A 3O6BB 5DFPA 2BAQA 3C4FA 1JTYA 4WSYA 3ANRA 3ZQCA 3DS6A 4LOOA 4BCNA 2PJRB 3MSSA 2OAZA 4UN0C 4UUSB 3SKCA 3AAFA 1HOMA 2V6CA 2HVSA 2WWYA 3WBLA 4BZDA 2L3DA 3EUAA 2K3FA 3IONA 3IS5A 4TYHA 4AD9A 1P4OA 4UZHA 3HX4A 5M4CA 5LEJA 3DZOA 1Q1VA 2MD0A 4LIVA 3DKGA 4MQ9F 1BJAA 5BVWA 3ODYX 3M1EA 4FISA 3I0OA 5B5EC 3HGGA 4PSXA 4X2NA 5D5VB 1JNKA 3H3UA 1URCA 3R71A 1Q99A 4MXCA 3BR2A 1FPQA 5FEQA 4O7VA 3FJQE 2CFOA 2PUIA 2WZJA 3FKLA 2R4GA 1YXUA 2E2BA 1XDSA 2OJIA 5CASA 3HTSB 4H0EA 3D7ZA 4DBNA 3VS0A 1HKSA 3KXZA 2I40A 4YLKA 3R1QA 4U7ZA 1B9MA 4ZEGA 1KWPA 3S4QA 3O50A 2EA2A 2YDJA 4I92A 2PEXA 3ERED 3CD6I 2WTVA 3GFMA 5K5NA 4JX6A 2W1CA 3HOSA 4IOCF 2DT5A 3K1NA 4AN9A 5FROA 2V1DA 5F95A 3AG9A 5ANDA 5AUYA 4BEHA 4OTHA 3KYCB 2IBDA 1D8JA 4IHPA 3MJ2A 3THBA 3MZ8A 1TT5B 2V22A 2J0KA 4ZTSA 5TOZA 3BG5A 3PTGA 2CHLA 3F8CA 5CU6A 3V8LA 3KE2A 4EGYA 2YM7A 3SXSA 4Q5SF 4C61A 3BX5A 3QQAA 5IQBA 3CJGA 1EH6A 1UKIA 4MD8E 5EH0A 3BJAA 1O9UA 3I59A 3ERMA 3CDLA 4F65A 4ZZMA 4HF1A 2C30A 1M2QA 4J01A 1FY7A 3VYTB 5AEPA 5CVIA 3DWLE 1J2XA 3WILA 1P4XA 2YHVA 4NM3A 3CKWA 3VHEA 1K3AA 2EFWA 1IDYA 3HLLA 2VN2A 5JK3A 2Y8OA 4EOKA 3I4PA 2EINH 2KL4A 3DNDA 1GLNA 4DH1A 3UNZA 4BB4A 4AT4A 4AT5A 3QXOA 4IZ5A 5F64A 2YM4A 4L3PA 2QG7A 3E97A 2JRMA 3ZFXA 2GQRA 1YHVA 2YIXA 4EQQA 3FQEA 5EG0A 4B8MA 5DDGA 2V9PA 3FBNB 3FLZA 2ITNA 3B8RA 4K18A 3Q04A 2V5QA 1UU3A 1H07A 4ZIMA 3EETA 3MY0A 3QHRA 2FNPA 2H8WA 5FFXA 3HOUJ 4BEHB 4GU6A 3IW7A 2D1HA 3IAM2 2DLLA 2IZRA 4P5QA 3SZPA 2K86A 1YFHA 4L8MA 3QD4A 4O83A 3PPZA 3WODF 1LVAA 2E5NA 2NPQA 1ZGJA 5ANEA 2IVTA 2ESMA 2PPQA 3NFFB 2HS5A 1VZ0A 5AP0A 2K02A 2DYLA 5AA9A 2P7VB 1QBJA 3Q53A 4FUXA 4OR5A 4PP9A 3DJ7A 3PVGA 3FY0A 3SW4A 1DS5A 3V6SA 3GQLA 2E2JJ 3I59B 3CC4I 3CJFA 3R0JA 3RPSA 5G1XA 3RK5A 2CCIA 1E2XA 4FBXA 1ZR2A 2BTSA 3NUAA 5M44A 2XAHA 1H1QA 2E1OA 2GMXA 2OJGA 1HCRA 1V5EA 4WG4A 3BZ6A 3MZHA 1OUYA 4RWKA 3ML6A 2VTLA 2ZO4A 2RFNA 4IJAA 4ITVA 1VQ6I 3ZMSA 1ZQ3P 2BKZA 3MPTA 4NUSA 2EXMA 3U87A 2ZXJA 5L2SA 2UZEA 3CS9A 1EKEA 3OYDA 3TNQB 2BVMA 4NFMA 4FK3A 2EIJH 3VRZA 1MBJA 4PNKA 2IZTA 5EG0B 4MFDA 1ACIA 1Z57A 4E7LA 4O0VA 4CCUA 6PAXA 1YQJA 5TF9A 2MC3A 2Z5UA 3F0CA 4S2ZA 5BYYA 4RAZA 5E8TA 1OYIA 2H94A 2PMNX 3KMMA 3DFAA 3J7AY 2EZLA 2BALA 2L9SA 1BR2A 4QMYA 3MB6A 2VKVA 4FHTA 3ZUTA 3DF8A 4FV0A 4FV8A 3UTOA 4PL3A 4IANA 2YERA 2ELKA 4XEYA 5ILVA 3WARA 4AXAA 1Z6TA 2QCOA 2EB7A 5J95A 3VJOA 4O2ZA 4UEUA 4HZSA 2CV0A 5IH6A 4BGQA 1B72A 5LRRA 4JG8A 4MAOA 3CP2A 4F6SA 3KN6A 1MSEC 5CVHA 2MG4A 5AV3A 3SZTA 4NFNA 4YFXF 1CKJA 3HV4A 1R1UA 3RPUD 4IACA 4KITB 3PA5A 5A4TA 1O6YA 5CKTA 5HBEA 4O7NA 2A6HF 5FEDA 3TM0A 2DPUA 2HR3A 4B3AA 4JX5A 4C4HA 1R00A 3AG2H 4HRIA 3E0JB 1A6IA 4CHUA 4GT4A 2HZNA 4MUQA 4DZPA 4QQCA 3FZVA 5IPAA 3HAVA 3TOAA 2OV7A 4E6DA 5LFAA 3PO2J 3VB2A 2R9SA 3QU0A 4UXNA 1YS6A 3F2AA 5L3AA 3NARA 4WO5A 3ZTXA 4IHWA 3F2RA 5AUVA 1R22A 3SLSA 4TW9A 3VWBA 3CD3A 3H4JA 3OYGA 5EDNA 2PZ5A 4ZS0A 3GBZA 3IDBA 5ETAA 1OPLA 3DKOA 3ZEWA 1OPJA 4FKOA 3VQHA 3A1YA 3QTQA 1PJKA 2IGNA 1AQ1A 3V7SA 4IAZA 3NNWA 1Z21A 1MBHA 1S3JA 3QKKA 2TCTA 4O22A 2WY8Q 2VNYA 1VNDA 3L8VA 3IQ7A 1T0FA 3G0FA 2Z7QA 3QCYA 2HVRA 3V6RA 3VUMA 3W2PA 3RNIA 4AWXB 1V5GA 3RQIA 3MWMA 3BYOA 4DFLA 1JJ8C 3DLAA 1R39A 3EL7A 2PMZA 1B72B 2M30A 4KINA 5JR3A 2QF7A 1G8XA 2L9VA 1NTCA 2K9QA 3O2PE 2LLKA 1LEZA 4BC6A 1M1EB 2HWVA 2PN6A 4BDJA 1S7EA 2O0YA 3Q9YA 4CLJA 2ITZA 3PJ1A 2C6LA 5CNOA 3FSKA 4FSYA 4XN3A 1SVEA 4GG7A 4W1UA 2PZYA 4NT4A 4FT7A 3N05A 4L46A 4A2UA 3ITZA 2QO2A 1D0XA 4I22A 2JBOA 2WQNA 1RE8A 4PMSA 4EJWA 2NNNA 3WZJA 2E71A 4AFJA 2OPTA 1GVDA 5T68A 4O82A 3KGAA 5IH5A 3NQOA 2STWA 2LFBA 4RGRA 5J8IA 2NP8A 3MTFA 2XGEA 5K5RA 3QC4A 1Z7LA 5E8VA 1VQPI 1DGWY 3MTLA 3VQUA 1WKMA 4TYGA 3RKWA 3TP0A 4C4GA 1LQ1A 1T08B 1LE8A 5E91A 1FGKA 5ICEA 3VBVA 2W9FB 4R1HA 3DCVA 2QHNA 3MJ1A 3KXXA 1IN4A 4DHZA 2CW7A 2JDTA 2MW8A 2XDVA 2GLOA 4X6AJ 4GK4A 3OMYA 3TKHA 3CCSI 3FC1X 5EHLA 1WVRA 4OIRF 3P86A 4CZUA 4IHTA 3CTAA 3I1AA 2X7GA 2XPVA 4EOQA 2OO8X 2XNPA 4JBQA 3IWFA 4G3EA 2R7DA 4P9UA 1TWAJ 3ERKA 1YXXA 4OBOA 4W4WA 1IAHA 4AA5A 4YSMA 5CZIA 3ZXSA 2JMWA 1UWHA 3VVHA 4AE9A 5BYLA 3E7LA 3SYTA 4QQTA 2XM9A 2IRFG 4IZ7A 3KZZA 4KRDA 4XRJA 2CQKA 4G7OF 3CQUA 1PYEA 2Y6OA 1UCRA 2YM6A 1TQMA 3CJRB 1R0PA 3E3VA 2VJIA 3ZN1A 4R8HA 2B0LA 1Q61A 4DYQA 4FV4A 3VRYA 3DY7A 3MI9A 5C01A 1J59A 4F0IA 4HV6A 4AS0A 4FMQA 2CUEA 4BICA 3KCFA 3G0EA 5CEMA 2V79A 2CYYA 2VX1A 4YO4A 2C3KA 4F9AA 4DJAA 5DOSA 2Z7RA 4D5FA 4M3QA 4U8ZA 1LE8B 3S1QJ 1J1BA 4XMOA 2R3IA 2YIYA 1W82A 3U4WA 5HO7A 3TO6A 4U41A 1O3RA 2BVLA 5H9BA 3UYSA 2FB8A 5LXMA 3JTHA 1MJAA 3PSIA 4EH5A 1UNHA 4LQMA 4XLAA 2L54A 3C0HA 4PDPA 5HTCA 1YOVB 2B9JA 1BI3A 1E3PA 3GTGJ 4Q2AA 3S00A 4RDUA 3DA6A 1MSFC 4FJVA 1Z0XA 1W36D 4RFYA 4WWCA 2BY1A 1OFCX 1JI8A 1U6GA 2Q0BA 4FSWA 1UKHA 1RIOH 5ANJA 3QU6A 3I7CA 4W4YA 4RA5A 1WJAA 2UVZA 3UBDA 3S93A 2KDZA 1XBAA 2H8HA 4WHZA 5EM8A 1QO0D 4GU9A 4HQEA 3IOKA 2QOLA 4IWPA 4FVRA 4QMZA 4K8AA 1TFFA 3SD0A 2WMUA 4ZJJA 4KIBA 4GCVA 3LFAA 3BE2A 4PK4A 3OWKA 4AUAA 3GT8A 3SOAA 4FV6A 3HP2A 4CFWA 5G6VA 4O7ZA 1IUFA 3GNIB 4EHVA 2UXNA 4PDOA 1OPKA 1ZTRA 2ETRA 3KN5A 4LRKA 3V5TA 3F6OA 3ORNA 4E4MA 2D2WA 4Q47A 3DBFA 2VXZA 3PWDA 5ILUA 1TKIA 5IYCJ 4J7BA 4EQCA 3HL2A 4FTJA 4AA4A 3OOPA 2VQCA 3PQJA 3TOBA 4AXCA 2E9PA 3VO3A 3HDDA 2CGUA 5DT0A 5HQ0A 3W6VA 2GU8A 2JVGA 4E20A 2R3HA 2HELA 4ITHA 2GA2A 4IB5A 2DJNA 3DKYA 4CCMA 1WCCA 5AIRA 1DM2A 3C0IA 1IC8A 5M4FA 3FM5A 1KGSA 1VQLI 5CALA 4JAIA 3B73A 4GDFA 3DXPA 5FKNA 3ANQA 1VR2A 4BJJA 2C68A 3HHGA 2X4HA 4NNJA 2OD5A 4QDVA 3F3XA 1CQTA 3ABUA 4I76A 3W0MA 3W2WA 3UDTA 1R71A 2Y4IC 1U2WA 2DPDA 3LA7A 4DBRA 2BBYA 3MH0A 3OEZA 4WUAA 5HCXA 2QOHA 2WV0A 5DEQA 4KNBA 3VF8A 4I6HA 1IG7A 5IA4A 2ESNA 3C51A 5LVOA 4QTDA 2XNBA 5CVVA 4DT8A 4EZ5A 2JSCA 2CKQA 1VQ5I 5DCMA 3C18A 4QTRA 2ELJA 4EATA 3GTQJ 1U78A 4RJ5A 4JAJA 4HLYA 3NUXA 2DYSH 5HI2A 4D0WA 1W7PA 3FHRA 3M8JA 2VX0A 2PUUA 4TN6A 2VOOA 3EQRA 1B4AA 1T98A 2OQRA 2O0UA 1DUXC 2VONA 4G6OA 4L7FA 4FK6A 1ODDA 1WBNA 4ZTHA 4DBQA 2VO0A 4IAYA 2VTIA 2WAEA 3FI3A 2JA8J 4NTTA 2P8TA 3ORZA 2ME0A 4JX3A 3TUCA 3AG4H 1T8IA 3HMIA 2FVDA 4AW2A 3BZKA 3K2ZA 4HA8A 3L2VA 3HZJA 3CO6C 2QOIA 4FSZA 4IC8A 2PE1A 1G3TA 2IT0A 1Z9XA 3V8WA 1JWHA 3ZZWA 4DHJA 5BVFA 2WADA 4QMLA 1GZOA 3IV5A 2XROA 3KC3A 2XF6A 2W17A 3QQFA 1CKIA 3K5VA 4G3FA 4BCQA 3I0TA 2JA7J 4NH1A 4BJJB 2KJCA 4EKLA 2FMLA 4Y5HA 5KMMA 2VWVA 2OCEA 5L6WL 3U6HA 3FXKA 3MN2A 1S6LA 5DE2A 2NVYJ 3TI1A 4C58A 3OD6X 3VBQA 2ICWG 2VE9A 3O8GA 3FMSA 3K4MA 2MGQA 2ERKA 1RDQE 1FNNA 1IA9A 2JIVA 1R1WA 1KZHA 4DH7A 2NNWB 4KICA 4MNUA 5CSPA 5CVUA 1PYXA 1W1WE 3L9FA 3A8XA 1GV5A 3ZO4A 5DCFA 2UV1A 2PVJA 3MZYA 3COKA 4J71A 5EG3A 1OECA 3I58A 3QLGA 3AG3H 1K79A 3MVHA 5DCMB 3EJ1A 3DTWA 4R3RA 5E17F 4XOPA 4ZMFA 3HPHA 4Q9SA 1YKRA 3V7RA 2HCKA 1W7PB 4EORA 1ENHA 4PNIA 5AJQA 3RDIA 4HF2A 5M4UA 2ZFYA 3OBGA 1R4NB 1APLC 2BHYA 2VTSA 3BQCA 3OYEA 3CCUI 3LM5A 3F69A 3L9PA 4N4NB 3P0MA 4XKVA 1JBPE 4NU1A 4DT9A 5JFWA 2GFCA 4RJ7A 4NJDA 2XARA 4HCUA 1LJ9A 2HKOA 3WTWC 4GW8A 2W1OA 1SNXA 4AOIA 3QKMA 3FXOA 4WXDA 4LG3A 2KP6A 1F43A 1Q24A 2E2IJ 2Y2ZA 2RGPA 1JPAA 1ETOA 1ZRCA 1I5ZA 4A7CA 2GNFA 5IA5A 5A14A 3D94A 4GL9A 4DEGA 2OKRA 4QMSA 1NG6A 4KWPA 1HW2A 3PFYA 3L8PA 4IQ4A 4YTFA 1SD4A 3H3ZA 1KONA 4A3JJ 4RBLA 3P9CA 3GXOA 2NVUB 4MNEA 5GP9A 4A4LA 1P14A 1XR1A 3PRIA 2Y4IB 2BW3A 4NJ3A 1X8BA 4AU8A 3UMXA 4I0BA 4AE6A 1HOWA 4EHEA 3DK3A 3F5UA 4XNEA 3HB9A 3GFEA 3IW6A 1YI6A 1X3UA 5IP7J 1E1XA 3ET7A 3N4VA 2DQLA 3MCZA 5KHXA 3CCLI 3PFIA 4Y73A 4BCOA 2DTRA 1NXKA 2ITPA 1IDZA 2ME6A 2IS6A 4DTBA 5IPJA 3JRCA 4XLEA 4LIUA 5DWRA 1FBQA 3H9RA 3ZMUA 4ZXTA 2E7XA 2OH4A 1RUNA 4L0YB 2W5AA 3CP8A 1I6XA 4I5MA 5CSVA 5A3XA 3IKAA 4CD0A 4DW6A 2ZSHB 1DDNA 1AU7A 3GP0A 4L01A 3GFLA 2B7AA 2OXXA 4JX4A 4Z7GA 5GJGA 1GZNA 5JGAA 4EYMA 3K2AA 2VGPA 1HKTA 3R63A 5EYMA 5DRDA 1X2NA 4Z16A 4KD1A 4QIWN 2XJ0A 2XIKA 2Y75A 1E3HA 4UWCA 4IFCA 4QYFA 4DEIA 5KK1A 2VO6A 4XX9A 5E92A 3TJDA 2R0QC 4FR4A 1BW5A 3I6WA 3FX3A 2HZ0A 4PL4A 1XH5A 5DUKA 5CT0A 3PFQA 1H01A 4FSMA 2JC6A 4I6FA 2UXXA 3QZGA 3G3ZA 1JKKA 3HMNA 2H1LA 4RPVA 3WE4A 4FT3A 4Y33A 4HV5A 2EBIA 3VUDA 5IA1A 4AGUA 2BW3B 5KX8A 2FX0A 3OXTA 2XVCA 4XLFA 4AGCA 4EQMA 4AW1A 2BXYA 3JREA 4EWQA 2V1XA 3DK7A 2FBKA 3AC2A 3K1MA 4WA9A 2VWIA 1KOAA 1W7HA 3BYVA 1NG7A 5ACBC 1ZOHA 4TNDA 4HX8A 4PFPA 3P78A 4FYNA 4YJOA 5HS9A 3W8QA 4OMZA 4C2TA 5A4CA 1XSDA 3UZPA 2AQEA 3EQHA 1LR4A 4BHCA 5B1BH 1GIJA 3AMYA 4XG8A 5CF4A 4IM0A 4XLPF 1ZOEA 4IAFA 3VHKA 2HQ5A 3NFGB 1O3SA 3FZRA 4NYEA 4NM5A 2PVHA 4B99A 2C3JA 2G2FA 2C4GA 5IISA 3C4CA 1P5EA 3HBLA 1ZGWA 2L4AA 3LMIA 1FOWA 3ZCOA 4D4YA 3KULA 1EF4A 4GUEA 4YTHA 3H5NA 3HZTA 4HGTA 1B38A 4G5PA 4LOQA 1L0OC 5F6FA 4DFZE 4IH8A 2CUZA 3GB2A 3TUDA 5ED4A 5GAHJ 2CLXA 5HKMA 2QOBA 4E6QA 3OWJA 5F0HA 4OIQF 2GTNA 2AYPA 5B2LA 3M8EA 4IRHA 1TTYA 4YNOA 3NRMA 4D1ZA 5EM6A 3HOYJ 2HXQA 4KA4A 2RGVA 2XKOA 4MXZA 3A4CA 2DFIA 1FWZA 5F9EA 1Y39A 3CP9A 3P7BA 2R7RA 1J7KA 1KU2A 2ZSIB 2XK3A 1WRJA 2NAZA 3JW4A 1OIUA 3HRCA 3QCXA 4G2FA 5A4LA 2EV6A 2OU7A 1I6HJ 2RNGA 1MW7A 3FZSA 1UHSA 2W1GA 2Q83A 1B6AA 4S05A 1R4MB 2HW7A 1SMYF 1ETYA 2PY3A 1MUOA 3PNYA 5GNKA 5A9UA 4R7IA 4E4HA 3PRFA 4J00A 3OOUA 3UP7A 3G51A 3S2DJ 4FL1A 2W7NA 4HSRA 2HWPA 3G5DA 2PZRA 3UDBA 2AXTC 5J4YA 3EQIA 4U0IA 4CICA 3SA0A 4FZDB 4WOVA 1OVEA 2VWWA 4D1SA 3Q0WA 3FKOA 1JSVA 2WA0A 3LFKA 1P7JA 2GAUA 4L9VA 3KREA 3R7VA 1LUJB 5KMNA 5A46A 3A0BC 3P7NA 2FA2A 4F6UA 3KULB 2Y9ZA 3EN5A 1SMTA 5ACKA 4PX6A 1AKHA 5D7VA 3Q9SA 1YITI 2JSPA 1PXNA 2O6GE 1Q8YA 4MX9A 5FRMA 4AZWA 4I7HA 3VNTA 2XRNA 1BN5A 2XGCA 3ZMTA 2L7MP 4L42A 4A4OA 5BVEA 4BCHA 4ARKA 3ZQIA 5CQUA 4KBCA 4WIHA 4D9JA 3KZIC 4FTQA 4N6ZA 3V01A 2R3SA 1IEPA 4EOPA 3CF2A 2FUMA 4QMNA 5EEHA 4P2KA 4CFVA 3UIUA 1IJWC 3LOKA 1FOTA 2Y6MA 3DV8A 5IQHA 2X48A 2RAEA 4RM3A 2ZMCA 4JP0A 2VODA 3VPRA 3RHKA 5KAFC 4LOCA 4M8TA 2TRTA 3KLNA 3R0AA 3EL8A 3ZQFA 2PBIA 3OR2C 1IXSB 2Z60A 4FICA 4RJ3A 1H9TA 4I09A 2F2UA 4XV3A 2A19B 2WMXA 3L00A 1D0YA 4JR7A 4JR3A 5I9WA 2M9HA 3W0PA 5ETCA 3CCJI 4FE2A 4FV9A 1ZOGA 1H89C 3TZ8A 2R7XA 4X3JA 4X1EA 4QMVA 3VS1A 2NOJB 2XGDA 4S30A 4V2FA 1RR8C 4CT1A 2OUMA 2IJMA 2IA1A 1ZLTA 5AM6A 5ITAA 5HE0A 1M2RA 2J51A 5D8LB 3QRKA 5AP1A 2MABA 1AKHB 4M3FA 1GVJA 1Q8UA 2X8DA 2Z02A 5LMAA 3ULZA 4ZLYA 4F0GA 3J7YJ 4K0YA 2NS7A 3BZ3A 4AZSA 4MCVA 4V01A 3LL7A 4MBIA 5HNFA 3TZMA 3BQRA 3PZEA 3TXOA 4IAAA 5BYZA 4LD5A 1UAAA 4AGWA 4FG7A 4I0TA 4A3CJ 3ELJA 2DBBA 1MKMA 5LMKA 1T38A 1R58A 5LCKA 4TWCA 3QRJA 3HDNA 1IO2A 3HRBA 2VLAA 1B59A 1MNEA 2QOQA 3VC4A 2RIOA 2UUEA 5IH4A 4DGMA 2L4MA 3OTVA 2VXDA 2RVCA 3GTOJ 5GJFA 2X1EA 3PSFA 1MJ9A 4ZH4F 1YJNI 1SNUA 1BC8C 2WFYA 1GDTA 2E35A 3P5JC 3HL7A 3SAYA 3R8MA 3AT2A 5M07A 1T39A 2VTHA 4XG7A 2P5LC 3ROUA 4E1ZA 3QRTA 4ZY4A 1QL6A 4EMSA 1XBCA 3FWQA 4G9CA 1ZY5A 5AV2A 5JMSA 4RGSA 3F8MA 4I2OA 4L45A 1ZYJA 4MIMA 4AWIA 4BHBA 1PKGA 4PTGA 4XRSA 2ZV2A 4NKAA 2CRGA 2YPRA 5HHWA 1FX7A 2UVXA 1F0QA 3ORMA 3TZ9A 3ZXZA 2LY1A 3LMHA 1VI0A 4O5VA 1YWRA 3SQQA 4EONA 1YYVA 4F63A 4PUSA 1CKPA 5IUGA 4EK3A 3RTPA 1QQIA 1S9IA 2ZXWH 2RF9A 1YDSE 1K78A 4NW5A 2Z7LA 1N78A 5B2MA 5HCYA 5FTOA 3U2RA 3RKBA 4QMOA 2V7OA 3WE3A 4IB0A 4NUBA 1SAXA 4H3BA 4JBVA 3CCYA 4AOTA 2CG4A 3JTGA 4FIEA 4EJUA 3HOWJ 3FBIB 1JKQC 1P4AA 2E9VA 5M5YJ 4UY8I 2VTJA 2JKQA 3TP3A 3N4TA 2L9NA 1PMNA 5E9EA 2CGVA 2VTRA 1R6RA 3FL4A 3J81K 1O4XA 4WNMA 4BIBA 1R1VA 1BL6A 2MLKA 4CLIA 4X2KA 1DGRM 1YX5A 5IOYA 4IKFA 2NO3A 3T9TA 3P5JA 2C5XA 3KCKA 3WU2C 3K3JA 4CXAA 1OCOH 3K70D 4AGDA 2Q0OA 4M3BA 3W3CA 3ELKA 3JRGA 2R0UA 4RX5A 3RP9A 4OTDA 5EW3A 4D58A 4EM1A 2I10A 4DNCA 1CF7A 4RAGA 4YLLA 3U1DA 2XCKA 1NA7A 4DCAA 2WMRA 2Z8CA 3AD6A 4FTLA 2YWVA 2F2EA 3G1OA 3LMMA 2WB8A 4BTKA 2VUWA 1Z3XA 4GFGA 3LSKA 5K4JA 1RJBA 1TLHB 3DEUA 4Y7NJ 1TQIA 4BBSJ 3MY5A 4XCUA 3A61A 4TWNA 2XC7A 2GNLA 5M3FJ 3BLAA 2FOWA 2JTVA 5FRNA 4N0SA 4BDIA 1K78B 2UZBA 2WTKC 2X9EA 3TEDA 4JOMA 2V26A 3FMDA 1VQ8I 4HPUE 4USFA 5JFXA 3CPCA 3LM0A 1OCZH 4DF3A 3AG1H 2O9LA 1SVOA 3WGGA 3S3NA 4JRNA 2QEXI 1ETVA 3MESA 4HYSA 5AP6A 3GU5A 1W0TA 5TISC 3ZC6A 1JSUA 4LMNA 4QPAA 4KIQA 4KISA 4C4EA 5FXRA 2XB5A 3G15A 3JRHA 3Q3SA 1ETKA 1FYKA 2YUSA 4S31A 1DAYA 4QP8A 2A6TA 5IG1A 4A0XA 3MIYA 5GJDA 4TKSA 2OJFE 4I02A 3LXPA 2QVOA 3ACJA 3MVMA 3TTIA 4G6TB 5EYRA 3HKZN 1H1RA 2KRCA 3S15J 4A9SA 5IMXA 4GSBA 4QQ5A 4I6BA 1CF7B 2BMCA 3FQSA 3TDVA 4BN1A 4EVIA 3DLZA 1YRPA 3JR1A 1YIJI 2W1ZA 1D8KA 2CKPA 1OZ1A 4ABZA 1KYZA 2BPMA 1X4PA 2RQPA 2A07F 4FKWA 4MWIA 2XPUA 1FYLA 3WZEA 5FP5A 4Z2YA 4Q5HA 3WU1B 4GO1A 2PU8A 4AVPA 1ORKA 2YCQA 1JUMA 4UXLA 1JGSA 4BAYA 3REPA 3WGHA 1IA8A 3EFJA 4EH7A 3E88A 4NSTA 1MIJA 2ETHA 1I1GA 3FXRA 3D7TA 2YABA 3HYIA 1HXDA 4O0SA 3LFFA 3R73A 4WNPA 4WG3A 3DFGA 1H0MA 2A4LA 3Q60A 3I4BA 2NRUA 4LDTA 1ZLJA 4FV3A 5IQGA 2W1EA 5HNHA 5C44J 4JX7A 1PXPA 4USDA 1KE9A 3WYXA 4XLNF 3U6JA 4Y15A 1RPWA 1AOYA 3PIXA 3V8SA 3VWAA 1VYZA 3B02A 4QMTA 1Q62A 4OINF 4UYNA 4NWMA 1YDRE 3CPBA 4BDZA 5L6PA 1H1PA 3C7QA 2ZFWA 4XG9A 5AV0A 4YP8A 3NW6A 4U0WA 5DT4A 2QZ8A 2JDSA 5EM7A 1HW1A 2OICA 2A3SA 3S32A 3NRVA 3DLLF 1HCLA 4F9CA 5DTDA 1ZZLA 3QD0A 4X0MA 2GPHA 1Y8QB 5BPIA 3BL7A 5EQYA 2A0CX 3KKVA 4ANBA 4EZ3A 3T5XA 3E8DA 3OS0A 4IJ9A 3I0QA 4UXQA 4ANMA 4EJNA 4BDYA 5J8FA 1G3WA 3R1SA 3BBTB 5BMMA 4H1JA 2WEIA 1W5SA 1OIYA 4LRJA 5JFSA 4KSQA 4E7HA 3OC1A 3O96A 3AMBA 1OMIA 5KVRA 2JLDA 2B9HA 4I3ZA 5CQGA 3CQZJ 3ZEPA 1IR3A 5H20A 3BL9A 3UODA 2QSHX 1TWGJ 4U3YA 1PKDA 1XMMA 3J81Z 4UB8C 4RFZA 2IVMA 1YWNA 4ZYGA 5KMOA 2WIPA 3H30A 2KIUA 2W85A 3D7TB 4CUGA 3NS9A 2YM8A 1OIQA 2QR7A 4R79A 1YI3A 1WGXA 2DUVA 3PY1A 3ROYA 2WTKB 3BLRA 5AX3A 2WB1N 4ZYEA 1XPXA 2ITOA 1JGGA 5LCJA 3E8CA 5BQ0A 3RAIA 2HIWA 3QD2B 2PULA 4CSWA 2R7UA 3OSFA 2KZVA 3R4KA 2QA4I 2W1DA 5EI6A 4XNFA 1Y0UA 2PVMA 2XF5A 1WBOA 4OBQA 3V8KA 2DA1A 1WVXA 1S7OA 2C6DA 5HVYA 5LVLA 4F55A 3FKNA 2XKPA 4LK1F 2JRTA 2M0MA 4MEDA 4BQQA 3FMJA 4BR3A 3WTVC 2GHGA 3EHAA 1XCBA 3C0GA 2M3AA 2EH3A 3KEXA 4FNXA 4G3DA 1VJYA 4B4LA 5LQFA 1XCVA 2EWAA 1FMOE 1ZYCA 2OBJA 3ZM9A 3BV2A 3K4JA 3GTJJ 4JBOA 3FI8A 4C36A 4E5BA 4L00A 2I0HA 3LSIA 4U5JA 3UOKA 4IM2A 3I54A 1ZMUA 2UZWE 1EV7A 2EZIA 2MLGA 1OGUA 3UO5A 1BKXA 5M55A 4NCTC 2KTYA 4CZCA 5EF6A 5F04A 4PZJA 3G73A 3RPYA 2FBHA 3DKXA 2CUJA 2HXOA 3NX8A 4G6DA 3RYRA 2XH5A 5DIAA 4CRLA 1F5TA 1B8IA 4RAYA 4RB2C 5CAOA 2C3IB 5FLMJ 3F3ZA 2C5YA 3FAAA 3D1NI 2RL5A 4X7QA 4XOYA 3VBXA 3FXQA 3V7CA 5HLHA 2LC2A 3OYJA 4Z7HA 3FMKA 2X1DA 1PHKA 3PNVA 2YZAA 2VBYA 4J19A 2D5VA 2HGCA 1VFCA 2VTTA 3W2CA 1GXPA 5J6XA 3RM7A 2O64A 4C3JJ 2EPFA 4KIGA 4JQEA 1DPUA 4YIIA 4IDVA 3D14A 1V4RA 4UV8A 5LWMA 2OTJI 2ZJRF 1WAKA 3UKGA 2GHLA 1BIBA 2HPIA 2XS0A 1JLUE 4M0YA 5LLQA 3BP8A 1BMKA 2LK2A 5HODA 1YI2I 3MMYB 5I9UA 2AUHA 1SYKA 4BVUA 5A6OA 2M7BA 5D6FA 1S72I 5HU3A 1Z77A 4KUMA 5C4KA 3DTKA 4ZOGA 3X2QH 1XH9A 5HVKA 3IPHA 4ZJIA 4APPA 2XSDC 3GVUA 2VO3A 1Q8ZA 3O8PA 1UZCA 1XH8A 2CNVA 3BGPA 2PX9A 5HNGA 4O81A 5FKOA 1VQ7I 4KABA 4TL0A 3BJ6A 2OW3A 2C1BA 5ICCA 1LEAA 4IEJA 2F4MB 4XIDA 3I7BA 2Z16A 3LA2A 1MRUA 3FLNC 3GZ5A 5DRBA 4MTAA 2QNJA 5E8YA 2JA6J 4DH5A 4BBMA 2ECCA 3E1SA 2ZNZA 3FHZA 2L02A 2F5DA 3FWEA 2R7TA 1O7FA 5TT7A 3LSGA 2DS1A 3PSCA 3DLSA 4B4CA 2IZUA 1MGTA 3MKYB 1XTAA 4LOPA 3HYHA 2CCHA 3D5XA 2ZM1A 3UOJA 2WPAA 1B8IB 1CSNA 2EV5A 4ASZA 3W33A 4FSQA 4QP6A 3CTJA 5C3EJ 1PY5A 3UMWA 4OMYA 4I0AA 3L2RA 2I8DA 4MLOA 4NC6A 5E79C 3TNIA 5F94A 2WAFA 1X2MA 3R60A 4RWJA 1GZ8A 2IS1A 2J0JA 3HMMA 3OHTA 4G31A 4GG5A 5E8SA 2F9GA 4JDKA 2KULA 2JVHA 1ERKA 2W1FA 4A9UA 3MB7A 4MYGA 1IXCA 1WH5A 3O7LD 3E7VA 4L9TA 4KA3A 1R23A 1TNSA 3A99A 4MGRA 3TGNA 5EHYA 2RC4A 4MXXA 4A3EJ 4UVCA 2QLQA 5EGOA 2QGUA 5J9YA 4J97A 2L7ZA 3DQXA 1XN7A 5CQEA 1Y6AA 2OU2A 3LZBA 3K5UA 3UDZA 3EUHC 2E7WA 2JJ7A 2RG6A 1PVEA 2VBWA 4C3IJ 3A2KA 3II5A 5DHJA 3IL2A 3PUBA 2BHEA 5IQDA 5TGTA 3QQGA 4AVZA 4UHTA 3CQEA 1B6CB 2PMOX 3A01A 1FIPA 2CW8A 4FKRA 1O3QA 2ZMDA 1LFBA 4A0YA 2J5PA 3PJ3A 3U21A 3QTUA 1OCPA 1I3QJ 4JJRA 5DR2A 3FKJA 3NWWA 5CAPA 4MD7E 3OSGA 1OISA 4UNOA 1H26A 2B0QA 5A2QK 1VEBA 3PG3A 3S8PA 2QOCA 3GYHX 3VS3A 3WHBA 2XYNA 2KJBA 1H9GA 3ZSHA 3COMA 3AKKA 2BHHA 1FGIA 4AIJA 3PSBA 1A5JA 2GNHA 4EOOA 2L0KA 1W84A 4IEBA 4IB1A 4XN0A 4D0XA 3UZRA 4QMXA 1SEUA 4CCLA 1QPIA 3P7AA 3GXLA 3NVKI 3I6UA 4QYEA 4D4SA 4HX4A 1R9TJ 4XSZF 4I0SA 2VTOA 4RJ8A 2MSYA 1K6OA 2M7AA 4TV7A 4YJQA 3R7UA 1PXOA 3HV6A 3FXZA 1K4TA 2BRGA 5M53A 1X58A 5EGOB 1MJBA 4DINA 2DQ7X 5CF5A 1FYMA 2JA2A 5BVOA 2ZKZA 5EEAA 3U9GA 1UG0A 3EUHA 3EUKL 1X3WB 2G7HA 1ZAOA 5M4IA 3TIZA 4MXAA 5LGTA 4F09A 4M15A 2EZKA 4LYNA 4L5JA 1F36A 4KT6A 3CCMI 3KCCA 1A9UA 1SD7A 1F4KA 5CLSA 3DB6A 2CSOA 4DGOA 3A01B 2COBA 2VX3A 2YX7A 3NEUA 2QVSE 4LK0F 4JMQA 1QZEA 3OT8A 4IBMA 4WT6A 3V8JA 2OJED 3NYNA 1UU7A 2UW9A 1MMNA 1YIOA 4R5SA 1QHGA 1YJ9I 2ISYA 2DA2A 4RIOA 3OVVA 5FG8A 3BTCA 1KE5A 2XAFA 2P7CB 4DLJA 3QRFF 2CFXA 2L2OA 3ISPA 2H27A 1R78A 3ZSIA 3QYEA 3HKZA 3IH4A 2B9IA 3KPHA 4A69C 1IN6A 1YWVA 3VS4A 3Q9VA 1OPCA 1YHQI 4HPTE 2Q2EA 1F9NA 3S14J 2HYGD 1H0WA 2OIDA 2HOTA 3D5RC 3C2HA 3QQUA 2G0EA 3PE2A 1AD5A 1XX5A 2CW0F 2X8IA 4IWOA 1ZHFA 2A5YB 3BPRA 3H3CA 1G4DA 2LRDA 2WTDA 3P7CA 2PYWA 4F92B 3G1LA 1FPUA 4F9YA 4RSSA 2W1HA 2ZAZA 3MIAA 3BG9A 4BZOA 2VWXA 4E7IA 4C3HJ 3G9LX 3PJCA 5D12A 1VQOI 3VONA 3QTRA 1TZLA 4NHJA 3MYGA 1FBSA 1YX3A 2O3PA 3F22A 2ZB1A 3SG9A 1T95A 2JA5J 1PP7U 1REKA 5HVJA 1T46A 4G3CA 1Y0NA 2LYCA 2J6MA 5CNNA 2O65A 2CLQA 2QURA 4R7HA 1J9IA 4GIIA 2V55A 3MWUA 3EQBA 3LE6A 1U5TC 2G1TA 1BI0A 2CPKE 2B1PA 3V8TA 2OH0E 1LFPA 1Z5MA 1W5CC 4ZTLA 5BUEA 2LDUA 2E9OA 2XIZA 3LAJA 1XQZA 1I09A 2WTJA 3LSHA 4JG7A 4AAYA 2FSWA 3RPOA 3R9HA 2W00A 4F7JA 2JAMA 2DTZA 2NVQJ 2J0IA 2QSFX 1J5YA 2MYSA 2NVXJ 3VS6A 3KP3A 5AWMA 4F64A 4R7BA 5DEYA 4A3GJ 2STTA 2QOKA 3TO9A 2Q0NA 2HPMA 4PMMA 5JVGF 2C6IA 2RKUA 4ETSA 5E7RA 2EIKH 2D1VA 2WBMA 5FO5A 3QLFA 3TYKA 2RQQA 3GW2A 5ETFA 2X1CA 1LVKA 3MQ0A 4O7TA 3QQHA 2NRYA 5DS9A 5FM2A 1ULYA 2Q2EB 1YVJA 4ENJA 2E1NA 4O6EA 3HOZJ 4BQNA 5AM7A 1IV8A 2XALA 1L3RE 4PTCA 3UYTA 1P92A 3MH1A 2W06A 1E9HA 5HX8A 4UZDA 2XNGA 1GZKA 4KYWA 1XD7A 5M09A 4FNYA 5CI7A 3PPJA 4ZJZA 3WTZA 4ZY5A 4AZFA 2KFDA 3SFIA 3VSKA 1YJWI 4L0ZB 1WWXA 1FOKA 4DAWA 2FOKA 4G1WA 3HIFA 4D7NA 1KE6A 5C1QB 4YTIA 4IOAF 2WB1A 2JBPA 3QP6A 2PL0A 2J0MB 2VAGA 2BKKA 1N77A 1IUYA 1U5TA 2V1NA 1VTNC 5AV4A 2ITVA 1VYWA 3MY1A 1ZREA 3M1CA 4YFKF 4FTMA 2QQAA 2Y69H 2PUPA 2P4IA 2UW4A 1J7LA 3I60A 2BROA 4IVCA 4KIFA 3SRVA 4Q5EA 2CJJA 3A7GA 3I71A 2DK8A 3BTIA 4OTQA 1RI7A 3CLOA 3HV3A 2LD5A 2HENA 3NZ0A 4V0GA 3FLYA 5EEGA 2PVNA 4D1QA 1W83A 2LY9A 4FNZA 4KUJA 4MHAA 2O7OA 5T6KA 3K4NA 4CA0A 3IW5A 3KF7A 4M6XA 4O0UA 3QCSA 5HCZA 5FLXK 2VC0A 3ZH8A 3Q4ZA 4A93J 2CJMA 3QL8A 2BZIB 3S2PA 4HNVA 1WHUA 1SFOJ 1BR1A 2W25A 1HDDC 4II3A 1HDPA 5KMLA 4FSNA 3I56I