3PFYA

The catalytic domain of human otud5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
129
Chain Sequence
b'MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU domain-containing protein 5
publication title The catalytic domain of human OTUD5
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 129
sequence length 146
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pfyA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pfyA01
3TMOA 3PFYA
chains in the Genus database with same CATH superfamily
2XBJA 2XC7A 3A4CA 2J4ZA 2FU4A 4YJVA 4ZY6A 4ZYAA 1BW6A 5J3LA 4WG5A 3SHEA 2IAIA 1WQ2A 4O0SA 3NNXA 3L2RA 4AXFA 5FXSA 3BQRA 1BI1A 3RAKA 1LVAA 3BWFA 3I6WA 4C3IJ 2G9XA 4PCQA 3HAVA 3SXSA 5K3YA 5IDPA 2V1XA 2DTRA 5EQEA 3OXZA 4XOPA 2DJIA 5FD2A 2TRTA 4UXLA 4ZZLA 1RR8C 2ETKA 2NRUA 3TI1A 2KIMA 5T3QA 4U0IA 3HOVJ 3LFQA 1WVWA 1OL2A 3V42A 3IOPA 1GHCA 4FC0A 1F5QA 4XBRA 5JMSA 4WKQA 3RZOJ 1JQHA 3GLXA 1FBNA 3QU3A 1Q3WA 3E8EA 1FSEA 3HL7A 1ZOEA 3JXWA 4KB8A 1W7PA 3OS0A 3HOSA 3DKXA 4BZNA 3LMGA 2BY1A 3QODA 2UW7A 3TKHA 5HNIX 4M8TA 3F8NA 3T8RA 3SW4A 2FUG2 4AIKA 4I5HA 4A0ZA 2W4OA 3FHNA 4DBRA 4J99A 1UHSA 3QC4A 1QVTA 3RKXA 2R7UA 4JDJA 4AQCA 1YHVA 2QHMA 3UIMA 2XCHA 4L42A 1HSJA 3GTGJ 2C68A 2DA2A 1K4SA 5HZNA 2O6GE 3DTCA 3PZHA 3GBZA 3GZ6A 3PXZA 2CW8A 3FYJX 2QEXI 3QTXA 5K4JA 3PY0A 3KXZA 3T8TA 2JIIA 4AW5A 1NVQA 2VTTA 3LIJA 2QOQA 1R5HA 5LMKA 4FX4A 4ZJZA 2VT3A 2FB8A 2VRXA 2XNEA 2E7WA 1W0TA 1XH5A 1HKTA 3FXMA 4HF2A 4J96A 1CMKE 2NVQJ 2ITYA 2PUUA 4ZYEA 2BY0A 3GUBA 3KZYA 4K11A 3E0JB 3AAFA 2E5NA 3D5RC 3QUDA 4RAGA 4EORA 3IH4A 4ZIMA 4Y72A 5K7ZA 2X8IA 5C03A 4U42A 1W82A 2P2HA 3O51A 3LLTA 4H3QA 5IA0A 5JGBA 2PMZA 3ULQB 1I6XA 1H00A 1JWHA 4EOQA 1YJ9I 3C4WA 1WZ2A 3CSVA 1U5TB 2R7SA 4Z6YA 3KIOA 3KXHA 5FM3A 2QR7A 4RIYA 4ENMA 2CUZA 2DK5A 3IDBA 4KICA 2BDJA 2GIVA 3JS2A 4BDBA 1BR2A 3ERED 2XPVA 5GADJ 1IUYA 5FLVA 2VO3A 3D2IA 2IS4A 2ERZE 3OUNB 1A6IA 2VONA 3UO5A 4L9JA 4MUQA 1TT0A 3H3UA 3VN9A 5EJCA 3IH3A 4GT4A 4FR4A 3HUGB 3V7CA 2JVHA 5ICCA 4JIKA 3KMMA 4IH8A 5AMNA 2IW8A 5IMXA 4RVKA 2WO6A 3LCSA 4UV9A 5KAIC 2IZUA 2V4JC 5IT3A 4WBBB 5JRQA 3BR5A 3ZQFA 4JNWA 4LQMA 2R3OA 3OS1A 4I0SA 2XASA 2IWIA 3GMEA 5ICEA 1G6NA 3FKNA 5EYDA 2C6MA 4P7EA 2HYFA 3TNWA 3L2UA 1DPUA 1ZOGA 3QRUA 2W82A 2GOXB 3CQZJ 2BZKB 4LB6B 4KBCA 2LVSA 4YZNA 1GZ8A 5HNFA 4PDYA 1V3FA 5FXRA 5KKRB 4I5PA 3ESWB 4H1JA 5ILSA 2O8KA 2V7FA 1OMWA 2R3QA 3FLWA 5BYLA 2XCKA 2QO7A 4AZTA 1S7EA 4QQCA 2M0MA 2MSYA 2OQRA 3KRJA 5HNBA 3QPTA 5F27A 4IB5A 4JDKA 4H3BA 1P4WA 3N4MA 2F5CA 3V5PA 3ODZX 4QQTA 5DN3A 2VTLA 3FQSA 4OTQA 5H6QA 4IC7A 4UUSA 5FKNA 2GZWA 5GP9A 5CQEA 4YNOA 3GVUA 3P7CA 3Q4ZA 3ONQA 3HDMA 1R7JA 2PZYA 1IDYA 5I9WA 2C6DA 2ZFWA 2GNHA 5A14A 4GK2A 2ZKZA 1YDTE 4NKAA 3DPUA 4YPSA 2I6LA 2ZXIA 3EQGA 1V4RA 2KT0A 1Q4LA 1FGIA 3TKYA 4LV5A 4XX9A 2OU2A 2QLQA 3OYEA 1G59A 4AIDA 2Z3YA 1T95A 4FV6A 1W7PB 1FMOE 3F2AA 1L8TA 4PTEA 4CLIA 2QQ7A 4CD0A 3PNTA 5FRMA 1TW2A 2XIGA 2ZYBA 5L3AA 2IVTA 2LBFA 1QPCA 4FSUA 3ZMTA 5FKMA 3T5XA 2JTVA 3H3ZA 2DCEA 3F61A 2ITPA 3IKAA 1TT5B 5IA3A 1H1QA 4MH7A 1GIHA 1T33A 5M09A 3HRUA 5KZIA 3OWKA 4L46A 2OU7A 4GKHA 4G3EA 4HCUA 1H9TA 4EOJA 2XK6A 4ITJA 4KT6A 4ZP5A 3B2WA 2Z2WA 2X7OA 1OB3A 1W4MA 4IOCF 1H89C 1AGWA 1NK3P 4FZAB 1PXMA 2HENA 4DFBA 4Y83A 2FOWA 3GQIA 5JQ5A 2RNJA 4E4XA 3V6SA 1GUUA 5JZJA 4FTOA 1B4AA 1KV2A 3LOKA 3GCPA 2HZDA 5L8LA 2KIQA 2CMPA 2NP8A 2LD5A 5E8UA 4IZZA 2GU8A 4S34A 3A7GA 1P4FA 1T45A 4IHWA 4HX7A 5ICPA 3WTZA 1H1SA 1FNNA 4R7HA 4RS8A 4XP3A 1CSNA 3FSKA 2FYSA 3ATTA 2VTNA 3ZEPA 4RIYB 4PV0A 4P9FA 5FTOA 3B02A 1D8KA 4D1XA 3GLLA 3QTUA 3HEFA 4XR6A 2Y4PA 4E6QA 2F4OB 5GPCA 1PY5A 1DAYA 4RJ4A 4DHZA 3ZMSA 4AYBN 1H1PA 3GCVA 4FIFA 1PP7U 3ZS5A 3F7ZA 3HRCA 2C47A 3L09A 2OPTA 2XNOA 3LSIA 3PUFA 3ANQA 3SEQA 4G2FA 3VJOA 4R3RA 4GUEA 3O71A 5M5XJ 4DFXE 4D5CA 2VWYA 1MH3A 3C18A 3I58A 1YXUA 4AN3A 1Z6RA 2O5KA 1WFCA 2FQ3A 3QCXA 2HQ5A 4JBAA 5A2QK 3CC6A 1OJLA 5CLSA 5EOBA 3HJEA 4CTBA 2CNUA 1OKZA 3HOWJ 4U97A 2ZV9A 2ZXWH 4TNDA 1SANA 3I53A 1O6LA 3O8UA 1RJBA 1XCVA 1BYGA 3UYTA 3S16J 3MKZA 4H05A 2IGKA 4BCHA 4FV5A 4O2ZA 1Y8QB 3OY1A 4C38A 3LL7A 2WV0A 2IN6A 3V51A 5AA9A 4B9DA 1GXPA 4JDIA 6PAXA 1ZOHA 5FGMA 4RVMA 2VWVA 3IL2A 3K2ZA 3DKOA 2PFBA 3LXNA 4YZDA 4BDKA 3CCMI 3DU6A 2C6YA 4LV7A 3PJ1A 5CVJA 3HRBA 4HVDA 5KMMA 3R71A 1WHUA 1OUYA 4NDLA 5JVTA 4LRMA 4FIJA 2YERA 3FMQA 4UUSB 3D7ZA 3I60A 4B09A 4BQNA 3ZSIA 3VJNA 2R3PA 5ILUA 2XPUA 5TT7A 3K4LA 2YWPA 3PPZA 4BQOA 4EK8A 3L8SA 4II3A 4FTLA 5AM6A 4XV2A 2HVRA 2R7OA 3R6SA 1W98A 2QZ8A 1IRZA 2BEOA 5DT4A 1T98A 4IRIA 4OTIA 5IUGA 2WTVA 2R7FA 4KMUX 3KRXA 4CXFA 1LEWA 2C6EA 5ANOA 5ETAA 2Q8KA 1R3CA 3QD4A 3KREA 1WVXA 5AJQA 4EJUA 3PWDA 5DG5A 3EYYA 4I93A 1BUHA 4GFMA 4BCOA 1R39A 1ETOA 3DPKA 1B8IA 4I0AA 2XUUA 2LSOA 2LBFB 1PMVA 1SM2A 4FNWA 5FEQA 3IS5A 2ACJA 2R92J 3LFNA 2YPRA 4IHTA 4FTCA 4WRGA 2DQ7X 5HLHA 2J5OA 2X6DA 4RB2C 5A6NA 3UMWA 2J5PA 2YABA 5ICGA 3OW4A 1FPUA 1UNGA 2XM9A 2XAFA 2KPMA 1UVRA 2PVNA 4QIWN 1XGMA 2XIYA 1M2QA 2VO6A 1IN5A 3QU6A 3A61A 1OIQA 1JI8A 2VD5A 3R1NA 2Z33A 4WK8F 5AUZA 1BLXA 4BL0B 3IDPA 3AC5A 4CCOA 4CLJA 4HSRA 2W5BA 3TNQB 4RX8A 4A3GJ 1VYWA 3ABTA 1OMIA 4UHTA 1BR1A 5E3LA 4BCFA 2ID3A 4XKWA 4KFCA 4IOAF 4GU9A 3BIZA 4RG0A 4M3GA 1LDDA 3DBFA 2R5TA 2O3PA 4G5JA 3RHKA 1KU9A 5E1EA 3PSIA 1Z1DA 3OCTA 5HI2A 3FYKX 1F9NA 4QMZA 4BDDA 4DYMA 3BE9A 2ZV7A 3MY0A 5EM5A 1SAUA 5DLSA 4BHNA 3ROYA 4YZ9A 2HOTA 3JW4A 2LC2A 4I6QA 3ROUA 1G3SA 2NPQA 2UZDA 5KX8A 1FT9A 2QG7A 3QHRA 1R1TA 3O17A 3OS2A 4QPOA 2FBIA 1LPQA 4Y85A 4F92B 2F2CB 2PVLA 5FLXK 2HNHA 3JCUC 1L3LA 3MJ2A 3K4NA 3E6CC 4NJDA 4WNOA 2UZEA 3PXRA 4FT0A 1J7IA 3DLLF 4AGUA 4FT3A 1ZK8A 2C6IA 3ATSA 3PXFA 2YAAA 4F91B 5AP5A 5CQGA 4FT5A 2IA0A 3RAHA 3ZMMA 4NC7A 4HEA2 2UZNA 2YIQA 2I7QA 1AQ1A 4PDKA 3TUBA 2ETMA 1XDSA 5M06A 1XWSA 2XP2A 4GRBA 3AMAA 3MYGA 3K69A 4Q5EA 4XG6A 3NMUF 3EB0A 4BDIA 2RN7A 5LJJA 4DEBA 2DQRA 5AUXA 3OR2C 1KGSA 2GPHA 3A0BC 1ETQA 4XMYA 3FXJA 1ZG1A 4WHZA 4BTJA 4PSXA 5F95A 1JT6A 3POZA 3SRVA 2ITWA 4O7LA 3GC8A 2FQ4A 1BJAA 2QA4I 4G12A 2PPQA 5AIKA 5EFQA 1LEZA 4Z7HA 3QQGA 3P23A 3TO6A 3V8WA 4GG5A 3TNHA 2GHMA 5ITAA 3Q5FA 3CCLI 3OCSA 3HHGA 4O6LA 3REPA 4E5WA 5KNLA 4KUMA 3HSFA 3SG8A 3BY6A 1LKXA 2KJCA 2CWEA 4RB3C 2QVOA 1I3AA 2QKLB 3EKKA 2UZTA 5HIEA 2A68F 5EK7A 3WARA 3SFIA 2R3JA 4C33A 4U9AA 2OO8X 4ID7A 3CCNA 3OY3A 3ZCOA 2L02A 3Q0VA 5AWMA 4O6JA 3FKLA 1YWRA 3UVQA 2JLDA 4WX9A 4OIPF 1FEXA 2DDBA 2J6MA 4QMLA 3LA2A 2V7OA 4NJ3A 1K6OA 1V55H 3VYSB 5KO1A 1DM2A 3QWKA 2MW8A 3PSFA 4C02A 3HL2A 2NVUB 5FD5A 4OR5A 3NIEA 3MMYB 4ENNA 2UW3A 2HXOA 2X1NA 3FZTA 1X2NA 3PFYA 2UZWE 3CXWA 2CNQA 1BBYA 1MJ9A 5LCJA 3VOEA 1O7FA 1XX5A 4I7HA 1ZMWA 2PJRA 5J87A 4CT2A 5M4IA 1NW1A 1B8IB 2AEGA 3H0YA 2GS7A 4LLNA 2OA4A 3OYKA 3J80Z 5LLQA 2HKOA 3FXLA 2W7NA 3G5DA 2ZVAA 4F0GA 1UWJA 3N4TA 1ETVA 2NYAA 3ZLWA 1HA8A 2NOJB 3HKZN 4N57A 3FMDA 3HOYJ 5LGNA 4MXOA 2Y2ZA 1YFHA 4MF1A 2VQGA 3IQ7A 1KU2A 2PVRA 5A4CA 3N4UA 5ANEA 3CMYA 3MGYA 3D94A 5GNKA 4JVGA 3RPQA 3BYMA 4Y33A 4MHAA 1KONA 3S3NA 3UNJA 3HGKA 2DA3A 3ZO3A 2QOBA 4RB0A 1Z77A 1GV2A 3D5LA 1DP3A 3JSOA 3I55I 4W1UA 4DDGA 4II5A 4BJ5C 4WBOA 5AUWA 4EQCA 4RC2A 3OYMA 4EC9A 3GEQA 4YTHA 2CRGA 4D4VA 4GT3A 4EHZA 4BHZA 3WE2A 4F64A 2YJSA 2KLOA 3OY9A 2K9NA 3S14J 5E17F 4OUCA 4NKSA 2X7FA 2KTYA 2CLQA 2JAVA 2KRHA 2UW0A 3E93A 2Z16A 3SDJA 3U6JA 2CYYA 4RB1A 2BGCA 2A3SA 1W1WE 2CN8A 3G1LA 2C30A 4J1RA 3S1MJ 3KX2A 4X1EA 3OFMA 1SEUA 3HUCA 1YI2I 2WTCA 4DH8A 4UUVA 2UWMA 2BHYA 4CCUA 2K40A 2OBPA 4RGXA 1U5QA 3RZBA 2BIYA 3SXRA 3L9MA 3UVPA 4GEOA 2ZXJA 5KKRC 1K6YA 4A3EJ 2WB8A 2E36A 4HYHA 1Y0UA 3QRFF 2JRMA 1DP7P 5HDGA 4EBWA 2F6CA 3ODYX 3DT1A 2AXLA 3W2VA 3RZDJ 2I10A 3R2BA 1VZ0A 1G5SA 4G7HF 3EWHA 2CH0A 4ANJA 1KE8A 3EETA 3L1PA 3S00A 5GAHJ 2JPBA 3TO7A 3KL8A 4RSSA 1OISA 3M07A 5BMMA 3WOWA 3D7TA 2JA7J 4EGZA 3HPGA 4ETSA 3RK7A 3U87A 3CO6C 2X8EA 3LE6A 3TCPA 3TP3A 2X2MA 2DDAA 5BV3A 4R5SA 2ZJPF 3F3ZA 4HNUA 1KU7A 3DXQA 3IECA 4HLYA 4FX3A 1GAGA 1LEAA 2PVYA 4WXCA 3QQAA 4E7IA 4OIQF 3OZ6A 5HOOA 1M7NA 2JAMA 4AA5A 4JAIA 2KFDA 1QA6A 2R3HA 4I24A 4J95A 3AL0B 3SRVB 4ZJVA 4BDAA 2VBYA 4Z2YA 4Q9SA 4D5HA 1S7OA 5CVVA 1XJDA 4PMPA 1E3OC 4CFVA 3OWJA 2FMLA 1ERDA 3HGYA 4F70A 4F7LA 2VXDA 1UHMA 2YM8A 1URCA 3IKVA 3SDGA 2P81A 3E8CA 1U59A 4OT5A 2BUJA 4L3JA 4MWIA 4DEHA 2FSWA 2VQLA 3MA6A 5EG3A 5EZGA 4ZSAA 3HYIA 3ZPLA 2JSPA 1ZGAA 4ASZA 1JKPC 3KXNA 4DH3A 2WMSA 4MXZA 3HZJA 3CBLA 3DPTA 2P55A 4FJVA 4RBOA 4AU8A 4JK1X 3KMWA 1K9AA 3EYHA 4NCTA 1SFEA 4KN7X 2WMBA 4ZSEA 4HYUA 4AW2A 2IO6A 1H0VA 3VYRB 3R7UA 1R6RA 1LE8A 2DFHA 1WJBA 4FSQA 4Q4ZF 5J95A 2IGNA 1TW3A 4FTNA 4BCNA 1W0UA 4DJAA 2GTNA 1BW5A 1QMZA 1ENHA 3U9GA 5JQ8A 1BR4A 1XH8A 4EYJA 2M0CA 2NVXJ 2VX0A 3PL8A 4EH9A 3KP5A 3J7YJ 3UZTA 3HOTA 1U2WA 3S2HJ 3S2PA 3S1QJ 1ZXEA 2OZAA 5AP2A 2PJRB 3BU3A 2HEOA 4X7QA 3SHFA 3QQHA 2ZBKA 1V5EA 2I0YA 4F3QA 5JFWA 2DOAA 2R4BA 1UNHA 1ZH5A 2WMVA 3PE1A 5L2IA 4JR3A 5AM7A 4DEAA 4OT6A 2ITQA 2H94A 3KIOC 2WADA 2DFIA 2XKOA 2PYWA 4MXYA 4O81A 4EOMA 2K3FA 3QGYA 3H1CA 3A02A 4TY1A 2HKXA 5BNGA 5LXMA 3QA8A 2WWYA 4ZYGA 5A4QA 1UELB 1XKKA 2Y9QA 3CTJA 3MJ1A 4L9TA 3IW8A 3UPZA 4BXUA 2W7XA 5HU3A 1H0MA 4QMTA 4RC4A 2CQQA 5E8ZA 3KU2A 3FXRA 4B4LA 2LREA 4MQ9F 2UXXA 1R58A 3ZFYA 1ZZ2A 4BIEA 2OK1A 3LQRA 2LY9A 4BUPA 3QU0A 2XAMA 4PGHA 4NWMA 4IQ4A 1Q24A 1BKXA 4KWPA 4B47A 3RKWA 4FZFB 4EHVA 4A7CA 4LRKA 3BWJA 5CQWA 3BLRA 5GIPE 2ELJA 3CE3A 1J2XA 3WGHA 1X58A 4G7OF 1VQ5I 4BGDA 5KBRA 3BEGA 3EYGA 3M8EA 4LYNA 5M51A 1XC5A 5K4IA 4ZTJA 4IJ9A 4YHJA 3FZRA 5EH0A 4LFIA 4I6HA 4WOVA 1BC8C 1J3HA 3H30A 3CCUI 3R9HA 5FKLA 4C59A 1XBBA 5EDPA 3DK3A 2PN6A 3FMNA 3OEFX 3R9DA 1HOMA 4PUSA 2CGXA 2K3PA 3ZQIA 3ECOA 3ZMVA 4NBQA 2OLCA 2EWNA 5D12A 1R71A 4O91A 4CEGA 5JLXA 2F5VA 3DEWA 3VBWA 3SA0A 2ZO4A 3P5KA 1OBGA 3TDZC 3G2FA 4RQVA 3T0YA 3CUOA 1NVSA 3Q53A 3FISA 3CDIA 3F7WA 1GZKA 3FMKA 3UOJA 3WYYA 4TW9A 4EK6A 3JTHA 4HA8A 5BPYA 5JI6A 3D7TB 3LAUA 4PMMA 1FIAA 4JRVA 2XGDA 4WG4A 5IA1A 2WBMA 2DO7A 2QD9A 2JEDA 2K86A 3PLAE 4S30A 3KK8A 2PJPA 3BHUA 4P4CA 3R83A 2CO5A 5EGOA 4NQWA 2AO9A 4B43A 3OSGA 2PUPA 2W17A 5IUIA 4G6QA 5IQHA 3RNYA 1J7UA 2Q1ZB 3DTEA 3E62A 5A46A 4Y95A 3FLZA 1MH4A 1GY3A 1G3YA 2VI6A 3AGLA 3VS0A 2WTKB 2O0YA 4XP0A 1FOKA 5IH4A 3K9TA 3L2QA 1X19A 2XHKA 3VNTA 1X8BA 5ILVA 3W0SA 1EH6A 4FTAA 2ESHA 1F36A 4YGAA 3OOUA 4I1ZA 3ZSHA 2VKHA 4GH2A 2XGCA 3PPKA 4G34A 5DOSA 1H24A 5BVOA 2CPKE 3R21A 4O22A 5JHFA 1QPDA 2P5LC 3F6OA 1A9UA 3TW6A 3TOBA 4QMSA 4A4OA 3VQUA 3FZ1A 3E7LA 3R8ZA 3IPHA 4M73A 3UDTA 2WTJA 3W16A 5LEKA 4LM5A 3HA8A 2VODA 2VPLA 4O0UA 2CHLA 1JAMA 2IXSA 2IVSA 1LE8B 3R0TA 5DA3A 4ZZNA 2XRUA 3SQQA 1QZEA 4WUNA 3P7NA 2QYOA 1U8RA 3BYOA 4W8EA 3QTWA 3A7IA 4CYCA 1J1BA 2HQNA 2EB7A 1G8XA 1QGPA 3TJDA 3H36A 4ARKA 3Q3SA 5ETIA 3R00A 2QG5A 2DMPA 4Y17A 2VO7A 4IB1A 2OW3A 4A0XA 2OZAB 1OPJA 5K5QA 2GIZA 4G7ZF 2BTSA 3E6BA 1B59A 2L7KA 4APCA 3AG3H 4QTRA 1EA3A 1USSA 4LMYA 5BUIA 5DI1A 2X39A 4KJZA 4GK4A 2E34A 4GVAA 3GX4X 4E7SA 2C6OA 2DA6A 5C44J 4ENKA 2QCOA 2H34A 3M42A 4FKVA 1JSTA 3H9QA 2C6LA 3DS6A 1S5LC 2HFHA 3A4OX 5F64A 1JKLA 2UW6A 3GTKJ 3KLOA 5DT3A 4D55A 1WSUA 1JTXA 5IT9Z 1YWNA 2VTQA 2BW3A 4AWXB 3W3CA 1SMTA 3LJ2A 3PUFC 3VS4A 1Y8GA 5HNHA 3GVAA 2G15A 5EKNA 3DAJA 5LHHA 2V9VA 4KINA 1MBFA 3EQLF 5HORA 5C3EJ 3DOGA 4XORA 3W1FA 4I41A 4D9UA 2JA2A 1FC3A 4FTMA 3T9IA 4AVZA 3BQZA 3MKYB 2H6CA 3NNVA 4BXFA 3ZH8A 1MSEC 1GZOA 2HWVA 2E19A 4F1OA 1BL7A 2X7GA 3DJ7A 4A3IJ 5FEEA 2VT2A 3I81A 2K5CA 3WGIA 4C2MJ 1ZWSA 1TWAJ 2VX3A 3ZN0A 1XR1A 2UV2A 4YR8A 2Q2EA 2LKPA 3LA7A 4A3MJ 3RINA 3QKMA 2GQQA 4FKWA 4XBUA 4ITHA 4MD9E 1SD7A 2PUIA 3DK6A 1JBPE 2BFYA 3GTMJ 4KIQA 2YHVA 3BT9A 3AT3A 3JPVA 4IX3A 3AKZA 3EQPA 1E2XA 1JSUA 3BJOA 4EZ3A 1U0JA 1MBJA 2KP6A 4YIIA 4AT5A 1IJWC 2LH9A 3FBIB 2QOLA 4G16A 5I9ZA 5CVIA 4YJUA 5AV2A 4EQUA 5IQCA 2G7UA 2W1ZA 3ORZA 1SMYF 5EGOB 4NQWB 1YI3A 2VWBA 4TWCA 4A3BJ 3P5JA 5DIAA 4RAZA 3AMYA 4FIIA 3CLOA 2EJRA 3N97A 1UMQA 2XVDA 4G9YA 5BPIA 2O5RA 2IJLA 4UALA 1K83J 1KE5A 3TV4A 3KXGA 2DN0A 2GNFA 1TWCJ 5GINE 4MXAA 5CVRA 2WMRA 4IIRA 2DOEA 4GKIA 5E9EA 4FUYA 5IP9J 4K77A 1R4NB 4FG7A 2R3SA 5L8JA 2P2IA 1R9TJ 4CVAA 1JKTA 2R3FA 4WO5A 2VE8A 5HVJA 2HDDA 4FE4A 1FLIA 1TNTA 1I27A 2P7CB 5CVFA 2NXNB 2XS0A 4FV7A 3KEQA 3HECA 3MB6A 3V5TA 1JKRC 2O9LA 3R8UA 4ZTLA 3NEWA 1KQ9A 4FVQA 3PYYA 2YX7A 1R49A 3F88A 2QODA 2DYRH 1U4DA 4B3XA 4GRIA 4CSVA 3TXOA 3TQNA 1HCKA 3TT0A 1Z57A 2ZB0A 5CF4A 3A0HC 4IDTA 1EF4A 2BXZA 1DGWY 1YW7A 4TN6A 2LY2A 2JBOA 5C8NA 4MGRA 3D14A 1R23A 3FK7A 4G31A 3CGOA 2DI3A 1MRVA 4CSWA 2EK5A 2EV0A 1EH8A 2OG8A 4GIIA 4BKJA 5KVRA 3DTIA 4LLGF 1LR4A 1MDMA 5IP6A 2JZYA 3LW0A 3FXWA 5AP3A 4MEXF 5J9YA 3WTWC 4DW6A 4BDJA 1SAXA 1OL5A 5DEWA 3V5WA 4IW0A 2VWXA 3CS9A 3HP5A 3LCKA 1XGSA 3HMMA 2NAZA 3H9RA 4I6ZA 3QP5A 1SVHA 4TWPA 2ZV2A 3S3OA 4AXAA 4JX4A 3BR3A 1S8NA 1WBOA 2YM5A 1ERKA 5ICFA 1OVEA 3PIZA 1E17A 1XH7A 3BL7A 2XARA 3GXLA 3TM0A 3G0EA 3I6UA 1LB2A 1X3UA 2BW3B 3I0TA 3MY1A 3OBJA 4S2ZA 4ZTFA 3V8JA 2EA2A 2H6DA 3BWGA 2ITTA 4FKIA 5HBEA 3LMIA 3H0DA 2L4AA 3V3VA 4KISA 2PMZN 2OJIA 4YLKA 4AWIA 1GDTA 3HOXJ 4MKCA 2V26A 2D45A 4FSRA 3CMEI 2B52A 2OIBA 4LK0F 3FI2A 4QPAA 4F9BA 1LQ1A 4YIFA 3QX2A 1RKWA 1V54H 3BTJA 4L0YB 2JKMA 2AQEA 3FM3A 3D0EA 3OIQA 4C58A 3HRTA 5GTIC 3AL0C 4M14A 3ASNH 2Q2EB 4NC6A 1Q5KA 5HVYA 3NUAA 3RM6A 1QZYA 3K1MA 1J75A 3RCJA 4CZZA 3LSGA 2YM4A 2CG4A 3F3WA 3OEZA 2AYPA 1Q61A 3L9PA 5GPAA 4JQEA 1SFKA 1IRKA 4I6LA 4FTTA 2LGCA 3PIOF 3V01A 1YHSA 4QP9A 3O8GA 4G9RA 2JA5J 4KITB 5J4VA 3BDDA 4N9HA 3ZEWA 5CEPA 3QWJA 1ZARA 4RX7A 1WBVA 1PYVA 2VPRA 3R1YA 2DQLA 2BV6A 3U6IA 3VYTB 4E6AA 4M97A 3W33A 1D0XA 4NNJA 1ON1A 2PTKA 3D15A 2L7MP 4FYNA 4JQ8A 3I0QA 4FEVA 4E6DA 2HQRA 4YFKF 3AKLA 4ZLZA 1UJ8A 2L7ZA 4CXAA 3QFVA 4WXHA 4XJ0A 4EJTA 3BTCA 1PYXA 3ZTXA 3DB8A 4TYHA 2PVHA 3UYSA 1R1VA 5E8GA 3WF9A 4FKGA 3FMRA 2JA6J 3PPJA 3UJGA 4J00A 2ESNA 1XMMA 3OYDA 1U9OA 5F1RA 3U54A 2WOUA 5D8LB 2R7TA 4XLNF 3LSHA 3ECHA 3HC7A 5HTCA 1IASA 2UZUE 4H39A 2XDVA 5ANGA 2QLZA 4KIPA 1BI3A 2IPQX 4D2SA 3DFGA 3FXXA 5AUYA 4EJWA 4CDGA 2Y9YA 4M3QA 4O0TA 2PMOX 3GFLA 3VS2A 3FY2A 3I4NJ 3EZVA 5M3FJ 4G3GA 4CG8A 4DGGA 1VNDA 5DM6F 2XJ1A 3I5NA 4FTHA 4PL3A 4FV8A 2C6TA 3MIYA 2HDCA 1FOXA 5HLIA 4ANSA 4IWOA 3S4QA 4B0GA 3OT3A 1ZYJA 2VOPA 2J0MB 2E1CA 4CMOA 3JR1A 2VN9A 3FLNC 3KPHA 3FZVA 3LA3A 4M3BA 3GO5A 4I76A 2PLYA 4QTCA 5AX9A 4CV9A 2JDTA 5CXHA 1R5GA 5KHWA 2OJGA 3CLYA 4ASXA 1MDMB 5BVNA 4WRSA 3CEKA 2P5VA 5FP5A 3FX3A 1WJAA 4FODA 4RWIA 5C26A 5J4YA 4B8XA 3JRDA 5DUIA 2B53A 4YLLA 4I5CA 2VWWA 4Y7NJ 3OG7A 3LSPA 5FBNC 3HV3A 5GJFA 2GNIA 5CZIA 3WILA 3ZBXA 3D5WA 3EUKL 3UIXA 4FZDB 4TRLA 5FLFA 1SVEA 4E7LA 3U8WA 1ORKA 3OMVA 1AU7A 4ACHA 3QPHA 2NVTJ 3M2WA 4FICA 3OWPA 3V5QA 2Z02A 4R7IA 3ABKH 3ZDUA 1OKVA 4MNFA 4D0PA 5GJDA 3ANRA 2ZJQF 1OPKA 1MBEA 3H3CA 1BX6A 3NFFB 3V5LA 4Y73A 2EFOA 4FNXA 4RJ6A 1ZHFA 4XRFA 3TDVA 3UC3A 2RFEA 2R64A 5IY5H 1NH3A 3BYSA 4KDPA 2WD1A 3BYUA 2Y0SA 3VC4A 1S9JA 3NWSA 2M4GA 4YHTA 1X3ZB 2EUFB 3TUCA 4Z7GA 2VV9A 5E1SA 4IAKA 2UXNA 5K5NA 4DG0E 1YXXA 4FYOA 2DOFA 2MYSA 5EW9A 3TO9A 4OTRA 2IVMA 1S7AA 3W8LA 1I1SA 2VU3A 2GAUA 4MVFA 4K8AA 4HG2A 4NH1A 3JYAA 4XIDA 4R5YA 2WTKC 3F2NA 3QCSA 1XO2B 4AN9A 3DB6A 2YA9A 3TNPC 2BZTA 1JKQC 2P3GX 3U51A 2F7EE 3PJ3A 4RIWA 2X2LA 2H1LA 3GCSA 3CCQI 5M44A 1PXNA 4AUAA 4N9IA 4LMNA 4RVTA 1P4OA 4OINF 3AT2A 1FYKA 2W1CA 2WU7A 2BVAA 3IAS2 3GCUA 4JI9A 1LVKA 3OD6X 3K4MA 4CCBA 5CPRB 4AAYA 3ZUUA 5IPAA 4ABZA 1D0YA 4NCTC 3CR0A 5LD2C 2Z2SB 4J8NA 1T08B 3R7EA 5HIDA 3K5UA 4P5QA 2W1EA 4BEHA 3QZHA 3VF8A 4UVAA 5H8EA 4BHCA 3BGPA 4TYHB 2ITNA 3Q9XA 5E7RA 2J0IA 2HU9A 2MLGA 3V8TA 2PX9A 4TTHB 3ZUTA 2X4HA 3NNUA 4N6ZA 3GC7A 3T3UA 3RQ4A 3EYIA 1H26A 3BG6A 3OYLA 3DBEA 2CKEA 3AMBA 2GXBA 1G8JA 2ELKA 5CI6A 1PHKA 4ANQA 2XGXA 1IN8A 2HXQA 5DHJA 3DXPA 3OOPA 3ITZA 3ZBFA 4I01A 2K9QA 4ESFA 2ZM3A 3CTQA 1PMNA 1I39A 3Q9SA 2JMWA 3ZQ7A 3VONA 1OKWA 3D5XA 2FNAA 4CFFA 2DPUA 3LSTA 1KUTA 5FD6A 3FLSA 1WKMA 2F4JA 3GOKA 4EH8A 3S0OA 1PKDA 4USEA 1FOWA 3ORMA 3BKBA 4EKKA 2ECCA 5EYKA 3VWAA 3KULB 2EA4A 2EZKA 5DE2A 2LOOA 1IEPA 3KP7A 3E5QA 1PVEA 5F0CA 2JD5A 4HNVA 2VTIA 4AA4A 4BCPA 5A6OA 3HVCA 2C5YA 1MSFC 2F57A 1X1DA 2RFDA 2R3GA 3TOAA 1HW5A 1P14A 5DTDA 5CI7A 4RA5A 3RALA 1VF9A 3OVVA 1LFPA 5FLXZ 5LFAA 5HGIA 1S9IA 3L8XA 5F20A 4A06A 4F09A 3AT4A 3BZCA 3VS3A 4M0YA 2CSOA 1B39A 3LFUA 1VQ8I 1UU3A 2F49A 5ACBC 4DGOA 2WEIA 2LMDA 5JFRA 2O8YA 4QWQA 4TWOA 4NW6A 2L3DA 4FE2A 4ZZOA 3FMMA 4LOCA 4ZTMA 5IMEA 1FJLA 2C5XA 3QTQA 1XH9A 5G1XA 4LD5A 3VIDA 5HX6A 3DDQA 3HM5A 4CNHA 2XV4S 4YTFA 5BVKA 4F9YA 3JY0A 4I0BA 2PE2A 2YCRA 4FTUA 4X21A 5CENA 3K2AA 1T56A 3MWUA 1HKQA 4E5AX 2PVFA 2VO0A 2CMWA 4W4VA 2F2UA 2OKRA 4RGRA 4U7BA 3VUKA 3VEPA 1FWZA 9ANTA 4R7BA 3DGKA 3NW6A 5D7AA 5ANJA 4FKSA 2VBZA 1ZGWA 3KXXA 1RETA 1MUOA 4EJNA 2GXGA 4XH6A 3LJ0A 1T0FA 3LAPA 1XS9A 4HDUA 4N4SA 2XJ0A 1MNMC 4XKVA 2A6EF 3W0PA 1IV8A 2P0WA 3K5VA 3MKWB 3RGFA 4BB4A 4CA0A 3P9CA 3OYJA 1JPAA 3PSCA 3K2LA 3PFIA 2XRWA 4WXDA 1GNGA 5CU3A 4MWHA 4RIWB 1G8KA 4BS9A 4IX5A 1TNSA 3VRZA 2WGJA 4RLQA 1WBWA 4U43A 1R1WA 1PXKA 2QLUA 2WC2A 4RFZA 2RKHA 4BBRJ 2B0QA 4O0XA 1I50J 3T3VA 4NHJA 4IM3A 3BR2A 1VQ6I 5LMBA 4KUJA 4YTCA 3R02A 2V6EA 4XLEA 3MH0A 1TP4A 5HS8A 2XROA 4CCNA 4J7BA 1JLUE 3FHIA 1U78A 1YOJA 2EZHA 4E93A 1QPMA 5BOXA 1B72A 4IFCA 4EH4A 3W0MA 1OPLA 4Y8DA 4BEHB 4QMWA 5E8TA 4F1TA 5BYYA 5B7VA 4EQQA 3O7LD 1JTYA 1G3NA 4NC8A 3FQHA 1CTPE 3OIPA 1BC7C 2H8RA 1FOYA 2FGIA 4BJJA 1UFMA 2R93J 1LDJA 3FLQA 2FNPA 4BZOA 2JC6A 2VUMJ 3PP0A 4IANA 3R7IA 5HE3A 3PXKA 1CF7A 2HYJA 4RM3A 4XLCA 5HDKA 1IV6A 1PP8F 4AG8A 3H3VK 2UZVA 4B7TA 4F7NA 4R78A 2DMNA 5I9YA 4XOZA 4C4EA 5I9XA 2CDZA 2FX0A 4A9RA 4IQ6A 5HX8A 2QC6A 1Y1WJ 3EL7A 1IXSB 4XG7A 3OYFA 2VTOA 2O3FA 1P2FA 3H5NA 3U4WA 1EV7A 4ZZDA 2STTA 3G1OA 2M45A 1Y0NA 5HCYA 1K79A 2P4WA 3LCTA 4RC3A 4BKXA 4RMZA 3NUPA 2Y6MA 4D58A 3QRJA 2R9SA 3GF2A 1ACIA 3QYFA 4MNUA 3U2RA 3WTXC 3LSKA 3DZOA 4NT4A 3JREA 5D8KB 5EM7A 2E7XA 1Q99A 1Z5MA 2WFYA 3LM0A 4F55A 1MNDA 1U9NA 4O0WA 1IG1A 2VC0A 3C0IA 4LOQA 1H27A 4I09A 2F4IA 1ZGJA 4QYHA 3G9LX 5E8VA 2A27A 4DZPA 2ZMEA 3C2GA 4L3LA 2JBPA 3SOAA 2BHHA 1QHGA 2VWUA 2PBIA 3PVGA 4DDIA 4Z9LA 1R00A 3LKMA 3A60A 4RZWA 4C2VA 2VJ5A 3S1NJ 4RLKA 1WBTA 3O8HA 5CEQA 3GI3A 4YIRX 3ALOA 1JNKA 3RKYA 1M2PA 2IZTA 5CU6A 4I21A 3RPOA 4E6KG 5L2WA 5KCVA 4CCJA 2XIKA 2G7HA 1H8FA 4IX6A 4BQQA 3C2HA 2O7OA 4NIFB 3W2CA 3DBLB 3RK9A 1FSHA 2BOLA 4A69C 3O8TA 4K2EA 2OF2A 2X6YA 2IRFG 4EHEA 2FE3A 3GOPA 4Y5QA 3K4BA 2H8WA 4O7YA 1IC8A 3CLQA 4AFEA 4WWCA 3QX4A 4FG9A 1REJA 2VTRA 4FG8A 3F9KA 1STZA 3QD3A 3QLFA 5FLMJ 3S3IA 3T9TA 2JT1A 2PSQA 1A35A 4TYJA 4CKJA 3W0QA 1E9HA 3CKWA 4F4PA 1KV1A 2OZUA 3CJNA 4XV9A 2WY7Q 3EN6A 3CP8A 3B8RA 5JLWA 3BU6A 4PZJA 4X2JA 2G0EA 2ELHA 5JSMA 4XK4A 4LLLA 2PMIA 3EFJA 3DU8A 3C5UA 3P5JC 4OWRB 5M5WJ 3E8NA 1ZN2A 1H8AC 3J7ZI 4AXEA 4BBMA 1L3RE 2DLLA 4OTHA 3QQFA 1UU8A 2IZRA 2O2UA 4AACA 1Q1VA 5IG1A 3HV5A 2VB6A 2C3LA 3OV8A 3WTTC 3LAJA 2CCHA 1IRGA 4CGAA 3HPHA 4AC0A 4YJRA 4J8MA 1BIAA 2RG6A 2CJMA 2DMUA 3JUHA 2PMUA 4AQKA 1SD4A 5BNJA 3FKOA 1CKIA 4Z16A 2EBIA 5GHVA 4BR3A 4RFYA 5IQFA 3E1SA 4HV6A 2HYGD 2CS3A 5LVNA 3FXOA 2XAQA 2FSMX 5BVEA 4ENJA 1Z7LA 3MH3A 1DPRA 4FISA 3PDTA 1H08A 3VS6A 3JSPA 2R7BA 4JBVA 3TZMA 2W25A 2CV2A 2DT6A 4IHSA 3CD8A 2RREA 2K27A 2JKQA 1B72B 1MMGA 2CFXA 3G33A 2UUEA 3OXIA 3WF7A 2ZJWA 2WY8Q 2DA7A 2EV5A 4DFZE 3QOPA 4PWNA 3H0ZA 1XSXA 4BI0A 3AD6A 4U7DA 4BJJB 3DKWA 2D1VA 3UTOA 4CHUA 1ZKGA 1WCMJ 1CF7B 3KYCB 4FIHA 4CG9A 2YU9J 4QT1A 5CAPA 2DS1A 5J1WA 5FROA 3E92A 4BYYA 4BU2A 5IQDA 5J8CA 1ZG3A 2EXMA 3H9FA 4DCAA 5HLTA 1Y6BA 1YX3A 4F0FA 5CF8A 3C7QA 1RRJA 2DK8A 4W8DA 4XRMA 5L8KA 4FETA 4C4IA 4FKOA 3IUOA 3DAKA 3UDBA 1QPJA 4FTKA 4RM2A 4BHBA 2IT0A 4BY1J 5IEYA 4DNCA 2UZKA 3IO7A 2WNTA 4IVNA 2JPCA 4L68A 1OPCA 1OIRA 2VNWA 1RUNA 4XV1A 2E9OA 3LFEA 2EINH 3IDCA 3MN3A 1NHAA 4FNYA 4B3AA 1FGKA 3Q5IA 2Y75A 3ULIA 3EFKA 3VBTA 4BE2A 4ZS0A 4E20A 5JR3A 1OGYA 3NW7A 4EUUA 4YP8A 2WXVA 2ZMEB 3SV0A 3VYUB 1T38A 2E1NA 5E8SA 5HVKA 3L2VA 2BYVE 1PF8A 3E7OA 3MVLA 4K6ZA 2YJRA 3SW7A 3BCAA 4YMJA 4NTTA 3KFAA 4XLIA 1ODDA 2WQMA 4XKBA 5J7HA 2PE1A 3A8XA 2Y30A 1E0EA 2WIPA 3F5UA 3FL4A 2B7EA 3BR1A 3KP2A 4FVRA 3W6VA 3F8CA 2XSJC 2NOGA 1AOYA 3E3PA 3GB2A 2XANA 2PZ5A 4GVJA 4YC3A 2AHQA 3L1SA 1A48A 2ZJ2A 4HQEA 1X1CA 4RA4A 2ZSIB 3CJRB 3ZXSA 1UV5A 3W10A 3BC8A 3Q6UA 2C5VA 5HBJA 4CT1A 2R5ZA 5HE2A 2GCDA 5AFVA 1IXRC 1SFOJ 2VASA 2DYSH 2HOSA 5IQBA 2EVAA 3F3UA 4H36A 3WZUA 1U6GA 3QWLA 3S2DJ 2KKOA 4ZDOA 2XJ2A 2ME6A 2XRNA 3ERKA 3ZMDA 1HC8A 2Y7JA 2MA3A 2K9LA 1YXSA 2R7DA 3MFSA 1IAHA 3RPRA 3W2QA 3D9VA 4ZY4A 1FYMA 2OFVA 3DXNA 3TDUC 2YN8A 4HNTA 2JN6A 3KETA 2YM6A 3MVPA 4EM1A 4FL2A 1J1CA 3VW8A 3I3LA 2Y0AA 1Y56A 2JITA 5H2FC 3PXQA 4F9WA 4XG4A 3ZU7A 4MAOA 2W9FB 5CU4A 4BF2A 5L6PA 4MFDA 4X2FA 5CALA 2OF7A 4QMMA 4IB3A 4C2WA 2ECBA 3E3BX 1HDDC 4E26A 2VWZA 3IWZA 1W84A 4DCEA 4EKLA 2M8EA 4CZCA 5D5WB 2OCCH 5E1WA 5KMNA 3MFRA 4LGGA 5IOZA 3ZQHA 3AG9A 1VTNC 3BJAA 3VQHA 2HOEA 4YZBA 4GYGA 4NK9A 2Z5UA 4A9TA 4NW5A 4GMYA 3P4KA 2W4SA 1UKHA 5CAQA 3BPRA 3AOXA 3CCYA 2ME0A 5D5VB 1Z3XA 3G9NA 2OF4A 5IU2A 2AC5A 2HZ4A 1WJCA 5B2MA 2LP0A 1R78A 2QHNA 3FF5A 3BV3A 3PSBA 5H8GA 4M69B 4CCKA 3NUNA 2YX4A 3EN5A 3JAMK 3MTFA 3V5JA 4RGSA 5I9VA 1SVGA 4QQJA 4C3RA 4BXXJ 4ENYA 3OF0A 2EFWA 2OXDA 3OYCA 3Q04A 3KCKA 4R1HA 4IHVA 2GFCA 2L9RA 2DUVA 3A2KA 2BKKA 1XMAA 4QNYA 4DF3A 1SFXA 5CSXA 4MBJA 3IGGA 3ABMH 4AT4A 5JHUA 1SC7A 4I4FA 3FXUA 5C8KA 1I1GA 3M3YJ 4N0SA 4OLIA 2R3IA 1T6SA 4P55A 3P1AA 4HOBA 4C0TA 3EIDA 4IJAA 5IPJA 1JT0A 5LHGA 4KYWA 3G1MA 3T1BA 1VQPI 5E79C 5F1ZA 4CFWA 1O9UA 2R7RA 4O0RA 4W4WA 3WI6A 4RWLA 2I5UA 4LG3A 2F4MB 3ABLH 3R8VA 5CY3A 3PO2J 2XAJA 5IISA 5B3SH 2PZIA 4NUBA 4ZLOA 2C69A 2NRAC 4PQNA 2O65A 2IBDA 2EPFA 2X81A 2EZIA 3E63A 4XLVA 3T8OA 3F0CA 1I3QJ 3OC1A 2WB1A 1LDKB 3C4XA 3FMHA 1UG2A 5AP4A 5FKOA 4IVCA 1AKHA 1V0PA 2DXIA 4QNAA 4EK4A 3A62A 3Q96A 2LLKA 4IFGA 3IRRA 2V79A 4EOOA 3MZYA 1JKSA 4EK5A 2K02A 3L2WA 5HLGA 4U7ZA 5AIQA 4HVHA 2RQQA 3GTOJ 3FMJA 3UC4A 2L9VA 2AQFA 3OL4A 2DU9A 1TZLA 2W0JA 5AV0A 4H0EA 4U6RA 5AAGA 2QOIA 2K85A 2R5ZB 3LXPA 5HG8A 3DBCA 5AEPA 4XBFA 4YO4A 4L18B 2ITXA 4FK3A 4CFXA 1LPUA 1KE6A 1D5YA 2O0UA 4RLLA 2OJFE 4UY8I 1X2MA 2BHZA 2X48A 2UV1A 4CKRA 4ZEGA 2OWBA 2XYNA 2YIXA 2BRGA 4IAIA 5J9ZA 4KRCA 2CUFA 1IF1A 5HKMA 2COMA 3O2MA 5IUHA 3DQWA 4M9SA 2LAVA 1VLRA 4EH2A 1WGXA 4V0GA 1G2HA 3F8FA 5E1XA 1WI9A 2AC3A 3V6RA 4GV1A 1VQNI 3ROCA 3PJ8A 4U8ZA 2GTMA 4U87A 3FEGA 4A12A 3LSRA 2V62A 4DFLA 2K4BA 5M3MJ 5HVQC 2VBWA 2R3KA 2NRYA 4XS2A 3PRFA 5C01A 2WZJA 4FA2A 4DYQA 4LMUA 3MFUA 1EJ9A 4U0WA 5H20A 2X2KA 3RAWA 4UZHA 2VJ4A 3P79A 2H96A 3AQVA 4OTGA 4QPSA 2ITOA 4QYGA 1UAAA 1BA5A 4UVCA 4HAMA 2X0GA 3PQJA 3GU7A 3HMIA 3NNWA 3RJPA 4M7IA 3H5RA 1ZRDA 1ZLJA 1JGSA 3HV4A 3RSNA 2GXAA 2NS8A 3O96A 4A5MA 4UXNA 1XGOA 2BVLA 4F1MA 3DWLE 4G94A 1R22A 1XMKA 2STWA 2BDFA 4UXQA 2ZAZA 2XAUA 2MH2A 3JRCA 3FQEA 3NYNA 2PULA 3RK5A 2L5QA 3WZKA 5EKOA 4Q2AA 2BE5F 1H25A 4OTWA 4HGSA 5JRSA 1UHWA 3C0HA 4TYIA 4CFUA 4RPVA 2IA2A 1W36D 3CQWA 4GSBA 3DJ6A 2GLOA 2BRNA 4AZWA 3DBDA 1YITI 1IR3A 4CH7A 2GNJA 2NVYJ 5JT2A 2WAJA 1UU9A 5JFVA 2C0IA 1MQ4A 2RIOA 3CPBA 2A2AA 2ID6A 2P5KA 3JRGA 5KUPA 1U54A 2YU3A 4FKPA 4HPTE 4TXCA 2BAQA 1BMKA 3R2YA 4EH5A 1H01A 2CN5A 3NAYA 1IA9A 2V55A 3OW3A 3PY1A 1YE9A 4XN0A 4IZ7A 3H0GJ 1N75A 1OUKA 4LUEA 3J80K 3C4EA 2WQOA 2J0KA 4KD1A 5GTHC 2V1UA 2CU7A 3ORPA 2FUMA 3K7AJ 3R04A 3OL3A 4UV0A 3ZONA 5EI6A 3OT8A 4Y3OA 3TZ8A 1MMDA 5EW3A 2O03A 4QMQA 3WODF 3G0FA 4N4NB 1B38A 4RA2A 2VUWA 3UODA 1R36A 4MX9A 3R1QA 4OBQA 3B6AA 3K10A 3GNIB 3I79A 3CQUA 5I9UA 1T0FC 4L53A 4RAYA 1OL1A 4WUAA 4AZEA 4M6XA 2YAKA 5IYDJ 3F69A 1QHHD 1MRUA 1AKHB 2LDUA 2JSCA 2E9UA 4XQFA 1WBNA 5LRSA 4JR7A 3FDYA 4KSQA 3RYPA 2BRHA 3A01A 4RRVA 4GU6A 1VJYA 3AC1A 3GUDA 4X6QC 1W7HA 3RMFA 4QLCU 3CJTB 4HQMA 4D7NA 3DV8A 1J09A 1MMAA 2Z7QA 3Q2JA 1O4XA 1LUFA 3L9NA 4KS7A 4YJNA 2QQ8A 1HF0A 4EC8A 2W1FA 2ETRA 4ALUA 2MH9A 2DT7B 2HZIA 2XEYA 5TISC 3TIYA 4B99A 3DAEA 3EQIA 4J98A 4IB0A 3C13A 4ACCA 3OCGA 1ZYCA 3UIBA 2W96B 1X4PA 5HLPA 5AP1A 2MC3A 4PDPA 4YBKA 1KWPA 4A3FJ 2VJJA 1LJ9A 3G71I 3M8FA 2BDWA 5KHDA 4BVUA 1YHQI 1RPWA 4KA4A 3DNDA 2PVMA 4LJZF 5LRRA 4V0GB 5DD4A 3BHTA 4ZJIA 1MBKA 1H0WA 5DGZA 3D0SA 5E18F 4M6YA 3A7JA 3EQRA 3PA5A 5JN2A 1ST4A 5KAFC 2Q0NA 5HG9A 4PDOA 2C0TA 3ID6C 5FM2A 4MYGA 3AC3A 3AC2A 3M1SA 3F8MA 1HKSA 5AUUA 1WI3A 2QKWB 5LMAA 2RGVA 3FKIJ 3DKGA 4JLCA 1WH7A 1DU6A 5ERIA 2M1BA 2HWPA 4BICA 4HYSA 4YTIA 2KIUA 4II2A 1Y1VJ 3MPMA 3D5VA 4HGTA 4TV7A 1FINA 3D83A 1IAWA 2BVMA 5F94A 2JUCA 2VKDA 5DD8A 4A9YA 4M3FA 4RIOA 5IZFA 5F0HA 4RJ7A 1Q8UA 4O82A 4ERKA 5CAUA 3NVKI 5IYCJ 4GO1A 4O38A 1ETKA 1J0RA 4QMYA 3R1SA 2FO0A 3FPQA 4BIBA 2D2WA 2W24A 2C4GA 4WNMA 2XKDA 4AOTA 5HCZA 4PFPA 2ZMEC 4FZ6A 4J19A 3MB7A 4QMUA 3OXTA 5CASA 1ZRZA 4C4FA 4FUXA 1YIOA 4D4YA 5HEZA 1QQIA 2R4GA 3LSMA 2WAQA 4AW1A 4HYEA 3VRYA 1X1PA 2L2OA 5J1RA 3LFCA 4RLFA 3VFZA 3LXLA 2W1OA 5F04A 1Y6AA 2MD0A 3FIWA 3BCEA 3HV6A 4QP8A 5HTBA 3HOUJ 4UB7A 1K78A 3WYXA 1U54B 5ACKA 1PXLA 3Q4CA 3UO6A 4KIFA 3VUIA 3LWFA 4A3DJ 3AG4H 2EU9A 4DHJA 4L52A 4YJSA 4M3DA 2XEZA 1ZYLA 1E3HA 1HCLA 2IVVA 5EF6A 3ZGKA 3EZRA 3RJCA 3EKNA 3R9NA 2ZNYA 3OWLA 4FASD 4JXFA 3RWPA 4I6BA 5HLNA 4B1RA 4O84A 2XKCA 1NG6A 2RFSA 3FI8A 2FEZA 2RVCA 1UB9A 3GC0A 4CGZA 4DQ2A 4HF0A 3WU1B 2A69F 3NSZA 3BTIA 2DBBA 3TEDA 3KEOA 5JFSA 2X1DA 2OJ9A 2C5OA 3W2WA 2Z7LA 3R73A 4QTDA 4HGEA 4C36A 3RTPA 3DP7A 2YIWA 1YHWA 2UW5A 3VUHA 3ML1A 2EV6A 4G6OA 3C0GA 3IOKA 2GA2A 3O7LB 3R01A 4UY9A 4DGLC 2EIJH 2CGWA 3SX9A 3BJ6A 4EJOA 4ONAA 3SZPA 2IJMA 3QCQA 1U3EM 4TL0A 2CCIA 2R7XA 2G1TA 5BS6A 3A1YA 4RAFA 3NQOA 3A01B 5J9LA 2PZRA 4WCGA 4UUTA 2GNGA 1REPC 2ZM1A 3I59A 3PIXA 1SD6A 4HSTA 3QXPA 1QRYA 1ETYA 4M3EA 3D2KA 1GVJA 3S32A 5L3EA 5DCFA 2PMLX 5CWZA 3ZQGA 3FUPA 3LVPA 1IRXA 2Y0SN 3IH2A 2OJJA 2XNNA 2YZLA 1F1ZA 4E1ZA 1L0OC 2QUFA 3UDSA 3R0AA 1R5ID 3KN6A 5JZNA 5TO8A 4QMOA 4B44A 4LIUA 5EYCA 5J1VA 5TRDA 3S93A 3FWQA 3CJQB 5FJ8J 5GIOE 4UWCA 4HDVA 3LHJA 2VIXA 5CS6A 2XAOA 1WRJA 3F82A 4DEGA 2QF7A 1D1CA 3CD6I 2X6WA 3Q2MA 2BXYA 4EL9A 2M4KA 5CKTA 4EEFG 3H9OA 1GJOA 5CT7A 2NNYA 4X2GA 4DZJA 4XLAA 2OIDA 2IS2A 1K3AA 4NM3A 4L45A 4PDSA 4QEBA 2QU5A 4DYRA 2J5EA 1DQUA 4BACA 3S1RJ 3V04A 2ZJRF 2WAEA 4FSTA 2A5WA 2B0LA 1I6HJ 5FRNA 3M7GA 1P6RA 2DODA 3EUAA 4AGCA 3JRAA 4I99C 4KRDA 2KULA 1WJEA 3I4MJ 2WOTA 4FSWA 1DGRM 1ZZLA 2X85A 3OYNA 4GK3A 3I9V2 2HYYA 2OTJI 4ZS4A 5CU0A 3TZ7A 1PMEA 4C37A 3RI4A 2YDKA 4FV1A 3HXLA 3M1EA 4KMFA 4BHPA 3FV8A 4KNBA 2M5WA 3W0NA 1FMVA 5CNOA 3ZRMA 3IW5A 3DPLC 1NG7A 4QQ5A 4C30A 3KVWA 2H09A 4UVBA 3UP7A 4O21A 4XONA 4KAOA 3GFIA 4MNEA 4BCMA 3C7JA 1YWVA 4KIBA 1TBXA 1GT0C 1J7KA 2CJJA 4IHXA 5EI2A 3TEIA 4JDHA 5EEHA 2BZHB 3WTYC 4IM0A 1JJ6C 1XMXA 3ZC6A 4F99A 5CEIA 4RFMA 5AADA 3VVHA 3GU6A 3LFAA 2ONLA 1OLTA 4DINA 1P9QC 4GGGA 1K2PA 4C2TA 1PXPA 2A05A 3QYEA 2GM4A 4U40A 3WF6A 1B1BA 5J47A 4NFNA 1TC3C 4EOPA 5L3GA 3QRTA 4V19K 3S17J 1H9GA 3P7BA 1P4AA 5M07A 4X2KA 2VTSA 2M7BA 1K78B 1F3MC 2XNPA 1BL6A 1Q3DA 2XF0A 1WZYA 5DBXA 1IG7A 2CGUA 4BDGA 4QTEA 3CDLA 2WMUA 4J71A 4I3ZA 4FX0A 3Q5ZA 4FKJA 3W2PA 5LBQA 3Q0WA 5BMSA 2YACA 1XH6A 2DPDA 2GOMA 2ISZA 2YIYA 4CFMA 3ZO2A 3M11A 4YC8A 2FRHA 3ETAA 2VAGA 3DBHB 4AFJA 2F5EA 4XRJA 2ZCWA 5KHXA 4IX4A 2R7IA 5L3DA 1MW7A 3SGCA 3HSRA 1TVOA 5D11A 4BCJA 3PLSA 1A36A 3NRMA 5EDQA 3OTUA 2KDOA 2F5DA 4S0HB 3KCFA 5IT9K 1XCBA 3E3VA 4M15A 4N0BA 1FMKA 4NFMA 2UZBA 3QD2B 3R8PA 2W9ZB 5AAFA 1VZOA 3VHEA 4F63A 5FXQA 4BCKA 1VFCA 4FTRA 4CMTA 5M55A 1HQCA 1YW2A 5K1YA 1O3QA 3UO4A 3BYVA 2W5AA 3COHA 3OOMA 4I92A 3I59B 4PUZA 1UNLA 5HICA 2PEXA 4Z55A 1YLFA 2ITVA 3OROA 1JSVA 4NSTA 3I4PA 2CQ7A 3NIZA 3RPSA 1UZCA 4E7WA 4ITIA 4ZTNA 3WGGA 3KRRA 3W32A 5DYMA 1K61A 2EFPA 3EJ1A 1YOLA 2EIKH 3QP6A 5M5YJ 4XLPF 1D3YA 2CW7A 3ZMZA 3BTLA 4E4LA 2OJED 1Z21A 4PP9A 4YFXF 3ORXA 2L01A 3SEZA 3MEXA 4D4RA 2EFNA 3RTRA 3O5AA 3JVRA 4BE0A 3CTHA 4ZSGA 2HW6A 1X3WB 4ESJA 3KZIC 3FC2A 4MEYF 4F93B 2OICA 4DYCA 3WZDA 2EILH 3F5GA 3EOCA 3GBGA 3MVHA 3IGOA 5DRBA 2B9HA 1RDQE 2WKMA 2VBXA 3WE3A 3AKKA 4GCJA 1GLNA 4DHFA 2X4FA 2RF9A 3DLSA 3ULZA 4D1ZA 4GFBA 5CXZA 4AIHA 2J2IB 3VB2A 3E5XA 1OCZH 5F1JA 2HY0A 3E8DA 4NUSA 3PA3A 2RV8A 4R3PA 5E91A 1YDRE 3KMUA 2BPMA 4IJPA 3ACKA 3KRWA 3K1NA 3UZRA 1Q8YA 4QPQA 4FT9A 1GIJA 3ZFXA 4XHKB 3GQLA 1W8CA 1IRFA 3MV5A 3TYKA 1XH4A 4MNEB 5EM8A 4FT7A 2X6EA 1ZREA 3Q9YA 5ETFA 4B4CA 2DMTA 4KA3A 3J81K 4O3MA 4OAYA 2X51A 3KLNA 3J7AO 2XPWA 4BCGA 5CSHA 2V6CA 1PXIA 1HOWA 1PMUA 3HHHA 5CANA 2XZSA 4HJOA 2A07F 3GP0A 2J5FA 4N6YA 2MG4A 4FI1A 1OYIA 2WAFA 3ZO1A 4QOXA 4ENXA 3F9NA 4DTAA 1I5ZA 3S15J 1TWFJ 3FBNB 1RUOA 3NYVA 4GL9A 2I0VA 2LKSA 5ANDA 3L9FA 1YI4A 4U3YA 2H1KA 2A6HF 4L00A 3F5XA 4AGDA 5LGTA 3D5UA 2BY3A 3CF2A 4ACDA 3CC2I 4MXXA 3QHWA 3I5ZA 2PMNX 2GQSA 1V1KA 2ADUA 4XV3A 3DKFA 4O7SA 3KVXA 3CJFA 2GHGA 3R30A 4ZYDA 4A3JJ 4BYJA 3ML6A 3BRBA 5LEJA 4C4GA 2M8GX 2QO9A 1BOAA 3RHXA 1Y8RB 2I0HA 3CD3A 2V9PA 4K0YA 3LFSA 4CTCA 5K5XA 2B7AA 1LFUP 3FDNA 5EM6A 4A07A 3RPUD 4W4XA 2RDPA 3PTGA 3TG1A 2D5VA 5HODA 2W85A 2ISYA 1U46A 1ZMVA 3I7BA 3B73A 3G2BA 4QP7A 4QMXA 3SLSA 3LJ1A 1MMSA 5E3NA 1F0QA 3BLQA 1RW8A 5F6FA 5JGAA 4U79A 4DC2A 4IPAA 2KMUA 4B8MA 4BN1A 2C0OA 3PNVA 3KN5A 1OFCX 5AP7A 2HWOA 1FTTA 5D41A 2E60A 1TWGJ 2R0UA 4FKLA 4MLOA 5L3BA 3ACJA 5DH3A 4AS0A 5DT0A 2R7WA 1HLVA 4XN3A 4NZWB 2Z60A 5IEVA 3AC4A 4ASNA 2BMCA 5EHOA 3FK6A 4FEXA 3G3ZA 4FIGA 2WMQA 4XG8A 1K4TA 5AV3A 4ASDA 4EUTA 4FSZA 3TMOA 3OHTA 3LCOA 4BE1A 3KFWX 4L5IA 3WE4A 3MW1A 3R0JA 3F22A 3HYHA 1KOAA 2DT5A 2CQXA 5D6EA 3OSFA 2OSCA 5B5EC 4YJTA 4WD5A 5J5SA 2XIXA 3MVJA 3ZZWA 4RJ3A 4IWPA 3H5AA 1D1AA 5DR2A 1XG1A 2DMQA 3KEXA 3LSJA 2RNGA 1GIIA 2WTIA 3OMYA 3FMLA 1G8SA 4JYKA 3VBYA 1QU3A 2ZDTA 1PXOA 2WQBA 3VPRA 1ZLKA 3VUGA 3O8PA 3RM7A 4I94A 5C1QB 3UPXA 3Q60A 4DHIB 2E2BA 4L5JA 4ZDLA 4XL9A 3DV3A 4C4JA 2X4ZA 2KISA 3JRFA 3R4KA 4DN5A 4Q9ZA 1RI7A 2H6BA 5TGTA 1XBCA 2A4LA 3KKVA 4HCVA 5HE0A 4BTFA 4F7SA 1LUJB 4W97A 4KIGA 3W2SA 5DFPA 4C2UA 3A99A 1OKYA 2JVGA 1GXQA 2IW9A 3GTPJ 1ON2A 3GCQA 4MHGA 4QMPA 4XG2A 2XK8A 4YFNF 1W83A 2CGVA 5GAEJ 1YI6A 3TIZA 4R8HA 5AIPA 1H1RA 1FZPB 2X6XA 2JDRA 4LITA 4XYFA 1FYLA 3TUDA 4E7JA 3NAXA 1XSDA 4PFOA 3GT8A 4UYAA 4HX4A 3GW2A 3GEZA 4HW0A 4WIHA 4FL1A 3PIYA 3ZLSA 4XKCA 4BJ6C 2QKRA 4AXCA 3ZFMA 4JG8A 2YITA 4OMYA 5DPVA 4S05A 1ZQ3P 4ZTRA 5E8YA 4BI1A 1BI0A 3WZEA 3GU4A 1O3RA 4PNIA 2NS0A 3BLAA 3PRIA 3PUPA 4CMUA 5BVFA 1P2AA 1OCTC 4LDTA 3Q32A 4FZ7A 4AF3A 2Y69H 1MP8A 3DJ5A 3MPTA 3ZN1A 2WQEA 3HLLA 4HOKA 1YVJA 2O64A 2BFXA 5CNNA 2Z8CA 2B63J 3FPMA 2B4SB 3ZHPC 3GFMA 3QYBA 3C51A 4QP1A 4X6RA 4V2GA 2XIRA 3MH2A 3UR3C 3BHYA 4PNKA 2M7AA 5FQDC 3C1DA 2QQAA 3OCBA 4BRXA 4YZMA 3L8VA 3BG9A 3BX5A 4Q5SF 1ZLTA 4IEBA 5ED4A 4PMSA 3L7WA 2PU8A 3I1AA 4IACA 1G4DA 3NYOA 5FDXA 3WE8A 4UBAA 3PSDA 3Q9WA 5CTPA 2GSFA 2X6OA 1DAWA 5AV1A 3II5A 4MO7A 4BIDA 5KMJA 4OTDA 1VQLI 3OUKA 4LB5A 5CVHA 2FSTX 5C9CA 3ZR8X 1YJWI 3TDWA 4YZCA 4MD8E 3HB9A 2KZGA 3Q4TA 3OR1C 2FF4A 2M2EA 4I4EA 3O0GA 5JH6A 1ZYRF 1IW7F 1O6YA 4V01A 2OC6A 4RGUA 2OH0E 4IAYA 2DFEA 2MC4A 5CSVA 5EQPA 4QO9A 2PE0A 2XRLA 4UB6C 4RX9A 1NXKA 2CKQA 5E3OA 5AUVA 5JGDA 3H4JA 4S32A 2WU6A 3Q4UA 3IKTA 2XB0X 5TR6A 1SVLA 1QPIA 4YJQA 3HGGA 2JK3A 2FA5A 3ZSGA 5CVGA 1FY7A 2ZFUA 2V22A 1A04A 4A0YA 4F65A 2W84A 3W8QA 4A6DA 2NNNA 4C3FA 1D5VA 3QL8A 4Q5HA 3JAMZ 4O2PA 4CYCB 2CLXA 2ZMCA 5LVMA 3OYAA 2DYLA 2HS5A 4DEEA 2PZPA 4EWHA 4CQEA 3BGQA 4Z3VA 3EQHA 3CKXA 4EHGA 4BDYA 3FXQA 4KBKA 2JIUA 4MXCA 1PYEA 1GOLA 4U41A 3A7FA 3I5UA 4FIEA 4WF2A 2YZAA 1IAJA 1VQ4I 5I5ZA 4BGHA 4P2KA 2BZJA 3LFBA 3LZBA 2IW5A 3V8KA 3GTJJ 4HPUE 5BUJA 3LQ5A 3PJ2A 1F43A 1OCRH 1NK2P 2XGEA 3MKLA 1EH4A 2YFXA 5C4KA 3K54A 3NGAA 2HZNA 3MSSA 5E92A 5BPDA 3S3MA 3I54A 2BHEA 3TZ9A 1MZBA 2VTAA 3QKKA 3R6XA 4PY1A 5CVUA 4AGWA 1W5TA 1SFUA 4HLXA 1DI8A 1ZYSA 2X9DA 3CTAA 5CQUA 4EOKA 3GYHX 4DFUA 4AP7A 3NRVA 4AE9A 5CLPA 2Y4IC 3QQJA 4IAFA 4LRJA 1YYVA 1ZY4A 1PW2A 3LMMA 2G9WA 3S1HA 3NVMB 1KYZA 3RIRA 5HESA 3LQQA 5E8IA 4OAZA 1SVOA 4K9YA 2EH3A 3RNIA 3LLAA 3SOCA 2K4JA 3W18A 2CW0F 4NTSA 5EHLA 4MBIA 1QNTA 1V0OA 4C34A 4AXDA 3COIA 3L00A 2M34A 4XP2A 3MAJA 1MRYA 1ETXA 3CUQC 2VKVA 3BG5A 2Y48A 5IEXA 2GBYA 1DUXC 4ACMA 4MQ2A 4BY9E 1TQIA 1WBPA 5L6WL 3K70C 2FSOX 1FP1D 2HOAA 3SZGA 3HX4A 3QZFA 3HG9A 4C4HA 5E3MA 3W2RA 1YX5A 4MQVA 2PUNA 2WTEA 2WMWA 4DEDA 1QZZA 3P0MA 3WBLA 2JKOA 5A4TA 4L7SA 3EHAA 2QKMB 4DE4A 1T2KA 1P4XA 4YJPA 3BHVA 1QL6A 3HAMA 2HVSA 4X3FA 3MCZA 4GUBA 1APME 2DTZA 1T8IA 2A6TA 5LVOA 3KP3A 4X6AJ 2WTWA 3JTGA 5AA8A 2NYXA 4IVAA 3G15A 5GAGJ 4CUGA 4Y5HA 2QSGX 3JR9A 4YURA 3BBTB 3TNIA 2XK3A 4IWDA 3FY0A 2E71A 3ZRGA 1FIPA 4ZXTA 2I0EA 3W55A 4BZDA 4D9JA 5HNGA 5D6FA 3TN8A 2OGVA 3N51A 2GA1A 2WB1N 3DCVA 1FVVA 4TZRA 2Z7RA 4M12A 2QM3A 4OOIA 2H9VA 2W1HA 4DITA 2KL4A 3MN2A 3ZQQA 4IL6C 4HW7A 3N9XA 5FBOA 3PQKA 3RDIA 3NEUA 4D7MA 2X9FA 4MEDA 5EEGA 5DR9A 3VBXA 2PVKA 1E3PA 5L3CA 1TQPA 3K1PA 3LOCA 4FE7A 2PQ8A 1JKOC 2XM8A 1P7JA 2VTHA 4XOYA 4HNIA 3CZ6A 4IZYA 1CGPA 3EMGA 4BBEA 3E5AA 4UWBA 4AA0A 1HBXG 3CP9A 1BOBA 2CQNA 2E1MB 4JG7A 4JBQA 3E97A 1NA7A 3Q52A 1YG2A 3KYDB 4RGJA 2QOHA 4OBOA 4XNFA 1GV5A 4ANBA 4E4HA 1O7LA 5AP6A 3VWBA 2QGUA 2VWIA 2MABA 3BELA 1M1EB 5EHYA 3B2TA 2MFZA 4DBXA 1FOTA 4NB5A 2HZ0A 2C3KA 3OTVA 4O0VA 1HCRA 1APLC 3BROA 4MIMA 5CEOA 2RL5A 4R79A 3KK9A 3ZRKA 4IRGA 4GFOA 4FKUA 5LCKA 5FTGA 4IO9F 2V1DA 1IO2A 2K9MA 3NCGA 1J5YA 1T46A 2EB3A 4HRIA 4JX3A 3AFHA 2P7VB 2ITUA 3F8BA 3VS7A 2YEXA 4FV0A 1JOWB 3JRBA 4D28A 3WF5A 1JUMA 4O7ZA 5IQAA 4ACGA 4C7TA 1KA8A 2EWAA 2ONLC 3EL8A 1TQMA 3AC8A 3VBQA 2OIQA 2JQ7A 3NUYA 3D5SC 4FHTA 5GJGA 4PTCA 3CESA 3QTSA 3P78A 4D1QA 3QA0A 3IONA 4FV4A 3FSFA 3W6JB 1ZYDA 3NDMA 1U5TC 4DBQA 3O2PE 4R77A 4F6WA 3QYZA 5A2QZ 1IDZA 2L9SA 3PVWA 2QI8A 2X1CA 1MNEA 5IYBJ 4EV0A 2W1IA 2L0KA 2R3NA 4AD9A 4CV8A 1OR7C 1BI8A 4QP2A 4EJ7A 1B9NA 5HHWA 4AVPA 3SG9A 2HOGA 1MGTA 3C5IA 2Z99A 5M4UA 4IX7A 4XLHA 5HS7A 4NU1A 5D10A 4IWQA 3FWEA 5CSPA 3WZJA 2WEVA 3AD4A 3F3VA 3EUHA 2Y9ZA 5E1ZB 4GXOA 1PUEE 1YRNA 3PWYA 2HPMA 2LR8A 4ZK5A 4APPA 5AX3A 3HMPA 4Y52J 3LFKA 1NT2A 4IM2A 4GYIA 2GDOA 3I0OA 2LY1A 3QQLA 3KCCA 4G1WA 1Y6IA 4JS8A 5D1JA 2DFFA 5E90A 1TFFA 2W1GA 4U3ZA 4IRHA 5DM7F 3VSKA 4ZSJA 3VBVA 4TNBA 3SAYA 5B66C 3CP2A 3DLAA 2XK4A 5B2LA 1Y39A 1OIUA 3MFKA 1LNWA 3CCSI 3W0RA 4USDA 2CUEA 5TJJA 5ANIA 3VUDA 2XB7A 4R1VA 2A19B 4M9ZA 2QVSE 5AV4A 4X3FB 1H4LA 4C3HJ 2XMYA 3ASOH 2R0QC 2WMAA 4IKFA 4PMTA 2IG7A 1B6CB 1OITA 4DGMA 3FI3A 3K0LA 4FSYA 1GVDA 1Q41A 1A5JA 2GWRA 4HZSA 4E73A 1RESA 4QSHA 3NPCA 2GHLA 4P5OA 1ZR4A 4ZJJA 3QTIA 1YO5C 4JJRA 3R7YA 1QO0D 3ZCLA 3LNQA 2RFNA 3HSEA 3SYTA 2VJIA 4FSNA 3FZOA 5DRDA 3HNGA 4Q48A 2Y6OA 3QLGA 5DR6A 1ONVA 3E7VA 4O7VA 2DA5A 4IMYA 3U9CA 1W0XC 4GFGA 4IHYA 4A2UA 4G3CA 5HCXA 3QD0A 2YS9A 4EJVA 2Z9OA 4JQ7A 2JA8J 2ZV8A 2XALA 3UE4A 3OYHA 4DG2E 2IGOA 3QRKA 2XNBA 1I44A 2VC1A 4KABA 3LXKA 4ZC3A 2CV1A 2G2IA 5EYMA 1WFXA 2PY3A 3G6HA 2I8DA 2JWTA 1W5SA 3TW7A 1Z67A 4JOAA 5DNRA 5AUTA 4B8LA 4EH3A 1YS6A 4OMZA 2YCSA 2EQRA 1JJ8C 3P9JA 5L2TA 3DY7A 5BMZA 3RCOA 2PMHA 2CQKA 4AOJA 5DEQA 3MY5A 3KE2A 5ETCA 1FX7A 2K9SA 4LOOA 3FC1X 5LWMA 3PY3A 2V9KA 1RIOH 2R2PA 3QAHA 3CCRI 3NS9A 3R63A 2IP2A 5D5XB 3ZO4A 2E9VA 2BZIB 5HE1A 4F6UA 4YLJA 1BIBA 1YW9A 3NWTA 1VR2A 3C4CA 1JVPP 2F7XE 1OCPA 1OIYA 1H88C 3MVMA 1V5GA 3TBIA 1B9MA 5LMKC 3SD0A 3G73A 3V8LA 2UW4A 4LL0A 5ANKA 3L2CA 4IVBA 2GNLA 4KKHA 5LGUA 1M7QA 3GGFA 3TP0A 3RPUA 1A31A 2DAOA 2OD5A 4DGWB 4OU0A 4I0TA 2ITZA 3DA6A 3QZGA 2Q83A 1X1BA 3ORLA 2AXTC 3QZIA 3I56I 4L0ZB 2E2IJ 2B9FA 1A6QA 5AP0A 5C4JJ 1PUFA 1D0ZA 5B2KA 3O6BB 3DLZA 1MQBA 3FBVA 4HYIA 2GMXA 3IK3A 1DS5A 1RR7A 2HCKA 1YS7A 1Q97A 3E6DA 2KIFA 2V5QA 4XSXF 3DEEA 1MD0A 4F08A 3DXJF 3EN7A 2ZC2A 2B55A 1Q1HA 4CCLA 1JUPA 4XG9A 2W4KA 1PJRA 3WTUC 4G5PA 1HW1A 3VW6A 1YW8A 2ZNZA 1XQZA 4QTAA 2WAQN 3UQCA 1WJDA 2IW6A 3UVRA 3J7AY 4B48A 4K1BA 4HVGA 1OL7A 1XHAA 4PTGA 3HBLA 4EZ7A 1YRNB 2BY2A 5A54A 4M72A 4KNYA 5DEYA 1J7LA 3G6GA 4M67A 3GTQJ 2WPAA 4CKIA 2C1BA 2QENA 3HTSB 4CZTA 3EN9A 4EM2A 3EFLA 4ZTSA 1J59A 4GS6A 4YU2A 4CRSA 1XSVA 3UKGA 2IEKA 3AG2H 1ZRCA 5KNJA 3FHRA 5KMLA 3U1DA 1DDNA 4ZY5A 3FM5A 3REOA 5E4HA 2XKFA 4D5KA 2KHMA 2WV1A 2FA2A 3RPYA 1OQYA 2IPXA 4YJOA 1W36C 2KZVA 3VS5A 4MTDA 4JX6A 4NYEA 3R7OA 5BVWA 4F52A 1GZNA 2XKPA 2IS6A 2IS1A 3LPBA 4H58A 2P6TA 3AD5A 2HTSA 2JFLA 5HS9A 2L7FP 3V7RA 3QPLA 4IF4A 4I22A 1A06A 5J8FA 3RAIA 3G4SI 4BYIA 4AT3A 3TKUA 3BCBA 2YIRA 2LTPA 2W99B 1PXJA 5EDNA 2WMXA 4G9CA 3BR6A 1ZR2A 3BG3A 2OAZA 4XNEA 2KQRA 4J01A 1SZMA 1Y8YA 3IP4B 3NWWA 4CCMA 4IZAA 1X4OA 4Q47A 5KMKA 4XUFA 3SVVA 3ZZEA 4DH1A 1JUSA 2DW4A 3M4OJ 5A4EA 3PG1A 5FB2A 2XA4A 4EATA 1POGA 3KP6A 4O7NA 1D1BA 3QQUA 2P0CA 5FGKA 4L3PA 3DDPA 2W57A 4FVPA 3TL8A 4XLFA 4IBMA 3GZNB 4FEQA 3A2CA 3IW4A 4BCIA 3KA0A 3DTWA 3V8SA 2OV7A 5AIRA 3HOZJ 3TTJA 4FT8A 4LGWA 2AUHA 5FFZA 1IUFA 2RQPA 1Q8TA 3ZXTA 5IF1A 1WWXA 5FRIA 5KMIA 4A5NA 3OYGA 1YXTA 4FOBA 1OECA 2VNYA 1LEBA 3PUBA 1SNXA 4O83A 3MZHA 2FBHA 4YO6A 4HZRA 4PJMA 5M08A 2HXIA 5DS9A 3UNKA 1M52A 1OYYA 4WNPA 2WIHA 4TYGA 4CICA 2XF6A 3HTUA 1IN6A 1Z3YA 3BPVA 4PRJA 5M4CA 3GFWA 2R3RA 2R3LA 2M30A 4U80A 5K5OA 4YSJA 3NUUA 4BJTA 3RCDA 3R8MA 4C61A 3SQNA 4O7RA 1PUFB 2OXXA 4BBFA 4FL3A 3BL9A 5JKGA 4WA9A 5J40A 4XICA 5FDPA 4G6NA 3KGAA 1NVRA 3IAM2 3U1KA 2BBYA 2R7ZJ 1XPXA 5B0XA 3X2QH 2V1NA 5EYRA 3RKBA 1ZG5A 1OCCH 2CGPA 4D9TA 3AG1H 2EXCX 4PL5A 1O3TA 3QOEA 1P7IA 4MK0A 1ZELA 5LHIA 3MFTA 3HRMA 2O63A 1O3SA 3IG7A 2QQ9A 4CZUA 4EZ5A 2XK9A 3PG3A 3HZTA 3N05A 3DFAA 2A5YB 1UG0A 2B1PA 5C27A 3SC1A 2W00A 2QO2A 3QKLA 4I2OA 2JKKA 3CMAI 3L8PA 4E6CA 2LYCA 2I40A 4HVIA 4I6FA 3UQGA 4O7WA 5A9UA 5IQIA 5JEBA 4L9NA 3MQ0A 1XD7A 5CEMA 4LIVA 2B9JA 2BAKA 2VLAA 5I0BA 4BDFA 1PDNC 3MPAA 1IXCA 2VGOA 2FMYA 4Y46A 2PWLA 5DCMA 2YWVA 3TACA 2BIKB 5F4NA 4DGNA 3BZ6A 4FGRA 1O6KA 1AD5A 5DUKA 1M14A 3Q0UA 4O86A 2E1MC 3HDDA 1WMKA 3OBGA 4BQAA 1YKRA 1I09A 2XIZA 4QTBA 2VX1A 3VULA 3ZQCA 1ZRFA 3ENHA 1S9HA 2RKUA 5KK1A 4O96A 4BH9A 3CCEI 3ELKA 3K70D 3O50A 4ZH4F 1WAKA 2VZ6A 2IVUA 2FSLX 3CJGA 5IQGA 3F21A 3COMA 4I5MA 5L2SA 4D1SA 4OBPA 4PJJA 3BPXA 1S29A 3P08A 4L43A 3EQBA 1MKMA 3TV7A 4FV3A 3THBA 2G01A 4KT5C 3WTSC 3QF9A 4EGYA 3R61A 1KU3A 3IWFA 2JDOA 4ZMEA 3Q6WA 3AGMA 4XCUA 4BDHA 4PJ0C 4FV9A 3H9JA 3PE2A 2CKOA 2QONA 4U44A 2P6SA 1XMLA 4MCVA 5BQTA 3KF4A 1RZ4A 1ND4A 3QGWA 3KF7A 4MTEA 4BNCA 4FGBA 1ULYA 2NNWB 4DEIA 4RWKA 3V7SA 3HIFA 3EQDA 1Z7UA 2EZLA 1RQQA 3NARA 3PXYA 3C3WA 4ITVA 1W5CC 3RWQA 3RQIA 2OUMA 5CF5A 3WHCA 1JHHA 3ZM9A 3SDBA 4JG6A 4G3DA 2R5YA 1K7AA 4GT5A 3KY2A 3FMEA 3J81Z 3DKCA 3BU5A 1WJFA 4HZFA 2HXLA 4KS8A 3IW6A 3MH1A 3K3IA 3MA3A 5D7VA 1AWCA 4EOLA 2UW8A 2SRCA 4WSYA 4X2NA 2IZSA 2Q0BA 1VQOI 3OS3A 3W2AA 2OFUA 2Y31A 4G6TB 2ACXA 1WBSA 1SNUA 2JRTA 4AYBA 1ETWA 4X3JA 3B6CA 2ZDUA 3K3JA 3P9KA 1USTA 3VUMA 3RYRA 4YSMA 3BG7A 3UOHA 3UG2A 1R4MB 3TWJA 4JBOA 2A1AB 5F08A 4MBLA 2YM3A 2KRCA 4FCYA 1OBDA 1S6LA 5HD7A 4AE6A 4PL4A 3CIKA 3R60A 1BL0A 2P4IA 2ZMDA 3DQXA 1MIJA 3HRFA 3NCZA 4LUDA 4S04A 3R28A 4IC8A 4C3PA 2HDWA 5CAVA 1SD5A 5JVGF 1U8BA 4PX6A 3H9GA 5EI8A 1BI2A 5K9IA 3ZOSA 4N70A 2B9SA 3LMHA 5K5RA 3DZQA 1UKIA 2DWBA 4RMNA 3DEUA 4RIXA 3QALE 2OCEA 4A4XA 3I7CA 1IN7A 4GJ3A 1HXDA 1YOMA 4X3FC 4BC6A 4ERWA 4ZAUA 3JY9A 4D2RA 2QOOA 4ZMFA 1KOBA 3ZC5A 3LM5A 1ATPE 4ANMA 2HR3A 3JVSA 4QYEA 3MBLA 3Q9VA 4FMQA 1JE8A 4G3FA 1FMWA 2ZSHB 5HO8A 4XOTA 4K2RA 4KKEA 4D0XA 2YUSA 1H07A 4JQFA 3ZM4A 1E1XA 2XVCA 4V04A 4O7TA 3QAME 3F5PA 4DG3E 3HV7A 3E88A 1YIJI 5FEDA 2UW9A 1UU7A 3ZMUA 3RP9A 4RX5A 3HUBA 3IHUA 4RDUA 3DNEA 1BJZA 4UX9A 1KE9A 1FBQA 2E35A 5E20A 4ZOGA 4JIAA 5DCMB 2PK9A 3MZ8A 2R7QA 1D8JA 1OKRA 4Y15A 1F5TA 1JKKA 3CGFA 4LV8A 1IZ1A 4U0VA 2NO3A 2W5HA 2ETHA 2Y0MA 2KRFA 1FBSA 5BX0A 2VTJA 4PSWA 2LRDA 1TLHB 3U9NA 2A61A 4AZFA 1MJBA 4DLIA 4ON0A 3C2BA 3P86A 3NAUA 4UZDA 3DF8A 3ERMA 3UBDA 3UOKA 4CO8A 3BEAA 2G2HA 3BE2A 4ZSLA 3QBNA 3MDYA 2M87A 5D4RA 2PL0A 4C35A 2V0DA 2BRMA 3GZ5A 1XB4A 1IGNA 2OBJA 1YJNI 2RAEA 5K7HA 3CY3A 4E70A 1FPQA 4YEJA 2W1DA 4EBVA 3QRIA 1VQ9I 2XB5A 5CEKA 1SYKA 4G8XA 5T6KA 3U21A 1REKA 5M53A 2JUGA 4AUXA 4EMSA 2ESMA 3ALNA 3S2WA 2X8DA 3TV6A 5J8IA 4DT8A 4MQ1A 2YDIA 5DWRA 1CKPA 3UNZA 2F5FA 2HI3A 3AKJA 5CJ9A 4HV5A 4RWJA 3PFQA 2CSNA 2BILB 3QTRA 4FKRA 2QOFA 1V5FA 3P9IA 3GFJA 4L9IA 3F3TA 2J7TA 3KC3A 1PKGA 2W48A 5EG0A 5BVDA 3VODA 3HKOA 4O6EA 4H4KC 3GCMA 4XG3A 2C3IB 4P90A 3ORNA 4R1YA 3V4GA 4USFA 4RQKA 2HVQA 2R5YB 1RKTA 3H92A 3EQCA 4D0WA 3TGNA 5FG8A 4X0GA 3FXKA 2IGMA 3WIKA 4K18A 4FTQA 2M9HA 2HW7A 3CO7C 2QOCA 4YG2F 4M6VA 4RJ5A 4KSPA 1XTAA 3LCDA 2VL8A 5FUTA 4L01A 1HW2A 2ZB1A 3D1NI 2PI0A 4EI4A 3L9LA 1MBHA 2B9IA 3EN4A 5HQ0A 1T39A 4JP0A 2GS2A 1W7PD 3PNYA 3S8PA 3KULA 3QUEA 1Z9XA 4OIOF 4IE9A 4G6DA 4L67A 2VQCA 3EUHC 3RI1A 2J0JA 2CFOA 2BCJA 4G6LA 3WTVC 4MD7E 1WCCA 4Y13A 4NM7A 2LF7A 1ITYA 3OYBA 4UYNA 4LG0A 5A3XA 4OTFA 3QTZA 5B1AH 4U5JA 2LK2A 3RVGA 5G6VA 1VYZA 2H8HA 4ZLYA 1FVTA 2PVJA 3VDXA 2VQHA 1XN7A 4EH7A 4DA5A 3PO3J 2LF8A 4DTBA 1BN5A 1OGUA 4TKSA 2O8XA 3BV2A 4NL0A 2M3AA 4A93J 1LP4A 1YRPA 4RIXB 5H2UA 2OXYA 4FEWA 1N77A 4G17A 1IA8A 5E8WA 4A4LA 2UUZA 5J6XA 3CF5F 4IADA 4HPQA 1M2RA 4RBLA 2YM7A 3BQYA 3B8QA 1Q62A 5LVPA 4OGRA 2VXZA 3NX8A 1OM1A 4IHPA 3R7VA 3FAAA 4IZ5A 1H28A 3WHBA 3TKIA 4UV8A 5L3FA 3GFEA 2ERKA 2XAGA 1QBJA 4PGGA 3VSLA 4CRLA 1OYWA 4M71A 4O0YA 4S33A 3JRHA 5C4LA 3RKQA 5DYJA 2BALA 2GQGA 3G90X 3ZQLA 3FL5A 3GWZA 3C4ZA 3GC9A 1R1UA 5H9BA 4DTKA 4LGHA 2PHKA 3CCJI 2YISA 4BAYA 3PJCA 2J9MA