3PFYA

The catalytic domain of human otud5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
129
Chain Sequence
MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
publication title The catalytic domain of human OTUD5
rcsb
source organism Homo sapiens
total genus 38
structure length 129
sequence length 146
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pfyA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pfyA01
3TMOA 3PFYA
chains in the Genus database with same CATH superfamily
4AE9A 3LCDA 4GW8A 5IPAA 3SW7A 1XCVA 2E36A 4O84A 5I9ZA 3EN7A 3AG4H 4JG7A 5IU2A 2PE0A 3DAEA 3O8TA 2QO7A 3SYTA 2GOXB 3DZOA 2KJBA 3E87A 4MBJA 2MG4A 1ZRZA 1DAWA 4ZZNA 1D3YA 1YRNB 3LOCA 2QVSE 4HV5A 4CG9A 5LGUA 3OWPA 3PUFC 1KGSA 2W1CA 3V8TA 3PXKA 4IWQA 3ELKA 1MSEC 3BJ6A 4LMNA 2XIRA 5ETAA 4RGUA 1O6KA 3W6JB 5EEHA 3F3VA 4O7YA 4IVBA 2ISYA 3UC3A 1HOWA 3FZ1A 4NM7A 3UYTA 5A4CA 4AIKA 4XV9A 4NW5A 3TCPA 3G1MA 3HRUA 3DKWA 3RTRA 4M84A 2O0UA 1D0ZA 3EQCA 3MDYA 2JITA 3GOKA 2EV0A 4AOIA 4IWPA 3UNKA 1EH4A 2JUCA 4N4OB 1FY7A 4WT6A 2CYYA 2XM9A 5FD6A 1TVOA 3MFKA 3A02A 3MN3A 5GPCA 3ZFYA 3U6JA 2X9EA 3ZZWA 4L43A 2GMXA 4G7ZF 2VGOA 3W8QA 4J01A 4BXXJ 4TXCA 5K5QA 4Q5HA 4NC6A 3JRHA 3OEFX 4HYSA 3C1DA 4A9RA 2FNPA 3DFGA 4G5PA 4MBIA 1JKPC 2HZNA 3RKQA 3AC5A 1PYXA 5KNLA 2ZDTA 5IUIA 1ZN2A 3OYMA 1GXPA 2WAQA 4XOYA 1PXMA 2BRGA 1H9GA 4RGJA 4D4SA 4BDBA 3QYFA 4M74A 4N4NB 4E7HA 3JY9A 4IVDA 3EUHC 2W4OA 3NWSA 3WZJA 3J81Z 4ZOGA 4C30A 3ERMA 4S04A 2VPRA 3GCMA 3F8FA 1G8AA 1R4MB 4F9BA 1XPXA 3FDNA 2W5HA 5AMNA 4WRGA 3S1NJ 4QP1A 5GNKA 1MBKA 2HFHA 3UE4A 4E4NA 4R3RA 2ME6A 5GADJ 3LQ8A 2XNBA 1XX5A 4QT1A 5IT9K 4AT4A 2QNJA 2AEGA 2V1XA 4BH9A 2LBFB 1U5TC 3UP2A 4EWHA 2Q2EB 4FT8A 2WTKB 3GB2A 3CJGA 4PDSA 3F5UA 3L09A 5EDNA 4PL5A 5CANA 2VBZA 3UVRA 3HOWJ 5EDRA 2QENA 3H9FA 4S33A 5HNGA 2VE8A 4I01A 3ZQFA 5HDGA 3ISPA 3A01A 2X85A 3A61A 2R92J 1IN5A 5FROA 1DAYA 4RBLA 1WBVA 5CF8A 1K78B 4BVUA 1SFOJ 4IJAA 3HGYA 2YCRA 4N6ZA 4BJ5C 2PK9A 3U1DA 2VWZA 1I6HJ 4UXNA 2WHBA 3AT4A 3S14J 1HLVA 3LFEA 1DI9A 2HYFA 3PJ2A 2CDZA 5E8ZA 4YELA 5D4SA 2ETHA 1H1RA 5B2KA 3RALA 3O50A 1IR3A 2BRBA 3IW4A 3VS7A 2BXZA 2YR2A 3HUGB 5E8TA 2MH9A 3G4SI 4LK1F 3CF5F 3F8NA 5HLPA 5D4RA 3L7WA 4BF2A 2C3KA 3RAIA 3A7FA 5J9LA 4L8MA 1PP7U 3V5WA 3H35A 2V9KA 3DV8A 4BCIA 4HVDA 4ZYHA 4WBOA 5FTOA 5JQ5A 1GXQA 3A60A 2DMNA 3FSFA 5CJ9A 4A06A 2W1HA 1FYKA 4S34A 1FMKA 1MIJA 5CU4A 4LOQA 5DLSA 2PVMA 4A3EJ 3R7VA 3R9DA 2UWMA 2GS6A 4ZMEA 4BHNA 1YI2I 4F7NA 2UXXA 4DG3E 4G3CA 2Z02A 3RNYA 4IEBA 4GL9A 1B39A 4QPQA 1KE8A 2ACJA 4A3BJ 1JE8A 3RCOA 3RKYA 3LFSA 4BKXA 1YKRA 2JD5A 4FTKA 3BZKA 2BCJA 5E8VA 2ZVAA 3U4UA 2DK8A 1VQ4I 1SZMA 2XV4S 2CLQA 3K2LA 3THBA 2R7FA 3S1HA 4WX9A 1VQMI 4FGBA 4ZSLA 1PDNC 1R5ID 1D8JA 4ID7A 4I0TA 2B1PA 4ZEGA 2WOUA 1PJKA 2IZSA 5DUKA 4F6UA 2XKEA 1I3AA 3CXWA 4UUVA 2QBYA 4ANSA 2QOOA 4BZDA 1VI0A 1YS6A 4UZDA 3HOSA 2QONA 3ZEWA 4OTWA 3FHIA 4QWQA 3GFEA 2C3LA 4L53A 3MD2A 5KZ0A 5T68A 4IWOA 3FZSA 2C5YA 2R7SA 3KRJA 2Y69H 5F0HA 3KRRA 3OT3A 5GIPE 5FLMJ 2ZM1A 1RQQA 1K79A 2Y2ZA 2AC5A 5IA3A 2XVDA 3QALE 5F1JA 4CFMA 3MFUA 3SVVA 4I4FA 4ANJA 4U3ZA 1ATPE 1ZREA 4ASZA 4M73A 1WZYA 3ANQA 2V6CA 5IG1A 1T45A 4X0MA 3GTGJ 3PIXA 5F1RA 3WF7A 3RKWA 1OI9A 4I6LA 2M0MA 3K4CA 3CY2A 2M7AA 2PE2A 3IW7A 5KHWA 2I0YA 4XN0A 2JGZA 4PMTA 1RESA 4LV5A 5M09A 1HXDA 2LKPA 1VLRA 1JI8A 5DPVA 4L67A 3PDTA 3WIKA 2B7EA 5F64A 1Y0NA 2ZFWA 4I3ZA 4WXCA 2B9FA 5EK7A 5AUVA 1SM2A 2F2EA 4PJNA 2W1DA 5HVKA 2BALA 5L3CA 2M2EA 2ZNYA 3R7IA 3S2PA 5CF4A 2VU3A 2LLKA 3FX3A 4QYYA 3BROA 3MTFA 2X6OA 4C3HJ 4X1EA 4O5VA 3LZBA 3V5PA 3FXZA 3HRFA 2YU3A 4X21A 4C2WA 2K5CA 5IISA 4CT2A 4L52A 5HI2A 3W0SA 1WVYA 1P6RA 4EJVA 1MP8A 3FY0A 4FVQA 3E88A 3MVPA 3IECA 4MBLA 3OR2C 4ANMA 5M5YJ 1MBGA 3N05A 4EONA 4IB1A 5CLSA 1QMZA 3L9NA 1Z7UA 5LVNA 2X6EA 3AKJA 4EOPA 2O3PA 3VBWA 4RIYB 3DF8A 4K18A 4GKIA 4K0YA 4KBAA 3WOWA 3K70C 4TYHA 3IOPA 1VTNC 4IHYA 4NNJA 4C62A 3OTVA 2JSCA 3ML1A 4NM3A 4CCLA 3W0PA 4M71A 4E7SA 2BKZA 4O6EA 3JXWA 2O6GE 3V5LA 4DHIB 2Z33A 3VW6A 3ZSHA 5DEQA 1GY3A 4FKSA 4XBFA 3C2HA 3JAMZ 2IA1A 4M9ZA 3VNTA 3WF5A 3ORIA 4K11A 4GDFA 3D2IA 2FUG2 3JSPA 2DFEA 4ZJJA 4B9DA 5BPIA 4F78A 3BX5A 3B8RA 1R22A 3MB6A 3CDIA 3U4WA 3D2KA 1IXSB 3PYYA 4NIFB 4P4CA 4TYIA 3S2WA 5KBRA 4EOKA 5J95A 4EK6A 4BI2A 5IQHA 2QR7A 4J00A 1GUUA 3GCPA 2UVYA 4AOJA 4C4JA 4A12A 3QA8A 1QHHD 1IRGA 2OJGA 1IDZA 4O0UA 4RQKA 4ZSJA 4D1XA 4IO9F 3GT8A 3DY7A 4ENJA 4HF1A 3OD6X 1O3TA 3QD2B 4DCEA 4HBLA 3IKTA 3ZO2A 1U5TB 3VW8A 2K4BA 2XF6A 4F09A 3RJCA 4XLIA 3R8PA 4FTOA 1DGWY 2BY0A 2PYWA 4BDKA 2V1NA 4CKJA 5M53A 4AU7A 4M6XA 4BZNA 2WTEA 4PY1A 2P5VA 3O8UA 2XKCA 3BEAA 3TMOA 4EL9A 3HAVA 3A1YA 3RK5A 2VTPA 4AUXA 2ITXA 3CCUI 1BC7C 4LOPA 3ZEPA 2QWWA 5AUYA 4FZFB 3DKGA 1H8FA 3PNVA 3RYRA 2PJRA 3FQSA 4O3MA 2OJIA 3O71A 5FQDC 4JDKA 3RDIA 2DPDA 5KMNA 5IP6A 4IHVA 4YJRA 5DR2A 2ACXA 2W4KA 5AAGA 5LARA 1APME 4QQJA 4EHVA 3PQKA 4PWNA 3MY0A 3HMOA 2QU5A 2ZFYA 3BJOA 2R5ZB 4BY1J 5D6FA 3Q53A 5BVOA 4DH7A 4RGXA 3U8WA 4XV3A 5CVRA 4DBXA 3W2OA 3EYIA 4HOKA 2EFNA 2HCKA 2PTKA 3GO5A 3WG7H 2XYNA 1U2WA 1E2XA 3EUKL 4QYGA 1VQ6I 1F43A 1BM9A 3PFQA 1O7LA 3S15J 5CI7A 4LV8A 1RZ4A 3FZPA 2XK4A 3DPTA 4HGTA 5F6FA 2PY3A 3BKBA 5EDPA 4E6DA 1QZZA 3E7VA 4Y52J 4CH7A 3B6CA 1FWZA 5IMEA 3P9JA 1R7JA 3OMVA 2DAOA 1CSNA 3HKZN 2WMRA 4LIUA 3LVPA 4OTQA 3OCBA 4WD5A 3DU6A 2QUFA 5B0XA 4UXQA 4B8LA 2XAHA 3IWZA 2YZLA 3ZUTA 3KP2A 4A3KJ 5L3DA 3W55A 4M7IA 3EN6A 2LMDA 4ESBA 1FMWA 4AW2A 4A3GJ 1D5VA 2OSCA 1H1QA 1P92A 5HIEA 4KA4A 5CXZA 5LD2C 4ASDA 4YSJA 3HKOA 1I1GA 3DK3A 4I5PA 5F04A 1U4DA 3FXWA 4QTRA 5L8JA 3GYHX 5DUIA 5AUZA 3W0QA 3H5AA 5IH4A 1M2PA 2C6IA 4I41A 5I9WA 1P14A 2JDRA 4I98B 3WG9A 2OI4X 2IS1A 4U44A 3LA7A 4RWJA 2HOEA 3ORLA 3PJ3A 5BNJA 2DQRA 1S9JA 4EQMA 5GAEJ 2G9WA 4D1SA 3HBLA 3FLWA 4IAIA 4W8DA 2OLCA 5EDQA 2FSTX 2MW8A 5CPRB 5DTDA 3QZHA 5D8LB 3CJQB 3L8VA 1VYZA 3OVVA 5I9YA 1IASA 2J5PA 4JIAA 2GWRA 5LEKA 2L0KA 3P9IA 1GIHA 4L0ZB 1Z5MA 2CNVA 5FTGA 2EQRA 2O8XA 2ZJWA 3S95A 2DI3A 5BVEA 5M44A 5EM7A 5M4FA 1MJAA 1NW1A 4PF4A 1MNDA 1ZGWA 4MQ1A 4RA4A 2J0MB 2QCOA 1FINA 2IA2A 3UKGA 5FDPA 3BV2A 2XPVA 3GUDA 3ROCA 2ZYBA 2O5KA 3U54A 4MD9E 4KS8A 3PJCA 1FIPA 2XH5A 3ZO1A 1YHQI 2D5VA 1RR8C 3VWAA 4NJDA 5BQ0A 4F7ZA 2EWAA 3OYGA 4WG5A 3OOGA 4QMWA 3FZOA 3RPSA 4AZEA 4X3FA 4A9TA 4AN9A 2ME0A 3GTJJ 3WIGA 2FYSA 2C5NA 3IRQA 4CUGA 4EH2A 4BCMA 4IX7A 4IX4A 5DI1A 3MPAA 1C0WA 5L6PA 2RGPA 4FODA 1S5LC 1QA6A 2P3GX 3C50A 4BUPA 4EZ7A 5I0BA 1SYKA 4X3JA 2CRGA 4FK3A 3GUBA 2CMWA 1IG7A 3GTQJ 4EC8A 3A2KA 3I4BA 2BILB 4BBEA 1K6YA 3OYKA 3R22A 4AXCA 3LQQA 3KREA 2GNIA 1B1BA 2LAVA 4EH8A 4E4HA 3EQFA 4AU8A 3TG1A 2QOKA 3QRTA 3NUYA 4RLKA 2DCEA 3RYPA 3C4CA 2F4JA 4KN7X 4WIHA 2UZEA 3QXOA 4AACA 3W2QA 4N57A 1N25A 3DS6A 4OOIA 2VTQA 4P55A 5LCJA 4EJ7A 1LDJA 4F99A 2XRLA 2R7TA 4DYCA 4AZFA 4I92A 2ITZA 1ULYA 1AWCA 3OXZA 1WWXA 2ITVA 4MF1A 4CQEA 5CVJA 4XR6A 3KFAA 4AXEA 4NFMA 3DU8A 3UGCA 3ZS5A 3G3ZA 5HBJA 2O61A 3LJ2A 2NRUA 3NVMB 3KULB 4BDFA 3BLAA 4NUSA 3LMIA 1LEAA 2WZJA 4BTKA 2K9NA 4D5FA 4S2ZA 1OGUA 5FKLA 4QMYA 4F65A 3PVWA 1YQJA 4ZTSA 4FA2A 2XF0A 3QPTA 3ZLYA 2GHLA 4U43A 2VKDA 2EFPA 4JBPA 4AGDA 3BLRA 3QWKA 5J6XA 3F5PA 4CCUA 2MA3A 2J5EA 2YDJA 3ZXZA 2OBJA 5IA4A 1JKTA 3QPSA 1HOMA 3W2PA 1BIBA 3WILA 2BW3A 2ITOA 4E4XA 4K8AA 1H00A 2WMQA 1OCTC 2WKMA 3EN4A 3DQWA 2VNYA 1M52A 2HU9A 1FPUA 4U80A 3HUCA 4H58A 2F5DA 4A9YA 4I6ZA 3OS0A 3OTUA 3WYXA 2RKUA 1HSTA 4YPDA 3L1PA 4Y15A 1MNMC 4M15A 3COMA 5ANEA 4D28A 3P1AA 3DKXA 5BVWA 2L7FP 4R77A 3WARA 3DT1A 5DT0A 4XLCA 4I6HA 4G31A 4FL1A 4M3GA 1XSXA 3K4JA 1OPJA 2M3AA 2VT2A 2EH3A 4R7BA 2WEIA 2GNGA 1ZG1A 2YEXA 4WNKA 2NAZA 3QYBA 3W2SA 2LF8A 1RE8A 4MNEB 5CY3A 1M1EB 2IS2A 4IC7A 4BBFA 1UAAA 1S8NA 5E1SA 3GU6A 4IOCF 4CCNA 1KE5A 5EOBA 3L8XA 2LD5A 1SD4A 4PMSA 4XOPA 2BIKB 2JEDA 4A0ZA 2VTRA 5AV3A 1OKRA 5IYBJ 4BTFA 5KBQA 3KCKA 1MZBA 2NP8A 1NH3A 5HHWA 3SLSA 1WI9A 5IP7J 5CWZA 3U9NA 2IGKA 1Z67A 3DKCA 5FXRA 4RT7A 1WJDA 3I1AA 1G6NA 3S3OA 4HX4A 4F91B 3HKZA 3IUOA 1YXVA 2M87A 3REOA 4FOBA 1X1CA 3OXTA 4UBAA 1Q8TA 4KMFA 3W0MA 3HMNA 3AGMA 2VOOA 4W4WA 3CCYA 1PYEA 4HG2A 2WMAA 3S1RJ 4RJ4A 2ELJA 2HVSA 3LAJA 3WZUA 4HVIA 4FTCA 4FZ7A 3ZBFA 1FJLA 1Y8QB 4YLKA 3Q60A 4IJPA 4LRMA 2NYAA 5FKMA 2HOSA 1LEWA 3COKA 3LLTA 3F5XA 3HNGA 2XPWA 5IH5A 3UO5A 3SW4A 4D2RA 5FD2A 2BMCA 1GNGA 4EUUA 3BGPA 1EJ9A 4GT5A 1CQTA 5DRDA 3GNIB 3KYLA 4W4XA 4R3CA 3KZYA 5K4JA 3GCUA 2CCHA 1VF9A 4OIRF 3ZMSA 1U6GA 1XQZA 2EK5A 5TOZA 3N4TA 3BELA 1ERKA 4RFMA 5EM5A 2OU7A 1DDNA 1Z91A 3QRJA 3LA2A 5JHUA 3SHEA 3P5KA 4LFUA 1YX5A 4DZJA 5CT7A 3W2CA 2QCSA 2WMSA 4MTAA 4ACGA 3LFFA 3KP5A 2KFDA 3CP9A 1R49A 1ZELA 4FK6A 4CFWA 2G7HA 1R1WA 1JKOC 4HNFA 3QPHA 4KRCA 4O6JA 2M34A 3HZJA 3QXPA 3T5XA 4RA2A 3A2CA 2X1DA 5ANJA 4NL0A 2QODA 2OJ9A 3QCYA 2F48A 3KK9A 3Q4UA 4AIDA 1R1VA 3NX8A 1UCRA 1UG0A 2CN8A 2UV1A 3CBLA 3S3NA 1B8IA 5HDNA 3H1CA 4MFDA 1A36A 4NQWA 2L2OA 2DYLA 2XNMA 4ZXTA 4KSQA 2WU7A 3KXXA 3QQHA 5HG7A 5AX3A 2V5QA 5E3MA 4IVCA 1JLUE 1JTXA 4C36A 4IRGA 5HICA 3SXRA 5EG0A 2F49A 3TQNA 4HDVA 5FFXA 1LQ1A 1OR7C 4L0YB 3BCAA 3EQBA 3DPKA 4UYAA 4RB1A 2OA4A 4CFVA 1OB3A 4MUQA 1V0BA 3VYUB 5BMZA 4G2FA 1V55H 2WGJA 3RQ4A 3SA0A 4FIJA 4L5IA 4E4LA 3FBNB 2W84A 4EOSA 5J1WA 2VWYA 3PXFA 1VR2A 3DB8A 2CWEA 4A3CJ 4BDJA 2W1EA 3GC9A 3LCSA 2QI8A 2LRDA 3GLXA 4CZUA 4DYQA 2DFIA 3I79A 1ZGAA 4ZY4A 4L45A 3PSCA 5AIQA 1SD7A 2BV6A 3OG7A 1IXRC 1TT5B 1F5QA 3DJ6A 5F95A 1CTPE 2QOIA 1P7IA 3OYHA 4KBCA 4J1RA 2R7IA 3LW0A 5HG8A 3IDPA 3I56I 4HQEA 5CSVA 4HQMA 2QKWB 4DNCA 2XGCA 3WODF 3CMEI 1OCPA 4A5NA 4BIDA 2OUMA 1ZMWA 4AN3A 5HESA 4FKGA 1E3OC 3DBRB 1Y8GA 1YOMA 2WB1A 3KVXA 5FRMA 1WAKA 4OR5A 2NVUB 2C6DA 3CTHA 5D5UB 2AXTC 3GI3A 1FVTA 2IS4A 2XEYA 1GV2A 2IS6A 5M4UA 2OU2A 1BN5A 3QTSA 2PMLX 1TWCJ 1QZEA 2W4SA 2R7OA 4NTSA 3DZQA 3K3JA 4A2UA 2MC4A 4L42A 1Y57A 2F6CA 5B5EC 4HGLA 4II3A 4FNZA 4QP7A 5IA5A 2MD0A 1ZMVA 4YSMA 4AQKA 1CM8A 3GBGA 1XDSA 1V5GA 4IZZA 3CO6C 1DM2A 3T9TA 4CFXA 2X7FA 3IONA 4KABA 1ZAOA 1YE9A 5LGTA 5IQIA 2WB8A 1ZOHA 4M3FA 3D7ZA 2KQRA 3R8UA 3CQEA 1M7QA 4IACA 2EZKA 3KETA 4QMSA 2K9MA 2E2JJ 2H34A 4YJOA 4HZFA 3CC6A 5E91A 2AHQA 4KFCA 4PQNA 2GA1A 5LMKC 4C4EA 4DFLA 4PK4A 2UZBA 3TKYA 4XORA 2PUNA 3FKIJ 4LYNA 2E9NA 4QQ5A 2HZDA 4QSHA 4Y7NJ 3FI4A 4CSVA 2HIWA 3MWMA 5T3QA 1TKIA 2R3MA 4XV1A 2WU6A 1QZYA 3MPTA 2VUMJ 1SD6A 1QHGA 4DE4A 4TYEA 4CGAA 1ST4A 4D7NA 4X6AJ 2IAIA 3LM5A 3KN5A 4AXDA 1U5QA 2X6XA 4U6RA 3LSPA 3FKOA 3Q52A 3RPVA 2IJLA 2ZJRF 3FXRA 3DNEA 1K61A 4BBRJ 4WNPA 3OW4A 2HXOA 4M6VA 4L00A 3RAKA 5CAQA 2WMXA 3PWYA 2BPMA 3K5UA 2ZXHA 3F23A 3KQ7A 4BGGA 2EBIA 1M14A 4H3PA 3PG3A 4ZTMA 1RI7A 4LUDA 4RJ3A 2B9IA 4GJ3A 2X7OA 3OYNA 3QCXA 4JX7A 5F0FA 3ZLSA 4JG6A 1UG2A 2DDBA 4F63A 2QEXI 5DOSA 1LKXA 4XOZA 1USTA 5HG9A 2NNYA 3U55A 2Q83A 1ZK8A 4HLYA 2PWLA 2ZKZA 3QGWA 2Z7SA 3H5NA 4AAAA 4H1JA 3V6SA 3RWPA 2ZCWA 5JLXA 3R8LA 2XUUA 4ZK5A 2PBIA 2KIMA 1MUOA 1FBSA 5FLXK 4MXCA 1REKA 2E35A 3LSRA 1H1WA 2RN7A 5DS9A 3A8XA 2CKPA 4NYEA 3DQVC 4XSXF 4FV6A 3MVLA 4NHJA 4K6ZA 3LFCA 1YDSE 4FTUA 4YMJA 2R7BA 3RKXA 2VZ6A 2W17A 1Z3XA 5GINE 5LVLA 3NW5A 5FFZA 1E9HA 3EQRA 1YDRE 5DR9A 2DA4A 3GFLA 2K9LA 3C3WA 3CF2A 1PYVA 1G3WA 5CI6A 2CQNA 2FA5A 3R8MA 5EOLA 2JC6A 3U87A 2P55A 4FKWA 3MPMA 2PJPA 3VF9A 3DTIA 1W0UA 2I0EA 3EFKA 3HUBA 3M7GA 3ZQ7A 1U59A 4KUJA 1PMVA 3F6OA 1YRPA 2BY3A 4MXYA 4KINA 4CD0A 2VO0A 4PMMA 1XMAA 2PPQA 4DZPA 3UQCA 3UG2A 5J3LA 5J1RA 3QGYA 3H0YA 2Z16A 2BRNA 2CQQA 1OIRA 3JR9A 4EJUA 1Y0UA 4BDAA 1UKIA 3ZPLA 3G6EI 4V2FA 1URWA 3ZXSA 3F3UA 3QTZA 4Y33A 4LGWA 2QBYB 2VC0A 3KKVA 4UX9A 4YRVA 1AGWA 3NLBA 5CSXA 1ETYA 1MBFA 3R6SA 2BRHA 2J0LA 4P5ZA 3Q5ZA 1LR4A 5CT0A 1H9TA 1LEBA 1SMTA 1FYMA 1OIUA 5DFPA 3GEZA 2W24A 5CEPA 4S05A 3HV7A 2XK7A 1HCLA 4CCKA 2D45A 5IMXA 3ORNA 2V1DA 5EH0A 3K0LA 5CEKA 3BR1A 3CCRI 2C4GA 3BU6A 3NZ0A 2QKMB 4OAZA 5CVVA 4UWCA 2GM4A 5TR6A 5C1QB 1HBXG 4I94A 2VTHA 3GTMJ 2LBFA 1JHHA 2CQXA 4QDVA 3KP6A 3VS4A 3MBLA 3HECA 2ITTA 3D0EA 2Q2EA 2HZIA 4EGYA 4YZMA 4IF4A 2XF5A 1R0EA 2PE1A 4KKEA 1DP7P 4AC0A 4QDEA 4DLJA 3C5UA 5CALA 4LOOA 1OUYA 1YJ9I 4RWIA 2NO3A 4MWHA 2FA2A 1K78A 2Z3YA 1G8JA 3GFJA 3Q5FA 1STCE 5EHOA 4A69C 5EGOA 4XG6A 5JHFA 1NVSA 4G6OA 3HLLA 4OW8A 4H36A 4S31A 4EC9A 1V5EA 2N8GA 2HYYA 4NU1A 3AD4A 3MVHA 4IANA 1V1KA 2Y48A 2W0JA 1TW2A 4G6NA 4FT7A 3BWJA 4UUSB 4CICA 3NYOA 4ASEA 5JQ8A 4GVJA 5IYDJ 5KCMA 4NZWB 3RPYA 3BYVA 2BZJA 3H0DA 2MSYA 1OISA 2X0LA 3IK3A 4C2TA 4YC6A 5DE2A 2DOFA 3H3ZA 4FR4A 3NPCA 1ZG3A 3L9FA 3IQ7A 3GOPA 1Z05A 5J1UA 1O3QA 2KLOA 1X19A 4FZAB 5LQFA 5DEYA 4QOXA 2JT1A 4MX9A 5CYIA 4E7IA 5KMJA 3QHRA 3ULIA 4EQCA 3GZNB 5CASA 2HKOA 3O8PA 4DEAA 3RQIA 1N77A 3EQLF 3HOTA 4ZIMA 4QP6A 4TN6A 3CLYA 2XM8A 4OT6A 5TISC 4J99A 3RJPA 4EJNA 2GNHA 1MMNA 2X9DA 2DQ7X 2DO7A 4FV3A 4PTCA 4EV0A 3DB6A 3J7ZI 3UIXA 3MZHA 2PMOX 2ZAZA 2Y31A 3KXGA 4KIGA 4XRLA 3BBWA 4MAOA 3RK9A 3QRIA 3C2GA 4YHTA 4ZY6A 5DN3A 1REJA 5DD8A 4JJRA 2YCFA 3JRBA 1MH4A 5HNBA 3KXMA 4R8HA 2HPMA 3P23A 2EWNA 4RAYA 3VBTA 1CGPA 3MMYB 5CSHA 2VWWA 2BTRA 3AMAA 5AONA 2XB5A 4QTDA 5A46A 3QYEA 5FB2A 2X0GA 2UW5A 2R3PA 3SEZA 4KD1A 2K40A 1TQPA 4N9HA 4WHZA 5C3EJ 3QP5A 4FASD 4E5BA 1J09A 2J6MA 2HXLA 4LB5A 2OH0E 3NW7A 4EOJA 2QZ8A 3G6HA 5LVPA 4CXAA 4MNUA 2JJ7A 1YDTE 1E3HA 4KUMA 2X2MA 3M42A 1BOBA 4C2VA 1SNUA 3T3UA 3NUUA 5FM3A 2KDOA 4FV7A 1OCCH 4AP7A 4UB6C 1QQIA 3DTCA 1IZ1A 4RAZA 2DLLA 1IGNA 1X2NA 1REPC 4ACCA 3RI4A 4WKQA 3NWWA 1J7LA 3FWEA 1YXXA 3KCFA 4V05A 4L18B 3CJRB 3VBXA 5HZNA 4GRBA 3MIAA 3R0JA 3VUHA 2Y4PA 4G1WA 5D7AA 1PXIA 2M4GA 2ZOQA 4O96A 4HVSA 4AOTA 2P6SA 3PUFA 2E2BA 2C6KA 4LDTA 4QO9A 2KHMA 1QPIA 4DEIA 2PN6A 4M3EA 1J3HA 1VQ7I 3TM0A 3F82A 1X8BA 5C01A 3WBLA 2XAFA 1M7NA 3M9AA 1DP3A 4L9JA 3CCJI 4QPAA 3IKVA 5LMBA 2Y75A 3P9KA 3E92A 3UOJA 4NM0A 2GIZA 4RM3A 4FZDB 3DNDA 1RW8A 1I39A 2W1GA 2WIPA 3E8CA 4EM1A 3PQJA 4XNEA 2V1UA 1HKTA 1Q97A 4RZVA 4ZDPA 1R71A 4RVMA 2R3FA 3HRBA 4L6QA 2E9PA 3EQPA 4U7ZA 2LR8A 3KYCB 3FC1X 4ZTQA 4APCA 4QRCA 1K4SA 3FYKX 1GOLA 5IQBA 1PMNA 3POZA 3PZEA 3QQLA 4J19A 1YHVA 2ID3A 2EB2A 2O2UA 2CKQA 4ZJVA 1X3WB 4JX4A 1FPQA 4Y5QA 1K4TA 1H25A 3QUPA 3CTJA 2GU8A 4O27B 1FOWA 3U2RA 3ALNA 3PSDA 3IPHA 3KMWA 2P0WA 2VONA 5ANDA 2XJ1A 4N9IA 2HS5A 1MRVA 5D5VB 2UW3A 4EVIA 4A4OA 5AJQA 2W85A 4E7LA 2YIYA 4A7CA 1JSVA 3RZDJ 3ZH8A 3BCBA 2P4IA 1PXJA 4RIXB 2XNGA 1ACIA 4XBRA 4KIBA 4DTBA 3DV3A 2CV2A 1PW2A 3R9OA 1YW9A 4J52A 3UVPA 4OTRA 1KOAA 2IRFG 4HZRA 4IBMA 4A6DA 3EUHA 3UO4A 2KL4A 3F88A 3CPBA 3KK8A 2HYGD 3MH3A 3EFWA 2BFXA 1XMXA 1BJZA 3BR2A 3N9XA 1JOWB 2DXIA 1W0XC 4KT6A 4RM2A 4JBVA 3QQAA 1SVHA 2HQNA 2VWVA 3CQZJ 1WMKA 1PUEE 4C9YA 3E5UA 3F3XA 5H2UA 4E7JA 1WBOA 5IY5H 1UZCA 1XH5A 3HDDA 1S7AA 4JVGA 1U5TA 2C69A 2JA5J 1VJYA 5HIBA 4QMOA 2A1AB 4J8MA 4I5CA 1BA5A 1W7HA 4FICA 4AFJA 3IKAA 4G8XA 2ISZA 1YVJA 2QQAA 3OOPA 4KIOA 3RAWA 2VQHA 5D41A 1OCZH 1NG7A 2JWTA 2ZB1A 2PHKA 3B6AA 2V26A 4U41A 2DS1A 1TWFJ 2M1BA 2HY81 1ZYJA 2NOJB 2C3JA 5HORA 4IQJA 1YJNI 1IRKA 4Y13A 1ZYDA 2DT5A 3E97A 4BCHA 2GTMA 1W5SA 3NNUA 4FV8A 2CN5A 4LG3A 2XYUA 4MKCA 2RDPA 4O2PA 2UW8A 2IGNA 4M3BA 4UY8I 3PSBA 1T39A 3ESWB 2J51A 4I21A 3G90X 4O0VA 2VIXA 1UVRA 4KRDA 1ERDA 4FMQA 2FQ4A 3V5TA 3ZQIA 1V54H 2E7XA 4X3FB 3N4UA 2R5TA 5CNNA 3ATSA 4ZTNA 1NT2A 4HAMA 3VFZA 1R00A 4ONAA 1JUPA 3K2ZA 3WE3A 5ICPA 3FXJA 5A54A 2CO5A 2EZHA 4GFMA 2F4MB 2OBPA 1J91A 3ZLWA 5BPYA 2NRAC 2XJ2A 4P7EA 3CR0A 4GXOA 2XGXA 3WZKA 2PUUA 4L9VA 2A4LA 2KULA 3G73A 2WMUA 2NS7A 2C0TA 3OCSA 1YWRA 2DODA 3J7AO 3MY1A 4IDTA 1WJAA 4F55A 1Q8ZA 4LQMA 3EZVA 4A3MJ 3N97A 1BI1A 2WAFA 3V3VA 1T95A 4TRLA 3AT2A 3HSRA 3HOYJ 3J7AY 3HV5A 4RIWA 3M1CA 3MKZA 4U0WA 1CKPA 2QLQA 2FXAA 2CQ7A 2ZM4A 1WH7A 1H0WA 3I53A 5IQAA 3KN6A 3LKMA 1WBNA 3QQJA 2B63J 4U0VA 5J8IA 4ZAUA 5EKNA 3H0ZA 3GX4X 3TBIA 1OKZA 2BDFA 3BZCA 4C4HA 2F2CB 4DA5A 5CKTA 3DLAA 5M08A 4FGRA 2ZJ2A 4FKVA 5GJDA 3DBLB 4M0YA 3A7HA 4E7KA 3I9V2 3ZO4A 5KMOA 3QCQA 2M5WA 3U6HA 1YG2A 2CSNA 4C0TA 4IWDA 1UHWA 3SGCA 3K4KA 5AIRA 5CAPA 5LJJA 5C8MA 2GXGA 1G8KA 4C61A 4KICA 1X4OA 2H8RA 4UUTA 1X58A 1XB4A 4ITVA 5IOZA 5CVIA 4EOLA 1TFFA 3NUNA 2GFCA 3KCCA 5ANGA 4AW0A 2CHLA 5DEWA 4IW0A 4X2FA 3VS6A 3LMHA 2OXDA 3LFQA 1X3ZB 1B9MA 2HQRA 3PO2J 4WXHA 2WY7Q 2DQLA 2FOKA 1XGMA 3B2WA 1OFCX 2P4WA 2C1AA 5LRRA 3TI1A 4A3LJ 3FPMA 3TDUC 4RFZA 4ZSAA 3NQOA 2OXXA 3FQHA 4FG9A 2VX1A 2HEOA 3AG1H 1XH9A 4JOAA 4M68A 3CKXA 3OR1C 2JSPA 5FKNA 3QX4A 4AZVA 1VQOI 5HD4A 1RPWA 4UVCA 1TC3C 4DJAA 4OLIA 2H09A 3ELJA 4XICA 4UB8C 1R5GA 2KRCA 4M69B 5M06A 4ENYA 2ZV2A 2CGWA 2ESHA 2GNLA 3FV8A 2DJIA 3ABTA 2BAKA 2B52A 2M7BA 3RPRA 1D5YA 2KJCA 4AW5A 3OS2A 3QYWA 4BI1A 3AT3A 2QOCA 4DLIA 3TW7A 2X4ZA 2WMBA 3QKLA 3DEEA 3S93A 5AV4A 5BS6A 2HGCA 4L44A 3I59B 2ZV7A 3JRCA 3L00A 3TZ9A 5HLWA 4ENMA 2VODA 3WI6A 3ZMDA 1HKSA 1V0PA 1YI6A 1ZWSA 5JH6A 4XKCA 3K1MA 3TUCA 2NVXJ 4C4GA 5HCYA 3LNQA 3DCFA 3OWLA 3GWZA 3TTIA 2A3SA 1W36D 4USFA 5AIPA 4R7HA 3DP7A 2YJRA 2M0CA 2QQ8A 4PGGA 3R04A 3J80Z 3EKNA 3R60A 1IN8A 1P5EA 2WADA 1T08B 4FSMA 5FLFA 1IUFA 3SEQA 2R2PA 2CW7A 3ZFMA 4ESJA 4ZZOA 2VTMA 4F52A 3HGKA 4XM3A 3DDPA 3C4FA 5HS8A 5E8GA 2XRWA 3WTSC 4G7HF 2G0EA 3FLZA 1UHMA 4O2ZA 4DCAA 3RP9A 3GFMA 5L3GA 3ZCLA 4CKRA 2LDUA 5DR6A 1U5RA 4CTCA 3KU2A 4OAYA 1JJ6C 5DBXA 3H30A 1QCFA 5K3YA 3T8TA 4EWQA 4AXFA 1YQAA 5GTIC 5KE0A 1UNHA 4QYHA 2VTOA 3TT0A 4EK4A 3BP8A 2C0OA 2VTJA 1JKRC 2CS3A 4BCNA 2CV0A 2IZUA 3N4VA 4AZTA 3VSKA 2WO6A 1ON1A 3PUPA 2O8KA 5CENA 2QLUA 4MQVA 2UZDA 3R7UA 4EHEA 5CEMA 3OXIA 3JCUC 2HTSA 3PNYA 2CJMA 4KIPA 3WTZA 1UMQA 1VNDA 4N0BA 5CQGA 2STTA 2H94A 4QMNA 5HE3A 4G9CA 3S32A 2HENA 4O82A 4XV2A 4J7BA 3EH9A 4DQ2A 4APPA 4U7BA 3GMEA 3BL9A 3WF8A 4X2GA 1Y8YA 1WCMJ 1XSVA 2QHNA 5CS6A 5JZNA 4CHUA 1J75A 3S0OA 3JRIA 3BWFA 4EOOA 5CVGA 3D5SC 4E6AA 2YDKA 1N75A 1X1AA 2NPQA 1KUTA 3JREA 3PXZA 5J47A 4JQEA 4C3RA 3V51A 2ZC2A 3D15A 4C4FA 3B2TA 3TIZA 4M8TA 2LK2A 4DH5A 4RG0A 1JBPE 2FF4A 4XSZF 4ABZA 2WD1A 1GT0C 3BPXA 2VAGA 3TJDA 2NXNB 3F6XA 4QMVA 5HX6A 2GHMA 2GPHA 3I71A 2VWUA 1T56A 3BQCA 3CMYA 4DBRA 1PHKA 3OUKA 3LJ0A 1KOBA 1PKDA 5B66C 3NDMA 4ENXA 4Q2AA 3E6CC 1B8IB 4XG2A 5FXSA 3DAKA 4NQWB 3Q0UA 3GBZA 3F66A 4OMZA 5EYDA 3NYVA 2VX0A 2OG8A 2HY0A 4JG8A 2PLYA 5ILVA 2R93J 3PLAE 4IPAA 3E7OA 4FIIA 5BVFA 4IKFA 5EG0B 1OL1A 4I6BA 2VTAA 3AC4A 3ODYX 5AADA 3P7BA 4BQNA 4QLCU 3ZRGA 3O17A 2O7OA 1YOVB 4BHBA 5AA8A 3IL2A 4BY9E 1GZOA 1IAJA 2GOMA 1QO0D 3ZSGA 1OLTA 3P7CA 1I1SA 4EBVA 2OKRA 4A4XA 3VDXA 3UP7A 2BFYA 4LRKA 5ILUA 4AVZA 3WF9A 2L9VA 3M3YJ 3Q3BA 1HQCA 2RFNA 3CTAA 2V9VA 4KITB 3EQIA 3LE6A 1D1AA 5E3LA 3RVGA 3I6UA 4Z16A 3QD0A 5C4XJ 1GIJA 5L3AA 2VWIA 3DBEA 3AMBA 2V7FA 3PJRA 3DPUA 2W9ZB 4TL0A 3UOKA 3ZP5A 4B44A 3BHUA 4GSBA 4UN0C 1YIOA 2R3KA 4FUXA 5K5XA 1ZXEA 3ZMMA 4F6WA 4U0YA 4I24A 1D8KA 1QPDA 3HHGA 4B6LA 2KISA 4KT5C 4JK1X 4IHWA 3NGAA 1K6OA 4L7FA 4FG8A 4YZDA 3V8WA 1SVGA 2VWBA 4DFZE 3U6IA 1W0TA 5H6RA 2GS2A 1TL8A 1YOLA 2YWVA 1IRXA 1W5CC 2B4SB 3QKMA 3NUAA 3FBVA 4FUYA 4GO1A 1FGIA 3QLFA 5CF5A 2K9SA 3CCNA 2QR8A 1ZYRF 4L9TA 2OFVA 2XNEA 4IH8A 2CW8A 2JDSA 1S6LA 3D1NI 4HA8A 5HLHA 1PXLA 3IW8A 4Y85A 3D5RC 4YJSA 3H9OA 1ND4A 1TQMA 1JGGA 4ZLOA 3OS3A 4S0HB 4QMQA 2BZHB 1TTYA 1J1CA 2ZMCA 5F20A 4XLHA 1UB9A 2JLDA 2COMA 2F5CA 4MEYF 4CV9A 4Y95A 2HWOA 3DK7A 4D0XA 5JZJA 4XLEA 3A4PA 4FEXA 3K3IA 3NVKI 2RAEA 5B1AH 4FIHA 4PNKA 3ZDUA 3FKNA 4Z55A 2JKKA 3C5IA 4BDDA 3O8HA 1ETKA 2BOLA 4UALA 2E34A 1OVEA 3QQGA 3RPOA 5A3XA 1HW5A 4GYGA 3RSNA 2PULA 4IFCA 4EZ5A 5CTPA 5K7HA 1OITA 5HQ0A 1QL6A 4JMQA 2L7ZA 3JRAA 3KL8A 1GZ8A 1SANA 4IHSA 4GT3A 2BAQA 3KC3A 3F5GA 3I7BA 3ZZEA 4LLGF 3EETA 3PM1A 3OL4A 5HLTA 3D5LA 5ETIA 1AKHB 2PVYA 3D9VA 1W5TA 3PIYA 4G9YA 3W2WA 3W10A 3R7EA 2PVFA 5CAVA 4IX6A 3H0GJ 2I0VA 4ALVA 2YIRA 4UB7A 3BCEA 4CTBA 1FLIA 5EJCA 3OOMA 3ZHPC 2IJMA 3W16A 4DAWA 4D4RA 1Q3WA 2YZAA 3W32A 3DTKA 3G5DA 5KUPA 3E93A 4YO4A 1R39A 5CAUA 5IEVA 4YNOA 2PG4A 5IH6A 2XAGA 5AP1A 3ZMUA 3L9MA 2C1BA 3C7QA 3CCLI 2JBOA 5HODA 5CEQA 1UU9A 5GP9A 4JQ8A 4YIRX 4HLXA 3LQ3A 1SVEA 4JLCA 4AS0A 3P7NA 4ZDOA 5CQUA 4RBOA 4BQQA 1K3AA 5FBOA 2ITWA 1P7JA 4J71A 2PFBA 4C3IJ 1Y6BA 3MVMA 4FISA 4IQ4A 4JL9A 1POGA 1EH7A 5FTQA 4DG2E 1P4FA 2CKEA 3HTSB 3TNQB 3CUOA 1XCBA 3LHJA 4CNHA 4NDLA 4QEBA 4I0AA 2RF9A 3COAC 2YX4A 3LM0A 3PWDA 1NVRA 3NNVA 3KXZA 5J9ZA 3DLLF 3R00A 5HO8A 5EEAA 4XP0A 4GIIA 4WG4A 3G71I 3S16J 3QHWA 2XMYA 3AL0C 2JDOA 5LRSA 3UG1A 3UO6A 3IH2A 3PVBA 4MVFA 3KMUA 3GTKJ 3MSSA 4W97A 1ITYA 4R6VA 5A2QZ 4J96A 4BQOA 4XKBA 1U78A 2JRTA 1ZMUA 3O7LB 4O38A 3MH0A 2X4FA 3T0YA 1ETQA 3LSHA 5HIDA 4YC8A 2VXZA 1T38A 3MESA 2W57A 3OROA 4QMLA 2OZ6A 2X2KA 1AQ1A 4O7VA 3PNTA 3QQKA 3DPLC 4ZTJA 4HX7A 2ITYA 3MTLA 4KDPA 4FOCA 4BR3A 4XRFA 1VQPI 1BMKA 5AV0A 4FEWA 3CJFA 4IE9A 2E5ZA 4G17A 4QIWN 5CVUA 2NS0A 4HOBA 1XN7A 3C7JA 2JPCA 2XVCA 3ABLH 1OMIA 2QSFX 3H5RA 4Q5EA 2VQLA 3EUAA 1S7EA 2L01A 2MD5A 1Q3DA 3Q9VA 1SC7A 3IOKA 5M51A 2VX3A 4R78A 4FSRA 3E6MA 2PI0A 3EOCA 2EINH 3S8PA 4YLLA 2C0IA 3R6XA 4LIVA 4FSNA 3PP0A 3JSOA 2OTJI 3V8SA 1U8RA 2GLOA 4FIGA 4Y17A 5A6OA 1T6SA 2LH9A 2MH2A 5B3SH 2OV7A 1U8BA 2GS7A 5H3QA 1TWGJ 3E5AA 1Y8RB 1LPUA 1WH5A 4FX4A 3OYBA 5E4HA 2WNTA 2H1LA 4FKJA 1DU0A 3TZ7A 1Z3YA 1PP8F 4GS6A 3LXKA 5BUEA 3VQHA 4F9CA 4HF2A 1FX7A 4DT9A 4I2OA 2CNUA 3WTVC 4GUBA 1R9TJ 4F9AA 4QMZA 2OGVA 1GHCA 5HS9A 1FGKA 2XBJA 3TUBA 1TW3A 3L2VA 4P1WA 4I5MA 3MKYB 1LFUP 3FMKA 2P5KA 3BE9A 2RNJA 1MDMA 5EGOB 4U8ZA 4CVAA 1BX6A 3BGQA 4ZYGA 4BDYA 4K77A 3LXLA 1LVKA 1W1WE 4E5WA 2XDVA 2LGCA 1B6AA 3P4KA 4ETSA 4DDGA 5J4VA 1YHSA 3DJ5A 3GVAA 1JKLA 2QOFA 5DM7F 5C26A 3OBGA 4H05A 1PXPA 1AU7A 1XTAA 3TOAA 1ZY4A 3DGKA 2E1OA 3QOEA 4OBQA 1OL2A 1VEBA 2V79A 2YUSA 4PMPA 3TV7A 2KZVA 4ZZMA 2QG5A 1H28A 2W05A 3C1XA 3FMRA 4L68A 4TZRA 1ZG5A 4Y4RA 5JRSA 4HGEA 5HO7A 3JPVA 3QWJA 3AOXA 4XH6A 4I0SA 1JXSA 2X8DA 3ZM9A 5IDNA 5LWNA 4DFYA 3TYKA 5DM6F 1IN6A 2F5VA 4YTHA 3PG1A 4RC3A 1HF0A 1YHWA 1A6IA 5HE1A 3HVCA 2XK6A 3UNJA 1RR7A 1YW2A 3ACJA 5EYRA 2C68A 2CGPA 3CQWA 4AT5A 3W2RA 3Q4CA 1XDUA 3FLSA 3E5QA 2EXCX 4C3JJ 4TT7A 4NFNA 2P7CB 4D5HA 2M8GX 4F1MA 2RG5A 1T33A 1PUFB 1ZOEA 3NAUA 3Q0VA 5M56A 5EQEA 2CJJA 2OJJA 3VQUA 2O8YA 2PMIA 3NFGB 3PPZA 3A4OX 3PVGA 1NVQA 1VQ5I 3S00A 4EKLA 2YHVA 1XMMA 4DHFA 4YURA 5CSWA 1U9NA 3GCVA 3UODA 3SRVA 4MHAA 4XRSG 3VUGA 4LITA 1B59A 2XJ0A 3V8KA 2HW6A 3SQQA 3NWTA 5CZIA 2GQRA 3ZFXA 1CDKA 3E3PA 1DPRA 3ACKA 5A14A 4O86A 4RC2A 4FE7A 5EG3A 3PSIA 1FMOE 3CD8A 1FQ1B 2X1EA 2EXMA 1GAGA 3BLYA 4U42A 4UEUA 4C3PA 4BY7J 1IAHA 5H9BA 2HWVA 2ZO4A 5ICEA 1QU3A 1A5JA 4UVAA 1UA2A 3GC8A 2DFFA 3Q04A 4AD9A 2J7TA 1P4OA 3OYDA 4Z3VA 3NFFB 1WVRA 1F5TA 3R2YA 4IZ7A 1AA7A 3MB7A 2R3LA 1XSDA 1TP4A 4NB5A 1TNSA 2BXYA 4RSSA 4AZSA 3CS9A 3GVUA 4BS9A 5EW8A 3FL5A 2GIVA 1OR7A 4FV9A 3FUPA 2W06A 3QAME 3R1NA 3ZN1A 5CAOA 1WBPA 3FY2A 4YEJA 2ONLA 2WBMA 3QL8A 3BTJA 1ZHFA 5HNHA 2YCSA 4XMOA 2QOHA 4DEBA 4FT9A 3DBQA 5DYJA 5DNRA 3OW3A 3IDCA 4L46A 5JK3A 2PUPA 3KP7A 4HNTA 4FSWA 4ZLZA 4RQVA 2A2AA 3Q32A 3HRTA 3I5ZA 4DH3A 3QYZA 3ZOSA 3FMEA 3WYYA 2ZJPF 4DFNA 2CGXA 4CZZA 3DKOA 2JIIA 3Q9YA 1ST0A 5CQEA 2DT7B 4B0GA 2VO3A 4ZTRA 1Y56A 1GVDA 4FV1A 1O6YA 1YWNA 3R0AA 3J81K 1IRFA 1UNGA 3JS2A 3V01A 4E6CA 3MGYA 1X3UA 3VBVA 4BHPA 1OGYA 2TRTA 3QAHA 4RB0A 4TTHB 2MGQA 1FBUA 5AP5A 4XX9A 3FEGA 2RFDA 2R0IA 2E2HJ 4UUSA 2AC3A 2HXQA 3HV6A 4D9JA 5F0CA 2J90A 3SFZA 3AL0B 2LNBA 2DYSH 4I02A 4BL0B 4M97A 3TEIA 3NMUF 4R5YA 2JUGA 1Q5KA 3LLAA 4YUQA 3DKFA 1D0YA 3AXWA 5BOXA 2OF2A 2YM6A 3KP4A 2Q0BA 4DEHA 2RFEA 5HEZA 4MHGA 3SOAA 3SZTA 4M0ZA 4LV7A 4IXAA 4PUSA 2WEVA 3BR3A 3QRKA 4XLFA 1UJ8A 3A7JA 2DPUA 3UNGC 5BYLA 5KX8A 1D0XA 5LVOA 2OPTA 3PO3J 2OQRA 3F2NA 4QP9A 4FG7A 3PIOF 3Q2JA 4WG3A 5E1XA 3L2RA 1OKWA 5AP2A 3MKWB 3IC7A 2OCCH 2DWBA 3LSJA 4R79A 4I6QA 2JFLA 2BROA 4FX3A 1FZPB 3EQDA 3KA0A 3R9HA 1MRUA 2FBIA 2XB0X 4BE1A 1P9QC 4FZ6A 1OIYA 2R3IA 2QQ9A 4PNIA 2CSOA 2VPLA 3CCEI 3ZTXA 1PKGA 4AG8A 4RWKA 2YM3A 5LMKA 3GFWA 5JFRA 2YAAA 2VLAA 2LY2A 3EKKA 3ZO3A 3MN2A 1XH8A 2VD5A 3QQUA 4OMYA 4RRVA 3OIOA 3BRBA 3D5XA 4V0GA 4RLQA 2HZ4A 4HNUA 2KP6A 3G51A 3FM5A 2H1KA 4BEHB 2R3NA 5IQGA 4FTIA 5LOHA 2X1NA 3ABKH 4ZS0A 3QOPA 3EPZA 4DEEA 4E20A 3FHRA 3H36A 2C6TA 3FMHA 4YO6A 3DTEA 5ICCA 1YX3A 2W9FB 1OUKA 4XG9A 5KHXA 5LXMA 5AWMA 3SDBA 3HPGA 2Y0SN 4LG0B 2VKEA 1CKIA 4DIQA 4YNEA 1J7UA 2QD9A 3ENHA 1STZA 3RWQA 2ITPA 4ZLYA 2YDIA 5L6WL 2WWYA 1JUMA 4FJVA 1KZHA 1F1ZA 5KAIC 4QTCA 3PPKA 4USDA 2X7GA 4YJUA 3G33A 2WC2A 3DEUA 1WJEA 1LUFA 3CESA 1Q8UA 1RUOA 2CW0F 2WMWA 4ENKA 4K2EA 3V5JA 2HELA 2OC6A 2BHYA 2XB7A 1B6CB 1OPLA 4O7WA 3W18A 5GJGA 3M1EA 3FDYA 2E1MC 3HTUA 2UZKA 3HRSA 2EFOA 2L3DA 2BZTA 2WMVA 3FHNA 4QTBA 4WWCA 1MQ4A 1L3LA 4E6KG 5L2WA 1ZGJA 3BU3A 5I9XA 4WUAA 4P9FA 1G3NA 5C9CA 1FOXA 3ORMA 2Y9ZA 3GTPJ 3QZFA 5BX0A 3RM7A 2IGMA 3PJ8A 2BY2A 4U0IA 2YERA 1IW7F 4BCPA 4HRIA 4MWIA 1R58A 4WXDA 2RREA 2O5RA 2EIMH 2H8WA 3ABUA 2JMWA 4YFXF 4KAOA 4XLVA 3VBQA 3UNZA 4LLLA 2PZRA 2M9HA 2W5AA 3HYIA 3E62A 3RPUA 4DT8A 3SX9A 4RIWB 2F5FA 5IP9J 4F6SA 4QMXA 3LFKA 3KP3A 4YTIA 3PY0A 3AFHA 1HC8A 2NNWB 2W96B 1QNTA 4K1BA 2TCTA 3PUBA 4MTDA 3I60A 2LKXA 2WTDA 2KRHA 3I7CA 2BHHA 2UZLA 4I4EA 4D5KA 2IVSA 1CKJA 4RIXA 4ACMA 4XP2A 3IWFA 5E1EA 2QSGX 3AC3A 3VHKA 3SG9A 3V7RA 2LOOA 3L8PA 3F2AA 3PA4A 1MMSA 5FKOA 1ZZLA 4BAYA 1MMGA 4BJ6C 4RVTA 4PL4A 1XG1A 2MC3A 5HG5A 2ZSHB 2Z7LA 3ZONA 2ZJQF 4LG4A 3UDSA 3HSFA 2XRNA 3VULA 4BYYA 2K9QA 2R4BA 4C2MJ 1L0OC 4X2KA 4FKOA 2ZDUA 4HPQA 2PMUA 2AQEA 1RKWA 4BBMA 4MXAA 3CUQC 4M9SA 2NYXA 3BGZA 3ZLXA 3OT8A 5KMMA 1IV6A 4Z2YA 1BI0A 4TNDA 1Q8YA 4RJ8A 1BC8C 3F9KA 4E8AA 4OBPA 5D1JA 3GXLA 1MD0A 3AG3H 3HHHA 4EEVA 4FX0A 5AV1A 5HU3A 3LIJA 3BQYA 3E7LA 4IC8A 1QGPA 2WXVA 4D0WA 2HVQA 4OT5A 2IN6A 5CF6A 2RG6A 2DYRH 2ADUA 4CMTA 4HGSA 1G2HA 3JAMK 2J0JA 3KZZA 3ABMH 1R0PA 2W1IA 3R8ZA 2OIQA 2R7DA 4FT3A 2Z60A 3HOZJ 2VC1A 4Z7GA 4ZDLA 3R21A 4YC3A 2UW6A 2ECBA 4Z6YA 3TO7A 4U45A 3A0HC 4CA0A 3TNPC 4BXFA 3RGFA 3DJ7A 1PVEA 4D1ZA 5TGTA 2BTSA 3ULQB 2C6LA 2LG4A 3GCSA 4XG3A 4F3QA 4OTGA 1RC9A 4PRJA 3I55I 2VO6A 3UBDA 5M5WJ 3FMJA 4I5HA 5AUWA 1HW1A 2K4JA 2A6HF 3CJTB 2H9VA 2IW8A 1NA7A 4G94A 3TEDA 3F8MA 3BHTA 4NBQA 1TT0A 4IM2A 1MGTA 2I1MA 4FE2A 3VOEA 2LY9A 3LSGA 2UUEA 2ITUA 2KRFA 2RV8A 2NS8A 3FPQA 5JN2A 5JT2A 1SMYF 1BYGA 3ORZA 1DU6A 4RJ6A 2X9FA 4AUAA 1HW2A 4XS2A 3Q4TA 3KPHA 1PXNA 3VWBA 2K3PA 3ECOA 4D7MA 3WGHA 1D1BA 2PVNA 2XIGA 1A35A 4DGOA 4EK3A 4FTRA 3AG2H 3BBTB 3I0TA 4GJ2A 4OTHA 1BI3A 5IYCJ 2PZYA 3TP3A 2NOGA 1Z9CA 4C2UA 2J5FA 3TV6A 1FOTA 1HSJA 3C0GA 4AFEA 3MY5A 1H88C 1JJ8C 3BG3A 5K1YA 5EHLA 4LFIA 4RB3C 2YU9J 3RHXA 1TZLA 5J7HA 3JTGA 2ITQA 1LFBA 4PTEA 3QF9A 4JBQA 3GU8A 4TYGA 3PSFA 1G3SA 4XL9A 3J7YJ 5J8CA 4R3PA 1RKTA 1I3QJ 4JNWA 2E9OA 2EPFA 2M45A 1B38A 3ZN0A 3IO7A 3VUKA 3TO6A 2RC4A 3RHKA 5LCKA 4BJJB 3K5VA 5K9IA 2WB1N 5CQWA 4JP0A 2QU6A 2VOPA 2HKXA 1ZYCA 3HJEA 1AD5A 2CNQA 4OIOF 2IZTA 2Y8OA 4BZOA 2VQGA 3BOQA 1RRJA 4MGRA 4ZYAA 2J4ZA 3ASOH 4BI0A 3AC2A 1VZOA 1SNXA 4EM2A 2L4AA 2QOQA 4PCQA 5IT9Z 3I81A 5DH3A 2VTSA 4BU2A 4KIFA 2Y9QA 3S4QA 1O9UA 1USSA 3EL8A 2JQ7A 1SEUA 1JT0A 1VQ9I 5EM8A 2Z99A 4NW6A 3IH4A 2EA2A 4PV0A 2B9HA 3H3CA 3NAXA 1VQ8I 1T46A 3ETAA 3R1YA 5GPAA 3R9RA 2G01A 3MEXA 3E1SA 3K2AA 4O21A 3G6GA 2HQAA 3PIPF 4HYEA 1EF4A 3FLYA 4M6YA 2A68F 4RC4A 1R5HA 5AP7A 2Y0SA 2YWPA 3P08A 4G6LA 5CU6A 4XIDA 3KF7A 4HVHA 4XG7A 5L2TA 3QC9A 4FT5A 1G3TA 2UV2A 3QWLA 3F22A 5H8BA 2OIDA 2X8IA 3HSEA 2V9PA 3GGFA 3HRMA 3LFDA 1H07A 3ENMA 4EHZA 2B55A 2OK1A 4BDGA 3WTXC 2IZRA 3K4NA 3FXOA 4C7TA 4D4YA 3ERKA 3IGGA 2JA6J 2BYVE 4UHTA 4L9IA 4R7IA 3I59A 5HCXA 1YTYA 2ZB0A 2E1MB 1Y1WJ 3BQRA 2L9RA 4M3DA 4CCJA 3TKHA 1E1XA 3IAM2 3BJAA 4CFUA 3HEGA 3TDZC 1JNKA 1KV1A 2VN9A 3MIYA 4N0SA 3ZC6A 3OYEA 4FTQA 5M07A 4A93J 5BQTA 3G9LX 2HDWA 1H01A 3W8LA 4NUBA 4HZSA 2YM7A 3QUDA 4JAIA 1FTTA 3BDDA 4IAAA 3OIPA 3LXNA 3WGIA 3OV8A 5J9YA 3MWUA 2P33A 4RX7A 3L2CA 1I27A 4GYIA 4LMYA 1R23A 4V01A 4DBNA 3E6DA 3MZYA 3WTUC 1ON2A 2LREA 3SQNA 4G3EA 5A6NA 2E9VA 4WRSA 1Q99A 4O0TA 1ENHA 3GTOJ 3BT9A 4CRLA 4CZTA 1BIAA 2BZKB 1XBCA 4F64A 4R1YA 3GC0A 5M55A 4IM0A 3RIRA 4HF0A 3P7AA 2ZV9A 2A19B 4LB6B 3C0HA 2UZWE 2PVRA 3QTIA 1G8XA 4QYEA 1LVAA 4EHGA 4ZP5A 5K5NA 3EYYA 4LGHA 1BBYA 2WTIA 2PSQA 5BUIA 1B4AA 2GHGA 2YITA 2VT3A 3LQ5A 3UQGA 4D1QA 3OYFA 2XIZA 3ZBXA 2EU9A 4YJNA 2Q8KA 4AIJA 4D9TA 3NW6A 4AGCA 5BV3A 4JRVA 4ANBA 3H9QA 2ZB9A 4II2A 4P9UA 1KWPA 2UW4A 4I1ZA 3DXQA 1QPCA 5DIAA 3CUQB 2J0KA 5E90A 2WTJA 5I4NA 1T98A 1YJWI 5LEJA 4G6QA 2DT6A 3VVHA 3BHHA 3AD6A 3WE8A 3FBIB 4YR8A 2VASA 4UXLA 4QP4A 3VBYA 2FBKA 3LJ1A 3UC4A 5CEOA 3LFBA 4C34A 4FL3A 4IAZA 3O0GA 4EORA 4AF3A 5ACBC 3OYLA 5HDKA 2LKSA 2LFBA 3CDLA 5M4IA 2Y0MA 5D12A 1PJRA 4CG8A 1VZ0A 3ZMZA 4FEVA 4MEXF 4S32A 1X1PA 2DOAA 4CSWA 3KXHA 4IZAA 2A6EF 1LEZA 3S3IA 1WI3A 2IVUA 3MA6A 2WOTA 4IQ6A 2EJRA 3TP0A 5JFVA 3FXLA 3UQFA 2H6DA 1ETVA 1OYYA 2FEZA 3K1NA 2YACA 1IEPA 1BJAA 3LCOA 3NRMA 1D1CA 3C9WA 4EQQA 3MFRA 4FTJA 2UW7A 1A48A 4FT0A 1JHFA 4I93A 1O7FA 2D1HA 5IQCA 5JKGA 1H0MA 4RVLA 5LGNA 4PDYA 4ITIA 2NNNA 2KIFA 5CLPA 4L3JA 4PFPA 2JIUA 5F94A 4DEDA 4J97A 1ZARA 3ZXTA 2XASA 1ZR4A 5DG5A 2WV0A 3M1SA 4DGWB 2ONLC 3FL4A 2WTCA 2JIVA 3NUSA 3MA3A 5J8FA 3OWKA 2DA2A 4EOIA 5ETCA 3ORPA 3QU0A 4MD7E 1KQ0A 2XEZA 4CYCB 2AS5F 5JFWA 4DN5A 3P0MA 1BW5A 4RLFA 5E1WA 4ZJZA 5GAHJ 2VBXA 1HA8A 3UPXA 2PVLA 3CCVI 3WU1B 4XLPF 4PFOA 4E7ZA 3NS9A 4F0IA 4HSRA 4NC8A 1JKSA 1FVVA 4FSZA 3PZHA 2QQBA 2VGPA 4QMMA 4Q4ZF 5CU0A 4UZHA 1RETA 2R7VA 2YABA 5M4CA 4GFBA 4DFXE 1YLFA 5ETFA 5KZIA 5EYCA 4R1VA 4ZMFA 2XALA 2D1VA 2O0YA 3W6VA 3D5VA 5JGBA 5IQDA 2W1OA 3G0EA 5JMSA 3L2QA 3UDZA 3C4XA 3I0OA 3ODZX 5DCMB 2CUJA 2OJED 5IT3A 1GZKA 2GAUA 2XAOA 2Q0NA 3CEKA 1S9HA 3HOXJ 2DA1A 2J2IB 4FSUA 4BBSJ 2LY1A 4ENNA 5ERIA 4D2SA 3MH1A 4GCJA 2F2UA 1UU8A 3QFVA 1O57A 4P90A 1Y91A 4IHTA 3CP2A 3K1PA 3HXLA 5G6VA 3S1MJ 4M12A 2P8TA 1O3RA 5TT7A 4U3YA 2DDAA 2O03A 5AV2A 2JA7J 5F08A 1X1BA 4EM0B 3UJGA 3G2BA 4FCYA 4U79A 3KB7A 4D55A 4J95A 2FOWA 4ASXA 5KAFC 2QQ7A 2H6BA 3SDGA 4NSTA 1T0FC 3MJ1A 3A4CA 2HK5A 3ID6C 3DU5A 5H6QA 3DBDA 3DWLE 1V5FA 2ECCA 1H1PA 3ZOBA 2FX0A 5KMIA 2XKFA 1WSUA 5HD7A 5FP5A 5AP6A 3GLLA 1MW7A 1Z6TA 2X81A 3VPRA 2EV5A 3OEZA 2RNGA 2PUIA 1AKHA 5FRIA 4KMUX 4NCTC 1H08A 1WBTA 2IWIA 4FV2A 4F08A 1KU3A 4H0EA 5EYMA 3DEWA 5J1YA 5FP6A 3KEYA 2XZSA 2DMTA 1X4PA 5ICGA 5DWRA 3MS9A 1G3YA 3TNIA 3BYUA 1BL7A 1ZY5A 4D0PA 5ANKA 3U9CA 1K7AA 3TACA 3VS1A 1EKEA 3EQHA 3RZOJ 2DOEA 5EZHA 3FMLA 3A0BC 4O6LA 2WY8Q 3V7SA 3UTOA 4MO7A 4XYFA 2JPBA 2IGOA 4C02A 4EOQA 3MFSA 2NVYJ 3BEGA 2KDZA 1MDMB 2RQPA 4MQ2A 2V55A 1XWSA 2R7ZJ 3QCSA 3D4QA 2YPRA 4Q5SF 2L7MP 3DDQA 4F9YA 2XIXA 4O7NA 3BYSA 4MK0A 5J5SA 1MJBA 2C6OA 3OHTA 3P79A 4IVNA 1A04A 4HPUE 4BDIA 5BUJA 4HPTE 4A3FJ 3JW4A 2Z8CA 4BCFA 4OTFA 3U21A 4Z9LA 5KHDA 4U40A 2I6LA 4AXAA 1ZQ3P 4DGNA 3MH2A 3NAYA 2DFHA 3NCGA 3FZTA 5EQPA 5A4EA 3QP6A 1VFCA 3ZUVA 2I40A 5CNOA 3DLZA 1OPKA 2ZNZA 1Q41A 2YJSA 4L5JA 4LL5A 2YA9A 3GZ5A 4WCGA 3CKWA 5HCZA 2V62A 3EDPA 3R9NA 3QUEA 3QC4A 4JDJA 4ZYDA 4CCOA 2IG7A 4FV4A 4TV7A 5FGKA 2F7XE 4A9UA 2XS0A 2REIA 4D58A 5F4NA 2IW5A 4FVRA 5EI2A 2YS9A 1FOKA 4KB8A 3V04A 2ZXWH 5C44J 2CPKE 2XIYA 1OYIA 3PXQA 5JLWA 5LWMA 1GIIA 1IN4A 2XANA 2XNPA 3HL7A 4RPVA 4M67A 4I6FA 4YFNF 2K86A 3VB2A 3CGFA 4FI1A 5ANOA 3E5XA 3GZ6A 5BMSA 3AAFA 3EWHA 2L5QA 3ORKA 3FLQA 2ZMEC 4G6TB 5GAGJ 2XNOA 5H8EA 4DFBA 3KX2A 3SZPA 1KONA 1R78A 1E0EA 4FBXA 3VYRB 2KT0A 4AAYA 3LAUA 2XGEA 2XF7A 1QBJA 5KVRA 1Z1DA 2MBFA 2NVTJ 3FQEA 3CDHA 5E79C 2UW0A 2IW9A 3K70D 2BVMA 4OU0A 4Y73A 3SRVB 5LLQA 4XLNF 1ODDA 1XH4A 2IPQX 4AA4A 4HVGA 1WVXA 2BAJA 4PJ0C 4CFNA 1H89C 2UVXA 3UZPA 1IUYA 4ESFA 3OYCA 4A6EA 4ZSGA 1IO2A 2C5XA 4EH9A 3OS1A 1YI3A 3ATTA 3MQ0A 3E8EA 4YBKA 3R61A 5DA3A 3ZR8X 2QKRA 3KE2A 3EFLA 3CJNA 5IOYA 1LE8A 2M8EA 2FNAA 5C03A 2VTNA 2ZBKA 1U54A 3VIDA 4YZBA 2WA0A 3ZCOA 5AAEA 3D7TB 1VQNI 4C38A 1FC3A 3S2HJ 4F7SA 2ELHA 3PXYA 2WQOA 2COBA 4EEFG 3II5A 1IC8A 2OF7A 2BDJA 2ICWG 3EIDA 5LHHA 3AQVA 4JI9A 3BG6A 2EUFB 4CDGA 1MSFC 1JGSA 3CIKA 2R9SA 1XBAA 1KU7A 2C5OA 2ZFUA 3FJQE 1AHDP 3O2MA 5JSMA 4KJZA 3V7CA 2ZV8A 3SG8A 2JDVA 1TWHJ 4ITHA 3KRLA 3KFWX 1HKQA 2FMLA 3E3BX 4DYRA 3ZQGA 5DT3A 2WTWA 1Q62A 3CTQA 5B7VA 2CCIA 4CEGA 3F6VA 5JVTA 2GA2A 4AM3A 5IEXA 3DCVA 3I4NJ 1Y1VJ 3UMWA 1W7PA 4F93B 2CUEA 4DBQA 4U9AA 2CQKA 3CE3A 1B9NA 1OIQA 3OF0A 4HW7A 1HCRA 3HZTA 2JVHA 3R7OA 1VQLI 2E1NA 1DPUA 1XJDA 2OH4A 2UUZA 4AX8A 4KISA 4PJMA 5FDXA 3HEFA 1PMEA 5KO1A 4AGUA 2OZAA 2HWPA 3UYSA 3PRFA 4WNOA 5TJJA 3HMIA 1ZR2A 3C4WA 4IX5A 4C58A 1JQHA 2FGIA 2R3SA 3M8JA 2XK8A 3ZRMA 4LJZF 2ZSIB 2QF7A 5EKOA 4XHKB 2FMYA 3BTIA 3VS0A 3B8QA 4JDHA 3M8EA 1B72B 5E8XA 4XNFA 1NG6A 5C8NA 3NUXA 4GFGA 1RIOH 1R3CA 4RIOA 2DTRA 4F7LA 5HVJA 3GU5A 4XG8A 4MXXA 2VKHA 4NKAA 1TWAJ 3BY6A 5FKKA 5ED4A 1XGSA 4RZWA 2F5EA 3FZRA 4ANQA 1K83J 3K10A 3H3UA 3LSKA 4BE0A 5J1VA 5TF9A 3W1FA 1PUFA 4C4IA 3H3VK 5H2FC 2GXBA 1OL7A 2XSJC 4AWXB 2R64A 3PLSA 4UYNA 4WUNA 4XRMA 4MTEA 3HM5A 3FF5A 5EI8A 3BHYA 3HV4A 1OYWA 4CLIA 3H10A 3FSKA 3BHVA 2VBYA 2DW4A 2Y30A 2BE5F 3HMMA 5KKRC 2CLXA 4NC7A 1MMAA 4RMNA 2H96A 4GCVA 3HA6A 4V0GB 1KYZA 1V0OA 1F9NA 3NIZA 3QTRA 4BIBA 3WHBA 2J5OA 2R5YB 2MLGA 4FNWA 3K4BA 3V8LA 1FIAA 3W6KB 3FXUA 1S72I 3UIMA 5EI6A 4HEA2 3UIBA 5HLGA 4CCBA 5CXHA 5E92A 3D5WA 2I8DA 1UKHA 4A3IJ 1IA9A 3KGAA 4OINF 2CUFA 3AG9A 4G12A 5FM2A 1K2PA 3TTJA 2KKOA 3AGLA 1Y39A 3P5JC 3NSZA 1ETOA 2XRUA 3G9NA 2QURA 5E8SA 4FC0A 4EI4A 4EKKA 5CU2A 4QNAA 4QTAA 5LHIA 1J7IA 4RX9A 4CKIA 4TY1A 3C18A 5JRQA 1KA8A 4O91A 4FIFA 3Q3SA 2C6EA 4X6QC 3REPA 2QO2A 2EZIA 4EGZA 4BHCA 1T8IA 3V6RA 2R7QA 3VS2A 3OL3A 3ASNH 3GTLJ 2DMUA 4YIIA 1H24A 2IPXA 4B43A 1DUXC 1IV8A 3NEUA 2ID6A 4PUZA 3EZRA 4RAGA 2UW9A 4JX3A 1JKQC 1YI4A 3GQIA 4GEOA 1Y6IA 3PVUA 2XPUA 4WNMA 4B8XA 4F70A 4RWLA 4WSYA 2PMHA 1F3MC 4O83A 2IEKA 3VRZA 5GIOE 2HAKA 4UV9A 4CLJA 2IA0A 3TDWA 3GCQA 2FSMX 3VF8A 4M72A 5IUGA 1V4RA 3DQXA 4HCVA 4BTJA 3PFIA 3HDMA 1O4XA 1ZYLA 3IW5A 3DKYA 4MXOA 4CV8A 5A4TA 4QMPA 3NARA 3P78A 3KLOA 1IJWC 4DC2A 4FKUA 3NNWA 4Y46A 4NM5A 3FLNC 4IJ9A 3OCTA 4Y72A 4P5OA 2DMPA 4DG0E 4RVKA 1ETXA 4V04A 1GLNA 2ZMEB 3I6WA 2BDWA 4AA5A 4NT4A 1UWJA 1WQ2A 1XGOA 3DBFA 2QLZA 3TOBA 4GK2A 4DF3A 3R63A 5CEIA 2FU4A 2YIWA 1RNLA 2ZXJA 4MH7A 4AWIA 2JA8J 3CZ6A 4J53A 4JX6A 1URCA 2EILH 4IX3A 4LGGA 2VI6A 5HBEA 1U0JA 3VEPA 4ERKA 4H4KC 2V22A 3ECHA 4K9YA 4R1HA 2R7XA 2CH0A 1U9OA 2WMTA 4CXFA 4DGLC 1W84A 4DHZA 1KSWA 2BBYA 1LB2A 1JSTA 5CYVA 5C4JJ 1FSHA 4XCUA 4RGRA 5F1ZA 2G2IA 1I50J 5E8UA 4QMUA 3SXFA 3BLQA 3VS5A 2G7UA 3BG9A 5L3FA 2PVKA 1HDDC 2DA7A 4RLLA 3M07A 3AD5A 4UNOA 2WAJA 2Z2SB 1SAXA 5AM7A 1Q8WA 4PGHA 4F0FA 4CMUA 3I64A 2EB7A 1BW6A 3LSTA 4BEHA 3TUDA 2PVHA 2HPIA 3QODA 3HAMA 3F3TA 3R28A 2BEOA 2JZYA 2EIKH 1ZLJA 4BGQA 5M5XJ 4G5JA 5K5RA 2PQ8A 1SMHA 4ALWA 3ZUUA 3FK7A 4CRSA 4BNCA 2W7XA 2DUVA 3FI3A 1IG1A 3IHUA 4DH8A 5AP0A 4LG0A 3JRGA 2W1ZA 2TDXA 4ZC3A 2DBBA 4FTNA 4O0WA 2BKKA 4A07A 4E7WA 1BUHA 5IZFA 4YZ9A 4WBBB 5DVRA 2JVGA 2ERKA 1W98A 5C8KA 2R3RA 3ZSIA 4FEUA 5AM6A 5FBNC 3AMYA 3Q9ZA 4B47A 3FISA 2X6WA 4JX5A 3TKUA 5IA0A 2CGUA 2L9SA 4FTHA 2HDDA 2A69F 3I3LA 1WPKA 3BR0A 1PXOA 3I5NA 1WBSA 2W7NA 4ZZLA 4D5CA 3L2WA 3H9JA 5FG8A 1SD5A 5E1ZB 2FUMA 1IAWA 1PMUA 1EH8A 3W0NA 3SHFA 1CF7B 4E1ZA 4IEJA 3UIUA 3C2BA 5JR3A 5FJ8J 1TQIA 2ZXIA 4BDCA 5FD5A 2OZOA 4UWYA 4PJLA 3F3ZA 3QTWA 5J40A 2FD5A 2A6TA 3HP5A 3V8JA 1ZRCA 3LAPA 2YFXA 2RQQA 4XKVA 1WRJA 4R5SA 4CT1A 4BRXA 1WBWA 1XGNA 2QHMA 1R1TA 3FYJX 5HVQC 3C13A 1A31A 4Y5HA 1XH7A 1WFXA 1SFKA 4PSWA 2K7LA 2XCHA 3ALOA 3UDBA 4CO8A 3DBCA 3MFTA 3FE3A 3WU0A 3OY1A 3ZGKA 3D83A 4GMYA 1U3EM 1NK2P 4EH4A 2EZLA 2H6CA 4II5A 5K7FA 4F92B 2PVJA 2XUBA 3T8OA 3QRUA 3BG5A 4EJTA 2VXDA 4C33A 4W4YA 4X2JA 1A9UA 2VKVA 3UPZA 5E17F 5KKRB 5FEDA 1RUNA 3R8VA 3AKKA 2FVDA 2W99B 3F9NA 5HU9A 3C4EA 5AX9A 4D4VA 1EH6A 2OXYA 3FMSA 1U46A 1P4WA 3D94A 1FBQA 2OIBA 3RZBA 1XMLA 2A61A 3CO7C 1OZ1A 2UZVA 5J87A 4GK4A 3COHA 4MXZA 1V3FA 3QU6A 4JR7A 1XMKA 2JN6A 3BG7A 2P5LC 3VUMA 5I9VA 4LK0F 3RAHA 5L3BA 3DXNA 5EW3A 5L2SA 3OFMA 4W4VA 3PA5A 5HNFA 4BKJA 1JWHA 3WHCA 4HYIA 5L2IA 1I09A 5EYKA 1UU3A 1W36C 2CV1A 4LLNA 2X51A 2JKOA 4H3BA 4FKTA 2XP2A 4PSXA 3TV4A 2ETKA 4TNBA 3EMGA 2DU9A 2HOGA 5E8IA 4IHPA 3TDVA 3OC1A 5E7RA 3ANRA 3K54A 2JKQA 3PPJA 2V7AA 2LP0A 3FM3A 4YFKF 5JGDA 3EL7A 3NYXA 3QD4A 4ORKA 5TKDA 3WTYC 1Q1VA 4PP7A 5FLXZ 2VN2A 1YW8A 4QPSA 3VYTB 3I4MJ 5C27A 4ALUA 4E93A 3FMDA 4B09A 1OQYA 1IA8A 4IAFA 4IM3A 3CQUA 2L02A 3E8DA 5A4QA 2CGVA 2OFUA 2PZPA 4TYJA 4CGZA 3ET7A 4FKLA 4YJQA 3UZTA 4FTTA 2NRYA 3MVJA 3A8WA 3IAS2 4PX6A 4EH3A 3GQLA 4ZTHA 4F1OA 4N70A 5ICFA 3FC2A 3T1BA 3Q5IA 3M8FA 5K4IA 2IXSA 1HDPA 2GQSA 2C6MA 3PY3A 2FSOX 4DITA 2XROA 2LF7A 2LVSA 2R3JA 3HGGA 2HW7A 1R6RA 4I0BA 3PL8A 3PTGA 3EN5A 2GBYA 1OMWA 2VTLA 1XD7A 1KE7A 2UZOA 4TWOA 2J9MA 3KXNA 2OD5A 4BE2A 3LOKA 4H39A 2R4GA 3ERED 3R0TA 3FMMA 2JKMA 2EA4A 4ZY5A 1NK3P 4FSQA 3HX4A 2AXLA 3F3WA 2B9SA 1W83A 4IADA 1LDDA 5HKMA 2YX7A 4JT3A 2OWBA 5DYMA 3GFIA 5F9EA 4YHFA 1WCCA 1XO2B 4BJJA 4RMZA 5BNGA 4A5MA 3H92A 1FSEA 4RB2C 3ZMTA 1OM1A 2VJJA 4DEGA 1Q61A 1A6QA 3JR1A 3KRWA 4ACHA 1LPQA 1VYWA 4Z7HA 2C3IB 1YOJA 3Q9SA 1X1DA 4YJVA 3SAYA 2F7EE 3CY3A 5JFSA 4B7TA 3OSGA 3ORXA 3TO9A 4XG4A 3SXSA 1DS5A 2C30A 3OOUA 4G6DA 5EM6A 4ASNA 1GDTA 3W0OA 4U88A 3K4LA 4DINA 4YTFA 2VWXA 4I20A 4G9RA 4OUCA 4ARKA 3CLQA 2SRCA 2V4JC 1BR1A 1MMDA 1I6XA 5E8YA 1LUJB 4I0RA 3PRIA 3FI2A 5M3FJ 3KZIC 4BJTA 4AIHA 4CFFA 2OICA 3EFJA 3H9GA 4AGWA 1E1VA 1F4KA 4A9SA 2WPAA 4A3DJ 1TNTA 3S2DJ 2YCQA 1WGXA 2FE3A 4V2GA 4DHJA 4M14A 4M9XA 4YU2A 5BVNA 5C4LA 5KMKA 1DI8A 1KU9A 5BMMA 4NWMA 4YHJA 3R4KA 3BR6A 3V42A 4O7TA 4HNIA 4LL0A 1BL6A 3KIOA 3VJOA 1Z57A 3ROUA 1Z21A 3VHEA 1QVUA 3FMNA 4XQFA 3CD6I 2K02A 3OSFA 1DGRM 5K5OA 4E70A 2GNFA 2L7KA 4BGHA 4RAFA 3JUHA 2YN8A 5D7VA 5HVYA 5K7ZA 4FNXA 1LJ9A 3SD0A 2OZUA 3A01B 4YPSA 6PAXA 1IXCA 5IQEA 2YM5A 3VODA 1FTZA 2B9JA 4L3LA 4LRJA 4MD8E 3UDTA 4ON0A 2OF4A 4F9WA 4GH2A 5CX9A 5IPJA 3R02A 3I0QA 1OKVA 1LDKB 4FYOA 2YM8A 3EB0A 3HIFA 4B8MA 5ACKA 1XHAA 4XONA 2E2IJ 2I0HA 2LC2A 4QTEA 1G8SA 3LA3A 5D6EA 5D5XB 5AUXA 1OKYA 3LWFA 1YRNA 1MH3A 2GNJA 4KN4X 3F21A 4PP9A 3O3KA 5FEQA 2Z1DA 4EJWA 1RDQE 5BYZA 5CU3A 2PZIA 4N6YA 4BN1A 3RCDA 5AFVA 3U51A 1Q4LA 3KEXA 2HZ0A 2YISA 3ROYA 3QD3A 4IAKA 4JAJA 4KKHA 3ULZA 1EA3A 5DRBA 4ERWA 3OMYA 2X8EA 4FEQA 4K2RA 1OBGA 1H4LA 2C6YA 3DOGA 2XIKA 3VJNA 5L8LA 5GJFA 4IIRA 1G59A 1SVLA 4BICA 2OO8X 3VO3A 3Q0WA 1BI2A 3Q2MA 4GU9A 5L6OA 3N51A 5GHVA 3SFIA 1FVRA 3F72A 1BI8A 5IF1A 1BR2A 1G5SA 3HL2A 3J80K 3NCZA 2QVOA 3CUQA 1W8CA 3GXOA 4JBAA 1OPCA 2F9GA 4E73A 4LMUA 5AAFA 4NK9A 2AQFA 3LMMA 1ZLKA 3G1OA 2DK5A 1H26A 1UV5A 2FO0A 3E63A 5LFAA 3TNHA 4EZ3A 2MLKA 4HW0A 2HR3A 4BDZA 4ZTLA 2R7RA 4W8EA 4Q47A 3A7IA 4O0RA 2ITNA 2R3QA 5ITAA 1Z6RA 2UZNA 3IGOA 3CGOA 5EHYA 4ZH4F 5D5WB 5H20A 1XR1A 2JBPA 3O96A 4JDIA 4YLJA 4EATA 2XCKA 3QZIA 2KIQA 4IAYA 4JQFA 4UY9A 1HCKA 5IDPA 3ZC5A 2BGCA 4MYGA 5KNJA 4O7LA 3RPUD 4HSTA 4AVPA 1MKMA 4QNYA 1O3SA 4HNVA 1CMKE 3ORTA 1WKMA 3R1QA 1OJLA 4UV0A 3BYOA 2FSLX 2EV6A 1WHUA 1LNWA 2Z5UA 2V6EA 3TZ8A 1MBEA 4WF2A 1J59A 4L01A 1UFMA 3A7GA 1KU2A 3LSMA 4X0GA 4CYDA 4AA0A 4XMYA 3VSLA 1ZOGA 2C5VA 2MYSA 4KBKA 3OUNB 3BU5A 3GP0A 2Z9OA 2MABA 3O6BB 3OYIA 4ZYEA 3HA8A 3MI9A 1YIJI 4G7OF 2CFXA 1I44A 2F7ZE 4GT4A 2VTIA 5JEBA 2RVCA 4XLAA 4BYJA 2HQ5A 2VRXA 2DJNA 1MRYA 1Z7LA 5DD4A 3ONQA 3CSVA 5LMAA 2H8HA 4TW9A 4XP3A 3HG9A 2P2IA 4OBOA 5AUTA 3QQFA 5E20A 2P0CA 3SV0A 4X6RA 4XKWA 4CYCA 4IB3A 2A27A 2X2LA 3ZQHA 3PE2A 4ACDA 4OIPF 3D0SA 1ZZ2A 3A03A 5KMLA 5E9EA 2CMPA 2B54A 4G16A 3WZDA 5T6KA 3TIYA 3G2FA 4NJ3A 4IB0A 1XKKA 1ZRFA 2I7QA 2R3OA 4B1RA 3VUDA 4WK8F 2DA3A 4PTGA 2OCEA 2WQNA 1WZ2A 2GQGA 3RKBA 1KQ8A 2HNHA 3LL7A 5DCFA 5CSPA 5KCVA 2BIYA 4X2NA 4QQCA 4FKPA 3R73A 5B2LA 2FJ1A 2HZTA 4X3FC 5FXQA 3HUGA 4EK8A 3F8CA 1R1UA 3QPLA 1JPAA 4DW6A 4EK5A 2BY1A 2WQBA 5DCMA 5C4KA 4GK3A 4Y8DA 2IT0A 4BDEA 5AIKA 3BYMA 5LBQA 3KLNA 4TYHB 2ETMA 4L7SA 4MNFA 4XRSA 2B0LA 3ZRLA 3FXQA 5I9UA 4TWNA 5FGMA 2K85A 2WELA 4JBOA 3PFYA 5FUTA 3O51A 3RM6A 2IP2A 5TO8A 4XBUA 1M2RA 3U9GA 3G15A 4DGMA 3Q4ZA 3GF2A 1YW7A 2FQ3A 2KPMA 4BCKA 1YFHA 2L4MA 3KY2A 1ORKA 3CLOA 2W48A 5IUHA 3CMAI 3SKCA 2PU8A 4BCQA 3HMPA 3PIZA 4BGDA 2XHKA 3V5QA 2WTVA 3VAPA 4BCJA 4N4SA 4GU6A 3CP8A 4FVPA 4JS8A 3HV3A 2X6YA 3W33A 2Y0AA 3O5AA 3MJ2A 3EJ1A 3T8RA 3NNXA 2BHEA 4BHZA 3NR9A 3UOLA 2XBAA 1S29A 4XN3A 3GU4A 3R83A 5E3OA 5BVDA 2OW3A 1MBHA 3RTPA 2FH9A 3P86A 4MCVA 4DFUA 2VJ4A 1GVJA 3OWTA 2YIXA 2F57A 2OAZA 5EW9A 2E60A 3BV3A 1YITI 1LE8B 4Y3OA 1U54B 4IL6C 2W00A 4IZ5A 4GG7A 4JOMA 2XARA 4I23A 4YZNA 4YP8A 2EFWA 4WOVA 4KSPA 3BQZA 2G1TA 4QQTA 2ESNA 3WTTC 2YM4A 3D14A 1KV2A 2QC6A 2XA4A 2Y9YA 5HBHA 3NIEA 3FKJA 2HXIA 4U7DA 1M2QA 5B2MA 3IH3A 4H3QA 2O3FA 2B53A 4BIEA 4C3FA 4B99A 3ZYAA 5FO5A 1JUSA 3LFNA 4O7SA 3OY3A 4FTAA 1FP2A 2IVVA 4MEDA 4FTLA 5JI6A 3S3MA 1WFCA 3QBNA 2GQQA 4M13A 1NXKA 3DXPA 4TWCA 1WJCA 2HVRA 2G15A 2Y6MA 3FWQA 3F0CA 3Q6WA 3WGGA 2PJRB 3HYHA 4F7JA 1YWVA 3VRYA 5BPDA 3ZM4A 5AUUA 1GV5A 2IBDA 5D9HA 3OP5A 3R30A 4GV1A 5DV5A 2QOLA 3L9PA 2Y4IC 3JY0A 3OZ6A 4JXFA 1T2KA 3F8BA 1W7PB 5E8WA 3Q9XA 5A9UA 2GCDA 2HOAA 2G2FA 5AA9A 3VC4A 2QSHX 4FNYA 4B4LA 3BTLA 2GSFA 4FYNA 4I22A 4FSYA 2R7WA 4KNYA 1NTCA 1YXSA 3FXKA 5LHGA 3ZQQA 2JAVA 2OZAB 3POOA 3DXJF 2UZUE 2DMQA 1UHSA 1WVWA 3TXOA 4GIHA 1MQBA 3R01A 2XNNA 3K6GA 2DN0A 2BUJA 4USEA 3QTUA 1W4MA 3CMMA 3A99A 1IF1A 5HE2A 4FL2A 1Z9XA 2ZMDA 3CCMI 2PX9A 3Q9WA 2R7UA 4RIYA 4BB4A 3S17J 2AYPA 2MFZA 4XOTA 1Z0XA 4YGAA 3C4ZA 5B1BH 1OECA 2VNWA 3TZMA 1QVTA 2J0IA 3K7AJ 4EH7A