3PFYA

The catalytic domain of human otud5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
129
Chain Sequence
MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The catalytic domain of human OTUD5
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
total genus 38
structure length 129
sequence length 146
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pfyA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pfyA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
1AWCA 4LGWA 3E6MA 4KYWA 2XNPA 1P5EA 3QALE 3T3VA 2MLGA 1SAUA 4UN0C 1KZHA 1NG7A 4HNVA 4NKAA 4FT5A 5BUEA 3ZMVA 4EK5A 3ZBXA 4HVHA 4LMYA 4RBOA 2OO8X 5LMKA 5K3YA 2ZMEA 5HDKA 5DEQA 4NTTA 5LWMA 3ZFMA 4GUBA 4AIDA 5B7VA 4I02A 3LNQA 2DOEA 2VN2A 1P4OA 1WJEA 4FJVA 3UDZA 1R58A 5ICPA 1G3SA 4Z7HA 4YBKA 3OL3A 3P9KA 3FMEA 1RKTA 3HHGA 3IH4A 3HRTA 3EIDA 5CVFA 2C5XA 3C18A 4B4CA 4FASD 4XP2A 2HPMA 3PJ2A 3AC3A 4NJDA 2VX3A 4TTHB 4ZYAA 4DBQA 1H9TA 2I7QA 3BV2A 3BKBA 4I20A 1BL0A 3NUUA 4FC0A 4CCJA 3I0QA 1FOYA 4JYKA 4NT4A 5L6PA 5EW8A 5IQBA 2L9SA 3CMYA 5A6OA 5ANOA 1QHHD 1E0EA 4FK6A 2VO6A 4C4HA 4ZTLA 2V0DA 4HG2A 4G6QA 5CF6A 3GBGA 5ANDA 3RPOA 4YSJA 3OTVA 2R7VA 3U4WA 3RKXA 3MZHA 4HNFA 4NM0A 3KIOC 5IUIA 2EH3A 5HVQC 4CXFA 5TT7A 5J1YA 1XN7A 3HSRA 5HLTA 3CY2A 4UX9A 2D45A 3BV3A 3CKXA 2YCQA 3AG2H 1MQBA 2R3OA 3N4UA 1GV2A 2TRTA 5D4SA 3FLYA 3UIXA 1E2XA 1O6YA 4A3CJ 1PUFB 4WXHA 4IWOA 4CV8A 5BVFA 2WMSA 4A12A 4FSWA 3W1FA 3QWLA 2B9FA 3LCOA 4B43A 1GJOA 4JX3A 3W18A 1YDRE 2XK6A 4BY7J 2CQKA 3PWYA 2W4OA 4NC6A 4NK9A 3E6BA 4D7NA 1Z1DA 3D2KA 5ANJA 5TRDA 3Q3BA 3MIYA 2GOMA 2HPIA 1BI3A 4PSWA 4JK1X 3D5XA 4PJNA 3NW6A 2FMYA 2AXTC 5EI8A 4DBXA 4IX7A 3BROA 3ZSGA 5DBXA 1UVRA 4M9ZA 3QTIA 4QO9A 2XB7A 3OVVA 5BVNA 4MXAA 3FHNA 2FA2A 4YLKA 4QP4A 3L8XA 4DYQA 4CKIA 2JMWA 3R2BA 3I56I 3ZRKA 4ANSA 2RV8A 3UQFA 5HU3A 1WI3A 5EG0B 4UNOA 2VRXA 4XK4A 2O0UA 4DFXE 4KT5C 1FP1D 4F6UA 5LXMA 2W9ZB 1YW7A 3ZSIA 3PIYA 5HIDA 2BGCA 1STZA 4FTJA 2UW9A 5AMNA 3FXRA 5EM6A 4DITA 4FNWA 3FWEA 5I5ZA 2K9QA 4UYAA 1YKRA 4BJ5C 5D6EA 2V1XA 5IF1A 2KZVA 4DGNA 2Y7JA 4GKHA 2NXNB 2RQQA 5KMNA 1RR8C 4D9JA 1MNEA 1SVHA 3DEWA 2KDZA 3W0PA 2WNTA 4XV3A 4XL9A 2HZ4A 2ME6A 4AW1A 2V79A 4BGDA 1D0ZA 4FQGA 2CWEA 2IW5A 3GT8A 2R7SA 3CJTB 3BLRA 4EK8A 4KIQA 2DFIA 4ESJA 2IXSA 3JRGA 2M7AA 3FXMA 3RYRA 5BPYA 3Q9VA 4IB1A 3PO3J 4I0TA 3EPZA 5FO5A 3E0JB 2GNLA 3QUEA 4DG0E 4YIRX 2QCOA 3HMMA 3Q6WA 4BXXJ 4M0ZA 2R3HA 3DS6A 2BZKB 4MTDA 4Y15A 4Z3VA 4IACA 1BC8C 4KD1A 4FZDB 3NWTA 3BX5A 5IDNA 2F2CB 4UWCA 2PX9A 4BI2A 4N9HA 2JA2A 3F2NA 4F6WA 3C4WA 3W3CA 3BE2A 1WKMA 2MABA 4U3YA 5FBOA 3F5GA 3SOCA 4GFBA 5HU9A 5EF6A 4XJ0A 3DKFA 2M45A 3H9QA 2XK8A 5DM7F 4XG2A 4HDUA 4D55A 5IA1A 4L44A 5HIEA 2WQMA 4AW2A 1USSA 1GIIA 3QQGA 2WU7A 1TQIA 3PJ3A 2ITVA 2DOFA 3LAPA 3C7JA 4RVMA 1R7JA 1XCVA 3E3VA 4HX4A 2D5VA 3QP6A 3R0JA 2YN8A 5HBEA 2X6XA 3OIPA 4CXAA 1JT0A 1K6YA 2NS7A 4YFNF 4Z6YA 3LOKA 4E4XA 3ZC5A 2LGCA 3BL7A 3NZ0A 3AKJA 2C3LA 2ESHA 1D1AA 2C0OA 3P4KA 4FVQA 2UW4A 3CE3A 2NNNA 3C7QA 3CLYA 2C47A 3L8VA 2IZRA 1Z57A 3VUHA 3CC2I 4Y5HA 5J1WA 2HW7A 4KKGA 2DODA 3R8PA 2XM9A 3RKBA 1JHHA 2EIKH 3IWFA 5TKDA 3RNIA 4WNMA 3IAS2 3HTSB 2P5KA 4OOIA 1Q8WA 5FRNA 1RETA 3G2FA 1X3WB 4RIWB 1ZG5A 2JA8J 3UJGA 2UZVA 1QPMA 2ZV2A 5M57A 3OIQA 3P23A 4DEBA 3HGGA 3P7CA 1APME 3LQ8A 3TNQB 4FICA 5E18F 4I94A 3FXZA 4M69B 4X3FB 1K78B 2HXLA 3VQHA 3L8SA 4KBAA 4D28A 2PVRA 3AGLA 3TACA 2QQ7A 4RGXA 4RX7A 4M3EA 2VZ6A 4Y13A 3HRMA 2PVHA 2UW0A 4PMSA 3F72A 1YHSA 2PE2A 1JWHA 4FIEA 2WD1A 2EA4A 4J53A 4BJTA 1D1CA 4LUDA 1O7LA 4FKJA 2QKRA 3FZVA 4DFUA 3A03A 4H1MA 4IXAA 3DK6A 4RGSA 2Z9OA 4YSMA 3DBLB 3W10A 4F7ZA 2VBZA 3SFIA 3CSVA 2JKQA 3UO5A 1DGRM 2HZTA 2PZYA 3ZUVA 3K9TA 1YJ9I 1SMYF 3MCZA 4O2PA 4IRIA 1E1XA 3I81A 1A35A 4UALA 3PVUA 1VQ7I 1VNDA 4Z55A 4PK4A 2F7XE 1YRNA 3BYMA 1T33A 5IZFA 1HSJA 4M13A 5GPAA 4FSUA 4DW6A 3TIZA 3CCEI 2XNEA 5AM7A 2VL8A 6PAXA 2HR3A 3GUBA 4PFPA 3K70C 1O6KA 1BL7A 5F95A 2QBYA 3GFEA 5T6KA 3T0YA 4I93A 4M3GA 3DQVC 5CU3A 1RPWA 4ITVA 1Z9CA 1Y1WJ 3I4MJ 2ZMEC 3BI6A 3CCQI 1ZRDA 3Q0WA 2QD9A 4Y8DA 4YC8A 4DQ2A 4FUXA 1JOWB 4GMYA 5B2KA 3N51A 4YC3A 4Y33A 3UQCA 1E3PA 1ZYCA 3QQLA 1OR7C 1FC3A 5C9CA 2XGXA 5M51A 3DV3A 2KMUA 2XAQA 3G6HA 1OL6A 1WVRA 4U3ZA 5IA5A 1QU3A 4LM5A 4IEBA 1S7AA 2PY3A 1S9HA 2BRMA 3MS9A 3HXLA 3ABLH 3GC7A 1IG1A 4RWIA 4GRIA 1H88C 2WMTA 4DG2E 3GLXA 3EYGA 5M44A 1KWPA 3BR2A 2X39A 4N9IA 4LK0F 1KQ0A 1BA5A 5AP1A 3AGMA 2LKSA 2WMUA 4F52A 5DFPA 3L9FA 5CVJA 1X4OA 1ETYA 3DOGA 4HGEA 3WG7H 3GOKA 4Q4ZF 3I5UA 3QODA 3VODA 2KIFA 1I6HJ 1HOWA 2V62A 2A5WA 3DQXA 2J50A 3VUMA 3I71A 4MQVA 1I27A 4U7ZA 4GT3A 1GZNA 1DP3A 3FQEA 1TP4A 1X1DA 2VT3A 4JQ7A 2J0LA 4V2FA 1JKTA 1IAJA 4EBWA 4EVIA 4A9SA 2GS7A 2M1BA 4G8XA 2XK9A 3F3WA 2UXXA 2EB7A 5GIPE 4FX0A 1Q3WA 4G7ZF 4BE1A 5FBNC 2QWWA 4JX6A 3RPSA 4BL0B 4QYHA 4QTRA 4MYGA 1XGSA 1JE8A 3R61A 5IOYA 2MGQA 2C5VA 3FI4A 3LAUA 4E4NA 4LG4A 3QQKA 4X0MA 4NFNA 2VWVA 4M73A 3VHKA 1W5TA 1QZEA 4LYNA 2H8HA 2JSPA 4RB3C 2UZUE 5CI6A 3MKLA 3RZOJ 5M5XJ 1HQCA 2KQRA 3KVXA 3MSSA 4OINF 3DKGA 2MH2A 3VRZA 2VWXA 4RLFA 3MN2A 3E6DA 2OAZA 4L67A 1SFKA 4CYCA 3ZZEA 3CJNA 4N0BA 1L8TA 2GQGA 4U41A 3DFGA 5T3QA 3ERKA 5CT7A 3NWSA 5FLMJ 2B9HA 4MNEA 5ETCA 1R0EA 3KEOA 2I5UA 2ITNA 2R3NA 4XKBA 1E3HA 2CRGA 5L6OA 2AEGA 3B2TA 2KL4A 4CCUA 5DRDA 3PUBA 1ACIA 1OYIA 1F5QA 4H05A 2YWVA 4IOCF 4A4XA 3AT2A 3F9NA 3UYTA 1BL6A 2N8GA 4O21A 5F08A 4IB3A 3RKQA 1FOXA 2Y9ZA 2RKUA 5D7AA 4UZHA 4AAYA 4I4EA 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 2BY2A 2BPMA 5GHVA 1IG7A 4WX9A 1ON1A 3SDGA 5AFVA 3R8MA 5C8NA 1P6RA 1SNXA 4AA4A 3CJRB 1R6RA 3BCAA 2K9LA 4BCOA 1G4DA 5AONA 5LQFA 1EH6A 2ZBKA 3DDPA 2QEXI 4RQKA 2QKWB 4ITHA 1UU9A 3NS9A 3NX8A 1Q1HA 4CFUA 4AXDA 2AC5A 3ZEPA 1ULYA 5JGDA 4RJ6A 2VTNA 5JMSA 3EKKA 3GVAA 1J7IA 4G6NA 2V26A 4HRIA 1OCRH 1MMSA 3R63A 3U55A 2VBWA 3V3VA 5EYRA 4L8MA 5FLFA 2WAQN 4ERKA 3EB0A 3FY2A 2R0IA 3OY1A 1CDKA 4Q5EA 3OT3A 3PQJA 3QOEA 5M4FA 3WYXA 4ZJJA 3A2CA 5TISC 3QA8A 5DCMB 4EOSA 4EOJA 2ZNYA 4X3JA 5L6WL 3WF9A 3EQFA 5DN3A 4L5IA 4CZUA 1Q24A 3L2VA 1MH4A 2VWYA 2LY9A 1AD5A 2WFYA 1MNDA 4AXAA 4CUGA 3PG1A 5HE2A 3WTZA 3FZPA 3VWBA 3EL7A 4BQAA 1N77A 2XAOA 3HA8A 2ZV9A 1Q8YA 4WO5A 1IAWA 5ICGA 4BBEA 4GU9A 4HQMA 3SDBA 2R3LA 3QUPA 3PTGA 4M71A 3REOA 2OKRA 2PL0A 3QWKA 1VQ9I 3MESA 3MGYA 5B0XA 3Q04A 1J3HA 3BQZA 2Q0NA 3UVRA 4FOCA 4QQ5A 1TVOA 1YE9A 5CI7A 1YRNB 5HLHA 5KX8A 4NDLA 3NUSA 4PX6A 1RR7A 1D3YA 2VB6A 2GQQA 3PJRA 2OU2A 4LV7A 1P9QC 4FKUA 4FG7A 5HCXA 4XOPA 4YO6A 4F9BA 3I3LA 2JPBA 3R28A 1JKKA 4G16A 1KE5A 4OIPF 3V7SA 4BU2A 3H0GJ 3BQCA 1OPKA 2DMTA 3BYOA 2HGCA 3DTIA 2VQCA 2XAUA 2EV0A 4N0SA 2KP6A 2WPAA 3PE1A 4HYIA 5K5XA 4HZFA 2GHLA 4BDEA 5HLWA 3UIBA 3IH2A 4AG8A 3VYSB 3HP5A 1G6NA 1W0XC 2H8RA 2Y0SA 1WJAA 3ZQIA 4DHJA 2Z7QA 5CLPA 1UFMA 3GFJA 2VTQA 2BY0A 1W82A 4HW0A 2ZMEB 3T8OA 3OOGA 1DUXC 5A9UA 5DM6F 3L2RA 1STCE 3DBEA 5E90A 4A9UA 1IN5A 3FZRA 3K2ZA 4NH1A 3QYBA 4EORA 4AYBA 4R1VA 3RQIA 1RI7A 1BN5A 1R36A 2V6EA 3TCPA 4APPA 2IS2A 2OG8A 4MWHA 3PQKA 4BF2A 3S17J 4YZMA 3TMOA 2IS6A 3KRWA 2GS2A 1Q99A 3WGHA 1G5SA 5LARA 3UPXA 4XQFA 1K78A 3Q6UA 4JR7A 2FE3A 3FJQE 3OYIA 3MVPA 2XNNA 4DHIB 2JN6A 3DTCA 1Q97A 3KXGA 3FI2A 3R1YA 4BS9A 3T8RA 5G1XA 1NA7A 3L2WA 4BR3A 3LVPA 1GXPA 3ZLXA 3ML1A 2YDKA 3FQHA 5A4QA 2R7ZJ 2NO3A 4ZY4A 5J9LA 3QQHA 1XCBA 3L1PA 2HELA 2WY8Q 3R6XA 1MH3A 1G8JA 2QF7A 2X2MA 2KIQA 3EQHA 1DDNA 1RE8A 3WZKA 3R7UA 3BYUA 3RTRA 5IUHA 3OSGA 2J5FA 2W4KA 3H10A 5BQTA 5HBHA 3G1OA 3ALOA 1SMHA 2ZMDA 1X8BA 2OXYA 3LFNA 1XGOA 2YM3A 3AQVA 3JSOA 5J47A 2Q0BA 2QA4I 1CF7B 1WH7A 3QXPA 5DD4A 3I54A 5M4CA 4AW0A 2XBAA 3GQLA 4AIKA 3DNEA 3VBVA 1I1GA 3WF8A 4GXOA 3S1HA 2OK1A 3G0FA 1IN7A 3EH9A 3FC2A 1QBJA 3CCVI 5BNJA 3O23A 2BXZA 4N6YA 4JG8A 1UWHA 3AG9A 3F6OA 2A1AB 1U8BA 4FNXA 3FMDA 3OD6X 4WA9A 3H9JA 2V1UA 1GNGA 4U7DA 4GG7A 4AYBN 3UZRA 2VKHA 2WBMA 4AT3A 2HWVA 2L02A 3UKGA 3GTGJ 5C01A 3A7FA 4EOIA 1P7IA 4B8LA 3KP3A 1ETVA 5FP6A 5CZHA 4R1YA 4C3JJ 5CNOA 3LJ1A 2CKPA 2E1MC 4HZSA 4QLCU 3TOAA 4CMUA 4K8AA 3JYAA 3U51A 4D1XA 2DA6A 3CGOA 1S3JA 3OBJA 4OIQF 1A5JA 3DKOA 5HORA 1N75A 2BUJA 2DWBA 3D4QA 4LMUA 2A19B 3T9TA 5E9EA 5F04A 4BCNA 3QZFA 1G3YA 3GEQA 3BIZA 3PIXA 5E8XA 4U7BA 4G5PA 3UVPA 3C4FA 4D9TA 2Z5UA 2FNPA 2JDRA 5L2IA 4UZDA 5LGNA 1KOAA 5J7HA 2FUG2 3IV5A 2B7AA 4AZFA 4D5KA 1B39A 5BMZA 1WBTA 5CJ9A 3UIUA 3C0IA 2D2WA 2QVSE 2J5PA 3VB2A 4N57A 2AXLA 4O84A 2ZM3A 3QTRA 2QKLB 5E1WA 3D14A 4EV0A 2J2IB 4A0ZA 2R0QC 1ND4A 2WZJA 4BCHA 3C2HA 1H0MA 3NYOA 1LJ9A 5LVLA 3O51A 2AUHA 2CHLA 2UVZA 2JUCA 2UZOA 4GVAA 4IHPA 4G94A 3DU5A 1XH8A 1TTYA 2UUZA 3EUHA 3J80Z 1EF4A 3B73A 4WOVA 2EV6A 3LQ5A 3ZBFA 4MQ1A 1TWAJ 2BBYA 3BY6A 3QRUA 3L8PA 4BB4A 4ITIA 3JVSA 3AT3A 4HBLA 4I7HA 2DFHA 1R0PA 3VONA 2QOLA 4UV8A 4B7TA 1OPCA 3FMSA 5EFQA 4XLAA 3TTJA 2O9LA 3UR3C 4FTKA 1UKIA 2ID6A 2J5EA 2XIXA 4LG3A 1PF8A 2FH9A 3ZFXA 3QTZA 3GVUA 3KL8A 4CCLA 2WMAA 4DN5A 1TWCJ 4RA5A 2F4JA 2BY1A 4PUZA 3WU2C 4BC6A 3UE4A 4XG7A 2MLKA 5E79C 2QONA 2UZBA 3EQBA 4AN9A 5D7VA 4EM2A 2DT6A 4DEEA 1J1BA 3E93A 4B3AA 4FV8A 5LEKA 2X85A 5HG5A 4M6XA 2FMLA 3FXXA 4I1ZA 2JRMA 5FTQA 3DJ6A 1OKVA 4V04A 1MBEA 2G15A 5F94A 2WB8A 3D5UA 4XRJA 5CEIA 1ETOA 3KRLA 4YZBA 1KE9A 2RFDA 1ZREA 3M8FA 4MBIA 2L0KA 3WODF 3M1EA 4XICA 2PMLX 2AO9A 4G6OA 3V5LA 1YI6A 2JRTA 2LTPA 2JVHA 4RIYA 1IO2A 5HS7A 1HOMA 3AD6A 4J52A 4A9YA 2LH9A 5JVTA 4CG8A 5EHYA 2ECBA 2DPUA 2PUIA 2V1NA 3MQ0A 5AV3A 3PRIA 1W5CC 3DKXA 3PZEA 2HVSA 4AGUA 4I0AA 3PVGA 3VN9A 1T8IA 1FX7A 4IVBA 1MBJA 4BTMA 2ZNZA 1WH5A 2VTHA 5LLQA 4XG6A 5CZIA 4APCA 2ESNA 4J71A 4MD7E 4CQEA 2DN0A 4FIJA 2PMHA 5DYMA 1PMVA 2HXOA 5H6QA 2CLQA 1OYWA 4ZZDA 4S05A 3H0YA 4ZYHA 4UXLA 2W96B 5ACKA 3RP9A 1GUUA 4EZ3A 3BE9A 5ED4A 2MFZA 2STWA 3AOXA 4RWKA 1R23A 1KQ9A 2R7WA 3NUYA 3TV6A 4LLLA 4BQOA 5A6NA 3SEQA 4JBAA 3RPYA 4BQQA 2DA4A 2W1HA 1JAMA 4BE0A 3PUPA 4ANBA 2ADUA 1USTA 4EOMA 4FE7A 4RJ3A 2RFNA 3O7LB 1MBHA 1YO5C 3VVHA 3TO6A 4O0UA 3S16J 1ENHA 4J99A 2YJSA 3GTLJ 3CJQB 3FV8A 2JIVA 4BEHB 3AL0B 3H30A 2CJJA 2NAZA 2X4ZA 2E36A 2QBYB 4BCKA 3P0MA 3F66A 5A4TA 5BS6A 3G5DA 3LKMA 4BACA 1CM8A 4USEA 4EJTA 3HECA 3UO4A 2PMZA 2GTMA 1FNNA 3SFZA 3NIZA 5CANA 3NUXA 4IF4A 2L9NA 2V55A 1HKSA 2VWWA 1QCFA 3S1MJ 2XIRA 4J1RA 1OI9A 5FM2A 3NCZA 2GFSA 3ZDIA 1XSXA 4FTQA 4MTEA 3ASOH 3VC4A 1FQ1B 3NDMA 4P5ZA 4XONA 2QHNA 3OTUA 1WVXA 1OUYA 5DD8A 2VWUA 2WGJA 1HC8A 2IW9A 3UG1A 3IRRA 2Y0SN 4E6AA 2KRCA 3LSIA 3ROYA 4FKPA 3ORXA 2O8YA 1SD4A 4L9TA 4JDHA 1YWRA 3HV5A 2BIYA 1OIUA 2O61A 3BYSA 3C4EA 4CHUA 3G6GA 1H00A 1WBSA 4I41A 1IF1A 4C59A 2HVRA 3RM7A 3HM5A 5E92A 4ANMA 4NSTA 5E1XA 3LM5A 1ERDA 4Y85A 2W0JA 2DMQA 2OF7A 1DM2A 4D2RA 4G9YA 2QZ8A 4ZTSA 5AP2A 5TO8A 4E7SA 4EBVA 4X6AJ 1QPIA 3QF9A 2CN8A 3IP4B 3V8TA 2OGVA 4TWNA 5LJJA 5E17F 3VEPA 1LPQA 3BJAA 3CCSI 4RVLA 3NVMB 4UBAA 2QNJA 1M7NA 4CG9A 3OF0A 4GJ2A 1SANA 4QYGA 3ZEWA 1MIJA 1VJYA 2ITTA 3ENMA 1WGXA 3VS3A 4JIKA 3TQNA 2WOUA 2CMWA 4RIXA 3HRUA 2ONLC 2VNWA 3MDYA 4EKKA 2J90A 4CFFA 1SVOA 1WMKA 2SRCA 5EM8A 2EWAA 3WGIA 1YI4A 1SVMA 4DFNA 2YM6A 3PLAE 2ERZE 4RRVA 4C0TA 2UZLA 3F22A 4XKWA 4QMMA 1JKRC 5J87A 2FX0A 3QKMA 1IAHA 3S0OA 2BAKA 5LVOA 4IJ9A 5IQIA 2RVCA 1XH9A 2COBA 2WV0A 5EEHA 3KFWX 3KLOA 4A5NA 3L09A 1RRJA 3BQRA 2MG4A 2ISZA 1MKMA 2KKOA 4PJ0C 3DFAA 5I9UA 3R1QA 1WFCA 4YJRA 2G0EA 4AW5A 2UUEA 1OPLA 3AFHA 1CKIA 3E6CC 1O57A 4A3JJ 3KK9A 3LLAA 1W5SA 5DWRA 5AP4A 5DH3A 5CVIA 4F6SA 3DB6A 2C1AA 5AUYA 4NM3A 1DAWA 1FSEA 2LY1A 1LQ1A 2JPCA 4LI5A 2F6CA 3OW4A 2CO5A 1NY3A 3A62A 3LJ0A 1T45A 4CFWA 3J7YJ 1PXPA 2XF0A 5CT0A 4AXFA 5IH6A 5LCKA 2Q2EA 3ZU7A 4GYIA 3FL4A 2RREA 4MXOA 4PRJA 3QD3A 2VJJA 3TV4A 4M9SA 3DPLC 2WEIA 2P5LC 2BHEA 4AZTA 3DU6A 4IAKA 3KLNA 4CSVA 3V8JA 2HWOA 1OCCH 4D5HA 1U3EM 5F0HA 1URCA 3MH0A 1DI8A 4ZIMA 4YJOA 1F1ZA 3TDZC 2KIUA 5HTBA 3HUBA 3SG9A 1T08B 3ORMA 1Z21A 4KA3A 4GK4A 3BT9A 3MPTA 2Y30A 3QLFA 3R9NA 2JD5A 4FT8A 2E5NA 2XKCA 4BH9A 3HX4A 2L7ZA 3QPSA 1QVUA 5CQUA 4PDSA 4DYCA 5J1RA 3TM0A 1OKRA 5EZGA 3TN8A 3BGPA 3GW2A 4ZSAA 3EKNA 3FKNA 4BCJA 1D8KA 1FMKA 3I53A 3CF5F 5AV0A 5A46A 1UJ8A 2W1FA 2BALA 3BBTB 1FYMA 3I9V2 3IKTA 3DU8A 2QO2A 1BI1A 5TJJA 4PDOA 3E62A 4R78A 3NNWA 4XG8A 1FGKA 3KU2A 2W1DA 3R8LA 4DFYA 4OU0A 2XV4S 2CDZA 1QO0D 4RG0A 4PY1A 2XUBA 3W33A 3VNTA 3W0NA 4E26A 1S7EA 3ODZX 3K4MA 2C6MA 2VBXA 1P14A 1W4MA 4DA5A 2QOQA 1Z6TA 4NCTA 4HPQA 5CKTA 1SNUA 3A2KA 4N4OB 3MVMA 3KP7A 3HDMA 4PJLA 3E1SA 4S34A 4BY1J 4EZ7A 2IVSA 5IQHA 4KA4A 1Y8YA 4KISA 2B7EA 1BIAA 2L01A 3OEFX 5LOHA 1AQ1A 4EATA 5ACBC 3JAMK 1R1TA 2R3GA 4FKLA 2C3KA 3C50A 4FEQA 5E8YA 3KP6A 3EWHA 1X19A 4MQ9F 4I5CA 1OCOH 2FB8A 1CKPA 3BU3A 2H6DA 3RKYA 1U46A 2OA4A 4A5MA 5EQYA 1JTXA 4YNEA 4E7KA 4ZLYA 2BTSA 4UWBA 3V8KA 4L3LA 4FODA 1BI2A 3OWPA 2VUMJ 1Y8GA 2R7BA 2VTLA 3K5VA 2E7WA 1LNWA 2REIA 5CU0A 2R3JA 5AX9A 5D1JA 4N4SA 3GU7A 3PZHA 4RPVA 3AAFA 1TW3A 4MEYF 3P7AA 2XK3A 4PUSA 3IUOA 4E7HA 3M42A 1MQ4A 3QC9A 4UVAA 3CPCA 3LFUA 2VPRA 2VOOA 4IAFA 2ITWA 4NBQA 1UNGA 3SXFA 3TKUA 3AMBA 3U6IA 2P55A 1AKHA 4O81A 5H8GA 4QSHA 4MVFA 1QMZA 1G8XA 1ETKA 1GZKA 4FIFA 3WIGA 3DBHB 1BKXA 1Z3YA 4GUEA 4WBBB 4IVDA 2OI4X 3LW0A 2CKQA 3FYKX 4HAMA 2H1LA 4WG5A 2XAGA 5E8ZA 5KUPA 3GCPA 3RPUD 2W1CA 3AD5A 3ERED 3PIPF 4L7FA 3OHTA 3RALA 4XG3A 3GFLA 1RKWA 1VQPI 5FEDA 4XLHA 3OOMA 3NPCA 2PPQA 5F0FA 4DIQA 3I4PA 3ZMDA 1FWZA 4XN0A 2BRGA 3AT4A 1L3RE 4NYEA 4JI9A 2ZFYA 3KRJA 3T1BA 1YX5A 3J7AY 2JITA 3BHVA 1VYZA 3MY0A 2WMXA 2KRHA 2W24A 3KK8A 4ANQA 2OF4A 3JVRA 4O0TA 2JAVA 3C0HA 4EOQA 3ECOA 2GXBA 2H9VA 4FTRA 2MH9A 1MW7A 1E3OC 3QCQA 2E9NA 4MNUA 5CY3A 4MBLA 5I9XA 3ZUUA 5KKRC 3FI3A 4BDIA 1O4XA 3L9PA 4R5YA 4WG3A 2QQ8A 3KRRA 4NM7A 4CTCA 3ZO3A 1GVDA 4KJZA 2UW7A 3PY1A 3BZCA 2Z7LA 2KJBA 1Q3DA 2DTZA 5CAVA 3D94A 1Y91A 5BUIA 4RM3A 2Y8OA 5KHXA 4O0SA 4DH3A 4F7LA 3NFFB 5GAHJ 2FSMX 4NCTC 5C8KA 2CLXA 3L9NA 4ACCA 4AFEA 3FLNC 4FIHA 2X0GA 3O0GA 1Q8ZA 4BBMA 3IW4A 2MBFA 3MY1A 5LEJA 1Y39A 2HWPA 5HG7A 5M07A 2FNAA 3AKLA 4M74A 2M4GA 5DG5A 2ONLA 3V7CA 2WAFA 2B9SA 3MVHA 1J5YA 3IRQA 4RB2C 5HG9A 3THBA 2LF8A 4A69C 2GHMA 4OT5A 3UOJA 2BV6A 2I10A 4FKTA 2XIZA 3C9WA 1H08A 1Q41A 2VC0A 2XKEA 1P2AA 3IAM2 1UZCA 3EOCA 4JS8A 4CRSA 2G01A 4RB1A 4I6FA 4BJ6C 2ZXJA 1PRYA 1K9AA 1LR4A 2ZDUA 3OG7A 1E17A 1D8JA 5JFRA 2R5YB 1A6IA 4GFOA 3W0MA 4BHZA 1YXVA 2M5WA 4FL2A 4FKOA 4IO9F 4XSXF 2BFXA 4W4XA 3F6VA 3I6WA 2Q0OA 2VONA 4FE2A 5FXQA 3ZMZA 3GU6A 2ZM1A 5E8WA 3HV7A 2DQLA 2IA1A 2QU6A 3RPRA 3IC7A 1J1CA 2RQPA 5FKKA 1FOKA 4IRHA 3CLOA 4CYCB 2W5HA 3PYYA 3SHFA 1YW8A 2DUVA 4R7IA 4IFCA 3SLSA 3BU5A 2OH0E 1R49A 4AUXA 3G51A 2WQNA 1ZMVA 4RC2A 2YCRA 1M2RA 4XRFA 4O96A 4PNKA 1JGGA 2BDJA 2JC6A 2J9MA 3PXYA 1QA6A 5IYCJ 2D1HA 3A4OX 3A61A 4YRVA 3KQ7A 1OPJA 4M14A 3E88A 4IW0A 2FXAA 3R7IA 3TYKA 3S93A 4EEFG 4ZYGA 4BQNA 5BUJA 4A6EA 2XAMA 2W25A 2JTVA 3CQUA 2XF6A 2XVDA 3D2IA 3R1SA 3TG1A 1MDMA 1RDQE 5KNJA 4ZTFA 3CMAI 2R5ZB 3CUQB 4YBJA 3RAHA 4EK6A 4BDGA 5C4JJ 3D5LA 1PXOA 3QQUA 3W2QA 4W4YA 4EYJA 3RQ4A 3MKZA 3HLLA 3ZLYA 4C2UA 4IHSA 2DS1A 3PLSA 1BMKA 4UB8C 5IEVA 4WXDA 4MHGA 3DBDA 4PDPA 5JRSA 4CV9A 4FUYA 3BOQA 3HKZA 3HJEA 4FV9A 3ZQHA 3O17A 4FEWA 3PXFA 3MI9A 4XG9A 2IBDA 5HICA 4E5WA 4AGDA 1T0FC 2FF4A 4GH2A 2I1MA 1P92A 1FMOE 3ZMTA 3IKVA 2GIZA 3TL8A 5KK1A 4I6QA 1SFOJ 5JI6A 3I55I 2XARA 4TY1A 4F1TA 4HPTE 2VO3A 2VXDA 5CXHA 4RX9A 5LVNA 2GNHA 3TI1A 1HCKA 4YZCA 2QOCA 4OTDA 3V5PA 5JHFA 1H27A 2FOKA 1YOJA 3WGGA 3LFEA 3JY0A 4HCTA 3OYBA 1H1QA 2OUMA 3OMVA 4EH4A 1JT6A 3SGCA 5CXZA 2X1CA 4Y52J 5H6RA 4XNEA 3OR2C 2GQRA 1KE7A 4MBJA 1EH7A 2X6OA 1MZBA 1PXKA 3H3UA 2F7EE 2UVXA 5DCMA 4ASXA 3MPMA 2V7FA 3MZYA 2H6CA 4EMSA 3S8PA 3OYGA 5IP6A 1YI3A 2VQHA 4J97A 2DYSH 4M84A 3WTVC 3COAC 3MJ1A 3CP9A 4FTAA 2DFEA 2YA9A 3R7OA 4RSSA 4I98B 5TOZA 1BW6A 2RGPA 4BICA 5ILVA 3HMNA 4JDKA 4QMOA 5JH6A 2B55A 4B0GA 3GZ6A 1T6SA 4YLJA 2VX0A 5CYVA 4B4LA 2Q83A 3OSFA 3Q60A 4Q9ZA 3WYYA 3HUGA 2XJ1A 4C2TA 3ORTA 1QZZA 5BVEA 4L00A 3VRYA 2W9FB 3EJ1A 4FX3A 5DR9A 2A6EF 4HVIA 2EU9A 4ENKA 4NNJA 1S72I 3QCYA 3R73A 3VAPA 4O7TA 1TWFJ 2NRAC 3P9IA 3RPUA 4QTCA 1W36D 3E3BX 2XGEA 5ICCA 4CZTA 1ZRCA 4JG6A 3TO7A 3POZA 5F4NA 2Z99A 3PSDA 1BOBA 3BJOA 3QD0A 1KU7A 2P2HA 5JK3A 3W0RA 2DOAA 2XYUA 1PP7U 1YW2A 4JNWA 5H8EA 3BLAA 2BTRA 4PJJA 3LFCA 4RJ8A 3D5VA 1YVJA 2XGDA 2XRWA 1X1CA 2ZAZA 3P5KA 2COMA 1OL7A 3G4SI 2M9HA 5KO1A 4GEOA 4JDJA 2VAGA 5AV4A 1P7JA 4A07A 2BYVE 1Y6AA 1JKQC 3QZHA 4MFEA 2M0MA 3BTJA 4HLYA 4E8AA 4M3QA 4J8NA 3VYUB 1D5VA 5KE0A 1G3WA 4USFA 2EFQA 2LYCA 4ZH4F 3VF8A 3TIYA 5F1JA 2MSYA 4IX4A 4DGGA 3FXLA 3UZTA 4Q5HA 3QRKA 5K5NA 4PQNA 1UU8A 3WHCA 2BE5F 1PHKA 1AHDP 2E2JJ 4IQ6A 3VYRB 2H09A 4FX4A 4OT6A 4ZOGA 3A60A 5KZIA 1A31A 1TWGJ 3IH3A 3A1YA 2PVKA 3QAME 2YERA 3COHA 4YIFA 2XRLA 5DVRA 4K2RA 1YWNA 2VUWA 3KEXA 3W2OA 2HOAA 3EQRA 4CEGA 4DHFA 2JDSA 1UU7A 4FKSA 2VTJA 3Q96A 1XG1A 2JVGA 2VXZA 4AUAA 2KULA 1JSVA 2BZJA 3I79A 4MK0A 3QWJA 4H36A 3M1SA 3BCEA 5I4NA 4HGTA 4LLNA 3W2VA 1OUKA 2YPRA 3Q5FA 3OCBA 3ETAA 4UB7A 4C4JA 5DEWA 2ELKA 3VUKA 4O6JA 3CXWA 2CN5A 4F99A 3WTSC 1YOLA 3UZPA 4CDGA 5IY5H 3OZ6A 2UW3A 5LWNA 3GUDA 2DPDA 5BOXA 4G3FA 3BHYA 4V19K 1KONA 2BW3A 5TGTA 4JJRA 3B2WA 5EM5A 3OS1A 3EFJA 2WXVA 1RNLA 1I50J 5HDNA 5J40A 2ZFWA 1U59A 1J59A 4S32A 1FYLA 3MD2A 4I09A 2XS0A 4B3XA 4AC0A 4EH3A 2NYXA 3DBCA 2F5CA 5DR6A 2GTNA 4JVGA 1I09A 3DP7A 3NW5A 3EL8A 1W98A 3W2RA 4RLQA 3TEIA 5EYCA 3RZDJ 3BEAA 3CMMA 4V2GA 4WIHA 1URWA 2PUUA 2M30A 2O2UA 4NM5A 3UODA 2R7IA 3K1MA 4RMZA 4Y83A 4YELA 1IN6A 2DU9A 2W99B 4EHZA 4TYJA 4MX9A 3KULB 2EFOA 4G3DA 4FKIA 1HDPA 2ZJPF 3E5AA 4NW5A 3FIWA 3ALNA 1KOBA 4XNFA 2M0CA 2KTYA 1FPQA 3IHUA 3C0GA 3RK7A 1MBFA 3QQJA 5GJDA 4FBXA 2W1OA 4CCOA 3I5NA 4DEAA 3J7ZI 4BHBA 2ZB1A 1V3FA 2XAJA 5JGBA 1H28A 3OROA 2VJ5A 3FMHA 5HO8A 5EH0A 4BN1A 5FFXA 2VN9A 4MFDA 3SHEA 3TWJA 4F91B 2WAEA 5JN2A 3PSBA 3TKHA 2Z33A 4HNIA 2P7VB 2OFVA 4IWPA 2CUZA 5FKLA 3V5WA 3WTUC 3JSPA 1IR3A 2A4LA 3UNKA 2R7DA 1RW8A 2CPKE 2FBIA 1OCPA 2XB0X 1WBWA 3D7TA 4RT7A 2I0EA 2DMUA 2Y6MA 3MKWB 4IHWA 4EZ5A 2P2IA 3R22A 5EDRA 4C33A 3T8TA 5GAGJ 3GTOJ 2UWMA 3K0LA 1XSDA 1J7LA 4G9RA 3HMPA 4G12A 1H01A 3BZKA 2GOXB 1OIRA 1T56A 4KBCA 3KKVA 3HRCA 1JKSA 2CV0A 1IUYA 3KETA 4P7EA 2E9PA 3B6CA 2QC6A 1U78A 4NWMA 2MD0A 3R83A 1PYEA 5E3OA 3L1SA 2OCCH 2XKOA 3FLQA 4O0WA 2X48A 4R3PA 3F6XA 1NVRA 3H1CA 1S29A 3LXLA 3OCGA 4AN2A 4Z16A 4EH5A 2VT2A 4P4CA 3LMGA 2JJ7A 4F0GA 4QQCA 3BWJA 2QOOA 1MP8A 5ETFA 3QPHA 3VF9A 3S4QA 3BJ6A 2VBYA 4MNEB 3DJ7A 3W6KB 3QYWA 5JVGF 1Z77A 5ANGA 3IG7A 5JLXA 2VTAA 1LVKA 5AP3A 1HDDC 3ET7A 4OMYA 4U6RA 2VLAA 5CQGA 3HOWJ 4ANLA 1RQQA 4W8DA 2FU4A 3PUFA 3TBIA 5CU6A 2YIYA 1JGSA 1O6LA 1ITYA 3BGQA 3D7ZA 3AKZA 1G59A 2FYSA 1HF0A 2C0IA 4A3IJ 3P86A 3NVKI 4V0GA 4IHVA 4ENNA 4YLLA 3A8WA 1WBPA 2P81A 5CENA 5D9HA 4DT9A 4AE9A 3P08A 1QL6A 3HOYJ 3MH2A 3OT8A 1IXSB 3HC7A 2HYGD 5IQAA 2HDDA 3P1AA 3WTTC 3BG7A 4FSMA 5EM7A 3UOLA 2PN6A 2CS3A 2BY3A 3O8TA 2WTVA 1MMNA 3ZMUA 4QEBA 2TDXA 1APLC 5H20A 3FXQA 3I7BA 1REKA 4PCQA 1NT2A 4N6ZA 2BDWA 2EUFB 1U2WA 4EOPA 2JQ7A 3HZJA 1BR1A 4YMJA 4F55A 4OUCA 3CUQA 1OM1A 4HOBA 2K85A 4H39A 2C6YA 4QMXA 2PMNX 3CCMI 3ZONA 4AWXB 4U40A 2JDTA 3WE3A 2RL5A 5D5VB 2CNQA 2JAMA 3OFMA 5GJGA 4AS0A 3BPVA 2DTRA 1MMDA 2B53A 4QRCA 1AKHB 1SZMA 2FSOX 1Q1VA 1W8CA 2XPUA 4PTGA 4F7JA 2PLYA 5HNBA 3O6BB 1FZPB 1SFUA 4C3HJ 2OSCA 5KMJA 4L5EA 4IZYA 3FXWA 3IW5A 4OR5A 5K5RA 4O7WA 3N4VA 2JDVA 3EYIA 2X4HA 2NOGA 2LC2A 1B8IA 3E7VA 3OC1A 5ICFA 1WJBA 3FEGA 4DJAA 1Z0XA 5HLNA 5CSWA 2DJIA 3OYLA 4J01A 4G17A 4IOAF 2YSRA 3NFGB 3FPMA 2WV1A 4YIIA 3A4PA 2X6YA 4KB8A 5KZ0A 3HMOA 5DPVA 4ZMFA 4P96A 4KRCA 4AE6A 2PE1A 3GFWA 5CAOA 3OIOA 1H0WA 4XOZA 3MJ2A 1YRPA 4KS7A 1J91A 4C30A 2B0QA 5JRQA 2VTSA 1Y8RB 1K4TA 4CGAA 3QRTA 1MJBA 3OP5A 1GIJA 2ZOQA 4MXCA 2H34A 4H3BA 3O8PA 1TNTA 2C0TA 3PDTA 3KEQA 4O7YA 4OBOA 5A2QZ 2HAKA 1Y57A 5EKOA 1FMVA 5AUVA 2W7XA 3A7HA 2NS8A 1SAXA 5D10A 1GAGA 3C5UA 5CWZA 3RK9A 3ZH8A 3TKYA 3VYTB 4QDVA 3WTYC 2PVJA 5E4HA 3ZQ7A 3OR1C 1W36C 2JFMA 1QRYA 4DGWB 4IWDA 4I6LA 3BLQA 3B8RA 4IDTA 5M4UA 2Z2SB 1WWXA 2HDWA 4FV1A 5EEGA 1PMNA 5C4KA 5EDPA 1HW5A 3KZIC 3U2RA 3U9NA 2BXYA 4BKXA 1XBCA 3DFCB 2G2FA 2Y4IC 4F3QA 1PW2A 1WZ2A 3G15A 3S3OA 4EUTA 3C5IA 1BIBA 1XGMA 3MWMA 1V5GA 4NKSA 4DCAA 2O8XA 4BKJA 1G3TA 1WQ2A 4ZY6A 3RJCA 4XEYA 3FXOA 1R5GA 3DPTA 2R3PA 5IQEA 3D7TB 1X58A 2R93J 3LFSA 4FKWA 3EUKL 2VU3A 5FLXK 2W5BA 3G0EA 3M4OJ 3FHIA 5IG1A 2YDJA 4CICA 4UV0A 3TDWA 5J8CA 3ZCOA 5CVHA 2UW8A 5HVYA 3VS1A 1OISA 3NYVA 4G6DA 3OS0A 1VTNC 1YDSE 3ANRA 4FTCA 1H0VA 1H8FA 4ZZLA 1UKHA 4GT4A 5H2UA 1MMAA 4QP6A 2AS5F 4LFUA 2XF7A 1F4KA 1G8KA 1BI8A 3B8QA 2W1ZA 3A8XA 4M3BA 3LCTA 4D4YA 4KIOA 4F0IA 3GFIA 3JRAA 4UB6C 5DUKA 1U5RA 3R9DA 4IKFA 2JT1A 3OYJA 1Q4LA 1QPDA 1O3RA 2C6TA 3FKOA 4BIBA 4JAJA 2BHHA 4HJOA 4LG0B 4ZSJA 4IDVA 3O8HA 2PJPA 5HVKA 5F9EA 1VQ4I 2X7GA 5FLXZ 5CSVA 4DINA 1H1WA 3T3UA 4C36A 3GTKJ 2A3SA 3QZIA 1LDKB 5CAUA 5HIBA 1BI7A 3ELKA 4U0VA 1AOYA 4ENXA 4CFVA 3CUQC 2L5QA 3E7OA 5KMLA 1SVGA 3KCCA 1TWHJ 5LMAA 1QPCA 4NHJA 3DAEA 4XBUA 3K6GA 3KGAA 4EQQA 5EK7A 2OF2A 2R7FA 2X9DA 4GK3A 3AG4H 1HSTA 2MC4A 5KCMA 1FJLA 4NUSA 1WSUA 1JUMA 3OS3A 2OZOA 1XD7A 4FHTA 4IZ7A 1K6OA 4S33A 4PDKA 2FOWA 2Y0AA 1FY7A 4JQEA 3GCUA 4IM3A 1ONVA 4U45A 2P33A 3E64A 1T98A 4U8ZA 2GMXA 1PMUA 5L8KA 2X8DA 3ZM4A 3R9HA 3HTUA 4QDEA 5ILSA 4NC8A 2CKOA 2RC4A 3CDHA 3M9AA 3EQGA 2K02A 2X1DA 2A69F 3W8QA 1KGSA 4CT2A 2B0LA 2F5FA 3LSHA 3SOAA 2GPHA 1H07A 2E35A 3VBWA 3Q32A 1YHQI 5IA3A 3NIEA 2LY2A 1FVVA 2IWIA 5FGKA 5JGAA 4NL0A 1OL5A 2EFPA 4FV0A 2GSFA 2ITXA 3LOCA 4PMTA 3HKZN 3KC3A 4E7WA 2DBBA 3L9LA 3OMYA 3CKWA 3PXKA 1GT0C 5FEQA 3KEYA 4B09A 4AU7A 4K77A 2V6CA 2RNGA 3QTWA 4JBOA 1H1RA 2KFDA 3PIZA 3R1NA 4O7LA 4J98A 3HEFA 4XLCA 4RS8A 2DFFA 5EZHA 5HE0A 4IAYA 3W6VA 2WQOA 2HOGA 1D0XA 3NW7A 1DQUA 3HSEA 3GYHX 1OCZH 1ZTRA 4HA8A 2W4SA 3DXQA 3BBWA 5JFXA 3BLYA 2PSQA 3CZ6A 2RGVA 5M3MJ 2HQNA 3U8WA 2JIIA 3P78A 4KUJA 2Y31A 1OR7A 4DGMA 4IIRA 2DA5A 4JQ8A 3IW7A 2WY7Q 3VHEA 4MUQA 2BW3B 1UNLA 2VPLA 4P55A 4IE9A 1P4WA 1JJ8C 2Z60A 2C1BA 2JA7J 2LNBA 4ZTQA 4E5AX 1QZYA 4V05A 1DGWY 2XJ0A 4AX8A 5D5UB 2M87A 5F1RA 3GMEA 2PJRB 3I7CA 5CVRA 2OTLI 3FMJA 3FC1X 3N97A 4HVSA 3VS4A 2OZAB 2DT7B 4TXCA 1LEBA 2IT0A 3R8ZA 3SDJA 3EZRA 3U1KA 2LG4A 3MFRA 4WF2A 1EH4A 4MNFA 2Y0MA 1XBAA 4BDYA 4QYEA 4RIYB 2ITZA 4ZJVA 3GU8A 4RJ5A 3DLLF 2XIYA 4EJ7A 4J8MA 1S9JA 4IRGA 3FMQA 3GZNB 5FXRA 3ZLWA 3J81Z 4AIHA 3P7NA 3SJMA 1FEXA 3CDIA 3QHWA 3I4NJ 5L2TA 5DEYA 4I99C 2VD5A 3CCLI 3QRIA 2QSGX 1EKEA 4BBRJ 4DTKA 3HUGB 4ZSGA 1HKQA 3VBQA 3P9JA 1I3AA 2EZIA 4CLIA 3CR0A 4Z2YA 3Q9YA 1M14A 3W8LA 4K18A 4QWQA 4FV3A 2OC6A 4B44A 3WF7A 4OLIA 3Q53A 4CGZA 4HLXA 3FUPA 4QP3A 4YC6A 4KFCA 4DG3E 1IA9A 3K10A 5HCYA 4BI0A 4DT8A 2Z02A 1XO2B 2VWIA 3VS5A 4CSWA 2B9IA 1YYVA 2JBPA 3F88A 4TWOA 3U54A 3A02A 4XMOA 3QLGA 4LV8A 2OD5A 5DNRA 1UMQA 1K3AA 2K7LA 5LFAA 3QRFF 2R64A 2V5QA 2V1DA 4Y3OA 4A9TA 3HNGA 4HYEA 1XWSA 4F9AA 1IRGA 2CSNA 3NAXA 3UDTA 3PPKA 4FV5A 4WCGA 3OYMA 3PA3A 3LSGA 4HVDA 4XN3A 3OXTA 3KE2A 1ZH5A 3FISA 3M8EA 4IAAA 4FSNA 3DZQA 3HDNA 4O91A 2LVSA 2CW7A 1O3QA 4GK2A 5HCZA 3A7GA 4WG4A 2R7UA 4FSTA 2VQLA 1B8IB 4U42A 4QMPA 2E1OA 2EQRA 5ANIA 4DH8A 4WK8F 2XA4A 2X1NA 2R3MA 2DK8A 4E6KG 1I3QJ 5E8VA 4EH2A 2AC3A 4GCJA 1PXLA 3C3WA 4FT7A 3ACKA 4ZSLA 4ALVA 4FL1A 2ZXHA 1VYWA 2W1GA 3BZ6A 1RUOA 4TNDA 4Y73A 3WTXC 3FHZA 2GIVA 2QURA 1R22A 1BR2A 3SW4A 4D2SA 3LCDA 2GDOA 3O71A 2IVTA 4I5PA 2LR8A 2CUFA 3ZQGA 3S1NJ 5AM6A 2XEZA 3ZLSA 2CUJA 4BCMA 3OY9A 4BYYA 4ITJA 5GTIC 1M52A 3A01A 5KKRB 2X6EA 2FA5A 2ELJA 3R0AA 4L9IA 2P4IA 3JR1A 2LP0A 3BTLA 3J81K 4B99A 3NQOA 1AU7A 5IP7J 1PYVA 3TUCA 4LRJA 5EYKA 1TNSA 4I23A 2NPQA 4OTHA 4RFMA 4P90A 1I5ZA 2JWTA 4L6QA 4OGRA 3JS2A 4BDFA 1IA8A 4HV6A 3FZ1A 4ZTJA 5HNIX 2XZSA 4D4SA 1YHWA 5B66C 3OW3A 3F23A 1OL1A 3EMGA 4USDA 1Z05A 2L7MP 4AVPA 3ROUA 3O2PE 1IW7F 2K3PA 5CPRB 3WF6A 2EK5A 4IAZA 3DXJF 5L8JA 1UNHA 4UY9A 5I9YA 4FTNA 3U6HA 3ZRLA 4BGGA 4AWIA 3O8GA 1HA8A 4I6HA 3D83A 1BR4A 5JT2A 3DLAA 4EC8A 2CQQA 4EOKA 4YGAA 2V9PA 2GFCA 2ZJWA 1O7FA 3DAJA 3FPQA 3HB9A 3EN5A 1POGA 2GXAA 4DFLA 2C30A 4LOQA 2RKHA 1WJCA 1BI0A 1UWJA 5M55A 2XSDC 5J1UA 4BUPA 2WTEA 4BBFA 4GV1A 5J9YA 4L9NA 4U79A 2EXCX 3CCJI 4XV9A 2E60A 3PIOF 3SXRA 5D6FA 3D15A 4XLFA 3JY9A 4L7SA 2GAUA 4X2FA 5LBQA 4FSZA 1VEBA 1G8SA 2WMRA 2ACXA 2WU6A 4WRGA 5JKGA 3CCYA 4YJNA 2MW8A 3HZTA 4FIGA 3FY0A 2EPFA 2K5CA 4C7TA 3I0TA 2R5YA 4C37A 1Z6RA 4G1WA 3ASNH 4W8EA 2C5NA 2XPWA 3MH3A 4ZSEA 4C62A 1NW1A 4NFMA 3QFVA 3ENHA 2IA2A 1R4MB 5M3FJ 2BZHB 2BRHA 4A2UA 2BFYA 5AIPA 5DRBA 2XYNA 3HIFA 4LIVA 4IBMA 3UTOA 2YM7A 1XMLA 3W55A 3TNPC 3ORZA 4FZ7A 2UZNA 1OGYA 4KWPA 4ZTMA 4RQVA 2JK3A 3ORIA 3S2WA 4JX7A 1XPXA 2B1PA 3ZHPC 4NQWB 5DOSA 2VOPA 3T9IA 4YR8A 3HOTA 3QYFA 9ANTA 4Y17A 3KZZA 4M3FA 3LMIA 4JP0A 4RLLA 2YZAA 3NAYA 3DZOA 3HEGA 5IA2A 3LM0A 1ZR4A 2WHBA 5L2SA 4EHGA 1UCRA 4E5BA 3FAAA 5AUTA 5DV5A 2IEKA 2V7OA 4YP8A 1BLXA 1YOVB 2ZM4A 2C5OA 4F7SA 2NRUA 4X2GA 3M1CA 1R5ID 2VO0A 3G73A 1H1PA 3JRCA 4IAIA 1ZXEA 2HW6A 4Q2AA 3PA5A 4PP7A 1JJ6C 1R9TJ 3ML6A 5CYIA 2XBJA 4LGHA 2E9VA 4O7ZA 4KS8A 4TYGA 4ONAA 4HV5A 3QD2B 4YTHA 3KXXA 4X3FA 5FTOA 3KZYA 4A3BJ 4A3LJ 2YR2A 2E34A 3WI6A 5EW9A 3K2AA 3JR9A 4WUAA 4RIOA 3Q2MA 2WB1N 2GLOA 3FKIJ 1JPAA 3BU6A 1B72B 4M8TA 2WAJA 4DGLC 2DDAA 4BCIA 4J96A 4AOJA 2X1EA 4YZ9A 1DP7P 2LREA 4FK3A 5HQ0A 3DK7A 3TL4X 2EIJH 3ULIA 2Q1ZB 4R5SA 3TDVA 3KP2A 4YTCA 4BDZA 4CH7A 3H0DA 4E6CA 3BTIA 2OBJA 5FTGA 2OJFE 2DCEA 4D1ZA 5FJ8J 4OTQA 2QSHX 3CQWA 1X1AA 2PUNA 1TT0A 4C35A 4U44A 1Y1VJ 4O7SA 2BHZA 1GXQA 3EHAA 1GZOA 5EDNA 2HFHA 3LCSA 2ZO4A 3CCRI 2C6KA 2D1VA 1W0UA 5F27A 3UC4A 3A4CA 1V5FA 2DA2A 1VQKI 1MMGA 1ZQ3P 1XH4A 2NVXJ 4HGSA 4DFBA 3HYHA 4YTIA 5EDQA 4Q48A 1EV7A 3POOA 3VJOA 4XBRA 5IMXA 5C44J 5LMKC 5IQDA 3UO6A 4R3CA 4E4LA 4XLEA 4EQCA 4BCFA 3QZGA 4KN4X 3HGKA 1WCMJ 4GCVA 3WTWC 5DTDA 3PNVA 4BAYA 3WZUA 3PJ8A 3HOZJ 1IV6A 4E20A 4IWQA 1RUNA 5FKMA 2B4SB 5B2MA 3R71A 2EFNA 2CG4A 1K79A 4A3MJ 2WTKC 3FZSA 5JEBA 5FEEA 3VWAA 4H3PA 2ZJ2A 3LCKA 5AJQA 3SW7A 1VQNI 2YIRA 2BZIB 2EJRA 2YAKA 3A01B 2CJMA 4NUBA 3BRBA 4G3GA 4WWCA 4J19A 1LUJB 4QP1A 2QOKA 3VS0A 2FQ3A 2E1CA 4Q5SF 2F57A 3ZYAA 3R30A 5IYBJ 4R3RA 2VO7A 4DAWA 4HOKA 1T46A 3QQFA 2PQ8A 3N9XA 3MBLA 2NS0A 4CT1A 1MGTA 2UXNA 3E8EA 1B4AA 5M09A 3AL0C 4ZZNA 2X4FA 3I1AA 1Z7UA 3NLBA 3HL2A 2NRYA 4FG9A 2C6LA 1QQIA 3PL8A 1XGNA 5KMMA 3TZ9A 3PY3A 4U87A 4JX5A 4I0BA 3UOKA 3V01A 5FGMA 1KU9A 2JIUA 3O3KA 4OTGA 2OJED 5B1AH 4MXXA 4I0RA 3LQ3A 4TYEA 2IS4A 4O86A 4ESBA 3LAJA 1BJAA 4C9YA 4ID7A 2YITA 1LVAA 1U5TA 3Q4TA 2VODA 3DWLE 4ZZOA 5HD7A 3HRBA 4L3JA 2LBFB 3R9OA 5HNGA 2CCIA 3BDDA 1IDYA 2UV1A 3GTQJ 3WIKA 5FDPA 4BCPA 3TUBA 4DFZE 3VFZA 3GI3A 4DEDA 4PF4A 2FD5A 4LK1F 3V6RA 1VLRA 1V5EA 4PL4A 4DZPA 3W2PA 2M2EA 3ODYX 1HCLA 3LSTA 3AC2A 1MJ9A 1VQMI 3AD4A 3FMNA 5C03A 4BDDA 3G9LX 1CF7A 2YX7A 3ULZA 3RYPA 4RC4A 5HLPA 3EDPA 1Y0NA 2ELHA 1KYZA 1H26A 1IUFA 4D58A 4BXUA 1PXJA 5J8IA 5A3XA 2XSJC 4EH8A 3D5SC 2BHYA 3CD3A 4BBSJ 5TR6A 4F9WA 4RX8A 3PNYA 3H36A 2L54A 2XK4A 1ZGAA 3RK5A 3FI8A 3TO9A 3IW6A 2XB5A 5HHWA 2JEDA 3UP7A 3L00A 1QGPA 4IL6C 1ZN2A 3RGFA 1U8RA 4DEIA 1R78A 1J2XA 3DCFA 1W7HA 3KXMA 5HEZA 5FD6A 4GIIA 3DNDA 4RA4A 3DA6A 5DA3A 3LFBA 1T95A 5AP6A 1B6AA 1X3ZB 4I0SA 4II2A 4HX8A 3VOEA 4UUSA 2O5KA 4KKEA 5K7FA 2G7UA 5CSHA 3MFKA 4ALUA 4JBQA 1JI8A 5JFVA 3IKAA 2YWPA 4ACMA 4CZZA 3CC6A 3BTCA 5HOOA 3DCVA 1QVTA 4J95A 4QPQA 4ZXTA 3TZMA 4KBKA 1OKYA 2KHMA 4O2ZA 4WHZA 4L18B 3C13A 3KN6A 1H1SA 2QSFX 4KSPA 2XCHA 5KBQA 1YHVA 5ILUA 3IO7A 4FSYA 3K4BA 4OIOF 4K2EA 4PL3A 4KSQA 2CYYA 2M34A 2VGPA 4TW9A 1NVQA 5DHJA 5FQDC 2PZPA 3LA7A 1B72A 2E2HJ 5IOZA 4C4EA 5L8LA 2CFOA 3C2GA 4P1WA 3Q5IA 2OICA 5H8BA 3W6JB 5JR3A 4GSBA 1YITI 2R3RA 1MD0A 3RM6A 1W83A 2WWYA 2KPMA 4O7VA 4A93J 4O0RA 4QP7A 3F8NA 5L3AA 4JG7A 4Z9LA 3Q9XA 2BIKB 3JPVA 1TBXA 4G3CA 4XOYA 1XMXA 3TNWA 4YTFA 2XC7A 1JLUE 3GU4A 4WBOA 2P5VA 5E8SA 3MW1A 3FKJA 4X2NA 2XDVA 2OJJA 3CEKA 4KDPA 5G6VA 4QMTA 3C2BA 5L3BA 2P6TA 4PNIA 4XLPF 5HNFA 3H3CA 3PXZA 2YM8A 3LFKA 4N70A 4U5JA 4I2OA 1DAYA 3JTHA 1U6GA 2ITUA 5HE3A 3ZN0A 5HZNA 3FSFA 1YI2I 2QCSA 5BPIA 4JBPA 3VBXA 4OAYA 2ZXWH 3N4MA 4K9YA 4YJSA 1R00A 1D0YA 1R1WA 4FTUA 1IRZA 2XKDA 5IA0A 4P9UA 4EQUA 4O82A 4BHPA 5K4JA 4EJWA 3D1NI 4FNZA 4O0VA 3ECHA 5CQEA 3ACJA 3M8JA 4MO7A 5LVPA 2F5EA 3D9VA 2V7AA 5L3EA 2YHVA 3VJNA 3S3IA 3MY5A 4RZVA 4KKHA 3KYDB 5ERIA 4UVCA 3LXKA 1GV5A 4LL0A 5I0BA 3E8NA 3K4CA 2OH4A 3A0BC 5BYLA 4O5VA 3OYAA 3FM3A 4EONA 4Q47A 4E1ZA 1OKZA 1KV1A 4XORA 2J0IA 4AZSA 4H0EA 2X9FA 2OIQA 4BIEA 1RC9A 2CFXA 5C1QB 3OL4A 4IEJA 4OW8A 3ZO1A 4CCBA 1KSWA 3GZ5A 4ZY5A 4BJJB 2DJNA 2ITQA 4IMYA 4IPAA 3AMYA 3DKYA 2V4JC 4MHAA 2PMUA 2XRNA 2XPVA 4TYHA 1IN4A 4FT0A 4FR4A 3E92A 5LGTA 1X1PA 3BLHA 4K1BA 4MH7A 4O83A 2E5ZA 3BR3A 1ZRFA 2IS1A 3QA0A 3QTUA 3VUIA 4F1MA 5TF9A 1FBSA 2R7XA 3GCVA 3HOVJ 4M68A 5J3LA 2BILB 4J00A 5ANKA 4MLOA 2PFBA 2OQRA 3IGOA 2PTKA 3W2WA 3P9CA 3COKA 1K4SA 2HOTA 5C27A 3SYTA 2K86A 3K2LA 1F43A 4HVGA 3E97A 1L3LA 1HW1A 1R5HA 4HYHA 5IT9Z 2EB2A 4AQCA 2ZYBA 3A99A 2V22A 1XTAA 4HEA2 1WJDA 3ORNA 3SXSA 3BCBA 2VJ4A 2CUEA 2XCKA 2J6MA 1NXKA 1ST0A 1J9IA 4PTEA 3BR6A 4LIUA 5T68A 3L2UA 5JLWA 2JFLA 4IX5A 5BQ0A 2RNJA 1FMWA 2X6DA 2H8WA 5EW3A 1PXMA 4EM1A 3QU6A 2WTWA 5J1VA 1VI0A 2XF5A 2Y4IB 3CTHA 1GDTA 3SKCA 3F61A 3DK3A 5BPDA 1VF9A 1RZ4A 2VE9A 5AEPA 2I40A 1R1UA 3LSKA 3HRSA 3ELJA 4W97A 1RIOH 3ZQQA 1F5TA 4MAOA 5HD4A 1KYWA 4TT7A 2R2PA 4GU6A 4DTAA 2XP2A 4U0IA 1PDNC 4QMQA 2C69A 5CF5A 2VKVA 3REPA 4F65A 1OVEA 4XIDA 1FT9A 3FK6A 2EB3A 2GWRA 3RINA 3MKYB 3IS5A 3LFDA 1IRKA 4KIBA 4AT5A 2PVLA 1F36A 3PPJA 1BX6A 5E3MA 3PFQA 1Z9XA 3QUDA 2YM5A 3ZR8X 5FB2A 3CGFA 3EFKA 3UC3A 5HGIA 2P0CA 3SQNA 3HAMA 4YUQA 2QLUA 1PMEA 5CAPA 2PE0A 3R01A 3KN5A 4YNOA 5KVRA 5IA4A 3S14J 3D5WA 4ZLZA 2DT5A 4FT9A 5E1SA 5BNGA 2KZGA 3OOPA 2VJIA 4BCGA 4UEUA 3QD4A 1X2MA 3BHTA 4IM2A 4TV7A 5HE1A 3F8BA 3DTWA 3VUGA 4IHXA 4A3DJ 3OWKA 4FV6A 5AP0A 1OL2A 3BWFA 4ZDLA 3PVBA 1VFCA 1JUSA 3OCSA 4MTAA 5D41A 4ENYA 1FYKA 4K6ZA 3ONQA 4S0HB 3VQUA 4TL0A 1U9OA 2IJLA 2W4JA 3DLZA 3OYCA 4D9UA 2XUUA 4WKQA 3EYYA 5FUTA 3X2QH 4HGLA 1UHMA 2CV2A 3NYNA 4EGZA 3KP5A 1FLIA 3VO3A 3RPQA 3CMEI 4QMSA 4F9YA 1A04A 2H96A 4IX6A 1CGPA 1M2PA 5JFSA 4FEUA 1ZWSA 4EM0B 2BAQA 1RESA 3PA4A 4Y7NJ 5HI2A 5DIAA 2J0KA 3ZXTA 5EJCA 3GFMA 5AUXA 3E5UA 5DDGA 2Y69H 2WB1A 2HTJA 4YHTA 4DGOA 1ST4A 2YEXA 3HMIA 4BZNA 2OJIA 3H92A 4C2WA 4A7CA 2QQBA 1XX5A 3ZCLA 4LV5A 1A9UA 4TZRA 2ZB0A 4GL9A 2BKKA 4BZOA 3LFQA 1ZYRF 3ZOBA 4BDBA 1SD5A 5E8GA 1MSEC 2R3IA 3IDBA 3GC8A 4MEXF 4OMZA 3RPVA 1CQTA 4W1UA 1V1KA 4II3A 2XEYA 3WE4A 3L2QA 4YJTA 5CAQA 4L52A 4RVTA 4HYUA 4FTTA 5LD2C 5BV3A 2NVQJ 3ZN1A 3PXQA 1HLVA 2CH0A 4ZP5A 4NQWA 3FLSA 2PWLA 3GWZA 3K4NA 5D8KB 2R9SA 2YAAA 2VGOA 1ZLJA 1UG2A 2ITOA 5FDXA 4FSRA 2OXXA 2QG5A 2LRDA 2XRUA 5DLSA 1WBVA 2M3AA 2L2OA 2X8IA 2PVYA 3K1PA 4Y46A 5DUIA 3RAIA 1WJ5A 2JZYA 2ZFUA 4RWLA 4E4HA 2XNMA 5KMIA 2DMNA 5CEMA 4HSRA 4K11A 3HA6A 4L43A 4DC2A 2RN7A 2YCSA 4I6BA 4FZAB 3M3YJ 4I24A 3PSIA 5AAFA 2K3FA 4EUUA 4CMOA 1MRYA 3TW6A 2L9RA 3UMXA 3IK3A 4ORKA 3G1MA 1LE8A 4AOIA 2F4IA 5FFZA 3CF2A 3U9GA 1GOLA 3TOBA 3F5XA 4LGGA 4UYNA 4H3QA 3KMUA 4R1HA 4UUSB 4DH1A 1YOMA 3DEUA 1PKDA 2RIOA 3KREA 1YFHA 3M7GA 4C3PA 4EOLA 4G3EA 3H9GA 1FOWA 2HI3A 1YQAA 3TZ7A 5L3CA 4L53A 2VASA 1WRJA 1F0QA 2DA3A 3OYEA 4IQJA 4ABZA 4KITB 4ALWA 4IC8A 3QRJA 4GT5A 3VS2A 1NHAA 2HQAA 2HVQA 4IHTA 3V6SA 4EH6A 4PV0A 3FDYA 2QHMA 1I1SA 4CCKA 5EEAA 3QYZA 4TKSA 3QTQA 3KP4A 3DDQA 1A06A 1FSHA 2YIWA 4YPSA 3F3TA 4EJVA 3F69A 1VQ8I 2BVAA 4L42A 2WO6A 5JFWA 2GXGA 3SG8A 3V51A 4EYMA 4ZDPA 5AP5A 4TRLA 1ZOHA 1NG6A 5CNNA 2L9VA 5AX3A 1DU0A 1Q62A 4DH5A 1FOTA 1OGUA 2NVTJ 4M6YA 2RG5A 4CCMA 2Z16A 4ERWA 2OJGA 2I0VA 1BUHA 2Q2EB 4AXEA 3PP1A 2CGXA 5GJFA 2ZCWA 2JLDA 2ACJA 3O5AA 2J4ZA 2XKPA 4XMYA 3OWTA 4QMUA 4IJPA 2FQ4A 4GW8A 3R4KA 2ISYA 4G31A 4X1EA 5L3GA 2PI0A 4C4FA 1YS6A 2O6GE 3AC5A 3I60A 4EQMA 1V54H 3EQIA 3L2CA 3R00A 1FPUA 4HCVA 2NYAA 2C3IB 3OYFA 4GKIA 4HCUA 3TJCA 3NMUF 2QM3A 5CALA 1SD7A 2GBYA 2YCFA 3VDXA 3E5QA 3ZXSA 1DS5A 2OIDA 4NTSA 3K70D 2JA5J 4BNCA 4YZNA 4XV1A 2XASA 2K40A 4RGRA 1NH3A 3ZPLA 3BHHA 4BE2A 4F93B 3MA6A 3DPUA 3S15J 4HYSA 5AIRA 1WPKA 4LOPA 2XVCA 3FK7A 2CNUA 5BMSA 4ZS0A 3UDBA 3QX4A 4PZJA 5J8FA 3QPTA 1IZ1A 4LB6B 1XQZA 1OCTC 3MWUA 3LSRA 1N78A 3UMWA 5CS6A 5L2WA 3EQPA 4IVCA 2EZKA 3UNZA 2W84A 1OZ1A 3KXHA 4LG0A 2EV5A 3CQZJ 1I44A 1XH6A 1IN8A 2M8GX 3RTPA 3C51A 4I5MA 3LLTA 3MFUA 5BMMA 3LMMA 3FSKA 2ERKA 2W5AA 1ZHFA 1OFCX 4WNKA 2STTA 3G6EI 2QR7A 4AVZA 3TT0A 1XDSA 1OMIA 4F78A 3OV8A 4DH7A 3BEGA 2ME0A 3FXUA 5KAFC 2HZDA 4QMWA 4BYIA 5KMOA 4IM0A 5E91A 2BZTA 4AGWA 2KIMA 1Y6IA 2PZ5A 4F92B 1ETXA 5D4RA 1JTYA 1XHAA 3QTXA 3IW8A 1FTZA 4IZZA 3CY3A 4GJ3A 4QOXA 4OWRB 1VZ0A 2UZTA 2OW3A 2X81A 4BGHA 2X2LA 4EH7A 4IC7A 4PDYA 4BXFA 4O22A 2UW6A 3ORLA 3F8MA 4RC3A 5EG0A 3FHRA 5AUUA 2A05A 4WD5A 1PVEA 3QTSA 3SEZA 2GM4A 3TZ8A 2R3QA 3NNVA 1WI9A 4RLKA 1OIQA 1TQMA 3R60A 4AT4A 2VQGA 4AZWA 5KAIC 5GNKA 4L45A 2EA2A 2P0WA 2W7NA 5D8LB 1TW2A 5HESA 5D11A 3EN4A 5BVWA 4EGYA 4D1QA 3KYCB 3S2DJ 4RFZA 4CTBA 4S2ZA 2L7FP 3W2CA 4MIMA 3QU3A 3V5QA 1UELB 3SZPA 4QIWN 3SVVA 3IPHA 2CW8A 2WMQA 4XBFA 5C4LA 3U1DA 1QPJA 5EGOA 3R0TA 2CNVA 4YJVA 2LD5A 2ZC2A 5FP5A 1VQOI 4XCUA 5EI2A 4YJUA 2A6TA 1MRUA 4OBPA 3IOPA 1QPEA 4X21A 4EKLA 5AAGA 5AAEA 3FLWA 2BKZA 4R8HA 5IT3A 1FVRA 5FRMA 5AV2A 4CVAA 2VKEA 4D0XA 4YURA 2DW4A 3HV3A 2ZXIA 3K1NA 3ABMH 1Q61A 3IECA 3PFIA 3ZMSA 3QKLA 2OZAA 4Z7GA 4L0YB 2IPQX 3WG9A 3GTMJ 3GC9A 4MD9E 4JXFA 4YO4A 2PVFA 3UNJA 4EWHA 3FZOA 4BEHA 2X2KA 3QOPA 4B6LA 2C4GA 5KHDA 4MD8E 4IX3A 3G9NA 1S7OA 4U97A 1ZGJA 5E8TA 3LXPA 5CX9A 2QOHA 4PP9A 1IGNA 1IEPA 1ODDA 2IGNA 2YU9J 3SAYA 4O3MA 4KRDA 3NUPA 3S32A 2GA2A 3LE6A 4A4OA 3WU0A 1X3UA 5H2FC 5K7HA 4DYMA 4M97A 4NIFB 4FIIA 4CZCA 4M12A 3QL8A 2QYOA 3DEEA 4ACHA 3SZGA 1FGIA 3R9RA 1LEAA 4PGHA 3DKWA 1SVLA 2QO7A 4DDIA 4CFXA 2VWBA 1OQYA 2JGZA 3NRVA 4ZDOA 4WNOA 2QU5A 2IP2A 2YACA 3NWWA 3MYGA 5FG8A 4R7HA 2W00A 4ZEGA 3DAKA 1ATPE 4OTFA 1OBDA 2PEXA 1ZK8A 3EYHA 1Q8UA 2E19A 3HRFA 1U54B 2R5TA 3LSMA 3Q9ZA 2AQFA 1YXTA 3MTLA 3I59B 3FBIB 4G9CA 4DYRA 4NB5A 1VQLI 3NAUA 1YJWI 2R0UA 1G8AA 4R79A 1OBGA 3K69A 3P5JC 2BAJA 3NRMA 3JRDA 4HF2A 3H5RA 2QQAA 3GXOA 4NW6A 1H8AC 4F70A 3SXYA 3U4UA 2NNWB 1ERKA 4JX4A 2CGVA 1ZY5A 3EN9A 3QC4A 4XOTA 4IVAA 5IPAA 3OEZA 3G1LA 2RDPA 5A14A 2WMBA 1OJLA 2O03A 3IDPA 3ZQCA 4QMNA 2FJ1A 3UDSA 3ID6C 4O0YA 4L9JA 2CGPA 3PP0A 3QBNA 2QOFA 4AOTA 2IVUA 1CKJA 2HY0A 4LRMA 5H3QA 2OTJI 2IPXA 3HPGA 3P79A 2CGUA 2XAFA 2PK9A 1XMKA 4R6VA 3GC0A 1ZZ2A 4CA0A 5M53A 3KFAA 2B54A 3OCTA 1XS9A 4ACGA 3LQQA 3I0OA 4OTWA 2UZEA 2ZV8A 3QYEA 4FKGA 3KCFA 5F1ZA 1MUOA 2XNGA 2FVDA 2A07F 3W0OA 2W06A 4G34A 4DTBA 4IZ5A 1L0OC 2VX1A 1NTCA 3ZO4A 4JL9A 4A4LA 4ZJIA 4HNUA 3FQSA 4CKRA 4FE4A 5IEYA 1IXRC 4S31A 4C58A 3OYKA 2WA0A 2P6SA 4WSYA 2HZIA 1WBOA 1J75A 4FYOA 3VS6A 5LRRA 4E7IA 5GADJ 3OWJA 4FISA 3IONA 3NARA 1HXDA 1UB9A 4E6DA 5HVJA 2LBFA 3MFSA 4BTFA 5AA9A 5DE2A 4AIJA 5CVGA 4Y95A 4BCQA 1XSVA 1UG0A 1SM2A 2E2IJ 4L46A 2UZWE 2LMDA 3CDLA 2HENA 2R4BA 3GNIB 4YFXF 2ITPA 1QNTA 3CD6I 3TP0A 3NYXA 5J6XA 3II5A 4H1JA 4RA2A 3DBFA 3GQIA 3DBRB 3BL9A 3LXNA 4G2FA 1O3TA 2OXDA 1MBKA 2GCDA 4R7BA 4JBVA 2NP8A 3IDCA 4MF1A 4KT6A 5DS9A 3VW6A 3GTJJ 1TKIA 5FD5A 3GLLA 1SD6A 2CMPA 1M7QA 2GU8A 3O7LD 4TN6A 4PFOA 1SVEA 5E1EA 4QPAA 1XH5A 4F4PA 3CTQA 1CMKE 1T0FA 5DT3A 4U88A 2KLOA 1KQ8A 4U81A 4B1RA 3F5UA 2IJMA 5CTPA 5LHIA 4PJMA 4YJPA 2F49A 4AQKA 1EJ9A 2HCKA 1JVPP 5EHLA 1LDJA 1WVYA 2PG4A 4X7QA 3ZFYA 2NOJB 1YIJI 5ANEA 1WAKA 3E3PA 5ETAA 4KMFA 2YU3A 3DXPA 3BG5A 4A0YA 3WZJA 2AQEA 3DJ5A 3V5JA 3NCGA 1REJA 1DPRA 5CVVA 2WTKB 3KULA 3PE2A 3QGYA 2R92J 4GVJA 3HAVA 2VTRA 1DI9A 3V7RA 2Y9QA 4A3EJ 1SFEA 2EBIA 2H27A 3JRBA 2UVYA 2PVNA 5F64A 4F08A 1T39A 4GO1A 3FMRA 4G7OF 2HK5A 3BELA 5AP7A 4ZTRA 4KIPA 3FLZA 3PRFA 2HQ5A 3Q9SA 5IQGA 3LJ2A 2F2EA 1YQJA 2WMWA 4NC7A 3RDIA 4ENJA 4X3FC 2XGCA 4PMMA 2JUGA 4A9RA 2G2HA 4CFNA 2WTDA 2F4OB 3OYDA 1UV5A 3QKKA 3LMHA 2UZKA 3V5TA 1LE8B 3MB7A 3CTJA 3V4GA 1IXCA 4E6QA 3AG1H 3FZTA 5AA8A 1OB3A 4F64A 5I9ZA 1UHWA 5ITAA 3R04A 3CJFA 2LSOA 1PXNA 1W84A 3ATTA 1BYGA 1FTTA 2YABA 4W4WA 4QNYA 2ETRA 3FX3A 2XANA 2EFWA 5FKNA 3ULQB 2OIBA 3S1RJ 3V42A 3HBLA 2HY81 4K33A 2GNFA 3K3JA 4X2KA 2DYRH 3E5XA 4AGCA 4D4RA 2DYLA 3UYSA 2WKMA 4L01A 2OFUA 1BBYA 3ERMA 3QP5A 3RJPA 1LFUP 2F9GA 3WARA 3RHKA 4QPSA 4LJZF 3CCUI 2GNGA 3HDDA 4XRLA 4OTRA 3NGAA 4FL3A 5HLGA 2O65A 4BVUA 4M15A 1IC8A 1I6XA 4ON0A 4EI4A 2W17A 1VQ5I 3Q4ZA 2VTMA 4OAZA 4UUTA 1AGWA 3WE8A 4O27B 2JDOA 2PMZN 1ZYDA 4XP0A 4JR3A 3H0ZA 2M8EA 1RJBA 3ZM9A 3IWZA 1G2HA 3V8LA 3H35A 2J7TA 2QO9A 3VUDA 4F7NA 3I6UA 3HG9A 3G3ZA 5FM3A 1XKKA 2A27A 2NNYA 2QOBA 4QMLA 4L0ZB 4QP9A 5IQFA 3E8DA 3TW7A 5KHWA 2V9VA 3MVLA 3UVQA 4AXCA 1OITA 4FKRA 3Q0VA 1J7UA 1XBBA 2C6IA 4EWQA 3K7AJ 3EQLF 2BRNA 2J51A 3TUDA 2PJRA 3CTAA 4HW7A 3OS2A 4C2VA 2OU7A 4B47A 3UBDA 2VIXA 5FD2A 3WHBA 5M5YJ 3LL7A 4TNBA 2BDFA 5LHHA 2PUPA 5EI6A 2IZTA 1ZG1A 3V04A 1D5YA 3QU0A 4I6ZA 4D0PA 4EC9A 2XNBA 4P9FA 1Z91A 2ZJRF 4XS2A 3FYJX 1NVSA 3BPRA 4O0XA 1H89C 3KXZA 5J95A 3RKWA 5D12A 1JSTA 3ZTXA 1X1BA 2O8KA 3QCXA 5F6FA 2IGKA 5EGOB 4LOCA 4JIAA 2VC1A 4J7BA 1H25A 4HNTA 4JRVA 2YFXA 2DO7A 3GCSA 3C4CA 2KISA 1Y56A 1ZLTA 4FTHA 2OZ6A 2IW8A 1KE8A 3O96A 4QP8A 4H4KC 3AC1A 5H9BA 2WQBA 3BG9A 3S2PA 4A3KJ 3S95A 5JZNA 1IRXA 3U9CA 5K4IA 2J0MB 2R3SA 2R4GA 5GIOE 2LOOA 5HS9A 4AFJA 4QTBA 4FA2A 4DEGA 2R7TA 1MRVA 1PKGA 4E73A 3F3UA 1KU3A 4F0FA 2E71A 1PP8F 1LEZA 4FYNA 2JA6J 1N25A 4CCNA 4M0YA 4CYDA 1GLNA 4P5OA 3ORKA 3KX2A 1YDTE 3F3VA 5L3DA 4FV2A 3BZ3A 2XALA 2MA3A 3TV7A 4FKVA 3VSKA 2XKFA 4X2JA 5M08A 2WQEA 3AG3H 4DLIA 3S3NA 2DMPA 3F9KA 3CS9A 2K9NA 1Z5MA 2JKMA 4DBNA 2DQ7X 2IO6A 1K2PA 3MTFA 4AA0A 1IDZA 3LQRA 5IYDJ 4CFMA 3GTPJ 1ZG3A 4M7IA 3E8CA 2HYFA 1WZYA 4DZJA 4C61A 3DQWA 2WTIA 4BIDA 2X7FA 3J7AO 2BR1A 3DTEA 4C4IA 1F3MC 2W1EA 4LRKA 1ZELA 3EETA 2FSLX 4X0GA 1JSUA 2PZRA 4L68A 3JCUC 3W0SA 3V8SA 2IVMA 3PXRA 4QTAA 4B8MA 3EFWA 4BYJA 3UIMA 4RGUA 5IPJA 1S8NA 2EZHA 2RAEA 3WOWA 5J4YA 4P5QA 3QHRA 1GVJA 4XH6A 4ASNA 2C6DA 5EQPA 2TCTA 4YZDA 2Q8KA 4QYYA 4RVKA 4C3FA 4KNYA 4HQEA 1Y8QB 3CUOA 2MD5A 3PSCA 1ZYJA 2HNHA 1PYXA 2QGUA 4RIWA 4TWCA 1ON2A 1XDUA 2OQGA 2HXIA 5EKNA 3HOUJ 2OCEA 1WJFA 1FBUA 1K83J 2LKXA 3GCQA 3MN3A 3B6AA 2HZ0A 1YTYA 1F9NA 4ZAUA 4PWNA 2WADA 2P7CB 2X8EA 4IVNA 2WOTA 4U80A 4C3IJ 4ZTHA 4XRMA 2HOSA 5IISA 4RMNA 5K5QA 3M2WA 4IANA 4B9DA 1UA2A 5GINE 4FTLA 4FMQA 4IFGA 4AACA 3ZSHA 3OUNB 4FEXA 3RI1A 2R3FA 1OKWA 1SFXA 2FSWA 2YJRA 2HKXA 2CCHA 1YS7A 5DT0A 3ZUTA 2H94A 4DDGA 2HTSA 3GEZA 1R71A 3MFTA 1YLFA 3R7EA 4GFMA 1UAAA 3RWQA 3F7ZA 4NJ3A 3S1QJ 3NUNA 5B5EC 5AIQA 2I0HA 4E70A 2YIQA 4RAYA 3F5PA 3NNUA 3WZDA 3K3IA 3G71I 1YX3A 3OXIA 3Q9WA 5HX6A 4FT3A 3UQGA 3VBTA 5EHOA 2BCJA 2Z7SA 5HS8A 2PZIA 3G2BA 2WIHA 2R5ZA 4R77A 5HDGA 1IJWC 5E8UA 4AU8A 4ZS4A 3QX2A 3LWFA 5K1YA 2R7OA 1EA3A 2WELA 1R4NB 4DBRA 1MNMC 3NEUA 4FGRA 4MXZA 3HV4A 1C0WA 4ESFA 3O8UA 4E7JA 5HLIA 5J4VA 3WILA 1BOAA 3MB6A 3VS7A 2X9EA 1Z3XA 1XJDA 1W7PA 5CLSA 5AADA 4AM3A 2F2UA 4GS6A 3CJGA 3GO5A 3HUCA 5EOBA 2CQXA 4D4VA 1FIAA 5BVKA 5E20A 4GGGA 4XRSA 4XLVA 3DXNA 1O9UA 4UWYA 3CESA 2R3KA 3RAKA 1OLTA 4FKQA 5K5OA 3HYIA 2Z8CA 5ICEA 2ICWG 5IH5A 3RMFA 4ZMEA 1Y0UA 3GB2A 2BVMA 1ZR2A 4ZZMA 4A3FJ 1MJAA 1IASA 4RJ7A 3SV0A 4G7HF 2B63J 5BVOA 4I92A 3LPBA 4RB0A 4EH9A 4FSQA 2RFSA 1U5TC 3F21A 1Z67A 2CV1A 3LHJA 2Z1DA 1JQHA 3ZXZA 4ZK5A 4Y4RA 3F8FA 4FTIA 3LZBA 3TXOA 4FCYA 1DU6A 2OV7A 3AXWA 1TT5B 3M07A 2CQNA 4TPTA 3I64A 3COMA 3BQYA 1CSNA 1LUFA 2QQ9A 4KABA 5IDPA 4QMZA 2A0CX 2XNOA 4EL9A 2A6HF 2XK7A 2JSCA 1U5QA 1A6QA 5M56A 2KDOA 4BDJA 4ZTNA 1GZ8A 4C38A 1JXSA 4GYGA 3F82A 2LLKA 4NZWB 2ETMA 1VQ6I 3ORPA 3ZZWA 1S6LA 5A4LA 2WMVA 2J0JA 5CASA 3A7JA 3LSJA 1JUPA 4G5JA 1OECA 1WBNA 2F7ZE 3C1DA 3H9FA 2Z2WA 2J5OA 3ZS5A 4YPDA 1PUFA 4D1SA 1A48A 2XIKA 4LFIA 3SRVB 2GA1A 4EK4A 4B48A 1X2NA 1V0BA 1B1BA 1SEUA 3ZQLA 3KMWA 3BR5A 5CVUA 4OBQA 4BHNA 2GZWA 1TQPA 1E9HA 4ETSA 2K4JA 4BDAA 3MZ8A 3WBLA 4HZRA 5J9ZA 1WCCA 4U0WA 4RAGA 5IT9K 3J80K 3HKOA 4Y5QA 3MEXA 2O7OA 3SD0A 3UNGC 4AP7A 1P4XA 4FI1A 3IL2A 3CPBA 3NNXA 3TKIA 4ARKA 4LD5A 2QG7A 2FGIA 2H6BA 4IH8A 1Y6BA 1FBQA 5C26A 3F8CA 3MAJA 3KY2A 3RCDA 4P2KA 4LL5A 2W57A 2CW0F 3R6SA 3H3ZA 2HYYA 3CC7I 2F5VA 2XHKA 4Y72A 5HG8A 5FKOA 2O63A 4RAZA 4MQ2A 4CNHA 1DPUA 5CF8A 4RX5A 2O5RA 1ZRZA 1TC3C 5B1BH 3KYLA 3IQ7A 4UV9A 3VSLA 5KBRA 4OTIA 2EWNA 1U54A 3DPKA 1B38A 4LOOA 3HOXJ 5M4IA 3TTIA 3MV5A 3GOPA 1WVWA 3ZGKA 3LSPA 2E9UA 2HZNA 1W0TA 2FBKA 4FETA 4IB5A 4DOZA 1ZKGA 2ZKZA 2JKOA 1B6CB 3JRHA 3L9MA 4BJJA 3BG6A 4KNBA 3C4XA 2DDBA 5CF4A 2L3DA 2FRHA 3R8VA 3E87A 1JKPC 4I5HA 4GDFA 3AKKA 4RJ4A 4CD0A 1SMTA 1M1EB 5FRIA 4WRSA 2DA7A 4UHTA 2PVMA 5E1ZB 2ETKA 3UG2A 4KUMA 4RWJA 2HQRA 1LB2A 5E3NA 1J0RA 3ZRMA 4JAIA 5A4CA 1Q8TA 4U43A 3GBZA 4F63A 1KU2A 3FWQA 4O7NA 3PY0A 1ZAOA 4D7MA 3FE3A 3RVGA 5IQCA 4C02A 4DCEA 1WHUA 4LDTA 2YIXA 5CQWA 3GGFA 4QQTA 2VTIA 3KIOA 2GHGA 3OOUA 2EIMH 3JAMZ 4FV7A 5L3FA 3PPZA 5AUWA 3H5AA 2YUSA 1T38A 3G90X 1GHCA 4QMVA 2FEZA 3HPHA 2QLQA 4RIXB 3TDUC 3CBLA 1LKXA 1R3CA 1ZARA 3UGCA 2VWZA 4PTCA 3U6JA 4N4NB 4XLIA 3GP0A 4PSXA 4XLNF 3SRVA 3KVWA 2A68F 3HSFA 4B8XA 4G6LA 2M4KA 1LPUA 1YWVA 5LGUA 3LA2A 4HSTA 4AZEA 5LVMA 2XROA 3WZEA 1MBGA 3BP8A 3A0HC 5JHUA 4FOBA 4EK3A 1VR2A 2X51A 1U9NA 4ASDA 3SX9A 4FTOA 5F20A 2WAQA 1YXXA 4RM2A 4M9XA 4YHJA 2YISA 4BGQA 1JNKA 5A54A 2IN6A 2OWBA 2G9WA 3KMMA 4H58A 4AF3A 4BZDA 3KXNA