3PFYA

The catalytic domain of human otud5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
129
Chain Sequence
MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The catalytic domain of human OTUD5
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
total genus 38
structure length 129
sequence length 146
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pfyA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pfyA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
2V9PA 3K3JA 5DFPA 5K5NA 3E6MA 1MZBA 4GS6A 3H3CA 4EKKA 4FTCA 1EV7A 5BYYA 4XG8A 4MIMA 3OYBA 4IADA 5H2FC 1D1AA 4HF0A 4EATA 3DAEA 2GHLA 4IO9F 2PZIA 1AQ1A 4JRNA 2MG4A 1LFBA 4O84A 2DUVA 2Y9YA 3H1CA 3I4PA 1P4XA 4H3PA 5AUVA 5CVFA 3F9KA 3GQLA 5I9VA 3QRFF 4Y7NJ 3FYKX 1KU3A 4P5ZA 5ITAA 5ETAA 3IK3A 4FNZA 2VL8A 1OL2A 2HYFA 3HRTA 2CNQA 2X9EA 4KIFA 5DYJA 1MQBA 4IB3A 2QEXI 4FKUA 5A2QZ 2WMTA 4GFOA 4FT8A 2UZEA 3DQXA 3FBNB 4EWHA 5AEPA 2CYYA 1IN5A 1SNUA 5K4JA 2OBPA 4AXCA 2HOEA 4KNYA 2QG7A 5DGZA 3DTWA 3LAPA 3FAAA 1MIJA 2OPTA 2GPHA 5AP0A 2J0JA 3NUAA 4BHZA 4MBLA 3Q3BA 1TWAJ 3FZTA 4H0EA 2BIYA 4E7KA 5AWMA 4TYEA 4QP2A 4V0GB 4AAYA 1WCMJ 4FG7A 4FMQA 2VBYA 2NNYA 4F0IA 3GI3A 3UOKA 1K4SA 3KX2A 4BGQA 3GC8A 4TWNA 2ZXIA 3IO7A 2P5VA 1H8AC 4EL9A 3OSGA 1KSWA 1XQZA 4BE0A 4XLAA 4A3BJ 4P1WA 4G6OA 2LBFB 1SNXA 4KMFA 2W9FB 4IVNA 2EZLA 2FUG2 4GO1A 3BIZA 3ET7A 3MPMA 1ON1A 4D1ZA 4ANJA 1YXUA 3WBLA 5L3GA 3DPTA 4FVPA 3FLNC 3D7TB 4FEWA 3MH1A 3KK9A 2JEDA 3FI4A 1ZYCA 2RIOA 2R7VA 4G94A 4AM3A 4FTKA 4Z9LA 4YFNF 5A4LA 2XKEA 2O2UA 3GEQA 2R7XA 1PMNA 3KPHA 4O7RA 4IAKA 1J59A 2YAAA 3RNIA 4IVAA 1BJZA 2OD5A 2RFDA 2NYAA 3OD6X 3PG1A 5HX6A 4BXXJ 4LG0B 4UVAA 5FGKA 1H26A 3OVVA 4RLKA 4H58A 4IHSA 5IEXA 4HX7A 4G9YA 4UWYA 3CLOA 3CP9A 2JIIA 3AT2A 4QYFA 4MD9E 4YJTA 4IWQA 4EZ3A 4DFLA 1LPUA 2EINH 3DGKA 3AQVA 1X4PA 3NDMA 3RGFA 4MWIA 3RCOA 2PUPA 3SYTA 4O2PA 1MRUA 1OECA 2Y31A 4QT1A 3R60A 1IN7A 4NH1A 4BRXA 4IZ5A 1OIYA 2ZMCA 3KVWA 4M68A 2HVRA 2XK4A 3AMBA 3SC1A 3SG8A 5H8BA 3C0HA 4F6UA 3AL0C 2H8RA 5B2KA 4BY9E 4BDIA 1XMAA 4A2UA 3FMQA 2FUMA 2V22A 4RAGA 5D1JA 3GCSA 3ZR8X 3T8TA 2IBDA 5LOHA 4V0GA 1P7IA 3HTUA 1FGIA 3RMFA 4G1WA 5KNLA 5M3MJ 3PVBA 4QQTA 1FY7A 4WX9A 3R28A 2ZO4A 5E90A 4B0GA 5AUTA 3CO6C 2LY2A 4AIJA 3QCQA 3GXOA 3SFZA 3F6VA 2XIRA 4O0XA 3FEGA 2UZDA 2X6XA 4LMUA 3R6XA 5IUHA 3SX9A 3PJ3A 4W1UA 4PZJA 3MPTA 3BLQA 3D0SA 3PXZA 3S3IA 3RM6A 3GXLA 5ACKA 2ELJA 4DCEA 3BE9A 3S93A 5CTPA 2COMA 3JTHA 4FC0A 5A6OA 4KINA 4XOPA 1Q5KA 3GTMJ 4DLJA 2VN2A 5AX3A 1TWCJ 3X2QH 4DAWA 5EYMA 2Y4IB 4FOCA 3K54A 1OKZA 3HUCA 3HOYJ 3DF8A 1S7EA 3VN9A 3ORLA 4DYMA 2V1UA 2VOOA 3AC5A 5FLXK 4IJPA 4D9JA 4Q5EA 4ZTNA 3UOJA 4UB8C 3OFMA 1MMNA 2AQFA 3BRBA 3F66A 4OIPF 5HE0A 5HLWA 1OYYA 2XK8A 2HW7A 1RKTA 1FGKA 5E8TA 2X85A 4QDEA 2XSJC 4M3EA 1H0MA 5CEOA 4NM3A 4HNIA 1DP3A 3R1SA 3PG3A 4JX3A 4DH5A 3A8WA 4BY1J 1XMLA 2YHVA 5CEPA 4WBOA 5E8IA 3CTJA 2A5WA 3TO9A 3P5KA 5CU2A 1KUTA 1ETVA 4QP8A 5CZHA 2XB0X 3EL7A 5J9LA 4A6EA 3E88A 5CU4A 3TZ7A 4N57A 3KEQA 3OEZA 4EH9A 3I4MJ 3TNHA 3F2RA 2O63A 4EH4A 4MEXF 3FMEA 4HZRA 2G2HA 2FEZA 3ROYA 3KULB 4A3DJ 3QTWA 4AIKA 2C4GA 4F09A 1WH7A 2VUWA 3LCTA 1GDTA 3K3IA 5BVKA 2R5ZA 3FMKA 4FSRA 2ZOQA 3PSIA 5HNFA 4JI9A 3MTFA 1SEUA 2JITA 2E5NA 4ZJJA 4L9TA 4QTAA 1J75A 4BICA 1SFUA 3P7CA 3A01A 3QC4A 3ML6A 3W2PA 2L01A 3KFAA 2W4SA 2YJSA 1GZOA 3M3YJ 1XSXA 3QP5A 3QX2A 1XSVA 4MQ2A 2WY7Q 1VQ7I 4JG7A 3CCYA 3ESWB 3GTLJ 4NQWA 2L5QA 3LNQA 1OBDA 4R8HA 2VQLA 5FROA 1M7QA 2EUFB 2F5DA 1TP4A 5B3SH 3GNIB 1XH9A 4QMYA 1VEBA 3OWKA 4AVZA 3AG1H 4FV2A 5FEEA 3RCJA 3H0YA 2PMIA 4YRVA 4IWOA 4ONAA 4IHTA 1XD7A 4IAAA 4WXHA 2A6TA 4MX9A 1U59A 4FIHA 3LFQA 3RJCA 3CUQB 3BR1A 3A7GA 2VUMJ 4K9YA 5E8SA 1PKDA 3ROUA 4CLJA 1WJEA 2ZB0A 3NEUA 3A4PA 4J52A 2WB8A 3ZFMA 2CO5A 1JQHA 2A19B 2C6YA 4YC3A 5T3QA 4FOBA 1ZZ2A 1YRNA 1NTCA 5FEDA 3TW6A 2MC4A 1WBNA 3I0TA 4DQ2A 1OPKA 4DBRA 1OITA 3WE2A 4AX8A 2KIUA 2JAMA 1VQMI 2Z1DA 2W24A 3ZMSA 2G7HA 1OMIA 1YJNI 4FT9A 3ZMZA 4BBMA 1FVRA 4BQQA 2XKDA 5FKKA 1Q24A 2GU8A 2QI8A 3ZQLA 2IVUA 1V4RA 3MY5A 1U8BA 2VD5A 1JKPC 3O5AA 4XRSA 2XNNA 4DEAA 1W0XC 3K2ZA 2VWVA 3I6WA 3RPUA 5FRIA 4F65A 2R2PA 2R3PA 4ZYDA 4YTHA 4RVKA 5JK3A 1B4AA 3FMRA 2O5KA 3TUBA 5IP7J 3C4ZA 4GJ2A 3I5NA 4WHZA 4FKPA 5EDNA 2E36A 4HF1A 4BJ5C 5AIRA 1PP8F 4LUEA 2M8GX 3FYJX 5B7VA 3AG3H 3ZRKA 2ETRA 2XUUA 3HRMA 3MZYA 4LV8A 2BZTA 4UWBA 5KE0A 3FUPA 4M73A 2H9VA 3A4OX 3QYZA 2PN6A 3LCOA 3EN9A 4BZDA 5FFZA 2HVSA 3CZ6A 4MFEA 3MFSA 3FHZA 2B9HA 2K7LA 3ISPA 1LEBA 4L53A 4W4YA 1TQIA 1HSJA 1MGTA 2DFFA 3FY2A 4XICA 3C3WA 4XMYA 4LRKA 5J47A 2Y48A 5K9IA 3QZGA 1ONVA 4DFUA 2EJRA 1ZKGA 3BG7A 4GG7A 3OC1A 2ACXA 3BEAA 4HW7A 3IDCA 1TVOA 5F0CA 4MF1A 1R1UA 3LAJA 4K2EA 3MPAA 3CMYA 2DA2A 3SW4A 1OISA 4FIFA 2LGCA 4E5AX 3W2AA 3M9AA 4GKIA 4XH6A 3ABLH 5HD7A 3G9LX 5HODA 3QPHA 4OMYA 1R0EA 1OGUA 1ZOHA 3S1MJ 4F1OA 3EQRA 4K6ZA 3DV3A 5KCMA 3CEKA 4ENXA 3R63A 3NGAA 4KD1A 1WAKA 1ZR4A 1SVGA 3VF8A 1WFXA 2ZXJA 3WHBA 4RX8A 4D5FA 1NXKA 1CGPA 4YFXF 2R7ZJ 4I6BA 2VQCA 1JKRC 4JQ7A 2QBYB 3EQPA 4AVPA 3GQIA 3SXYA 3QTUA 3OTVA 4C3FA 2AXLA 1S9JA 3CJTB 5AP3A 1GVJA 1XC5A 1K79A 3CDHA 2XMYA 4G6NA 3UDSA 4UUSA 4EJNA 2KRFA 2IVTA 1H4LA 5L3AA 4U80A 1ZYDA 2K9MA 4CMOA 3TP3A 3A0BC 2XNOA 4Z6YA 3FSKA 3CC7I 2C0IA 5EYRA 2EFNA 3OXIA 1GIIA 2XROA 2EU9A 2Z7LA 2L9NA 1V5EA 4IHYA 4C4IA 1Q97A 3UG2A 3QGYA 2J7TA 2K9SA 2R3HA 5CSWA 2F2UA 3U87A 3N51A 3S3MA 3FE3A 1KU7A 4RLQA 2R7QA 3EB0A 4GK4A 2EPFA 3O71A 3BWJA 1P7JA 2YCRA 5DR9A 1ETYA 2KT0A 4S05A 4YELA 3MS9A 1BIBA 1KGSA 4FIGA 1Z21A 3BY6A 3PRFA 2GFSA 3QWLA 4HNUA 4EKLA 5F94A 3E8NA 2GS2A 3GUDA 3DJ7A 3SKCA 3ZYAA 1PUFB 4LITA 3CTQA 2GXBA 4LQMA 1R1TA 2IJLA 4I24A 1Y0UA 3WG7H 4A12A 4BGGA 2OG8A 5BNGA 1H9GA 2RFEA 4IE9A 2PEXA 4XIDA 5HZNA 3SGCA 3IW7A 4IX5A 1U2WA 4EK3A 1X3WB 4HVIA 4EOQA 5JSMA 1RDQE 3AOXA 2X7GA 2A6EF 2ZNZA 2PUUA 1WJFA 3LSTA 2IG7A 2W7NA 4GMYA 3N4UA 4N4SA 5KBQA 2Q1ZB 1ZMVA 4DEBA 5H2UA 1XBAA 1L3LA 2KJBA 2QVSE 2QOIA 1KOAA 4M0ZA 3DB6A 3EZVA 4EOPA 5E3LA 2E9OA 1OR7C 3MESA 1YIJI 3P9JA 2PSQA 4QPSA 4IHPA 4FJVA 4CUGA 1FC3A 1QO0D 2WBMA 2YPRA 4LM5A 2XAJA 1YW7A 2VO0A 4HYUA 4XG2A 1TTYA 3HIFA 4ZY4A 1MH4A 3EN7A 3SRVA 5F08A 3JCUC 1A06A 3AT3A 3QLGA 5HLNA 2AC5A 4FIIA 3UNJA 4XG9A 2CW8A 2LKPA 1CKJA 2L4MA 3TM0A 4GUBA 3OROA 5G6VA 4AGCA 1VNDA 4U81A 1FOYA 4G7ZF 3GU7A 3PUFA 5D5VB 2R5YB 3MD2A 1B72A 1O3TA 1YX5A 4RVLA 5IDPA 4JYKA 1EKEA 2M1BA 1EJ9A 4FYOA 2ZJQF 1YDTE 1P9QC 2XNMA 4USFA 2LSOA 2LAVA 1HKQA 4JQFA 2ITXA 2M3AA 5BV3A 2NS7A 5L2WA 1I09A 2ECBA 5CEMA 5JGBA 3GC7A 2YISA 4FKWA 4RFZA 2WELA 3WIKA 1MSFC 3VUKA 4GCVA 1D8KA 1X8BA 4E26A 1FOTA 1SD7A 4XM3A 3KK8A 4XHKB 3WU0A 3OYIA 1N78A 2WOUA 4GU9A 4O0YA 3L2RA 3CTAA 2JD5A 4PSXA 1FVTA 5HOOA 5EHOA 3QZFA 4I0AA 4RGRA 2VTLA 2QO2A 1M2QA 2QSHX 2OTJI 5IUGA 3DCVA 3KCCA 4I76A 2W82A 4FX3A 4C4HA 3KREA 4BH9A 3QRUA 2WAQA 3GO5A 2ZMEB 4DBQA 3HRFA 4PNIA 5HCXA 2UV1A 1BL0A 3TT0A 4M13A 3I59A 1SVMA 1XH8A 3AG9A 5D5UB 1FMOE 4B99A 4ZY6A 3W0OA 5J1WA 2UZVA 4F78A 4IEJA 3FHNA 4X2FA 2JWTA 3Q2MA 2DO7A 3H0GJ 4W4VA 3JRFA 4UNOA 4QEBA 1IRKA 1WJDA 1DI8A 2C6DA 3EUHC 2DN0A 2H34A 4TXCA 4RX7A 2V55A 2IGKA 3FKIJ 2VTSA 3FMNA 2EXCX 3ZSGA 1YI3A 4D5KA 3FLZA 4L9JA 3M4OJ 4MH7A 2XPVA 3EJ1A 3PSBA 2K40A 2JFMA 2YU3A 1G3TA 1U5QA 5FDXA 4MO7A 4J98A 4LD5A 3OIQA 2R5TA 3R1NA 1E2XA 1DPRA 3IOPA 1KA8A 4FE4A 1AKHA 1LE8A 2BY3A 2A4LA 5H6RA 1X1AA 5L2TA 5IP9J 3IGGA 5EDQA 4FCYA 1J09A 5DE2A 2PVKA 3D5VA 5EZGA 4FV9A 1YHVA 3W8QA 2YZLA 4F0FA 3ZC6A 1UU7A 3IW6A 3TCPA 3OYJA 4XV1A 2ESMA 3VAPA 3HL2A 2KJCA 3TIZA 4NM0A 5EG0A 1Z0XA 4EK8A 2WQNA 5EI8A 3S1QJ 4OTFA 5HVJA 2R3JA 2BPMA 3V8KA 3GVAA 3GP0A 5DBXA 1YI4A 5D4SA 3F5GA 4E8AA 4E7LA 5EQEA 2VNYA 3R7VA 2OBJA 4QNAA 1M17A 2X48A 3FL4A 2FH9A 2ZMEA 1A31A 1VI0A 4BQAA 5BVDA 3RQ4A 1LKXA 3R01A 5AUUA 3PJ2A 2R3MA 4EI4A 4LMYA 3BC8A 3FXUA 1JKOC 4EZ5A 3HPHA 2E9VA 1BI7A 3VFZA 2WC2A 4FNYA 1FNNA 3V8LA 1JJ8C 2ZMDA 2NOJB 4DT9A 3O17A 4HJOA 2AS5F 2LTPA 3R0TA 2WB1N 2PX9A 3O8HA 3BEGA 1LEAA 3F21A 2W1ZA 2QKRA 3OTUA 2PWLA 2ZSIB 2DK5A 2FNAA 1UV5A 3G15A 3UMWA 1XH5A 4D7NA 1YVJA 4DH1A 2LK2A 1X3UA 3F3UA 2H8HA 2VPLA 5BQ0A 2ECCA 3DFCB 3VW6A 2CWEA 4QOXA 2PLYA 3PWYA 3M1CA 1B39A 2RQQA 3LCDA 4H05A 3WI6A 4IQJA 2XGEA 2JSCA 3AC2A 3UG1A 1WMKA 3UVRA 4ZJZA 5IP6A 1P5EA 4J97A 4NL0A 3ZCLA 1J7UA 1MJ9A 3QD3A 4CNHA 4EQMA 3DTKA 1MDMB 4IM0A 2L7KA 4KRCA 4LLNA 2YJRA 3HAVA 5K7ZA 5DEWA 3PLSA 2MLKA 4AA0A 4BCJA 3UKGA 2VV9A 1G8XA 4HVDA 3OSFA 2XRLA 4EBWA 4EJVA 2VNWA 1F4KA 1LDJA 4F7LA 4RS8A 3LSRA 3M8EA 4S34A 2XKOA 4FI1A 4EH3A 2EIJH 5AV1A 3T8OA 2RC4A 2XJ1A 4YBJA 3KRLA 4GDFA 4W4WA 1YW9A 3DLLF 4A3FJ 1PYXA 4IH8A 2PYWA 5IH6A 1J5YA 1K6OA 1BBYA 4DC2A 3RPUD 3LA3A 4CYDA 5C4LA 3SZTA 1KE7A 3NW7A 4ZY5A 2C6OA 2J51A 3MBLA 3EETA 5AMNA 1AOYA 2YDIA 1YHWA 1O6KA 1M7NA 3A60A 3OS1A 3LMHA 4AN3A 5HGIA 4O7SA 5CVVA 3W0NA 4U6RA 3NQOA 1HLVA 3WZKA 1MBEA 4ZSLA 2Z02A 3BHYA 2GOMA 2JRMA 2EB7A 4WG4A 1PVEA 3UZTA 1AA7A 4WK8F 2EA4A 3OYNA 4KS8A 3VS0A 3V5LA 5BVNA 4B9DA 3AGLA 4Y5HA 1TT5B 4FSMA 1FOKA 4M8TA 1OL6A 5L3BA 4P4CA 3IWFA 5M55A 3R6SA 1CMKE 1WVXA 3CP8A 5CU0A 4QMSA 4V19K 1MBKA 5DOSA 4L68A 4KABA 1A04A 3BX5A 5FB2A 2OF2A 3OYKA 1I27A 3JVSA 3RAKA 3MVPA 2JMWA 1A9UA 4UWCA 2O8KA 2WADA 3RKWA 2QQ9A 1Z57A 3MVJA 3ORIA 4BDYA 5AAEA 1RC9A 4OIOF 4BGDA 3AKJA 4UX9A 3PE2A 2VKEA 2BZKB 4X1EA 1T95A 4L6QA 3UDBA 5E92A 3JS2A 5KMNA 5BMMA 1F43A 1QQIA 2BTSA 2VJIA 2CS3A 4FTJA 4BDDA 2EILH 4U5JA 4EOOA 4CGZA 2I7QA 4BN1A 4EZ7A 3IAS2 1YDSE 1L8TA 4UV9A 4P90A 1BL7A 1KE5A 1DGRM 5ANDA 2CG4A 5M51A 1LEWA 2OAZA 5CEIA 4C3HJ 3HOSA 3V3VA 1AGWA 4BHNA 2HWPA 3PQJA 3A2CA 3ORMA 4ON0A 3NYNA 3P79A 3FZOA 4Y95A 1FOXA 3JY0A 4NC8A 1BKXA 2W4OA 3IW4A 2P6TA 3MAJA 4V01A 2OZAB 1ZXEA 5M4IA 3LSIA 4FHTA 3PL8A 2ID3A 5A54A 2QOFA 1FQ1B 4NKSA 5GINE 1F1ZA 1ZY4A 2M45A 2H8WA 1YI6A 1YS6A 2OZUA 2WHBA 5GTHC 3IRRA 4JG6A 3OS3A 5DH3A 3RPYA 3CF2A 5E8XA 2W17A 3H3UA 3ATSA 4DH3A 4I6ZA 4PMTA 2KIFA 2DT6A 3MN3A 4C4EA 4FBXA 2F57A 3WF5A 4BXUA 2X6YA 1ON2A 1AU7A 5D10A 5K1YA 2VTOA 1UWHA 4H1JA 2XIYA 2ID6A 2O8YA 3K1MA 3RYRA 3GCQA 3UPXA 3IC7A 2J0LA 3ORTA 4XCUA 2LMDA 2W06A 2LVSA 2YCSA 4O7NA 4BIEA 4BC6A 2L9VA 4PV0A 4YZCA 3AKZA 4ALVA 5E9EA 2K27A 5C44J 4HQEA 3BZCA 4YLLA 2DFIA 2DWBA 1ULYA 4RT7A 3ZDUA 2IS2A 3PO2J 2Y2ZA 2O0UA 2OTLI 5F20A 1BR1A 2C47A 1B6AA 2YCQA 1R39A 3GENA 4QYGA 3ETAA 5EI2A 3L9PA 1BW5A 4BYJA 2W4KA 5DA3A 2Q83A 2R3QA 3KF7A 3OCTA 2J4ZA 5IDNA 4TYHA 4LYNA 3HMIA 1Y39A 4KT6A 3CJFA 3F6XA 5IQEA 1G3NA 3VRZA 5A14A 3BYUA 3F22A 2X1NA 4KDPA 3ZBXA 4CYCA 3ZOSA 3PO3J 3UNGC 2BVAA 3LOCA 2W1EA 2H6CA 4FSWA 1R9TJ 4LK0F 3W8LA 2GSFA 5HBEA 3ZQCA 3QLFA 3TDZC 4U88A 3E7VA 1X19A 2A0CX 2QVOA 2XDVA 2QR8A 5ILVA 5F1RA 1H1WA 4QTDA 1R7JA 1GVDA 5A2QK 2HOTA 4WCGA 4L7FA 2PE2A 2FGIA 3W33A 5CF6A 2PMLX 3ERED 3JR9A 2NNWB 4RJ5A 1U54B 5KHDA 4PFOA 4X2GA 4GVAA 1KE9A 1XS9A 5FXQA 1O7LA 5EHYA 2DQRA 4G17A 2LREA 4J19A 1FTTA 2DA4A 2E5ZA 3H36A 2Y6MA 3AKLA 3ZM9A 2UW5A 2JPBA 2E34A 3LFNA 5GPCA 5L2IA 2CCHA 3SD0A 4AXAA 4QTBA 3RJPA 2ZM4A 3R1YA 3A0HC 3ZLYA 4FV0A 1JKQC 3ZC5A 4ERWA 5KCVA 1S9HA 3S2PA 1YLFA 4B6LA 3ZEWA 2HELA 1G2HA 4L8MA 1SVEA 4IACA 5DIAA 4Y72A 3HEGA 3ZO4A 4DG0E 4CICA 2ITVA 3TQNA 1S9IA 3EMGA 4EHEA 1PXLA 4W4XA 5A3XA 4UV8A 3P23A 1Q62A 5CU6A 3AFHA 3FK7A 3M42A 4N6ZA 4Q5HA 4RMZA 4BJTA 1YW8A 4ZDOA 1D1BA 3EKNA 4LRMA 2NAZA 5EQYA 4BCMA 3CLQA 2TCTA 3BG9A 1GY3A 1URWA 3I4NJ 3UO6A 4XL9A 4M97A 2ZM1A 4O7WA 2OXXA 1DM2A 2P5KA 1Y8RB 3FX3A 5FP5A 2NOGA 3C0GA 3R9OA 3MZHA 4O6JA 4IAIA 4O3MA 3CC4I 3EWHA 4I93A 2P8TA 1PP7U 4AUAA 4AZTA 1FBUA 2C68A 2P4IA 3OOGA 4FT3A 3OF0A 4U87A 2HZTA 4ALUA 3R61A 5K5OA 3FMHA 4IL6C 1SM2A 4ZP5A 3JW4A 4MD8E 3IW5A 2DDBA 3Q96A 5HTCA 3PIOF 4L3JA 5EYCA 3HGGA 4G12A 1W7PD 3ZO3A 3O50A 2DFEA 4A3EJ 4II5A 4I22A 5FD6A 2DW4A 2I0YA 3LQ5A 2W84A 3BZKA 1U4DA 3TO7A 1NVRA 2JSPA 5ANIA 1ZLKA 4ASDA 4TN6A 4L3PA 5HHWA 4OIQF 4IHWA 5M09A 3BI6A 4MWHA 4AT3A 3Q5IA 4RIXB 2BRHA 2QUFA 2WTIA 4DNCA 3KFWX 2NVXJ 4CZZA 5J87A 3RVGA 3WF9A 3HOVJ 3VS1A 5LVPA 3WU1B 3FBIB 4GW8A 1DAYA 2C3KA 3V7SA 4IJAA 1QRYA 2BAQA 5K3YA 3QAHA 5DRBA 4U3YA 2K9NA 3U54A 4L01A 4R1HA 2JVGA 1R5HA 4O2ZA 3HV4A 3IDBA 2A07F 4CD0A 4HNTA 4O0RA 3C9WA 1CDKA 1N25A 4ANBA 3RQIA 3ZO2A 3GX4X 2GNGA 4AW2A 4Y52J 1ZOGA 2TDXA 1UAAA 2AYPA 2B9JA 2FA2A 4H3BA 5FKNA 1FPUA 4C36A 3LCSA 4CFFA 3F9NA 4HOKA 4UUTA 1I1SA 1A48A 3LA2A 2JGZA 1YO5C 1D8JA 2IAIA 5GAEJ 5IOZA 2NO3A 4FUYA 1DS5A 3E3PA 3ZONA 1CTPE 3C4FA 5E8GA 5DHJA 3Q6UA 5DT3A 1Y8YA 5E1SA 2X6EA 3DQVC 3VUGA 2A5YB 3IH3A 3S17J 5D7AA 3PIZA 3O2PE 1ZRFA 1Z77A 2PZYA 2M7BA 2K02A 1ETOA 2Z2WA 4JK1X 3UP2A 2HOAA 2DK8A 3KB7A 3HXLA 4BCQA 2OF7A 5AP1A 2ZSHB 3FJQE 3RI4A 4ESJA 4XP2A 1XH4A 2YACA 1LUFA 4FV3A 4ACMA 2WTWA 2ZCWA 4MAOA 3QA0A 3C13A 4YO6A 2VOPA 3VS2A 1JSVA 5F9EA 4FV5A 2XIKA 4JDKA 3FXWA 3A7HA 2B9FA 4RQKA 1KV2A 2ESHA 4L5JA 4O7LA 4UXQA 4RWIA 2WMQA 3IHUA 2XVDA 3OYEA 4OAYA 4HW0A 2ZAZA 3OYFA 3GFEA 2DOAA 4KNBA 3ZH8A 3CCRI 4LIVA 4NDLA 2JKOA 3IH2A 3BTCA 2WZJA 2FQ4A 3QALE 2BAKA 3LOKA 3LXNA 1T08B 3G0FA 4M6XA 3F61A 2CSOA 3P4KA 1VQ8I 2OI4X 2WQOA 3RP9A 3MVMA 5K7FA 4QQJA 3L00A 3MFRA 2PVNA 5JMSA 3MWMA 4RB1A 4CCLA 1BJAA 2UW6A 3V8TA 5L8JA 4BJ6C 3II5A 2DPDA 3F3ZA 3OMYA 3RPRA 4OINF 4MK0A 3VHEA 4KJZA 2OIBA 2CPKE 3PRIA 5HO7A 2CMPA 2ITQA 1IAWA 1HC8A 3KE2A 1UHSA 1ZG1A 3BR0A 3BL7A 3ZRLA 2UW3A 2IJMA 3P0MA 3ZQ7A 4AA5A 2JTVA 2RFSA 4D5HA 3PA3A 4O81A 4YEJA 3POZA 3P86A 4C0TA 3K5VA 2WV1A 1DUXC 2JLDA 5KZIA 4IB1A 4ASEA 3JAMZ 4MXYA 1JHHA 3R8LA 1JTYA 1PHKA 2IPQX 3MYGA 1ST4A 4YUQA 4XX9A 4Y83A 3ZMVA 4DT8A 3FKJA 2UZTA 2W1CA 1RR8C 2K5CA 4X3FC 3G3ZA 3OZ6A 3L2UA 1XGSA 3FPMA 5FKOA 4LV5A 4LJZF 4MGRA 2O64A 1DGWY 5KMMA 3DBHB 4IQ4A 4J8NA 2BVLA 4E6CA 2J6MA 1MNEA 5DRDA 4A07A 2VTIA 1UNGA 1PY5A 3B2WA 1J3HA 3DWLE 2A61A 5BVWA 1G5SA 3A61A 4D4SA 3TJCA 3A8XA 5TISC 5E8UA 3VHKA 3WYYA 2WFYA 3I1AA 4RGXA 4WIHA 2ZV2A 4IX6A 2KP6A 3QQFA 3PPZA 4C59A 4X7QA 3GCMA 1IG1A 5KMIA 3V6SA 3GFIA 3PY0A 3G5DA 2CJMA 4LL5A 3UVPA 3IGOA 3V8WA 4A3KJ 5GJFA 5AUZA 3GVUA 2VAGA 4FTLA 1DQUA 3ZZWA 2BBYA 3ALOA 5GADJ 3QXOA 4ACCA 2PVYA 4OUCA 4EOLA 4RA2A 2ZB1A 2FOWA 2ITZA 3LL7A 2XSDC 2CGUA 3P1AA 2GOXB 5D12A 3N4TA 2IZSA 5M5XJ 1Y1WJ 4CG8A 2IRFG 3V8JA 2Z8CA 4D0WA 3NFFB 1QZEA 2X1DA 1Z3YA 3KN5A 5CNOA 1A5JA 4PDOA 4CQEA 4DINA 2DMQA 5DV5A 1NA7A 2M2EA 3LHJA 3UNZA 3KXHA 5CXHA 2OA4A 2O7OA 3NIEA 4RJ8A 2X39A 3L1PA 2ITPA 5J9ZA 4E73A 3L9NA 1S6LA 4RWJA 5ANEA 2PJRA 2IVMA 4HQMA 3BR5A 4D2SA 4YURA 4KS7A 1Y57A 2WEVA 4F1TA 4E4MA 2QO9A 3VBWA 1KQ0A 2CV2A 2ZJ2A 2F7XE 3L1SA 1BR4A 2CFOA 4Y85A 4UV0A 2F4IA 2CQNA 2WKMA 4J7BA 1ZRDA 3LLTA 4YSMA 5ETFA 3JSOA 1Z05A 3MWUA 5CVHA 4PUZA 1WWXA 4Q9SA 4NUSA 3Q9YA 3OG7A 5C8MA 2IA0A 3SXSA 1OZ1A 4FKVA 4BTFA 3UDZA 4L00A 3VUMA 4E4HA 4ZLOA 5LRSA 4AF3A 1SVHA 4JRVA 5J6XA 3J7YJ 3ZXSA 2E1OA 2C69A 1Y8QB 4GGGA 4FKIA 2Z7RA 2JAVA 1OIUA 4AOIA 3PFIA 4YIIA 2BZHB 3JRBA 2JQ7A 3IP4B 2XBJA 1I6HJ 4DBXA 5IMXA 5I0BA 2G1TA 2IW9A 3PVUA 4DEIA 3F6OA 3KMMA 4IC7A 1T0FA 4WRGA 3QPLA 5JHFA 2E1CA 3OBGA 3R8VA 3S00A 2LY1A 4YU2A 1FT9A 2IA2A 3BPVA 3F5XA 4QYHA 4M12A 2CNVA 4IC8A 3LSGA 4M69B 1IXSB 2ZFYA 3OXZA 4DFZE 4DH7A 3NEWA 4USEA 1VLRA 1UMQA 3EKKA 3WF7A 3TL8A 3I0QA 4S2ZA 5ANOA 3R04A 1U54A 2MYSA 1QPJA 3KMUA 3NNUA 3S1NJ 1OCCH 2O6GE 1APME 4F9BA 4Y4RA 3REPA 2VXZA 1MMGA 1YWVA 3S14J 2GTMA 3OCBA 1STZA 3L2CA 4HYSA 3VRYA 4DGLC 4EK6A 2B9IA 2J5OA 4CCKA 4NB5A 2RVCA 1MMDA 3J7AO 1SFEA 3CUQC 6PAXA 2TRTA 1FJLA 4E7ZA 3W2RA 2YIQA 3OYMA 3W55A 3L8XA 3MJ1A 4FGRA 5I9WA 5HG9A 3R9HA 2WWYA 4AA4A 2FBKA 4A69C 2OKRA 4CMTA 5FTGA 1W83A 3HSFA 1X1DA 4KT5C 3R9RA 2F5EA 1VQNI 1IRFA 4O0TA 3L8PA 3AG4H 3OIOA 1F0QA 2XPWA 4PY1A 5E3NA 3ORKA 4R3CA 2HI3A 4F0GA 3W0RA 4AD9A 1LFPA 4EHGA 2HZDA 5EG0B 2BHYA 3OL4A 2W5AA 3GUBA 3I6UA 2ZM3A 4XG3A 3COIA 3QPTA 2BUJA 2Z60A 3Q4UA 4DIQA 5KAIC 3ERKA 3Q60A 3VJOA 2RG6A 1M1EB 2P7CB 3JY9A 3T3VA 2F48A 2V26A 4PDPA 2P0WA 1X2MA 5LMBA 3KP7A 3QP6A 1JKKA 2HDWA 2HFHA 4UY8I 1JLUE 4I09A 4N70A 4OTWA 1WBPA 3U21A 1R3CA 3DEUA 3WTVC 5DI1A 5K7HA 3O7LB 2QLZA 4A93J 4FT5A 5CEKA 3Q52A 4PSWA 2R92J 2CKPA 4AGUA 5L3FA 3CIKA 4NJDA 2BFYA 2QOBA 3G71I 1OL7A 1HQCA 3ASOH 3HKZN 3FISA 2DA6A 2XZSA 3DBDA 1YTYA 4IOAF 5CLSA 1O6LA 3NUXA 3GU8A 2FA5A 4DF3A 5IPAA 4XKBA 4A3GJ 5D4RA 2HWOA 4F9YA 2RKUA 5AA9A 5CAOA 2JDTA 5BVEA 3ZEPA 2XGXA 2R64A 5IQIA 5FLXZ 3JREA 4MFDA 2KRHA 3IQ7A 1JKLA 4NBQA 4BYIA 5JFRA 4OAZA 1XR1A 4B44A 5FD2A 5IPJA 1ZYJA 4KIOA 1V3FA 2EV0A 4L3LA 3RZBA 2F49A 3W1FA 4RSSA 1W84A 5LWMA 4PJ0C 3DKOA 3D15A 1TLHB 2RQPA 2UW7A 3JYAA 4HYHA 3ZFXA 5F64A 4DGMA 4P96A 5M5WJ 3BHTA 1S3JA 3S3OA 5K5RA 1QZZA 4CCOA 3PA5A 5H8EA 1GOLA 3DBFA 3CE3A 4FSNA 1FMWA 3VS3A 3HOTA 5D8KB 4RC3A 3FXQA 4QMZA 2EZIA 4JIAA 4J8MA 1XN7A 1OIQA 5ICPA 4F9CA 3PYYA 4C4JA 2FSWA 4M72A 3DNDA 3EN6A 3CR0A 1IAJA 4KIPA 4OBQA 1LE8B 2ZV9A 4H4KC 2ONLC 5IQHA 4S31A 2XAHA 4N0SA 4MXZA 4HV5A 2F2EA 3CJGA 3W6KB 4ZZNA 2QD9A 2HYGD 1JJ6C 1ZLTA 1BI0A 3VWAA 4U40A 4FG9A 4PJMA 4FTHA 4FNWA 3GTPJ 3F3VA 4F08A 2PQ8A 4C3IJ 3KETA 1VTNC 2J5PA 3ABTA 4XMOA 5JRSA 5JH6A 2EZKA 3RPOA 4KUJA 2JA2A 2YIXA 5JGAA 2F5VA 3T9TA 5IISA 4FL3A 1FINA 3LSJA 4UYAA 3F8NA 5D5XB 1Z9CA 4CZTA 2VWBA 3NAUA 3RKXA 2W9ZB 3HDNA 3QA8A 2IW6A 2XPUA 1RRJA 2PVJA 5DM6F 4XONA 2VBXA 2ZXHA 1O3SA 1KE8A 2XKCA 4I41A 2CQKA 3SA0A 2HGCA 4GL9A 2GNFA 3R7YA 3PPKA 4NKAA 2G9WA 3ZFYA 1P4OA 2O0YA 3RNYA 2V1DA 5C03A 4KISA 2F5CA 5DN3A 2GS6A 3RYPA 2R5YA 1FYLA 3GCUA 4JBQA 2XF5A 3KP3A 4DHFA 5I5ZA 4O21A 3PTGA 1CF7A 4CFVA 1IA9A 3HDMA 5I9XA 2EK5A 4DITA 4XLHA 1UHMA 3MFUA 2BXYA 3A7IA 3Q5ZA 4BDAA 5M08A 3CCSI 4ENKA 4FZAB 2VKHA 3M1EA 2X6OA 1D3YA 2CRGA 3NUSA 1EA3A 2OU7A 4AZVA 5M3FJ 5F1ZA 3EUKL 4A9YA 5FLMJ 2YM3A 4TW9A 4ACDA 4QYEA 4DE4A 4FV7A 3PFYA 2A68F 4KN4X 4BBFA 3F7WA 3WE4A 4RDUA 3TUDA 3QCSA 4PDYA 2OJED 4OLIA 4XRJA 3IS5A 2B7EA 1LVKA 3AGMA 3RZDJ 1EH6A 1YRPA 5CVRA 2LRDA 1Y1VJ 4M15A 4BCFA 3ODYX 1YXTA 4QP6A 5HCZA 3S1RJ 3MIYA 2GM4A 2ELHA 1T33A 3Q9ZA 1OL1A 5FTOA 5LVNA 3WG9A 3CBLA 4UVBA 2QOKA 3GU5A 3HV6A 4AFEA 5DG5A 5IEYA 3U9NA 3SOAA 4NHJA 1RKWA 5J8CA 4XG7A 4LGHA 3FLSA 4XOYA 3E62A 1YS7A 5EGOA 2CN5A 3FZ1A 1Q1HA 4MCVA 1P4WA 4HRIA 3OCGA 3QQKA 3PUFC 4DG3E 1FPQA 3GFMA 3QYWA 1SVLA 5AFVA 3HUGB 2YWPA 2B53A 4C2WA 3I9V2 1OR7A 4I99C 3IL2A 4K77A 5HBJA 1F3MC 4LOOA 1B9MA 4C35A 1U46A 5HVKA 4GUEA 3A7FA 3TDVA 4BI2A 3SLSA 2MD0A 3BGQA 5E1ZB 4ALWA 5DDGA 3HOWJ 3Q0UA 4RAYA 4XLIA 1OI9A 5IF1A 2XEZA 2C6TA 3AC4A 3GF2A 4QQCA 2OQGA 2KTYA 3ZUUA 2OZAA 2V9KA 3ORNA 1OJLA 5L3CA 4ZMFA 4P5OA 1RZ4A 3QRIA 1JUPA 5LLQA 3VNTA 1YE9A 3KULA 2BEOA 4WF2A 3QU3A 1RESA 3WARA 3D0EA 3RIRA 3C0IA 1A35A 3B6CA 5F1JA 3HMOA 4R7HA 3GOPA 3GCVA 2ITYA 3MY1A 4YIRX 4XLPF 3W2VA 4BL0B 4ZC3A 4JBAA 4B1RA 3QPSA 4M6YA 3W10A 4TYIA 2R7RA 3H4JA 5AM7A 2YX4A 4YZBA 4O0VA 1ZTRA 3CCQI 2BYVE 3DPUA 2M0CA 1LPQA 1BUHA 4C37A 2VWUA 4FK3A 3W0SA 4FKTA 3Q2JA 2PZ5A 3CPBA 4LFIA 4GIHA 2CJJA 3IUOA 1OCZH 3E7LA 4YR8A 3KVXA 4IANA 1VQPI 3WTUC 4O7ZA 4XSXF 1JNKA 4KA3A 5LFAA 4AN2A 3OL3A 2MH9A 1PJKA 4EJ7A 4XEYA 3BQZA 3ZN1A 4F6WA 1V0BA 3W6VA 2IEKA 4HBLA 3BOQA 3DKYA 4MBJA 2WIPA 1GT0C 4QMNA 4ID7A 1OM1A 3DDPA 3C1XA 2VIXA 1MKMA 5KMKA 1T6SA 3AC1A 3B73A 4RGSA 5J1UA 5J8FA 3GLLA 5CAVA 1BOAA 4M6VA 2K4JA 4QP4A 3DK3A 4JXFA 3HOUJ 4XV2A 5IT3A 3VUDA 4FV4A 4PTCA 5A9UA 3S2WA 3ZMTA 3M1SA 2ISYA 2W05A 4XRFA 3F0CA 3SJMA 2GS7A 3BELA 3BDDA 3S0OA 4E93A 1PMUA 2JA8J 1R5ID 1N77A 2DLLA 2VX0A 1ND4A 2MBFA 3R8PA 3M7GA 3PSDA 4GVJA 4IVDA 1SD5A 1MDMA 4LL0A 5HNGA 3LJ1A 3OW4A 2XM9A 5E3OA 3UQFA 1Q8YA 4EM0B 1MP8A 1XBBA 3H92A 4YSJA 2R9SA 5CYIA 2IWIA 2ZYBA 1J1CA 3F82A 3CO7C 5HVYA 5KUPA 2KKOA 4N0BA 2XF7A 4C3PA 3R9NA 3PZHA 1JXSA 3JRDA 2M0MA 1R5GA 3V6RA 3ZUVA 5LMAA 3QTXA 2QCOA 4MLOA 2EFWA 3FY0A 3PNYA 3P9KA 3EUHA 3GWZA 2ISZA 3FSFA 1T0FC 4TT7A 3V4GA 5IMEA 4CV8A 1PYVA 2OICA 1U5RA 4PTEA 3NUUA 1FBNA 4V2FA 1ZG3A 2R5ZB 2VO7A 5C27A 1LFUP 1QPCA 4J01A 1LB2A 2HZ4A 2UV2A 3MIAA 3G2FA 4AGWA 1BMKA 3KQ7A 3QQJA 4XOTA 1G8AA 4HCTA 4TNBA 4L9VA 3COMA 1MW7A 3IDPA 4X6AJ 4S0HB 3R8MA 1XGNA 4J53A 4NW5A 2HCKA 3H5AA 5TJJA 1D1CA 5M06A 2WOTA 5J1VA 2KLOA 2CW0F 5B2MA 3EQLF 2HQAA 4EWQA 5K5XA 2J2IB 3HA8A 2VWIA 4L52A 2VT2A 3W3CA 4KITB 3LQ8A 3DCFA 4IQ6A 3FI2A 4BAYA 2UXXA 3K4MA 5JKGA 4L18B 4QP1A 4UUVA 5BVFA 2A1AB 1G3WA 2JDVA 4A9RA 1IDZA 4TPTA 2F6CA 1W5CC 1X4OA 3OBJA 4GEOA 4MXCA 1ZRCA 3JRHA 1U5TB 2P0CA 5BUEA 4RIWB 2VXDA 1YQJA 5JFWA 2Q2EA 1NW1A 2BZIB 4D2RA 4NT4A 2GNIA 4IVCA 3TTIA 2OJFE 2XS0A 4HCUA 3VIDA 4DEGA 1HW5A 2EZHA 1PUFA 3AC8A 3CXWA 4OMZA 3ZBFA 4GG5A 3LFCA 2ZVAA 4QMUA 2PUIA 2ITNA 5JVTA 1YHQI 1H0VA 2IGNA 3TZMA 4LB6B 2XCKA 3K6GA 3VODA 4ZEGA 1BW6A 3EQFA 3AG2H 3E8EA 2W5HA 3FLWA 4J00A 3MY0A 5E91A 2VJ5A 3LFSA 3HMMA 5J5SA 2YAKA 3GFLA 1NG7A 2HVQA 4FKQA 3RSNA 3RPSA 1Z7LA 3G90X 4LLLA 3TNQB 4DH8A 3QWKA 3HUBA 2IXSA 1KYZA 2LOOA 2XYNA 3V5WA 2OK1A 4FG8A 2M4GA 4E70A 4G6LA 2BTRA 4ZTQA 3E5AA 3DDQA 4E4NA 2KQRA 4FGBA 5J95A 5CF5A 4AQCA 2C0TA 4MNEB 4O96A 4AG8A 4Y17A 3AD5A 4RC2A 3FKNA 1UA2A 4XV3A 2R7SA 5EI6A 1YXVA 2VJ4A 3ZGKA 3DXPA 5E17F 3V5TA 3TMOA 4B8XA 2M5WA 3HUGA 2BROA 2GCDA 2QKMB 1XG1A 3OUKA 2WU6A 4QLCU 3G6EI 2OFVA 3VO3A 3Q5FA 4U41A 5JI6A 3G0EA 2PJRB 1R78A 1WKMA 2KZGA 3G1OA 2X51A 2VB6A 3LZBA 4F55A 4ESBA 4FA2A 1ZLJA 3CF5F 3EPZA 4F7JA 2QWWA 1E17A 4B7TA 4KBKA 2FSMX 3DU6A 3OEFX 5HICA 2GXGA 3IRQA 5BS6A 3AMYA 2RN7A 2WB1A 2OCEA 4BS9A 2X0LA 1Z9XA 4XSZF 3L9FA 3Q9VA 3D5XA 4K18A 2OIQA 2K85A 5ACBC 1XJDA 4HSTA 1E3OC 2JN6A 4I2OA 1IJWC 4BKJA 2Z33A 2GXAA 1CM8A 5BUJA 5LXMA 1U5TC 4AW5A 3H9GA 4ZXTA 3ZHPC 4FODA 4KKGA 4JDJA 1YHSA 2ZBKA 2D1VA 4RPVA 3RPVA 2HIWA 2WV0A 4ARKA 5J7HA 1VQ9I 4RLFA 2C5XA 5KZ0A 1RUOA 2QU5A 3P9CA 3F23A 3ZUTA 2ICWG 3RK9A 2XA4A 2HWVA 3QD0A 2YCFA 3ROCA 3SDGA 3WGIA 3QCXA 4FEUA 3BG3A 4DYRA 1P14A 4EOMA 4Z16A 5HDNA 1FX7A 3LIJA 1RQQA 2YIRA 1ORKA 4EM1A 1FOWA 2UZUE 4CDGA 3MKYB 4FZDB 1IXCA 5FXSA 5CAPA 1XDUA 4AZWA 4E7WA 1IV8A 1JBPE 2RKHA 3DTEA 4GK2A 1HKTA 3CMEI 2CMWA 2ELKA 3Q04A 1H1SA 3NCZA 5EM8A 1R58A 3HBLA 3QQHA 3DXJF 3WTYC 3CJNA 3QTSA 3FLQA 4CFXA 3QYBA 3FKOA 4O83A 4I4EA 3R7IA 5H9BA 5TGTA 4DYCA 2OC6A 5DR6A 2QODA 2PI0A 3OMVA 3GTJJ 3K1PA 3RALA 4BI1A 1TWHJ 3TL4X 1I1GA 2Q0OA 1BR2A 4R6VA 2QC6A 4TZRA 2H6BA 2Z3YA 2J0IA 1X1CA 3WTWC 3RDIA 4F99A 3ZMMA 2F4JA 5A4EA 2A2AA 4BQOA 4XP0A 1FBQA 4B3XA 1IV6A 2UVYA 5TF9A 2A05A 4X21A 2XB5A 2B54A 5DVRA 5IA1A 2C6IA 5CZIA 1FSEA 4KFCA 3MJ2A 4G34A 2LY9A 1WBTA 1WZ2A 4Z7GA 4PUSA 1LEZA 3OWJA 3TG1A 4D4RA 3D4QA 1ETKA 4X0MA 3BHUA 3DBQA 3MA3A 3SDJA 1HOMA 5ILUA 4D7MA 2X1EA 4QTRA 2HYYA 1HCRA 2EFOA 2SRCA 3LXLA 1OLTA 2ZDUA 2NYXA 3T3UA 2QKLB 3Q0VA 4EC8A 2R3GA 2UXNA 5LGUA 5CASA 3Q9XA 3R4KA 3THBA 2G01A 2MH2A 5DS9A 5FQDC 4HGSA 2Y9QA 5LGTA 5L6WL 3CY3A 4GKHA 4O86A 3G2BA 3MSSA 5IQCA 1PYEA 5J4VA 1MNMC 3T8RA 2O3FA 5D7VA 4FISA 2DA7A 2W99B 1PJRA 3OWLA 4QYYA 1YXSA 3PP1A 2C1AA 5IQAA 3ZM4A 4Y13A 1W36D 4RBLA 3TKYA 4B47A 3DBLB 1U78A 1Q3WA 4L45A 4UVCA 4OR5A 5ANGA 1OIRA 1TWFJ 5LMKA 1ETQA 2CHLA 4GRIA 3J81K 1IW7F 2DTRA 4FX0A 1VZOA 3L2QA 3ZLXA 4M71A 5JZJA 1NY3A 2MFZA 3D5UA 1XDSA 3FDYA 4H39A 3K1NA 1P92A 5GAGJ 3GBZA 2RV8A 4HGTA 2E9NA 3T9IA 1UKHA 2HQRA 3H9OA 5CS6A 3EL8A 5IEVA 1JT6A 5E20A 2HR3A 2YWVA 4M74A 2LF7A 1Z6RA 3QODA 4GV1A 3QTQA 4IZAA 4OU0A 4PQNA 3HYHA 3E64A 3O0GA 4MTDA 3TKIA 4L42A 3LXKA 1R36A 4FK6A 3QD2B 3FIWA 3DKWA 3HLLA 3NW6A 2DOFA 1J9IA 3TEIA 3RWQA 1DP7P 5LWNA 2OF4A 3ASNH 3FXOA 1OKRA 3QKMA 2G15A 1V55H 4APCA 1B59A 2Z7QA 2BCJA 3H9QA 1H1RA 4U0WA 1BI1A 3LQQA 2VZ6A 1V5FA 4YG2F 3GTKJ 2QHMA 5DD8A 4ETSA 1X1PA 2R93J 2HTJA 3KEXA 1S72I 5AUYA 1ZARA 3DKFA 4BY7J 4EJOA 2H09A 4RJ3A 3ZPLA 3S2DJ 1OPLA 4XORA 4QO9A 3E6DA 2O03A 3SQQA 3F8CA 4A5MA 4XS2A 3WTZA 5IYDJ 4LFUA 1E0EA 3J80Z 3S1HA 1BX6A 1T38A 4EUUA 3CPCA 4ITHA 2GA2A 1VQOI 2B0QA 3BT9A 4ESFA 2YIWA 1YOLA 3MVHA 3KZYA 5LEJA 3K70D 4G3EA 2F4MB 2BDWA 2FSTX 4YNOA 4IRHA 2PVMA 3U6IA 1E1VA 2GQQA 1WBVA 3E97A 4BU2A 3JPVA 2PULA 1IN8A 3VS6A 3COHA 4G31A 3OOMA 2IVSA 1Z67A 2HAKA 1WSUA 2R3SA 2K3PA 4TWPA 3NVKI 3TZ9A 3NYXA 2KHMA 4LUDA 1ZYSA 3K4BA 2HKOA 5F0HA 1H27A 5JQ8A 4PMMA 2HZNA 1GIHA 2F7EE 4IFCA 3BP8A 3PJRA 1FSHA 2DA1A 2BHEA 2WTKC 5C01A 3DA6A 5EJCA 1RUNA 3ZQQA 2EB2A 3KKVA 5KHXA 2GZWA 5HBHA 2LNBA 4HDUA 2LG4A 3BWGA 3GYHX 4CCUA 3WOWA 1XHAA 3Q4TA 1PMEA 2XAQA 4BDCA 3WF8A 4FVQA 4O22A 5K5QA 4XBRA 2GMXA 4ORKA 5L6PA 4G3FA 1B38A 3IECA 2XASA 4E20A 4ZTRA 4LOPA 3DB8A 4LRJA 2MABA 2DT5A 1AHDP 4MYGA 5L2SA 4EQQA 5JHUA 4CHUA 4MD7E 4IDTA 4BBRJ 2LFBA 5AIPA 2JUGA 4A4LA 1OKVA 5GJGA 4I6FA 4DGGA 3O3KA 4ZOGA 3HVCA 2REIA 4ZJIA 3HAMA 4DTBA 2HXIA 2ME0A 3SVVA 3UIBA 4I5PA 3UOHA 4YJRA 1KU9A 4RGJA 2VLAA 4L9NA 3EZRA 4K33A 4UEUA 2BXZA 3KXXA 3O51A 4ZYEA 5L3EA 4KIGA 4XK4A 3BU3A 3QYFA 2IPXA 3VUIA 3S2HJ 5JFSA 3PM1A 1OFCX 2OV7A 3FM3A 2XF0A 4U8ZA 4E6AA 4FX4A 1QA6A 3BYMA 2XNGA 3FV8A 4C3RA 2CQXA 4E4LA 4E7HA 4UB6C 4DOZA 3OS2A 3GU6A 3ZO1A 3PQKA 3BZ6A 4O7TA 2DMUA 1IGNA 4MNFA 3IKTA 4E5BA 4ENMA 4A9SA 3HMNA 1D0XA 1XMMA 4N9HA 4I0RA 1G8SA 2KDOA 1Q8WA 1XPXA 5J4YA 3PE1A 4LMNA 2Y69H 3A02A 4NTTA 5AV4A 2DCEA 4EVIA 5F6FA 1FTZA 4Y8DA 5D11A 1P6RA 1X58A 2EFQA 2JC6A 3KXMA 5EEGA 4E7SA 1Q4LA 2DAOA 2IGMA 1DU6A 4HVGA 5LEKA 4FEXA 3HB9A 3ZMDA 1H08A 5A46A 4X3FB 4JJRA 4V05A 4CMUA 2CGWA 4BIDA 2QU6A 5AA8A 4KKHA 3CKWA 3K4JA 4IVBA 3PSFA 4LG0A 2OCCH 2JKKA 3L7WA 2HY0A 4PRJA 4KIQA 2WNTA 4AW1A 4ENNA 1YXXA 4CVAA 4WRSA 2Y75A 4QPOA 5E3MA 3PDTA 2D1HA 2VWYA 4B8LA 1HDPA 2WIHA 4I92A 2PPQA 4M7IA 4X3FA 3ELJA 3VONA 4AE6A 2NS0A 2M9HA 4AT4A 4JDHA 4QWQA 4G5JA 1VQ6I 2E35A 1MJAA 5KKRC 1YDRE 4NQWB 3Q53A 3KP5A 4OTHA 3S95A 3DP7A 1LVAA 3EFKA 1R0PA 5FKLA 5C4KA 1Q41A 5ERIA 4RB2C 1LUJB 3WHCA 4XKWA 2WTKB 1LR4A 1NG6A 3CD3A 3ACJA 1IR3A 1LJ9A 2XKPA 4FKRA 3HP2A 5JGDA 5HIDA 4GSBA 3O23A 4EOSA 5LRRA 2AO9A 1XMKA 5HE1A 2AUHA 3KY2A 1DDNA 3EYGA 2CV1A 1VF9A 1HA8A 2IW8A 1ZGJA 3ZRGA 4YGAA 4KBAA 3QHWA 1HDDC 1E3PA 5HS9A 1OPCA 2Y9ZA 1ETWA 1WVRA 3PJ8A 4AE9A 1VFCA 4G6TB 5FUTA 1QCFA 3LAUA 1HW2A 4RWLA 4MKCA 5BVOA 3OWTA 1FWZA 4NC7A 3QFVA 1O6YA 4X3JA 3U4UA 1YRNB 5B5EC 3AMAA 2DBBA 2FSOX 2P4WA 3TKUA 4BB4A 4MHGA 4IZZA 5IQFA 4Y3OA 4AT5A 1UNLA 2ZV8A 2BZJA 2X9FA 1ZYLA 3PSCA 3PXQA 3QAME 1TBXA 3UMXA 2YDKA 2IS1A 2H96A 1W1WE 4Q5SF 2Q0NA 2DPUA 5IUIA 2VI6A 2NVUB 2VKVA 1QU3A 4O0SA 4RGUA 4IHVA 3U6HA 2I8DA 2BE5F 3KC3A 3U2RA 1HCKA 3PVGA 3SHFA 2C1BA 3NWWA 3SZPA 5C8NA 2RF9A 2R0UA 2XAMA 2BY0A 2XARA 5HE3A 4PCQA 3PA4A 3GW2A 3R7UA 2VQGA 3RAHA 4MBIA 3CCLI 2ZB9A 2R3OA 3EQHA 4GXOA 4JIKA 5A4TA 1NVSA 2JDSA 1NVQA 1V0PA 1G3SA 1O4XA 3DAJA 2X0GA 4NW6A 2PVHA 3OHTA 1XTAA 1FBSA 3I7CA 4J99A 2ONLA 1WPKA 2E71A 2P6SA 4Q2AA 1SFOJ 4R7BA 4YTFA 2M87A 2E1MB 3PUBA 1JOWB 2QQ7A 3LM0A 4DG2E 5DNRA 1SFKA 1HBXG 4U9AA 5IQGA 3S8PA 3UGCA 2ITUA 5AV3A 4Y46A 5D41A 2E1NA 2KIQA 2DU9A 3H9FA 2STWA 1H24A 1E1XA 4EJWA 5C26A 4G7OF 2OGVA 4I3ZA 2VTRA 3VQHA 2EA2A 3DNEA 5AAFA 3GZ6A 4GH2A 5CX9A 4A5NA 1GIJA 3H3ZA 3DK6A 3WF6A 4FTRA 3OYCA 4LG3A 4A9UA 4LK1F 3REOA 4F7NA 4CFWA 4WOVA 4EORA 3K70C 2E2HJ 1R4NB 3DTCA 4II3A 2OQRA 5BYLA 1YG2A 3QHRA 3CJRB 3D5LA 3HGYA 1MBJA 2ZFUA 3KIOC 1VQ4I 2Q8KA 1XX5A 4JR7A 1L3RE 3U1KA 4EK5A 1JGSA 3LSPA 3BR2A 2VTPA 4Z55A 2UZBA 1CKIA 3DEWA 4I1ZA 3KRJA 4RA5A 2LKXA 4LV7A 3BGPA 2FXAA 4X6RA 5FRMA 3CCVI 1J7IA 4CXFA 3CD8A 4JNWA 3EYIA 3BROA 5E4HA 5JVGF 5E1WA 1MD0A 4QNYA 2KDZA 5I9UA 3RM7A 3FL5A 4X2JA 4DN5A 2Y6OA 1AWCA 3OT3A 2WAFA 3E93A 5GNKA 2WQMA 3QL8A 5LJJA 3SEQA 5CQWA 4EYJA 4KSQA 1FP2A 3I64A 3EFLA 3PZEA 3HEFA 2QSFX 2VGOA 4BDKA 2OFUA 4JX7A 4Y15A 4H1MA 3HP5A 2VTMA 3OW3A 2XANA 2K4BA 2VASA 3GZ5A 4HG2A 2CLXA 5AAGA 1REKA 5HU9A 3VPRA 3HHHA 4G3GA 1ERKA 4L9IA 5KMJA 3BHHA 5DUIA 5HNHA 2O65A 2DYLA 1ERDA 4R3PA 4B09A 2R3RA 2GFCA 5M4FA 1YX3A 3MKZA 2YZAA 3FXRA 4EEFG 4F6SA 4XRMA 2ZJWA 3CJQB 1MBHA 4TV7A 4D4YA 4L5EA 3ZSHA 1FYMA 3NR9A 2MC3A 5JT2A 4AQKA 3K4LA 3ECHA 2QOLA 3ABUA 3DPLC 1T45A 3VYTB 1W0TA 4BJJA 1PDNC 3KXNA 3I4BA 1CKPA 3R1QA 4F4PA 3HOXJ 4Y5QA 2XM8A 5JN2A 2PE0A 1FLIA 4LI5A 2VTAA 3TTJA 3CUQA 3MTLA 5IA3A 1XBCA 2WEIA 5CLPA 4U43A 2AEGA 4BDEA 1YYVA 4S30A 2WTCA 4CYCB 2IA1A 4BTKA 1W7HA 4FICA 4UXNA 2PVRA 1WI9A 4BKXA 4GIIA 3AKKA 3WU2C 1PXMA 5LQFA 1CF7B 2P81A 3I56I 4C33A 2ERZE 1Y6IA 4KRDA 4DZJA 5AX9A 3HZTA 4RB3C 4PGHA 1VJYA 3ORZA 5GHVA 3KYDB 1BI8A 3QGWA 2HXOA 5J9YA 4IPAA 2R7UA 1JI8A 5AV2A 4O82A 1JUSA 5F95A 2VBWA 5ILSA 3NNVA 1YJWI 1RR7A 1R71A 3QU0A 5BPDA 2YS9A 3CC6A 3GFJA 3TV7A 3KL8A 1ST0A 3LE6A 1ZRZA 1QPDA 2I0EA 4GYGA 1OCOH 4KN7X 1IZ1A 5LBQA 5HG5A 4Q9ZA 2Z16A 2WAQN 4YBKA 1XGMA 3TDUC 4YZDA 2X8EA 3MMYB 5KX8A 4XG6A 4AGDA 3NARA 3SZGA 3SAYA 3KRXA 4IF4A 2YM4A 4FZ6A 3BTJA 4OTIA 5C8KA 3NUYA 3SDBA 4NIFB 2F2CB 3CCUI 1ACIA 4RBOA 2GHMA 4BUPA 3WE8A 4DEDA 5EKOA 3MI9A 4JQEA 5EF6A 3ORXA 3UBDA 3CUOA 1I3QJ 2QO7A 3WILA 2P2IA 5KMLA 4AWXB 2YU9J 3LMIA 2BDJA 3U1DA 5CAQA 3RK7A 4FSZA 3NCGA 5CENA 2W4JA 3O8PA 3DV8A 3E5QA 3SFIA 2FSLX 3B02A 4HX4A 3HV3A 2QQ8A 5EM6A 2W00A 4PWNA 4NUBA 1FYKA 2KMUA 4CO8A 2FU4A 4XNFA 5IT9K 3C4WA 4D28A 4UY9A 1XKKA 5IT9Z 1JVPP 2E60A 3LA7A 3U9CA 1BOBA 2OH4A 4AZSA 3FC1X 4Z3VA 4E7IA 2M34A 3ZXTA 5L6OA 3G6HA 1UU3A 2DQ7X 2WU7A 2W57A 3BJOA 1XO2B 1ZOEA 1NK3P 2WXVA 3IKAA 4FZFB 4MEYF 3R02A 4IX3A 2UVZA 3OP5A 1TW3A 4OTQA 3K2LA 4G8XA 3HZJA 4TRLA 2I0HA 4PP9A 5EM7A 5AP5A 2AQEA 1O7FA 4L7SA 2JDRA 3ULIA 4D4VA 2QYOA 2ZV7A 4TY1A 4MNEA 1RE8A 4BIBA 3UYTA 4BEHA 2HDDA 1HCLA 2BAJA 2RNJA 4Q47A 4I6QA 5JRQA 3TJDA 4NJ3A 1HF0A 1W8CA 3HRCA 3ZDIA 4I0TA 1W82A 3F3XA 3HRUA 4RM3A 1UVRA 5JR3A 2CU7A 5CT0A 4XQFA 2H94A 2VPRA 1PKGA 3S4QA 2HXQA 4RAFA 1GZNA 5AP6A 5J40A 2ZMEC 3I58A 5JQ5A 2BRGA 2MLGA 4HVHA 2CKQA 2QLUA 2WTEA 4D58A 4HA8A 3A4CA 4ACGA 2Y4PA 2VGPA 3M2WA 2VBZA 2R7FA 3KZZA 3SV0A 3K4KA 4HAMA 2KPMA 1IN4A 2PZRA 4A0XA 2VX3A 4GCJA 2VO6A 3V51A 5IH4A 1YFHA 4ZSJA 3MB6A 3GCPA 4MXOA 2CUFA 5T68A 4XP3A 3V5QA 1S7OA 1GNGA 4RIYB 4D0PA 1YJ9I 1ATPE 3VYSB 1QPMA 2RNGA 4HZSA 4AIHA 2OH0E 4C4FA 2B55A 3K9TA 3A2KA 2EIMH 3CCNA 3NUNA 5ICCA 1HOWA 4QP7A 4QPAA 2CH0A 2UW4A 2E9UA 2JK3A 1REJA 3FMSA 3TOAA 3FXLA 4J71A 3RHKA 9ANTA 2XIXA 3BPXA 4FEVA 2F9GA 3OV8A 4F70A 3TYKA 3E1SA 2EQRA 4IJ9A 4FKJA 3F7ZA 1WQ2A 4YJQA 2R3FA 5A4CA 3I5ZA 3RINA 4WKQA 5GAHJ 4AN9A 2MSYA 3PY3A 2OJGA 1JSUA 3Q0WA 1K83J 3CKXA 2HKXA 2VN9A 4WNOA 2WD1A 5DYMA 1BA5A 3D7ZA 3TZ8A 4BQNA 4P2KA 3HC7A 4CKJA 4CSWA 4FTIA 2VRXA 1OCTC 4OBPA 2HW6A 2EH3A 1YW2A 4NYEA 3HKZA 3TEDA 4QRCA 2XC7A 4YLJA 2DTZA 4EQUA 4FTTA 4AWIA 3NMUF 1FIAA 2QSGX 3VBXA 3NAYA 3ZXZA 2FVDA 4WXDA 1F5TA 3C4XA 2BDFA 4A7CA 4A3IJ 1A6IA 3HNGA 3H0DA 1FIPA 3EIDA 5A4QA 3L2VA 1V5GA 5IG1A 4C7TA 2B7AA 4U44A 1Y6BA 3F3WA 4CCJA 3I54A 2J5FA 2L7MP 3MQ0A 3ANQA 1U8RA 1EF4A 5HIEA 2I0VA 3QUPA 1XCBA 4RVTA 4R7IA 2X4FA 4ZDPA 2VU3A 2L02A 1SC7A 4CFUA 3QWJA 3POOA 3I5UA 3LFFA 1WZYA 3ZLWA 3TW7A 4BR3A 4HGEA 4FKOA 4C34A 2YIYA 3QUDA 3BYVA 2NVYJ 4C2TA 5KMOA 4ZZMA 4RJ4A 5IOYA 4QPQA 3QQAA 1URCA 3D83A 3UO4A 3ODZX 3HECA 3HHGA 5HE2A 3GGFA 2Y8OA 5D5WB 2DMPA 4BHCA 4BGHA 1IN6A 4APPA 5EW8A 4CFMA 4I98B 3R21A 1J7KA 4BNCA 4QTEA 4CT1A 3KYLA 4RRVA 4O6LA 3BBWA 3BQYA 3KRRA 5CI6A 2XIZA 1X3ZB 4C02A 1QGPA 2C3IB 2HNHA 4IB5A 3CMAI 2CUEA 2HQ5A 3BR6A 4HDVA 5CNNA 5BQTA 1GJOA 2L4AA 4DEHA 3RAWA 2OUMA 4IKFA 3CSVA 2G9XA 2QURA 2QLQA 1HXDA 5E1XA 2UWMA 5B66C 1K7AA 5T6KA 2KFDA 3FWQA 3UJGA 4EEVA 5IYBJ 4FL1A 3MW1A 4HSRA 3O7LD 5HCYA 2E9PA 5LHIA 4FSYA 4TYHB 1OCPA 2I40A 3IW8A 2IS6A 3IG7A 1FMKA 1VQLI 3PY1A 3GMEA 2NRYA 3CMMA 3DFGA 4BF2A 3QUEA 3D5RC 1OUYA 3ZTXA 2EBIA 1PXIA 4G9RA 5ETIA 3O8UA 2K86A 1K61A 4J95A 3DPKA 4IIRA 1BYGA 3E92A 4DHJA 2H6DA 1CSNA 2L7FP 3OCSA 2QQBA 2R3IA 4DYQA 5E7RA 1JPAA 4XYFA 5IZFA 3FHIA 3RCDA 2ERKA 3TNIA 2BKKA 3OOUA 1F36A 5F0FA 2VWXA 5HLIA 2CGVA 3VS7A 4FT0A 3FXKA 2NS8A 1SANA 4FKLA 5E79C 3MKWB 1KQ9A 2MGQA 1YQAA 4KUMA 1W4MA 4TL0A 3FC2A 4DTKA 3CDIA 3LMGA 2JDOA 2R7OA 5IQBA 3CQWA 3VSLA 3FDNA 3SQNA 4XLCA 4CLIA 3HTSB 4XV9A 4RB0A 3EYHA 2ESNA 5BYZA 5M4UA 2GQGA 3BE2A 2DODA 4UHTA 5DT0A 1H07A 4XLNF 2YX7A 1F5QA 2H27A 2GWRA 2XP2A 1Q99A 2C5NA 4M9SA 2DA5A 2ACJA 2VQHA 3UC4A 1RJBA 4FYNA 3HSEA 4D1QA 1QHGA 4PF4A 3IOKA 3G1LA 4EJUA 2KISA 5LMKC 2UZKA 5FM2A 1H00A 4K1BA 4YTIA 1UZCA 1UG0A 1SMTA 4M3FA 1BI3A 4I21A 3F2AA 2EVAA 4D9TA 3R2YA 4PTGA 4O5VA 2V79A 4FZ7A 3DZOA 2X9DA 4YC8A 4C4GA 3KZIC 1OGYA 4QQ5A 1MJBA 4F7ZA 1MBGA 2OIDA 3DKXA 3E8DA 4IXAA 4LGWA 4JDIA 4JL9A 3L8SA 2QBYA 3K7AJ 5DUKA 3JAMK 5F4NA 5H3QA 3FPQA 1XMXA 4FTUA 2DMNA 3QU6A 4G7HF 3GTOJ 4PDKA 4I5MA 4JQ8A 4TKSA 3PVWA 4RA4A 4CKRA 2WAEA 2DS1A 5CT7A 3F5UA 2GDOA 1IO2A 3RAIA 2CGXA 4MXAA 3JRCA 3A7JA 4FE2A 1K4TA 3CGFA 3SW7A 5HLHA 5ICEA 4XN3A 1OPJA 5JZNA 3UP7A 1KV1A 3L9LA 5B1BH 2XAFA 4ACHA 4FKSA 2A6HF 5CVUA 1OKWA 2BRBA 3NFGB 3NYVA 2N8GA 2D5VA 2VKDA 4GYIA 2QF7A 4KWPA 5M07A 5FLFA 4PDSA 2KULA 3CD6I 4HPTE 2W1IA 1DPUA 3P7AA 1S5LC 2QHNA 1I39A 4EQCA 3H30A 4BE1A 4UBAA 1RPWA 3NWSA 3WGGA 4OTDA 2E7WA 2UW0A 4CRLA 3EN4A 4PL4A 1WFCA 1IXRC 3BL9A 3ZQFA 4M9XA 1T39A 4Q48A 3BPRA 3IKVA 2X4ZA 4L5IA 3ZQHA 2BY2A 2NRAC 5JFXA 3LFAA 4A06A 4TWCA 4K11A 5L3DA 4FUXA 3GZNB 3E0JB 4ZLZA 1XCVA 4I0SA 3HL7A 3DXNA 1SFXA 2HENA 3ACKA 2I1MA 3U4WA 4PFPA 2K3FA 3DS6A 1WVWA 2OWBA 4BCIA 4IMYA 3LSKA 4EHZA 4GFMA 2HZ0A 3TUCA 4LOCA 2A69F 4IWDA 1APLC 3ZCOA 4DW6A 5ED4A 4NFNA 4PJJA 4O6EA 3H35A 4KB8A 3DBRB 4B48A 5ANJA 5CU3A 4AS0A 1L0OC 1O57A 4CXAA 4ZTLA 4JBPA 4R5YA 5J1RA 3C51A 2UUZA 4GT5A 4JMQA 2COBA 2C3LA 4DFBA 3ANRA 3RHXA 4XN0A 2Y0AA 3BV3A 4LLGF 1R4MB 1I44A 2YA9A 2LDUA 4CTCA 4FSUA 5M4CA 3PXFA 1AKHB 3QF9A 2HPMA 5BNJA 4U0IA 3D94A 5E18F 3TOBA 1J91A 4EMSA 4BDHA 3F3TA 5EDPA 1Z91A 4AZEA 5JFVA 2W25A 4YC6A 2C6KA 2IO6A 2R3LA 4FV6A 3J7ZI 5FLVA 4B3AA 4YP8A 2K9QA 3FMDA 2ITOA 2IZRA 3TI1A 4M84A 3WODF 5LVLA 2OXDA 3N4MA 3DBCA 4QP9A 1GV5A 5HS7A 3ZMUA 5FEQA 1BIAA 4ZDLA 3NX8A 4Z7HA 3PWDA 3RI1A 5EEHA 2WA0A 4CEGA 5ICFA 2EV6A 2VE8A 2W1HA 4YJSA 1SD6A 1M2PA 4RIYA 4DZPA 3AL0B 3S3NA 4I23A 1PXPA 5C1QB 5HNIX 3IV5A 4C3JJ 4WNPA 1E3HA 4XKVA 3OYAA 1WVYA 3A01B 1NHAA 1VZ0A 2B9SA 4HV6A 2M30A 2BALA 3O8TA 5IQDA 4XKCA 4BCKA 3OUNB 2P5LC 2HPIA 1H8FA 2WGJA 2FBHA 1JKSA 3BGZA 4X2NA 3UQGA 3MN2A 4XBUA 5CVGA 2AHQA 2CUZA 5KAFC 3LSHA 4MNUA 3GC0A 5JLXA 3G33A 1OB3A 2X6WA 4BZNA 1QPEA 1VR2A 2O5RA 4J1RA 3WTTC 2IGOA 5GP9A 3T5XA 2BR1A 2YR2A 5CY3A 4EOKA 5E1EA 2BW3A 3PJCA 3UC3A 5G1XA 3DLAA 2XF6A 4HCVA 4J96A 2W1GA 1WBOA 3B8RA 3OOPA 3GEZA 1Y0NA 1H25A 5EK7A 2F4OB 3D1NI 3TIYA 4EH6A 5HDGA 5AP4A 2RFNA 3DJ5A 3J80K 1IASA 2Z2SB 4UXLA 1KWPA 5A6NA 4R78A 5IA5A 3V5PA 4G3CA 5AIQA 3JRAA 1XSDA 3DTIA 2JJ7A 2A27A 3NRMA 5CF4A 3VYRB 1JGGA 2DYSH 1DI9A 3P5JC 1ZK8A 3AXWA 3R73A 1T2KA 4RC4A 1OQYA 5EOBA 4ITIA 4L0YB 4ZTMA 5EKNA 4IX7A 3QCYA 4G3DA 3DZQA 3E8CA 4RX5A 2C5VA 2X1CA 1PXOA 4QMTA 5FO5A 4BHPA 4BTJA 3CC2I 5DEYA 4XBFA 2BY1A 3D5SC 3WZUA 2L7ZA 1PXNA 1SD4A 2XK3A 2P3GX 2GNHA 3DOGA 4GFGA 2V1NA 4P55A 1TZLA 1H9TA 2WQEA 3I0OA 3NW5A 2JA7J 4HLXA 2WMUA 3JVRA 3KU2A 5GPAA 4I6HA 4BDBA 5C9CA 1OL5A 3S32A 3CCJI 4BBSJ 3UR3C 2C3JA 2J0MB 2CW7A 3R00A 3F69A 5AJQA 3VS5A 1OYIA 2LBFA 3PPJA 2ZKZA 3U51A 1B6CB 4RM2A 3C5UA 5EW3A 2R4GA 4GFBA 3R71A 4I02A 4HNFA 3C1DA 2XEYA 1ENHA 1ZN2A 5FRNA 3DLZA 5M57A 4UUSB 3LM5A 2HQNA 2QNJA 5DLSA 5EEAA 4M3QA 4W97A 2WTJA 4ZSAA 2BW3B 2QM3A 2WTVA 5TT7A 3QXPA 1JUMA 4CTBA 4RFYA 1T98A 4AYBA 4KIBA 2XK6A 4L46A 4U0YA 4BACA 4GT4A 3O8GA 1MH3A 4EGZA 4IDVA 2LP0A 4YFKF 2GAUA 2XAOA 2X2KA 3E63A 1J2XA 2CV0A 3F8BA 1J1BA 4AW0A 2CDZA 1D0ZA 3LFKA 1KZHA 4YNEA 3OY1A 1LNWA 2DA3A 3W6JB 1W98A 2NRUA 3MDYA 4E6QA 3NNXA 2MW8A 2Y0SA 2VT3A 1TQMA 2C6EA 4I01A 2W1DA 1W7PB 4BE2A 1WBSA 2A3SA 5I4NA 4YTCA 3O6BB 2XJ0A 5FM3A 5CI7A 4IB0A 2VTTA 3BG6A 3G9NA 2RL5A 1IUYA 3QQGA 1TNTA 3RWPA 4M3BA 2GNJA 3MVLA 2D45A 1CQTA 3W2SA 1SZMA 4A9TA 5EW9A 3QRJA 3PNTA 3KCKA 3MFTA 2R3NA 1W0UA 5CWZA 2P33A 4BCGA 2PMUA 3VEPA 4CG9A 5H8GA 1K78A 2UW8A 4QP3A 3WGHA 2GA1A 1QVUA 3TDWA 4QDVA 3DK7A 3GOKA 3CLYA 1UB9A 5ICGA 4BVUA 4FIJA 4FTMA 2PVLA 5KVRA 3IWZA 1D5VA 3KYCB 4HZFA 4N4NB 3UNKA 1JKTA 4RJ6A 3VB2A 3HYIA 2IVVA 4O7YA 4HLYA 5AIKA 4DEEA 3M8FA 4XR6A 3OYDA 2AC3A 2PMHA 3NZ0A 2ETHA 2WMXA 5E8VA 2QGUA 1YOJA 5F27A 1VYZA 1QL6A 4CSVA 5IA4A 3QX4A 4I20A 3PXRA 4QMLA 1PW2A 3FBVA 4PK4A 5LD2C 4CKIA 5HTBA 3EQIA 2PMNX 4V2GA 4PP7A 3PP0A 2HOSA 2OZOA 3UODA 4EJTA 2RAEA 2FF4A 4YMJA 2JKQA 3UDTA 2CUJA 3UZRA 4LOQA 4WBBB 4ZTSA 2OJ9A 3VJNA 3ENMA 4XUFA 1EH8A 1FEXA 4A3LJ 1YIOA 2DDAA 4D0XA 3C7QA 4RIWA 1ITYA 4X0GA 3TBIA 4CFNA 3AD6A 2FNPA 2BILB 4JVGA 4U3ZA 4NFMA 2UW9A 4XLEA 4ABZA 4G5PA 4ZMEA 3IH4A 1GZ8A 1R00A 1IG7A 2QKWB 3GU4A 4WD5A 3FMLA 2VX1A 4MQ1A 3CQUA 4ZYGA 4WWCA 2EWNA 2OU2A 3LLAA 3L9MA 2FOKA 5GIOE 3WIGA 3CQEA 4PMSA 1ZMUA 4KSPA 4EM2A 3LQRA 1FZPB 2PZPA 4O7VA 4RFMA 5B1AH 4NCTA 2Y0MA 4ZH4F 2OSCA 4QMWA 3R22A 1R1VA 4WUNA 1K9AA 4D1XA 4MQ9F 3HV7A 3BCAA 1QPIA 4P9UA 4MVFA 3G1MA 2NXNB 2NNNA 3KRWA 1MSEC 5J8IA 5BUIA 3DEEA 2B63J 1GXPA 1ZHFA 2ETMA 3P5JA 4DGWB 3BU6A 2W48A 3R2BA 2JIUA 5L8LA 4M3GA 5HLGA 3W32A 2B1PA 3HOZJ 4U45A 2EB3A 3TXOA 4FETA 4XRSG 4QMVA 4L0ZB 1U0JA 5BOXA 3MH2A 3W2QA 4NTSA 1TL8A 2IN6A 5IY5H 1Z1DA 2FQ3A 3KEOA 4FIEA 2QQAA 3F72A 3JUHA 4OTRA 3KA0A 3LFEA 5BX0A 4ENJA 2OJIA 3W2WA 5CPRB 3I7BA 5BPYA 1H1PA 2P2HA 2E2IJ 5DWRA 3WZJA 2HDCA 4YHTA 2HOGA 2RGVA 3LQ3A 3I3LA 2O3PA 4ANMA 3VS4A 4I6LA 5C4XJ 2YM7A 2G2IA 3HSRA 2M7AA 1QVTA 1P2AA 3EQBA 3U8WA 4S04A 2Y7JA 3V7RA 3COKA 4PL5A 3LPBA 3EN5A 4AACA 3UZPA 5IH5A 5AONA 3KLNA 4Q4ZF 1IRZA 5CJ9A 2UZWE 4UN0C 2I5UA 2XK9A 3BCEA 4YJOA 3BZ3A 4CH7A 4WG3A 2WMRA 4E5WA 1J0RA 4ERKA 4C61A 3UYSA 4EYMA 5HQ0A 4M14A 4YO4A 2R7WA 4F1MA 4II2A 3NLBA 3QOPA 4CZUA 1MRYA 2XGDA 4ZYHA 2E2JJ 1ZMWA 4FE7A 1B1BA 3ABKH 4O91A 4TYGA 2YDJA 1ODDA 2JA5J 4ZTHA 3CGOA 3MA6A 2LH9A 3KP4A 3W0PA 1S29A 3UOLA 2H1LA 2YUSA 5H20A 2R7DA 3BG5A 3FM5A 3PIPF 2I10A 2RREA 2ETKA 2WPAA 3FQSA 3FI3A 3AAFA 2WMSA 5EZHA 5KO1A 5HG7A 1Q8TA 3L2WA 2R7TA 4R1YA 1KYWA 2E1MC 1JAMA 2YFXA 3R7OA 3LFDA 4A4XA 4EGYA 4JOMA 1TNSA 1M52A 4RG0A 2B52A 4F64A 3E3VA 1W36C 2R7BA 4FQGA 5AUXA 4PX6A 4I4FA 3F8MA 1YKRA 4D5CA 2PL0A 3K69A 3VWBA 2L3DA 3EQCA 3IONA 4FSQA 3R0JA 4M0YA 2CLQA 4CCBA 1NT2A 3UO5A 3V5JA 3CS9A 2LYCA 3NVMB 4JBVA 1SAUA 4BCOA 1ZR2A 4IAFA 1Z6TA 5FD5A 1IDYA 4O0UA 1EH7A 5TOZA 4YJVA 2V6CA 4BXFA 3NRVA 1ZH5A 2FE3A 2BFXA 2XJ2A 1KE6A 5ETCA 4CRSA 1Y8GA 3RZOJ 2V7FA 2XKFA 3T0YA 1W7PA 3Q3SA 3FF5A 4ITVA 4WNKA 2DJNA 2LKSA 4MUQA 5DCFA 4ZIMA 1M14A 4R5SA 5D6FA 2UZNA 2Y4IC 3QRTA 4EK4A 3ULQB 3JRGA 4EH7A 3I71A 2LD5A 2J90A 5GIPE 2GTNA 1S8NA 4FSTA 3J7AY 4JBOA 5FBOA 3HM5A 3QTRA 5DD4A 1PRYA 2IW5A 3GC9A 4G6DA 3LMMA 3EQDA 4CA0A 4EV0A 2C0OA 3RKBA 4WUAA 5TKDA 4DBNA 3QBNA 3Q9WA 3CCEI 3VBQA 1XWSA 3BWFA 2QOOA 1IRGA 4JX4A 4OW8A 1ZGAA 3BV2A 5HD4A 3UQCA 2GQRA 3OS0A 2BKZA 3C4EA 4R77A 3EFJA 4YIFA 3FZSA 4P5QA 1VQ5I 3P08A 3RPQA 4CV9A 3H10A 4YJUA 1R6RA 4DGNA 3F8FA 3VW8A 5AUWA 2VODA 3SEZA 1I3AA 1K3AA 3OWPA 4PJLA 2B0LA 3GTQJ 4EH5A 2XHKA 4LG4A 2ADUA 2C6MA 2XRWA 1Y91A 1JHFA 3EYYA 2GQSA 1MMSA 2OLCA 4OTGA 2CQ7A 2PHKA 4TYJA 2PU8A 3OY3A 2KIMA 3B6AA 3PUPA 2ZFWA 1R22A 2W1FA 3GLXA 3IPHA 3OYLA 5JEBA 3H9JA 4WSYA 5IYCJ 2PG4A 2F7ZE 3TGNA 3RK5A 1OCRH 2CSNA 4ZZOA 3KF4A 3I60A 5CSPA 4BDGA 1SYKA 4KA4A 4QTCA 3CDLA 3K2AA 4W8DA 5LCJA 1M2RA 5KHWA 2JFLA 4EONA 1LQ1A 3BLHA 4XNEA 2WMVA 1X1BA 3D14A 2J0KA 3DJ6A 1WGXA 3GBGA 3DU5A 2PUNA 1GAGA 2UVXA 1YOVB 1XGOA 4O0WA 5HDKA 5BMZA 4NM5A 4Y73A 3HMPA 3K5UA 1GLNA 3OR1C 3W2CA 4G16A 4DDIA 5AP2A 2XGCA 5DCMB 1SMYF 3BR3A 4AC0A 2STTA 4DHIB 4YPSA 3DY7A 1NK2P 3UTOA 2ZC2A 2L9RA 2ZDTA 3NS9A 2JT1A 1H01A 5BMSA 2OJJA 3BJ6A 2R3KA 4OT5A 4BDZA 2ITTA 3SG9A 2Y0SN 2P55A 1Y56A 1JSTA 2JRTA 2PVFA 3L09A 4CCNA 4BCNA 3NNWA 1IRXA 4NU1A 2WTDA 4IEBA 3HRSA 3HKOA 4F52A 1B8IB 3QTZA 2E2BA 4UYNA 2XH5A 1I50J 5DR2A 3UPZA 2BRNA 2VWWA 2MA3A 4I5HA 4AU7A 4A4OA 5EYDA 4EOIA 4FTQA 3CESA 2VONA 3MFKA 4USDA 3HDDA 3RKQA 5LVMA 4IAZA 3S15J 2ME6A 3EH9A 2FRHA 1HW1A 4GK3A 3UVQA 3D2KA 4I5CA 5F04A 4RX9A 2J50A 1B8IA 4BEHB 3A03A 2ZJPF 3C5IA 1IEPA 5KKRB 4D1SA 3DT1A 5IA2A 4U0VA 3QZHA 1XH6A 3FZRA 1VQKI 4TTHB 3N9XA 4WT6A 4KBCA 3E3BX 1UNHA 1X2NA 1WHUA 4E6KG 2YITA 4TWOA 2CCIA 3M07A 3U55A 3PJ1A 1JE8A 4A0ZA 2HEOA 2C5OA 1O3RA 1AD5A 2C30A 3BJAA 3PXKA 3FK6A 4YHJA 2XRNA 5LCKA 2V6EA 5ANKA 3A62A 3B8QA 2X81A 2GBYA 2FBIA 4F9AA 3C4CA 2W0JA 2VO3A 1ETXA 3I53A 4JAIA 3F5PA 3VC4A 5AV0A 4AXEA 3H5RA 3DU8A 1WJCA 3NAXA 2QG5A 1JWHA 4M9ZA 3V8SA 2HS5A 4AP7A 1SVOA 4MTEA 4EH2A 4DCAA 3HGKA 1GXQA 5HESA 4H3QA 3HRBA 4GRBA 4BTMA 2Z5UA 4TNDA 3ZQGA 1RW8A 4QMMA 2V7AA 2WMWA 4HNVA 2WY8Q 4FT7A 2EWAA 4XLVA 3G73A 1Q61A 3SHEA 3GT8A 3GFWA 3EQGA 3LWFA 3MH0A 3KLOA 2R7IA 1R23A 2X6DA 1VYWA 4I7HA 2ZJRF 3EUAA 4F3QA 1QNTA 1Y6AA 2G7UA 3ITZA 5FG8A 1TW2A 3RTPA 3BBTB 5CXZA 1H1QA 3BYOA 3CQZJ 2WO6A 3MB7A 4AAAA 4IZ7A 3KMWA 5CAUA 2RDPA 2QOCA 4M67A 4E4XA 4QSHA 3H3VK 4HPUE 1RETA 3G4SI 3GB2A 3FKLA 5DPVA 5E8YA 4RVMA 1G3YA 4AOTA 2EIKH 1E9HA 5LVOA 2YERA 3P7BA 4BDFA 2BOLA 3PIXA 2QOQA 2DOEA 3ULZA 4JX6A 4YPDA 2X4HA 1MNDA 3P7NA 1USTA 2E7XA 1B72B 1BC8C 3I55I 3DLSA 2X2LA 4FEQA 4C58A 5CQGA 1W5TA 4IM2A 1FP1D 1IUFA 1KU2A 4JP0A 3E6CC 4O38A 2VC1A 2R0QC 2I6LA 3TACA 1N75A 3UIUA 4OGRA 2CN8A 4IBMA 4G2FA 2CNUA 4NK9A 4DHZA 3O96A 2PMZA 1PF8A 2XB7A 4YZMA 4AU8A 4GU6A 4W8EA 2YABA 1T8IA 1JT0A 4U79A 2DJIA 4D9UA 4L44A 3ONQA 3AT4A 4ASNA 4C62A 2IZTA 1T46A 3RTRA 4XRLA 4LGGA 1G8JA 4NC6A 4YZ9A 4X2KA 4A3JJ 2CKOA 2W1OA 5D6EA 4BZOA 3GTGJ 2W7XA 1OKYA 2DFHA 1YITI 1PXKA 4ZSEA 3NUPA 4E1ZA 2G0EA 3BTIA 4YHFA 4L43A 1ZGWA 4F93B 3RKYA 2QONA 3FLYA 3WZEA 3E5XA 1H0WA 5M44A 4QMPA 3BYSA 5B2LA 4FR4A 5E8ZA 1UCRA 3W0QA 5CVIA 2HU9A 3BTLA 3CCMI 3ZRMA 5HS8A 4C9YA 1IA8A 2DYRH 3JR1A 3VBVA 3TN8A 2OXYA 4ZZLA 4JX5A 3KGAA