3PFYA

The catalytic domain of human otud5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
129
Chain Sequence
MDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU domain-containing protein 5
publication title The catalytic domain of human OTUD5
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 129
sequence length 146
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pfyA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pfyA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
5IT9Z 4V19K 4EJWA 1SVGA 4PFOA 4U8ZA 3NFFB 3WTYC 3ZQFA 3MMYB 5JGDA 3DKCA 1SVOA 4BQNA 3ZSGA 3W16A 5DM6F 3CUQC 3RYPA 4A3BJ 2P3GX 5J8CA 4UUSA 4L18B 3LFKA 1U6GA 3FXUA 3FKLA 1O3TA 1M17A 1MJ9A 1GOLA 2HOSA 4LLNA 4YHJA 5JZJA 1WI9A 2HI3A 2RDPA 1KUTA 4JI9A 4GGGA 1WJDA 3ATTA 4CGAA 1QU3A 1K4TA 4DEBA 2XK3A 1IR3A 3EQIA 2YZLA 4PMSA 5GAEJ 1SVLA 4XKCA 3JRFA 2OZOA 4I0BA 1H0WA 2KRFA 1ZH5A 4UY8I 2KIQA 4CFNA 1T46A 2YM5A 4CO8A 3DNDA 2RL5A 4BDFA 1SAXA 3QZIA 2VTIA 4HYUA 5HEZA 3GCSA 2HQRA 4G6NA 3UODA 4HCVA 5JHUA 1Y6AA 3RAIA 5EHLA 4GFBA 3TO9A 4JX5A 4RLFA 3QTIA 2K86A 1Q24A 2DDBA 1SC7A 5CX9A 3BU6A 3DA6A 2KT0A 1A06A 3M2WA 2B52A 4IZ7A 2I0VA 3I55I 4CG9A 2O6GE 3PFYA 4C0TA 1KWPA 3M7GA 3BKBA 5ERIA 2YIWA 2DA3A 4XV3A 3R8UA 1OQYA 4DFZE 3FF5A 3EFKA 1Q99A 2WA0A 4PCQA 1YOJA 4M69B 1N75A 3DQWA 4NYEA 3U54A 3S2DJ 3QKLA 4ORKA 4L52A 3NNVA 4XG9A 4J19A 2D5VA 4ZSGA 3NAXA 4O7SA 1Y39A 2HXIA 3ULIA 1D3YA 5EGOB 2BOLA 4AXAA 2A4LA 3VW8A 2MFZA 5TGTA 2ZMEC 4A5NA 2XV4S 4AZSA 2LK2A 1TQPA 5ICPA 1Z7UA 3OOMA 3EHAA 5FGMA 3HP5A 4ZDLA 2R7OA 2DAOA 3DY7A 4NNJA 3DDPA 1YJWI 4IAYA 3R9RA 5DRDA 2XDVA 5LMAA 1X3UA 2O5RA 1O7FA 2G01A 3UDZA 2DA2A 4CSVA 2LOOA 4FTNA 4FQGA 1BW5A 4XIDA 1MMSA 4U44A 2ZM3A 2VOPA 2O8YA 3O7LB 3FXQA 2E5ZA 5DT0A 3P86A 3B2WA 3UTOA 5AV4A 2VONA 3IHUA 3H92A 1UWHA 3RAHA 4AVZA 1WSUA 4GO1A 4DF3A 3MI9A 2BKKA 3A61A 4CCNA 4ENXA 2FH9A 2UZOA 5FM3A 4BUPA 5FDPA 5HDGA 2PX9A 4DYMA 3ORPA 4DEHA 3RKYA 1B9MA 5DYJA 5CU0A 1X2NA 3SDBA 5M5XJ 1UFMA 3TNQB 3TMOA 3U1KA 2C6LA 3J81Z 4LG4A 1NVRA 2XK9A 3QU6A 3WTTC 2X2LA 3ASOH 5IG1A 1GZ8A 2VTHA 3I81A 1E3HA 2VPRA 2EFWA 4R7BA 1U2WA 3IDBA 3V8SA 1BX6A 3FQSA 3VAPA 1U3EM 3DJ5A 3SX9A 3MWMA 1QHGA 3G5DA 2XRNA 1KGSA 1XH6A 4Q5SF 2DFIA 3VNTA 4TKSA 1ON1A 4OIRF 3ML1A 4FKJA 2X39A 3OW3A 2A05A 1WBVA 5JSMA 2HY81 3I5ZA 2VGOA 3BQRA 2WAQA 1H9TA 4MIMA 2CSNA 2I40A 4CKRA 4O0WA 1BN5A 1IUFA 2STWA 4KDPA 2PZYA 3QP5A 4FTUA 4C33A 5EHOA 3TW6A 4CZCA 4AACA 3QQKA 3P1AA 5J40A 3UG2A 3BGZA 2R7XA 1YLFA 4I6HA 2P0WA 1W36D 4BCQA 4BIDA 4XOYA 4AN2A 4BTKA 3R04A 3EUAA 4CHUA 4UHTA 4NFNA 1H88C 4AS0A 2FUG2 1XS9A 4XX9A 3V6RA 1YIOA 1QL6A 1W84A 3LAPA 2QVSE 2NNNA 4FTKA 2JN6A 2Q0NA 3NQOA 2J4ZA 1M52A 4FTAA 4I02A 3JRAA 1OUYA 1LKXA 3V7SA 1MIJA 3HZJA 3MA6A 3H9QA 2DMUA 2FX0A 2ACJA 2FSMX 4A6DA 2I1MA 4MD8E 3OIPA 2GXGA 1BIAA 1IN7A 3K6GA 4BHBA 4L9NA 2GIZA 1XX5A 4IZZA 4PGHA 5IMXA 2YAKA 3TZ7A 4LK0F 3MKYB 1YXTA 5IQCA 1W7PB 2XM9A 2QOLA 3H5NA 5E8IA 3RQ4A 3PYYA 3W2AA 2K9NA 1PKGA 3S14J 5LRSA 2JIVA 4A3GJ 4O7WA 5HG8A 1PP8F 3UMXA 3AQVA 2DU9A 2XAGA 2VWZA 3E6MA 4IVAA 1S72I 4MBJA 2R5YA 2IGNA 3AOXA 2K9QA 2WAFA 1XDSA 3GLLA 2DXIA 3QOPA 1OCZH 1IZ1A 2HDDA 5DRBA 3F8MA 1DI8A 3R4KA 3HRTA 4PL4A 2OO8X 4A3IJ 1GAGA 4C2VA 4DH7A 3JAMK 4ASXA 3H3ZA 4WT6A 3WYXA 2O0UA 3NUPA 3B8QA 2WU6A 1ZLTA 1A6QA 3HP2A 5M08A 2KPMA 4YZDA 3C0HA 3TZ8A 1WPKA 4U41A 4HV5A 3TDVA 4EV0A 3R8PA 3UGCA 3DAEA 2XJ2A 4J8NA 1Q97A 4C3HJ 4BIBA 1TWCJ 1KOAA 3BJ6A 3MZHA 2CSOA 4FTLA 4ZMFA 4QQTA 2W99B 3SXYA 4YTFA 5KMNA 2RC4A 3IRQA 5AONA 2CGWA 2ZXWH 4QMZA 3M07A 2C6YA 3QCXA 4GSBA 2OPTA 3BC8A 3QD4A 1YOLA 3L00A 3R7IA 4XJ0A 1K4SA 1XH7A 3ZONA 2P5LC 3DBLB 3FLWA 3PVWA 3V8JA 4D1SA 2W1OA 5CEMA 3KVWA 4HZFA 3QX2A 1YYVA 2WTEA 4WNOA 4MF1A 4HDUA 5LOHA 2G2IA 1QVUA 3ZXTA 4F52A 3D9VA 1LDKB 1HW2A 4U7BA 4F1OA 3WE8A 1XMAA 2WO6A 2VPLA 5CEIA 5LMKC 4AZFA 2OF7A 5EYCA 4CYDA 3KA0A 5JKGA 2VE8A 2L02A 2UZEA 4C58A 5A4TA 4FK6A 3O3KA 3QF9A 4XMOA 1V54H 4G9YA 1UNHA 2AEGA 5IF1A 3WBLA 4EM0B 2GNLA 4BCGA 4RAZA 3DFGA 1MW7A 3R1QA 3HSFA 1UMQA 4BDJA 3COKA 1W5TA 3LSJA 1HCRA 3A0HC 3G4SI 1GIJA 1Q3DA 3ENMA 4IWOA 4TL0A 2NP8A 2Q0BA 2WTJA 2OGVA 3SLSA 3R00A 1ZOHA 4FSRA 5HIEA 3D0EA 4BY7J 3OY3A 5AP3A 2IBDA 2EB2A 2QVOA 4LOQA 3ALOA 1HXDA 3CZ6A 2P81A 5FTQA 2PQ8A 5C01A 4O82A 3WGGA 1BL7A 1PMVA 3ULZA 3GP0A 2I7QA 3AG2H 4CTBA 3BPXA 4HW7A 4GK2A 4KS8A 3IDPA 2HZDA 5AEPA 4N0SA 2D1HA 4ANQA 3CPBA 3QQAA 1LUFA 3QZFA 5E18F 1ZY5A 5JRQA 2K5CA 4AFEA 3ORMA 5AIRA 2VC0A 2VNWA 1IJWC 4QMSA 5CU6A 5G1XA 3UYSA 5HE3A 2HR3A 1STZA 4MD7E 4G3DA 3JRIA 3FM5A 4EK6A 3GC9A 2GQSA 2E7XA 2PVLA 3I71A 1TZLA 1IXSB 2FA2A 5BX0A 4H4KC 4OU0A 2V55A 2BAQA 2YHVA 2OBJA 4PFPA 3LAUA 3Q52A 3UKGA 4ACHA 1U5QA 3IC7A 4E8AA 3HZTA 4C62A 1MBKA 3FKJA 1LPUA 3WE4A 5B2KA 1USTA 1WAKA 3ZRGA 4D0WA 4ZJIA 3DPTA 3H1CA 4CCMA 3D2KA 4BJ6C 3HMNA 3QGYA 1JUPA 3QU0A 4NK9A 3LCKA 3B8RA 5BPIA 2W1ZA 5H8BA 4KICA 2IA2A 1HKTA 3BCBA 2HOEA 3PIOF 3K4LA 2BXYA 4C38A 4G6OA 3LSGA 1PMEA 2CQ7A 3QQHA 3FL4A 3R21A 4BCIA 4IJAA 1XCBA 3SC1A 3MZYA 2NS7A 1LUJB 4ITVA 3OSGA 4ESFA 2HTSA 4RWLA 4J99A 3EUHC 4BTJA 2BIYA 3MAJA 3D5RC 4IB1A 2JKKA 3DCFA 5E1EA 4KS7A 3TDWA 4DINA 2MGQA 4KABA 4M7IA 4C35A 1JHHA 1XTAA 4OIPF 1ITYA 2AC3A 4OTWA 2FOKA 3ZYAA 1FPQA 2M4KA 2H9VA 1MMNA 2C3JA 3AT2A 3H3CA 3U2RA 2OXDA 4A9UA 1E1VA 1XBCA 4XG2A 4DH3A 5K4JA 4P7EA 1CDKA 1TC3C 2PVRA 5IQIA 3ODYX 2L5QA 5BVEA 1IN4A 2O2UA 2OF4A 3I4NJ 4IANA 4E26A 2EB3A 2W7XA 1CKIA 5A6OA 2ACXA 1VI0A 1WVRA 3MFSA 3IS5A 3QFVA 5EYKA 1OPCA 1RIOH 3IO7A 4EOKA 1DPRA 1YDSE 2O03A 4L42A 1M14A 2YISA 3S3IA 2JLDA 1SD4A 2C68A 5IA2A 1CQTA 5KKRC 2MYSA 4XEYA 2JDOA 4UWBA 3UC3A 5JQ8A 2F5EA 1F5QA 4AYBA 2W96B 4RIXB 4FKPA 5L3GA 4M3EA 1VZ0A 3VUHA 5AUZA 3ZXZA 4G7HF 2RG5A 5HTCA 2YM4A 2XPWA 3RI4A 4ANBA 4CFUA 5DR6A 2DA7A 1L3LA 1B8IA 3AG1H 1FP1D 3HJEA 2MH9A 2NVYJ 2VX0A 3EQLF 4DDGA 3P7AA 2F7ZE 1BA5A 3NYXA 4F6WA 1QQIA 1QNTA 2UW5A 3DU8A 2X85A 4CMUA 2WTKB 3TDZC 5M51A 2FJ1A 4BN1A 1IA8A 2E2BA 3LSPA 3TKUA 2DTZA 3BLRA 4U0IA 2XHKA 4CSWA 4IVCA 2YM6A 3DV8A 3OWKA 4CFWA 1Y8QB 1O4XA 3DOGA 2R5ZA 4BI1A 4USDA 1NG6A 1TWFJ 2A5YB 4F65A 3SYTA 3GYHX 2RFNA 3WE3A 1TVOA 3DGKA 1WWXA 3JREA 3VSLA 3J7AO 4FEWA 2GNFA 4L00A 4B0GA 3OG7A 4G31A 4NCTA 3P78A 5GJDA 4FG9A 1EH7A 2M7AA 2MD0A 2PE1A 4K2RA 1RUNA 3U6HA 3MA3A 2O0YA 1PKDA 5LMBA 4PSXA 1YDRE 3OYEA 1K79A 3BOQA 3DFCB 5FXQA 3F22A 1KE7A 1ZR2A 3J80Z 3PXFA 3WODF 2QU5A 2XANA 2VWUA 5FRIA 1AD5A 4G9CA 4WSYA 2JIIA 1N77A 3VWBA 2BRGA 5CU2A 1IG7A 3TKHA 3FJQE 2CDZA 1YW9A 3PIZA 1YG2A 1I1SA 4QMPA 3ATSA 4F78A 3MEXA 3F23A 1O3RA 2RNGA 1U78A 3DU5A 1WJAA 4FV9A 4R8HA 3A01A 1R5GA 4LRMA 4FASD 4IEJA 5IH6A 3VRYA 1M7NA 2DMQA 2IW6A 4A3EJ 3C7JA 3ORLA 1ZN2A 2BALA 3LVPA 3FZSA 4K6ZA 1NK2P 5EYRA 3K1PA 3N9XA 4ZLOA 3PFIA 3NW7A 2RNJA 5HCYA 2MSYA 3VS4A 4HLYA 4EWQA 4MLOA 3DKGA 2GQGA 2LY2A 3HHGA 1IV6A 4OT5A 4IAZA 3ZMZA 4E4HA 2QQBA 1PXKA 1YI4A 3RTRA 3KXGA 2P7CB 1SMHA 5KMOA 4D7MA 2W1CA 2QODA 3VBVA 1BR2A 3E3VA 5H8EA 3KXZA 2AO9A 4PTGA 1FYMA 2X7FA 4MX9A 2XNGA 3R0TA 3C4FA 5JI6A 2KHMA 2M3AA 1A35A 4M6YA 4LYNA 5CU4A 4R1VA 1D1AA 3P23A 4QYYA 3IKAA 1YOVB 4Y15A 5HLNA 1OIQA 2I10A 4XG8A 3DB8A 3AC5A 3OROA 1E3OC 1UG2A 1JKQC 1HDDC 2LSOA 4UNOA 4C36A 1OCTC 4TYHB 3MW1A 3K69A 3DQVC 3I7CA 3E3PA 3BV3A 5A6NA 3HOUJ 2WHBA 3UNZA 1UHMA 2F7XE 2YCSA 3LSKA 3DK7A 4FV8A 5EJCA 1HSJA 5FLXZ 5EDQA 2M8EA 3NX8A 1JKSA 4G5PA 4CG8A 1R5HA 3HUCA 1H00A 5M56A 2L0KA 5AIKA 5ANIA 4G8XA 1R58A 1OCPA 3VN9A 2QF7A 2J51A 3B6AA 2CV0A 1G8JA 4O0XA 3NAYA 3CGOA 3O8GA 2X1DA 3GQIA 2WMRA 3UQCA 3HTSB 5K5QA 1ZG1A 4EL9A 2C0OA 3I64A 4L3PA 5KVRA 2WD1A 3QRIA 4YFNF 1XH4A 3OWTA 3V7CA 1Y57A 3NVMB 4G6QA 4QDVA 4M0YA 3HSRA 2ELHA 5J8FA 5CPRB 1FT9A 3SA0A 4YTHA 2F4MB 2P2IA 1ERKA 4BJJB 3MYGA 2CGUA 4EH8A 1MMAA 5IQGA 1TWAJ 1E1XA 3FV8A 3MJ1A 3LFSA 4L43A 2OZAB 2IJLA 1E3PA 4XSZF 4AVPA 2OXYA 4YPDA 2COMA 1HOWA 4IPAA 4DLJA 2W4SA 5ANJA 3S0OA 3NFGB 3EOCA 2YIXA 4I0TA 3KRRA 3E6DA 2L9VA 1BLXA 3OP5A 2W25A 5CEQA 2P2HA 3ZUVA 3FMJA 3ZSHA 4HBLA 1WVXA 4AD9A 2ZC2A 3EPZA 3PJ1A 3KCKA 4WK8F 2CUJA 2PWLA 2PU8A 4ZC3A 1FY7A 3PPJA 5A2QK 4DYRA 3KX2A 2W17A 4TY1A 3WOWA 4R6VA 2Z60A 3BQYA 4C4FA 3HRUA 3WYYA 4ZJJA 5FLVA 3C5UA 3DJ7A 1YI6A 2ZKZA 2R7RA 3ZBFA 2BTRA 3W6KB 4BU2A 3BJOA 3FHIA 1T95A 4DOZA 2XJ0A 3HB9A 1JVPP 2J50A 3W6JB 5D8KB 1HLVA 3AC4A 5KAFC 4F6UA 1OL2A 3TG1A 2B4SB 3FWEA 2JSCA 4K0YA 1FSEA 3BE9A 3RVGA 3P5KA 4M71A 4L01A 3GBZA 4FE4A 4XUFA 1M2RA 5J87A 5C03A 3WU0A 2XNMA 3SEQA 1B6AA 5KMMA 4LG0B 3ZTXA 2UZUE 3MVJA 3NYVA 3WU1B 4IDTA 5ILVA 1X4OA 2HKOA 4UV8A 3QALE 4J1RA 1RC9A 3AL0B 4O0YA 1MNEA 1VQ4I 4JRVA 1R22A 3O71A 3VVHA 2MA3A 3EQGA 4GRIA 1VQPI 1ZYDA 4JX6A 2E9VA 3MJ2A 4C30A 4PJNA 4GT4A 5F27A 3ZR8X 4OLIA 2YJRA 4MAOA 4A93J 4O7TA 5I9ZA 2HIWA 2BTSA 4GFGA 2XIKA 4XG6A 3C4XA 1DS5A 3FISA 4XV2A 4TPTA 2KFDA 3R1SA 3E3BX 5J4VA 3L9FA 4WNPA 1GVJA 3FY0A 3N4VA 2CJJA 2WTIA 4PMMA 1HW5A 3OXZA 3K10A 3E5UA 3BL7A 2JTVA 5FJ8J 4FKOA 3FLYA 3I4PA 4DN5A 1AA7A 1J7KA 1MSEC 2FO0A 2LY9A 1IAHA 3QAME 2Z7RA 4XRMA 1Q3WA 5CS6A 2HCKA 3H0ZA 1PXOA 2GNHA 3CBLA 3LCDA 3DLAA 1Q61A 5AP7A 1RKWA 5HLIA 3KP6A 3BHUA 3ROUA 1NG7A 1PVEA 3KULB 4MXZA 4FYOA 2XVCA 3L7WA 4RB1A 1S3JA 3GVAA 4OIOF 2VNYA 4BYIA 1B72B 4F0GA 5CAPA 4WXDA 3PP0A 4R7IA 5T6KA 3LMGA 4IHVA 3U87A 3COHA 5EDRA 3K4NA 4AT4A 1Y8YA 4QYGA 3ZU7A 4JRNA 5IOYA 2H8WA 3MH3A 2ADUA 3FM3A 5LGTA 4O7NA 4II5A 3NLBA 4B43A 3FZVA 1XB4A 2O8XA 2YDIA 3QBNA 3NGAA 1PXJA 5GADJ 3S4QA 4HQMA 3V8WA 1I50J 3L8PA 1OJLA 4LLLA 3BCEA 4I5MA 3LQQA 4RVLA 4BXFA 3PIXA 1B38A 5BUEA 1URWA 2CNVA 4BGQA 4N70A 3M1SA 3JSPA 4RVMA 4AGDA 2R7DA 2XS0A 4DT9A 4MXOA 3UZTA 2GPHA 2XNPA 5J5SA 2WIHA 4AF3A 2QOKA 5HIDA 2YM3A 5EDNA 2FSLX 2XGEA 3LJ0A 3AG3H 4D1XA 1F9NA 2PJRA 2QKRA 1I1GA 4MXCA 3VJOA 1ZZ2A 4XLFA 5IU2A 2BPMA 3BHTA 3E63A 4M73A 2IWIA 4FKGA 3P08A 4BCHA 3CQUA 4DAWA 4WBOA 4UXQA 5KAIC 3UG1A 2JUCA 4J98A 3KCFA 3ZLYA 2EZIA 1VQOI 2Z7SA 5LD2C 2X2KA 4NQWB 2NNWB 3EIDA 4TNDA 3HSEA 3E8DA 1R1TA 1XWSA 3NSZA 4DNCA 4HG2A 4FTHA 4AOJA 3Q9ZA 4X6RA 5EW8A 3S3OA 2ZV7A 4WWCA 2JDSA 4CXFA 1YHQI 2ITNA 2PMLX 3CCYA 3UZRA 3MCZA 3BZ6A 2XB7A 4FE2A 3BYOA 3KXXA 4NWMA 3CCRI 4UZHA 3II5A 2XF5A 2N8GA 2PI0A 3LFEA 2Y0SN 2M5WA 1B9NA 1SNXA 3S32A 2RV8A 3VYTB 2FMYA 5L2WA 3HV7A 2A6EF 2NS0A 1Q8WA 1FMOE 1WJFA 2QOQA 4AXFA 3IWFA 5M57A 2RG6A 3DCVA 1ZYSA 4RC4A 1R3CA 2Z2SB 2ETRA 3TZMA 1XGNA 5AA9A 3UQFA 4DCAA 5L6PA 1JE8A 4ITIA 2HFHA 5HO7A 2Y4IC 2A0CX 4HF2A 3BR0A 3HLLA 3HRMA 2W1HA 1TTYA 4OW8A 4QWQA 3OCBA 1I27A 4CCLA 3GCUA 5FTGA 3A7IA 3R83A 4G12A 5IT9K 2VQCA 4F7ZA 3H36A 3IQ7A 5GP9A 3ROCA 4C4EA 4AOTA 3GXOA 1DAYA 1WBOA 3CUOA 3HRFA 3EDPA 4KJZA 3R6SA 4D9JA 3GX4X 3NW6A 3NVKI 1AWCA 3QCYA 3K4MA 1MDMA 2KLOA 1MJAA 1OITA 4IW0A 4H39A 3Q5ZA 1Q41A 5IEVA 1H0MA 4UY9A 4DTKA 2W9ZB 4CLIA 4CZTA 3BBWA 2CGPA 4QT1A 3BG3A 5FD2A 3GU8A 4IVBA 1GVDA 2MLGA 1ZG3A 3KN5A 3FQEA 2XPUA 5FXSA 3CD6I 4G5JA 4YFXF 4XOTA 4B99A 4I3ZA 2TCTA 5D6FA 2XKDA 3KIOA 3CEKA 4DZJA 5DCMA 4CTCA 1OECA 4QNAA 3KLNA 1D1BA 3OIOA 5DS9A 1A6IA 5CI7A 2J5FA 1G8AA 3IRRA 2EK5A 3PIPF 2VO7A 4M14A 3V01A 3QPTA 4YU2A 3CJGA 1YWVA 4JBVA 3OCTA 4II3A 3UYTA 3A2KA 3P79A 3HRSA 3FQHA 4QP3A 3H3UA 2CKPA 2YM7A 3JVSA 2LLKA 5GHVA 3R6XA 4XM3A 2XEYA 2IS6A 4M9SA 5DT4A 2V0DA 1YXVA 3Q04A 3PXZA 1RR7A 1UU7A 3TUBA 2DA1A 2XKCA 4BY9E 4RQKA 1TLHB 2AHQA 1JKOC 3R8MA 3COIA 4APPA 4GEOA 2QQAA 3RK9A 4AAYA 4DCEA 3QRJA 3DXJF 3IW4A 2CGVA 5CQUA 3K7AJ 4YJQA 5HHWA 3R63A 3IGGA 1USSA 5C4KA 1WVYA 5D4SA 2FMLA 1NTCA 2X0GA 3MESA 4GDFA 4YJRA 3THBA 2OH4A 4EH4A 1TNSA 3CJQB 1M2QA 2XF6A 3GBGA 3RM7A 3ANQA 3DBRB 2WMXA 5LCJA 3BGPA 5JFWA 4HGTA 3A0BC 3Q9SA 2R7VA 1JNKA 3DPUA 4BQAA 2J0JA 3R22A 3BR6A 4ZTMA 2UZLA 5ANKA 1TNTA 1VQKI 1A48A 2VC1A 4MK0A 1HCKA 2LBFA 3WGIA 3KXHA 3FPMA 4F64A 4XKBA 2WU7A 3R0AA 3E88A 1XD7A 2K3PA 2F2EA 3ZQIA 4RAGA 5M06A 5A4LA 4I4EA 3RKXA 2DDAA 3OUNB 4AU8A 2QEXI 1OKRA 3MFTA 4L0YB 2R7SA 2QI8A 4W1UA 4CV8A 5IH4A 4IJ9A 3BTLA 3D15A 4ZYHA 4IFGA 3HL7A 2VL8A 3WTZA 5T68A 3W0SA 2FBHA 4ESBA 3J81K 3DLSA 4HVDA 4FTMA 3EFLA 4CVAA 4AIKA 1DAWA 3FZ1A 4EK4A 2OBPA 2ZJWA 3HOYJ 3GTLJ 4FBXA 2EV6A 2CW7A 5T3QA 5LVNA 2WTWA 4XH6A 2YWVA 4L46A 4V0GA 3NR9A 4FUYA 1W36C 3BZ3A 1VF9A 3CJFA 2FYSA 5D7VA 5DI1A 5HS9A 4WXHA 3NYOA 1JT0A 4AWXB 2P4WA 4YNEA 3K1MA 5IA5A 4F9CA 2CUZA 3HAMA 2BY0A 3DBFA 3WF9A 4KFCA 4I76A 4BGHA 3ZGKA 2F2CB 1U8BA 3D2IA 4RJ6A 4QP7A 4QMXA 3G33A 1BR1A 2LF7A 4JOAA 2LGCA 4EJTA 4M15A 1X8BA 4P55A 3W2VA 4ZDOA 4Z2YA 4DEEA 4AGCA 4OMZA 2ITPA 3ASNH 5CVFA 5J6XA 4M97A 3BROA 5BYLA 4AIHA 4CNHA 4I6ZA 2M45A 4Z7HA 2VXZA 2A19B 3S93A 4RLKA 1NVQA 2W06A 3WU2C 1VQ8I 2VBWA 3W8LA 4IB5A 4LL5A 2E71A 2WY7Q 2OF2A 3SZPA 3CCVI 4O81A 1EV7A 3QD2B 4BCKA 2Z5UA 4EM2A 4FI1A 3OYFA 4H1JA 3VBWA 3P9CA 1W4MA 5BMMA 2BGCA 1P14A 4IHWA 1BI3A 2CNQA 1H27A 5CAUA 1J09A 2LKPA 3A99A 1YO5C 3JSOA 4XYFA 4CEGA 3JYAA 3DAKA 4J71A 3S8PA 3PJ8A 2C6EA 2PMZN 3MIYA 5I9YA 4BIEA 5CI6A 5IP6A 4BR3A 1JJ6C 3IAM2 1SMTA 4J01A 1PJKA 3O51A 4YC6A 3SW4A 2WNTA 4ZLZA 2QU6A 5HDKA 2OIDA 1VQ6I 5CEKA 3QCQA 5D7AA 1TQMA 4ALUA 3CC4I 2R3IA 3LOCA 3LCTA 4FZ7A 4I20A 3EQPA 4EQQA 5FRMA 4RMNA 3DEWA 4G3GA 3CJRB 5CALA 4HX8A 3KREA 3RWPA 3RINA 4QTRA 4EH3A 3BHHA 4C4GA 4KSQA 1JOWB 2VN9A 2L54A 2O61A 4PJJA 1ZRZA 4BB4A 4C59A 4RVTA 2AC5A 1ZRDA 3PL8A 1XR1A 1R0EA 1J3HA 2YEXA 3E93A 2I8DA 4IX5A 2EWAA 3OUKA 2D45A 1E2XA 4TRLA 4AW2A 4PP9A 4ZY6A 2X6YA 3OOUA 5C4XJ 2W1EA 4QRCA 2VTQA 3G73A 3ALNA 2XPVA 3LSTA 3SAYA 3WZUA 4IF4A 3LSRA 3R28A 2EB7A 2AXTC 4D4SA 2H94A 2X6OA 4OTRA 2ID3A 3T8OA 4U40A 2V1UA 3VIDA 4Y46A 3KP5A 3VHKA 3A8XA 2QWWA 4GMYA 4E5BA 3VFZA 3E8CA 3ZDUA 2Y31A 4ZTSA 1OYWA 3ZQQA 4BAYA 4E7SA 4LIVA 1T98A 4P5ZA 5EI6A 2HW7A 2QO2A 3A8WA 5C3EJ 1I5ZA 1IDYA 3E64A 4ARKA 3ZCLA 1J75A 3UR3C 1JSTA 3VUGA 4A69C 2G2FA 5IY5H 1I44A 2PYWA 2JZYA 5JQ5A 3L09A 1FVRA 4UYNA 3DEUA 2NYAA 3ZEWA 5F64A 1HOMA 3BWFA 3MTLA 5D5VB 5D1JA 2E9UA 3VHEA 3PDTA 4F9BA 3A60A 4RIWB 2X4ZA 4TTHB 5CVVA 2Q1ZB 3WG9A 2CMWA 1JKTA 2OSCA 2ZBKA 5CAQA 3CR0A 2NOGA 3OSFA 4FG8A 3HYIA 3H5AA 3FEGA 3DK3A 2WADA 1FOKA 2LFBA 4FX0A 4BDDA 3KFAA 2I5UA 3OL3A 3KF7A 2UVZA 3CY2A 4U88A 1PYEA 5J1VA 3QTZA 3Q96A 5FEDA 2DODA 4MGRA 4HSRA 3VW6A 4OTIA 3VBQA 2ZB1A 4MFDA 3CP8A 4J96A 4GUBA 2VGPA 2X0LA 1YDTE 5DEWA 3HDMA 3I60A 2HZTA 4V01A 3ZFYA 4PGGA 1T45A 4X7QA 3ORKA 4DH1A 1SVEA 4ON0A 1ZZLA 3I7BA 4QMOA 4QDEA 1W0XC 5M09A 2IVSA 3HBLA 4PP7A 4YR8A 3HAVA 1D1CA 1J9IA 4QMLA 3CXWA 4DEGA 1P4WA 4WF2A 5DBXA 2P0CA 3MH0A 2FB8A 3FBNB 1VYZA 2KDOA 2OJIA 4CDGA 1XSXA 1XO2B 5ICGA 3NEUA 1KU7A 2PZRA 2XF0A 4NTTA 3CE3A 1FZPB 5IA4A 2A6HF 1TKIA 2FU4A 5LARA 3E92A 2WMUA 4E7IA 3LA2A 1Z3YA 3RYRA 2ETHA 4IACA 3VPRA 4BACA 3SRVA 4ANMA 1U54B 3RPQA 4NUSA 3KP7A 2EWNA 2GS2A 4PF4A 4YJUA 3ABLH 3V5PA 1GUUA 1HSTA 2ELJA 2VN2A 3LAJA 2XROA 4WG3A 1ZLJA 1S29A 4D4VA 2RAEA 4LL0A 3ZMUA 1EH4A 1SD6A 2NRAC 5D11A 4D1ZA 1BI7A 4K11A 5E17F 1ZGWA 3DBDA 2E1CA 5C1QB 4LGHA 4YJTA 4JVGA 2HVSA 3ETAA 3EH9A 2J5OA 3EQHA 1T38A 2O3PA 3OTVA 4O86A 2SRCA 3A7JA 3VBXA 5AV2A 1P5EA 4MCVA 2YCFA 3CESA 4M68A 1ZXEA 3QUEA 2VTMA 3F0CA 3ML6A 3RZBA 1ZELA 2A61A 4O0VA 3PTGA 3ZM9A 1SAUA 3HV4A 5H9BA 4LV7A 4LGGA 4M8TA 3GTMJ 1XGSA 2PVNA 3HTUA 5F6FA 3FMDA 1QRYA 3HA8A 4AG8A 4I09A 4AUXA 2HPMA 4KD1A 4L9TA 2QUFA 3GFWA 4BDAA 1X3ZB 3JPVA 1NA7A 2VT3A 2OQGA 1ZRFA 2VUWA 1V5GA 2JITA 3PA5A 2R5YB 3RHXA 5K7ZA 3HEFA 2E1NA 3Q6WA 3Q0WA 2DFFA 3OYNA 5AP4A 4PL5A 2XK8A 3G6EI 3F9KA 1O9UA 4EKKA 2I0EA 3IAS2 2XNOA 4EZ7A 3HMIA 4AT5A 3EETA 4BBEA 4RBLA 2Y69H 4QMTA 2YDJA 3A4CA 2DJNA 3TTJA 4TYJA 1MSFC 5IQHA 2A69F 3VYRB 4JJRA 5EGOA 5ILSA 1EA3A 3O50A 4OAZA 4XN3A 3UVPA 4GIHA 1OCRH 5D5WB 5DYMA 2B0LA 2XB5A 3N4UA 1I39A 1AGWA 4IQ6A 4NCTC 3O7LD 1K9AA 1N25A 3HDNA 4EQCA 5HNHA 5BVFA 2OAZA 2XNEA 1UZCA 3K70D 2OH0E 2QURA 2WOTA 4DBQA 3AC1A 4NM0A 3QODA 3K4JA 5CVRA 1WVWA 3KK8A 3JW4A 5FQDC 3BLAA 1BKXA 5DTDA 1ULYA 2QSGX 1G2HA 2ZDTA 4L5JA 2LREA 4O7RA 3KQ7A 1U5TB 4QMNA 5JGBA 3VEPA 1YE9A 2V1XA 1FP2A 5DV5A 3G9NA 4ZSLA 1HA8A 4GFOA 2JIUA 4O7ZA 1CF7A 3C18A 4DTAA 4GK3A 1APME 2WTCA 3GQLA 4S33A 3ACKA 2JBPA 3KE2A 5K7FA 2DYRH 2ONLA 3VUMA 4YNOA 4DG2E 2W84A 3QLGA 4HZRA 2WELA 1IAWA 4JQFA 5L8JA 5CQGA 1OKVA 5F1JA 2DQ7X 1Y6BA 5HG9A 2QBYB 1Z57A 2IEKA 3Q2JA 4HGSA 3OYLA 2JKQA 3K4CA 4P90A 2DA6A 4PDOA 4MHAA 4RGUA 4YC3A 4N9HA 1V5EA 2XBAA 5GIPE 1REJA 1MP8A 2BY3A 3WG7H 5E1WA 2L7MP 2WQEA 1RUOA 1KZHA 2HYYA 3FI2A 3E7LA 3RDIA 3TT0A 5E3NA 4YIIA 4IC7A 2WTDA 3SV0A 2WMWA 2P6TA 2W9FB 4PWNA 2GAUA 3HNGA 2Z1DA 4XHKB 2ESHA 2HW6A 5M5WJ 2W0JA 1H89C 3Q4UA 3RAKA 2HZ4A 3POOA 1KQ9A 4JP0A 3EN7A 4LV8A 1WBNA 3KY2A 3C1XA 3UDBA 2Y4PA 2XBJA 4UX9A 4MNEA 4UXLA 1IF1A 5AP5A 4F7SA 4Z9LA 5IDNA 1V5FA 4CZUA 5LEJA 3ANRA 3M11A 4A9SA 2HQ5A 2WB1N 2QQ8A 4HF1A 3W2WA 4GU9A 1FBSA 2XCKA 4BZDA 4P2KA 5D6EA 5E8UA 2IRFG 1YW2A 3VS7A 4BXUA 4L8MA 1YRNB 3TNWA 4DLIA 2V7AA 3QRKA 3QQGA 5J8IA 2PSQA 2ZJ2A 3D4QA 3WZKA 3HHHA 2QCOA 2IZTA 2V6CA 1W7PD 2QD9A 2FSWA 2WPAA 2E5NA 4AW1A 3F2NA 4LQMA 4G3EA 2C6IA 1LJ9A 2P8TA 5KMKA 4FT8A 1MJBA 5AP1A 5HVKA 3BCAA 4X21A 4GYGA 5LVOA 3QQJA 4CXAA 1W7PA 2PUIA 2OTJI 2Y9YA 4E7LA 2Q2EB 3KXNA 2CRGA 3LXLA 4RVKA 5LVPA 2IVTA 1POGA 2JDRA 3RNIA 2BR1A 4BVUA 4TNBA 3LCOA 3VS0A 5I4NA 3KRXA 2HXOA 2X6WA 4U81A 2HKXA 3HPHA 5FLXK 1Z6RA 5LFAA 5A3XA 1KA8A 3IG7A 2HS5A 2WMBA 2YU3A 2QHNA 2DT5A 4O84A 4IWDA 1DU0A 5EQPA 3CIKA 4UVAA 5EOBA 5KMLA 4YLLA 4C2WA 3LL7A 2P7VB 2WQMA 3WTUC 3NUSA 2J2IB 1R6RA 1OMIA 1H4LA 5B66C 1QBJA 1V55H 2QZ8A 3M4OJ 3HVCA 3ZMVA 5IPJA 4LB6B 4IQ4A 2C6KA 4U7ZA 1MBFA 3BEGA 5L6WL 1V4RA 2OI4X 5LCKA 3OHTA 3H10A 3GTKJ 4BJTA 4D5FA 3RZOJ 3ZN0A 2YWPA 5J3LA 2IT0A 3Q2MA 4EGYA 2XUBA 4YC8A 2KQRA 1CSNA 3I6WA 4YZNA 4FGBA 4IAAA 4ZK5A 2HVQA 2V9VA 4H3PA 3M1EA 3OC1A 1VJYA 4YMJA 3NUYA 2Z7LA 3ZZWA 3WTXC 4LG3A 4H3BA 3OMYA 1Z77A 3QZGA 1DPUA 5CT0A 3DQXA 4A9TA 4ITHA 3PO2J 4CRSA 5DOSA 4BS9A 2BZIB 4JBPA 3Q9YA 3CF2A 2Y48A 1Z5MA 3U21A 4USFA 3OV8A 4BCPA 2X2MA 1W82A 1R39A 5HCZA 2Y0AA 3KEXA 3IW7A 5E92A 3BPVA 3MBLA 1FJLA 2UW4A 1K6OA 3DLZA 4BTMA 2DT6A 4C9YA 4A3MJ 4NJ3A 3ET7A 3CDLA 1OPKA 4Z7GA 2BZHB 2A3SA 3NS9A 4IADA 4HNIA 5BV3A 4GIIA 3NUNA 5FFZA 3PVGA 5EQEA 3PUBA 5K1YA 4XP3A 5ED4A 5LWNA 4BYYA 4L3JA 4UYAA 1TL8A 4V04A 5AUYA 3E5QA 2YX7A 2HYGD 3PSBA 3AT3A 5A4EA 2OU7A 4X3FC 1J7IA 2A07F 4PTCA 2PVHA 4LFIA 5BUIA 3QX4A 5IDPA 2W1IA 1XMMA 3U51A 2R9SA 5M53A 1J59A 4BZOA 3T9IA 3AC8A 2QKLB 5CSXA 4H58A 5ANEA 4B3AA 4FKQA 1SNUA 4I01A 5F1RA 4QP4A 2XKEA 3HV3A 3LMMA 1ATPE 4F9WA 1I09A 3PO3J 1Z1DA 5LWMA 2L4MA 1LEAA 3GWZA 3BQZA 4MQVA 4YJVA 5J7HA 4FKVA 2R3OA 4A0YA 2UW0A 3DT1A 3W2QA 3BTIA 4HPTE 2ME6A 3H4JA 4KUJA 3SOAA 1ZGJA 2Z16A 3TYKA 3BDDA 3MVHA 4Y73A 1O6YA 1FC3A 3E6BA 2UZKA 4GKIA 4ZDPA 4JX3A 3GT8A 4WHZA 1K83J 3TNPC 3P4KA 4A6EA 4D2SA 3P9KA 4QNYA 3JRBA 2LR8A 2ECCA 4KA4A 4DJAA 4BHNA 1YW7A 3FLQA 2PVJA 2ITQA 3C50A 3K2LA 1X1AA 4LOPA 3OYGA 2MBFA 4BI2A 4DEAA 5B1BH 5D5XB 2VTOA 1YS7A 3E62A 2OLCA 5F0FA 1QPCA 4BCJA 5EEGA 4UZDA 2BY1A 1DP3A 3F8NA 1NVSA 3QXOA 2BMCA 3NYNA 4IWPA 2VKEA 2X8IA 2BE5F 3AMBA 3VS6A 4ZSEA 3ZLWA 4EJ7A 5CANA 3MFRA 3SZGA 4C2TA 1T6SA 1YJ9I 2OG8A 4HQEA 3NWTA 1DUXC 2VTAA 3HUBA 3JVRA 3CO6C 3FXMA 4KINA 1E17A 4L44A 2ITOA 4ENNA 4KMFA 3PUPA 3UIBA 5E3LA 3EMGA 1OMWA 4D7NA 3F5GA 4RGJA 2BUJA 3PRFA 1P4XA 3E5AA 4AU7A 1L0OC 1D8JA 2YSRA 2X4HA 3SXSA 1O7LA 4GFMA 5M07A 1PHKA 3KLOA 3QTXA 3OT8A 3CLOA 3DTWA 3TJDA 5HX6A 3G6GA 4DGGA 2IA0A 1JKRC 1J7UA 3RK7A 4J8MA 4WG5A 5EZGA 2C5YA 3ZRLA 1UHWA 3DKOA 2E9PA 3W0OA 2LF8A 3PSDA 5AADA 2LYCA 4JX4A 2WMAA 3DXQA 2BRHA 2G0EA 1R78A 3F2RA 2WMSA 4AIJA 3U4WA 2QO7A 4M12A 4FT7A 2KDZA 2C5OA 2BHZA 3QP6A 4RGSA 4DITA 1ETKA 4IB3A 1VQ9I 3JS2A 3LMIA 4RIXA 4KAOA 2V7OA 5LXMA 4YTCA 1ETQA 5C44J 4I92A 1IC8A 1YRPA 2RQPA 5I5ZA 2IA1A 4RBOA 2IVMA 1SVMA 2R3LA 3L2RA 3BR1A 3V42A 4B6LA 1XG1A 4XLHA 1ZY4A 4A12A 1IUYA 2G2HA 3B2TA 3QQFA 4DC2A 2M8GX 2PJPA 2CGXA 3SZTA 4FEQA 3REOA 3PA3A 3FHRA 2BDFA 2QHMA 3M8EA 4RJ7A 1VLRA 3HMPA 3R9HA 2CQNA 5CXZA 2VKHA 3OYCA 3QWJA 3IL2A 2ZJQF 1SM2A 4IC8A 3LLTA 1R1VA 3R0JA 3VYSB 4IHXA 2F4IA 4BH9A 4AWIA 3EYYA 2PTKA 3P9IA 3KIOC 4KKEA 4FSZA 3DBCA 3TGNA 4GUEA 4KKGA 3QRFF 4YSMA 3FX3A 5IMEA 2X4FA 5GINE 5FTOA 4WD5A 5DE2A 4XRSG 5CQWA 2E36A 4BE1A 4KSPA 4HGEA 3H30A 2QA4I 1CTPE 2IGMA 3VULA 4CRLA 5IEYA 2R7ZJ 1SEUA 2Z99A 4NB5A 2J0LA 3CQEA 2QG5A 4ZSJA 4M3GA 4I5CA 2W4OA 3JRDA 3OT3A 4I24A 5DD8A 4RIOA 4B8MA 4QPQA 3FZRA 2YJSA 3GU5A 2WMTA 4L5EA 3NUXA 2OJFE 3ROYA 3G71I 4JG6A 1G4DA 5B7VA 3LHJA 4RA5A 3MY1A 1ZKGA 5FB2A 5E8TA 4PUZA 5HVJA 3RPRA 3PJRA 1UKIA 3JY9A 2JDTA 4CFFA 1IV8A 4KIPA 3D7ZA 4CMOA 3L9PA 5AFVA 2ZFWA 4FODA 1V3FA 3UIUA 4WUNA 5EZHA 3HRCA 4AN3A 5GNKA 2GFCA 3L2WA 3V7RA 4S04A 5EQYA 3V04A 3A2CA 3Q0VA 3QQLA 5A14A 2PN6A 5D5UB 2IW9A 3A62A 3PVUA 4YHFA 4EH5A 4XLPF 1NH3A 4FSWA 3W55A 4O91A 2PFBA 4YURA 2OJGA 2ME0A 3KB7A 4JQEA 4EC8A 3CJTB 2HAKA 3QTWA 4IM3A 3D5VA 3WILA 4RG0A 2BHYA 2P55A 1R0PA 4JNWA 3LWFA 3IDCA 2R0UA 3O96A 2YR2A 4ABZA 1KU2A 1FVTA 4QEBA 1KV2A 3BTJA 1WH7A 3PFQA 4EJVA 1G6NA 4HVGA 1VQ5I 3TNHA 1YXSA 2GTNA 1W0UA 5EFQA 4O96A 4QQ5A 3GC8A 3NWSA 2ZB0A 4QP6A 3I5NA 4EKLA 2OZUA 4NUBA 2IW5A 5TO8A 1PXNA 2MC3A 4ZMEA 3ITZA 3ZMDA 2P5VA 1MQBA 3OVVA 4RT7A 3L9NA 3RCOA 1NXKA 3LFFA 4JMQA 2NXNB 5AM7A 5JK3A 2XASA 1HQCA 1ZK8A 4QOXA 4FTJA 2B1PA 1S9JA 2K4BA 3CMEI 2L9RA 2GS7A 2K40A 4IRGA 2YCRA 4ZOGA 5CSWA 4U87A 4W4WA 1SANA 3GVUA 5BPYA 3K4KA 4O3MA 3QWKA 5ETIA 2W4KA 5I9WA 3L2QA 3HV6A 2G7HA 2C6DA 4TV7A 3MKLA 2AXLA 2CU7A 1YITI 4A9RA 3T8RA 5IUGA 2UW7A 4Q2AA 3H3VK 3OIQA 4X2FA 4HPUE 4J7BA 3ERKA 2DMPA 2XK6A 3R9OA 1WHUA 2EZLA 5K3YA 5HDNA 2B54A 3EN9A 2C4GA 1ZGAA 4OWRB 2A27A 2DWBA 3SG8A 2IN6A 2VBYA 5FROA 4N0BA 5EK7A 2IS1A 3E1SA 2NOJB 3D5LA 3LZBA 4CICA 4KN4X 5CZHA 2IG7A 3RK5A 3R8LA 1W8CA 2FA5A 2XVDA 1XDUA 3RPVA 3TBIA 3L8SA 5H2FC 3CKWA 2R5TA 5AM6A 4IRHA 2PJRB 2OZAA 2VWBA 3R2YA 3BLQA 4FHTA 2B53A 3MQ0A 3QKMA 2L9SA 5C8MA 3LE6A 4FV6A 1ZAOA 4EMSA 3OS2A 3BQCA 4FR4A 2QC6A 5EI8A 3DS6A 5A9UA 1I3AA 2LY1A 4FTCA 1RDQE 3EQRA 5BNGA 3W0QA 5FKKA 4JBQA 2DPDA 2H34A 4ASNA 4IBMA 2WTVA 2E1MC 1LVAA 2CLQA 4QSHA 2G9WA 3HEGA 2EU9A 2C3IB 4JXFA 1OR7C 4FTOA 1AU7A 3I58A 4FE7A 3W2PA 2GQRA 5M4CA 3A7HA 4AXCA 4II2A 4TYIA 1IN8A 3R60A 1NW1A 4FC0A 1REPC 4PDKA 1AKHB 2J7TA 4EK8A 1PYXA 3W32A 3BELA 4E6CA 3OYBA 5ILUA 3A7GA 5LEKA 4S34A 4BYJA 1FGKA 1FOWA 1LE8A 3JXWA 2ZNYA 3Q3SA 3WHCA 2ZJPF 4NU1A 4FTRA 3CUQB 3O2PE 4I0SA 5DD4A 4BBRJ 4FCYA 3I56I 3O0GA 1LB2A 3L8VA 5JFRA 3PSIA 5BNJA 2QYOA 4W97A 4Y4RA 4KBCA 3IECA 3CCMI 4WUAA 4LG0A 2X48A 3CCNA 3OBJA 4A3DJ 1S7AA 3JR9A 4U80A 4IVDA 3V8TA 4E6DA 2UW3A 2PL0A 5CKTA 3L2UA 4YJSA 1WBTA 1YXUA 2UUZA 3SG9A 2BAJA 4ITJA 2VJIA 3EYIA 5FKLA 2L2OA 5BMZA 4WG4A 3W0NA 2L01A 4CKJA 3QYZA 2B9JA 1P2FA 4FYNA 4IE9A 3FC1X 4XRJA 5ETFA 1H9GA 2EZHA 5JR3A 4NM5A 4CZZA 3I6UA 5K7HA 4ID7A 3FI4A 3VO3A 2XA4A 1MDMB 1DGRM 2M0CA 2R0QC 3R2BA 1ETYA 4RB0A 4DEDA 1WKMA 3KU2A 4EYJA 3QZHA 1XBBA 2F49A 2NRYA 3EQCA 3UP2A 5KZIA 2Y6OA 1UG0A 4C3PA 3IKVA 3IP4B 3GLXA 3ORIA 5AUTA 4LLGF 1G3YA 4AFJA 4L7FA 1QPDA 2DT7B 2X8DA 4IOCF 1X58A 5DCMB 3WIGA 4LV5A 4C2MJ 4BL0B 2V7FA 3L2VA 1E9HA 2PVFA 4FKLA 4NTSA 3CD8A 4WNKA 3QKKA 2VTLA 3S1HA 3WIKA 3ZC5A 1RJBA 4FGRA 2GBYA 2ZMEB 4W4YA 4RJ8A 4E6QA 2JAMA 4DGNA 1UU9A 3HRBA 4ACDA 4GG7A 4R78A 3PXQA 3R1NA 4YRVA 2MC4A 3EYGA 4FICA 4MTAA 4LIUA 1FOXA 4I21A 3WZJA 3E0JB 1J0RA 3ORNA 2DYLA 4NL0A 5HVYA 1RQQA 4YBKA 2A68F 1O6LA 4A9YA 4G17A 3SFZA 1JSUA 5E7RA 5JT2A 1QO0D 3OYKA 4ZS0A 5KBQA 4XOZA 2VKVA 3AKZA 3G6HA 2B9IA 1FIAA 3ELJA 3F8BA 1I6XA 4IAFA 1KSWA 1R1UA 2IZRA 4ZTNA 4YLKA 5BVNA 2ESMA 3CSVA 1CM8A 4O5VA 1BI1A 5E8GA 4XNEA 1VNDA 4TWNA 4YJNA 1FYKA 1BR4A 5L6OA 1OYYA 4BBFA 1JUSA 3H0GJ 4U3ZA 4I41A 3IGOA 4FV0A 4H1MA 3TJCA 4GH2A 2Y7JA 5HD4A 3LFUA 4E20A 3JRCA 1YI3A 4IM2A 3CLYA 3WZDA 4ALWA 3E7VA 3P9JA 2R3QA 1OBGA 2ZXHA 2FBIA 2EV0A 4I6FA 1YS6A 3KP2A 3OBGA 3R9NA 2E35A 2LBFB 3QYWA 4LUEA 3GF2A 2Y30A 1YX3A 3GU6A 4FT5A 2CV2A 2C30A 3BYVA 4E70A 3S3NA 3C13A 4Q9ZA 4ZYDA 4MFEA 1X1PA 3HPGA 1TT0A 1V0OA 2V6EA 4EM1A 3FXZA 3HG9A 3QTSA 1DGWY 3KYCB 3VB2A 4QTAA 4R5YA 2QO9A 4PK4A 3LXKA 1J7LA 5EI2A 1YTYA 5IYDJ 3S16J 2FNAA 2WV1A 4Y8DA 1ZOGA 3FIWA 4RLQA 4WXCA 3S15J 3DV3A 4PDPA 5TJJA 4U0WA 2GDOA 4ZEGA 2JRMA 4H3QA 5FD6A 3CTHA 4DGOA 3WTSC 2VJJA 3NARA 3GZNB 3VF8A 5KCVA 4JDJA 4DHFA 4V0GB 3C5IA 2F5VA 5JLXA 1T0FA 1PMUA 1KQ0A 3CDHA 3PQJA 4MVFA 3BTCA 4BF2A 5L3EA 2BBYA 2AS5F 1RNLA 2JWTA 5BQ0A 4R3CA 4E7WA 3ECOA 3F6OA 4X2GA 4YLJA 1WCCA 3F6VA 2JA5J 3R73A 1X1CA 1TQIA 4MNFA 5M5YJ 2QOFA 3DTKA 3HOZJ 2GHGA 2B0QA 4DFLA 3CLQA 1W98A 2C6TA 4XL9A 4FSYA 5LHIA 4RX5A 2BDWA 4NW5A 2FF4A 4XQFA 3W2CA 4F09A 3OYDA 3B02A 4I5PA 2BAKA 2KTYA 3PSFA 3S1QJ 2JKOA 5E20A 4IZAA 3D5SC 3G1LA 4LMNA 4U9AA 2LH9A 1MUOA 4FUXA 4EUTA 3PJ2A 4FVPA 4YZ9A 4XSXF 4HLXA 2HWPA 1YWRA 2O63A 3BYUA 4ZJVA 4ASEA 3C3WA 1R23A 3BL9A 4L9IA 4MO7A 4JS8A 1GXPA 2BRBA 3CTAA 3S1RJ 2Z2WA 4QMWA 4UVBA 4MEXF 2ZVAA 3UOKA 2EIKH 5FKMA 1GY3A 5HNGA 1YWNA 3UP7A 4OTQA 4XRFA 3EQFA 3BZKA 4GCVA 4EOQA 4ASDA 1WJEA 2VTPA 3COMA 1BJZA 2C47A 2F48A 1Q8TA 3MPTA 1RR8C 3KF4A 2LP0A 2QOBA 4O83A 1YXXA 3C2GA 2J5PA 4BGDA 3HA6A 4AA5A 1L3RE 3P5JA 4R79A 2XRLA 3G1OA 3TV4A 3D7TB 2E9NA 2CG4A 3W2RA 3K0LA 4PNKA 5IYBJ 3F3ZA 4TN6A 1OKYA 4DH5A 5D4RA 5JEBA 3CMAI 3N4TA 3KEOA 3F61A 3I59A 1ZMWA 1XQZA 2HNHA 1MGTA 2CW0F 1MRYA 4MYGA 3CCSI 1H25A 2CKOA 3KZZA 1A9UA 1O3SA 4DG0E 4K2EA 5IQAA 3Q9WA 1S6LA 4BCNA 4FNWA 3BT9A 5IEXA 5IPAA 4IAKA 2XAFA 3C9WA 2NO3A 5TT7A 4W4VA 3UO6A 3K70C 5LGUA 3F3WA 3TV6A 3NIZA 3MB7A 3F66A 2L3DA 2H6BA 4O0SA 5FXRA 5HVQC 4N4SA 3TN8A 3HOSA 4NW6A 3WI6A 5IZFA 3GU4A 4OT6A 2ZB9A 2E2JJ 3Q9VA 5EH0A 3UNGC 2BFXA 2ONLC 4NT4A 4X2NA 1FMWA 2JK3A 4RGXA 2JMWA 4RWJA 5BUJA 1IA9A 2VWWA 3TWJA 2WZJA 2ZXIA 4JG7A 5DR2A 2CHLA 3FMEA 1AOYA 2CH0A 1QGPA 2RN7A 4AUAA 1IEPA 4F63A 2R4GA 1UU3A 4ENKA 1WFXA 2P33A 3K5UA 1B39A 4D5CA 2DN0A 5LVMA 3CP9A 5CLPA 2WAQN 2CS3A 3TP3A 2BIKB 2OZ6A 3QTUA 4J53A 4FSQA 5JLWA 3ENHA 5K5NA 3EZRA 2QLZA 3ZUTA 3PPZA 2WY8Q 3KCCA 4G94A 2O3FA 4V2FA 2XIZA 4FIIA 3V5LA 2IZSA 1KU3A 3ACJA 5ANGA 4DFUA 2XSDC 1JBPE 5IISA 4EOMA 3SW7A 4KYWA 3P0MA 2BCJA 3FYJX 4AA0A 3GI3A 4IKFA 4F7NA 3BZCA 3H9JA 1MZBA 3FLZA 4A0ZA 3KFWX 5CVGA 1OPLA 2LD5A 1W7HA 4FV4A 2R3GA 2JVHA 4HF0A 2PZIA 4UV9A 4HOBA 4HYIA 3OXIA 1K3AA 3EYHA 1XKKA 4DE4A 3CP2A 3FXOA 4NC8A 5CT7A 4QLCU 1FTZA 5IUHA 3UVQA 4EEVA 1UB9A 5HG5A 1VQNI 2YU9J 4LMUA 4MXAA 3AFHA 3H5RA 4BCFA 3KYLA 4BDIA 3PE1A 3PP1A 4WOVA 4EZ3A 4PSWA 4E93A 4EC9A 3BV2A 5F95A 4EOLA 4A5MA 1O3QA 3KMMA 2LG4A 3PY3A 5AV0A 4FZ6A 2OIBA 2NPQA 3OYHA 2O5KA 4HYHA 3W6VA 1LR4A 2DS1A 3EQBA 4O27B 2VAGA 4TWCA 5HLWA 1WZYA 5KX8A 4HNFA 3M42A 1GLNA 4BDCA 3ZO4A 4M0ZA 2VV9A 3DBHB 5L3DA 4S05A 4ENYA 4OTGA 3V6SA 1ZLKA 2VX1A 2I6LA 4RIYB 1R00A 4OINF 3W8QA 4JR7A 4YTIA 2X9DA 2CCHA 3TXOA 3VS3A 2BY2A 1GIHA 4KBAA 4I6BA 1ZG5A 3OL4A 4QPSA 4EK3A 3FXJA 2VZ6A 2I0YA 1HCLA 4Q47A 4K1BA 5D8LB 2AQEA 2J9MA 1BW6A 3AD4A 5K9IA 3EQDA 3ZO2A 3TKYA 3H9RA 2X6EA 3FZPA 4LFUA 3NCZA 3JRHA 3SFIA 3BI6A 2OCCH 1WBWA 3PZEA 4AZVA 3W2OA 3JRGA 2UV1A 4EOOA 1ND4A 2HOAA 5TR6A 5J95A 4D5HA 2VASA 4UWYA 4KBKA 4DFBA 4KIBA 2W05A 1OCOH 3TDUC 4D9TA 4TYEA 4EJNA 2XB0X 2QOOA 3FXWA 3MSSA 1LNWA 4XN0A 2VBZA 5EM5A 5AAGA 4IQJA 1XH9A 1YQJA 2FXAA 2BZKB 2VUMJ 3RCJA 2CMPA 4FV7A 2EVAA 2KMUA 3GXLA 1IW7F 2JBOA 1D5VA 4C3JJ 5EF6A 3DPKA 4YZMA 1XMXA 3AMYA 4FV3A 1K78B 1WMKA 3QHWA 2OWBA 2VJ5A 3OEZA 5K5RA 1S9IA 3RKBA 2XF7A 5C9CA 2ITTA 2XCHA 3IW8A 2F9GA 5KNJA 3F6XA 5DT3A 4AM3A 2IPQX 1J91A 4QMVA 1ETVA 1PXMA 2CPKE 4XG3A 5DG5A 3CTJA 2ISZA 3L9MA 2OFVA 3DXNA 4CT2A 2REIA 3GB2A 4JAIA 4N9IA 3ISPA 3LA3A 3ZO1A 2J5EA 1Z9XA 1F4KA 3HOWJ 3FMRA 4WIHA 1BL6A 4D4YA 4EH2A 4JIAA 3DK6A 5KKRB 4RX9A 2C0IA 3DKWA 3F7ZA 1MBEA 3WARA 2ETKA 4AE9A 1H8AC 2M34A 2DO7A 2C3LA 3M8FA 3DF8A 4XRSA 2LRDA 2VTJA 2EIMH 2VQLA 3FK7A 2BFYA 5HBEA 5CLSA 2W00A 3EL7A 2JRTA 3GFLA 4RAFA 3PZHA 2DMNA 1FWZA 1P7IA 5L3CA 2OD5A 5IA0A 2FSTX 4BHZA 4N57A 1OLTA 4UB7A 1GIIA 2QSFX 4XNFA 3KEYA 5HS8A 4Y13A 2UZDA 2K4JA 2O8KA 1EH6A 3G15A 3RPUD 4YO4A 2QLUA 2ZOQA 2K9MA 3TEDA 4DFNA 4I0AA 3ZM4A 1URCA 3RQIA 5KMIA 4RA2A 3KMUA 4L9JA 1HDPA 1FMKA 4RIWA 4ZP5A 4DG3E 2PVMA 2UW6A 4HAMA 4FNXA 1Z91A 3F82A 3TI1A 5BOXA 2X9FA 3RPUA 2BKZA 5KO1A 3MWUA 5E79C 2HOGA 3BBTB 2ZV8A 4X3FA 4KRDA 4Q5HA 1ETXA 5C8KA 3EKKA 1ZTRA 3NAUA 5LHGA 4RFZA 4L5IA 4FSMA 3F72A 5KHXA 1KQ8A 4BEHB 1JGGA 4GVAA 3AC3A 3PXKA 5KMJA 2F4JA 5AJQA 2HPIA 3FPQA 4EGZA 1EKEA 1FLIA 2D1VA 1U46A 2ITXA 5E1XA 2H6CA 2IS2A 1X19A 1EH8A 3CMMA 4ACGA 4F99A 3I9V2 1A5JA 3LA7A 2PK9A 3O8UA 4EOIA 3Q60A 3MZ8A 2QKWB 3WF5A 2RKHA 1GHCA 4ZTFA 4DHJA 2NVXJ 2ZJRF 4NDLA 4ZTHA 3ZSIA 3QCSA 2M2EA 5J1UA 1CF7B 3NWWA 4DGWB 3CCUI 1WRJA 3BLHA 3PNYA 4ZZLA 4EHGA 1Q62A 3CS9A 2DPUA 3V3VA 2JDVA 3TEIA 2WQNA 3PXRA 4D0XA 3BG6A 5CY3A 3FMKA 2VQHA 4F7LA 3ZEPA 3S95A 4BBMA 5LHHA 3ZDIA 1ZYCA 3F88A 2GFSA 3FMLA 5EG0B 3ZQGA 4LITA 5CEOA 4BHPA 4BQOA 5JFXA 5CQEA 6PAXA 3PY1A 4JT3A 4CKIA 2EFPA 3JCUC 2YIQA 3RZDJ 3FZTA 4BDKA 3E8NA 1QPIA 2B7AA 4R3RA 3V8LA 4FTQA 4GW8A 3A03A 5D41A 4MBIA 1XCVA 2CFOA 3AKJA 1MMDA 1FGIA 3PUFA 2GNGA 3PVBA 1R4NB 3T9TA 4PMTA 4IZ5A 3ZLXA 1JKLA 2XAOA 4IB0A 4O38A 2F5CA 4M3BA 1U54A 4ZTLA 3MVLA 5HKMA 3R7OA 4GT3A 3DXPA 3HXLA 1JUMA 4NIFB 1BOAA 3VSKA 3L1SA 3U1DA 3DPLC 3GTGJ 1LPQA 4XBUA 5FBOA 1OM1A 3HL2A 4MNEB 5FRNA 3UOHA 1JKPC 4C4JA 1YHWA 3W33A 3CKXA 1SD5A 3ERED 4KNYA 5TF9A 3FAAA 3CY3A 4D55A 1T08B 3UOLA 5EG3A 3U55A 2KULA 4GKHA 1Y56A 5HE1A 3BP8A 2XYUA 3I54A 4EOJA 4CYCB 5M3FJ 2BW3B 4AYBN 1IRZA 2W57A 3F3UA 2NVQJ 1LFBA 2ITYA 3SDGA 3R02A 3FWQA 2MD5A 3FMHA 1Z21A 1Q8ZA 4EATA 1QPEA 4GXOA 1B59A 5HZNA 1J1BA 2H8RA 3SHFA 4IMYA 5L2IA 3BHVA 4FIGA 2G1TA 2UVXA 2V26A 2EV5A 2JEDA 3QOEA 4M74A 4DTBA 2UXNA 4Z3VA 3VUKA 1FYLA 4U3YA 2VJ4A 3PNTA 5CNOA 4MQ9F 3FI3A 4PTEA 3IKTA 1ST4A 4FKUA 4Y85A 4O0UA 1BC8C 4AQCA 5F94A 3I5UA 4D1QA 3VC4A 1FTTA 4ERKA 3BPRA 3MKWB 4KT5C 3QYEA 4RWIA 3EFWA 3OWLA 1BI2A 3QGWA 4MD9E 2BVLA 1Z6TA 3W0MA 1LQ1A 2B55A 1OISA 3KN6A 4XG7A 4XKVA 4P9FA 3P7BA 2WTKC 3R01A 4NM3A 3RJCA 2ERKA 4UN0C 4AC0A 4D4RA 2Z8CA 2XK7A 5HQ0A 5DM7F 2WQOA 4FT9A 1KE5A 3G2FA 1UCRA 4HVIA 2M7BA 2JA8J 2C0TA 4FT0A 5HD7A 3OY9A 1PUFA 4LRJA 3LFNA 2V79A 2BROA 1X4PA 5BVWA 3LW0A 2YAAA 2XKOA 1WQ2A 5IP9J 2W5BA 5D10A 4MXYA 2X8EA 4JBOA 2IXSA 4DYQA 3FL5A 2HZIA 3SXFA 2A6TA 1G8KA 3TQNA 3GOPA 3W0RA 4ZYEA 2BHEA 1B4AA 2X51A 4XOPA 4ZYAA 2YIRA 1M1EB 5GPAA 4L45A 2KISA 1VQ7I 3V5TA 1XPXA 2FUMA 5HORA 4K33A 5FGKA 2HWOA 1U5RA 1U5TA 3GFIA 4QP9A 4G2FA 1P6RA 4HX4A 3DTCA 4DQ2A 3S17J 4PX6A 3DBQA 4JDKA 2HXQA 4FISA 2VWYA 4F92B 3QXPA 4JL9A 4C2UA 1PW2A 2R7IA 3BJAA 4JK1X 4Z6YA 5ICEA 1XMLA 3KL8A 1JAMA 4AQKA 5CVIA 5FKOA 3OOGA 4IHSA 3IW5A 3R9DA 2Q0OA 5KUPA 2LAVA 4G7OF 4WNMA 3QYBA 3HV5A 1UNGA 1OL7A 1WJBA 2QBYA 2EXMA 4FX4A 2IZUA 2WB8A 3ZMTA 4EWHA 4HA8A 3N51A 2JFLA 4ETSA 3GFEA 3F21A 3GENA 1S5LC 1H1SA 2X1CA 3Q9XA 4ANSA 4XLIA 1QHHD 3KRWA 3I0QA 4R7HA 4U79A 2MG4A 4RJ4A 4I7HA 5IUIA 2C6OA 3DDQA 2M30A 1X2MA 3LKMA 4G16A 3WF7A 2YDKA 1MMGA 2JVGA 4XONA 4HCTA 4NC6A 1JHFA 3IW6A 4BDZA 1F1ZA 2YX4A 5E9EA 2HWVA 2XIGA 3LXNA 3KK9A 2Z02A 4YP8A 2EBIA 5IP7J 2STTA 9ANTA 4E7KA 1IG1A 2ECBA 5B0XA 4DGMA 5HI2A 1BI8A 3CCEI 5G6VA 2HZ0A 3R7EA 2C1AA 4G1WA 2QNJA 3QUPA 4YZCA 2HGCA 4U6RA 2VO3A 3RAWA 1WFCA 1BUHA 1U0JA 4B1RA 4UUVA 3FUPA 3UPZA 4DFXE 5DHJA 1Z7LA 3ZS5A 2WWYA 3VODA 5F04A 2VT2A 1P9QC 4KIGA 3SQNA 4TWOA 3SDJA 1FOYA 3DWLE 4JOMA 2DBBA 3CCQI 5CYVA 1W5SA 4BNCA 3D83A 2DOFA 5LJJA 1YRNA 1JJ8C 5FLFA 5EEHA 2YN8A 4NSTA 1YW8A 1JT6A 4JDIA 2P6SA 2AUHA 4JAJA 4CA0A 1NY3A 4EVIA 4NM7A 2XNNA 2E2HJ 3R71A 2UZWE 1Q1HA 4HVHA 2XP2A 2ZNZA 2PMOX 3I0TA 3AKLA 5HG7A 2WQBA 1RETA 3PNVA 4DFYA 3A4PA 3Q4TA 4L68A 2VRXA 2C5VA 2GS6A 2R3SA 2QR8A 1RZ4A 2B9FA 1G3NA 1H24A 2Q2EA 1DI9A 3LFCA 1V0BA 4M84A 2C5NA 3HUGA 3OR1C 1D0ZA 3NIEA 4JG8A 2B9HA 4E7JA 2XIRA 3D1NI 1U9OA 1P7JA 1U4DA 2KKOA 2VBXA 4RFMA 4B7TA 2ZXJA 1W83A 2YS9A 4XG4A 1IDZA 5JVGF 3FY2A 2WIPA 4M9XA 2Y6MA 4KITB 2KJCA 2XAUA 4HEA2 2CW8A 5KE0A 3TZ9A 5KHDA 5FEEA 3GZ5A 4O7YA 3HOTA 5ICFA 4QP2A 4ZS4A 5I9XA 4F4PA 3K5VA 4IX3A 2PBIA 2CFXA 5FG8A 4HJOA 4QP8A 4AW5A 2D2WA 3G0FA 2ESNA 3MFKA 3QC9A 1N78A 1NT2A 2E19A 1V1KA 2L7ZA 2JKMA 4BI0A 3GEZA 1CKPA 3DZOA 1KYZA 4RB3C 1UELB 3HIFA 1Z0XA 5J4YA 4GJ2A 5EKNA 1OR7A 3RPSA 4FZAB 1H0VA 4RMZA 3RKWA 3LSHA 3UVRA 5CVHA 3QRUA 4N4NB 4HDVA 4CCBA 2WV0A 2Y75A 3C1DA 3PE2A 4RS8A 2KJBA 5L3AA 4KISA 1SVHA 4HNUA 4QTEA 2PY3A 3F3VA 1OKZA 3TV7A 4NH1A 2VB6A 4UUSB 3GZ6A 2R3MA 1UNLA 4X2KA 3R7VA 5FFXA 1Y1WJ 4NBQA 4GRBA 4IHPA 1WZ2A 3NPCA 2XARA 4W4XA 5EW9A 2UV2A 3WF6A 5BVOA 2DMTA 4XLEA 3HM5A 3NNXA 4I6LA 2F4OB 1ZYLA 4E7ZA 3PJCA 3KRLA 4LRKA 4MTDA 1H01A 3AL0C 4U43A 2Y0SA 1J2XA 2Y4IB 2BDJA 4YG2F 3TO7A 2UVYA 3VYUB 1XHAA 4KMUX 3K4BA 2YCQA 4LUDA 5C4LA 4R77A 2JUGA 3GC7A 4IVNA 1K6YA 3ZQHA 5AX9A 5E4HA 1QZEA 3S2PA 3KXMA 1TT5B 3OD6X 3GGFA 4M9ZA 3N97A 2IO6A 3U4UA 4HV6A 3UJGA 3Q5FA 3RIRA 2XAHA 2PUNA 4JBAA 1NHAA 5F0CA 3ABKH 4FJVA 4DBRA 4WO5A 2HTJA 3TUDA 2C3KA 5I9UA 4FIJA 2XAJA 5F08A 1MD0A 3LCSA 5GIOE 4S31A 2XSJC 5HICA 2VTTA 5AAEA 4TXCA 2BRNA 3TIZA 1ZOEA 5EYDA 5HLHA 3ZQCA 3MD2A 2DFHA 3SOCA 5L3BA 4AGUA 2W48A 4OTDA 4NJDA 5E8YA 1SYKA 2TDXA 2BVAA 3KGAA 5ITAA 4DHIB 1PF8A 2ZMCA 3T8TA 5HLPA 2VODA 4O22A 2EA4A 5HIBA 1LDDA 3ZUUA 2NVUB 2KIMA 1P4AA 5D12A 3BIZA 3TL8A 2I0HA 4A4LA 1D0XA 1H28A 2K9LA 4U0VA 3LJ1A 4KB8A 2LVSA 4X0GA 4GVJA 5BMSA 3VS2A 2QM3A 5ETCA 5B5EC 2DTRA 2FRHA 1BJAA 5KK1A 3ZOSA 2WMVA 5DNRA 1D8KA 5GJGA 3PPKA 1FVVA 3X2QH 3WF8A 4E5AX 2GWRA 1TBXA 3EWHA 2R3JA 5E8SA 5H2UA 3QPLA 4XLCA 3OR2C 3UQGA 3OYMA 1ETOA 1HBXG 1T8IA 1JTXA 4EZ5A 1OI9A 1Z05A 3T0YA 3T1BA 4RA4A 3FK6A 4ZY4A 2OUMA 2CUFA 1Y8GA 2X7OA 3MS9A 4XV1A 2CKQA 1T39A 3AG9A 5GTIC 4B47A 5E8WA 4G3FA 4Z55A 2WXVA 4QQCA 4IDVA 4PY1A 2R92J 4XICA 2J90A 3DNEA 3BWJA 3RMFA 2JA7J 3C51A 1VQMI 3UPXA 4CCJA 1Y6IA 4QYHA 3TP0A 3L2CA 1QZYA 4Y52J 4XKWA 2XGDA 3MFUA 3K9TA 2XJ1A 2HVRA 3R7UA 1PYVA 2PZPA 4Q48A 2GCDA 1ZMUA 1BMKA 3ZFMA 4NZWB 3O23A 5FKNA 4G7ZF 3W18A 4LMYA 1J5YA 5DUIA 1OIYA 4IM0A 4JIKA 4BE0A 4M13A 3ZRKA 2M1BA 2ZV2A 5H20A 1HF0A 2RGPA 2EFNA 3PY0A 4MWIA 1E0EA 3DFAA 4ANJA 5HOOA 3DLLF 1OIUA 3RWQA 3MY5A 5HE2A 4G6TB 4E4MA 3FHNA 3F8FA 4MTEA 2YUSA 4YPSA 1JI8A 3RP9A 4YJOA 2GIVA 2VU3A 4O6LA 3GUDA 2DQLA 4U0YA 3EJ1A 1T0FC 2W1FA 2XZSA 2DUVA 4EH6A 5KNLA 3LQ3A 3OS0A 4TW9A 2R7BA 3LSIA 1EF4A 3PA4A 1O57A 3R30A 1PXPA 3JR1A 1XC5A 2XRWA 2WFYA 1SFXA 3BHYA 5FUTA 4FV5A 4BCMA 4MQ2A 3O8TA 2XIXA 3MVMA 3OXTA 2FD5A 2CN8A 4K18A 2BZJA 3WZEA 5CJ9A 2OXXA 2VTSA 5EW3A 3M8JA 3RCDA 2KP6A 5I9VA 4FL3A 3BYSA 1JSVA 2HYFA 4M6VA 3D94A 4KIQA 5C26A 2UWMA 4EHVA 1T33A 2FE3A 4JDHA 1STCE 1D5YA 4YFKF 2HELA 4QYFA 3N4MA 3HGGA 3HKZA 1YJNI 2H6DA 1ODDA 4H05A 5F4NA 4E73A 4F6SA 1NK3P 2M4GA 4ZTRA 4IJPA 5H6QA 1PJRA 2VWVA 4A3KJ 3OW4A 3FI8A 4AW0A 3ODZX 2OV7A 5TISC 3HOVJ 4FTIA 1XSVA 2OW3A 1ERDA 5FEQA 4GYIA 3LNQA 3ZCOA 3J7AY 4UVCA 5AIPA 4HPQA 4TT7A 4ONAA 1APLC 1H8FA 2IW8A 1Y91A 1QPMA 4Y95A 5AUXA 4AA4A 5FM2A 2JT1A 3P5JC 4X3JA 3RTPA 2HQNA 3OYIA 3P7NA 4KUMA 3AG4H 5BS6A 2ZO4A 4RQVA 3F3XA 2DK5A 4C4IA 2FBKA 4RZWA 2CQQA 5LLQA 5DGZA 4YO6A 3UO5A 2A5WA 2G9XA 2VTRA 2R7QA 3TOAA 1I6HJ 4XS2A 3C2HA 5J9ZA 3PJ3A 2ZFYA 4S30A 1P4FA 3DZQA 1LE8B 2PMZA 3GEQA 3BR3A 2C6MA 2OC6A 1SMYF 4ENMA 3D5XA 3F9NA 2C69A 1FEXA 3PWDA 4XP0A 2BV6A 1UV5A 4ACMA 3SGCA 2ZV9A 1XH5A 3ZN1A 4P5QA 1ZRCA 1BM9A 2RFEA 3K2AA 3I79A 1K7AA 4PDYA 2DYSH 3H0DA 1WJ5A 3FYKX 2KIFA 1P92A 2EQRA 4A2UA 1A36A 5HNFA 5JVTA 4XBRA 4Q9SA 5K4IA 4BGGA 1FQ1B 3HMMA 2XIYA 4PJMA 1QZZA 4OGRA 2H09A 3FMMA 3F5UA 2V5QA 4GCJA 5E3MA 5E1SA 5CF6A 3WTWC 4APCA 3Q6UA 2H8HA 2QKMB 5HBJA 3ZC6A 4X1EA 1WBPA 3BG5A 2UW8A 4JYKA 1IASA 2DA4A 5A4QA 4I22A 1YOMA 2YABA 3GCVA 4ZSAA 3DKXA 1TWHJ 3O5AA 1JTYA 5DR9A 5DLSA 5ACKA 1C0WA 4I98B 4XORA 4M67A 1WH5A 3UO4A 2GHLA 3WTVC 4BE2A 3CF5F 2WBMA 3Q5IA 1X3WB 1IXRC 4EJUA 5J1WA 3SXRA 3M3YJ 2UXXA 2A2AA 1XGOA 4IWQA 3CCLI 4FX3A 4QTBA 3NUUA 4UEUA 4PNIA 2X9EA 3BGQA 5LBQA 2WMQA 3CDIA 3PRIA 2IP2A 4YEJA 3SEZA 2R3KA 3A1YA 4DBXA 2ITUA 4AOIA 3FZOA 3ZMSA 4O6JA 5IYCJ 2ZCWA 2E9OA 4V2GA 2V62A 1BYGA 2DJIA 3I0OA 3KC3A 3MH1A 4QTCA 2WC2A 4XLNF 1WGXA 4JX7A 2CUEA 4Y5QA 1FINA 4IEBA 5HGIA 3NW5A 5L8KA 2K85A 4C02A 4X0MA 5HBHA 2ETMA 3VQUA 5AX3A 3PG3A 4FKSA 1O6KA 2X7GA 2O9LA 4ZTJA 3ERMA 2QONA 1JWHA 4I6QA 1SFOJ 2HYJA 1FOTA 4DEIA 4P9UA 3IWZA 1TP4A 4Y33A 2R3FA 3RPYA 2DI3A 4QMUA 3WE2A 2H1LA 3DTIA 5H6RA 4LB5A 3QPHA 2EILH 3LMHA 3DKFA 2W5HA 3GMEA 4CGZA 2JPCA 3Q3BA 3MPAA 2UZVA 3BEAA 4BKXA 4EQUA 5LVLA 2WGJA 4EYMA 3I4BA 5DH3A 3T3VA 1V0PA 2MH2A 5DPVA 2XAQA 4RRVA 3HMOA 2GA2A 4DHZA 3REPA 2GNJA 2F5FA 1F43A 4IXAA 3QYFA 3ZRMA 2FQ3A 4OMYA 3CPCA 2XC7A 3MY0A 5EEAA 4FVQA 5HODA 2E1OA 1Q8UA 1G59A 4MBLA 3ELKA 4CFVA 1G8XA 2L4AA 2XGXA 4YIRX 3C4ZA 4AZEA 1HKSA 4FVRA 1FX7A 2F2UA 1XH8A 4UBAA 1H1PA 2Y9QA 1UJ8A 4XCUA 2BEOA 1MRVA 2W5AA 2COBA 2WAEA 4L53A 1GV2A 4NKAA 3UIMA 3KZIC 3Q4CA 2ID6A 4LI5A 4PL3A 4XRLA 2LKSA 3S2WA 5CF5A 1G3TA 2VOOA 2KRHA 3O2MA 5ANOA 1S7EA 2ERZE 4QMYA 3C0GA 1AKHA 4I99C 4CUGA 5A4CA 1HC8A 4G3CA 4KIFA 2KIUA 3R61A 3VDXA 4OOIA 3GCPA 3TTIA 2HXLA 2DCEA 3P7CA 3E7OA 2UZNA 2PULA 1UHSA 3CUQA 3FMQA 4QPOA 1GT0C 1KV1A 1Q4LA 2L7KA 1U59A 1YKRA 4D28A 3ULQB 4OBPA 4Y17A 4AGWA 4L7SA 2VIXA 3QQUA 2PPQA 1ONVA 4RJ5A 2NRUA 4E4LA 3V8KA 1OL5A 2IVUA 3LQ5A 3CO7C 1GV5A 1IGNA 2CWEA 4RGRA 2R0IA 3GTQJ 2PHKA 3G90X 5IQBA 5CF8A 2DW4A 3B6CA 3G3ZA 3IOPA 2QG7A 4IX6A 1Q1VA 1R1WA 4F70A 1VZOA 3JTGA 2IPXA 5CEPA 2VO0A 2JPBA 3ZPLA 1B1BA 4OBQA 1OFCX 4L0ZB 1LVKA 2PMUA 2E2IJ 4G9RA 4AZWA 2XALA 5DIAA 2HY0A 3V4GA 2J6MA 3S2HJ 2QOIA 1B8IB 4XR6A 2TRTA 4GU6A 2PMNX 1TW3A 4I93A 4KN7X 3EFJA 3ORXA 1F3MC 1LDJA 5E3OA 3KVXA 2ITWA 4DH8A 2XK4A 1Y0UA 3ESWB 4FZDB 5HNBA 5JFVA 1X1BA 2HK5A 5AUVA 3MPMA 2VLAA 1YX5A 4HW0A 2CN5A 5KZ0A 2GZWA 1JGSA 2OJED 4E7HA 4DA5A 1H1QA 3K2ZA 4FEXA 1XN7A 2ISYA 3BR2A 2R5ZB 3DTEA 3A7FA 4P96A 5GTHC 1GZNA 2K9SA 3F2AA 2HOTA 2GSFA 4FNZA 2GU8A 4U97A 3D14A 3GU7A 2PEXA 2DFEA 2Z33A 2ZMEA 3FLNC 1MNDA 4BICA 1HW1A 3I59B 4H36A 3TCPA 3H0YA 5BQTA 4YIFA 5AV1A 4AP7A 4Y7NJ 3ID6C 3PWYA 2OK1A 2YM8A 3LFBA 5AUWA 3E97A 3ABTA 3QD3A 4A7CA 3QTRA 4P5OA 1G3WA 3DBEA 4PRJA 4C37A 4PDSA 3U6JA 4FT3A 4DW6A 1ZREA 2OQRA 1PXLA 3FC2A 3G0EA 4RC3A 3CQWA 2VX3A 4F91B 4J52A 4C4HA 4R5SA 3L8XA 3FLSA 2R3PA 3LLAA 5FP6A 3VBTA 5J9YA 2OFUA 2WOUA 4JR3A 4DYCA 4BBSJ 4F93B 4X6QC 3HGYA 5C4JJ 3HYHA 5AAFA 2J0MB 1BI0A 3ECHA 4EH9A 4AAAA 3TW7A 4ANLA 2IJMA 3A01B 3CTQA 3Q53A 3RNYA 4G6LA 3V5QA 2DOAA 4GT5A 2AYPA 1XJDA 4BXXJ 2UUEA 3HDDA 4IAIA 3OEFX 4LDTA 4IIRA 4YJPA 3FXKA 4B4CA 3BU3A 3T5XA 3S1MJ 5IA3A 2OICA 2HDCA 4RJ3A 4GJ3A 3PUFC 5KHWA 4PZJA 4YBJA 1MBHA 3ZLSA 5B2MA 4RWKA 4LGWA 3TKIA 2GQQA 3AAFA 3I4MJ 4P4CA 4O0TA 2QLQA 1OKWA 3U9CA 1RKTA 2EIJH 2GXAA 4U45A 3UDSA 1Q5KA 3E5XA 3SJMA 1H26A 2DQRA 1MQ4A 3G51A 4R1HA 1Z67A 4BCOA 2A1AB 2VO6A 4F9YA 3SD0A 3BY6A 3KRJA 4MXXA 2JA2A 3UNJA 3GFJA 1YIJI 2EJRA 4PQNA 2EFQA 2JD5A 4TWPA 5HNIX 2ZYBA 2CKEA 2OJJA 4L9VA 3NZ0A 3MGYA 4O6EA 2QENA 3FXRA 4HYEA 5AV3A 1JPAA 1LP4A 2PLYA 2BYVE 3U9GA 1PP7U 3CMYA 3AKKA 4QPAA 4FV1A 3DKYA 4FTTA 3H35A 1PRYA 5EHYA 4I4FA 3FKNA 3QC4A 4C34A 3W3CA 3VUIA 4IX7A 3HKZN 4HRIA 1G8SA 2DLLA 2B9SA 3L1PA 1FMVA 4CV9A 2X1EA 2WB1A 3O8PA 3JAMZ 2UZTA 3R1YA 1S7OA 2ZSIB 4RX7A 4E4XA 2X81A 3H9GA 3RSNA 1MRUA 2IGOA 4CMTA 4K9YA 1Y1VJ 2R7FA 4OTFA 5HO8A 1JKKA 1OYIA 3GCQA 2KL4A 1PUEE 1BOBA 1OVEA 3S00A 2NS8A 3POZA 5AUUA 4XBFA 1GXQA 4IOAF 5HU9A 3GC0A 4UV0A 3MIAA 3UIXA 3CJNA 1VEBA 4Q5EA 4D58A 1RESA 5CVUA 3KYDB 4ZLYA 1OUKA 4FL1A 4ZYGA 3U8WA 5H8GA 4QIWN 4FSTA 4E1ZA 5CNNA 4KA3A 2W1GA 2XAMA 2V1NA 2OU2A 4UXNA 4RLLA 2IVVA 5F1ZA 3FBIB 1TWGJ 4E6AA 3LM0A 4RC2A 3RJPA 1DQUA 3COAC 2Z3YA 4I2OA 4FEUA 4IRIA 3GNIB 4JQ8A 3NEWA 3CQZJ 4QYEA 4ZAUA 1FIPA 4FKRA 3OWPA 3D7TA 3M1CA 4A3JJ 3EUKL 4O21A 4Z16A 3VOEA 2IS4A 4AX8A 4YSJA 2CLXA 4USEA 4ZZOA 2YZAA 4LK1F 2EINH 2EUFB 4XK4A 2XYNA 2JFMA 3UMWA 1RI7A 2W85A 1FPUA 2DK8A 5LRRA 2FQ4A 3K3IA 1CGPA 3OYJA 3RGFA 4BRXA 4RZVA 1VQLI 2FOWA 3PG1A 1U5TC 1ACIA 4IHTA 1OIRA 2BVMA 4PV0A 2CO5A 3UZPA 2JJ7A 2HZNA 4ALVA 1F36A 1Z3XA 1IN6A 3O8HA 3K54A 4BTFA 3MVPA 4MHGA 2QCSA 5ICCA 1W1WE 3T3UA 4J00A 2Y8OA 1TW2A 4EQMA 2VQGA 5JN2A 2HU9A 5K5XA 3CC2I 2V22A 4F1TA 3RPOA 5LMKA 2H1KA 1YVJA 5E90A 3E6CC 4WRGA 3ONQA 2XGCA 4I94A 2XKFA 4NC7A 2K27A 4P1WA 5CXHA 2X1NA 2UZBA 2HENA 1DU6A 4RFYA 5JH6A 3BG9A 3OFMA 1H1RA 3LFDA 2EZKA 4M6XA 5AP0A 1W0TA 2XH5A 4ACCA 3RALA 2GNIA 3EL8A 4HNVA 1FBUA 5CU3A 2VWIA 4DDIA 4FNYA 4Y3OA 5E8VA 2M87A 3PLAE 2FSOX 4YUQA 5JRSA 5CSPA 4C7TA 1XMKA 5CAOA 1XSDA 4DIQA 2Z9OA 4FSNA 2EPFA 3GO5A 2RIOA 4LJZF 4WRSA 4X3FB 2JA6J 4MEYF 4EK5A 3FE3A 2HDWA 1GZKA 4FETA 4PJLA 3IH4A 4NKSA 4I0RA 5F0HA 5FBNC 1K2PA 3LFQA 1QVTA 2F57A 4CFXA 1MH3A 3KETA 4UB8C 3B73A 4QMQA 5A54A 2W4JA 4EUUA 4TYHA 2QSHX 1LFPA 3E87A 3F8CA 5AA8A 1OGUA 4OIQF 3AGMA 5JFSA 1UU8A 3R8VA 2PMIA 3TL4X 4ZTQA 3VF9A 3I1AA 4G34A 3VUDA 4KT6A 4ESJA 3CGFA 5EOLA 5CYIA 5D9HA 2B7EA 4RM3A 4EONA 4RB2C 3G9LX 2GMXA 4B44A 4OBOA 3IONA 3OS3A 3NNWA 2PG4A 1KE9A 4RIYA 4B48A 1OL1A 4DBNA 5BYZA 2M9HA 1KONA 1KE8A 1YHSA 1MBJA 2GLOA 3BX5A 4WBBB 3EN5A 1KE6A 4KIOA 2H96A 3EKNA 4MKCA 4IFCA 4O7VA 1ZHFA 4UUTA 4DGLC 5L2SA 1TFFA 3V51A 5FP5A 3PLSA 2V9KA 3UE4A 2V9PA 1IRFA 3IH2A 2VE9A 1OPJA 2BZTA 3VRZA 1AQ1A 4MWHA 4A3LJ 4EBWA 1IRXA 3PM1A 1VYWA 5IQDA 2Y0MA 4LM5A 4ERWA 5EM6A 2PUPA 2X6DA 5ANDA 1UA2A 4BDHA 2R2PA 1ZQ3P 1GNGA 4HCUA 4BJJA 2MLKA 4XLAA 4NFMA 1A04A 2E7WA 4BKJA 4EH7A 5JMSA 2YACA 4FKTA 5H3QA 2R3HA 1F5TA 3BYMA 3EUHA 5FO5A 2XUUA 4FA2A 4Q4ZF