3W0RA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n202a), ternary complex with amp-pnp and hygromycin b
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSANVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0rA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0rA02
5IQBA 3W0QA 3HAVA 4ORKA 2I7QA 4R78A 4R7BA 3TYKA 3UZRA 4O7OA 4U98A 3MESA 3ATSA 1ND4A 5IQAA 3W0SA 4R77A 3DXPA 1J7LA 5FTGA 3SG9A 2PULA 4BR3A 3SGCA 2OLCA 4FEXA 4H05A 4DE4A 2PUIA 5BYLA 4EJ7A 3FEGA 4DTAA 3W0NA 3W0OA 4FEVA 3Q2JA 1L8TA 5IQHA 4DBXA 3DXQA 3FI8A 4U94A 3F2RA 3HAMA 3C5IA 3JR1A 3TM0A 4FEWA 4DTBA 5IQIA 4DFBA 2CKPA 4FEUA 5EQPA 4DCAA 3G15A 2CKOA 5IQCA 1J7IA 4DT9A 4O7PA 2B0QA 3N4TA 3CSVA 4DA5A 3W0MA 2QG7A 5IQDA 3LQ3A 3TDVA 2IG7A 4GKHA 4CGAA 2PU8A 3TDWA 4DFUA 5C4LA 2PUNA 2PUPA 5AFVA 2PPQA 1J7UA 4N57A 4PDYA 4CG8A 5FUTA 5IQFA 4DT8A 5IQGA 3SG8A 4WZYA 3ATTA 3N4VA 3W0RA 4CG9A 3N4UA 3ZM9A 3W0PA 2PYWA 1NW1A 2Q83A 5EQEA 5EQYA 5IQEA 2CKQA 5C4KA 4GKIA 2BKKA
chains in the Genus database with same CATH superfamily
4CV9A 2PZYA 2XMYA 4ACHA 3MY1A 3O23A 2HXLA 4IMYA 3IOPA 5G6VA 4C0TA 4PQNA 4AS0A 5AM7A 3FY2A 3UOLA 2VWUA 5H8BA 4QNYA 4U9AA 4H36A 5LWMA 3OY1A 3PJCA 4QTAA 4BDIA 2JEDA 2HZNA 5M07A 4KIPA 2RF9A 4AZSA 1KE5A 1ZAOA 2BROA 4CV8A 1OZ1A 3EOCA 4L67A 4BICA 5FTGA 3V04A 3BHTA 1YDRE 5K4JA 4FI1A 3RPRA 4MKCA 4FV2A 3ORNA 3EKKA 4ZSGA 2YA9A 5A9UA 4MXXA 3QU0A 3M2WA 3QUEA 4J8NA 4HVHA 5IUGA 3VF8A 3FLZA 4O91A 1YOJA 1KE8A 3BE9A 3JY0A 3DXQA 4GSBA 5K5XA 4GU6A 1M7QA 2JDOA 3I0QA 2B54A 2QKWB 3LFBA 3P79A 1W8CA 2GU8A 4DYMA 1E1VA 3EN6A 3QRUA 4TXCA 4FSNA 2JIUA 4YNOA 2PSQA 5CQWA 3UOHA 4CRSA 3MFUA 4YLLA 4CFXA 5JEBA 3G15A 3PXZA 2WNTA 4CCBA 5KHXA 3FZOA 3KGAA 3PZEA 4LI5A 4PL3A 4K6ZA 5CI6A 5FM2A 3RNYA 4PL5A 3ZM4A 4IDTA 5HVYA 3GC9A 2X2KA 2QC6A 2VU3A 1Q3WA 3RGFA 1H27A 1H25A 2PVYA 2XUUA 5M4FA 4U6RA 5T3QA 4WG5A 4FYNA 5KMOA 3RHXA 2OIDA 4F7LA 4EQMA 5BMSA 2VTTA 3NEWA 4AT5A 3E8EA 1ZOGA 3C0HA 2OKRA 4ZIMA 2HY81 2RIOA 4EK8A 3R6XA 3PSDA 2ZOQA 3L8VA 3V51A 4DDIA 3IS5A 3MVLA 3NW5A 3PIYA 4BTFA 5LMKA 4L01A 2ERZE 3A61A 4RZWA 5BYYA 3V6RA 1RW8A 1Q99A 4M0YA 4UBAA 3ZRKA 5DR6A 1JBPE 2C4GA 4DDGA 3W2CA 3OP5A 4EH7A 2I0HA 4U3YA 4IDVA 4JX7A 1Q24A 1L3RE 3HNGA 3KU2A 4MXOA 4RLKA 4FTLA 4B6LA 1H1PA 2IVVA 3OBGA 3QQHA 4O7TA 4QP9A 1J7UA 3BGZA 4X3JA 5ETFA 4G1WA 3RPYA 4YHTA 4JDKA 1FVRA 1G8SA 3CPCA 3I0OA 3O51A 3UIUA 3EZVA 5IQFA 2CNUA 3AD6A 3PY3A 1OB3A 5IQGA 5ETIA 3GQLA 1E9HA 1LP4A 2GHMA 3PJ1A 4UY9A 4F09A 4NFMA 5BPYA 5ICPA 1ZYDA 2XCHA 3OW3A 3K3JA 1URCA 3C7QA 3QC4A 1REJA 1F3MC 5CVFA 5C9CA 4EYJA 4WIHA 4QP1A 4OTGA 4ZZNA 5KO1A 2W96B 4EZ5A 4QP4A 5IISA 2YDKA 2XNNA 1XBAA 4UXQA 4PTCA 4JQ7A 3QAME 5DBXA 3R9NA 3VUKA 2ITUA 3I60A 4BDEA 5JKGA 4ZJVA 3BLRA 2UW9A 4C2VA 5IQEA 4BCMA 5J8IA 2BZIB 3WF5A 2RFEA 3EL7A 3W0QA 3QD3A 2R4BA 1Q97A 4K8AA 4LG4A 4RBLA 5EI8A 3FV8A 4JDHA 1WBSA 2V7AA 4J52A 1OPJA 1OGUA 5A3XA 1IG1A 3D15A 3KEXA 1WBPA 2GTMA 3PJ2A 3P7BA 2RFSA 3MVJA 3PPKA 3NPCA 4YC8A 5TKDA 3ALOA 4BDGA 3VHEA 4ANSA 3UC3A 2X4FA 2XEYA 4R77A 3WZDA 2XP2A 4R1VA 5IUIA 3G5DA 2V5QA 3R1YA 4GT4A 1SYKA 2ZM1A 4YO6A 3TZ9A 3ORPA 4NW6A 3Q52A 2I0EA 4EONA 3OWJA 3FBVA 3LXNA 2C0OA 3LMGA 3TT0A 5HQ0A 2BALA 5JFSA 2J4ZA 3HV6A 2QOIA 4FIJA 4FSUA 4HGSA 3F82A 4M7IA 5I9VA 4BB4A 4MHAA 4A9TA 4ONAA 3HAMA 5BVFA 3HMNA 4RX9A 2VWXA 4EUUA 4FEWA 5JZJA 1CMKE 3GU5A 4IM2A 2C0IA 3KXNA 4FVQA 5E91A 3E7OA 3ZLXA 3MB7A 3N9XA 4KIOA 4L8MA 1IR3A 3FLSA 3UDZA 3R22A 4EEVA 1BX6A 1LR4A 4E20A 1WBWA 2R5TA 4BRXA 2OBJA 3AG9A 3LW0A 5AP5A 5D1JA 2WU6A 4U79A 4GJ2A 2Z02A 3UG2A 5FGKA 5AUYA 4E7WA 1NT2A 3MPMA 2CN8A 4FMQA 4ZEGA 5L2WA 4EHEA 2XK9A 1HCLA 2WQNA 3A7JA 3WIKA 3ZLSA 4I0SA 3G33A 5HU9A 1M2PA 2DYLA 4U8ZA 5KE0A 3T9TA 2WTKC 2VTNA 5EM6A 2QO9A 2AC3A 3EQHA 4Y72A 3KMMA 4YJQA 5JH6A 3CLYA 4DTKA 2ITVA 3DCVA 3UVPA 3QLGA 4IADA 3KRRA 4I5MA 4JJRA 2IW9A 3LMHA 3ZSGA 1IRKA 2YCQA 3DT1A 3CGOA 3F2NA 3F6XA 1IAJA 5DRBA 3VHKA 1JKLA 1E1XA 4FOCA 2G2HA 3FPQA 2XZSA 3UGCA 3TUBA 4HCVA 4G3EA 2IVSA 5H3QA 5LCKA 3D7TB 5FXRA 5TF9A 2PUPA 4BTKA 2FUMA 2PVJA 4PL4A 2JDTA 2UW0A 2X8DA 3T9IA 5DT0A 4O81A 4ALVA 3HDMA 3LFNA 4O22A 3GU6A 4E6QA 3GXLA 4JRNA 5FEDA 3IOKA 1GIJA 3MW1A 3FMKA 1BKXA 2RG5A 4YJRA 3PWDA 4C34A 4TWCA 3QQKA 1ZOHA 1RQQA 2R3KA 5DE2A 3NUNA 4AW5A 3WIGA 1Q3DA 4HOKA 4W8EA 5E1EA 4ZLZA 3PWYA 2IVUA 4FC0A 4YP8A 3KXMA 3R8PA 3RCJA 3ATTA 4ANMA 4LDTA 4B4LA 3BYMA 4ASDA 2XK6A 2ITTA 2QHNA 2VGOA 3BLHA 3DB6A 3LFSA 1PYEA 3AD4A 3OWKA 4FSZA 4LV8A 4BIEA 2KULA 2NO3A 3UIMA 2BFXA 3QUDA 2YIYA 3FMDA 3W32A 1TFFA 2OJJA 4FIIA 4FIEA 2C6DA 3RPOA 1CTPE 5A4EA 5DRDA 1ERKA 3AC5A 3QRJA 2ONLC 2C6IA 2WTDA 3LLAA 1FOTA 4ORKA 4YBJA 4I3ZA 2YM5A 3QCSA 5D10A 2LGCA 5LARA 4EK3A 2GDOA 3MESA 4G6OA 2XF0A 3NIZA 5FG8A 4C33A 1FGIA 3I5ZA 3ATSA 4MXCA 4YJVA 4IVBA 4O0SA 2IVTA 2B55A 2PVHA 3Q4TA 3UQGA 4O7LA 3I7BA 4D4RA 3I6WA 3FZTA 1YRPA 3EYHA 1PMUA 4U81A 2OJ9A 2B53A 4KKGA 4YNEA 4OTWA 3TTIA 2R3HA 4TPTA 1BLXA 3H9FA 4E6AA 4BCNA 4PUZA 5HIEA 4YZCA 1JKKA 4YLJA 2E2BA 3OXZA 4MQ2A 4QMSA 2C3KA 2ONLA 3C0IA 4HVDA 3S00A 4NK9A 5I4NA 1WZYA 4DTAA 4ENYA 1Y8GA 3GOKA 4J98A 5HNGA 3BBTB 3RP9A 2GNLA 4WRGA 2C6KA 3R73A 3WBLA 3KREA 3EYGA 3JPVA 4FKRA 5LMBA 3UNKA 3UO4A 4BHNA 3AT2A 4A07A 3QUPA 3WE8A 3ZXZA 3O8TA 1DM2A 4DFBA 2XANA 2REIA 3IW4A 4O2PA 3PTGA 4XYFA 3PXFA 4U40A 5E8SA 5LMAA 1J7IA 5HD7A 4JT3A 4KBKA 2F2UA 4RJ5A 2J51A 3KA0A 2YZAA 4AZFA 2ZFYA 4CKRA 2F7ZE 3A8WA 5HO7A 4DFNA 3DTCA 3F61A 3QTXA 4IJ9A 3POZA 4L9IA 4XHKB 4Y85A 1J1BA 4NUSA 4ZSLA 5BVKA 3R8ZA 3UDSA 4C4EA 3QTQA 4YTCA 3VBYA 2BUJA 1ZYLA 3IK3A 2OU7A 5L2IA 1H1RA 3QTWA 5F95A 4DH5A 3ZUVA 3ULIA 2YWVA 2C0TA 4XLIA 1KOBA 1BMKA 3RWQA 5KZ0A 3IW5A 5JQ8A 1GZ8A 3D5UA 1G3NA 2W1GA 3BYOA 3MTFA 3QFVA 4FA2A 4Y8DA 5TO8A 4HVGA 3FI4A 1GIIA 1XH8A 4OTFA 4W8DA 4LOPA 2WEIA 2B9IA 2EXCX 2JKKA 3ERKA 4ZP5A 4FZFB 4CTCA 1PRYA 3PYYA 1HCKA 4FICA 3B2WA 5C1QB 4CG8A 4QOXA 4OBQA 2UW8A 4FYOA 5HNIX 5AP3A 2XALA 1B6CB 3F3WA 1Q8YA 2ZVAA 4ZSJA 2HIWA 1G8KA 4LL5A 4S33A 2XK8A 4W4WA 1ST4A 3SRVA 4QTEA 3S2PA 5ETAA 4F65A 2GMXA 2H8HA 2YIQA 1QMZA 3RWPA 3VS4A 1YDSE 3C1XA 3OWPA 3QGYA 4K2RA 4DEHA 5GINE 2FSLX 5BUIA 4QMLA 1OVEA 4FTUA 4XNEA 2VWYA 2XJ0A 3MFRA 5DEWA 2B7AA 3ZM9A 1WVXA 4FIFA 5ACBC 4L00A 2XIZA 3QXPA 2P55A 3BI6A 3BHYA 4NCTA 4YSJA 5CAOA 5L2SA 2XIKA 3K5UA 3JVSA 4DGLC 3FE3A 4YJOA 5T6KA 2XRUA 4QYFA 4S31A 4RWIA 4I5CA 4DFZE 4GJ3A 5BVNA 4KS8A 3ZBXA 1QPDA 3LFDA 5CAUA 1J3HA 3NW6A 5EG3A 3V6SA 2R3RA 4RGJA 3DXPA 4WNOA 4WRSA 1Q41A 4GIHA 2W5HA 3MIYA 4JBVA 4RVTA 1YVJA 3W2PA 4OBPA 4FTCA 1AD5A 5I9YA 3PLSA 2PUIA 3CKXA 5K3YA 2FYSA 3ZBFA 4O7WA 2XEZA 2UZOA 4EQUA 1P2AA 2OSCA 4R1YA 1L8TA 3BIZA 3R63A 4KB8A 4DFLA 4M69B 2YJRA 4WA9A 4G17A 2PK9A 4ZXTA 5CSPA 4HGEA 4XH6A 5JT2A 3R9RA 2DUVA 1PKGA 3R7EA 3HEGA 2ESMA 3FHRA 3OCGA 3PUFC 2V55A 3Q2MA 3QA0A 4FUXA 2QO7A 4PNIA 2JITA 4YC3A 3NUSA 3RK9A 2VGPA 2W17A 5CEOA 1ZZ2A 4GUBA 2C3IB 4FEUA 3O0GA 2VTPA 2QKRA 3BQRA 4IB3A 2VTOA 4H1MA 3NZ0A 4L44A 5DOSA 2W0JA 1PMNA 5FBNC 4FTNA 3LCOA 5B2MA 3AC8A 1R0EA 1J91A 3E64A 4HYHA 1PF8A 4E73A 3FC2A 4HCTA 2BZJA 5IU2A 4NM5A 1YOMA 2XA4A 3EFJA 2VTRA 3ETAA 2XNGA 3P0MA 3FKLA 3QZHA 5CEPA 3FLWA 3EQRA 3DFCB 3A62A 4YPSA 4MXZA 5FXQA 3L9MA 3P1AA 2P33A 3SOCA 2C5YA 3R1SA 2WD1A 2FO0A 3LFCA 3UOJA 2ITQA 4BDJA 2P4IA 3NGAA 1XBCA 3VONA 3EQIA 5IG1A 4AQCA 3CD8A 4S2ZA 2ETMA 5DNRA 4NWMA 2X0GA 3D4QA 3R9OA 4FVPA 4UEUA 4NM3A 3OWLA 3DBCA 1PMEA 2BHHA 3U54A 1YWVA 5JGAA 2YWPA 3QQUA 4C7TA 4H3PA 2KTYA 3H3CA 3QBNA 3QD0A 2B9FA 3TZ8A 4MXYA 3S1HA 4ERKA 4WD5A 4AG8A 2X7GA 2BFYA 4MEDA 4TYIA 5GHVA 3DTWA 4GUEA 4QPSA 3OROA 2F49A 2XARA 4X3FC 1OGYA 4YJTA 5FP6A 3BYVA 4OLIA 3KMWA 2ZYBA 4U80A 5AV1A 3SA0A 3D0EA 3FLYA 4FSQA 5HE3A 4FKUA 2X7OA 4DGNA 5K5NA 2WMAA 2PE1A 3QTIA 1W98A 2PVMA 4HGTA 2A1AB 2GQRA 1H4LA 3DQWA 5L3AA 3R21A 3WF8A 4BI2A 3V8TA 3EIDA 5EQEA 4ACCA 3RK5A 4E4MA 2WTKB 3W2OA 3CIKA 4Q5EA 2IN6A 2X1NA 1NVQA 3P7AA 4I24A 3ZO2A 2GFCA 5H2UA 4JBOA 5L6OA 2I7QA 3V8WA 4ZS0A 3SOAA 4FEQA 4G3DA 2C3LA 2ITWA 3GBZA 4XG6A 5GJDA 3TYKA 4X3FA 3L8SA 4AXCA 4IAKA 1UU9A 4KWPA 4FSMA 2RKUA 5CZHA 4C2WA 5DI1A 1MRYA 4CKIA 4MNEB 3WOWA 2HW6A 4EYMA 2WQEA 1T46A 2XKEA 1W7HA 3E92A 3PG3A 2EUFB 2YACA 3ENHA 3SG9A 1DI9A 1PXPA 4RG0A 5AWMA 4F0IA 1BI7A 1YHSA 4KKHA 5L8JA 1JPAA 3VUDA 5BUJA 4BGQA 2C47A 3Q6UA 4YJNA 4DHIB 1PXOA 3HUCA 4I6BA 5KKRC 1ZOEA 4QMTA 4C58A 1Q61A 3EZRA 3VBWA 3LFEA 4F0FA 1JLUE 4CFMA 4XG3A 5CSHA 2YM6A 4U3ZA 4C4GA 4FX3A 3E87A 4PDSA 4R7HA 3P4KA 4A7CA 5CEMA 4KBAA 3F2RA 2CLQA 5EM8A 4E4LA 2JDSA 4IB1A 4CD0A 5IDPA 2R3MA 3SW4A 2XJ1A 3D2IA 4ENXA 1XBBA 3C51A 4M3QA 4FTTA 5LVNA 4ERWA 3QALE 2ERKA 3UVQA 3COKA 5ANJA 2WMVA 3CEKA 1OPKA 2YM4A 2Y4IC 4A9RA 3ZSHA 3QL8A 3R30A 3TZ7A 4J97A 2YM3A 5B2LA 3DLZA 3HMIA 4M67A 3IPHA 3UZPA 4RC3A 2HWOA 3OUNB 2FSTX 4A4OA 4YTFA 4UB7A 4O27B 4OTHA 4EZ3A 4IAYA 4XS2A 1NA7A 4OTIA 3PVBA 4C02A 5CQUA 4F7NA 4V05A 4TW9A 1GAGA 4FG9A 4IB0A 4JAJA 4IAZA 3UYSA 3TDWA 4RIOA 4NYEA 3SV0A 5DH3A 4MYGA 1ZZLA 5CY3A 4GU9A 5CU4A 3AT3A 3ZFMA 5EOLA 1Z5MA 3GENA 4LRKA 4RFZA 4CQEA 3UVRA 3AGMA 4CZUA 2ITYA 3UQCA 2W1CA 3D7TA 3WZJA 4TYEA 3V3VA 3ACJA 5KMMA 3NYNA 2J6MA 4PDYA 5FD2A 2E9UA 1J1CA 2IW6A 3KXZA 3HP5A 1ZARA 2XYNA 2ZB1A 4JQEA 4LMNA 4RJ6A 3QKMA 5DT3A 4ARKA 5JGBA 3SW7A 1DI8A 4N6ZA 3F5PA 4ITIA 4J96A 1ATPE 2V7OA 2Y7JA 3KC3A 4QYEA 5DVRA 3T3UA 3IG7A 5HE1A 4AWIA 3MDYA 3DOGA 3PXKA 2H34A 2PE2A 3D83A 3TZMA 4AFEA 1LEZA 3W0RA 1YWRA 4PMTA 2VTHA 4KA3A 2OH4A 1REKA 3F3UA 2OGVA 3R8VA 3Q32A 3OT8A 4JQ8A 5JN2A 3UG1A 3BL7A 4AZEA 1YW2A 3VUHA 3U6IA 3AT4A 4BDAA 5LXMA 5HHWA 4PMSA 4NW5A 1XHAA 3DY7A 3R1NA 4XP3A 2VTSA 3HMOA 4CFUA 4EKLA 2GHLA 4FKLA 1S9IA 3QZIA 2AC5A 3PP1A 2A27A 3CY2A 2BTSA 4R3PA 4U97A 4USFA 3ID6C 3U6HA 4G9RA 4IB5A 5IQAA 2WEVA 3D9VA 4LGHA 4QQJA 5KMKA 1PY5A 1KUTA 2BDJA 3BZ3A 5LVMA 4E6DA 3NAYA 4QP6A 1SMHA 3E88A 1YKRA 1NVRA 4AA5A 5KX8A 3PG1A 4RIWB 4BCKA 2B4SB 5AP7A 4BBMA 1O6KA 4XG7A 5BYLA 2X81A 2VO3A 4O0WA 3AMBA 4K33A 3R01A 5AM6A 1OBDA 3VIDA 2HXQA 1XH6A 3COMA 4JG6A 4LRMA 5GNKA 3FKNA 3SDJA 4ASXA 4CTBA 3W0NA 1H1SA 3CE3A 3Q2JA 5CU3A 4D1XA 3ZYAA 4RIYB 5HG7A 3BL9A 3VBVA 4AGCA 4D1ZA 4U7ZA 3OF0A 4G6NA 2WELA 2ITZA 3PDTA 3TI1A 3EH9A 4AW1A 4BCJA 5TR6A 2YCFA 4FT3A 4NFNA 2X9FA 5E7RA 2V22A 5M55A 2UV2A 4IM3A 4JBPA 2CN5A 4QMQA 4RX7A 4TYGA 5CF8A 2H96A 3LHJA 3R02A 1H08A 2WTJA 4O7PA 3OD6X 4I6HA 1SNXA 2OJIA 4J8MA 4MWIA 5AIRA 2VD5A 2VWWA 5CT0A 3II5A 4EC8A 4D2SA 4V01A 4BCHA 2ZM3A 5BV3A 1OIUA 2CCIA 3CJGA 4C3FA 3FZ1A 1FMKA 3PFYA 3PJ8A 4FKSA 4DEIA 4YBKA 3RAKA 4EKKA 4ZTNA 1QPJA 2FSMX 5A54A 4GKHA 1NVSA 4FNXA 5A4LA 2J0MB 2W1ZA 2R3JA 3HA6A 1YI4A 5E4HA 3RI1A 4RQKA 3HMMA 1P14A 5E8ZA 2O0UA 5C4LA 2R3PA 4Z16A 2WZJA 2IW8A 3R8MA 4FIHA 3MVMA 3R2YA 4WKQA 1JVPP 5IPJA 3PPJA 4AP7A 1R39A 4XG9A 3VQHA 4D28A 5ANOA 3NUPA 2WXVA 3CS9A 4EC9A 4IX5A 3R2BA 3ENMA 4QMMA 2CGVA 4JXFA 2R3GA 4ALWA 4HZSA 1K2PA 2B9HA 4V04A 5CENA 4UX9A 1U5RA 3UZTA 5EDQA 4EH8A 5KNJA 1KE9A 2IPXA 5EM5A 3OHTA 4FT5A 4E5BA 3TV4A 2WHBA 4O7NA 3RAHA 4O7VA 2BKZA 2QI8A 5TT7A 4I21A 2E9NA 5AV2A 3BBWA 3OY3A 3QYWA 3NNXA 1RE8A 4G31A 4GMYA 4B9DA 5CNNA 5F9EA 2WMSA 2Y6MA 4MK0A 5I0BA 4APCA 2OI4X 5LVOA 4FV1A 1YHVA 2CKQA 1XMLA 4FTOA 3UOKA 3ELJA 3PVWA 5DG5A 4EUTA 3LZBA 2VN9A 1BUHA 3HLLA 3PE2A 4FZ7A 3QKLA 3T3VA 1QPCA 2CNQA 5F4NA 4AN3A 3BPRA 3EQGA 3RHKA 2G2IA 5L8KA 1F5QA 4UALA 3N51A 4CCUA 1KWPA 2P3GX 4FOBA 3DA6A 3LCSA 4GRBA 4QP8A 2CGUA 4Y83A 4PV0A 5EKNA 4QDVA 3F5GA 4FK3A 4FSRA 4FV7A 4JX3A 3DDQA 1M2QA 3MY0A 4ZTMA 3NR9A 3M42A 4FKIA 1Y6BA 5CVHA 3EB0A 3I1AA 3MTLA 2IZUA 3LJ2A 2CDZA 3Q53A 4IBMA 5EDPA 4ZLYA 1PJKA 5C8MA 4JI9A 4P5ZA 5JFVA 3PRIA 3Q6WA 3PPZA 4C59A 5CF6A 3F66A 1BYGA 4XRJA 3TIZA 4PP7A 4QMNA 4O0UA 3FLNC 5EHLA 5HCXA 3COIA 2CLXA 4X3FB 2C5VA 2PZ5A 2XYUA 2XAOA 5HEZA 3O7LB 3K5VA 4GW8A 5GIPE 3FYKX 3A60A 4AGUA 3DNEA 1G8AA 3GCQA 4J99A 4O7ZA 4GCJA 4WG3A 4YZBA 3DLSA 1R3CA 4BDFA 2P2IA 4UXLA 2XIXA 2QOCA 4YJUA 4TYJA 1V1KA 4GK2A 2JKQA 3AD5A 1K3AA 3G2FA 3GGFA 3ML1A 4XOZA 3L1SA 3AMAA 4N6YA 4DCAA 3U51A 3LM0A 3MIAA 4WUNA 4U0IA 4G3CA 3JS2A 4MCVA 4F63A 5AADA 4RX5A 2J5EA 5BUEA 5HD4A 5L2TA 4RFMA 3NW7A 3CD3A 4P90A 3SAYA 3C9WA 3DAJA 1XO2B 4GH2A 4MBIA 3TJDA 2OIBA 3MFTA 5AMNA 3DNDA 3CSVA 3RPSA 4XBUA 2OWBA 3T8OA 3WI6A 3L9NA 3O5AA 4H3QA 4DA5A 3VQUA 3HA8A 5HZNA 4FKQA 5K9IA 2CMWA 4OTRA 4JBQA 4RFYA 4DG0E 1TQPA 4BZNA 4YGAA 3WF6A 3DKCA 3ZLWA 4M15A 2VTMA 3NRMA 4PDOA 2JC6A 3KXHA 3ZO1A 4CGAA 2UVYA 4D58A 4WG4A 3BU6A 3ZFXA 4AF3A 4J95A 5KKRB 5EI2A 2C6TA 3KULB 4GG7A 2RGPA 4I4FA 2QHMA 2YDJA 4GVJA 1Q8TA 4FTRA 1KE7A 4BZOA 4F9BA 3LFQA 1UKIA 3QZGA 3UQFA 3L9LA 1H00A 2R0UA 1KE6A 3FJQE 3KFAA 3PRFA 4IIRA 4NJ3A 4TZRA 4ZSAA 3QX2A 3KVXA 3A7HA 5ANGA 4DC2A 5HCZA 3AXWA 5CNOA 3DJ5A 2GQSA 3A7IA 5B0XA 2YAKA 5M51A 2C5OA 2QLQA 2ETKA 3SG8A 4CFNA 4JG8A 1ZWSA 4O82A 5E8VA 4LMUA 2Y4PA 3GFWA 4X21A 3TNHA 4BCQA 4YJPA 2PMNX 3PVGA 4L7FA 4GYIA 3LXLA 4NJDA 4QMZA 2Y4IB 4XV3A 2OG8A 1VEBA 4F7SA 3HDNA 3TKIA 5M53A 2PUUA 3IKAA 2CPKE 3ET7A 4G3GA 1FVTA 5EDRA 2X8EA 4RIXB 1PXLA 2YM8A 4Z7HA 2YISA 3KRLA 1UV5A 4FE2A 3BKBA 5G1XA 4OGRA 1DAWA 5AJQA 3GT8A 3GC8A 3HECA 4MH7A 3W10A 4RWJA 5J1VA 2ACXA 5CXZA 4C37A 3HV4A 4CSVA 2W1IA 3VWAA 4BDDA 4CT2A 5E90A 5FDXA 3VW8A 4ZJJA 4S30A 4WO5A 4LFIA 5A6OA 5J7HA 2VWIA 4U98A 3F5UA 2WMUA 5CAVA 1YQJA 3TKHA 3S0OA 1ZLTA 4DEGA 4WNKA 4I6LA 4HNFA 3GUBA 3G6HA 1OL2A 4BN1A 3QA8A 5M08A 1Y57A 4L45A 4D0WA 3NVKI 3NNWA 5A4TA 4JIKA 5J9LA 4ALUA 3VC4A 4DEAA 1H01A 4CKJA 4XX9A 3ODZX 4MNEA 2OLCA 2R3LA 2QOFA 4RLLA 4ACDA 3BGPA 4X2FA 4WSYA 2FH9A 3NMUF 5HBEA 4O2ZA 5HLWA 4RPVA 4QQCA 4EORA 3C50A 1Q4LA 4FTMA 2YIXA 5CU6A 4ZTLA 5IMXA 2WOTA 5A4QA 2O63A 4JMQA 3TM0A 3KXXA 4FKWA 1P4OA 2UZLA 3BU5A 3R00A 5BX0A 3HVCA 2UZWE 2WIHA 4XV1A 2VTAA 4IZ5A 3ORTA 2X39A 1GZNA 4Y73A 4PY1A 1OKVA 2I1MA 2R2PA 1B39A 3OC1A 1B38A 3LFFA 4B99A 3DKOA 4ACGA 2VO6A 3NNUA 3EL8A 3TXOA 4DGMA 4TWOA 3FMLA 3TNQB 3ZSIA 3R83A 3ZXTA 4U42A 3QWJA 3MPAA 3IGOA 3Q5IA 2XK4A 5HO8A 5CU2A 1AQ1A 3PY1A 1U54B 2NRYA 3N4TA 4IANA 3DU8A 2VWZA 3TNWA 1ZYJA 3VBTA 2NPQA 4K9YA 3I4BA 2VO0A 3OBJA 3OG7A 3B8QA 1W0XC 3Q9XA 3H9OA 3HV5A 4FUYA 5E8TA 4EOQA 4O84A 3BX5A 5M4CA 3C4CA 4MTAA 4IFCA 3F3TA 1YXXA 3NYOA 4TY1A 1A48A 4F70A 2W1DA 5FLFA 4K18A 1JSVA 3ZUUA 4TYHA 4YSMA 2R3OA 4DHZA 5KBQA 3ZH8A 3NIEA 4E5AX 3MGYA 3L8XA 2PUNA 4QRCA 5IUHA 1WBTA 3GEQA 4FTAA 3O8PA 4XBRA 5HTBA 4E8AA 3V8SA 3AC3A 4NTSA 2DWBA 2BRMA 3BU3A 5CEIA 4AU8A 4B0GA 3FMMA 4AOIA 2CGXA 4O0VA 3MSSA 2O65A 2R9SA 4N57A 4KSPA 2QU5A 2UVXA 3ZONA 4RSSA 4IVAA 5GIOE 4BBFA 4BDCA 3LCKA 2VV9A 3FKOA 3QZFA 4QMPA 4XEYA 4MD9E 2GQGA 2JFLA 5AV3A 2QOBA 2G15A 1XMMA 5EOBA 4EOPA 4G3FA 4IX6A 2PMIA 5M4IA 2H9VA 4QYYA 1V0PA 3UPZA 3GU7A 3RINA 5FEQA 2VTIA 4F0GA 2EU9A 2Y0AA 5KCVA 4V0GB 3CCNA 4O0YA 3ZLYA 3IW7A 5DN3A 5EFQA 5JRSA 4FTKA 2QOLA 3OMVA 4E93A 3EMGA 1ZY5A 4YZMA 4KSQA 2UZDA 3PY0A 3V5JA 3VUGA 4U43A 2XRWA 4ZTQA 4BJJB 2BRHA 4P7EA 3AKLA 4YTHA 4CRLA 1UA2A 3R04A 1VZOA 1TQMA 3BEGA 3MV5A 3EQCA 1PXJA 2UW6A 3I79A 2XIRA 4FTIA 4R78A 5EW3A 4EBVA 3FMEA 3G9NA 4D2RA 3Q9ZA 5J1WA 1UU8A 2J2IB 4FT7A 2OFVA 2X6DA 2YJSA 3GCPA 1IASA 2W1EA 3ROCA 3R8LA 4L7SA 2QOKA 5HG9A 3TTJA 2F2CB 4X2JA 3CPBA 3ALNA 2VWBA 3KMUA 1O6LA 4QPAA 3UDBA 3R7OA 3FDNA 4MWHA 4BIDA 4N70A 1PXKA 2YN8A 3LCTA 3FL5A 3VS1A 2UZTA 2XVDA 4HPUE 3ZU7A 2UZVA 5M06A 5HVJA 3R7UA 3QRIA 2GCDA 4RIWA 3G0EA 1KOAA 3A4OX 4W4VA 4AGDA 3G9LX 3W0OA 3RNIA 3RPVA 4DBXA 3FI8A 1STCE 2OZOA 3V5WA 5BMMA 2JGZA 5C27A 2NRUA 1XWSA 3JR1A 4FKOA 3DFAA 1JWHA 2FGIA 2NP8A 3QC9A 4RIYA 4H3BA 3MWUA 4GFOA 4U41A 2VO7A 5IH4A 1OL7A 2RG6A 4BC6A 2GSFA 2PMLX 3KRWA 2CKOA 1PHKA 2CCHA 2OIQA 1OKZA 2FA2A 3ZS5A 3VW6A 3EQDA 4CVAA 4FTQA 5AUVA 2B0QA 3PJ3A 3O2MA 5AP1A 5IMEA 3R8UA 2B1PA 2C1BA 4GYGA 2OF4A 3GU4A 4FVRA 1W83A 2PY3A 4HCUA 2J7TA 4I20A 2UZUE 3IW8A 4YU2A 4WNPA 3GNIB 4M14A 2C5NA 2E9PA 2C6OA 4EH4A 5HG8A 1GJOA 2FVDA 3HRCA 3COHA 2ITOA 3M1SA 3VULA 2Q0NA 4BDHA 3OTVA 3OZ6A 2WMXA 1Z9XA 4BYJA 2GNJA 5LCJA 4RWKA 2HOGA 3P78A 4XJ0A 3AC2A 3K54A 5HE0A 5FM3A 3QKKA 2WB8A 1BI8A 4TRLA 4BI0A 2F4JA 4JRVA 3KN6A 3IDBA 2OF2A 4ZTHA 4TWNA 4KNBA 1TVOA 2ZAZA 4U45A 3VS3A 4ASEA 5BNJA 5HBJA 4XRLA 4Q9ZA 3RKBA 2I0VA 5A46A 1MQBA 4IH8A 1OIRA 1TQIA 3FPMA 2PVNA 3OVVA 3TCPA 2PHKA 3UIXA 4FKGA 3BQCA 2CJMA 4NZWB 1KSWA 1VLRA 2YDIA 2YIWA 3NNVA 5E8XA 3WYYA 1YDTE 3QHWA 3OW4A 3DS6A 3WZKA 3PVUA 4QEBA 4BCOA 4AT3A 3DKGA 5EI6A 1H8FA 4Y46A 3QX4A 4PDPA 4BF2A 2V62A 5F1ZA 4A9SA 2IZRA 1WFCA 5HG5A 4MAOA 1NW1A 2Q83A 3ORZA 3D7ZA 5IA3A 5AV0A 4BDKA 5IF1A 1JSUA 5HCYA 3MBLA 1OL1A 2BRBA 2J0LA 3LIJA 5HX6A 1OPLA 4E5WA 1H07A 1IEPA 2VAGA 4J71A 5FRIA 3SXFA 2BILB 2XBAA 4JR3A 3S95A 1GIHA 3NDMA 4UZDA 4BGGA 1ZY4A 3W18A 2SRCA 4G2FA 2Z7SA 5BVEA 3TJCA 1OL6A 2B52A 1CSNA 2W05A 4GK3A 3SXSA 3RCDA 3PXQA 2VWVA 3NFFB 4CNHA 3VRYA 1OECA 5JRQA 2XH5A 3CTQA 5ANEA 3ULZA 3FMNA 5B2KA 1JNKA 2GTNA 2W1FA 4LOOA 5CALA 2PL0A 4YMJA 4EK6A 3PSCA 2X9EA 4K1BA 4DEEA 4DEDA 4BVUA 4EOLA 1VYZA 4D0XA 3I81A 4CFVA 3ROYA 4QQ5A 3AKJA 3TIYA 4RC4A 3HKOA 3BYUA 1G5SA 2XKDA 3P9JA 5ANKA 2HAKA 1I09A 2XM8A 2UZNA 3CQUA 3VBXA 3DKFA 3C5IA 4W4XA 2EVAA 1U46A 5IH5A 5CS6A 3OOGA 4DTBA 3ZEWA 1CM8A 3DXNA 5DLSA 4FZDB 5EYKA 4AGWA 4DH3A 3H30A 5DWRA 5HESA 1EH4A 2V0DA 3RVGA 3WE4A 2CNVA 3OTUA 2OJFE 2QR8A 4MVFA 4DT9A 3OCTA 3DDPA 4FKTA 4RC2A 2QODA 2HW7A 2VTLA 3GC7A 3SHEA 3SX9A 1YI6A 1PYXA 3D14A 4D4SA 4LV7A 2W9ZB 3KRXA 4JVGA 3O7LD 4IVDA 4DGGA 3U4UA 4EH6A 2OJGA 2W7XA 2J50A 4YUQA 3ORLA 4AACA 5M57A 5H9BA 2PVKA 3GC0A 3W0MA 5HTCA 3FZRA 3ZRMA 4PRJA 1H28A 4FKPA 3ZZEA 2PVFA 4D9TA 4FODA 5M56A 2XAMA 3TDVA 2W99B 2BRGA 4AZTA 4FNYA 4BTMA 4BCIA 2RFNA 5I9ZA 5J5SA 3LKMA 4O83A 1CKPA 1SVGA 4FL3A 4I22A 4Q9SA 1Q8WA 2Z2WA 4I5HA 5A14A 4NH1A 1FVVA 4QNAA 1APME 3THBA 4GFMA 5AP4A 2XKCA 2IZTA 4FBXA 2Z8CA 3FHIA 1XR1A 4EWQA 4WUAA 3LQ8A 3KULA 3E5AA 4IZYA 5HLPA 5HNBA 4D4VA 2CGWA 4D9UA 4IAFA 3FZSA 3ORMA 4ZJIA 4ANLA 1M17A 3E7VA 4O0XA 5AA9A 3UJGA 3F3VA 5IA4A 2ZJWA 3KQ7A 2BVAA 3NAXA 3KKVA 3IONA 3R71A 4TYHB 1GZKA 3C4XA 4WZYA 2YM7A 4M0ZA 4S32A 3IDPA 3UODA 3QCXA 1Y8YA 4LGGA 4UWYA 1WBOA 3H0ZA 4BHZA 4M13A 3FSFA 3HV3A 4EJNA 3O71A 3QTZA 4TWPA 5D7AA 3SQQA 4CG9A 2O64A 2JDVA 4FT9A 3W0PA 3KF4A 4I0RA 2A4LA 4JNWA 3UC4A 2BPMA 2Z7QA 3HMPA 5C4KA 4PMMA 2XK3A 4NM7A 2O5KA 4FSYA 3MH0A 4PX6A 3OXIA 4RIXA 3ZRLA 5JFXA 4YURA 2ZV9A 3EN9A 4X2GA 2ZM4A 2GNFA 3U8WA 1ZYCA 2VX3A 1K9AA 1P5EA 2ZB0A 4QMXA 4H39A 5DA3A 3U9NA 4C35A 4EOKA 4F9CA 5M09A 2CSNA 1WMKA 4ZY4A 2VZ6A 5FQDC 4UWBA 3W0SA 3W8LA 2XNPA 5I9XA 2YZLA 1J7LA 4CMTA 1OI9A 3CC6A 2WQMA 3Q4CA 5D9HA 3ZMMA 1FPUA 3FWQA 4KRDA 4Y5HA 4O96A 5C8KA 4I1ZA 4NT4A 4RVLA 3MJ2A 1Q8UA 3BLAA 3FXWA 4E6CA 3FUPA 4EJ7A 3HL7A 3MPTA 1PMVA 3VS7A 2R64A 4BYIA 3RM7A 4FEVA 1DS5A 4PP9A 4UZHA 3BV3A 3FXXA 4BDBA 2HWPA 2X7FA 2PE0A 3FQHA 5CEKA 2QLUA 4J53A 3ORXA 4DAWA 4BIBA 4GIIA 3W8QA 4EBWA 3PFQA 2XS0A 4I6FA 3C0GA 4CMUA 3DJ7A 2WU7A 4G16A 3E8DA 4BZDA 1MUOA 1T45A 3BLQA 1F0QA 4C4FA 4FV8A 2R0IA 4MUQA 5AAEA 5ANDA 2BAJA 4GS6A 3SVVA 1MRUA 5IZFA 1MQ4A 2JKMA 3Q60A 4L46A 4HVIA 3C5UA 1M14A 2XBJA 4MXAA 3K2LA 4NIFB 4DFYA 1G8JA 5D11A 3VS6A 2Z60A 3ODYX 1U54A 1O9UA 3EQBA 3GCSA 4P4CA 2WTVA 1QPEA 4O86A 3EQFA 4IC8A 2GNGA 3EFLA 4QYHA 2BDWA 3F69A 2AUHA 2NNWB 2JIVA 4DFUA 4CLJA 3BWJA 4H1JA 3NCGA 5LVLA 2F9GA 1IA8A 4Q2AA 3TV7A 3O8UA 3CGFA 5EKOA 1UKHA 2OICA 3TNIA 4QT1A 3KIOC 2QOHA 3IQ7A 3GQIA 4I93A 2C6MA 5EHYA 4L43A 2A2AA 5GJGA 4HW7A 1OUKA 1R1WA 4LUDA 4R3CA 3G51A 4BCGA 3OEZA 4F64A 4K0YA 2LAVA 2VTQA 3RAWA 4FV0A 3V01A 2QR7A 2VRXA 4OT6A 4QYGA 1UNGA 1SVHA 3A7GA 3BYSA 3QHRA 3ZEPA 1M7NA 1PXNA 1JSTA 2ZDUA 2A19B 4X6QC 5HI2A 4AZVA 1OKYA 2ZDTA 3U4WA 2FB8A 1XKKA 5M44A 2WFYA 5CANA 3KRJA 5CWZA 4EH2A 3LLTA 3N4UA 1UWHA 5CTPA 1XH5A 3B2TA 2JAMA 5EQYA 3UTOA 2F57A 3ITZA 3WZUA 4V0GA 3ZCLA 3NSZA 1KV1A 3ZDIA 5BVOA 2NYAA 4R6VA 3EN5A 4FSTA 4ITJA 3HAVA 2PMOX 3VVHA 4USDA 1QCFA 2EXMA 3O17A 5I9WA 4BJJA 4XP2A 2UW7A 3KK8A 5CAPA 2HZIA 3F9NA 1MP8A 2XNMA 4HYUA 3R7IA 4ANQA 1ND4A 4O7YA 4QP3A 2W4JA 4ZK5A 3L9PA 5LMKC 5E92A 2YHVA 2PVRA 4J7BA 5EH0A 3SD0A 4AAYA 3UDTA 1X8BA 3BV2A 3SGCA 3NWWA 3LOKA 3ZZWA 4CFWA 1WVWA 3ZO4A 4DLJA 1Q62A 4M68A 3UBDA 4BCFA 4WOVA 4W4YA 3ORIA 1UNLA 3PA4A 4DITA 3TUDA 5CU0A 3G6GA 4FNWA 2PZIA 2C6EA 3GCVA 2WO6A 3RALA 5E8WA 1SVEA 1ZRZA 5IQHA 3R1QA 2WTIA 4JL9A 3JUHA 3QLFA 2C69A 4AE6A 3F5XA 2R3IA 4EOSA 3LAUA 4LUEA 3W55A 1I44A 2G2FA 5ITAA 5C01A 2AYPA 2CKPA 1YXVA 4FIGA 4L3LA 4IAIA 3DZQA 1S9JA 1RDQE 4RA4A 3M11A 4F08A 3D2KA 2IJMA 4IFGA 3VF9A 5HU3A 3AC4A 3E8CA 2ITXA 2ZMCA 4HZRA 4I94A 3FY0A 1LUFA 5CSVA 3C4ZA 2HCKA 4M12A 5EM7A 1FINA 2WMQA 2F7XE 4MX9A 4FZAB 3KL8A 2VNYA 2WPAA 4FL1A 4IZAA 4X7QA 3NVMB 2BRNA 4M8TA 4RRVA 3LM5A 5DPVA 5D7VA 3VO3A 4ZAUA 2QG7A 2C1AA 4CMOA 2BZKB 3GOPA 2EB3A 5IQDA 5DR9A 1W82A 1YWNA 2YCRA 2IG7A 4DBNA 1NY3A 3MA6A 5ETCA 3MJ1A 4WHZA 3C4EA 3PIZA 4TTHB 4XV2A 4IWPA 3I7CA 3VAPA 3VN9A 5D41A 3B8RA 2WGJA 4O6EA 4RJ4A 2WMWA 3LXKA 2QO2A 4F1TA 4ZLOA 3DK6A 1SNUA 3FYJX 2WOUA 4HPTE 3IW6A 4HGLA 3TUCA 2P0CA 3E3BX 1FGKA 4GG5A 5CI7A 4QQTA 1FQ1B 4JR7A 4B8MA 2E9VA 5BQ0A 4R7IA 5CASA 3AMYA 5L6WL 4EWHA 5CF4A 4IX4A 5HX8A 1V0BA 3KXGA 5IA1A 4D5HA 4DT8A 1JKTA 1WAKA 3OCSA 4DEBA 1XQZA 5BVDA 4BY9E 2O8YA 3R0TA 4HYIA 5AUWA 4GT3A 4MD8E 4WBBB 4DG2E 5HGIA 3NFGB 5F94A 3MYGA 4FR4A 4KD1A 5EK7A 2EB2A 2ZV8A 4X2KA 4ZTRA 3QF9A 2HZ4A 3QTUA 2PYWA 1WCCA 4LM5A 4RQVA 4RJ7A 2JBPA 3EFKA 5EYDA 5BVWA 4EOMA 4F4PA 4PTEA 3FQSA 4A4LA 4NKAA 1H0WA 3EKNA 3POOA 4Z7GA 2BTRA 4KIQA 4AAAA 2UVZA 3LE6A 3FI2A 4FV4A 4OT5A 4C4JA 2JIIA 2GS7A 4D55A 4C4IA 3DJ6A 3KK9A 3MS9A 3JVRA 3NUAA 4IVCA 2R3QA 2XNBA 4C36A 5AUTA 2YCSA 2J90A 2Z7LA 4IAAA 3I6UA 3VS5A 3VS2A 4O38A 2PULA 2JDRA 4XLVA 4G6LA 1IAHA 1U59A 4QMUA 4FEXA 2QQ7A 4QMWA 4GT5A 1YXSA 4R5SA 4XG4A 4AOTA 3L8PA 2BIKB 4IW0A 5IEVA 2XM9A 4AA4A 4YO4A 4Q5HA 4RJ3A 2F7EE 4XUFA 3ZDUA 4FTJA 2C6LA 1OMWA 3HRFA 3MI9A 4DHFA 4U44A 4DH7A 1CKJA 5EYCA 4AX8A 2W5BA 4ZS4A 4ZOGA 3DBQA 4F9WA 4ZMEA 2QG5A 5CVGA 5HIDA 3ANRA 3C4WA 3PA5A 4R3RA 5DR2A 2GFSA 3R28A 3WARA 1OUYA 3LXPA 4YC6A 3S4QA 2DS1A 3FI3A 1CDKA 5AP0A 3FQEA 4FKVA 3P7CA 3QRKA 3W1FA 4XG2A 3VJOA 4AXAA 2WQOA 4WBOA 4UYNA 3IECA 3UMXA 4EHGA 3UO5A 2OW3A 2QVSE 2GS2A 2X8IA 3FL4A 3TG1A 2FSOX 4UN0C 4I6QA 2YEXA 4ITHA 4MQ1A 1VYWA 2BR1A 4AQKA 2G1TA 3BE2A 4HJOA 3PIXA 4P5QA 5I9UA 2Z7RA 3OOMA 5FTOA 2ITPA 4CFFA 5L8LA 3ZOSA 4Z55A 4RWLA 5JGDA 3DBDA 4DGOA 4NL0A 5A4CA 3REPA 4GEOA 5I5ZA 3GFEA 3PSBA 3D5VA 5IA5A 1URWA 3Q96A 5IH6A 5AP2A 2PPQA 2UZEA 4R5YA 3PXYA 4KABA 3ZUTA 3W2RA 5KBRA 1JKSA 4TT7A 2PZRA 4IX3A 3A99A 3MN3A 4X0MA 2G01A 2IWIA 3DBFA 2W4KA 4XMOA 5FEEA 4YPDA 5E9EA 4B8LA 3HYHA 3PZHA 2OZAB 3Q04A 4FJVA 3Q4ZA 5H8GA 4EOOA 2UW3A 4KRCA 4I23A 1A9UA 4IJPA 3F7WA 1TKIA 3TEIA 4E1ZA 3DAKA 2QOOA 2BIYA 3FSKA 2PZPA 1GY3A 2XJ2A 5JFWA 3HGKA 5K4IA 3RJCA 4AFJA 4PNKA 3E93A 4P2KA 1MRVA 2X2MA 4MBJA 2J9MA 4YR8A 1LPUA 3P23A 2C30A 3RAIA 4EHZA 1UU7A 2Y6OA 3IO7A 2R7IA 4JOAA 3P5JC 4AN9A 5IQBA 5DGZA 3ZTXA 4JS8A 2JFMA 2OXYA 2RFDA 4GL9A 4IHPA 2BZHB 4II5A 5CT7A 3LJ0A 3UP7A 4M97A 3TV6A 3UZRA 4A9YA 4O7OA 1YXUA 2W1HA 3HP2A 3V5QA 3GB2A 4YLKA 5FBOA 3TNPC 5HORA 3FMJA 3MH2A 3AQVA 3BGQA 3H4JA 4OBOA 3VBQA 3NCZA 1OL5A 3E63A 4EOJA 4DH8A 4DHJA 2PWLA 3R7YA 3KF7A 2UW5A 5JQ5A 2OO8X 1UWJA 2Y9QA 4GV1A 3ZHPC 4F6UA 1Q5KA 3UP2A 2JKOA 4FL2A 5HKMA 5AAFA 4PTGA 3WILA 2XCKA 4I0TA 4L68A 4TKSA 2P2HA 1CKIA 2GHGA 4S34A 3FEGA 4YTIA 2C3JA 4XG8A 3DAEA 4AA0A 4EI4A 2A0CX 4O7SA 4G5PA 2JBOA 2G9XA 2QNJA 4AXDA 2XIYA 5DYJA 3KCFA 5CLPA 5HVKA 3RM6A 4IC7A 3PUPA 3EN7A 4KKEA 4FKJA 5BYZA 3HZTA 2H6DA 4O21A 3ZC6A 3ZFYA 3QD2B 3LQ5A 4LL0A 3RTPA 5EQPA 1ZXEA 5LOHA 2AEGA 5IQCA 4BI1A 3A8XA 5GJFA 3EHAA 3UNZA 5HBHA 5JMSA 4EHVA 3WZEA 5HLNA 3CTJA 3G90X 4EL9A 4FV6A 3LMIA 5AV4A 3HUBA 4NCTC 4ZTSA 3SLSA 2ZV2A 4X2NA 5KMIA 1GNGA 3ORKA 2W9FB 4WNMA 4L3PA 2VNWA 3DK7A 1H1QA 5DT4A 3WF9A 3WF7A 4E26A 4QDEA 3NUYA 2QURA 3JXWA 2W5AA 3O96A 3KCKA 4QP7A 3TMOA 4Y5QA 4C3RA 3SKCA 1XH4A 4ZMFA 5J9ZA 5M4UA 2IZSA 4FV3A 2I0YA 3HX4A 1XJDA 2PU8A 1OKWA 3EQPA 1YI3A 3TWJA 3OCBA 1SM2A 2HELA 4TL0A 4I5PA 2X2LA 3W2QA 3QGWA 4KBCA 1H1WA 2HY0A 1BL6A 4XV9A 4YZNA 5E8YA 1H0VA 3D5WA 3H0YA 5CYIA 5AX3A 1WVYA 3OT3A 4F6SA 4FV5A 3RK7A 4NTTA 4K77A 4YZDA 3VRZA 2R7BA 3QQGA 4YZ9A 3KY2A 4QTDA 4JDJA 4XCUA 3F7ZA 3UYTA 2ZMDA 4HVSA 2WKMA 2XKFA 3W2SA 5FXSA 3TKUA 4J1RA 4OUCA 4TN6A 4X6RA 1Y6AA 2YABA 4I4EA 4U5JA 1YOLA 2WAJA 4C62A 4DLIA 4CT1A 1OBGA 4G34A 5C03A 4DINA 2EWAA 5T68A 2ZV7A 3SC1A 4QMVA 4JIAA 4UWCA 5DEYA 3VJNA 2XNEA 3P5KA 5CF5A 3MH3A 3BELA 2J0IA 4F1MA 3O50A 2O3PA 4E4XA 3NX8A 1PXMA 3RMFA 4EOIA 2WMRA 3CR0A 5KHWA 1WBNA 2BKKA 4DFXE 2OXXA 4AW2A 3E8NA 2O2UA 3VS0A 2GNIA 4CEGA 2XB7A 5EHOA 1RJBA 2RL5A 5AA8A 5CAQA 2R3FA 3QTSA 4IZ7A 5KZIA 1JQHA 2XK7A 1ZYSA 3FMHA 3W16A 4ACMA 3KN5A 1JAMA 3A4PA 4C3PA 2YAAA 3GVUA 4F1OA 1OITA 3CJFA 1IA9A 5IEYA 3ANQA 2X6EA 3BHHA 3Q9WA 4CZTA 3PA3A 3CY3A 3QQFA 1Z57A 4USEA 2BDFA 4IWOA 4EK5A 1GZOA 1V0OA 3OS3A 3DQXA 1A06A 4IQ6A 1FMOE 4ID7A 5EW8A 4AE9A 2JAVA 2YITA 3I5NA 4ZSEA 4D5KA 4ZY5A 3TACA 5D12A 3FZPA 4TNBA 3IDCA 3FXZA 3HRBA 4PF4A 4ASZA 4L52A 5KUPA 5AEPA 1H24A 5AUZA 4U94A 3KB7A 3SXRA 2I40A 4AUAA 4K11A 4N4SA 3NUXA 2QONA 3CBLA 3K3IA 4H58A 3QRTA 4O0RA 3BWFA 5AAGA 1UVRA 3OEFX 4O7RA 5F20A 1XH9A 1NXKA 2YIRA 1PXIA 2C5XA 3PLAE 5AUUA 2J0JA 4APPA 1DAYA 2IO6A 2BAQA 3DBEA 3DB8A 2UZBA 2UUEA 4I41A 4ZZOA 3G0FA 1U5QA 3Q5ZA 3AC1A 4YHFA 3UPXA 3AGLA 5LQFA 3U55A 3DV3A 4BGHA 2W4OA 1M52A 3D5XA 3FLQA 4MNFA 4QMOA 3CQWA 4EH5A 1P4FA 3ZO3A 3D94A 4C4HA 1PW2A 4D1SA 4PMPA 5IA0A 1WBVA 5L6PA 3NS9A 4L6QA 4QTCA 5FTQA 3EWHA 3RZBA 4QO9A 2QU6A 3NUUA 5J95A 4BBEA 5HICA 4QTBA 3LQ3A 4KAOA 4KUJA 4EH3A 4IWDA 2OXDA 3FAAA 3JYAA 1LEWA 2WTWA 3KVWA 3MA3A 2VX1A 3F88A 4FT0A 4DG3E 3F3ZA 5KMNA 4L42A 4F9YA 2J5FA 3GP0A 3UMWA 1YXTA 4NU1A 1Y91A 2VUWA 4XOYA 4YJSA 3DK3A 5LVPA 4C61A 1ZMUA 2QD9A 5JSMA 5LWNA 4TNDA 1HOWA 3IGGA 3PP0A 4WT6A 5CSWA 3UIBA 3OUKA 3P86A 4F9AA 5IEXA 1JOWB 5CXHA 3V5TA 2XNOA 4FGBA 3MH1A 2JD5A 5FUTA 1R0PA 1VR2A 5DIAA 3NLBA 4AXFA 4FG7A 1VJYA 3CP9A 4RX8A 5IDNA 5EYMA 2WTCA 5B7VA 2HYYA 2CKEA 3OXTA 2B9JA 3MY5A 4A4XA 3MFSA 4DH1A 4HNIA 1YHWA 3C4FA 2GS6A 3LCDA 2WMBA 2Y8OA 4JAIA 1ZMWA 3MB6A 3WYXA 4DN5A 2W06A 4EH9A 4BTJA 5AX9A 4F78A 4ANBA 4RT7A 3EFWA 1PKDA 2OH0E 3Q3BA 4F99A 2HZ0A 1R78A 1KV2A 1Q8ZA 2Q0BA 3CXWA 4XP0A 3QD4A 4GKIA 4KS7A 4Z3VA 3R7VA 3FC1X 5AP6A 3P08A 3DZOA 2GNHA 2PTKA 3PXRA 4R7BA 3ACKA 3PE1A 4CXAA 4DCEA 4G5JA 4AW0A 3AKKA 3VUMA 1U4DA 4LQMA 3V5LA 4MBLA 4OR5A 4YHJA 4A9UA 5ACKA 3E62A 4QP2A 2QOQA 5AIKA 1O6YA 5CX9A 1OIYA 4E4NA 3VUIA 1QL6A 3H10A 4MD7E 4BCPA 4BR3A 4RJ8A 3Q9YA 3GI3A 4FGRA 4H05A 4DE4A 4AOJA 4UYAA 4AT4A 2E9OA 2J0KA 2VTJA 4AZWA 4C38A 4A06A 3QCYA 4M84A 2YFXA 3OFMA 4LV5A 3DGKA 3CKWA 4NSTA 4RA5A 4L53A 4AXEA 4UV0A 3TL8A 3E3PA 1ZMVA 4AN2A 3W33A 1M2RA 4HYSA 3BCEA 5E8UA 5DFPA 4RZVA 5HIBA 4OTDA 4ZY6A 3QCQA 2BAKA 2ITNA 5CEQA 3EN4A 3UE4A 3LJ1A 3JY9A 2VX0A 5IQIA 5CZIA 5FP5A 4G9CA 5A6NA 1UNHA 3BEAA 3BHUA 5KMJA 1GOLA 5J87A 2OK1A 4IM0A 1XH7A 3A2CA 3CTHA 4IEBA 5H8EA 4F7JA 1OIQA 1BL7A 2OFUA 4Z9LA 2WIPA 2I6LA 4LOQA 5FDPA 5J9YA 4B7TA 3QXOA 5DHJA 3UO6A 4DF3A 5C26A 3QTRA 5TOZA 3LPBA 2BMCA 4RVKA 4OW8A 4GK4A 2CHLA 3GCUA 2HENA 4I92A 3EJ1A 4LYNA 3LFAA 3U87A 5LJJA 3NYVA 3R9HA 3TN8A 4JLCA 3Q4UA 3QQJA 3U6JA 5C8NA 4ZZMA 4IE9A 1FBNA 2YERA 3MVHA 1SZMA 4KINA 4D4YA 3BRBA 2GPHA 2BHEA 2UW4A 4L3JA 4EZ7A 5IA2A 3DPKA 2QCSA 4FV9A 4O6LA 4FG8A 4FZ6A 4OTQA 1AGWA 3LVPA 4Y95A 5AFVA 4O0TA 5ANIA 1H26A 3V5PA 4EK4A 3S3IA 3ZC5A 5AUXA 3GU8A 3NYXA 3QYZA 4NM0A 4PWNA 3VNTA 4CLIA 3BHVA 2PVLA 4FSWA 3SRVB 2WMTA 4IWQA 4MF1A 3UNJA 5HE2A 5KMLA 2HK5A 2JLDA 2X4ZA 3C13A 5EW9A 3HV7A 4FK6A 4GVAA 5CSXA 5E1SA 2R3NA 1OM1A 2ETRA 4F6WA 3U9CA 3R9DA 3N4VA 1UU3A 3H9RA 2WQBA 4NKSA 1W84A 4EQCA 4GFGA 3CQEA 2OZAA 4JDIA 3A7FA 3QQLA 4RMZA 4RVMA 2BCJA 3F2AA 5JK3A 5JZNA 4JG7A 3QWKA 2C68A 2DQ7X 1ST0A 4QMYA 3AOXA 4BKJA 4FNZA 4N0SA 4IACA 4LRJA
chains in the Genus database with same CATH topology
4CV9A 2PZYA 2XMYA 4ACHA 3MY1A 3O23A 2HXLA 4IMYA 3IOPA 5G6VA 4C0TA 4PQNA 4AS0A 5AM7A 3FY2A 3UOLA 2VWUA 5H8BA 4QNYA 4U9AA 4H36A 5LWMA 3OY1A 3PJCA 4QTAA 4BDIA 2JEDA 2HZNA 5M07A 4KIPA 2RF9A 4AZSA 1KE5A 1ZAOA 2BROA 4CV8A 1OZ1A 3EOCA 4L67A 4BICA 5FTGA 3V04A 3BHTA 1YDRE 5K4JA 4FI1A 3RPRA 4MKCA 4FV2A 3ORNA 3EKKA 4ZSGA 2YA9A 5A9UA 4MXXA 3QU0A 3M2WA 3QUEA 4J8NA 4HVHA 5IUGA 3VF8A 3FLZA 4O91A 1YOJA 1KE8A 3BE9A 3JY0A 3DXQA 4GSBA 5K5XA 4GU6A 1M7QA 2JDOA 3I0QA 2B54A 2QKWB 3LFBA 3P79A 1W8CA 2GU8A 4DYMA 1E1VA 3EN6A 3QRUA 4TXCA 4FSNA 2JIUA 4YNOA 2PSQA 5CQWA 3UOHA 4CRSA 3MFUA 4YLLA 4CFXA 5JEBA 3G15A 3PXZA 2WNTA 4CCBA 5KHXA 3FZOA 3KGAA 3PZEA 4LI5A 4PL3A 4K6ZA 5CI6A 5FM2A 3RNYA 4PL5A 3ZM4A 4IDTA 5HVYA 3GC9A 2X2KA 2QC6A 2VU3A 1Q3WA 3RGFA 1H27A 1H25A 2PVYA 2XUUA 5M4FA 4U6RA 5T3QA 4WG5A 4FYNA 5KMOA 3RHXA 2OIDA 4F7LA 4EQMA 5BMSA 2VTTA 3NEWA 4AT5A 3E8EA 1ZOGA 3C0HA 2OKRA 4ZIMA 2HY81 2RIOA 4EK8A 3R6XA 3PSDA 2ZOQA 3L8VA 3V51A 4DDIA 3IS5A 3MVLA 3NW5A 3PIYA 4BTFA 5LMKA 4L01A 2ERZE 3A61A 4RZWA 5BYYA 3V6RA 1RW8A 1Q99A 4M0YA 4UBAA 3ZRKA 5DR6A 1JBPE 2C4GA 4DDGA 3W2CA 3OP5A 4EH7A 2I0HA 4U3YA 4IDVA 4JX7A 1Q24A 1L3RE 3HNGA 3KU2A 4MXOA 4RLKA 4FTLA 4B6LA 1H1PA 2IVVA 3OBGA 3QQHA 4O7TA 4QP9A 1J7UA 3BGZA 4X3JA 5ETFA 4G1WA 3RPYA 4YHTA 4JDKA 1FVRA 1G8SA 3CPCA 3I0OA 3O51A 3UIUA 3EZVA 5IQFA 2CNUA 3AD6A 3PY3A 1OB3A 5IQGA 5ETIA 3GQLA 1E9HA 1LP4A 2GHMA 3PJ1A 4UY9A 4F09A 4NFMA 5BPYA 5ICPA 1ZYDA 2XCHA 3OW3A 3K3JA 1URCA 3C7QA 3QC4A 1REJA 1F3MC 5CVFA 5C9CA 4EYJA 4WIHA 4QP1A 4OTGA 4ZZNA 5KO1A 2W96B 4EZ5A 4QP4A 5IISA 2YDKA 2XNNA 1XBAA 4UXQA 4PTCA 4JQ7A 3QAME 5DBXA 3R9NA 3VUKA 2ITUA 3I60A 4BDEA 5JKGA 4ZJVA 3BLRA 2UW9A 4C2VA 5IQEA 4BCMA 5J8IA 2BZIB 3WF5A 2RFEA 3EL7A 3W0QA 3QD3A 2R4BA 1Q97A 4K8AA 4LG4A 4RBLA 5EI8A 3FV8A 4JDHA 1WBSA 2V7AA 4J52A 1OPJA 1OGUA 5A3XA 1IG1A 3D15A 3KEXA 1WBPA 2GTMA 3PJ2A 3P7BA 2RFSA 3MVJA 3PPKA 3NPCA 4YC8A 5TKDA 3ALOA 4BDGA 3VHEA 4ANSA 3UC3A 2X4FA 2XEYA 4R77A 3WZDA 2XP2A 4R1VA 5IUIA 3G5DA 2V5QA 3R1YA 4GT4A 1SYKA 2ZM1A 4YO6A 3TZ9A 3ORPA 4NW6A 3Q52A 2I0EA 4EONA 3OWJA 3FBVA 3LXNA 2C0OA 3LMGA 3TT0A 5HQ0A 2BALA 5JFSA 2J4ZA 3HV6A 2QOIA 4FIJA 4FSUA 4HGSA 3F82A 4M7IA 5I9VA 4BB4A 4MHAA 4A9TA 4ONAA 3HAMA 5BVFA 3HMNA 4RX9A 2VWXA 4EUUA 4FEWA 5JZJA 1CMKE 3GU5A 4IM2A 2C0IA 3KXNA 4FVQA 5E91A 3E7OA 3ZLXA 3MB7A 3N9XA 4KIOA 4L8MA 1IR3A 3FLSA 3UDZA 3R22A 4EEVA 1BX6A 1LR4A 4E20A 1WBWA 2R5TA 4BRXA 2OBJA 3AG9A 3LW0A 5AP5A 5D1JA 2WU6A 4U79A 4GJ2A 2Z02A 3UG2A 5FGKA 5AUYA 4E7WA 1NT2A 3MPMA 2CN8A 4FMQA 4ZEGA 5L2WA 4EHEA 2XK9A 1HCLA 2WQNA 3A7JA 3WIKA 3ZLSA 4I0SA 3G33A 5HU9A 1M2PA 2DYLA 4U8ZA 5KE0A 3T9TA 2WTKC 2VTNA 5EM6A 2QO9A 2AC3A 3EQHA 4Y72A 3KMMA 4YJQA 5JH6A 3CLYA 4DTKA 2ITVA 3DCVA 3UVPA 3QLGA 4IADA 3KRRA 4I5MA 4JJRA 2IW9A 3LMHA 3ZSGA 1IRKA 2YCQA 3DT1A 3CGOA 3F2NA 3F6XA 1IAJA 5DRBA 3VHKA 1JKLA 1E1XA 4FOCA 2G2HA 3FPQA 2XZSA 3UGCA 3TUBA 4HCVA 4G3EA 2IVSA 5H3QA 5LCKA 3D7TB 5FXRA 5TF9A 2PUPA 4BTKA 2FUMA 2PVJA 4PL4A 2JDTA 2UW0A 2X8DA 3T9IA 5DT0A 4O81A 4ALVA 3HDMA 3LFNA 4O22A 3GU6A 4E6QA 3GXLA 4JRNA 5FEDA 3IOKA 1GIJA 3MW1A 3FMKA 1BKXA 2RG5A 4YJRA 3PWDA 4C34A 4TWCA 3QQKA 1ZOHA 1RQQA 2R3KA 5DE2A 3NUNA 4AW5A 3WIGA 1Q3DA 4HOKA 4W8EA 5E1EA 4ZLZA 3PWYA 2IVUA 4FC0A 4YP8A 3KXMA 3R8PA 3RCJA 3ATTA 4ANMA 4LDTA 4B4LA 3BYMA 4ASDA 2XK6A 2ITTA 2QHNA 2VGOA 3BLHA 3DB6A 3LFSA 1PYEA 3AD4A 3OWKA 4FSZA 4LV8A 4BIEA 2KULA 2NO3A 3UIMA 2BFXA 3QUDA 2YIYA 3FMDA 3W32A 1TFFA 2OJJA 4FIIA 4FIEA 2C6DA 3RPOA 1CTPE 5A4EA 5DRDA 1ERKA 3AC5A 3QRJA 2ONLC 2C6IA 2WTDA 3LLAA 1FOTA 4ORKA 4YBJA 4I3ZA 2YM5A 3QCSA 5D10A 2LGCA 5LARA 4EK3A 2GDOA 3MESA 4G6OA 2XF0A 3NIZA 5FG8A 4C33A 1FGIA 3I5ZA 3ATSA 4MXCA 4YJVA 4IVBA 4O0SA 2IVTA 2B55A 2PVHA 3Q4TA 3UQGA 4O7LA 3I7BA 4D4RA 3I6WA 3FZTA 1YRPA 3EYHA 1PMUA 4U81A 2OJ9A 2B53A 4KKGA 4YNEA 4OTWA 3TTIA 2R3HA 4TPTA 1BLXA 3H9FA 4E6AA 4BCNA 4PUZA 5HIEA 4YZCA 1JKKA 4YLJA 2E2BA 3OXZA 4MQ2A 4QMSA 2C3KA 2ONLA 3C0IA 4HVDA 3S00A 4NK9A 5I4NA 1WZYA 4DTAA 4ENYA 1Y8GA 3GOKA 4J98A 5HNGA 3BBTB 3RP9A 2GNLA 4WRGA 2C6KA 3R73A 3WBLA 3KREA 3EYGA 3JPVA 4FKRA 5LMBA 3UNKA 3UO4A 4BHNA 3AT2A 4A07A 3QUPA 3WE8A 3ZXZA 3O8TA 1DM2A 4DFBA 2XANA 2REIA 3IW4A 4O2PA 3PTGA 4XYFA 3PXFA 4U40A 5E8SA 5LMAA 1J7IA 5HD7A 4JT3A 4KBKA 2F2UA 4RJ5A 2J51A 3KA0A 2YZAA 4AZFA 2ZFYA 4CKRA 2F7ZE 3A8WA 5HO7A 4DFNA 3DTCA 3F61A 3QTXA 4IJ9A 3POZA 4L9IA 4XHKB 4Y85A 1J1BA 4NUSA 4ZSLA 5BVKA 3R8ZA 3UDSA 4C4EA 3QTQA 4YTCA 3VBYA 2BUJA 1ZYLA 3IK3A 2OU7A 5L2IA 1H1RA 3QTWA 5F95A 4DH5A 3ZUVA 3ULIA 2YWVA 2C0TA 4XLIA 1KOBA 1BMKA 3RWQA 5KZ0A 3IW5A 5JQ8A 1GZ8A 3D5UA 1G3NA 2W1GA 3BYOA 3MTFA 3QFVA 4FA2A 4Y8DA 5TO8A 4HVGA 3FI4A 1GIIA 1XH8A 4OTFA 4W8DA 4LOPA 2WEIA 2B9IA 2EXCX 2JKKA 3ERKA 4ZP5A 4FZFB 4CTCA 1PRYA 3PYYA 1HCKA 4FICA 3B2WA 5C1QB 4CG8A 4QOXA 4OBQA 2UW8A 4FYOA 5HNIX 5AP3A 2XALA 1B6CB 3F3WA 1Q8YA 2ZVAA 4ZSJA 2HIWA 1G8KA 4LL5A 4S33A 2XK8A 4W4WA 1ST4A 3SRVA 4QTEA 3S2PA 5ETAA 4F65A 2GMXA 2H8HA 2YIQA 1QMZA 3RWPA 3VS4A 1YDSE 3C1XA 3OWPA 3QGYA 4K2RA 4DEHA 5GINE 2FSLX 5BUIA 4QMLA 1OVEA 4FTUA 4XNEA 2VWYA 2XJ0A 3MFRA 5DEWA 2B7AA 3ZM9A 1WVXA 4FIFA 5ACBC 4L00A 2XIZA 3QXPA 2P55A 3BI6A 3BHYA 4NCTA 4YSJA 5CAOA 5L2SA 2XIKA 3K5UA 3JVSA 4DGLC 3FE3A 4YJOA 5T6KA 2XRUA 4QYFA 4S31A 4RWIA 4I5CA 4DFZE 4GJ3A 5BVNA 4KS8A 3ZBXA 1QPDA 3LFDA 5CAUA 1J3HA 3NW6A 5EG3A 3V6SA 2R3RA 4RGJA 3DXPA 4WNOA 4WRSA 1Q41A 4GIHA 2W5HA 3MIYA 4JBVA 4RVTA 1YVJA 3W2PA 4OBPA 4FTCA 1AD5A 5I9YA 3PLSA 2PUIA 3CKXA 5K3YA 2FYSA 3ZBFA 4O7WA 2XEZA 2UZOA 4EQUA 1P2AA 2OSCA 4R1YA 1L8TA 3BIZA 3R63A 4KB8A 4DFLA 4M69B 2YJRA 4WA9A 4G17A 2PK9A 4ZXTA 5CSPA 4HGEA 4XH6A 5JT2A 3R9RA 2DUVA 1PKGA 3R7EA 3HEGA 2ESMA 3FHRA 3OCGA 3PUFC 2V55A 3Q2MA 3QA0A 4FUXA 2QO7A 4PNIA 2JITA 4YC3A 3NUSA 3RK9A 2VGPA 2W17A 5CEOA 1ZZ2A 4GUBA 2C3IB 4FEUA 3O0GA 2VTPA 2QKRA 3BQRA 4IB3A 2VTOA 4H1MA 3NZ0A 4L44A 5DOSA 2W0JA 1PMNA 5FBNC 4FTNA 3LCOA 5B2MA 3AC8A 1R0EA 1J91A 3E64A 4HYHA 1PF8A 4E73A 3FC2A 4HCTA 2BZJA 5IU2A 4NM5A 1YOMA 2XA4A 3EFJA 2VTRA 3ETAA 2XNGA 3P0MA 3FKLA 3QZHA 5CEPA 3FLWA 3EQRA 3DFCB 3A62A 4YPSA 4MXZA 5FXQA 3L9MA 3P1AA 2P33A 3SOCA 2C5YA 3R1SA 2WD1A 2FO0A 3LFCA 3UOJA 2ITQA 4BDJA 2P4IA 3NGAA 1XBCA 3VONA 3EQIA 5IG1A 4AQCA 3CD8A 4S2ZA 2ETMA 5DNRA 4NWMA 2X0GA 3D4QA 3R9OA 4FVPA 4UEUA 4NM3A 3OWLA 3DBCA 1PMEA 2BHHA 3U54A 1YWVA 5JGAA 2YWPA 3QQUA 4C7TA 4H3PA 2KTYA 3H3CA 3QBNA 3QD0A 2B9FA 3TZ8A 4MXYA 3S1HA 4ERKA 4WD5A 4AG8A 2X7GA 2BFYA 4MEDA 4TYIA 5GHVA 3DTWA 4GUEA 4QPSA 3OROA 2F49A 2XARA 4X3FC 1OGYA 4YJTA 5FP6A 3BYVA 4OLIA 3KMWA 2ZYBA 4U80A 5AV1A 3SA0A 3D0EA 3FLYA 4FSQA 5HE3A 4FKUA 2X7OA 4DGNA 5K5NA 2WMAA 2PE1A 3QTIA 1W98A 2PVMA 4HGTA 2A1AB 2GQRA 1H4LA 3DQWA 5L3AA 3R21A 3WF8A 4BI2A 3V8TA 3EIDA 5EQEA 4ACCA 3RK5A 4E4MA 2WTKB 3W2OA 3CIKA 4Q5EA 2IN6A 2X1NA 1NVQA 3P7AA 4I24A 3ZO2A 2GFCA 5H2UA 4JBOA 5L6OA 2I7QA 3V8WA 4ZS0A 3SOAA 4FEQA 4G3DA 2C3LA 2ITWA 3GBZA 4XG6A 5GJDA 3TYKA 4X3FA 3L8SA 4AXCA 4IAKA 1UU9A 4KWPA 4FSMA 2RKUA 5CZHA 4C2WA 5DI1A 1MRYA 4CKIA 4MNEB 3WOWA 2HW6A 4EYMA 2WQEA 1T46A 2XKEA 1W7HA 3E92A 3PG3A 2EUFB 2YACA 3ENHA 3SG9A 1DI9A 1PXPA 4RG0A 5AWMA 4F0IA 1BI7A 1YHSA 4KKHA 5L8JA 1JPAA 3VUDA 5BUJA 4BGQA 2C47A 3Q6UA 4YJNA 4DHIB 1PXOA 3HUCA 4I6BA 5KKRC 1ZOEA 4QMTA 4C58A 1Q61A 3EZRA 3VBWA 3LFEA 4F0FA 1JLUE 4CFMA 4XG3A 5CSHA 2YM6A 4U3ZA 4C4GA 4FX3A 3E87A 4PDSA 4R7HA 3P4KA 4A7CA 5CEMA 4KBAA 3F2RA 2CLQA 5EM8A 4E4LA 2JDSA 4IB1A 4CD0A 5IDPA 2R3MA 3SW4A 2XJ1A 3D2IA 4ENXA 1XBBA 3C51A 4M3QA 4FTTA 5LVNA 4ERWA 3QALE 2ERKA 3UVQA 3COKA 5ANJA 2WMVA 3CEKA 1OPKA 2YM4A 2Y4IC 4A9RA 3ZSHA 3QL8A 3R30A 3TZ7A 4J97A 2YM3A 5B2LA 3DLZA 3HMIA 4M67A 3IPHA 3UZPA 4RC3A 2HWOA 3OUNB 2FSTX 4A4OA 4YTFA 4UB7A 4O27B 4OTHA 4EZ3A 4IAYA 4XS2A 1NA7A 4OTIA 3PVBA 4C02A 5CQUA 4F7NA 4V05A 4TW9A 1GAGA 4FG9A 4IB0A 4JAJA 4IAZA 3UYSA 3TDWA 4RIOA 4NYEA 3SV0A 5DH3A 4MYGA 1ZZLA 5CY3A 4GU9A 5CU4A 3AT3A 3ZFMA 5EOLA 1Z5MA 3GENA 4LRKA 4RFZA 4CQEA 3UVRA 3AGMA 4CZUA 2ITYA 3UQCA 2W1CA 3D7TA 3WZJA 4TYEA 3V3VA 3ACJA 5KMMA 3NYNA 2J6MA 4PDYA 5FD2A 2E9UA 1J1CA 2IW6A 3KXZA 3HP5A 1ZARA 2XYNA 2ZB1A 4JQEA 4LMNA 4RJ6A 3QKMA 5DT3A 4ARKA 5JGBA 3SW7A 1DI8A 4N6ZA 3F5PA 4ITIA 4J96A 1ATPE 2V7OA 2Y7JA 3KC3A 4QYEA 5DVRA 3T3UA 3IG7A 5HE1A 4AWIA 3MDYA 3DOGA 3PXKA 2H34A 2PE2A 3D83A 3TZMA 4AFEA 1LEZA 3W0RA 1YWRA 4PMTA 2VTHA 4KA3A 2OH4A 1REKA 3F3UA 2OGVA 3R8VA 3Q32A 3OT8A 4JQ8A 5JN2A 3UG1A 3BL7A 4AZEA 1YW2A 3VUHA 3U6IA 3AT4A 4BDAA 5LXMA 5HHWA 4PMSA 4NW5A 1XHAA 3DY7A 3R1NA 4XP3A 2VTSA 3HMOA 4CFUA 4EKLA 2GHLA 4FKLA 1S9IA 3QZIA 2AC5A 3PP1A 2A27A 3CY2A 2BTSA 4R3PA 4U97A 4USFA 3ID6C 3U6HA 4G9RA 4IB5A 5IQAA 2WEVA 3D9VA 4LGHA 4QQJA 5KMKA 1PY5A 1KUTA 2BDJA 3BZ3A 5LVMA 4E6DA 3NAYA 4QP6A 1SMHA 3E88A 1YKRA 1NVRA 4AA5A 5KX8A 3PG1A 4RIWB 4BCKA 2B4SB 5AP7A 4BBMA 1O6KA 4XG7A 5BYLA 2X81A 2VO3A 4O0WA 3AMBA 4K33A 3R01A 5AM6A 1OBDA 3VIDA 2HXQA 1XH6A 3COMA 4JG6A 4LRMA 5GNKA 3FKNA 3SDJA 4ASXA 4CTBA 3W0NA 1H1SA 3CE3A 3Q2JA 5CU3A 4D1XA 3ZYAA 4RIYB 5HG7A 3BL9A 3VBVA 4AGCA 4D1ZA 4U7ZA 3OF0A 4G6NA 2WELA 2ITZA 3PDTA 3TI1A 3EH9A 4AW1A 4BCJA 5TR6A 2YCFA 4FT3A 4NFNA 2X9FA 5E7RA 2V22A 5M55A 2UV2A 4IM3A 4JBPA 2CN5A 4QMQA 4RX7A 4TYGA 5CF8A 2H96A 3LHJA 3R02A 1H08A 2WTJA 4O7PA 3OD6X 4I6HA 1SNXA 2OJIA 4J8MA 4MWIA 5AIRA 2VD5A 2VWWA 5CT0A 3II5A 4EC8A 4D2SA 4V01A 4BCHA 2ZM3A 5BV3A 1OIUA 2CCIA 3CJGA 4C3FA 3FZ1A 1FMKA 3PFYA 3PJ8A 4FKSA 4DEIA 4YBKA 3RAKA 4EKKA 4ZTNA 1QPJA 2FSMX 5A54A 4GKHA 1NVSA 4FNXA 5A4LA 2J0MB 2W1ZA 2R3JA 3HA6A 1YI4A 5E4HA 3RI1A 4RQKA 3HMMA 1P14A 5E8ZA 2O0UA 5C4LA 2R3PA 4Z16A 2WZJA 2IW8A 3R8MA 4FIHA 3MVMA 3R2YA 4WKQA 1JVPP 5IPJA 3PPJA 4AP7A 1R39A 4XG9A 3VQHA 4D28A 5ANOA 3NUPA 2WXVA 3CS9A 4EC9A 4IX5A 3R2BA 3ENMA 4QMMA 2CGVA 4JXFA 2R3GA 4ALWA 4HZSA 1K2PA 2B9HA 4V04A 5CENA 4UX9A 1U5RA 3UZTA 5EDQA 4EH8A 5KNJA 1KE9A 2IPXA 5EM5A 3OHTA 4FT5A 4E5BA 3TV4A 2WHBA 4O7NA 3RAHA 4O7VA 2BKZA 2QI8A 5TT7A 4I21A 2E9NA 5AV2A 3BBWA 3OY3A 3QYWA 3NNXA 1RE8A 4G31A 4GMYA 4B9DA 5CNNA 5F9EA 2WMSA 2Y6MA 4MK0A 5I0BA 4APCA 2OI4X 5LVOA 4FV1A 1YHVA 2CKQA 1XMLA 4FTOA 3UOKA 3ELJA 3PVWA 5DG5A 4EUTA 3LZBA 2VN9A 1BUHA 3HLLA 3PE2A 4FZ7A 3QKLA 3T3VA 1QPCA 2CNQA 5F4NA 4AN3A 3BPRA 3EQGA 3RHKA 2G2IA 5L8KA 1F5QA 4UALA 3N51A 4CCUA 1KWPA 2P3GX 4FOBA 3DA6A 3LCSA 4GRBA 4QP8A 2CGUA 4Y83A 4PV0A 5EKNA 4QDVA 3F5GA 4FK3A 4FSRA 4FV7A 4JX3A 3DDQA 1M2QA 3MY0A 4ZTMA 3NR9A 3M42A 4FKIA 1Y6BA 5CVHA 3EB0A 3I1AA 3MTLA 2IZUA 3LJ2A 2CDZA 3Q53A 4IBMA 5EDPA 4ZLYA 1PJKA 5C8MA 4JI9A 4P5ZA 5JFVA 3PRIA 3Q6WA 3PPZA 4C59A 5CF6A 3F66A 1BYGA 4XRJA 3TIZA 4PP7A 4QMNA 4O0UA 3FLNC 5EHLA 5HCXA 3COIA 2CLXA 4X3FB 2C5VA 2PZ5A 2XYUA 2XAOA 5HEZA 3O7LB 3K5VA 4GW8A 5GIPE 3FYKX 3A60A 4AGUA 3DNEA 1G8AA 3GCQA 4J99A 4O7ZA 4GCJA 4WG3A 4YZBA 3DLSA 1R3CA 4BDFA 2P2IA 4UXLA 2XIXA 2QOCA 4YJUA 4TYJA 1V1KA 4GK2A 2JKQA 3AD5A 1K3AA 3G2FA 3GGFA 3ML1A 4XOZA 3L1SA 3AMAA 4N6YA 4DCAA 3U51A 3LM0A 3MIAA 4WUNA 4U0IA 4G3CA 3JS2A 4MCVA 4F63A 5AADA 4RX5A 2J5EA 5BUEA 5HD4A 5L2TA 4RFMA 3NW7A 3CD3A 4P90A 3SAYA 3C9WA 3DAJA 1XO2B 4GH2A 4MBIA 3TJDA 2OIBA 3MFTA 5AMNA 3DNDA 3CSVA 3RPSA 4XBUA 2OWBA 3T8OA 3WI6A 3L9NA 3O5AA 4H3QA 4DA5A 3VQUA 3HA8A 5HZNA 4FKQA 5K9IA 2CMWA 4OTRA 4JBQA 4RFYA 4DG0E 1TQPA 4BZNA 4YGAA 3WF6A 3DKCA 3ZLWA 4M15A 2VTMA 3NRMA 4PDOA 2JC6A 3KXHA 3ZO1A 4CGAA 2UVYA 4D58A 4WG4A 3BU6A 3ZFXA 4AF3A 4J95A 5KKRB 5EI2A 2C6TA 3KULB 4GG7A 2RGPA 4I4FA 2QHMA 2YDJA 4GVJA 1Q8TA 4FTRA 1KE7A 4BZOA 4F9BA 3LFQA 1UKIA 3QZGA 3UQFA 3L9LA 1H00A 2R0UA 1KE6A 3FJQE 3KFAA 3PRFA 4IIRA 4NJ3A 4TZRA 4ZSAA 3QX2A 3KVXA 3A7HA 5ANGA 4DC2A 5HCZA 3AXWA 5CNOA 3DJ5A 2GQSA 3A7IA 5B0XA 2YAKA 5M51A 2C5OA 2QLQA 2ETKA 3SG8A 4CFNA 4JG8A 1ZWSA 4O82A 5E8VA 4LMUA 2Y4PA 3GFWA 4X21A 3TNHA 4BCQA 4YJPA 2PMNX 3PVGA 4L7FA 4GYIA 3LXLA 4NJDA 4QMZA 2Y4IB 4XV3A 2OG8A 1VEBA 4F7SA 3HDNA 3TKIA 5M53A 2PUUA 3IKAA 2CPKE 3ET7A 4G3GA 1FVTA 5EDRA 2X8EA 4RIXB 1PXLA 2YM8A 4Z7HA 2YISA 3KRLA 1UV5A 4FE2A 3BKBA 5G1XA 4OGRA 1DAWA 5AJQA 3GT8A 3GC8A 3HECA 4MH7A 3W10A 4RWJA 5J1VA 2ACXA 5CXZA 4C37A 3HV4A 4CSVA 2W1IA 3VWAA 4BDDA 4CT2A 5E90A 5FDXA 3VW8A 4ZJJA 4S30A 4WO5A 4LFIA 5A6OA 5J7HA 2VWIA 4U98A 3F5UA 2WMUA 5CAVA 1YQJA 3TKHA 3S0OA 1ZLTA 4DEGA 4WNKA 4I6LA 4HNFA 3GUBA 3G6HA 1OL2A 4BN1A 3QA8A 5M08A 1Y57A 4L45A 4D0WA 3NVKI 3NNWA 5A4TA 4JIKA 5J9LA 4ALUA 3VC4A 4DEAA 1H01A 4CKJA 4XX9A 3ODZX 4MNEA 2OLCA 2R3LA 2QOFA 4RLLA 4ACDA 3BGPA 4X2FA 4WSYA 2FH9A 3NMUF 5HBEA 4O2ZA 5HLWA 4RPVA 4QQCA 4EORA 3C50A 1Q4LA 4FTMA 2YIXA 5CU6A 4ZTLA 5IMXA 2WOTA 5A4QA 2O63A 4JMQA 3TM0A 3KXXA 4FKWA 1P4OA 2UZLA 3BU5A 3R00A 5BX0A 3HVCA 2UZWE 2WIHA 4XV1A 2VTAA 4IZ5A 3ORTA 2X39A 1GZNA 4Y73A 4PY1A 1OKVA 2I1MA 2R2PA 1B39A 3OC1A 1B38A 3LFFA 4B99A 3DKOA 4ACGA 2VO6A 3NNUA 3EL8A 3TXOA 4DGMA 4TWOA 3FMLA 3TNQB 3ZSIA 3R83A 3ZXTA 4U42A 3QWJA 3MPAA 3IGOA 3Q5IA 2XK4A 5HO8A 5CU2A 1AQ1A 3PY1A 1U54B 2NRYA 3N4TA 4IANA 3DU8A 2VWZA 3TNWA 1ZYJA 3VBTA 2NPQA 4K9YA 3I4BA 2VO0A 3OBJA 3OG7A 3B8QA 1W0XC 3Q9XA 3H9OA 3HV5A 4FUYA 5E8TA 4EOQA 4O84A 3BX5A 5M4CA 3C4CA 4MTAA 4IFCA 3F3TA 1YXXA 3NYOA 4TY1A 1A48A 4F70A 2W1DA 5FLFA 4K18A 1JSVA 3ZUUA 4TYHA 4YSMA 2R3OA 4DHZA 5KBQA 3ZH8A 3NIEA 4E5AX 3MGYA 3L8XA 2PUNA 4QRCA 5IUHA 1WBTA 3GEQA 4FTAA 3O8PA 4XBRA 5HTBA 4E8AA 3V8SA