3W0RA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (n202a), ternary complex with amp-pnp and hygromycin b
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSANVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0rA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0rA02
5IQDA 5EQYA 3ATTA 3MESA 4U98A 3N4TA 5C4KA 4R7BA 3UZRA 3TYKA 5FUTA 3ZM9A 1J7LA 2CKQA 4EJ7A 5FTGA 5C4LA 4FEWA 2QG7A 4DT8A 3SG8A 4BR3A 1J7UA 3C5IA 4CG9A 3N4UA 3W0OA 2PPQA 4DTAA 4O7OA 2PUIA 4N57A 5IQFA 5EQPA 4FEXA 4PDYA 5IQIA 3HAMA 5IQHA 2B0QA 3W0MA 3TDWA 4R77A 3CSVA 3FEGA 3W0QA 5EQEA 5IQBA 2CKPA 3W0SA 2Q83A 3ATSA 4U94A 3W0RA 4DA5A 2PYWA 2BKKA 4FEVA 2CKOA 2PULA 3TM0A 5IQCA 4CGAA 3F2RA 3LQ3A 4DT9A 3TDVA 5IQEA 5IQAA 4H05A 2PU8A 4R78A 1J7IA 3G15A 3FI8A 4ORKA 1L8TA 4DBXA 3HAVA 3DXQA 3W0NA 1ND4A 4DFUA 3W0PA 4DCAA 4GKIA 3SGCA 2PUNA 2I7QA 3N4VA 4GKHA 4WZYA 5AFVA 5BYLA 1NW1A 3JR1A 4DFBA 2IG7A 4DE4A 5IQGA 3Q2JA 4FEUA 4DTBA 3DXPA 2OLCA 4CG8A 2PUPA 4O7PA 3SG9A
chains in the Genus database with same CATH superfamily
4RC2A 3BV3A 4D4YA 3DBCA 4I22A 4QMMA 4FNYA 2PUUA 2C6IA 2XM9A 1OI9A 4QTDA 3ZLWA 3UBDA 4E5WA 2OIBA 3EL7A 3LMGA 4NT4A 4HGSA 3NIZA 3D7TB 1XMLA 4HCUA 3I7CA 4O82A 4BCNA 4F1MA 3TT0A 3ZU7A 5HIEA 1K3AA 3F5UA 4EZ3A 1BUHA 4E6DA 4MWIA 5ETCA 4AQKA 5EHOA 3NYVA 3T9IA 2CKQA 4UWBA 3QD2B 3BYVA 5KX8A 2WMWA 4E4LA 5JN2A 4X3FB 4FX3A 2C0IA 5JFWA 4GK2A 1CSNA 3E7VA 3FC1X 3KREA 3LPBA 4NSTA 1Q8WA 4OTWA 3W0OA 4EOLA 2OBJA 4C61A 2JGZA 1E1XA 3NUPA 4L45A 3E92A 4U42A 3ELJA 4DEIA 1MRVA 5DI1A 4BDHA 2OFVA 4PNIA 4J99A 4AOJA 1GIJA 4TYHB 3L8PA 1YI6A 2VO6A 3ORPA 2HZNA 5DT3A 2OICA 4X21A 4AFEA 4B7TA 1IEPA 2C68A 3LHJA 2W5AA 3DLSA 5FXQA 5CWZA 5BMSA 3W2CA 4U5JA 3CKXA 3ACKA 4KS7A 3FQEA 4RJ6A 3S3IA 5EI8A 3AT4A 2QKRA 4U40A 3UNJA 3GU4A 1R0PA 1IASA 2FYSA 2UZUE 5H2UA 2Z7LA 3GVUA 2ZMDA 2GS2A 4CMTA 4UXLA 3QQUA 3RNIA 5LMBA 3NDMA 5L2IA 3QTXA 5JQ5A 4MXXA 3QTRA 2ITQA 3H0ZA 1WBPA 2NP8A 2ZM3A 5CSPA 1QPEA 4FNZA 3EQIA 4OW8A 1JKLA 3HUCA 3ZYAA 2XP2A 4FVPA 4DH7A 4FKSA 4CKJA 3UZTA 4L00A 3QX4A 2XZSA 2WIHA 4R78A 4D5HA 3C4WA 5BVWA 2IO6A 5BUIA 1CTPE 1Z5MA 4PF4A 2CGWA 3LMIA 3F6XA 5EFQA 5FRIA 2G2HA 4E6CA 5H9BA 4M67A 2OJ9A 1JOWB 2HAKA 3TTJA 2X2MA 5ITAA 2LGCA 5JFXA 2IZSA 5L6WL 4I0SA 3V5WA 5M08A 4F65A 3I0QA 3IQ7A 3AKLA 4IDTA 3B2WA 4ZAUA 1PMNA 4QPAA 5I0BA 1NVQA 1GZNA 4EBWA 4AW2A 5I9WA 3F3UA 3GC7A 5JK3A 4HGTA 2XK8A 2XMYA 4FTTA 4O21A 4FIJA 3KN5A 4L53A 1PKDA 4MXAA 2BROA 1ZZLA 4MCVA 4ZEGA 3VBQA 2FUMA 3UVPA 2R3MA 3Q2JA 4RIYA 3OT8A 2XIRA 3LQ8A 4F6UA 3HP2A 4X2NA 5CS6A 4ZJIA 2PUPA 4F9WA 5ANIA 5T3QA 3O0GA 2Q0NA 3L8SA 4G5JA 1WBWA 2PY3A 2X4ZA 3GC0A 2EB3A 1ZY4A 2ZV2A 4ID7A 4MNEA 3Q9YA 2E9UA 4JS8A 5J87A 3QUPA 5KBRA 5CF4A 5A46A 4L43A 1Z9XA 3FZRA 3PXFA 5BVKA 5DPVA 3IW5A 3HZTA 5FQDC 1MQBA 4LFIA 3SD0A 4EI4A 4HNFA 3ORIA 2PE1A 2OG8A 4TT7A 3M11A 4C4GA 2QC6A 5FTQA 3IDBA 4MQ2A 4U79A 4NKSA 4Y8DA 4EHVA 1NXKA 3QCQA 4FTQA 3HP5A 5E8VA 3SG8A 3MSSA 3UOLA 2X7FA 2CMWA 3FAAA 3QTWA 4I23A 5EYKA 3N9XA 4A07A 4F63A 5HNIX 3MFRA 4W8EA 4TWCA 4XYFA 4GVJA 4BC6A 3GFEA 3VS6A 3WIGA 4ZTNA 1P5EA 3FSKA 4RIWA 5HE0A 3EQGA 4BDJA 4F78A 2VUWA 4EBVA 5IA3A 3SXSA 1Q99A 2C5YA 2WMRA 3E8EA 4AT4A 3CJGA 3EIDA 2Y9QA 3QTQA 3RVGA 3KVWA 3P5JC 4ZJVA 3POZA 4FZFB 4F6SA 2V22A 5CT0A 1MQ4A 2WTDA 3MW1A 3V04A 5FBNC 3EQFA 1UNLA 2C1BA 1JSTA 4ZSAA 3MY1A 4JT3A 5AM6A 5LMAA 4OBOA 4DHIB 4IQ6A 3D5UA 4DHZA 4I6HA 4XNEA 3NUAA 3PWYA 5EW9A 2Q83A 3VVHA 3H10A 1OPLA 2BTSA 4AW1A 2RFEA 4YO6A 2UW6A 5DIAA 3HEGA 2R3JA 2UW7A 3FY0A 4MNFA 4TWOA 5D7VA 3MY0A 2ITXA 1OIYA 2ZDUA 3KULA 3ZUVA 3I1AA 3W2OA 2Y4IC 4AZFA 2XEZA 2EXCX 5AEPA 5FP6A 1I09A 1PXMA 2H96A 3ETAA 4PMSA 4QNYA 2FSMX 4APCA 3RZBA 3D9VA 5DT4A 1OZ1A 5TF9A 4G31A 2WTKC 2YN8A 4FKUA 4L52A 3F82A 4RG0A 4FSUA 4U41A 3PXZA 3KCFA 1UVRA 4U6RA 4PMTA 1UU9A 5JEBA 3P7AA 3BX5A 5IA5A 4ALWA 3LXLA 3V8SA 4BGHA 3ZRLA 2OU7A 1CKJA 4H3BA 4KIQA 2AEGA 3HGKA 3R1YA 4C0TA 1M7NA 3O23A 3C4FA 4EC8A 5IA1A 3LZBA 4QTBA 4FTIA 3FHRA 2VTJA 4TRLA 3ZONA 5GNKA 5AAEA 2UZVA 4PL4A 4RVLA 3TZ7A 3UDZA 1Y8GA 4GUBA 2H34A 3R9HA 3GU8A 2GFCA 4JBOA 5CAOA 4CKRA 3BLQA 4JDIA 4RJ8A 4JL9A 4AOIA 1O9UA 3FZSA 3M2WA 3QX2A 2F4JA 5D12A 1O6LA 4GVAA 5BPYA 1O6YA 1W82A 3DY7A 4M12A 4ZTHA 2UZLA 4C2WA 3MFTA 4RX7A 3BU5A 3U9CA 3LOKA 4FTLA 3R6XA 2Y7JA 4AN2A 2VTHA 1Q61A 2VWVA 2XNNA 3OG7A 3Q4TA 3Q5IA 2IVVA 4ANBA 4YBJA 4ZLYA 3UDTA 4YMJA 2BZKB 3SRVB 4D55A 3NCGA 4F0FA 5FTGA 2HW6A 4DEEA 3WOWA 2CDZA 3MH2A 4IACA 5M4FA 5A4TA 4PUZA 2YZAA 5DE2A 2CCIA 2WKMA 4I92A 4MEDA 2C3IB 4H1JA 3U4UA 3HRFA 3P0MA 3C5IA 1WVWA 5L8JA 1JPAA 1V1KA 3PIZA 3EH9A 4AXDA 4YU2A 5JRQA 3UIBA 5C26A 4J8NA 3GU6A 3UQFA 3F3VA 3BWJA 4HGEA 1HOWA 4O7NA 4M84A 4O7OA 2B7AA 2J0MB 3GCVA 4DG3E 3QCSA 3H30A 4N57A 4JQ7A 2YM7A 3RWPA 2X7GA 3QKLA 3I79A 3HKOA 5IUIA 4YJRA 3DAEA 5A3XA 2LAVA 4RJ7A 5HI2A 3UO4A 4FV6A 4AN3A 3A61A 3LXNA 2E9NA 4QMWA 1ZYCA 2VO0A 4FKQA 4E4NA 3I5NA 4QMNA 2BAKA 3IDCA 2J6MA 5L2WA 1YXXA 3WE4A 1Q62A 3VUDA 2QKWB 2YWVA 4YJQA 3PPZA 4I5HA 3QC4A 5HNBA 5J1VA 4YPSA 3ZUTA 4HVSA 1EH4A 1ZYLA 4JDKA 3FYJX 3QD3A 3MBLA 5F4NA 4QTCA 3WZJA 2RG5A 1PXPA 2FO0A 3C0GA 4M8TA 5IQCA 2XK9A 2PMOX 4FICA 2FSTX 3DZOA 4E20A 4KA3A 3CS9A 4O6EA 2EUFB 3NPCA 3MH1A 4XLVA 4LRJA 4QDVA 2W4JA 4NW6A 2VNYA 4OTQA 5AP1A 5HLNA 4AW0A 2X8DA 5HCXA 2R2PA 4F1OA 5HKMA 3EFWA 5HO8A 3D5WA 3KMUA 2UVZA 2WQEA 4IWOA 4LL0A 3GC8A 4CV9A 2X8EA 5FM2A 2BRHA 4IC8A 5HIBA 4JRNA 4TNDA 3BV2A 3TNQB 2Z2WA 4GFMA 3ZZEA 4X2GA 1OL2A 3KK9A 3P08A 1RJBA 4NM3A 3DBQA 4NW5A 1KE8A 2VWIA 2WU7A 5LVNA 2WQOA 3EOCA 3P78A 3PY0A 4IB0A 4OTGA 4EOJA 3CTQA 3D0EA 4ZY4A 1ZYSA 4EH5A 4F99A 3TUBA 2UVXA 3OROA 3SW7A 3KF7A 3A62A 2JITA 3QTSA 4D4VA 2C1AA 1XH8A 1SVHA 4BTFA 2R3QA 4LOOA 4Y95A 5AUZA 3PP0A 5EKNA 4ERWA 3MYGA 3DJ7A 3T8OA 4D0XA 2O8YA 2QOFA 4OR5A 4LI5A 4N6ZA 4V0GA 5HX6A 2JKKA 3TCPA 1P4OA 2Y6OA 4FTMA 5IQDA 2G2IA 2BRGA 5KMIA 3QTUA 2HW7A 3ORKA 4EWQA 2CCHA 5T68A 4NCTA 4EOKA 4LV5A 4FV7A 2PMLX 3VBWA 3Q04A 5KKRC 3UIXA 4RWLA 5KBQA 4HVHA 4CD0A 4O0TA 3R2BA 2IVTA 4H3QA 3ZCLA 5LVPA 3H9OA 3OF0A 4BHNA 1MUOA 4NIFB 4ANLA 4C02A 4WHZA 2XUUA 2Z7QA 3OEFX 3PY3A 3QKKA 4GW8A 2NPQA 2XYUA 4NCTC 4AU8A 4ZY5A 2CJMA 3R9OA 3NUXA 4MVFA 2R7IA 1XH5A 4WO5A 2WMTA 3KU2A 4O0SA 3FDNA 4QQJA 5IUGA 3SQQA 3UP2A 1Q8TA 3DGKA 2J50A 1S9JA 3PY1A 4YJSA 3FL4A 3LCOA 4FV5A 4K11A 4ZS0A 4C35A 4JIAA 5GHVA 3VNTA 3O50A 2BAQA 3F9NA 4RWKA 2VX0A 2XAOA 3BRBA 3DQXA 3ZTXA 1IG1A 1KWPA 3R0TA 2WQMA 4F4PA 3VHKA 2HELA 3CBLA 2OW3A 2B54A 2BFXA 2BKZA 1NA7A 4K6ZA 4DDGA 3C1XA 4YLLA 3CXWA 2NRYA 2JBOA 5JSMA 2OSCA 3KCKA 2O5KA 5JRSA 3V5JA 4C3FA 5EYDA 2DYLA 3K3IA 4JJRA 4O0WA 3FE3A 5DEWA 3AMBA 2PZYA 5AV2A 2NYAA 2Z02A 2WTCA 5A4CA 3FMLA 4JAJA 4S2ZA 4TW9A 1F5QA 2YJSA 3ZEPA 3MV5A 5AA8A 3PXRA 4QNAA 4C2VA 4ACMA 4EOPA 5DFPA 5M09A 1Q3WA 1V0PA 2G15A 4K8AA 2ITOA 3UYTA 2F7XE 5CASA 3DKOA 2ONLA 3HDNA 2VWZA 4MD8E 5J8IA 3TV6A 5A54A 4J97A 1PXOA 5DNRA 3Q6UA 5AUXA 4R6VA 3EN4A 3G15A 4U9AA 4M0ZA 4MNEB 2QOHA 5FG8A 4ZLZA 4FOBA 4FSMA 2B53A 1YHWA 4DCEA 4BCJA 2HZ0A 4I6QA 4S30A 4YZCA 4JG8A 3OY1A 5EDPA 2R3OA 4NTTA 4U43A 2O63A 2ONLC 5A4LA 2X2LA 2QOKA 4QO9A 4WRGA 4R7HA 4EH8A 2I0VA 4QYEA 2YACA 3OS3A 1U59A 2UZDA 1XO2B 1GZ8A 4O7ZA 3ZO2A 2W1GA 3CD8A 1YWVA 3HMIA 4DGMA 4RT7A 4QP3A 3UNZA 4M7IA 5JFSA 1VYWA 4DGNA 4EOIA 3AC5A 5DR9A 4MUQA 4XP2A 4FV8A 3MTLA 2XVDA 4IBMA 5EM8A 3HA6A 3CEKA 2BIYA 4OT5A 4Q9ZA 4IAIA 4IEBA 5ETAA 5CNNA 2C0OA 3OBGA 5AA9A 5CALA 4HCVA 5J9LA 5EHLA 3EN7A 2CNVA 4TWNA 4IVCA 3RMFA 4YTFA 1Y6AA 2PK9A 3AKKA 2X6EA 5HO7A 5AV0A 2XA4A 4USDA 3I60A 3LJ2A 3UMXA 1OGUA 5CU0A 3DBFA 5AIKA 5M53A 5LMKA 1VJYA 1FVRA 2FSLX 3COIA 5A14A 3NIEA 4QOXA 4A7CA 2VTOA 2XIKA 2Y8OA 1R0EA 3JXWA 2ITVA 4E8AA 2GS7A 2JDRA 3FI4A 3L8VA 3ZC5A 1PMUA 2OZAA 3G9NA 3ERKA 5JMSA 3Q2MA 4XG2A 3MA3A 1H24A 2PSQA 4OBQA 4Y5QA 3BHVA 3R30A 1YRPA 2BDFA 4FT0A 4Y83A 2CPKE 2VWUA 4MXYA 4FSNA 3IGGA 4HZRA 3ALOA 2WTJA 3ID6C 4B8MA 3FI2A 3O71A 4IANA 4RJ3A 2YIQA 2YCSA 5G1XA 4O7VA 3RP9A 4DH8A 1TQPA 4RFZA 4FSZA 3KA0A 2GNFA 2HWOA 2OXXA 2EVAA 4KINA 4PMMA 4QMOA 4FTCA 4RFYA 3VWAA 2Z60A 5F9EA 5ICPA 4E4MA 4YZ9A 3RM7A 3UTOA 3GEQA 2A4LA 2HCKA 3MY5A 4FZ7A 5H8BA 4RSSA 4KKHA 3QTZA 5ANDA 3LFAA 3W0SA 5E90A 3BHUA 2AC3A 1PY5A 3ENMA 4ZMEA 3PVUA 4MKCA 3UG1A 3ZO1A 5KMOA 3KF4A 1FINA 4BI2A 4XUFA 3PXYA 4JNWA 4F7LA 3R8LA 4QYFA 2JDOA 4D1SA 1M52A 1FMOE 4V01A 2G2FA 2W1EA 4RIXB 4MWHA 3TV4A 3UVQA 5EOLA 1H1SA 4FYNA 1W7HA 2GQSA 4QRCA 3ZXTA 3L1SA 4I6FA 4Y46A 3QLFA 5CXZA 1CKPA 1OMWA 5D9HA 3SOCA 4GIHA 4IHPA 3SAYA 3F5GA 4JOAA 4XX9A 3I81A 4FV2A 2ETKA 3Q52A 4BY9E 1O6KA 2WO6A 4PL3A 4Q9SA 4IH8A 1M17A 1J1CA 3QHWA 4ZSGA 4C3RA 2YZLA 4BCGA 4FZDB 2OFUA 4DFNA 5K4JA 3GCSA 2I7QA 2J0LA 3COKA 2P2IA 3FLNC 3KXNA 3U87A 4KBAA 3DZQA 4C59A 4ANQA 3KC3A 3DPKA 2X1NA 3CR0A 2WQBA 5HBHA 4YTIA 3VUHA 3P4KA 4OBPA 3SXRA 5DR2A 1DAWA 4DFBA 1K2PA 1KSWA 4EK3A 3HRCA 5IQGA 4I6BA 5HLPA 5D1JA 4JG6A 2XKEA 4CFVA 4D1ZA 4IWDA 3BQCA 3G6HA 3OUKA 4UWCA 4PTCA 1OUYA 4I1ZA 4PX6A 4ZIMA 1PXKA 2VTLA 5FDXA 3ZDUA 4LV7A 4QMLA 4XS2A 4EOMA 4QMZA 2BFYA 4BDGA 2ZYBA 3G0FA 4H1MA 3QQGA 4U98A 4D1XA 4D5KA 2XNPA 4D4SA 3VC4A 4RA4A 4BCQA 1ZARA 3H3CA 4CT1A 1JBPE 4EK4A 2HXQA 5I9XA 3DK7A 3EZRA 3OXIA 3UG2A 3RCDA 2VZ6A 5KZ0A 4JQ8A 2FA2A 3HMNA 2ZFYA 4TY1A 3QCXA 2YAAA 2YHVA 2VWWA 2YEXA 4HCTA 4W4YA 4JDHA 4E1ZA 3KMMA 3WARA 1UU7A 3IKAA 1XMMA 3Q60A 3COHA 3PDTA 4IM3A 2WAJA 3I4BA 3ANQA 4XV1A 5KHWA 3Q9XA 2VV9A 2YABA 5KO1A 4IZ5A 2HWPA 4R1VA 5EM6A 2CLXA 3CGOA 3E7OA 1TQIA 4BCFA 4OLIA 5B0XA 1OBGA 1T45A 3FV8A 3T9TA 4KABA 3TTIA 1G8KA 3VS0A 3CJFA 4D2RA 4RX5A 3DTCA 4DG0E 3ALNA 2UZWE 3BI6A 3OW4A 4Z7GA 3HRBA 4R5YA 1MRYA 1A9UA 3RHKA 2VTIA 3QD0A 2XKCA 1KOAA 3FMEA 4FTNA 5E8SA 5HEZA 4BHZA 4EQCA 3NCZA 3LFSA 3DFAA 3EFJA 3K5VA 4CV8A 1VYZA 5LWMA 2BALA 4FEQA 2RF9A 1PJKA 3KMWA 4XG8A 5D10A 4RBLA 1U54A 3DQWA 3N51A 4RPVA 3QYZA 3BYUA 4N70A 5M57A 5HBJA 2XNGA 4XG9A 4EOQA 4OTIA 1REJA 4IB3A 4FE2A 3G2FA 5CSHA 3ZUUA 3AT2A 4FZAB 5CNOA 4C4HA 4CGAA 5F95A 5CY3A 4BTMA 3OUNB 5FTOA 1JSVA 1OUKA 4J71A 1Q5KA 1KE7A 5KZIA 3PLAE 3SX9A 3EQCA 4BGQA 2XCHA 3F61A 4FKGA 4O6LA 3UO5A 2YDIA 5EYMA 1PMVA 2QO7A 5J95A 4FKRA 2JLDA 5L6OA 5L8LA 2F7ZE 4V0GB 2B1PA 4F0IA 3DB6A 5E7RA 3UP7A 3R73A 4RQKA 1P4FA 2W0JA 1PF8A 3AD5A 3PZEA 2VAGA 4FTUA 4X6QC 2B52A 4II5A 1QL6A 1XJDA 1HCLA 2P33A 3ZM4A 4DFUA 2UVYA 5ANJA 4XMOA 4DEAA 3PFQA 4F9BA 1H07A 1ST4A 2ITNA 2W7XA 4BF2A 4L44A 3NUNA 4AZEA 2XARA 3MS9A 2BPMA 5CENA 3P79A 4FV4A 3W18A 1H8FA 4F7JA 3OZ6A 5BYLA 2P3GX 4FNWA 1BYGA 2IG7A 4GU6A 4PDOA 4PL5A 2WEVA 3GNIB 3EMGA 1PHKA 1PXNA 4FKJA 5AP6A 1GNGA 5M4CA 4DTBA 5A9UA 5AMNA 4FVQA 4RLLA 3OT3A 4YGAA 3V8TA 4E7WA 1QCFA 4YSJA 3OXTA 3PA3A 2W4KA 3F7WA 3IOPA 5LARA 5DG5A 2H9VA 3TEIA 3VF9A 3Q96A 4QQCA 3GXLA 5TT7A 4F7SA 3WF7A 1YOLA 5HCYA 4C7TA 2XIZA 4R7BA 3D5VA 4MAOA 2XBAA 1ZYJA 2GTMA 3NR9A 3OCTA 3ORXA 4O0XA 3TYKA 2F7EE 5HD7A 3L8XA 4MXCA 5LJJA 1W84A 4IZYA 5CF5A 4I4FA 3HLLA 3R8PA 3TG1A 3VQHA 2VX1A 2X8IA 5C4LA 3IW4A 4RWIA 5E92A 3V5TA 1XR1A 3SKCA 5AM7A 2DS1A 4GT3A 2OO8X 4U80A 3F5PA 3R83A 3SV0A 3ANRA 1H0WA 2UZBA 2PVYA 2R3HA 4MBIA 3BQRA 4GU9A 5CT7A 2V0DA 4HPUE 1XBAA 4I4EA 4C4EA 4BB4A 2Q0BA 1ZYDA 3RPVA 2Y6MA 3EWHA 5CI6A 2ZVAA 2OKRA 3RPRA 4W4XA 5CEQA 3P7CA 1XWSA 4B4LA 4GK4A 4B6LA 4BIEA 2IW9A 3MGYA 3RCJA 2A2AA 1JSUA 4YJOA 2X0GA 4V04A 3MJ2A 3UMWA 3HVCA 4AFJA 2B0QA 4ZTMA 4AAYA 4DFYA 5AUVA 4PQNA 5AADA 4J7BA 4GRBA 4G3GA 3UQCA 2C6LA 2CNQA 4WBBB 3SW4A 2YERA 5IEYA 2WEIA 4NKAA 2C5OA 3NNXA 2PZIA 1WVXA 5BYZA 3PJ3A 4BJJB 4F9YA 5FD2A 1SM2A 4BZOA 3IW6A 5CXHA 4ARKA 4L67A 4PV0A 2C6OA 1OPKA 2J2IB 3A7IA 3LE6A 4JR3A 5JGBA 1YXSA 2BKKA 2ITPA 4A9YA 1U5QA 1KE5A 3GOPA 3LLAA 1E9HA 2C4GA 2QNJA 4D4RA 2IZUA 1KE9A 3H4JA 4O0VA 2UZNA 3DS6A 2EU9A 4GMYA 2IJMA 3W1FA 4DHJA 1UA2A 2JBPA 3EN5A 3OTUA 3ENHA 4PTGA 2BCJA 3TJDA 1LP4A 4ITHA 4H3PA 5IQEA 4EH2A 4QP1A 3RK9A 3VRZA 5AJQA 4UZDA 4ZSEA 4WKQA 3R8UA 5EDQA 3F3WA 1W0XC 2RG6A 3LCKA 2C3LA 3K54A 3QTIA 3WBLA 1WMKA 4HNIA 3W2SA 3R9DA 3PJ2A 2RFSA 3V8WA 5BNJA 3HAVA 3T3UA 4XV2A 3VS5A 1YDRE 2VWBA 2OIDA 4YSMA 1ND4A 1R78A 2PTKA 3VJOA 3FLZA 4IAYA 4LDTA 1IAHA 3BYOA 3V5LA 3VUGA 3SGCA 1FGIA 1WBTA 4GT4A 1GJOA 5CEIA 2ETMA 5AWMA 4OGRA 2JC6A 3ML1A 4QYHA 2F57A 4FK3A 4X3JA 1UU3A 3TKUA 3UE4A 4F70A 5E8WA 4MF1A 5CSWA 4FSWA 5FXRA 3QRTA 2XB7A 3SDJA 2J90A 3OFMA 2WTIA 3A7JA 3GOKA 3IS5A 4DE4A 3GUBA 1GIIA 2JIUA 3GFWA 4FEUA 4KKEA 4XOZA 5KE0A 3ZFYA 4XG7A 2XIYA 1R1WA 4S33A 5M55A 3NW6A 4E5AX 3Q32A 5M4UA 4CFFA 4O7PA 4XBRA 4YUQA 4G16A 4O81A 3EL8A 3U51A 2GHMA 2OGVA 4Z16A 5GJFA 3W8QA 4UALA 3D5XA 4ZLOA 1ZLTA 2QOIA 4BZNA 1SMHA 3MWUA 3MESA 1VZOA 2C6DA 2QOOA 2X7OA 5K5NA 5AV1A 3C4EA 4R7IA 3G9LX 3ROYA 2QD9A 2R3PA 3GI3A 4AACA 2GNGA 2C3JA 3EKKA 4ACDA 3LXKA 4EH9A 3QZGA 2I0EA 2BMCA 1G3NA 4P2KA 4BCMA 4YTCA 4FL2A 5HVJA 2JAMA 4YP8A 4AZTA 4USFA 5HESA 4O22A 1FBNA 2XJ0A 2Z7SA 4O7YA 4M68A 5DRBA 4JLCA 3O96A 4J53A 4B8LA 4WD5A 4CG9A 2R3FA 2ZM4A 3GU5A 1KE6A 4FIIA 3REPA 3CGFA 4K2RA 4EUUA 3PLSA 5K4IA 1XH6A 3BIZA 5J7HA 1FVVA 2WMQA 5AAGA 4BBFA 3C4ZA 4W4WA 3E8NA 3NUUA 2WTWA 2XANA 3UOHA 5I9YA 1CM8A 3HV7A 4GG5A 5DRDA 4LRKA 3V51A 4BDBA 4D58A 2GTNA 2HIWA 2JDTA 3HAMA 4G3CA 4MD7E 1FOTA 4CTBA 4CRLA 3VBXA 3MIAA 4YPDA 5LOHA 3DB8A 3PE1A 4I24A 4M0YA 4A9RA 4EQMA 3NYNA 3CSVA 3D14A 3QF9A 3R01A 2V5QA 3R8VA 3VS3A 4UYAA 3UIMA 2BRBA 3LM0A 1W8CA 4ZTLA 3NNWA 4EH7A 3UC4A 3NEWA 4XBUA 2HENA 4R3PA 2EB2A 3P1AA 4TN6A 2WHBA 3UODA 2QHMA 2PYWA 1H0VA 3BL9A 2PVJA 4AZSA 5CZIA 4HYUA 1WBOA 3RINA 4O7WA 2GQGA 3A7HA 2PVLA 4WSYA 2WOTA 3U54A 3W55A 3ZZWA 1JKTA 3A7FA 4FI1A 4IW0A 4QTAA 4CQEA 2B4SB 2Y0AA 4JX7A 1FQ1B 1PYXA 4LM5A 3VS1A 1V0OA 4O0RA 4H05A 1OBDA 3QZIA 3DV3A 1A48A 1AGWA 2IZRA 4AXFA 4ZP5A 3ZLYA 1WBNA 2RL5A 2V62A 2OI4X 4QEBA 4E26A 2YIYA 2H6DA 4Z3VA 4EZ7A 1OPJA 2UW4A 4GYGA 5BV3A 3EQPA 3MN3A 2C47A 4XCUA 5EG3A 1Q8UA 1FPUA 5CLPA 2G9XA 3LCDA 5DA3A 3O7LB 4K33A 3K2LA 4UXQA 1QPDA 2GU8A 3A2CA 4X6RA 5HE3A 2J5EA 4WOVA 2PE2A 4P5QA 4IE9A 2XKDA 1ATPE 1IA9A 4AGCA 5IEVA 4WZYA 2XNOA 3QZHA 1TKIA 4QQ5A 3VO3A 5BVDA 1UNGA 4ALUA 1PXLA 5CVGA 3OD6X 4G5PA 5HU3A 3GCUA 1GZKA 3ORTA 4C4IA 5EK7A 1Y8YA 3SHEA 4IDVA 3HV3A 3C9WA 3DJ5A 3TWJA 4MD9E 4V05A 4BDAA 3R9NA 2PVFA 4YZNA 4CT2A 2WMAA 4XHKB 3SG9A 1DI9A 2PE0A 2ZB0A 3PG1A 5CQUA 4BKJA 5F20A 3MVLA 3TZ8A 3AD6A 4C3PA 4JBPA 1Y57A 4ERKA 3QGYA 3NRMA 3EYHA 5BUEA 5E8TA 4RX9A 3NNUA 1ZMUA 3O8PA 4CEGA 5EI6A 3OBJA 4U3ZA 3UZRA 2ITUA 3I6WA 4NTSA 4KBCA 2I6LA 4WT6A 5IDNA 3HV6A 2CNUA 3D7TA 3FXZA 1ZAOA 3AD4A 2YITA 2YM6A 1Q41A 3BYMA 3VUMA 4O2PA 3A8WA 5IU2A 4RJ5A 5BVNA 2I0YA 3OC1A 1TVOA 1DS5A 3KIOC 3TJCA 3V6SA 4GUEA 2OIQA 4IX5A 1J7UA 3HMMA 2GFSA 4EKLA 3N4UA 1OIUA 3JYAA 3Q3BA 4MXZA 4BDEA 4DTAA 4HYHA 3D15A 3DXNA 4CZUA 4FTRA 5KMNA 3AGMA 5JH6A 4I6LA 3MVHA 1Q3DA 2QOBA 3QHRA 3QQFA 4FV9A 1WVYA 2OJFE 3DKGA 4HJOA 2JDVA 3QBNA 2WELA 4KWPA 4O38A 3RHXA 5M06A 4GEOA 3FQSA 1JQHA 3PUFC 1Y91A 3AC2A 3OW3A 4L3LA 4YZBA 4QQTA 4L6QA 3NZ0A 4TYHA 4X3FC 3GT8A 3KFAA 2GNJA 2Z7RA 1NVRA 3ZOSA 3BU6A 2YCRA 5M07A 2OXDA 1GOLA 2R3GA 4AA0A 1AQ1A 2OH4A 3D2IA 4BDCA 5EQEA 3SVVA 5B2KA 3DTWA 4M97A 4QYYA 2CKPA 2VU3A 2GNIA 1NVSA 2JDSA 4JBVA 4XOYA 5M44A 4LRMA 2R3KA 3C0IA 4O96A 5AP5A 4APPA 3D4QA 5L8KA 3CLYA 1YI3A 2IPXA 2W1DA 5AUYA 4JRVA 3TM0A 4DEDA 1OKVA 1Q4LA 3GGFA 4CCBA 1YQJA 3HX4A 3SXFA 2QG5A 1H1PA 2Y4PA 3DT1A 3LFBA 3LQ3A 5FGKA 3RPSA 3FJQE 4O0UA 1OIQA 2YFXA 3LFFA 3QRKA 3RWQA 4X0MA 3L9PA 5CQWA 3ZH8A 3BU3A 4BCPA 1SZMA 5CAUA 3DOGA 1MP8A 2YA9A 4ACHA 2UZOA 3IECA 4FT3A 5L2SA 3FXXA 3UZPA 1W83A 5DLSA 3C50A 4FODA 1X8BA 2OJIA 2XJ1A 3ZSGA 1KOBA 4RC4A 4X2KA 4YBKA 4QP4A 4Q5EA 3ZEWA 5BMMA 4KAOA 3PG3A 4FT7A 4GKIA 5CZHA 3ZDIA 2VTAA 3FL5A 5CAVA 4DGOA 3W8LA 4BIBA 4PTEA 1S9IA 2WMUA 3LJ0A 3MVMA 4MTAA 5C8NA 2XRUA 5AFVA 3QLGA 4WNPA 2V55A 2VN9A 1YHSA 2F9GA 3JUHA 4FVRA 4KSPA 4QP8A 2A1AB 4IB1A 3TI1A 3WF5A 4J1RA 4RIYB 4UN0C 5IDPA 3FMDA 3AC1A 4UYNA 3AC8A 3GB2A 4IMYA 3RK5A 3L9LA 4CLJA 5GINE 4CG8A 2F2UA 2HOGA 3S2PA 1BL6A 3KL8A 5B2LA 3QKMA 4U8ZA 3DBEA 2ERKA 3WI6A 1ZY5A 5EQYA 4DEGA 4H58A 5B7VA 5K3YA 4XV3A 3RJCA 5G6VA 5E8XA 3S1HA 2X6DA 2Z8CA 5A4QA 5EOBA 1BLXA 1ZMVA 3ZBFA 5IPJA 4HZSA 4LGHA 5CEKA 3RAHA 3JS2A 4NFMA 4U45A 3ZM9A 2VO3A 1SNUA 5J5SA 4FMQA 2YIRA 3F2AA 2CSNA 3ODYX 2XIXA 3O5AA 1UNHA 2PVNA 1WCCA 4LV8A 4EL9A 3VS4A 2CHLA 3WF8A 4EOSA 4RIWB 5I9ZA 3JY0A 3EJ1A 3LLTA 4CLIA 2R0IA 4L3JA 2BAJA 5HICA 1UWJA 2AC5A 3QQJA 3DU8A 3S0OA 4JX3A 4FG7A 4ZS4A 1HCKA 3BWFA 1NY3A 4BIDA 1LEWA 3OEZA 3S4QA 2GPHA 3DNEA 4L01A 3PVWA 1XH9A 1B38A 4DFZE 3R04A 2BTRA 4Y85A 3V6RA 4AF3A 4KRDA 4AT3A 5D7AA 4YJUA 2V7OA 4UWYA 2Y4IB 5LWNA 5BX0A 2J51A 5GJDA 4C33A 3R7VA 1APME 3FXWA 2IW8A 5GIPE 2W1ZA 2IN6A 2W05A 1OKZA 2VWYA 1SVGA 1U5RA 4UBAA 5C9CA 3FPQA 3MJ1A 4PP7A 2BHHA 1F0QA 3PTGA 3QFVA 2C5XA 4TYGA 4XRLA 3LQ5A 1KV2A 3PSBA 3ATSA 2WPAA 1KV1A 2WTKB 4P5ZA 4WA9A 4TPTA 2UUEA 1K9AA 3PJ1A 5AV3A 3KULB 4DLJA 4FA2A 5KHXA 2JFLA 5LCJA 4BBEA 2R3RA 2CN5A 5CEPA 4BDDA 3ROCA 5IZFA 5AP7A 5DHJA 4FUXA 4E5BA 2B9IA 4YZMA 2E9VA 4DYMA 3FLWA 3QRIA 4E73A 4EHGA 3KY2A 2A27A 4UEUA 2JIIA 1OKWA 4KBKA 3U9NA 4HW7A 4RLKA 4AXAA 1J7IA 1YVJA 2IVUA 4FV1A 5DVRA 5DGZA 1L8TA 4A4LA 3UNKA 2B9JA 3PSDA 5HHWA 3RAWA 1YHVA 2IVSA 3CQUA 2YM5A 4Z9LA 3V5PA 5BVFA 3LXPA 4DCAA 3AXWA 2AYPA 4M3QA 4XLIA 4ASDA 4JIKA 2HZIA 4A06A 3F66A 4IVBA 2YWPA 1VEBA 2ZAZA 3EQHA 1STCE 3GCQA 4EZ5A 1BI7A 5JGDA 1RDQE 2B55A 2ITYA 4XJ0A 5LVOA 4IFGA 3R1SA 4A9UA 3HDMA 4CFNA 4TZRA 1LUFA 5JKGA 2WGJA 4QMPA 3DDPA 1OM1A 5HD4A 2DQ7X 4UZHA 4EYJA 3NUYA 4OTDA 2XK7A 2QODA 5KNJA 2GSFA 3OCBA 3E8CA 3P9JA 2W5HA 4IM0A 4UY9A 3AMYA 4D28A 4QMQA 4KUJA 3G33A 1QPJA 3FPMA 4CVAA 3R1NA 2YISA 3VIDA 5HX8A 3UOJA 1PW2A 4FL3A 3TL8A 3WYYA 4GFOA 4EC9A 2BR1A 1OL1A 4B0GA 4NFNA 4N6YA 4KD1A 2B9FA 1URWA 1YKRA 2BZJA 3MIYA 3NW7A 1SYKA 5AIRA 5HE2A 3ZHPC 2XS0A 4S32A 2CGXA 4ITJA 4AG8A 1GZOA 2R3IA 4O27B 3GQIA 3RALA 5JQ8A 2HZ4A 1FVTA 4NU1A 4YNEA 3SOAA 3TNIA 4WUNA 4DLIA 4G34A 5TO8A 3WF6A 4NZWB 2YCFA 4WBOA 4B99A 5A6OA 2R9SA 1Y6BA 5TKDA 3OY3A 3SA0A 4D9UA 3D7ZA 4F7NA 4FKWA 3W2RA 4FNXA 3JPVA 1OGYA 2YM4A 3KRLA 3ULZA 2O65A 3K5UA 2BZHB 2XM8A 1B39A 4AZVA 2WXVA 4IAAA 2PUIA 3PFYA 2JIVA 3BL7A 2C69A 3E8DA 4K9YA 4AW5A 4CNHA 2BDWA 4G2FA 3QZFA 4O7RA 3RAKA 4FKPA 2I0HA 2C6MA 1JAMA 5AX9A 1J91A 4L3PA 3TZMA 3BLHA 3ZLSA 4FUYA 1OL6A 4RJ4A 3SC1A 3BPRA 1J1BA 3HNGA 4LQMA 3UGCA 3NSZA 3FEGA 2QOCA 5AP3A 4MBLA 3EHAA 1URCA 4KKGA 3W0QA 3NFFB 2ZM1A 3NX8A 2W1FA 1H1QA 3II5A 4P7EA 4HPTE 3EYGA 1M2QA 2PVRA 3L9NA 4L8MA 1SNXA 2KULA 4FG9A 3O8UA 3TZ9A 3CC6A 1G8AA 1B6CB 3R21A 5FLFA 4N4SA 2XYNA 4DEHA 4F9CA 2W9FB 3G0EA 3F2RA 2R0UA 4CTCA 4BCIA 4LOQA 3IGOA 3TACA 2IW6A 1A06A 4IWQA 4CFUA 4D9TA 3W32A 4GG7A 2VGPA 3L9MA 4RVKA 3BE9A 4LL5A 2J7TA 3NYOA 1DAYA 4EK5A 1UV5A 4MK0A 2PHKA 3O17A 4Z55A 4JXFA 3I6UA 4ZTRA 4BTKA 3VULA 5L3AA 1OITA 1KUTA 1ST0A 3FI8A 3FC2A 4O7LA 3U8WA 2HY0A 3Q6WA 4C58A 4DN5A 4RRVA 4FR4A 4UV0A 1YW2A 5I5ZA 3QALE 1GAGA 4FTOA 5M56A 4GT5A 5DOSA 1RW8A 4G6LA 4IJPA 5CF8A 4WIHA 4ENYA 2J5FA 2YIXA 3MH0A 4KSQA 2FVDA 3W0PA 2XEYA 1M2RA 3LKMA 4R3CA 4R1YA 5KCVA 4IJ9A 2XNMA 2QR8A 2I40A 2VNWA 4GK3A 4YHFA 4TYEA 2QOQA 3W2PA 3B8QA 4CMUA 1Z57A 2VTTA 4KB8A 4L7FA 4BCKA 2NO3A 2SRCA 3HV5A 3BHYA 4W8DA 2YAKA 4WUAA 5KKRB 3ZO4A 4C62A 4DTKA 1PXJA 3EQRA 4J52A 2YCQA 4TWPA 3R7UA 4XG3A 3OWPA 3QWJA 2OLCA 3QXPA 3C0HA 4EJNA 3KQ7A 4A9TA 3W2QA 4FGRA 4IIRA 2VTPA 3E64A 5ETFA 4RZWA 3Q9WA 4MBJA 2JAVA 2WMXA 3FZPA 5HG5A 3BEGA 5HE1A 3D94A 3NLBA 5CEOA 5LQFA 3VW8A 3I7BA 3ATTA 3LFDA 5KUPA 4WG3A 4Y73A 4NH1A 4XRJA 4ZTSA 4BDKA 3WIKA 4OUCA 3CE3A 3TNPC 3DJ6A 4C38A 3PWDA 5DH3A 4FKVA 4PNKA 2WFYA 4I5PA 4MX9A 3TIYA 5HVYA 4TL0A 4HVGA 1XHAA 3PSCA 3FKLA 4J98A 2XNBA 3C5UA 4EH6A 3QRUA 4ENXA 1H28A 4EHZA 4BDFA 3TNHA 2WMVA 2YJRA 3O7LD 4FSRA 5HTBA 2IWIA 3M1SA 3RPOA 3TMOA 2X9EA 4NK9A 2C6TA 1YXTA 5HG7A 3MFUA 4I93A 5E8UA 4NWMA 1W98A 5AAFA 4AE9A 1JKSA 2F2CB 4QP6A 2GHLA 2XALA 4ASEA 3P5KA 4DFXE 3IONA 2QU6A 3BYSA 5IQIA 3QAME 4L46A 3WZKA 3EQDA 2P0CA 3PJCA 4I21A 3O8TA 4JVGA 4G17A 4RQVA 5IA2A 1R39A 1T46A 4FZ6A 3VS2A 4FIGA 1WBSA 2ZV8A 3S95A 2BDJA 3ZLXA 4YZDA 4I0TA 4YHTA 4X7QA 4EHEA 5HU9A 4EKKA 4BYJA 3AT3A 2GNHA 2OF2A 3KKVA 3DKCA 3RTPA 4RWJA 3MA6A 4LG4A 2JFMA 4L7SA 3LAUA 2XAMA 4LOPA 4AQCA 2HYYA 4K0YA 4WNOA 5E91A 4JMQA 3VUIA 3G6GA 4AXEA 1GIHA 1ZOEA 3TDVA 2UW9A 2FGIA 4ZXTA 2KTYA 5CANA 1E1VA 2J4ZA 3PVBA 5CU3A 5CU2A 3UQGA 3MPAA 2QI8A 5AP0A 4FIFA 4H36A 3RM6A 2QHNA 3FSFA 3QGWA 3TV7A 4DG2E 3C7QA 3PE2A 2PL0A 2R3LA 4R3RA 3W33A 4H39A 5B2MA 5CAPA 3AC3A 2ITTA 3AQVA 3LVPA 3F5XA 4U3YA 3F3ZA 4G9RA 4WNMA 5GIOE 3BELA 5E1EA 2WZJA 3RK7A 2PUNA 1UKIA 4FV3A 2PVHA 1BL7A 4YTHA 5IISA 5IA4A 4DFLA 4QMTA 4UX9A 2O0UA 3R7OA 4IAKA 2BVAA 4EOOA 3MB6A 3GP0A 3QL8A 2XBJA 4YURA 4BVUA 1UKHA 4QT1A 4F1TA 3NVMB 3OTVA 3KEXA 4CFXA 2YM3A 4DDIA 2CGVA 3DXPA 3H9FA 3KXHA 4R5SA 1YI4A 4AGWA 4HVDA 4P4CA 2YIWA 2XCKA 3IDPA 3QC9A 2X9FA 4L68A 3A4OX 2B9HA 4O7TA 4YHJA 3VQUA 3FHIA 4CFMA 3UC3A 3BZ3A 2BRNA 4ANSA 3BKBA 3F88A 4G3DA 4DINA 3G90X 3MFSA 1ZRZA 4FSQA 3FMMA 2C6KA 3VHEA 2QLUA 3Q53A 1DI8A 3E62A 5IG1A 2YDJA 3LFNA 4FSYA 1YWNA 2VGOA 3DDQA 5DEYA 4ZZMA 4LMNA 4QTEA 5C4KA 1IR3A 3NMUF 4DGLC 1BKXA 4GYIA 4EORA 1JNKA 3A99A 3BHHA 4G3FA 4X2JA 3TKIA 1J7LA 2OZAB 4EYMA 3OWKA 3U6JA 4RMZA 2O64A 3VBYA 3RKBA 4HOKA 4EJ7A 2QG7A 3FZ1A 5LVLA 4K1BA 2OXYA 5K9IA 2PMIA 1YWRA 3MB7A 4C34A 3E63A 4BCHA 1WAKA 2C30A 3FZOA 4FT5A 1JVPP 4OTFA 4RC3A 3FBVA 3UDBA 2W1CA 4DITA 5TOZA 2ZV9A 4C37A 3H0YA 2E2BA 3ZMMA 4FGBA 5ANGA 2OF4A 4LUDA 3O2MA 3V5QA 3KRXA 4BRXA 4E6AA 4QMXA 4CSVA 3BEAA 5FBOA 3DFCB 4AGUA 3BBTB 4F08A 3FLQA 3G51A 2WTVA 4FG8A 2QO2A 4ACCA 4ACGA 1VR2A 4AUAA 3IOKA 3W0MA 3KK8A 3ZO3A 2OJJA 1ZXEA 2EWAA 4TKSA 2WD1A 5ANOA 3KXXA 5FDPA 2NNWB 4E4XA 1M7QA 5IQBA 1NT2A 2VTQA 3AGLA 3KXZA 5C8MA 4IX4A 3VRYA 3TNWA 4ZZOA 2VX3A 4FEVA 2CLQA 2GDOA 4FV0A 1Q8ZA 4GFGA 5TR6A 3A8XA 3PXQA 3FMNA 5IMEA 4BI0A 4KNBA 4O86A 4LMUA 4RVTA 5H8GA 3PIYA 2E9PA 4YC3A 3SLSA 1OKYA 3A60A 1RE8A 2VD5A 3ODZX 3QUEA 3DK3A 4YLKA 4Z7HA 2R3NA 4D0WA 2BUJA 1P2AA 5IQAA 4RVMA 4BBMA 5C03A 5DYJA 2PU8A 4O91A 5HIDA 5CU4A 1DM2A 1IAJA 3DCVA 3MPMA 3CPBA 4OT6A 4RIXA 4D2SA 5BVEA 5AUUA 5F94A 4I94A 4QMSA 3R8MA 4GCJA 2BILB 4C4JA 4QMUA 1PMEA 1WFCA 3HL7A 3UO6A 2G1TA 5C1QB 3E87A 4IM2A 4ZOGA 4ITIA 5CSVA 4NUSA 2JKOA 2YDKA 3TIZA 3FZTA 4MXOA 4GSBA 3ZSHA 1ZWSA 4LGGA 1BMKA 4J8MA 4RIOA 5CAQA 5AP2A 2XH5A 3HMPA 4L42A 5LCKA 4ZK5A 4BGGA 2JEDA 4I5CA 2RFNA 3DLZA 4IAZA 3QXOA 3IK3A 3AMAA 3FI3A 3RNYA 2O3PA 4I5MA 4RX8A 4A4XA 4GS6A 3UYSA 4AS0A 5ANEA 1QMZA 3JR1A 4XG6A 1AD5A 1H08A 2WU6A 3PVGA 3AG9A 3BE2A 4NYEA 2ETRA 2BRMA 2J0IA 4NM7A 5DR6A 4FKOA 3VN9A 5M51A 5CSXA 3C13A 1G8JA 1PRYA 3IW8A 4BICA 3VJNA 4I0RA 3OWJA 3E3BX 4M69B 5A6NA 3EN9A 3ZBXA 3DKFA 3UDSA 1Q24A 2O2UA 4FKIA 3PPJA 2QR7A 1LEZA 3PIXA 4XP3A 3ZFMA 3NAXA 3BBWA 1R3CA 2X2KA 3ORNA 3BLRA 4GL9A 5CTPA 3R22A 5KMLA 2XRWA 2CGUA 4FBXA 3GCPA 3FKNA 1CDKA 2FH9A 2WIPA 3ITZA 3KRWA 4CKIA 2G01A 3C51A 3CQEA 3F69A 4MHAA 4BI1A 4BCOA 4QP9A 4IVDA 5ACBC 2QVSE 3DNDA 5ACKA 2BIKB 3K3JA 3CP9A 4BR3A 3KN6A 3LMHA 3OCGA 4G6OA 5C8KA 1OECA 3DAKA 3WE8A 4FJVA 1WZYA 2EXMA 1OVEA 2PPQA 3FYKX 4G6NA 4G9CA 3QQLA 3IW7A 3LW0A 1CMKE 3ULIA 2XNEA 3BGZA 4O0YA 5H8EA 4Y5HA 3UPXA 1H4LA 1L3RE 4NM0A 5HLWA 5IQFA 3WZDA 3ZFXA 3FLSA 4I3ZA 4PDPA 2XJ2A 4FEXA 3CTHA 3P23A 4QMVA 2YM8A 5KMKA 3HUBA 5FM3A 5IQHA 5HBEA 2CN8A 4HVIA 3U6IA 4XV9A 1Q97A 4BYIA 5J9YA 2QONA 4ZMFA 4YC6A 4J95A 3OXZA 5FEEA 4NJDA 4WG4A 2UZTA 3EKNA 3WILA 3ACJA 3UPZA 4E6QA 1WBVA 4AE6A 2PWLA 1CKIA 3NFGB 1U54B 4O2ZA 3PRFA 5E1SA 4DF3A 5HVKA 2ESMA 1SVEA 1XBCA 4X3FA 1ZOHA 4PRJA 4XP0A 4GJ2A 3R2YA 2JKMA 5DN3A 3VUKA 4I20A 4IAFA 3FUPA 2CKOA 2VTNA 3HMOA 4DA5A 2BZIB 2I1MA 2PULA 1YDTE 5HTCA 3ORMA 4F09A 2J0JA 3V01A 4F6WA 3R71A 4IC7A 4YJPA 1V0BA 3LCSA 3QQKA 5CEMA 1U4DA 2ZMCA 3QCYA 4GIIA 4YJVA 4ZSLA 3B8RA 3HA8A 4C36A 3OP5A 3CIKA 3FMJA 2W1HA 4QYGA 4DT9A 3WF9A 4K18A 3R9RA 1H25A 5JFVA 4U81A 2GCDA 2C5VA 3BGQA 4N0SA 3BCEA 3Q4ZA 4DH3A 1J3HA 3OOMA 4EEVA 3GBZA 4U7ZA 3R28A 3TXOA 4ZTQA 4M14A 4C4FA 3BLAA 3R7EA 4XG4A 2W99B 3DBDA 2QCSA 3JVRA 2ZDTA 3D2KA 3GQLA 4FKTA 3NAYA 4MH7A 4S34A 4LYNA 3GU7A 3NW5A 3KVXA 2RFDA 4IVAA 4U0IA 5H3QA 5K5XA 4CCUA 4RZVA 1H26A 3MI9A 5EW8A 5CX9A 3RI1A 4QMYA 1GY3A 2GHGA 4KRCA 1H27A 3ZXZA 4BTJA 5DBXA 2ITZA 3LIJA 1RQQA 1OL7A 2C6EA 4IZAA 3RPYA 4ASXA 5EH0A 3CY2A 2WMBA 5I9VA 4PP9A 1YOJA 5IEXA 2XF0A 2QLQA 2WMSA 3B2TA 3QU0A 4PY1A 5FXSA 1IA8A 4ANMA 3TUDA 3NVKI 1I44A 4A9SA 4DC2A 5HZNA 1ZZ2A 1IRKA 3FY2A 3QWKA 4TTHB 1ZMWA 2A0CX 4AZWA 5JZJA 2RIOA 5C27A 4EWHA 4CRSA 3VF8A 5EDRA 3LFCA 3QA8A 4G3EA 2QOLA 3E3PA 3EB0A 4ZZNA 4TNBA 3COMA 3EN6A 5I9UA 2W9ZB 3NGAA 5FEQA 2X81A 3N4TA 5IUHA 4AOTA 3AOXA 2XK4A 3Q5ZA 4JDJA 5CVFA 3RGFA 4M15A 1P14A 2ERZE 4U97A 4TXCA 2WB8A 3PJ8A 5FUTA 5IF1A 5CVHA 2VWXA 3PYYA 4K77A 5CF6A 3LCTA 3MDYA 5IH5A 5E4HA 3BGPA 3CPCA 3F2NA 1LPUA 4NL0A 3HYHA 2PVKA 4L9IA 4QDEA 4CFWA 4XH6A 4M13A 2A19B 2PVMA 2VTRA 5KMJA 4TYIA 1XQZA 2X4FA 3FMHA 3FWQA 4ZSJA 5ETIA 3R7YA 5IH4A 2P55A 3D83A 3KXMA 3UOKA 2WOUA 5E9EA 3CTJA 2UW0A 3QYWA 4JAIA 4EONA 5EQPA 1PYEA 1TFFA 3PP1A 3G5DA 3R63A 3W16A 3AC4A 3FKOA 3PXKA 1PXIA 4JR7A 5ANKA 3TDWA 2AUHA 2E9OA 2QO9A 1H1WA 4R77A 3Q4CA 4O83A 3S00A 5FEDA 4BZDA 3WZUA 5E8ZA 3VONA 4RFMA 3EZVA 4IFCA 3HV4A 5HG8A 4YO4A 3NWWA 1YXUA 2RGPA 2W5BA 3QRJA 4J96A 5E8YA 3LM5A 5EYCA 2PZPA 4FIHA 2C0TA 4BJJA 3NS9A 3W0RA 5KMMA 2OWBA 2ACXA 4FL1A 1VLRA 4W4VA 4EH4A 1H00A 3ZRKA 4FK6A 4CMOA 3H9RA 2JKQA 1OL5A 3GC9A 5AUTA 3VBTA 3HECA 4FOCA 1REKA 4YJTA 3MH3A 3EQBA 4F64A 2P4IA 5HNGA 4AWIA 2OJGA 5CI7A 3R7IA 4DHFA 2OH0E 4HYIA 2GS6A 3QQHA 4USEA 3DAJA 4BDIA 3FQHA 2HK5A 2HXLA 2W17A 4QPSA 4QP2A 2F49A 1YXVA 4WG5A 3FLYA 3ORZA 2WQNA 4O84A 5EM5A 3DXQA 5CYIA 3ZC6A 3IPHA 3ZRMA 3UIUA 3QA0A 4FT9A 4NM5A 5EM7A 5D11A 5DWRA 3W0NA 4ALVA 5BUJA 4YLJA 1LR4A 4CZTA 4F9AA 1Q8YA 5EHYA 4A4OA 5FP5A 4E93A 3LFQA 3N4VA 4HGLA 3ORLA 2W1IA 2W4OA 2IZTA 4NJ3A 2JD5A 2ZB1A 4GKHA 3VS7A 3LFEA 3Q4UA 4AAAA 3OMVA 3OVVA 3PA4A 3R1QA 4LUEA 5EW3A 3TUCA 2V7AA 4IX3A 3ET7A 3MVJA 4EK8A 4IZ7A 3UJGA 3POOA 3IO7A 4B9DA 5LXMA 1FMKA 5LMKC 3LJ1A 3IG7A 1ERKA 2QQ7A 3M42A 4GH2A 5HCZA 4YJNA 4JBQA 4DGGA 1ZOGA 5BQ0A 2GMXA 3A4PA 2GQRA 2OZOA 2PZRA 3U55A 5A4EA 1UU8A 4GV1A 3TKHA 5LVMA 4ASZA 3FMKA 3ZSIA 2PMNX 3F7ZA 2FSOX 4Y72A 2C5NA 3CD3A 1XH4A 2UZEA 3P7BA 4IX6A 4IWPA 3I0OA 4AA4A 5T6KA 3DK6A 3P86A 4RA5A 5L6PA 1G8SA 3NUSA 5J9ZA 3OWLA 2P2HA 4PDSA 3VAPA 1OB3A 1XBBA 2UW5A 3E88A 5HQ0A 3W10A 4FEWA 1FGKA 3MPTA 4AP7A 4DT8A 3PZHA 5I4NA 4YC8A 5CU6A 4Q5HA 4P90A 3R00A 5GJGA 2GNLA 3WZEA 5L2TA 5AV4A 3C4CA 3QUDA 3KXGA 4BN1A 3VBVA 1UWHA 3KRRA 3NNVA 5BVOA 4XEYA 3THBA 4U44A 3F3TA 5HG9A 2CKEA 2XKFA 3A7GA 3PA5A 4JQEA 5DT0A 3PRIA 2ZV7A 3JVSA 4IB5A 2RKUA 4FKLA 2QURA 1BX6A 2W06A 2ZJWA 3KRJA 3R02A 3WYXA 1JKKA 2XK3A 2DUVA 4PDYA 4OTRA 4DEBA 4WRSA 5JGAA 2ZOQA 3U6HA 1G5SA 4JG7A 1MRUA 4WNKA 5AUWA 5IMXA 5JZNA 2XK6A 4FTAA 1OIRA 3DA6A 3EFLA 1QPCA 2VTSA 3JY9A 4UB7A 3SRVA 2ITWA 4AA5A 4DH1A 3Q9ZA 5EKOA 4KS8A 4S31A 1H01A 1YOMA 2OK1A 2VRXA 5BYYA 5J1WA 4IADA 1YDSE 3AKJA 5C01A 3U4WA 2R64A 5JT2A 4YNOA 4U94A 4DH5A 4ONAA 4EH3A 3OCSA 4GJ3A 3OHTA 1M14A 4MYGA 2R4BA 4AXCA 2FB8A 3EFKA 2UW8A 3QD4A 2R5TA 4PWNA 5AX3A 5EI2A 4DAWA 5IA0A 3TN8A 3CKWA 2BHEA 2REIA 5HORA 5AP4A 4G1WA 2VO7A 1XKKA 1H1RA 1TQMA 4HYSA 2NRUA 1JWHA 3RAIA 2DWBA 4FTKA 3ZS5A 3CCNA 4AGDA 5HGIA 1M2PA 3BHTA 4EQUA 1PKGA 2PZ5A 2J9MA 2X39A 4ORKA 3KGAA 4F0GA 2WNTA 1F3MC 4DBXA 4PMPA 4OTHA 3E5AA 5M4IA 3VW6A 4X2FA 4TYJA 4CXAA 4AX8A 5F1ZA 2R7BA 3I5ZA 3KB7A 4ZJJA 3R8ZA 3UVRA 3O51A 2HY81 4I41A 4FIEA 2QU5A 3T3VA 3OOGA 4O7SA 4EUTA 3MTFA 4YR8A 3V3VA 4EK6A 2UV2A 4MQ1A 3PUPA 4KIPA 1JLUE 4DBNA 1U46A 3CQWA 1NW1A 4AT5A 5IH6A 2J0KA 3PPKA 3NYXA 4AN9A 3GENA 4KIOA 4QP7A 3E93A 5D41A 2C3KA 2VTMA 1XH7A 4RGJA 4JI9A 2UW3A 4FTJA 3CY3A 4FSTA 1BI8A 4FYOA 4ZY6A 4Q2AA 3C4XA 4FC0A 2W96B 2H8HA
chains in the Genus database with same CATH topology
4RC2A 3BV3A 4D4YA 3DBCA 4I22A 4QMMA 4FNYA 2PUUA 2C6IA 2XM9A 1OI9A 4QTDA 3ZLWA 3UBDA 4E5WA 2OIBA 3EL7A 3LMGA 4NT4A 4HGSA 3NIZA 3D7TB 1XMLA 4HCUA 3I7CA 4O82A 4BCNA 4F1MA 3TT0A 3ZU7A 5HIEA 1K3AA 3F5UA 4EZ3A 1BUHA 4E6DA 4MWIA 5ETCA 4AQKA 5EHOA 3NYVA 3T9IA 2CKQA 4UWBA 3QD2B 3BYVA 5KX8A 2WMWA 4E4LA 5JN2A 4X3FB 4FX3A 2C0IA 5JFWA 4GK2A 1CSNA 3E7VA 3FC1X 3KREA 3LPBA 4NSTA 1Q8WA 4OTWA 3W0OA 4EOLA 2OBJA 4C61A 2JGZA 1E1XA 3NUPA 4L45A 3E92A 4U42A 3ELJA 4DEIA 1MRVA 5DI1A 4BDHA 2OFVA 4PNIA 4J99A 4AOJA 1GIJA 4TYHB 3L8PA 1YI6A 2VO6A 3ORPA 2HZNA 5DT3A 2OICA 4X21A 4AFEA 4B7TA 1IEPA 2C68A 3LHJA 2W5AA 3DLSA 5FXQA 5CWZA 5BMSA 3W2CA 4U5JA 3CKXA 3ACKA 4KS7A 3FQEA 4RJ6A 3S3IA 5EI8A 3AT4A 2QKRA 4U40A 3UNJA 3GU4A 1R0PA 1IASA 2FYSA 2UZUE 5H2UA 2Z7LA 3GVUA 2ZMDA 2GS2A 4CMTA 4UXLA 3QQUA 3RNIA 5LMBA 3NDMA 5L2IA 3QTXA 5JQ5A 4MXXA 3QTRA 2ITQA 3H0ZA 1WBPA 2NP8A 2ZM3A 5CSPA 1QPEA 4FNZA 3EQIA 4OW8A 1JKLA 3HUCA 3ZYAA 2XP2A 4FVPA 4DH7A 4FKSA 4CKJA 3UZTA 4L00A 3QX4A 2XZSA 2WIHA 4R78A 4D5HA 3C4WA 5BVWA 2IO6A 5BUIA 1CTPE 1Z5MA 4PF4A 2CGWA 3LMIA 3F6XA 5EFQA 5FRIA 2G2HA 4E6CA 5H9BA 4M67A 2OJ9A 1JOWB 2HAKA 3TTJA 2X2MA 5ITAA 2LGCA 5JFXA 2IZSA 5L6WL 4I0SA 3V5WA 5M08A 4F65A 3I0QA 3IQ7A 3AKLA 4IDTA 3B2WA 4ZAUA 1PMNA 4QPAA 5I0BA 1NVQA 1GZNA 4EBWA 4AW2A 5I9WA 3F3UA 3GC7A 5JK3A 4HGTA 2XK8A 2XMYA 4FTTA 4O21A 4FIJA 3KN5A 4L53A 1PKDA 4MXAA 2BROA 1ZZLA 4MCVA 4ZEGA 3VBQA 2FUMA 3UVPA 2R3MA 3Q2JA 4RIYA 3OT8A 2XIRA 3LQ8A 4F6UA 3HP2A 4X2NA 5CS6A 4ZJIA 2PUPA 4F9WA 5ANIA 5T3QA 3O0GA 2Q0NA 3L8SA 4G5JA 1WBWA 2PY3A 2X4ZA 3GC0A 2EB3A 1ZY4A 2ZV2A 4ID7A 4MNEA 3Q9YA 2E9UA 4JS8A 5J87A 3QUPA 5KBRA 5CF4A 5A46A 4L43A 1Z9XA 3FZRA 3PXFA 5BVKA 5DPVA 3IW5A 3HZTA 5FQDC 1MQBA 4LFIA 3SD0A 4EI4A 4HNFA 3ORIA 2PE1A 2OG8A 4TT7A 3M11A 4C4GA 2QC6A 5FTQA 3IDBA 4MQ2A 4U79A 4NKSA 4Y8DA 4EHVA 1NXKA 3QCQA 4FTQA 3HP5A 5E8VA 3SG8A 3MSSA 3UOLA 2X7FA 2CMWA 3FAAA 3QTWA 4I23A 5EYKA 3N9XA 4A07A 4F63A 5HNIX 3MFRA 4W8EA 4TWCA 4XYFA 4GVJA 4BC6A 3GFEA 3VS6A 3WIGA 4ZTNA 1P5EA 3FSKA 4RIWA 5HE0A 3EQGA 4BDJA 4F78A 2VUWA 4EBVA 5IA3A 3SXSA 1Q99A 2C5YA 2WMRA 3E8EA 4AT4A 3CJGA 3EIDA 2Y9QA 3QTQA 3RVGA 3KVWA 3P5JC 4ZJVA 3POZA 4FZFB 4F6SA 2V22A 5CT0A 1MQ4A 2WTDA 3MW1A 3V04A 5FBNC 3EQFA 1UNLA 2C1BA 1JSTA 4ZSAA 3MY1A 4JT3A 5AM6A 5LMAA 4OBOA 4DHIB 4IQ6A 3D5UA 4DHZA 4I6HA 4XNEA 3NUAA 3PWYA 5EW9A 2Q83A 3VVHA 3H10A 1OPLA 2BTSA 4AW1A 2RFEA 4YO6A 2UW6A 5DIAA 3HEGA 2R3JA 2UW7A 3FY0A 4MNFA 4TWOA 5D7VA 3MY0A 2ITXA 1OIYA 2ZDUA 3KULA 3ZUVA 3I1AA 3W2OA 2Y4IC 4AZFA 2XEZA 2EXCX 5AEPA 5FP6A 1I09A 1PXMA 2H96A 3ETAA 4PMSA 4QNYA 2FSMX 4APCA 3RZBA 3D9VA 5DT4A 1OZ1A 5TF9A 4G31A 2WTKC 2YN8A 4FKUA 4L52A 3F82A 4RG0A 4FSUA 4U41A 3PXZA 3KCFA 1UVRA 4U6RA 4PMTA 1UU9A 5JEBA 3P7AA 3BX5A 5IA5A 4ALWA 3LXLA 3V8SA 4BGHA 3ZRLA 2OU7A 1CKJA 4H3BA 4KIQA 2AEGA 3HGKA 3R1YA 4C0TA 1M7NA 3O23A 3C4FA 4EC8A 5IA1A 3LZBA 4QTBA 4FTIA 3FHRA 2VTJA 4TRLA 3ZONA 5GNKA 5AAEA 2UZVA 4PL4A 4RVLA 3TZ7A 3UDZA 1Y8GA 4GUBA 2H34A 3R9HA 3GU8A 2GFCA 4JBOA 5CAOA 4CKRA 3BLQA 4JDIA 4RJ8A 4JL9A 4AOIA 1O9UA 3FZSA 3M2WA 3QX2A 2F4JA 5D12A 1O6LA 4GVAA 5BPYA 1O6YA 1W82A 3DY7A 4M12A 4ZTHA 2UZLA 4C2WA 3MFTA 4RX7A 3BU5A 3U9CA 3LOKA 4FTLA 3R6XA 2Y7JA 4AN2A 2VTHA 1Q61A 2VWVA 2XNNA 3OG7A 3Q4TA 3Q5IA 2IVVA 4ANBA 4YBJA 4ZLYA 3UDTA 4YMJA 2BZKB 3SRVB 4D55A 3NCGA 4F0FA 5FTGA 2HW6A 4DEEA 3WOWA 2CDZA 3MH2A 4IACA 5M4FA 5A4TA 4PUZA 2YZAA 5DE2A 2CCIA 2WKMA 4I92A 4MEDA 2C3IB 4H1JA 3U4UA 3HRFA 3P0MA 3C5IA 1WVWA 5L8JA 1JPAA 1V1KA 3PIZA 3EH9A 4AXDA 4YU2A 5JRQA 3UIBA 5C26A 4J8NA 3GU6A 3UQFA 3F3VA 3BWJA 4HGEA 1HOWA 4O7NA 4M84A 4O7OA 2B7AA 2J0MB 3GCVA 4DG3E 3QCSA 3H30A 4N57A 4JQ7A 2YM7A 3RWPA 2X7GA 3QKLA 3I79A 3HKOA 5IUIA 4YJRA 3DAEA 5A3XA 2LAVA 4RJ7A 5HI2A 3UO4A 4FV6A 4AN3A 3A61A 3LXNA 2E9NA 4QMWA 1ZYCA 2VO0A 4FKQA 4E4NA 3I5NA 4QMNA 2BAKA 3IDCA 2J6MA 5L2WA 1YXXA 3WE4A 1Q62A 3VUDA 2QKWB 2YWVA 4YJQA 3PPZA 4I5HA 3QC4A 5HNBA 5J1VA 4YPSA 3ZUTA 4HVSA 1EH4A 1ZYLA 4JDKA 3FYJX 3QD3A 3MBLA 5F4NA 4QTCA 3WZJA 2RG5A 1PXPA 2FO0A 3C0GA 4M8TA 5IQCA 2XK9A 2PMOX 4FICA 2FSTX 3DZOA 4E20A 4KA3A 3CS9A 4O6EA 2EUFB 3NPCA 3MH1A 4XLVA 4LRJA 4QDVA 2W4JA 4NW6A 2VNYA 4OTQA 5AP1A 5HLNA 4AW0A 2X8DA 5HCXA 2R2PA 4F1OA 5HKMA 3EFWA 5HO8A 3D5WA 3KMUA 2UVZA 2WQEA 4IWOA 4LL0A 3GC8A 4CV9A 2X8EA 5FM2A 2BRHA 4IC8A 5HIBA 4JRNA 4TNDA 3BV2A 3TNQB 2Z2WA 4GFMA 3ZZEA 4X2GA 1OL2A 3KK9A 3P08A 1RJBA 4NM3A 3DBQA 4NW5A 1KE8A 2VWIA 2WU7A 5LVNA 2WQOA 3EOCA 3P78A 3PY0A 4IB0A 4OTGA 4EOJA 3CTQA 3D0EA 4ZY4A 1ZYSA 4EH5A 4F99A 3TUBA 2UVXA 3OROA 3SW7A 3KF7A 3A62A 2JITA 3QTSA 4D4VA 2C1AA 1XH8A 1SVHA 4BTFA 2R3QA 4LOOA 4Y95A 5AUZA 3PP0A 5EKNA 4ERWA 3MYGA 3DJ7A 3T8OA 4D0XA 2O8YA 2QOFA 4OR5A 4LI5A 4N6ZA 4V0GA 5HX6A 2JKKA 3TCPA 1P4OA 2Y6OA 4FTMA 5IQDA 2G2IA 2BRGA 5KMIA 3QTUA 2HW7A 3ORKA 4EWQA 2CCHA 5T68A 4NCTA 4EOKA 4LV5A 4FV7A 2PMLX 3VBWA 3Q04A 5KKRC 3UIXA 4RWLA 5KBQA 4HVHA 4CD0A 4O0TA 3R2BA 2IVTA 4H3QA 3ZCLA 5LVPA 3H9OA 3OF0A 4BHNA 1MUOA 4NIFB 4ANLA 4C02A 4WHZA 2XUUA 2Z7QA 3OEFX 3PY3A 3QKKA 4GW8A 2NPQA 2XYUA 4NCTC 4AU8A 4ZY5A 2CJMA 3R9OA 3NUXA 4MVFA 2R7IA 1XH5A 4WO5A 2WMTA 3KU2A 4O0SA 3FDNA 4QQJA 5IUGA 3SQQA 3UP2A 1Q8TA 3DGKA 2J50A 1S9JA 3PY1A 4YJSA 3FL4A 3LCOA 4FV5A 4K11A 4ZS0A 4C35A 4JIAA 5GHVA 3VNTA 3O50A 2BAQA 3F9NA 4RWKA 2VX0A 2XAOA 3BRBA 3DQXA 3ZTXA 1IG1A 1KWPA 3R0TA 2WQMA 4F4PA 3VHKA 2HELA 3CBLA 2OW3A 2B54A 2BFXA 2BKZA 1NA7A 4K6ZA 4DDGA 3C1XA 4YLLA 3CXWA 2NRYA 2JBOA 5JSMA 2OSCA 3KCKA 2O5KA 5JRSA 3V5JA 4C3FA 5EYDA 2DYLA 3K3IA 4JJRA 4O0WA 3FE3A 5DEWA 3AMBA 2PZYA 5AV2A 2NYAA 2Z02A 2WTCA 5A4CA 3FMLA 4JAJA 4S2ZA 4TW9A 1F5QA 2YJSA 3ZEPA 3MV5A 5AA8A 3PXRA 4QNAA 4C2VA 4ACMA 4EOPA 5DFPA 5M09A 1Q3WA 1V0PA 2G15A 4K8AA 2ITOA 3UYTA 2F7XE 5CASA 3DKOA 2ONLA 3HDNA 2VWZA 4MD8E 5J8IA 3TV6A 5A54A 4J97A 1PXOA 5DNRA 3Q6UA 5AUXA 4R6VA 3EN4A 3G15A 4U9AA 4M0ZA 4MNEB 2QOHA 5FG8A 4ZLZA 4FOBA 4FSMA 2B53A 1YHWA 4DCEA 4BCJA 2HZ0A 4I6QA 4S30A 4YZCA 4JG8A 3OY1A 5EDPA 2R3OA 4NTTA 4U43A 2O63A 2ONLC 5A4LA 2X2LA 2QOKA 4QO9A 4WRGA 4R7HA 4EH8A 2I0VA 4QYEA 2YACA 3OS3A 1U59A 2UZDA 1XO2B 1GZ8A 4O7ZA 3ZO2A 2W1GA 3CD8A 1YWVA 3HMIA 4DGMA 4RT7A 4QP3A 3UNZA 4M7IA 5JFSA 1VYWA 4DGNA 4EOIA 3AC5A 5DR9A 4MUQA 4XP2A 4FV8A 3MTLA 2XVDA 4IBMA 5EM8A 3HA6A 3CEKA 2BIYA 4OT5A 4Q9ZA 4IAIA 4IEBA 5ETAA 5CNNA 2C0OA 3OBGA 5AA9A 5CALA 4HCVA 5J9LA 5EHLA 3EN7A 2CNVA 4TWNA 4IVCA 3RMFA 4YTFA 1Y6AA 2PK9A 3AKKA 2X6EA 5HO7A 5AV0A 2XA4A 4USDA 3I60A 3LJ2A 3UMXA 1OGUA 5CU0A 3DBFA 5AIKA 5M53A 5LMKA 1VJYA 1FVRA 2FSLX 3COIA 5A14A 3NIEA 4QOXA 4A7CA 2VTOA 2XIKA 2Y8OA 1R0EA 3JXWA 2ITVA 4E8AA 2GS7A 2JDRA 3FI4A 3L8VA 3ZC5A 1PMUA 2OZAA 3G9NA 3ERKA 5JMSA 3Q2MA 4XG2A 3MA3A 1H24A 2PSQA 4OBQA 4Y5QA 3BHVA 3R30A 1YRPA 2BDFA 4FT0A 4Y83A 2CPKE 2VWUA 4MXYA 4FSNA 3IGGA 4HZRA 3ALOA 2WTJA 3ID6C 4B8MA 3FI2A 3O71A 4IANA 4RJ3A 2YIQA 2YCSA 5G1XA 4O7VA 3RP9A 4DH8A 1TQPA 4RFZA 4FSZA 3KA0A 2GNFA 2HWOA 2OXXA 2EVAA 4KINA 4PMMA 4QMOA 4FTCA 4RFYA 3VWAA 2Z60A 5F9EA 5ICPA 4E4MA 4YZ9A 3RM7A 3UTOA 3GEQA 2A4LA 2HCKA 3MY5A 4FZ7A 5H8BA 4RSSA 4KKHA 3QTZA 5ANDA 3LFAA 3W0SA 5E90A 3BHUA 2AC3A 1PY5A 3ENMA 4ZMEA 3PVUA 4MKCA 3UG1A 3ZO1A 5KMOA 3KF4A 1FINA 4BI2A 4XUFA 3PXYA 4JNWA 4F7LA 3R8LA 4QYFA 2JDOA 4D1SA 1M52A 1FMOE 4V01A 2G2FA 2W1EA 4RIXB 4MWHA 3TV4A 3UVQA 5EOLA 1H1SA 4FYNA 1W7HA 2GQSA 4QRCA 3ZXTA 3L1SA 4I6FA 4Y46A 3QLFA 5CXZA 1CKPA 1OMWA 5D9HA 3SOCA 4GIHA 4IHPA 3SAYA 3F5GA 4JOAA 4XX9A 3I81A 4FV2A 2ETKA 3Q52A 4BY9E 1O6KA 2WO6A 4PL3A 4Q9SA 4IH8A 1M17A 1J1CA 3QHWA 4ZSGA 4C3RA 2YZLA 4BCGA 4FZDB 2OFUA 4DFNA 5K4JA 3GCSA 2I7QA 2J0LA 3COKA 2P2IA 3FLNC 3KXNA 3U87A 4KBAA 3DZQA 4C59A 4ANQA 3KC3A 3DPKA 2X1NA 3CR0A 2WQBA 5HBHA 4YTIA 3VUHA 3P4KA 4OBPA 3SXRA 5DR2A 1DAWA 4DFBA 1K2PA 1KSWA 4EK3A 3HRCA 5IQGA 4I6BA 5HLPA 5D1JA 4JG6A 2XKEA 4CFVA 4D1ZA 4IWDA 3BQCA 3G6HA 3OUKA 4UWCA 4PTCA 1OUYA 4I1ZA 4PX6A 4ZIMA 1PXKA 2VTLA 5FDXA 3ZDUA 4LV7A 4QMLA 4XS2A 4EOMA 4QMZA 2BFYA 4BDGA 2ZYBA 3G0FA 4H1MA 3QQGA 4U98A 4D1XA 4D5KA 2XNPA 4D4SA 3VC4A 4RA4A 4BCQA 1ZARA 3H3CA 4CT1A 1JBPE 4EK4A 2HXQA 5I9XA 3DK7A 3EZRA 3OXIA 3UG2A 3RCDA 2VZ6A 5KZ0A 4JQ8A 2FA2A 3HMNA 2ZFYA 4TY1A 3QCXA 2YAAA 2YHVA 2VWWA 2YEXA 4HCTA 4W4YA 4JDHA 4E1ZA 3KMMA 3WARA 1UU7A 3IKAA 1XMMA 3Q60A 3COHA 3PDTA 4IM3A 2WAJA 3I4BA 3ANQA 4XV1A 5KHWA 3Q9XA 2VV9A 2YABA 5KO1A 4IZ5A 2HWPA 4R1VA 5EM6A 2CLXA 3CGOA 3E7OA 1TQIA 4BCFA 4OLIA 5B0XA 1OBGA 1T45A 3FV8A 3T9TA 4KABA 3TTIA 1G8KA 3VS0A 3CJFA 4D2RA 4RX5A 3DTCA 4DG0E 3ALNA 2UZWE 3BI6A 3OW4A 4Z7GA 3HRBA 4R5YA 1MRYA 1A9UA 3RHKA 2VTIA 3QD0A 2XKCA 1KOAA 3FMEA 4FTNA 5E8SA 5HEZA 4BHZA 4EQCA 3NCZA 3LFSA 3DFAA 3EFJA 3K5VA 4CV8A 1VYZA 5LWMA 2BALA 4FEQA 2RF9A 1PJKA 3KMWA 4XG8A 5D10A 4RBLA 1U54A 3DQWA 3N51A 4RPVA 3QYZA 3BYUA 4N70A 5M57A 5HBJA 2XNGA 4XG9A 4EOQA 4OTIA 1REJA 4IB3A 4FE2A 3G2FA 5CSHA 3ZUUA 3AT2A 4FZAB 5CNOA 4C4HA 4CGAA 5F95A 5CY3A 4BTMA 3OUNB 5FTOA 1JSVA 1OUKA 4J71A 1Q5KA 1KE7A 5KZIA 3PLAE 3SX9A 3EQCA 4BGQA 2XCHA 3F61A 4FKGA 4O6LA 3UO5A 2YDIA 5EYMA 1PMVA 2QO7A 5J95A 4FKRA 2JLDA 5L6OA 5L8LA 2F7ZE 4V0GB 2B1PA 4F0IA 3DB6A 5E7RA 3UP7A 3R73A 4RQKA 1P4FA 2W0JA 1PF8A 3AD5A 3PZEA 2VAGA 4FTUA 4X6QC 2B52A 4II5A 1QL6A 1XJDA 1HCLA 2P33A 3ZM4A 4DFUA 2UVYA 5ANJA 4XMOA 4DEAA 3PFQA 4F9BA 1H07A 1ST4A 2ITNA 2W7XA 4BF2A 4L44A 3NUNA 4AZEA 2XARA 3MS9A 2BPMA 5CENA 3P79A 4FV4A 3W18A 1H8FA 4F7JA 3OZ6A 5BYLA 2P3GX 4FNWA 1BYGA 2IG7A 4GU6A 4PDOA 4PL5A 2WEVA 3GNIB 3EMGA 1PHKA 1PXNA 4FKJA 5AP6A 1GNGA 5M4CA 4DTBA 5A9UA 5AMNA 4FVQA 4RLLA 3OT3A 4YGAA 3V8TA 4E7WA 1QCFA 4YSJA 3OXTA 3PA3A 2W4KA 3F7WA 3IOPA 5LARA 5DG5A 2H9VA 3TEIA 3VF9A 3Q96A 4QQCA 3GXLA 5TT7A 4F7SA 3WF7A 1YOLA 5HCYA 4C7TA 2XIZA 4R7BA 3D5VA 4MAOA 2XBAA 1ZYJA 2GTMA 3NR9A 3OCTA 3ORXA 4O0XA 3TYKA 2F7EE 5HD7A 3L8XA 4MXCA 5LJJA 1W84A 4IZYA 5CF5A 4I4FA 3HLLA 3R8PA 3TG1A 3VQHA 2VX1A 2X8IA 5C4LA 3IW4A 4RWIA 5E92A 3V5TA 1XR1A 3SKCA 5AM7A 2DS1A 4GT3A 2OO8X 4U80A 3F5PA 3R83A 3SV0A 3ANRA 1H0WA 2UZBA 2PVYA 2R3HA 4MBIA 3BQRA 4GU9A 5CT7A 2V0DA 4HPUE 1XBAA 4I4EA 4C4EA 4BB4A 2Q0BA 1ZYDA 3RPVA 2Y6MA 3EWHA 5CI6A 2ZVAA 2OKRA 3RPRA 4W4XA 5CEQA 3P7CA 1XWSA 4B4LA 4GK4A 4B6LA 4BIEA 2IW9A 3MGYA 3RCJA 2A2AA 1JSUA 4YJOA 2X0GA 4V04A 3MJ2A 3UMWA 3HVCA 4AFJA 2B0QA 4ZTMA 4AAYA 4DFYA 5AUVA 4PQNA 5AADA 4J7BA 4GRBA 4G3GA 3UQCA 2C6LA 2CNQA 4WBBB 3SW4A 2YERA 5IEYA 2WEIA 4NKAA 2C5OA 3NNXA 2PZIA 1WVXA 5BYZA 3PJ3A 4BJJB 4F9YA 5FD2A 1SM2A 4BZOA 3IW6A 5CXHA 4ARKA 4L67A 4PV0A 2C6OA 1OPKA 2J2IB 3A7IA 3LE6A 4JR3A 5JGBA 1YXSA 2BKKA 2ITPA 4A9YA 1U5QA 1KE5A 3GOPA 3LLAA 1E9HA 2C4GA 2QNJA 4D4RA 2IZUA 1KE9A 3H4JA 4O0VA 2UZNA 3DS6A 2EU9A 4GMYA 2IJMA 3W1FA 4DHJA 1UA2A 2JBPA 3EN5A 3OTUA 3ENHA 4PTGA 2BCJA 3TJDA 1LP4A 4ITHA 4H3PA 5IQEA 4EH2A 4QP1A 3RK9A 3VRZA 5AJQA 4UZDA 4ZSEA 4WKQA 3R8UA 5EDQA 3F3WA 1W0XC 2RG6A 3LCKA 2C3LA 3K54A 3QTIA 3WBLA 1WMKA 4HNIA 3W2SA 3R9DA 3PJ2A 2RFSA 3V8WA 5BNJA 3HAVA 3T3UA 4XV2A 3VS5A 1YDRE 2VWBA 2OIDA 4YSMA 1ND4A 1R78A 2PTKA 3VJOA 3FLZA 4IAYA 4LDTA 1IAHA 3BYOA 3V5LA 3VUGA 3SGCA 1FGIA 1WBTA 4GT4A 1GJOA 5CEIA 2ETMA 5AWMA 4OGRA 2JC6A 3ML1A 4QYHA 2F57A 4FK3A 4X3JA 1UU3A 3TKUA 3UE4A 4F70A 5E8WA 4MF1A 5CSWA 4FSWA 5FXRA 3QRTA 2XB7A 3SDJA 2J90A 3OFMA 2WTIA 3A7JA 3GOKA 3IS5A 4DE4A 3GUBA 1GIIA 2JIUA 3GFWA 4FEUA 4KKEA 4XOZA 5KE0A 3ZFYA 4XG7A 2XIYA 1R1WA 4S33A 5M55A 3NW6A 4E5AX 3Q32A 5M4UA 4CFFA 4O7PA 4XBRA 4YUQA 4G16A 4O81A 3EL8A 3U51A 2GHMA 2OGVA 4Z16A 5GJFA 3W8QA 4UALA 3D5XA 4ZLOA 1ZLTA 2QOIA 4BZNA 1SMHA 3MWUA 3MESA 1VZOA 2C6DA 2QOOA 2X7OA 5K5NA 5AV1A 3C4EA 4R7IA 3G9LX 3ROYA 2QD9A 2R3PA 3GI3A 4AACA 2GNGA 2C3JA 3EKKA 4ACDA 3LXKA 4EH9A 3QZGA 2I0EA 2BMCA 1G3NA 4P2KA 4BCMA 4YTCA 4FL2A 5HVJA 2JAMA 4YP8A 4AZTA 4USFA 5HESA 4O22A 1FBNA 2XJ0A 2Z7SA 4O7YA 4M68A 5DRBA 4JLCA 3O96A 4J53A 4B8LA 4WD5A 4CG9A 2R3FA 2ZM4A 3GU5A 1KE6A 4FIIA 3REPA 3CGFA 4K2RA 4EUUA 3PLSA 5K4IA 1XH6A 3BIZA 5J7HA 1FVVA 2WMQA 5AAGA 4BBFA 3C4ZA 4W4WA 3E8NA 3NUUA 2WTWA 2XANA 3UOHA 5I9YA 1CM8A 3HV7A 4GG5A 5DRDA 4LRKA 3V51A 4BDBA 4D58A 2GTNA 2HIWA 2JDTA 3HAMA 4G3CA 4MD7E 1FOTA 4CTBA 4CRLA 3VBXA 3MIAA 4YPDA 5LOHA 3DB8A 3PE1A 4I24A 4M0YA 4A9RA 4EQMA 3NYNA 3CSVA 3D14A 3QF9A 3R01A 2V5QA 3R8VA 3VS3A 4UYAA 3UIMA 2BRBA 3LM0A 1W8CA 4ZTLA 3NNWA 4EH7A 3UC4A 3NEWA 4XBUA 2HENA 4R3PA 2EB2A 3P1AA 4TN6A 2WHBA 3UODA 2QHMA 2PYWA 1H0VA 3BL9A 2PVJA 4AZSA 5CZIA 4HYUA 1WBOA 3RINA 4O7WA 2GQGA 3A7HA 2PVLA 4WSYA 2WOTA 3U54A 3W55A 3ZZWA 1JKTA 3A7FA 4FI1A 4IW0A 4QTAA 4CQEA 2B4SB 2Y0AA 4JX7A 1FQ1B 1PYXA 4LM5A 3VS1A 1V0OA 4O0RA 4H05A 1OBDA 3QZIA 3DV3A 1A48A 1AGWA 2IZRA 4AXFA 4ZP5A 3ZLYA 1WBNA 2RL5A 2V62A 2OI4X 4QEBA 4E26A 2YIYA 2H6DA 4Z3VA 4EZ7A 1OPJA 2UW4A 4GYGA 5BV3A 3EQPA 3MN3A 2C47A 4XCUA 5EG3A 1Q8UA 1FPUA 5CLPA 2G9XA 3LCDA 5DA3A 3O7LB 4K33A 3K2LA 4UXQA 1QPDA 2GU8A 3A2CA 4X6RA 5HE3A 2J5EA 4WOVA 2PE2A 4P5QA 4IE9A 2XKDA 1ATPE 1IA9A 4AGCA 5IEVA 4WZYA 2XNOA 3QZHA 1TKIA 4QQ5A 3VO3A 5BVDA 1UNGA 4ALUA 1PXLA 5CVGA 3OD6X 4G5PA 5HU3A 3GCUA 1GZKA 3ORTA 4C4IA 5EK7A 1Y8YA 3SHEA 4IDVA 3HV3A 3C9WA 3DJ5A 3TWJA 4MD9E 4V05A 4BDAA 3R9NA 2PVFA 4YZNA 4CT2A 2WMAA 4XHKB 3SG9A 1DI9A 2PE0A 2ZB0A 3PG1A 5CQUA 4BKJA 5F20A 3MVLA 3TZ8A 3AD6A 4C3PA 4JBPA 1Y57A 4ERKA 3QGYA 3NRMA 3EYHA 5BUEA 5E8TA 4RX9A 3NNUA