3UDZA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with adp and ip6.
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
434
structure length
379
Chain Sequence
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFDCISVEIKPKCGFLPTSRFIGKENILKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPIALPLDESLKIVKEYLIAATAKDCSIMISFQSTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol pentakisphosphate 2-kinase
publication title Inositol phosphate-induced stabilization of inositol 1,3,4,5,6-pentakisphosphate 2-kinase and its role in substrate specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 122
structure length 379
sequence length 434
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3udzA01
3UDSA 2XARA 2XALA 4AXDA 2XAOA 4LV7A 4AXCA 4AQKA 3UDZA 2XANA 4AXFA 3UDTA 4AXEA 2XAMA
chains in the Genus database with same CATH superfamily
2H96A 2I40A 2NRYA 2H6DA 2QC6A 3O51A 3F3TA 4RBLA 1KE5A 4FK3A 3LFQA 4GT5A 4N4SA 3FXZA 3AKKA 5CX9A 5K9IA 2PZYA 3KXNA 4DEGA 3KF4A 4EK8A 4XMOA 2CPKE 4EONA 3PJ3A 3CR0A 3ZSHA 4FTTA 5DN3A 4EI4A 3AC8A 3ZFXA 1E1VA 2C5YA 2WXVA 2JKQA 3A4PA 4TYHB 1VR2A 4MWHA 4XHKB 2R3QA 4F9AA 4CNHA 2GNFA 5IUIA 3Q60A 4MQ1A 5H8BA 4G6NA 3D2KA 4JIAA 4RIXA 1NA7A 1PJKA 4C58A 4O7VA 2C3JA 5CT7A 3QLFA 4AOIA 3OCTA 4DYMA 3ET7A 4QP8A 3W55A 5CS6A 3WF5A 4BBFA 2NNWB 3KN5A 4DEHA 4JVGA 1Q8UA 3GP0A 3DAJA 2UZDA 5IF1A 2B9JA 2CSNA 1DI9A 4TRLA 5DR2A 3CJFA 5K4IA 3RKBA 3EN5A 2BTRA 3NNVA 4FZAB 4CTBA 2YCFA 2J9MA 3RPSA 1PKGA 1Q3WA 2VRXA 4C59A 3I60A 5KMLA 3BLAA 1GIHA 2FA2A 4OUCA 1WBSA 3BYVA 4Q2AA 4O22A 3ID6C 3KMWA 1BX6A 3TV6A 3OMVA 1P5EA 3WYXA 4PY1A 4WUAA 5BMSA 3ETAA 5KHXA 1XJDA 3BPRA 3Q2JA 1U5QA 2PZ5A 4IZ5A 2XIYA 5EFQA 5HBHA 4FUYA 2FB8A 4RJ3A 5HEZA 5IDPA 2E9PA 4BDCA 3ZONA 4TW9A 4HGTA 3PVWA 3ZLWA 4L46A 1KE9A 4CT1A 1DAYA 4DA5A 3CY3A 1Q99A 1ST4A 4O96A 5CU2A 2WEIA 4UXLA 5HLWA 3OWKA 3CXWA 2PTKA 4L68A 3SLSA 4ANBA 4BTJA 5DE2A 4W4YA 3RVGA 3ORXA 2RG5A 1TQIA 1PYXA 4IAZA 2WNTA 3CIKA 3N4VA 3OC1A 5J95A 2QONA 3UOLA 3B2TA 3KREA 4XOYA 4LDTA 5EDQA 4I4FA 2UW6A 2UZVA 4R1VA 3DBQA 3P86A 2R3IA 2G9XA 1H26A 2XNMA 3OXIA 3G5DA 3A8WA 2ZDUA 5EI8A 3AKLA 5FBOA 4DF3A 2VWUA 3AC3A 1Y6BA 3BHTA 3FMHA 3FYKX 3MFRA 3QD4A 3HDMA 4FKJA 3LFEA 3DNEA 3MVJA 5BUEA 4J7BA 2GCDA 3IOPA 3OY1A 5ANIA 3ZUUA 4ANLA 5I9YA 5LMKC 4BDBA 1GIIA 3KCKA 4D0XA 1HCLA 2OXYA 2QD9A 3HA6A 1H1PA 3V5TA 5IPJA 1OL6A 4TWPA 2C1BA 1YI3A 2HIWA 3BLRA 3DLSA 3H9FA 4O2PA 1KSWA 4KSQA 1Z5MA 2ZV9A 4YU2A 4O0YA 2IVVA 3R8UA 4LGGA 2BILB 1K2PA 4FKIA 3LCTA 4BRXA 4EOQA 3C4FA 4AZTA 1OPKA 1K9AA 4M0YA 3R9DA 5KNJA 2HXLA 3ODYX 5EW3A 4H58A 4RVTA 2OFUA 3H9RA 4RJ6A 4XH6A 3SRVB 3TDVA 3R8VA 3S00A 1SNXA 5HE2A 1W83A 4K9YA 4DGGA 2ZJWA 5CENA 3VW6A 1M2PA 5CVGA 4IB3A 2C68A 3AD5A 3R8PA 3NW6A 2GMXA 4TKSA 5AM6A 3HEGA 5DRBA 1YDSE 2YDKA 3IS5A 4W4WA 3LMGA 1ZZ2A 5LVNA 1G8JA 3CQUA 4U8ZA 2XK3A 1NVSA 3OOMA 1X8BA 4LUDA 4MXOA 1UU8A 4WIHA 4EWHA 4U45A 1ZZLA 1XHAA 4CD0A 3C4XA 2PMIA 3AT3A 4GJ3A 4NCTC 2ERKA 5DHJA 3QBNA 2WMQA 3DXPA 4FKVA 2YM7A 5CVHA 4HCVA 4GVJA 2Y4IC 2YEXA 5IISA 3FPQA 4IX4A 4JS8A 4JX7A 4O6LA 4QQCA 4X21A 5DT3A 3TTJA 3WYYA 4FODA 2YJRA 4U43A 3ZYAA 4DHZA 1CM8A 4ZAUA 5AADA 4OLIA 4BCHA 5FDPA 3F66A 5IQCA 4IHPA 2XK7A 4CFWA 2OZAB 5EM5A 5KKRB 3AC5A 4FT9A 4FL3A 3MI9A 5ITAA 5K5XA 3ZXZA 4NH1A 2JDVA 4GU9A 4XG9A 3LJ0A 4ZS4A 2R9SA 3QZFA 1LEZA 2QHMA 4U81A 2XNBA 5HE0A 2XNNA 4YLKA 4B0GA 4PL4A 4XP3A 4N57A 3RPVA 4I6HA 3NRMA 3LIJA 4I5HA 4DEBA 3MVHA 5IMXA 5BV3A 3ZOSA 5KMKA 2HZNA 4UXQA 4CKJA 4OTHA 4WG4A 3CP9A 3A7JA 4PNIA 3N9XA 3ORLA 3MS9A 4PQNA 3SXSA 5A3XA 5M57A 5JZJA 3OT3A 2W1GA 3EMGA 2W96B 4FTQA 1BI8A 3IONA 4MNEA 3F5GA 2VUWA 3ORKA 3PE2A 4XV1A 1OKVA 4Y73A 3CQWA 4F65A 5FG8A 3VONA 4CFMA 4ZJJA 2ETRA 5AUYA 5HCXA 1Q8WA 1ZAOA 4JT3A 3BZ3A 3UQFA 1W8CA 3RCJA 2XKCA 4I4EA 3OG7A 4FSRA 3HGKA 4GVAA 3QZGA 4QDVA 1IEPA 2XCHA 5AUVA 3VS5A 4DH7A 3R8ZA 4GEOA 2GNGA 3TZMA 5CWZA 2X2MA 1UNGA 4I21A 3UTOA 4DINA 3QX4A 2BFYA 3GCPA 4U41A 4UX9A 4J1RA 3P7AA 4P90A 5E8YA 5DGZA 4IEBA 4E1ZA 2E9UA 4LL5A 4EKKA 3DCVA 1PF8A 4FV5A 5CF5A 3MSSA 1OZ1A 2VZ6A 2J0KA 2XIXA 3FL4A 4NWMA 4XBRA 3RGFA 2XYNA 3VBXA 2OJFE 4ACGA 5IH4A 5JEBA 3Q6WA 2OJIA 3O8TA 2BAQA 3OBJA 4GKIA 5E90A 5I0BA 4QMSA 2QVSE 4FICA 2OICA 1NXKA 3AOXA 5IA0A 2ZM4A 3TKHA 3CSVA 5FTGA 5KE0A 3PSBA 4KNBA 3RNYA 1UU7A 2XRWA 4D4SA 5CF8A 4FG9A 4FUXA 5D7AA 2E2BA 3C4ZA 4CXAA 4IX3A 3WF6A 1Q3DA 5DBXA 3BBTB 2PVKA 5M53A 2GNJA 3QWKA 4NKAA 4WA9A 3MH2A 4G3GA 4QQ5A 4DCAA 3JR1A 5EG3A 3UOKA 4GV1A 1W84A 4DHFA 4GS6A 4MYGA 4YC3A 5K4JA 1MRYA 3LFSA 3KVXA 3BWFA 3JY9A 2W4JA 3QQFA 5LWMA 3D94A 3EQDA 1QPDA 4R3RA 4J8MA 4K77A 4KWPA 3P08A 4AE9A 5FBNC 2YWPA 4H39A 2XJ0A 4HJOA 1NW1A 4RMZA 2QQ7A 2WTKB 4CV9A 1UU3A 3H0YA 3VQHA 5EHOA 4XLIA 3VJNA 5GINE 3NUAA 5ETCA 2A4LA 3UJGA 3KK9A 4YO4A 5C4LA 3C5UA 3OHTA 4HNFA 3DB6A 2WIHA 1J91A 4GL9A 3K5VA 3UOHA 4AT4A 3V6SA 3UO4A 5AV4A 3CGOA 3ZM9A 5HBEA 3C0HA 3E8NA 3PVUA 4YHJA 4RIXB 2QG7A 3UDTA 4C3RA 1ZYSA 3QRJA 4QPAA 4GG5A 4E4NA 2VX0A 4GYIA 3FHRA 3TNPC 3FMMA 2PVHA 3OBGA 2DWBA 2G15A 3E3PA 3EQRA 3NGAA 4M12A 1YWVA 4ZY6A 3TKIA 4BCKA 3QCSA 3LQ3A 4JDJA 4DFXE 4A9RA 5CEKA 3M1SA 3PFYA 4FZ7A 3G9LX 3NUNA 4NJ3A 2XAOA 4FIJA 5AP6A 3HV5A 3TZ9A 4RVMA 1YHSA 1JNKA 4FEQA 5FXQA 4G3DA 5JGBA 3C0IA 3R8MA 4HZSA 4TYGA 4E5AX 2QNJA 3FY2A 4IZYA 4M3QA 3W18A 3EOCA 5AV1A 3W2OA 3PY3A 1PMEA 4O0VA 5AMNA 3ZUVA 5M44A 3TNQB 4CLIA 2VWZA 4WNKA 4LMNA 4XJ0A 4MXAA 4MXXA 5LVLA 2J4ZA 4FVRA 3SVVA 3BLQA 4G1WA 5J9YA 2PYWA 4YC8A 4DEIA 3AG9A 5BYZA 4L6QA 3FPMA 4M15A 4AA0A 3UP7A 4D1SA 3COKA 5HVJA 1OMWA 5CEQA 5T68A 4KSPA 4G3EA 3LM5A 3NCGA 4YPDA 4PL5A 2V62A 3HP5A 3LXKA 2ONLC 3P23A 2J0JA 3PP1A 2BRGA 3BHHA 4E4LA 5HVKA 4MXYA 4BDFA 1JPAA 1YWNA 4QMYA 1WBWA 4HNIA 3OW4A 4TNBA 2X7OA 4MXCA 4IVDA 4YBJA 5FEQA 3ZBFA 4FL1A 4P2KA 1Q8YA 4F7SA 4UB7A 3UPZA 3AT2A 3R2BA 1L8TA 4BZNA 2C6EA 5JH6A 3RWPA 3MPAA 4FEXA 4R77A 3VUKA 2P55A 1URCA 2RGPA 3R7VA 3ZO2A 2Y9QA 4CFFA 3FE3A 2HXQA 2VTLA 3C4EA 1MQBA 3BYSA 4O81A 5JGDA 3UO5A 4MHAA 5ANGA 4DTAA 2JC6A 3BHUA 1BYGA 4V04A 5CU4A 4TT7A 3C50A 1KE7A 2PK9A 4JRNA 3IQ7A 5LCJA 2JITA 3IDCA 2X9EA 3QTWA 4F08A 2VWVA 2UW4A 4ZJVA 4DG2E 2C0OA 1H24A 2CGVA 5A14A 2VGOA 2OF4A 5CSVA 2B0QA 3GCUA 4ZZMA 2OG8A 4KIQA 1WCCA 1H27A 4LUEA 4U5JA 5AP4A 4BCOA 5DRDA 1WBNA 4QO9A 4F7LA 1VYZA 2OI4X 3CQEA 4KIPA 3UP2A 4DTBA 3R30A 4ARKA 5EH0A 4ZLOA 3BQRA 1ZY5A 4CFVA 4WNMA 2P33A 3QUPA 4BGGA 2GHGA 4JQ8A 4MBJA 4C35A 4G6OA 2ITNA 2XARA 5JGAA 1GIJA 3NAYA 2KTYA 4JG6A 5TOZA 1Q8ZA 4A9TA 3BGPA 5LVMA 4WG5A 3SOAA 3OTUA 1H0WA 4F09A 3R9NA 1PXKA 4UN0C 4RLKA 4XEYA 2OSCA 1W0XC 2YIXA 4AUAA 5IUHA 2XRUA 3IGOA 4JBQA 3SOCA 1TFFA 5L2TA 3MTFA 3FZOA 1UVRA 4O91A 3QZHA 4M7IA 5L6PA 2WELA 3L9MA 4LRJA 4J97A 3DA6A 4AE6A 4EBWA 3IW6A 5A4TA 1JWHA 4FC0A 3UDZA 5BVEA 3PIXA 1H00A 5AV3A 2PUUA 3AC4A 3MY5A 3NAXA 3PA4A 3UC3A 3QC9A 4FSMA 2GSFA 1ZYCA 4WBBB 3ACJA 4P4CA 3AKJA 4I6BA 2YWVA 3BEGA 3NZ0A 4QMVA 4U3ZA 2RFDA 1ZYDA 5BVOA 3IK3A 4LOPA 4YJRA 4CMTA 4RFYA 4DEAA 4H1JA 3EZRA 4I22A 4FSTA 4CFNA 1IRKA 2BRMA 4DDGA 3EH9A 3GUBA 2ZAZA 2JDTA 4NM3A 4YZDA 3ZSIA 4YHTA 5JN2A 3BU5A 4G2FA 4RG0A 2QCSA 4MNEB 4FV3A 2XK9A 4G9RA 4F6UA 3P5KA 4DGMA 4C4FA 1QMZA 2ITOA 4QNAA 3KXHA 4DBXA 3A8XA 3EWHA 4YMJA 2B9IA 2GPHA 2HAKA 3W0MA 2I0VA 3REPA 3BL7A 3OCSA 1JBPE 1ATPE 3QRUA 5CXZA 2CNQA 2UZOA 1H01A 4YNEA 3L8VA 4M84A 4BHZA 4EH8A 3O7LD 4Y5HA 5CAQA 3W10A 3QTQA 1IG1A 5AFVA 2HZ0A 3LMIA 4RZWA 3A4OX 4X6QC 4I20A 3U6IA 3BIZA 2JAMA 2VX1A 3RJCA 4FBXA 3F5PA 3PRFA 4M8TA 4QYGA 2XJ2A 5HIBA 4YZCA 3DBEA 3DTCA 4LFIA 2BAKA 5HESA 1Q8TA 5HIDA 2QU6A 3DS6A 5F1ZA 1U4DA 2YM8A 4G3FA 2EWAA 1H1WA 3VF9A 4BGHA 2VTAA 4ZMFA 4AZVA 3OWJA 3MV5A 2C5VA 1GZOA 4H1MA 4YLJA 3ZSGA 4C61A 5FEEA 4LV8A 4C0TA 2B55A 3GC0A 4NTSA 3W0RA 3ROYA 2WMRA 3WZJA 4AAAA 1MRVA 3UNKA 4Q5HA 5KKRC 4HYHA 4WUNA 5G6VA 3QQUA 1STCE 2XYUA 3CE3A 3HV7A 1XBCA 3NVKI 4H05A 2XBJA 3Q5ZA 2ZFYA 1IASA 4YJNA 3KMMA 4JXFA 2WTCA 4XOZA 4CG8A 2JBOA 5AUZA 4HOKA 2ETMA 4PX6A 2BMCA 3U4UA 5HNIX 1FINA 2QU5A 4FTCA 4L67A 4LM5A 4NT4A 1R39A 3D2IA 4M69B 3G9NA 3KL8A 3LLTA 3R01A 4KKGA 2ITUA 5GIOE 4XNEA 1Y8YA 5ETFA 4BCIA 1G5SA 4X7QA 5GHVA 4BKJA 4MX9A 4C38A 3QQKA 4YTIA 4EC8A 4USEA 1P2AA 2RIOA 3TT0A 1ZMVA 1WBOA 4R1YA 3MVMA 3NS9A 1CKPA 3QGYA 3CLYA 3LM0A 4OBQA 5EHLA 1OI9A 2GS7A 3QXPA 3NYXA 4NJDA 1G8KA 2QOBA 1XMMA 4BYJA 2WMVA 4O0XA 3CD3A 2ITPA 2O63A 4FGBA 2NP8A 3HMIA 4GUEA 4II5A 4E6QA 1FVVA 2A0CX 3T3VA 4Z7GA 4JMQA 5DVRA 5JZNA 4O0RA 4HGEA 4IACA 4RFMA 4AZWA 5M09A 4FV8A 5DR9A 3KRWA 3FV8A 4GH2A 5T3QA 4RQVA 4EH7A 1SVGA 2XEZA 4BR3A 4XP0A 2BCJA 2CMWA 3FHIA 3U51A 3V01A 3EKKA 1OBDA 2XVDA 4YJVA 2JEDA 3T9IA 1YXXA 2VU3A 4EZ7A 2CGUA 2WTWA 3KULA 4CZTA 1KE6A 5D1JA 1YOMA 3PLAE 3UZTA 4YJQA 4IWPA 3MH0A 5C8KA 3ORPA 2O0UA 2R3NA 3FJQE 3OD6X 3BCEA 4L7FA 2J0IA 1G8SA 3U6HA 3C9WA 2JGZA 3WI6A 2C3KA 4NL0A 5I9ZA 5L3AA 5LCKA 2UVYA 1UNHA 3RALA 4XG8A 3DK3A 3S95A 4K33A 2C1AA 1BLXA 3GNIB 2OF2A 4OTIA 2HENA 4Z9LA 3RK5A 4HYUA 2XB7A 4I24A 2ZMCA 4Y95A 4KKEA 1JOWB 4I0TA 2DYLA 3QCYA 4ACHA 3W0OA 3R00A 4IZAA 4RVLA 2BTSA 2WHBA 3EQGA 3UYSA 5HORA 4RFZA 4ZLYA 4R5YA 1ST0A 3LCDA 4CKRA 2GQGA 4S2ZA 4HVHA 4QTCA 4IC8A 3M42A 1PXOA 3V5WA 2JIVA 2RFNA 4FZDB 1BKXA 3FQSA 4O7ZA 3HX4A 4PMPA 3O17A 1U54A 4PP9A 5C27A 4AA5A 5IQDA 4EQCA 2W1CA 2QI8A 2IZSA 2WAJA 2JIIA 3JY0A 3KRJA 3POZA 4P5QA 1XBBA 4IZ7A 2QOKA 5E8TA 4I3ZA 3K3IA 1PXIA 1PKDA 2CCIA 3OXZA 5B2KA 3E3BX 4RWKA 4BIEA 3R7EA 4YR8A 5TKDA 4L52A 3AC2A 2J90A 3QLGA 5A4CA 4L53A 3HYHA 3KN6A 4I23A 5I9WA 5HU3A 3O8PA 2C6DA 4IVCA 1ZMUA 5JQ8A 2FYSA 3TNWA 5M08A 4OR5A 4FTOA 4C4EA 3MFSA 3FQHA 3ZBXA 4FIGA 3UODA 5AIKA 4G5PA 2FVDA 2F7ZE 3ZCLA 5AAEA 4IMYA 4FTKA 2YAKA 4FVPA 1A48A 5BQ0A 3OFMA 5IEVA 3GFWA 3FSFA 2I6LA 3PE1A 3PXFA 3W2PA 2R2PA 3CS9A 4EOOA 1BL7A 5D10A 3JYAA 4CMOA 3POOA 4FSYA 2JIUA 3THBA 4DAWA 2A2AA 5CTPA 5TO8A 1V1KA 1G8AA 3MPTA 4NM5A 2C0IA 3DQXA 5EYKA 3DK7A 5AX3A 1CKJA 2CN8A 2OXDA 4G3CA 1AQ1A 4QMOA 4U7ZA 2W5BA 2IJMA 4FOCA 3TTIA 3RM6A 4JI9A 5E9EA 4RX9A 4HVDA 4C4JA 2ESMA 1CDKA 3IG7A 3HDNA 4PV0A 4V0GA 3MIYA 2E9NA 4I0SA 4QDEA 3GFEA 4EK4A 1F0QA 1S9IA 3FI3A 4Z7HA 1BMKA 3F2RA 2XJ1A 4IQ6A 5HD7A 3R83A 2WU7A 3B2WA 3PPJA 5KMNA 4IFGA 4V05A 3U4WA 3UG1A 5HX8A 5J5SA 1ZLTA 3PA3A 2VTJA 2CHLA 2C6MA 4FKWA 3FDNA 3VC4A 4JJRA 1K3AA 2CKQA 5H8EA 5IQHA 2XNEA 4EH3A 1GY3A 3D5WA 4D5HA 5I9UA 4F64A 3ALOA 4NIFB 3TI1A 2IO6A 4JIKA 3GC9A 4EHGA 5CEPA 1FVTA 4R78A 3D0EA 3OEFX 4LMUA 3DJ7A 3HLLA 3GBZA 3EYHA 3QTSA 2VTRA 4X2KA 3G0EA 4YLLA 4EH9A 4ERKA 5LXMA 2PU8A 3RPOA 1IA9A 2CCHA 4PNKA 4EYMA 2QG5A 4UWBA 3CTJA 2BZHB 2YIQA 3ZMMA 3W2RA 5HQ0A 5CYIA 3W2CA 3KXGA 3TIZA 3V5PA 5CEMA 5DOSA 3DFCB 5E8SA 1M52A 1A06A 3ZZEA 4WNPA 3DBDA 4GCJA 2XBAA 1FPUA 1FGKA 4J53A 4C36A 2YCRA 3ZEWA 2QKWB 4U40A 3NIZA 4WSYA 5M4IA 3R0TA 2QOHA 2B1PA 2QO9A 4ZP5A 2ITYA 4WNOA 4QMTA 2J2IB 3GXLA 3D5VA 1OITA 1YXTA 3OWLA 1ZARA 4O27B 5IQBA 2KULA 1RE8A 1LUFA 4WT6A 5KBQA 4DHJA 3WBLA 1DM2A 1M14A 1FQ1B 4MUQA 5JFVA 3C13A 4FKLA 4L00A 4RC4A 4EUTA 3LLAA 5AAFA 4FSWA 4AGDA 3DBCA 4S30A 4XV9A 5IZFA 5E8VA 3TACA 3QX2A 4FK6A 4C4GA 4ITIA 3HMPA 4IW0A 2I1MA 3WIGA 1V0OA 4E4XA 2PZIA 4MAOA 2OO8X 3HRCA 4NTTA 4ZY5A 3ML1A 5JT2A 2XANA 3OS3A 5JFXA 3NLBA 5A6OA 5KMJA 3O23A 4O7SA 4FNWA 3AGMA 4AFEA 2HW7A 2JLDA 4BCJA 4L43A 1H8FA 2VTHA 3DXNA 3E93A 3GCVA 3PXYA 1OL5A 3D7ZA 1V0PA 3G51A 3B8RA 3S3IA 2BZKB 3FUPA 4J52A 3QCXA 3UGCA 3NCZA 1XO2B 4OBPA 5AM7A 2OZOA 3F6XA 4YBKA 3R7OA 2V5QA 1H1QA 4ONAA 5HO7A 3CGFA 5ETAA 3V51A 3U54A 3Q53A 4HW7A 4GK4A 1V0BA 3Q52A 4XRJA 3PUPA 5C26A 2HZ4A 2FUMA 3V8SA 2AYPA 4KKHA 1TQPA 3HAMA 3EFWA 2YZAA 3QRKA 5M07A 1ERKA 2O5KA 4Y8DA 3FMLA 3PZEA 4FT5A 4Y46A 2P0CA 3FLQA 4UEUA 2HWPA 2YIYA 2IVUA 4X3FA 5HI2A 1DS5A 1VLRA 4NU1A 4C3FA 4ZTQA 5CSPA 4JBOA 3IDBA 5C03A 2CLQA 3E5AA 3PXRA 5AUWA 2W99B 3FYJX 4BYIA 4DGLC 2QLQA 4IJPA 3TN8A 1PXNA 3IW5A 3OXTA 4ITHA 3GQIA 2X8EA 4FV9A 2C5NA 2PVRA 3DBFA 1EH4A 4NFNA 4OT5A 4F1MA 2VTPA 1OIRA 1XH6A 2BRBA 3QKLA 4IIRA 2VAGA 2P4IA 4W4VA 5EOBA 5C01A 3MGYA 4BZOA 2WU6A 4FV4A 5M55A 2PMOX 4BBEA 3BV2A 3LCOA 2R3GA 4RWJA 3FQEA 3UBDA 4FIFA 3V5QA 3SW7A 1BUHA 1VEBA 3FAAA 4N0SA 2I7QA 2YN8A 4H3PA 4EC9A 2XIZA 4FKOA 2C3IB 4RIWA 3H30A 2R0UA 5FM3A 4L8MA 3SQQA 4BDIA 3R02A 2X4ZA 4MD8E 1ZRZA 3CTHA 4QP3A 4GT3A 1ZY4A 3KULB 2QR7A 4H3BA 4JQEA 4RIOA 4R6VA 2DUVA 4B8LA 4BGQA 4GYGA 4AW2A 5A54A 3O96A 4CFUA 3NNWA 1W82A 2GQRA 4O7RA 3NSZA 4WG3A 2XALA 5JFWA 2O64A 2BAJA 2X81A 3CD8A 3FKNA 4FTRA 4ANSA 4M68A 3F3WA 2YIWA 1XMLA 4GFGA 3Q4CA 2WOUA 5CAVA 3ZC5A 3PJ2A 4RX5A 3L9PA 2XM8A 4DH5A 3MPMA 3RI1A 2GQSA 1R0EA 3QHWA 1B38A 1DAWA 1O6LA 2NPQA 3BV3A 2GNIA 2I0EA 2VWYA 3NW5A 3QGWA 2Y4PA 3MYGA 4IM2A 4LRMA 5T6KA 4A9UA 4AZSA 2XCKA 2FO0A 2GHMA 3IPHA 4DH8A 4DT9A 5CU3A 4CRLA 4FV7A 4IVBA 4QYHA 4ZZNA 3V6RA 4IAKA 3MH3A 4K11A 3KU2A 4ZXTA 5ICPA 2F2UA 3NW7A 1OBGA 4YPSA 3OROA 4FGRA 3VF8A 1J3HA 3R9HA 3KMUA 4BI0A 2Z02A 4NCTA 1U54B 3SXRA 3V5LA 4USFA 2C5XA 1WMKA 3I6WA 3K3JA 1SVEA 4L3LA 3N51A 4IB1A 3CPCA 3LXPA 4E26A 4KRCA 4WRSA 1PY5A 2BKZA 5HLNA 3GOKA 4IANA 3MW1A 3U9NA 4HYIA 3TXOA 4JG7A 2F4JA 2R0IA 3LXLA 2FSTX 3QU0A 4FEWA 3LW0A 4IBMA 3IKAA 2RF9A 4DH3A 4EOJA 2IZUA 3OT8A 3EN6A 3R28A 4HYSA 4GSBA 2WQMA 1A9UA 4S32A 2F9GA 4QYEA 1LP4A 4AS0A 2ZM3A 1E1XA 3GI3A 1J1CA 3VBTA 1KV2A 1YOLA 2W17A 5F94A 3K5UA 4U42A 2R3JA 3UO6A 2GS6A 4FEVA 4C4IA 3QFVA 5D9HA 1OL2A 2PUPA 3BE9A 4DFBA 4ZTRA 5G1XA 3EL7A 4MBLA 3VUHA 4G17A 1UKHA 1WVWA 2OIBA 3GC7A 1F5QA 3MVLA 3PJ1A 5CSXA 3FC1X 1YXUA 3BU3A 5AP7A 1Q5KA 4CKIA 3PY0A 4EWQA 5AAGA 2EVAA 4V0GB 1KOAA 5CVFA 2EB3A 2YAAA 2CKEA 3TL8A 4C62A 5IUGA 3G2FA 3DGKA 3TM0A 2ACXA 3VUGA 3LE6A 3V04A 4FVQA 5LJJA 2QOFA 3U87A 4QMUA 4DN5A 4WD5A 4EK6A 4EH6A 3QD2B 4QP6A 4GU6A 3D9VA 4O7YA 4IX6A 4ZK5A 3QXOA 4W8EA 5C8MA 2XNOA 3O50A 4AT3A 4EUUA 3O2MA 4NKSA 4LQMA 1MQ4A 3BKBA 3SW4A 2IG7A 4TN6A 5HHWA 4KB8A 5JRSA 5GIPE 2OWBA 3GQLA 5KZ0A 1I44A 4EOKA 3FI8A 2OH0E 3AC1A 1JKSA 3M2WA 4ERWA 4D4YA 1P4OA 4LG4A 4BHNA 5LQFA 3OCBA 4X2JA 3UZRA 4N6YA 4FL2A 2RG6A 3EFKA 2QHNA 4I6QA 3VBVA 4AU8A 3WF7A 2UZTA 3NMUF 3H3CA 3PZHA 3COIA 3D4QA 3G90X 1YXVA 4JR3A 3WZEA 3LQ5A 3BELA 5B2LA 4JL9A 1YXSA 2C6LA 4QNYA 4FKQA 3WILA 1OUKA 4FV2A 4AXCA 3VBWA 5JKGA 1Q41A 3DXQA 4PMTA 4RQKA 3ZO1A 2WFYA 3RPYA 3H4JA 4LGHA 5CAUA 2GDOA 4QYFA 1PW2A 5M06A 1YVJA 4QP2A 5A4LA 2XEYA 3PYYA 3RHXA 5EKOA 2CDZA 5ANOA 5I5ZA 3LJ1A 5LMBA 4I0RA 4BI2A 3L9LA 1CMKE 3Q9ZA 3QTRA 2BDFA 3UE4A 5BVNA 4HVSA 3F3UA 2Z8CA 4K0YA 5CXHA 3I5NA 3OTVA 3BE2A 3VS2A 4U44A 3OCGA 2WMUA 2YA9A 2XA4A 2PVYA 3FLSA 3ORMA 4OBOA 5FUTA 3PJCA 3VVHA 5KMMA 1H1RA 5F4NA 4AN9A 3SA0A 3PWYA 4LRKA 4ZMEA 4ZTMA 2BHEA 5D12A 2UW5A 4UYNA 1M2QA 4AGWA 5A4QA 4CG9A 1H08A 3SDJA 3VUMA 3TDWA 5IA4A 2JBPA 1KWPA 3I7BA 2O2UA 2YZLA 3GENA 3O5AA 5IDNA 3FZTA 2HY81 4D5KA 5TF9A 5TT7A 2AEGA 5ACKA 2W0JA 1M7QA 3QRIA 3W33A 4HGSA 5LMAA 4ALUA 4FTUA 4P5ZA 3P9JA 4EL9A 2QO7A 2VWIA 3OUNB 4FKPA 5DWRA 5GJGA 3RMFA 5M4UA 5IG1A 3QQJA 2BDWA 4FV0A 4EH5A 3DZOA 4AN3A 2WMTA 4HGLA 3I4BA 5CI6A 4DG3E 2PULA 4FTNA 2GFCA 3FBVA 1MRUA 2FSLX 5AP0A 4QMLA 3P7CA 1O6KA 5FP6A 3NEWA 5F20A 4X3FB 3AT4A 5IA5A 2W5AA 4YJTA 5I4NA 2ZB1A 3FSKA 4R3CA 4E6AA 2C6KA 3NUXA 2WQEA 4AW5A 3K54A 5CASA 4FTAA 2ONLA 3SGCA 4QOXA 3ZLXA 4D4RA 4U6RA 5BPYA 5E4HA 3R7IA 3ALNA 3SV0A 3EN9A 2W4OA 5LOHA 2UW9A 1XR1A 4D28A 4GK3A 2J0MB 3BL9A 5J9LA 3WZUA 4JDKA 5CY3A 3ZUTA 4QMWA 1F3MC 4G34A 3Q2MA 4FNXA 4RJ5A 2F7XE 3QZIA 4KS8A 2XP2A 3VS6A 4J98A 3HMOA 4RIWB 4D55A 3WZDA 5A46A 2YACA 4RVKA 4CCBA 2GFSA 3G33A 2WTDA 4FTLA 1Z57A 3UNZA 3W8LA 4O0SA 4YTFA 3EIDA 4IH8A 4R5SA 2BR1A 4M14A 2IZTA 2QLUA 3I5ZA 2Z60A 3W0SA 2REIA 1UV5A 3LXNA 4PTGA 5HE3A 2VV9A 4F6WA 3RP9A 2XIRA 4C2VA 1UWJA 4CV8A 1RJBA 3F61A 5BUIA 2YCQA 3C4CA 1FMOE 4FT0A 4JAJA 3PG1A 3EHAA 2PZRA 4CCUA 3VS7A 1W7HA 3MY1A 1YKRA 4DC2A 5JSMA 2W9ZB 3WARA 3PIZA 4C4HA 3HECA 2PHKA 2ZYBA 4ANQA 5IH5A 3TUCA 5JQ5A 4FNYA 4J8NA 5EM7A 4B4LA 1OPJA 4MH7A 1REKA 5EQEA 2IPXA 3QKMA 4I5CA 4ZSJA 4G5JA 1PXMA 3LFAA 3HV3A 2CLXA 3CJGA 4IAAA 4N6ZA 3MFTA 3C51A 4EJNA 5E8WA 3F5UA 5E1SA 4HVGA 5HO8A 3RAHA 4FZ6A 4TWCA 4XYFA 4O83A 2EU9A 3HVCA 3FZPA 5EOLA 3OW3A 1OIQA 3OUKA 3EQIA 2Y4IB 4I6LA 4IFCA 4RPVA 5K5NA 3Q4ZA 4DEDA 5KO1A 3KEXA 4FYNA 2B9FA 4G16A 2J6MA 3F2AA 1RDQE 1URWA 2IW9A 4C7TA 4JR7A 3QUDA 3CC6A 5AX9A 3VN9A 4AX8A 4CEGA 2R3PA 5F9EA 4FMQA 4OTWA 2JFMA 2AC3A 5CT0A 1JLUE 3NVMB 4EKLA 4Z16A 1KOBA 4RX8A 2OW3A 4IAFA 4U97A 3TEIA 2R4BA 4MD7E 3MFUA 4XG7A 3DKCA 4DLIA 2W1FA 3O7LB 4BCQA 3P78A 2OGVA 3W0PA 3Q9WA 1Y57A 4E6DA 4U79A 1DI8A 3AQVA 4FYOA 3KK8A 4GT4A 4GK2A 4I5MA 3P0MA 4ZSEA 4C3PA 3VS1A 3Q6UA 3ENMA 3F7ZA 3Q96A 5HTBA 2Y7JA 4OTRA 1GZKA 2HZIA 4JRVA 3TKUA 2WMSA 3UMXA 3RHKA 1XH9A 3Q04A 3W0QA 4BDKA 3JS2A 5FTQA 3A62A 4CRSA 4AAYA 1IR3A 3SAYA 2VO3A 1CKIA 4OTQA 3VJOA 2FGIA 2WQBA 3CPBA 4XP2A 3R1YA 4O21A 3DT1A 4N70A 4EHZA 5CQWA 3ORIA 5AUTA 3ELJA 4F0IA 2PMNX 2W1EA 2PY3A 4KD1A 4EZ5A 2B54A 4YO6A 3V8WA 2W05A 4DFNA 3LHJA 3R6XA 3UG2A 5HIEA 2CGXA 3B8QA 1YW2A 4MNFA 2HK5A 3DFAA 4B8MA 2YITA 4QYYA 3PSDA 5CAPA 5LARA 5IA2A 3IW4A 1WVXA 2AC5A 2BHHA 3LPBA 4C34A 4PMSA 4W4XA 2OKRA 5DEWA 2VTQA 2VTIA 4I6FA 2ZVAA 2G2FA 3GEQA 3PP0A 2WTJA 5EM8A 2CN5A 2OFVA 3GU4A 4QT1A 4EZ3A 1QCFA 3ROCA 3ORZA 4RX7A 2IW6A 2WTIA 5BVDA 3P5JC 3Q9XA 3MA6A 3U8WA 3UC4A 3OP5A 1R1WA 4A9YA 4CMUA 3I0OA 4PDSA 2Z2WA 3BEAA 4LOQA 4YJOA 4UYAA 2UZNA 4GUBA 2ITWA 4MXZA 4XUFA 3ZU7A 1JAMA 2JDRA 3U9CA 5EQPA 3R1SA 3H0ZA 3AXWA 4S33A 1QL6A 4XBUA 3HA8A 3OY3A 3R04A 3DJ5A 3R2YA 4PDOA 4YJUA 3DKOA 4L01A 4RT7A 3ZS5A 4ID7A 3EQBA 4E6CA 4D9UA 4OTGA 2PMLX 3KRRA 4K18A 4YZ9A 2I0HA 4X6RA 3KVWA 4YUQA 3W2QA 4PWNA 2VGPA 4QP9A 4EH4A 4BC6A 2VN9A 4IADA 5EKNA 4Q5EA 4JAIA 4D9TA 4F9WA 3I7CA 5C8NA 4WBOA 2LGCA 3JPVA 3MA3A 4KBKA 3IDPA 2ITQA 4FSUA 5LVPA 2PE2A 2OIDA 4RSSA 3SD0A 4DHIB 2R7IA 3NNXA 5L2IA 2XAMA 3AMAA 2EUFB 4RC2A 4F9BA 2WTKC 2W1IA 4AF3A 3F9NA 2R3LA 3PJ8A 5HG9A 3KKVA 5B2MA 4BIBA 4M67A 2XS0A 3LCKA 4RIYA 2W7XA 5J9ZA 4ACMA 3NPCA 5CNOA 3EZVA 4AT5A 4E4MA 3EL8A 2BPMA 2X39A 2OXXA 5FLFA 3R8LA 5KCVA 2F2CB 4QEBA 3E87A 2XH5A 3S4QA 3UDBA 3HZTA 3PLSA 3R7YA 3EN7A 3TYKA 2X7FA 1UWHA 2V7AA 2J7TA 2YDJA 4O38A 3EJ1A 3HV6A 4MD9E 1JKTA 2PE0A 4IX5A 3QYWA 4WKQA 3O71A 5E7RA 4ANMA 5FGKA 3R63A 4O7TA 5C4KA 4QP7A 5J7HA 5FXSA 3U55A 1H25A 1ZOHA 2B52A 4E73A 4OT6A 2G1TA 4CVAA 3MTLA 4QMMA 2OJJA 4RA5A 4NFMA 3LMHA 5E1EA 3T3UA 3C5IA 2OJ9A 5KZIA 5IU2A 5J1WA 2WMAA 4GFMA 3ZFYA 4D1ZA 3QD3A 3NFFB 3FLZA 5C1QB 2W1DA 5I9VA 1WBVA 3ZRMA 3ZRLA 3VRZA 1HOWA 4FI1A 3E62A 3A7IA 3PFQA 5IA3A 2O8YA 3FKOA 3HMMA 4L7SA 4CT2A 2B4SB 2PVJA 2XK8A 2XUUA 3R1QA 2OIQA 4PTEA 2X8DA 3LKMA 2J50A 5HNBA 4QMNA 3QWJA 3QTIA 1YWRA 4DGOA 1PYEA 2DS1A 3OOGA 4YSMA 4USDA 4DT8A 4BJJB 3I0QA 3EYGA 3MB6A 2A19B 3UIUA 5B7VA 4GIIA 3SKCA 2GU8A 4Y85A 2V7OA 2YM6A 4CGAA 4NW5A 4A4OA 4F78A 5BYYA 5CANA 3V5JA 4E8AA 4PDPA 4BDAA 3W8QA 4J96A 3TNHA 2X2LA 2OU7A 3ERKA 4DBNA 5HCYA 4EORA 3LFCA 1XWSA 4BDHA 4XV2A 3ZM4A 1OIUA 4E7WA 4ZY4A 2GNHA 5HD4A 4NM7A 3P79A 4D58A 1GZNA 3KB7A 5LVOA 3QTZA 3KQ7A 5LMKA 4H3QA 3NFGB 3HAVA 3HUBA 3W2SA 4A4LA 4FOBA 2RFEA 4ZS0A 5IMEA 1U46A 3GVUA 3WF8A 3FMEA 3D7TA 3L1SA 5HCZA 4X3JA 5L6WL 4B6LA 2HYYA 1WAKA 3EFLA 4HPTE 3BX5A 1Q61A 3A2CA 4WO5A 3LFNA 5HICA 5DA3A 3NR9A 4JBVA 2WOTA 5BYLA 1YI6A 1GAGA 3BWJA 3FKLA 5GNKA 4AXFA 4QQTA 5HGIA 3H9OA 2I0YA 2OH4A 2XK6A 4IWDA 4BBMA 3FI4A 2WMWA 4O86A 2WO6A 1Q62A 5CI7A 3E92A 5HG5A 3ZDIA 4Q9ZA 5IQIA 5E91A 4LI5A 1W98A 2VNYA 3P1AA 4F0GA 1FOTA 4X0MA 2YFXA 4FKSA 4MTAA 2UUEA 2UW3A 2BVAA 2XKFA 4GRBA 1H0VA 1B39A 4I92A 4Y72A 2C4GA 3FL5A 4X3FC 5HTCA 2VO7A 2Z7RA 2WTVA 2ITZA 3ATSA 1GOLA 1XKKA 2ZOQA 3E63A 3LVPA 5CZHA 1TKIA 5EK7A 4XS2A 3WF9A 1H07A 3TCPA 3P7BA 4R7BA 4TWNA 3QALE 4AW0A 2RL5A 2BRHA 4B99A 3SG8A 3ZC6A 3DU8A 4FR4A 2WZJA 4XCUA 5E8XA 3VW8A 4ASZA 4UZHA 4YC6A 1NT2A 3LCSA 5IA1A 2X0GA 1YDRE 4OGRA 1YDTE 3DKGA 3TV4A 3FC2A 4ZTSA 4AOJA 4ZLZA 5A4EA 4AGCA 3I79A 2LAVA 3QQHA 3RK9A 5AV0A 2G2HA 1WFCA 2QOLA 3CCNA 2CNVA 1IAJA 2R3OA 4IVAA 4TYIA 3ANQA 3VO3A 2PVFA 5D7VA 4WHZA 4U3YA 4ZJIA 5E8UA 2FSOX 3D15A 4IAYA 4TNDA 2XNPA 2QKRA 5H2UA 3ZRKA 4EYJA 4XRLA 5KX8A 4TYJA 1T46A 5AP5A 2UZWE 4BTMA 2FH9A 2Q0NA 3OEZA 3UVPA 4U0IA 4CTCA 1KV1A 2ZM1A 4H36A 3UIXA 2C5OA 4U9AA 2WQNA 2OBJA 3G6GA 4PMMA 3PVGA 3RPRA 3U6JA 4F1OA 1SYKA 3S1HA 4LV7A 3QTXA 5A6NA 1ZYJA 5CSWA 2X7GA 4BVUA 4AACA 2YIRA 4MEDA 4RLLA 3RK7A 3QKKA 3FZRA 5HBJA 2EXMA 5EQYA 2RFSA 4DITA 4YZNA 3FWQA 2WPAA 3R1NA 5ETIA 1GJOA 3DY7A 2VTTA 3ANRA 5A9UA 1ND4A 3COHA 4BB4A 3WOWA 1PMVA 4FSZA 4FSQA 4D1XA 5CEOA 2UZEA 1OUYA 3QTUA 4L42A 2R64A 4FNZA 3NYVA 1OGUA 1H28A 4J99A 3C7QA 4NK9A 4S34A 1ZOGA 4LYNA 3DNDA 2IN6A 2UV2A 2UZBA 3EFJA 4IC7A 3DDPA 4AXEA 4UBAA 4IE9A 1U59A 4ZEGA 2VD5A 4A06A 1AD5A 3DJ6A 3VBQA 4UWCA 3VQUA 5HNGA 3QCQA 4QP4A 4X2NA 3R71A 2B53A 3LOKA 4AP7A 4E5WA 3QQLA 5FP5A 4O0UA 4Y5QA 5DEYA 3DTWA 2VX3A 1FBNA 1IAHA 3NUYA 2JDOA 2OK1A 3FZ1A 1XH5A 2BUJA 2UZUE 3MESA 5EHYA 1E9HA 3NUPA 4IM0A 2UZLA 3PXKA 2NRUA 2Q0BA 4TYEA 4RRVA 5KUPA 5HLPA 4E93A 2ZV7A 1VJYA 2GS2A 3IW8A 3V8TA 1OKZA 4ZSAA 4FE2A 4IDTA 2X8IA 4AG8A 3VAPA 1PMNA 4IB0A 4AXAA 1LPUA 2ZB0A 1Y6AA 5BVWA 3D83A 3DPKA 3GU5A 4JDHA 2HELA 2PVLA 3IW7A 4TY1A 3HKOA 5H8GA 4EBVA 2PVMA 4XV3A 4MCVA 2WMBA 3FXWA 3M11A 3AMYA 4FKRA 4GJ2A 4IB5A 2JKKA 4F70A 3GT8A 3ITZA 4J71A 3MY0A 4FTJA 4FEUA 3R9OA 4QMQA 2VO6A 3Q9YA 5GJDA 4EK5A 3RWQA 1UU9A 5HE1A 2GHLA 2X6DA 2X4FA 2UW7A 3UDSA 4PF4A 5J8IA 3QAME 3OWPA 4L9IA 3VUIA 4Z55A 4AQCA 3TJDA 4YSJA 4RIYB 4JG8A 3O8UA 3TIYA 1IA8A 4X2FA 3NX8A 5GJFA 1JVPP 3MN3A 3PA5A 3HRFA 2E9VA 4XG3A 5DG5A 3KF7A 1PMUA 3VS0A 1PHKA 4ITJA 1XH8A 2C3LA 3PPKA 1SNUA 4YNOA 3TNIA 3F69A 4BY9E 3RM7A 2H8HA 4G6LA 4I5PA 2R3HA 2RKUA 2IVSA 2HOGA 3HL7A 4FV1A 4RJ4A 3GU7A 4RWIA 3MDYA 4TL0A 1XQZA 4JDIA 4BICA 3Q3BA 1BL6A 3FLWA 1MP8A 3NIEA 4KS7A 2V22A 1PXJA 3E8CA 3W16A 3ZEPA 5EW8A 2C6TA 1OL7A 3FZSA 2DQ7X 4FV6A 2PZPA 3OVVA 3F5XA 3G15A 2UVZA 4PL3A 5AUUA 5ANJA 3ZXTA 4MQ2A 3QRTA 3DDQA 3D5XA 4HZRA 4JBPA 4IDVA 4NZWB 2NO3A 1I09A 2R3FA 3CEKA 5H3QA 4DCEA 4DLJA 4K2RA 1OPLA 4O84A 5DYJA 4BCPA 2J5FA 3IO7A 5CU0A 3COMA 4HPUE 3FMJA 2X9FA 3KXMA 4MWIA 2W06A 3MJ2A 2ZV2A 3BHYA 2BKKA 4I93A 3TWJA 4QPSA 2O65A 2UVXA 3RNIA 3II5A 4DFYA 1CTPE 2HY0A 3F2NA 1G3NA 3H10A 3EQPA 4NYEA 4RJ8A 5AIRA 2GTMA 2SRCA 1QPEA 2YERA 5DI1A 4MK0A 2BZIB 4GKHA 2R3KA 4BCFA 3QHRA 4QTEA 2A1AB 4RC3A 5H9BA 3TZ8A 4ZTLA 1YRPA 4F1TA 4ACCA 4FT7A 1XH7A 2UW8A 2X6EA 1Z9XA 4A7CA 3UPXA 4JX3A 5BVFA 3PTGA 5AWMA 4WOVA 5DFPA 5L8KA 4A4XA 2X1NA 4ENXA 5D11A 2B9HA 3VHKA 4AFJA 4DDIA 1H1SA 3G6HA 3Q5IA 2VWXA 4W8DA 5FM2A 5FRIA 4BDGA 1QPJA 5HG8A 3PIYA 2QODA 3DOGA 4ALVA 3SC1A 2BALA 2C69A 4M13A 3TMOA 4RJ7A 2ZMDA 2PSQA 2CGWA 3D7TB 3FMDA 3KA0A 4EEVA 3TUBA 1LR4A 3ULIA 2EXCX 4JOAA 3DLZA 3QUEA 2F7EE 4UV0A 4L3PA 5DPVA 2HW6A 3GGFA 5EW9A 1SZMA 2IZRA 3R21A 2JDSA 3KY2A 3WIKA 3AD6A 4O7LA 1Q24A 3CBLA 2P2HA 5KHWA 1JKLA 4XG6A 1ZOEA 5E8ZA 5IEXA 4OTFA 2BFXA 4Q9SA 4AZEA 4EOIA 3FY0A 3ORNA 3QA8A 5AJQA 1OKYA 2H34A 3SG9A 4QQJA 1FVRA 4ZSGA 2R3RA 5JK3A 3FMNA 4HCUA 3VUDA 3G0FA 4EHEA 1O6YA 4KINA 2PE1A 3C1XA 4B9DA 4BTKA 4FKGA 5EDPA 3T9TA 4QRCA 3O0GA 1U5RA 5M4CA 2VWWA 4PP7A 3PPZA 1J7IA 3FLYA 4BZDA 4FKUA 3IOKA 3UNJA 1RQQA 4BI1A 3UIBA 3R7UA 4C37A 3BBWA 5DNRA 4YP8A 1O9UA 3OZ6A 2WGJA 1PRYA 1OVEA 2VO0A 1WBTA 3AMBA 2CKOA 4ACDA 4ASEA 4YZMA 5F95A 4BCMA 4EQUA 2Q83A 3OF0A 4KIOA 3L9NA 4KAOA 5K3YA 3QA0A 4R7HA 3L8SA 3L8PA 2J0LA 4J95A 3RAIA 2P2IA 2FSMX 3BQCA 3DK6A 1JSTA 1FMKA 4UY9A 1KUTA 3T8OA 1SMHA 4AWIA 4BIDA 3Q4UA 4K1BA 5M4FA 3UQGA 4F63A 4F6SA 2PVNA 1ZMWA 4D2RA 3QL8A 2V0DA 3ZDUA 3RINA 4AQKA 4ZZOA 5AA9A 4KRDA 4F7NA 2QOIA 3VWAA 1LEWA 1UNLA 2ZDTA 3EB0A 4XG2A 4ZTNA 4KA3A 4DE4A 4YURA 4FKTA 3PRIA 2JKMA 2XF0A 4CZUA 2YHVA 2O3PA 3FXXA 3ZH8A 5DLSA 1VZOA 5FDXA 1KE8A 2Z7SA 2BIYA 4FZFB 4A9SA 1Q4LA 1YOJA 2QURA 4BJJA 4OTDA 4OW8A 1WZYA 4QTBA 4F4PA 3E7OA 5L8LA 4YJSA 3W32A 4EOLA 2WQOA 1YI4A 4GG7A 3UOJA 3BRBA 3FEGA 3EN4A 3N4TA 3NUUA 1APME 3LQ8A 3W0NA 3BGZA 5CEIA 3UQCA 3JXWA 2BROA 3AD4A 5CLPA 3UVRA 5CSHA 4D4VA 3R22A 3CKXA 3C0GA 3MWUA 3GCQA 2Y6MA 1UKIA 2GNLA 3A7GA 5IQGA 4FIHA 4TYHA 1WBPA 2PPQA 5FQDC 4BDJA 4I1ZA 3IGGA 5DR6A 3C4WA 3QYZA 2IW8A 4DFZE 4FA2A 5EYMA 4AN2A 1REJA 2Y6OA 4KABA 4PRJA 4HVIA 4LV5A 4M0ZA 1OGYA 4YTHA 4XX9A 5CZIA 3E7VA 2JFLA 4KBCA 4AOTA 3JUHA 2BIKB 3PXQA 4FTIA 2F49A 4XLVA 2AUHA 4JNWA 4DG0E 3F7WA 1S9JA 4R3PA 1QPCA 3FI2A 4KUJA 5HVYA 2YJSA 4O6EA 4NW6A 1OB3A 4AXDA 2GTNA 3AGLA 3ATTA 4RA4A 5AP2A 4L45A 1XBAA 4O0WA 5EI2A 4Y83A 1GNGA 3LZBA 4YZBA 3PG3A 4YGAA 3PWDA 3BGQA 5CQUA 4I41A 5CF6A 5CAOA 1OIYA 4QMPA 1M2RA 4FG7A 4IM3A 4EHVA 3E8DA 4BF2A 1CSNA 3RCDA 5L2WA 2J51A 4F9YA 2VNWA 4O0TA 4O7WA 3ZZWA 4K8AA 5BNJA 3BLHA 5ANEA 5EDRA 3UVQA 2XNGA 3TZ7A 3UMWA 3UZPA 1M17A 2PWLA 4E20A 3L8XA 1R0PA 2W4KA 2WD1A 1YQJA 3BYOA 3E88A 3F82A 5B0XA 4HCTA 2XM9A 3V3VA 4G9CA 3WE8A 1Q97A 3I81A 2ZV8A 2VTNA 4I94A 1ZXEA 1OL1A 5CU6A 5IEYA 3D5UA 4QTDA 2R5TA 1RW8A 3ACKA 5KBRA 1TVOA 2XKDA 3N4UA 4FSNA 4YJPA 4BDEA 3PDTA 1T45A 3NYNA 2C0TA 3RTPA 4NM0A 4X2GA 4ASXA 2W9FB 2C30A 5C9CA 5M56A 4PDYA 2YCSA 2YM5A 3S0OA 2VTOA 1R78A 2W1HA 1BI7A 3I6UA 3NUSA 4QMXA 5JRQA 1AGWA 2YDIA 3E64A 1ZWSA 5BMMA 3ZHPC 4GFOA 5L8JA 3A99A 3LFDA 4NUSA 3EQCA 4ZOGA 3WZKA 4DGNA 5ANDA 5DIAA 2F57A 1HCKA 2E9OA 3CKWA 3F88A 5DH3A 4CFXA 2QOQA 3A7HA 5I9XA 1P14A 5IQFA 4ORKA 4LL0A 3VNTA 4YTCA 4M97A 3KFAA 3R9RA 3ZO4A 4ENYA 1ZYLA 4EJ7A 3E8EA 3GCSA 5BX0A 1MUOA 5L6OA 3SXFA 4F99A 3HV4A 3TJCA 4FIEA 4WRGA 3KXXA 2OJGA 2VWBA 3GB2A 3PY1A 5AP1A 3DAKA 1J7LA 1J1BA 4O2ZA 3DZQA 1R3CA 2PL0A 3VS3A 5FD2A 2R3MA 4F0FA 3DV3A 2HCKA 4LOOA 4L3JA 5IQAA 3P4KA 4FG8A 4UZDA 3SRVA 3IECA 4C02A 4R7IA 4APPA 1Y8GA 2R7BA 2Y8OA 3QD0A 4UWYA 4V01A 4ALWA 5AA8A 2NYAA 3ZO3A 1SVHA 5JMSA 1M7NA 2C47A 2G2IA 2XZSA 3BU6A 3VIDA 4KBAA 3VHEA 4FIIA 3PSCA 3W1FA 5AEPA 3GOPA 3NYOA 4FTMA 2XIKA 3JVSA 1YHWA 5EI6A 1H4LA 3EQHA 3HNGA 5EYCA 2YISA 4DFUA 3QC4A 3DKFA 3NWWA 5DT0A 3MBLA 3F3VA 4IJ9A 3KC3A 5EYDA 4PTCA 4RWLA 3ORTA 1J7UA 4FJVA 5L2SA 3ZFMA 4EOPA 2OLCA 2H9VA 4XG4A 3MIAA 4TTHB 1SM2A 3ULZA 2VTMA 4CQEA 3GU8A 5HG7A 3ZLSA 4BTFA 3EKNA 3ZLYA 2CJMA 2G01A 4AW1A 4EOMA 4CLJA 5HU9A 3MH1A 3TUDA 1UA2A 2WMXA 4O7NA 2W5HA 2ITVA 4EOSA 2OZAA 2C6IA 1Y91A 3LAUA 2XKEA 3VRYA 4ZSLA 4IWOA 4QMZA 1JKKA 3CTQA 5E92A 5M51A 2ETKA 4Z3VA 4C2WA 5DT4A 4ZTHA 3R73A 4U80A 4IWQA 3I1AA 1XH4A 3SX9A 4CSVA 4DEEA 4DTKA 4TWOA 2P3GX 3FLNC 3QF9A 4S31A 3TG1A 2C6OA 4APCA 4A07A 5FXRA 3KRLA 4TZRA 1VYWA 5BVKA 3LFBA 3DQWA 1L3RE 1OECA 2XK4A 1GZ8A 4GMYA 5HX6A 2BDJA 3VULA 4F9CA 2WEVA 2BRNA 2JD5A 5AUXA 1PXPA 4D0WA 4RZVA 3CY2A 4QP1A 3UYTA 2IWIA 3EQFA 2Y0AA 2JKOA 2YM4A 4BN1A 4AZFA 3DB8A 5HKMA 4EH2A 2PUIA 2J5EA 4MKCA 2V55A 1B6CB 4EK3A 5D41A 3BI6A 3HMNA 1PXLA 3MB7A 3TV7A 3VBYA 2JAVA 3ENHA 3Q32A 2EB2A 3QQGA 5IQEA 2HWOA 4YHFA 4BCNA 3PUFC 1FGIA 2XMYA 4D2SA 3SHEA 4ZIMA 2X2KA 4MBIA 1NVQA 4NSTA 5FEDA 3NDMA 2YABA 3VS4A 1JSUA 1OM1A 4BCGA 1NY3A 2BZJA 5CNNA 1TQMA 3RZBA 4JLCA 2YM3A 4AGUA 4MF1A 3WE4A 4O82A 3ZTXA 4QTAA 1OKWA 3A7FA 3D14A 5FTOA 3GU6A 4BDDA 3MJ1A 2B7AA 1P4FA 2QOOA 1NVRA 5CF4A 3A60A 1JQHA 4DH1A 5IH6A 2WKMA 2Z7QA 4E5BA 4DFLA 1WVYA 2A27A 2QO2A 4B7TA 5AP3A 2ERZE 5BUJA 3HP2A 5CALA 3KCFA 3ODZX 4FX3A 3BYUA 5EM6A 5KMIA 3KGAA 3KXZA 5ANKA 3F3ZA 2CKPA 3A61A 3KIOC 5AV2A 4PUZA 3BYMA 2WIPA 3RAWA 5KMOA 5JFSA 2VTSA 4JQ7A 3KRXA 5J87A 3UIMA 3K2LA 4FT3A 2PUNA 3GC8A 4MVFA 3HRBA 3LFFA 2UW0A 4GIHA 3JVRA 4L44A 3BHVA 4TPTA 5LWNA 4AA4A 4G31A 3LJ2A 5J1VA 2CNUA 2W1ZA 3PXZA 3Q4TA 3FMKA 3HUCA 2ITXA 3NNUA 3PVBA 4GW8A 4RGJA 4TXCA 4UALA 5ACBC 4C33A 1JSVA 3S2PA 2ITTA 3DAEA 2QR8A 4IAIA 1YHVA 5TR6A 5HZNA 4ASDA 2WB8A 2QOCA 4P7EA 3RAKA 4K6ZA 4EQMA 2Z7LA 4F7JA 2IVTA
chains in the Genus database with same CATH topology
2H96A 2I40A 2NRYA 2H6DA 2QC6A 3O51A 3F3TA 4RBLA 1KE5A 4FK3A 3LFQA 4GT5A 4N4SA 3FXZA 3AKKA 5CX9A 5K9IA 2PZYA 3KXNA 4DEGA 3KF4A 4EK8A 4XMOA 2CPKE 4EONA 3PJ3A 3CR0A 3ZSHA 4FTTA 5DN3A 4EI4A 3AC8A 3ZFXA 1E1VA 2C5YA 2WXVA 2JKQA 3A4PA 4TYHB 1VR2A 4MWHA 4XHKB 2R3QA 4F9AA 4CNHA 2GNFA 5IUIA 3Q60A 4MQ1A 5H8BA 4G6NA 3D2KA 4JIAA 4RIXA 1NA7A 1PJKA 4C58A 4O7VA 2C3JA 5CT7A 3QLFA 4AOIA 3OCTA 4DYMA 3ET7A 4QP8A 3W55A 5CS6A 3WF5A 4BBFA 2NNWB 3KN5A 4DEHA 4JVGA 1Q8UA 3GP0A 3DAJA 2UZDA 5IF1A 2B9JA 2CSNA 1DI9A 4TRLA 5DR2A 3CJFA 5K4IA 3RKBA 3EN5A 2BTRA 3NNVA 4FZAB 4CTBA 2YCFA 2J9MA 3RPSA 1PKGA 1Q3WA 2VRXA 4C59A 3I60A 5KMLA 3BLAA 1GIHA 2FA2A 4OUCA 1WBSA 3BYVA 4Q2AA 4O22A 3ID6C 3KMWA 1BX6A 3TV6A 3OMVA 1P5EA 3WYXA 4PY1A 4WUAA 5BMSA 3ETAA 5KHXA 1XJDA 3BPRA 3Q2JA 1U5QA 2PZ5A 4IZ5A 2XIYA 5EFQA 5HBHA 4FUYA 2FB8A 4RJ3A 5HEZA 5IDPA 2E9PA 4BDCA 3ZONA 4TW9A 4HGTA 3PVWA 3ZLWA 4L46A 1KE9A 4CT1A 1DAYA 4DA5A 3CY3A 1Q99A 1ST4A 4O96A 5CU2A 2WEIA 4UXLA 5HLWA 3OWKA 3CXWA 2PTKA 4L68A 3SLSA 4ANBA 4BTJA 5DE2A 4W4YA 3RVGA 3ORXA 2RG5A 1TQIA 1PYXA 4IAZA 2WNTA 3CIKA 3N4VA 3OC1A 5J95A 2QONA 3UOLA 3B2TA 3KREA 4XOYA 4LDTA 5EDQA 4I4FA 2UW6A 2UZVA 4R1VA 3DBQA 3P86A 2R3IA 2G9XA 1H26A 2XNMA 3OXIA 3G5DA 3A8WA 2ZDUA 5EI8A 3AKLA 5FBOA 4DF3A 2VWUA 3AC3A 1Y6BA 3BHTA 3FMHA 3FYKX 3MFRA 3QD4A 3HDMA 4FKJA 3LFEA 3DNEA 3MVJA 5BUEA 4J7BA 2GCDA 3IOPA 3OY1A 5ANIA 3ZUUA 4ANLA 5I9YA 5LMKC 4BDBA 1GIIA 3KCKA 4D0XA 1HCLA 2OXYA 2QD9A 3HA6A 1H1PA 3V5TA 5IPJA 1OL6A 4TWPA 2C1BA 1YI3A 2HIWA 3BLRA 3DLSA 3H9FA 4O2PA 1KSWA 4KSQA 1Z5MA 2ZV9A 4YU2A 4O0YA 2IVVA 3R8UA 4LGGA 2BILB 1K2PA 4FKIA 3LCTA 4BRXA 4EOQA 3C4FA 4AZTA 1OPKA 1K9AA 4M0YA 3R9DA 5KNJA 2HXLA 3ODYX 5EW3A 4H58A 4RVTA 2OFUA 3H9RA 4RJ6A 4XH6A 3SRVB 3TDVA 3R8VA 3S00A 1SNXA 5HE2A 1W83A 4K9YA 4DGGA 2ZJWA 5CENA 3VW6A 1M2PA 5CVGA 4IB3A 2C68A 3AD5A 3R8PA 3NW6A 2GMXA 4TKSA 5AM6A 3HEGA 5DRBA 1YDSE 2YDKA 3IS5A 4W4WA 3LMGA 1ZZ2A 5LVNA 1G8JA 3CQUA 4U8ZA 2XK3A 1NVSA 3OOMA 1X8BA 4LUDA 4MXOA 1UU8A 4WIHA 4EWHA 4U45A 1ZZLA 1XHAA 4CD0A 3C4XA 2PMIA 3AT3A 4GJ3A 4NCTC 2ERKA 5DHJA 3QBNA 2WMQA 3DXPA 4FKVA 2YM7A 5CVHA 4HCVA 4GVJA 2Y4IC 2YEXA 5IISA 3FPQA 4IX4A 4JS8A 4JX7A 4O6LA 4QQCA 4X21A 5DT3A 3TTJA 3WYYA 4FODA 2YJRA 4U43A 3ZYAA 4DHZA 1CM8A 4ZAUA 5AADA 4OLIA 4BCHA 5FDPA 3F66A 5IQCA 4IHPA 2XK7A 4CFWA 2OZAB 5EM5A 5KKRB 3AC5A 4FT9A 4FL3A 3MI9A 5ITAA 5K5XA 3ZXZA 4NH1A 2JDVA 4GU9A 4XG9A 3LJ0A 4ZS4A 2R9SA 3QZFA 1LEZA 2QHMA 4U81A 2XNBA 5HE0A 2XNNA 4YLKA 4B0GA 4PL4A 4XP3A 4N57A 3RPVA 4I6HA 3NRMA 3LIJA 4I5HA 4DEBA 3MVHA 5IMXA 5BV3A 3ZOSA 5KMKA 2HZNA 4UXQA 4CKJA 4OTHA 4WG4A 3CP9A 3A7JA 4PNIA 3N9XA 3ORLA 3MS9A 4PQNA 3SXSA 5A3XA 5M57A 5JZJA 3OT3A 2W1GA 3EMGA 2W96B 4FTQA 1BI8A 3IONA 4MNEA 3F5GA 2VUWA 3ORKA 3PE2A 4XV1A 1OKVA 4Y73A 3CQWA 4F65A 5FG8A 3VONA 4CFMA 4ZJJA 2ETRA 5AUYA 5HCXA 1Q8WA 1ZAOA 4JT3A 3BZ3A 3UQFA 1W8CA 3RCJA 2XKCA 4I4EA 3OG7A 4FSRA 3HGKA 4GVAA 3QZGA 4QDVA 1IEPA 2XCHA 5AUVA 3VS5A 4DH7A 3R8ZA 4GEOA 2GNGA 3TZMA 5CWZA 2X2MA 1UNGA 4I21A 3UTOA 4DINA 3QX4A 2BFYA 3GCPA 4U41A 4UX9A 4J1RA 3P7AA 4P90A 5E8YA 5DGZA 4IEBA 4E1ZA 2E9UA 4LL5A 4EKKA 3DCVA 1PF8A 4FV5A 5CF5A 3MSSA 1OZ1A 2VZ6A 2J0KA 2XIXA 3FL4A 4NWMA 4XBRA 3RGFA 2XYNA 3VBXA 2OJFE 4ACGA 5IH4A 5JEBA 3Q6WA 2OJIA 3O8TA 2BAQA 3OBJA 4GKIA 5E90A 5I0BA 4QMSA 2QVSE 4FICA 2OICA 1NXKA 3AOXA 5IA0A 2ZM4A 3TKHA 3CSVA 5FTGA 5KE0A 3PSBA 4KNBA 3RNYA 1UU7A 2XRWA 4D4SA 5CF8A 4FG9A 4FUXA 5D7AA 2E2BA 3C4ZA 4CXAA 4IX3A 3WF6A 1Q3DA 5DBXA 3BBTB 2PVKA 5M53A 2GNJA 3QWKA 4NKAA 4WA9A 3MH2A 4G3GA 4QQ5A 4DCAA 3JR1A 5EG3A 3UOKA 4GV1A 1W84A 4DHFA 4GS6A 4MYGA 4YC3A 5K4JA 1MRYA 3LFSA 3KVXA 3BWFA 3JY9A 2W4JA 3QQFA 5LWMA 3D94A 3EQDA 1QPDA 4R3RA 4J8MA 4K77A 4KWPA 3P08A 4AE9A 5FBNC 2YWPA 4H39A 2XJ0A 4HJOA 1NW1A 4RMZA 2QQ7A 2WTKB 4CV9A 1UU3A 3H0YA 3VQHA 5EHOA 4XLIA 3VJNA 5GINE 3NUAA 5ETCA 2A4LA 3UJGA 3KK9A 4YO4A 5C4LA 3C5UA 3OHTA 4HNFA 3DB6A 2WIHA 1J91A 4GL9A 3K5VA 3UOHA 4AT4A 3V6SA 3UO4A 5AV4A 3CGOA 3ZM9A 5HBEA 3C0HA 3E8NA 3PVUA 4YHJA 4RIXB 2QG7A 3UDTA 4C3RA 1ZYSA 3QRJA 4QPAA 4GG5A 4E4NA 2VX0A 4GYIA 3FHRA 3TNPC 3FMMA 2PVHA 3OBGA 2DWBA 2G15A 3E3PA 3EQRA 3NGAA 4M12A 1YWVA 4ZY6A 3TKIA 4BCKA 3QCSA 3LQ3A 4JDJA 4DFXE 4A9RA 5CEKA 3M1SA 3PFYA 4FZ7A 3G9LX 3NUNA 4NJ3A 2XAOA 4FIJA 5AP6A 3HV5A 3TZ9A 4RVMA 1YHSA 1JNKA 4FEQA 5FXQA 4G3DA 5JGBA 3C0IA 3R8MA 4HZSA 4TYGA 4E5AX 2QNJA 3FY2A 4IZYA 4M3QA 3W18A 3EOCA 5AV1A 3W2OA 3PY3A 1PMEA 4O0VA 5AMNA 3ZUVA 5M44A 3TNQB 4CLIA 2VWZA 4WNKA 4LMNA 4XJ0A 4MXAA 4MXXA 5LVLA 2J4ZA 4FVRA 3SVVA 3BLQA 4G1WA 5J9YA 2PYWA 4YC8A 4DEIA 3AG9A 5BYZA 4L6QA 3FPMA 4M15A 4AA0A 3UP7A 4D1SA 3COKA 5HVJA 1OMWA 5CEQA 5T68A 4KSPA 4G3EA 3LM5A 3NCGA 4YPDA 4PL5A 2V62A 3HP5A 3LXKA 2ONLC 3P23A 2J0JA 3PP1A 2BRGA 3BHHA 4E4LA 5HVKA 4MXYA 4BDFA 1JPAA 1YWNA 4QMYA 1WBWA 4HNIA 3OW4A 4TNBA 2X7OA 4MXCA 4IVDA 4YBJA 5FEQA 3ZBFA 4FL1A 4P2KA 1Q8YA 4F7SA 4UB7A 3UPZA 3AT2A 3R2BA 1L8TA 4BZNA 2C6EA 5JH6A 3RWPA 3MPAA 4FEXA 4R77A 3VUKA 2P55A 1URCA 2RGPA 3R7VA 3ZO2A 2Y9QA 4CFFA 3FE3A 2HXQA 2VTLA 3C4EA 1MQBA 3BYSA 4O81A 5JGDA 3UO5A 4MHAA 5ANGA 4DTAA 2JC6A 3BHUA 1BYGA 4V04A 5CU4A 4TT7A 3C50A 1KE7A 2PK9A 4JRNA 3IQ7A 5LCJA 2JITA 3IDCA 2X9EA 3QTWA 4F08A 2VWVA 2UW4A 4ZJVA 4DG2E 2C0OA 1H24A 2CGVA 5A14A 2VGOA 2OF4A 5CSVA 2B0QA 3GCUA 4ZZMA 2OG8A 4KIQA 1WCCA 1H27A 4LUEA 4U5JA 5AP4A 4BCOA 5DRDA 1WBNA 4QO9A 4F7LA 1VYZA 2OI4X 3CQEA 4KIPA 3UP2A 4DTBA 3R30A 4ARKA 5EH0A 4ZLOA 3BQRA 1ZY5A 4CFVA 4WNMA 2P33A 3QUPA 4BGGA 2GHGA 4JQ8A 4MBJA 4C35A 4G6OA 2ITNA 2XARA 5JGAA 1GIJA 3NAYA 2KTYA 4JG6A 5TOZA 1Q8ZA 4A9TA 3BGPA 5LVMA 4WG5A 3SOAA 3OTUA 1H0WA 4F09A 3R9NA 1PXKA 4UN0C 4RLKA 4XEYA 2OSCA 1W0XC 2YIXA 4AUAA 5IUHA 2XRUA 3IGOA 4JBQA 3SOCA 1TFFA 5L2TA 3MTFA 3FZOA 1UVRA 4O91A 3QZHA 4M7IA 5L6PA 2WELA 3L9MA 4LRJA 4J97A 3DA6A 4AE6A 4EBWA 3IW6A 5A4TA 1JWHA 4FC0A 3UDZA 5BVEA 3PIXA 1H00A 5AV3A 2PUUA 3AC4A 3MY5A 3NAXA 3PA4A 3UC3A 3QC9A 4FSMA 2GSFA 1ZYCA 4WBBB 3ACJA 4P4CA 3AKJA 4I6BA 2YWVA 3BEGA 3NZ0A 4QMVA 4U3ZA 2RFDA 1ZYDA 5BVOA 3IK3A 4LOPA 4YJRA 4CMTA 4RFYA 4DEAA 4H1JA 3EZRA 4I22A 4FSTA 4CFNA 1IRKA 2BRMA 4DDGA 3EH9A 3GUBA 2ZAZA 2JDTA 4NM3A 4YZDA 3ZSIA 4YHTA 5JN2A 3BU5A 4G2FA 4RG0A 2QCSA 4MNEB 4FV3A 2XK9A 4G9RA 4F6UA 3P5KA 4DGMA 4C4FA 1QMZA 2ITOA 4QNAA 3KXHA 4DBXA 3A8XA 3EWHA 4YMJA 2B9IA 2GPHA 2HAKA 3W0MA 2I0VA 3REPA 3BL7A 3OCSA 1JBPE 1ATPE 3QRUA 5CXZA 2CNQA 2UZOA 1H01A 4YNEA 3L8VA 4M84A 4BHZA 4EH8A 3O7LD 4Y5HA 5CAQA 3W10A 3QTQA 1IG1A 5AFVA 2HZ0A 3LMIA 4RZWA 3A4OX 4X6QC 4I20A 3U6IA 3BIZA 2JAMA 2VX1A 3RJCA 4FBXA 3F5PA 3PRFA 4M8TA 4QYGA 2XJ2A 5HIBA 4YZCA 3DBEA 3DTCA 4LFIA 2BAKA 5HESA 1Q8TA 5HIDA 2QU6A 3DS6A 5F1ZA 1U4DA 2YM8A 4G3FA 2EWAA 1H1WA 3VF9A 4BGHA 2VTAA 4ZMFA 4AZVA 3OWJA 3MV5A 2C5VA 1GZOA 4H1MA 4YLJA 3ZSGA 4C61A 5FEEA 4LV8A 4C0TA 2B55A 3GC0A 4NTSA 3W0RA 3ROYA 2WMRA 3WZJA 4AAAA 1MRVA 3UNKA 4Q5HA 5KKRC 4HYHA 4WUNA 5G6VA 3QQUA 1STCE 2XYUA 3CE3A 3HV7A 1XBCA 3NVKI 4H05A 2XBJA 3Q5ZA 2ZFYA 1IASA 4YJNA 3KMMA 4JXFA 2WTCA 4XOZA 4CG8A 2JBOA 5AUZA 4HOKA 2ETMA 4PX6A 2BMCA 3U4UA 5HNIX 1FINA 2QU5A 4FTCA 4L67A 4LM5A 4NT4A 1R39A 3D2IA 4M69B 3G9NA 3KL8A 3LLTA 3R01A 4KKGA 2ITUA 5GIOE 4XNEA 1Y8YA 5ETFA 4BCIA 1G5SA 4X7QA 5GHVA 4BKJA 4MX9A 4C38A 3QQKA 4YTIA 4EC8A 4USEA 1P2AA 2RIOA 3TT0A 1ZMVA 1WBOA 4R1YA 3MVMA 3NS9A 1CKPA 3QGYA 3CLYA 3LM0A 4OBQA 5EHLA 1OI9A 2GS7A 3QXPA 3NYXA 4NJDA 1G8KA 2QOBA 1XMMA 4BYJA 2WMVA 4O0XA 3CD3A 2ITPA 2O63A 4FGBA 2NP8A 3HMIA 4GUEA 4II5A 4E6QA 1FVVA 2A0CX 3T3VA 4Z7GA 4JMQA 5DVRA 5JZNA 4O0RA 4HGEA 4IACA 4RFMA 4AZWA 5M09A 4FV8A 5DR9A 3KRWA 3FV8A 4GH2A 5T3QA 4RQVA 4EH7A 1SVGA 2XEZA 4BR3A 4XP0A 2BCJA 2CMWA 3FHIA 3U51A 3V01A 3EKKA 1OBDA 2XVDA 4YJVA 2JEDA 3T9IA 1YXXA 2VU3A 4EZ7A 2CGUA 2WTWA 3KULA 4CZTA 1KE6A 5D1JA 1YOMA 3PLAE 3UZTA 4YJQA 4IWPA 3MH0A 5C8KA 3ORPA 2O0UA 2R3NA 3FJQE 3OD6X 3BCEA 4L7FA 2J0IA 1G8SA 3U6HA 3C9WA 2JGZA 3WI6A 2C3KA 4NL0A 5I9ZA 5L3AA 5LCKA 2UVYA 1UNHA 3RALA 4XG8A 3DK3A 3S95A 4K33A 2C1AA 1BLXA 3GNIB 2OF2A 4OTIA 2HENA 4Z9LA 3RK5A 4HYUA 2XB7A 4I24A 2ZMCA 4Y95A 4KKEA 1JOWB 4I0TA 2DYLA 3QCYA 4ACHA 3W0OA 3R00A 4IZAA 4RVLA 2BTSA 2WHBA 3EQGA 3UYSA 5HORA 4RFZA 4ZLYA 4R5YA 1ST0A 3LCDA 4CKRA 2GQGA 4S2ZA 4HVHA 4QTCA 4IC8A 3M42A 1PXOA 3V5WA 2JIVA 2RFNA 4FZDB 1BKXA 3FQSA 4O7ZA 3HX4A 4PMPA 3O17A 1U54A 4PP9A 5C27A 4AA5A 5IQDA 4EQCA 2W1CA 2QI8A 2IZSA 2WAJA 2JIIA 3JY0A 3KRJA 3POZA 4P5QA 1XBBA 4IZ7A 2QOKA 5E8TA 4I3ZA 3K3IA 1PXIA 1PKDA 2CCIA 3OXZA 5B2KA 3E3BX 4RWKA 4BIEA 3R7EA 4YR8A 5TKDA 4L52A 3AC2A 2J90A 3QLGA 5A4CA 4L53A 3HYHA 3KN6A 4I23A 5I9WA 5HU3A 3O8PA 2C6DA 4IVCA 1ZMUA 5JQ8A 2FYSA 3TNWA 5M08A 4OR5A 4FTOA 4C4EA 3MFSA 3FQHA 3ZBXA 4FIGA 3UODA 5AIKA 4G5PA 2FVDA 2F7ZE 3ZCLA 5AAEA 4IMYA 4FTKA 2YAKA 4FVPA 1A48A 5BQ0A 3OFMA 5IEVA 3GFWA 3FSFA 2I6LA 3PE1A 3PXFA 3W2PA 2R2PA 3CS9A 4EOOA 1BL7A 5D10A 3JYAA 4CMOA 3POOA 4FSYA 2JIUA 3THBA 4DAWA 2A2AA 5CTPA 5TO8A 1V1KA 1G8AA 3MPTA 4NM5A 2C0IA 3DQXA 5EYKA 3DK7A 5AX3A 1CKJA 2CN8A 2OXDA 4G3CA 1AQ1A 4QMOA 4U7ZA 2W5BA 2IJMA 4FOCA 3TTIA 3RM6A 4JI9A 5E9EA 4RX9A 4HVDA 4C4JA 2ESMA 1CDKA 3IG7A 3HDNA 4PV0A 4V0GA 3MIYA 2E9NA 4I0SA 4QDEA 3GFEA 4EK4A 1F0QA 1S9IA 3FI3A 4Z7HA 1BMKA 3F2RA 2XJ1A 4IQ6A 5HD7A 3R83A 2WU7A 3B2WA 3PPJA 5KMNA 4IFGA 4V05A 3U4WA 3UG1A 5HX8A 5J5SA 1ZLTA 3PA3A 2VTJA 2CHLA 2C6MA 4FKWA 3FDNA 3VC4A 4JJRA 1K3AA 2CKQA 5H8EA 5IQHA 2XNEA 4EH3A 1GY3A 3D5WA 4D5HA 5I9UA 4F64A 3ALOA 4NIFB 3TI1A 2IO6A 4JIKA 3GC9A 4EHGA 5CEPA 1FVTA 4R78A 3D0EA 3OEFX 4LMUA 3DJ7A 3HLLA 3GBZA 3EYHA 3QTSA 2VTRA 4X2KA 3G0EA 4YLLA 4EH9A 4ERKA 5LXMA 2PU8A 3RPOA 1IA9A 2CCHA 4PNKA 4EYMA 2QG5A 4UWBA 3CTJA 2BZHB 2YIQA 3ZMMA 3W2RA 5HQ0A 5CYIA 3W2CA 3KXGA 3TIZA 3V5PA 5CEMA 5DOSA 3DFCB 5E8SA 1M52A 1A06A 3ZZEA 4WNPA 3DBDA 4GCJA 2XBAA 1FPUA 1FGKA 4J53A 4C36A 2YCRA 3ZEWA 2QKWB 4U40A 3NIZA 4WSYA 5M4IA 3R0TA 2QOHA 2B1PA 2QO9A 4ZP5A 2ITYA 4WNOA 4QMTA 2J2IB 3GXLA 3D5VA 1OITA 1YXTA 3OWLA 1ZARA 4O27B 5IQBA 2KULA 1RE8A 1LUFA 4WT6A 5KBQA 4DHJA 3WBLA 1DM2A 1M14A 1FQ1B 4MUQA 5JFVA 3C13A 4FKLA 4L00A 4RC4A 4EUTA 3LLAA 5AAFA 4FSWA 4AGDA 3DBCA 4S30A 4XV9A 5IZFA 5E8VA 3TACA 3QX2A 4FK6A 4C4GA 4ITIA 3HMPA 4IW0A 2I1MA 3WIGA 1V0OA 4E4XA 2PZIA 4MAOA 2OO8X 3HRCA 4NTTA 4ZY5A 3ML1A 5JT2A 2XANA 3OS3A 5JFXA 3NLBA 5A6OA 5KMJA 3O23A 4O7SA 4FNWA 3AGMA 4AFEA 2HW7A 2JLDA 4BCJA 4L43A 1H8FA 2VTHA 3DXNA 3E93A 3GCVA 3PXYA 1OL5A 3D7ZA 1V0PA 3G51A 3B8RA 3S3IA 2BZKB 3FUPA 4J52A 3QCXA 3UGCA 3NCZA 1XO2B 4OBPA 5AM7A 2OZOA 3F6XA 4YBKA 3R7OA 2V5QA 1H1QA 4ONAA 5HO7A 3CGFA 5ETAA 3V51A 3U54A 3Q53A 4HW7A 4GK4A 1V0BA 3Q52A 4XRJA 3PUPA 5C26A 2HZ4A 2FUMA 3V8SA 2AYPA 4KKHA 1TQPA 3HAMA 3EFWA 2YZAA 3QRKA 5M07A 1ERKA 2O5KA 4Y8DA 3FMLA 3PZEA 4FT5A 4Y46A 2P0CA 3FLQA 4UEUA 2HWPA 2YIYA 2IVUA 4X3FA 5HI2A 1DS5A 1VLRA 4NU1A 4C3FA 4ZTQA 5CSPA 4JBOA 3IDBA 5C03A 2CLQA 3E5AA 3PXRA 5AUWA 2W99B 3FYJX 4BYIA 4DGLC 2QLQA 4IJPA 3TN8A 1PXNA 3IW5A 3OXTA 4ITHA 3GQIA 2X8EA 4FV9A 2C5NA 2PVRA 3DBFA 1EH4A 4NFNA 4OT5A 4F1MA 2VTPA 1OIRA 1XH6A 2BRBA 3QKLA 4IIRA 2VAGA 2P4IA 4W4VA 5EOBA 5C01A 3MGYA 4BZOA 2WU6A 4FV4A 5M55A 2PMOX 4BBEA 3BV2A 3LCOA 2R3GA 4RWJA 3FQEA 3UBDA 4FIFA 3V5QA 3SW7A 1BUHA 1VEBA 3FAAA 4N0SA 2I7QA 2YN8A 4H3PA 4EC9A 2XIZA 4FKOA 2C3IB 4RIWA 3H30A 2R0UA 5FM3A 4L8MA 3SQQA 4BDIA 3R02A 2X4ZA 4MD8E 1ZRZA 3CTHA 4QP3A 4GT3A 1ZY4A 3KULB 2QR7A 4H3BA 4JQEA 4RIOA 4R6VA 2DUVA 4B8LA 4BGQA 4GYGA 4AW2A 5A54A 3O96A 4CFUA 3NNWA 1W82A 2GQRA 4O7RA 3NSZA 4WG3A 2XALA 5JFWA 2O64A 2BAJA 2X81A 3CD8A 3FKNA 4FTRA 4ANSA 4M68A 3F3WA 2YIWA 1XMLA 4GFGA 3Q4CA 2WOUA 5CAVA 3ZC5A 3PJ2A 4RX5A 3L9PA 2XM8A 4DH5A 3MPMA 3RI1A 2GQSA 1R0EA 3QHWA 1B38A 1DAWA 1O6LA 2NPQA 3BV3A 2GNIA 2I0EA 2VWYA 3NW5A 3QGWA 2Y4PA 3MYGA 4IM2A 4LRMA 5T6KA 4A9UA 4AZSA 2XCKA 2FO0A 2GHMA 3IPHA 4DH8A 4DT9A 5CU3A 4CRLA 4FV7A 4IVBA 4QYHA 4ZZNA 3V6RA 4IAKA 3MH3A 4K11A 3KU2A 4ZXTA 5ICPA 2F2UA 3NW7A 1OBGA 4YPSA 3OROA 4FGRA 3VF8A 1J3HA 3R9HA 3KMUA 4BI0A 2Z02A 4NCTA 1U54B 3SXRA 3V5LA 4USFA 2C5XA 1WMKA 3I6WA 3K3JA 1SVEA 4L3LA 3N51A 4IB1A 3CPCA 3LXPA 4E26A 4KRCA 4WRSA 1PY5A 2BKZA 5HLNA 3GOKA 4IANA 3MW1A 3U9NA 4HYIA 3TXOA 4JG7A 2F4JA 2R0IA 3LXLA 2FSTX 3QU0A 4FEWA 3LW0A 4IBMA 3IKAA 2RF9A 4DH3A 4EOJA 2IZUA 3OT8A 3EN6A 3R28A 4HYSA 4GSBA 2WQMA 1A9UA 4S32A 2F9GA 4QYEA 1LP4A 4AS0A 2ZM3A 1E1XA 3GI3A 1J1CA 3VBTA 1KV2A 1YOLA 2W17A 5F94A 3K5UA 4U42A 2R3JA 3UO6A 2GS6A 4FEVA 4C4IA 3QFVA 5D9HA 1OL2A 2PUPA 3BE9A 4DFBA 4ZTRA 5G1XA 3EL7A 4MBLA 3VUHA 4G17A 1UKHA 1WVWA 2OIBA 3GC7A 1F5QA 3MVLA 3PJ1A 5CSXA 3FC1X 1YXUA 3BU3A 5AP7A 1Q5KA 4CKIA 3PY0A 4EWQA 5AAGA 2EVAA 4V0GB 1KOAA 5CVFA 2EB3A 2YAAA 2CKEA 3TL8A 4C62A 5IUGA 3G2FA 3DGKA 3TM0A 2ACXA 3VUGA 3LE6A 3V04A 4FVQA 5LJJA 2QOFA 3U87A 4QMUA 4DN5A 4WD5A 4EK6A 4EH6A 3QD2B 4QP6A 4GU6A 3D9VA 4O7YA 4IX6A 4ZK5A 3QXOA 4W8EA 5C8MA 2XNOA 3O50A 4AT3A 4EUUA 3O2MA 4NKSA 4LQMA 1MQ4A 3BKBA 3SW4A 2IG7A 4TN6A 5HHWA 4KB8A 5JRSA 5GIPE 2OWBA 3GQLA 5KZ0A 1I44A 4EOKA 3FI8A 2OH0E 3AC1A 1JKSA 3M2WA 4ERWA 4D4YA 1P4OA 4LG4A 4BHNA 5LQFA 3OCBA 4X2JA 3UZRA 4N6YA 4FL2A 2RG6A 3EFKA 2QHNA 4I6QA 3VBVA 4AU8A 3WF7A 2UZTA 3NMUF 3H3CA 3PZHA 3COIA 3D4QA 3G90X 1YXVA 4JR3A 3WZEA 3LQ5A 3BELA 5B2LA 4JL9A 1YXSA 2C6LA 4QNYA 4FKQA 3WILA 1OUKA 4FV2A 4AXCA 3VBWA 5JKGA 1Q41A 3DXQA 4PMTA 4RQKA 3ZO1A 2WFYA 3RPYA 3H4JA 4LGHA 5CAUA 2GDOA 4QYFA 1PW2A 5M06A 1YVJA 4QP2A 5A4LA 2XEYA 3PYYA 3RHXA 5EKOA 2CDZA 5ANOA 5I5ZA 3LJ1A 5LMBA 4I0RA 4BI2A 3L9LA 1CMKE 3Q9ZA 3QTRA 2BDFA 3UE4A 5BVNA 4HVSA 3F3UA 2Z8CA 4K0YA 5CXHA 3I5NA 3OTVA 3BE2A 3VS2A 4U44A 3OCGA 2WMUA 2YA9A 2XA4A 2PVYA 3FLSA 3ORMA 4OBOA 5FUTA 3PJCA 3VVHA 5KMMA 1H1RA 5F4NA 4AN9A 3SA0A 3PWYA 4LRKA 4ZMEA 4ZTMA 2BHEA 5D12A 2UW5A 4UYNA 1M2QA 4AGWA 5A4QA 4CG9A 1H08A 3SDJA 3VUMA 3TDWA 5IA4A 2JBPA 1KWPA 3I7BA 2O2UA 2YZLA 3GENA 3O5AA 5IDNA 3FZTA 2HY81 4D5KA 5TF9A 5TT7A 2AEGA 5ACKA 2W0JA 1M7QA 3QRIA 3W33A 4HGSA