3UDZA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase from a. thaliana in complex with adp and ip6.
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
434
structure length
379
Chain Sequence
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFDCISVEIKPKCGFLPTSRFIGKENILKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPIALPLDESLKIVKEYLIAATAKDCSIMISFQSTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Inositol pentakisphosphate 2-kinase
publication title Inositol phosphate-induced stabilization of inositol 1,3,4,5,6-pentakisphosphate 2-kinase and its role in substrate specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 122
structure length 379
sequence length 434
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3udzA01
3UDTA 3UDZA 2XANA 4AXEA 2XAOA 2XALA 4AXCA 4LV7A 3UDSA 2XAMA 4AQKA 4AXFA 2XARA 4AXDA
chains in the Genus database with same CATH superfamily
4ZSLA 3QCQA 1IG1A 4G3CA 3QALE 2W4OA 3O8PA 4FKPA 3UNJA 3VQUA 3UC4A 1QCFA 5C01A 4EQCA 5FXQA 4RWIA 2JFLA 3FLNC 3QKLA 4O86A 4U40A 3VF9A 2QU5A 3ZHPC 3NVKI 1URCA 3RPRA 4BCKA 4BICA 3MY0A 3NMUF 4X2JA 4ARKA 3SW7A 3A60A 3ZXZA 5C4LA 3ZUUA 3QAME 2G2FA 2BFYA 3NUUA 4N6ZA 3PY1A 4AA5A 2BKKA 2OWBA 4BVUA 4RRVA 5JZJA 4Y5QA 1HOWA 2F7EE 3MA3A 4I24A 4DEHA 4E6CA 4BN1A 4FG7A 4Y5HA 3LXLA 2R3KA 5CEPA 2VNYA 4H58A 4JIAA 2EWAA 3MVHA 4O27B 5JQ5A 5BV3A 5A4CA 4LV5A 2GS2A 3C50A 2OICA 4EH8A 3L9NA 1UU3A 1G8JA 2WQBA 3R7VA 4CRSA 1H1WA 2B4SB 5JKGA 3GU8A 5HG7A 3RK5A 3UDTA 4ZEGA 5K5XA 3FMLA 4RGJA 2ACXA 4MBLA 3AC1A 1XH9A 4F9WA 4RX5A 5L2TA 4BYJA 1P14A 2YITA 3VUKA 5HI2A 2VAGA 4ZLYA 4EHVA 4C38A 4IAKA 4MD8E 2HZIA 1NVQA 4CNHA 1XHAA 2P2HA 4HYSA 3RM7A 2WMTA 3NUPA 3KRJA 1KOBA 4FZAB 4PTEA 4X2FA 4FTRA 2YAKA 3DZOA 2PK9A 3RWPA 4QQTA 1G8KA 2G9XA 1ZYDA 2SRCA 3DZQA 3ZU7A 4UXLA 2BZKB 3F7WA 3MYGA 3T9IA 3A7GA 4CV9A 4DGNA 2PZIA 1PXJA 2OXDA 4Q2AA 5BYYA 5IQDA 1J7UA 1Z57A 4I5HA 1GZNA 4FSZA 1WCCA 4QQ5A 3F5XA 3U4UA 2QR7A 2W1FA 4JDIA 3NCGA 3V5LA 2PUIA 2C6OA 5LQFA 4TWNA 2JLDA 4R3PA 3PA4A 2WTDA 1HCLA 4IWDA 3EN4A 2HWPA 3ODZX 3U6HA 2XAOA 3EL7A 4JDKA 5KZ0A 5D9HA 4E5BA 1UVRA 2FA2A 2R9SA 3CJFA 3CQUA 5GIOE 2DYLA 4DH8A 3RK9A 1GY3A 5EKNA 3AKLA 3QCSA 4XOZA 4YTCA 4I3ZA 1BL6A 3PG3A 1DAYA 3G5DA 2W1IA 3FMNA 4FNXA 4ZTRA 3OROA 4ZZOA 5C27A 4RQKA 5CEIA 4PRJA 1Q61A 3QGWA 1YWRA 4XOYA 4ACDA 2XVDA 3DDQA 4APCA 3ORZA 2XIYA 1FMKA 2GHLA 2WMBA 3CBLA 3QTZA 5IA5A 5DWRA 3Q96A 2R0IA 2X4ZA 4LMUA 4U6RA 3W8QA 3HMNA 4CZUA 3AD5A 4J95A 2GU8A 3H9OA 4YNOA 1DI8A 3KMWA 1K3AA 3D5WA 4YSMA 1ZOGA 3LFAA 2VTRA 3COIA 3FY0A 3KMUA 3P1AA 3DQWA 1OPKA 1CTPE 1LPUA 2F49A 2B52A 3DKOA 3IW5A 3HUBA 3NNVA 3SG9A 4EWHA 5A4EA 3DK7A 3MPMA 3RZBA 3VW8A 5C4KA 4LRMA 4JR3A 3NGAA 4L46A 5AUYA 4L45A 1OITA 2VTSA 3BBTB 2IPXA 5EI8A 3AMBA 1LEWA 2R3LA 3BE9A 4RWJA 4Y73A 4QP4A 4P7EA 3R7IA 1BLXA 2CNUA 3FLWA 3C7QA 4FEUA 3DBEA 3FMHA 3DBFA 1KOAA 4FX3A 4YJOA 3VF8A 4IX4A 3QBNA 4KNBA 5HVYA 3KL8A 4I5PA 4S30A 3GC9A 4U81A 4XG8A 5IG1A 4CZTA 3MS9A 3D15A 1Q4LA 2C3LA 5ETCA 2RG6A 3PXKA 4AOTA 2XF0A 3FL5A 3V01A 2WMXA 4XEYA 4XNEA 4FUXA 4JRVA 4W8EA 4BDHA 4R77A 1OECA 1ZZ2A 2H34A 2RFDA 3VUMA 1Q41A 2C3KA 2CNQA 3KN5A 4DHIB 3OBGA 3I5NA 4FKWA 1LR4A 2E9UA 2W9FB 2WHBA 4C3FA 2O63A 1OKYA 2PSQA 2P0CA 2CKPA 2H6DA 4PTGA 4BCPA 1JWHA 4FSMA 4OW8A 4CEGA 2PZRA 3UQFA 3HL7A 3JPVA 4W4VA 1G8SA 1H24A 2QNJA 3BCEA 2OGVA 2IW8A 4ZJVA 2IW9A 3BQCA 3MPTA 5M07A 4QMTA 2Z2WA 5DR2A 4L67A 2XALA 5JK3A 4CQEA 2QKWB 4FSRA 4GJ2A 2F57A 2R3GA 4E5AX 4QTCA 4AFJA 4XG6A 5H2UA 5H9BA 1ZMUA 4GEOA 3E3BX 4MH7A 4LFIA 4IWQA 4O21A 3F3TA 5F9EA 2BKZA 3D0EA 5CF6A 5IUGA 4ACHA 4XLIA 3CTHA 3QZIA 5CVHA 1LP4A 3OHTA 5CSWA 2GNHA 3C4FA 4JAJA 4D9TA 2QU6A 4F09A 2R3JA 3MY5A 3M2WA 3B8RA 4I6BA 1BYGA 4QPAA 4UWYA 5KBRA 3LMHA 4BDDA 3FV8A 3DK3A 5G1XA 1OL6A 4E5WA 4EL9A 3H10A 4D5HA 4B0GA 2ZV9A 4L43A 5AUVA 1OKWA 5HNBA 5AAEA 3WARA 4EHEA 5A6OA 2BRMA 2DQ7X 3Q4TA 3HV3A 5EW9A 3MVMA 3KY2A 4BTMA 3U54A 4XYFA 5LVMA 2FSMX 2UZWE 4RWLA 3FYJX 4FV0A 4DCAA 3FPMA 1WFCA 3OWLA 1O6LA 3R30A 3KVWA 4UN0C 3GCPA 5IA4A 3FZPA 5LVPA 4AE6A 4AW1A 3GU5A 1TKIA 3F3WA 1OZ1A 3V5JA 1ZRZA 1APME 1ZARA 3HA6A 4F1TA 2NP8A 2IVVA 3K3JA 2I1MA 3KXGA 5CNNA 1O6KA 3AD4A 2WMSA 4RIYB 4CCUA 4F70A 1H1PA 3MTLA 4HGTA 5KMOA 3BZ3A 4F65A 2GS6A 5LMKA 4RFYA 3SGCA 4RIYA 1XR1A 3ERKA 4KKHA 2PZ5A 3WZDA 3ZYAA 1Y8GA 1KE8A 5KBQA 3NVMB 1SMHA 3K2LA 3PIXA 4KRCA 2WZJA 3CJGA 1L8TA 2RG5A 3BGZA 3QA8A 4DHJA 4HW7A 3PY3A 2I0VA 3D5XA 2BTRA 4YHTA 3BU3A 2PVHA 4WO5A 3BHUA 1XWSA 4FSTA 2OJ9A 4X6QC 1H01A 1K9AA 4JQ7A 1KSWA 2I0EA 3BX5A 3E5AA 3UIBA 5GINE 3FXZA 4O7YA 4ZMFA 2ONLC 5ACKA 5DRDA 2OSCA 1JKSA 3BBWA 3LCSA 4PUZA 4U0IA 1CM8A 4TYGA 4I1ZA 5AV3A 1W8CA 1QMZA 3QHRA 4P5QA 1SVEA 1ZXEA 2QONA 3FZTA 1WMKA 3DJ6A 2XMYA 3PLAE 3OCBA 4XJ0A 3JY9A 4A4OA 2Z8CA 3KXMA 3DK6A 3MY1A 1Q97A 4JBVA 4GUEA 4UXQA 3QXOA 2B55A 2G01A 4RVKA 2XIXA 4GFGA 3LCTA 5BX0A 4TYIA 3QUDA 1U54B 2YM4A 4J98A 4ZTNA 3DFAA 2WQOA 4HYHA 4AGDA 4F9CA 4YZCA 3SVVA 4WG4A 2XIKA 3IOKA 4FTQA 4RWKA 4UBAA 5HE0A 2X8EA 2VTQA 3R83A 3MI9A 2CNVA 2YM7A 3MB6A 4BTKA 2VX3A 3MW1A 3RPOA 5BUJA 2BUJA 3DKCA 2WIPA 1YXXA 3N51A 5CSXA 4FVPA 3W0MA 3WF5A 4CG8A 3IW8A 2CLQA 2Y4IC 3VULA 2H96A 1RJBA 3ZO4A 1M7NA 4CLIA 3QKMA 4NM3A 1WVYA 3CGFA 1XH4A 4QTAA 4WBOA 3GENA 5ACBC 1UWJA 1Y6BA 2V7AA 2PVRA 2X2MA 4FEWA 5JGAA 4IBMA 1EH4A 4TRLA 5EYMA 4A7CA 1JKKA 1AQ1A 4FL2A 1XBCA 4C3PA 4D2SA 4O0UA 1FINA 2C1AA 3EN9A 3PYYA 1H07A 5DEWA 2EUFB 3FSFA 4B9DA 5J9LA 1VZOA 3FHIA 5M55A 2VD5A 3MH0A 4DTAA 3E8DA 4BJJA 3DY7A 5HE1A 1IASA 2R3FA 2XJ1A 3FKLA 2QCSA 3NUSA 3OEZA 4N6YA 3NWWA 3E64A 4GRBA 4HZRA 3FQEA 3SV0A 2X7FA 4FKQA 4KIOA 4OTDA 5KMNA 2QC6A 5K4IA 3H30A 4C33A 4DITA 2J0IA 4WNOA 4F78A 4TWPA 3IG7A 3PXYA 5CYIA 3ZRLA 5AAGA 2W7XA 4EYJA 3TTIA 3GC0A 5EDRA 3V8WA 2B1PA 4U8ZA 5KHXA 5E8UA 3QTRA 5IU2A 4YZMA 3UG2A 4EK3A 2WEIA 2C3IB 4FIGA 3N4TA 4EC9A 3KF7A 5BVOA 4G3GA 4C59A 3IKAA 2YWVA 4DEAA 3N9XA 4BCIA 3ALNA 3PJ3A 3W0SA 4Y85A 3DJ7A 3U55A 4YURA 3EYHA 5HCZA 2XK6A 3KULA 5IQEA 3BYVA 4TYHA 5IQGA 2YACA 3B8QA 5ANKA 5F4NA 3FZ1A 4HVDA 3P4KA 1ZYJA 4ZJIA 4FKSA 2GNLA 2OZAB 3O7LB 1WZYA 4EBVA 4UWBA 1YKRA 3OWPA 4G9RA 3DGKA 5GJDA 3DLSA 4FKLA 2OO8X 2VTOA 4Y46A 4WRSA 2BFXA 3NUAA 4AGUA 4D1SA 3D83A 4U3ZA 4PP9A 4BB4A 5L2IA 3THBA 3LE6A 3NFFB 4PF4A 4JLCA 4L44A 4CFMA 4PP7A 3EQRA 3E7OA 5EW8A 3MV5A 4R7HA 3BHHA 1OIYA 3W2QA 2JIIA 4I5CA 2ZV8A 3HAMA 3TTJA 2GNJA 4PX6A 4KSQA 1B6CB 1OBDA 2HWOA 4AUAA 5IA3A 3JXWA 3PUPA 3G51A 5EDPA 5CI6A 3F61A 4HZSA 4CMTA 4IZ7A 2QOFA 4MVFA 4EORA 5IA1A 3V5PA 3IGGA 4BCGA 4V0GB 3WIGA 1UA2A 1ZZLA 2OBJA 3U6IA 4FYOA 5EHLA 4CKRA 2J0JA 4X2GA 3HKOA 1IAJA 3KIOC 5AV4A 2Y8OA 3DJ5A 2IWIA 4MF1A 3RCDA 3KK9A 4F1MA 3BL9A 3LFDA 2CCIA 4UV0A 5GNKA 3BYSA 1YDRE 3PJ1A 3QQUA 4FL1A 3P08A 4ZY6A 4DAWA 2P2IA 3RKBA 2QOKA 4QRCA 4LV7A 4FJVA 4I93A 4DT9A 1FVTA 5LVLA 4AXEA 4NTSA 5J7HA 3AC5A 4TWCA 1PYEA 3BWFA 3V51A 4AXDA 1CKJA 4ENYA 5CU6A 3VS0A 4MBIA 2YISA 3IONA 3UNZA 1H1QA 4E93A 2JDOA 4FNYA 2XJ0A 4HCTA 4WUNA 5EI6A 4TWOA 3HNGA 4WG3A 3SW4A 2V5QA 3EZRA 4FZDB 4AOJA 4EJNA 2UW6A 2B9IA 3HAVA 4IAYA 3V5QA 1NT2A 4EWQA 4YJTA 4GH2A 2LGCA 1W0XC 5ANDA 3CKWA 3AC8A 2JEDA 4JDJA 4GU6A 3BLQA 4MXAA 2JD5A 3IW6A 3BELA 4IB0A 3LAUA 5IQBA 3POOA 4G17A 3EFKA 4PMMA 3WZUA 4XUFA 1UNLA 4IAZA 4O0YA 4LL5A 3Q3BA 1PMVA 2OF2A 3R9NA 3L9PA 2XYNA 4PMTA 3G9LX 3EKNA 3UODA 3CTJA 4F63A 4MUQA 1U46A 5HHWA 4QMWA 5FTGA 4A9SA 3D7TA 4D1ZA 2Z7RA 3L8PA 4JNWA 4RVLA 3R8UA 2PUNA 3GC8A 1YDTE 2ZAZA 5DBXA 4EH7A 3IDCA 5HE2A 4S31A 1V1KA 3AC2A 3FJQE 3H4JA 3ORNA 4BCNA 5DFPA 3TV6A 4UY9A 3QA0A 4HOKA 3DAKA 4D4VA 4FV6A 3K5UA 4IC8A 3TZ8A 5DHJA 3COMA 3Q9WA 4IAAA 4X3JA 2HYYA 3DOGA 3F3VA 4K8AA 4UYNA 2ZDUA 5GJGA 4EONA 3C4ZA 1QPDA 2OH4A 2A1AB 3G9NA 2ERKA 3OTUA 3TKHA 3ANQA 3EHAA 4F6SA 5TO8A 2QO9A 3R9DA 2FO0A 3W2CA 4I0RA 2ITOA 2VUWA 3TUBA 3LFBA 3W33A 4PMPA 2R3OA 5FXRA 2G2IA 4BKJA 3HV6A 4RJ8A 1JSUA 4D4RA 2PUPA 2AC3A 3P7AA 3Q9XA 4Z3VA 3C5IA 2X7OA 2CCHA 2O8YA 4R78A 2W06A 5FP6A 4D4SA 3QQKA 2X6EA 3G6HA 3FLZA 4NU1A 5CU3A 4RJ5A 3GNIB 3GU4A 3BYOA 4OTHA 1PXPA 4TXCA 2HZNA 4ZP5A 4XMOA 3ZUVA 2BHEA 3IDBA 4FV7A 5DT3A 1T46A 2XP2A 3EH9A 5EQEA 4FICA 3ZM9A 3HV7A 3LXKA 3UPXA 5HCYA 2UVXA 4EUUA 4NSTA 2VX1A 3ZFYA 2XANA 2F2UA 2R3PA 2VTAA 3HV4A 3ZCLA 1G8AA 2C6EA 3MIYA 4R1YA 3W2RA 2UW5A 3O51A 3R1YA 4RQVA 2Z7QA 3OP5A 4GFOA 1PXMA 1A06A 2O3PA 5HIDA 3POZA 3JS2A 3RPSA 3ZFMA 2BRBA 3F7ZA 4FGBA 1MRVA 3VO3A 4BHNA 4EK4A 2RKUA 1NVRA 2WELA 1UKIA 2OJJA 4OTWA 4LYNA 5EYDA 5E8YA 4WHZA 3C13A 4DG0E 3FI3A 2IG7A 2X1NA 3OD6X 5D10A 2YDJA 4KINA 3SXRA 2X7GA 2ZMCA 4M69B 3HRCA 4J8MA 4MXOA 4DBXA 3E62A 3FAAA 1P2AA 2UW4A 4Y95A 2Q0NA 2OLCA 4RVTA 3ZZEA 4O7VA 3TKIA 4RC2A 2JKKA 3NNWA 3UOLA 2R3RA 2XRWA 1KE6A 3I7CA 4DTKA 1Q99A 1IRKA 3LXPA 1X8BA 1H1SA 1XQZA 3VJOA 2VO6A 3GQLA 2QOOA 4KBAA 4I0SA 4RJ3A 3HVCA 3DAJA 3TM0A 4HVIA 5CT0A 1PKDA 4BI1A 5L6PA 2YCFA 3OVVA 1R39A 4RA4A 5JRSA 4II5A 1Q8UA 2DUVA 3KB7A 2IZRA 4D2RA 3GT8A 5J9ZA 4U44A 1JOWB 4M84A 3NW5A 4IADA 4W4XA 4TY1A 3ANRA 5EQPA 1YXSA 2NRYA 4QMOA 4EOKA 4QP9A 3CY3A 3LFNA 3QWKA 4ZZMA 3LHJA 3W10A 4I41A 4IH8A 2C3JA 2QHNA 3DKFA 5HG8A 2CGXA 1OGYA 1WBOA 3BV3A 4DBNA 4GYGA 3GP0A 4MBJA 4DFZE 2C69A 2XRUA 2C6LA 3G0EA 2E9NA 3CSVA 4Y72A 3FSKA 3A4OX 4IWOA 3FI2A 4BZDA 1M52A 2FSLX 3R9OA 2XKEA 4ZSGA 4EOPA 3P79A 1S9IA 1YI6A 3EQBA 2P55A 2QD9A 4KD1A 2C5NA 2QHMA 2WU7A 5ETAA 3FWQA 5HVKA 3JR1A 4FKRA 2W4JA 3MFTA 4NUSA 4O2PA 2EB2A 1NY3A 1M7QA 4NT4A 3O5AA 3C51A 3PZHA 3COHA 3BLHA 2QR8A 4N0SA 5CQUA 2PVMA 4JX3A 4I6QA 4O7LA 1KE7A 2WTJA 3TUCA 4AS0A 2YAAA 5FEEA 5LXMA 1ZMWA 4JT3A 4HVHA 3CC6A 3PTGA 4AP7A 3R02A 3GCQA 3FMKA 3TDVA 5AV2A 4M13A 5CANA 1M2PA 5HX6A 2ITNA 5HBJA 5DEYA 3QF9A 5HLWA 1SYKA 1ZAOA 2OIBA 4TYEA 4USEA 1YHVA 4MXCA 1FMOE 4YTIA 3V6SA 5F95A 4QYYA 5L6OA 3QRKA 2R0UA 5AP5A 3W0PA 1ZY4A 2JDRA 4MWIA 4OGRA 3RAWA 3D2KA 4PDSA 3QCXA 4AAYA 3QD4A 3BEAA 5AM7A 4AU8A 5KUPA 2YIQA 4DC2A 3DDPA 3ZZWA 4BIEA 5IDNA 4B8MA 5L8LA 2W1CA 5CEOA 3QL8A 3F2NA 4C4HA 3F82A 5TOZA 2XUUA 4FE2A 3VBYA 3GUBA 4ZTHA 3ZO2A 1FPUA 3GOPA 3MFSA 2AUHA 2WMWA 3OZ6A 5CQWA 5GJFA 2VU3A 5M4CA 1FBNA 3NRMA 4PL4A 5FM2A 3PJ2A 5HG9A 3VN9A 5D7VA 2CN5A 1FVRA 4RPVA 3UP7A 2FSTX 3OUKA 1CDKA 2UZUE 4ZXTA 2JAVA 4XLVA 1YWNA 4I0TA 5D7AA 2C0OA 4DEIA 2HW6A 3P7BA 1UNGA 2VNWA 2E2BA 4QMSA 4C4IA 3P0MA 3ZO1A 4YJPA 2OF4A 4AZFA 5J9YA 2Y9QA 3EQPA 4IHPA 3QZGA 4JVGA 4BDJA 4EC8A 4UWCA 2BIKB 1H27A 3KC3A 5E92A 5CEKA 4IB5A 1O6YA 2BAQA 1J7LA 4YZ9A 5IQFA 5CU0A 2CKQA 4J7BA 2ETKA 2VO0A 4V05A 4FC0A 4C0TA 3BYUA 4ZS0A 3EQCA 3OT3A 3GI3A 3PFQA 3MA6A 4YZDA 3F88A 3NCZA 4QNYA 3FDNA 2HW7A 3R7YA 4QEBA 3VW6A 2FVDA 5CSPA 5G6VA 2PVJA 4B4LA 1PKGA 4MK0A 2C6KA 3K54A 4FIJA 5DPVA 3RGFA 4AQKA 5J5SA 3GCUA 2BZIB 2RFEA 3M1SA 1REKA 4QMPA 2WMVA 5EM8A 1OI9A 2CPKE 2WTIA 3PG1A 4GIIA 3E93A 4XHKB 5E90A 4X3FC 2XCKA 4O22A 4AA0A 3NUYA 2CDZA 4X2KA 3ORPA 4RBLA 3CKXA 4LMNA 3VUDA 3FE3A 2CGVA 4L3PA 4OTGA 3SOCA 5CZHA 2YM5A 2YABA 4OBOA 3U9CA 5JGDA 2OW3A 4YJRA 3EQHA 2ITPA 5CTPA 4L53A 4DLJA 4QOXA 3C4WA 4DEGA 4GKHA 4QQJA 5HICA 3C5UA 4QYHA 5CVFA 3TXOA 3JUHA 1ZWSA 3PZEA 3EZVA 1XMLA 4C4FA 4LUDA 5DNRA 5A3XA 4G2FA 4IIRA 4M0ZA 2JDTA 3D14A 3KRRA 3TNQB 4CD0A 1YRPA 2PU8A 3SXSA 2BDJA 3QU0A 4G31A 5CASA 5HO8A 3I81A 4G16A 4OTIA 4FKUA 2JIVA 3UYSA 4BTFA 3TN8A 2XJ2A 3VUGA 4D0XA 5KMLA 3UGCA 2QOIA 2ZB1A 4FI1A 4O6LA 5JN2A 3NUXA 2YHVA 1PYXA 2R3HA 4F7JA 2QO2A 3QLGA 4YUQA 5CF4A 3Q6UA 2JKQA 2OIDA 3Q2MA 4QDEA 4H1JA 4M8TA 4JG6A 3DNEA 1JLUE 4OTRA 2WFYA 3SAYA 4N4SA 4ASZA 5IH6A 2OK1A 3O96A 3CQEA 5J8IA 2CHLA 5J87A 5M09A 5TR6A 3W0QA 3EYGA 4C3RA 5DR9A 4M97A 3VBWA 5E7RA 2BDFA 2UZOA 3E92A 5DVRA 2XK4A 4TZRA 2WMRA 3QTUA 2CMWA 3P86A 4IW0A 3ZOSA 4HCVA 2XH5A 2GHGA 3W8LA 5CEMA 3TV4A 4L7SA 4QNAA 2OFUA 4G34A 2CN8A 2QOBA 4FV1A 4I6LA 1GOLA 5M57A 2NYAA 3AKJA 1Q8WA 2EU9A 3ODYX 5EOLA 4I22A 2W99B 2YIRA 3GFEA 4WG5A 3DXNA 5HU9A 4CSVA 4W4YA 2HOGA 4I20A 2R4BA 2UZDA 4D0WA 3ZFXA 3NAYA 4RX7A 4AXAA 3I1AA 3Q5ZA 4ITJA 5ANIA 3E87A 2PE2A 4YTFA 2V22A 3UTOA 4PDPA 3VBVA 4AT5A 3MH3A 5KKRC 3RCJA 2XZSA 1JBPE 1R0EA 1SNUA 1YWVA 3EIDA 1RQQA 3DCVA 4FK3A 2W1EA 4M7IA 2BIYA 4LM5A 4TL0A 4I23A 4O96A 5HE3A 5IPJA 3GFWA 2RFNA 3LLTA 4MXXA 3TZ7A 3R7OA 1A9UA 4HVGA 5E8WA 3WZKA 3ELJA 5B7VA 3PUFC 2I0HA 2J9MA 4OBPA 3UP2A 3LOKA 5BVEA 4FTKA 5JSMA 2BMCA 4YBJA 4RSSA 5I9ZA 4GFMA 4AT3A 3ITZA 5HBHA 1WBTA 4D5KA 4R5YA 3VS5A 4TKSA 3E3PA 4LV8A 1G3NA 1H1RA 4JMQA 4FV4A 4CFNA 2PVNA 1ST4A 3CR0A 3LMIA 3QRIA 2GNGA 2Q83A 2X39A 3AG9A 3O23A 3OWJA 4QYGA 5KX8A 3HMPA 3UMXA 4ZY4A 1FOTA 1FQ1B 2XK7A 4GV1A 3PXQA 3GEQA 4FG8A 4G1WA 4UEUA 4ACMA 4Q9ZA 5KMMA 3EQIA 4NJ3A 4C35A 1CMKE 4QMXA 2QLQA 1NXKA 4F0GA 4GK4A 4I6HA 4WNPA 2X9EA 4O38A 4MTAA 5CLPA 5M56A 3WILA 3QC4A 3R8LA 4F9BA 3ORLA 4Y83A 3L9MA 4ORKA 3UZPA 3V6RA 2FB8A 3COKA 4E4LA 3BV2A 3FMJA 5AUTA 2VRXA 2KULA 3LLAA 4JXFA 5E9EA 1JSTA 3TG1A 4DLIA 2XNPA 3QTIA 1UWHA 2WTKB 2W1ZA 2WTVA 4X0MA 4CKJA 4FIHA 3VS4A 3ZSGA 3LM0A 4DCEA 3A2CA 4ASDA 3RALA 1YVJA 1KUTA 4BGHA 4FIIA 3HRFA 3KA0A 3QZHA 4F7SA 5CXZA 3EN6A 3KKVA 4R6VA 3WE8A 5EK7A 4HGEA 4O2ZA 5FTOA 4FV5A 3K3IA 2WMQA 4BIDA 3UZTA 3KK8A 4BBFA 3GGFA 5I9WA 2GQGA 3NPCA 1SM2A 2A2AA 2EXMA 4A9TA 2HAKA 3R22A 4AN3A 4H39A 3EL8A 2C6DA 3UO6A 4DH1A 4JS8A 3CE3A 2ITYA 3R04A 1VLRA 1PXNA 4FTLA 3TNIA 2J2IB 4D1XA 4NJDA 3S2PA 4YPDA 1GIHA 2YA9A 2VTLA 4YC3A 2BRHA 4GU9A 3FXWA 1MP8A 2J51A 2UZEA 4I4FA 4FKTA 4LL0A 3UQCA 4ZS4A 3F2RA 4KB8A 2W9ZB 4KAOA 4RFZA 4U9AA 3LJ2A 5DR6A 4FTOA 2W5AA 4IANA 2ZV2A 4WOVA 5AIRA 1OPLA 4RIWB 3DB8A 2YZLA 3BLRA 2X2KA 2WMAA 3V3VA 5AA9A 2GTNA 4RIWA 4EOMA 4WNKA 3W0OA 3I6UA 4BCHA 5ANJA 1JNKA 4RMZA 5EW3A 3WF6A 2WU6A 3LM5A 4IB1A 3MJ2A 2ZM4A 1BMKA 1ERKA 4M0YA 5IA2A 3W32A 4FOBA 3RI1A 5H3QA 4FNWA 2XK8A 3WYXA 1ZLTA 4BCOA 3CY2A 3OT8A 3R8PA 4O7WA 4OBQA 5J1VA 2PMIA 4IFGA 4KS7A 4K0YA 4MD7E 3RWQA 4QMUA 2UW8A 4O7RA 4N57A 5DLSA 5IDPA 2C68A 2GQSA 2HZ0A 2REIA 3BYMA 5IUHA 2B0QA 4FZ6A 4EH5A 5IZFA 5FUTA 1YQJA 2JBOA 3LFEA 1DM2A 2VTHA 4K33A 3FKNA 5AX3A 5CAOA 3UOJA 2VTMA 5FBNC 3CD8A 2CLXA 3ZO3A 4B7TA 3IS5A 4KRDA 1WBNA 4ZTLA 2WMUA 2ITUA 4FODA 5HTCA 2GPHA 1VR2A 3DAEA 1Q5KA 5EH0A 5HEZA 2PY3A 4RG0A 3VS2A 3ZSIA 1VYWA 1A48A 2GMXA 4IVCA 2QQ7A 3AC4A 3R9RA 4EZ5A 2V62A 2RF9A 4JQ8A 3MVJA 3SDJA 4E4NA 3I60A 5T3QA 2C6IA 3MDYA 4RIXB 3LCOA 3A7JA 4DEBA 4BJJB 4FEQA 4AX8A 4QMNA 4O83A 3ATSA 2O0UA 3Q9ZA 4FV2A 4GVJA 2QG5A 4H36A 1KWPA 4RIXA 2Z7LA 4JQEA 4XS2A 2W4KA 4EOJA 4BYIA 4NKSA 2RGPA 3L8VA 4JRNA 2C5OA 3PXZA 3C9WA 4YC8A 5AUXA 4FT7A 5BVKA 3ATTA 1PHKA 3NZ0A 3C4CA 4CLJA 4A07A 3MGYA 4R5SA 4CT1A 4ZTSA 3PSDA 4F0FA 4S2ZA 3ZEWA 5KCVA 4DFNA 4BZNA 2WQEA 3VIDA 2W1GA 4IE9A 1MQ4A 2QKRA 2ITQA 4LOOA 2Q0BA 2ZYBA 4RA5A 4CVAA 3OUNB 4XV2A 2UZVA 4O7NA 5IH5A 4QDVA 3PXRA 4G6NA 1NVSA 4EHZA 4D9UA 5DI1A 3L8XA 3ZEPA 3R2YA 5CAUA 2PL0A 3LQ8A 2PZPA 3TNHA 4DGLC 3BKBA 5JH6A 4FVQA 1JPAA 4EZ7A 4CMUA 4FTJA 1VJYA 3IW7A 3KULB 3FQHA 4TYHB 2WTCA 3UOHA 5LVOA 2LAVA 2AEGA 3VS1A 4Z55A 2HELA 3F5GA 4X2NA 3DLZA 1GAGA 4LRJA 3F3UA 3BL7A 4HGSA 4EH9A 3LZBA 1QPJA 4CTBA 2PWLA 4JBQA 2XNOA 5D12A 2W1DA 5ETIA 4XH6A 3SXFA 4DDGA 2WQMA 4TTHB 1SZMA 2OXYA 4FTIA 4HPUE 2OU7A 2F7XE 2PYWA 2VWVA 2XBJA 3O71A 4QP8A 2HIWA 2Y0AA 4NM5A 3FZRA 5AV1A 5A54A 4BZOA 3ML1A 4PDYA 3ZRMA 4DG2E 2UV2A 2XYUA 4G5JA 5CSVA 2ITXA 4YU2A 3PJ8A 5L2SA 2IO6A 3SC1A 5FBOA 3VS6A 2HXLA 4FTCA 4CFVA 1DI9A 2X6DA 4EOLA 3GXLA 4DGOA 4B99A 2OJGA 1HCKA 1OIQA 4DEEA 3PE2A 4FUYA 3R71A 4LI5A 4WT6A 4NM0A 3NUNA 3PP0A 2B53A 2XEZA 3OFMA 4HNFA 3NIZA 4YLJA 3HV5A 3QKKA 5AUUA 4BGGA 2I7QA 5AP3A 2BVAA 2ZFYA 3DFCB 2UW9A 3NW7A 2F9GA 1SVHA 4C61A 3OOMA 2WOUA 4G9CA 4MEDA 5EQYA 2X81A 3CPBA 3W2PA 5EOBA 2V7OA 5D1JA 3QC9A 3MH2A 4NTTA 4FTMA 1J91A 1OL5A 2ITWA 1PXKA 1P4OA 3S3IA 4YO4A 4ITHA 5FDPA 1JVPP 3CXWA 3F9NA 4JBOA 4BCFA 2J4ZA 4Z9LA 5DT0A 5E8SA 3WE4A 3NYNA 3F5PA 1NW1A 3C0GA 2W96B 3HECA 4DFYA 2YJRA 2WTWA 4AW2A 3SQQA 2UUEA 3AOXA 1YHWA 3DBCA 2FUMA 3H3CA 3TEIA 3HLLA 3I7BA 1XKKA 4E8AA 3H0YA 5FDXA 2XKCA 3GC7A 2XS0A 3PVBA 3P7CA 4XBRA 2OFVA 4E20A 4EOOA 2YIYA 4ZLZA 2W1HA 4RZWA 3U4WA 4OT6A 3FZOA 4C2VA 3MPAA 5I4NA 3KU2A 3UNKA 3VUHA 4GSBA 5JEBA 1G5SA 3D7ZA 3IGOA 4YPSA 4XP3A 1F3MC 1TQMA 1W7HA 3W0NA 2XNBA 4H05A 2BZHB 5A14A 3QHWA 1WVWA 1URWA 3DV3A 3SX9A 4PV0A 3UVQA 2BPMA 1YXTA 2J0KA 1ZMVA 4B8LA 2WGJA 1Q8YA 2BHHA 1J7IA 4EOSA 2IZTA 2CKOA 4MQ2A 2WOTA 3VNTA 5A4QA 4IAFA 3MSSA 3A7FA 2BROA 3D7TB 2J7TA 2CGWA 3HP2A 5HZNA 3UIMA 4E1ZA 4O81A 4AA4A 4PL5A 5JFVA 3F66A 3AGMA 4DFLA 4UYAA 1GZOA 4M3QA 2KTYA 4IVAA 3DBDA 4QMMA 4GT4A 4DA5A 5HQ0A 3OXTA 3Q6WA 3RAHA 3O8UA 3OBJA 3FC2A 5AA8A 2WB8A 5FP5A 2UZLA 3Q60A 4XG9A 2CGUA 1V0PA 4AE9A 5I9XA 2W05A 1ATPE 2OJFE 4GT3A 4MKCA 3FPQA 3UVPA 3UE4A 5HLPA 3A62A 4BIBA 2P4IA 5KMJA 3QGYA 3WYYA 3Q52A 2WNTA 4FL3A 4XCUA 5E1SA 4FKIA 1YI3A 2YWPA 4MXYA 3VS3A 1PRYA 2X8IA 4W8DA 5JFSA 4AZEA 4AGCA 3S0OA 1JKLA 4XRJA 3MN3A 2GTMA 3KCKA 3QX4A 4FT0A 4GT5A 5LMKC 2ITTA 4FOCA 3TKUA 5B0XA 4JIKA 4QMZA 5BVNA 4NZWB 2NPQA 3TCPA 1VYZA 4KIPA 4KWPA 3N4UA 4A4LA 2HXQA 5JT2A 1ZOEA 2PVYA 4IZ5A 4N70A 1V0BA 1YI4A 3AGLA 3WIKA 3RJCA 3T3UA 4FYNA 4H1MA 4ITIA 1FGIA 3R1SA 4G6OA 5TT7A 4DN5A 2QURA 3PWYA 5LWMA 4DFUA 3O50A 4EK5A 3R1QA 3TYKA 2IVSA 1OPJA 3LFFA 4M14A 2GS7A 4BDGA 4FEXA 2ETMA 4MX9A 1I09A 4J1RA 4CFXA 2XCHA 3KQ7A 1CKIA 3ZMMA 4GYIA 5HD4A 3Q53A 5M4FA 1PY5A 1FGKA 3RVGA 1RW8A 4BDCA 4GG5A 4DH7A 3BU5A 2PHKA 3EQGA 1STCE 5AUWA 3ZLXA 2GNIA 2OXXA 3KREA 3PWDA 3VVHA 5KZIA 1TQIA 1YW2A 2YIWA 3I6WA 2Z7SA 4FTNA 1IA8A 3FYKX 4R7IA 4FKGA 3W55A 4BF2A 4BI0A 4R3CA 3UG1A 3UQGA 4HVSA 1AGWA 4I94A 4K9YA 4UALA 2X8DA 4DGMA 1H4LA 3CS9A 4YTHA 4V01A 4BDIA 4LOPA 4FR4A 3PFYA 3R8MA 4I92A 3VRZA 4AAAA 1Q8TA 5M4IA 3KXHA 4DFXE 2VX0A 3A4PA 3NDMA 2JAMA 4GVAA 3FBVA 3UOKA 4DEDA 2QOCA 1ZYSA 3R7EA 3SLSA 3FMEA 2XKFA 3UIXA 3UVRA 4C02A 5TKDA 1BI7A 3WF7A 4CTCA 2C47A 3ZUTA 5CEQA 4FA2A 4ASXA 3DBQA 1WAKA 5HU3A 3K5VA 4J97A 1W84A 3DPKA 2R3QA 3DU8A 4E4XA 4YO6A 3ROCA 1OL2A 1PXLA 2QI8A 4C37A 1FVVA 4JR7A 4F9AA 3RNIA 2C30A 3FKOA 1PMNA 1Z9XA 3PVUA 4L68A 3UO4A 3VJNA 5AWMA 4S34A 5EM5A 2QOHA 3SRVB 4HCUA 3FI4A 3V5TA 4D4YA 5AADA 4LOQA 3AT2A 2VGOA 4CMOA 5FEDA 3A61A 3QQHA 2G2HA 5AJQA 2YDIA 2GFCA 3BHYA 3ETAA 4XRLA 5AUZA 3SRVA 2VWWA 4ENXA 4H3BA 2J0LA 4GK2A 3QD0A 3TJCA 5E8VA 3OY1A 3V8SA 3D2IA 3NW6A 3HDMA 4PTCA 1YHSA 1PF8A 4I6FA 3RAKA 4IWPA 3QYZA 3B2WA 4EZ3A 2DS1A 3PRFA 3R7UA 1M2QA 1UKHA 2RIOA 1YXUA 3I0OA 3PPJA 3OXZA 3R0TA 4JBPA 4XG2A 3TIYA 5DE2A 3DB6A 3U8WA 4EQUA 3GVUA 4P4CA 4ID7A 5EDQA 1WBPA 4A9YA 2ZV7A 3BRBA 4TNBA 4BRXA 4EOIA 3HX4A 4AXCA 4J71A 5CWZA 3P5JC 3S95A 4F1OA 5IMXA 2IJMA 3PLSA 4IB3A 1QPCA 2R64A 4LUEA 3QQJA 5CAQA 4O91A 4EK8A 5H8BA 3RHXA 4EOQA 4JDHA 1PMEA 4D55A 2YCQA 4EI4A 3Q32A 4P90A 1P4FA 5F20A 3HDNA 3C0IA 3ACKA 4M67A 4PDOA 4RFMA 3NIEA 4JAIA 1OB3A 3MBLA 2XA4A 5K4JA 1IR3A 3KXNA 3T8OA 1MRYA 1PJKA 3E7VA 3A7HA 4MNEA 1Y91A 3TI1A 4DFBA 2VTNA 1H00A 2IW6A 2ZDTA 3ZTXA 1OKVA 4ANBA 4E6AA 2BTSA 1H8FA 4EH6A 4G3FA 5JMSA 2BRGA 2VV9A 2W5BA 3BEGA 4NFMA 4A9UA 3F69A 2BAJA 5I0BA 2CKEA 2YM8A 3EFWA 5JRQA 4C4EA 4BHZA 3NX8A 2JDVA 4OR5A 2YIXA 2I6LA 3ORXA 2FH9A 4IQ6A 2ONLA 2OKRA 2VTIA 3IQ7A 4FEVA 4IZAA 3GCSA 1S9JA 2QOLA 4E7WA 3G0FA 3LFQA 4Z16A 4FT3A 1XO2B 1W83A 4I5MA 2Z60A 4L01A 1OVEA 3T9TA 1MUOA 2PVKA 3NYVA 3P23A 1K2PA 3W2OA 2YN8A 4EQMA 4G3EA 4H3PA 4AWIA 4GUBA 3SHEA 4QP7A 4YHFA 3JY0A 2ZM3A 3RINA 2P3GX 4AQCA 3ZLSA 3P5KA 4ASEA 5IISA 5C9CA 3FY2A 4PWNA 4FGRA 2C6MA 3TL8A 3DXQA 5AP7A 5CT7A 5AP2A 4NK9A 2UVZA 1XBBA 2F2CB 4NKAA 4DF3A 4FZ7A 5H8GA 1H0VA 1WBWA 3QD3A 4AZSA 4FSWA 4WIHA 3BHTA 5C1QB 4IM0A 5KHWA 2Y4IB 4XP0A 1DAWA 4C36A 3TUDA 5CS6A 4EUTA 4QQCA 5LOHA 3LQ5A 4K11A 5BYLA 2C0TA 3ORMA 4O6EA 4U41A 3L1SA 4DINA 2H9VA 4BDAA 1F0QA 4KIQA 4FK6A 4V04A 5CU2A 3A8WA 3MESA 4FZFB 1YXVA 4WRGA 4EHGA 3PY0A 5CVGA 3VHKA 2PE1A 4KUJA 4CKIA 1RDQE 5BUEA 5LVNA 3NFGB 4C4JA 4M15A 5KNJA 4WBBB 5DOSA 3REPA 2XM8A 3LJ0A 4GL9A 4CG9A 2BR1A 4FTAA 2A4LA 3TT0A 4E26A 4QMVA 4BBMA 2CSNA 2XKDA 5LARA 2JFMA 3F6XA 4GMYA 5IQCA 1V0OA 3PE1A 3U9NA 4AN9A 3EJ1A 4QTDA 3P78A 1L3RE 3O7LD 4YZNA 2VWIA 3AT3A 4RX8A 4EKKA 1NA7A 1UV5A 4BDFA 5ITAA 3V04A 4IEBA 3A7IA 4IC7A 3FMDA 5D41A 2CJMA 3IK3A 5K9IA 3HYHA 2BRNA 3NSZA 4FMQA 4X21A 4D58A 4EKLA 1PXOA 4OTQA 3RM6A 3WBLA 4FTTA 3D9VA 4FT9A 2XAMA 3ID6C 3PRIA 2HK5A 3CPCA 4BDKA 2C5XA 5HORA 2JBPA 5BMSA 4BTJA 5HO7A 4FV3A 1JQHA 4DTBA 2PVLA 3QYWA 2R7BA 3W0RA 3ZM4A 2OZOA 3E88A 3CCNA 4L52A 4LGGA 2NRUA 5EHYA 4FVRA 5M53A 4DDIA 4J99A 3PJCA 1BI8A 1H28A 4H3QA 4DHZA 3RPVA 4ZOGA 1VEBA 2G15A 5FG8A 3RPYA 3ZS5A 2PUUA 5CNOA 3TV7A 4YLKA 3QXPA 4HNIA 5FGKA 2XARA 3LFSA 4QT1A 1W98A 5HNGA 2UZBA 4MD9E 5E8XA 2X4FA 4NCTC 4IDVA 4EH4A 4AOIA 1E9HA 3H0ZA 4IM2A 3BIZA 4L9IA 3W16A 4YHJA 3OW3A 4IACA 5L6WL 2J50A 5A4TA 1UU7A 5FLFA 4FV8A 2X2LA 3W1FA 2VN9A 1YOMA 4JG7A 3TZMA 5DA3A 3AMAA 4K77A 3BHVA 1J1BA 3ENMA 3LFCA 3D5VA 4HGLA 4ALUA 2GQRA 5CF8A 5CF5A 4RLLA 5AV0A 5HIBA 3RMFA 5M4UA 5IUIA 2C6TA 2VTPA 4KABA 4RZVA 3BGQA 3CEKA 3II5A 4KS8A 3AXWA 2E9VA 2GHMA 3CLYA 4DT8A 4ZMEA 4USDA 4YJQA 5CALA 5JFWA 5L8JA 5M08A 2J5EA 3HMIA 2YFXA 2UW3A 1U5RA 4DH3A 5FXSA 3PVWA 4ERKA 2EVAA 2PMLX 3MH1A 5F1ZA 2W5HA 4M68A 4KKEA 2WEVA 3E63A 2ZJWA 4PL3A 4XG4A 5I9VA 2VO7A 5CZIA 3ZH8A 5EYCA 4F08A 4B6LA 4P5ZA 4AZTA 3AKKA 4TYJA 4G6LA 2FYSA 5HD7A 5M06A 1TQPA 5IF1A 2JKOA 3MB7A 4YMJA 4CV8A 4L8MA 3VUIA 3OMVA 5IEVA 3I0QA 3HUCA 3R6XA 4PY1A 4ACGA 3ZDUA 3ROYA 1Q3WA 4AT4A 2UW7A 4U43A 5ICPA 3Q4ZA 3C0HA 3CQWA 4NIFB 5EHOA 5FRIA 3QLFA 3AD6A 4FNZA 3HGKA 4O84A 4KA3A 4Y8DA 1REJA 4IFCA 4F6WA 1H25A 1Y8YA 4C34A 1B39A 3GB2A 4EYMA 3VC4A 1J1CA 1H0WA 1MRUA 4BDBA 3DT1A 2HENA 1IEPA 5AIKA 1YOLA 5C8NA 3Q5IA 4O0VA 4R1VA 3TWJA 4AF3A 3HZTA 3H9RA 4LGHA 4U5JA 1P5EA 1OBGA 3D4QA 3FC1X 3PP1A 4QP3A 5T6KA 4YR8A 4WUAA 3OOGA 3PPKA 4R7BA 5B2KA 5KE0A 2YJSA 4CFWA 3PDTA 4GS6A 3EB0A 3TDWA 3UDSA 3R21A 4BBEA 3E8EA 4E4MA 4Z7HA 3QUEA 4UX9A 3DTWA 1KV1A 4GG7A 4GK3A 3GU6A 2OH0E 4JJRA 3UJGA 3VBXA 4BI2A 4L00A 4C62A 5M44A 2R7IA 3NR9A 1KE9A 4X6RA 3WZJA 3BPRA 3ULZA 2X0GA 1OUKA 4HYUA 2B54A 4OT5A 3KGAA 5AP1A 4F6UA 2A19B 3SOAA 5LMBA 4CGAA 2B7AA 3W2SA 3OS3A 1R3CA 2O2UA 4WA9A 3V8TA 5BMMA 2B9FA 5HG5A 2UVYA 5HIEA 2GCDA 5I5ZA 2YM3A 2XBAA 2XIZA 5A6NA 1UNHA 3QTSA 5JGBA 4QMLA 3Q2JA 3LIJA 3PSCA 5IEYA 3KCFA 4YJNA 5A46A 2ZVAA 3GQIA 4Q5HA 4DE4A 5K3YA 4IDTA 5HLNA 4ACCA 3UDZA 4PQNA 3KRLA 4AACA 2E9OA 5I9YA 4GIHA 2H8HA 2R3IA 1OMWA 2YDKA 4RC4A 3WOWA 5C8KA 3ET7A 4NL0A 3LJ1A 1ZYLA 3GU7A 1XH5A 3IW4A 3I4BA 2J90A 4YC6A 2C0IA 4XV1A 5ANOA 2P33A 2J5FA 3QX2A 4RT7A 5B2MA 3OTVA 3RTPA 3NEWA 1OUYA 4IAIA 5D11A 1JKTA 2O5KA 2ZB0A 3WZEA 1OM1A 5IH4A 2VZ6A 3EFJA 2IVTA 3R00A 4PNIA 4TT7A 5LCKA 4BDEA 4AXFA 4F99A 4F0IA 3G15A 3IPHA 4AG8A 2XK3A 1W82A 2A0CX 3QCYA 5FM3A 5IEXA 4FT5A 5DH3A 4BCJA 5LJJA 5DRBA 4XG3A 3KRXA 2ZMDA 1M2RA 4CRLA 3FLYA 3R01A 2QOQA 4F7NA 4RVMA 2A27A 2NNWB 4RJ4A 4RLKA 3JVRA 3NNUA 3F3ZA 5L8KA 3U6JA 3OY3A 2VGPA 4QMYA 1BX6A 4ZSEA 3F2AA 1KV2A 3NYXA 1BL7A 2GSFA 3CGOA 3DKGA 1DS5A 3R2BA 4O0WA 4HYIA 4CFUA 2HZ4A 1WBVA 2UZTA 5M51A 4U7ZA 2PPQA 2QG7A 2IN6A 2PMOX 3FMMA 5DIAA 4AZWA 5IQAA 4ZLOA 1U54A 5DGZA 1WBSA 4AN2A 1Y57A 2JKMA 1Z5MA 5AFVA 4AGWA 3ZXTA 5AP6A 2BCJA 4ERWA 3C4XA 3V5WA 4ALVA 2WXVA 3D94A 3MVLA 5AEPA 5C8MA 3BE2A 1XBAA 5CY3A 4YGAA 3VWAA 4EEVA 2HY0A 1ZOHA 4JG8A 1PW2A 2ESMA 3R28A 2VTTA 2R3NA 2R3MA 1UU9A 2HCKA 1GJOA 4IJ9A 4OUCA 2BILB 2VWBA 3MWUA 4O82A 4RJ6A 4IX5A 5HTBA 4BR3A 2XNMA 3QTXA 3IECA 4FSUA 5EFQA 4NFNA 2XB7A 5CXHA 2RL5A 4BCMA 4ANLA 4L6QA 4U80A 2I40A 3FEGA 3KN6A 4O7ZA 3OCGA 5FTQA 4DG3E 4JL9A 4LDTA 4MHAA 3ZONA 3ACJA 4I4EA 2J6MA 1J3HA 4GCJA 1Q24A 4C4GA 2Y7JA 4RX9A 1ZYCA 3VQHA 1IAHA 1XMMA 2OG8A 1H26A 1TFFA 4YJVA 5A9UA 2B9JA 4DGGA 4Q9SA 3ZDIA 3N4VA 3AQVA 3LXNA 2YEXA 5CI7A 3S4QA 5EM6A 4FIFA 4WSYA 3VS7A 2VWUA 3BI6A 3VBTA 5HVJA 4F9YA 1YOJA 3C4EA 4IJPA 2E9PA 1ND4A 2JGZA 3ZC6A 3RHKA 3W18A 3DS6A 4F7LA 4K1BA 3P9JA 3ZRKA 4JX7A 5LWNA 1ZY5A 3E8NA 4P2KA 4U79A 1OGUA 4U97A 5E8TA 4IZYA 4FV9A 3KMMA 4EH3A 3B2TA 2C4GA 1Q8ZA 2R5TA 2UZNA 2EB3A 1OIUA 3F5UA 3FXXA 2JITA 1M17A 3R63A 4IX6A 4O0TA 3AC3A 5CX9A 2WD1A 2YCRA 3NS9A 2W0JA 5EYKA 3BU6A 4K18A 2PULA 4TN6A 4DHFA 2AYPA 2YERA 4IM3A 2OI4X 2OZAA 3U87A 1BKXA 1XH8A 2WIHA 3ENHA 5E4HA 3KXZA 1WVXA 4CT2A 5AP0A 4QTEA 5JFXA 1IA9A 1SVGA 5JZNA 1M14A 4FKJA 4G5PA 4UZHA 3OG7A 4LRKA 3MFRA 5EI2A 1BUHA 3HMMA 3EMGA 4YBKA 4GKIA 3EWHA 5FQDC 4K2RA 3ORKA 3ZBXA 2WAJA 2NO3A 1U4DA 3C1XA 4MYGA 3L9LA 4ZK5A 4NH1A 4FIEA 3GOKA 4ANMA 4CCBA 5BPYA 3VAPA 4FSYA 4BY9E 3BWJA 3QRJA 3JVSA 4ZY5A 5IMEA 3Q04A 4F64A 4J52A 1PMUA 1GIIA 4YJSA 4QP2A 4AW5A 3M11A 5L2WA 4C58A 2DWBA 3QUPA 5K5NA 3TJDA 5BUIA 2ITZA 1T45A 5CAVA 4MWHA 4MAOA 3TZ9A 3LQ3A 4AZVA 4WD5A 4O0SA 4CXAA 3FLQA 4V0GA 1GIJA 3EN5A 3QQFA 4EK6A 4ZZNA 3RNYA 3HA8A 2AC5A 3QWJA 4QP6A 3A99A 3BQRA 1ST0A 4R3RA 4ZIMA 3FLSA 4KBCA 2B9HA 3Q9YA 3QD2B 5HCXA 5IQHA 2JIUA 4O7TA 5KMKA 1RE8A 4GJ3A 5JQ8A 1Q3DA 4NW6A 5HX8A 2JDSA 4ZSJA 4L3JA 1E1XA 1CSNA 2IZUA 2R2PA 3PVGA 3UZRA 2G1TA 3WF9A 1E1VA 4XX9A 3QRUA 3UBDA 4EH2A 3OXIA 2ERZE 5CSHA 3EOCA 2WKMA 2VWYA 3CP9A 4KBKA 4MQ1A 4X3FB 3IOPA 4FSQA 2PVFA 2XNEA 1GNGA 3IDPA 3GCVA 5LMAA 3UIUA 4X3FA 4IMYA 3DNDA 5B2LA 3R9HA 1XH7A 4USFA 4I21A 3R1NA 3FZSA 4ALWA 2FSOX 3OWKA 2PTKA 1B38A 3OF0A 4XV3A 4YZBA 5C26A 3G6GA 3LKMA 4YJUA 2Y6MA 3HEGA 5KO1A 1XH6A 4D28A 4IVDA 1OIRA 2BALA 3PA5A 3DTCA 4O7SA 3AMYA 3LCDA 3EQFA 2WTKC 4S32A 4AW0A 1AD5A 4S33A 4TW9A 2F7ZE 3IO7A 5FD2A 1QPEA 1OKZA 2V55A 3H9FA 3I79A 3KVXA 4HJOA 5IA0A 2OJIA 4M12A 4IX3A 4ONAA 3UYTA 2FGIA 4IVBA 1H08A 3VHEA 3TIZA 5EM7A 4J53A 5F94A 2XEYA 4J8NA 1O9UA 3JYAA 3OW4A 4MCVA 2PZYA 5GHVA 2WQNA 5I9UA 3BGPA 3GBZA 3QZFA 4NYEA 2BZJA 3EFLA 3KF4A 3LPBA 5DN3A 3QTWA 4XP2A 1PXIA 5AM6A 5LCJA 3UDBA 2GFSA 2V0DA 2PMNX 2Y4PA 4MXZA 5BYZA 2F4JA 4WNMA 1LUFA 4X7QA 5ETFA 3DQXA 3UO5A 3ALOA 3VONA 1GZKA 5E91A 3O0GA 3HMOA 4RJ7A 1OL7A 5CU4A 2JC6A 3PA3A 4A06A 2BAKA 4JOAA 5AMNA 3E8CA 2Z02A 5H8EA 3PSBA 4U45A 4XG7A 5HBEA 3OEFX 4FKOA 1R1WA 1U59A 3Q4UA 5GIPE 3MIAA 4QO9A 4E6DA 4FG9A 2I0YA 3FHRA 4G3DA 4L42A 3TNWA 4C2WA 2XM9A 4KKGA 5ANGA 3PXFA 5DT4A 5TF9A 4RIOA 1TVOA 2ETRA 5AX9A 3RP9A 4GW8A 5BQ0A 2BDWA 4RC3A 4NCTA 2GNFA 2VTJA 4O0XA 5E8ZA 5FEQA 4PMSA 3O2MA 4WKQA 1JSVA 4NM7A 4ZTQA 5HNIX 3FQSA 3L8SA 4K6ZA 1XJDA 3MTFA 2ITVA 3Q4CA 3ZBFA 1U5QA 3QFVA 4A9RA 2O64A 1I44A 2ZOQA 5EG3A 4L7FA 5KKRB 3UPZA 3PIYA 3R8ZA 5ANEA 3ZLWA 3FUPA 3QTQA 4CFFA 2WO6A 3CTQA 3QRTA 4QPSA 1JAMA 2C5VA 1GZ8A 3EQDA 3NLBA 2QO7A 3A8XA 3CIKA 2OIQA 1OL1A 2J0MB 3SG8A 2IZSA 3AT4A 2IVUA 3SD0A 4ZSAA 5BVDA 1LEZA 3NYOA 2XIRA 4QTBA 1F5QA 3R8VA 3OCTA 4BGQA 3KXXA 3NNXA 2YZAA 3SA0A 5J1WA 5HESA 4EBWA 3U51A 4QYEA 1Y6AA 3R73A 3OC1A 5C03A 5CENA 3KEXA 1Q62A 3EKKA 4DYMA 4YNEA 5BVWA 3UC3A 4OTFA 5HKMA 3M42A 3LCKA 4NW5A 2XNGA 4U3YA 1UU8A 4YLLA 4QMQA 1R78A 4E73A 1CKPA 3QQLA 3KFAA 4FTUA 3PIZA 4KSPA 3SKCA 2C1BA 2YM6A 5AP4A 5J95A 2C5YA 2X9FA 3EN7A 3LMGA 3LW0A 4LG4A 4NWMA 4BCQA 5HGIA 3MFUA 5EKOA 4TNDA 2WPAA 3WI6A 3HRBA 4JI9A 4ZAUA 5DYJA 4E6QA 4YSJA 2YCSA 3ZSHA 4QYFA 3ZLYA 4EJ7A 2O65A 2VWXA 4FBXA 3DXPA 2VWZA 4U42A 2XNNA 4O0RA 5IQIA 3TNPC 4TPTA 3VBQA 3LVPA 4J96A 4ZJJA 3TMOA 5BNJA 2QLUA 3O17A 5L3AA 3I5ZA 3WF8A 1SNXA 4HPTE 4ANQA 2VO3A 4C7TA 3FL4A 3G90X 5DG5A 3ORIA 1KE5A 2QODA 4PNKA 2PE0A 3PPZA 2RFSA 2UW0A 4MNFA 5KMIA 4W4WA 3HP5A 3O8TA 1MQBA 4OLIA 4ANSA 3BLAA 2Y6OA 3S1HA 3CD3A 1QL6A 3ZC5A 3NAXA 5E1EA 5T68A 4UB7A 3ULIA 1YDSE 5A4LA 2HY81 3G2FA 3DA6A 3QQGA 3G33A 4L3LA 3MJ1A 2QVSE 4FKVA 4MNEB 4XBUA 5BVFA 5AAFA 2ZM1A 2EXCX 4QP1A 1R0PA 2W17A 3RAIA 3ORTA 4A4XA 4BC6A 3D5UA 2XK9A 3KRWA 2GDOA 3T3VA 4Z7GA 4DH5A 3FI8A 4Q5EA 3RK7A 4AFEA 4F4PA 4APPA 4LQMA 4XV9A 3UMWA 4YP8A 5CAPA 4FSNA 3TACA 4ZTMA 4UZDA 3S00A 3OCSA 3VRYA
chains in the Genus database with same CATH topology
4ZSLA 3QCQA 1IG1A 4G3CA 3QALE 2W4OA 3O8PA 4FKPA 3UNJA 3VQUA 3UC4A 1QCFA 5C01A 4EQCA 5FXQA 4RWIA 2JFLA 3FLNC 3QKLA 4O86A 4U40A 3VF9A 2QU5A 3ZHPC 3NVKI 1URCA 3RPRA 4BCKA 4BICA 3MY0A 3NMUF 4X2JA 4ARKA 3SW7A 3A60A 3ZXZA 5C4LA 3ZUUA 3QAME 2G2FA 2BFYA 3NUUA 4N6ZA 3PY1A 4AA5A 2BKKA 2OWBA 4BVUA 4RRVA 5JZJA 4Y5QA 1HOWA 2F7EE 3MA3A 4I24A 4DEHA 4E6CA 4BN1A 4FG7A 4Y5HA 3LXLA 2R3KA 5CEPA 2VNYA 4H58A 4JIAA 2EWAA 3MVHA 4O27B 5JQ5A 5BV3A 5A4CA 4LV5A 2GS2A 3C50A 2OICA 4EH8A 3L9NA 1UU3A 1G8JA 2WQBA 3R7VA 4CRSA 1H1WA 2B4SB 5JKGA 3GU8A 5HG7A 3RK5A 3UDTA 4ZEGA 5K5XA 3FMLA 4RGJA 2ACXA 4MBLA 3AC1A 1XH9A 4F9WA 4RX5A 5L2TA 4BYJA 1P14A 2YITA 3VUKA 5HI2A 2VAGA 4ZLYA 4EHVA 4C38A 4IAKA 4MD8E 2HZIA 1NVQA 4CNHA 1XHAA 2P2HA 4HYSA 3RM7A 2WMTA 3NUPA 3KRJA 1KOBA 4FZAB 4PTEA 4X2FA 4FTRA 2YAKA 3DZOA 2PK9A 3RWPA 4QQTA 1G8KA 2G9XA 1ZYDA 2SRCA 3DZQA 3ZU7A 4UXLA 2BZKB 3F7WA 3MYGA 3T9IA 3A7GA 4CV9A 4DGNA 2PZIA 1PXJA 2OXDA 4Q2AA 5BYYA 5IQDA 1J7UA 1Z57A 4I5HA 1GZNA 4FSZA 1WCCA 4QQ5A 3F5XA 3U4UA 2QR7A 2W1FA 4JDIA 3NCGA 3V5LA 2PUIA 2C6OA 5LQFA 4TWNA 2JLDA 4R3PA 3PA4A 2WTDA 1HCLA 4IWDA 3EN4A 2HWPA 3ODZX 3U6HA 2XAOA 3EL7A 4JDKA 5KZ0A 5D9HA 4E5BA 1UVRA 2FA2A 2R9SA 3CJFA 3CQUA 5GIOE 2DYLA 4DH8A 3RK9A 1GY3A 5EKNA 3AKLA 3QCSA 4XOZA 4YTCA 4I3ZA 1BL6A 3PG3A 1DAYA 3G5DA 2W1IA 3FMNA 4FNXA 4ZTRA 3OROA 4ZZOA 5C27A 4RQKA 5CEIA 4PRJA 1Q61A 3QGWA 1YWRA 4XOYA 4ACDA 2XVDA 3DDQA 4APCA 3ORZA 2XIYA 1FMKA 2GHLA 2WMBA 3CBLA 3QTZA 5IA5A 5DWRA 3Q96A 2R0IA 2X4ZA 4LMUA 4U6RA 3W8QA 3HMNA 4CZUA 3AD5A 4J95A 2GU8A 3H9OA 4YNOA 1DI8A 3KMWA 1K3AA 3D5WA 4YSMA 1ZOGA 3LFAA 2VTRA 3COIA 3FY0A 3KMUA 3P1AA 3DQWA 1OPKA 1CTPE 1LPUA 2F49A 2B52A 3DKOA 3IW5A 3HUBA 3NNVA 3SG9A 4EWHA 5A4EA 3DK7A 3MPMA 3RZBA 3VW8A 5C4KA 4LRMA 4JR3A 3NGAA 4L46A 5AUYA 4L45A 1OITA 2VTSA 3BBTB 2IPXA 5EI8A 3AMBA 1LEWA 2R3LA 3BE9A 4RWJA 4Y73A 4QP4A 4P7EA 3R7IA 1BLXA 2CNUA 3FLWA 3C7QA 4FEUA 3DBEA 3FMHA 3DBFA 1KOAA 4FX3A 4YJOA 3VF8A 4IX4A 3QBNA 4KNBA 5HVYA 3KL8A 4I5PA 4S30A 3GC9A 4U81A 4XG8A 5IG1A 4CZTA 3MS9A 3D15A 1Q4LA 2C3LA 5ETCA 2RG6A 3PXKA 4AOTA 2XF0A 3FL5A 3V01A 2WMXA 4XEYA 4XNEA 4FUXA 4JRVA 4W8EA 4BDHA 4R77A 1OECA 1ZZ2A 2H34A 2RFDA 3VUMA 1Q41A 2C3KA 2CNQA 3KN5A 4DHIB 3OBGA 3I5NA 4FKWA 1LR4A 2E9UA 2W9FB 2WHBA 4C3FA 2O63A 1OKYA 2PSQA 2P0CA 2CKPA 2H6DA 4PTGA 4BCPA 1JWHA 4FSMA 4OW8A 4CEGA 2PZRA 3UQFA 3HL7A 3JPVA 4W4VA 1G8SA 1H24A 2QNJA 3BCEA 2OGVA 2IW8A 4ZJVA 2IW9A 3BQCA 3MPTA 5M07A 4QMTA 2Z2WA 5DR2A 4L67A 2XALA 5JK3A 4CQEA 2QKWB 4FSRA 4GJ2A 2F57A 2R3GA 4E5AX 4QTCA 4AFJA 4XG6A 5H2UA 5H9BA 1ZMUA 4GEOA 3E3BX 4MH7A 4LFIA 4IWQA 4O21A 3F3TA 5F9EA 2BKZA 3D0EA 5CF6A 5IUGA 4ACHA 4XLIA 3CTHA 3QZIA 5CVHA 1LP4A 3OHTA 5CSWA 2GNHA 3C4FA 4JAJA 4D9TA 2QU6A 4F09A 2R3JA 3MY5A 3M2WA 3B8RA 4I6BA 1BYGA 4QPAA 4UWYA 5KBRA 3LMHA 4BDDA 3FV8A 3DK3A 5G1XA 1OL6A 4E5WA 4EL9A 3H10A 4D5HA 4B0GA 2ZV9A 4L43A 5AUVA 1OKWA 5HNBA 5AAEA 3WARA 4EHEA 5A6OA 2BRMA 2DQ7X 3Q4TA 3HV3A 5EW9A 3MVMA 3KY2A 4BTMA 3U54A 4XYFA 5LVMA 2FSMX 2UZWE 4RWLA 3FYJX 4FV0A 4DCAA 3FPMA 1WFCA 3OWLA 1O6LA 3R30A 3KVWA 4UN0C 3GCPA 5IA4A 3FZPA 5LVPA 4AE6A 4AW1A 3GU5A 1TKIA 3F3WA 1OZ1A 3V5JA 1ZRZA 1APME 1ZARA 3HA6A 4F1TA 2NP8A 2IVVA 3K3JA 2I1MA 3KXGA 5CNNA 1O6KA 3AD4A 2WMSA 4RIYB 4CCUA 4F70A 1H1PA 3MTLA 4HGTA 5KMOA 3BZ3A 4F65A 2GS6A 5LMKA 4RFYA 3SGCA 4RIYA 1XR1A 3ERKA 4KKHA 2PZ5A 3WZDA 3ZYAA 1Y8GA 1KE8A 5KBQA 3NVMB 1SMHA 3K2LA 3PIXA 4KRCA 2WZJA 3CJGA 1L8TA 2RG5A 3BGZA 3QA8A 4DHJA 4HW7A 3PY3A 2I0VA 3D5XA 2BTRA 4YHTA 3BU3A 2PVHA 4WO5A 3BHUA 1XWSA 4FSTA 2OJ9A 4X6QC 1H01A 1K9AA 4JQ7A 1KSWA 2I0EA 3BX5A 3E5AA 3UIBA 5GINE 3FXZA 4O7YA 4ZMFA 2ONLC 5ACKA 5DRDA 2OSCA 1JKSA 3BBWA 3LCSA 4PUZA 4U0IA 1CM8A 4TYGA 4I1ZA 5AV3A 1W8CA 1QMZA 3QHRA 4P5QA 1SVEA 1ZXEA 2QONA 3FZTA 1WMKA 3DJ6A 2XMYA 3PLAE 3OCBA 4XJ0A 3JY9A 4A4OA 2Z8CA 3KXMA 3DK6A 3MY1A 1Q97A 4JBVA 4GUEA 4UXQA 3QXOA 2B55A 2G01A 4RVKA 2XIXA 4GFGA 3LCTA 5BX0A 4TYIA 3QUDA 1U54B 2YM4A 4J98A 4ZTNA 3DFAA 2WQOA 4HYHA 4AGDA 4F9CA 4YZCA 3SVVA 4WG4A 2XIKA 3IOKA 4FTQA 4RWKA 4UBAA 5HE0A 2X8EA 2VTQA 3R83A 3MI9A 2CNVA 2YM7A 3MB6A 4BTKA 2VX3A 3MW1A 3RPOA 5BUJA 2BUJA 3DKCA 2WIPA 1YXXA 3N51A 5CSXA 4FVPA 3W0MA 3WF5A 4CG8A 3IW8A 2CLQA 2Y4IC 3VULA 2H96A 1RJBA 3ZO4A 1M7NA 4CLIA 3QKMA 4NM3A 1WVYA 3CGFA 1XH4A 4QTAA 4WBOA 3GENA 5ACBC 1UWJA 1Y6BA 2V7AA 2PVRA 2X2MA 4FEWA 5JGAA 4IBMA 1EH4A 4TRLA 5EYMA 4A7CA 1JKKA 1AQ1A 4FL2A 1XBCA 4C3PA 4D2SA 4O0UA 1FINA 2C1AA 3EN9A 3PYYA 1H07A 5DEWA 2EUFB 3FSFA 4B9DA 5J9LA 1VZOA 3FHIA 5M55A 2VD5A 3MH0A 4DTAA 3E8DA 4BJJA 3DY7A 5HE1A 1IASA 2R3FA 2XJ1A 3FKLA 2QCSA 3NUSA 3OEZA 4N6YA 3NWWA 3E64A 4GRBA 4HZRA 3FQEA 3SV0A 2X7FA 4FKQA 4KIOA 4OTDA 5KMNA 2QC6A 5K4IA 3H30A 4C33A 4DITA 2J0IA 4WNOA 4F78A 4TWPA 3IG7A 3PXYA 5CYIA 3ZRLA 5AAGA 2W7XA 4EYJA 3TTIA 3GC0A 5EDRA 3V8WA 2B1PA 4U8ZA 5KHXA 5E8UA 3QTRA 5IU2A 4YZMA 3UG2A 4EK3A 2WEIA 2C3IB 4FIGA 3N4TA 4EC9A 3KF7A 5BVOA 4G3GA 4C59A 3IKAA 2YWVA 4DEAA 3N9XA 4BCIA 3ALNA 3PJ3A 3W0SA 4Y85A 3DJ7A 3U55A 4YURA 3EYHA 5HCZA 2XK6A 3KULA 5IQEA 3BYVA 4TYHA 5IQGA 2YACA 3B8QA 5ANKA 5F4NA 3FZ1A 4HVDA 3P4KA 1ZYJA 4ZJIA 4FKSA 2GNLA 2OZAB 3O7LB 1WZYA 4EBVA 4UWBA 1YKRA 3OWPA 4G9RA 3DGKA 5GJDA 3DLSA 4FKLA 2OO8X 2VTOA 4Y46A 4WRSA 2BFXA 3NUAA 4AGUA 4D1SA 3D83A 4U3ZA 4PP9A 4BB4A 5L2IA 3THBA 3LE6A 3NFFB 4PF4A 4JLCA 4L44A 4CFMA 4PP7A 3EQRA 3E7OA 5EW8A 3MV5A 4R7HA 3BHHA 1OIYA 3W2QA 2JIIA 4I5CA 2ZV8A 3HAMA 3TTJA 2GNJA 4PX6A 4KSQA 1B6CB 1OBDA 2HWOA 4AUAA 5IA3A 3JXWA 3PUPA 3G51A 5EDPA 5CI6A 3F61A 4HZSA 4CMTA 4IZ7A 2QOFA 4MVFA 4EORA 5IA1A 3V5PA 3IGGA 4BCGA 4V0GB 3WIGA 1UA2A 1ZZLA 2OBJA 3U6IA 4FYOA 5EHLA 4CKRA 2J0JA 4X2GA 3HKOA 1IAJA 3KIOC 5AV4A 2Y8OA 3DJ5A 2IWIA 4MF1A 3RCDA 3KK9A 4F1MA 3BL9A 3LFDA 2CCIA 4UV0A 5GNKA 3BYSA 1YDRE 3PJ1A 3QQUA 4FL1A 3P08A 4ZY6A 4DAWA 2P2IA 3RKBA 2QOKA 4QRCA 4LV7A 4FJVA 4I93A 4DT9A 1FVTA 5LVLA 4AXEA 4NTSA 5J7HA 3AC5A 4TWCA 1PYEA 3BWFA 3V51A 4AXDA 1CKJA 4ENYA 5CU6A 3VS0A 4MBIA 2YISA 3IONA 3UNZA 1H1QA 4E93A 2JDOA 4FNYA 2XJ0A 4HCTA 4WUNA 5EI6A 4TWOA 3HNGA 4WG3A 3SW4A 2V5QA 3EZRA 4FZDB 4AOJA 4EJNA 2UW6A 2B9IA 3HAVA 4IAYA 3V5QA 1NT2A 4EWQA 4YJTA 4GH2A 2LGCA 1W0XC 5ANDA 3CKWA 3AC8A 2JEDA 4JDJA 4GU6A 3BLQA 4MXAA 2JD5A 3IW6A 3BELA 4IB0A 3LAUA 5IQBA 3POOA 4G17A 3EFKA 4PMMA 3WZUA 4XUFA 1UNLA 4IAZA 4O0YA 4LL5A 3Q3BA 1PMVA 2OF2A 3R9NA 3L9PA 2XYNA 4PMTA 3G9LX 3EKNA 3UODA 3CTJA 4F63A 4MUQA 1U46A 5HHWA 4QMWA 5FTGA 4A9SA 3D7TA 4D1ZA 2Z7RA 3L8PA 4JNWA 4RVLA 3R8UA 2PUNA 3GC8A 1YDTE 2ZAZA 5DBXA 4EH7A 3IDCA 5HE2A 4S31A 1V1KA 3AC2A 3FJQE 3H4JA 3ORNA 4BCNA 5DFPA 3TV6A 4UY9A 3QA0A 4HOKA 3DAKA 4D4VA 4FV6A 3K5UA 4IC8A 3TZ8A 5DHJA 3COMA 3Q9WA 4IAAA 4X3JA 2HYYA 3DOGA 3F3VA 4K8AA 4UYNA 2ZDUA 5GJGA 4EONA 3C4ZA 1QPDA 2OH4A 2A1AB 3G9NA 2ERKA 3OTUA 3TKHA 3ANQA 3EHAA 4F6SA 5TO8A 2QO9A 3R9DA 2FO0A 3W2CA 4I0RA 2ITOA 2VUWA 3TUBA 3LFBA 3W33A 4PMPA 2R3OA 5FXRA 2G2IA 4BKJA 3HV6A 4RJ8A 1JSUA 4D4RA 2PUPA 2AC3A 3P7AA 3Q9XA 4Z3VA 3C5IA 2X7OA 2CCHA 2O8YA 4R78A 2W06A 5FP6A 4D4SA 3QQKA 2X6EA 3G6HA 3FLZA 4NU1A 5CU3A 4RJ5A 3GNIB 3GU4A 3BYOA 4OTHA 1PXPA 4TXCA 2HZNA 4ZP5A 4XMOA 3ZUVA 2BHEA 3IDBA 4FV7A 5DT3A 1T46A 2XP2A 3EH9A 5EQEA 4FICA 3ZM9A 3HV7A 3LXKA 3UPXA 5HCYA 2UVXA 4EUUA 4NSTA 2VX1A 3ZFYA 2XANA 2F2UA 2R3PA 2VTAA 3HV4A 3ZCLA 1G8AA 2C6EA 3MIYA 4R1YA 3W2RA 2UW5A 3O51A 3R1YA 4RQVA 2Z7QA 3OP5A 4GFOA 1PXMA 1A06A 2O3PA 5HIDA 3POZA 3JS2A 3RPSA 3ZFMA 2BRBA 3F7ZA 4FGBA 1MRVA 3VO3A 4BHNA 4EK4A 2RKUA 1NVRA 2WELA 1UKIA 2OJJA 4OTWA 4LYNA 5EYDA 5E8YA 4WHZA 3C13A 4DG0E 3FI3A 2IG7A 2X1NA 3OD6X 5D10A 2YDJA 4KINA 3SXRA 2X7GA 2ZMCA 4M69B 3HRCA 4J8MA 4MXOA 4DBXA 3E62A 3FAAA 1P2AA 2UW4A 4Y95A 2Q0NA 2OLCA 4RVTA 3ZZEA 4O7VA 3TKIA 4RC2A 2JKKA 3NNWA 3UOLA 2R3RA 2XRWA 1KE6A 3I7CA 4DTKA 1Q99A 1IRKA 3LXPA 1X8BA 1H1SA 1XQZA 3VJOA 2VO6A 3GQLA 2QOOA 4KBAA 4I0SA 4RJ3A 3HVCA 3DAJA 3TM0A 4HVIA 5CT0A 1PKDA 4BI1A 5L6PA 2YCFA 3OVVA 1R39A 4RA4A 5JRSA 4II5A 1Q8UA 2DUVA 3KB7A 2IZRA 4D2RA 3GT8A 5J9ZA 4U44A 1JOWB 4M84A 3NW5A 4IADA 4W4XA 4TY1A 3ANRA 5EQPA 1YXSA 2NRYA 4QMOA 4EOKA 4QP9A 3CY3A 3LFNA 3QWKA 4ZZMA 3LHJA 3W10A 4I41A 4IH8A 2C3JA 2QHNA 3DKFA 5HG8A 2CGXA 1OGYA 1WBOA 3BV3A 4DBNA 4GYGA 3GP0A 4MBJA 4DFZE 2C69A 2XRUA 2C6LA 3G0EA 2E9NA 3CSVA 4Y72A 3FSKA 3A4OX 4IWOA 3FI2A 4BZDA 1M52A 2FSLX 3R9OA 2XKEA 4ZSGA 4EOPA 3P79A 1S9IA 1YI6A 3EQBA 2P55A 2QD9A 4KD1A 2C5NA 2QHMA 2WU7A 5ETAA 3FWQA 5HVKA 3JR1A 4FKRA 2W4JA 3MFTA 4NUSA 4O2PA 2EB2A 1NY3A 1M7QA 4NT4A 3O5AA 3C51A 3PZHA 3COHA 3BLHA 2QR8A 4N0SA 5CQUA 2PVMA 4JX3A 4I6QA 4O7LA 1KE7A 2WTJA 3TUCA 4AS0A 2YAAA 5FEEA 5LXMA 1ZMWA 4JT3A 4HVHA 3CC6A 3PTGA 4AP7A 3R02A 3GCQA 3FMKA 3TDVA 5AV2A 4M13A 5CANA 1M2PA 5HX6A 2ITNA 5HBJA 5DEYA 3QF9A 5HLWA 1SYKA 1ZAOA 2OIBA 4TYEA 4USEA 1YHVA 4MXCA 1FMOE 4YTIA 3V6SA 5F95A 4QYYA 5L6OA 3QRKA 2R0UA 5AP5A 3W0PA 1ZY4A 2JDRA 4MWIA 4OGRA 3RAWA 3D2KA 4PDSA 3QCXA 4AAYA 3QD4A 3BEAA 5AM7A 4AU8A 5KUPA 2YIQA 4DC2A 3DDPA 3ZZWA 4BIEA 5IDNA 4B8MA 5L8LA 2W1CA 5CEOA 3QL8A 3F2NA 4C4HA 3F82A 5TOZA 2XUUA 4FE2A 3VBYA 3GUBA 4ZTHA 3ZO2A 1FPUA 3GOPA 3MFSA 2AUHA 2WMWA 3OZ6A 5CQWA 5GJFA 2VU3A 5M4CA 1FBNA 3NRMA 4PL4A 5FM2A 3PJ2A 5HG9A 3VN9A 5D7VA 2CN5A 1FVRA 4RPVA 3UP7A 2FSTX 3OUKA 1CDKA 2UZUE 4ZXTA 2JAVA 4XLVA 1YWNA 4I0TA 5D7AA 2C0OA 4DEIA 2HW6A 3P7BA 1UNGA 2VNWA 2E2BA 4QMSA 4C4IA 3P0MA 3ZO1A 4YJPA 2OF4A 4AZFA 5J9YA 2Y9QA 3EQPA 4IHPA 3QZGA 4JVGA 4BDJA 4EC8A 4UWCA 2BIKB 1H27A 3KC3A 5E92A 5CEKA 4IB5A 1O6YA 2BAQA 1J7LA 4YZ9A 5IQFA 5CU0A 2CKQA 4J7BA 2ETKA 2VO0A 4V05A 4FC0A 4C0TA 3BYUA 4ZS0A 3EQCA 3OT3A 3GI3A 3PFQA 3MA6A 4YZDA 3F88A 3NCZA 4QNYA 3FDNA 2HW7A 3R7YA 4QEBA 3VW6A 2FVDA 5CSPA 5G6VA 2PVJA 4B4LA 1PKGA 4MK0A 2C6KA 3K54A 4FIJA 5DPVA 3RGFA 4AQKA 5J5SA 3GCUA 2BZIB 2RFEA 3M1SA 1REKA 4QMPA 2WMVA 5EM8A 1OI9A 2CPKE 2WTIA 3PG1A 4GIIA 3E93A 4XHKB 5E90A 4X3FC 2XCKA 4O22A 4AA0A 3NUYA 2CDZA 4X2KA 3ORPA 4RBLA 3CKXA 4LMNA 3VUDA 3FE3A 2CGVA 4L3PA 4OTGA 3SOCA 5CZHA 2YM5A 2YABA 4OBOA 3U9CA 5JGDA 2OW3A 4YJRA 3EQHA 2ITPA 5CTPA 4L53A 4DLJA 4QOXA 3C4WA 4DEGA 4GKHA 4QQJA 5HICA 3C5UA 4QYHA 5CVFA 3TXOA 3JUHA 1ZWSA 3PZEA 3EZVA 1XMLA 4C4FA 4LUDA 5DNRA 5A3XA 4G2FA 4IIRA 4M0ZA 2JDTA 3D14A 3KRRA 3TNQB 4CD0A 1YRPA 2PU8A 3SXSA 2BDJA 3QU0A 4G31A 5CASA 5HO8A 3I81A 4G16A 4OTIA 4FKUA 2JIVA 3UYSA 4BTFA 3TN8A 2XJ2A 3VUGA 4D0XA 5KMLA 3UGCA 2QOIA 2ZB1A 4FI1A 4O6LA 5JN2A 3NUXA 2YHVA 1PYXA 2R3HA 4F7JA 2QO2A 3QLGA 4YUQA 5CF4A 3Q6UA 2JKQA 2OIDA 3Q2MA 4QDEA 4H1JA 4M8TA 4JG6A 3DNEA 1JLUE 4OTRA 2WFYA 3SAYA 4N4SA 4ASZA 5IH6A 2OK1A 3O96A 3CQEA 5J8IA 2CHLA 5J87A 5M09A 5TR6A 3W0QA 3EYGA 4C3RA 5DR9A 4M97A 3VBWA 5E7RA 2BDFA 2UZOA 3E92A 5DVRA 2XK4A 4TZRA 2WMRA 3QTUA 2CMWA 3P86A 4IW0A 3ZOSA 4HCVA 2XH5A 2GHGA 3W8LA 5CEMA 3TV4A 4L7SA 4QNAA 2OFUA 4G34A 2CN8A 2QOBA 4FV1A 4I6LA 1GOLA 5M57A 2NYAA 3AKJA 1Q8WA 2EU9A 3ODYX 5EOLA 4I22A 2W99B 2YIRA 3GFEA 4WG5A 3DXNA 5HU9A 4CSVA 4W4YA 2HOGA 4I20A 2R4BA 2UZDA 4D0WA 3ZFXA 3NAYA 4RX7A 4AXAA 3I1AA 3Q5ZA 4ITJA 5ANIA 3E87A 2PE2A 4YTFA 2V22A 3UTOA 4PDPA 3VBVA 4AT5A 3MH3A 5KKRC 3RCJA 2XZSA 1JBPE 1R0EA 1SNUA 1YWVA 3EIDA 1RQQA 3DCVA 4FK3A 2W1EA 4M7IA 2BIYA 4LM5A 4TL0A 4I23A 4O96A 5HE3A 5IPJA 3GFWA 2RFNA 3LLTA 4MXXA 3TZ7A 3R7OA 1A9UA 4HVGA 5E8WA 3WZKA 3ELJA 5B7VA 3PUFC 2I0HA 2J9MA 4OBPA 3UP2A 3LOKA 5BVEA 4FTKA 5JSMA 2BMCA 4YBJA 4RSSA 5I9ZA 4GFMA 4AT3A 3ITZA 5HBHA 1WBTA 4D5KA 4R5YA 3VS5A 4TKSA 3E3PA 4LV8A 1G3NA 1H1RA 4JMQA 4FV4A 4CFNA 2PVNA 1ST4A 3CR0A 3LMIA 3QRIA 2GNGA 2Q83A 2X39A 3AG9A 3O23A 3OWJA 4QYGA 5KX8A 3HMPA 3UMXA 4ZY4A 1FOTA 1FQ1B 2XK7A 4GV1A 3PXQA 3GEQA 4FG8A 4G1WA 4UEUA 4ACMA 4Q9ZA 5KMMA 3EQIA 4NJ3A 4C35A 1CMKE 4QMXA 2QLQA 1NXKA 4F0GA 4GK4A 4I6HA 4WNPA 2X9EA 4O38A 4MTAA 5CLPA 5M56A 3WILA 3QC4A 3R8LA 4F9BA 3ORLA 4Y83A 3L9MA 4ORKA 3UZPA 3V6RA 2FB8A 3COKA 4E4LA 3BV2A 3FMJA 5AUTA 2VRXA 2KULA 3LLAA 4JXFA 5E9EA 1JSTA 3TG1A 4DLIA 2XNPA 3QTIA 1UWHA 2WTKB 2W1ZA 2WTVA 4X0MA 4CKJA 4FIHA 3VS4A 3ZSGA 3LM0A 4DCEA 3A2CA 4ASDA 3RALA 1YVJA 1KUTA 4BGHA 4FIIA 3HRFA 3KA0A 3QZHA 4F7SA 5CXZA 3EN6A 3KKVA 4R6VA 3WE8A 5EK7A 4HGEA 4O2ZA 5FTOA 4FV5A 3K3IA 2WMQA 4BIDA 3UZTA 3KK8A 4BBFA 3GGFA 5I9WA 2GQGA 3NPCA 1SM2A 2A2AA 2EXMA 4A9TA 2HAKA 3R22A 4AN3A 4H39A 3EL8A 2C6DA 3UO6A 4DH1A 4JS8A 3CE3A 2ITYA 3R04A 1VLRA 1PXNA 4FTLA 3TNIA 2J2IB 4D1XA 4NJDA 3S2PA 4YPDA 1GIHA 2YA9A 2VTLA 4YC3A 2BRHA 4GU9A 3FXWA 1MP8A 2J51A 2UZEA 4I4FA 4FKTA 4LL0A 3UQCA 4ZS4A 3F2RA 4KB8A 2W9ZB 4KAOA 4RFZA 4U9AA 3LJ2A 5DR6A 4FTOA 2W5AA 4IANA 2ZV2A 4WOVA 5AIRA 1OPLA 4RIWB 3DB8A 2YZLA 3BLRA 2X2KA 2WMAA 3V3VA 5AA9A 2GTNA 4RIWA 4EOMA 4WNKA 3W0OA 3I6UA 4BCHA 5ANJA 1JNKA 4RMZA 5EW3A 3WF6A 2WU6A 3LM5A 4IB1A 3MJ2A 2ZM4A 1BMKA 1ERKA 4M0YA 5IA2A 3W32A 4FOBA 3RI1A 5H3QA 4FNWA 2XK8A 3WYXA 1ZLTA 4BCOA 3CY2A 3OT8A 3R8PA 4O7WA 4OBQA 5J1VA 2PMIA 4IFGA 4KS7A 4K0YA 4MD7E 3RWQA 4QMUA 2UW8A 4O7RA 4N57A 5DLSA 5IDPA 2C68A 2GQSA 2HZ0A 2REIA 3BYMA 5IUHA 2B0QA 4FZ6A 4EH5A 5IZFA 5FUTA 1YQJA 2JBOA 3LFEA 1DM2A 2VTHA 4K33A 3FKNA 5AX3A 5CAOA 3UOJA 2VTMA 5FBNC 3CD8A 2CLXA 3ZO3A 4B7TA 3IS5A 4KRDA 1WBNA 4ZTLA 2WMUA 2ITUA 4FODA 5HTCA 2GPHA 1VR2A 3DAEA 1Q5KA 5EH0A 5HEZA 2PY3A 4RG0A 3VS2A 3ZSIA 1VYWA 1A48A 2GMXA 4IVCA 2QQ7A 3AC4A 3R9RA 4EZ5A 2V62A 2RF9A 4JQ8A 3MVJA 3SDJA 4E4NA 3I60A 5T3QA 2C6IA 3MDYA 4RIXB 3LCOA 3A7JA 4DEBA 4BJJB 4FEQA 4AX8A 4QMNA 4O83A 3ATSA 2O0UA 3Q9ZA 4FV2A 4GVJA 2QG5A 4H36A 1KWPA 4RIXA 2Z7LA 4JQEA 4XS2A 2W4KA 4EOJA 4BYIA 4NKSA 2RGPA 3L8VA 4JRNA 2C5OA 3PXZA 3C9WA 4YC8A 5AUXA 4FT7A 5BVKA 3ATTA 1PHKA 3NZ0A 3C4CA 4CLJA 4A07A 3MGYA 4R5SA 4CT1A 4ZTSA 3PSDA 4F0FA 4S2ZA 3ZEWA 5KCVA 4DFNA 4BZNA 2WQEA 3VIDA 2W1GA 4IE9A 1MQ4A 2QKRA 2ITQA 4LOOA 2Q0BA 2ZYBA 4RA5A 4CVAA 3OUNB 4XV2A 2UZVA 4O7NA 5IH5A 4QDVA 3PXRA 4G6NA 1NVSA 4EHZA 4D9UA 5DI1A 3L8XA 3ZEPA 3R2YA 5CAUA 2PL0A 3LQ8A 2PZPA 3TNHA 4DGLC 3BKBA 5JH6A 4FVQA 1JPAA 4EZ7A 4CMUA 4FTJA 1VJYA