2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
1YHSA 1K9AA 3HMPA 4XG2A 4O91A 5EIWA 4RTQA 3FV8A 3R9HA 3EQFA 3TI1A 4IWQA 4RVMA 2BHHA 4HVHA 4XH6A 3QU0A 3GQIA 3WE8A 4BDFA 4BICA 3Q04A 5KUPA 3ZLWA 1NW1A 4OT6A 3PSBA 3OFKA 4XBUA 3S2PA 2OXTA 2OXDA 1QPJA 4J99A 4Z16A 1NBHA 4V0RA 3KPYA 3M70A 3PSDA 4X6QC 3D4QA 4USFA 3OCSA 3Q96A 3EVBA 3HCEA 5BVOA 2ITTA 5M57A 3FC1X 1IEPA 4FIHA 3ULIA 5KMOA 1QMZA 3MDYA 4QTEA 5BYLA 3PA3A 3DMGA 1Q24A 1L9KA 2Y4PA 3FUPA 3W2SA 2OG8A 4QYEA 2JD5A 2PULA 4YO4A 2HOGA 4GOMD 2GNLA 2XNGA 4QP4A 3ENHA 4AGDA 3DY7A 1PF8A 4H3PA 1YXVA 5KQSA 1VYWA 1EJ6A 3RTPA 2WA1A 3I53A 4MTAA 1UU3A 4C06A 3SV0A 4OTFA 3UO5A 3S1HA 4YTHA 3KN6A 1PXMA 5ICFA 3EL8A 2ZZKA 3GRRA 3M4XA 4KB8A 4Q5EA 4YLKA 3HNGA 5I0BA 3EFJA 2AN3A 3LVPA 3OEZA 2Y9QA 2W4KA 2UW9A 4TWNA 3SW4A 4LWOA 3OXTA 2GB4A 3QL8A 1BL7A 2C1BA 3A7DA 2ZW9A 4HOKA 3SXJA 5EKOA 5BUEA 3F82A 4I24A 4X60A 2PVRA 2XKFA 3C4ZA 1ZYJA 2NXCA 5HNIX 1PYEA 3P4KA 1J7LA 3BHVA 3HZTA 3ZFYA 4BGGA 4X61A 3KU2A 2ERZE 4CT2A 3OE5A 4C59A 5M4CA 3DGKA 3AXTA 3R71A 3LBYA 1QCFA 4DEIA 3VUIA 4GJ3A 2EWAA 1Z57A 2J7TA 2XKDA 4I5PA 3KXXA 4GVJA 4H1MA 2OO3A 4RVLA 4AF3A 4LL5A 2HYYA 3NWWA 3S00A 5KHWA 3HV5A 4X2NA 2PK9A 2P0CA 2H34A 1DL5A 2XEZA 3RP9A 3EHAA 1LPUA 2ZMDA 4IDTA 5AV3A 1U54A 4FNXA 4MCVA 3ZM4A 2GCDA 3KMUA 3M2WA 4EOPA 3HCDA 5C9CA 2ZZMA 1UNGA 4AGUA 4PP7A 5B2LA 1WBPA 2UVXA 1Q61A 3ZEWA 3MPTA 3IW7A 5A54A 2CKDA 2ZV8A 1UNHA 4UB7A 2ZWAA 1G38A 3LHJA 3FQHA 4FTIA 1PXPA 3F3TA 3VBTA 2YM8A 2C5OA 3OOGA 5E1OA 3PXKA 2YR0A 4RWJA 3SXRA 3PT9A 4UEUA 4WG4A 3DJ5A 4ZY5A 2XNMA 4GU6A 4P90A 2P3GX 2OF2A 2J4ZA 4F7LA 4ISCA 1UKIA 2QVSE 3LFAA 2B9IA 2G2HA 4FT2A 4L46A 3HTXA 4B4LA 2R6ZA 4TYHA 3PFGA 4K0YA 2QRVB 1ZG3A 2VU3A 2PYWA 5KE0A 4OTHA 1YF3A 3PRFA 2BM8A 1JKSA 4BCHA 3RHKA 3S4QA 4I0TA 1ERKA 3LQ8A 5A14A 5HIMA 2CCHA 4YV2A 3ANXA 3BCEA 1CKPA 2XM9A 3G2FA 3EYHA 4YC6A 4RA4A 2V62A 5HO8A 5AA8A 2YIQA 3R3HA 3BWBA 4E4XA 5DWQA 2IFTA 4RIOA 3UQFA 2VO7A 2XMYA 4E7WA 4C58A 4DEBA 3G9LX 4ZLZA 2XK8A 4EH9A 2QO2A 1I44A 2GNJA 4RTJA 3D5XA 4O7VA 4YV0A 3F3VA 4AWIA 3AGLA 4CEGA 3SLSA 4TYIA 4FSDA 2ONYA 2ZULA 3FUTA 2XVMA 4E33A 1KYZA 3B89A 3V04A 4PNKA 3RJCA 3OFJA 5FG8A 4I94A 3GXLA 4CTBA 3IW5A 5J9ZA 4L53A 2QYOA 3RGFA 2B2CA 3UJ8A 2PMNX 5BPYA 3O0GA 2QOLA 3DJ7A 4LFIA 3ELYA 2OW3A 4EYJA 3Q4UA 2P3LA 3FTEA 1XBBA 2G8NA 4QP3A 3QUDA 2RG6A 3IOKA 5IDNA 2ZM4A 1VP3A 2RL5A 3ZHPC 4L52A 1KE6A 1IA8A 4GT3A 3PE1A 3BX5A 3FI8A 3CXWA 1JSZA 4O27B 4JI9A 3QD2B 2YM5A 5GOZA 2YAKA 1V39A 2UW4A 1YOJA 3NYNA 3TQSA 3C4CA 5D12A 4HYIA 2OPBA 2YM3A 4CKBA 3QTZA 5I9VA 3UNJA 4POOA 5EYCA 3BGVA 3DXZA 4G3FA 4PINA 5IEXA 4I3ZA 5FRIA 2UYHA 4IM0A 4TNDA 3P0MA 3A7GA 3P86A 4BRXA 2CNUA 1JKLA 3F7ZA 4B8MA 3OWKA 5HEZA 4YUWA 2ZM1A 4QP7A 3P9JA 2V0DA 5LOHA 3UJ9A 4AOJA 3OP5A 5IH3A 5DT2A 1O9GA 3V97A 4E30A 5H8BA 3KULA 4FR0A 5I9ZA 5K9IA 4PMSA 4GKHA 5FWAA 5HG9A 3IHTA 1M17A 2PZPA 3BZ3A 4PP9A 4LG1A 1D2CA 3CVOA 4UWCA 2YZLA 4IEBA 4WT6A 4F84A 4I23A 3E8EA 3K2LA 3R24A 3PS9A 4U3YA 4X1OA 2WQOA 5JT2A 5JFWA 4H58A 2XH5A 4E6QA 4CLJA 4WNOA 3TTJA 4Y72A 2UZLA 4YMJA 4Q9ZA 3SW7A 3D7TA 5IG1A 2C3LA 2PWLA 4J52A 1HMYA 5DSTA 2OXYA 3VJOA 5LQKA 3SRVB 3KXMA 4NM7A 2FH9A 3FZTA 3ERCA 3F69A 2CLXA 3LQ5A 5DM4A 4C04A 3LXPA 3I9FA 2GPHA 3UJDA 3JPVA 3IDCA 3QQUA 4FSUA 3IO7A 4RZVA 3D2KA 3GRVA 1TKIA 5FD2A 2IW6A 5EYMA 4EBVA 1Q8TA 3TNIA 5KMLA 3V8TA 1J7IA 3KQMA 3VUDA 3UQGA 1PMNA 4L3JA 3VBQA 3LPBA 5A4LA 1Y8CA 4Y95A 2AUHA 5FHRA 5HIJA 4GH2A 1JLUE 3ET7A 3CGFA 4IWPA 5IQFA 3DS6A 4KRGA 2OH4A 4EQCA 3HEMA 3DA6A 4O7WA 4XRLA 3ELWA 4D28A 4YJTA 2OICA 5HVKA 3FMHA 4PWYA 4TPTA 3GCSA 3MPAA 4H3BA 3FYDA 4FSYA 2NP7A 5GM2A 2XNNA 5EW8A 4CTCA 3DTWA 4FX3A 3G8AA 4YTFA 4PMPA 4RTMA 4IB0A 5DYJA 5DR6A 4RZWA 3MCTA 2ZB1A 1YI6A 2PHKA 3MFTA 3UIXA 1NW3A 4ZJIA 2FA2A 3HNRA 2PY3A 2IVTA 3PG1A 1QAOA 5HD4A 4N57A 2OBJA 5HCXA 2BZHB 4UN0C 4W4XA 1AV6A 3OT8A 5DT3A 3KK9A 2I6LA 5D1NA 3M1SA 3VF9A 2ETKA 5AJQA 4FIEA 4X0MA 5JQ5A 3PA4A 2YM7A 4C37A 3UZUA 2WELA 3EKKA 8MHTA 2YQZA 4XV9A 3SVVA 2CGWA 2F7ZE 4AZVA 3LCDA 4ITHA 4JBQA 3QZGA 4PYMA 4P2KA 2V7OA 2RIOA 2QOOA 3T8OA 3BKXA 3KREA 5LQNA 3F3ZA 2BTSA 4FKPA 2E5WA 4G3EA 3SKCA 3RINA 5JGDA 3VHKA 3O4FA 4GW8A 3AMBA 3UJ7A 2UW3A 4MD7E 5J9LA 3V8VA 1Q8ZA 4EC9A 2HZNA 3DBCA 4CGAA 1UWJA 5HNBA 3I58A 4DKJA 4A7CA 2F8LA 4RJ7A 4ASDA 1R1WA 3KXNA 4FTTA 3FUUA 5LQCA 4M14A 5E8VA 3TCPA 5DTRA 4A9YA 4BI0A 3PJ8A 4GOLD 3JY9A 4KIOA 2AOVA 1JG3A 3O31A 4NK9A 4IWDA 4NKAA 4ZMFA 2QR8A 2ITZA 3IW8A 4F64A 3R02A 1Q0SA 4FODA 2XYNA 3PLAE 3F2AA 4R1VA 4GG7A 2XJ0A 3POZA 1HOWA 4PY1A 4FGZA 1L3BA 3V6RA 1VR2A 4E4LA 5LWNA 2A14A 4RX1A 3EN4A 3POOA 5KQRA 1V0OA 3G2MA 2QCSA 3DLZA 1GIIA 5LMAA 3FLQA 5CSPA 4I0RA 3LM5A 5H2UA 3GP0A 1SYKA 4E31A 1URWA 1OVEA 2HZ4A 3F61A 5AWMA 4C3RA 1RI3A 2C7PA 2FCAA 3DXPA 5IPJA 4O96A 4F1TA 2NXNA 3ORTA 3MGYA 3BT7A 4JJRA 4EQMA 2Q41A 2X8IA 2R3MA 2C0TA 3P1AA 4ZXTA 1VBFA 2YDIA 5DFPA 2WMXA 2PUIA 5D1JA 1H1WA 4OA5A 4HJOA 2XA4A 5AM7A 2B52A 2YTZA 5EM8A 4EEVA 2WD1A 5BMMA 2XYVA 2C7QA 4DG0E 2HXQA 4AUAA 2C6LA 4NSTA 4FEWA 1O6YA 1LEZA 2LD4A 4RTLA 4EZ3A 4KIFA 4C4IA 1MRVA 5T67A 3ZFMA 4ACGA 4E93A 2ZMCA 2FPOA 4XMOA 4FVRA 2PGXA 2GHLA 4U7TB 5IQGA 3D7ZA 4AUKA 5JZNA 4D2RA 5HLPA 1VIDA 2BZIB 4C35A 3P5KA 4LGHA 4O7SA 4O0VA 3D9VA 1SG9A 4DFYA 4AX8A 2PMOX 4MXCA 3FZSA 2YAAA 1WAKA 5E1EA 3SAYA 3FE3A 2EX4A 3A7HA 3EOCA 4QMTA 4U43A 4MXXA 3EGEA 2QU6A 2WTJA 3G51A 1FP2A 2CMHA 3L9LA 3FRHA 3CY3A 5T64A 2Z8CA 2BH2A 5ICEA 1V1KA 2VNWA 3AC3A 1OITA 5TR6A 3MY0A 1WVXA 4XHKB 5L3AA 3EQDA 3FMEA 3HDNA 4I0SA 2O5KA 3Q2MA 1P2AA 2VGPA 3VUGA 4FSQA 3IYLW 4ACDA 2AYPA 1UVRA 3BLHA 5DLSA 3KF4A 4E5BA 2XIXA 4A07A 3PJ3A 4D0XA 4M8TA 4M38A 5DR2A 1DUSA 2CKPA 2VWBA 4AU8A 2ZLBA 3FQSA 2JITA 4QMMA 4PF4A 5BUIA 4F0IA 1Q5KA 3JWIA 4CKEA 1XO2B 1JKKA 3QWJA 2QHMA 1M52A 4RVFA 2GAFA 5FCDA 1OECA 1H27A 4ER7A 5DT4A 3PLSA 3V8SA 2R0UA 4YBKA 5HOQA 5F9EA 4EBWA 5ICGA 4KW7A 2CDZA 2VTJA 5M44A 3V6SA 4M3QA 3ZC5A 1P14A 4X2KA 4NCTA 4BTMA 4K33A 3DB8A 3BBTB 4GKIA 2VS1A 4ZTSA 1APME 3T7TA 2HCKA 3EFWA 3MA3A 3QOWA 2YZAA 3EVDA 4BF2A 1OL1A 4W8EA 4EHZA 4BKJA 4X3FA 3E8SA 4RGJA 3C9WA 3GFEA 3OUNB 3DR5A 1JVPP 4D4YA 3KXHA 3UP2A 2BROA 3GJYA 4YJPA 4P4CA 3GI3A 2WGJA 2VTHA 5C27A 4CFMA 1NKVA 4RSRA 4GEOA 2W06A 3MQ2A 2XYRA 3TR6A 5I9YA 1PKGA 2ZV2A 4QMPA 3IONA 1WBSA 5EI8A 4XYFA 4YBJA 5C03A 4RTRA 5IMXA 2JFMA 3MTIA 4O38A 4CTJA 3HGKA 4FV4A 3ME5A 4KVZA 4FMQA 2GS9A 5FHQA 2QD9A 3VHEA 4YJVA 5DX0A 4FTNA 4I1ZA 4QYHA 3F2RA 3AXWA 4CMUA 1XH4A 1PMVA 4CFFA 4QDJA 4A9SA 4WIHA 4ZZMA 3QCXA 3EL7A 4QTCA 1SZMA 4RT7A 5HTBA 3TACA 4G3CA 3TM4A 4KSPA 2NXEA 5DRYA 3FLSA 3PP0A 1L3CA 4NM3A 2FGIA 3GRZA 4G3GA 3RPVA 2CSNA 3NLBA 4O2PA 4O6EA 3BXOA 3LQ3A 3TKUA 4DTKA 5CAPA 2QOQA 5L2SA 1M2PA 4N70A 2PUNA 1KSWA 3FMMA 1KE8A 3NAXA 4DHFA 3KU1A 5KYGA 4IV8A 1OBDA 1NBIA 3QFVA 3HEGA 4JX7A 4GU9A 2Z6QA 1YRPA 4BZDA 2PVMA 4FEXA 4Z9LA 3R8ZA 2PWPA 4BP1A 3UBTA 3QQLA 3V5LA 3EVZA 1XHAA 4C4GA 2YUIA 4L7VA 4OQEA 4JDHA 4M7IA 3A26A 5HFJA 2EXMA 2W9FB 3F66A 3TKAA 2O0UA 2ESMA 3OZRA 1ZGJA 1TW2A 3PY3A 1FPUA 3RM6A 2YIWA 4B0GA 4CFWA 2DYLA 5CAOA 3O2MA 1L8TA 4FZDB 4RVKA 5J95A 3GDHA 2YISA 4F0FA 4FZFB 1CSNA 3KQYA 2FUMA 3UG2A 4PNEA 1W84A 3UZTA 5E1SA 2OFVA 4Y83A 2QLQA 1O9UA 2HWPA 3ANQA 1L3IA 2VRXA 3EFKA 3R9DA 2O07A 5AUTA 1OKVA 2HR1A 1LR4A 4HTFB 2OZAB 4H3QA 3UE4A 5U4XA 1PJZA 1YVJA 1ZOGA 3V3VA 4FTUA 2R4BA 4FT5A 1KE5A 2FSMX 5C01A 3EQRA 2GTMA 3UOJA 1JBPE 4EJNA 5L8KA 5CZHA 1YXXA 3G6GA 4J96A 5CAQA 4NFNA 3R1QA 2WTKC 2NNWB 2C68A 5L8LA 2R3FA 1W0XC 2PXXA 4QQ5A 5BX0A 3NDIA 3BYMA 3FY2A 2VWVA 1SNXA 4PYLA 1JR4A 2XVAA 2IVUA 3PFHA 3CPBA 2GNHA 1RW8A 4F7NA 3PWYA 1P91A 4TYJA 1FJXA 3EYGA 3C4EA 4RVTA 3BYVA 1Z3CA 5K4JA 4YHTA 4F85A 4F6UA 4YUYA 4C4EA 2QO9A 2OSCA 3DCVA 2P41A 4GC9A 4UWYA 4F6WA 5K09A 1KWPA 5EHIA 2UZTA 2JHPA 1Q97A 5DBXA 2YACA 2GMXA 3HVCA 5KBRA 5FBOA 5E90A 3TZ9A 1Q8WA 1VP9A 3NNVA 1Q62A 2CKQA 5CVUA 4N4SA 3BWMA 3KRRA 4ERWA 4BHNA 4YUQA 1YI4A 3O8TA 4O7NA 4D1XA 5CS6A 2DULA 3TDWA 4AW5A 1M0EA 2BZJA 3U54A 4YJNA 5EW9A 3VBWA 3C50A 1ZLTA 2X2KA 4RVHA 2CL5A 5HILA 1KPIA 3QQFA 4IJPA 4E1ZA 2VN9A 4FICA 2WTWA 3PZHA 1VEBA 4RQVA 2AOUA 2X8EA 3L1SA 3EGVA 2X2MA 4U9AA 1H24A 3CTJA 5M09A 4AT4A 3GRUA 1OL6A 2BR3A 3KPVA 1YHWA 5EI6A 4ALUA 4ZZOA 1P4OA 4DZRA 5C0OE 4IV0A 1B42A 4YMHA 5DTQA 3GNIB 5CT7A 4RFYA 3D94A 4F86A 1G3NA 3U8WA 4RMZA 5BXYA 2XIZA 3JUHA 2OY0A 3ORXA 1NW7A 4E73A 1U5RA 4X2GA 3QTIA 3HDMA 2UZNA 4HZSA 4ZAUA 2OBFA 3O7LD 3HM2A 4GOOD 3ORKA 1A9UA 1NVSA 4IACA 2Z7RA 5EVJA 5AUVA 3N4VA 5IA3A 1OIQA 1UWVA 1AQ1A 2YWVA 4IBMA 3LXKA 1JWHA 3VN9A 5CF6A 5H8EA 2YN8A 3LJ1A 1H4LA 1M6EX 2YXDA 4RWIA 3ZBFA 3WZUA 5H02A 4YGAA 1IA9A 3ZCLA 3D2LA 3R9XB 4G9CA 4E6AA 10MHA 4NKSA 2V22A 3LM0A 4AW2A 5FQOA 2EB3A 1R74A 4QT1A 3R30A 3R7IA 3SDJA 3ZLYA 1W83A 4FKOA 3CQUA 5HNGA 2ZIFA 3CJTA 4C08A 1FOTA 5JFVA 3V5TA 2GNFA 2ITOA 4AOIA 5DHJA 2RFDA 3KKVA 4GMYA 3R6XA 2NP8A 4ZTBA 3BLQA 3DLSA 3KEXA 2CMGA 5GWXA 5AA9A 3KB7A 2A4LA 4L7FA 4YJOA 2YJRA 1BKXA 3FZ1A 3M42A 3FPHA 1H8FA 4DH5A 1UU9A 1YUBA 5IQHA 5HBEA 1JQ3A 4EKIA 1YB2A 4EQUA 2GS2A 3MA6A 4FIGA 3RMFA 4BDGA 3HA3A 4JLCA 3HYHA 3ZOSA 4ZSGA 3F88A 1Q99A 5E9EA 2P1DA 4FUXA 2HW6A 1PXNA 4Z7HA 5AV4A 4GS6A 2WO6A 4RTKA 4GCJA 2QOHA 4XX9A 3SXSA 4OW8A 3E3PA 1J1CA 5E8WA 3OCBA 3IOPA 5CT0A 3TV7A 3P8ZA 3FUWA 4OBQA 5E9WA 2JDOA 3ZRLA 2P4IA 4I5CA 1ZMWA 3MV5A 3MY5A 2QC6A 3EVFA 5EK7A 1U54B 4YMGA 2B25A 3V5PA 4IZAA 3U6HA 1FINA 3F5GA 4X7QA 3FXWA 1HNNA 5CD1A 4XCUA 2CGVA 3WYYA 1ZARA 4BYIA 4OLIA 2J50A 3KMMA 3IW6A 2X0GA 4S2ZA 5BW5A 4KDCA 2ZV7A 5LCKA 5DEWA 3WI6A 4FV3A 4ITJA 4TY1A 3QXPA 1XWSA 1RQQA 4BDDA 4IZ5A 4OX9Y 3LDGA 2QLUA 4DT9A 3H0YA 1WCCA 3EN7A 4WRSA 1G60A 1NVRA 1L3RE 2PT6A 5AFVA 4HNFA 2C6EA 1NW6A 1ND4A 4DG3E 3NWEA 1P1BA 5CTPA 2PLWA 2X7GA 4TYHB 5DG5A 4FV8A 3OG7A 4LYNA 3ZM9A 2VNYA 3PXRA 4FNZA 2PUUA 4V0GA 2YCFA 3R2YA 4XV1A 4JBVA 5CU2A 4YTCA 5H8GA 3AJDA 1O6KA 2UZEA 4AG8A 3TPZA 3QKKA 3HP7A 3U51A 3DK7A 2VWIA 3MJ2A 3VVHA 1G8SA 3MYGA 3B2WA 4KWCA 4EC8A 3LZBA 4AFEA 1F38A 3C51A 3BWYA 3PXFA 4G5PA 2WU6A 3ODZX 1WZNA 4AT5A 4JG7A 4I41A 3C4FA 2XBMA 5K4IA 4CG9A 5LMKC 1JSUA 2OB2A 1JNKA 3TZ8A 2VWYA 1SNUA 4U0IA 4YJQA 2YIYA 1JKTA 3CP9A 4I4EA 1RE8A 3EPPA 2W1HA 4PWNA 4GVAA 3E23A 3UJ6A 3PRIA 4FZAB 4FA2A 1F5QA 2NP6A 4ZTRA 4PX6A 3I5UA 3MFUA 5DRBA 4K6ZA 3OF0A 3QZFA 4KS7A 3UOLA 3HP2A 5M55A 4B7TA 1CDKA 4G6NA 4F65A 4EOKA 2FK8A 2C6TA 3TIYA 1WBVA 2CMWA 3UNZA 3OROA 3OTVA 3RWPA 1OL5A 5IMEA 5CM2Z 5HU9A 2AOTA 1CKJA 4HCTA 4MEDA 4DAWA 3NCZA 4AACA 1MUOA 1KV2A 3BRBA 2X81A 1XCLA 3U9CA 3UPXA 1XR1A 4CRSA 5A4EA 5JZJA 5EDRA 2B1PA 2ZBPA 4F4PA 1H26A 5FWDA 5JRQA 4EH8A 2C1AA 2B0QA 1U46A 2WIPA 4DTAA 5D41A 2VDVE 5AADA 4QPAA 3FLNC 5FA5A 3NMUF 4G9RA 4ATNA 2ITNA 2PT9A 3A27A 3FRIA 4NH1A 3EN5A 2W7XA 4PONA 4MWHA 5DLYA 2IBSA 3F3UA 5BYZA 3DXNA 3ZUVA 3I79A 4G34A 4O6LA 3OW4A 1VJYA 4RPVA 3QUEA 2JBPA 5DSXA 4BB4A 2UYCA 2PPQA 3QD0A 2C5XA 1UNLA 4BCNA 3GOPA 3C4WA 3OEFX 3IS5A 1NV8A 3B7PA 3EZVA 2P33A 2V5QA 2C30A 3KULB 3WE4A 3Q32A 1ORIA 1H1QA 4NZWB 1NXKA 5EM5A 5HESA 2BRHA 3SXFA 3JR1A 3AT3A 3PVGA 4QP6A 2PVNA 3LFBA 4IVCA 4OA8A 3L8DA 4O2ZA 3C0KA 2ZDUA 3EEYA 4KBKA 2UVYA 4GEKA 4E4NA 4IAKA 5C4KA 4D1SA 1Y6BA 5BVEA 3ALOA 4C2VA 4DN5A 2FSLX 3IGOA 3TKIA 4UOEA 1BYGA 3PJ2A 1FVVA 2W1DA 4A6EA 3D7TB 3P23A 3DH0A 3LMHA 3K3IA 3NGAA 5ETIA 5AX3A 4ANSA 2ZBRA 3Q9XA 3FYKX 3JVSA 2CGXA 4QQNA 4NJ3A 4G17A 4A9TA 4YSMA 3EB0A 4DLJA 4M97A 1M7NA 1R00A 2HENA 1WY7A 3LBFA 3G5TA 4ZJJA 2W4OA 3RM7A 3AY0A 2GQSA 1B39A 5E8RA 1GZOA 5K0BA 9MHTA 1GZNA 5A46A 3AC2A 5CALA 4DE4A 5DH3A 5AV0A 3UVPA 2X4ZA 3SM3A 5J9YA 1FP1D 3VS2A 4MTLA 5LVLA 3G8BA 3THSA 2WTCA 2UW6A 2W5AA 3ELDA 2WTDA 4LI5A 4ZP5A 2PVCA 5ACBC 2ZVJA 4YNOA 3GEQA 4YJRA 5A9UA 2VTOA 3E5AA 3GFWA 4P7GA 3S68A 4TWOA 3M6XA 2ZOQA 2GNIA 4XP0A 4RJ8A 3DZQA 3BHTA 4HGEA 3PXYA 4ENYA 3QC4A 3ZSHA 3SSMA 3FMDA 2P7HA 1JQHA 4KRCA 4J53A 2WZJA 4FP9A 4H0NA 3FY0A 4CZUA 3I6UA 5CIYA 3LCVB 3L9PA 4E2WA 1NV9A 4PCAA 3FJQE 1KR5A 3ZMMA 2OLCA 2WFYA 3ZEPA 3ZS5A 2ADMA 4AGWA 3ZLXA 3NTVA 3OS3A 2BKZA 5IQIA 1XBAA 2YM4A 1NW8A 3I0QA 2YDJA 5IF1A 2X6EA 4G2FA 1MJFA 3P9NA 3WZJA 4F1OA 3AT4A 4APPA 3G2PA 3JY0A 3GCZA 3G0EA 3ZUUA 4QMSA 4CG8A 2VTIA 1QL6A 3HVIA 3AC8A 2Z2WA 3QTWA 2YWPA 4QMVA 2VWXA 5FDXA 4FV6A 5EKNA 2ETMA 3NNWA 4EHGA 4S32A 3CJRA 2BVAA 5CF8A 3DLIA 2XVDA 4MXZA 4KRDA 3OU6A 4JVGA 2BAQA 5K8VA 5IKMA 4I21A 4HVSA 3HV3A 4Q5HA 2E9OA 4FL1A 4EH4A 2WQBA 5L8JA 2DS1A 4IIRA 3F5PA 3MCZA 3H9OA 2JJQA 1KOBA 2R5TA 2UW5A 3NVKI 4JXJA 2GQGA 1ZY5A 3R22A 4BCFA 5FTWA 2Q83A 2IGTA 4BCKA 4Y46A 3GXOA 5CU4A 4XS2A 3R1YA 2X2LA 4RLKA 4HCUA 4TWCA 4ZTHA 3R9OA 4IWNA 4RTOA 1INLA 1YOMA 3QRKA 4HG2A 2VX3A 4R8RA 3W32A 3QGWA 2WOUA 1H01A 2YJSA 3F9NA 3PX2A 3DMHA 3ORMA 1KP9A 1XH9A 1U5QA 2YA9A 3G7UA 4FT4A 3FMKA 5ETFA 3FI4A 2PMIA 5EG3A 4FE2A 5K05A 2QI8A 4FIJA 1PYXA 2R7BA 3KPWA 5DWRA 3ER8A 3H10A 1CTPE 4JNWA 1ATPE 4PYNA 4RWZA 3X0DA 5CQWA 2R7IA 3CC8A 1GNGA 2WKMA 3MS9A 4ZMEA 4R8SA 5B2MA 3OU7A 3IKAA 4QNAA 1FVTA 3CTHA 4O29A 1P39A 3EMBA 3LFQA 3DFAA 2C5YA 2ITVA 1REJA 3AMAA 4R5YA 3MH0A 4XRJA 3COHA 4WXHA 5KMJA 2F4JA 4FNYA 2WB8A 1QZZA 3R8PA 3CBGA 2GFSA 3FXXA 4DGNA 3V5QA 1IM8A 4DH1A 4PDPA 2P2HA 2QG5A 2EB2A 4XP2A 5IH6A 4LRJA 4DGGA 1EH4A 4FT9A 3R7EA 3E7VA 5ERGB 3BGQA 3VWAA 2Z60A 2HXLA 5I5ZA 4O7ZA 4UY9A 4J7BA 5C26A 5TO8A 4ZIMA 3VIDA 4BTJA 2WA2A 4HC4A 1IR3A 2C5VA 3R1NA 3P7CA 4HNIA 2BRNA 3CQEA 4WSYA 4YUZA 1QPEA 5DTMA 5K03A 4CMTA 4ER0A 3QRUA 4MXOA 3ZSIA 3LSTA 4D1ZA 3JWHA 3R21A 3GU8A 3THRA 5LMBA 2VWWA 4HTFA 5BNJA 3NYOA 3UIMA 1GZKA 2BAKA 2Y4IB 4FVQA 4MD9E 4OBOA 4G1WA 4P5QA 4QQKA 4O83A 1WVYA 4QMZA 4FL2A 3T9IA 4IAYA 4E8AA 2FB8A 3MSSA 3Q9ZA 4BI2A 1KPGA 3WF5A 3G89A 3KRLA 3DLCA 3V5JA 2REIA 2FYTA 2VTAA 1OPLA 2CKOA 4RFMA 2PVJA 4PCLA 1R3CA 3REOA 3RCDA 3VC1A 3EFLA 3CJGA 3UA4A 3SGCA 2G71A 1IAJA 1T45A 4U40A 4ZY6A 3P78A 2G1PA 2ITUA 3NIZA 4U44A 3TUBA 2VZ9A 2BKKA 3R04A 2Z6UA 3VS0A 5MHTA 3KPUA 3UWPA 3T7SA 2HZ0A 4FTKA 4CSVA 1YI3A 4IQ6A 3NYXA 2A1AB 3VQUA 4EK9A 3M6WA 3JVRA 4DQ0A 4R6XA 4WO5A 4Y73A 3FQEA 4YSJA 4KAOA 1PRYA 2WQNA 5HU3A 2W1GA 2ZTHA 3O7WA 4PUZA 4FIIA 3CJFA 3RPYA 5HZMA 1WG8A 4GV1A 3UJCA 3R63A 4JG6A 2PE2A 2C6IA 4IAFA 5DX8A 3LCTA 4XEYA 3FPFA 4DLIA 1M2RA 5HIKA 5A6OA 4X3FB 3WIGA 4A9UA 4EKKA 5L6OA 4PIPA 3K3JA 4K11A 1OR8A 3GU7A 2BMCA 2PXAA 5CX9A 3PPZA 2BFYA 2H6DA 3JYAA 3K54A 4B6LA 4ANQA 4AN2A 1JSTA 3W2OA 2BPMA 4YLJA 2UZ4A 1P5EA 5CF4A 2X9EA 3HV4A 2BDWA 3DP7A 4O84A 3ORHA 1H07A 2CKEA 1V0BA 2QKRA 1W8CA 4O0RA 4HGSA 3UYSA 2QR7A 2RFNA 1BX6A 3LIJA 1YKRA 3E3BX 4U80A 3TV4A 3UOHA 4PYJA 5LQRA 5B1SA 4GIHA 4AE9A 5ETAA 4HRAA 4FSXA 3JS2A 1GZ8A 4FSTA 3E7PA 3OOMA 1IXKA 2RG5A 2JDRA 3JXWA 1FBNA 4YZ9A 5IA1A 2BUJA 3F4KA 1CKIA 3MIYA 4F99A 2YABA 3R1SA 4F7SA 5EH0A 2BHEA 2Y7JA 2R3IA 3R7YA 3HP5A 1X1BA 3QYWA 5J87A 3ANRA 2GHMA 5AV2A 3CCNA 5JGBA 5FQDC 5EHOA 4O0YA 3BQRA 5FEQA 4TZRA 2IWIA 1UKHA 3ORZA 3AMYA 4FKUA 3EVCA 2C3JA 3HVKA 3OWLA 3RI1A 2B7AA 3TNQB 1R18A 5FUBA 1XDSA 5K3YA 4DEHA 4YTIA 4CV9A 3G33A 3HMOA 5D10A 3N9XA 2KULA 3ATTA 2P2IA 3KVWA 5KS2A 3QV2A 4YZMA 2XS0A 5M51A 2LAVA 3PY0A 3Q53A 2X1NA 2EJUA 3TG1A 4KIGA 2WMWA 2J0LA 1JG2A 1YHVA 3VBYA 1PMUA 4YZCA 1JTEA 1I09A 2OK1A 3DFCB 5CENA 2FVDA 4BVUA 4IB1A 5T6KA 3WZDA 2R3NA 4AZSA 4GG5A 4AW1A 4ACMA 3AOXA 3LCKA 3TJCA 1OL7A 3NCGA 5DGZA 4EZ5A 3UO6A 2UV2A 3NUSA 4EOMA 4PTEA 3UZPA 4M0ZA 5ANDA 2H96A 3BU6A 5K0CA 4TWPA 7MHTA 2FHPA 2N47A 2YCRA 2PWYA 3MIAA 1S9JA 3ERKA 3HAVA 1H00A 2JHAA 3OY1A 3LKDA 5JFXA 1ZOHA 1H1DA 5HO7A 4OBXA 3UMWA 1OKWA 2H9VA 2PE1A 4F0GA 3MB7A 3GC9A 2YX1A 1FVRA 1YFJA 5GINE 3K5VA 3GQLA 3MTLA 2IDJA 2IZUA 3R28A 3BEGA 4MBJA 3NUYA 3NPCA 1MRUA 3PVUA 5CU0A 3AG9A 3W16A 3ZTXA 3FZOA 4FIFA 3TLJA 3R0QA 4CFUA 5AIKA 3BIZA 3TXOA 4ID7A 4BDKA 3BWCA 5FADA 3SR4A 4EK3A 4KS8A 1XH6A 4W8DA 3DOGA 4EH7A 1OL2A 4G16A 3ZRMA 3EQPA 3BQCA 4TXCA 2JKQA 2XNPA 4CKCA 1H1RA 4R3CA 4DH3A 3NR9A 1GIJA 3NS9A 4DTBA 3O50A 5F94A 2O64A 4MAOA 3HRBA 2RFSA 2ETRA 3KN5A 5IQDA 2CHLA 2E9UA 5C1IA 3WYXA 1YZHA 4MVFA 3R8LA 3HCAA 4UZHA 5KZ0A 3PIYA 4FTAA 1RJBA 4F6SA 4KSQA 2PU8A 5E8YA 5IA2A 2J0MB 5CQUA 3DZOA 1A06A 3IEIA 5LQUA 3VBXA 3LFEA 3M6VA 4JRVA 2J5EA 5E8UA 2BR1A 1FPQA 4A4XA 4I20A 4RWLA 4DGMA 2C4GA 2ITXA 1N2XA 1HCLA 4F9BA 3W10A 3OMVA 4NW5A 2GS6A 3P9KA 1R78A 3KCFA 3PXQA 5L2IA 1HCKA 4U6RA 1T46A 4EMSA 5CCBA 3TMAA 3IDPA 3KQQA 2XCHA 2R0IA 4UZDA 5FP5A 1KV1A 1F3MC 4AN3A 1PXIA 2UVZA 3LMIA 5EMLA 2PX2A 4MKCA 4RJ6A 3EQBA 2AOUB 3ZZEA 2PVFA 2YIRA 3TUCA 3EVEA 4OTQA 4AS0A 2UYQA 4N0SA 1AD5A 5LMKA 3C3YA 4Q9SA 4RJ4A 4FEVA 3PB3A 4V04A 1H0VA 3A2CA 3AQVA 1OBGA 3OTUA 4JG8A 3RWQA 4ACCA 2PSSA 4YJSA 4YC3A 4E2ZA 2PX4A 3LGAA 1X8BA 3U81A 4UALA 2EXCX 4HPUE 3L8PA 2OIQA 3CY2A 3H9RA 3OHTA 4CVAA 4G56A 5CEMA 5AUXA 4QTDA 2VDWA 5EEGA 2ITQA 2C3IB 2W0JA 1Q41A 4WNKA 2IO6A 3FPQA 3QRTA 3E62A 4AW0A 1SM2A 5KMIA 1D2HA 4DITA 5HLWA 1WS6A 5HIIA 2C0IA 3QQKA 2VO6A 3DT1A 4BR3A 4U41A 2V7AA 5ICCA 5M56A 3V01A 3NIEA 4IFGA 4ALWA 5IA4A 5DXJA 2O2UA 4NTSA 3V8WA 1X1DA 3W2QA 4R05A 4R3RA 4DH8A 1FQ1B 1YDTE 4AZWA 4F7JA 3P9CA 4CFVA 1FGKA 4DEDA 4DT8A 3HX4A 4FI1A 1Y8GA 3H30A 2BFXA 5LWMA 3DOUA 4NM5A 3B5IA 4UYAA 4M13A 3QD3A 3BGPA 2VZ6A 3PIXA 3FWQA 4ZSEA 5HE0A 5EQEA 1M7QA 3H9FA 4ZSJA 5KBQA 4BZOA 3IPHA 4FTQA 5HIBA 4KABA 2XUUA 3NYVA 4AA0A 2G01A 4YURA 2EG5A 5AUWA 4R6WA 4BCJA 3ENMA 4ZLYA 1G6Q1 4G31A 1AQIA 4XOYA 3FSKA 2VWUA 4PTGA 4DCEA 3FTFA 4PL3A 4UXQA 5T68A 4Y2HA 3Q5ZA 3Q7EA 2JG3A 4U7ZA 3ZDIA 4FV5A 4NT4A 1YXTA 2C3KA 3MERA 4XG3A 5IH4A 4OTDA 4EOOA 4RIYB 3FZPA 5LQAA 4G6OA 3FXZA 3I7CA 1J1BA 5EMKA 3FI2A 3NX8A 2PZRA 3RAWA 4PL5A 4UYNA 5M53A 4IJ9A 3EMGA 3QC9A 5K5XA 3A4TA 2VX0A 3LDFA 5HHWA 5HVJA 3DDQA 5FUTA 3UJBA 3KMWA 3C6MA 3LKMA 4S33A 2UZDA 5IA5A 5E8ZA 4ASXA 4QMLA 5IUHA 4XLVA 3K0BA 5FTGA 2UZVA 2H00A 2W1FA 3WARA 5AP2A 4WBOA 5BUJA 2PZYA 3LCSA 4B8LA 3BHHA 4RA5A 4E20A 4M0YA 5DIAA 4V0QA 4QO9A 3PVCA 3E92A 3BYSA 3QZIA 4LGGA 1CM8A 4V0GB 3RALA 4S31A 4E2YA 2VAGA 4BN1A 4M12A 4B17A 3BV2A 3LE6A 3KVXA 3V5WA 3SSOA 4M84A 5AMNA 4R7BA 3UNKA 2X8DA 4UV0A 1XDZA 4K1BA 2UW7A 3BGIA 3I5NA 4FKVA 3SD0A 3WF9A 3OC1A 1F0QA 4LECA 2IZSA 2XM8A 3OVVA 3UZRA 2BM9A 3T0IA 2J0JA 5E2AA 1KYWA 4WHZA 3R01A 3TIZA 3MN3A 3FUXA 1NVQA 3UGCA 3GIWA 2CPKE 3QTUA 5AUZA 2WOTA 5KNJA 1MP8A 5K0FA 1WBTA 3VUHA 3UJGA 1ZGAA 3E05A 4EOJA 4BIEA 1IRKA 3NUAA 1NY3A 4PIMA 4LUDA 4DCGA 5AP6A 5FXQA 5CEKA 3HA6A 4MWIA 4BBFA 4ALVA 3CCFA 2VTQA 3DDPA 2PUPA 1EJ0A 5CVDA 5KCVA 1J7UA 3D5WA 1WXWA 4TNBA 1T43A 4I5MA 3IK3A 4AFJA 3G5LA 3TKHA 3ACKA 4K6MA 3VS3A 2AOTB 2AOWA 5LVOA 3ORPA 3A25A 4L3PA 4J8MA 2OF4A 2W96B 1XH5A 4X63A 3QGYA 5CANA 3TN8A 2CNQA 4ZTQA 2I6GA 4KNBA 2W5BA 1TQMA 3KXGA 2W5HA 2XK9A 1RI2A 3UPZA 4IX6A 3AT2A 1RI4A 2IPXA 2ZWVA 5I4NA 4QQTA 2WMBA 4JDJA 4S34A 3EWHA 4E6DA 4IB3A 3R2BA 5HG5A 1OKYA 2WTVA 3SA0A 5IQEA 4IDVA 3QQGA 4BDAA 1F3LA 4FK6A 2I9KA 3ZYAA 5IQBA 5G02A 2ZVAA 3T7RA 4ZSLA 3VC4A 3UQCA 3DXXA 4IANA 4JBOA 4KD1A 3VC2A 3DNEA 2UUEA 5H3QA 3DK3A 2OWBA 3HMNA 1STCE 3P9IA 1I9GA 1DI9A 3FSFA 4K18A 3FPJA 5DOSA 4C3PA 3NWBA 4YZBA 1CMKE 1R39A 4XLIA 3KRJA 3COIA 3NUUA 1I1NA 2XBJA 4E70A 5HORA 5CXHA 4WA9A 3W2PA 4KUJA 2XK6A 3AXSA 3MHTA 5JKGA 3W2CA 3DULA 2GS7A 2HK5A 3BGZA 2I0VA 2QODA 4QTAA 2WQEA 5AP0A 2B9HA 4IM2A 4XP3A 2C0OA 2UZOA 4RLLA 1TPYA 4IW0A 5JMSA 2GPYA 4QQJA 4BTFA 1SQGA 5E92A 4C4HA 4FC0A 1QPCA 3F7WA 4D4RA 3C5UA 2G15A 2ZSUA 4X3FC 4ERKA 2WIHA 4P5ZA 2P8JA 2EU9A 4D0WA 5FP6A 4AQCA 4FKIA 4ZTLA 4E5WA 4MD8E 5D1HA 5C8NA 3DQWA 3EZRA 1Q8YA 5DNRA 5M08A 4FR4A 2OYRA 5ANKA 4Q2AA 4EUTA 5CI6A 5E2BA 4FYOA 3CIKA 3CGGA 2XEYA 3FPMA 3WZKA 4G6LA 4XUFA 2WNTA 3PTGA 3KQ7A 1Y8YA 5F95A 1YXUA 3GCQA 1GIHA 3MVHA 3Q4CA 4DA5A 3HKOA 1FGIA 2JKKA 4MQ4A 2QQ7A 5BVDA 5CLPA 4TRLA 4AXAA 3OZTA 5LQFA 3BE2A 4LUEA 4YR8A 5E8TA 3VS1A 4ZLOA 3A61A 3LCCA 4BCMA 2V55A 2W9ZB 2OZVA 3SHEA 2I7CA 3VRYA 5CAUA 2EUFB 2B4SB 1RJDA 3FPEA 4E5AX 5AP7A 3ZLSA 3H2BA 5EI2A 1Y57A 4FTOA 4P7EA 4Y85A 3CC6A 3NVMB 3CS9A 2B55A 4APCA 5M5BA 5KO1A 5CSVA 4JDIA 3II5A 4AE6A 4KKHA 4HZRA 1WZYA 4ZS0A 3UP7A 1WBWA 3LFSA 3KK8A 2PKWA 4K8AA 4IFCA 4M36A 5E1DA 4MYGA 4MWZA 2XNOA 3UOKA 4BIBA 4XV2A 3QTQA 2J6MA 4R6VA 5E7RA 3MB5A 3BPRA 3TTIA 5LVNA 2H11A 3MVLA 3PZEA 5DA3A 1JOWB 4A4OA 4BC6A 2BIYA 3KQPA 1ZYSA 3HMIA 2AS0A 3GO4A 1XH7A 2YIXA 4MIKA 4PDOA 2PJDA 3E8CA 1UU8A 5EKXA 4CFXA 4IH8A 5A4TA 2C47A 5EG5A 5E4HA 5HTCA 4ENXA 2UZUE 3F3WA 4QTBA 2WMAA 4PMTA 4GK2A 3LLTA 1ZAOA 4HVGA 5JSMA 3NUPA 5ANOA 2CLQA 3LFFA 2VX1A 2YEXA 3DTNA 3L8SA 4QP1A 5AP4A 3A4PA 5CXZA 4H1JA 4FZ7A 2CNVA 2Z7QA 4XV3A 2QKWB 1XKKA 4O22A 4FGRA 5CSWA 3M33A 5TF9A 4IB5A 5DM2A 2V74B 4FVPA 1WBOA 4A4LA 2ZCJA 5GNKA 2NRUA 2J5FA 2ZYBA 4O7TA 4USEA 3THBA 4BCIA 1BLXA 4R7HA 4WNPA 3JWJA 4WG5A 3NSZA 3FTDA 3W33A 3TM5A 4EOLA 3ZBXA 1IY9A 4V01A 5EMMA 3H4JA 4BDJA 4EHEA 2R3RA 2IH2A 4BCQA 4C03A 2AZTA 5DEYA 4EK6A 4M15A 2CJMA 2IN6A 4O7YA 3PIZA 3UA3A 3RPOA 1AF7A 2HY0A 4RWKA 3AC4A 2Y0AA 1PMEA 2VTMA 5BVNA 5E9QA 5HIEA 1KE9A 3ID6C 4O0TA 4RIWA 5EM7A 3RVGA 4IVBA 4DH7A 5GIPE 5DRTA 5HE2A 2W1EA 4WRGA 4FV0A 4C38A 2UZWE 5HZNA 2FYSA 2QU5A 1KHHA 1YWRA 3IW4A 3EKNA 3Q6WA 4TYEA 2DUVA 3FDNA 5AIRA 1N7JA 4OUCA 1QAMA 4RC3A 3P2EA 3KQTA 4K2RA 2OKRA 1M2QA 4NWMA 5JR3A 1OZ1A 1BL6A 5C8KA 2R2PA 1R6AA 2JDSA 4FSMA 4V05A 2Y6MA 3ER9A 3DAEA 4GUBA 3KR1A 1L1EA 2C6OA 4O0XA 2XIRA 2JKOA 5C1QB 4RSSA 2VTTA 4X2FA 3GENA 3VW8A 4DGOA 4CWAA 5EEHA 5CNNA 3BGDA 2I0EA 5HX6A 3UJAA 3CKWA 1SVUA 2CN8A 3GCVA 2Z7SA 5D9HA 2G9XA 3W18A 5BMSA 3SOCA 3EVGA 2X9FA 3QYZA 1MHTA 2OIBA 3P79A 3VS4A 2PVHA 4CQEA 3T9TA 3P2KA 4AT3A 5F4NA 2VD5A 5GM1A 5F20A 4HYSA 4AGCA 4F1MA 4RV9A 4G5JA 2R3PA 3PDTA 1PKDA 1XVAA 4DFUA 4EZ7A 3RPSA 4RFZA 4HH4A 5M4FA 2WEIA 2XIKA 2YERA 3QALE 4EVIA 4XG9A 3OE4A 4DEGA 4FKGA 2QURA 3CGOA 1E9HA 2FRXA 4EOIA 1Q8UA 1H08A 4O0WA 1DM2A 4GIIA 4L67A 2C6MA 1ZKDA 4JQ7A 3EQCA 2W1ZA 3RK9A 4EHVA 3MAGA 5K0EA 3KHKA 4EKGA 4I6HA 2JKMA 4BIDA 4YNEA 4QNYA 4AZFA 3KQWA 2RGPA 4D2SA 1B6CB 5DR9A 2XRWA 1VLMA 2P35A 2WMQA 2R3GA 4J98A 3GC0A 2J51A 3W55A 4FTMA 5HG8A 2R3KA 1REKA 2VV9A 4E32A 3KRWA 2QG7A 3LL7A 1PXLA 4E6CA 4DA4A 1Z5MA 4KINA 3RCJA 1R8XA 2XNBA 4CNHA 3G15A 1IG1A 4MH7A 3BV3A 4BBEA 3QQJA 3TJDA 4EH2A 3K6RA 1AQJA 1TQPA 5DPMA 3U6IA 4FL3A 3M11A 4AP7A 4I92A 3QBNA 3HCFA 1JTFA 3TUDA 4OR5A 3GNLA 3LX6A 2JDTA 1SVEA 4XBRA 3Q4TA 5FDPA 5KZIA 3E8DA 5HEKA 2UYOA 4K9YA 4TN6A 2WMUA 3NUNA 4H05A 4PNIA 1EQAA 4GFGA 5L2TA 5DE2A 3I81A 5LJJA 4JOAA 5FTQA 1AGWA 4L6QA 2W1IA 5IUGA 1KUTA 3IQ7A 3E93A 3JWGA 4PYKA 3EGIA 4EH3A 3Q9WA 2WTKB 4KKGA 4I5HA 1BOOA 3EQGA 2OZOA 1BKYA 5F2KA 5L6WL 2V7EA 3B2TA 3VAPA 1TVOA 3HUCA 2JDVA 3TT0A 2JLDA 1O54A 3T3UA 5IEVA 2ERCA 3CBLA 4UBAA 2DPMA 2J2IB 2Z7LA 2BRMA 4GFMA 4FSWA 4JIKA 5J7HA 3ZFXA 3D5UA 3DMFA 3TNPC 2G72A 3CKKA 4BLWA 4PDYA 4CV8A 4LG4A 4NYEA 4HPTE 2O65A 2PVYA 3BKWA 4C05A 4IE9A 3RPRA 4BGHA 5L2WA 1YDRE 3D2IA 4FKQA 3A62A 5JUWA 2OKCA 3WF8A 2NRYA 4QYGA 4USDA 2BZGA 3CEKA 1V0PA 4U5JA 4UX9A 4MXAA 4EWHA 1VL5A 2IVVA 3FLWA 4FT0A 2QOIA 5EGSA 5ANJA 2F2UA 1OPJA 4IZYA 2HIWA 2HTEA 2Y8OA 3QZHA 4LOOA 3IGGA 4CCBA 4RTSA 2I0YA 4GUEA 2O06A 1NT2A 3LXLA 3QQHA 4RQKA 2JGZA 4DMGA 3R0TA 2PZIA 4R7IA 1SMHA 3G88A 3DBEA 4IWOA 1OIUA 3W1FA 3B8QA 3MWUA 3OCTA 1R0EA 2A19B 3ULZA 4J95A 3E87A 4CCUA 2I1MA 1XJ5A 3DNDA 4LOQA 3E64A 1B38A 2GQRA 4XUEA 5E8JA 4IX3A 4M37A 5D7AA 3GUBA 4PRJA 1YDSE 1UFKA 5LVMA 3D15A 4HW7A 3ZO4A 2IW8A 5FULA 2IDKA 3KF7A 4LOPA 5CVGA 2PX8A 1G8AA 3A8XA 3KKZA 4C62A 4RJ3A 5D7VA 3VSEA 4DCMA 3NDJA 2X7FA 1BMKA 3C1XA 1KE7A 2W4JA 4GK4A 2E9VA 4WG3A 2BILB 3QF9A 4X21A 4L9IA 4C2WA 3ZXZA 4FYNA 4L01A 5IH5A 5JQ8A 5JFSA 2QNJA 1BC5A 5I9WA 3PPJA 4NIFB 4NL0A 3ZSGA 3CD8A 3ORNA 2OIDA 4OTRA 4ZZNA 4ZY4A 5HE3A 4CXAA 2XYUA 4RIYA 3SVZA 3I7BA 3TNHA 5GHVA 4N6ZA 4R77A 3HA7A 2PX5A 4ASZA 2HV9A 3KR0A 3OZ6A 3MVJA 4GT5A 4BBMA 3FZGA 3O7LB 2FO0A 3PXZA 4QMXA 3LCOA 2Z02A 4BDEA 2B54A 2EJTA 1PXOA 3GWZA 3O51A 4Y30A 3VUKA 4BCGA 2F7XE 2R9SA 3R9RA 2QHNA 5D11A 3GGFA 3OD6X 1G5SA 4DFXE 3OXIA 3SQQA 3A4OX 2Q0NA 2EFJA 5HG7A 5ANGA 2XRUA 5M4UA 2PMLX 3QCQA 5CEQA 5DM0A 2B53A 5IQAA 3AD5A 3RAKA 3GU3A 4WKQA 3SGLA 3NEWA 4KDRA 4CT1A 4YUVA 4L7SA 5KKRB 3FMJA 5BW4A 5I9UA 2C6DA 2WU7A 3QX2A 4FG9A 3FLZA 1I4WA 2BCJA 1SQFA 3CR0A 2WMSA 4GFOA 3Q5IA 2W17A 3C13A 4X2JA 5F2OA 4NTTA 2JH8A 2ONZA 2PL0A 3NDMA 5CSHA 4ZSAA 5CSXA 3QHRA 4NU1A 4Y5QA 5KMMA 3O96A 3MGGA 4WBBB 2XJ2A 4FV2A 2WQMA 2XCKA 5EOLA 2GSFA 3UC4A 3U87A 4PQNA 2ITYA 3F6XA 4DC2A 1ZRZA 4EK4A 3ZO2A 3WOWA 3RNIA 4D9TA 4BDBA 4N6YA 3MVMA 1XDUA 3DK6A 2XJ1A 2OGVA 1FMOE 4NUSA 4YJUA 4QMUA 2C7OA 3E88A 4U42A 2BTRA 4FOCA 3SC1A 4FTCA 5JGAA 3O8UA 5K0NA 1QYRA 4XG6A 1JQDA 3RHXA 4ER3A 4K77A 1ZMVA 4LWPA 1JQEA 4AZTA 2UZBA 4J1RA 5EPEA 4GC5A 1RJFA 2R3HA 2WAJA 3RIEA 5FA8A 5E8SA 1PHKA 5HD7A 3OWJA 5E9JA 3ZZWA 3P2IA 3HRFA 1X1CA 3L9NA 2OU7A 3C0IA 4GOND 5T3QA 4PTCA 3ZUTA 4BYJA 4E4MA 3BI6A 3OCGA 4XG4A 3BE9A 4U81A 4QMWA 4X3JA 2QM3A 1W82A 3NW6A 3QTRA 4P7FA 4L68A 2AR0A 5E91A 5IDPA 3I6WA 3U55A 2X39A 3WF6A 4BLUA 4MF1A 5JEBA 1YW2A 3VW6A 3L8XA 5CVEA 2YDKA 1GOLA 1H0WA 3G6HA 2R3QA 2VO3A 4JBPA 4J71A 1SUIA 4RX9A 3MTEA 4OGRA 1OIRA 3PY1A 4EQZA 3U4WA 3MJ1A 3GC7A 5FXRA 1A48A 2XB7A 1WXXA 1UU7A 5HIDA 3COMA 3LJ0A 5LR6A 3DKCA 5G1XA 4ANLA 3VBVA 1ZXEA 5IISA 2F7EE 5KX8A 3I0OA 4FSRA 4O7LA 3HCBA 3SSNA 4QPSA 2XKCA 3P08A 4YZNA 3ZONA 3LAUA 4DBXA 4MQ2A 4QTTB 3NW5A 5EOVA 3DUWA 3AGMA 3BKBA 3AWIA 1S9IA 3LDUA 3MH2A 4RX7A 1SUSA 1OB3A 3Q3BA 2ITPA 2BRBA 4GYGA 4P58A 4HYHA 3HVJA 2LGCA 5CF5A 2JH9A 4I93A 4M7RA 3BU3A 1UIRA 4FTRA 3LCUA 2IBTA 2WK1A 4PYOA 5B2KA 1OGUA 3GU4A 2Q0BA 1XJDA 3CPCA 1KPHA 3DAJA 3AD6A 4RG0A 4EL9A 4PGGA 2YCQA 5FGKA 1K3AA 2BZKB 5KMNA 1W98A 3W8QA 3FKOA 5LCJA 3DV3A 2VUWA 3R9NA 4RIXB 4HVDA 2ORED 3W8LA 3TZ7A 3SG8A 1OPKA 2VO0A 3M6UA 1RI5A 4Z3VA 4U3ZA 3MW1A 3I64A 4QMQA 2C6KA 3FUVA 3U4UA 4M68A 4QYYA 3OUKA 3TKYA 3TZMA 1D2GA 1MQBA 3UYTA 1WMKA 4I4FA 5K5NA 3BUSA 4U79A 4FKTA 2JFLA 4A06A 3GCUA 3ATSA 2XNEA 3TNWA 4LMUA 4CFNA 5AP5A 3CJQA 4S30A 2IIPA 3TV6A 1J3HA 5ETCA 4OBWA 4F08A 4R5SA 4CXMA 3DKGA 2J90A 3VNTA 3QRJA 2K4MA 3UVQA 1QAQA 5EHGA 4I6FA 4GRBA 4BDIA 4FKLA 4GUAA 4L43A 3UBDA 5FM2A 5IEYA 3EQIA 5K01A 2OB1A 2WMVA 4B9DA 4FKRA 4CKIA 1PW2A 2ZIGA 5CVHA 5IA0A 2ERKA 1GAGA 1YWNA 4GBED 4W4VA 2OJFE 3AC1A 3CD3A 5HBHA 4L44A 3D83A 3D0EA 3FMLA 4WUNA 4MNEB 4RC4A 3R7OA 4C4AA 5BP7A 3ODYX 2R64A 4J97A 2I0HA 4OQDA 5A6NA 3IV6A 1X1AA 4W4WA 4FZVA 2JC6A 2ZBQA 3ZC6A 2CN5A 1R8YA 4FNWA 3R7VA 2ZAZA 3G0FA 2O8YA 4II5A 1E1XA 1XQZA 3VS5A 1URCA 3WIKA 3DQXA 3VULA 2DQ7X 5J5SA 4I22A 2G1TA 5P8WA 1ORHA 1W7HA 4RC2A 3ROYA 4ASEA 4TKSA 5F1ZA 4XNEA 4GF5A 4U45A 1RJGA 2ONLC 4YC8A 1EIZA 1JG1A 4RX5A 3R83A 2OJIA 4KBCA 4XJ0A 4QMOA 5AUYA 3BLRA 4O21A 1LP4A 1XCJA 1YXSA 3GVUA 3DJ6A 3OT3A 4CKRA 4DGLC 3HV6A 2BRGA 3PPKA 4P7JA 3ZO3A 3PG3A 5DPVA 5C4LA 2O57A 2BDJA 4QQCA 3FHIA 2C5NA 5CVJA 3PA5A 3KC3A 2B78A 3VS6A 1JSVA 4CKJA 3F2NA 4RX8A 2IG7A 3A7FA 2YCSA 3PFQA 4QMYA 4QP8A 1TW3A 5L6PA 4D9UA 3KY2A 4C34A 2OI4X 3OY3A 5EYKA 4HGYA 2KTYA 3QD4A 1VE3A 2QOKA 4I6QA 4DFLA 4RRVA 3PWDA 5CEOA 2YVLA 4FS8A 4RYLA 3A7IA 2HMYB 3R8MA 3HCCA 5TOZA 1YWVA 3P7AA 2HW7A 4H39A 5LXMA 5A4QA 3MB6A 2B9EA 4JRNA 3WBLA 1YZ3A 3ZXTA 4BGQA 4C4JA 2IW9A 4JAIA 4BLVA 4FUYA 4LV8A 4B99A 3LFNA 2ZZNA 4DFNA 4IAIA 4JQEA 2YXEA 4QOXA 1ZYCA 5EMJA 4A6DA 4LRMA 4TL0A 4AN9A 4D4VA 4WD5A 1VPTA 2ITWA 2R3JA 2O3PA 5E1BA 2H1RA 4CLIA 2UW8A 4FEUA 4XG8A 5CCXA 4IC8A 5K0LA 2E2BA 2GNGA 2QRVA 3PYYA 3Q87B 2E9PA 2JIVA 3Q52A 4P7KA 4RVDA 4C3FA 3KFAA 4AA5A 2IH4A 4PGHA 1G55A 1RJEA 4L3LA 5FEDA 4UWBA 2WHBA 3FPGA 2QOFA 3RAHA 4FV9A 5K0GA 4YPDA 5EFQA 2FSTX 4RVGA 5J1VA 5FXSA 2XIYA 1RI1A 4BHZA 5EHYA 3I5ZA 2GA9A 3ITZA 2NO3A 4ACHA 2XYQA 3S95A 2A2AA 3EIDA 2QY6A 3GT8A 3G2QA 4D5KA 4OTGA 4EKLA 4C07A 3Q60A 4YHJA 2YHVA 1OUKA 1WBNA 1KOAA 4TTHB 4Z7GA 3UIUA 4JQ8A 2WMRA 3PVBA 4RJ5A 2W05A 4IMYA 4F9WA 4KWPA 2HAKA 4BI1A 2R3SA 3EEOA 1EG2A 4NW6A 3O17A 3OBJA 5ANIA 3VO3A 4QP2A 2HNKA 5BYYA 5CU3A 5EZQA 3LHDA 3LFDA 3QWKA 3NAYA 5M4IA 4ER5A 3LXNA 4GJ2A 3KR2A 4ARKA 2VTSA 2XK3A 2HELA 1DI8A 2W1CA 3WSTA 3HUBA 4IZ7A 4QYFA 4BP3A 2KW5A 3C6KA 4HGTA 5EKUA 3BWFA 3N4TA 1U4DA 3SOAA 5J1WA 5H9BA 2PE0A 3LOKA 3C5IA 4WNMA 2ZIEA 4U7PB 2VWZA 3ZO1A 4DYMA 4CRLA 2VP3A 2PXCA 3BU5A 2IJMA 5ACKA 3FI3A 5B7VA 1BHJA 5BQ0A 1QPDA 5A4CA 1YQJA 3P7BA 4C36A 3DBQA 4IHPA 4L8MA 4DF3A 4TYGA 4FSZA 3B3FA 3DBFA 3QCYA 3ROCA 5FQNA 1JSXA 1RDQE 3PP1A 5TT7A 5EM6A 5HX8A 2YFXA 3A60A 3V51A 2ESRA 2SRCA 4W4YA 4FZ6A 3OPNA 2QOCA 3VS7A 1Q3DA 4C0TA 3QAME 4FEQA 1IASA 4XUCA 2Y1WA 3HECA 4D58A 5KMKA 2J0IA 4YZDA 1DAYA 4G3DA 2J0KA 5EQYA 4IM3A 2GLUA 2AVNA 3N4UA 2BALA 4F9AA 4LM5A 3DB6A 3NW7A 4AA4A 4BDHA 4EUUA 2BDFA 3PVWA 3N51A 4JS8A 4ZOGA 5DRDA 3E63A 2F2CB 3I4BA 1K2PA 4BY9E 1H25A 3C4XA 3NRMA 4QRCA 4GT4A 4DCAA 4ZTMA 3FZRA 5TKDA 3OWPA 3LMGA 4KIQA 5BVWA 2ACXA 4EOSA 2ZJWA 4GYIA 5GJGA 4EOQA 3KQSA 2Y6OA 3FAAA 1UV5A 4NM0A 4NFMA 2PV0A 3HA5A 4EK5A 5ITAA 1MRYA 2RKUA 3KL8A 4FG8A 4ANBA 3SRVA 4GQBA 4O81A 4ORKA 3GCPA 3IDBA 4M67A 4JR3A 4PL4A 4CD0A 5GJDA 5AM6A 1NE2A 3PUPA 3MTFA 3FHRA 3TL8A 1ZOEA 3UDBA 4F9CA 4PYQA 3QKLA 5DT0A 5HI2A 3HL7A 2F9GA 1VQ1A 3Q4ZA 3I60A 4QVGA 3TRKA 5CNOA 3LJ2A 1WFCA 5IU2A 4E26A 3MFRA 2OJJA 3DPKA 4OTIA 4IAAA 5FEEA 4XCXA 1ZWSA 3DBDA 3ORIA 5CVVA 5KKRC 3PE2A 4RIWB 3VRZA 3NJRA 3R00A 5JRSA 3Q6UA 2NXJA 2B9FA 5CUQA 3HVHA 3BEAA 3MESA 4GL9A 3UMXA 4JT3A 4EH6A 4EJ7A 4ZTNA 5JH6A 2NPQA 2VTRA 3UFBA 1U59A 2I62A 3FL5A 3F5XA 3R6TA 2I40A 2IZTA 3I1AA 4R3PA 2FSOX 3BHYA 3C7QA 3QKMA 4D4SA 4IVDA 4ITIA 2AN5A 2QOBA 3FYJX 3FBVA 3O23A 3VF8A 1GJOA 5K0JA 4CMOA 4F70A 4EONA 3R73A 4YV1A 2WEVA 3DU8A 4MBIA 3EQHA 5GP1A 5HVYA 4FGBA 5HLNA 1BI8A 2W99B 2E9NA 4D5HA 3QRIA 2QONA 3QCSA 4DINA 3U9NA 3KXZA 4A9RA 4HCVA 5CVFA 3EH9A 4C4FA 3W2RA 1VYZA 3EN6A 1OUYA 1NA7A 1Y91A 2PVLA 1XH8A 1O9HA 3SX9A 2F57A 4FSNA 1ZY4A 5HGIA 3DAKA 5EQPA 1Y6AA 3GOKA 2XK7A 2GTNA 3ELJA 2P3OA 2HWOA 4QDKA 3QHWA 5CZIA 2OO8X 4MXYA 4EORA 5T6BA 5CEPA 4YPSA 3ALNA 5GJFA 3VUMA 3DKOA 3GU6A 3CSVA 3ZDUA 3UTOA 4GK3A 1PY5A 3PSCA 4MBLA 2JEDA 5G6VA 5CU6A 3G2OA 1LUFA 2IH5A 4JAJA 5HBJA 2AC5A 3RK7A 5AUUA 3GBZA 4XOZA 5DN3A 5EC8A 2BAJA 2I7QA 3NZ0A 2XF0A 4EH5A 4EWQA 3ELUA 3A7EA 5I9XA 3F5UA 3FTCA 3KA0A 5EOBA 3GRYA 1LEWA 3CTQA 3OW3A 4DBNA 3MY1A 2WTIA 1ZYDA 4EI4A 5LARA 5FM3A 3KQVA 4CTKA 3QLGA 4R78A 4RBLA 3TFWA 3ETAA 4ONAA 5HCZA 2JIUA 3S3IA 4YO6A 2GH1A 3FC2A 3NNXA 2J9MA 2GU8A 1ZHFA 2C7RA 1N7IA 2QE6A 4O82A 1SVHA 1OIYA 2GFCA 4IAZA 4RTPA 3G9NA 3Q2JA 2B9JA 4AZEA 2P7IA 2VTPA 1SVGA 3BWJA 3CLYA 5E8XA 5J8IA 2PSQA 4FG7A 4DEEA 3B3GA 3ORLA 4AAAA 4TT7A 2F49A 3D5VA 3HA8A 3R8UA 2VDUE 4MHTA 3DXYA 4F63A 2GDOA 4ZS4A 5EHLA 3IECA 3OXZA 2BR4A 4FT7A 2YITA 3U6JA 3P97A 4UXLA 3HV7A 4HGZA 4DFBA 1YOLA 5BVFA 5DI1A 5BVKA 3DXQA 1XBCA 3SMQA 4BDCA 2PVKA 3O71A 4FKWA 2NYUA 4KKEA 4AOTA 4ER6A 5GIOE 4DEAA 5C9ZA 3VYWA 3UG1A 4F9YA 2ZV9A 3LW0A 1DCTA 1EAMA 4C02A 2OJ9A 4H36A 1ZMUA 5EIFA 5CWZA 1OKZA 1Q3WA 3OU2A 3QXOA 3L8VA 5ANEA 1H1PA 1X19A 4U97A 1WVWA 2XK4A 2BR5A 4IADA 4PV0A 4QVKA 3GB2A 4FV1A 1XTPA 4EK8A 3C3PA 3TEIA 2IVSA 3GU5A 5FTOA 4HVIA 4KA3A 4C7TA 4O7RA 3GGDA 3BYUA 4FTLA 5CI7A 1M6YA 5AP1A 1P1CA 3RW9A 4IVAA 4PMMA 5IQCA 4Y5HA 4JR7A 2OXXA 5M06A 3H3CA 4IKPA 5HQ0A 3QTXA 3RK5A 2GHGA 3G5DA 4NJDA 3Q9YA 1JG4A 4ZK5A 1Q0TA 4LL0A 3TDVA 5HCYA 1SKMA 3WZEA 3ZH8A 4RIXA 2P40A 4PYIA 2RFEA 2H8HA 4Z2YA 4QPPA 3E7OA 2AVDA 3LPMA 3UODA 2PZ5A 2UW0A 3R7UA 2ZB0A 5JN2A 3EN9A 4YLLA 3KPJA 4FBXA 3OBGA 3EVAA 3A8WA 4FV7A 3SX0A 4HGLA 2HWKA 4OTWA 3UVRA 4C61A 4M69B 4XG7A 1M14A 2DWBA 4O0SA 4E2XA 3GC8A 4MHAA 3ZRKA 2CGUA 4X41A 2HY81 5EZSA 1OMWA 4X6RA 2XBAA 1R0PA 1BI7A 3MBLA 2WPAA 2ZFUA 5EYDA 5KVAA 2OJGA 3VJNA 1ZZLA 3MH1A 2JHCA 4Y8DA 1KXZA 4FTJA 4DM3A 3FYCA 3PJCA 4BTKA 3A7JA 2EVAA 4KIPA 2JAVA 2PBFA 3KRXA 5AAEA 2JAMA 4IX4A 1KIAA 3RAIA 3UO4A 2ZM3A 3QA8A 2C69A 1BUHA 4MNEA 2WXVA 3QA0A 4U8ZA 4JL9A 4LRKA 1FMKA 2R3OA 2WMTA 2JBOA 3NUXA 2Y1XA 5CEIA 5B0XA 4QMNA 3EJ1A 3TWJA 3MI9A 4J8NA 3EMDA 5FLFA 3FL4A 4I6BA 1JAMA 2B3TA 1GY3A 3HMMA 1JPAA 3FEGA 3BYOA 1H1SA 3AC5A 4FOBA 1VZOA 3FKNA 2CCIA 4O86A 4MX9A 4BCOA 1Q4LA 3REPA 2AOXA 2FK7A 5IUIA 4LV5A 5LVPA 5AEPA 4FKJA 5F2NA 3LLAA 5JK3A 4MNFA 5EDPA 3CE3A 4DFZE 5AV1A 2YXLA 4NECA 4QP9A 4WUAA 2VTNA 1PXKA 4Z55A 4QPNA 3DKFA 1OM1A 2R3LA 3UC3A 5C8MA 3LKZA 4LQMA 4HYUA 5CYIA 5KHXA 5HE1A 3RZBA 3C0GA 2HZIA 2IP2A 2XP2A 4IX5A 3IG7A 3KR9A 1E1VA 1OI9A 5AX9A 2AN4A 3OZSA 2X6DA 4HSGA 4L42A 5CASA 3CKXA 3TM0A 2IZRA 2Y4IC 2XZSA 1NW5A 3PTAA 3B8RA 4OT5A 5EDQA 4GSBA 5M07A 3MFSA 2VGOA 3DTCA 3E8NA 1XXLA 5DXAA 3D14A 1UWHA 3BZBA 4MQ1A 2BIKB 2P3QA 4YHFA 1YFLA 1TQIA 1ZQ9A 1PJKA 2G2IA 1MQ4A 3R8VA 5E1MA 3OFMA 3S0OA 1UA2A 5ICPA 3KQOA 3QTSA 3BBWA 3PJ1A 5AAGA 4KBAA 3QLFA 2QO7A 1QANA 4RTNA 5DX1A 4TW9A 2ONLA 3FKLA 4DG2E 5EQJB 1Z9XA 3QUPA 4ZJVA 4JDKA 1DS5A 4O0UA 3NW9A 4F09A 1H28A 4PDSA 3OCJA 2OZAA 3FLYA 3AD4A 3HLLA 3C0HA 3P71T 3H0ZA 4L00A 3LFCA 3B3JA 1IAHA 1DAWA 4L45A 2CWWA 4R1YA 2AC3A 2P55A 4IC7A 3VQHA 3HAMA 3ZU7A 2JIIA 5DVRA 2YM6A 4YP8A 3HRCA 3G90X 3TOSA 4ZEGA 2O05A 4BZNA 4NCTC 4WOVA 3ACJA 3O8PA 2XKEA 5EW3A 3KGAA 1O6LA 4YU2A 4FT3A 2X4FA 3L9MA 4EYMA 3WF7A 3K5UA 4FK3A 1ZZ2A 3CQWA 4FKSA 4OBPA 5HKMA 3BELA 2ZDTA 3A99A 1U2ZA 5AP3A 4YUXA 5HICA 2X7OA 4JIAA 5FBNC 5LSAA 5A3XA 5CY3A 2O0LA 3KCKA 3T3VA 1J91A 4XUDA 4C33A 3BHUA 5IZFA 4JX3A 3SG9A 3MH3A 5DM1A 4ANMA 3RKBA 4MK0A 1P4FA 2OH0E 5CAVA 4D55A 4BCPA 3UIBA 2OFUA 3QX4A 2A0CX 2Z6AA 4JXFA 5AAFA 3FMNA 2RF9A 2PY6A 3PX3A 2G2FA 4WVLA 2O63A 3RODA 3WILA 3COKA 4QTUB 3MPMA 1PXJA 4LMNA 2VTLA 5LQJA 3NNUA 2G70A 3LECA 2PTKA 3QOXA 4CZTA 2A27A
chains in the Genus database with same CATH superfamily
2Q5CA 4DNXA 1I4LD 3N75A 3R9HA 2ZT6A 1SC9A 3F9CA 3TI1A 3MGKA 1MAUA 3K2EA 2JRCA 3W4JA 1CVLA 4WE3A 4TTRA 5AJHA 3GQIA 4BICA 1AA9A 3AHCA 4E1BA 5A7FA 2QLBA 2POCA 4OHXA 3PSBA 3KFXA 4XBUA 5TMDA 4F7WA 2R7KA 4J99A 1NBHA 1E6WA 1IK4A 2VK2A 4BNZA 2IXBA 3OCSA 3Q96A 2D8MA 3HCEA 1GR1A 3LRXA 4UHBA 4O3MA 3JQFC 4R68A 4PC3A 1MLDA 3PA3A 1CUUA 1L9KA 1A76A 1RQXA 2Q4BA 2OG8A 5LYYA 1WF3A 2HOGA 2GNLA 3MCUA 3RYCA 3WGOA 3IIKA 1KRXA 3DY7A 5K4AA 2UUPA 4AIIA 2BBSA 1J9ZA 1YXVA 2QRMA 1BEEA 1VYWA 5KQSA 5JADA 4BV3A 4AS2A 1Z16A 4ZAWA 1AQ6A 1UU3A 4C06A 3SV0A 2BEWA 1R6VA 3WWOA 3KN6A 1GPNA 4BWVA 5IK2D 5ICFA 3EL8A 2ZZKA 4FNAA 5I0BA 5LBUA 5FJJA 1SMKA 3RU9A 3R7BA 2BE9A 3OBIA 3SW4A 5LXTA 1NF2A 2C1BA 3A7DA 3I01M 2HDOA 1MB4A 3F82A 2GASA 3OQNA 2PVRA 5L4SA 1TCUA 2AKYA 2A1TS 1GG5A 2WSBA 3HZTA 4A82A 1DMSA 3Q1LA 4B4DA 2CNKA 3RC1A 3QSGA 1TYZA 3UWOA 5BV0A 5GPBA 1NNSA 3AXTA 1FF9A 4KUEA 4GJ3A 5B7PA 3L4KA 3O4VA 3WADA 1Z57A 4K46A 4R5HA 4JXXA 1PJCA 3JYOA 2QZ4A 4J1TA 4Z9FA 4X7BA 3EMVA 2X1VA 4LBYA 3Q7RA 1A2KC 4YWHA 3HV5A 4F93B 4X2NA 5JAIA 2PK9A 1RC8A 3IAHA 2H34A 3KFVA 4AM8A 1B6TA 4DC1A 1BW9A 4EHBA 5BNIA 1LPUA 4RVSA 3GVHA 1U54A 3G6KA 3T3IA 5FUQA 3ZM4A 1ATZA 3KMUA 1C0IA 3HCDA 1V9LA 5CDHA 3E9YA 3FJYA 4CR7A 5DCWA 3IBTA 1Q61A 1MQ9A 1V26A 3ZEWA 3ZWMA 3QWAA 3VISA 4BO3A 4CNQA 4BFVA 2PCJA 4AK9A 3F5QA 3FQHA 2VWQA 3VBTA 4OHBA 4TTTS 4RWJA 1X7XB 3SXRA 3PT9A 4RIGA 5E6SA 4WG4A 1GAEO 3OPXA 1BCRA 1WD5A 4GU6A 3PGA1 1WXQA 1RWNA 4ETIA 4DMMA 2P3GX 2PKQO 4MUXA 4F7LA 3QRWA 4QU9A 2QVSE 1LX6A 2G2HA 4FT2A 3L1VA 5B7NA 3PUVA 3UAZA 3G8CA 3PFGA 2HHLA 4K0YA 1U7XA 4QYMA 5LCXA 2PYWA 1ZLXA 3P9SA 4M0MA 4OTHA 1T5LA 4AWBA 5FL7D 1DKQA 1JKSA 2GSDA 2I2AA 1ERKA 4U4AA 2OM6A 2OV8A 3LQ8A 1NVGA 4M6WB 3HDHA 1CQPA 1E2HA 1VYTA 1K6XA 2CCKA 3G2FA 2C8KA 2GF0A 1XRQA 1P31A 4L51A 2COUA 2PRZA 2EZ8A 5AA8A 1BWPA 1K6JA 1Q7RA 5H82A 1JDUA 1M2HA 1TF2A 3CEAA 4E4XA 3BQ9A 5DWQA 2IFTA 3LZCA 4E7WA 4Y6OA 4OFWA 4DEBA 3G9LX 1ZN8A 4ZODA 4XCQA 2GNJA 4RTJA 3D5XA 1SC1A 1RWWA 5DHQA 4IIUA 3F3VA 2R00A 3AGLA 4PAOA 4TYIA 4HH1A 1E20A 1Z74A 4RK1A 1KYZA 3B89A 4UPDA 1YACA 4PNKA 2IE8A 3IQXA 1OASA 1PWXA 1T1SA 3LUKA 1MXFA 3RJCA 3OFJA 4AJ1A 5FG8A 4PN7A 1K97A 3GXLA 1UXKA 1Y5MA 2DFDA 2B8JA 5IT4A 2IU4A 3IP1A 2AYXA 4FEYA 3K71B 4E12A 5BPYA 3O0GA 3CO0S 1PJ2A 3Q4UA 3FLAA 3E22A 3FTEA 4ZYLA 1FSZA 3IBSA 1VLZA 4M7WA 2VK8A 1KE6A 3DHVA 2LTAA 3VYRB 4XVRA 3GJ7A 4GT3A 1OSNA 3JASA 3K31A 3M5WA 1YQQA 2P2CA 2UYGA 2YM5A 2VQFB 2FMFA 1W75A 5KWJA 3TQSA 3FG9A 3FHJA 3H2ZA 3NM6B 1ZVKA 2OPBA 4D8UA 1B8UA 1XD2A 1I3OA 5F7XA 3AM5A 3BGVA 1ZKMA 3GLGA 2VJQA 4I3ZA 2GD0A 3SC2A 4R4JA 5COAA 5HEZA 4UU8A 2DBRA 4QP7A 1O8BA 3VR4A 1X1TA 5LOHA 4EVRA 4LXHA 3OP5A 1SJ9A 5IH3A 3V97A 1Y34E 4EA7A 3KULA 4FR0A 1V2GA 5K9IA 1JZQA 4GKHA 3I6ZA 3U13A 3FOEC 3GWGA 3IHTA 4KH0A 1M17A 1RWMA 1MQAA 2VUIB 1D2CA 3GNTA 3K9QO 4UWCA 3JR3A 1YULA 1U31A 2PE5A 2DB3A 1WZEA 3K35A 4F84A 4I23A 121PA 3LL4A 4YMIA 4BASA 4U3YA 1Y80A 3V7YA 4H58A 3TZ6A 1EIWA 5D5PA 1R0LA 2EFGA 1ONNA 2Z6VA 4Y72A 5JPDA 2UZLA 1RS0A 4Q9ZA 3SW7A 2NLOA 2JZOA 4KWHA 1Z7BA 4BCBA 4N48A 5FKJA 3TFOA 1RBYA 4KIJA 1Z4NA 4TTVA 1QHIA 1VHQA 1W87A 2FH9A 3JQGB 4LNUA 1T26A 3LQ5A 3GLHE 5EJFA 3IAM6 3I9FA 3MJTA 3P0IA 3OAAD 4GI2A 3ZJTA 4RD4A 2PEYA 3K0FB 3M5DA 3VMMA 4E08A 4KN6A 5B4UA 1ZN7A 4BJ5A 4IFEA 2ASEA 3S81A 3IO7A 3HHEA 2CL7X 4YK7A 3VOBA 3S1AA 2YOHA 1TKIA 2IW6A 5EYMA 4IEEA 4HFRA 2FW1A 1Q8TA 3VZRA 4P34A 1T2CA 1J7IA 3Q8MA 5I9MA 4DLPA 3QVGA 2VYVA 3UQGA 1PMNA 3VBQA 3GR6A 5A4LA 5K3EA 1Y8CA 4Y95A 2AUHA 5FHRA 1E8DA 5HIJA 1M2KA 3M3HA 5AJYA 3ET7A 3CGFA 2CMFA 2XB9A 2GBCA 4KRGA 4D0LB 4NAVA 3DA6A 4O7WA 3ELWA 3OX4A 1TZBA 3AHJA 4QOIA 1LZKA 1I5RA 3UB2A 2NP7A 5KTRA 2XNNA 4DDHA 1C30B 4RACA 3KBBA 1UQRA 4FX3A 5FNZA 5IBQA 1SEPA 4TYYA 5DYJA 2GYUA 2I4MA 3MCTA 2ZB1A 3T1HB 1HLPA 4DNOA 4ZJIA 3OP1A 3HNRA 2IVTA 3PG1A 1X7ZA 2OAQ1 5HD4A 2MWMA 3LO5A 5FWNA 2OFXA 4W4XA 3OT8A 1W96A 3JYQA 3V4OA 3X1KA 2B99A 4MYDA 5DT3A 2BFAA 2DG2A 3M1SA 3T5BA 2OO5A 4I1PA 4KAJA 5AJQA 1A2BA 4FIEA 3PA4A 1TZMA 4ECAA 3AHFA 4Q16A 1Q0HA 3C98A 4Y2JA 1PF7E 2CGWA 1QGZA 1KDTA 3FDZB 3LCDA 2XUAA 1Y37A 4OK6A 4YRPA 1JEYB 4PO9A 2RIOA 2EFEB 3T8OA 1U8CB 4US0R 1A5TA 3PUKA 3VU9A 5LA6A 2Q5EA 1PWYE 4B79A 4INAA 4CEJB 3P2YA 4JEMA 2E4WA 2Y0DA 2AQHA 1CUHA 1V9CA 3OX1A 3N8HA 4J0FA 2D1SA 3KZKA 2C78A 2HZNA 2OQ2A 3DBCA 3RIXA 3L8GA 4AO7A 5HNBA 3I58A 3A8TA 4A7CA 2JB9A 3BK2A 4EH1A 4FTTA 3Q9UA 5E8VA 1PK8A 4G6ZA 3AF6A 2FZWA 4BI0A 3PJ8A 3KXIA 4NYJR 4GOLD 2A67A 3QUQA 4UEWA 4J7AA 1KVQA 4NKAA 4ESVA 1NF8A 4JC0A 1NSFA 5JJBA 1KEEB 3F2AA 1OTHA 3POZA 4ZO6A 2IC5A 1VB5A 1IQ0A 4HQLA 2IU3A 4RX1A 2O3TA 1K66A 3KKQA 4QOHA 1LXCA 3B2NA 3GDOA 4JQZA 2JHGA 4BX9A 1I7LA 1P0PA 5CSPA 4I0RA 1HFKA 3LM5A 5JBNA 1Z2CA 3USCS 6ABPA 5EERA 2HZ4A 4HAUA 4DRYA 3F61A 5AWMA 3R5TA 5ARCA 2Q1YA 3G0IA 2UKDA 5T4BA 3GV0A 3RHZA 3NOVA 2FCAA 1X9IA 4JT9A 1LPOA 2EIXA 4MUIA 2WKRA 4O96A 4A7PA 3TW8B 4DW8A 3STTA 3SOZA 2BRUC 2QROA 3E84A 5C18A 2VWPA 1P4SA 1AQLA 2YDIA 3N76A 5DFPA 2WMXA 4V3BA 3D5QA 4QUBA 5FUYA 2PUIA 3Q72A 4S1OA 1M75A 2ROQA 4C1NA 4MR8B 4EEVA 2V4UA 3JPYA 3DEZA 3NR2A 4GXTA 2Z57A 3O4JA 4MW1A 4AUAA 4JVMA 2GBFA 3GPBA 2XAAA 3G17A 4AULA 2IKQA 4FEWA 1O6YA 4NCAA 1XA4A 4KIFA 3AETB 5T67A 1NYLA 1G19A 1G7SA 3UOWA 1QVAA 3E3AA 1OYWA 1H93A 2W6PA 2WSYB 4AUKA 3FCXA 2R44A 5JZNA 5C51B 1I4DD 1GRVA 1GDDA 1Y0BA 4C35A 4LYGA 4RSMA 4Z9XA 1SXIA 3P5KA 1JIIA 1LI4A 4M86A 4MUBA 2GETA 3H42B 4GSKA 1YE5A 5TPWB 5CB0A 3CX4A 5H5JA 3A58B 4D4IA 1UJ4A 5FL3A 5A3JA 5FA6A 3GYGA 5ES4B 3FE3A 3ZZUA 3KX2A 2YICA 1HFWA 5IAEA 2WHRA 2WEKA 2QU6A 2WTJA 1OI7A 3L9LA 4D9GA 4DLRA 2PBRA 4B82A 4F46A 5FTNA 2C4UA 1GNLA 2IZ5A 4X62B 4DR2B 4KYTA 3VGJA 2VDMB 3MY0A 4XHKB 4UAVA 3FMEA 3HDNA 4ZPXA 4A92A 4BMYA 1PI3A 3HUDA 1U5BB 1EE9A 1XTTA 3HB5X 3IYLW 3ROEA 1UVRA 1RPJA 2V0NA 2Y68A 3OJ0A 3KF4A 4A07A 3I39X 4J76A 3NFGB 1L7VC 1N8KA 4C22A 5JT1A 4IGAA 2Y1KA 4UVGA 1AN0A 2IYUA 4LCBA 3VR6D 3LLVA 4AU8A 3LCJA 3FQSA 1RDFA 3GZNA 3DOIA 4JELA 4PF4A 1WE2A 4OHRA 1XO2B 3ESZA 2ECFA 4U5XA 1JKKA 3LC1O 1QDLB 4WNAB 2GAFA 1OECA 4MWGA 2QG6A 2GCIA 1TFUA 2RHBA 4WCFC 1RWVA 4LBWA 2OR3A 4ND1A 1Z7GA 2G1KA 2ZE7A 2JGDB 5ICGA 3IUMA 2IYNA 4HTAA 2CDZA 2AK3A 3PLNA 1WUHS 4NU5A 4HGNA 1ECJA 4X2KA 5KOIA 3A6ZA 3W5SA 4NCTA 2X42A 3WK5A 4BTMA 2W8ZA 3WP1B 5ELXA 1Z34A 4H6WA 4TZTA 4C0XA 4ZTSA 2GEJA 3F6EX 3FCOA 4BMOB 4IW3B 2W4MA 3K8YA 4W8EA 4EHZA 4ZAVA 4X3FA 721PA 1XAJA 3C9WA 2ZIUB 4MPTA 3AR8A 3DR5A 3EW9A 1JVPP 4CLRB 5LMUB 4CKXA 1E0JA 1H8ED 2WGJA 5C27A 1CQJB 2FW6A 4GEOA 3F9IA 2W06A 4BV8A 4TTSA 1GUZA 5I9YA 3FR7A 3FFXA 2PVSA 4Z5XA 2P9QA 5EI8A 4XYFA 4RTRA 3PGJA 3EODA 1M2NA 3AP1A 4CTJA 3K7EA 1DT5A 3IUNA 4LSMA 5JWHA 3KUCA 2GS9A 2C9BA 4A0SA 3WA6A 7GPBA 2IYAA 3FSJX 2H3EA 1LS1A 3AXWA 2G77B 4CT5A 1XH4A 5YASA 3C2QA 4CFFA 4QDJA 3WWYA 3DBIA 4KPUB 4WIHA 3QCXA 3EL7A 2BI4A 3AP2A 1HRDA 1RLUA 5HTBA 1Q1GA 1TK2A 2FPIA 2HIAA 4I14A 3MJCA 5DRYA 2REBA 5A3VA 3I6QA 1L3CA 2GAJA 3K94A 5EWLA 4QGSA 3GRZA 3KZCA 2XTMA 1YHZA 4Y0VA 5HGXA 4OGLA 1HSZA 1MVOA 2C04A 3FN4A 5HUQA 3BXOA 5I3CA 3IKMB 3KDAA 4F06A 4IM7A 2AYYA 4N70A 4HNUA 2BFBB 1KE8A 1XJQA 3AB7A 3JZFA 5H9VA 2BZSA 4IV8A 1OBDA 4BN0A 4CMKA 5AKYA 1I0LA 3UMMA 1CK4A 4GU9A 4RZSA 3DOCA 4FEXA 2C4NA 2VK1A 3RGWS 4KNWA 5ECDA 3W7AA 3QQLA 4M8IA 1XZNA 2JBAA 4I81A 1QH0A 3MUFA 3K92A 3SEAA 1MB0A 4C4GA 4OHUA 4L7VA 4O1HA 4L16A 4PFSA 1Z6AA 4OQEA 4JDHA 4BAGA 3O1JC