2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
4JBQA 1OM1A 1M52A 2HV9A 1KE8A 3G5LA 1R0PA 3FL5A 3NUUA 3ZSIA 3KQMA 2XB7A 2C3LA 1J1CA 2UZEA 3DQXA 2EUFB 3LFDA 4FEUA 3T9IA 3S00A 3L9NA 3NIEA 3OWJA 3TUBA 1IM8A 3HEMA 4HGEA 4EH7A 4EHGA 3ORTA 3D7ZA 4BCFA 3KQPA 5DXJA 1KE9A 5C0OE 1SVHA 2NP7A 4WHZA 2VO7A 1YF3A 4O84A 3FHRA 4LUDA 4DH7A 3B89A 3DA6A 3QF9A 4IM0A 4HVHA 4QTUB 4GK2A 4TYHB 4C3RA 2ADMA 3GRZA 1Z3CA 2ZV7A 3CY3A 3F2NA 3NW7A 2IPXA 4CRSA 1N7IA 1SKMA 4GEKA 2W4KA 2YAAA 1UKHA 3R7IA 3TZ7A 3CC6A 3F2AA 2C7PA 2WTKB 2YJRA 4RJ3A 3F61A 2ITZA 1YKRA 4B0GA 3RWQA 4NH1A 4G31A 2XVAA 4BRXA 2BZKB 4PGHA 1JSUA 3QXPA 4O2ZA 5E8VA 4CCBA 3COHA 4M97A 2P3LA 1XH4A 2J9MA 4RX5A 2C1BA 1Q5KA 2GQGA 3LJ1A 2HCKA 4CGAA 5HEZA 2IH2A 2VGPA 4NW5A 3P9IA 3D0EA 3UBDA 4RIXB 3O71A 1JG3A 1WMKA 5AJQA 3IW4A 1XH5A 2J51A 4YTHA 3HNRA 5EG5A 2IBSA 1ATPE 5EM6A 2UW8A 3CEKA 3ZUTA 1K3AA 1Q99A 3LBFA 5E1BA 4YJVA 2B9JA 3VBQA 2GAFA 3KPUA 3LCSA 5IZFA 3W1FA 2BR4A 5KMOA 4EC9A 2OJGA 1YI3A 1NW5A 4E8AA 1YOMA 5DT2A 3SXJA 1V1KA 1SM2A 5HZNA 4ZJVA 3Q6UA 3FTCA 4KWCA 3ENHA 5AP6A 4BDIA 2O06A 4DTBA 4G6NA 3LFSA 4ALUA 3KQ7A 4BI0A 2VUWA 5HG5A 4EORA 4PIMA 3R71A 2OH4A 3V5PA 1B6CB 2IO6A 1UVRA 4BN1A 2I0VA 4W4XA 3G2OA 3ZCLA 3ZSHA 4UXQA 3Q5IA 3R6TA 4QMOA 3NDMA 4APCA 4IX6A 4BDJA 3F88A 3C0KA 3Q5ZA 2DULA 3BHHA 3RK9A 3GU7A 3EIDA 3VRYA 3ZUVA 1BI8A 2CKPA 4CFWA 5A4CA 5LMBA 1HNNA 3LHDA 4NTTA 2Y4IB 3OS3A 3RGFA 3PXQA 4RMZA 5HBJA 3EKNA 1URWA 2PSQA 4L6QA 4EWHA 3MCZA 4MAOA 4RJ8A 2I6LA 3LQ5A 4RX9A 4GBED 5AP4A 3NDJA 3UZUA 1XHAA 5DA3A 2ONZA 4A07A 3JYAA 5HD4A 3TIYA 3BPRA 5DYJA 1JAMA 3QRTA 2XS0A 3VUIA 2PVJA 3BE9A 5E8JA 3A8XA 2CL5A 4F85A 3QLFA 4H3QA 4U79A 4F7SA 3EVGA 5AAGA 4M84A 3LAUA 2B9EA 1CSNA 2IGTA 3PTAA 1G38A 3UA3A 4BF2A 4KRDA 2VTOA 3RALA 2IIPA 3F3ZA 3A4OX 4I0RA 4I0SA 3UE4A 5DR2A 1KYZA 1REKA 1JLUE 4G9RA 3CJQA 3D4QA 2YXLA 5LVMA 3FKLA 1ERKA 5DXAA 3FPFA 2XCKA 3TLJA 3R7EA 2QY6A 4NECA 4POOA 3FQSA 5J9YA 4IWPA 1CM8A 3P9JA 4JL9A 2YDJA 3Q52A 3KRXA 3R01A 4GC5A 3UBTA 1QAQA 3QQGA 4ZJIA 5IQBA 3AC1A 3W2SA 1BI7A 5A4TA 2VWVA 3EVAA 3JVSA 2O0UA 2ONYA 4PINA 3EN5A 1SQFA 4ENYA 4DCGA 5LSAA 3O0GA 1L3IA 3LCTA 2XYNA 1M2QA 4UALA 3RTPA 3KR9A 4O0UA 4MX9A 1OITA 4JLCA 4JI9A 4OT5A 3E7OA 3CR0A 2ZIEA 5I4NA 4HPTE 2C7OA 3K54A 2XBMA 4AZEA 1OL2A 3AMBA 5DTRA 5LARA 1OL6A 2AUHA 5L8JA 4UZHA 4KIQA 3DBFA 5JFWA 3HA3A 1NVQA 1Q8YA 2G01A 4A9YA 2J6MA 2X8IA 3BYMA 3IDPA 3DJ5A 4JIKA 5CX9A 5EG3A 5BUJA 4CXAA 3BEGA 5I9WA 4DZRA 3TKUA 2C47A 1ZZ2A 4FSWA 4IW0A 2C5XA 2FSLX 4NFNA 4FBXA 3DGKA 1V39A 5F9EA 3UWPA 3N4TA 5H9BA 1XWSA 2A27A 2VDWA 3VYWA 5K03A 1YZHA 2RG5A 3F66A 4RIWA 3KXNA 4H36A 3RPYA 4R1YA 3ZFMA 2VTAA 4FKQA 1G6Q1 1AF7A 2G72A 3GJYA 4QDKA 1JKKA 3NUXA 4DTKA 4OTWA 4DH5A 5HU9A 2IDJA 3A4PA 4PTEA 3RK7A 3QUDA 4M67A 4QMUA 4EQCA 3EQGA 4TYIA 3FKNA 3EHAA 3V8VA 5EFQA 2OZVA 4HZRA 3WZUA 3RODA 1BLXA 5K5XA 4ER0A 1YUBA 3BYVA 3DKGA 4C7TA 2WU7A 4Y8DA 4K33A 3DB6A 3L8XA 3RAHA 2UYQA 4WNOA 2R3JA 3DTNA 2FSTX 1CKPA 3D2LA 3EGIA 5FA8A 1L3CA 5F2OA 5K0CA 1UNGA 3KQYA 3OD6X 4X63A 3EEYA 5E7RA 3MS9A 4XEYA 4C33A 4GSBA 4IEBA 5M4UA 5HEKA 2Z6QA 1H0WA 3I9FA 3V6RA 2FVDA 2FYSA 1XR1A 1ZMVA 5DT4A 2B25A 1NA7A 3OE4A 4KRCA 3BLRA 3M11A 5E90A 5M4CA 1ZZLA 4QTAA 3THRA 1OPJA 4HGZA 1F0QA 3DK6A 2WK1A 2OF4A 4NYEA 4RFZA 5BQ0A 5ACKA 3FQEA 4J96A 4Q2AA 3FRHA 3O8UA 1PXLA 1FPUA 3E7VA 3LKMA 4U44A 5E2BA 3UO4A 2PMOX 5EKUA 1DAWA 4W4YA 3NLBA 4IB0A 5DE2A 3FY2A 5HE0A 4AU8A 2BAKA 4LM5A 1FP1D 4EEVA 4AA0A 2PT6A 3VC2A 2BDWA 2WMBA 2PPQA 3MGYA 4F1MA 4FKVA 3HM2A 3ZLYA 4UV0A 5JQ5A 3GO4A 4C59A 4BGHA 5AAEA 3V01A 3M42A 4EC8A 5AM7A 2PZRA 2PVCA 2W1IA 4WRGA 4RPVA 1SUSA 2E9UA 1XCJA 3DXXA 3SHEA 1LEWA 2QHNA 3WBLA 4AN9A 4DGGA 4EUUA 5EHGA 4GJ3A 3EN4A 5DWRA 3OWPA 4BBFA 4FS8A 3PIYA 4Z2YA 1YFJA 3FMMA 4IIRA 4DEGA 4IWOA 4M7IA 2VWXA 4E6DA 3WF9A 5ICFA 2ZV9A 3E62A 3Q3BA 4WSYA 3QUPA 4C3PA 5A14A 4NM5A 4DKJA 4FC0A 2VTLA 3RAWA 4HRAA 2UZBA 3FBVA 3LCDA 5AEPA 3LL7A 2BR3A 4ATNA 4JXFA 3F5XA 5CVFA 2FK8A 3BQRA 4QVKA 4RVDA 2PL0A 4E4NA 3EQCA 4EOOA 3VW6A 2VDUE 5CU4A 1XH6A 2P7HA 4KA3A 5BX0A 2HXQA 3OTUA 5LQAA 1VP9A 4M12A 2OBJA 4YC6A 3VJOA 3PXZA 2VTMA 3EN9A 4XG2A 3HCCA 2IH4A 4IJ9A 5M07A 5LQKA 1IASA 5C1QB 1NW8A 3LBYA 3VC1A 1PMEA 2NXNA 3HTXA 4OX9Y 3DAKA 3IKAA 3UG2A 4C34A 2BM8A 3ORMA 2JFMA 1B38A 4NFMA 3ZEWA 1RI5A 3LX6A 2B78A 2OJIA 3O23A 4RTMA 4G3DA 3F2RA 5F20A 1KIAA 5JFXA 5GM2A 4R77A 4PP7A 4FYNA 4NKAA 3NX8A 4AT4A 4GG7A 3G2PA 3DK3A 2XNBA 5E9WA 5JFSA 2UVYA 4LMNA 3HVHA 3C5UA 4FT3A 3POOA 5HE2A 2XYQA 3FUVA 3ELJA 4MWZA 3QX4A 5IEVA 1G5SA 1JPAA 4IBMA 4BCOA 3R9DA 1RI4A 2PVYA 4EK9A 4D9TA 3QXOA 2GFCA 1R3CA 4LRJA 3ZLWA 5L2TA 2WIPA 3CD3A 2WQBA 4MYGA 4O27B 5AV2A 4PGGA 3OCJA 4RTPA 1OL1A 2A4LA 1PXPA 1ZWSA 4DINA 1JKTA 2XZSA 2FSOX 2UZOA 2BR1A 3AT3A 4RIYB 3MTEA 3Q53A 3KY2A 2R3RA 2H6DA 3E3BX 4G6OA 4HYHA 2ZMDA 3A2CA 5AUZA 4AP7A 2EU9A 4CT1A 5A54A 3RI1A 1FQ1B 2Z60A 1VR2A 1EG2A 4RJ6A 2ZIGA 1R8XA 2YVLA 2P3QA 1Y57A 5FADA 5IQAA 2ZDTA 2VTIA 3QYZA 4GYGA 3H4JA 4ERWA 4F6WA 1XH8A 2OZAA 2IBTA 3BEAA 3OW3A 4FKSA 4MQ4A 2QYOA 3KCFA 2XEYA 4TYJA 4FSYA 4A6EA 4A9SA 1LPUA 1Q0SA 5BVNA 2JKQA 5BW5A 4ZOGA 2YQZA 3M6WA 3UJ6A 4WBBB 1P39A 1H25A 2CSNA 3B8RA 3L8SA 1JBPE 4XV2A 5JEBA 3FYJX 3BKXA 4YMJA 5KQRA 3L9LA 5IH3A 1KOAA 2R4BA 2OF2A 3NW6A 4HTFB 3FQHA 2VTHA 1IR3A 1M14A 3A7JA 3ERKA 3C13A 3IG7A 2PE0A 3QC9A 3UZPA 4XRJA 1OBGA 1J7LA 2CNVA 4FV7A 5ETCA 4EOIA 5JR3A 3ZO2A 4ZTNA 3PPKA 2WIHA 4GUBA 3DXQA 3NNWA 1URCA 4RZWA 5CVEA 4IX3A 3WZEA 5EZQA 3GU5A 2VWWA 3OF0A 4IDVA 3QTQA 4CV9A 4E93A 4EK6A 9MHTA 4PV0A 2Y6MA 5EYDA 4FODA 2V7AA 4ONAA 3CKXA 5L2IA 1MJFA 2AR0A 3OBJA 2X39A 3A7GA 3BZ3A 1PMNA 3CTQA 5LVPA 3DMGA 3KXMA 7MHTA 2ZZMA 3CKWA 3BWBA 2UUEA 4MBIA 3ZS5A 4AGUA 3PWYA 5KMIA 5HX6A 1W0XC 4FTJA 4QDJA 3CQUA 4O86A 1IA9A 1P1BA 4ERKA 2XYVA 1KE5A 2OPBA 2ZJWA 4JBPA 1FVVA 3O8PA 5ACBC 2XKFA 4OTIA 4BCMA 1M6EX 3QOWA 4ZLZA 3LDUA 1YRPA 3D2KA 3AT2A 4OBPA 1X1DA 4HGYA 10MHA 5BYZA 1PXIA 3II5A 3C0GA 4FKPA 4M14A 4C0TA 2B0QA 2PVLA 3LMIA 2WKMA 5EHLA 3F5GA 1Y8CA 3CY2A 3KU2A 4TXCA 2R7BA 4TNBA 4XUDA 2ITYA 5F4NA 3CCNA 1XDSA 4OBXA 4P2KA 2W9ZB 2RF9A 4E5BA 2GPYA 4O29A 3SRVB 3R24A 1M2PA 3KN6A 3DDPA 1SG9A 3AWIA 3KK8A 3NUNA 4QYGA 2C0OA 5HICA 3RJCA 3LDGA 3UJ9A 4CTBA 1MUOA 5AUTA 1PJKA 5CF4A 4XG8A 3PX2A 2NXJA 4YUYA 2Z8CA 5TF9A 4E5WA 5EEGA 4CMUA 4J7BA 5ANGA 4MIKA 1L1EA 1H07A 4QQCA 3KXGA 4NJDA 4XOYA 3ROCA 5IA0A 3A61A 5HIJA 5E9JA 4Q5HA 3OUKA 3MFRA 4FTRA 2J0JA 2ZSUA 3DUWA 4B99A 3P0MA 1ZXEA 2I7QA 4LUEA 2PZYA 2P8JA 3B8QA 4R7HA 3A7FA 3KF4A 4BTKA 3S3IA 2AOTA 3CVOA 3BWYA 5DRYA 2C68A 1ORIA 3GBZA 3ZRMA 2P4IA 3P79A 3MB5A 4XYFA 3B7PA 4GOLD 3U55A 4EZ7A 3F3UA 4GT4A 3B2TA 3C51A 4RTLA 1IAJA 2H34A 3Q32A 4G17A 3RPVA 3OEZA 3G33A 3R1QA 2FB8A 2QO2A 4O83A 3FUUA 3GI3A 4RC3A 3UPZA 4L3JA 4JDIA 4ZLYA 4PYOA 4GVJA 2OXYA 4RTJA 3GNLA 1H01A 3NWEA 4RWLA 1PW2A 5CF8A 4R05A 2FSMX 2R3LA 2RG6A 3DNDA 2R0UA 3HVCA 4F6SA 3RCDA 5LJJA 5GJGA 3B3JA 4QRCA 1VE3A 4KIGA 2WEVA 3DY7A 3LFEA 3VBTA 1HCKA 4AFJA 3GRRA 4EONA 2PYWA 2WFYA 2OXXA 3MW1A 4HNIA 4WO5A 3V5WA 2IN6A 2P7IA 3UZTA 2QOFA 3R02A 4PQNA 4FT2A 3POZA 3SW4A 4TYGA 4CD0A 4EK5A 5IISA 4M69B 3TNWA 3COIA 1BYGA 5G6VA 1B39A 2GQRA 3R1YA 5EW8A 4QMQA 3B3GA 4FVRA 4GF5A 3LMHA 3P9NA 3HMIA 5DTMA 3SC1A 3EVZA 2REIA 4AW5A 2VZ6A 4D5KA 4GIIA 4ARKA 5DOSA 3VAPA 3SW7A 3GCSA 3FKOA 3PP1A 4O7ZA 5CQWA 4BR3A 3CSVA 2FYTA 5HESA 3F4KA 4FA2A 4F0FA 4BP1A 2GHGA 4QTBA 1H1RA 1Q24A 3CGGA 4UB7A 2HMYB 5HIMA 3S95A 4MXOA 3RW9A 4YSMA 4YMGA 1SZMA 5D1JA 5HIDA 3D5VA 4C38A 2PK9A 3TACA 3QTZA 5ETIA 3A7DA 4U7PB 1H08A 2BTRA 4WA9A 4ZP5A 2WTWA 4IM3A 3OY3A 4DYMA 4FKIA 2C5YA 2I40A 2C0TA 3GCUA 1R00A 3OG7A 3WF6A 5HU3A 3UJCA 5L8KA 5LQRA 2PHKA 3PY0A 4XG7A 5AP1A 5DX1A 5EZSA 5EMJA 1LR4A 1YWVA 1YXTA 3E8EA 5CS6A 1LUFA 4HCVA 3UQGA 4DGMA 3KPJA 3P9CA 4GOND 4CCUA 4GKHA 2QHMA 3HMMA 4F70A 2QC6A 2Z6AA 3R9HA 4GS6A 5EYKA 3LFQA 3NVKI 4PWYA 2HY0A 1JG4A 2YIWA 4X2NA 1H1PA 2IVVA 4YZ9A 3VHEA 3VS5A 5M09A 2B52A 3BYSA 4DGNA 3G0FA 1EAMA 1XVAA 2PGXA 2EXCX 3KR0A 1EIZA 5KBRA 2W1EA 2VX3A 4KKHA 3ETAA 3RHKA 3SAYA 3AMAA 3UQCA 2FHPA 3SM3A 5K01A 3UYSA 2P3GX 3HCAA 2PWYA 3B2WA 2Z7RA 2IVUA 4IB5A 4M7RA 4BHNA 3IW8A 1UU3A 3HRCA 3K5UA 4NJ3A 5KMLA 4FNZA 5CVHA 2N47A 3DAJA 4J53A 2B4SB 4AGDA 2QM3A 3MIAA 4FIGA 1U5RA 2Y1WA 2HTEA 3FSKA 4FOBA 5JKGA 2Y8OA 4I23A 4CNHA 4FTTA 5IQHA 2OH0E 2OJ9A 2GHLA 3I0QA 3FZOA 4UBAA 3L8DA 2VU3A 3TL8A 5FM2A 3H2BA 3BE2A 4HOKA 4U97A 3PB3A 3E8NA 3OROA 4E5AX 4QP3A 5BUEA 4FV4A 4ZTSA 2FPOA 5E8RA 3MY0A 4Q9SA 3FC2A 3R21A 4FSNA 5DR6A 3QKKA 3IGGA 3HCEA 2CJMA 3EZVA 2VO6A 3LZBA 3DBEA 4KSQA 4R7BA 3LCUA 1JSXA 4QTTB 3THSA 3KC3A 2ITUA 2PT9A 3MH1A 2YM6A 5K8VA 1YHVA 3D14A 3DJ7A 1Q8UA 3FHIA 3PZHA 4RWJA 3EVFA 3NMUF 3SSMA 4MTAA 4R6WA 3U81A 3PSCA 5FBNC 5IQCA 1D2GA 1KUTA 4U45A 3R8VA 4YJSA 4L42A 2OW3A 5IA1A 4OBWA 4FSQA 2BH2A 2UZVA 2YN8A 3ME5A 3UC3A 2J0KA 4O2PA 4IACA 3EL7A 3GB2A 4X0MA 1K9AA 3ZONA 2V7EA 4HH4A 2ZOQA 1XTPA 3QWJA 4JOAA 1JVPP 4L52A 2QLUA 3VS7A 2AN4A 3C7QA 2JBPA 3LW0A 2GPHA 4BCNA 3PRFA 3Q96A 2YEXA 3ZFYA 1WBSA 3TG1A 1R8YA 1PRYA 3DT1A 2ITPA 1QAOA 1INLA 3O51A 3FYKX 3W2PA 3I5ZA 3C0HA 4OTRA 5IF1A 2E2BA 2PXXA 5FULA 4I5PA 2V7OA 1O54A 1W98A 3JWHA 5BW4A 3SLSA 5ETAA 1ND4A 3MA3A 2JKMA 3KPYA 5K0FA 5JRSA 4LRKA 5DEWA 5KMMA 5LWNA 4XBRA 3DR5A 4YZMA 3MQ2A 4P58A 2VNWA 3JS2A 3DBCA 4LL5A 4Y5QA 3QHWA 3FLQA 4PUZA 4D1SA 3I6UA 4D2RA 5CAVA 1NW7A 3FSFA 3D5XA 3BX5A 2NRUA 3N9XA 3Q6WA 2J5FA 1WZYA 4U3ZA 2YAKA 3WZKA 5B2MA 4XV1A 1H27A 5JT2A 4YUQA 4MHTA 4EOJA 2JDTA 4IVBA 2BR5A 4HC4A 4CSVA 3ELYA 4ZLOA 4OA5A 4R8RA 3OZTA 5EMMA 4HYUA 2VNYA 4ZMFA 2HWOA 5DIAA 3HMNA 3BWCA 2I9KA 4OTGA 3HL7A 5KUPA 2YX1A 3UO5A 5LOHA 4AACA 5E1OA 1X8BA 3D7TB 4QQJA 3CS9A 1P2AA 3C5IA 4QNYA 4FZFB 1JQHA 3T3VA 4A9TA 1Q3DA 2XIRA 1FPQA 1JSZA 3KULB 5CVUA 1W84A 4ACGA 4BBMA 4HYSA 3G6GA 1L3RE 3PXRA 2WHBA 3FMDA 4I93A 4C04A 2XCHA 4A4XA 1R18A 3UP7A 2IDKA 3PP0A 3HV4A 3CCFA 3VS6A 4FIIA 5KKRC 3Q4CA 4GG5A 4I94A 5EM7A 4DEBA 4CQEA 4HVGA 3BELA 1ZKDA 2BCJA 3TN8A 3GRVA 3ID6C 3AD5A 1M2RA 2GA9A 2GB4A 3ORIA 4KAOA 5M5BA 2EG5A 3KRRA 1U4DA 3UIXA 5C4KA 5DH3A 2B53A 4HZSA 4II5A 1TVOA 1J7IA 4UWCA 3R7YA 3R1NA 3B3FA 3PVCA 2WMTA 4APPA 4YZDA 4JVGA 1DAYA 3HAVA 5BUIA 4FTNA 1XXLA 1OVEA 3R9NA 5FG8A 1O9HA 1JNKA 2VWIA 2JDRA 4FL3A 3V5QA 3I1AA 2RGPA 4YLKA 1OMWA 2BIKB 3SGLA 3M6XA 3GU4A 5FDXA 2W1ZA 2PUPA 4FSRA 1YXXA 3V5TA 5HHWA 4YO6A 1U59A 4EKIA 4YNEA 2PE1A 5DRDA 3BYUA 3KQOA 5C27A 2YZLA 3TKAA 1GZ8A 4QT1A 2IZTA 3KRWA 2X1NA 3LDFA 2XMYA 4DC2A 5LWMA 4M36A 2XK4A 2CKDA 3NWBA 4MTLA 3P4KA 3E3PA 4C35A 4DEAA 3K5VA 3FLYA 5B2LA 5DTQA 5EC8A 3I6WA 2XRUA 4GVAA 3I53A 3RM7A 2I0EA 4GUEA 1MHTA 2UVXA 2ITTA 3OHTA 1Z5MA 1VL5A 3O17A 3SX0A 2H9VA 1ZYSA 4RIWB 3V3VA 3ELDA 1NVRA 1PXNA 3R7VA 3SXFA 4ASZA 4CFXA 3FEGA 4NM3A 3ZXZA 2EB3A 1NW3A 3TUCA 3P97A 5IEXA 4PL3A 1REJA 3ZFXA 4A4LA 1D2HA 5FCDA 2WGJA 2PTKA 4C36A 4GRBA 3A26A 4PNEA 2ESRA 5BYYA 2CLXA 4O91A 4YLJA 4OBOA 3BU6A 4WNMA 5HCZA 4DA4A 4GUAA 5H8EA 3TWJA 2ZV2A 2WQOA 4RZVA 2XNMA 3FJQE 1SYKA 3CD8A 3PXKA 3Q2JA 4LOOA 5EDPA 5EM8A 3VS0A 1QYRA 3KQQA 4NT4A 2OLCA 4CZUA 4KIFA 1CKIA 3G6HA 1NKVA 3EQBA 4DLJA 2PZPA 2W4JA 1ZY5A 2OK1A 3R22A 1OIUA 2WB8A 3ZYAA 1XH9A 3OT8A 1WVWA 3QALE 3QZGA 4QNAA 3V8WA 1PJZA 4USFA 4F9AA 2VDVE 4I22A 4RVKA 5EDQA 4V0GA 3ZDIA 4OQDA 1DCTA 2F7EE 2QRVA 3LPMA 4C08A 2OFVA 2PUUA 3ORLA 4DA5A 2IH5A 3BQCA 4L8MA 4DFLA 3H0YA 4C4AA 2YISA 3LXNA 3TV7A 4HCTA 3F5PA 3LLAA 4WXHA 1FVTA 3NYOA 3DXNA 5E8XA 4M38A 3WILA 2EVAA 4ZTHA 3TPZA 2GQSA 3AQVA 1KPGA 5CEKA 3HP7A 4L67A 3C4XA 1OB3A 3PY3A 4X7QA 3LCKA 1H00A 4HGLA 5LXMA 2PMNX 2YJSA 3G8AA 5K4JA 4I6BA 3K2LA 3UJBA 5EW3A 3VHKA 4EJNA 5L6OA 1SVUA 4N6ZA 4EKKA 5KS2A 3JUHA 3OPNA 4YJRA 2EJUA 3Q2MA 2OJJA 3GENA 4FZ7A 3CKKA 3RAKA 4JXJA 4H0NA 3LKZA 5CNOA 2UW3A 2CGXA 2WQMA 3P5KA 1W7HA 5HIIA 1M7QA 4PCAA 4MH7A 5BVEA 4C4HA 5KYGA 3PJCA 3Q4ZA 4YPDA 4QTCA 2W1FA 3UMWA 4AF3A 4AXAA 4FTQA 4C37A 2A0CX 3K3JA 4L43A 3R8LA 1EJ0A 5EOVA 3S68A 4OTHA 3V51A 2Q0BA 2XJ1A 2IP2A 3EQPA 3VUMA 3VF8A 3I64A 4IZ7A 2RFSA 3I4BA 3IDCA 3ZXTA 5DM1A 2ZWVA 4A06A 4V04A 5FLFA 5BVWA 3Q7EA 4BIBA 3R2YA 1Q4LA 4DFYA 2ZZNA 4D4YA 2X2KA 5KBQA 3AC3A 3PE1A 4O7VA 2JG3A 3EQRA 3R7UA 4GK3A 4Z3VA 5F2NA 2NP6A 4D0WA 1ZOEA 1STCE 2VX0A 2YCSA 3HGKA 3PFQA 1RQQA 4EH6A 5DGZA 3PYYA 3VJNA 4D55A 4W8EA 4AA4A 4QP6A 3LECA 4IJPA 3C4ZA 3GP0A 3P7AA 3UJDA 3ORHA 4RSSA 5LMKC 3ORKA 2W7XA 4FG7A 4UX9A 2OB2A 5JUWA 3SXSA 1UKIA 1ZMUA 4FKWA 4PDSA 2X9FA 4ANQA 1KPHA 5FUBA 2Y1XA 3KULA 4CFFA 3SR4A 4KNBA 3M70A 4O0XA 5K05A 4QMXA 4LI5A 4WBOA 2F8LA 4S33A 3VSEA 4G56A 3FTEA 2W4OA 4YJPA 3QTIA 2AC5A 4AN2A 3KPWA 4YUWA 3EB0A 3PS9A 2ZIFA 3QD4A 2YIRA 5T6KA 4PYLA 3R2BA 1KE6A 4UEUA 1H24A 2O8YA 2BMCA 2CMHA 4E20A 2CLQA 2ZBPA 3MH2A 3VULA 3RM6A 3H30A 4MXZA 4OUCA 1G8SA 3ZM4A 4UN0C 4Z7HA 3L8PA 4FIFA 1QPCA 1Q97A 4FL2A 5DBXA 3HV7A 3FDNA 4Q5EA 4QPPA 5K0LA 3FPQA 4IB1A 4A4OA 4I21A 3LIJA 2UW5A 3KL8A 4TKSA 5LVLA 3M4XA 4DGLC 4U9AA 1OKYA 2VO0A 2QONA 4I4FA 1H28A 3FPJA 5G02A 3OFKA 2WOUA 3FYCA 3CTJA 1ZAOA 3DFCB 2UVZA 4RX7A 4YBJA 4JRVA 3MFUA 4YJQA 5CI7A 1JOWB 3LHJA 5AA8A 3QHRA 3TV4A 2GSFA 3NCGA 4OT6A 4AS0A 2LD4A 1HOWA 2P1DA 4P4CA 4QP7A 4EOPA 3FZSA 5IUGA 4AW2A 2ZFUA 3PVBA 1H1WA 4GOMD 5E91A 3PTGA 3DBDA 3NYVA 1Y8YA 2XF0A 4PMMA 5AUVA 3ROYA 1NW6A 3BBTB 2G70A 3TJDA 3WYYA 3GOPA 4O0YA 3MJ2A 3CTHA 1AQIA 1MRYA 2G9XA 3ZOSA 3VVHA 4ASXA 4CG8A 3NZ0A 3SXRA 2PXAA 4IANA 3N51A 3QFVA 2OXDA 5BPYA 4RIYA 3R8PA 3TJCA 1UA2A 4DCAA 4R8SA 5CYIA 2YM4A 5EOLA 3SX9A 3U87A 4FT4A 4LG1A 3LGAA 3G5DA 3CGOA 5CT0A 2XEZA 4JG7A 5HNBA 1SVEA 2B9HA 4S34A 3R0TA 1FMKA 1H1DA 2OO3A 2QG5A 4V0RA 2UV2A 4O7LA 4TYHA 1XBCA 5AFVA 5E8UA 3LCVB 1YOJA 4I92A 4QPNA 4BBEA 2PX5A 4Y30A 4NZWB 4XG4A 2EFJA 5H8BA 3PIXA 3I5UA 4PYIA 4PMPA 3TDVA 5DM0A 2WQEA 2AOUA 3A4TA 2EB2A 2QOQA 2W1CA 3FI2A 4MXYA 2VWYA 4QYFA 2PVFA 3QX2A 5A9UA 4BGQA 3MPAA 3Q04A 4JAIA 1U5QA 4O0VA 2IVSA 4NUSA 3NUPA 1GNGA 3VF9A 5J87A 3VUKA 5DX8A 2F7XE 1PYEA 2FA2A 3FMJA 2VTNA 5FBOA 4BDCA 1PXMA 4W4WA 2ZVAA 4IMYA 3L9MA 3PPZA 3BGDA 2Z7SA 3TM5A 5DNRA 2GU8A 2ZCJA 1OPKA 2QG7A 2P55A 3H9FA 3ZM9A 3OWLA 1PY5A 3BV3A 2XJ2A 2HR1A 4QP9A 3TCPA 4OA8A 4F7NA 3GXOA 1UU7A 2XVMA 1UWHA 3KREA 3HA5A 4FKJA 2KTYA 1O9UA 1MRVA 1WBOA 1ZARA 3FYDA 1DUSA 3A8WA 5BVFA 2JBOA 5EQPA 3VUGA 3E87A 2FCAA 2Z7LA 4CFMA 4ZY5A 4O0RA 1K2PA 2E9OA 5DR9A 4C4JA 1B42A 3CIKA 3O7WA 3FLSA 4DMGA 4CRLA 4W8DA 2AOTB 2C30A 2I7CA 3T0IA 3NYNA 5T67A 3CGFA 2Y7JA 4BZOA 4QQNA 3FZTA 1G3NA 2KW5A 2C3JA 4XOZA 4V05A 4ZS4A 3C6KA 3KGAA 4FIHA 4FOCA 4FTKA 3BU3A 4L00A 2WZJA 4DFNA 4F7JA 2NYUA 5ANOA 3I0OA 3I81A 2QOCA 4MD8E 4GT5A 4D5HA 2JIIA 4AG8A 3P08A 2OIQA 5FTOA 4HVSA 4KS8A 5HZMA 5DT3A 2XNEA 3BI6A 1TW3A 3IO7A 3MFTA 4S30A 4YTFA 1RDQE 2O65A 3KMUA 3TNIA 5KNJA 4G6LA 1VBFA 4MNEA 3VO3A 4XH6A 4TPTA 3R8UA 4D28A 3ULIA 4J99A 2H00A 4X61A 3M6UA 3VBYA 1XCLA 3GCZA 4M13A 2VZ9A 2BZIB 3VWAA 4DEEA 3L1SA 3IYLW 3NYXA 5FTWA 3EVBA 4BP3A 2YM3A 2ERKA 2V22A 3FLWA 3QTSA 4YTCA 4NTSA 5CEOA 5IQEA 3UMXA 3O96A 1U2ZA 2PX4A 3EVCA 2A1AB 3HA8A 2VRXA 2HWPA 3F3VA 5HGIA 4E26A 2VV9A 3EKKA 3FLNC 2PLWA 2XK7A 5FUTA 3R63A 1XBBA 3QBNA 2WTDA 3HZTA 2H1RA 4J98A 4U40A 3PA3A 3QYWA 2IJMA 4CEGA 5AUUA 4KBCA 5BNJA 4A9RA 2ITXA 3LJ0A 3LPBA 5HQ0A 3M6VA 3CQWA 2G15A 3UIUA 5DSTA 2BRHA 2ITWA 5T68A 3E8DA 4E70A 3MVJA 4EHZA 2X2MA 2R3NA 3BU5A 3TKIA 2C5VA 2PMIA 3ALNA 3WE4A 3ZH8A 1KV2A 3RMFA 4DFXE 5L8LA 2UYOA 2WQNA 3EWHA 3K6RA 3MH0A 4QP4A 5CUQA 4ZTBA 3FZGA 3MPTA 3GOKA 5HIEA 4KS7A 3R9XB 2ZB0A 5DM2A 5EEHA 4QO9A 2WMUA 1BL7A 1IEPA 3AG9A 4RYLA 4TZRA 4DN5A 4F1TA 4C06A 2WMAA 3KKVA 4D58A 4ER3A 3NEWA 1KXZA 3DZOA 3KMWA 2BFXA 5EYMA 3WF7A 4CKBA 3PZEA 5TO8A 3C4FA 5CAPA 4PDPA 5CQUA 4FT7A 3CLYA 3IW6A 4XG6A 3MERA 4X2KA 3BHYA 3Q9ZA 4X3FA 5CTPA 2XNNA 4KIPA 5ETFA 3HA7A 4O0TA 1YHWA 2CNQA 5B7VA 4L7VA 1O6KA 2IZSA 4MCVA 2J90A 2C7RA 1Q62A 4X60A 4BCIA 3FTDA 2G2IA 3OBGA 4YPSA 2XYRA 4FX3A 3K3IA 1ZYDA 5E1EA 3FE3A 4NM0A 4EYMA 2J0IA 5AA9A 2JAMA 3C1XA 2O07A 3OU6A 5HFJA 3H9RA 3LE6A 3ZRLA 2Y4IC 3NR9A 2NNWB 3PG1A 4YJTA 3NS9A 5EK7A 5P8WA 5CIYA 2XIKA 4IX5A 4K2RA 4WKQA 4YBKA 5ITAA 2BUJA 2UZLA 2RL5A 4MWIA 5FXSA 2BZGA 2WEIA 2B54A 4FIJA 3NW9A 4HGSA 4E73A 4F0IA 3P9KA 3KB7A 4FV2A 4CFVA 4EH2A 1YHSA 3DKFA 1SMHA 4L53A 1X1BA 5FWAA 3I5NA 4L01A 4RTNA 3O7LD 2F2UA 2UW0A 2XIXA 4XP0A 5I9VA 2CMGA 2WO6A 2SRCA 2QOBA 3JR1A 4IE9A 2W99B 1SUIA 3ZTXA 1YZ3A 5KHXA 5M57A 3DULA 1YWNA 5GJDA 1H26A 3QQKA 2VTJA 3SV0A 4N70A 4X2JA 3R3HA 5CNNA 3UVRA 4KABA 4QTDA 5K9IA 2JEDA 4D4RA 5JGAA 2QI8A 4QMPA 5J9LA 3HEGA 4MVFA 4BCHA 1NBIA 1I1NA 4FTCA 1WBTA 2HZIA 4LV8A 4RJ7A 3RPRA 4RV9A 3DFAA 3KCKA 3GC0A 5JN2A 4ZS0A 5EW9A 3E8CA 1UNLA 4A7CA 4DE4A 5GIPE 4XMOA 4EK3A 2K4MA 1JR4A 2GS7A 4EH9A 2PSSA 3TM0A 1XH7A 3TIZA 4JG6A 5K09A 3UTOA 3FZ1A 3PA4A 3DLCA 3OCGA 3KR1A 4EH3A 4G3FA 5LMKA 5K5NA 4EMSA 5E9EA 3CBLA 5DLSA 5HLPA 5C8MA 4GFOA 3RK5A 5JSMA 2YWVA 4ITIA 4KIOA 4B9DA 1VP3A 3RWPA 3P1AA 1WCCA 3HV5A 4CFNA 4EBWA 2PUIA 4K18A 4BIDA 5HORA 4JX7A 3PJ8A 5FEDA 3SOCA 3ZEPA 4ACMA 3FZRA 4X3JA 1A9UA 3F7WA 3OY1A 3TI1A 4U41A 2YERA 3QWKA 3U51A 5AP2A 3OXTA 4ZSEA 3L8VA 4XG3A 4RG0A 4B8LA 1KOBA 5EKNA 3TV6A 4FGZA 4DEHA 2UYCA 3BGPA 2UW9A 2BDJA 1OIRA 1WBNA 4HW7A 2PX8A 4YUZA 1GZNA 4HVDA 4F6UA 5I9UA 2QQ7A 4MD7E 1JSTA 2FO0A 2R3GA 4QYEA 1AV6A 4G3GA 5E92A 3IK3A 5CT7A 4J97A 3EFWA 3THBA 4BDKA 5HNIX 1KE7A 4BHZA 3TOSA 4H3BA 3OT3A 4LMUA 4YC3A 3O4FA 5AV3A 2Z2WA 3IQ7A 4MXCA 3HVIA 3G5TA 2GH1A 2QURA 2CGWA 1KHHA 4FSDA 2J5EA 3BHTA 3KN5A 4X1OA 3U4UA 5FQOA 3U6IA 2X81A 2FRXA 4FSXA 2OG8A 1OIQA 3FPMA 4FE2A 3ODZX 4FTLA 4GJ2A 1YI4A 4R5SA 4RC4A 4RQVA 1P4OA 5D12A 3VRZA 3C0IA 4TN6A 3A7IA 5LCJA 2IVTA 4WD5A 3EVEA 4U6RA 2F49A 5AIKA 4X2GA 4MK0A 3G2FA 2YWPA 4O6LA 3C4CA 5K0BA 3R8ZA 5IDNA 3AD4A 4FT9A 2EJTA 3EMDA 1R78A 3HLLA 3WF5A 3KA0A 1BMKA 4ZSLA 4CTCA 5J8IA 5K4IA 2O5KA 4MHAA 5AX9A 5K0JA 3ODYX 1SVGA 3P78A 3ATTA 3NGAA 3QGYA 1BKYA 4X21A 3AD6A 4EHVA 3G9LX 1XDUA 4H05A 2OGVA 3LFFA 3UO6A 3LQ3A 4OTQA 3O7LB 4DBXA 1XJDA 2JFLA 1FINA 3GGDA 1Q0TA 3EYHA 2XIYA 4FUYA 3ENMA 3PLSA 1JQDA 2ZYBA 2AN5A 4FGRA 4DHFA 4QMNA 4G9CA 3PRIA 2J7TA 4RTOA 2AC3A 2XIZA 4FSMA 5HO8A 3U8WA 2G71A 2XK9A 1ZY4A 4O7SA 1UWJA 2C6MA 2GNJA 3QCXA 4FV5A 4ZSJA 3VS4A 2ZVJA 4ZY4A 5DLYA 3U9CA 4AZTA 3NUAA 2R3MA 4XS2A 2UW4A 1ZG3A 3ACKA 4FZ6A 4BKJA 4HG2A 5CF5A 1CDKA 2BDFA 2J50A 4KBAA 4Y5HA 3NAXA 4HGTA 3F6XA 4IZ5A 3CPCA 2YFXA 3SDJA 3UJGA 3DDQA 3HMPA 4WG5A 3UOJA 4BI2A 2R64A 3ZBFA 3OZRA 3Q60A 1XO2B 5CVDA 4WUAA 2YITA 4PCLA 1V0OA 3GVUA 2RIOA 4FZDB 2ZM3A 2X7FA 5FXQA 2ETMA 4G5JA 4WG3A 3ELUA 3VC4A 3BV2A 3TEIA 2QRVB 5M51A 3ZRKA 2ETKA 4WNPA 5CF6A 2HENA 2PVHA 3MHTA 4YR8A 5A46A 5L3AA 4FZVA 5HVKA 5LMAA 3CJGA 4FEVA 3TRKA 3GQLA 4ZTLA 4CKCA 3WSTA 1OUKA 4O7YA 4I6FA 4MQ1A 3DXYA 3C4EA 3QAME 2FK7A 2WMSA 4QMMA 3NVMB 4G3CA 3SA0A 1P91A 1ZOGA 5JRQA 5D1NA 2EXMA 5IH4A 2ITOA 2NO3A 5HI2A 3SOAA 4YC8A 2O0LA 4QQKA 2WA1A 4FSUA 2Z02A 4FKOA 4JRNA 4RWKA 2VD5A 5C9CA 2ORED 5CD1A 2JJQA 5I5ZA 4GL9A 4AZVA 1H1QA 2XVDA 3A27A 5J95A 5D10A 3UJAA 5BXYA 2R3HA 3E7PA 4CG9A 3X0DA 2I62A 4KRGA 3ZLSA 2AOXA 4YURA 2YR0A 3DKOA 3NDIA 3QA8A 3IEIA 5C03A 1PMUA 2UZUE 2W1DA 3KRJA 4RVGA 3DNEA 4QYYA 4I5MA 4FKTA 4CT2A 4DG3E 1YDSE 4GKIA 1J1BA 1AGWA 3MV5A 4D9UA 4ZZNA 3ZC5A 2HOGA 5AV0A 4AW0A 3TXOA 3I60A 4FMQA 3C50A 4DGOA 4RJ5A 4FSZA 3W8QA 3TZ9A 5CANA 5HVJA 4XCXA 5FWDA 5GP1A 3FI4A 3IHTA 4EI4A 5E8ZA 3OXZA 3FPHA 5ANKA 3ZU7A 3KQTA 4FK6A 3P2IA 2YA9A 3MTIA 3ORNA 4PX6A 3TZMA 3I7BA 5CLPA 2ETRA 5AIRA 4E2WA 2VTPA 4CZTA 2XUUA 1TPYA 4AW1A 3HV6A 2CGVA 4L45A 5EYCA 3SKCA 3EGVA 3LJ2A 1OIYA 4BDBA 5M4IA 2AZTA 3D5UA 4P7FA 5IH5A 1DS5A 5HBHA 4FR4A 4YZCA 4CLJA 3RINA 3PUPA 3KU1A 1RJEA 4ANSA 1BKXA 5K0NA 3QCSA 4HSGA 1P1CA 5DSXA 1J7UA 3DLSA 3F7ZA 3RCJA 4BCJA 4FKUA 4GIHA 5C1IA 3PVWA 3MGGA 3T7RA 1GZOA 3COMA 3VUDA 3EZRA 4F9CA 4P7KA 2PWPA 4OQEA 5K0EA 4LQMA 5TKDA 5AUWA 3SQQA 4I41A 3MY5A 4IC8A 3DOGA 3EN7A 3REOA 3GT8A 3HA6A 2QLQA 3CBGA 3Q9YA 4M0YA 2OB1A 1VYZA 3OMVA 1M17A 4KUJA 3ZSGA 4IADA 4ACHA 4E6QA 2C6DA 2YXDA 3FY0A 1T46A 4FNYA 4FTIA 4E4MA 2GNLA 4C02A 1WBWA 5J1VA 2BFYA 2C6LA 1I9GA 2OYRA 5AP5A 1G8AA 4XP2A 2V5QA 3GXLA 3WIGA 1F3MC 1MQ4A 5I0BA 1QZZA 1RI2A 1WZNA 3JWIA 4TNDA 2GCDA 5AV4A 2G1PA 5IA3A 1VYWA 3SG8A 1BOOA 5E1SA 4AFEA 3GU8A 1NV9A 4YNOA 3UIMA 4RA5A 4XNEA 4BCKA 4YSJA 3LQ8A 1WY7A 2YM5A 1YDRE 2ZLBA 4J8NA 1FMOE 1QPDA 2XKDA 4AA5A 4IZYA 2AOWA 4L46A 3WZJA 2HAKA 4RTRA 4HNFA 4IVAA 2Z6UA 3OZSA 4LRMA 1L9KA 4OTDA 4MF1A 5TOZA 1UV5A 4D1ZA 3LCCA 5HCYA 4LOPA 4BGGA 3BGVA 4GQBA 3G8BA 4BICA 4DQ0A 2WAJA 3PXFA 4OTFA 1XKKA 2XNPA 3LOKA 4TT7A 1ZLTA 4ITHA 3DQWA 4W4VA 5CSHA 5M55A 2CDZA 4AN3A 4HVIA 1JTEA 4UXLA 2ACXA 4C2VA 2BKZA 1FGIA 3BIZA 3QQJA 2C5NA 2PZIA 3NSZA 3QLGA 3KRLA 4J8MA 4RRVA 5AP7A 3UPXA 2R3FA 3W33A 1RJDA 3N4UA 2WPAA 3MESA 4RIOA 4ID7A 1QL6A 4LL0A 4C58A 5CEPA 3OP5A 2QU6A 2UZTA 4JS8A 1RJFA 1JWHA 4C03A 4ZJJA 1JQEA 3LXLA 3ANQA 4R6XA 1IG1A 4ASDA 4DH3A 4BDGA 1HCLA 1YDTE 3R00A 2A19B 4FNXA 4GEOA 2JKKA 5JFVA 3GU6A 5DM4A 2WTCA 2IG7A 5GJFA 5CASA 1IRKA 4E2XA 1GIJA 4NKSA 4R1VA 3W18A 2OO8X 4EOSA 4F0GA 1IAHA 3KPVA 4U81A 1OL7A 2IZRA 3H10A 5AP0A 3UOLA 1JQ3A 5FQNA 3D94A 2J0LA 4K6ZA 1G55A 3A60A 4QTEA 5M44A 3C9WA 3CXWA 4K11A 5F95A 4V0GB 4AOIA 5DX0A 3TM4A 3KQSA 2ZV8A 4FT0A 2J0MB 1JKSA 1U54A 5IUHA 3QKMA 3DK7A 3F5UA 3OZ6A 3UVPA 4I0TA 3E8SA 2BROA 4U43A 4BCGA 3BGIA 2XNGA 4A6DA 4D4SA 3O2MA 4ER5A 1WG8A 2ONLC 3WI6A 2BM9A 4F1OA 4E33A 2PZ5A 4L3LA 4ORKA 4PYMA 5FHQA 4JQ7A 4YMHA 4V01A 4GV1A 5GIOE 2WTJA 2G2HA 3FPEA 4NCTA 4E4XA 4RJ4A 3GCVA 1DI9A 4PTGA 4E31A 4RX8A 5HG7A 2CCHA 3IGOA 4RVMA 2YIYA 1U54B 3FXWA 3QZFA 5CXZA 3BWMA 3I58A 5IU2A 4R6VA 4O22A 2BHEA 4NIFB 2XA4A 4F63A 1WXWA 4OLIA 3BT7A 3M1SA 4ISCA 2OI4X 4E32A 3L9PA 4G5PA 4JJRA 4N57A 4ZTQA 5IQDA 1F3LA 4AAAA 2XM9A 3G0EA 2B2CA 4PYNA 1MP8A 4EJ7A 4FTAA 3KKZA 5F1ZA 4EUTA 5IMEA 5B1SA 1RW8A 4YLLA 3FUXA 4GU6A 3BUSA 2WTKC 3KXZA 4N6YA 2Y9QA 3D5WA 4MBJA 4FG8A 4U7ZA 5CSVA 1NXKA 2QR7A 5HIBA 4JDHA 5FP5A 1F38A 1WBVA 4O7WA 3EQFA 4O0SA 2OWBA 4EK8A 1Q41A 1HMYA 3PFGA 3OVVA 5CENA 3Q87B 4BYJA 4OR5A 2GFSA 3W32A 2E5WA 3QCYA 3UOHA 2JHAA 1OUYA 3TR6A 5E4HA 4L68A 3VBWA 4U8ZA 5BMSA 4YHFA 3W2CA 2HNKA 4F64A 4BTMA 1U46A 3WIKA 3HP5A 3RNIA 2WELA 1QANA 5EQJB 5CXHA 2R3KA 4QMTA 5LVNA 2JIUA 5CAOA 5H2UA 3DMFA 3OOMA 4GCJA 3PPJA 1A48A 4S2ZA 5DG5A 4G16A 4O7TA 4YJUA 5DPVA 3ZUUA 5JZJA 3T7SA 4Z7GA 3PJ1A 2JAVA 4BC6A 4YZNA 1O6LA 1ZQ9A 3LFCA 1RJGA 2W05A 3FLZA 2PVKA 3DB8A 3BHUA 4GU9A 4ZXTA 2IW8A 3UJ8A 1W83A 1YXUA 2XM8A 4DCEA 4UWBA 5FA5A 5CM2Z 4KD1A 3NNXA 2ERCA 1O6YA 3F9NA 3C3YA 5T6BA 4EH5A 3P7BA 3DXZA 4L44A 3BZBA 3KK9A 3P2KA 1ORHA 5FTGA 4D2SA 3VS2A 1AQJA 1N2XA 3EQDA 3KFAA 2B9FA 3ORZA 2W0JA 5CVGA 5F2KA 4J1RA 3TDWA 4AZFA 1DL5A 4PL4A 3UNJA 3EQIA 5DEYA 2VTSA 3KHKA 3KQVA 4JDKA 4RSRA 3ELWA 1JG1A 4DFUA 4JR7A 1P5EA 4USDA 2V74B 2GDOA 5IUIA 3V8SA 3F3WA 4ALVA 2P3OA 2WMWA 3U54A 1UIRA 3H9OA 4OBQA 2XBJA 1ZMWA 4MEDA 3ZMMA 5EIFA 3WE8A 5B0XA 2QR8A 5CWZA 1WBPA 3ORXA 5LQCA 2H11A 1NW1A 5CZHA 3SVVA 4ANBA 3W2OA 1Z57A 3MIYA 2OZAB 4JDJA 1S9JA 2GS9A 3GWZA 3IECA 2F7ZE 2YHVA 3WF8A 5CI6A 4JR3A 4LECA 4ZZMA 3R1SA 3TNHA 1CMKE 3HDNA 3A25A 5E2AA 3UP2A 1TQMA 3FMNA 3TZ8A 2JHCA 3BXOA 4XG9A 4JIAA 1VQ1A 1FBNA 1WAKA 2KULA 2RFEA 4FTOA 4LGGA 1OR8A 4E6AA 2W5BA 3NW5A 4EKGA 2YXEA 4ANLA 3OCTA 3CE3A 2X7GA 3DKCA 3FAAA 2X9EA 3VBVA 4C62A 3AC2A 1GIIA 2W5HA 4F84A 4MWHA 1H0VA 4F9BA 5E8TA 3VUHA 1YI6A 4MKCA 4PDOA 4WUNA 4F08A 3QA0A 4PNIA 1L3BA 2HELA 5E8WA 1M6YA 3ULZA 2B7AA 4RC2A 3G9NA 4D4VA 4CVAA 2ZAZA 4TY1A 2BHHA 3W2RA 2A14A 2BRMA 5CU2A 2X7OA 1QPJA 1V0BA 3G2QA 3WARA 1R39A 5TR6A 4DEDA 3LXPA 2ZB1A 4CV8A 3U6HA 5HKMA 5FXRA 5KMNA 3PX3A 2X0GA 2P2IA 3MA6A 3DH0A 5A6NA 2HW7A 4FV9A 3S0OA 3UQFA 4YO4A 4Z55A 2PE2A 3FMEA 4DH8A 2QE6A 3GEQA 4FTMA 4PYQA 2YCQA 2YIQA 4QMZA 5DRTA 4AE9A 3GRYA 3DXPA 3E5AA 2QNJA 2GNIA 3MDYA 2I1MA 3QD3A 3C6MA 3LXKA 4FV6A 5A6OA 3OWKA 2ZW9A 2JGZA 4KW7A 3ZO1A 3ERCA 3DBQA 1A06A 2WMRA 2UZNA 3KF7A 5EM5A 3GQIA 5HOQA 4P5QA 5FEQA 4RTSA 3G51A 5L2SA 4RIXA 1QAMA 4RT7A 2JITA 2VTTA 3ET7A 1LP4A 4R5YA 5IA5A 3RKBA 3NPCA 2UYHA 3AC8A 4FKGA 4DG2E 3DP7A 3NUYA 2R6ZA 1NV8A 4Y83A 5LCKA 4IWQA 3DS6A 4ASEA 3PY1A 4KB8A 5KZIA 2CCIA 3ANXA 3EVDA 4WRSA 4C4FA 4DT9A 3ER9A 4MQ2A 3KR2A 3T8OA 3GRUA 1NVSA 4QMLA 2PKWA 3TKHA 4DH1A 3QOXA 5EI8A 3VQUA 3MAGA 2BRGA 3BLQA 1WVXA 3BCEA 1KPIA 4H39A 3P2EA 4XLIA 1BX6A 4LOQA 3MYGA 4NK9A 3CQEA 3AMYA 4TWPA 3REPA 4DT8A 2OBFA 4AQCA 5IKMA 3CJTA 4FP9A 1AD5A 3QRUA 3HNGA 4WG4A 3BKBA 2OSCA 3HRFA 4U3YA 5IA2A 4GMYA 3QRJA 5CEMA 3GIWA 1NBHA 1PXKA 2PMLX 3TQSA 5EQEA 3TUDA 1FVRA 4QMWA 1FOTA 1S9IA 2JHPA 3CJRA 4R78A 4RTKA 3M33A 2C6KA 4GYIA 3FZPA 4JQEA 1TKIA 5CZIA 5IPJA 5D1HA 3H0ZA 2CN8A 2ITVA 3QQUA 4M0ZA 1GJOA 2VTQA 2Y6OA 3FMLA 2V55A 3GFWA 1YWRA 4O6EA 3TNQB 3UDBA 2AS0A 3NTVA 5HILA 3DZQA 1Q3WA 3QGWA 3D9VA 3SGCA 2WTIA 4I6HA 1DM2A 2CPKE 4FVQA 1KWPA 3BWFA 4FEWA 4FSTA 3W2QA 3R28A 4IFGA 5HTBA 5M53A 2OXTA 5BVKA 1ZRZA 5AWMA 3QZHA 4PYKA 1KV1A 3BYOA 2C5OA 2Q41A 4IVCA 3CJFA 3PDTA 1BL6A 3UZRA 4BY9E 4IC7A 3QRIA 4G2FA 5FQDC 2PWLA 3GUBA 2VGOA 3E05A 3KMMA 3DPKA 5AX3A 2ZDUA 3MTLA 1APME 3QQHA 4FI1A 4LV5A 3D83A 5TT7A 4IAKA 4MNFA 3EH9A 2GS2A 2GTNA 2RFNA 1L8TA 2XJ0A 3KXXA 2R3IA 3MSSA 1OBDA 2Q83A 4JNWA 3HMOA 4WNKA 4Y72A 2DUVA 4KBKA 4MNEB 4NM7A 4ZIMA 4EWQA 2HWKA 4KVZA 4WIHA 4I1ZA 5IQFA 3FTFA 4ACCA 1PF8A 5GINE 4LFIA 5U4XA 2OU7A 4TWCA 2W06A 5MHTA 3LCOA 4UZDA 4JAJA 4TWOA 5B2KA 4FKLA 2X6EA 4RLLA 2R3QA 4G3EA 4X2FA 5C26A 3LM0A 4CKJA 4KSPA 4IAYA 3JWJA 2OKCA 3DAEA 5H02A 3E93A 4BCQA 3P23A 3EGEA 3R9RA 3ER8A 4QPAA 4B7TA 3AGLA 1N7JA 2P0CA 4IHPA 2R9SA 4MD9E 1YVJA 3WOWA 2J2IB 5D41A 2P33A 3Q4UA 4K77A 4CKIA 1M0EA 4IDTA 3TTJA 2CKQA 2OFUA 3OTVA 3DJ6A 1ZYCA 3JXWA 3AXWA 4ITJA 3F69A 4IX4A 4FR0A 2OJFE 4L7SA 4RVFA 2R3SA 4RLKA 4IZAA 3SVZA 4EOQA 4X3FC 3PIZA 2GNFA 5ANIA 5BMMA 4QVGA 3QKLA 4LGHA 2HYYA 3OW4A 3EYGA 4I3ZA 4XV3A 3O31A 2FUMA 5GHVA 4BDFA 3PSDA 2VP3A 4IVDA 4FZAB 2J4ZA 4UWYA 5AUYA 2X8EA 4YUVA 4JBOA 3UA4A 5EHOA 1EH4A 4O81A 4FNWA 4QP8A 2JC6A 2X4ZA 2VAGA 4GFMA 2BRNA 3MJ1A 4TTHB 2BVAA 4I20A 4YZBA 5K3YA 3SMQA 3PLAE 1F5QA 3UODA 3ITZA 2I0YA 4P5ZA 1OI9A 3DCVA 4DFZE 3UC4A 4UY9A 4CXMA 3AC4A 3E64A 4K8AA 1NT2A 3ORPA 4Y85A 5IQGA 3U6JA 3VBXA 3NIZA 1ZGAA 4KDCA 4FTUA 1G60A 2HW6A 4FVPA 4AGCA 1VLMA 1YW2A 2IW6A 3V97A 4N0SA 2O64A 4ACDA 4JT3A 4IV8A 3T7TA 4YU2A 4K9YA 3QZIA 1YB2A 2AVNA 4F7LA 2C1AA 4O21A 2BAJA 3PXYA 2H8HA 5H3QA 2EX4A 3G2MA 5GOZA 3T3UA 3EMGA 3ALOA 4RA4A 4PMTA 4FK3A 2GS6A 1Y8GA 4KWPA 4PYJA 3BHVA 3PSBA 1OECA 3OE5A 4RFYA 2CKEA 2JDVA 3D7TA 3LKDA 2PUNA 3QD2B 4FGBA 2YIXA 2GNHA 3G88A 5FRIA 4ALWA 4Y2HA 3SSNA 4B17A 4JBVA 5FP6A 3AT4A 3MY1A 3VW8A 4C4IA 4XHKB 5IA4A 3GC7A 3V04A 4ZAUA 1AQ1A 2YDIA 1PHKA 2JDSA 4GK4A 3UIBA 5KMKA 1SQGA 4ER6A 2NXCA 5DT0A 4IWDA 3HP2A 2JH9A 3OCSA 4EHEA 3B5IA 2HZ4A 3BWJA 4M15A 5CSWA 5CCBA 1YQJA 4YHJA 4EKLA 4PWNA 4FYOA 3TFWA 4YV1A 1FJXA 4Z9LA 4QOXA 5EOBA 2FH9A 4FT5A 4AT5A 5KMJA 5EVJA 5FM3A 3AGMA 2JIVA 4FV8A 3NNUA 4P7EA 5HTCA 3HDMA 3EEOA 2OIDA 2QVSE 4EK4A 3AC5A 2XBAA 3PA5A 2JH8A 3QC4A 3I7CA 5AADA 4AOTA 5EHIA 4ZK5A 2IWIA 4EVIA 2B9IA 2XK3A 3OUNB 5EDRA 4IAZA 2YABA 1MRUA 4XV9A 3OXIA 3BGZA 4KKGA 3UGCA 3IW7A 2BILB 2VTRA 3RPOA 1P14A 1XBAA 4EH4A 3S1HA 2W17A 3P8ZA 1JTFA 4DM3A 3FUTA 5GWXA 5IG1A 4ZMEA 4FG9A 5I9XA 2VWBA 3JPVA 5J7HA 2G8NA 3NJRA 1KR5A 1XJ5A 2R3OA 1WVYA 4K6MA 3BGQA 5ERGB 3H3CA 4ANMA 4JQ8A 5IMXA 5EGSA 2YCRA 2PJDA 2OIBA 1IXKA 2PX2A 3BKWA 2UW7A 3FMHA 4O96A 3TMAA 1QCFA 1PKDA 2BALA 3JY0A 3ANRA 2WA2A 3ZBXA 4C2WA 4CFUA 2OY0A 4X6RA 5HE1A 5K0GA 2PY6A 2B1PA 3HUBA 4QMSA 2CGUA 2C7QA 4LG4A 5CSXA 3UNZA 4PONA 5HBEA 1BC5A 2C6TA 4FKRA 4RX1A 5LQNA 5HLNA 4LWOA 5FDPA 2NXEA 5EKOA 3VS1A 2ESMA 3HV3A 3NRMA 3PG3A 5KX8A 1GAGA 3RZBA 2EWAA 4FICA 4LYNA 5HO7A 3DU8A 3EFKA 3KXHA 4CKRA 5BP7A 5ANEA 5GNKA 4O0WA 2HZ0A 2QOOA 2CMWA 3GU3A 1JKLA 3GGFA 5E8YA 4R7IA 3IV6A 4AOJA 4L3PA 5JK3A 3HYHA 5D9HA 4I5HA 5FTQA 2IFTA 3R6XA 5CVVA 3TNPC 1JG2A 2RKUA 1E1XA 2C3KA 3PWDA 4AUAA 2F57A 2BPMA 3LVPA 4NU1A 4MXXA 3P86A 3BLHA 1OZ1A 2XK8A 3MPMA 4YJOA 4YTIA 4PMSA 4EQMA 3BRBA 2BTSA 2P2HA 5DRBA 1GY3A 1ZYJA 2R5TA 3DTWA 4LWPA 2UZ4A 4UOEA 5J9ZA 2OZOA 5EH0A 1OKVA 1WFCA 3GDHA 1R1WA 1BHJA 3JVRA 4AX8A 4OW8A 3UVQA 2O05A 3N4VA 3EQHA 4BYIA 3GCQA 3RIEA 2W96B 3A62A 5LQJA 1OKWA 1ZHFA 3QCQA 2BAQA 1J3HA 1Y6AA 4PF4A 5AV1A 1IA8A 4XCUA 2WMQA 1XQZA 3W16A 3G7UA 3UJ7A 5ICPA 3NUSA 3OOGA 2O63A 2CWWA 4K0YA 2F2CB 4B6LA 2OKRA 4BTFA 4GFGA 4U5JA 5C9ZA 3NWWA 3LLTA 3HUCA 5E9QA 1UFKA 4IAIA 4RBLA 5CSPA 3HVJA 4XUEA 3MVLA 4AUKA 3ZLXA 2I0HA 4WOVA 3HCDA 1SNUA 5HE3A 4JX3A 3AY0A 4E4LA 1RE8A 4XLVA 2YUIA 4L9IA 4F99A 4M68A 3E63A 3O50A 5CVJA 1Q8WA 5BYLA 2CNUA 5JQ8A 3AJDA 2ZBRA 5CCXA 5ICCA 4PTCA 3DLIA 5JH6A 4RFMA 4A9UA 4R3CA 3SG9A 1E1VA 1Y91A 3IOKA 2GHMA 3QTXA 1OGUA 4XRLA 1JSVA 5CY3A 3VNTA 4CMTA 2DPMA 5F94A 5JMSA 4IAAA 4B4LA 4S31A 3QV2A 4GOOD 1BUHA 4YP8A 2QOHA 2HY81 2X2LA 1I09A 1KYWA 3HCFA 1YXVA 4TYEA 4HPUE 4U42A 1X1CA 2Y0AA 3EFJA 5DI1A 4QP1A 3MFSA 4O82A 3RP9A 3NAYA 5L6WL 3QTRA 5LR6A 4F9WA 2ZZKA 2E9VA 1EQAA 4RVHA 1IY9A 3OU7A 4XUCA 3T9TA 3NCZA 3KQWA 3C4WA 4H58A 1Q8ZA 3HCBA 2YDKA 4BIEA 4YGAA 5A4QA 4CKEA 3M2WA 3QQFA 4E2ZA 3HECA 1WS6A 2B55A 2R3PA 4TW9A 2BZJA 2WXVA 4HYIA 5A4LA 3FL4A 5KO1A 4BI1A 4DG0E 4BB4A 2HK5A 2AYPA 5IQIA 3RPSA 2ONLA 3RVGA 4E7WA 4QPSA 5FEEA 1PXJA 3TT0A 1XDZA 4MBLA 3PT9A 1H1SA 2C4GA 3KEXA 4H1MA 4NL0A 1V0PA 3G90X 4UYAA 5AUXA 2WOTA 4BCPA 5HLWA 3EN6A 1E9HA 2GNGA 2JLDA 5L6PA 4EYJA 2GLUA 1W82A 1PXOA 1SNXA 4H1JA 4XJ0A 2QODA 4S32A 4ZEGA 2ZULA 4QMYA 4GC9A 3R04A 4NW6A 3SD0A 5ANDA 4YUXA 2VN9A 3S2PA 4BZNA 5EI6A 5L2WA 4K1BA 4TWNA 1DI8A 3GC8A 2XK6A 4PDYA 3EJ1A 5DPMA 3ZC6A 3OFMA 4DF3A 5KKRB 4BLUA 4CTJA 4RVLA 4O38A 3P7CA 2AVDA 2P40A 5FHRA 5DWQA 4AT3A 2C0IA 3QUEA 3DMHA 4C61A 4GT3A 4PIPA 3EPPA 1Y6BA 4J71A 1PKGA 5BVOA 3ACJA 5HCXA 3IOPA 3GCPA 1VIDA 3A7EA 2P41A 4V0QA 4QMVA 2W9FB 3MVHA 4Q9ZA 3OU2A 4X6QC 3U9NA 3Q4TA 5ANJA 4E1ZA 4H3PA 2PVRA 5D11A 4C4EA 4QQ5A 2ZWAA 4YV0A 4L7FA 3UFBA 1WXXA 5DVRA 2JD5A 4C05A 2JDOA 3PVGA 3R73A 3VS3A 4U80A 4EZ5A 1TQIA 2UZDA 3NNVA 3V8TA 2VWUA 1R74A 3LSTA 4I6QA 4BLWA 1Z9XA 1T45A 4NWMA 3FC1X 4RGJA 5DHJA 1X19A 2LGCA 5IEYA 3PE2A 4BDEA 5KQSA 3A7HA 2BZHB 5T64A 4CTKA 4PY1A 2F9GA 1UU9A 3I79A 2YZAA 5EQYA 2PV0A 2IZUA 4KINA 3UNKA 3FRIA 4BLVA 3WZDA 4IKPA 5EI2A 3MWUA 4X41A 4QYHA 3RHXA 3W8LA 4EOLA 5CU0A 2I6GA 4MXAA 4P7JA 2YM7A 3EL8A 3D15A 4IWNA 3VIDA 1T43A 4ZZOA 2G2FA 4ZSAA 4O7RA 1I4WA 5M56A 1QMZA 5A4EA 1FP2A 3UYTA 3DTCA 5CU3A 5KZ0A 2WU6A 4ZSGA 5T3QA 2IW9A 3VQHA 4YV2A 3S4QA 4PNKA 3LFNA 4U7TB 1OPLA 4EQZA 4RVTA 2NPQA 3QQLA 3QL8A 3FI3A 3IPHA 2ZM1A 5HVYA 3V5JA 4Y73A 3AOXA 5KE0A 4AZSA 4E6CA 4ZTMA 5M06A 3AXTA 2C6EA 4BVUA 5HNGA 4HTFA 5ICEA 3HX4A 2V62A 4AGWA 2QOIA 5E1DA 4G34A 4FUXA 3G15A 4HJOA 3MVMA 1O9GA 5JZNA 5IDPA 2O3PA 3DLZA 1Q61A 5M4FA 4WT6A 4F65A 5CAQA 3QRKA 4B8MA 4F9YA 4I5CA 4CMOA 5AMNA 2G1TA 2ITNA 3CC8A 4DBNA 2ZMCA 3F3TA 3R9OA 2F4JA 2QO9A 5CAUA 3JWGA 2QO7A 3IONA 2HIWA 2WMXA 4Y95A 5I9YA 2ZBQA 4RTQA 4I4EA 3RAIA 1YFLA 3ATSA 3QTUA 4C3FA 4ENXA 2W5AA 4R3RA 3UOKA 4XBUA 3ZO3A 5JGBA 1EJ6A 4DLIA 5GM1A 4F4PA 2YACA 5HG8A 4BZDA 2GTMA 1GOLA 4EH8A 3R30A 2PVNA 1VPTA 2YTZA 5HX8A 1VEBA 1QPEA 2WMVA 4KKEA 4UYNA 2C6OA 4C4GA 4QQTA 5C4LA 4IV0A 4OGRA 4C07A 3MH3A 3KVWA 2QU5A 1CKJA 2PULA 2W1GA 2ZM4A 2DS1A 3SRVA 4BTJA 2X6DA 5M08A 5EKXA 1PMVA 2BKKA 2QOLA 1NY3A 5HG9A 3K0BA 2B3TA 2QCSA 2V0DA 3FWQA 3MB7A 2PU8A 3ZHPC 1RI1A 2WNTA 3A99A 3FUPA 5HD7A 3UG1A 2XKEA 3MTFA 3W10A 3MN3A 5I9ZA 2UW6A 5CU6A 3Q9WA 4D0XA 5HIKA 3MBLA 4NSTA 4USEA 2WD1A 4J95A 3ZDUA 4DFBA 3VN9A 5KVAA 2VX1A 2X8DA 3LM5A 3QD0A 3OEFX 3QTWA 2P35A 5LVOA 4M37A 5C8KA 3EOCA 5LQUA 4DAWA 4R3PA 2LAVA 4TL0A 5J1WA 2AN3A 4FIEA 4FEQA 2W1HA 3R83A 3FMKA 5CEIA 2VWZA 1FGKA 2CKOA 1PYXA 1RJBA 4IB3A 1UU8A 3FXXA 4JG8A 4IM2A 3MB6A 4PL5A 4RQKA 1M7NA 2XNOA 5D7AA 4XUFA 3DOUA 2NP8A 5EPEA 2ERZE 4YJNA 2QOKA 5A3XA 2H96A 5CEQA 4P90A 1KSWA 3FUWA 3HKOA 4YHTA 1VZOA 4M8TA 3G89A 3F82A 3OFJA 5KHWA 2XRWA 2C3IB 3D2IA 2BIYA 3GNIB 5FGKA 4G1WA 3R7OA 3ZZWA 5H8GA 4EZ3A 5KCVA 3PJ2A 2C69A 1D2CA 3EMBA 4AZWA 4E2YA 5AM6A 3R0QA 4KDRA 5LQFA 4D1XA 2QKRA 2DQ7X 3E88A 4I24A 2XKCA 3O8TA 1UNHA 2O2UA 5C01A 2AOVA 3HRBA 1OL5A 2E9PA 4CLIA 3PVUA 5BVDA 4CWAA 4DCMA 2RFDA 4IQ6A 5G1XA 2PXCA 2WTVA 5EMKA 2R0IA 2C6IA 3V5LA 3COKA 2Q0NA 4BDDA 2XH5A 4EL9A 4FEXA 3FPGA 4ZY6A 3E23A 2PVMA 3GC9A 1YOLA 4AE6A 1R0EA 5E8SA 3PJ3A 2FGIA 5DFPA 3TTIA 3LFBA 4DEIA 2ZTHA 2DYLA 4ZTRA 3ZO4A 5EIWA 5AP3A 5AAFA 1J91A 1R6AA 2XP2A 3CP9A 3CPBA 3DV3A 3E92A 4N4SA 2VS1A 3IDBA 3IS5A 2AOUB 3PFHA 2BRBA 4EOMA 4BDAA 5IH6A 3SSOA 3HAMA 2YM8A 3MI9A 4ER7A 3U4WA 2VO3A 4FV0A 1OKZA 4M3QA 4QP2A 4EOKA 4TRLA 3WYXA 4RWZA 4Z16A 5EMLA 4X3FB 2NRYA 2Z7QA 4FV3A 5CALA 2HZNA 4XP3A 5DN3A 2JKOA 3BBWA 1KP9A 1P4FA 4O7NA 5ICGA 1GIHA 2CN5A 3TKYA 4E30A 2XYUA 2QKWB 3C3PA 4GH2A 2QD9A 4GW8A 2ITQA 2Y4PA 1UWVA 1GZKA 1H4LA 1VJYA 1ZOHA 2X4FA 3QU0A 4FL1A 4IAFA 4EQUA 4F09A 5E1MA 4RWIA 4XX9A 4AWIA 4WVLA 3KVXA 2PBFA 1W8CA 4P7GA 3JY9A 4HCUA 3MCTA 3LFAA 3W55A 4PRJA 1H8FA 1RI3A 2OICA 3HVKA 3OCBA 1YXSA 2PY3A 5D7VA 4DITA 2DWBA 4J52A 4F86A 1X1AA 4FV1A 2R7IA 3OC1A 3Q9XA 2GMXA 2E9NA 5EHYA 3V6SA 4Y46A 1ZGJA 3FXZA 1TQPA 2UZWE 2CHLA 5J5SA 3FI8A 2YCFA 3EFLA 4IH8A 4NCTC 4U0IA 3FV8A 4DTAA 4PP9A 5JGDA 2O57A 3P71T 2HXLA 4EBVA 1Q8TA 5FD2A 3AXSA 8MHTA 1I44A 2A2AA 2R2PA 1TW2A 3GFEA 1CTPE 1LEZA 5C8NA 3R8MA 3IW5A 1MQBA 3ZZEA 4BDHA 4IFCA 1NE2A 3LMGA
chains in the Genus database with same CATH superfamily
4FKZA 3NUUA 3ZSIA 2C9DA 2C3LA 3L9NA 3OWJA 3ZXYA 5C0OE 2VO7A 4JUDX 4HVHA 2BHLA 3VU9A 1FE8A 3EMKA 1SKMA 4WZAB 1JFRA 4NH1A 4G31A 2QRGA 2IH2A 4Q9IA 3P9IA 1WMKA 1QIGA 2NX2A 2B9JA 1J2YA 1KS2A 4F45A 4IOKA 3EK2A 2CJWA 4KWCA 2I4IA 5CURA 3KQNA 1QBKC 4I9HA 4BN1A 3ZCLA 2COUA 3OPQA 3IAHA 3AEKB 4A8TA 5BV3A 1AQYA 1Z6GA 2X6QA 3EKNA 1AB5A 4EWHA 4HO1X 3MCZA 2Z9CA 1T4GA 2IDZA 4HN4B 3F4BA 1F3OA 5BQ3A 1LTKA 2PVJA 4N0MA 5JZMA 4GX0A 2UUBB 3CEPB 3SICE 1JQ5A 4I0RA 4UM8B 1WPQA 4TKLA 3MXTA 1RQLA 3FM9A 3T3MB 3LFUA 5TIIA 4QBGB 2UYGA 4HVCA 4NLLA 1OL2A 4A9YA 5DOVA 4HUQB 1ZJ5A 1ZEMA 4Y1RA 2WWHA 4KQGA 4ZZ1A 1K1EA 4NARA 4GP6A 2A27A 1YZHA 2O2DA 2RG5A 2OUIA 1G6Q1 1RLJA 3I6ZA 2XDQB 4U9HS 4C7VA 1Z2OX 3EQGA 1JEOA 3TNDA 5C1OA 1DRWA 2BL4A 1V25A 2WJGA 1E6LA 1Y3BE 1UNGA 4X63A 4GSBA 2ZUDA 3MIIA 4H6VA 5TQVA 1IVSA 1NW9B 1L7MA 3M9XA 4RFZA 2I55A 2RKOA 1YULA 5THKA 1NN3A 5EKUA 5DE2A 4D3DA 4MUAA 2ZWIA 1RLTA 4L74A 4XJSA 5KI6A 3WBLA 3K09C 5ICFA 5KTTA 4HRAA 2WDPA 5CVFA 3BQRA 1MB2A 1R0XA 3VVCA 1XH6A 1FFWA 5BX0A 5G4LA 4LJKA 1N0VC 1WU8A 3EUEA 3GBPA 2H52A 4OX9Y 4XGKA 2DCMA 5DP1A 4ALKA 1DRUA 4FT3A 2RHCA 3FUVA 5D51S 4D9TA 5L2TA 1KFBB 2WQBA 4BNJA 5A03A 1QS0B 2CYBA 2P3QA 4EG0A 4HL6A 3BEAA 3OW3A 3H2JA 4A6EA 4FSYA 4M0KA 1EFRD 4A9SA 4UZEA 3VSAA 1IL0A 1QYIA 4KODA 5KQRA 2JAWA 4OXQA 4RJKA 2MYNA 3UV6A 2KQUA 1Y81A 4KFRA 5D3ZA 1W5SA 1BD3A 3HJBA 1T34A 2Y6MA 2VP5A 1FSFA 1MJFA 2JGDA 1BA2A 1C4KA 1GZHB 4YRTA 1RXIA 3SJ7A 3ZS5A 4P36A 1AM4D 2OC9A 1F2UB 1SCJA 1K2WA 1P31A 2EKLA 4MIEA 4U39A 2B0QA 3CY2A 4XUDA 3HDHA 1KVTA 5LDGA 1P9OA 1U0HC 1SG9A 3DDPA 4ALLA 3P26A 2CUKA 4DLYA 1KP3A 2FZGA 4G4JA 5IA0A 3OTQA 3I9JA 2I7QA 2WWYA 1HDGO 4Z7QB 1G3MA 1LWNA 1GP2A 3EXIB 4MVJA 5L4SA 1YZQA 3H2ZA 2O3SA 4IR7A 1NL3A 3DAGA 2R1UA 4IO0A 2GN4A 2FCRA 4G17A 2EWMA 3G33A 2Z1MA 3DLPX 1UDBA 1H01A 4TL9A 4EONA 2OXXA 3O95A 3UZTA 3POZA 4TKVA 5A2QA 3R1YA 3I6MA 3P9NA 5IXYA 1CP3A 3E7DA 2FSIA 2FYTA 2XSZA 2CNDA 5HRAA 4QTBA 4X1IA 5HIMA 3LP6A 1WQ4A 4C38A 3SYRA 3D6AA 3NP7A 2QT1A 1TQ2A 4CM4A 3ORSA 1R3UA 1XMOB 1R00A 3WF6A 5HU3A 1L7RA 3C2QA 4XG7A 5EZSA 4Z99A 1MP0A 3B60A 2QHMA 2QRLA 3L07A 4RH3A 2PVSA 1NVTA 2AJDA 4PWYA 4IIJB 1FYEA 3H05A 1A8QA 3GVPA 3GLGB 2JAOA 1XPOA 2C1ZA 1K75A 3U3MA 4R2IA 4G4GA 1LQTA 2A9RA 3L8DA 1P0CA 4ZDWA 2G07A 2QN6A 4HOKA 5HOEA 4KR7A 5DR6A 4CG1A 1R7RA 1X7ZB 1AOXA 4RD2A 3KC3A 5DCUA 4R6WA 4R3UC 3IAUA 4DR6B 4PLGA 2QSZA 1JR3D 3SKXA 1ZMXA 1GNTA 4Y7DA 4GZLA 3EL7A 13PKA 3AFGA 3U13A 3IJRA 4BCNA 2BTOA 1TZ2A 4NE7A 3EBOA 3LRXA 1YXMA 1F8XA 5IF1A 2E2BA 3QXSA 3FHLA 2VNWA 4GMKA 3FVVA 4PUZA 1V5IA 4D1SA 3PUHA 4JKIA 3O73A 4IICA 1OZGA 4IDBA 2GD2A 4HYUA 5DIAA 2JZNA 2WWRA 3ZCXA 3RYCA 3PXRA 4G63A 4AECA 3K2IA 5EXXA 4FIIA 2XODA 4WXEA 4XYLA 4HVGA 4BMYA 1RWMA 1BEEA 3DYBA 2WG2A 2QPTA 3ZDQA 5EJ8A 3AI3A 3ZV6A 3EHEA 4YZDA 3V2UA 3UYLA 4PZPA 3M6XA 2F3QA 4YO6A 1K89A 3NXSA 4M36A 5B2LA 3K5VA 3HCNA 2I0EA 4A8JB 1K8QA 4V0KA 5IEXA 4I5IA 3ZFXA 3CMMA 5SZHB 1ODSA 3UMYA 1U3DA 3EZFA 4FW9A 3SXPA 2WB8A 1PJZA 3QALE 4ZO8A 2VDVE 4OQDA 3D8RA 2J0SA 5IM5A 2WIAA 2ONKA 3EC2A 1N2EA 3K5IA 3FCAA 4BNLA 3KKPA 2WE7A 4JJZA 4E3ZA 4ZI7B 4EJNA 2ZSJA 4Q7QA 5BSGA 1GRVA 2YXNA 5LIPA 3QEAZ 3TIFA 2FDCA 4R01A 4MPJA 4DHZA 3KE8A 3KHSA 5BN4B 4A06A 4V04A 2ZU0C 4DFYA 1JZTA 1V7PC 2R8RA 4E5NA 4Z3VA 4D0WA 2VX0A 4UBJA 2O3RA 4RSSA 1T2CA 2O0JA 3QLUA 4QU0A 3JYQA 1Y8RB 2W4QA 4XASA 5ALRA 4GBJA 4GDFA 3QD4A 5T6KA 4PYLA 2BMCA 1G8SA 4UN0C 4HGOA 3E6AA 5IDWA 1X15A 3HPRA 4TKSA 1FYVA 3MSCA 3W6PA 1ZNZA 1AS3A 5AA8A 2IXEA 2I03A 1UBGA 2QU8A 4M49A 2QPLA 1Y9EA 3S7ZA 1ECFA 1O0BA 5E91A 4EG6A 2WYHA 3W9YA 2I2DA 3DOJA 4V3BA 5KVSA 3NX4A 1NSYA 3RVSA 1E2LA 4UMVA 2PCLA 4JG7A 2Y1CA 2OO3A 1TCBA 3ND7A 3DD5A 3C74A 2OQIA 4L9SA 4PYIA 1T9KA 4YCJA 3A4TA 2FX5A 5A9UA 4JAIA 4Y1GA 1ZRSA 5J87A 3RSCA 1PYEA 2VXBA 1BHQ1 3PNYA 4COOA 1U65A 4BFVA 1XEWX 2BBSA 2VPXA 3KEMA 3E3MA 3ZU3A 4FKJA 3AV0B 2M6RA 2Y0EA 4YK7A 2A1IA 1DT5A 4ZY5A 4C4JA 2X3FA 4BLQA 3FLSA 1L0BA 4AWXA 2ZVDA 2Y7JA 3ZY5A 5BT9A 4XEUA 4EG5A 4FTKA 4PZ0A 4BO1A 4KG7A 1OX4B 2Q0QA 4TTRA 2FPUA 5LU9A 3TNIA 3LNTA 1VBFA 2OBLA 4KZPA 4D28A 3LCJA 1U9JA 4OOFA 3NYXA 4UXHA 2V22A 1R0RE 1U2ZA 1SCBA 1IC6A 1NT4A 1CUCA 3F3VA 3IIMA 2XK7A 1XBBA 2H1RA 2HA7A 4FNMA 2ITXA 3M6VA 5JQGA 3UIUA 2BRHA 1JVBA 4EHZA 3AVQA 3BU5A 1QUEA 2LKDA 2UYOA 2WQNA 2JFHA 5CUQA 1FDIA 4X1YA 3GJ3A 3NBZC 3E4DA 2BFXA 1UDWA 4CKBA 2Y93A 4X7MA 4XLTA 4HMPA 3RC3A 2VH5R 4X3FA 3BHYA 3CZRA 1PJRA 1YHWA 1Z38A 3R5FA 1LH0A 3QU4A 2O3TA 4NM0A 5AA9A 3JQ6A 1LDYA 3IKLA 1Q6YA 1T2DA 3VR1A 4EH2A 4RTNA 2Q5IA 3VNRA 2F2UA 3L82B 3NEYA 4G1FA 3BA1A 3DULA 1B74A 3K9BA 4OM8A 3R3HA 4OSOA 2XKBA 4Q39A 5F7XA 1UPCA 1QIEA 1UNLA 2W6QA 1V1RA 4XOUA 1KNXA 4DDTA 1V45E 4F72A 3PA4A 3H9CA 4KIOA 1T36B 1KFKB 1JXOA 2I1QA 1A9SA 4PAGA 5JWRA 3ZEPA 3Q2KA 1EGVB 5HKAA 5JLJA 4L5IA 1YVEI 5EKNA 4WDQA 1OIRA 4YUZA 2BI8A 4YRGA 3LQ4A 1L8XA 3TOSA 1RM4A 3HVIA 4MR8A 1KHHA 3PNKA 2OG8A 5D12A 4U02A 3LVRE 5AIKA 5BSVA 4PGMA 4O08A 4BO4A 4QXRA 1DX4A 1E1MA 1DRKA 2W2MA 5K4IA 5ARCA 3PQ3A 3R9IA 3O4HA 3V1MA 3NAZA 4YRBA 4RQUA 3AUFA 2DHDA 3PRIA 3A9TA 5LWQA 5EE3A 3BXEA 4BKJA 3FPKA 3NAXA 3DDQA 4TLMB 1PEDA 3A9SA 3S44A 2JFUA 5IKEA 4H08A 3PHLA 4PLTA 2Q2QA 4WNPA 1OXVA 5ANRB 4LZAA 2ODPA 1ULTA 3C4EA 4F06A 4QMMA 2JBHA 2VC2B 1Z83A 2O0LA 4FSUA 4EHLA 3AP3A 4MUGA 2ORED 3ZBUA 1TVKA 3N2EA 1XTRA 1Q1BA 4UDYX 5LNK1 3Q72A 3TAHA 4YURA 4CQMD 4DLTA 1E96A 1N5DA 3RWBA 3AF1A 4FSZA 1VJCA 2FJ0A 4ZOCA 5AM2A 3ZU7A 3P2IA 3AESA 5LM3A 4YJ2F 1IQ0A 4AN1A 1LPBB 2GO1A 1GXSB 1ZINA 4RKRA 4UCQA 4HSGA 4ZYYA 1D6MA 4HP8A 3PQ2A 4B3TB 4F9CA 1KJ8A 2GBGA 1QHXA 4I41A 3IERA 4O6VA 4GYWA 1ZWLA 2D5CA 2G1PA 4IXWA 1FQOA 1BOOA 2GM9A 4DIUA 3OQHA 1NV9A 4YNOA 4YCAA 3BRSA 5EUBA 3WB9A 4NK4A 4RTRA 1UK8A 5IK2A 2OORC 4EQ6B 2GDJA 3WSWA 2IOQA 4OTFA 4TT7A 3LOKA 1P2UA 3VI3B 4EJSA 2XMPA 5IMSA 5A6VA 3N4UA 4OI4A 3C5WP 1JFLA 3QUBA 4IDAA 2ZI7A 3LXLA 4ARZA 1YDTE 4RD1A 2Z43A 2J3EA 5GJFA 3B8HA 5AP0A 3F1KA 3WRYA 3L0BA 1EYZA 2VEOA 4D8YA 3ZQUA 3JQBA 1UR5A 2CV1A 1UK9A 1QF7A 3E8SA 2HW8A 4CVNA 1E9EA 4O25A 5B7PA 4PYMA 2G2HA 2HWYA 4UVGA 2C0PA 4RVMA 3D8TA 4INOA 2R4TA 3KQLA 4AVYA 4ZTQA 1Z33A 2Q9CA 4PSVA 1HDCA 4EJ7A 4J7XA 2XNHA 2Z83A 3BQMB 4NG5A 2IYXA 2XA2A 4YMLA 3OJCA 2JGRA 2FSUA 3I1FA 4BYJA 3ZNOA 1WQ1R 2WABA 2EL7A 4KLAA 1A48A 2N1MA 4Z7GA 4KWIA 1RXYA 3GUZA 3BQ9A 3S8MA 2W05A 3EHDA 4YCCA 1GUDA 4S1OA 1Z5GA 3EOAI 4TS3A 3CLVA 3OZUA 5CVGA 3AF3A 4XIIA 4P33A 3W8NA 3RARA 5AOAA 1GFZA 3ENWA 4D41A 3GPBA 3MS4A 1E69A 3PKJA 3IECA 2YHVA 1N5RA 2OFXA 2VZ8A 1M74A 2WM3A 2J5RA 5E2AA 4XG9A 1ONSA 4FMBB 3PFYA 3Q3VA 4WJKB 3VBVA 1JG6A 1LX6A 5E8TA 1YI6A 1RYZA 3C6QA 1M1YE 3ITEA 2WF6A 3FMPB 2VT6A 3TMKA 2BFWA 1KJZA 1WR8A 1Y6RA 5FXRA 4QPCA 2NN3C 3E9CA 1OUMA 2G5GX 5HSGA 4TV9F 1R8JA 4KW7A 5TLSA 3DBQA 2WMRA 2IYEA 2QRPA 5EM5A 5FEQA 3G51A 2ECFA 1DFHA 2XALA 4I50F 1R4NA 1IPEA 1JQKA 3TKHA 3T0GA 1AJEA 5ALIA 1MHPA 4G07A 3QBTA 1GTSA 4AQCA 5JPDA 2OO7A 4EITA 3HNGA 4W5HA 4WESA 2OSCA 1SKYE 2EXXA 1RADA 3HRFA 1NQUA 3EPRA 1EVYA 4GYIA 5IAKA 5D1HA 4M0ZA 4KQWA 1IE3A 4O6EA 3QE9Y 3WIBA 1OYVA 1DM2A 4BN5A 4MW2A 2ZIXA 2C5OA 4IVCA 4G0ZA 1JFFB 4G2FA 2WP0A 3GUBA 4C0JA 2O4CA 3ASZA 1DWUA 4IAKA 4JNWA 2I5PO 1PGQA 4I1ZA 1G9TA 2W06A 4TXMA 4JAJA 3A10A 4EHJA 2ZRIA 2X6EA 1B7GO 2G0NA 3ORQA 4ESEA 5D41A 3GUUA 3TTJA 4YRDA 4O2LA 4IX4A 4KQ6A 2A86A 1SBIA 3VZBA 1NW6A 2BVAA 1SVIA 2N42A 4XWOA 3CCCA 3A6DA 3LUKA 3K9GA