2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
b'MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
4XBUA 2O05A 3R6TA 3LFSA 4E5AX 2PE1A 4AU8A 3PXYA 3QC9A 4FTAA 1SMHA 4TW9A 4YUQA 4KIFA 3NLBA 4RFMA 5EG5A 2CPKE 4CEGA 4AF3A 2WEIA 4TZRA 3MJ2A 2Y7JA 4QP8A 3WYXA 5JKGA 3FYJX 4B0GA 1D2CA 3MCTA 3V5LA 3V04A 1B42A 3C6MA 5HNBA 4ER3A 3L9NA 3JY9A 3IDBA 4AE9A 4AS0A 1TPYA 3AMYA 2PULA 4YJNA 3ZBXA 3P9KA 3QTXA 3PX3A 2WZJA 5M53A 4YUWA 3R24A 2X8IA 2C0IA 2YIQA 3KPJA 1V0OA 4BYJA 4ZIMA 2YABA 3SC1A 4YUVA 3AXSA 3PZEA 4MXAA 4PYQA 5B2MA 3DXYA 5K09A 3TNQB 1I1NA 2JDTA 4IX4A 4BCOA 3IHTA 4TKSA 1MRYA 3TN8A 3IW7A 2ZOQA 4RJ4A 4F7SA 2Y4IB 4LUDA 4B4LA 3HKOA 2QQ7A 4GU9A 3FWQA 2QO7A 2I6GA 10MHA 3IG7A 3MDYA 3KRWA 2OZAA 4CKEA 3B2TA 4CRSA 4EZ5A 1FPQA 3W1FA 4AOTA 4ATNA 4XUEA 1MRVA 3TLJA 2JH9A 2OBJA 3PG1A 1JG4A 1NW1A 3IOPA 3JYAA 3ZSGA 2QR8A 5JT2A 3KN6A 4QYFA 1YDRE 3F5XA 3VHEA 2PLWA 1X8BA 3UNZA 4FTOA 4PDPA 2QODA 4UWYA 4DG0E 3GNIB 2I0YA 3FL4A 2OJGA 4ID7A 4AGCA 1H08A 5CIYA 4M15A 4J71A 3PY3A 4IAZA 1YXTA 2BAKA 3R9HA 1IASA 5IQCA 1XVAA 4RTOA 1P5EA 4XLVA 4L9IA 5A6NA 4FEVA 2J51A 4L7VA 3D5WA 1UU8A 2BRHA 5E91A 3BPRA 2WMVA 1YKRA 4FGZA 3D83A 3E7OA 4EVIA 1H1WA 4IJPA 4F9YA 4FSXA 5A6OA 4YSJA 1UKHA 1ATPE 4O0SA 4C3PA 1PKDA 2W5HA 3QUEA 2E9NA 3PJ1A 3LFAA 1G5SA 3SXFA 2ZULA 4MAOA 3D15A 3HTXA 2R2PA 3OWPA 5IPJA 4AG8A 4B99A 1Z57A 4IADA 4RMZA 4ITHA 4LMNA 3AT3A 5CF5A 1VZOA 4ANSA 3UIXA 5KHWA 2XUUA 3HP5A 5C9ZA 3GC7A 2Z6QA 2ZWAA 5A4TA 3ACKA 4C62A 5ERGB 5DRDA 5P8WA 4X3FA 4BBEA 2ZYBA 5EQJB 2BCJA 2YCQA 4E6CA 1L3BA 1H07A 2BTRA 1IAJA 2ZV7A 2VTNA 4RV9A 4MQ1A 3BGDA 4XP0A 3R73A 5JGBA 4FNZA 1FVTA 2YM4A 1WG8A 4I4FA 4CFVA 5HQ0A 5DIAA 3GNLA 3MPTA 3T3UA 4Z55A 1QAMA 3QTRA 3PPZA 3MVLA 3MGYA 3NNXA 4XP3A 3B89A 4DEHA 3W2SA 4M8TA 3FPEA 5KO1A 5EQPA 4C34A 1OKZA 1YFJA 3OMVA 2YZAA 3GWZA 2KULA 2BPMA 4PYIA 2J0KA 3HA3A 2G1TA 2AN4A 2JKQA 4GJ2A 2CL5A 3BEGA 4PYKA 1JQDA 3BE9A 4YZCA 2X8DA 4XEYA 1JVPP 3T9TA 1ZMVA 3RHKA 4E30A 5K05A 1YI3A 3QKLA 3FLSA 1VYZA 2VWVA 4DH7A 4OBOA 1AV6A 3NIZA 1JSUA 2YFXA 3G88A 3A7FA 2P2HA 4IWPA 2UZUE 5EOVA 1M7NA 4MIKA 2X4FA 3AD6A 4PCAA 2WNTA 3E3BX 5EW8A 3Q2JA 3RM7A 4F09A 4FOCA 5A4QA 1W84A 2XIYA 3IYLW 5D41A 4DYMA 4ZTNA 2VNYA 4ZSEA 2YIXA 2WTJA 4O6EA 5CAPA 2OFUA 2KTYA 2W9FB 4E4LA 4MKCA 3TZ8A 5EYKA 2IFTA 1P1CA 3P71T 3QXPA 2RFEA 3PXFA 3CBLA 4APPA 4UYAA 3B5IA 3TV6A 3NUYA 4DA5A 5CF4A 3VUHA 3LQ8A 5HTCA 4Q9ZA 3TEIA 2BTSA 3WSTA 4U44A 3ZYAA 3R04A 4RIXA 1Q41A 2XK3A 1PMEA 4K77A 2ZV8A 2EB3A 2NYUA 5HU9A 3D2IA 4YBJA 2IW8A 3VS1A 3LCTA 3P97A 4BCMA 2ETMA 4FOBA 3GCSA 4MWIA 3HUCA 4BCGA 5FWAA 1YXXA 5FEQA 5CVEA 3BYMA 3FSKA 2VZ6A 2B9JA 3FXZA 4JLCA 5CEKA 3UO5A 4F70A 1F3MC 4XG9A 2WMWA 4YGAA 4LRKA 1MQBA 4BGQA 3LKDA 2OY0A 5E8RA 3HA8A 4OTIA 4PGGA 1R6AA 3F3UA 2UZTA 2UW6A 3MB7A 3Q60A 4QMUA 3V8WA 4AA0A 2CN5A 1VYWA 5ANEA 3MSSA 5H3QA 5KKRC 2ZB0A 2FUMA 3WZKA 2W1HA 3LIJA 3V6SA 1OL5A 4J97A 5FADA 1I4WA 4D1XA 5CQWA 2X1NA 2QOKA 5JFXA 2QNJA 2W06A 4FE2A 2OXXA 3P7AA 3DY7A 3VBXA 4IFGA 4DCEA 5DT0A 2C1AA 5M55A 3BT7A 4FGBA 3N4TA 4MXCA 5DWQA 4PY1A 2XVDA 2C1BA 4JBPA 2C0OA 5CU2A 3FI4A 2AR0A 2QG5A 5K3YA 3GGFA 3CQWA 1DCTA 1ZHFA 4O0UA 5HKMA 5M07A 3D7TB 4IZAA 1H1QA 2J0IA 1PJZA 4H1JA 3OROA 4LRMA 5CENA 5IQAA 1EIZA 3R8VA 4AWIA 4BIEA 4GUAA 3MVHA 2OW3A 5DNRA 3LFFA 4O81A 3PVUA 5CF8A 4ARKA 3R9XB 5K5XA 1OMWA 4TYGA 4ZZOA 3UJ7A 3NR9A 4BCIA 3NIEA 1DS5A 4JBVA 5JUWA 3BYUA 3WIGA 4XV3A 2XKFA 3AT4A 5GINE 1VQ1A 4RRVA 3BZ3A 4QPNA 4KRCA 3BQRA 2YCRA 4QMMA 2HY0A 4EKKA 3WI6A 3QBNA 4L46A 1ZRZA 5HFJA 1YI4A 3U55A 3LBYA 2IZSA 4MBJA 4D58A 3BYOA 1OUYA 4CMUA 3ZFYA 3EQHA 4QPSA 4A4OA 4BDBA 4XUFA 3VRZA 2BH2A 4CTJA 4F6WA 4BKJA 2YUIA 2YJRA 4BZOA 3AC4A 2ZMCA 2X2KA 4FZVA 3LECA 2WOTA 3RHXA 1AQ1A 4BCKA 3H9RA 1YXUA 4RJ7A 3DAJA 4FG9A 2HW7A 3OFKA 4WUAA 1ZOHA 3DJ7A 5B0XA 2YACA 3ATTA 4E7WA 2C4GA 1MQ4A 3AC2A 2BR3A 5HCXA 4NJ3A 1JNKA 3WF9A 4LGGA 5K8VA 4YZMA 4IVBA 5GM1A 3I5NA 2QHNA 5I9ZA 3FPQA 5LXMA 1K3AA 5EHYA 2EWAA 4IV0A 3PUPA 2V7AA 4UZHA 4YTIA 2DQ7X 4JG8A 2BALA 4E4XA 2I9KA 4FV2A 3EN9A 5AP6A 4D5HA 3BRBA 4I5PA 3W33A 1FVRA 2QO9A 3SQQA 3WOWA 4AFEA 1YHVA 1KIAA 3R71A 4FKSA 3EGVA 4YUZA 1YI6A 4Y2HA 3CBGA 5CSXA 5LVMA 4PX6A 3UIBA 3UFBA 4KNBA 5C8KA 3A2CA 3F61A 4ZY5A 1SVGA 2NO3A 2W1DA 3A7DA 2XRUA 4HH4A 2A2AA 1JSXA 1GZNA 4P58A 5HVKA 2CWWA 3ZM9A 2ZB1A 5KX8A 3MB6A 1X1BA 2XBAA 1RJBA 4EZ3A 3MGGA 3FYDA 4BHNA 3AD4A 1EJ6A 4IVCA 2YVLA 4PQNA 4JR3A 2WQBA 3FE3A 3VC1A 3QOWA 4IIRA 3KXZA 3G90X 3I5UA 1BL7A 3PXRA 4I5CA 3DFAA 1N2XA 1OVEA 1H01A 5EDQA 1M2QA 3G5LA 2IDKA 2NRYA 3G9LX 3ROCA 2QD9A 4O38A 3CE3A 4HVHA 5IDPA 1JAMA 4EHGA 3O17A 5JK3A 3LCVB 2P3OA 3UYSA 1H4LA 4X21A 4J53A 4FNYA 4K2RA 1MP8A 4FV8A 4FTJA 4F6UA 3H9FA 1P14A 4CG8A 2JAMA 5CCXA 4HYIA 4FT3A 1ZGJA 2YISA 3H0YA 3M6WA 5EIWA 2VWUA 5EYDA 3D7ZA 2GAFA 4V0GB 5FM2A 4CKRA 4EZ7A 5G02A 3WE8A 2OJIA 3PVGA 4J8MA 2VP3A 4YUXA 2WQMA 3CJGA 3R28A 3DKFA 2ONLC 1KE7A 2YIRA 4R1VA 3PLSA 4C02A 1H26A 2AOTB 4TPTA 1BKXA 4F9AA 3FBVA 2O5KA 4E70A 2X8EA 4JDIA 4DGMA 3VBYA 2XNPA 3FUUA 5AUVA 1WBSA 2Q0BA 4I6QA 4QQTA 3MA6A 1WVYA 2XK7A 4IX5A 4O0XA 5CANA 1TQIA 4JDJA 3EMBA 4F4PA 4EK3A 1SG9A 3RPRA 3UDBA 1VLMA 2X2LA 4CZUA 2PGXA 4PTEA 3S1HA 2IG7A 3EGEA 3ZEPA 2JIIA 3W8LA 4CG9A 5CX9A 2W5AA 2PVMA 5EDPA 3MVJA 2CN8A 3E8NA 1XDZA 2QVSE 4L43A 5FM3A 3BWCA 5AX3A 2Y4PA 2I0VA 2QE6A 4JAIA 3VIDA 1IA8A 2GNLA 3FLWA 4RX8A 5LMKC 3AJDA 4L00A 3ZRLA 1Q3DA 3LXKA 3UOHA 3VJNA 1VPTA 3ME5A 3Q53A 5JGDA 2GB4A 1YXSA 3I6WA 2OLCA 3IPHA 2VTRA 4UYNA 3OXIA 3A99A 3UOKA 4P7KA 1MJFA 4XG3A 5LCKA 2K4MA 3FLYA 2ITXA 2C7QA 3VS2A 4CGAA 4KKHA 4HPUE 4JX7A 1FGIA 3TKYA 4IDVA 1P91A 1RJFA 4EOQA 4RQKA 1EQAA 4TWPA 5BVOA 4AGUA 3TIZA 4LM5A 3JWGA 1B39A 3EL8A 4PYMA 5LMAA 4JBQA 4DITA 2FA2A 4HGTA 3EQIA 3QRIA 5F95A 3BCEA 4FX3A 4LRJA 5IZFA 3HNGA 5BYYA 3PIXA 4E32A 3D7TA 5K0JA 4RC2A 4GKHA 2W1GA 3MH1A 3CJTA 1Q24A 3EQBA 1E1VA 4WOVA 4QYYA 5BUIA 4DFUA 4FVRA 4L42A 5CSHA 4ZP5A 2EX4A 4ZOGA 4MQ4A 4U7PB 4IM2A 3R8MA 2UZ4A 2BHEA 4QDJA 1JQ3A 3PZHA 4RZWA 3BX5A 1XBAA 1AD5A 2FYSA 4X2NA 4AW2A 3M6UA 4PNKA 4MD9E 3W2QA 5ICPA 3DMGA 4G3GA 5HGIA 4G31A 2IJMA 4O7ZA 2PUPA 4EH9A 3C0IA 4G3FA 3R9OA 3DP7A 4JI9A 5IISA 3V51A 3MV5A 5DM1A 3ETAA 2ZBPA 4IWQA 2WFYA 5C1IA 3A61A 4O0YA 4ZTRA 2Z60A 1XKKA 3QRUA 4Z3VA 4X41A 3FQHA 3PJCA 4FSMA 3WF8A 3QD0A 5M5BA 2FHPA 4KRDA 4G3DA 5HG5A 4AT4A 3TJDA 1RI5A 2OF4A 4NM0A 4PDOA 4LV5A 3REOA 4WO5A 3PJ8A 5DR2A 4J52A 5A4EA 3PSBA 4EKIA 3AOXA 2QOIA 3DDQA 1MRUA 3ITZA 5IQDA 3GXLA 2CCHA 5ANDA 4FMQA 4C33A 4TWCA 4AT5A 4USEA 5CAUA 3DBQA 5AP5A 3I53A 1YDTE 1BKYA 3SVZA 4RIWB 4DGGA 5EHGA 4DT9A 1XH8A 3GENA 2ONZA 3L8PA 4FV0A 1QZZA 5IH3A 3BHHA 5CQUA 4DMGA 2GQSA 2R9SA 2DPMA 2J7TA 2W9ZB 3IW8A 4XRJA 5L8KA 4U5JA 5CASA 4BCJA 3RK9A 3VC2A 2HW6A 2VNWA 1SNXA 3FPFA 3GU3A 1ZQ9A 1UIRA 3G6HA 4PTGA 4EQZA 4FK3A 3M4XA 3OCGA 4CFUA 1BMKA 3RM6A 4F1OA 3FI3A 3HDNA 5BMMA 5U4XA 5BUEA 4GVAA 3S95A 2ZDTA 1Y6AA 3QTWA 4EWHA 3BQCA 2C69A 3ANXA 3EVBA 2PZRA 4QYGA 4HSGA 4QMSA 1Z3CA 5FTWA 1DI8A 5DVRA 1W0XC 2N47A 1P4FA 4CFMA 2IGTA 5M08A 3TUBA 4RIOA 5FULA 3ZSIA 2EXMA 4Z16A 4FT5A 2BAJA 1KP9A 4YZNA 4GL9A 4LMUA 4IDTA 2I62A 5CVDA 5DBXA 3R7IA 5HHWA 4YURA 4YO4A 1FQ1B 2LAVA 3M70A 4RIYB 3II5A 5BW4A 4TYHB 3KU2A 5FG8A 1GIIA 2XIZA 5AIRA 4C0TA 2ESRA 1OPJA 4FT0A 2ZTHA 2CSNA 3AQVA 4BR3A 2XYQA 2UZVA 3JPVA 8MHTA 4I24A 3VBQA 4XOYA 3OXZA 5FWDA 5EEHA 1W83A 2Z7QA 3TTIA 3GU8A 5J87A 4TRLA 4V0GA 3VUMA 4K6MA 3KCKA 4YPDA 5HICA 2P7HA 4H3PA 3U81A 2XS0A 4B17A 3EQCA 3DB6A 3MTEA 4NSTA 2X7GA 2XA4A 3QC4A 4JQ8A 2AOTA 4FT4A 4NCTC 2XYRA 5EK7A 3DFCB 3GRVA 5CT7A 4FKOA 1ZWSA 3P7CA 3FXWA 2GTMA 4D1ZA 1H0VA 2YEXA 4EH3A 4R8RA 1FVVA 2B52A 1YWRA 2WU6A 4ACMA 4Y85A 3GRUA 4QVGA 3KL8A 4U45A 2FSMX 4C37A 3CQUA 4KWPA 4DTBA 3UG1A 4PNEA 4AP7A 5ETFA 2P2IA 4QOXA 2PUNA 3O0GA 4GV1A 3G7UA 4R78A 5CD1A 5D12A 4QMZA 5E8SA 5LWMA 1SNUA 4YSMA 1JLUE 5BPYA 4M7IA 3VBTA 2J50A 2ZM3A 5E92A 4R3CA 5HG9A 3S4QA 3BZBA 3WF7A 1YOJA 4OT5A 3E63A 5JZJA 1Y6BA 3GOPA 1KE8A 4RFYA 2P4IA 4KSQA 4FEWA 1XBBA 1XHAA 4M0YA 5BP7A 1H1RA 3TKIA 1YFLA 4IWNA 5HILA 4HCTA 1FP2A 4JS8A 3TNWA 3PE1A 3R9DA 4YLKA 4BDKA 1IM8A 1U5QA 2EJTA 2VWIA 2R0UA 4OTHA 1YVJA 3OPNA 4EOSA 3ENMA 1Q8UA 3LFDA 3R22A 3PTAA 3E8CA 1HOWA 4WT6A 2PZIA 5J5SA 4A6EA 3NZ0A 4AXAA 4GG5A 3KR9A 4IAIA 4NM3A 2IH2A 2OICA 3KXMA 2P35A 2BR4A 1ZOGA 3KXHA 4X2GA 2GS9A 3QAME 3W10A 2ZBQA 3FZSA 4CT1A 1JTFA 3LCCA 2H8HA 2AYPA 4GBED 3CR0A 3SGCA 2QOOA 3A4OX 3FZGA 2IIPA 3F82A 3FUXA 3M42A 5GJGA 5IQEA 5EIFA 3C5IA 2OWBA 4OR5A 2ITNA 3OBJA 1P2AA 5CVUA 2ITOA 1KPGA 4BDJA 4A6DA 4I93A 2B78A 3HCBA 4PWYA 1URWA 5KHXA 4YJTA 1FMKA 5D1NA 5DM2A 2RG6A 2HWPA 2W1IA 3C9WA 4ZSLA 3OEZA 3OCJA 3FZPA 2NP8A 2HV9A 5B1SA 2JC6A 1ZXEA 4BHZA 1HCLA 3OU7A 3OS3A 4TYIA 2UZWE 4FVQA 4WKQA 3EVDA 4CXAA 4DLJA 2WMTA 3P8ZA 2ITUA 5G1XA 2FCAA 4C4HA 4UOEA 3QD4A 4U40A 2ESMA 4QDKA 3TWJA 4AN9A 3GQIA 1YF3A 4JRVA 4ACDA 1JKTA 1NW6A 3C4FA 1JOWB 3PJ3A 3QZHA 4FNXA 2PMOX 3LJ2A 2BKKA 2WMRA 1EAMA 1TW2A 4Q2AA 3KRJA 3TNIA 1ORIA 4XUDA 3SA0A 4ZLOA 4JG6A 2PVCA 4O7RA 3E93A 4POOA 1KHHA 4RIWA 2QOQA 5HX8A 4MNFA 2YIWA 5AAFA 5LVOA 2Z02A 2QY6A 3NNVA 2ZFUA 5M56A 2JBOA 4Y8DA 3D0EA 2DS1A 5J9YA 1G3NA 5FQOA 3R3HA 2VWBA 4ASEA 4ZAUA 5CAVA 3D2KA 3RPYA 4PYOA 2ZM1A 4U0IA 5EOLA 1Q8ZA 1REJA 2RKUA 1GIJA 5FRIA 3GO4A 4WHZA 3VS5A 3IS5A 5IEVA 1P4OA 3SKCA 3UJ6A 1VP9A 1XBCA 1Y8CA 3G5DA 1YW2A 2XIXA 5E8VA 3MYGA 2YM5A 3RJCA 4FYOA 3EYGA 4FZFB 5HIIA 1PJKA 3HRCA 3KQOA 5EOBA 3P1AA 4HC4A 3V3VA 1H1SA 4R5SA 1OPKA 4MEDA 4FEXA 2JKKA 3QCXA 2V74B 3OW4A 3KR1A 5L8LA 4EH8A 3RTPA 5FEDA 4MD7E 3QTIA 3ET7A 2JHCA 5A14A 4XS2A 3D5XA 4L7SA 3P9CA 4EOOA 1WS6A 2GS2A 3TCPA 4RIYA 4TYHA 2QU5A 4CV9A 5IH5A 4YJSA 2O3PA 4GIIA 3W8QA 2GSFA 2PWYA 5E8TA 2BRBA 3K54A 5AP4A 4XG7A 3R7EA 3O31A 2ERKA 3AC1A 3QD3A 3MESA 3ORXA 4L68A 4MTAA 1NV9A 1OIUA 4M14A 3L8XA 3HVHA 1AQIA 2GMXA 2WMUA 3OHTA 4KSPA 3IK3A 4YC3A 5C01A 4DLIA 3E23A 5AUYA 3LQ3A 3BYSA 2VTTA 3BU3A 4E20A 3FL5A 4R5YA 3SSMA 4GK2A 1W8CA 2PT6A 4LOQA 4RZVA 3RI1A 1OGUA 1J91A 5BUJA 1WXXA 5KUPA 3H9OA 1PXNA 4HCVA 2PWLA 2G2IA 5CU6A 4A9RA 5BVEA 2FO0A 4TL0A 5CNNA 2XVMA 3Q4ZA 2JITA 2R3PA 2ZLBA 5LWNA 5E1OA 2IZUA 4KIQA 3MA3A 4FR4A 4FL2A 3NMUF 2NXNA 1V0PA 4WG5A 4NU1A 4KA3A 5LVNA 2WTKC 4FTLA 1KPIA 3ZOSA 1XR1A 4KBKA 2B4SB 3KXGA 4CV8A 4RA4A 3F2NA 3BLQA 3D14A 5HD7A 4DF3A 4YPSA 1YHWA 4DFYA 2WEVA 2O07A 4QMXA 4GOMD 3VF8A 5CSVA 4PP7A 3EKKA 5FP5A 4JDKA 5FXQA 2PT9A 5L2IA 2OSCA 1XH7A 4M67A 5H8BA 2C6LA 4QQ5A 3F5GA 2ITYA 3C3PA 3DB8A 3PJ2A 1ZZLA 2ITQA 4K9YA 3JR1A 4PRJA 3W2PA 3LFEA 4W8EA 2VRXA 4K1BA 2FSOX 3EFLA 1OIYA 3CY2A 5EW9A 2QKWB 5KMIA 2V7OA 2QR7A 2WTIA 4QRCA 5H2UA 3V5JA 2C6MA 4FTCA 4U9AA 4O83A 4O0VA 4AZWA 1B38A 3SR4A 4XG8A 1YZ3A 4KABA 4RX9A 5IA1A 2PVFA 3ZFMA 4HRAA 1OL7A 4FBXA 4PDYA 1KOBA 3PP1A 2B9IA 5CYIA 2VTHA 4TNBA 5ICGA 2Z6AA 4ZK5A 4DGNA 3KQQA 3E8DA 3BBTB 3FQSA 4C2VA 2BIKB 2HMYB 3F5PA 2HCKA 2B7AA 3JWHA 4Y46A 2EJUA 3DT1A 4F7NA 3NGAA 3BGZA 3QZGA 3T8OA 1KYZA 4YJUA 4KAOA 4I6BA 5CALA 2ZCJA 2BRMA 2OZVA 2XNEA 1K9AA 3QGYA 3ZLYA 3Q87B 4FG8A 2JAVA 4FGRA 2Y8OA 5AV1A 4YTHA 1SVUA 3SG9A 1PMNA 2VGPA 1H24A 4IZ5A 1U54B 5DPMA 3NW9A 3RWPA 4NT4A 1GNGA 4FSTA 3G9NA 5CT0A 3V8VA 4IANA 4C05A 4ZLZA 2OKRA 4L01A 3C5UA 1JKSA 2PTKA 3KQMA 3EL7A 3SM3A 3UOJA 3QZFA 5DHJA 2Y4IC 2UZBA 2VD5A 4O86A 1M2RA 4V0QA 5IUGA 4FKPA 3BKWA 3LJ0A 2CKOA 1EJ0A 5GWXA 3W2CA 5T3QA 5AV4A 3VUKA 3OWLA 4GW8A 5ITAA 3HVKA 4L67A 4DQ0A 4IB5A 2XVAA 5EMKA 2VGOA 3ULIA 3D9VA 3BWJA 4MWZA 4AN2A 2BZKB 4QP2A 4UN0C 2YJSA 4PMTA 1TQPA 5GOZA 5FGKA 5JN2A 2HELA 1SUIA 2G9XA 1L3IA 4MHTA 4HCUA 1XH6A 4P7EA 4E6DA 2DULA 3NUNA 2A1AB 1UNHA 1VIDA 1H8FA 3KPYA 3JWIA 4EC9A 1KPHA 3DKOA 3FPGA 3NW6A 2QHMA 3F5UA 3FY2A 2QYOA 4YC8A 2YTZA 2X7OA 3ORIA 5IA5A 3HGKA 5K0FA 2BKZA 3KU1A 1PHKA 5KKRB 5AM6A 4A06A 2O63A 4JDHA 3RCDA 2JIVA 3UJ9A 4QO9A 2Y6OA 4YHFA 1BYGA 3M6VA 4RPVA 4L6QA 4QMPA 3NUUA 3PIYA 4MXXA 5ANGA 4F99A 3P0MA 2DUVA 1UU3A 4D4VA 2W5BA 3QOXA 2VO0A 4O82A 4U41A 4ZTHA 2C5VA 2PVHA 3PXKA 1XDSA 2YITA 3SD0A 5EM5A 2VDVE 4FK6A 5I9XA 3MS9A 3OU6A 2JDVA 4F0GA 2WMXA 1M6EX 1VL5A 4FSQA 5DSTA 3G8BA 1PRYA 3PP0A 3LQ5A 4KKEA 3PA3A 3KR0A 1GZOA 4O91A 4IM0A 2Y1WA 5EZSA 1XH5A 4BDIA 3GVUA 3WZDA 3COMA 4ZMEA 3CXWA 3ZCLA 1QAOA 3RNIA 3LLAA 3E8SA 4MVFA 3IONA 3DAKA 3ZUVA 2NXJA 4OBPA 3CTQA 4EOJA 4U42A 2FSTX 3HRBA 1M6YA 1O9GA 2CCIA 4C7TA 2H34A 3BIZA 5HNIX 2UYCA 1T45A 3FZTA 3BV2A 2XEZA 3G2PA 4GUBA 4IC8A 5HLNA 4P7GA 3FV8A 4H58A 3Q4TA 4YJPA 3AC8A 4D1SA 4N0SA 3JXWA 3THRA 5EVJA 5GIPE 3TQSA 3VBVA 5E1DA 4I41A 5HOQA 4RGJA 5ANKA 3F4KA 2YCSA 4YZ9A 4IFCA 3PFQA 5LMBA 1R74A 4C61A 4QP1A 2PMNX 2XM8A 4S33A 3ZDIA 3LM0A 5AADA 2YM3A 1NVQA 4HGYA 4CKIA 3FUTA 4FTKA 5E2AA 2ITVA 3U87A 4D9UA 3L9PA 4DH5A 3HV3A 3HAMA 2BMCA 3U8WA 3NVKI 2Q0NA 3IO7A 4IWDA 2PUUA 4QTCA 2AOUA 3JY0A 1ZAOA 3MFSA 5DA3A 3G89A 2CGXA 3DTNA 3ZU7A 1SM2A 3QTZA 2PMIA 1CM8A 5D9HA 4BDDA 4FUYA 3GDHA 5AP7A 5H9BA 2OBFA 4D4YA 2BAQA 3FMJA 5E1BA 2PX2A 3R02A 2Q83A 3OE4A 3VS0A 4AZSA 3TL8A 4ZY4A 3OVVA 4I21A 3KK9A 3JVSA 5DTRA 1OECA 5ANOA 2PVRA 1DM2A 1ZY4A 4TN6A 4EHVA 3HM2A 1OIRA 1UU7A 5H8GA 4RVKA 4W4WA 4CTBA 2YAAA 2YR0A 1Q8YA 3HCDA 3OXTA 4X63A 2VWWA 4YTFA 1BI7A 3BI6A 3DOGA 3MERA 3GFEA 2PVNA 4FIFA 3MN3A 4RTMA 1SQFA 5E9EA 4C04A 3FLZA 2C7RA 2W99B 4TYJA 3ORNA 3EQFA 4BLVA 3VC4A 4F6SA 4USDA 2HTEA 2F9GA 3TRKA 4DN5A 2BZGA 5DH3A 3LPMA 4YJOA 4LOPA 3COHA 3GT8A 3NCZA 2UVZA 3NYOA 3PWYA 3ZEWA 3RGFA 3AG9A 3KULB 2R3NA 5C8MA 5KE0A 3DKGA 3CKKA 5AP3A 3IGGA 3GJYA 2XK8A 3VBWA 5LVPA 5HIBA 5CEPA 1U54A 5AUZA 1NVSA 3P5KA 2P41A 4BTJA 3QLFA 4BZDA 4DH8A 4WIHA 4FTUA 4PMSA 1VE3A 3REPA 3ELJA 2OO8X 3VW6A 4RX7A 2WMSA 2GH1A 4AW5A 4MK0A 4RIXB 3GQLA 1WY7A 4ZXTA 3RPSA 5IMEA 3UC4A 1PYXA 1OIQA 3W2RA 3FSFA 4IVAA 2ZZMA 2WIHA 1NW3A 3P2IA 3EIDA 4RG0A 2XNOA 3DTCA 4F7LA 2VWYA 5E8WA 4S2ZA 2OPBA 2C0TA 2JKMA 1TKIA 1R18A 3DZOA 4FSRA 4NJDA 2QCSA 4O96A 5F2OA 1Q99A 4O2PA 2XNBA 2CMWA 2UW3A 3KR2A 3G51A 5K4JA 5HEZA 1R8YA 4ZY6A 3V97A 5EKUA 4N57A 4MTLA 2EVAA 1J7IA 5EW3A 4GJ3A 3LZBA 4PV0A 2G8NA 3PDTA 1O6LA 4V05A 2ITZA 4D9TA 3UVQA 2B3TA 2VX3A 5FDXA 2RF9A 4TXCA 3OCTA 1D2HA 5E90A 4I94A 5D1JA 5HIEA 3ALOA 3UODA 3M2WA 2H96A 2C5XA 4IEBA 2WTWA 4F85A 2W7XA 3THBA 3QX2A 1RE8A 4I5HA 1YHSA 2CLQA 3DA6A 2PU8A 3HEMA 2F7ZE 4AT3A 2OH0E 3LBFA 4TT7A 3N4UA 2FK7A 4RTPA 3UPXA 5FXRA 5C8NA 3T9IA 2QOFA 4RTSA 3CEKA 1OZ1A 3QUDA 1PXKA 3PYYA 5HI2A 1LEZA 3MH3A 1DUSA 3BE2A 1RJEA 3C51A 4IB3A 3QCYA 4BCPA 5FA5A 5DX8A 4FICA 3PSCA 4DEDA 3EFJA 3ZHPC 4E2XA 3Q9WA 2VO6A 4EH6A 3QU0A 5J9LA 3UYTA 4GFGA 3UG2A 2UYOA 2CMHA 1UFKA 3N51A 1M52A 4A9UA 1CSNA 2EU9A 4RTJA 3AY0A 4FV9A 4EOPA 4XCXA 3QQJA 3TIYA 2R3OA 1ZKDA 3OUKA 4DCMA 3OD6X 3R8UA 2QRVB 1QCFA 2FPOA 4D2RA 3R63A 2ZSUA 4R3RA 4F9BA 5CXZA 3MH0A 3UA3A 1U46A 1KSWA 5L2SA 4WNMA 2WA1A 3ER9A 1NA7A 2W0JA 3Q5IA 2O06A 4MH7A 3FTEA 4ZS4A 3GRZA 4LQMA 2LGCA 4E93A 3GUBA 4JXJA 2CMGA 3KQWA 2X9EA 4E8AA 4F1TA 3VW8A 4QMWA 5JMSA 3FUPA 1CTPE 3CLYA 3RWQA 3KGAA 4W4VA 4S34A 4K0YA 5HX6A 4BBMA 2PJDA 2GPHA 5AP1A 2XBMA 4PONA 2O8YA 4UB7A 2ZBRA 5EI2A 3ZONA 2YN8A 5AX9A 5HORA 2ZV2A 5F4NA 5LOHA 1NW5A 1ORHA 4CKCA 1INLA 2X6EA 1FOTA 4NTTA 2HK5A 4BI1A 2B2CA 3NW7A 2J5FA 5DT3A 4EH2A 3QZIA 3FMDA 1CMKE 3NWEA 2VTIA 3B2WA 4C3RA 3PFGA 4II5A 2YM6A 4O27B 4RTRA 4X2FA 1V0BA 4HOKA 1OBDA 3OWJA 2YAKA 2XH5A 2ONYA 5EI8A 2BZHB 4WG4A 3R9NA 1M0EA 4NFNA 4RVFA 2PBFA 4IV8A 2RIOA 2QOBA 3F3VA 4KIGA 3WYYA 2JKOA 4BLUA 5CU3A 2BRGA 4JNWA 3LMHA 2F7EE 3MAGA 2WD1A 3O8PA 5F1ZA 4ZEGA 2ZDUA 4AOJA 4U8ZA 3FLQA 4JQ7A 2AC3A 2VTMA 3M33A 4AZVA 2IBSA 1FJXA 4LUEA 2O0LA 5ETAA 1JKKA 4IZ7A 5C26A 4DH3A 1U4DA 3ODZX 1OM1A 3DKCA 4PL4A 5KVAA 2BRNA 3ULZA 1UNLA 4FT2A 4IMYA 3SW4A 3PVWA 4WG3A 2GDOA 4DE4A 4EQCA 1WZNA 3HZTA 1WBNA 3AT2A 3KK8A 1SZMA 5AEPA 4X2JA 2VTLA 3TKAA 4QPAA 1VBFA 2YX1A 5HE1A 3FTCA 5EMMA 2WQOA 2HWOA 3NJRA 3MPAA 4NZWB 3EQGA 2GQGA 3R21A 4A9YA 4UZDA 3A27A 1DL5A 4J98A 3TJCA 2VDWA 4OT6A 5DLYA 3E7VA 5KMNA 2HZ4A 1A9UA 2OI4X 5AA8A 1RI4A 2QI8A 3VNTA 3Q96A 4R05A 4BP3A 5LQCA 2RL5A 4M68A 3BGQA 1P39A 3FJQE 4UALA 1ZYJA 2BHHA 4QTEA 5HESA 1IEPA 3HCEA 4E33A 3V01A 5BVWA 5C0OE 4QTDA 3ORZA 3AXTA 5D10A 3U6JA 4OTDA 3CCFA 4XV2A 4C4IA 4AZEA 4XP2A 3P9NA 3WF6A 2VZ9A 3PY0A 1M14A 2HZ0A 3KCFA 3FYCA 3SSNA 3LLTA 3KULA 4K18A 4EQMA 5GNKA 4E1ZA 4F0FA 2W4KA 3OP5A 3IQ7A 3DXNA 4O22A 1NBIA 1JPAA 3R00A 3KY2A 3ACJA 3C4WA 5A3XA 2XF0A 3NVMB 3UNKA 3KN5A 4ERWA 1O9UA 5AWMA 4M69B 5EC8A 1YWVA 4FTNA 2NP6A 3DAEA 4RWIA 3JVRA 3HRFA 4KS7A 4YZDA 4QMYA 4X0MA 4EYMA 1UWVA 2PK9A 5AV2A 2WPAA 1SUSA 4M12A 4WXHA 5E2BA 3O2MA 2R3SA 1GAGA 3DULA 3I58A 1H27A 3SHEA 3SAYA 3MTIA 1R39A 4I5MA 2G15A 3DK6A 5IQIA 1APME 3UJGA 1JG3A 4DCAA 2YIYA 5JZNA 2R6ZA 4RJ6A 4NKAA 5LMKA 2J2IB 5LQAA 4U7TB 5AM7A 4P5QA 4DG3E 5IDNA 4ONAA 5DTMA 5AUXA 2P1DA 4FL1A 4RX5A 4S30A 1FINA 3GU4A 1QYRA 2GHMA 2BZIB 3DK7A 2Z7SA 4E5BA 3MVMA 4HG2A 4JAJA 4RVHA 3KXXA 5EKXA 3RALA 3FZRA 4KRGA 4JL9A 4AW1A 5FA8A 2X81A 3FI2A 4ZZMA 3DGKA 4XLIA 3F2RA 4E4MA 3NCGA 2X4ZA 3RAHA 4MXOA 4Y5QA 5DG5A 5AAGA 4G5JA 4H3BA 3QGWA 3ZC5A 3QQUA 4Z7HA 5CTPA 4G17A 5DT2A 2QOHA 3RP9A 2ZVAA 3PX2A 5EYMA 3I9FA 2AVNA 4TYEA 1LEWA 4ZTSA 4FKLA 4FVPA 3FMKA 3WIKA 1NY3A 3D94A 3KXNA 2P33A 2A19B 4QNAA 3MTLA 4YMJA 3CQEA 4FR0A 5BX0A 2QRVA 3I64A 3CKXA 1G55A 4PDSA 1RW8A 4PWNA 5CLPA 3UBTA 3Q9ZA 2J90A 3ALNA 4FTQA 4KUJA 4EKLA 3MWUA 4QMTA 2W1CA 3HMNA 4X3JA 1QANA 2C6DA 3QQHA 4M84A 3ZO3A 4H36A 5KMJA 4GKIA 4DEGA 3EYHA 2A27A 4O7VA 4UWBA 2XNMA 4GEOA 4N6YA 2GHGA 4ENXA 5EQEA 4OA5A 4L3LA 4JIAA 2HIWA 2YDIA 5JFWA 5BYLA 1W82A 4NW5A 1HNNA 5DRTA 3KC3A 4G34A 3D4QA 4IB0A 3ERKA 4AACA 5B7VA 4JR7A 4G6OA 4H0NA 4HVGA 4I4EA 4XYFA 1R00A 1DAWA 2IVTA 4UBAA 2JJQA 4WRGA 2A4LA 2CLXA 2HZNA 4JT3A 5GJDA 2OZOA 1KOAA 2YWPA 4DFZE 5IQHA 4QPPA 1GJOA 3DR5A 5KZIA 4PL5A 5K5NA 4NW6A 2P40A 3RPOA 3UE4A 3V8TA 3E7PA 3UBDA 3EJ1A 1UVRA 2Z7RA 3SVVA 1MUOA 4MCVA 4MD8E 5JQ8A 1PXOA 1XO2B 3I4BA 3KRXA 3OT3A 1F0QA 4AQCA 1OL1A 4Z7GA 3C6KA 3DZQA 3PA4A 3MFTA 3UZPA 5DYJA 4TWOA 4C35A 2C47A 2OU7A 2B53A 3V5WA 4IW0A 3OZTA 4WVLA 2C3KA 3BHYA 1O9HA 1E9HA 3FZ1A 3LVPA 4FKRA 3DLCA 4EQUA 2Y0AA 4AZTA 3NNUA 5I4NA 5FP6A 3G33A 3B8RA 3LX6A 4BIDA 1R8XA 2I40A 2R3JA 3R1YA 2RFDA 3E5AA 2C30A 3Q4CA 4BYIA 5C27A 4ER0A 4L7FA 1QAQA 3HMPA 4R3PA 4CSVA 5I9UA 2GNFA 5IMXA 3SRVB 3EB0A 5HG7A 3DBFA 4B6LA 4QTTB 3M6XA 3F66A 2OKCA 1NKVA 3WBLA 1VJYA 3LPBA 4CCUA 2F49A 1PXIA 5JQ5A 2WOUA 2IZRA 1N7IA 4R7IA 4U81A 5HBEA 4PMMA 3PG3A 4O7YA 1YXVA 5DFPA 4A9TA 4ASXA 4F84A 4QP6A 3DQXA 3TT0A 3HP7A 1HMYA 3UPZA 4L3JA 4C36A 5EKNA 3NSZA 3KFAA 3FY0A 4UXLA 4CTCA 5IA0A 2YZLA 2ERCA 4ISCA 1AGWA 4EONA 3H3CA 3ZSHA 2IZTA 4BCFA 3LCUA 4FT7A 4APCA 4YMGA 4JJRA 4XV9A 2NXCA 2PYWA 2JHAA 2YM7A 1N7JA 1XCLA 4OBXA 5EPEA 1NV8A 2WKMA 2BIYA 4PYJA 3DMFA 2C3LA 3ZXZA 2ZIEA 3E3PA 4FS8A 3Q32A 3I5ZA 1H28A 4YC6A 3ZH8A 4X60A 2LD4A 4EK4A 4Y73A 2X9FA 4CFNA 3SLSA 3B3FA 2ZVJA 1IG1A 2ZJWA 1PKGA 4NCTA 3CS9A 5BYZA 4BCNA 3PTGA 4P90A 2B9EA 3C4ZA 3A7IA 4F1MA 4ACGA 2B1PA 2PPQA 3PLAE 3LOKA 2RFSA 4QNYA 1SVHA 3PRIA 2HYYA 2W17A 2A14A 3ZO1A 4P4CA 1FP1D 4ANBA 5LQKA 4GEKA 1XCJA 4HTFA 3L8DA 2G01A 4BGGA 4E2YA 1NW8A 3KVWA 3TMAA 3F2AA 2VUWA 5L8JA 3VVHA 4C4JA 4WNKA 2XK4A 3L9MA 4HNIA 2C68A 3LM5A 1IXKA 2F2UA 1UU9A 5CZIA 5K0EA 3GC0A 3SXRA 4KIPA 2AS0A 1JG1A 3HX4A 3KPUA 1W7HA 5CY3A 2G2FA 1L8TA 3TM0A 3FKOA 4EEVA 3CTHA 4FIGA 2OXYA 2UUEA 4KINA 1YQJA 3QFVA 5ICCA 1WMKA 4P7JA 2HR1A 3K5UA 3F7ZA 2FRXA 4QP4A 4RJ3A 4KBAA 3CGOA 3DBCA 2P7IA 4O7TA 2FGIA 2PV0A 1KV1A 3GCUA 4P2KA 4BVUA 4DA4A 5LSAA 2ZM4A 3MH2A 3FMEA 5B2KA 3T3VA 2WQEA 1FMOE 3ZTXA 5JR3A 1RQQA 3S0OA 3IW4A 2CDZA 5EMLA 1X19A 4YUYA 5E9WA 3ER8A 4L53A 4C38A 1ZARA 2W05A 4LG1A 2RG5A 3F3ZA 4DH1A 2H9VA 3WZUA 1J7UA 4OTGA 3F3TA 3R8PA 3FPJA 3R6XA 5ETIA 3R2YA 3TKUA 1I9GA 5M4CA 5FDPA 3Q9YA 3O7WA 2VWZA 1I09A 4DT8A 1QPDA 2GNIA 5J9ZA 2I0EA 2HWKA 4CT2A 1UNGA 5IA4A 3NYNA 4IAAA 1KE9A 1OB3A 4NM5A 4P5ZA 3GU7A 4IWOA 3EVFA 4FZ6A 3ZM4A 3A62A 3F9NA 4BDAA 3O8TA 3RPVA 2Z2WA 2X6DA 4DGLC 5ANJA 4MF1A 3K3IA 4FL3A 3TFWA 2JLDA 3BU5A 5DWRA 3HAVA 5BNJA 4LI5A 4I22A 2WELA 1OKVA 5AJQA 4F64A 3P08A 4EKGA 2B0QA 3EEYA 2XYVA 3UTOA 2R3HA 2XKCA 4JVGA 3F69A 4FZAB 4V01A 4DEAA 3R9RA 2C6OA 4QP7A 3PT9A 4C06A 4D2SA 4EH7A 4B7TA 2XJ1A 3WE4A 5CEMA 3CY3A 3FUWA 3CP9A 2UV2A 5C9CA 3UJ8A 3RAWA 5HG8A 3QCQA 3G2FA 3GI3A 4FTIA 4RT7A 4C4AA 4IBMA 2REIA 3QD2B 3FHIA 4PINA 2O65A 2PE0A 3SX0A 3ZMMA 3LL7A 2B25A 4D4RA 4XOZA 3TOSA 3LJ1A 1V1KA 4C3FA 3FTFA 4XNEA 3LE6A 3UQCA 1AF7A 5HLWA 3BLHA 3LXLA 4ALVA 4FZ7A 5FBOA 2EB2A 3EGIA 2UW4A 4RQVA 3C4CA 5IQFA 3MJ1A 4FIJA 4HGSA 3DTWA 4YV2A 2JH8A 1F38A 3DMHA 3FKLA 3W16A 2C5YA 3TNHA 2QURA 4AAAA 3EMGA 2OB1A 2WO6A 4FEUA 2BILB 5AV3A 3PVBA 3SOAA 4CXMA 3P4KA 4ZJVA 4V0RA 4EOIA 3QQGA 3FRHA 2X7FA 3A8XA 4HVSA 4JOAA 3FXXA 3SRVA 4HPTE 4CTKA 1ZYSA 3UWPA 1QPJA 3PSDA 1KWPA 2IVUA 5D7VA 4C2WA 5FEEA 3U9NA 3QTSA 3H30A 2ERZE 1KR5A 3HVIA 1BC5A 3U6HA 3O23A 3BKXA 2JHPA 3UJBA 3COIA 5CAQA 3FRIA 3FUVA 2WMQA 5CZHA 4K33A 4AGWA 3KMMA 1IRKA 2XNNA 5ACBC 1GOLA 3QWJA 4HJOA 2UVYA 2XJ2A 3SSOA 5BW5A 1PY5A 4G1WA 1RI1A 5CEQA 4W4XA 2FK8A 2XRWA 2Z6UA 3FMMA 5HZMA 2YA9A 5DR9A 3R0TA 4MBLA 1OPLA 2VTQA 2PVLA 4OW8A 2BZJA 2ITTA 1WFCA 3MTFA 3V6RA 4FEQA 4KWCA 3SG8A 4AX8A 3Q4UA 4M97A 4KS8A 5M06A 5T67A 4O7NA 3EH9A 5KCVA 1NBHA 4FIIA 3UMXA 1FBNA 5BMSA 4IM3A 1JR4A 2C5OA 3MQ2A 2YHVA 4IJ9A 2ZIGA 3TZ7A 4WBOA 3NWBA 4R7BA 4BDEA 2PL0A 4E31A 5FTQA 4Y30A 1YDSE 1NT2A 3ELDA 3ORMA 3CJFA 2OO3A 4GOLD 3LXNA 3GC9A 2F7XE 4WA9A 3HMOA 2CKEA 2G2HA 4RBLA 3Q6UA 1Q5KA 3UA4A 2RFNA 3GXOA 1PXJA 1ZLTA 3GCVA 5IH4A 1BI8A 1RJDA 4RTKA 3HMIA 2FSLX 3HV7A 3PE2A 4J95A 4PYNA 4QQCA 3VS6A 3TXOA 4KB8A 3PRFA 3LMIA 4EK8A 4FV7A 3HV6A 1X1AA 3QF9A 2QC6A 3MY1A 1NXKA 3UO4A 2F4JA 3UVRA 2ZV9A 4F9WA 4DGOA 2YQZA 4PUZA 2R3MA 5DE2A 3TTJA 4L45A 3ID6C 4BB4A 4K8AA 4KD1A 4HNFA 4E2WA 3MI9A 1RJGA 2IH4A 2AOVA 2EXCX 1ZY5A 2PZ5A 2HAKA 1UA2A 5AIKA 4YJVA 4GS6A 4CKBA 1R78A 1O6YA 3EZVA 2J6MA 5JFSA 2VX0A 3HMMA 5K0LA 5HNGA 5J7HA 5HE0A 3NTVA 2JDRA 2F8LA 4EHEA 4OBWA 1K2PA 3A25A 4I0RA 4EOMA 4Q9SA 3SW7A 4EK5A 2OIBA 1JBPE 2WAJA 5KMKA 2ADMA 2PY6A 3UP7A 3D5UA 2ZZNA 3BWMA 3QLGA 3QRTA 5LQUA 2GFCA 4U7ZA 1L3RE 4HW7A 4UXQA 3VS4A 3BBWA 3P79A 2B54A 3H0ZA 2VV9A 3ZZWA 4XG6A 1WBWA 2WIPA 1QL6A 5JH6A 2ZWVA 4GSBA 3R7UA 3OEFX 1OBGA 2VTAA 1XH9A 3UNJA 3G8AA 5GM2A 5AUTA 3ANRA 1H1PA 2XEYA 3KA0A 1IA9A 2WTDA 3NAXA 3W32A 4HVDA 4DBXA 3HV5A 4ZMFA 4RJ8A 4GOND 2BDFA 2V7EA 3EQDA 1L1EA 3A7EA 3AMBA 2JGZA 1KYWA 5D7AA 3THSA 3CD3A 5CM2Z 3DCVA 4QQNA 1OI9A 4RWJA 3QXOA 4ER7A 4ZSGA 2V0DA 3EN6A 3WZJA 3A4PA 5I0BA 4NTSA 2XCKA 2DYLA 3U54A 5K0BA 2J0MB 2O0UA 4S31A 4NKSA 3M1SA 4I3ZA 3LFQA 5EHLA 1H25A 4ITJA 4FTRA 4GRBA 4FKVA 3FYKX 3ZO4A 2J5EA 3LDGA 2CKQA 5CU4A 4H3QA 4NK9A 5LQFA 3DBEA 3BV3A 5EM7A 3DLSA 2OIQA 5LQRA 3ELWA 1Q8TA 3ZRMA 1KUTA 4IHPA 1XJ5A 4RTNA 4PIPA 5E8JA 4LL0A 3GU5A 1RI3A 4L44A 4GIHA 5IF1A 3EMDA 4G6LA 3AD5A 5EH0A 4OLIA 2CNUA 3A7JA 5BXYA 3UC3A 1G6Q1 2BR1A 2NRUA 5CVHA 4NIFB 4Y95A 4FG7A 4C4GA 4EWQA 5DRYA 3QHRA 4QVKA 2W4JA 1OL2A 1Q0SA 4LWOA 2GS6A 3LGAA 4G3EA 2UW0A 3TV4A 3BGPA 3NUAA 5AMNA 3R7YA 4KDCA 3NUXA 1Q62A 3QQLA 2HZIA 4NWMA 5KMLA 5CF6A 4O2ZA 3I1AA 4MXZA 4R1YA 3P7BA 4DEIA 2H11A 4L8MA 1ZG3A 4R6WA 1LR4A 3KREA 4HGLA 3IOKA 4RSSA 4XH6A 2XP2A 1PYEA 4FKIA 4J7BA 4DCGA 5C4LA 4PCLA 3KQSA 3EKNA 3VUGA 2IVVA 3O50A 2UW5A 3N9XA 4EORA 4M36A 5CVFA 4BN1A 5IQBA 3KQ7A 5DX0A 3KQTA 2Y9QA 4X3FC 5T64A 3Q2MA 2PUIA 3EZRA 5H02A 4KW7A 4AA5A 3BWFA 1VEBA 4DEBA 2IW9A 3F88A 3EN7A 3TV7A 4F9CA 5E1SA 1ZZ2A 1LPUA 3QUPA 4R8SA 3HVCA 5DI1A 3QA8A 3QL8A 2UZNA 4RLLA 4FI1A 4E4NA 4NM7A 3PVCA 3SX9A 4ZLYA 3I7CA 4Y5HA 5JGAA 3NX8A 4EK6A 1TVOA 4FSNA 3ORKA 1JSVA 1XQZA 3Q5ZA 3LFBA 4GVJA 4AOIA 4QMQA 4H05A 1YRPA 4LOOA 4GYIA 4UWCA 3C4EA 3OOMA 5BVDA 4YO6A 2G70A 5FQDC 2B55A 2OK1A 3TUDA 4C58A 4OTWA 5HD4A 4CKJA 4CVAA 2GTNA 4GT4A 3OFJA 2AZTA 5I9VA 3H4JA 4Q5HA 1ZMUA 4YJQA 5TT7A 4BGHA 3O4FA 3P9JA 4ZS0A 4BTKA 3BWBA 5CSWA 4UY9A 2H6DA 2XK6A 2CGVA 3HCFA 5EMJA 2QKRA 2R4BA 4YLLA 2CGWA 2EG5A 4CFFA 3LCDA 3NUPA 3EVAA 3DBDA 4N6ZA 7MHTA 4EOLA 2OIDA 3G5TA 2CJMA 4ERKA 5M44A 4F08A 3F7WA 2GU8A 1O54A 3KQYA 3HYHA 3DOUA 2HENA 4EUTA 4DBNA 3EVEA 1OL6A 3K0BA 1JQEA 2R3QA 3E92A 3KMUA 4JQEA 4CFXA 3MY0A 2AOUB 5J1VA 3TNPC 2HNKA 2JFLA 3CJRA 3HA6A 4HGEA 2R7BA 2WB8A 5E9QA 3FMNA 5ICEA 4KBCA 2PZYA 3GOKA 3L1SA 3QKKA 2IWIA 1ZMWA 2BUJA 3DXPA 4M7RA 3FMLA 4EK9A 3WF5A 3HCCA 3ZUTA 1M2PA 4YTCA 2YM8A 4BDHA 1RDQE 3HP2A 2FYTA 3VQHA 4NFMA 3VHKA 3OT8A 4GYGA 3TDVA 5KZ0A 3DU8A 5CVJA 5DM0A 2YXDA 1H1DA 4FIEA 4XJ0A 4A7CA 3E05A 2IN6A 2OGVA 3OTUA 3C0KA 3H2BA 3Q9XA 1Y8YA 1NW7A 5HZNA 5IU2A 2NNWB 3W18A 3OU2A 3SXSA 4KDRA 4RSRA 2BM8A 2CHLA 2G71A 4O84A 3ZFXA 4OX9Y 5HIDA 2XBJA 2JDSA 4UX9A 2Y1XA 2PVYA 3V5PA 3OF0A 4IX3A 2OXDA 4OA8A 2GNJA 5DRBA 3GCZA 2VDUE 2P8JA 3EFWA 5IUHA 2X0GA 2AN5A 2ETRA 4EBWA 4QYEA 3B3JA 4MQ2A 3GRRA 4IH8A 1J3HA 1WAKA 4TY1A 5D1HA 3A60A 4EBVA 4WNPA 5IA3A 5DEWA 4FSZA 3B8QA 1Q4LA 4X6QC 4DG2E 3KQVA 3VS3A 3PFHA 4AW0A 4DAWA 3DV3A 3MW1A 1M17A 4AUKA 2YDKA 1OR8A 2FH9A 4DFXE 2WTCA 3IDCA 5LVLA 3DDPA 2AUHA 3VJOA 2UW7A 4HVIA 3FC2A 5K0CA 4IAKA 2DWBA 4RTLA 2NXEA 3R7OA 3POOA 4GK4A 4EC8A 3M11A 4MNEB 4FV6A 3AWIA 5C4KA 5T68A 1Y8GA 3EEOA 5EYCA 3VO3A 3QA0A 5DEYA 4F65A 4PP9A 4O29A 5IH6A 2OB2A 2CKPA 1QPEA 3SDJA 4CFWA 5D11A 3JUHA 2QO2A 1GIHA 5E8UA 2V55A 4BP1A 3EWHA 4M37A 3P86A 3C7QA 4ENYA 2P3LA 3MIAA 2VU3A 3FHRA 3Q6WA 1JSTA 5CWZA 4YV1A 3N4VA 3BUSA 1CKJA 3P2EA 1ZYCA 5DTQA 4FKTA 2PWPA 4D0XA 4U3ZA 3WARA 2UZDA 5EGSA 3ATSA 4BI0A 4QP9A 4C59A 3P2KA 5KS2A 3I60A 3TM4A 4KKGA 2UZOA 3R30A 1Z9XA 5A4CA 5K9IA 3PPJA 4PF4A 1REKA 4G16A 3R8LA 4R7HA 3VN9A 5KBQA 4HYSA 1L9KA 5L6PA 2WQNA 4U80A 3DK3A 4FA2A 3DXXA 3BWYA 4X7QA 3SXJA 4U3YA 1Y57A 3O8UA 3TZMA 2PVJA 3P23A 5ANIA 2VN9A 3GEQA 5FLFA 4EL9A 1ZOEA 4X6RA 2C3IB 3KF4A 2PX8A 2NPQA 3RODA 3GBZA 2QLQA 1SQGA 1XH4A 2R3FA 3S3IA 3GP0A 2XM9A 2JD5A 5IQGA 4J1RA 4RX1A 2JFMA 1BOOA 4PGHA 5G6VA 3P9IA 2P3GX 1JG2A 4E6AA 1KE5A 5L2TA 3FPHA 5GHVA 4EHZA 5HCZA 3SOCA 2OYRA 2JEDA 5DOSA 2ITWA 4ALWA 2I7CA 4RVMA 3GIWA 1YZHA 4MXYA 5M57A 4A4LA 5CEOA 4K6ZA 5F2KA 4DKJA 1Z5MA 2XKEA 2PSQA 2XB7A 3EN4A 3IW6A 3PWDA 4OTRA 1W98A 4GC9A 5TKDA 3OC1A 2R7IA 4EUUA 3ANQA 5EG3A 3RZBA 4YZBA 4G2FA 5I9YA 3K6RA 3GU6A 3ZLXA 5HU3A 4JRNA 3ENHA 4IZYA 3HECA 3RAKA 3PXQA 2XK9A 4QYHA 3FQEA 4EJ7A 3UQFA 4G9RA 1J1BA 4XBRA 4XV1A 3VUIA 2VO7A 2I7QA 5K0GA 4G6NA 4YNOA 3CD8A 2P0CA 1A48A 1P1BA 5A9UA 3CJQA 2C6TA 4RFZA 4RVLA 3GFWA 5L6OA 2J9MA 3AGMA 4PNIA 4BDFA 2O64A 4C08A 2E5WA 2UW8A 4M0ZA 4IVDA 3QRKA 4BZNA 4LL5A 3FPMA 1Q61A 1J7LA 4QMVA 4CLIA 1ND4A 2H00A 4TNDA 3GRYA 3GCPA 2UYHA 2CNVA 5HE2A 3C50A 3QCSA 1R1WA 2WGJA 3DS6A 4R6XA 2VO3A 2GNHA 3LDUA 5HCYA 4HZRA 2XJ0A 1GY3A 2GHLA 3PY1A 2BR5A 5AFVA 3V5QA 3BU6A 1U2ZA 5AP0A 5EQYA 4OQEA 3ERCA 2WMAA 3CPBA 1XWSA 3I0QA 4ORKA 5FCDA 5EHOA 2XIRA 1VR2A 2WU7A 2OFVA 4R77A 2IBTA 5E4HA 1MHTA 1XXLA 5JRSA 4MYGA 1JSZA 1AQJA 1UKIA 1CKPA 5HBJA 4N4SA 1NE2A 3BHTA 3O7LD 1JQHA 4BDCA 5HVYA 5DXJA 3BLRA 1BX6A 4OBQA 3SGLA 4JBOA 3D2LA 4FTTA 3ZRKA 4CNHA 5F9EA 3DXQA 4YV0A 3EPPA 3U51A 5KQSA 4G56A 3FMHA 5CAOA 3UZTA 4I92A 3SV0A 3DNDA 2ETKA 2AN3A 1IY9A 3TKHA 2YDJA 3UOLA 4AUAA 4RLKA 3ELUA 2V62A 2OXTA 5K0NA 2XCHA 4WSYA 3FEGA 2QU6A 1WBPA 1OKWA 3AC5A 5GP1A 3AXWA 5HEKA 5DR6A 3LAUA 5FHRA 2I0HA 5BVNA 4F7JA 4AFJA 4QTBA 3A8WA 5DSXA 4W4YA 3U4WA 2FVDA 5CVVA 3KB7A 2C6EA 1YOLA 3PS9A 5HO7A 4GU6A 4FUXA 5KQRA 5EKOA 5IG1A 4IKPA 1WXWA 2IPXA 4BY9E 3C0GA 3KPWA 1WZYA 2JDOA 5MHTA 4Y72A 2R3KA 5J8IA 5IEYA 3NNWA 4YHJA 2PSSA 3MCZA 4DHFA 3X0DA 4C03A 2IVSA 4F63A 2B9HA 3HEGA 4IQ6A 4LWPA 5LQJA 3ZBFA 4O7WA 4GH2A 3DNEA 2VTSA 4EH5A 3Q3BA 3R2BA 4GOOD 4MNEA 3PIZA 4LG4A 4MBIA 3PPKA 5HIKA 2GLUA 1JWHA 2J4ZA 3OTVA 1T46A 4FIHA 2ZZKA 3NAYA 3UIMA 4BI2A 2IDJA 4GK3A 1BL6A 3HUBA 5C1QB 2W1EA 3HNRA 3CGFA 3F6XA 3QRJA 4OTQA 5FHQA 1S9JA 5KYGA 1XDUA 2KW5A 2PHKA 3BHVA 3VWAA 3O96A 4QTUB 3A7HA 4E73A 3UO6A 4BDGA 1YB2A 1O6KA 4U43A 4BLWA 1H00A 3F3WA 5CVGA 2ZIFA 2UVXA 3ELYA 4A4XA 3QQFA 4ZSAA 3OOGA 5AUUA 4FSDA 3CIKA 1EG2A 3QKMA 5JSMA 4YR8A 4G5PA 4ALUA 3L8SA 2R3LA 3MY5A 2IP2A 4FSWA 4G9CA 4Y83A 4UV0A 5A46A 3RK7A 4DZRA 4MX9A 5FD2A 1LUFA 4DM3A 3VULA 3RINA 2Y6MA 3RMFA 5GJFA 5JEBA 2XYNA 3GGDA 3T7SA 3I81A 3EQRA 4FV1A 4GC5A 4A9SA 3MBLA 4USFA 3IV6A 2OJFE 4I1ZA 2SRCA 3A4TA 3UP2A 2YXEA 1SYKA 4IAYA 3FKNA 2PX5A 3QALE 1S9IA 4CMTA 1IR3A 4NH1A 2JBPA 4HZSA 3I6UA 3NUSA 4JXFA 1PMUA 1NVRA 5LJJA 4EYJA 2UYQA 3HCAA 5HLPA 5T6BA 3BGVA 1OUKA 4B9DA 3HA7A 5JFVA 1UWJA 1CDKA 3RW9A 2OF2A 2P3QA 2PY3A 3ORTA 4BCQA 4QTAA 4BICA 2BFYA 3TACA 4BC6A 1X1CA 3MHTA 3MIYA 4CD0A 2GFSA 4M3QA 3LCKA 4GUEA 4Z9LA 5A54A 4GG7A 3Q7EA 5TR6A 1G8SA 4KIOA 5E1MA 5TOZA 3Q52A 3IKAA 3TG1A 3NEWA 1V39A 3NDJA 2QM3A 3W55A 5L2WA 1ZYDA 2A0CX 3E88A 3VRYA 4PTCA 1HCKA 2PKWA 4J8NA 3O7LB 3OY3A 2J0LA 3K3JA 5AAEA 4QMLA 4BF2A 3ODYX 5EI6A 3CGGA 4CMOA 3QTQA 2E9VA 4F0IA 4QT1A 2P55A 3C3YA 1DI9A 5CS6A 4YP8A 2ORED 5KBRA 4DFBA 2PXXA 2O57A 4EI4A 3RCJA 1WCCA 3S00A 4PIMA 4CRLA 3RVGA 5EHIA 4GFOA 1R0PA 3POZA 1J1CA 2XKDA 5CI7A 1PF8A 5ACKA 4XMOA 4IB1A 3BGIA 5M4FA 4QMOA 3QTUA 5DN3A 3FZOA 3QV2A 4D28A 3UZUA 3G0FA 1XJDA 4XHKB 3FC1X 4YU2A 3B7PA 3LKZA 3NRMA 3FI8A 1OKYA 3T0IA 2UZLA 5IEXA 4EOKA 3TZ9A 3E62A 3FAAA 2GCDA 2OG8A 3TPZA 4S32A 1SKMA 2QONA 3B3GA 4TWNA 3HA5A 4FKJA 5JRQA 2CGUA 4CLJA 4D4SA 1YOMA 5F20A 3LCOA 2Z7LA 2C7OA 3SMQA 3DJ6A 5M51A 3MB5A 3LFCA 4RC4A 2W96B 3LXPA 4ANLA 4D0WA 1ERKA 1L3CA 2VAGA 4ACCA 2PZPA 3G6GA 2PXAA 4AE6A 2BVAA 2O2UA 5KNJA 4XG2A 2I6LA 4L52A 1Q8WA 3CCNA 5E8ZA 4A07A 4RA5A 3MFUA 1Q3WA 5KMOA 1KE6A 2C5NA 4JX3A 4X2KA 4GCJA 4FV4A 3E8EA 4D55A 2HY81 2CNQA 3DJ5A 5K4IA 3LHDA 3LW0A 2BROA 3ZLSA 4AGDA 3KRRA 5HIMA 3OUNB 4XG4A 3U9CA 4CWAA 4GT5A 4OUCA 2B9FA 4F86A 4FNWA 4QP3A 1UV5A 4PYLA 3KKVA 4YNEA 3NS9A 3EN5A 1WVWA 2W1FA 3AMAA 3PB3A 5EM8A 1R3CA 2YCFA 3VYWA 3KMWA 3NWWA 2GQRA 4GMYA 3KKZA 3RK5A 3C4XA 4IX6A 4LECA 4L3PA 4FP9A 1R0EA 4X1OA 1U5RA 2GPYA 3UJAA 1F3LA 3VAPA 3JWJA 3I7BA 2OJ9A 1G38A 4HYHA 2ZMDA 3S2PA 3OFMA 2BFXA 2C6KA 3RKBA 4BBFA 2QG7A 3ZC6A 4GFMA 3JS2A 5LARA 3KHKA 5J95A 4ZTLA 4P7FA 2X2MA 5ETCA 2C6IA 4H1MA 2ONLA 2EUFB 4BTFA 4DC2A 5J1WA 4QQKA 4Q5EA 5F94A 3A26A 2V22A 3CVOA 3U4UA 2IW6A 4N70A 5FBNC 3V8SA 2PXCA 5E9JA 4ZZNA 5CCBA 1T43A 4ZTMA 3CC8A 4O0TA 5K01A 3FLNC 5F2NA 2QOCA 4JIKA 1M7QA 1LP4A 3FDNA 3ZO2A 2EFJA 2E9PA 2BDWA 2J0JA 5BVKA 4RC3A 4HTFB 1URCA 3NDIA 5FQNA 4FV5A 3UJDA 5I9WA 5DPVA 4ACHA 3OZRA 4WNOA 1KXZA 4YJRA 3VF9A 3OG7A 4ZJJA 4V04A 4RTQA 3EVGA 2OJJA 3W2OA 4ZJIA 2Z8CA 2BDJA 4EH4A 3ORLA 3R1SA 2E9UA 3GCQA 5HO8A 2BM9A 2ITPA 5FXSA 2R3IA 2W4OA 5T6KA 3BKBA 3BXOA 2XZSA 3U6IA 2AC5A 3QQKA 5CU0A 4IE9A 4MHAA 4BCHA 4BRXA 3OE5A 4U79A 1A06A 3QYZA 2C7PA 2V5QA 3LCSA 4U6RA 5E7RA 5HBHA 3EHAA 4O0RA 1D2GA 4J96A 1Q0TA 5CEIA 5FUTA 2UW9A 3GC8A 4CQEA 5E8XA 3G2MA 4QQJA 1YWNA 5EM6A 2QOLA 5E1EA 1PW2A 5M4IA 3CSVA 3BELA 4OQDA 4ZTQA 4ER5A 5EDRA 4IACA 4WBBB 1DAYA 3ZLWA 3C1XA 3E64A 2AVDA 1RI2A 4G3CA 3OCSA 4R6VA 4RJ5A 1JTEA 4C4FA 3UGCA 2QLUA 3CTJA 2W1ZA 1ZGAA 2UZEA 4I6HA 3NDMA 2YERA 5DXAA 3LFNA 4NECA 2R0IA 4FTMA 4W8DA 5DLSA 2XYUA 3K5VA 3AC3A 3NPCA 1E1XA 4RVTA 3IGOA 4I23A 3K2LA 3G2QA 4GF5A 1GZKA 3KEXA 4E26A 4K11A 4O21A 3DLIA 4GQBA 3ORHA 2ZAZA 3BHUA 1JKLA 5L3AA 2IH5A 3LHJA 4FT9A 2YWVA 5BQ0A 4YLJA 3O51A 5FTOA 4DFLA 2WHBA 1YUBA 3G2OA 4FSYA 4NL0A 3BYVA 1WBTA 5C03A 3DQWA 4ANMA 3QHWA 3LMGA 4O7SA 4ANQA 3HVJA 2VWXA 3R7VA 4ITIA 3EVZA 2WA2A 4B8LA 4UEUA 1BUHA 5CNOA 5CSPA 3HL7A 5ICFA 4WD5A 3IW5A 4XX9A 4JG7A 2C3JA 3KPVA 3IEIA 5TO8A 5EFQA 3R1QA 3GB2A 3WILA 5DX1A 2OZAB 1QMZA 4WRSA 1EH4A 4DINA 3FTDA 3PXZA 4DTAA 1H0WA 3NYVA 3O71A 1WBOA 3ZS5A 2E9OA 4KVZA 3CPCA 1U59A 2HXLA 3AGLA 3OY1A 3WZEA 3H10A 1TW3A 3T7TA 5FUBA 1IAHA 5DGZA 5HVJA 3Q04A 3TDWA 2HXQA 2JIUA 4ZSJA 3CKWA 2VTPA 4D5KA 1G60A 3R0QA 4ASZA 5KMMA 3RIEA 3IDPA 5TF9A 4OGRA 3QYWA 4PL3A 3A7GA 5LQNA 4RYLA 4WUNA 2PMLX 4NYEA 2PE2A 3L8VA 1BLXA 3E87A 5GIOE 4LFIA 3T7RA 3R83A 4RWZA 3UVPA 1GZ8A 2X39A 3KQPA 5LCJA 2RGPA 4IC7A 4RVDA 3CC6A 3I79A 5AP2A 1FGKA 3VUDA 1UWHA 2R3RA 5I5ZA 1VP3A 3DLZA 3UJCA 3P78A 4I20A 3G0EA 2GS7A 4YMHA 5M4UA 1WBVA 2F57A 5IA2A 1WVXA 4FKWA 3EOCA 5IUIA 3TM5A 4AA4A 3PA5A 5HTBA 3OWKA 3KRLA 1FPUA 3KF7A 5L6WL 2XIKA 3TR6A 4FC0A 4C07A 3HLLA 5B2LA 3EVCA 3C13A 3NW5A 5HIJA 4X3FB 3UIUA 2ACXA 3DXZA 4HGZA 3OW3A 5CUQA 4IAFA 4EMSA 2R64A 3RAIA 4OTFA 4NUSA 4EJNA 3MPMA 2OH4A 4PMPA 2PX4A 3ZZEA 3BEAA 5EEGA 5E8YA 4ER6A 4ASDA 1X1DA 3EQPA 5M09A 3MFRA 5DM4A 4FSUA 3OZSA 1PMVA 4X61A 4CZTA 9MHTA 1F5QA 4O6LA 2F2CB 4FKUA 2G72A 4MWHA 4BTMA 2R5TA 3HDMA 1OITA 2H1RA 4E6QA 2VTJA 3DPKA 4LV8A 4XRLA 2HOGA 3OZ6A 2WMBA 2XMYA 5IKMA 1STCE 4C4EA 3OCBA 1Y91A 2WK1A 3IECA 3L9LA 2Q41A 5CI6A 4O0WA 4B8MA 4ZTBA 4XUCA 4RWLA 3NYXA 1G8AA 4AZFA 4Z2YA 5AUWA 1BHJA 3R1NA 3ROYA 3VQUA 4BIBA 3ZUUA 3LKMA 5CXHA 4AN3A 4FKGA 4RVGA 5BVFA 1PXLA 1XTPA 5LR6A 4E2ZA 5DT4A 4FKQA 2AOWA 1CKIA 3KVXA 4FZDB 3ZDUA 4QMNA 4M38A 4GT3A 4J99A 2CKDA 3COKA 4YHTA 3EFKA 2E2BA 3VS7A 4DTKA 2JG3A 3ORPA 3ZXTA 4DFNA 4FYNA 3R8ZA 3HV4A 5K03A 2WTVA 4LGHA 2WTKB 2GA9A 5H8EA 4CCBA 1KV2A 2IO6A 3LSTA 4H39A 3QX4A 4XCUA 2VTOA 3C0HA 5AA9A 3DUWA 2PVKA 2I1MA 4YBKA 2GNGA 1SVEA 1I44A 3TUCA 4HYUA 3R01A 5FTGA 4DEEA 5HE3A 2G1PA 3UMWA 5AV0A 1Q97A 3DH0A 4I0SA 3TI1A 4E5WA 3UZRA 2ZW9A 2VS1A 1PXMA 3QWKA 3S68A 2WXVA 3UQGA 3OBGA 5A4LA 4FV3A 5EZQA 4M13A 1QPCA 4LYNA 1PXPA 2XNGA 4I0TA 2AOXA 4U97A 4FODA 3D5VA 4O7LA 4TTHB 1B6CB 3I0OA 2R3GA 2FB8A 1TQMA 3V5TA 3VSEA 2NP7A 3LDFA 2YXLA 4RWKA 2VX1A 4I6FA 3G15A
chains in the Genus database with same CATH superfamily
2GFHA 1GIAA 2VJLA 2ZBVA 2XWSA 5BSGA 4F2PA 4E5AX 2PE1A 4AU8A 4L75A 3W34A 2CXNA 3QC9A 1H93A 1SMHA 1QVZA 5ER6A 1JXOA 4KLCA 2O8DA 4BE9A 1OBFO 3H5RA 3RANA 3SJUA 4BWVA 5C51B 3NLBA 4RFMA 4ZVVA 1M2OB 2WEIA 2Y7JA 5HCIA 3Q40A 4QTZA 5NLLA 1D2CA 3H2ZA 3V5LA 3AOGA 3O38A 3UMMA 3IDBA 2UU9B 4AS0A 3TVYA 3AMYA 1HFJA 5EI5A 2FF5A 3PX3A 3I45A 2A9JA 1K5GA 5M53A 2GF9A 4DFDA 4ZT2A 2R8XA 1M34A 1NR5A 1OI2A 4CR8A 2VT3A 2C0IA 5IG2A 1KI3A 1BWQA 4DGQA 2YABA 3CE9A 1N2JA 1VDZA 1K4KA 4JAVC 1U1IA 3PE6A 5FA6A 3DXYA 2JVJA 1GNQA 5HUHA 1BE0A 4QOJA 4NS4A 4W1RA 3VQTA 3FMPB 1ORDA 4H0FA 2QE7A 4DQUA 2F64A 3PRHA 3MXOA 1V3QE 3IW7A 2ZOQA 3CIFA 4WA8A 4DYHA 2Y4IB 1N6LA 4LCEA 3H0CA 4AS1A 3MDYA 1W52X 4EY6A 4CKEA 1WPGA 5H5JA 2P9JA 4ATNA 3PEWA 1M1ZA 4IOJA 1GPMA 1NP3A 4BQNA 1JG4A 2WPDD 3ITDA 5EL0A 1V11B 1IOWA 3ZSGA 2QR8A 4XXHA 1ISMA 3AVWA 1XZIA 3V80A 2H5LA 3VHEA 2VDMB 2QIOA 3WDSA 1YASA 2QXTA 4DG0E 4CEJB 3GNIB 3R44A 3GZ4A 4ID7A 5K20A 2DBVO 3TG8A 4QRDA 3ENQA 3HR7A 4G5GA 3NT4A 4NE2A 3ACDA 2BFCA 2P9YA 4HUQA 4MKIA 4M15A 1I5RA 4D79A 2AJ8A 3BJZA 4IDBA 2BAKA 1R4MA 5D86A 5B4UA 2R60A 5IQCA 3EFOA 4KFSA 5DTEA 2RHRA 3EX7C 1P5EA 1GQFA 4MIOA 5A6NA 2FA9A 2J51A 2XDAA 1UU8A 1XTJA 2XUZA 4MX8A 3L18A 1YKRA 3NVAA 3E7OA 4L5JA 2XQVA 4IJPA 2CE7A 2AKAB 5KMGB 4DUPA 3GB9A 2CMDA 1ATPE 4O0SA 5LZ4A 3QUEA 1LQUA 4BVFA 5HZGA 4KN8A 3JQCA 1L4EA 1OQAA 3OWPA 5IPJA 1ZD5A 1D4AA 2DC1A 1Z57A 4RMZA 3STTA 1P31A 3D6MA 4QNNA 1KZGB 1AO3A 2KPOA 4MIYA 3URKA 4TROA 4WA7A 3BQNB 1XTQA 2KX7A 1KZYC 1E1NA 3GEBA 4MGEA 2BCEA 1YR1A 4G1MB 3HHEA 5BYJA 1IAJA 3DEFA 4ID9A 3DHNA 2IZ6A 1M1NA 1I4DD 3BGDA 4M6WA 4XP0A 4FNZA 4W1QA 4G4GA 5DIAA 3N2KA 2HHHB 3T3UA 4Z55A 4LN1A 4C2AA 1JZTA 2XW6A 3KK0A 3ONDA 1QCDA 2OHVA 2ASVA 4IAOA 5ILGA 3QUCA 4NL4H 3B89A 2O1XA 5KO1A 4I4NA 5EQPA 1JEDA 1TE2A 2N42A 2NTVA 4C34A 1OKZA 4ENPA 1W36C 5E9AA 1TQ2A 1HGXA 4PYIA 4W5NA 2IIVA 2AN4A 1XTBA 5ITZB 2OFOA 1JQ5A 5A1JA 4PYKA 1I32A 5EP4A 4DBLE 5K05A 3QKLA 3FLSA 2Q0QA 3GYGA 2XMQA 1AO0A 4BRWA 3G88A 3BRSA 3DKIA 4LHVA 2R6HA 3LT4A 2JZOA 5EOVA 4D2IA 3QX7A 1M7NA 4MIKA 3Q15C 3X1ZA 1WMBA 2X4FA 1PX2A 1W5EA 1JALA 2QQEA 2WNTA 4ZDWA 3EBLA 3RM7A 2GJ4A 4XSVA 5LQMA 3KZXA 1WHSA 3CWZA 1MNAA 4DYMA 2VNYA 5LZ9A 4ZSEA 2GVNA 4X6UA 2WTJA 3VV2A 2B5OA 2ERYA 1MZPA 2J48A 3F1LA 3RRBA 1JR3A 4MKCA 3ILXA 2IHTA 5JSQA 1CY1A 5C8YF 2VSOA 4LISA 2K87A 4OHXA 1TQHA 2IFTA 3QXPA 3OQHA 1QFSA 2RFEA 3UHAA 5IVKA 2VT7A 1IY2A 2B8TA 4LXIA 3QBTA 2O2XA 1UDWA 4OGFA 5TQ0A 1T3ZA 3AUTA 2QA5A 4DA5A 3DVRX 3B5EA 4DA9A 1QRTA 2H63A 3ZYAA 4RIXA 1PMEA 5AD1A 2RK4A 3D2IA 3C1TA 3HI6A 1TA9A 3BGSA 5FWAA 4BP9A 3BYMA 3FSKA 4XSGA 3KIOC 1GRVA 4G07A 1HXHA 1F3MC 4UHJA 2EBFX 4HS9A 1WO8A 3NGLA 3CISA 1QVRA 4BGQA 2LTAA 3LKDA 3PXAA 3L1HA 1A2KC 1RLOA 4PGGA 5E95A 3S6JA 1HNXB 3HSYA 5J9FA 1G4HA 4EHFA 3QKTA 5J2TA 1UBRS 3GFRA 3V4OA 5H3QA 1JBKA 1Z37A 1Z45A 3V6SA 2Y0EA 2JH3A 5FADA 1ECPA 4TTPA 4TKLA 2GDJA 2QNJA 2W06A 4MHSA 1VGVA 2ZYDA 4AS2A 4FE2A 5BN4A 4Q19A 2OXXA 4RDHA 4IFGA 1JG7A 2GESA 2DMRA 1L4YA 1PBNA 5JHGB 5DWQA 4PY1A 2BGRA 3SIRA 2CYAA 2RHDA 4FMDF 3B6EA 1ZHFA 5HKMA 5F2EA 2PUEA 4OQNA 3DW3X 2WNHA 4G0WA 3CW2A 3OROA 5FXMA 2X8JB 2EW2A 5EXDA 3HWRA 4YA6A 1ZMTA 4FNAA 4AZ3A 2OW3A 3Q8LA 3RGWS 3PVUA 3SYTA 1VMAA 4FYPA 1OMWA 3IXLA 4WFJA 1DKQA 2NO9A 4J16C 1YDFA 3UJ7A 4O5OA 4GLFA 3NIEA 3IQEA 3EMVA 5LBUA 1Y0BA 3AT4A 2G09A 3Q9SA 2YWDA 4RRVA 2Q8NA 3PVSA 5IDVA 4QPNA 3BQRA 4QMMA 3L4BC 4ND5A 2OMEA 3DOFA 2AUMA 5SY9A 5HGJA 1JWLA 5FJIA 4G85A 4Q3EA 4CMUA 1QNFA 3ZFYA 1O8CA 3CN7A 4QPSA 4A4OA 4LAFA 4OHCA 1GA4A 2Q7OE 4CTJA 2HLHA 4WLUA 2I1LA 2XWQA 3AC4A 2ZMCA 4UTNA 4BCKA 4RJ7A 4CKYA 1Q92A 2HW7A 3KLPX 1ZOHA 4GEGA 2X7XA 1V1MB 4RLSA 4Q4JA 4MWEA 2CLLB 2W9XA 1J5XA 4E94A 2AD1A 3IGFA 1MV8A 4E7WA 2FPUA 1ZUNA 4FYYA 4AMYA 5BPFA 3NJ4A 3CX4A 1V8BA 2PXHA 3T3NA 5G0TA 1GKIA 4BOYA 4IJMA 1JQKA 2Q5HA 1DIAA 2B82A 4CMIB 4YZMA 4IVBA 3I5NA 5GM1A 3QQ5A 4GKKB 1K3AA 1XNGA 4EG8A 2V7AA 1QLHA 4YTIA 4JG8A 2BALA 2O50A 3FE2A 4FV2A 4WW0A 3BRBA 2FFQA 4QDOA 1DCKA 3EB9A 3Q8KA 3I12A 3IVAA 2OMKA 5L53A 5BO5A 5ADWA 3X2SA 1YHVA 3EGVA 5GZ1A 3JQ8A 1R8QA 2CD7A 2QNRA 4EF4A 4YRQA 2WMNB 4KNBA 2ZQYA 3I9V1 3EZXA 4BCDA 3E70C 2IUUA 4ZY5A 1SVGA 2B2NA 1MC4A 2W1DA 1TTHA 3OZIA 2VLBA 2BFNA 4Q9DA 2D6FA 4NCXA 1UZLA 1JSXA 3RC8A 2J0UB 5ALUA 1SCJA 2OO5A 4DA7A 1CJTC 1R6VA 1X1BA 3HXQA 1RJBA 3C7TA 3FYDA 5DGCA 1JJBA 2C3MA 3FHTA 1QFJA 1EJ6A 5ENVA 4PQNA 2Q9AA 3FE3A 1U8YA 4JI7B 3S0JA 4HLUA 2F17A 1J0XO 3SQXA 4JVNA 3OP1A 3G90X 1BL7A 4I5CA 3GDWA 1M76A 1OVEA 1S4QA 3C1OA 1UZNA 3QFTA 2RC5A 5GV8A 3OQMA 4U2GA 4O4IF 5JCPA 2ZSJA 4A82A 1HYHA 3CE3A 3HKEB 1U0GA 5F5XA 5LP6A 4MOWA 1JAMA 3R3ZA 2D06A 3UF0A 4BE7B 3B9RA 1FFHA 4FHCA 3PXDA 5MN5A 2Z58A 2P3OA 3TL6A 5ALOA 2HEIA 4X21A 1F2TB 4J53A 5D51S 3C5HA 5AKZA 1MP8A 4EJMA 3IQZA 4F6UA 4CG8A 3BE6A 4IUDS 2CHVA 4FT3A 3RYHA 3LQ2A 3D81A 1DQZA 3UT5A 3ZI4A 3H0YA 3DW1X 5D8DA 2NU7A 2J3IA 4RGVA 5EIWA 2JIBA 2QJFA 2YMMA 5FM2A 4CKRA 4HAXA 1AV7A 4YJFA 4EZ7A 1XYGA 4LK3A 3WE8A 5JXJA 2A94A 2H48A 2YWJA 5TGDA 2A86A 2HQRA 1ZD9A 3NV9A 2GEKA 2YIRA 4A0RA 4C02A 2PEZA 3UCXA 1BKXA 3ZX4A 2C2KA 3AB7A 4DV6B 4DA6A 2X8EA 4DGMA 2EKLA 4LS3A 1XZCA 2XNPA 2YJ6A 5IDQA 4DQVA 5AUVA 4F6LA 4LI0A 3MA6A 3HLTA 5DGHA 2Z30A 2BL4A 3D0RA 1JEEA 2B83A 4EK3A 2JFHA 3GLTA 3ZGZA 5FNVA 1QC5A 3T9AA 4LI3X 4MR7A 3S1HA 2W6OA 3ZEPA 2VL7A 1CB0A 4K26A 1S02A 1OB5A 4CG9A 3WLPA 1EA7A 1VIMA 1XDZA 3M6MD 1P4SA 1NG1A 4A8JA 3DSRA 1KSGA 4NQRA 3ZTWA 3V8RA 4KYUA 5AX3A 5IABA 5D2CA 1ZL0A 2Q99A 3ZWWA 5KKCA 1E8NA 3V1KA 3WZLA 3U17A 3GLFB 4DV0B 3AJDA 3UYKA 1E7MA 1ZXBA 1Q3DA 3SQNA 3UOHA 3VJNA 4MPTA 4Y6OA 5H83A 4YPOA 1EX1A 3I6WA 2OLCA 3TTWA 2X40A 4UYNA 3L02A 1JXMA 3UOKA 2DQZA 3R3XA 5J40A 1MJFA 4UARA 4XG3A 4L0QA 2VQSA 1K7SN 3S1LA 3VS2A 4KKHA 2ZIUB 1WD5A 1E2FA 2PJUA 2SNIE 1KRHA 1YIAA 4EOQA 4OI0A 4AGUA 1SC9A 4MYRA 3X1KA 3LGSA 4BZPA 4NHEA 5FPQA 3RFTA 2HW8A 1E6WA 4IDQA 1RCFA 1A8HA 1QOZA 3LC2O 2XCTB 3GP5A 4HGTA 1YCFA 3EIHA 4DA8A 3WAJA 1O0BA 3HNGA 4RHCA 5A9RA 1ZNXA 3KUDA 2V7UA 5K0JA 4RC2A 3OA2A 1KI7A 1A7AA 3CJTA 2C5SA 3EQBA 1E1VA 3BHNA 4P4GA 5BUIA 3BXGA 4DFUA 4FVRA 2VQDA 3MIIA 1JPNA 2XDQA 2OV3A 4P4TA 4CIVA 5B2EA 3R9XA 1ONBA 1GUBA 4YMWA 1G5PA 4UM8B 3R3VA 1V25A 3HB7A 4LXHA 4FXPA 4RZWA 5HMLA 2ZUBA 3M6UA 4HEA6 1GUDA 1YQDA 4CMGA 4MD9E 3OEWA 4KNWA 3W2QA 2GM9A 5ICPA 1SZCA 3DMGA 2OVBA 3JQRA 4G31A 3N7TA 3U48A 4O7ZA 3LWDA 4E46A 1D0SA 2FUKA 3L01A 1OD6A 5DM1A 3ETAA 3QUAA 2WFYA 3F3SA 5JQGB 1GCOA 2X41A 1GFWA 3A14A 2A33A 4O0YA 1LQTA 1OCEA 3KJHA 4D97A 1AK2A 1LNZA 4Z3VA 1IQ0A 1YQEA 1O5IA 3GRFA 4MW2A 4FGKA 5B58T 5A1TA 4MYCA 3BMXA 3QD0A 1Q12A 4LDRA 3A4MA 3CX8A 4G3DA 3TJDA 2OF4A 4PDOA 2VA8A 3LZCA 4LV5A 2GPJA 3VISA 3PJ8A 4XPIB 1LTHR 1AXGA 4B6PA 3QU5A 2QOIA 1MRUA 2CCHA 5EKDA 1XO1A 3ANTA 4USEA 4QEKA 4G01B 3I53A 2XRZA 5CFQA 1BKYA 1RYEA 3SVZA 2I91A 4RIWB 3GENA 2PFSA 1ORWA 4WKBA 1N9ZA 4CU5A 5D00A 3FPSA 3OPQA 2OTCA 3DA8A 3RK9A 3BILA 1Z12A 3VC2A 3RUFA 3R5TA 3ZXYA 1CJUC 1J2TA 3C7AA 1S2NA 4NXMB 3H11B 2WDPA 3FPFA 5EJEA 2QUKA 1A9YA 3DUFA 4URXR 5EQTA 4CFUA 3H4TA 4MUAA 3P0IA 5AXBA 1BMKA 1XPRA 4PC7A 1FX0A 3HDNA 2IYVA 4JT2A 5U4XA 1PNQA 4Q3KA 2XRYA 1Q7TA 2W6CX 3EVBA 2WINI 3WIUA 2J32A 2R1TA 4NU8X 4Y0NA 4AJNA 4QYGA 1JL3A 3AUFA 1UC8A 4YMUA 3Q7QA 2NU6A 1SXJC 1W0XC 2ZIXB 4M54A 2N47A 1P4FA 5IANA 2JEYA 3EFBA 5FYQA 1KA9H 2RGWA 2IGTA 3IC5A 5FULA 3ZSIA 1X13A 2V5AA 1HEIA 1MABA 1RBYA 4LFCB