2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
4R77A 3VN9A 3NAYA 2JC6A 1BX6A 4PY1A 4I92A 5F95A 2X2KA 3D7ZA 3EQHA 4FG8A 4KKEA 2B78A 1YFLA 7MHTA 2QHNA 1XJ5A 5CEMA 1KYWA 3FLYA 4IAYA 3RWPA 3KXMA 5E91A 4RTOA 3CIKA 4A7CA 4MKCA 3WZJA 3K54A 5F9EA 1VEBA 2V7EA 2VZ9A 4D4VA 1OL2A 2WQNA 4MBJA 3KMUA 5CVGA 3ZRLA 4IM0A 2ZSUA 1Q97A 3DULA 2G1PA 2YIQA 4D5HA 3Q87B 4ALUA 2UZVA 2FCAA 5L6OA 5M07A 3ME5A 3BGPA 4FV4A 4PQNA 3GRZA 1HOWA 4FZ7A 4K9YA 2LD4A 2PTKA 4YLLA 1VP3A 3JWIA 3M33A 5EMMA 2OI4X 3HRCA 3SW4A 5GWXA 2QVSE 4ZSJA 5DT4A 5K0BA 2YISA 3FHRA 2FA2A 1RW8A 4RQVA 4TYGA 4KRGA 1PMNA 5EYMA 1Q0SA 2AC3A 2P2HA 3NUSA 4EK3A 5CAVA 1NW7A 3OFJA 3ORZA 2RG5A 2VGOA 2AS0A 4UZDA 4I5CA 4XP2A 1XH7A 2CGXA 2WIHA 4APCA 2W5BA 4QQJA 3BKBA 3H2BA 3QYZA 1WY7A 3PX3A 3UJAA 3BLRA 3C50A 3PXQA 2OF2A 4EKIA 3PJ8A 5K03A 5I9YA 4AUKA 1HCKA 5CF5A 5E8YA 1XH5A 3ZOSA 3FMEA 3GC7A 3L9NA 2HXLA 4A9UA 5D1JA 3ODYX 2FHPA 2REIA 3M6XA 3MB7A 4QTAA 3KN6A 2ZMCA 1SUSA 2C0TA 4L46A 4XV3A 4DCMA 3FL4A 3O31A 3C9WA 4AOIA 3CC6A 3EWHA 1H00A 5A9UA 2AN5A 4C04A 5CEPA 4DFYA 2JIIA 5DRYA 2UW4A 4IWPA 2ZM3A 4WUNA 1ZYJA 3KA0A 3MN3A 4FTJA 3BUSA 5CCXA 5JZJA 1FVVA 3HEGA 2YX1A 1MRVA 3D2IA 2ZAZA 2YR0A 4QMQA 1RDQE 4TYJA 3QHRA 1KV1A 5AA9A 4NW5A 3UQCA 5FTOA 4PDYA 3FTDA 4GMYA 5HCXA 2QONA 3R1YA 3REOA 4RJ4A 4YJNA 3PVUA 4MWHA 4O7YA 1XVAA 5LSAA 2WEVA 5HO7A 1M6EX 2XKEA 3LXKA 3H10A 2ZCJA 1FJXA 3VBQA 3EB0A 3TCPA 2ZZKA 3R21A 2I40A 3FDNA 4BCHA 3QC4A 1NT2A 2VTOA 5AM7A 5EYKA 5LCKA 4F84A 4D9UA 5KQSA 1YOLA 1JQDA 1W82A 4KS7A 3TUCA 1L1EA 2WXVA 4D1SA 3G9NA 4LM5A 3R01A 2I6LA 4DQ0A 3PVBA 4F9WA 3ENHA 4YJQA 2JHAA 4XG7A 5BUEA 4JG6A 4L6QA 4QMUA 3KQMA 1LUFA 3LAUA 5AV4A 4TY1A 4IX5A 5CEOA 3DB8A 4O2PA 5FP5A 5IEVA 2VGPA 5M4IA 1MRYA 2GS7A 5CWZA 5AA8A 1NV9A 2NP7A 3R8MA 5AP3A 2W9FB 4CKRA 5K4JA 3A7JA 2UZNA 4X6RA 5C4KA 3FSFA 2PMNX 1DL5A 4FUYA 4XOYA 3IECA 4YTHA 5HESA 4HC4A 3D7TB 3BU3A 5AMNA 2BDFA 4FIHA 3ZONA 5AADA 1NW1A 3U55A 5JRQA 4KNBA 2XYNA 4DFNA 2W99B 3KQQA 2HR1A 3QCXA 3HRFA 2NRUA 4EH7A 2VX3A 2YZLA 4C4IA 3BBWA 2ZB1A 3IOPA 4YHJA 4FNXA 3JY0A 2C5YA 3PIZA 1TW3A 1J91A 1KPHA 4AE9A 2W5AA 4BLWA 4M12A 5HZNA 3MFSA 4DT8A 4O0SA 5GOZA 1WVYA 3Q4ZA 1VR2A 2PE1A 3MPMA 4GVJA 1NW6A 1YI6A 2XNOA 5ANDA 4XYFA 1FPUA 3ZUTA 1EQAA 3LFQA 1VP9A 3UOLA 3D4QA 4G3DA 3SRVB 5BUIA 3EN5A 4O7VA 3R7UA 3RKBA 1NE2A 4UN0C 4YLKA 1O6YA 4F1TA 4Z3VA 3QWKA 2YWPA 3DUWA 5AAGA 4HCTA 4I0RA 1OI9A 5C9ZA 3KPUA 3C7QA 5HE3A 4HG2A 4JVGA 2WTJA 3SGLA 4HYHA 3KRWA 1GZNA 1YW2A 1YQJA 4P5QA 3IS5A 1EIZA 4O22A 2YABA 3UP7A 2Y6OA 5HFJA 5JFSA 2H1RA 2I0VA 3ZUUA 3G2PA 1M52A 1H1PA 2PULA 3ET7A 3IDBA 4R6WA 5E8RA 2UW6A 3RPRA 1DUSA 4MHAA 3G6GA 4BCPA 1UVRA 4EOSA 4PONA 2BRNA 1EH4A 1RE8A 4TW9A 3KXHA 5CT7A 4ZTQA 3ZSIA 4E26A 1AGWA 2Y6MA 3GC9A 1PXPA 3PZEA 4LUEA 4XHKB 4GFOA 1K9AA 4X3FA 4U7TB 5CF6A 5D11A 3TL8A 2RFEA 3MA3A 1R6AA 2C69A 4O7SA 3UJDA 5KQRA 3C4FA 4X0MA 3ORKA 5EMJA 3CY3A 2RFSA 2OSCA 3F5GA 3PJCA 4FSYA 1T45A 2UW3A 2V55A 4IAFA 4DHFA 4M7IA 3PXYA 3VJOA 4KW7A 1ZWSA 2X2MA 3ZDIA 4NZWB 4RTMA 5AP7A 2OKCA 4BP1A 4FICA 3PG3A 3CJTA 2R3FA 2XJ2A 4JS8A 3EGIA 3G2MA 5EI8A 2NXJA 2PX5A 3JPVA 4L52A 3NX8A 5EH0A 3AJDA 4ANLA 5GJGA 3FWQA 4CMUA 4PMSA 2CKEA 2ERKA 5L6WL 4XV9A 2Z7SA 4DH1A 1M17A 3QV2A 5EFQA 3DAKA 2B7AA 3MVJA 4PDPA 1O9HA 5JK3A 2G71A 3LCUA 5K0LA 2IDJA 4FSDA 5EQEA 3RPVA 5T68A 2XUUA 1VE3A 5EQJB 4FV6A 2PY6A 4ACMA 5E8SA 1J3HA 3P23A 1Z5MA 3KFAA 4XLIA 5AV2A 3LBYA 3IW7A 3F5PA 5CT0A 3VUMA 4RIXB 1QPEA 5K3YA 4WIHA 2GSFA 3OF0A 3S0OA 2NP6A 4I94A 2JKQA 2CKQA 4I1ZA 3TN8A 3OXIA 4DG3E 4YUXA 4DFBA 4ACGA 1ND4A 4GJ2A 4H1JA 3ZO2A 4C36A 3VUHA 2Y4IC 3GENA 4X3FC 4DE4A 4YJSA 2NNWB 4J97A 4UEUA 2A19B 4AZEA 4DT9A 5J5SA 1A06A 4M37A 1REKA 4C07A 2ZBQA 4ER7A 4RIXA 4M13A 4WSYA 3B2TA 3JYAA 4E2ZA 4I5HA 2XKFA 4NSTA 3AOXA 2YAAA 5J9ZA 2P3LA 3AXSA 3PSDA 5EIWA 4I6HA 2OJJA 3KGAA 3R0TA 2QR7A 3OT3A 3OHTA 4QP8A 4CEGA 5DR9A 2WZJA 2ZV9A 3TIZA 3ZSHA 3SD0A 1YOJA 3H0YA 3GIWA 3FEGA 3G9LX 4O7WA 4EOKA 2UZBA 3R9NA 1P1CA 1UFKA 3KREA 5E9JA 3OBJA 2ZYBA 3BXOA 2UZUE 2HW7A 4C08A 4BDDA 1UNLA 3LJ0A 1PXNA 2X7GA 3PT9A 5DT2A 1PRYA 4W8DA 3GU8A 3L8PA 3U51A 3LCVB 2JKKA 3M42A 3NCGA 3NW9A 3SXJA 5DI1A 5T6KA 3A61A 1FVTA 3HV4A 4E2YA 4BBEA 4R5SA 3ELJA 4GUBA 4XCXA 1P39A 3NUAA 1K3AA 5GP1A 3CS9A 2BZHB 4JIAA 5CVEA 1UKIA 4FIEA 2C68A 2Z7QA 4XG4A 4A4OA 4OBQA 1WMKA 3I64A 3QQJA 4C4JA 3O50A 4EZ5A 1JLUE 3G88A 4IAAA 3A25A 4M7RA 2PUUA 4FMQA 1M2PA 1OBDA 2IVUA 3LQ5A 5E90A 4B8LA 4NM7A 4ITJA 4F1OA 4Q9SA 3LDGA 2IP2A 3OCJA 3QQGA 2GU8A 4P90A 4FEWA 3BGIA 3LKDA 4RC4A 4V0QA 4PV0A 4K1BA 3R9RA 2JGZA 4USFA 1V39A 1YUBA 2XK6A 4D28A 4CCBA 2P41A 3FYDA 2Z02A 1NVQA 5DT3A 3HEMA 1OUKA 1SG9A 4E20A 2XYVA 2W4JA 2YIWA 4RVFA 1WAKA 2Q0BA 2B9FA 2GCDA 2ITYA 5J9YA 4O29A 5K0FA 3PVWA 2GB4A 4UBAA 4IB5A 3CXWA 2WAJA 3N51A 5E8XA 4ZJJA 4BC6A 2NXCA 1R39A 4PYIA 3A2CA 3SKCA 4YTCA 4FT0A 4D0XA 2AOUA 3GRVA 4HNIA 2GNIA 3ORLA 5GIOE 1ORIA 3UC4A 3HP2A 3I53A 2BHEA 4EZ3A 2O06A 2JBPA 4FTKA 4QT1A 3RI1A 2A0CX 3FPHA 2UYCA 1AV6A 3VUIA 5KS2A 5AUVA 5M55A 4GOMD 5M06A 4X41A 5FP6A 5EM5A 3ZS5A 4BDHA 4XG9A 1DS5A 4K6MA 4FEUA 2G01A 4LRKA 5KE0A 5FEEA 4EHEA 3WI6A 3ZYAA 2WU7A 2GS2A 4BDKA 2O07A 3I5UA 2B4SB 2PUIA 4IZYA 2PZPA 1W8CA 3I7CA 3C0IA 4BGGA 3VQHA 4BI2A 4ISCA 5G6VA 2YCFA 3QL8A 1SYKA 5C27A 2BTSA 5F94A 4BGHA 3ID6C 1M2RA 1SVHA 2OBJA 4JRNA 3DTNA 5EHLA 1JSVA 3A8XA 1OIQA 1F5QA 4LYNA 3HA8A 2ZVJA 2C7QA 3KRRA 4YHTA 3U4UA 5B2LA 4FUXA 4ASDA 1KPIA 3QCQA 4FKIA 1ZHFA 4RFYA 4FV5A 4UY9A 4FSQA 5DPMA 4IFGA 1JKTA 1GNGA 5CVHA 5J95A 3KQPA 4I93A 3TUBA 2WA1A 5HTBA 4XG8A 4CFFA 4PCAA 2VTTA 5KZ0A 3B8RA 3EYHA 1YZHA 3GDHA 3K6RA 2PKWA 4FX3A 4O0YA 1BKXA 4YURA 3ZMMA 3LPMA 4IBMA 4CKBA 1FQ1B 5K0CA 2A27A 4RZWA 1LEZA 3R8UA 3ALNA 1OUYA 3ATTA 3KPWA 4EQZA 4FT3A 4FOCA 1O54A 3FAAA 5EHGA 3DJ6A 4YUZA 2YJRA 3D14A 3I7BA 1OGUA 5DWRA 1PJKA 5BVEA 3UO6A 3F61A 2ZBPA 3CBLA 5HIIA 1KYZA 3QCSA 1OIRA 2X2LA 2HENA 3MYGA 4IB1A 2GMXA 4PTGA 5CSHA 4O84A 3SLSA 5LVMA 4FT4A 2BRGA 5EOVA 4S33A 5L2WA 4EZ7A 3HTXA 2PT9A 3OOGA 4FBXA 2PE0A 2VNWA 5ANGA 4J96A 3LCCA 4UALA 5A14A 3AMBA 5ACKA 2R9SA 3UMWA 3VJNA 3REPA 2NPQA 1PYEA 1H1QA 4XLVA 4AGUA 4DEAA 1X1CA 2ITZA 1NW8A 2W4KA 3MPTA 3Q60A 1UWVA 2PVMA 2VX1A 2WQBA 2PMLX 2KTYA 4HOKA 3R28A 3DJ5A 4R3PA 3UOKA 2VTRA 3ZFYA 2X1NA 3P5KA 4H1MA 4U97A 5T3QA 3DK3A 4H05A 4H0NA 2IBTA 4O0RA 4BDFA 2IBSA 2VO0A 1G5SA 3EN7A 2ONLC 1GAGA 2PSQA 3HRBA 5DNRA 2DYLA 1STCE 3AC4A 3ROCA 3Q5ZA 4ZLOA 4M8TA 5BX0A 1G6Q1 1YXSA 3I1AA 4RIYB 1R8YA 5H02A 4ER0A 5IQGA 3ORMA 3T9IA 2HWKA 4AG8A 3B89A 3MGGA 4MQ4A 4JT3A 3W8QA 4DCEA 1PXIA 3EL7A 3I81A 4I23A 3RM7A 3MI9A 1L3CA 2FYSA 5CX9A 3QUDA 2ITQA 4CVAA 2PSSA 4GFGA 2XBMA 5CVVA 4MYGA 4RRVA 5KZIA 4C58A 5KKRB 4FVQA 1JG1A 4E33A 5FQNA 3EGEA 3FQSA 3OOMA 1PW2A 5JR3A 4RVHA 1JSUA 5CAUA 4ZY5A 2QE6A 4C34A 3OCBA 5HQ0A 3OEZA 2W1FA 3W2QA 2QC6A 3QTRA 3DLZA 3O96A 2Y4IB 1OL7A 4X3FB 5E9QA 3P0MA 3QZIA 5IQFA 4I6QA 5HX6A 1GIIA 4ZZOA 3HA6A 5TOZA 5ANIA 3BV2A 4LWOA 4L8MA 1DI9A 4XJ0A 4XUCA 5E8ZA 2QM3A 4MH7A 2BZGA 4QTCA 4MXYA 5AP1A 2PX2A 3FMLA 5JRSA 5IEXA 5LMKA 2AOVA 3M70A 4F9YA 4G56A 4NCTC 3VS1A 2YIRA 2YAKA 4DEIA 5A54A 4PYOA 5K0EA 3EQBA 4YTFA 2ONZA 2Z60A 2FPOA 2O57A 3O7LD 5HE0A 4EWQA 3HLLA 3GCQA 5HG7A 3FLNC 5LCJA 4G1WA 5HIBA 5M4CA 5HLPA 3VYWA 4GU6A 2ORED 4LV8A 2J5FA 4DCGA 2CHLA 4RZVA 3FI3A 3UE4A 1YHWA 4IVAA 5AUWA 4AZTA 1MP8A 2JHCA 2JLDA 4X2JA 4PDOA 1Y8YA 4I6FA 4BIBA 2X8EA 3U81A 3CPCA 3QTQA 3SG9A 3EVEA 2B9EA 2I1MA 1V0OA 2ZVAA 4XG2A 3P71T 4I6BA 3TRKA 3F3ZA 1G60A 3SW7A 2V5QA 5EDPA 4YSJA 4R6XA 4XMOA 3QKMA 4U3YA 5HBHA 3TUDA 3M6VA 3SXRA 3PB3A 5DSXA 1J7UA 3G15A 1KE7A 3PFHA 1H0WA 4OR5A 4XEYA 4W4WA 2WMAA 4EOIA 2OJGA 3O7WA 2PUPA 4C02A 2IW6A 3Q53A 2C5OA 4PYMA 3UIBA 3P9CA 5FA5A 2QOFA 4I21A 5FBOA 3P2IA 2HWPA 4K6ZA 4DEBA 2BAQA 4IX4A 2G2FA 1YVJA 2J90A 2CN5A 3KVXA 2HMYB 3D5XA 3O4FA 5DFPA 5CLPA 4ZXTA 3KPYA 2B9IA 4NECA 4AGDA 5E7RA 1ZQ9A 1KPGA 3FE3A 2EJUA 4OTDA 4QYEA 5CEIA 4EH8A 1OKWA 3RINA 2WMUA 3ZDUA 3BHVA 2OG8A 3GGFA 4AFJA 2IDKA 2BAJA 4CTBA 2QOIA 5MHTA 3BGZA 4MQ2A 4OTIA 5CAPA 3AC3A 3GCPA 3D5WA 3P7CA 5CAOA 4UXLA 3BU6A 3BHUA 2C30A 3LPBA 2OXYA 5JT2A 2PHKA 3R04A 2AVDA 4RJ7A 5U4XA 2DULA 4UX9A 3FQHA 4DGMA 4IV8A 4LOOA 4XNEA 2YUIA 3LMHA 5JN2A 4O38A 1UU8A 1XH4A 5DE2A 5B2KA 3KMWA 5IF1A 3AC1A 2QKWB 3FUWA 5E2AA 5LQKA 3EEYA 3QZGA 5FBNC 1LPUA 3LSTA 3C6MA 1JQHA 4PMPA 2AYPA 4O6EA 5EDRA 3MCTA 5IA4A 2XEYA 3R30A 1PXJA 2R3NA 3F88A 5CIYA 2HK5A 3NGAA 3NJRA 4HSGA 5B7VA 3UZUA 4CTJA 2DPMA 3KR2A 5FG8A 3VULA 2Y4PA 3C1XA 3FXWA 4L53A 3UQFA 3EVAA 4TPTA 3G5LA 4UWCA 4Y5HA 3MSSA 4L7FA 4FGZA 5M51A 3G2FA 3UIMA 2JDRA 4I0SA 1PMEA 4AN3A 2VWIA 2J6MA 4P7FA 5J9LA 1YOMA 2DUVA 3HGKA 3DK7A 2HAKA 4YHFA 3LGAA 4A9YA 2WTVA 2PBFA 1RI5A 2OKRA 2R0UA 2BR5A 1OPKA 3FBVA 4V0GA 4AE6A 4QQCA 4FKWA 2UVZA 4IVBA 1ZOEA 1Q61A 3O8PA 4HCVA 4X3JA 1RI4A 4QMYA 4AW5A 5KMNA 1N7IA 1WG8A 3DP7A 4ZSEA 1PXKA 2UZWE 3ELDA 1P4FA 3ZH8A 1WXXA 3DLIA 4D4SA 3LCTA 4DG0E 1H24A 3HCBA 5LQNA 4U3ZA 4FZAB 4QVGA 2R3SA 1BKYA 4FTTA 4LV5A 1KE9A 3UNJA 1R0EA 2R3RA 5IA2A 4R6VA 1VL5A 5HIKA 4W4XA 5DM4A 2ZIEA 3IKAA 2OZOA 2PV0A 2BVAA 4YZMA 4AOJA 4RSRA 3FYJX 4O7NA 2VNYA 4NFMA 3FI4A 5EOLA 2WIPA 3KCKA 4Y46A 5K05A 5E8VA 4FTNA 3EQPA 3QQLA 2YERA 5KBQA 4FV1A 4IVDA 3R8VA 3BX5A 1F3LA 3E3PA 3Q9YA 3KC3A 1ZG3A 4RVGA 1SQFA 4G16A 4RMZA 1IRKA 3LMIA 5D41A 2QCSA 5CVUA 2XMYA 1D2CA 3R73A 4BCJA 3KKZA 4YUYA 2YM7A 3FUPA 3EQGA 3KVWA 5ANJA 2HZ0A 3PYYA 4I5MA 2BR4A 2GFSA 3BEAA 3VUDA 3MY5A 5GIPE 3BWBA 1RQQA 4FT9A 3QTIA 3LZBA 4CSVA 3ELUA 1SQGA 1VBFA 5IPJA 1SNXA 2QNJA 4FT7A 4G5JA 3E8NA 4FTIA 4J99A 4RJ3A 4ZOGA 3UWPA 4IW0A 4NKSA 4CCUA 5HICA 3LW0A 3VS7A 3DBFA 4C37A 4MTLA 3H9RA 2XS0A 2W4OA 1ZMWA 3MH0A 4W8EA 5LJJA 4V0RA 3EMGA 5EC8A 3QOXA 3JY9A 5FADA 3LQ3A 3A4TA 4BP3A 3IO7A 4FTLA 4K0YA 4WOVA 4ZJIA 4BIDA 4GK2A 4R3RA 2BRHA 4DH8A 3HV3A 5IA1A 4R3CA 3ACJA 1JQ3A 5JQ8A 2FB8A 4XG6A 4QQNA 4DTBA 4TYHB 1NKVA 2CMGA 2ITTA 3FZOA 4RJ8A 2PXXA 3DTCA 4ER5A 5IQDA 3NUPA 3QTWA 3RAKA 1FMKA 1V1KA 3E63A 3VBXA 4E4NA 3NAXA 3F69A 5M44A 1UNGA 4DFZE 4D55A 2P35A 4FG7A 4QP4A 2F2UA 2AOWA 4L7VA 4EONA 4DLJA 1AF7A 3E87A 2YXEA 3BKXA 3FPJA 3Q52A 4WBBB 5I9ZA 4R05A 2CNVA 2OYRA 1H28A 1OL6A 2BKZA 3AXWA 3DGKA 4TYHA 4MWZA 3C4ZA 5CVJA 2WTCA 5FD2A 1JWHA 4IC7A 2OPBA 3HCFA 3FYCA 3ORHA 3OZ6A 2P2IA 4K77A 4BCGA 1YI4A 5AV3A 3UA4A 4RC2A 2PK9A 4HGTA 4DBXA 3NUNA 3QUEA 3G51A 4F08A 3QX4A 4YZBA 2XIZA 3TJCA 3U6IA 3NNVA 2JFLA 3IK3A 3TI1A 4L00A 3OZRA 3TZ9A 2ITOA 5TT7A 3GEQA 2H8HA 2QOCA 3HDMA 2WKMA 4EBVA 3TNWA 4HW7A 5C8KA 3HDNA 4HVGA 4U9AA 1ZYCA 3HMIA 3KCFA 4EKGA 3LBFA 5IA0A 1SZMA 5CYIA 3WIKA 3AC8A 2YCRA 4BCIA 3R83A 4P58A 2GPYA 4BIEA 5EKUA 1KV2A 4FSMA 4RBLA 2WTKC 2YACA 2J0MB 2JHPA 5DTMA 4FL1A 5AIKA 1UWJA 1SVEA 2Q0NA 1X19A 4OTHA 2E9PA 5EQYA 3OVVA 3EVDA 4E4MA 2CN8A 1U4DA 2XF0A 3P7BA 4F9AA 4WT6A 3PPZA 2OZVA 3DXZA 4IAZA 4IM3A 5FM2A 4BTFA 4C05A 1UNHA 2I6GA 3Q9ZA 2FSLX 3BEGA 3MBLA 1G3NA 4XBRA 3QXPA 1U54A 3P9IA 2BHHA 3U54A 1G8AA 4ALWA 3IHTA 2R3PA 4JR7A 3T7TA 4GYIA 1PXMA 2C5XA 4CFUA 2H34A 3PY0A 4FTMA 3BWYA 3E7VA 3E7PA 3RK7A 3R7VA 4N6ZA 1WZYA 1GZ8A 3CTQA 4ORKA 1OL5A 1VPTA 2W1CA 4IWDA 2XBAA 5A4CA 2EG5A 1W83A 2ZDUA 5EHOA 4C4GA 3C0KA 1SNUA 5AP2A 5EMLA 3FPEA 2XJ0A 2GHGA 3SHEA 2P55A 2YQZA 3DKFA 1ZY4A 2XCKA 4IWQA 2ETMA 5DRBA 4GG5A 4KAOA 4QMXA 5F20A 4AT4A 3C5UA 2C6LA 3CKXA 3ZZWA 4A9SA 3HECA 4C38A 4LL0A 3MTLA 4S30A 1V0BA 4NTTA 4TKSA 4IZ7A 2OICA 3LFCA 4RLKA 1WBVA 4GKIA 4MX9A 4ACHA 1IM8A 1KHHA 4G3CA 3HP5A 4QMMA 5E8UA 4J53A 4RTJA 2EB3A 2C4GA 4HGEA 3VBWA 3ZFMA 4J95A 3ULIA 2OY0A 4OQDA 5IQHA 3WF8A 3GP0A 3PXRA 5JKGA 3EVCA 4H3BA 4O7TA 3FSKA 4QMSA 5A3XA 3DY7A 2BUJA 2C5VA 4UWYA 4WBOA 3ZLWA 3ZUVA 4Z7HA 2VV9A 5K0NA 3BYUA 3TM4A 5KMKA 4TWCA 4M97A 3QZHA 4PNIA 3UVQA 4CKJA 3ZO3A 2VTLA 3NUXA 3IQ7A 5FXQA 2PGXA 3EGVA 2FSTX 3NDJA 3BI6A 5K8VA 2XKCA 4FSXA 5DTRA 3QRIA 3UG1A 3IONA 5FTWA 4YUVA 1BUHA 4GK3A 2GNFA 4IWNA 5DXAA 4UXQA 1OECA 3NMUF 4TXCA 5M09A 5T67A 4JNWA 5B0XA 4K18A 1URWA 4DCAA 5HNGA 4C62A 3I60A 1B38A 3HNRA 4PUZA 5C03A 3VW8A 2PVNA 4FK3A 4RX9A 5IMXA 3ZM9A 1QMZA 4GJ3A 3PP1A 3LMGA 4O91A 3SOAA 4IM2A 4WD5A 4KDCA 4LWPA 3DDPA 2IG7A 2YN8A 3DPKA 4QOXA 1APME 2ERZE 2QR8A 4DEEA 5JMSA 2ACXA 4FKTA 4Y85A 3E8SA 3Q32A 5J7HA 3BELA 3LM0A 4G34A 3TNIA 3ZHPC 2XNMA 2YDKA 1YZ3A 4BVUA 3VBYA 4IX6A 3O7LB 4EH5A 5C01A 3WZUA 3HM2A 4IX3A 3ELYA 3WF6A 4BDIA 1CKJA 3BYVA 3KQ7A 3NDMA 3O17A 5DRDA 5LMAA 4X60A 3QD2B 5HG8A 2CWWA 2WQMA 1XH9A 2PYWA 4RVKA 4HJOA 4FSZA 4XBUA 4B9DA 5ICCA 2VO3A 2XM8A 3PE1A 3B3JA 3CJFA 5D12A 1Q99A 1ZOGA 2XA4A 3VBTA 4TWOA 4X1OA 4RJ5A 3OE4A 3UODA 2EVAA 1XHAA 4KA3A 4BDJA 2WOTA 5IISA 2VTPA 3WZEA 1NV8A 1A9UA 1BL6A 4QP7A 5K5NA 1TQPA 1WBTA 3HMMA 1Q8UA 2QOOA 4Y30A 4EHZA 4D4RA 3KY2A 3JWHA 5E2BA 4U79A 3NLBA 1YFJA 3DXQA 2P4IA 2VDWA 2WTKB 1J7IA 3MESA 2YM6A 4IIRA 4CMOA 3HVHA 2OIQA 2BFYA 4WRSA 4BI0A 4CFVA 4GYGA 3QQUA 2QG5A 3AT4A 4R7IA 1OMWA 4E1ZA 3F4KA 4HZRA 4FV0A 4CD0A 3VC2A 3ZXZA 4S34A 3CP9A 2IW8A 1BYGA 3ZRKA 2JJQA 5ICGA 5EYDA 1YDTE 4LFIA 5A4QA 4FT2A 3DNDA 3GCSA 3NNUA 3PS9A 4W4VA 4RTPA 1KOBA 2YZAA 3O8TA 3QD4A 4PL5A 5IUGA 2AR0A 5CQWA 2BZKB 2R7BA 3UIXA 1BL7A 4JQEA 3B7PA 4AWIA 4K33A 2WPAA 3G2QA 3DT1A 3OWKA 1Q24A 4BICA 4FR4A 1XXLA 4YO4A 4FA2A 4RVMA 2J5EA 2OZAA 5LR6A 3MVMA 3QCYA 3MIAA 3P7AA 1JR4A 4G17A 3QQFA 4DH7A 5JFVA 5LARA 2OZAB 1GIJA 3TNPC 3GQLA 1WBOA 3C4EA 4M84A 3TKUA 3LVPA 3FMJA 3F3TA 4FV3A 4RIWB 4X21A 1PKDA 3BZBA 3I0OA 2XNEA 1JSZA 4FODA 4YUQA 1KR5A 3C3YA 4BDGA 1NXKA 4BI1A 4E70A 5BXYA 4FEXA 4FL3A 3TLJA 1FOTA 3FQEA 3ELWA 4X63A 2BDJA 2YWVA 4II5A 4G2FA 3CCNA 2CJMA 4IE9A 3TACA 3UMXA 5KVAA 3M1SA 2VWBA 3ANXA 4H3PA 5CF8A 4O7RA 4S32A 4XUDA 5ETFA 4FS8A 3OU7A 5HKMA 5CD1A 3LCSA 4MF1A 3VNTA 4XUFA 4R8RA 4DG2E 4KKGA 5KO1A 3ZZEA 3BHYA 1V0PA 4GFMA 4OTRA 4CGAA 3LCOA 4PF4A 4NM3A 4ZY4A 4RWJA 2PLWA 4PWYA 5D1NA 1XCLA 3SR4A 3JR1A 4X2GA 3NWBA 3FY2A 1YXTA 2YJSA 5AP5A 3SVZA 1QANA 2X0GA 3PLAE 4KABA 4I22A 3D5UA 2FYTA 2IWIA 3F6XA 5EM7A 3MS9A 3OWJA 4I4FA 2C1AA 5HHWA 4AXAA 2JDVA 4KUJA 4AGWA 3TG1A 3I6UA 4G6LA 4UV0A 5AIRA 4NT4A 5IDPA 3AGLA 1H07A 3KQWA 3UFBA 1GZOA 2OWBA 4DKJA 1GIHA 5FXRA 3DA6A 3TFWA 2IZRA 4U41A 3R1SA 3UBTA 4ZAUA 4KRDA 1XH8A 4X6QC 3FI8A 5IA3A 4QYHA 4YBKA 3MTIA 3KMMA 2JIVA 2DS1A 2QOLA 3FJQE 3LFAA 2W1HA 3MCZA 3FC2A 3PG1A 3FZ1A 5DTQA 4KIFA 4G5PA 4AZFA 5DR2A 3FL5A 3G0EA 1RJGA 3HL7A 3IPHA 4EJNA 1IAJA 3FMKA 4NJ3A 1J1CA 4EH3A 2P7HA 2I7QA 2QU5A 3WYXA 5FUBA 4LG1A 4EH9A 4CLJA 2QG7A 4QYGA 3II5A 4Y72A 4BCKA 3VQUA 3PFQA 2YFXA 4L43A 3CC8A 2QOQA 2E9OA 2RGPA 4FSWA 4BZDA 3FI2A 3N4UA 4ZZMA 3EZVA 3UO5A 1XTPA 3HCAA 2RIOA 4FKJA 2PMIA 3BYOA 1OVEA 3BYMA 3F2RA 3MJ2A 1W0XC 3OFMA 3K0BA 2WGJA 3NWEA 4W4YA 3P2EA 3R9OA 4OBXA 5I9XA 2JDTA 5EOBA 5DSTA 3TR6A 2WMQA 1ZYSA 2NRYA 4AT3A 2CCIA 2ZDTA 1KUTA 4JBOA 5GINE 1J7LA 5KUPA 5FA8A 2VO6A 2CGVA 3JVSA 4JBVA 2GNHA 3W2SA 4AW1A 4CFMA 3BBTB 3QZFA 5IG1A 3LJ1A 3OBGA 3BRBA 3PJ3A 1WCCA 3NYXA 3FXZA 4IHPA 3FTFA 5AUTA 1OIUA 2W17A 4BB4A 3Q04A 3A7EA 2N47A 4PP9A 5L2IA 3BKWA 4L67A 4M15A 2B0QA 4YJTA 5HIDA 3UNZA 3MFRA 2R3IA 4OT5A 1B39A 4M36A 3F3VA 3VVHA 2RG6A 2W1ZA 2WHBA 3W10A 2P7IA 3O51A 3HUBA 2GHLA 3KXNA 3PP0A 4L3LA 5HGIA 1DAWA 4O83A 5E1MA 1YWVA 1YXXA 1H1RA 3KXXA 2H11A 4OTFA 4MWIA 5CAQA 4LMNA 3VO3A 2HZIA 3RHXA 4PNKA 3EEOA 4XX9A 1HCLA 3OCSA 2JAMA 4BTJA 3PXZA 5E1OA 2P1DA 4CRLA 2GTMA 5D10A 2PVLA 1B42A 1Q62A 4RC3A 1QAOA 3QRKA 4BYJA 2R5TA 5AP6A 4JL9A 3T3UA 3G89A 4BCMA 2FGIA 2E2BA 3QD3A 3UC3A 3CKKA 1F3MC 2YM4A 3UA3A 2ZV8A 1QPDA 3E8DA 2Z8CA 3NIZA 2F8LA 2F2CB 4L3PA 5K0JA 1WXWA 5HG5A 2XYUA 1AD5A 3EZRA 5CS6A 3MTFA 3BV3A 4RQKA 1GZKA 2ITXA 4LOPA 4X2KA 5AP0A 5HVJA 2GH1A 4PIPA 2AVNA 3ALOA 4FKOA 3JS2A 4MXOA 4CFNA 4DFUA 3BZ3A 5AX3A 5EI6A 4EORA 2PVFA 4WG4A 1QZZA 3FZRA 5CY3A 4I20A 4FZVA 2X9EA 4QTTB 4LQMA 4Q2AA 4PTCA 2OK1A 3NRMA 2F7ZE 2UYQA 3FY0A 3OZSA 3OMVA 1VYZA 2PVKA 5J8IA 3TKIA 4QTEA 3EVGA 4RTQA 3LFBA 3NYOA 3VWAA 4F99A 5A46A 1ZRZA 1UU7A 3V8WA 5L8KA 1F38A 4BBFA 2BM9A 2EXMA 2JH9A 3R2YA 2C3LA 3FYKX 3MJ1A 1M14A 4CKIA 1ZGAA 2UZTA 4JG8A 4I41A 3GRRA 3PVCA 2X4ZA 4CXMA 5L8JA 1JVPP 1Q8WA 1CKPA 3PY1A 5CU6A 1ZMUA 3R7IA 1X1BA 2ZIGA 1YHVA 3L9MA 1IY9A 4FIIA 3Q5IA 3OU6A 1OM1A 2SRCA 4KSQA 3FUTA 4PGHA 2X7FA 3LX6A 5M56A 2OF4A 1PMVA 2Z2WA 2OU7A 2AN3A 3W2PA 2Y1WA 4DMGA 5L3AA 4O96A 2W1IA 3R7OA 4X7QA 3RMFA 2J50A 4CV8A 2IFTA 1KSWA 4BN1A 2BPMA 3P4KA 5LQJA 3GO4A 3CKWA 1BI8A 4TT7A 4J71A 1FINA 2C6OA 3D2LA 5ITAA 5FXSA 4IFCA 2GAFA 3BWCA 1KE6A 3C0HA 3ORTA 4U44A 4JQ7A 5DM1A 1M6YA 4KRCA 4LG4A 2PX8A 4WNMA 3TKHA 1H25A 4OTGA 3ZC5A 2A4LA 3UVRA 4DINA 3ZBXA 3GBZA 4Q5EA 2ONLA 4BTMA 2QRVB 4R1YA 3NWWA 3VRZA 4C3RA 3KQTA 4AS0A 5I0BA 2JDSA 2CNUA 2VWXA 4RFMA 2W05A 1NBIA 3P97A 4YU2A 5H2UA 1E9HA 3OUNB 4DGGA 1YKRA 1ZZ2A 4E6AA 3GU5A 1YXVA 3G33A 4IEBA 5ANKA 5EG5A 4LMUA 2BM8A 4NL0A 5ANEA 2HZ4A 4GT5A 3EYGA 2IW9A 3MY0A 3DB6A 5DVRA 2HY81 1DCTA 2XEZA 3ANQA 2VWWA 4CZUA 2F49A 5HTCA 3MB5A 4G3FA 4FTRA 3UVPA 4YMGA 4F6WA 2G2HA 2QODA 3OTUA 2AOXA 4FYOA 5HLNA 1IAHA 4BRXA 2F7XE 4I0TA 1OKVA 2RFDA 4IV0A 2CL5A 2F57A 4GUEA 4RIOA 4RWLA 3ZC6A 3VBVA 3HNGA 4DGOA 1VIDA 2ESMA 4GOND 3P2KA 2J0IA 4GIHA 3QC9A 3E3BX 4GCJA 3K5VA 2XK3A 2PVJA 3OROA 3OWLA 4G3GA 4JX3A 4O82A 3FLZA 1IXKA 3COHA 2X8DA 3LFSA 4FEVA 4FTQA 3Q2MA 3GWZA 3LL7A 2BR1A 3PTGA 4YMHA 3QXOA 1H4LA 1P4OA 1PY5A 4N6YA 1KE8A 1Y6BA 4ITIA 3V3VA 4HPUE 4MK0A 4DA4A 5L8LA 5JUWA 3PSCA 3W16A 3HMPA 4O0WA 3OD6X 3PY3A 3POOA 4BGQA 3OXZA 3P08A 4EK6A 4HYSA 4PL3A 4YLJA 3UYSA 5FTGA 3FKOA 1PMUA 2CDZA 4OBOA 4WNOA 3W18A 4BCNA 4BDEA 2VDVE 4GOOD 3UJCA 5LQRA 1X8BA 3H9FA 4JDHA 1UKHA 2CPKE 3KEXA 3PJ1A 4ZEGA 2IO6A 3H0ZA 3MVHA 4F9CA 4A9TA 3VS5A 3OT8A 4XCUA 5JFXA 3OPNA 4TWNA 3VIDA 1UA2A 3CGOA 4AN9A 4R1VA 5FHQA 2P0CA 3ODZX 4KIQA 2HZNA 5C0OE 3O23A 4M0YA 4RT7A 2VTAA 3MDYA 2R0IA 5CNOA 3HMNA 1BOOA 2XK7A 2PXAA 1Y57A 3S1HA 4YZNA 3TNQB 4Z16A 4Z2YA 4YC3A 2WU6A 3BYSA 4F09A 3OU2A 3DNEA 4ARKA 4AW0A 4B4LA 3L8VA 3N4TA 5BVDA 4FSUA 4ACCA 4EKKA 3KQVA 3E8CA 5D7AA 3E7OA 1W7HA 4EK4A 4O2ZA 2QU6A 3TNHA 2ZLBA 3T7SA 3O8UA 2FH9A 2HELA 4JJRA 3W2OA 1JQEA 2JBOA 2GFCA 4APPA 4FYNA 4QO9A 3A7HA 4HYUA 4ZLYA 5KKRC 2AN4A 4EQMA 2NYUA 2V74B 4FNZA 2QYOA 3PFGA 1SM2A 4OBWA 4YZDA 3E62A 5G1XA 4ZJVA 4ENXA 2R2PA 4QQ5A 5DLYA 5EG3A 2YA9A 2WMTA 1QPCA 4L01A 2XYQA 5HIMA 4EK5A 10MHA 2EB2A 3LE6A 2EXCX 3MB6A 5FGKA 2C47A 4YMJA 5JH6A 1F0QA 1GJOA 2O3PA 3IGOA 4L7SA 2X6DA 3FHIA 3OFKA 5ACBC 3SX0A 4ZSAA 1LP4A 3I9FA 1TKIA 4O0XA 4C2WA 3D7TA 1JOWB 2OJIA 3AMYA 3Q4CA 3T8OA 1R00A 1T43A 5ICEA 2BDWA 4XV1A 3BLQA 5B2MA 4YTIA 4ATNA 1E1XA 4WO5A 5HEZA 3KQOA 2W7XA 2G1TA 3Q4UA 4N57A 1VLMA 2BIYA 2WTDA 3QKLA 4MXXA 3QUPA 1RJFA 3R00A 2GNGA 4C61A 3RP9A 1PXOA 3S95A 3F5UA 3NUYA 2QO7A 3HA3A 2WELA 4HTFA 4AT5A 3EFJA 3GCUA 5CZHA 3FUXA 4O6LA 5AM6A 3TV6A 3ITZA 4DGNA 5AV1A 3RJCA 3F7ZA 3MFUA 5C8MA 4FSRA 1WVWA 4QNYA 2XM9A 2PJDA 2JG3A 4C0TA 4U45A 4E6CA 4CMTA 3BE2A 5KHWA 2R3JA 3ERCA 2OBFA 5KBRA 1INLA 3RGFA 2O0LA 3P78A 3ZEPA 4QVKA 5DRTA 5FULA 1Q5KA 5LVPA 3N9XA 5IQBA 5FCDA 4CWAA 1PKGA 2ZW9A 2Z7RA 3PVGA 3K2LA 2NP8A 3ZO1A 4ID7A 3LKZA 3FRHA 1I09A 2JIUA 2VTJA 2QO2A 3I58A 4IANA 3QTZA 2WD1A 3O2MA 4RIYA 5BYYA 4GSBA 4O0TA 4TL0A 1P1BA 5HCYA 4HPTE 3B3GA 2EUFB 1B6CB 4EK9A 3EIDA 4ALVA 2G9XA 1VYWA 4RX7A 3MWUA 4E32A 3OCTA 4ER6A 3DZQA 3CSVA 3C4WA 1PF8A 4L42A 2J4ZA 2XIRA 4RVTA 4BZNA 3A26A 4D58A 3TOSA 2H6DA 5HD7A 3GRUA 3CQUA 1PJZA 4P7GA 2GQGA 3FC1X 1CKIA 4N0SA 4PRJA 4U43A 3DOGA 4QP1A 1H26A 4FNYA 4WG3A 5E4HA 3H9OA 3HAVA 4AUAA 4EQCA 1YF3A 5AEPA 3DAEA 5L6PA 1IASA 1KWPA 3PPKA 4GEOA 5FWAA 3TQSA 2WTIA 4AA4A 5EQPA 4BHNA 1Q8YA 2ZFUA 3NTVA 5D9HA 3V5PA 3NNXA 5HVKA 2PWYA 4AX8A 5IQIA 5FRIA 5ANOA 3OCGA 4EJ7A 3V51A 2G8NA 4U40A 1H8FA 1E1VA 4NU1A 4EQUA 3BWFA 3ANRA 2VRXA 4FVRA 1PHKA 2UYOA 3RW9A 1NBHA 4RIWA 2IJMA 3S2PA 4E4XA 5LQCA 3LLAA 3F9NA 4YR8A 3HV7A 4I4EA 5IZFA 3EVBA 4HH4A 2BAKA 4DFLA 2BALA 2X6EA 4O81A 3NNWA 4FL2A 2X8IA 4LOQA 1R1WA 3GFEA 4O27B 1KOAA 1SVGA 4FC0A 3TIYA 5CANA 3V97A 3CE3A 1R8XA 2R6ZA 4RTLA 1H1WA 4E6QA 4F7JA 3QTSA 1XBCA 3KKVA 4FSTA 3VW6A 5L2SA 3AD6A 2ITVA 5J1WA 4UWBA 4EKLA 3PSBA 3RNIA 4GVAA 3HV5A 3PA3A 2PVRA 2X4FA 4NJDA 2Y8OA 4XG3A 5CEKA 3OE5A 3WIGA 3TJDA 1JKLA 2J0JA 3V6RA 4AF3A 2DWBA 4ZMEA 3HP7A 4QMPA 4CKEA 4RFZA 4F85A 3NSZA 2XIXA 2ZJWA 2LGCA 3V6SA 4F65A 5J87A 4NW6A 4QYFA 1NW3A 4YV1A 2JKOA 3CCFA 4WUAA 4X2FA 4RPVA 4DC2A 1PXLA 3CD8A 3R2BA 4KB8A 5A4EA 3HVIA 4PIMA 4RSSA 1S9JA 1L9KA 5HCZA 3KF7A 2A14A 2IZUA 2CNQA 3LXPA 2ONYA 4KIGA 3FUUA 4WG5A 3TMAA 4AZVA 1VZOA 2JKMA 1CTPE 3FZTA 4PL4A 1PYXA 3OS3A 2VN9A 2PZYA 4PMTA 5IA5A 1GOLA 4Z55A 3UNKA 4Q9ZA 3A8WA 5H8EA 5BPYA 2ZIFA 2VAGA 4MD7E 3WF9A 4CRSA 1L3RE 2HW6A 5KYGA 4N4SA 1DM2A 5E9EA 5F4NA 1BMKA 2F7EE 2Z7LA 5HU9A 3G5DA 5EPEA 3QGWA 3IOKA 3C13A 2XNBA 5AUUA 2G70A 5GM2A 1J1BA 1Q41A 5EVJA 2OXXA 5M4UA 2B9HA 4JIKA 1ZGJA 2Z6AA 4AACA 3TWJA 4EUTA 4Y73A 4QP3A 4XS2A 4F86A 4FKSA 3FMHA 4MNEB 1JBPE 4D1XA 4DF3A 2ITNA 4PWNA 4DM3A 3S68A 3UO4A 3GRYA 3CJQA 3FUVA 4RTNA 2QQ7A 3G2OA 3ZU7A 1P91A 3RAIA 5EZQA 2OFVA 5E8TA 3UZRA 5KMOA 1XCJA 2VWZA 5CENA 2CCHA 5IDNA 5DR6A 2W06A 3DBDA 4FV2A 3BWMA 1REJA 3DMFA 2ETKA 5LQAA 4BLVA 1WBWA 2WTWA 4U5JA 4EOPA 3DXNA 3LCDA 1XR1A 2IZSA 3CTHA 3LFDA 4GRBA 5BUJA 3GCZA 2HV9A 2HY0A 4C2VA 5FDPA 3A7FA 2CMWA 3I0QA 3QU0A 5D7VA 3SXFA 5JGDA 4JQ8A 3HCEA 3A62A 3DAJA 1WBNA 1LEWA 2C7OA 3TKYA 2I0EA 2E9NA 4BDBA 3BE9A 2QOHA 2V7OA 4ASZA 2OO3A 5FHRA 3JVRA 3LM5A 3R9HA 1ZXEA 5K5XA 3F3WA 3IW6A 4IB0A 5EEGA 1O9UA 4C4AA 2ZOQA 4QTDA 4RYLA 3UIUA 3L9LA 3E8EA 3EQFA 2Q83A 3GXOA 5F2OA 1IA9A 1M7NA 3PTAA 2YHVA 5BVKA 3FKNA 3FMMA 3GU7A 3C3PA 1JAMA 3Q6UA 4WXHA 3SM3A 2G2IA 3DTWA 5HOQA 2WMWA 4XP0A 3ZBFA 5FEDA 3EH9A 2J51A 2KULA 2B54A 4ZS0A 3POZA 3IGGA 1BC5A 3E92A 3R63A 3WZDA 5I4NA 3BHTA 5CTPA 2ZB0A 3NZ0A 3PZHA 4ZTNA 2XP2A 3CVOA 3F66A 4IAKA 5H8BA 1MQ4A 3KK9A 3R8ZA 4B8MA 2PUNA 2UW8A 3B3FA 2RL5A 2NXNA 3FZPA 2HIWA 3KF4A 4FZDB 5M53A 2Z6UA 5AV0A 5C9CA 1FP2A 3ENMA 5HI2A 3TDWA 3GFWA 1KP9A 1P5EA 2CKPA 3SX9A 3PWDA 3PUPA 2PT6A 3P1AA 5A6NA 1G38A 3GUBA 4ZS4A 1G55A 1ZAOA 3DBEA 3DKGA 1S9IA 4HGSA 4GUAA 3R7EA 1R74A 1FMOE 5C4LA 3QRJA 1JKKA 4HGYA 3SA0A 2J9MA 5HNIX 3AG9A 4HGZA 2CMHA 3FLSA 3VS4A 3R0QA 4QDJA 2PVYA 2WOUA 3E5AA 3KK8A 3DKCA 4MBLA 5EM8A 5KX8A 1SVUA 3FPMA 2B1PA 4FKQA 2XVDA 3KU1A 2IZTA 3L1SA 1K2PA 4EEVA 2R64A 4YBJA 3CBGA 3DMHA 2O5KA 3S3IA 3IEIA 3MHTA 5BVOA 4OQEA 4E5BA 2W1EA 3PRFA 4FOBA 4M0ZA 1XBAA 2GDOA 4JI9A 1U59A 4YV2A 3EQIA 5HIEA 1X1AA 4QDKA 3N4VA 1OZ1A 1SKMA 2WFYA 1H1SA 5DM2A 2V0DA 3PXFA 3ZTXA 2FK7A 3C6KA 4YJUA 5HVYA 5LVOA 5DX0A 4BLUA 4ZMFA 2GS9A 4ANSA 3PE2A 2ITPA 2K4MA 3G90X 5AUXA 1EG2A 3TM5A 4A06A 4PDSA 2ZZNA 3RVGA 3PIXA 1ATPE 4L3JA 2O65A 4QP2A 5C8NA 2EU9A 4RLLA 4OW8A 5CXZA 3NVMB 4MD9E 3GOKA 4QTBA 3VRYA 4PYLA 4YJRA 4F1MA 3WSTA 5DPVA 4CT2A 2XVMA 3D2KA 4CTKA 4NWMA 4RV9A 4I24A 4D2SA 4RWZA 3ACKA 5JEBA 4EMSA 4KD1A 3MY1A 3V5LA 2WMRA 1JNKA 2H00A 3VS6A 4BZOA 4QQTA 4G6OA 4ZTLA 2FVDA 3CGFA 3LIJA 1X1DA 3BQCA 2QRVA 5EYCA 4HYIA 2YITA 4WKQA 3MGYA 4E2WA 5DIAA 4UB7A 4M14A 1RI3A 2W1DA 4DEDA 2Y7JA 3PPJA 5IH3A 4C35A 1Q0TA 3C4XA 5JQ5A 3COMA 2QURA 4IZAA 4GH2A 3RPSA 5LQUA 4U80A 1O6KA 3MH1A 5HU3A 4GC5A 1H0VA 1OITA 9MHTA 5CSPA 3ZEWA 3AWIA 3IDPA 4FVPA 3A99A 2C0IA 3CJGA 3QLFA 3R1QA 4BKJA 4E93A 5IH6A 2CKOA 5F1ZA 1KIAA 5DN3A 3SSNA 2PU8A 3HMOA 3E93A 4G9CA 4RA4A 3UJ8A 3R22A 4P5ZA 4DAWA 2ZWAA 2VWVA 4FNWA 2UZ4A 5E1SA 3UGCA 4FKGA 4OT6A 2P40A 4C03A 3CPBA 2R3MA 5CQUA 5DLSA 4DH3A 4GEKA 4TYIA 2WA2A 4DH5A 3RZBA 5LMBA 5EMKA 3IW5A 2G15A 2JAVA 2XJ1A 2YM8A 4E5AX 4KBAA 3EFWA 5CSVA 4HVHA 2XNPA 4B7TA 3M6WA 5HIJA 4E30A 1NVSA 4G31A 5CASA 5KMJA 1IR3A 2UUEA 4HNFA 1CDKA 4S31A 4DGLC 3VS2A 3Q7EA 3UJ7A 3NS9A 3G5TA 3KULB 4I3ZA 4QTUB 4WVLA 1L8TA 3PIYA 3VAPA 5EZSA 2IVTA 1HMYA 2C7RA 4LRJA 3KULA 3ATSA 2C6IA 1TQIA 3KL8A 1IG1A 4JBPA 4HVIA 3NIEA 5DM0A 3Q2JA 5E9WA 4JOAA 3MA6A 3SDJA 3UPZA 5FLFA 3CD3A 2BFXA 3OTVA 4E5WA 1A48A 4Y8DA 2G72A 3DOUA 3HVJA 5CCBA 3QGYA 4USEA 4EH4A 3LKMA 4V04A 2BZIB 3DS6A 4YSMA 3I5ZA 3UQGA 4BBMA 5BNJA 1ZZLA 3FMNA 3VF9A 2J7TA 4A07A 5KMLA 4F4PA 1OL1A 4DTAA 4ZTSA 1N2XA 2YTZA 3NW5A 5BW5A 2Y9QA 4J1RA 3VF8A 2O0UA 3FXXA 4CZTA 4P7KA 4IJPA 5EDQA 3UZPA 3IYLW 2UZLA 5ERGB 3UJ6A 2W1GA 3OW3A 4MEDA 1FGKA 4YPSA 3OG7A 1ZLTA 4PGGA 4G9RA 3D0EA 5T64A 4F70A 2A1AB 4U8ZA 3TV4A 3C51A 4H3QA 3QQKA 4KBKA 1EJ6A 3DXXA 3ORNA 1OKYA 3AY0A 2ZZMA 1EJ0A 2WQEA 1JG2A 3G0FA 1DI8A 5JZNA 1ZMVA 4C59A 4E73A 3SC1A 4ZZNA 2OIBA 4YC6A 5FDXA 2PY3A 4KIPA 4LI5A 3ETAA 4EUUA 3KQSA 1QCFA 5AWMA 2QOKA 4ZP5A 3P9JA 1R0PA 3OEFX 2GQSA 2V7AA 5ETAA 1ZY5A 5E8JA 3A60A 3QWJA 3E88A 3VHKA 1I4WA 2HXQA 2QKRA 4YNOA 2PZIA 3QQHA 1IA8A 3V8SA 4ERKA 4RTSA 4V01A 4O0VA 4K11A 5CVFA 3WE8A 3FLWA 5FWDA 4A4LA 2VU3A 2C7PA 5DT0A 2Y1XA 4GQBA 4LECA 2UW9A 4GKHA 4PX6A 1OPJA 3F2AA 3UYTA 3PA5A 2YCSA 3GU6A 2BH2A 2VO7A 1U2ZA 3FZGA 2EWAA 3LXNA 4MCVA 3GT8A 4CQEA 5JGBA 4ZTBA 2XK8A 2C6MA 5EI2A 3T0IA 2X39A 4GU9A 2VTMA 2ITWA 3R8PA 1R3CA 3SAYA 1H01A 3BCEA 4AAAA 1MJFA 3DMGA 3OY3A 4L68A 5DH3A 4F6SA 1JG3A 4PCLA 3MH2A 4ZY6A 4AFEA 2BZJA 2O2UA 4PMMA 4EBWA 4F0IA 3DKOA 2ZBRA 2VTHA 4AA0A 3DLSA 2VWUA 4WNKA 3WILA 2WK1A 4PYQA 5P8WA 4CKCA 5DWQA 4JBQA 1U5QA 4IC8A 2GLUA 2V22A 1BLXA 2RKUA 3EMBA 3G6HA 1U46A 4DN5A 4RX8A 1Y8GA 4QMZA 4MHTA 3TDVA 3U87A 2UZEA 2P33A 4FZ6A 1XWSA 5CU4A 2GTNA 2JEDA 3RHKA 4DZRA 2GHMA 4R7BA 3RM6A 3UZTA 4FK6A 4PYNA 2XIYA 2B25A 3BGQA 2C3KA 2YM3A 3HYHA 3DCVA 4BY9E 3LQ8A 3WF7A 1URCA 4F7NA 4U6RA 2P3OA 3R02A 5TR6A 3LHJA 5AP4A 1BHJA 2I7CA 4O86A 3U8WA 4U0IA 4OA5A 2VTNA 2OB1A 3NDIA 3VUKA 1P2AA 1XDSA 2W96B 4YNEA 5HD4A 4V0GB 1NA7A 4IMYA 3RCDA 2YEXA 3F3UA 1H08A 4TNBA 2J0LA 2W9ZB 4CTCA 4F7SA 2ESRA 1JTFA 4RTRA 3HKOA 3A7GA 2FUMA 2WB8A 1WVXA 3COKA 1O6LA 2WO6A 3UG2A 5BMSA 3A7DA 4FR0A 3AT2A 4YPDA 2VX0A 5JSMA 4NK9A 3K3IA 5DGZA 2QLQA 3THBA 4TTHB 3ZCLA 3THRA 3HA5A 5EEHA 4POOA 2PL0A 4HCUA 3R6TA 3NR9A 5EIFA 5HEKA 4ASEA 1XKKA 4YV0A 3AD4A 3LECA 2O8YA 3QRUA 2UV2A 5C1QB 4IKPA 1YI3A 5FM3A 3R1NA 1KXZA 3JUHA 5CSXA 4IADA 3G8AA 3GNLA 3MW1A 4NKAA 2ZWVA 3TPZA 3BGDA 4F0FA 3ORIA 3KR9A 1XDZA 4KVZA 5C1IA 2JITA 3DFCB 2WQOA 5AUZA 3WBLA 3HVKA 2WMVA 2ZM1A 4ITHA 4EOOA 5E1BA 4QYYA 3T3VA 3R9XB 3P9KA 4YUWA 2GPHA 1FGIA 4HZSA 2VUWA 2OGVA 3NUUA 4NFNA 2QD9A 3EOCA 4U7PB 5M5BA 3QHWA 4QP9A 5DHJA 5EW9A 5HO8A 1Q8ZA 1RJBA 2R7IA 2VTSA 3GC0A 2UVXA 3MVLA 4JXFA 2BCJA 2ZM4A 2HWOA 5CNNA 5DOSA 1MHTA 4JX7A 4TRLA 3CQWA 3L8SA 4AGCA 3UJBA 1NW5A 2FK8A 5IKMA 3V01A 3BGVA 5GM1A 5CVDA 4PNEA 4YJPA 1QAQA 2WMBA 2GNJA 2GS6A 4F6UA 3HX4A 3FV8A 4G6NA 3X0DA 2OH4A 3I6WA 2OO8X 3DR5A 3CLYA 3D15A 5TF9A 3GU3A 5FQOA 3QTUA 4IZ5A 2AZTA 5AUYA 3NPCA 2UW7A 1CSNA 3D83A 3LJ2A 1OB3A 3TM0A 3U6JA 4A6DA 2XRWA 1G8SA 3ULZA 1FPQA 1M0EA 5L2TA 5LMKC 5T6BA 3GNIB 4FG9A 2F9GA 1WBPA 3DDQA 4J8NA 3MTEA 3DQWA 3OP5A 1Y6AA 3W55A 3GOPA 4BCOA 4RA5A 2YDIA 2IIPA 5EKXA 2GNLA 2WMSA 5KNJA 3A4OX 4UZHA 5FUTA 4RX5A 2F4JA 1YB2A 2HTEA 3MFTA 4L44A 3AD5A 3NYNA 1ZARA 3TZMA 3NYVA 4WHZA 5HBJA 4FI1A 5AAFA 4GC9A 2BRBA 4FKVA 4KBCA 4KSPA 4FEQA 3GC8A 4KWCA 1ZYDA 4CLIA 4PYJA 3CR0A 3CTJA 3EFKA 4ZTRA 1UU9A 4A4XA 5DG5A 4B99A 4EVIA 5F2NA 2I9KA 4D4YA 1SMHA 4IJ9A 4ANMA 4FKRA 4IB3A 4MNEA 4MQ1A 3S4QA 3PRIA 5H3QA 4BCFA 2PXCA 4E4LA 4EOMA 1XDUA 3V5QA 5K9IA 2OH0E 4YJVA 2LAVA 3HA7A 2PX4A 1UU3A 2RFNA 2YM5A 4QPPA 2CLQA 2PPQA 3RK9A 4CNHA 3ZO4A 3DLCA 5LWMA 1YXUA 3EHAA 3DXYA 3ORPA 4YZCA 3EQCA 2J2IB 4ZSLA 2C3IB 2BTRA 4EOLA 5BP7A 4XV2A 4TZRA 2NO3A 3HVCA 2PZRA 4LRMA 3CEKA 4Y95A 1ORHA 3LFFA 4AQCA 4H58A 5CEQA 3KB7A 5LVNA 4EYJA 5FEQA 4GBED 2ZV7A 4DBNA 1NY3A 5M08A 4Y2HA 3PA4A 5K01A 1YWRA 3KQYA 5HILA 4DITA 4RX1A 1T46A 5A6OA 4CV9A 3GJYA 3OWPA 3TZ7A 2YDJA 3EVZA 3QYWA 4R7HA 3R8LA 4QMWA 3R71A 4P2KA 3RPYA 3WOWA 3PX2A 4ZSGA 8MHTA 2AUHA 1HNNA 5DXJA 4AN2A 1I9GA 2C0OA 1WS6A 2AC5A 3IW8A 3QKKA 3JWGA 4KDRA 3THSA 4TN6A 3R24A 1Q3WA 4JRVA 4HRAA 4PYKA 1MUOA 2XBJA 2I62A 2R3QA 4F0GA 2H96A 3OW4A 4XRJA 5DEWA 1I1NA 2B53A 4RWKA 4D1ZA 3SSOA 1U54B 3P86A 3VS3A 3L9PA 4FT5A 3NCZA 4YZ9A 3EL8A 2XKDA 4HGLA 1OBGA 4BR3A 3ZFXA 1YWNA 4FTOA 4ZTMA 4AU8A 5IUHA 4BCQA 3C5IA 2ZULA 5F2KA 2WEIA 2OB2A 4R8SA 4M69B 4RJ6A 2X81A 3QTXA 4NIFB 2YIYA 4V05A 3T7RA 4B6LA 2B9JA 1RJDA 5DBXA 2IH4A 3IG7A 4FP9A 3BQRA 2A2AA 2WMXA 3ORXA 3MQ2A 2VD5A 2I0HA 5B1SA 5M4FA 4NM0A 4AP7A 3QA8A 3ROYA 2OLCA 4E6DA 5BW4A 5A4TA 2JFMA 2OXDA 3EN9A 2R3HA 4PTEA 3ZSGA 3DH0A 1JSTA 1QYRA 2CGUA 4D5KA 4XUEA 4EH6A 5AJQA 4JR3A 3DQXA 2O05A 1DAYA 3FKLA 3OXTA 3KRJA 3KXZA 2BRMA 3RALA 4MXAA 4D2RA 1TVOA 4RVLA 3PXKA 3FTEA 2CSNA 3JXWA 4LUDA 3OUKA 4ANQA 4BDCA 1XQZA 5CSWA 2QOBA 3F2NA 3O0GA 4QNAA 5GJDA 4IDTA 4IVCA 5EKNA 3HCCA 3QAME 3SV0A 4KIOA 4K2RA 3LDUA 3LHDA 1R18A 5CU0A 2BKKA 2ZMDA 2FSMX 4GG7A 2E5WA 3KHKA 4OUCA 4TWPA 5EW8A 4XH6A 3NEWA 3TTIA 3KU2A 1Y8CA 5I9UA 4ZIMA 5IQEA 2VP3A 1XO2B 5KMIA 3SSMA 4PINA 5DEYA 2ZTHA 4NH1A 2OJ9A 1ERKA 4YC8A 5CU2A 5KHXA 1Z3CA 4OX9Y 3GU4A 4NYEA 2XIKA 3SOCA 3IV6A 5CM2Z 4AOTA 1O9GA 4RG0A 4QMNA 1YHSA 3A7IA 4EH2A 5HG9A 3EJ1A 4GS6A 3TXOA 3DV3A 5D1HA 4KKHA 5CALA 3L8DA 1CMKE 3JWJA 3P8ZA 3ZXTA 2HOGA 3VUGA 4Z9LA 1TPYA 4EWHA 1QAMA 1AQ1A 4D9TA 4AA5A 3R9DA 3FPFA 3SMQA 3D9VA 4ERWA 3Q4TA 3D5VA 4J8MA 4BYIA 3EN6A 3F5XA 4UYAA 3RTPA 2I0YA 5ICPA 4KINA 3Q6WA 4O0UA 3MH3A 4FIFA 3AGMA 1NVRA 3DBCA 3ZLYA 2VDUE 4MD8E 4RGJA 3D94A 4GF5A 2VTQA 4NTSA 3PDTA 1FP1D 4QPNA 4F9BA 5J1VA 4M68A 2EJTA 2FRXA 4FZFB 3V04A 3MPAA 2VS1A 3B8QA 2B52A 1TW2A 2C6TA 4EI4A 3SXSA 3FLQA 2NXEA 2UVYA 3PJ2A 2Q41A 3W2RA 4WNPA 2OFUA 4RVDA 3DXPA 3KRXA 2B55A 5DYJA 3UTOA 4EC8A 2OXTA 2V62A 3AMAA 5E8WA 4ENYA 2AOTA 2HYYA 3G7UA 2PVCA 3Q9XA 2YCQA 3ZRMA 4FV7A 3AC5A 4LGGA 4OTWA 2AOTB 1RI1A 2P3GX 4JDJA 3RPOA 2XNGA 4DTKA 3EN4A 1MRUA 4TNDA 5IUIA 3F82A 4ACDA 1VQ1A 2O63A 3HZTA 2C3JA 2IH5A 4B17A 1H1DA 3CQEA 3DFAA 4ASXA 3NVKI 4OLIA 4AZWA 1JTEA 4U81A 2XK4A 3E64A 3W32A 3H30A 2IVSA 3RWQA 2UYHA 4XRLA 3CJRA 3RAWA 3M4XA 2RF9A 5I5ZA 3BWJA 3EQDA 4QMOA 3V8VA 2IN6A 5CU3A 2ERCA 3VC1A 2C1BA 3OY1A 4M3QA 3KPVA 3CY2A 1JKSA 2CKDA 1QL6A 4CXAA 5BVFA 1RI2A 3E05A 4FKUA 5CF4A 3G8BA 2YVLA 3UBDA 3ZLSA 1YDRE 2XCHA 5CI7A 2ITUA 2PE2A 4EK8A 2EFJA 4DLIA 4GL9A 3SGCA 4FSNA 3RCJA 1EAMA 4R78A 1ZKDA 3R3HA 3FZSA 3QA0A 4LGHA 5EM6A 2R4BA 3Q3BA 4FGBA 5BVWA 2QI8A 4NM5A 4QRCA 3K3JA 4IAIA 4MBIA 3QRTA 2BIKB 3U9CA 1UIRA 4QQKA 4E2XA 2IGTA 4ZLZA 3QX2A 3U4WA 5E1DA 1WFCA 5IH5A 3KR1A 5EKOA 1LR4A 1W84A 4J98A 3ER8A 3Q96A 3WE4A 4P7JA 3LLTA 3UOHA 4DFXE 3M2WA 5H9BA 4OTQA 1M7QA 4C4EA 2KW5A 3C0GA 3V5WA 2XK9A 3OC1A 4U7ZA 2BROA 5E92A 4ANBA 4EYMA 4QMLA 1FBNA 1IEPA 5CI6A 2QO9A 4A9RA 4QPAA 3VS0A 2OW3A 4M38A 4DA5A 4JXJA 2ETRA 3QOWA 3TV7A 3SQQA 3BLHA 3UP2A 5AAEA 4HVDA 4E7WA 3CGGA 4USDA 3VHEA 3I4BA 4MVFA 4EHGA 2GA9A 5DX8A 5EW3A 2R3GA 3EVFA 4TYEA 4AZSA 3OZTA 1OR8A 2XB7A 4ER3A 3MERA 4OBPA 4YJOA 1RJEA 3UPXA 5BVNA 1VJYA 5CZIA 4YGAA 3F7WA 3EKNA 5GHVA 3GI3A 5LVLA 3LFEA 4B0GA 2IVVA 2XH5A 4O7ZA 2R3OA 4FTAA 4JAJA 4JG7A 4QMVA 2FO0A 4ZK5A 5HX8A 5LQFA 4DYMA 1KE5A 4JAIA 1BI7A 4FTUA 4YP8A 4IACA 3L8XA 3R6XA 3V5TA 3TT0A 4AW2A 4C4FA 2BR3A 1Q8TA 2H9VA 2WNTA 4GK4A 1JSXA 3KR0A 3W33A 2P8JA 5G02A 3P79A 1MQBA 5IMEA 4X61A 2Y0AA 3MAGA 1CM8A 3HUCA 4L9IA 1JG4A 3A4PA 3DK6A 2JD5A 3B2WA 1XJDA 4R5YA 5FQDC 3VC4A 4BDAA 4IDVA 5IU2A 3FTCA 4J7BA 3GCVA 4FGRA 4FKLA 4GT3A 3I79A 3NW6A 3R7YA 4F63A 5KMMA 3WZKA 4O7LA 3GVUA 4CT1A 5ETIA 5K09A 4EL9A 4EOJA 2VWYA 1W98A 3EQRA 5AFVA 3K5UA 4L45A 3RODA 2B2CA 3GB2A 3UDBA 4HVSA 4MNFA 2W0JA 4J52A 3BU5A 1WZNA 1FVRA 4IWOA 5IQCA 4UYNA 5IQAA 5I9WA 5JGAA 3DBQA 5LXMA 1H27A 5HBEA 3RIEA 1M2QA 3MV5A 5C26A 3FPQA 3AXTA 3UJGA 3LDFA 5LWNA 4IH8A 3KN5A 3AT3A 2YIXA 2PZ5A 4QMTA 3EPPA 2X7OA 1R78A 2DQ7X 2UZDA 4ONAA 4P7EA 2OIDA 5H8GA 1QPJA 2YXDA 4LL5A 5EGSA 3LOKA 2FSOX 4DEGA 3COIA 4FKPA 4P4CA 2C5NA 2R3KA 3LCKA 4Y83A 2J0KA 4MXCA 3M11A 3SRVA 3U9NA 4GV1A 4E8AA 1XBBA 4N70A 5FTQA 4D0WA 2XYRA 3BT7A 2E9VA 4YO6A 4RWIA 3NW7A 2BMCA 1I44A 4EOQA 4GT4A 2AOUB 1OIYA 3H3CA 3C4CA 5AX9A 3WARA 5LOHA 3S00A 3E23A 4ZTHA 2VTIA 3HCDA 1YDSE 3H4JA 1L3IA 4OA8A 3ER9A 1YRPA 4F7LA 3UJ9A 2C6KA 4BTKA 3TEIA 5GJFA 3GGDA 3W2CA 3I5NA 3TTJA 3ERKA 4GIIA 4OGRA 3WF5A 4C3PA 4C7TA 2C6EA 3Q9WA 1UV5A 4WA9A 3TKAA 1ZOHA 2E9UA 4K8AA 2B3TA 3GXLA 2IH2A 4XOZA 2JDOA 2QLUA 4F64A 4MIKA 3LXLA 4A6EA 4UOEA 1AQIA 2OJFE 4C3FA 3QBNA 4IQ6A 3BPRA 2CLXA 4KWPA 1OKZA 3IDCA 4FE2A 4MAOA 1P14A 2PVHA 5EK7A 4Q5HA 3UOJA 4C06A 3TZ8A 3BHHA 3V8TA 2XZSA 1JPAA 3EMDA 3DJ7A 3FRIA 5K0GA 3W1FA 3KPJA 3WYYA 1UWHA 3M6UA 2O64A 1Z9XA 3QALE 3W8LA 2UZOA 4CG8A 3RAHA 4QPSA 1Z57A 2QY6A 2IPXA 1SUIA 5BQ0A 4MTAA 3U6HA 4I5PA 4H36A 2HNKA 2GQRA 5GNKA 3T9TA 5CXHA 2PWLA 3IW4A 2XNNA 1Q4LA 4FIGA 4DEHA 5K4IA 3BIZA 4EC9A 3QD0A 5TO8A 3DZOA 3HV6A 2YXLA 3HAMA 2X9FA 4FV8A 4CG9A 5I9VA 2P3QA 4Y5QA 4M67A 3ZLXA 2VZ6A 2JH8A 3B5IA 2W5HA 4JLCA 5EHIA 1Y91A 4FV9A 2XVAA 4QP6A 4KS8A 3EKKA 3SVVA 1GY3A 3GQIA 1XH6A 4FIJA 5E1EA 3MIYA 3AQVA 3LFNA 4NCTA 4CFXA 3V5JA 5TKDA 4GOLD 5IH4A 2CGWA 3P9NA 4NUSA 4O21A 4HTFB 1TQMA 4JDKA 3VSEA 1WBSA 3DU8A 5HLWA 4FTCA 1Q3DA 3ZM4A 4E31A 3PLSA 1AQJA 4S2ZA 2XRUA 2BILB 3QFVA 4XP3A 3KRLA 5HNBA 4G3EA 4MXZA 5HORA 5BYZA 1L3BA 4PP7A 5EHYA 4BHZA 3AC2A 4C4HA 5KCVA 4WRGA 1N7JA 2HCKA 5HZMA 3QLGA 3SG8A 3FMDA 4BF2A 5HE2A 5BYLA 4CFWA 1D2HA 2PWPA 4RTKA 1D2GA 4GW8A 4X2NA 5IEYA 3FPGA 5BMMA 1OPLA 2C6DA 2R3LA 5DA3A 3RK5A 3A27A 5ICFA 2Z6QA 3KXGA 3PWYA 3QF9A 5ETCA 4H39A 4U42A 5M57A 2UW5A 5CUQA 1U5RA 3EFLA 4EHVA 5HE1A 2EX4A 5DX1A 2PMOX 2QHMA 4Z7GA 2ADMA 2ZV2A 5JFWA 2UW0A 4C33A 4JDIA 5A4LA 3O71A
chains in the Genus database with same CATH superfamily
2ZRQA 3PJGA 3EQHA 4BU0A 4FX5A 1W8IA 4Q4HA 3WZJA 1FEZA 4IM0A 4ALUA 3D1LA 3QLUA 1HOWA 4PLPA 5EMMA 3JWIA 3KD3A 5JSYA 1JGTA 1NP6A 4CL8A 1XMPA 4G0UA 3CCBA 2P2HA 3EDYA 1F06A 2WIHA 1XB2A 4ZQEA 2OF2A 4AUKA 3GC7A 3EQ7A 1RQLA 2CHEA 2FR0A 2WTBA 2X22A 4KO2S 2GK7A 5K8LA 2HDHA 5EWLB 4KN5A 1JPUA 3PVUA 5CB8A 1JNXX 2CN1A 4EUEA 1ULBA 3D9QX 1ZC3A 4RXUA 3EB0A 2I40A 2YFQA 3TUCA 2EKQA 2OXCA 1Q0HA 4H18A 3LAUA 2YMQA 4YV7A 5CEOA 1N0UA 1V16B 4MV4A 3NQ41 2O48X 5HQ3A 2I6SA 1I33A 1Z7EA 4FIHA 3KQQA 1UPBA 5B5SA 2VX3A 4YHJA 1W36C 4FNXA 3HP1A 1VCOA 1A9SA 1V1MA 1CR2A 5EKDA 4G8DA 3T15A 4P4UA 1F9AA 1FSSA 1NE2A 4AN0A 1MIOA 3IEVA 3A4LA 5HE3A 3IOYA 1YQJA 4MARA 4MYRA 2PMFA 2RIPA 2BGRA 4XASA 5HFJA 2ECQA 2PULA 1BEZA 1AURA 1NP3A 3R7NA 2C69A 2E85A 1ODCA 4CUJA 1JEQA 4PR0A 3PKIA 5KVQA 4NZWB 5J2TF 3K05A 5CXXA 4G07A 4ANLA 1FY2A 1NJFA 4E5MA 5DHRA 2GJKA 3DAKA 3D3WB 1Y9ZA 4FV6A 5HF8A 1ADYA 5THXA 4WTOA 1T2VA 1DQZA 1S3FA 3O8QA 4C36A 2ZYSA 3AF3A 5J5SA 1Q74A 1TZJA 2OJJA 4OKIA 2ZV9A 1TQ2A 4JZYA 4UM5A 3KREA 3OBJA 2L69A 3BHJA 3OX3A 3LUHA 1PXNA 3M2TA 4DDMA 4ZK2A 1M34E 2IHVA 4FB4A 4GUBA 3ZBTA 1KDVA 3L6CA 2Z7QA 5BUCA 3CZAA 3FFBA 1WMKA 3O50A 3N8GA 4QGAA 4GIBA 2M6LA 1Y42X 2XMQA 3WA6A 2ENUA 3RUCA 2VP2A 2GCDA 3VO1A 1QCZA 2ZANA 2UVQA 1KVQA 1I94B 1R39A 3I2JA 5HKKA 2GNIA 3KDSE 1CS4C 4FTKA 3FPHA 1AV6A 1UOOA 1HZZA 2FWBA 2BP7A 2CVOA 4JT2A 1K3UB 4AJKA 4BDKA 1P7YA 2O5EA 1P0PA 2WWVD 1P3JA 3UNXA 1ZHFA 3O1LA 4UY9A 5JG7A 4IDQA 4I93A 3GDHA 2DLDA 3BOSA 5CURA 2YJRA 1HE4A 3G79A 1COWD 5LLTA 4MP3A 3FM9A 4WJKB 4CG3A 2MWMA 5G1OA 4I5EA 4DEAA 3M7IA 1BXKA 2IBSA 1G5SA 2ONLC 1F1JA 4H6PA 3Q5ZA 3CMMA 3I1AA 5IVDA 2FX2A 4S1NA 2HJGA 4U2DA 3MJCA 2XUKA 5LMNB 4GFGA 5HNKA 1JXAA 8ATCA 3BRCA 2UZIR 2EEPA 1UBNA 2DPLA 4XUCA 2C0CA 5EKSA 4UDYX 2QM3A 4I5IA 1GZHB 1YSCA 3FHJA 5GJWC 5ALEA 2IC5A 2JLSA 3GUUA 1WLSA 4EHJA 2V0GA 2HSEA 3GCQA 5C3UA 2EWVA 2GHIA 4FYKA 3NBYC 3QTQA 2JFOA 1KZ4A 2WF6A 2C5GA 4U3YA 3TUDA 1RHQA 1Z4IA 2PRIA 1KE7A 3ZU2A 2X6RA 3BTUA 2PUPA 2H4XA 4FGLA 1T5HX 4PYMA 3P9CA 2OC4A 3MFQA 4BNTA 5JRDS 4NECA 5E7RA 3BL6A 5L3ZA 3T99A 3GGFA 4M0MA 1QRAA 1KTVA 1RPJA 4LX0A 3AC3A 3P7CA 4D0LB 1CQJB 2D3WA 5D7BA 5I4IA 4IV8A 3ZVKA 2V3CC 4XX1A 4RFVA 3ZQJA 1OYOA 2D1QA 2XEYA 2HK5A 2QW8A 3UZUA 2Y4PA 5BN1A 1BX0A 3P5JC 2D4AA 4HQ0A 1DTWB 4KMMA 3RC8A 1LC3A 2CVQA 4XD7A 3VPDA 4AW5A 5KMNA 3KB1A 3LS2A 3JZAA 1I3KA 4LWZA 3DVAA 4B4VA 5HIKA 1G3RA 5D3QA 1Y82A 3LQRA 1YA6A 4FTNA 3L05A 1GN9A 1IM5A 5JHHB 1M1YE 2AX4A 1RRKA 5A04A 3M81A 3KVWA 4I5MA 1HQDA 3AWDA 3BWBA 4HUTA 4JLKA 2X4LA 1XMMA 4ZARA 4W8EA 3OLXA 4FHCA 3A4TA 2ZE6A 3CX7A 1GUDA 4JA0A 1CIVA 2WQ7A 2P0EA 1B76A 3NIWA 3T4XA 4DCSA 3EQZA 4TXJA 1A1VA 4DLJA 1GTL1 2OYRA 3CN9A 4OTZA 4K77A 4DBXA 4AXCA 4J94A 3FPKA 5IM4A 1L1RA 3GEQA 4HWKA 4HVGA 1SZMA 2Q5OA 2YCRA 1FMJA 1X38A 3GELA 5EKUA 4DWWA 5DTEA 1X19A 2O5VA 3LZCA 3UT6A 3LQYA 2BFCB 2A5JA 1G3NA 3QXPA 1U54A 2AE1A 2JB9A 3MG9A 4CFUA 2LV8A 4F1JA 1GKIA 1JSLA 3E7VA 4DMFA 2VAXA 1T5LA 3I1YA 3HV0A 3Q1LA 5I48A 1C9YA 2EP5A 2ZUUA 2YQZA 4AT4A 4K28A 1P3Y1 3CSUA 4FLEA 2OICA 3SZLA 1RAGA 4OQQA 2OY0A 3ULIA 5A3XA 2FPUA 5K0NA 4CV1A 3K0HA 3QZHA 4G63A 1E0AA 3BI6A 2WPNA 1ADJA 2C2MA 3UAOA 5DXAA 2IY8A 4DSAA 4M9UA 3N70A 4WD5A 1F14A 2OCDA 2DR2A 3QPWA 4FKTA 3I9NA 4WHMA 4JVNA 3BELA 3HB1A 3NTLA 4A2QA 2ZE7A 2P2GA 1BVRA 1OJ7A 2AMJA 2WAXA 3B3JA 3CJFA 3VBTA 2G9VA 2JIZD 4RJ5A 3KSMA 2EVAA 1XHAA 3H1FA 3FVRA 4NJEB 5AW6A 2VDWA 3HMQA 5KKAA 3SS9X 1V6CA 3DKKA 1N2SA 4BI0A 3KKMA 4IUDS 5LYJA 4OQZA 2IW8A 4D3ZA 3ZRKA 1MAAA 4FT2A 4CR6A 4KDFA 1EBFA 3VUEA 3SZOA 4MRPA 3KUDA 3LTEA 1LLUA 1JHZA 2WPAA 3DT1A 2GF2A 2HHLA 4AQ7A 3VTAA 1XBTA 1TMKA 2J6IA 4AICA 4OH7A 2WSYB 1GIJA 3BD9A 1E7SA 2WB2A 4I1RA 1JHQA 3LLSA 5EE3A 1JL3A 3CLKA 5HTOA 2FJPA 4ONEA 1MU0A 3AEXA 3PPIA 4E7PA 3JXEA 2UXDB 1CUCA 3TKLA 2C5LA 4QDTA 3OURA 5AP5A 1Z5WA 2E87A 4JWTA 1T1RA 4BMDA 2AI2A 3PFFA 2VHZA 4NDNE 3BFJA 2IUSA 4H1UA 4FC7A 3V8PA 3F67A 2R6DA 3MTIA 2QPAA 3FJQE 3PG1A 2HCBA 3FZQA 4G5PA 4JBIA 4A8JC 1U0RA 3W0QA 4LYGA 4LG1A 4R7ZA 4CLJA 5AI4A 3RIMA 2YFXA 1X7HA 3TTYA 3M6WA 3LT1A 1MB0A 2Z2JA 1D9ZA 1X7WB 2GPTA 4UREA 4UE2A 4KWHA 2ZDTA 4JBOA 4CFMA 1ZAKA 3QZFA 4MLCA 3CWZA 3AG5A 2VJAA 3ESXA 2V7QA 3BKWA 3GFVA 3PPWA 3F3VA 1OXKB 2WHBA 4DSNA 3HUBA 1VYHA 4KE8A 4O83A 4OTFA 1V7PC 5F52A 3SF0A 1AHHA 2H5EA 2PVLA 4G5HA 1Q62A 3QRKA 3M6MD 1XNRB 4WI1A 1F3MC 3JQ7B 3E8DA 3FMGA 1GZKA 4WCFB 2NZYA 1SWVA 3NOQA 3QVTA 5EWMA 2EZUA 1QP0A 3BERA 2CHGA 1CUSA 5L4LA 1COWA 4KYUA 1ESDA 3OCVA 1E6KA 3FYKX 2WMDA 1PLKA 1KZ9A 5CU6A 4JJGA 1ZMUA 4GI2A 2QD1A 1IJBA 3G9TA 1UZMA 1PMVA 2OU7A 3L1JA 2GM9A 1N92A 3P4KA 2C2WA 4XVUA 3TYXA 3WXBA 4B0PA 1DIRA 2ONLA 4R1YA 2CNUA 4B09A 3BH0A 5HR5A 2W11A 3B1VA 4HDAA 5ANEA 3RUFA 3CKYA 1XKTA 2XQKA 4LI3X 1LPOA 3ANQA 4CZUA 2JAQA 1WHSB 4BP8A 3VBVA 4X90A 1AUVA 1T26A 3E3BX 4PBTA 3PIDA 1X80B 1QQ7A 1PY5A 4N6YA 1NZDA 1Y6BA 4ZZIA 1SB9A 4O1HA 3GRYA 4EIWA 4FMDF 3VSCA 4B45A 3HH8A 5LQRA 4J0FA 4RF2A 3VIDA 3K71B 2J3IA 2OG2A 5C0OE 2J3EA 4Z16A 4JHXA 4YC3A 4ARKA 2A58A 4ACCA 3KQVA 1KXJA 4KN9S 4EK4A 4UE3S 2J3LA 4ZLYA 3PFGA 4EEZA 1SM2A 3ZDRA 4QQ5A 5EG3A 2IT1A 1KEWA 3AR9A 5JH6A 1GJOA 1KMHB 2AV6A 3AEUA 4O0XA 1NT4A 4XIIA 4QL3A 3KQOA 3Q4UA 3RRBA 3EEQA 2EGUA 1VLMA 4OK3A 5KNBD 3QKLA 1Z2DA 4EPRA 3HA3A 4BVLA 3OQNA 3OPYI 3AZQA 2JG3A 1IULA 3NT5A 3AHCA 2X5XA 4DIKA 5KBRA 5FULA 3ZEPA 1NRIA 4L0QA 1Z6YA 3CXUA 4YH1A 1ZESA 5EJIA 3RKRA 3O91A 3H9EO 4UAJA 5FO1A 1BD4A 2JIZA 5LKAA 3MYRA 2DMRA 5I4KA 4HZIA 2YDXA 1PKEA 1ZCJA 3QEMA 4NXMB 3HXQA 1SBNE 2PGOA 1C0EA 4DKJA 5DCYA 2GZRA 3WI7A 1C9NA 2DBVO 4RPGA 5E6SB 3VR4H 4PIVA 2JFFA 5BQFA 4DFLA 3GLFA 2KB0A 3MWJA 2X8IA 1KOAA 1DARA 1JIJA 4JLVA 3AVOA 2IHUA 2J45A 2WFLB 1R0LA 2J0JA 3HYCA 4LGYA 3R5XA 3GFRA 4MKFA 1DIGA 3T3NA 3EQ9A 4AZVA 1VZOA 3V48A 5I9TA 4C7OB 4ZAYA 1MOSA 4G26A 2CNNA 1PS9A 1B2RA 4PC3A 1Z6GA 4Q1CA 2B9HA 1A97A 4B7ZA 5LC1A 4I55A 3KXKA 3EULA 5C4IA 4G4JA 2OFVA 1HDXA 3E3NA 2YN4A 3DMFA 4EEXA 1WBWA 1ANKA 2A9FA 2HV9A 4NZPA 3FG9A 1F9EA 1E7RA 4JUAA 2H4ZA 1WCYA 3ITEA 4IDCA 1EZ4A 2AKAB 2WKRA 3MMNA 1TAHA 1OLXA 2DWCA 3F9CA 4KYIB 1M7NA 3QE2A 3WGJA 1ZUHA 4LZJA 5AI6A 2ZUSA 4IAKA 4IVNA 4B8MA 4M7WA 3B3FA 2OUKA 3OP4A 1M3SA 4CMBA 1G38A 2RHDA 2B6HA 5FI3A 4TKMA 4QRDA 3FSJX 3THWB 5HNIX 2OT3B 1QTNA 2XSZD 1YL5A 3U5TA 5AKYA 3FPMA 2P0YA 4GT1A 1UDBA 1N33B 4M0ZA 4JI9A 4RXMA 3VU8A 1X1AA 4FZ5A 2WFYA 4EBBA 5EMHA 1I32A 3ORRA 1EG2A 1QRRA 5AHRA 4TXHA 3R44A 4FTWA 2O65A 4KJZA 4RLLA 3ZBQA 3VRYA 4JBGA 2XVMA 4A5SA 1SPBS 4MCIA 3QVVA 1XLTA 5JEBA 3GLGE 4LZZA 3C3DA 1D2NA 4HT3B 1MN6A 2OMEA 2Z09A 2XGSA 5E1SA 1RE0A 1QHSA 3C87A 3WAKA 3GBSA 4TYIA 2DFDA 2WA2A 1KARA 2GCOB 3E9CA 4DGLC 1N8TA 4OLHA 4TWRA 4WVLA 3LQKA 2IVTA 1CHNA 5JMPA 3WB9A 3EUFA 2BFXA 1NBME 3QGYA 3TMAA 4YSMA 3A2NA 3EAFA 1T36B 4DTAA 1CR4A 1KJJA 3PDHA 5ALXA 2XDWA 5AOVA 2CXHA 3C3MA 1ZBQA 2RE8A 3HB5X 3TV4A 2E6UX 2WQEA 3CHYA 5IXYA 1GARA 4JKOA 2QNRA 4ZP5A 2RMKA 4INPA 4HTAA 3K9WA 5CVFA 1T2FA 3QNUA 4ZVPA 3TJZA 3CNNA 4LECA 4GKHA 1U2ZA 1KH3A 4ZFNA 4CQJA 5LU8A 1R3CA 3BCEA 4D26A 3VJMA 4HLQB 2WK1A 1RXVA 3MZ0A 1DEHA 4MWOA 1JMKC 4DLRA 2GXAA 2O2HA 2B8EA 4U6RA 2I7CA 1Y5LA 2VTNA 5HD4A 1JTFA 4RTRA 4KR9A 3SE7A 1QIFA 1ZNQO 3P9RA 3ETJA 1HSZA 3NFRA 5HEKA 1CUDA 2I2AA 1WVMA 5D5PA 4TWBA 3AFIA 5IM5A 4EHDA 2CL6X 3R1NA 5J40A 3ITDA 4FYXA 1IUPA 2NZ8A 3S40A 5FUYA 4BMXA 4HZSA 4H31A 3ZHYA 3ZI7A 4DCCA 2C2ZA 3I6BA 5DOSA 3BULA