2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
1Q5KA 4I0RA 5B2MA 4QYEA 4FUXA 4UYNA 4G16A 3BLRA 3PDTA 2VNWA 4CNHA 5HVYA 5CF5A 2B78A 3G2MA 4EHVA 3FDNA 2YJSA 4ZMEA 4YJVA 3BWYA 1UU3A 3QUPA 5C1QB 4EOKA 3C5UA 4FIIA 2UV2A 2UZTA 2X81A 3NSZA 5ETCA 3C9WA 4XG9A 5E9WA 3OS3A 5HX8A 2WQEA 3G9NA 4JQ8A 3VC4A 5ICGA 3PT9A 4IC7A 1WBWA 3HUBA 3UQCA 4WNPA 4C4EA 4XV2A 5DLYA 3DBEA 3C0KA 2PX2A 4LV8A 1L1EA 3SA0A 2Q0NA 5DYJA 3QUDA 2YDJA 3HRBA 2C6OA 2O3PA 2UVYA 2Y4IB 4I20A 1Z3CA 4O0XA 5LCKA 4OTIA 2B52A 3PVCA 4MAOA 2O06A 5E7RA 4RTPA 3SSNA 2VAGA 3TN8A 1WBTA 2UZWE 3EVZA 2W5AA 3UODA 2XYUA 5ANIA 1YWRA 4U41A 4XCUA 1J1CA 4XG4A 3C50A 3UJBA 2PZPA 5IA5A 2XZSA 3GRYA 1U54B 2PE0A 3MB5A 3O7LD 3EQRA 4I0TA 2XKCA 5GM2A 2ZZNA 3PXYA 3DU8A 3S3IA 3R3HA 3DBDA 5AIRA 3ELDA 3R8PA 4K18A 5GJDA 4G2FA 3I81A 4C59A 3X0DA 2XCHA 4FX3A 4X3FA 4YMJA 5CENA 1Y8GA 1X19A 3VBYA 3FSFA 2XIXA 5AUUA 4ASEA 3FZRA 1R6AA 1GIIA 5M51A 3CSVA 2RFSA 1FPQA 4I6BA 1O9HA 4F6WA 4LG4A 4R8SA 1J7LA 4J95A 5AP2A 2E9VA 4RVLA 4O29A 3PSBA 4P5ZA 3FC2A 3SVZA 3QLGA 4DFYA 3LXNA 4IFCA 5EKOA 4AA0A 4ZSJA 2R3QA 4EH6A 4EOQA 2FK8A 3NX8A 3ZSIA 2ZTHA 3VJOA 1VP3A 4U79A 5HOQA 2ZMDA 3HM2A 4ZK5A 4GUEA 1VIDA 3DK7A 2VGOA 3UGCA 4C35A 1P1CA 5J9YA 3EGVA 1GZNA 1XO2B 4ITHA 3RNIA 4BCNA 4HW7A 1Q41A 1WAKA 3BBWA 4C37A 3KU1A 2REIA 1QAQA 3W8QA 3G2FA 2JDOA 3R1QA 3HEMA 5CVDA 3KXHA 1FGIA 4U80A 3A4PA 3EZVA 4QMTA 3FZOA 3ZBFA 4DGLC 4AX8A 3GCUA 4IM3A 2O8YA 4MNEB 4O91A 3ZLSA 3PXQA 4DC2A 2BCJA 3HMNA 5HG7A 2W1IA 4AN2A 3O7WA 3BWMA 4G56A 4DFLA 3UQFA 2AZTA 2PY6A 5JN2A 2F2UA 4FV3A 4UZHA 1CKPA 5K4JA 4IVAA 1EH4A 4MWIA 5EYCA 2R3LA 3LX6A 3NUAA 5KHWA 2XK7A 4ENXA 2PZYA 3UO4A 4EYMA 3QWJA 4M15A 5CANA 3DOGA 5EQYA 5U4XA 2RG6A 4YO6A 4BKJA 5DR2A 3GQIA 2X7FA 5EI6A 2X9FA 3G7UA 5CVHA 4W4YA 2VTMA 5IA1A 3DB8A 3TPZA 3RPRA 1JTEA 5D7AA 5E8WA 3FZ1A 2OXTA 3EHAA 2OKRA 5HX6A 1M7QA 2QNJA 2BMCA 3QC9A 5EKNA 4HJOA 2OZAA 1QZZA 3FYDA 4PONA 5EHGA 1G3NA 3R8MA 4CFNA 2B7AA 3ZUTA 4L3LA 2QO9A 5HBJA 3LW0A 3F5GA 4ASXA 5GIOE 4DH1A 1IY9A 3KPJA 1ZRZA 3OFMA 5DVRA 4L42A 3GXOA 3KL8A 5HICA 1UWVA 3SD0A 3Q4ZA 3MY1A 1NW7A 2XK3A 3EQHA 2ETMA 2I0VA 4PY1A 4C0TA 3PRIA 3AC3A 2YA9A 5ANDA 2V7EA 3OFJA 5KKRC 3DQXA 4TNBA 3P5KA 3ZLXA 3QZFA 3HCCA 4WD5A 5JFWA 1M7NA 4YUXA 5HLWA 5MHTA 3OXTA 2V62A 3SMQA 5E8JA 4M84A 4USFA 3TWJA 3R24A 2A4LA 3FMJA 2I40A 2CCHA 3OZSA 2C69A 3OBJA 4U6RA 3PE2A 2P3LA 4HCVA 3EZRA 5KMLA 3GU5A 4QPAA 2CLXA 4LRMA 4TY1A 3U9CA 5FXQA 3V8VA 4E2XA 1S9IA 1U46A 2C30A 5JGAA 3VUHA 4AT4A 2G9XA 5FLFA 3O2MA 1ZGJA 2W17A 3TG1A 3MFSA 1UWHA 2XA4A 1RJEA 5JQ8A 2FCAA 4R05A 1Q8ZA 5A6OA 1JQDA 4GUAA 5IQEA 2QLQA 4WO5A 2ZWVA 4FT5A 1WBVA 4TT7A 3L8PA 5CEOA 5ETFA 4QMVA 4E30A 4D5KA 4V04A 5CAUA 4KRDA 3P78A 3T7SA 4O7LA 1QL6A 5ANKA 3VBWA 3O50A 5LVNA 2PMLX 4WRGA 4WXHA 1OPJA 1H1SA 3HKOA 2BKZA 4YGAA 3W18A 2GTMA 4MXOA 5BUIA 1RJBA 3CD8A 4LV5A 1ZYSA 4FS8A 3G5LA 2UYCA 5ANEA 3DB6A 3ZFMA 4YZMA 4EKIA 3TNHA 3TI1A 1JVPP 4Q2AA 4YZDA 1R18A 2CHLA 3HYHA 3RK5A 2H1RA 4M12A 4LRKA 1PY5A 3O8TA 1WG8A 1NVQA 1KE8A 3ORZA 5IH4A 1NBHA 3MCZA 3N51A 2Z02A 3ORLA 4CFWA 1O9UA 2DUVA 5DGZA 3F82A 3C0IA 3TTIA 5M5BA 2E5WA 3CGOA 2EG5A 5HCXA 3BV2A 5M07A 3PG1A 2P2IA 3CD3A 4KRCA 3ET7A 3MTLA 4QP2A 4Q5HA 3MGYA 5KKRB 4RVMA 3DNDA 1GIJA 3RAKA 4O0TA 2GAFA 4NM5A 1M0EA 3DV3A 3E8CA 3FLQA 4QYYA 4Y2HA 4AOJA 3DDPA 2EB3A 2UYQA 3RHKA 4AZWA 4DMGA 3MN3A 1A9UA 2WTDA 2WXVA 2VU3A 3FY2A 4CLIA 1NW3A 5CU4A 2GPHA 2KW5A 3EL8A 2C6KA 3ZCLA 3WF5A 1M6EX 3W2RA 4FSYA 3NUNA 2R3IA 3DAEA 4GJ3A 5BQ0A 2YM4A 5HNBA 2BR4A 3RAIA 1QYRA 3IDBA 3U81A 3VWAA 3LMIA 4YURA 3GEQA 5C8MA 2VTIA 4C08A 3CKXA 4GKIA 4RJ7A 2VDUE 4C4AA 1NXKA 3OFKA 2P41A 4QPSA 4PUZA 3HV7A 2JLDA 3TM4A 3T8OA 3R28A 2YWVA 2WD1A 4E20A 4HC4A 1WBPA 5L8JA 4M3QA 3CGFA 4L8MA 1JG1A 3OCSA 5FRIA 2KULA 4Y5HA 3BHVA 4ZEGA 5DEWA 1KPHA 4DEIA 3CE3A 3RP9A 3WYXA 3FUWA 1N7IA 3RAHA 3MYGA 4QQCA 5E90A 4USDA 4XNEA 2C6TA 5KZ0A 3SXJA 1UVRA 5E2BA 3IEIA 5CSHA 3E7PA 2W5BA 5EMJA 3QLFA 3BE2A 1JG3A 4FZFB 1F0QA 5CEIA 3RM6A 2V0DA 3TV7A 4LL0A 5DM2A 3KF7A 1XBBA 3CGGA 1OIYA 3QUEA 3GCZA 5C1IA 4RSSA 5EI8A 1NA7A 3GP0A 2DWBA 3VS3A 2EVAA 1IG1A 5LR6A 4BN1A 2YCFA 2NYUA 1VJYA 2XKEA 2CMGA 4WIHA 5LMBA 3ODYX 1XWSA 5LQKA 3PP0A 3TKAA 3NWWA 5KVAA 4L6QA 4RC2A 3HNGA 3MTEA 1SQFA 3ZEWA 5DBXA 2BIKB 1E9HA 4IM2A 3PXRA 2UW0A 1WBNA 2VX0A 3QX2A 2YIWA 4BDAA 4IWNA 4XBUA 4F9WA 4R7HA 2G2IA 4PRJA 4BDGA 4HVDA 4E1ZA 3AGMA 3UMWA 3ER9A 3BYMA 3KXNA 3COHA 5BW5A 3QOXA 2XK4A 3OF0A 3LFCA 3PX3A 1UIRA 4QQKA 2BH2A 2NRUA 4CKJA 3F69A 4Q9ZA 5BVWA 3VW8A 3P2KA 4HGLA 4RTSA 2F7ZE 3U6IA 3ENHA 1D2CA 5GP1A 3EKKA 5TKDA 2R9SA 3GU6A 4I23A 3IDCA 3WF6A 3R9HA 3EYGA 4EWQA 4IX6A 3WZUA 2BRNA 5F2KA 1YUBA 1YXXA 5T68A 3P7CA 4O83A 3F5XA 2C6IA 4BIEA 3DMGA 2AOTA 1YI4A 2PTKA 2W99B 3C3YA 1WBSA 1XDSA 5IG1A 3H4JA 3EGEA 1XH7A 2JKMA 1DM2A 1XH5A 2VTOA 2WU7A 2JITA 1MQ4A 5CM2Z 3QRTA 5GWXA 5CSPA 4B8MA 4UWCA 4A4XA 4CV9A 4FKQA 4JDJA 2HYYA 2XVAA 2UYHA 5HGIA 2ITUA 2YWPA 4IH8A 3KQ7A 5CU0A 3OZTA 3SC1A 3PLSA 5DSTA 1YDTE 4G6OA 4QOXA 1WCCA 4YZCA 3SSMA 1W0XC 4F1OA 3SXRA 4E6CA 2GS9A 3NDJA 1BHJA 1SNXA 4RIXB 3ZSHA 2C0IA 1OUKA 3DKGA 2QOCA 4ANLA 4BBEA 4TYEA 3RPOA 1EJ0A 2R7IA 3QTUA 4FODA 3LPMA 2IG7A 2ZIFA 1PMNA 4KIGA 3VUGA 5LXMA 4DKJA 4F85A 4DCMA 4U9AA 3U51A 3BWFA 4BCIA 4BI2A 2R3FA 1Q62A 2CKQA 5H8BA 1H1DA 3ELWA 3O4FA 5DTQA 3GFWA 3A62A 5DRTA 4V0QA 3KHKA 4I41A 4O0YA 3FYCA 1JKKA 2FYSA 3ATSA 3L8XA 4NU1A 1KE6A 4RRVA 4B4LA 4AZSA 4CGAA 4FSZA 3VIDA 5IH5A 1BKXA 1MJFA 5E2AA 1CSNA 1F3MC 3EKNA 3SGCA 4ASZA 3SSOA 4IDTA 3EWHA 1JLUE 3BEAA 3LKZA 2QOQA 3F66A 1SQGA 4L53A 5BVDA 3G51A 3LOKA 3V8TA 4HH4A 3ROCA 4AXAA 4XOZA 2VS1A 3MWUA 5ICCA 3GC0A 2BR3A 3HV5A 3T0IA 3ERKA 2WA2A 4YZ9A 3UZUA 5IU2A 3G0EA 3EJ1A 3F9NA 2QR7A 4R1VA 4EKGA 3LCOA 2YAAA 1UNGA 4L00A 4QP4A 3CBLA 3IOPA 1XDUA 1HOWA 3DLIA 2YACA 3DJ7A 3FSKA 3AMBA 1XDZA 2HK5A 4FEQA 4E26A 3U6HA 5CAPA 2NP6A 3Q4UA 3KF4A 4ERKA 4QVGA 3HNRA 4M69B 4O38A 5LVLA 1QPDA 1VZOA 2QRVA 2GNLA 3UA3A 1VYZA 3OHTA 4U45A 3FUPA 2B2CA 4IKPA 3QF9A 4EK6A 3NYNA 2VWVA 4FT7A 1EG2A 2XKDA 2ZM3A 3FUXA 2WGJA 2DYLA 1ZYCA 2VTTA 3DQWA 2PHKA 4IMYA 5KMNA 4DF3A 2XRWA 4NK9A 4RTQA 5A9UA 2WMSA 2VWYA 5I9ZA 4GK4A 5EPEA 2HWOA 2BAQA 3LDUA 4FVRA 2G70A 4IE9A 2Y1WA 3BX5A 2QU6A 3Q5ZA 2WPAA 1F5QA 3CEKA 3OU7A 4YJNA 1KPIA 2XCKA 5CVEA 3UVRA 3PJCA 3KC3A 3PIZA 3KY2A 4MTAA 4YBJA 5I9XA 5DR9A 3C5IA 4EH9A 2QCSA 5DH3A 1WZYA 3QTRA 4EMSA 3K54A 2BR1A 4ACCA 3TFWA 2OKCA 4GG7A 4UALA 2ETRA 4MWZA 4DG0E 1ZYJA 4O7NA 4XBRA 2EX4A 4G3GA 3E8NA 3O71A 2CPKE 4ANMA 3JWIA 3NDMA 4FSMA 3LFDA 4K11A 2WOTA 2FO0A 4L68A 3M42A 5AP3A 4KIQA 3HUCA 3GC8A 1KYWA 4D4SA 3HGKA 2VTQA 5CVFA 1UNHA 1ZZLA 5ERGB 3AJDA 4IACA 2NP7A 3CVOA 3EQCA 4HTFB 5JRQA 4D4YA 3TIYA 5IZFA 1YOJA 4D0WA 3TNWA 1L3BA 3P9NA 3AMAA 4RV9A 5I9WA 3UOJA 2UW8A 1OUYA 2Z7QA 3FQHA 4EQUA 4QMWA 4BLWA 4S30A 5FBOA 4WSYA 1VQ1A 2O0LA 4FKIA 2PU8A 3WZJA 4ALUA 3Q7EA 1YW2A 2E2BA 4IZ7A 4C62A 2YABA 4GIHA 5M53A 4Y72A 4FV1A 4XRLA 4AACA 1L9KA 1OL6A 3R8ZA 4L7SA 1P2AA 4FTQA 3K6RA 3CP9A 1UWJA 5IA0A 1IA9A 1FVTA 4QQJA 5CEKA 2PMNX 2OF2A 3NUYA 3IDPA 2BVAA 3BT7A 4FC0A 4G3EA 4UX9A 3AMYA 2IW8A 4FZ6A 4CFMA 3V6RA 3GU8A 3HECA 2XNEA 4RIWA 5JGDA 4KW7A 1RE8A 4EK5A 2RFEA 1JSUA 4YV2A 1R0EA 2LD4A 4OW8A 4A9SA 4FKWA 5EW9A 2YQZA 3BYSA 3R9DA 2OFUA 3AT2A 2FUMA 4AN3A 3D5XA 4DINA 5C8KA 5JR3A 3I5ZA 2J50A 3O23A 4CV8A 4YJOA 4IX5A 2WTVA 2ZV7A 5FUTA 3QKMA 5CVUA 3F3WA 1N2XA 2PMOX 3NVKI 5E8YA 3AT3A 5DXAA 2ZBPA 5H8EA 5HIKA 4TYHB 3H9RA 1KIAA 3ETAA 4HPTE 4A4LA 4CEGA 1HCKA 3OWLA 4K0YA 2C5OA 4XEYA 5B2KA 5EW8A 4LUEA 4BGQA 1H0WA 4F84A 2PX5A 3FBVA 4OTRA 3E8DA 3WARA 5EIWA 3KVXA 4MVFA 5H9BA 1XBCA 2PSSA 3TR6A 4L45A 4PYLA 3NCZA 3TNIA 4FUYA 3K5VA 3H0YA 3TDWA 3DOUA 3QQLA 5FULA 4YUWA 4CMTA 2W1HA 3OUKA 2WB8A 4FG8A 3EFKA 4EH7A 2YUIA 4JBOA 1JWHA 3KU2A 3AGLA 3FLNC 1A48A 2V22A 5CF8A 4FNXA 4EWHA 4X7QA 3ZTXA 2C4GA 4AFJA 3FRHA 4IM0A 4HGYA 1ZARA 4EOMA 3FL5A 2YDIA 4AU8A 4LRJA 2J6MA 3ORMA 5EQJB 2ITVA 3TJDA 4FL3A 3UC3A 4H3BA 5DI1A 3NLBA 4YJQA 4WG5A 3UJAA 4DEBA 4LGGA 3B2TA 4PDPA 4QP6A 4G1WA 2XJ2A 2WMTA 1OB3A 2R3NA 3OEFX 4MX9A 3K3IA 2Y9QA 3FXZA 1OGUA 3P1AA 2HXQA 4H3QA 5M4CA 3KRRA 2H6DA 4CRSA 4QNYA 2BRGA 4YPSA 3G0FA 5IPJA 4PIMA 4BDIA 2AN4A 3BU3A 4IX4A 2FH9A 2WMBA 5K3YA 4FK3A 3R30A 2VX1A 3UYTA 5DTRA 1Y8CA 4FKGA 2JHPA 4ZTHA 4EEVA 3LFAA 4APPA 1ZG3A 3QKKA 2P33A 4LG1A 3A7FA 1FP2A 2YERA 5ITAA 3ACKA 3E87A 1NVSA 2OGVA 4O0VA 4IIRA 3FUVA 5K9IA 4YSMA 5CU2A 2G8NA 2ZZKA 3OY3A 4MNFA 3ZRKA 2B53A 2WOUA 2E9OA 3KCKA 1PXJA 1DUSA 2YZAA 4BDJA 2AYPA 4YLKA 2CKDA 3OEZA 5G02A 1CKIA 4RTKA 4FTLA 2WMXA 4CRLA 5HIEA 3TLJA 3SG8A 4JAJA 3CR0A 3VS4A 3SAYA 3HCEA 1VR2A 3PE1A 4C58A 4TXCA 3DAKA 2OXDA 3CXWA 4RA4A 5CTPA 5AEPA 3IHTA 2BM9A 3VBTA 3D2KA 4PTGA 3M6WA 4AOTA 4QP7A 1B42A 5EEGA 3I79A 2ZFUA 4PCLA 3I60A 2X1NA 4ID7A 1WY7A 3HA7A 3A7GA 4IVBA 4U44A 4O0SA 3ZM4A 4XLIA 2NO3A 3CY2A 4G9CA 3NPCA 1PXMA 3DTWA 3UOHA 4YV0A 5DIAA 3FY0A 4AZTA 3MA3A 2ZBQA 1WVWA 3HLLA 4HYHA 1FQ1B 3RVGA 2EXCX 2GFCA 2YM6A 4YJRA 4ZMFA 2YN8A 3VNTA 5TR6A 4PGGA 1ND4A 4BI1A 4IB3A 2V7AA 1CTPE 4BZDA 4YLLA 3RPYA 2BRMA 3AD4A 1J1BA 4RFMA 4CKIA 5EZQA 2RFDA 2PBFA 3QKLA 4XP2A 5B1SA 4BCHA 3FLWA 1P14A 4RLKA 4IANA 5EOLA 4EBWA 5CU6A 2UW4A 2ZV9A 1OKZA 3R21A 2F9GA 3MTIA 2R3PA 4OQDA 1L3RE 2PVKA 4FGBA 3B7PA 4BCGA 1AF7A 2PVYA 3PRFA 3G2PA 4BCQA 1DL5A 3CS9A 3ELYA 3V97A 4LMNA 5EH0A 1XH6A 4LQMA 3KPYA 3UFBA 1XJDA 3JVSA 4U43A 3QGWA 1PMUA 2JFLA 5GM1A 1IASA 2VX3A 1BUHA 3BGDA 3BHHA 4D0XA 5J9LA 3KRLA 3NCGA 4MCVA 4AZFA 3VAPA 2B1PA 4TYGA 1PXLA 2ORED 4J52A 2FHPA 2A27A 1ZOEA 5HE3A 5AP7A 1YXVA 3ZC6A 4NCTA 2ZLBA 4AUKA 4M0YA 2W06A 5F9EA 4DBXA 4UEUA 3QTQA 3DMHA 3DTCA 4J8NA 3S1HA 3UPZA 2FPOA 3QQHA 3MFTA 3F2RA 4EOOA 4DEDA 4FE2A 4LWPA 4YPDA 4BBFA 3GO4A 1OPLA 2YIRA 5DHJA 2QG5A 5IUIA 1R8XA 4NJDA 3VBXA 2YR0A 2BUJA 2QOKA 4EOPA 3O0GA 2VWWA 4D55A 3P0MA 4U3YA 2BFYA 3UJ9A 2HZIA 1OBDA 3U4UA 3HL7A 4FMQA 3R1NA 2GB4A 3FXXA 4KBAA 4QMZA 5DT0A 5C26A 1F3LA 5K0CA 3I0QA 3WBLA 2IH2A 2HNKA 2OXXA 2J0IA 3T9IA 4AWIA 4RC3A 2J0LA 2JKOA 3QYZA 3SRVA 4M0ZA 3A7HA 3LQ8A 3GIWA 4FL1A 3BYOA 4E7WA 4DITA 5EM8A 4YUVA 1W83A 1OI9A 2JBOA 3KR1A 2Z7LA 4TWOA 1VPTA 1Q24A 2BTRA 3ZC5A 2YFXA 4X3FC 3RW9A 3QRJA 5DLSA 1SZMA 3QQKA 3E05A 4X0MA 4WKQA 3DJ5A 4ZJJA 4XH6A 3VBQA 2EFJA 2PXAA 3MS9A 2XUUA 2GA9A 4GL9A 4RPVA 2BM8A 4GU9A 3TV4A 2ZJWA 2NXEA 3DJ6A 2GH1A 4Y95A 4ZTMA 3R73A 3D4QA 5AV4A 4EH4A 3QC4A 1ZWSA 4C05A 3E93A 3DULA 3KQYA 4I22A 3BQRA 1EIZA 2H00A 3C3PA 4ER7A 1R74A 1B39A 4C03A 3OT8A 4PDSA 4HVGA 5CXHA 1BOOA 3W1FA 2R3OA 3AC5A 4D4RA 4I1ZA 2DPMA 2XH5A 3PVWA 3AC2A 3AXWA 3I4BA 3OG7A 1BI7A 5DT4A 2P1DA 1YOMA 4MH7A 3LM5A 3EMDA 1Y6BA 4E32A 4BYJA 5IEVA 3PJ1A 2C68A 2HMYB 3C4ZA 2PUUA 1XQZA 3H9OA 4V0GA 2IVTA 2YM5A 2GQGA 3ORKA 2Y6MA 4G3DA 1L8TA 4QQNA 4NH1A 5IQGA 4FSTA 3IW7A 5E1SA 1J7IA 3GDHA 3QALE 3T7RA 4YC6A 4RYLA 4WNMA 1IM8A 4FSXA 3R7YA 5BYYA 5LVOA 3UE4A 4F0FA 4JI9A 4AW0A 4TPTA 3MGGA 1YI6A 3L9MA 5A4QA 4TYJA 4Z9LA 5JRSA 4G31A 3A8WA 3B3FA 4ZSLA 4J53A 3V8WA 1XKKA 4ZZMA 4A06A 1OECA 4Y5QA 5FD2A 4ZIMA 2ESMA 4PYQA 2IWIA 2ZV2A 5IA3A 5FEEA 2GNGA 2YZLA 4F9CA 5EQPA 1JQEA 4MD7E 4X3FB 3F4KA 3AC8A 3FZGA 4QPNA 3NNXA 4ANBA 2CDZA 5LJJA 4IBMA 3EPPA 4DFBA 3MH0A 4O2ZA 4MK0A 3HP7A 5HCZA 4ACHA 3U6JA 4BLUA 3RINA 3UOKA 4J98A 3V3VA 3F7ZA 2QY6A 4F1TA 4P7KA 3NUPA 4FI1A 2Z6UA 3KMWA 4CTBA 5AX9A 1U5QA 2CN5A 5DN3A 4BR3A 4BDHA 3PLAE 3MV5A 3FPEA 2W4KA 4I93A 3TUCA 4LYNA 3K0BA 5E9JA 1OVEA 1UU9A 4IHPA 3R8VA 1R39A 2AOUA 2PVHA 2DS1A 3A26A 2GPYA 5BYZA 4C4FA 4JBVA 4F1MA 4ZTBA 1TQPA 3QXPA 4YC8A 3F3ZA 4Y73A 3V5QA 4M38A 1R8YA 4X2NA 3R2BA 1L3IA 5CT0A 4EKLA 3GOKA 4ER5A 1GY3A 2ZM1A 2GFSA 4CQEA 3RALA 2XNNA 1BMKA 4TRLA 4X2KA 4M7IA 2PVNA 3L8VA 2YXEA 4J7BA 5IQCA 4WBBB 4G5PA 3W2QA 5C01A 4C3PA 4FTIA 1GZ8A 5LQNA 4X2GA 5CF4A 2XYNA 4RX9A 3VHKA 3SW7A 1AQ1A 4GCJA 2W4JA 5EDRA 4CFXA 3E7OA 4R6XA 4FA2A 3I5NA 2OO3A 3BGQA 3D5UA 3BXOA 2X39A 5A4EA 3PJ2A 4NT4A 4XG2A 3PTGA 2BAJA 1SVEA 2X4ZA 4BRXA 3S2PA 3CIKA 3NS9A 3P9JA 5D1HA 3PXFA 3D7TA 4FZ7A 4XUDA 1X1BA 4GJ2A 1KHHA 2WMUA 5EMLA 4FG9A 3UJDA 5KMOA 2O57A 3M1SA 1YF3A 3P86A 4GK3A 1Q99A 4DZRA 3UBDA 3Q87B 3FI3A 4EL9A 3R02A 3UBTA 2WHBA 3MH2A 2OZAB 3LE6A 4ZS4A 4APCA 3LCUA 5HE0A 4RVTA 2I0EA 3PX2A 4GIIA 4O0UA 5AP6A 3ZBXA 3PSDA 4AFEA 4MBLA 5CS6A 1OPKA 3P2IA 2Y4PA 3FEGA 1TQIA 4FKJA 2PT6A 4DG3E 1ZOGA 4AZEA 2WTJA 2GMXA 4IAAA 3BYUA 3EVEA 3HV3A 4MXXA 4IWPA 3JY9A 2ITXA 4JR7A 4RWLA 4GT5A 1V1KA 2CCIA 3L8SA 4GYIA 5AUXA 5EM6A 2PMIA 2CNVA 4BIBA 2Z6QA 3VF9A 4QVKA 4FOCA 4PNIA 4XLVA 2C3KA 4UZDA 2XMYA 3QOWA 3KK9A 3B8RA 3FMMA 3NNUA 4DEGA 4ZSAA 4DGNA 2E9NA 2ACXA 4PYNA 3HRCA 3KULA 3QV2A 3BPRA 1DAWA 3JYAA 4CKCA 3C6KA 4YHTA 4O7ZA 3GFEA 4CMUA 2F2CB 4FK6A 1G60A 2BHHA 1YB2A 3H0ZA 3MIAA 3EQDA 4MQ1A 4RVHA 3MY0A 4HPUE 4QMQA 1WVYA 1OIQA 3ZZWA 4U97A 4QMXA 4W8DA 3ORIA 2WU6A 2VWBA 2JKQA 4BF2A 4EC9A 2WMWA 1I1NA 4F7NA 2FYTA 3R0QA 2E9UA 3LGAA 4R77A 3A7DA 2Z60A 3NUSA 3VHEA 4ZZOA 5T6KA 2B25A 4FR0A 3D9VA 4QP3A 2PXCA 5EYDA 1ZQ9A 1WVXA 3GVUA 3M11A 3HEGA 3FZTA 4QP8A 3MTFA 3GU4A 3G9LX 5DE2A 2DULA 3OC1A 4P7EA 3N4UA 4IDVA 4HGSA 1APME 4XYFA 3KQQA 5DWQA 3ERCA 4FTNA 4XG3A 3GOPA 5AP4A 3CJRA 5K03A 4ZLYA 5AMNA 4O7YA 4BHNA 3ITZA 3MPAA 4G5JA 4YO4A 5I9UA 2C7QA 3HVKA 1OL1A 4GC5A 3HV6A 3ZOSA 1H1QA 1PKGA 1XH8A 2NXCA 5FA5A 4ORKA 5BMSA 4YTHA 2PX8A 2YCSA 4EZ3A 2ZOQA 3HMOA 4HG2A 3V51A 4Y83A 4BC6A 2C47A 4RJ4A 1P5EA 5A46A 4JG8A 4KSPA 3W10A 1W8CA 2IZTA 5DOSA 4C2WA 1O6LA 2R6ZA 3IOKA 3E64A 5K0FA 5IEYA 3LZBA 3CJTA 4QMOA 4UXLA 4FP9A 3I58A 3R01A 1YFJA 2NXNA 3BCEA 2XF0A 1QPEA 2EUFB 2NPQA 4BDCA 4JT3A 4AE6A 5CVGA 3SDJA 3UG1A 1Q8YA 1OKYA 4CFUA 3VC1A 3EVCA 2BR5A 1GJOA 5K01A 1ZLTA 3FQSA 2BROA 2AN3A 5GJGA 1LEWA 4OTGA 1KE7A 4B0GA 2CMWA 5CAOA 4JIKA 2JD5A 3DA6A 3NIZA 3UJCA 1FVRA 3ALOA 3LECA 2R0UA 4BTKA 1W84A 3V5PA 4G6NA 4USEA 5DRDA 2IH4A 3ZRMA 3FPQA 2AC3A 4R3PA 5BVNA 2X4FA 2IBTA 5HQ0A 1BC5A 3KQTA 3FTFA 3QAME 5JZNA 2IO6A 1D2GA 4KUJA 4S2ZA 4M14A 4BGHA 3GNIB 2W1EA 3ROYA 3LAUA 2OYRA 3NJRA 4JQ7A 4FTMA 5FXSA 2OJJA 3R7EA 4B17A 1UNLA 5AV0A 4EBVA 2HOGA 2ZIGA 3BWCA 5M06A 3WE8A 4RX8A 3WI6A 4FEVA 3H2BA 3RIEA 4I4FA 4EI4A 4F0IA 5FWDA 3O7LB 1BLXA 2ITNA 1KOAA 8MHTA 4RG0A 5BMMA 3EN7A 5D1JA 3P7AA 4ZY6A 3LCKA 3D5VA 4FSWA 1KE9A 3EL7A 4JBPA 3QTIA 3DZOA 5HEKA 3UYSA 4G6LA 5IUHA 4U8ZA 5CIYA 3C6MA 2CGXA 3E3PA 4O7RA 1H00A 4QYFA 1RJGA 1R3CA 3FMKA 1I44A 3DXYA 2IDKA 3KRWA 3SXSA 4IWDA 3I64A 4O0WA 4RA5A 2IP2A 5K0JA 1Y6AA 4BVUA 4I6QA 3A99A 5G1XA 5DSXA 4HVHA 3ANRA 5KMMA 4J99A 4AS0A 1AD5A 1T43A 4GFGA 2ITYA 2ONLC 5K5NA 4FEUA 1PXNA 2VZ9A 4YMHA 4FIJA 3ZMMA 2GSFA 3CKWA 3FKOA 2P0CA 1B6CB 4FSRA 3KFAA 3VBVA 1XVAA 3JUHA 4MTLA 3Q04A 4J71A 5FXRA 3Q9WA 3MB7A 3A2CA 1XH9A 4DA4A 1YRPA 3VUMA 4OBXA 4HZRA 5J7HA 4EZ7A 3NW5A 3LHDA 3PFQA 3ZUUA 5EGSA 5DXJA 2Q41A 2F4JA 3FLYA 3PJ8A 3RWPA 5BNJA 4HZSA 2IPXA 5CNOA 2AOTB 5HO8A 4W4XA 5EOBA 2QHMA 4DBNA 4IW0A 5LVMA 4FIHA 3E3BX 2XYQA 4IADA 1M17A 3PFHA 5CQUA 2C6DA 5BUJA 1WXWA 3CQEA 2CNUA 4IAFA 3GRUA 5LQUA 3WIGA 2W9ZB 3MVMA 3F5PA 3N4TA 2VTNA 3BYVA 3H3CA 3DTNA 4TWPA 4HYSA 3ER8A 4U0IA 5C9CA 4OA8A 5IISA 5J8IA 4R1YA 3FI8A 4KDRA 2C5XA 5ETAA 5DM4A 3EN6A 3N4VA 3D7ZA 3CJFA 2WIPA 4X21A 5E1OA 4Z55A 1UFKA 4ZOGA 3G5TA 3TKHA 4XUFA 1UKHA 3FWQA 3CCFA 3PVBA 2QOFA 4E4NA 3C4WA 3O8UA 4FGZA 4O7SA 4D1XA 1RW8A 3P9KA 4IZAA 4WUNA 3VS7A 3R1YA 4DTKA 2X7OA 1K3AA 1NW1A 3BU6A 2OJ9A 3VSEA 5EHIA 2VV9A 5DEYA 4ANSA 1YFLA 1ERKA 1H4LA 4I24A 5H02A 1YVJA 4LFIA 2GHMA 4AT3A 3DK3A 1ZOHA 4D1ZA 4RJ3A 5DWRA 4FV2A 4O6LA 5LSAA 1STCE 2PKWA 4I3ZA 4PP9A 4S31A 3M33A 2C1BA 1SMHA 2OZOA 2GLUA 3CTHA 4AZVA 4FKVA 3FPFA 1KR5A 4BCOA 3HAVA 1IAHA 2BZHB 2VO6A 2WZJA 1ZMVA 3QX4A 3LLAA 4JDKA 5DG5A 3BUSA 2QO7A 4DH8A 3R83A 4QTCA 4FV9A 5M4UA 2OK1A 2OY0A 4FVPA 1G6Q1 2PK9A 4LM5A 3GUBA 2HR1A 3TZMA 2IGTA 3RGFA 2BRHA 5AUVA 5JUWA 3HZTA 4W8EA 4F86A 3IW6A 1RI5A 5FADA 1ZY4A 5K5XA 3JVRA 3PUPA 4I94A 3IO7A 5LQAA 2Y8OA 1YXTA 3LVPA 1YZ3A 4H05A 4QYHA 1U4DA 4UBAA 1URCA 4OGRA 2VTPA 2OWBA 3IW8A 1JNKA 3FI2A 2OLCA 2HY0A 5EG3A 5E1MA 3UDBA 2ZM4A 3FUTA 3MERA 4M37A 2WO6A 4RGJA 3UC4A 4GS6A 4DM3A 4EJNA 4CZUA 4GC9A 3U4WA 3E63A 2QRVB 4KIOA 3HX4A 5EHOA 4NJ3A 4OLIA 3B3JA 1H25A 4FNZA 3OVVA 5CWZA 4QTTB 2Z6AA 5JQ5A 1U5RA 3TACA 3T3VA 2BALA 4ANQA 1JBPE 2X6DA 4EH2A 4TNDA 5KO1A 4GKHA 3AXSA 3ZDIA 3OCGA 3MVHA 3NRMA 3E92A 3O8PA 4X2JA 3ZH8A 2XNGA 4E6QA 2BZGA 5AIKA 4XS2A 4FT4A 5D12A 5A4TA 4HYIA 1UV5A 3V5LA 2OJFE 4C02A 2B3TA 2PJDA 5LQFA 2I6GA 4Z7GA 3M6UA 1P1BA 3NMUF 5CALA 4DGMA 4UOEA 3AQVA 3D14A 3PPJA 4OUCA 1E1XA 5L8KA 5CNNA 4MF1A 2OBFA 4YHFA 3VS0A 3ZO3A 4BYIA 4XCXA 1WBOA 1YDSE 3KN5A 5K4IA 2ZV8A 3QBNA 3CCNA 3VJNA 4MXYA 4FTUA 3VN9A 2JFMA 3QZHA 1JSZA 2FK7A 4BCFA 4KRGA 3NUUA 4LL5A 2P4IA 5HCYA 3MB6A 2CKPA 3P4KA 4FR4A 5AUTA 4AN9A 1TVOA 2IBSA 2OW3A 4WA9A 3NGAA 3HAMA 3RHXA 4DH5A 3LXKA 4P7FA 3LCCA 4J8MA 3DBQA 3ZZEA 4Z16A 5K8VA 3A7IA 3IV6A 3M4XA 3ZXTA 2O5KA 4HSGA 3FXWA 3VQHA 4DGOA 2QOHA 3MDYA 1BKYA 5T67A 3E23A 4AA4A 4C3RA 3FHIA 4N57A 5LARA 1KE5A 5AADA 4EVIA 4BDDA 1HMYA 2VTSA 4CMOA 5FP5A 3FTDA 2ERZE 4PYKA 4ZSEA 3QRKA 3UO6A 5CEPA 2QYOA 1A06A 4BDFA 4FIEA 2UW5A 2YM7A 3Q96A 3KKZA 4OTQA 3TJCA 5T6BA 3FKLA 4JOAA 1TPYA 4BICA 5AUYA 2R64A 1XBAA 5GINE 3BZBA 2J5EA 4CG8A 1DAYA 3LQ3A 3OUNB 2X8DA 3UVQA 2RG5A 5IMEA 3QD3A 2JH8A 5LMKA 4RIWB 3KXGA 2FB8A 3PG3A 1AQJA 5CY3A 3ZHPC 3MI9A 3G33A 2BIYA 2GNFA 3BV3A 4LOOA 2FSLX 1JSTA 2J0KA 5HE1A 4IC8A 3QCYA 4BTMA 5LQJA 5HVKA 3Q2MA 3HRFA 3HP2A 4Y46A 5AWMA 4XV9A 3TNQB 2WTIA 2OB1A 2WAJA 4F4PA 1G8AA 4PYJA 2AN5A 4GOOD 5CT7A 4YSJA 4WT6A 5D41A 2EJTA 5L2TA 3OCTA 3UO5A 2IZSA 1RI4A 3FMLA 4X60A 3BRBA 4XHKB 5AV1A 4QPPA 1QPCA 2R3HA 2J9MA 4FSUA 3VUDA 3R9XB 5F20A 2WQBA 4NWMA 3UP2A 1M2RA 4FKLA 5F2NA 4HNFA 1H07A 4PIPA 4H1MA 5DFPA 2IZUA 4A07A 3R0TA 1FMKA 3SKCA 2PUIA 2BDJA 2HW6A 2XK9A 4KWCA 2PSQA 4QMPA 4M8TA 2P35A 4D9TA 1VL5A 4F65A 3KQSA 3ANXA 4KIFA 2JHCA 4RIOA 4FTRA 4O7WA 5EZSA 4I6HA 2HCKA 3W2CA 2A1AB 5ACKA 4PMMA 2QE6A 3OROA 2Z2WA 5IUGA 3MIYA 3RK7A 1J3HA 2HY81 3N9XA 4GOLD 4W4WA 1Z57A 5AFVA 5BUEA 3PY0A 4KD1A 5CASA 3GNLA 3LFNA 3IK3A 3NW7A 4C36A 1NKVA 3KXXA 4DTAA 4ITIA 2PZIA 4C04A 2B9IA 5JFXA 4FV6A 4RVGA 5J87A 3T3UA 2R3RA 4I92A 3C0HA 4LECA 3S0OA 3A8XA 2HW7A 2IDJA 2ZB0A 3RPVA 3DXQA 4E70A 1E1VA 4JBQA 3NWEA 3HMPA 5J1VA 5EDQA 4GEOA 3VUKA 4NTSA 2CN8A 5FQOA 4DEAA 3UZRA 3PFGA 3ZO1A 2WMRA 4FV5A 4Z3VA 2JEDA 3PSCA 2ITWA 5A14A 4UYAA 4YJSA 4KS7A 3GU7A 1XXLA 2YX1A 4X41A 3QXOA 4W4VA 5HZNA 3GRRA 4IEBA 3FLSA 4NKSA 5EIFA 5HFJA 5CU3A 4RTMA 4PTEA 3VS6A 4PQNA 3MPMA 3UIMA 5IQBA 3EH9A 2YM8A 2I7CA 3KQOA 3COMA 5CUQA 3FC1X 1KP9A 4DE4A 5JMSA 4PWNA 2OO8X 1VBFA 3ZONA 5D7VA 2PL0A 3VO3A 3QQUA 3CKKA 2GNIA 3AT4A 1SVHA 4D9UA 3DAJA 5EHYA 4RVKA 3OD6X 2Y0AA 3NW9A 3ODZX 4AUAA 4EORA 3GENA 3G2QA 3AC4A 2F7EE 3G8BA 2OIBA 4MHAA 4NCTC 3PXZA 4BB4A 3OXIA 2XIKA 4FTAA 2IN6A 4R3CA 4RZVA 2VD5A 4QDKA 4FKSA 2PVMA 4BIDA 4HYUA 3L9NA 3SOAA 3RM7A 4FGRA 3WYYA 4ZTQA 3HMIA 4L46A 3DPKA 4GBED 5ICPA 5HLNA 3FMHA 4QQTA 3DZQA 1DI8A 5FTOA 2WMAA 2H9VA 1DI9A 3W55A 5E8UA 2F57A 2VTJA 4KB8A 3HCAA 5FWAA 5LCJA 4M36A 4GT3A 2XIYA 2W5HA 1M6YA 2ADMA 1IAJA 3CY3A 4DTBA 4WUAA 4FSNA 4DH3A 4B6LA 5AM7A 1Q3WA 4Z2YA 4JDHA 4IAIA 3BQCA 2R3KA 2VTRA 2W4OA 4FV8A 1YI3A 3QCQA 4M68A 4CG9A 4LWOA 4JX3A 2ITPA 4GFOA 4EHZA 1JR4A 4POOA 2ITQA 3SHEA 3R7OA 3BU5A 4EJ7A 2CL5A 2Y6OA 1XTPA 4IX3A 4BBMA 4P7JA 3ZSGA 3PPZA 4XV1A 4IV8A 3G5DA 3LPBA 2F49A 5L3AA 2YIXA 4E33A 1B38A 2GS2A 1OR8A 1YWVA 1ZMUA 2WIHA 2XBAA 5BP7A 4FVQA 3G8AA 4O2PA 2B9EA 4N6YA 5FGKA 5B7VA 4OTHA 3PY3A 4UWBA 1F38A 3DBCA 5HD7A 2QI8A 2V74B 2PUNA 3EQBA 2QVSE 2VGPA 3VC2A 3U9NA 5HBEA 2YISA 4ZJVA 5BXYA 1OL5A 3BE9A 3JWHA 2OJIA 4C38A 1OL2A 3GCQA 3V5WA 3E8EA 3M70A 2AOWA 3EN9A 2B54A 2VO0A 4P2KA 3VUIA 1AGWA 5AP1A 3Q60A 3NYOA 4RSRA 1WFCA 4K2RA 2VNYA 4MWHA 2I1MA 3G90X 1FMOE 4BCJA 5CVJA 3G6HA 2ERKA 3EB0A 4UXQA 4EK4A 2OIQA 2AOVA 3FV8A 1RJDA 5HI2A 3TOSA 2YXLA 5BVKA 2EJUA 3QCXA 3LXPA 5EEHA 3WIKA 3F61A 2Z7SA 3RAWA 4E73A 5EQEA 1OBGA 3FYJX 5EKUA 3QL8A 2R3GA 3PIYA 1SVGA 5L6WL 4KABA 4YR8A 2QO2A 3CQWA 3ZS5A 4H3PA 3KRXA 1XR1A 4F7JA 4RIYA 5C0OE 1Q97A 3UIBA 4MXZA 4A9YA 2C3LA 3A61A 5JH6A 3FMNA 2ZMCA 3ZO4A 4FICA 2QOBA 4P90A 4J96A 2B0QA 5LQCA 3LJ1A 4MHTA 4FEWA 5IA4A 4OTFA 2QU5A 3SRVB 4EONA 4PL4A 2X7GA 3C4FA 3F3UA 3K2LA 3GC9A 5DA3A 2UVXA 4CWAA 4L3JA 5HU9A 1GZKA 4AE9A 5JKGA 5KQSA 5CVVA 4K33A 3THSA 1CKJA 2VTAA 3OU6A 3IPHA 2FGIA 1XCLA 3D83A 1JOWB 2GDOA 2JIUA 5TF9A 3AXTA 3EYHA 1GIHA 5P8WA 3KRJA 2Z8CA 2C1AA 2ONZA 4R78A 3LKMA 3PA3A 2YIQA 3NDIA 2UW6A 2PVLA 3Q9ZA 5JEBA 4PWYA 5JFSA 4YV1A 5FM2A 2VTLA 4I5PA 4OQEA 2BDFA 2ZULA 2UW9A 5E91A 4NECA 3KQWA 3BIZA 2QKWB 5HO7A 1PXPA 3REPA 4XG8A 4CT1A 4BCKA 4HVSA 1V0OA 4UN0C 4EK8A 4EKKA 1OIUA 4GQBA 1X8BA 2GHGA 3EN4A 4OTDA 1R1WA 3W33A 4WVLA 4ZY4A 3KR2A 4AOIA 5E1DA 2UUEA 3FRIA 4X6RA 4IJPA 4ZTSA 3EVFA 1QAOA 4TW9A 1RI1A 4PNEA 4RJ5A 3QD2B 5E8TA 3EVBA 3TKYA 3RKBA 4V0GB 2PVJA 3M2WA 5HKMA 3OWJA 5DX1A 2AVDA 3EIDA 4WNKA 4S34A 3QA8A 2XS0A 1MHTA 1Q4LA 4N0SA 2P55A 1PYXA 5LWMA 2WEVA 1WS6A 2YCRA 4YTIA 2XP2A 1BYGA 3W32A 1JPAA 4NIFB 4KVZA 4XV3A 4WBOA 2W96B 4PCAA 3LM0A 2VTHA 3AD6A 4FKPA 3HVIA 4YTCA 3QGYA 2H96A 3HA8A 1P91A 3L9LA 4L01A 3W2OA 5FHQA 4L52A 3F3VA 4ER0A 4GFMA 3FUUA 3A4OX 5A6NA 4BY9E 1I09A 4NKAA 2CNQA 2WKMA 3HA5A 1QANA 2X0GA 3RODA 2GQRA 4L43A 3ZLWA 3Q52A 3ZU7A 3DGKA 4QMYA 4FTTA 1ZYDA 4ACGA 5KS2A 3RCDA 3BKBA 3BWBA 3KB7A 1KXZA 2R3SA 2YTZA 3R9RA 3VS2A 3LCTA 5GJFA 5ANGA 2JAVA 4RTNA 4ZLZA 2P3QA 4EC8A 2IFTA 3R9OA 4ASDA 4DCEA 3D2LA 4NW5A 2PT9A 3KEXA 4JXFA 4EQZA 3KXZA 4WRSA 3RWQA 1Q8WA 4QT1A 3AWIA 3P97A 5HTBA 5CSXA 2EWAA 3MBLA 3ATTA 1PJZA 5J95A 2C5VA 5DR6A 1EQAA 2VN9A 4DG2E 4E2WA 2VP3A 1HNNA 3G89A 2H11A 4L7VA 3A25A 4RJ8A 1BX6A 4MIKA 4O21A 4EK9A 4DAWA 3E5AA 4FT9A 4GH2A 2OZVA 4QTEA 2JJQA 2H8HA 3QQGA 5JZJA 2AOUB 4EQCA 1R00A 2GTNA 4RTJA 3A27A 2PVCA 3BBTB 3TZ7A 4IB1A 1V0PA 4JG7A 5CD1A 4ITJA 2G1PA 2BDWA 2UZ4A 5HEZA 4K1BA 5IQAA 3LFFA 4R5YA 3EVDA 2QC6A 3IKAA 3P71T 3LMHA 4P7GA 3FTEA 2CGUA 3MVJA 3H9FA 2V5QA 3CC6A 4I0SA 5CXZA 4CTJA 4FIGA 3LFEA 3S68A 1FJXA 5K05A 5FM3A 3CPBA 3LIJA 3THBA 3MPTA 2PWYA 5KX8A 5EG5A 4XOYA 4Y8DA 2YAKA 5F1ZA 1IEPA 5FEDA 4RWIA 3FYKX 3TZ8A 3JWJA 3ZXZA 4FKOA 5AV3A 3UZTA 2O2UA 4RWKA 4EQMA 2UZLA 5AP0A 4XUCA 1T46A 4EZ5A 3D7TB 3HMMA 5BW4A 3IW4A 5DT3A 4EH8A 4KAOA 4FT3A 4RTOA 3AG9A 5CCXA 3F5UA 5A4CA 3NW6A 2ZAZA 5EW3A 3U55A 3KREA 3PB3A 4M7RA 3KGAA 3JY0A 3PA4A 3OU2A 3F2NA 2G2FA 1Q8UA 2IIPA 4YZBA 4F08A 2PZ5A 1V39A 3UTOA 3FTCA 2FRXA 4F9AA 2OPBA 3QHWA 3LCVB 1YHVA 2XYVA 4XJ0A 3L1SA 5DT2A 3KXMA 4MBJA 2YIYA 2ITOA 3FI4A 4QTDA 2A0CX 3Q9XA 5M44A 1J7UA 5FP6A 3R2YA 4LOPA 4FKRA 1JSVA 5DPMA 4RFYA 5H2UA 4B7TA 2BHEA 2JC6A 3SGLA 2C7OA 3OOMA 3BLHA 3A7EA 1IRKA 5C9ZA 2WFYA 4C2VA 5HHWA 1WZNA 3C4EA 3EEYA 1G8SA 2IH5A 4TZRA 1S9JA 2ZCJA 1FPUA 4GW8A 1TW2A 4RQVA 5EMMA 4RZWA 3THRA 4IVDA 3PA5A 4KBCA 2HAKA 3PP1A 4X2FA 5K0NA 5FBNC 5L6OA 2ZZMA 1NT2A 3KULB 4ZLOA 2QOLA 3P7BA 3MVLA 4YUZA 4I4EA 2UYOA 2C6MA 5JT2A 3EFWA 3ZFXA 2ZDTA 4IJ9A 3DY7A 1REKA 2OFVA 4JIAA 3OWKA 4H58A 1QAMA 4OTWA 5L2SA 4QMLA 4ZTNA 3HV4A 1KV1A 1OZ1A 3V5TA 3BGVA 3DDQA 3OBGA 2JBPA 2OF4A 4IZYA 4PTCA 3WF7A 3MY5A 2IJMA 1FP1D 3I6UA 5KMIA 1SVUA 3OPNA 2QODA 4YJPA 4KS8A 5DTMA 3RK9A 4ARKA 4R7IA 2YVLA 2GS6A 4MD8E 4D5HA 2HV9A 1YWNA 5EM5A 3MFUA 2OXYA 1O6YA 1INLA 2I0HA 1FINA 4DFNA 2ITZA 4JJRA 5DX8A 5HNIX 2UW7A 4QP9A 3ELJA 3LFBA 5HLPA 3KPUA 3HA6A 2BTSA 5GOZA 3PWYA 2A19B 3PYYA 2B9HA 2QOOA 3DCVA 3VW6A 4EOJA 3TIZA 3DKOA 4EOSA 1CM8A 3LQ5A 2G01A 3RI1A 2PWLA 3WILA 2PYWA 2HWKA 5H3QA 4ACDA 1PMEA 5IH6A 3KA0A 3NTVA 4RLLA 3RPSA 2WTKC 1W82A 3EQGA 3QCSA 4PYMA 3D5WA 3NNWA 4MBIA 2PULA 2YHVA 2BPMA 2DQ7X 4MXCA 5K0BA 2IW6A 3Q32A 2WNTA 3DH0A 5KZIA 4BDEA 4WHZA 4U42A 2FVDA 2RKUA 2CGWA 4RQKA 2BZKB 4YBKA 3TUBA 4V01A 4PV0A 4LMUA 5HILA 3ULZA 3G2OA 3IGOA 3LJ2A 2N47A 3COKA 4PDYA 3B8QA 4TWNA 1NV8A 5FA8A 3EQIA 3EQFA 3SLSA 4CFFA 5EMKA 3IS5A 4CLJA 3AD5A 1YDRE 2IVSA 7MHTA 3GGDA 2W1ZA 3FZSA 5HIMA 4LUDA 3ZYAA 2OJGA 1I4WA 2W1CA 2ZVJA 3E7VA 3TNPC 3R1SA 1U54A 4KKHA 2LGCA 4PMSA 1KYZA 4IZ5A 5E4HA 3E88A 2G1TA 4G17A 4QRCA 4M13A 4R6WA 4U7PB 1YHSA 2XNMA 2PE2A 2J2IB 2UW3A 4FNYA 3ID6C 4JXJA 1U2ZA 2XK6A 3PJ3A 4RMZA 4PL3A 3LJ0A 3QTWA 2PVFA 4WNOA 5AA8A 2PX4A 1OL7A 2UZVA 3I1AA 1JKTA 1MP8A 4KA3A 2NNWB 5LVPA 3O96A 4Q9SA 4DGGA 4YLJA 4E2ZA 3JR1A 3AC1A 3OTVA 3C13A 4L67A 3KPVA 2JDTA 4NM3A 3DXXA 4CCUA 3DLZA 2XIZA 1X1CA 2P7HA 5LQRA 2YDKA 1QMZA 3UNZA 3IGGA 1R0PA 4ERWA 4YP8A 3ALNA 2XBMA 4PINA 4BGGA 3D94A 1GZOA 4GVJA 4O7VA 3ZO2A 3BZ3A 1XH4A 2WQNA 4BZOA 3ORHA 5DRBA 4NUSA 2HENA 4G3FA 2WTKB 1FGKA 4FV4A 2HWPA 3BGPA 1SYKA 5FUBA 1REJA 2G71A 3V01A 5EFQA 4PMTA 5I4NA 4FZDB 3EMBA 4V05A 3H10A 2JIIA 3NZ0A 4I5HA 3OY1A 2B4SB 4X6QC 2P3OA 2JDRA 5CSVA 3NAYA 4YC3A 5GIPE 5JFVA 2WELA 3HVCA 4TN6A 3UWPA 2OG8A 2KTYA 4U5JA 2OH4A 3JS2A 4IQ6A 4MKCA 4YNEA 4MNEA 2E9PA 1M2PA 3OZ6A 2AOXA 4O96A 3TEIA 2ONLA 4QMSA 4F70A 1GNGA 1RQQA 3Q5IA 4YMGA 4CKRA 3DK6A 3Q2JA 2Z7RA 4N4SA 4AW1A 4C4GA 3R7VA 3LCDA 3PTAA 1NY3A 2CMHA 5TOZA 2CSNA 5KUPA 2J7TA 3DXPA 3PXKA 4YHJA 4P4CA 2I6LA 4JRVA 1PF8A 3O17A 4U81A 3RCJA 2AC5A 3HTXA 3OW3A 3KQVA 2CGVA 2OSCA 2WMQA 3MSSA 3QFVA 3UZPA 3PVUA 2OIDA 2C3IB 4F9YA 2QONA 4TL0A 5IQHA 2O63A 1XHAA 2R3MA 4OA5A 5I5ZA 5D10A 2XJ0A 3MJ2A 1LR4A 3FAAA 5M08A 2IVVA 5KYGA 5AUZA 1BI8A 4X3JA 4AGDA 3UNKA 3TQSA 3BI6A 2WQOA 3BKWA 5EHLA 5GNKA 2QKRA 2QR8A 2J5FA 5EYKA 5AJQA 5AUWA 1OITA 1KPGA 1H24A 3LDFA 4LI5A 1NE2A 4E5WA 3PY1A 4R3RA 1M52A 2RL5A 3LL7A 2HXLA 4AW2A 5IQDA 5JK3A 4GF5A 5CI7A 1YZHA 4RWZA 3UJ7A 4GMYA 2QQ7A 4R7BA 4AAAA 2YM3A 3Q6UA 2R5TA 4OT5A 5EM7A 2UVZA 4JG6A 2W05A 3UMXA 4EYJA 3GCPA 4ER6A 2G15A 4ALVA 4HGTA 2HTEA 4EOLA 3NAXA 3COIA 2J90A 4DYMA 3L9PA 5HVJA 2XYRA 2P40A 4E6DA 4D4VA 1CDKA 5HIDA 4F63A 4ISCA 4GU6A 4DA5A 4G9RA 4C3FA 5IA2A 4QYGA 3TL8A 3GXLA 5ICEA 2WMVA 2AVNA 1OKWA 1I9GA 4R8RA 2I9KA 5IQFA 1RJFA 3ORXA 4JDIA 4E5AX 4J1RA 1QPJA 1P4OA 3QYWA 3OW4A 4DCGA 1O9GA 2VZ6A 3P9IA 5DM1A 3R04A 4FYNA 5BPYA 2C0OA 4PMPA 2HIWA 2XNPA 2UZNA 2C6EA 5C03A 2OI4X 2O65A 4JR3A 5HD4A 4FT2A 4OBWA 3EOCA 4B9DA 5J5SA 1RI3A 2VWIA 1ZHFA 2AUHA 2JG3A 4PF4A 5DNRA 2ZIEA 3EFLA 3FL4A 3ZUVA 5I9YA 4HVIA 5C4KA 3CQUA 5EYMA 4O6EA 1TKIA 3TM0A 3T9TA 4FNWA 3GRVA 1G55A 3OE4A 4XG7A 3SR4A 3DKCA 3FKNA 4MQ2A 4YU2A 1MUOA 2JDVA 5LMKC 2ZSUA 3QA0A 4PDOA 3LFQA 3NYXA 2UZUE 4DT9A 2SRCA 5J1WA 2CLQA 2PZRA 4RWJA 5GHVA 4QDJA 4C4JA 3Q3BA 4AGCA 2VWXA 3FJQE 3CBGA 5IKMA 4IWOA 4FIFA 5HU3A 3VYWA 4U40A 4O22A 4DLJA 4DT8A 5FQNA 3DLCA 3PVGA 1LUFA 4NW6A 4O27B 2JKKA 2HZ0A 4FTJA 4TYIA 3OCJA 1UKIA 4CCBA 4YNOA 2ETKA 4OBOA 4ZTLA 4AF3A 3DUWA 3VS5A 2XBJA 3A7JA 4H0NA 1RI2A 5KMKA 3LLTA 1H27A 4KINA 4E8AA 4RFZA 3SM3A 4C06A 5D9HA 3LFSA 3SVVA 3K5UA 5L2IA 2W7XA 2VDWA 5CZHA 3TDVA 4AQCA 4JRNA 1OIRA 4NL0A 4ZZNA 2V7OA 5EOVA 4YTFA 3BEGA 3W8LA 4EH5A 1ZAOA 3SG9A 3EN5A 5FG8A 2O05A 5HORA 1PMVA 1T45A 3FLZA 3SW4A 4Z7HA 2JAMA 2P3GX 1MRVA 4A9RA 4E93A 4O81A 3S4QA 3ULIA 3EQPA 3GBZA 2AR0A 5L2WA 4XRJA 1GAGA 2R3JA 3CLYA 1UA2A 3VRYA 4ATNA 5ICFA 4K8AA 2GQSA 3F2AA 5E8RA 5ANJA 3IW5A 3KR9A 4G3CA 3C0GA 3T7TA 4IB0A 3MJ1A 4XMOA 2UZOA 3GGFA 1XJ5A 3P9CA 1H28A 3ORNA 3E62A 4EUUA 1K2PA 4A6DA 4FG7A 4H36A 3QD4A 4PP7A 1MRUA 4R6VA 1H1RA 2Q0BA 4QMNA 3DFCB 4YUQA 2X8EA 2YEXA 1VE3A 3QWKA 3TUDA 2P8JA 3WZEA 3R00A 5FCDA 2RF9A 4M67A 4G34A 3CPCA 4UB7A 5K09A 3FPHA 4PYOA 1UU7A 3ZDUA 1Q3DA 3H30A 5KMJA 3UJ8A 2FSMX 4RX1A 5CLPA 4OBQA 3QTXA 3OCBA 4XP3A 1Q8TA 2BZJA 1FVVA 3WE4A 4FKTA 5KNJA 3HP5A 4AA5A 4KBKA 3U87A 4ZTRA 1TW3A 2QG7A 4N70A 5I0BA 4DH7A 4GUBA 5CZIA 3GC7A 5L6PA 3WZDA 3QD0A 3VQUA 4I21A 1LPUA 3R8UA 3NNVA 3UPXA 1O54A 5HG5A 4BTJA 4DCAA 1Q0SA 3EGIA 5ACBC 2RGPA 3C4CA 3IECA 4RVFA 4NFNA 4S32A 4IAKA 3UVPA 1JQ3A 3M6XA 5M4FA 5E92A 2J4ZA 4BHZA 3QRIA 3VRZA 1CMKE 5H8GA 4TKSA 3KN6A 4OR5A 2WQMA 2A2AA 4C4HA 3FHRA 1H8FA 5HTCA 3KR0A 3LBYA 5HBHA 3ELUA 4C07A 4D2SA 1PXOA 4L3PA 4QTUB 3SXFA 3RZBA 4C4IA 1ZMWA 4XX9A 3SV0A 2ZWAA 3FMDA 2RFNA 5D11A 1H26A 3D2IA 5HZMA 2WTWA 4CXAA 4QMUA 4L7FA 3CJQA 5BYLA 3BHYA 4CZTA 2JHAA 5TT7A 3OT3A 2PUPA 4RIXA 3Q4TA 4YJUA 3WSTA 2BAKA 2QD9A 3CJGA 1ATPE 3PIXA 1X1DA 4ALWA 2QM3A 4E2YA 4GSBA 3W16A 1IA8A 4MQ4A 3UP7A 2XRUA 4FBXA 4ZP5A 1D2HA 3BHTA 3DXZA 4AGWA 3TMAA 5IMXA 3UNJA 2B9JA 1HCLA 3QRUA 5E9EA 5F95A 4B99A 2PV0A 5M4IA 3PZHA 2OH0E 5HE2A 1RDQE 1NVRA 3F3TA 4AG8A 2X2LA 5A54A 3JXWA 5AAFA 4JLCA 3HVHA 3BGIA 4EK3A 4Q5EA 5CEMA 3MFRA 3LKDA 5CSWA 3SX9A 4IFGA 5T64A 2J0MB 5T3QA 4NTTA 2XB7A 1SM2A 3NEWA 2XM8A 4FTKA 4OBPA 4YJTA 3UJGA 1PYEA 4C61A 1ZY5A 3IYLW 1JG2A 2ERCA 2V55A 1PHKA 2ESRA 2F7XE 3Q6WA 4BI0A 4HCUA 4IWQA 2Y1XA 4Y30A 4P5QA 4L44A 3CC8A 4PNKA 3JPVA 1ZKDA 3NYVA 3DXNA 1KOBA 1WMKA 2BRBA 5FDXA 2QLUA 3V5JA 2HZ4A 4FL2A 3R8LA 2RIOA 3I7CA 4OT6A 5AA9A 5CX9A 5M56A 2YJRA 2O64A 4GRBA 1H1PA 10MHA 3F6XA 2Y7JA 1YHWA 3ENMA 4RBLA 4RTRA 3ACJA 3O51A 1PW2A 3MH1A 5TO8A 3GRZA 3GCVA 4MXAA 1JQHA 3GWZA 4MEDA 3MHTA 5IDPA 4ZSGA 4KIPA 4HRAA 4JVGA 2PWPA 5F94A 3W2SA 4NFMA 4F7SA 4BCMA 2G72A 3II5A 2GCDA 5AV2A 2VWZA 2O0UA 1OM1A 4E4XA 4D28A 3PZEA 3C1XA 2VO7A 1QCFA 4O7TA 3TCPA 3KPWA 4ENYA 1Q0TA 2CKOA 2UZDA 5AP5A 2UZEA 4AT5A 2B9FA 4AP7A 1ZGAA 2B55A 3QZIA 3K3JA 4XP0A 4F09A 1NW5A 1P39A 2YXDA 3UIUA 3DP7A 1H01A 2XK8A 3L8DA 2R7BA 3G6GA 3MW1A 4DLIA 3MAGA 1ZZ2A 5LOHA 3ZRLA 1X1AA 1DCTA 2PPQA 3RTPA 4S33A 2X2MA 3CTJA 1ZXEA 2PXXA 4DN5A 4GEKA 5F2OA 4CTKA 3I6WA 3RJCA 4EH3A 4ONAA 3ORTA 3IG7A 3A60A 5IEXA 5M09A 9MHTA 3V04A 3OXZA 4U3ZA 5DX0A 4NYEA 2VO3A 2IVUA 3OOGA 5FDPA 3HDNA 5BVFA 3OWPA 2ZVAA 2NXJA 1SUIA 1G5SA 3LMGA 4DEHA 3MESA 2EU9A 2I62A 4FTOA 4RVDA 4K9YA 4XUEA 1JTFA 2CJMA 1Y91A 4UV0A 4WG4A 4ER3A 3PWDA 1IXKA 3EVGA 4HGZA 3S00A 3FE3A 4C7TA 5FHRA 3GI3A 3AY0A 4CXMA 4X61A 2PGXA 2PY3A 2EB2A 4HTFA 2OICA 3I0OA 4EOIA 3I53A 3SX0A 3MCTA 3UJ6A 3P79A 3GCSA 4CKBA 5K0GA 1Z5MA 1JG4A 4YUYA 3R6XA 3B3GA 3FPMA 4NSTA 5FTWA 3F88A 2J51A 4BLVA 1YXSA 2FSOX 3ZFYA 1EJ6A 3WF9A 1XCJA 4WOVA 1SUSA 1URWA 3TV6A 2HELA 2O07A 4GOND 5KQRA 5CYIA 5BX0A 3HCFA 3OTUA 3POOA 3HCDA 1NW8A 3GU3A 4K6ZA 4DFZE 3KCFA 4KWPA 1H1WA 5BVOA 4EUTA 2YITA 1VP9A 1JKLA 2X9EA 2X6EA 5HESA 1BL6A 3LCSA 4FV0A 5K0LA 3DMFA 3Q53A 4CSVA 2OU7A 4IAYA 4PYIA 5C8NA 2W1DA 1KUTA 4RIYB 2JIVA 3GJYA 3FPGA 2QOIA 1WXXA 3MA6A 3OP5A 4F7LA 3B89A 4L9IA 1J91A 4JX7A 4HGEA 4DQ0A 1U59A 3PPKA 2WK1A 1M2QA 4GT4A 3HA3A 3G15A 4D58A 3UIXA 3QU0A 5D1NA 4F6SA 3TT0A 4NZWB 4RJ6A 4QMMA 5HG9A 4FYOA 3R71A 3CTQA 5AM6A 4QP1A 4TYHA 3KMUA 5FTGA 2JDSA 5DM0A 5M55A 4AGUA 2W9FB 3KKVA 3EFJA 3LHJA 4M97A 2K4MA 2R4BA 3KQPA 2NRYA 3BKXA 4X1OA 3U54A 4D2RA 3DS6A 4DHFA 3BELA 4BP3A 3EEOA 4JNWA 3FPJA 5CEQA 1GOLA 3BHUA 4H39A 2XKFA 4KKEA 4IVCA 1KWPA 4E4MA 5AAGA 1AV6A 4KDCA 4PX6A 2Q83A 4FTCA 1R78A 5HG8A 1ORHA 5AX3A 4U7ZA 2GNJA 3C7QA 4A9TA 3S95A 2WEIA 4CKEA 1ORIA 3DFAA 3REOA 3R9NA 2R2PA 4BCPA 5FQDC 3OMVA 3B5IA 3LXLA 1DS5A 4F0GA 3E8SA 2ZW9A 2BKKA 1TQMA 3V6SA 4RX5A 5ANOA 4O86A 3ZEPA 3TTJA 4FZAB 4FZVA 4LOQA 1OKVA 3ANQA 3RMFA 2XM9A 2JH9A 2P7IA 5EKXA 3QHRA 3VS1A 4NM7A 5KCVA 1LP4A 3DBFA 4Y85A 3HVJA 2GS7A 3UG2A 1EAMA 3ZM9A 5IDNA 2QHNA 2PVRA 2YCQA 2LAVA 3FMEA 5EVJA 4DFXE 4R5SA 3WOWA 1IR3A 3NWBA 3B2WA 4EHEA 3LSTA 5KHXA 3IQ7A 2W0JA 3P8ZA 5CQWA 4A6EA 1PXIA 1YQJA 5BVEA 4A9UA 2AS0A 3D0EA 3WZKA 2XNBA 4TTHB 4ZS0A 4B8LA 3MQ2A 3A4TA 3WF8A 5HNGA 2FSTX 2BILB 5HIIA 3BGZA 2JGZA 5ETIA 2HZNA 4HOKA 4JQEA 4QTBA 1H0VA 5A3XA 3QTZA 4N6ZA 3W2PA 3TM5A 4K77A 1NW6A 4HCTA 5CF6A 1H08A 5CAQA 1OMWA 2C7PA 3D15A 5KE0A 2F8LA 2IZRA 1PRYA 2ONYA 4IAZA 4D1SA 4BTFA 1V0BA 2XNOA 1NBIA 4E5BA 2BFXA 3QQJA 4KSQA 5JSMA 4BDKA 5E1BA 3NUXA 1JSXA 1Q61A 2XIRA 4OX9Y 3GQLA 4IV0A 1PXKA 3UQGA 1MQBA 4RT7A 5C4LA 3NR9A 4BDBA 5FEQA 2R0IA 2P2HA 5JGBA 4FKUA 4UY9A 3JWGA 2W1FA 5E8XA 1Z9XA 4KKGA 4FSQA 3BLQA 5HIBA 4GK2A 2I7QA 3R63A 4XG6A 2PLWA 4GV1A 4ACMA 3C4XA 1W98A 2VUWA 1BL7A 4QQ5A 4MD9E 5EI2A 3VVHA 5AAEA 1N7JA 4QTAA 2EXMA 4A7CA 4H1JA 1SKMA 1K9AA 4FOBA 2OBJA 3POZA 5IQIA 2C6LA 4BZNA 2X2KA 5EC8A 4FSDA 1Y57A 2VDVE 5DPVA 2PE1A 3TRKA 3KVWA 5M57A 2WA1A 5F4NA 4ZAUA 1M14A 2C3JA 4F99A 2CWWA 2H34A 1UU8A 2J0JA 4FV7A 3R7UA 3SOCA 4CTCA 4U7TB 3QQFA 4KNBA 3SQQA 3Q4CA 4A4OA 1SNUA 4YZNA 3BWJA 3I9FA 2CKEA 4UWYA 2ITTA 1NV9A 5I9VA 4WG3A 3PS9A 1YKRA 5LMAA 3TZ9A 2QURA 1MRYA 4FT0A 2IW9A 3AOXA 3UOLA 1YXUA 2C5NA 1FBNA 5IH3A 4JS8A 4EHGA 1KSWA 4I5CA 3G88A 4RX7A 4C33A 4E4LA 5B0XA 4E31A 3I7BA 2OB2A 3DLSA 4LGHA 3R6TA 2I0YA 4CD0A 1W7HA 4IB5A 2XEYA 4P58A 5J9ZA 2GHLA 4GVAA 1JKSA 5CI6A 1PJKA 3DT1A 3EMGA 3ORPA 2NP8A 5E8ZA 3NVMB 4GG5A 2VWUA 2ZBRA 3DKFA 5E9QA 4F9BA 5KBQA 2A14A 4J97A 2ZB1A 5KBRA 3ZLYA 2FA2A 4DFUA 2X8IA 3HCBA 1VEBA 5CAVA 4DEEA 3TXOA 1P4FA 1JAMA 2XVDA 1YOLA 4MYGA 5E8VA 4O82A 1VLMA 5LWNA 3LBFA 1LEZA 4RC4A 3F7WA 4E6AA 2C0TA 4HNIA 2UZBA 4JAIA 4CFVA 3ME5A 4ZY5A 1KV2A 4I6FA 3V8SA 3Q9YA 5K0EA 3O31A 3M6VA 2Y4IC 3MH3A 1AQIA 3VF8A 3DNEA 2W1GA 4I5MA 3LDGA 3FQEA 4X63A 5EK7A 4F64A 3TKUA 3FZPA 3VULA 3QZGA 2GNHA 3TKIA 2G2HA 3KK8A 1FOTA 4FEXA 3NIEA 1SG9A 3HDMA 3P08A 4BP1A 1O6KA 3KMMA 3IONA 4PGHA 3OZRA 3C51A 5EDPA 4ZJIA 4JL9A 1PKDA 4QO9A 4II5A 2XEZA 5CCBA 1VYWA 5A4LA 2XJ1A 4V0RA 3OE5A 1Y8YA 4CVAA 4PL5A 3KQMA 5G6VA 5IF1A 2BZIB 2VRXA 4NM0A 5C27A 4GYGA 4RTLA 3P23A 2XVMA 3QTSA 4QNAA 2C7RA 5L8LA 4GOMD 5HIJA 4O84A 3R22A 3DR5A 5FTQA 4K6MA 1L3CA 1G38A 4CT2A 3I5UA 3UA4A 3U8WA 4C34A 3R7IA 2ZDUA 3P2EA 2ZYBA 2C5YA 2GU8A 5E1EA 4F6UA 4O0RA 5B2LA 5DRYA 4AW5A 3GT8A 4ZXTA 3GB2A 4TWCA 3EVAA 5E8SA 2WTCA
chains in the Genus database with same CATH superfamily
4ETIA 4I0RA 4AYXA 4QYEA 4FUXA 2IX9A 3P4UA 5GY7A 3AW8A 5HVYA 1ZK1A 1WX1A 3FDNA 2YJSA 2HSDA 4F5ZA 3TLKA 1L8XA 3H4MA 5C1QB 4CCYA 1CUHA 3NAZA 1YIDA 2UV2A 2X81A 3D8RA 1BX3A 3LAWA 1IMOA 4JQ8A 2JI4A 4C0SA 4O25A 3G68A 3QY0A 5A2GA 3UQCA 4P8RA 5DBGA 1N0IA 4YP5A 3TJMA 1W9MA 3U56A 4ZJPA 3W5JA 1TYBE 3H3JA 1T4MA 3AEKB 4UEQA 1L7DA 3GDFA 1OREA 1QFSA 1P0CA 3E4DA 2Y4IB 2I1WA 4C7OB 1NLFA 4D8VA 4MVJD 4OTIA 1CUUA 3TLMA 3BTOA 3PVCA 4BQRA 1SELA 2QLJA 2O06A 1JT9A 4H6XA 4PXSA 2PIAA 1JP7A 3GFPA 3HI4A 3WO0A 3BMCA 1QDUA 4AG5A 3CRZA 4ALKA 2HU8A 4BQFA 2OHOA 5COQA 2UZWE 1K98A 1EFDN 4OXIA 4YO7A 1UDRA 1DI0A 1UT8A 1RRGA 3E35A 3RNLA 4GI3A 5LNK1 1YWRA 1E1QA 5JALA 4MVJH 1YOVA 2GJKA 3UJBA 2PZPA 1QP0A 2HH9A 2ZDGA 1TQ4A 2XZSA 1PWEA 1IM2A 3K5HA 3HJUA 2C3UA 2PE0A 4X8OA 1OT3A 1AOXA 3OIGA 2O2SA 4KNVA 4C6HA 3M3HA 3SSAA 2BJWA 5GM2A 2ZZNA 2D5CA 1Y8AA 3DBDA 1KVUA 3EQ2A 3HY3A 4G86A 2XOXA 3AV3A 2XCHA 7REQA 4YMJA 1P44A 2JIRA 4JP1A 4W8HA 2XIXA 3CR3C 1PJLA 1XDGA 3NHBA 3BN3A 3A3OA 4OHXA 2JKVA 4FYWA 1ZVMA 3DUFA 1GIIA 3Q9SA 2WBLC 1PK7A 4LGMA 4BMSA 3L4KA 2ZRHA 1OWOA 4J95A 5FBZA 1G20B 2E9VA 2E55A 3HSYA 3WB9A 4O29A 4UZEA 4RAQA 3CH6A 2IXEA 1H5NA 3PUIA 5B7PA 4LMAA 4IFCA 4TWJA 4AA0A 4ZSJA 2K6GA 3MW8A 1RM4A 2R3QA 2FK8A 4FMCF 2GK3A 3NX8A 1QQ6A 1WUHS 5ECYA 5E7QA 4I55B 2Q5FA 2GKOA 2VXCA 1QRUA 5ELMA 3L9WA 2Q8QA 2CLMB 3T5GA 2IXFA 4GUEA 4XGRA 1U3GA 2VGOA 2VP0A 1NPYA 3A6EA 1XTVA 1W19A 5J9YA 1OAKA 2XCRB 2YOGA 4NS1A 1GZNA 5AM0A 4ITHA 3RNIA 4BCNA 3H0KA 5SICE 2JZNA 4BEVA 3SX4A 3G2FA 4YLGA 3AESB 4B0PA 1FGIA 3CEAA 1E7QA 1E2NA 2H9AA 4MVJF 1LX7A 4KSCA 3VZQA 4AX8A 3GCUA 4IM3A 2O8YA 1XEWX 1O4VA 2R6CA 4O91A 4PG4A 4L50A 4RKYA 2NVUB 3OF2A 1F6BA 4R16A 4O2AF 3VKFA 4DC2A 5KU7A 2A5YB 4KGDA 4E5NA 3SN6A 1WW8A 2AZTA 2QG9A 3IAEA 4DL9A 3EG9A 5JN2A 3LXXA 3SIPA 1DTEA 4IG4A 4FV3A 4DLKA 4AJ1A 4CL0A 1EFTA 3D3JA 1CKPA 5K4JA 1XQ1A 4NMXB 2GNAA 1DOHA 3EY9A 2AFVA 4BKMA 3NUAA 5KHWA 4EJ0A 3UO4A 4EYMA 4GSYA 1PR3A 4M0PA 4P82A 2RG6A 4M99A 3GJ0A 4BKJA 2HF8A 2DH6A 3GJRA 3HWX1 1TRKA 4FC6A 3V6MA 4M49A 4W4YA 3M5PA 2R1TA 3DSRA 5IA1A 5BV7A 1OV4A 3RPRA 4YLEA 2F8MA 3FZ1A 1OZFA 2OKRA 2R7KA 2BMCA 4CHTA 2DERA 1CQXA 1RQNA 3TQCA 3ORQA 4HJOA 3V48A 5EHGA 1QZZA 4PONA 4CFNA 2P90A 4L3LA 4RVSA 4HS4A 3ZLTA 4DH1A 3K8OE 1Q0UA 4DHWA 3TLYA 3IMGA 2CHGA 1UWVA 2QXUA 4ZV4A 3PTZA 3MY1A 2EIHA 4D4IA 5EXXA 1L6RA 2OWEA 3UOWA 4C0TA 3PRIA 4ZAWA 2R7NA 1AV7A 1N0HA 1LD3A 1ORDA 1FP4A 3DQXA 3P5KA 3HCCA 1Y7HA 2Y67A 4WD5A 4OKNA 4BKUA 2EFCB 4L5JA 2DSTA 5C18A 1M7NA 4FW8A 3BTVA 5HKKD 2CCKA 3PE2A 5JS8A 1YRBA 1Q7EA 2C29D 1H6BA 4MKHA 1G1AA 4HMQA 5KMLA 2ZRLA 2FKAA 1AS3A 3GPDG 2CLXA 3E53A 1LPAB 1ISJA 3CUWA 3U9CA 4B47A 4YJ2F 4E2XA 1U46A 5JGAA 3A36A 2NU9B 3G0CA 3TVDA 5H8WA 1V8ZA 4PZYA 3MLAA 4BO0A 3TG1A 1UWHA 1AN9A 1PD0A 3NYQA 3O2SB 1RJEA 5JQ8A 1VI5A 4F78A 2FCAA 4RANA 1JQDA 2ES4A 4TT7A 1ZM2A 5ETFA 1PR0A 3K0FA 4QMVA 4LX8A 4E30A 5HQJA 4D5KA 2NSDA 1NNUA 2B8EA 3P78A 2GTHA 3PC7A 3T7SA 3OPYB 5BVHB 4Z9AA 1YB6A 3SC6A 3VBWA 5F98A 5LVNA 3VAYA 4WRGA 3IBFA 2GFQA 2HW8A 4HRVA 3ZBQA 1QE0A 2JGFA 3DEFA 5K3FB 3K7EA 5BUIA 1RJBA 3C24A 4FS8A 1B76A 4DADA 2AC7A 3U37A 2I80A 1KJ9A 4BBZA 3ZQKA 1Z8HA 2KBEA 3HXQA 3PXXA 1AU9A 4B1FA 4J1SA 2UYYA 1H8EA 5ALYA 1MNAA 1ZD5A 1SY7A 3GZTB 2IHBA 1PY5A 4KWEA 3DZIA 2H17A 1WG8A 4JP2A 1KE8A 1K8XB 2WPDD 1JFVA 1M1ZA 4LOJA 5CXQA 3N51A 4GZ5A 3TLBA 3WL5A 5JZOA 2B82A 2VOJA 2CXPA 3U7RA 1HI9A 3F3MA 3IIKA 1O9BA 3ONVA 2BRUC 3W0OA 4CM9D 3C0IA 2ZJBA 1YS7A 3GLRA 4O5OA 3RQIA 3BV2A 3PG1A 2HHJA 2P2IA 3CD3A 2I4LA 5KQLA 3ET7A 1WAMA 1T0UA 3DNDA 1CUAA 3RAKA 2HSWA 5KJ6A 5TGDA 3HB7A 4IHKA 3HUFA 2FB9A 1IZ8A 2EZ4A 2RGNC 2CE7A 2IYYA 4TTVA 4Y2HA 5L6MB 2A1UA 1EX9A 2HUPA 1TM7E 4PC2A 3MN3A 1A9UA 2WXVA 4XVQA 4JC5A 4CLIA 5CU4A 2KW5A 3WF5A 3G0BA 1DLJA 1UJ6A 1GTJ1 2C96A 5DM70 5BYJA 5JASA 5CH5A 3K92A 1E59A 1QYRA 1PUXA 4KLZA 3U81A 3RYIB 4RH0A 3L1HA 5EWLA 3VUEA 3BQ9A 2GD0A 4HNTA 2QN8A 2WF5A 1NXKA 3OFKA 2QN9A 4PUZA 2QJOA 3HV7A 2JLDA 4MVJA 2DVMA 5LA6B 1UEIA 3IDQA 3PE6A 2WSSD 1WBPA 5C80A 3ETHA 2VDWB 1JG1A 4CUJA 5FRIA 1NXTA 5AOCA 1E89A 4O2AA 2L17A 3UVEA 3BHVA 1Z6TA 4ZEGA 4L2IB 4XIFA 3T3OA 1Z47A 1XFAA 1LC0A 2B61A 5E90A 3G1TA 4XNEA 1PDVA 3SXJA 2XT6A 2I0FA 3U7HB 3CEPB 4AQYB 4PBRA 1E79D 1L8OA 1NQ5A 1QV9A 3NHYA 3QLFA 1IIRA 1AUOA 5CEIA 1F0QA 5HJEA 1AUQA 1U6JA 3TV7A 4LL0A 1HETA 1YZTA 5DM2A 2DFNA 1BDIA 1OIYA 3QUEA 3GCZA 2JGAA 2EEZA 2WM8A 5C1IA 2C9ZA 2IK8A 4B82A 5BWOA 3RD5A 4RIHA 4XVCA 3IUSA 4WIHA 2PAFA 3JATB 5LMBA 1Y48E 2CY0A 3PUWA 1XZJA 3B7GA 1JYSA 4LXUA 2W00A 4ZV7A 1GR1A 1TYEB 5KVAA 3MTEA 5BQ5A 2C9DA 2VK2A 3ZI0A 3R3UA 3PXRA 1WBNA 2XVXA 3QX2A 5CHEA 4IWNA 4XBUA 3TF5A 2G2IA 1Q3HA 3DV0B 4OXQA 4BDGA 3MA0A 4Y2RA 4HVDA 2IHVA 3W90A 3TLCA 3NWPA 3AGMA 1H3NA 3UMWA 5TNXA 5KWSA 2ZQYA 3PXUA 2ODEA 3M89A 3BYMA 3COHA 1UBEA 4OSOA 1VCNA 2RHBA 2P6MA 1A95A 3IODA 4TMFA 1YZGA 2NRUA 1E3WB 3BFKA 2K5UA 2XPCA 1N0VC 4HGLA 5DP2A 4KR6A 2GN6A 1ZC3A 3WAGA 2F7ZE 2ZYUX 3U6IA 5B1HA 4W7IA 5GP1A 3OHSX 2R9SA 4ZHQF 1NWCA 4F6LA 4JXXA 3IDCA 3WF6A 4YJHA 1W48A 3WJ2A 3EYGA 2VRCD 2BRNA 5DIZA 1E1MA 3F5XA 1RAAA 4AKEA 1OFUA 4M1YA 3C3YA 1IM5A 2G04A 2VWGA 2JKMA 1SOVA 3TNYA 5IT0A 2WU7A 4YJ2A 2UXCB 5B30A 1MQ4A 1DT5A 5GWXA 2W5UA 1HYBA 4B8MA 4EFLA 3VNVA 4JLOA 4MWTA 2ZTVA 4CV9A 3PRYA 4FKQA 1GRQA 1T9GR 4O1IA 4U2KA 3R41A 2EGHA 4PLZA 1T24A 2WYVA 5H5JA 4H1HA 2HPVA 3ZQ6A 5CU0A 5B37A 2PAAA 5TF0A 3RS3A 2ZR8A 3Q72A 3T7JA 4QOXA 4LVNA 1KFKB 3SSMA 3FNEA 3SXRA 2OG2A 1YB1A 1SD1A 2R25B 4YRLA 4NFYA 4L28A 1HFJA 1BHJA 4E0BA 2PYIA 4K6GA 1GPDG 3EEQA 3VR6D 3RUAA 1OUKA 2QOCA 4ANLA 1Y8QA 4FDVA 1J9GA 3RPOA 2C42A 3JALA 1ODJA 1A76A 1R0CA 1J8VA 4CFYA 4E15A 2AEGA 1KH1A 2OYSA 3OLZA 1V47A 3LO5A 1U5AA 2VYQA 2ZSEA 3U61B 2JI8A 3DW3X 4CT0A 4ND8B 4GYKA 3H7IA 1T0HB 2GT1A 2VDMB 3VR6H 1CJUC 3TL3A 1ZCAA 1NLYA 1XMJA 3TD9A 3HKEB 2W6NA 5TS3A 5G40A 1FX0A 3CH7A 4TQ9A 3O4FA 3S28A 5DTQA 5J23A 1U7UA 5DRTA 1MBZA 5UKDA 3QU5A 3QVLA 4HI0E 2WSIA 4RF5A 2FYSA 1C8LA 2WSBA 2WHXA 2ZB8A 3F2IA 4F0JA 1FNNA 1QIFA 2NUPB 2DP4E 4CGAA 1CHDA 4FSZA 5E2AA 3EKNA 4ASZA 1XTTA 3KOUA 1NW9B 4N0DA 2AG8A 1L5YA 1DQZA 4L53A 3PI6A 2O8EA 3LOKA 1M7HA 3NYWA 3ROCA 2V55B 3INNA 1B23P 3KUKA 5HKKA 4A0QA 2VS1A 5ICCA 1YOBA 2X0KA 5KI6A 1KMHA 1EI9A 2J08A 1SCUA 4QZVA 1RD4A 2WA2A 2FZLA 2ODNA 4YZ9A 1IJFA 4GKVA 3G0EA 3EJ1A 2DECA 2GBIA 4Z54A 4YT4A 2MMGA 4FFWA 1BDMA 3KAQA 4Z9FA 1Y4AE 3NUZA 1XDUA 2YACA 2OFXA 1YACA 1F8YA 3FFAA 5CAPA 3VU1A 2IF0A 4PGFA 3KOOA 2YV1A 1RHRA 3NHRA 4MDEA 1LVHA 4GYYA 1RNLA 4ERKA 4LVCA 3NUGA 2BDUA 4C0AC 4XPZA 2X8BA 4AM8A 3DMPA 3KKKA 5K45A 3CX8A 1Z2EA 5AM4A 2PZLA 4O38A 3HO6A 2XDQB 4DEXA 1IZZA 2GNLA 1D8AA 4REQA 3OHTA 4UBJA 4KN6A 3CNOA 5AWFC 3I9NA 2B2CA 2PKCA 4EK6A 5JFOA 4DV1B 2FTKE 4FT7A 4Y1GA 3IXMA 1EG2A 4JAVC 2XKDA 2DYLA 1SCBA 2GJ8A 3DQWA 3D8TA 1Q83A 3D3EA 4UMFA 4NX2A 2BGTA 2FMIA 1E60A 2G4LA 2FNAA 2WMSA 2Q5CA 3CCCA 1OFTA 2I2FA 2XIJA 4F4IA 1TM1E 1DJLA 4L73A 1MJ5A 1CY1A 1VPEA 3P94A 4PV7A 1AQUA 4IE9A 5HE8A 2YXBA 2F9FA 1ZN7A 3Q5ZA 2H0QA 1F5QA 4M1WA 3OU7A 4YJNA 3NATA 3L07A 5EMNA 5L3SB 3PJCA 3PIZA 2HBYA 2WPDA 3MSXA 4QARA 2E7ZA 2IEAA 3ZI7A 3ANYB 1XE3A 5ALMA 1ZIOA 4R5MA 1M67A 3K2QA 2DKNA 5DH3A 4CM9A 5B12A 2X76A 4EMSA 2BR1A 4D8TA 2ETRA 4MWZA 1R10A 3BIOA 4Q66C 1JJIA 1VPWA 3TPCA 3HK2A 4G3GA 1PDWA 3VHRA 1I94B 5JARA 2I99A 3U5ZB 3NDMA 4FSMA 4RO0A 5DASA 2C2BA 2WOTA 2FO0A 1KYXA 4L68A 3M42A 1C14A