2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
4PMTA 1SYKA 5FEEA 5LMBA 3G15A 4QMWA 3R9DA 3C4FA 3DXZA 2BZIB 4EK3A 4XEYA 1B39A 3D4QA 4ANLA 4IANA 1XKKA 5K09A 4ENYA 3ANXA 2C7QA 5CY3A 3THSA 4L43A 5EHYA 2ZDTA 3WARA 3GXLA 2QC6A 2O63A 4FEVA 4L45A 4M13A 2FCAA 1EJ0A 2GNLA 3V6RA 3DFCB 2ZOQA 5IUHA 1U59A 5K0JA 3FHIA 4OTQA 3VBWA 2NXCA 4UWYA 1DM2A 2YIRA 2PZRA 3LM0A 4MF1A 1JKKA 1T45A 3W32A 4Y72A 2HW6A 4AGUA 2UYHA 5FHRA 4NYEA 2Y1XA 1ZY5A 3KR1A 4PDSA 2XM8A 4LRJA 3UZRA 5E9JA 1I44A 1MQBA 2W9FB 1BKYA 4AN3A 2X39A 3HP2A 3D2KA 4FKWA 2FSLX 1Q62A 2BAJA 3OXZA 5FTWA 3G5DA 1PMUA 1RJEA 3RKBA 1KPGA 3R8ZA 1OL7A 3CQUA 4B6LA 4HGZA 4TPTA 1WBOA 5GIPE 4DFNA 1XH4A 4QDJA 1MHTA 3T9IA 1KE5A 3G0FA 4F9AA 1NV8A 3CQWA 3C6MA 1ZY4A 1U54A 3ZLYA 2BHHA 1PKGA 2YQZA 5A3XA 4ZJJA 4BF2A 1ZZLA 4O7WA 2ITQA 1QAQA 4C4JA 1FPUA 4RC2A 4XV2A 2XCHA 2XYQA 2VTPA 4BIBA 4O84A 4C34A 4O7RA 3IPHA 3EVBA 1H0WA 2DYLA 4FKOA 3C3PA 4G34A 4OR5A 2PX5A 4A7CA 4L44A 4ALWA 3P79A 2PVFA 2I0EA 4J8MA 5A4LA 4FT2A 5LMAA 2ONZA 3IDCA 4WXHA 4QNAA 2W1ZA 3ACKA 4L00A 2ZBRA 4IKPA 5KE0A 2YIYA 3CIKA 3HDMA 5FXRA 1Q0SA 5JZNA 3RAIA 3VS7A 1VR2A 4S33A 4JJRA 2RG6A 3U4WA 4C4GA 3TKIA 5EI8A 3BE2A 2XK3A 5B2KA 5BYZA 5HEZA 1ZHFA 4HYUA 4B9DA 5JQ5A 3LIJA 3M6XA 3A2CA 4KD1A 4CT1A 4AF3A 3EVGA 2WOTA 4FSDA 5GOZA 3F88A 4YUXA 3QUEA 2C3LA 4YTFA 2UYQA 5KS2A 4RVFA 2LGCA 3COIA 4R3RA 2XBJA 3LJ1A 2ZWVA 3R7EA 4RQKA 3P2EA 4KINA 4KDRA 4QNYA 2YERA 5C03A 2VTMA 4EOSA 2YXEA 4DEGA 4DH7A 3FRIA 3MTLA 3FLQA 3KU1A 4KKHA 4JXJA 2R3RA 3TKAA 4IM3A 3G89A 3QZIA 3FMJA 4RVKA 3FBVA 4JL9A 2G1PA 1R8XA 2PUUA 3NLBA 1BUHA 4OBWA 3FLNC 3N4TA 3GCPA 2BVAA 2PK9A 3JWHA 2FK7A 1V1KA 2WU7A 1TQPA 3LBYA 3F7ZA 5FD2A 3MAGA 2OJIA 1GNGA 2X4FA 3HM2A 4NZWB 4TYIA 1UNHA 3R22A 5EMJA 4KKGA 4KWCA 1ZAOA 4YJSA 3I6UA 5EKOA 4I41A 3LFQA 4H39A 4FSUA 4YHFA 5J5SA 2GHGA 3C0KA 4KIOA 3W8LA 1RJDA 3E63A 3I7CA 5HO8A 3DY7A 1M14A 4X21A 3FPJA 2GFSA 1H1QA 3NX8A 4D2SA 3I5ZA 4IX6A 4G56A 2R3FA 5CVHA 4A07A 1KPHA 4FNWA 4U40A 2NXNA 1KIAA 4FKGA 4QTEA 5G1XA 5FWDA 2WTKB 1CTPE 2BZJA 1IRKA 3LFCA 4RWKA 1H1PA 5I0BA 4FVQA 4MWHA 4YC3A 4AX8A 2JEDA 3TPZA 4RWZA 4HTFB 4RX5A 3LFAA 3R1QA 1D2GA 4PL4A 4JOAA 3AC8A 3R0QA 2P2IA 1U5RA 4GYIA 4GU6A 4FT0A 3H9FA 2YA9A 2BILB 1WVXA 4AA4A 2R0UA 5AADA 1WBWA 3B89A 3NAXA 4AW5A 5BPYA 2B9EA 5EG5A 4C4HA 3BHUA 3FMEA 4GV1A 4OTHA 4G5PA 5CD1A 4ER7A 4F64A 1J7UA 3W18A 2YISA 4BB4A 3KR0A 4ZTRA 5BVNA 1NW3A 2OXTA 1J1BA 4DEHA 5L2WA 2ZIGA 5AUZA 3RAKA 1FP2A 3RCDA 5KQRA 1BMKA 3C7QA 3UZUA 3OFMA 3C6KA 4PINA 4YTCA 4RTSA 3E64A 2PXCA 3G6HA 4RFYA 3QOXA 2WMVA 3LCVB 2PMOX 3AMYA 4EK5A 4QTBA 5TO8A 1OPLA 2CKQA 4JLCA 3UJBA 2W06A 2WMWA 4GOND 3KREA 3PZHA 4TYEA 2CNVA 5DX1A 4MKCA 3VAPA 4KUJA 5BP7A 4PYNA 5DXJA 4IB5A 4YSJA 2VUWA 2CLXA 3PXKA 3OUKA 1WVYA 4WOVA 5FDXA 4CZTA 5AP0A 4A4LA 5CVVA 3FZ1A 5AP3A 3U51A 3ZO3A 2BAQA 1FGIA 2R0IA 2UZNA 3UPXA 1OIUA 3R63A 3LXKA 4BDAA 3BGQA 3D7ZA 3MB7A 4OTGA 1Q3WA 2AC3A 4F84A 3UTOA 4KIFA 1H4LA 2WQBA 1OKYA 2FUMA 3ANQA 4U43A 1E1XA 3TRKA 4YMGA 5DH3A 5HLNA 1VYZA 4RZVA 1UU8A 4C03A 4E31A 2AZTA 4I22A 5KHXA 3AC3A 3JUHA 4U80A 1XXLA 4RT7A 3K54A 3Q4TA 4QPNA 5FXQA 2C5OA 1YOLA 3P78A 4W4VA 3DZQA 1W7HA 2HXLA 2QG7A 5DT4A 2V74B 3EB0A 1ERKA 4XLVA 4QQKA 3SXSA 3NVMB 1OKZA 4JBPA 3UG1A 1I9GA 4F1TA 2ZJWA 3TQSA 1WBNA 1PXOA 5FQNA 4GEOA 4PNIA 4F63A 3S1HA 5ANDA 3TDVA 2H1RA 1NA7A 2Y4IC 3BIZA 3QV2A 3WBLA 3CJGA 3MA3A 3P4KA 4ACCA 5BMSA 1JQ3A 3D9VA 4O0RA 3Q6WA 1OGUA 2ITTA 3Q3BA 3FAAA 3ORMA 4WG4A 4DEAA 5LOHA 3DFAA 3HV5A 3NS9A 4PRJA 4OA5A 4L53A 2XP2A 5BVOA 3GC0A 3TFWA 3A25A 2ZZKA 3VS1A 4B8LA 4O7LA 4O0YA 3F7WA 3E8NA 1OBGA 4HG2A 3Q9XA 3WF9A 1WXWA 5EMKA 2IWIA 2W1FA 4ZOGA 3DTCA 2PT9A 4EI4A 3GCZA 4Z3VA 3I1AA 2J0KA 3G2QA 2ZTHA 3O23A 2OU7A 1OBDA 3AOXA 3VBXA 2WEVA 3G8BA 4KRCA 4X61A 4IAKA 5LMKA 4MXAA 3D15A 2F7EE 4OBOA 3DAEA 4XP0A 4NKSA 3S95A 3AT3A 4EQMA 3K3JA 2R3MA 2CJMA 2C5VA 5EW8A 5K05A 5DR6A 3VUDA 4GC5A 2P8JA 4H05A 5ICCA 4IV8A 4S32A 1SNXA 3OF0A 5FEQA 5EH0A 2FSMX 3PIYA 5DWRA 2C3KA 4ORKA 4BY9E 3H0ZA 3KEXA 2J9MA 5IISA 3CPCA 4GVAA 3UNZA 5GM1A 5DFPA 4QYGA 3UP2A 1NVSA 3CTQA 1W0XC 4R3PA 4E7WA 1FVRA 5HHWA 3UVPA 2PKWA 4GIIA 5IA2A 1D2HA 5E9WA 5B0XA 4DE4A 2C69A 4QOXA 4RJ3A 5B2LA 3VUGA 2ITXA 4IW0A 4CKJA 4FV1A 3NPCA 4R6VA 3NYXA 1N2XA 3DJ5A 4BC6A 1M7QA 3GUBA 5HU3A 2PX2A 1QYRA 2O05A 2G2FA 3O7LB 3CJTA 4JR3A 4O82A 4FKVA 5CU0A 3QHRA 5EM6A 5JQ8A 4UY9A 4ZMFA 3VS0A 3FZSA 4AW1A 5AP5A 4R78A 2P40A 4XV3A 1GAGA 4BR3A 2J0JA 4CEGA 3PVGA 1SG9A 2XYVA 3MPTA 2W4JA 4EKIA 5IH3A 3P0MA 2V7AA 3FKLA 3O50A 4E20A 3CGFA 3ZLWA 4KIPA 1SZMA 5D7VA 4NCTA 4YURA 1JG4A 5FADA 2PU8A 3HP5A 3DBQA 4P7EA 1ZXEA 3DAKA 1AGWA 3D14A 3PJ2A 3Q52A 3M6VA 5A6OA 3CE3A 5JFWA 4EK6A 5HTBA 4GJ2A 3IGGA 3EVDA 4TZRA 4TYJA 4FEWA 3CC8A 3D7TA 3DBEA 3HVJA 5CSHA 4Q9ZA 5IDPA 3NIEA 4BTMA 4X3JA 3VBVA 4IAIA 2ONLA 4YZDA 3TG1A 5LQAA 5DM2A 2WMQA 5FDPA 4C58A 3FMDA 4JQ7A 2QYOA 2XKDA 3KVWA 4CFUA 3IW7A 4LMNA 2GQRA 5E8UA 4EHZA 4ZY5A 5M08A 5B2MA 3C1XA 3WIKA 3BHYA 2QKWB 4EH2A 2VTSA 4CSVA 2R3PA 3ZFYA 2GCDA 3F5GA 2IH2A 3HA6A 3BYVA 2PVLA 4EOJA 5K0NA 5J8IA 5CT7A 2ZZMA 1PMNA 5DPVA 3FPGA 3ZSIA 2BTRA 4AZVA 4YJOA 3GFEA 5IH6A 3L8VA 3MFTA 3FTFA 4EH3A 2IVVA 4IM2A 2PY6A 5CENA 4MTLA 2WQNA 3QTIA 4BGHA 1RI3A 3FI8A 5BYYA 2FYSA 5F2NA 2PZ5A 3RALA 5JZJA 3KCFA 2UZLA 2HZIA 2BRBA 4GUEA 2GDOA 4FV5A 1CKPA 3DXYA 1ZYJA 1ZG3A 4IJPA 4IH8A 2IVTA 2IZUA 1KHHA 2P3LA 3MGGA 5KHWA 2WD1A 2ITNA 3AG9A 3ORIA 5JRQA 3MB6A 4Y46A 4Y2HA 4ASDA 3DLCA 1H1WA 3BGZA 3OFKA 1EIZA 2J0LA 2JDVA 4E2ZA 2OZAA 4EJ7A 2IDJA 4MNEA 4IX4A 4D55A 3MESA 3LCSA 4RLKA 4OLIA 3IW5A 1H0VA 3HDNA 4RX8A 4AXAA 3CJRA 1RI5A 5GJDA 2JKKA 3LFEA 1JSTA 4L3LA 1R18A 3EVCA 2NO3A 5ANJA 1ZKDA 3G2OA 4UZDA 2ADMA 5JT2A 3MJ1A 2ZV9A 3OCBA 5CF4A 5CVDA 3ZXZA 2CN8A 1RI1A 2Z2WA 2PXAA 4CGAA 3DOGA 1G60A 5DG5A 3LPMA 2JBOA 4RIWB 2YWPA 3PA5A 2C6DA 4II5A 2YDKA 4YLJA 2C7OA 3MN3A 2RFDA 5DBXA 4EUTA 2YFXA 1JSVA 3A60A 4ALUA 3R04A 3NJRA 1WMKA 3N4VA 4ZTQA 4WSYA 3TV7A 4PYJA 3ID6C 3KQSA 4F7JA 2Y7JA 1IEPA 3EQDA 3Q60A 2VO3A 4F08A 4H3QA 4TWOA 3BU3A 2GNFA 4CG8A 3FUPA 4YZBA 3JWGA 4FTNA 1TW3A 3PE2A 4OTRA 4E5AX 3LVPA 1VJYA 4IE9A 2HMYB 5HORA 4A9UA 4K0YA 2OWBA 1KV2A 4P7FA 4DH8A 4U9AA 4M0YA 3C4ZA 3MDYA 4RJ6A 2IN6A 3POZA 5ACBC 2P7HA 3DKCA 3AY0A 1PXPA 3R73A 1JSXA 2BRHA 2JIVA 5M55A 4O7YA 3GO4A 4YSMA 5I9WA 2OF2A 3DLIA 3BELA 2VX1A 2O8YA 2I62A 3P7AA 3TXOA 5CZIA 5KYGA 4XOYA 1O6LA 4N0SA 4FC0A 2O64A 3HV3A 5CVFA 2B0QA 2QHMA 4CWAA 5M4FA 3HMNA 1IM8A 3S68A 2AVDA 5HO7A 2ZSUA 5C9ZA 4KIGA 3E92A 4HGTA 2UZOA 4B17A 3FTCA 4CD0A 3QX2A 4FV0A 3QCXA 4H1MA 1OL1A 1F3MC 3ELDA 4AGWA 4RTLA 4QP3A 3KGAA 4GT4A 3TACA 4J53A 2G2HA 3C9WA 3ME5A 2Z6QA 3NW6A 2C47A 3K5UA 2PVNA 1E1VA 2OJGA 2HELA 3ZXTA 3DR5A 4L8MA 4I92A 3ZMMA 5EEGA 2OB1A 4O7VA 2UZEA 4F6SA 5HG8A 4TNDA 3F82A 5AP4A 5IEXA 1GIJA 3PY0A 1B6CB 2PSQA 5CCBA 3IS5A 3GEQA 3RVGA 2YABA 1YHSA 3CPBA 3E8EA 2Y9QA 3JVSA 3LCUA 5DX0A 4FICA 2HOGA 3ZH8A 1IXKA 2VTJA 3O96A 5LVPA 3PPZA 1F3LA 4O2ZA 5DE2A 4BIEA 3P23A 2PE2A 1OPJA 5IG1A 5DRYA 4FTCA 2XYRA 5EHGA 4ITIA 3BKWA 4DM3A 3CTJA 4I5CA 3EMBA 2UZTA 4E4MA 5ITAA 5BVDA 1JPAA 3BWCA 3S4QA 2W96B 4AGDA 1KWPA 5EMMA 1G55A 4XLIA 2XJ2A 2P4IA 3GU8A 4QO9A 3P9JA 3P71T 4JS8A 2OXYA 3BU5A 4JDHA 2RF9A 4ARKA 1AF7A 5GHVA 3R24A 1M6YA 4PONA 5CSVA 3RODA 5KMNA 1VL5A 3GCSA 4O0WA 3V97A 5K4JA 3I5UA 1QPCA 3KRJA 2W5BA 2Q0BA 4G31A 4PGGA 5M4UA 4PUZA 4XOZA 3HV6A 5JGDA 4YZCA 4YV1A 4D9TA 5ETIA 3A7IA 4YHJA 3HEGA 4E6AA 2V62A 2PX8A 4R3CA 1REJA 3D5VA 1XBAA 1KOBA 4JVGA 1YOMA 3ITZA 4LOQA 4FG7A 5CAQA 1WCCA 5J9LA 1UWJA 4EH9A 3Q5IA 4ANMA 3EMDA 3WF6A 3HRFA 3T7SA 2GHMA 3R8VA 3VUIA 4JDJA 2Z6AA 3VUKA 3DZOA 3BWBA 3QA8A 4EZ7A 4L9IA 3GCQA 4TYHB 2PWLA 2UW6A 2WKMA 3DV3A 4ID7A 4D9UA 1SVHA 2HCKA 5FGKA 3SSOA 2GU8A 1YWRA 1R00A 4GUAA 4G3CA 3ET7A 3O31A 3KCKA 1OPKA 3UMXA 1P4OA 3R00A 1P1BA 2R7IA 1QCFA 1DS5A 4FSQA 5IA0A 4R05A 4RVTA 5FBOA 4RIOA 3UIBA 4NM5A 1X1AA 2REIA 3UBTA 1JKLA 3K0BA 5BXYA 4R1YA 3C51A 4YJQA 5ICEA 5K0LA 1Z5MA 3KN6A 3VBQA 4Y83A 1I09A 2P3GX 4BGQA 1OIYA 4JXFA 2GHLA 1G8AA 5KO1A 1NT2A 4QMUA 3G90X 4RMZA 5ETAA 4RLLA 3ZFMA 1ORHA 3U6IA 3NUSA 5FM3A 4ZXTA 1D2CA 5DRDA 5JR3A 2I40A 3G6GA 4F9WA 2SRCA 3V8SA 2FB8A 3PSBA 4RZWA 4HZSA 2AS0A 1XDUA 1H1DA 4E8AA 5C27A 1OECA 2OI4X 3HA3A 3V5PA 1FJXA 4FTTA 4LV5A 2BRMA 4BN1A 2AOWA 2EJUA 3PRIA 5I4NA 3FXZA 3BGIA 4BDCA 4I6HA 5HX8A 2JD5A 3A4TA 4X3FC 5C8KA 2IZSA 3KRXA 4EC8A 3ORHA 5DM0A 2VWXA 5C4LA 3VRYA 3RWPA 3QLFA 4M36A 3QF9A 4DEDA 4XH6A 3RPSA 3MY1A 5CNOA 4EJNA 3QYWA 1SQGA 4YUWA 3PP1A 2R3GA 2RFNA 4FK3A 4TN6A 5IF1A 4ISCA 3LXPA 5JFVA 3ZRLA 1NW6A 4DZRA 3GP0A 3EVFA 3SMQA 3EYHA 3FMNA 3K5VA 4DGNA 3UA3A 3ZBXA 3SXRA 3P8ZA 4XV1A 4K6MA 1OL2A 3LGAA 3T8OA 3O17A 4ZK5A 4LWOA 2OGVA 3ER9A 1RI4A 1SUSA 4UV0A 4EKLA 1TPYA 4DLJA 4EH5A 2G71A 3G7UA 3UO5A 3CD8A 5IMXA 3FQSA 2ITWA 2JDOA 4EL9A 4D4YA 1BLXA 2B9FA 2C6EA 5EM5A 3FUWA 3GGDA 1UU7A 1RJFA 4R77A 2EB2A 2J50A 2XKFA 4KB8A 5GIOE 2VTHA 4YNEA 1H28A 4IZ7A 4GS6A 2YJSA 4DYMA 1W82A 4EYJA 3EMGA 4HVSA 1PXIA 1Q8YA 1G5SA 3PZEA 3TZ7A 2ITYA 4FR4A 3FEGA 1GOLA 2A1AB 2O0UA 3JY9A 3MERA 5FUBA 2WGJA 4FA2A 4C05A 3ZUVA 2XK7A 1INLA 3OTUA 4ZTBA 1NXKA 3FRHA 2GH1A 4RWIA 2W7XA 4RTRA 4FUXA 3O8PA 3AD4A 5E2BA 4OTWA 4W8EA 3BBTB 3ZDUA 5ANIA 4GT5A 4NT4A 4XX9A 3DJ6A 4NCTC 2GNIA 4PNEA 4DBXA 1U54B 3S3IA 3LCOA 3ZHPC 5BX0A 2YIWA 5EKNA 5J1VA 2IBTA 4U3ZA 2GS6A 3IO7A 4AZEA 1XO2B 4LUDA 2CGUA 2GNGA 3WF7A 4RVGA 5E8YA 3VS2A 4X41A 2RKUA 3P9IA 1Y6AA 4EQZA 3KVXA 3PY3A 4U81A 4OBQA 3RCJA 4OGRA 1OIRA 1Y57A 2VTRA 5L6OA 3DUWA 3B3FA 2QNJA 3R01A 2VRXA 2R4BA 1LP4A 5IQHA 4E30A 1XH9A 2HR1A 3FZGA 4RWLA 1VE3A 3GGFA 1J7LA 4ACMA 3S0OA 2WMAA 4YV0A 4X7QA 4I4EA 1KXZA 4U7TB 2I0YA 4FSZA 4C36A 3VC4A 5AP7A 2GPYA 4NKAA 3OG7A 3KXNA 3GRRA 3Q4UA 3QALE 5FP5A 3ETAA 4KS7A 4DGLC 3FYJX 2CWWA 3UG2A 4M0ZA 1XH8A 3FV8A 3QGYA 3QQHA 4RVMA 1ATPE 3GI3A 3E8DA 5J95A 4UBAA 1XCLA 4YZMA 5M07A 3FE3A 1NVQA 1QL6A 4DH3A 3TTJA 3AT4A 4AP7A 3F9NA 3V04A 4USEA 2QURA 2QQ7A 3BBWA 1UA2A 2AN3A 4NL0A 4XBRA 4MX9A 2OG8A 1FINA 4B0GA 2J5FA 3LFDA 3SSNA 3P9NA 1RE8A 3B3GA 2PJDA 4IB3A 2JLDA 5F2KA 4PGHA 4ZSLA 1GZOA 5AV1A 1PYEA 3MPAA 1YDSE 4P7GA 2R7BA 3QYZA 4BI2A 4IQ6A 3KMUA 3UVRA 3DXPA 3LCDA 4F99A 2Q0NA 2ZIFA 1R78A 3C13A 1XH5A 3SW7A 2Y1WA 5EGSA 3KR9A 4PYKA 3Q2JA 3L8DA 3B5IA 3QTXA 5KMLA 5L6PA 4ZTMA 5IH4A 4F85A 5DLYA 2OF4A 4DITA 4MWZA 3NCZA 5AA8A 3AC2A 4D4SA 2ZVAA 2ZCJA 2IG7A 3EQIA 2WU6A 5EQPA 4K33A 2IZTA 3MHTA 1UFKA 4ZSEA 1YW2A 4M12A 4RGJA 3VNTA 2ZYBA 3B3JA 4YGAA 3QAME 4YJNA 3TUBA 4QMZA 5CF8A 2YM4A 3R1SA 2X7FA 5KQSA 3R7YA 3CCNA 4GK3A 4IV0A 4NUSA 4XP3A 3LXNA 5IUIA 3A27A 4E4LA 5CTPA 4WBOA 3TI1A 5E8VA 1JTEA 1ZYDA 3P5KA 4KKEA 4EQCA 5BUEA 2YM5A 2XIXA 2WOUA 2PZIA 3EWHA 4FX3A 4EOOA 1YI3A 2VNYA 4OUCA 2YCRA 2HWKA 2PMNX 2XNMA 2JC6A 3DTWA 3LMIA 1JVPP 3IKAA 4BCQA 1YZ3A 4I5HA 2Q83A 1O9HA 4XG8A 4E2XA 4EH4A 2F8LA 2UW0A 5IA4A 3MV5A 3PLSA 4AFJA 1ZMVA 3QTUA 3RPVA 4WRSA 3OMVA 5AWMA 1MQ4A 4WA9A 3B8RA 5DM4A 4C61A 4LYNA 1WG8A 3A62A 2P35A 3Q32A 3TKUA 4TYGA 3RWQA 4U79A 3SKCA 1B42A 4IWPA 3FI4A 2GB4A 3NEWA 3IOPA 2WZJA 3PRFA 1IA8A 5EG3A 2OO3A 2YM3A 3O51A 2XIYA 3PVWA 3BZ3A 4ER6A 1BX6A 5LWMA 3BQRA 4NM0A 2A14A 3ZFXA 4DCEA 3QTZA 2IH4A 1JG2A 3UYTA 4KNBA 5HTCA 2JH9A 4HGYA 2W0JA 3OEFX 3PXRA 3RPRA 3ACJA 3MI9A 4UOEA 3GIWA 3QTRA 5CQWA 5F1ZA 3UO6A 2GNHA 3U6JA 3UJCA 1VQ1A 1Q5KA 1ZLTA 4O29A 3F5PA 4BDFA 3CC6A 5AV4A 4MWIA 4IVCA 2VX0A 3ELUA 3SOAA 2XIKA 3FZTA 4O0XA 3P9KA 2YJRA 3LSTA 3EFKA 5FWAA 5LWNA 4NSTA 5E90A 1VLMA 5EK7A 3MH2A 4AWIA 2VN9A 5EOLA 5KNJA 4GKHA 1GJOA 5E9EA 4QYFA 1LUFA 4IAYA 4YJRA 2VWWA 2C5NA 3TMAA 1Y8CA 4S31A 4PL3A 2WEIA 2ZW9A 4FSWA 5CSXA 2W9ZB 3FY0A 3QTWA 4BCHA 4GCJA 3Q4ZA 3KRLA 4LRKA 4RPVA 5E1OA 3LDFA 2ZMCA 3UGCA 5M4IA 3ODYX 2IDKA 4HVDA 3UYSA 2ESRA 3FZPA 3DB6A 5KZIA 4N4SA 4FGZA 3M42A 1H1SA 4V04A 3V5QA 4E2YA 4CKIA 4U8ZA 4ZZOA 4ONAA 4ZSJA 3NW7A 2X2MA 3QKKA 5HCXA 2QOLA 3EVAA 4IM0A 3OU2A 3EGIA 4FYOA 4G6NA 3LDGA 1VP3A 4QMPA 1LEWA 5C1IA 2PT6A 4GL9A 4FG9A 5AUVA 2QG5A 3PFHA 3KF4A 4IB0A 4G16A 3VS3A 3JS2A 5A9UA 3EKNA 4C38A 3HCFA 4TRLA 2OW3A 4IZAA 5D41A 2CMHA 1VZOA 1PRYA 3HMIA 3MTEA 1R39A 3T7RA 2WTKC 3R1NA 3RAHA 3ORKA 1T43A 1L1EA 1ZGJA 3ATSA 2WAJA 3MW1A 2DPMA 3M70A 3CKWA 2YACA 3AGLA 4PNKA 4AACA 5F95A 4X2GA 4ER3A 3TUDA 2I6LA 1JWHA 5EC8A 3NUXA 2UW3A 2GS9A 4H3BA 3LCKA 3E5AA 4FZVA 3GQIA 2UW9A 2V7EA 3NNUA 2QR8A 3L8SA 2VDWA 5BQ0A 5HBHA 5U4XA 3WYYA 1JTFA 4BICA 5B1SA 4WUAA 2W1CA 2V55A 4N6YA 1M6EX 2UZUE 4JIAA 3LMHA 4AOIA 2ZV2A 4BTJA 3LJ2A 4FTAA 3SXJA 5D10A 2OH0E 2B3TA 5EIFA 3R7UA 2CSNA 4ZMEA 5DOSA 3H9OA 2PY3A 3NYVA 3M6UA 4XUCA 2X81A 2HENA 4PMMA 5E9QA 2BMCA 3F3WA 1M17A 4P58A 4NIFB 3SRVA 2JIUA 3AMBA 2DWBA 2J0MB 4YC8A 2JDTA 5DN3A 5CEIA 3QCQA 3SVVA 1PYXA 3BLHA 5I5ZA 2WO6A 3I5NA 5FHQA 2C6TA 2IPXA 5D7AA 2XVDA 1JQDA 2NXJA 4QTUB 3VUMA 2C5YA 4L7FA 2CL5A 3HNRA 3B2TA 3LW0A 5KMJA 4QQNA 2O3PA 1S9JA 2I7QA 4EWQA 2QOBA 4TTHB 4ZY4A 4FV8A 4JQ8A 3VJOA 1FGKA 1OM1A 3QD3A 1R0PA 2RIOA 2PMLX 5A4EA 2C6OA 4WO5A 2ZM4A 1Y91A 4BP1A 2HK5A 2CKEA 4HRAA 2R3NA 3UFBA 4PY1A 3P9CA 4WD5A 2XM9A 4Y85A 1CKJA 1OIQA 5H02A 3UNJA 2W5AA 4ZTSA 2HY81 3UWPA 5CWZA 5L2IA 4CKEA 3UQCA 2G9XA 4L68A 4R7HA 4NJDA 3W8QA 4G9RA 3PTAA 4FZDB 4HC4A 3NMUF 3WZKA 4BDHA 2CCHA 3I0QA 4DGOA 1TQIA 2C6IA 5HIJA 4DLIA 4BDEA 1XDSA 3TKHA 2AVNA 2ZFUA 3OEZA 1YHVA 1KP9A 4IWNA 5LQJA 1H07A 2CCIA 4E73A 2BFYA 2X4ZA 4C02A 3LLAA 4V05A 1QPJA 3O7LD 2JBPA 2XK8A 3EQGA 5HLWA 5EHIA 1G38A 2VDUE 3OUNB 3ZUUA 5EM8A 4M37A 4DFYA 2ITZA 3D7TB 3VWAA 4YV2A 2CLQA 2KTYA 4EBVA 5M5BA 3R8MA 4EONA 2OJJA 3DBDA 5EDPA 5LQRA 3AMAA 4QTDA 4OQDA 4FTMA 5CF6A 5HD7A 1PXMA 4FV2A 3O0GA 3HA5A 3OZTA 4W8DA 2HV9A 3ULZA 2YAKA 4UXLA 4PIMA 4CKCA 4PWYA 3KQQA 2A19B 1YFJA 4RTOA 4FL2A 4DFLA 3GC8A 5M56A 1RDQE 4BYIA 3U55A 3DKOA 2HYYA 1MJFA 4LI5A 3OP5A 3BYSA 3KA0A 4F6UA 1PXJA 4PMSA 3IW4A 4BZOA 4HNFA 3WOWA 3ZO4A 3E87A 2PMIA 1PF8A 2JDRA 4BCJA 1QMZA 2QRVA 5L8JA 4PP9A 5T64A 5AJQA 4GEKA 2PUIA 2W05A 1YDRE 4YUZA 2Z7LA 4QMLA 2Z7RA 3U9NA 4FSNA 2YDJA 1V0PA 3G9NA 2YR0A 3EQPA 5DIAA 3CKKA 3SQQA 3RW9A 2YAAA 3MVMA 3NUNA 3Q87B 4QQTA 4NFNA 1L3IA 5K0CA 2XCKA 5HIEA 5FRIA 2UVXA 2OSCA 4XRJA 4CQEA 3I64A 3UZPA 4QMQA 3DMGA 2I9KA 3ROYA 4XYFA 1ZYCA 4C4IA 2WMTA 3R2BA 4BCMA 2OZAB 3OVVA 2BZKB 4MNEB 4HPTE 4I6FA 5D11A 4IIRA 4BDGA 4AZSA 2JJQA 1YB2A 4PX6A 1H8FA 4QYEA 5E1MA 2A0CX 3HEMA 2P1DA 1Z57A 2F7XE 3V5LA 2AOVA 2GNJA 2AR0A 3R8PA 3FKNA 3BU6A 2Y0AA 4QMSA 5FG8A 3TJDA 5EYDA 4X0MA 2LAVA 4PCAA 3QRKA 3IDPA 2QO7A 2QOIA 5LARA 4EVIA 4NTTA 3AXWA 4QMNA 1LEZA 3PVCA 4E1ZA 1XJ5A 2C6LA 1ORIA 2WMXA 2YCSA 4G3GA 3AGMA 4NW6A 4C3FA 3E93A 3EL7A 3MFRA 2X9EA 1JKTA 2ACXA 1J1CA 3T0IA 3TCPA 4LM5A 5D1HA 2C1BA 2BROA 5IUGA 3PUPA 1JG1A 2R3KA 1KPIA 1DAWA 1H25A 1BI7A 3SD0A 5CSPA 1U5QA 5KKRB 3S00A 4FEXA 1H00A 5A14A 1X8BA 3LPBA 4XCXA 1IA9A 1BL7A 5ANEA 3OW3A 2CNQA 3OWLA 2FYTA 3GU4A 4JX3A 4B7TA 5GJGA 4P5QA 3W55A 5G6VA 5BVKA 2PE1A 5HIMA 4FODA 2EWAA 2WQMA 4O86A 3SG8A 5K03A 5HE0A 3EFLA 1JG3A 1WXXA 4TY1A 1Q41A 5T68A 3HECA 2PGXA 2BR5A 3GWZA 2XF0A 4YPDA 4EORA 1XTPA 3AC1A 4IC7A 3TM4A 2XRWA 5M51A 3A7DA 4YPSA 5M09A 1N7JA 4O2PA 4APPA 4FZ7A 4MXYA 4DG3E 5C4KA 5BW5A 5KMOA 4D28A 3PSDA 3HCDA 3UJAA 5HNBA 9MHTA 1ZWSA 3PE1A 5IQGA 1RJBA 3C5UA 1NV9A 4XG7A 3Q9ZA 2CKDA 3MFUA 4AN2A 3CJQA 5DXAA 3HVHA 3EQRA 4XMOA 5DR2A 2XJ0A 4MXCA 4Q5EA 1FQ1B 2IW8A 5HE1A 1WAKA 4EKKA 2QOCA 5JFSA 3VULA 3WI6A 2E9PA 4G3DA 1AQ1A 4NU1A 1EAMA 4RQVA 5CVJA 4Y30A 3D5WA 5IQDA 3EQFA 3KU2A 5J7HA 4AQCA 5IQAA 4YLKA 3V5JA 4BI1A 3OCTA 1UNLA 5HVJA 3VQHA 3BCEA 5JMSA 2YDIA 3O8UA 3EGEA 3VS5A 1Q24A 4P7KA 2FRXA 3IK3A 2AOUB 2PL0A 5LR6A 4M84A 5ICGA 1G3NA 5AV0A 3PXZA 2BTSA 4NFMA 4BLWA 3T3VA 1UIRA 4PIPA 3AQVA 1OUKA 2E9UA 3CS9A 4NM7A 3A4PA 4JAJA 3NNWA 5H8EA 5FLFA 2BUJA 4JBQA 4V01A 4Y95A 1Q8UA 3WZDA 5JRSA 4GMYA 2JHPA 2OXDA 2UW4A 1JOWB 2NP6A 3TIZA 4J1RA 1YXSA 4U44A 4BLVA 7MHTA 3SLSA 5L2SA 3WZUA 3P1AA 2VX3A 2CGWA 4X6QC 3QCYA 5LQCA 1YI6A 5JSMA 4EEVA 1OMWA 3EEYA 3R0TA 2OK1A 2AC5A 3L8XA 2VTOA 2B54A 2B9JA 4Q9SA 5C26A 3ZRMA 4FVRA 4C4AA 3HRCA 4BZDA 5A4QA 4QMOA 3G88A 4WG5A 1FOTA 4GC9A 3ZEPA 2PUPA 4BYJA 1ZZ2A 3NUYA 5DPMA 1V39A 3DKFA 4XJ0A 2FSTX 4NM3A 4ANQA 3A7GA 3ZONA 2HNKA 3GFWA 1DCTA 1BC5A 1TVOA 4LWPA 4O38A 4QMMA 3KXXA 1VYWA 3ZC6A 3BZBA 3W33A 3VQUA 2BZHB 3SDJA 4Q2AA 5IQFA 3W10A 4BLUA 4Z16A 1WFCA 3NR9A 5LSAA 3GENA 2BRNA 4KDCA 2GTNA 2CGXA 2VP3A 3BV3A 4GYGA 4I0SA 3JYAA 3HA8A 3O8TA 3O4FA 2I0VA 2BDJA 5DWQA 4ATNA 5TT7A 2UVZA 4XG4A 4NTSA 3F3ZA 2PVCA 4FE2A 4BCPA 1ZQ9A 2DULA 4M67A 3FUVA 2C4GA 3NDJA 4CFXA 3MVLA 3GRYA 4G5JA 2NRYA 4QVGA 5EYMA 4L3PA 4D1ZA 2J7TA 4DFZE 1RQQA 4EHGA 5DM1A 2ZBQA 4X60A 3QKLA 4Z7HA 2WTVA 4XBUA 5CASA 1YOJA 3RZBA 3KQMA 2OO8X 3DQXA 3F5XA 5EM7A 4FKJA 4Z7GA 1SM2A 3SGCA 3FMLA 4AA0A 2R3IA 2X9FA 4F0IA 3H30A 2PVYA 2XNGA 3DK6A 1ZRZA 5E1BA 3SOCA 3DMFA 3DT1A 3DQWA 4BHNA 1PJZA 4OBXA 3F61A 2UW7A 4HCTA 2G2IA 3OOMA 3R3HA 2PVKA 2C3JA 4JT3A 4XUDA 4RJ5A 1O6YA 4ASZA 3EN4A 5I9ZA 1FVTA 3G8AA 2WTJA 4CZUA 3C0IA 3II5A 1O9UA 1ZARA 4KBCA 4AZFA 1Q8TA 2VDVE 5F20A 3UOJA 1PXNA 4TXCA 4H58A 3EFJA 2IJMA 2V5QA 2EUFB 4G3EA 4CTKA 5CS6A 3FSKA 2IGTA 4GG5A 4MBJA 1BHJA 4D0XA 1KYZA 3UIMA 3OWPA 4W4YA 5AUTA 3PY1A 1SVEA 3VSEA 2GFCA 2J6MA 5K4IA 4DEIA 4LUEA 2BFXA 3I79A 2QOHA 5HBEA 5HCYA 3IOKA 1NBHA 4D4VA 1W8CA 3A7FA 1HOWA 4Q5HA 4GFOA 5HG9A 4RBLA 4MQ4A 5M4CA 2YCQA 3U9CA 2O0LA 4ZLZA 3NUUA 4D4RA 5DT3A 4MD8E 3MH3A 4CXAA 2B78A 2ZDUA 2CHLA 4U6RA 3OTVA 2WQEA 5BW4A 5DR9A 2OPBA 2OY0A 1F38A 2BDWA 3HP7A 2Y6MA 4EOMA 2R3HA 2HY0A 1YXXA 2QOKA 4JNWA 4FIEA 1KE7A 4X63A 4LL5A 3GU3A 3KF7A 1YXTA 1A9UA 1A48A 4E2WA 3F3UA 3ATTA 3EKKA 5D12A 5CEQA 2WMRA 5J9YA 3BGVA 3TNIA 4V0RA 3NYNA 3AXTA 1UVRA 2R3QA 2QOFA 1M2QA 3IGOA 3ORPA 1VPTA 2IIPA 3UJ8A 3PIZA 1A06A 4MIKA 4A9TA 3QFVA 3LZBA 4A4XA 4XRLA 3PPJA 2C68A 3TUCA 3H10A 1OL5A 2NP8A 3M6WA 3I6WA 3MY5A 3CY3A 3HUBA 2R3SA 4ZSAA 4LOOA 5HIIA 5EQYA 2PZYA 1QANA 1BI8A 3DPKA 1XBBA 4RFMA 4EK8A 4I23A 5HCZA 1QPDA 4AU8A 2PVJA 1Y6BA 2X8EA 3FLZA 4UN0C 4FKQA 5C8NA 4W4WA 3LQ3A 5IA1A 1VEBA 4RWJA 4ZAUA 5FBNC 5K5XA 4BKJA 2JAMA 4BGGA 5CUQA 2VNWA 4O83A 2DUVA 4AUAA 2GPHA 1L3RE 5J87A 2QM3A 3KQYA 2ITVA 2X7OA 3KK8A 2C0TA 3L9PA 2JH8A 4F1OA 3H3CA 4H0NA 4X2NA 3LOKA 4AT3A 5FA8A 5IZFA 4BVUA 4V0GA 4YP8A 4WUNA 3BYMA 3FLSA 4LOPA 1EG2A 2BR1A 4KW7A 2OFUA 1YF3A 3LKZA 5DSXA 5KMMA 4G3FA 4X2KA 3DLZA 3FYKX 2VTIA 3HNGA 1UKIA 3UBDA 2J5EA 1NW8A 4P2KA 4CRSA 2P7IA 3G0EA 2WB8A 3GU5A 3MTIA 2A2AA 4FSRA 4CVAA 4U3YA 3WZEA 3UJ9A 5E8JA 4IX3A 5FQOA 1QPEA 4F0GA 4XG6A 3UC3A 4O7NA 3HYHA 3A7EA 4GOLD 4RJ8A 5JKGA 4RIXA 3ZOSA 4RTNA 2IVUA 3R9HA 3LX6A 1HNNA 4WNPA 4G17A 4FNYA 3FXWA 2ETMA 2FPOA 1J91A 3EL8A 1GZ8A 4WNOA 3BEGA 3QZFA 4FTLA 3BYUA 1GY3A 3H4JA 4OW8A 3KULB 3FI2A 4FEQA 5AA9A 4DKJA 3PWYA 4RVHA 3DNEA 2X0GA 1DUSA 4I3ZA 5DHJA 5A6NA 5P8WA 3R8UA 4RX9A 5EEHA 5CEOA 3RI1A 5HKMA 3BYOA 1XR1A 2OICA 1YDTE 3DOUA 2R6ZA 1WS6A 2CKPA 4EH6A 2H34A 2QODA 3EHAA 1BL6A 3ANRA 2UYOA 2QE6A 2ETKA 3JY0A 4FT7A 1P14A 2FA2A 2RFSA 4UWCA 2VO0A 4A9RA 3MIAA 3TKYA 3QGWA 5BYLA 3ER8A 4MYGA 1LPUA 3EN9A 5LQFA 5F9EA 3UODA 1WY7A 3R30A 4YLLA 5HEKA 4HVHA 3M2WA 3Q2MA 3EZRA 3TEIA 2N47A 2GQGA 5IQCA 3BI6A 1JR4A 1F0QA 4M69B 3V5WA 2VS1A 3BWMA 2C0IA 1Z3CA 5AV2A 2H96A 2FVDA 2PWPA 4RG0A 5LJJA 3IG7A 3E8SA 4O81A 3QRIA 2IO6A 4KBAA 4GJ3A 3M11A 5EOVA 4QP1A 4AOJA 4D58A 1URCA 2XNEA 3MSSA 3FSFA 4FEUA 4RRVA 1AQJA 5CVGA 4C7TA 3E7OA 2C3IB 5LQNA 2JITA 5CXHA 4GOOD 3CLYA 3WIGA 4HGLA 3L8PA 4YC6A 3M4XA 1HMYA 4IWQA 3OWKA 4F09A 1MUOA 4BHZA 5F4NA 3C4EA 1Q99A 3HLLA 4ANBA 1F5QA 4HOKA 4I4FA 2CMGA 4O0TA 5AAEA 4R6WA 3RNIA 3OD6X 5AP6A 2XNOA 5EW3A 3FKOA 2KULA 3OOGA 4LECA 4JDKA 4MD7E 3TIYA 2G72A 3C0GA 5CVUA 3FLYA 4E6QA 4L7VA 2XYNA 1KSWA 1UWVA 4MQ1A 2JIIA 2FSOX 3R9XB 2EFJA 2ZV7A 3Q7EA 3UIXA 3VHKA 3G2MA 3G51A 2B4SB 4XG2A 3SM3A 4WRGA 2HWPA 4DTAA 3BWJA 4F70A 3FUUA 4RVDA 3R9OA 3BWFA 3G2FA 4CXMA 4GK2A 1OL6A 4G6OA 3E3BX 1CDKA 4WBBB 3F3VA 4NECA 5EQEA 1IR3A 3DCVA 4IAFA 3FI3A 4XP2A 4J95A 3K3IA 4JIKA 3TJCA 3RTPA 5FA5A 1STCE 1R0EA 4DT9A 3VS6A 3PXFA 3P7BA 5IPJA 5IEYA 1WBPA 4XG3A 2BH2A 5ACKA 5CALA 1K2PA 5CF5A 2BAKA 3V3VA 3D5XA 3PTGA 3COHA 1TKIA 4AA5A 5C1QB 5JFXA 1WVWA 3POOA 2QOOA 4B99A 2FH9A 4CV8A 3SX9A 3C4WA 4IX5A 3FHRA 2EB3A 3SSMA 3TM0A 4EC9A 1MRUA 4MEDA 4DGMA 4O7ZA 2W1EA 3SXFA 3PLAE 1NBIA 3FZRA 4RIYA 5AAFA 4IDVA 3F2NA 5CX9A 2XKCA 3WSTA 4LL0A 4F4PA 4O6EA 4S30A 4YHTA 1AV6A 3BRBA 3RK5A 4ACDA 2VWBA 3NSZA 3KPJA 5GINE 2B1PA 4M14A 4CMUA 4EBWA 2EXMA 3BKXA 3EEOA 3KHKA 4CKBA 3RHXA 5E92A 2A27A 3E7VA 1XQZA 3SC1A 2BR4A 3D2LA 4ZIMA 3LE6A 3F66A 1YI4A 5E1EA 5I9VA 3OPNA 3OZSA 3CGGA 10MHA 5LCJA 2YITA 4I6QA 3D83A 4FNZA 1R1WA 4IAAA 3FXXA 3RAWA 4UB7A 4RTQA 2AOUA 4KRGA 4CT2A 3UA4A 2OKRA 5FTOA 1GZNA 5CEMA 4L42A 4MNFA 4E70A 3SG9A 1YKRA 2ZB1A 3RHKA 2JHAA 1V0BA 4C06A 2EXCX 4U41A 5FM2A 4QVKA 2XZSA 1SMHA 1KR5A 1R3CA 2OKCA 3TZMA 2P3OA 3LCTA 2BIYA 4J71A 2G1TA 4YNOA 2QU6A 3E23A 3A61A 5IU2A 4RJ7A 5HIDA 3DDQA 3A8WA 3FL5A 2XA4A 4Z2YA 3R9NA 4O6LA 4CFVA 2QO9A 4JG6A 5KBQA 1Q8ZA 5EI6A 2R3JA 4E33A 4GK4A 3HZTA 3SRVB 3TTIA 4AOTA 3TV6A 2XNPA 4QTAA 4PF4A 1OKWA 4C37A 5HI2A 4DT8A 1P4FA 3ELYA 3TZ8A 3TV4A 4OQEA 2QOQA 4USDA 5HG7A 2OIQA 2Z7QA 3DTNA 2YWVA 5KMIA 4Z55A 2ERCA 1NY3A 5CU3A 3FPMA 5T6BA 4YU2A 3SR4A 5DGZA 3UQFA 5HQ0A 8MHTA 1V0OA 5TR6A 3EYGA 3UDBA 3E8CA 2P0CA 4O22A 5EI2A 4HCVA 4EZ3A 2UW8A 2OJFE 4R8SA 2H00A 2HWOA 2BCJA 3PXQA 5EQJB 2VD5A 4NJ3A 1X1CA 4UZHA 2F49A 4MXXA 4DG2E 4DCGA 3VRZA 5E8TA 4NWMA 2GS7A 1RW8A 2OZVA 3FPQA 1U46A 4H3PA 5A4TA 2EVAA 3ERCA 4HYHA 4IMYA 1WBSA 4BBMA 3MS9A 4XG9A 4N70A 3F3TA 3BWYA 3DXNA 2PE0A 1ZMWA 1O54A 1KE8A 4X6RA 4DEBA 5CT0A 2FHPA 3R7VA 4MVFA 3N4UA 4FGBA 2AUHA 2OZOA 4BZNA 3BEAA 2XK6A 4QPPA 4MBLA 3V6SA 1T46A 3OXIA 3LMGA 4A6DA 3ORZA 5JN2A 2IFTA 2Z60A 1R6AA 4M7IA 2IZRA 5CAOA 3Q9YA 3ZO1A 2GLUA 4PWNA 5CI6A 1YXVA 3SV0A 2P55A 3U4UA 2VTQA 1Y8GA 3BV2A 4N6ZA 3U87A 3VHEA 3QTQA 3K6RA 1B38A 2QVSE 2W1DA 3KQOA 5GM2A 4IFCA 5L8KA 3PJCA 4WHZA 4R5YA 3C3YA 4YO4A 5AAGA 4QPAA 2PZPA 3UJDA 2BKKA 4ZTHA 3FPEA 4RA5A 2XEYA 3NDMA 4F9YA 4I5PA 2OYRA 4IEBA 3ENHA 4I1ZA 4MQ2A 3PX2A 5LQUA 4I20A 3HVIA 4FT9A 3SW4A 2X6DA 1PJKA 4FV3A 1X1DA 4DFUA 1O6KA 4CCUA 3H9RA 5TKDA 2XRUA 4YMJA 3I7BA 4R7IA 1X19A 4QP9A 2YM7A 4BCIA 3HTXA 4BI0A 4HVGA 4FOCA 3LM5A 5BUJA 3KRWA 3QLGA 2NPQA 4I5MA 1BOOA 3QWKA 2PBFA 3LQ5A 3OS3A 4TW9A 5LMKC 3DH0A 3KPWA 3QWJA 5LVNA 4QTTB 4ITJA 4O0SA 4K6ZA 5LXMA 4BTKA 4JG7A 2WMBA 2QHNA 2XB7A 5L6WL 2I6GA 2QRVB 3KXHA 3VYWA 3F5UA 4A06A 3F2AA 2GQSA 5J1WA 4BP3A 5H8BA 1YWVA 3FC1X 1H24A 4EK4A 4CLJA 4C07A 5M53A 4M3QA 3LFNA 4FBXA 4CKRA 4IHPA 1HCKA 4ERKA 2B52A 4IACA 2XBMA 2HAKA 1JLUE 4MD9E 1CMKE 2GAFA 3A99A 3PFQA 3TDWA 3QOWA 3RPYA 3EQCA 3RIEA 3FMMA 1URWA 3AC5A 1ZOGA 5AMNA 3ZRKA 5JGAA 3D0EA 2X6EA 3DS6A 1NKVA 2XJ1A 5HX6A 2QR7A 4DINA 4JR7A 3QQJA 4RTMA 4GVJA 2R2PA 5BVFA 1CM8A 3SHEA 1N7IA 2BPMA 3KXGA 3KMWA 4L46A 2PV0A 2ESMA 3MB5A 2Z02A 4DFXE 2C7PA 3PWDA 4P4CA 1P5EA 3EVZA 3FLWA 2AOXA 3FY2A 3OY1A 4UX9A 1E9HA 4X3FA 5FTQA 3MY0A 5LCKA 2RFEA 2VO6A 3CVOA 3A8XA 5AUXA 4FSMA 3PA3A 1Y8YA 4QYYA 2KW5A 3BT7A 4CCBA 3QQKA 1L3BA 4D0WA 3AD5A 1I1NA 4L7SA 4ERWA 5D1NA 4MXOA 1XBCA 3CEKA 2WELA 2QLQA 4UXQA 1FMOE 3EN6A 3ORXA 4HCUA 5KUPA 4FT4A 4ANSA 3RPOA 3FYCA 3FPHA 2BZGA 3OXTA 3LHDA 4ZP5A 2PWYA 2XUUA 5AP2A 3HMMA 4EOIA 1WZYA 2ONLC 3FJQE 3PYYA 4S34A 2JKQA 2VO7A 1K3AA 3NW9A 3EH9A 1AQIA 4NW5A 3Q6UA 3ZEWA 3TL8A 4ZLYA 3KB7A 4L6QA 1CKIA 4FI1A 5IQEA 2G70A 4I93A 3LFBA 5I9UA 2F57A 1IY9A 2DS1A 4IADA 2YN8A 2HZNA 3QQLA 4D1SA 2YZLA 5E1DA 3HRBA 2VWUA 4PV0A 4FTJA 2YVLA 2ETRA 4MTAA 3QL8A 2ZWAA 2OIDA 4DN5A 1ZOHA 3QQFA 4QP2A 4JRVA 3EN7A 2GMXA 3LQ8A 4RYLA 5E7RA 2C5XA 2QU5A 3PPKA 5DEYA 3FMKA 5JUWA 5AUWA 3HKOA 5G02A 1U4DA 4XS2A 3I4BA 3LHJA 1ZYSA 3OT3A 5F94A 1PW2A 2XNNA 4GFGA 3KULA 3MGYA 3WE8A 3DA6A 4ZS0A 1L3CA 2NRUA 4YO6A 5CU4A 5CEPA 1FBNA 1YRPA 3HAVA 5E8WA 3A4OX 4BBEA 4Y73A 3OU7A 4MBIA 2H6DA 4I21A 2ZMDA 3HAMA 3UVQA 5HBJA 4FL3A 4FMQA 2IH5A 4DEEA 3PA4A 3I9FA 3DDPA 4A9SA 3BE9A 2RL5A 2O57A 5IA3A 1KV1A 1NW5A 2CGVA 4WG3A 3LLTA 4FKSA 3A7HA 3UP7A 5EFQA 3ROCA 3ZS5A 3GQLA 5K9IA 2ZBPA 3ZLSA 3QKMA 2OB2A 3PG1A 2YEXA 4FT3A 1M52A 3VF9A 3VS4A 2XVAA 3OBGA 5IEVA 4H1JA 2P2HA 2JKOA 3QUPA 5DTRA 3FPFA 1G6Q1 3HMOA 2Q41A 3KL8A 2UUEA 3HCBA 4HYIA 2C6MA 3REOA 3DK3A 2VWYA 3HV4A 1XWSA 1KE6A 4UWBA 3RM6A 3CR0A 4M38A 4C2VA 4ALVA 4GKIA 4EH8A 3IW6A 1Q0TA 4BCFA 5KCVA 4K11A 3PSCA 1BYGA 5GP1A 5HG5A 2J51A 3VJNA 2HXQA 3BLQA 1TW2A 3D5UA 2ZV8A 4X1OA 4KAOA 1DI8A 3PJ8A 3ZYAA 3IDBA 5L3AA 2PVHA 4E5WA 5KKRC 1P1CA 1KOAA 3I58A 4RX7A 3RK9A 3QD0A 4FYNA 2FO0A 4L67A 5FXSA 4F65A 1RJGA 5CXZA 5C01A 3GVUA 2OFVA 5EKUA 3EVEA 4U7ZA 3G5TA 4EQUA 4M97A 5KX8A 4J99A 3U54A 4GFMA 2WPAA 2F2CB 3IONA 1Q61A 4YJPA 3VIDA 2JDSA 3OZ6A 4E5BA 2XH5A 2R64A 3F2RA 5IQIA 2WIPA 4EK9A 5M44A 4ACHA 5KZ0A 3QRJA 5E91A 3UOKA 2EJTA 1GIIA 1FPQA 5K5NA 2V22A 3P7CA 5CSWA 5EPEA 1IAJA 1UV5A 2ZM3A 1UU9A 2PUNA 2ERKA 4FV4A 1PKDA 3MTFA 4PYQA 3KPVA 3REPA 4J98A 2O07A 2OIBA 3E62A 4HPUE 4FL1A 3L9MA 2PLWA 2UZWE 3FUXA 5HZMA 3GOKA 4R8RA 3TN8A 3FWQA 3GRZA 4BRXA 4YTHA 3H2BA 5FQDC 3R7IA 3TNHA 3F69A 3HVCA 2G15A 1SNUA 4EWHA 1YUBA 4KIQA 3KXMA 1TQMA 4EOKA 4ENXA 4O21A 3B7PA 4DFBA 2EU9A 3CGOA 3N51A 4RJ4A 4XUEA 3DB8A 4YBKA 4EMSA 3Q4CA 5A4CA 5ERGB 4DA5A 5AX3A 3KKVA 2JKMA 2PVRA 2VGPA 3GXOA 3KQPA 3OROA 3ZLXA 3KN5A 4PTCA 3DXQA 3QQUA 4YJUA 5CEKA 2PSSA 2YXLA 4F0FA 2ORED 2X7GA 2HIWA 1X1BA 3FTDA 4QQCA 4FTQA 4IFGA 3ZM4A 4O27B 2JFLA 3RJCA 2VV9A 2B55A 2BRGA 3DLSA 1SUIA 2ERZE 3DMHA 2G8NA 4DCMA 4CMOA 5EDQA 3GDHA 2DQ7X 3PT9A 4RV9A 3U81A 4FUYA 3OW4A 2LD4A 4J96A 3W2RA 3UPZA 2C7RA 5D9HA 3ZU7A 3W2SA 4QQ5A 3ORNA 3SAYA 4F9CA 5CNNA 2Z8CA 5ANGA 4KSQA 2YIXA 3AXSA 3SGLA 2B9HA 3MWUA 2BKZA 5M57A 3ZSHA 5ICPA 2R3OA 3OE5A 2W5HA 4DGGA 3DXXA 5DRTA 4PDYA 4MK0A 2JG3A 4HGEA 3EQHA 4GOMD 1OI9A 1RI2A 4FNXA 5K0EA 3NWWA 2UVYA 4FZFB 4CFWA 3QBNA 2B25A 1SVGA 3AT2A 3VBTA 4AGCA 4J52A 3EN5A 5ETCA 3CP9A 5DSTA 3R9RA 2F4JA 2P33A 3CBGA 4LFIA 3A26A 3DBFA 4FOBA 4C08A 2BHEA 4OT6A 1YVJA 4C4EA 5CZHA 3EGVA 3E3PA 3TNPC 2XVMA 4D5HA 2YZAA 1FMKA 1M2PA 2WA2A 4X2FA 3UO4A 1Q4LA 3ORLA 3OT8A 5CIYA 3GOPA 4FKTA 2WIHA 1UNGA 3ENMA 4IVDA 4F6WA 4YBJA 2WTWA 1DAYA 4F1MA 1IASA 3W2PA 4AW0A 4DH5A 3DNDA 4YR8A 3IV6A 2BALA 4RFZA 3PXYA 3FC2A 3CBLA 2XKEA 3GC7A 4C4FA 4FKLA 4FSXA 3CY2A 3OCGA 3GRVA 2FK8A 5CI7A 5HVYA 2XK9A 4FT5A 4UYNA 3MPMA 4BCKA 3WF8A 4CFNA 2Y4IB 4QQJA 2X2LA 4MHTA 3LCCA 4E93A 2YX1A 3C0HA 1DI9A 2OBJA 3MH1A 3NIZA 3RMFA 3PS9A 4IDTA 4TWCA 5CCXA 4AT5A 2YIQA 3R71A 4I0TA 4UEUA 4BDJA 2XMYA 4O91A 3K2LA 3Q53A 3V5TA 3RM7A 2J4ZA 4OBPA 3MCZA 1WBTA 2XS0A 3OCSA 3MH0A 2PXXA 4HTFA 5ANOA 3C50A 3ZBFA 5AFVA 2YUIA 4I6BA 3UMWA 3BGPA 5LQKA 4MH7A 4QDKA 5CQUA 1M0EA 4V0GB 5K0GA 5DVRA 1UWHA 1QAMA 2PVMA 4DA4A 1REKA 3HA7A 1Z9XA 3DK7A 4E6CA 2AOTB 4ACGA 2BDFA 1JSZA 3RK7A 5JH6A 4FVPA 3JWIA 5A46A 2H8HA 5T3QA 2WTCA 4WVLA 2X8DA 5CAVA 4XNEA 3GCUA 4N57A 3T7TA 3DAJA 2G01A 2YM6A 4C62A 3P97A 2AN4A 2Y8OA 4AAAA 5E1SA 5GNKA 1NW7A 5BVWA 3NAYA 4QP7A 2VZ9A 4ZS4A 1QZZA 3KR2A 3QQGA 2ZVJA 3NNXA 1VBFA 4A4OA 2ZM1A 2VWIA 2W1IA 5TOZA 2K4MA 2I7CA 5FTGA 2XBAA 3BUSA 3IYLW 4RIXB 2W1HA 3ZM9A 3U8WA 3QXOA 3FQEA 1YFLA 4ZTNA 3P2IA 4WNKA 4HH4A 3MCTA 2W99B 3HMPA 1PXKA 1JQHA 4CMTA 3SA0A 1ND4A 2C1AA 2F9GA 2HZ0A 4CV9A 3ODZX 2RGPA 5EHLA 4YJVA 3ZZEA 1OZ1A 5DLSA 3DBCA 4V0QA 3ZCLA 4GG7A 3CJFA 3GU7A 3ZSGA 3L1SA 4FP9A 2OXXA 2JGZA 4LGHA 2EX4A 3PJ1A 4USFA 4FIJA 3LFFA 4DCAA 4AN9A 4LG1A 2O2UA 2RG5A 5EMLA 4FTIA 3UZTA 1S9IA 5KVAA 4J8NA 5F2OA 3E88A 2XK4A 2QY6A 3KQTA 1WBVA 4EOPA 1L9KA 3X0DA 4KRDA 2UV2A 4EH7A 5EHOA 4DQ0A 3W16A 1PY5A 5FUTA 4OA8A 3GNLA 2JHCA 3GNIB 4R5SA 2V7OA 1P91A 4GBED 4BCOA 4J7BA 5CM2Z 4ZY6A 4G6LA 3VW6A 4C33A 5J9ZA 4CG9A 3VF8A 4C3RA 3C5IA 3PDTA 3SVZA 4YZ9A 4DBNA 1MRYA 1VP9A 2QD9A 2WFYA 3GU6A 3BXOA 3JWJA 2GTMA 2W4KA 4APCA 3MJ2A 4ASXA 4RX1A 2UW5A 3QA0A 1HCLA 4PL5A 3PFGA 3CQEA 3MBLA 1PHKA 2VWVA 4EUUA 4AE6A 5K3YA 5I9YA 4CTJA 3R6TA 4JAIA 3KMMA 4JRNA 3LL7A 4GH2A 4F9BA 2XEZA 4G1WA 2Z7SA 5K0FA 3CD3A 4QRCA 4EOLA 3TNQB 4JBOA 2QONA 4FR0A 4L3JA 3TT0A 1R74A 2P41A 4LV8A 4EOQA 5JEBA 2F2UA 5HGIA 4E4XA 4I24A 5TF9A 5EVJA 1XH6A 2E2BA 2WHBA 2ZIEA 3BHVA 3DP7A 5A54A 3HV7A 1O9GA 3DU8A 4ZZNA 4A9YA 2BIKB 5LVOA 3PJ3A 4L52A 4GQBA 2C6KA 2Y6OA 4PP7A 4FTUA 4M68A 5D1JA 3CCFA 4FIHA 2UZDA 5ANKA 4AFEA 3QRTA 3UIUA 2OBFA 2HTEA 5I9XA 3OY3A 3NCGA 1EQAA 4R6XA 4RA4A 4U97A 4GRBA 4PYMA 4RC3A 3IW8A 2VZ6A 3FZOA 4YZNA 3LECA 3V8VA 1G8SA 2ONYA 3PIXA 3FTEA 3ALNA 5HESA 4HVIA 2FGIA 2ITUA 4NH1A 2OJ9A 4JG8A 4TNBA 3COMA 5K8VA 3TM5A 5CAUA 1W84A 2WK1A 4MXZA 1JSUA 1J3HA 5K0BA 4AW2A 4HGSA 4C2WA 4C59A 5EZSA 2PYWA 4LQMA 3O71A 5HIKA 3GJYA 1VIDA 4GT3A 4ZLOA 5DTQA 4J97A 1OB3A 3AJDA 3TZ9A 4YUQA 3KXZA 3FMHA 5HICA 4E32A 3ZDIA 3OFJA 5FULA 3NUPA 5HE2A 1OUYA 3OBJA 5IA5A 5DEWA 2Z6UA 3QD4A 3EQBA 4OTDA 1NVRA 4EZ5A 1KE9A 4RVLA 2B9IA 4YMHA 2QKRA 3LFSA 5DNRA 3N9XA 2PX4A 5KBRA 4BDBA 3IEIA 3G33A 5DX8A 5MHTA 4TWPA 4WT6A 4K9YA 3I81A 1YZHA 4KA3A 1W83A 4DG0E 2F7ZE 3AC4A 2UZBA 3JVRA 4ZSGA 4I0RA 1AD5A 4RIYB 4PDOA 4QP6A 3F6XA 3F4KA 5BUIA 4DTKA 3IHTA 4UYAA 3BLRA 3TWJA 3TR6A 4DTBA 2NXEA 4M7RA 3GB2A 3OCJA 2XYUA 2X2KA 4ZTLA 3GRUA 4FKRA 3LXLA 4R7BA 4OTFA 3G5LA 3L9LA 5JK3A 4KWPA 3NW5A 3RGFA 3W2QA 1OITA 2ZAZA 1SKMA 4MAOA 1XH7A 3E7PA 3MYGA 3V8WA 5IH5A 3EPPA 4FTOA 4LRMA 2CMWA 1UU3A 4IZYA 4QYHA 5HOQA 3VVHA 4U0IA 1CSNA 4CLIA 3MFSA 5DRBA 4Z9LA 3QRUA 4IZ5A 3HL7A 3QUDA 2YTZA 2C0OA 4FTKA 4XHKB 3VBYA 4NK9A 3KKZA 1W98A 5AUUA 1YHWA 5C0OE 3V51A 3JR1A 3I53A 2X8IA 5EDRA 4PCLA 3EIDA 2R9SA 5ICFA 4JQEA 3OZRA 4POOA 3H0YA 5LVMA 3VUHA 4TL0A 2QLUA 3OC1A 5ETFA 3TNWA 4QMXA 2WXVA 2P3QA 3SX0A 4IWOA 4XV9A 3EJ1A 4G9CA 3NDIA 2IBSA 3EFWA 1OR8A 3OU6A 4IBMA 3QTSA 2OLCA 3FQHA 5AM6A 3QHWA 2X1NA 4CFMA 4JBVA 3P08A 2AN5A 3QC9A 3R7OA 1Q8WA 1PMVA 4B4LA 1XJDA 3NWEA 1KYWA 5DT2A 2VAGA 3UQGA 3COKA 3KQVA 2CKOA 1UKHA 3LJ0A 2WNTA 1GZKA 3LKDA 4KSPA 4A6EA 1H27A 3Q9WA 3I0OA 4O96A 5CU2A 2YCFA 5DTMA 3QCSA 3DJ7A 3MVHA 5CVEA 1JBPE 4HYSA 2XIZA 5H3QA 3G2PA 3GT8A 3KK9A 5DI1A 2VTLA 4FV6A 3TLJA 3NUAA 3LDUA 3WILA 2YXDA 4C0TA 5E4HA 5EKXA 3QC4A 2XNBA 2QI8A 4ITHA 4S2ZA 2W1GA 4GF5A 3W2CA 1U2ZA 1MP8A 4RSRA 4TWNA 4I94A 3AD6A 4AZTA 3ZUTA 1YXUA 1M7NA 1NE2A 4D5KA 3R1YA 2PULA 3D94A 2BM8A 5CYIA 2A4LA 4HNIA 2CDZA 2HW7A 3BPRA 4WKQA 4CNHA 4HW7A 2E9VA 3PX3A 4K1BA 4M15A 2Y4PA 4FG8A 4ASEA 3KFAA 3QZHA 3UE4A 1JNKA 4JI9A 4WNMA 3VO3A 1H1RA 2J2IB 4L01A 4IC8A 4OTIA 3UOHA 5JGBA 4HZRA 4RTJA 3KQ7A 3EZVA 2CNUA 2J90A 3P86A 5EYCA 5KMKA 3FDNA 3UC4A 4W4XA 4D2RA 3V8TA 4DC2A 3ERKA 5EZQA 2PTKA 3WZJA 3HCAA 5EYKA 4RIWA 2UZVA 4RSSA 1Q97A 3ALOA 3WF5A 4PYOA 4YTIA 3TOSA 4LG4A 5DYJA 3ELJA 4ZJVA 3QD2B 1SQFA 4RTPA 4MHAA 1I4WA 3ELWA 4ZJIA 4CTBA 2XIRA 3C4CA 1XDZA 5C9CA 4EKGA 4KVZA 3NRMA 3QU0A 3ORTA 4GIHA 5FP6A 4PYLA 4CTCA 2IVSA 2WMSA 1IG1A 5HLPA 1XHAA 1J7IA 1L8TA 4F86A 2ZB0A 4YJTA 4FTRA 3BHHA 4O0VA 4FKPA 3M33A 3NNVA 4FIGA 3Q5ZA 3DGKA 4FSYA 2VU3A 5H2UA 4XUFA 4FZ6A 4U5JA 1SVUA 4U45A 2WMUA 4LGGA 3DKGA 3QZGA 3PVUA 4KABA 4R1VA 3OE4A 4BBFA 2B53A 1MRVA 4F7LA 3OWJA 5LVLA 3JPVA 3IQ7A 4AG8A 3PG3A 2H9VA 3LAUA 2PPQA 3GBZA 3EOCA 2YHVA 4K2RA 3THRA 3UJ7A 1ZOEA 2JFMA 3PP0A 5HVKA 3HCEA 5HFJA 4Y8DA 5HNGA 3NVKI 1JAMA 3L9NA 5L2TA 3GCVA 1DL5A 3NGAA 4Y5QA 5HU9A 3AWIA 3OHTA 2QO2A 2I1MA 3GC9A 3BQCA 5BVEA 5GWXA 3CXWA 1GIHA 5CANA 4P7JA 5CU6A 4FZAB 4U42A 3NZ0A 3HX4A 2WA1A 4X2JA 2VWZA 5AX9A 1Q3DA 3T9TA 2VTNA 1H08A 3KY2A 4JDIA 4RTKA 3KQWA 4PTGA 5DA3A 5HILA 4E4NA 4GW8A 5HNIX 2QCSA 5IKMA 5AM7A 3HCCA 5L8LA 4PDPA 4BDIA 3RP9A 5DT0A 5EOBA 1JKSA 4PTEA 4K8AA 5E2AA 1PXLA 5HIBA 4IJ9A 3ULIA 4AS0A 3MA6A 4C3PA 2JAVA 5HZNA 4FKUA 3WYXA 3BGDA 4ER0A 3RINA 3PB3A 3ZZWA 4X3FB 4AT4A 3HUCA 3M1SA 2HZ4A 3HGKA 4BCGA 4EHVA 3ZO2A 3O2MA 4IVAA 2BR3A 4HSGA 2ITPA 3UJ6A 2W4OA 3Q04A 3U6HA 2ZZNA 4AE9A 4F7SA 5AV3A 3V01A 2WTIA 2NP7A 2CN5A 5CAPA 2W17A 4FK6A 5T6KA 4C04A 4DF3A 4E26A 2VTTA 3NWBA 4FV9A 3ZC5A 3FYDA 1JQEA 1KUTA 1R8YA 4QTCA 2ITOA 2NYUA 5BNJA 2EG5A 3T3UA 4KBKA 4KS8A 3THBA 2IW6A 1QAOA 4P5ZA 1ZGAA 4C35A 5B7VA 3CSVA 4MCVA 4FS8A 3VW8A 2VTAA 4FV7A 5FEDA 2CPKE 4DH1A 2AOTA 4QMVA 4FIIA 4OX9Y 4IB1A 3B2WA 3MVJA 1NW1A 4BDDA 5M06A 4QPSA 4BIDA 3FUTA 1M2RA 1P39A 4TT7A 3JXWA 2E5WA 5CLPA 2B7AA 3R2YA 4TKSA 3KPUA 2IP2A 3FL4A 5HE3A 4YUVA 3DULA 4LMUA 4M8TA 3W1FA 4P90A 4PQNA 4IVBA 4FSTA 5GJFA 2H11A 2IW9A 5IDNA 4FGRA 3WE4A 3NYOA 2YM8A 4TYHA 2V0DA 4EYMA 5C8MA 3D2IA 3QX4A 3BKBA 2O5KA 4BDKA 4D1XA 3KRRA 3R02A 4U7PB 4FKIA 4UALA 3HVKA 3I60A 3LBFA 5AIRA 4RC4A 4ZZMA 4DHFA 2E9NA 3S2PA 4QMYA 5EW9A 1APME 4YUYA 4K77A 2B2CA 5EIWA 1FVVA 3IECA 1XVAA 5E8ZA 4JX7A 2UYCA 2R3LA 3CKXA 2NNWB 3VC1A 2GA9A 5IQBA 3KPYA 3MQ2A 4E6DA 4HJOA 4AUKA 4DAWA 2E9OA 3R21A 4G2FA 3QXPA 4GU9A 3BHTA 3MIYA 3W2OA 1WZNA 3UOLA 2O65A 3A7JA 5AIKA 2WQOA 2ZULA 4XCUA 5AP1A 5H9BA 5E8RA 4DMGA 3E05A 3R6XA 4PYIA 3VN9A 4K18A 1H01A 2BM9A 1OKVA 3CTHA 3PVBA 1FP1D 4EHEA 4QP4A 1ZMUA 5K01A 2I0HA 4IAZA 5E8XA 4O7SA 1BKXA 3VC2A 5T67A 3BX5A 3LKMA 3P2KA 1H26A 1XCJA 4BTFA 1OVEA 2GS2A 4CRLA 1EH4A 3R28A 2GSFA 1IAHA 3O7WA 4O7TA 3G9LX 3UJGA 4IWDA 4WIHA 2J0IA 1PMEA 5IMEA 2C30A 5AEPA 5AUYA 3KC3A 1YWNA 2O06A 2UZ4A 4QP8A 2PHKA 3ZTXA 5FCDA 4GSBA 4F7NA 3C4XA 2R5TA 3Q96A 4H36A 4O0UA 2AYPA 4QMTA 4AZWA 4BCNA 4ZEGA 2ZLBA 5E8SA 4GUBA 3B8QA 1YQJA 4FIFA 1LR4A 2WTDA 4QT1A 5H8GA 1K9AA 1EJ6A 4B8MA 4CFFA 1P2AA 2VGOA 3R8LA 3R83A 4OT5A 4Y5HA 5HD4A 5BMMA 4ER5A 4PMPA 3NTVA 2OH4A 3UNKA
chains in the Genus database with same CATH superfamily
1WVIA 4WZBB 1Q0ZA 3R9DA 4H4CA 1G2OA 1Y6FA 1V37A 4ZWNA 2A58A 4XEYA 2ZJOA 3ANXA 2WPNA 3I9JA 2ZDTA 3WARA 4BFLA 5CFQA 1V16A 2O63A 5JS8A 4JXXA 4FFBB 5AICA 2YH2A 3ETJA 4EAQA 1M7BA 2AX3A 2HPHA 5K0JA 4OTQA 1DM2A 1JKKA 4YJDA 1T45A 2HW6A 2UYHA 2CXQA 3FDZB 4NYEA 5FHRA 1XRNA 2ZI7A 2XRZA 1U98A 2Y1XA 1UH5A 1XZQA 3PQ4A 2RHDA 2WM3A 3QXHA 5GONF 4JUIA 4TWZA 3TQRA 1WPQA 1E2QA 2HX1A 1QS0A 1CY6A 2BMVA 1HRDA 4PX5A 4AY5A 1PS0A 2XCIA 2W2QA 5AJWA 4PXYA 3GGGA 2BAJA 2AA3A 4TZ0A 3LY8A 2C29D 4DRXB 1V2HE 3RKBA 4YJ2A 3T3DA 2ZQYA 3DVSX 4QPDA 2TMGA 4BQRA 5BR8B 4B6LA 1FYWA 4HGZA 1LC0A 4X8OA 3WDSA 5FNVF 2ZI4A 1MHTA 4I6GA 3G0FA 1NV8A 3KDSE 3CQWA 2WF7A 2OAQ1 1PKGA 1PJ3A 5A3XA 4BF2A 1ZZLA 1I30A 4MV1A 4QXQA 3T4PA 3GBPA 5CA0F 1VYVA 5M04A 3DQPA 4Q4AA 1QYXA 1TUEA 4Y1GA 4CLOA 5FF9A 5JAHA 3ORQA 1LRJA 3PUKA 3TLBA 1E9BA 4O84A 1UJMA 1WETA 3IX7A 2A92A 1WXDA 4Y2VA 2A4KA 4G34A 4OR5A 3RAFC 1BQ3A 2XDQB 4ND8A 4J8PA 2QM8A 2DERA 1KDPA 1DBRA 1ST2A 2I0EA 5A4LA 4FT2A 3HJGA 1FVHA 3FSGD 5LMAA 3IDCA 4WXHA 1H2HA 4WGFA 2P2NA 5D85A 2EKQA 3ACKA 3C6XA 2PVPA 2ZBRA 3K1AA 3TZKA 4IKPA 2YIYA 3CIKA 3HDMA 3RAIA 1URPA 1IJKA 4O4IF 3AUKA 4JJRA 3GA5A 4MDHA 2ACVA 1XXHB 3RVQA 4YDSA 5HEZA 2CLEB 2QS9A 4MI9A 4B9DA 1JQJC 5DLDA 2FEMA 2OBMA 3D6JA 2QQ5A 5EPOA 3G9XA 3RAEC 2JPDA 2RG1A 4AF3A 3EVGA 2C77A 1B73A 3ZZMA 2VHXA 4HWPA 4P22A 1ST4A 3OTOB 4KQFA 4TSRA 2C3LA 4YTFA 5KS2A 3URKA 4DDMA 1G3RA 4RVFA 1NM5A 4A2WA 5LJLA 3LJ1A 4RQKA 2QAGA 4KINA 1A96A 2ID4A 4R41A 3W05A 3UV7A 4B6PA 4QNYA 2G9NA 2YERA 1JHPA 4MPRA 1RC0A 2R5FA 1NOKA 1NFFA 1PGPA 3DKRA 4WZAE 4RA9A 1IXYA 3WJAA 4IM3A 1KBZA 3QZIA 2C1EA 3RK0A 2G1PA 3JALA 3HN2A 1A04A 1BUHA 3KQNA 1PX0A 2O5CA 3U39A 5F3WB 1DEAA 1G3IA 4Z9XA 4WKGA 4ENRA 1TQPA 1K7XB 4DJTA 4ECAA 3CMMA 3MAGA 2IT1A 2G5CA 1K92A 4TYIA 1ECPA 5EMJA 2WHQA 4R01A 1A9TA 3B53X 4KXXA 5IKOA 2YIMA 1JALA 2JBAB 2H2AA 4I41A 3D6MA 3WK9A 1KEVA 4QJ4A 2WFMA 3W4JA 1RJDA 1T1IA 4RQTA 1M14A 3E8XA 3FPJA 1L1RA 4D2SA 5BSKA 2B1JA 4WTOA 4PXAA 4RVOA 2KPOA 4L4RA 1IQUA 3HADA 3K15A 3ROEA 2R3FA 5CVHA 2GK4A 2VPIA 2JVIA 5C52B 5G0TA 4IIYA 4BB0A 4FKGA 1Q1GA 1QFSA 3ESRA 4UHDA 2WTKB 1CTPE 4BV2A 2QSYA 1TIBA 5IJ0A 1CEYA 4JVSB 4XD7A 4MWHA 2IA5A 3WBBA 2B2NA 4FN4A 2RSLA 3ADOA 3EGDA 4A10A 5AIBA 4EG5A 3ZG6A 1IRXA 3R1QA 4PC3A 3R0QA 3KOWA 1I94B 4S3MA 1WB5A 4GU6A 4FT0A 2YA9A 2C07A 1WVXA 2R0UA 3A4YA 1KY5A 4LS3A 5AADA 1WBWA 4PLTA 1DBPA 2DFVA 2B9EA 2VJCA 3BHUA 2ZWPA 3FMEA 1NMYA 2HBQA 4GV1A 4UUQA 5T6MA 3UYKA 4G5PA 5CD1A 4ER7A 2DP4E 3ZK9A 3I1YA 1TF2A 1J7UA 3QTTA 5LLSA 3WFIA 5EIBD 1ZNZA 2OXTA 1O03A 4V2UA 5AVWA 3MJ4A 5AUZA 5DEOA 1P5ZB 2VA9A 4ANFA 1XZAA 3W8DA 1Y1PA 1E1QD 4OXRA 1J8FA 2IP1A 4J07A 4IR7A 3UZUA 3CN9A 4RK7A 5K3FA 3EIUA 1GITA 3KP1A 4LOIA 1GTG1 3E64A 1DKOA 4J29A 3QOXA 2G4LA 3T94A 2WMVA 2TS1A 2PMOX 5M3BA 4EK5A 2G28A 2J3KA 2QLJA 1ZMXA 5TO8A 3RT7A 1OPLA 1SXGA 3F7TA 1EK5A 2P6NA 3UJBA 3TLKA 2WMWA 4GOND 3QU7A 2WY2D 3KREA 4NBLA 1K9VF 5CYOA 3KFXA 2CNVA 5DX1A 2ZSIA 3AW9A 5T3UA 3WKAA 4CDRA 4WKCA 4KUJA 1E3LA 4PYNA 5A06A 2CLXA 4Q7MB 3BG5A 4WOVA 4W9RA 4A4LA 3FZ1A 3FSEA 1TGYA 3ZO3A 1RHMA 2BAQA 3KFLA 2R0IA 2AMVA 2IHKA 1OIUA 3R8FA 1IY8A 4D25A 4DV3B 3LXKA 4ROSA 4R8MA 3BGQA 3MFYA 3F6BX 1NYTA 4WBSA 2B34A 1OKYA 2FUMA 2DYKA 1MO5A 4BEVA 4NX2A 2Q6IA 3HFRA 1OMOA 1U1EA 1U5AA 5HLNA 1ZUWA 3RQIA 3K2EA 3S1LA 1KDYA 1UU8A 3IR5A 3LIIA 1C0PA 4WLFA 5JW6A 1XMSA 4LXXA 1XXLA 1E5QA 3O1HB 3Q4TA 2GBGA 3WLJA 5LNK1 3NM4A 1UEXC 2QLFA 1YOLA 3E35A 2YN4A 3RVPA 3P78A 3OEYA 3TUZC 4W4VA 3DZQA 4CR8A 3NG1A 2UV8A 5I9IA 1QHNA 4B3RB 3EB0A 4FM9A 4XLVA 1X7HA 1Q22A 2XCTB 2HLDD 2PGOA 4QQKA 1UZAA 2RK4A 3NVMB 1B74A 3UG1A 1I9GA 3UHJA 1IQRA 1WUIS 3UDTA 3RS3A 3MTJA 5I9BA 1S89A 1JEYB 1LEHA 1NP6A 1YB1A 3LCRA 1OAOC 1OA1A 2H1RA 3KVOA 3C48A 4QG7A 3OM9A 1DE0A 5AW4A 4E21A 3QV2A 3WBLA 1VHLA 2DUUA 3PL5A 4PAWA 5BMSA 5H1YA 3D9VA 1LWOA 4MB6A 3Q6WA 3Q3BA 2A7QA 4R31A 1VSBA 5DN6D 5K9ZA 4UKDA 4Y6SA 4BCBA 4HB4A 1YQEA 3AQ4A 4FDMA 4K40A 3NS9A 2FFBA 4PRJA 3M4NA 4LRSB 3KELA 2FX5A 4LBVA 4U2CA 3GC0A 3TFWA 3A25A 4LV8B 3RTAA 4B8LA 3Q8MA 4DV4B 2UUAB 2ZR9A 2FH5B 5JAUA 4HG2A 1OF1A 1W94A 3C1UA 3WF9A 5EMKA 3PNSA 3P20A 4DWOA 3DTCA 2H1HA 1HZZA 1S2DA 2R4UA 1N4AA 4ZI5A 5GV7A 2PT9A 3HN7A 3B1JA 2VOEA 3BBLA 2QJWA 2J0KA 4KL8S 3O23A 3ABZA 4Q3EA 4IDPA 1TUBA 2DPHA 4MITA 4XJSA 3G8BA 5EIOA 2PDAA 1K7CA 2H5LA 4KRCA 1ZH2A 3ISJA 1D6SA 4MI6A 1Z6AA 2Z8YA 2A1TR 1FFXA 1D7AA 1FMLA 4UD2A 1OQAA 1CR4A 3PC8A 3S95A 1CZUA 1NVAA 4I6LA 4O0LA 1ODKA 2QZ4A 4LHSA 4QAQA 4I3HA 4CCSA 1CZHA 5LMNB 1X7ZB 1EWYA 2F9FA 5K05A 4GM0A 3A8TA 1U2PA 3OEHD 2P8JA 4H05A 3FHLA 5SV2A 4S32A 3DTTA 1MVOA 1YZTA 1SNXA 1JYSA 3BMOA 2XSZD 2C4UA 5DWRA 1CD5A 2WVAA 4TL6A 1DG1G 3K2BA 4YXWD 1CUGA 1F17A 3AU9A 4H7FA 1G3UA 3RS2A 1PEYA 3SLRA 1KZ6A 1IBMB 5DTIA 4TZ6A 1TEHA 4E7WA 1ZLXA 5HHWA 5ALTA 2QJFA 3UVPA 2QUHA 4EY8A 2GGSA 4UMDA 2G1KA 4BL5A 4JX9A 3ZNNA 3OY7A 3I9V1 1XZMA 1D2HA 5BNTA 1T91A 2QUAA 2VYFA 4BFWA 1H6AA 4RJ3A 4AMZA 3IB3A 3VUGA 4ZFNA 5AK0A 2BTQB 3A4MA 4S1VA 4CKJA 4FV1A 2PFSA 3NJ4A 3NPCA 2WZCA 4R6VA 1L8LA 1LV7A 2X5NA 2Q21A 3GUBA 2Q3EA 3LUKA 4FOPA 3FMPB 4OMUA 1SVKA 1SUPA 3PIRA 1QYRA 3G0OA 2G2FA 3CJTA 5LXTA 1CJVC 5JSZA 1YA8A 2QKYA 2BFCB 4O82A 5CU0A 3W0MA 3QNWA 1LPSA 5EM6A 2R7LA 2VJAA 3C5CA 4FFRA 1LCIA 2FB9A 4ETMA 1U7TA 5AP5A 4YT5A 1EDZA 2PV7A 2I8CA 3AV0B 3MSCA 4LUCA 5EE5B 3ZQUA 2W4JA 5ALPA 4DLWA 3P0MA 1GSIA 2WEKA 2OXRA 4MJLA 3CGFA 4RL4A 2AG1A 2ILVA 2X1HA 5D7VA 3LPLA 3GLGA 4NFSA 1NI4A 4XAQA 3HP5A 5G53C 5CEJA 2ZUTA 4L5JA 2IU3A 3D14A 1P2GA 5A6OA 1MKYA 5CTJA 3EVDA 1V5EA 4F1WA 4V0ME 3D7TA 3WGOA 3DBEA 3HVJA 2H2FA 2B4AA 4YALA 5JZMA 1SHUX 5LUBA 4GYJA 4DV7B 4J0EA 4BTMA 4ZK6A 4YAUA 4N82A 4JLMA 1WQ4A 3D4IA 1WF6A 2OCPA 4L6AA 5KBYA 4QOJA 4DQDA 3DVRX 5K3EA 2WMQA 5FDPA 3SDBA 1GCUA 5AP9A 3KVWA 1GNPA 3RYTC 1C3EA 4CFUA 2Q0QA 1OLXA 2WUVA 2O54A 3O26A 4LMNA 4OHFA 3HB7A 4ZY5A 4GX1A 1KDRA 2A1IA 4H77A 1JS1X 3GUCA 1AZLA 2DCUA 2DPLA 4K03A 2JCVA 3TW8A 4HDCA 5F1PA 2Q9UA 4N12A 3FYSA 2ZPUA 2NVUA 3MRVA 4L51A 3WLAA 3ZFYA 2GCDA 1EINA 1OILA 3KT3A 4A9AA 3IIIA 1E2DA 4MV7A 1S2IA 3MRSA 5J8IA 2AMLA 1QTQA 1AKRA 3QEAZ 2CNWA 1HNXB 3QF7A 5JAOA 4DB2A 4EPWA 5ELXA 3MFTA 3FTFA 5H9VA 4EH3A 2PY6A 5H8WA 5CENA 5DIFA 1X2EA 4ZV9A 1DMRA 2WQNA 5DCWA 1RI3A 1TMKA 3DZGA 4H7HA 2I6FA 1XPJA 3FI8A 2MINA 1P29A 5IWCA 2DE0X 3GVPA 2PZ5A 2J3DA 3THYA 3RALA 3K9LA 2I1QA 4TT8A 3DXYA 3OPYA 4X6LA 1ZG3A 1QHFA 4A2CA 4XCQA 4XJVA 2RARA 1V5GA 3MGGA 4NYMQ 3K9BA 2M2IA 3RNOA 4FC6A 3HXPA 2OC4A 5JYDA 2YJNA 4Y46A 5CB6A 421PA 3IEVA 1H1WA 3KCNA 3OFKA 1U3DA 2QNBA 1ZCFA 1G9TA 5CB0A 4YI3A 3IEKA 3L18A 1DG3A 4I4IA 2HMWA 3MESA 2EBWA 4ZCPA 5FI5A 1WOMA 3LCSA 4MV3A 2C2WA 2CXPA 1LJ8A 4TT3D 2R8BA 4ZOLA 3FWHA 1G8GA 1H0VA 1O6BA 4E1AA 5KB3A 5HGJA 4YCCA 2PRKA 4H31A 3TVTA 3IAAA 1RT9A 4RABA 1WUHS 3EVCA 2NO3A 1OLOA 1T34A 3X1WA 3G2OA 2BGTA 5FTMA 2HQRA 4YAWA 3MJ1A 5A3RA 4ZZ1A 1ZK3A 5CF4A 3ZXZA 4GLBA 5HXAA 3UPUA 2PXAA 1CEEA 4ZU3A 1G60A 3H86A 5DG5A 2JBOA 5FYQA 3GW8A 3PA5A 2NSYA 4BV3A 1H4TA 1LDMA 2QLNA 4S24A 4G0YA 3DE5X 1P4HA 1YV9A 1P2BA 4P5EA 1LPBB 2W4MA 4A91A 4JMQA 1W5TA 4PYJA 3GPIA 4OVKA 2YWRA 3ID6C 1Q0QA 3KO8A 1IEPA 3OE1A 3Q60A 1NM5C 1E66A 4PC6A 1JR3E 1U99A 4QIHA 3P26A 5CYFA 1CRZA 4PZUA 4IS2A 4LY3A 2X3UA 5FTNA 2DUNA 3DLHA 3PE2A 1Z08A 4E5AX 1VJYA 1HYHA 3RT9A 1LLUA 2A1UA 2NAPA 4K0YA 2OWBA 1KJQA 4EG8A 1V35A 2WV9A 3ZV3A 4S04A 3D59A 3GA7A 2IN6A 3POZA