2IPXA

Human fibrillarin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
220
Chain Sequence
MVEPHRHEGVFICRLVTKNLVPGESVYGEKRVSISKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Fibrillarin in complex with SAH
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords rRNA 2'-O-methyltransferase fibrillarin
total genus 70
structure length 220
sequence length 229
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ipxA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2ipxA02
4IX5A 5HLPA 3R0TA 3ANXA 5IH5A 2HZ4A 2R3NA 4OBQA 5ETCA 1NY3A 1JLUE 4ZSAA 3LVPA 1EAMA 3UWPA 1FGIA 4DA4A 4QYHA 5C8MA 3R22A 5FG8A 3VW8A 2XBAA 3M1SA 3FYDA 4PYNA 5HIJA 2QO2A 3OCSA 4PGHA 3UIBA 1MP8A 2Y1XA 3EKNA 5CEMA 3PPKA 4AFEA 3BHUA 1Q8UA 3QTSA 2PE2A 3F6XA 5F20A 1R3CA 2GNIA 3B2WA 2WMTA 3Q04A 4RGJA 3VQUA 4ANQA 2XH5A 5FEDA 2BAQA 2WMUA 5HEKA 4HOKA 4OTRA 3FY0A 5LMAA 4O0TA 2WQEA 3FTDA 2UZDA 4S30A 1YWNA 4NSTA 4TY1A 3WARA 4UZHA 3G9LX 3W2OA 3V3VA 4WG5A 4F6UA 2BAJA 2ITQA 2X0GA 3GUBA 4J99A 4O27B 4DT8A 1U5RA 3B89A 4GCJA 3DMHA 2QR8A 1T45A 2VTAA 2YDIA 5K0LA 4USFA 2JDVA 1OB3A 2IVSA 5BVWA 3AXTA 3NYOA 2IW6A 3GNIB 3DKOA 4J53A 1BHJA 3HV7A 3PSBA 2GNLA 4U79A 5KMNA 2ZYBA 5C1QB 2BZIB 3QD0A 4XCUA 3CEKA 4I1ZA 5DH3A 4AGCA 1S9IA 4DN5A 3CP9A 5H2UA 1TQMA 4OTGA 4RJ5A 4RVLA 4CRSA 4GJ2A 4YTIA 5K5XA 3ITZA 1ZAOA 4RRVA 2GPYA 2ONYA 2ZBRA 2AC3A 3QL8A 4YZCA 4DH8A 4DM3A 2VWIA 3HYHA 3F3WA 2AOUA 3SAYA 3A8XA 3NR9A 4JVGA 3ZDIA 2ITYA 3ET7A 5LMKA 4FTMA 2ZBPA 2XYQA 3ORIA 3LXPA 2ZW9A 2WTVA 1EG2A 5DEWA 4O7TA 4NL0A 3D9VA 3K5VA 4X3FC 1OBDA 1YOLA 5J1VA 2BRNA 3PWYA 4X2KA 1ZRZA 5ANDA 4EL9A 3G88A 4AUAA 3PXKA 5I9UA 5ICPA 4EC9A 2OPBA 5A4TA 5E2AA 2J6MA 4MQ2A 3OOGA 5FQDC 2PX8A 2OJGA 2ZCJA 3QUEA 3E7OA 4ERKA 4FVPA 2VWWA 3GCPA 1B38A 5EI8A 4GBED 1XKKA 4ER5A 3UJAA 3NW7A 1ZOGA 3GRZA 4S32A 4R3CA 4ZOGA 4NTSA 2WQOA 3E88A 4O82A 4F6SA 1WVWA 4JDKA 5KBQA 2ETMA 4RIXA 4UWYA 3HM2A 4NWMA 3HRFA 4LYNA 3DBCA 4O7SA 4I94A 5TO8A 5BVOA 4IVDA 2P7HA 3H2BA 4J97A 3NNVA 3TCPA 1UWJA 2RIOA 3U4WA 1JG3A 4PONA 4C0TA 5GJGA 4UBAA 4AGUA 4QQNA 1FBNA 2JIUA 2CL5A 2JGZA 1ZWSA 2UW4A 4M15A 4ZTLA 2XNNA 1X1BA 3GRVA 3RK7A 3CJGA 4CG9A 5DM4A 2XM8A 4OBOA 4R1YA 4DAWA 3JPVA 4F85A 4D0XA 1JSVA 2JDRA 2HXQA 1JQ3A 3GJYA 1URCA 2FK8A 1J91A 4G9RA 2WGJA 4JBQA 4Z2YA 3WSTA 2WMXA 3QLGA 4H3QA 2JDTA 3LMGA 4S31A 5FP6A 4PX6A 4L00A 3EOCA 3QTWA 5CQWA 3ZLSA 3SG9A 1IAJA 3ZZWA 3P71T 3UJ6A 2E2BA 4AT3A 3BCEA 3LQ3A 5IG1A 1KYZA 3VQHA 2AR0A 3BV2A 2ZLBA 3E7PA 3OFJA 3SR4A 3SSMA 5KHWA 3LCCA 4QP4A 3DGKA 4JBVA 3WF7A 2GNGA 3Q52A 3O2MA 2ITXA 3T9IA 3H9OA 5CASA 4BYIA 1Y8CA 2OXTA 3D94A 3TT0A 1QL6A 3WF5A 4HTFB 3DS6A 2JITA 4J7BA 3SVZA 5LQCA 4APPA 1OZ1A 1VLMA 2QM3A 3ALNA 4I5CA 4DTAA 4EK9A 1MHTA 1E1VA 3MFRA 2EU9A 1O54A 4CKBA 3JXWA 4CFXA 1KXZA 2AC5A 3C7QA 3I7BA 4YHFA 3VWAA 3I4BA 4QP7A 4RV9A 1WAKA 3CCNA 4ZP5A 1H1DA 5CENA 1YHVA 1H1QA 2ZOQA 4M14A 4IV0A 5AAEA 1G8AA 2HK5A 4NT4A 2J9MA 2W17A 5M57A 5BYYA 5DN3A 2Y6MA 3LCVB 4IKPA 3O8TA 1YDSE 1OGUA 1YWVA 2UZUE 5T67A 4POOA 8MHTA 4V05A 3VHEA 3FZRA 4IX6A 1UIRA 3BKWA 5CVJA 1H07A 5FQOA 1M2QA 3Q3BA 3K2LA 4F9WA 3COHA 3QWJA 2GH1A 4X3FB 4FSUA 3R8MA 1AGWA 5AV0A 4ARKA 4CMOA 1OL6A 4GYGA 3FV8A 4PNIA 3W1FA 3V8WA 2WELA 5IEYA 2E5WA 1YI4A 4JNWA 2H96A 3C0HA 4UXQA 4O7YA 2CKPA 3S2PA 4IWNA 2O65A 3CY3A 3Q4TA 5HO8A 3P2IA 2SRCA 4RTLA 4KA3A 3LOKA 5CSXA 5AP0A 4MD9E 2JKKA 3KPUA 1BC5A 2PZ5A 5ACBC 5J5SA 4DCAA 1M6YA 4WD5A 3I53A 2BR5A 3O23A 4YZMA 3OU7A 5EMJA 2VWBA 2W1EA 1KP9A 2YWPA 4W4YA 3WZUA 2UVZA 5EK7A 3UYTA 2GTMA 4J71A 4BB4A 4FOBA 4D1XA 3UJ7A 5JT2A 4FTLA 4X21A 2QOHA 3BYUA 3KR1A 3FZGA 1UA2A 3LM0A 4XHKB 5AIRA 3IDBA 3SRVA 5HGIA 2XK6A 3JYAA 3KXGA 4XG2A 2OFVA 3LCKA 4U44A 1V39A 5IQBA 2P3OA 4GU6A 3C9WA 4NJ3A 4O83A 5GJFA 2QG7A 2AZTA 4BLWA 5FBNC 4Y73A 1TQPA 3A62A 4FNZA 2Q0NA 4XEYA 4DGMA 5HCYA 2PVCA 3PS9A 4AA4A 4FSNA 2EFJA 3ENHA 3FC1X 3FPMA 4FEWA 4I5MA 4OGRA 5AIKA 2VP3A 4KB8A 5A9UA 3QD4A 2PZIA 5IA5A 1Y6BA 2CSNA 3HMMA 3Q96A 2B2CA 2QURA 3ROCA 4QYYA 3RKBA 4GFOA 5CU4A 4EH4A 3GU7A 4G6LA 4E93A 4HYHA 2ZZNA 2R3HA 1REKA 4QOXA 4ZY5A 4A07A 1H1SA 1H0WA 5A54A 1PKGA 2J0JA 2ZV2A 4MXXA 2YM4A 4BCFA 3ZZEA 4EK3A 3R8ZA 2YWVA 1RI3A 4F99A 5L6OA 5D1JA 1HCLA 5FA5A 4MWIA 5GNKA 3HRCA 1RDQE 2OWBA 1YDTE 1YFJA 3WZDA 5P8WA 2B1PA 3R9OA 4DFZE 1IEPA 3JUHA 3ZOSA 3I64A 3Q9WA 5AX3A 4YMHA 4BGHA 2W9FB 2PGXA 5M5BA 3DCVA 3MW1A 4GH2A 4AE9A 1I1NA 4IWOA 2QU5A 3EJ1A 1TPYA 3LFFA 4IZYA 4PMPA 3E8EA 3HNRA 2F7EE 4R8SA 1OL7A 1R78A 5FUTA 3EL7A 4Z3VA 4M12A 3GDHA 2E9VA 2VTNA 3OOMA 4UYAA 4YJQA 1KE7A 1TQIA 5AA9A 5LWNA 2BILB 3NW5A 4FMQA 4M7RA 5CCBA 3SXRA 1Z57A 3PVGA 4NTTA 3O96A 4KUJA 5J87A 5LSAA 1JKSA 5DA3A 3PZEA 1BKXA 4DLJA 1P4FA 3U6JA 4E26A 2X2LA 2J0KA 3G33A 4P7EA 4EOQA 1W82A 4OA5A 3PE1A 3EN7A 4QNYA 2XVDA 2CKOA 5JQ5A 2C30A 4ZTMA 3CJQA 2Y4IC 3CVOA 3Q6WA 4FKWA 3TJCA 3ZC5A 4LOPA 5DFPA 5BVDA 3CS9A 4AW1A 5CSPA 2ZWAA 2DPMA 4K6MA 4E2ZA 3IECA 1KIAA 2YXEA 1OVEA 1ZYCA 3GQLA 3NYNA 4MYGA 4NFNA 4O7LA 1MRVA 3TNHA 3VVHA 4U5JA 5M09A 2BDFA 3KQ7A 3FL5A 3GGDA 4AGDA 1YW2A 5EZQA 4RIOA 4K8AA 3NUNA 3OCBA 4QYEA 4YC8A 4I5HA 2JAMA 3GCVA 2IO6A 4A4OA 1IY9A 3DXZA 4RVGA 5HE1A 4X41A 2QHNA 2ZV7A 4KIGA 3SX9A 4K6ZA 5DR9A 3EHAA 4XH6A 3W2SA 2J0LA 3R9DA 1FVRA 1Q99A 4GT5A 4E4MA 1RJEA 1P91A 4YMGA 4Y2HA 4ZAUA 4ZS4A 4CQEA 2IDKA 4FKTA 3RMFA 2PV0A 3WZKA 4ASXA 3CC8A 4AZWA 2WMSA 5IU2A 4C37A 2R3KA 4ER3A 4ZY4A 4IACA 5D1NA 3SQQA 3F2NA 4FT0A 4FTNA 5A4LA 1WY7A 3UTOA 4L01A 3DXXA 3UZPA 4YZ9A 3UPZA 3BWMA 3P8ZA 4XG6A 5T6BA 2NRYA 4J8MA 5B2KA 4XOYA 4TZRA 5DTQA 2QOLA 3KMUA 4JLCA 3E23A 4RVDA 3ANRA 3DBQA 1M2RA 2XVAA 2R3SA 2XCKA 2R64A 2XJ1A 3SKCA 3R73A 3LCOA 4YLLA 5HLNA 5DLSA 3MIYA 1Z9XA 4G3DA 5EPEA 3BYOA 2HXLA 2Y8OA 3OMVA 3PJ1A 3QCXA 5C8KA 3DLCA 4GOMD 5E9EA 4FZVA 5CAOA 4B4LA 2F9GA 2J7TA 4FV3A 3RTPA 5CY3A 2XYRA 4CCBA 2FB8A 3L9LA 5AAGA 3W10A 5CVEA 5IQGA 3O4FA 3UP7A 2AOTA 1X1AA 3CSVA 2J5EA 5B2LA 5CAPA 5CAVA 4FV6A 4O0UA 4I0SA 1N7IA 3JWJA 4EHGA 4IWPA 2C5VA 3FUWA 3NLBA 3IW4A 3BWCA 5H02A 2P2IA 3SD0A 2YUIA 5FXRA 2IW8A 2G8NA 3VC1A 1OPJA 2GFSA 3VC4A 1L3IA 3KPYA 3R7VA 4RX1A 1YOJA 4FSQA 3U8WA 4AUKA 2ITOA 3DXQA 2VGPA 5EQYA 2PUNA 4FL1A 1OKWA 3LE6A 3VBQA 2QONA 3DY7A 3MY1A 1QAMA 10MHA 2IH4A 4GKHA 3T8OA 5LQRA 3BWYA 4XV9A 5EIWA 5EYKA 2PMOX 4NCTC 4CXAA 1G8SA 2QOQA 2XB7A 4W4VA 3R83A 4AN2A 2PYWA 1OIUA 2NXEA 3V6SA 4C06A 5D1HA 2WFYA 4PTCA 4FI1A 1NVSA 3BWJA 2XK4A 1F0QA 3G2PA 2V0DA 2VWXA 4CVAA 4B7TA 4D4SA 4FT3A 5C26A 1VP9A 2YIYA 2WIHA 4I41A 4EKKA 3HCAA 2B25A 3NJRA 4NJDA 4UZDA 2FK7A 4KRGA 3UIUA 3EYHA 4CFUA 2C3JA 3P86A 2FH9A 2R3GA 4CT1A 2P0CA 2QODA 3HDMA 2A4LA 3U4UA 3POZA 2GPHA 4Q5HA 2WD1A 3V51A 1JQHA 2WXVA 1PYEA 2ZM3A 4NKSA 4NKAA 5AP5A 4RWLA 4ZSEA 2XKDA 5DRDA 5I9ZA 1D2HA 3HA5A 5F2NA 4USDA 5IDPA 4AW5A 2EWAA 2XNOA 1Q4LA 2OKCA 2XNBA 3PWDA 1OITA 3PIZA 4IWQA 3W2RA 4RVHA 5D10A 3MVJA 4YJOA 5AMNA 1Q8WA 3G6GA 2B9HA 1KV1A 4CTBA 1OL2A 4TRLA 4YLJA 5HCZA 4CXMA 4FOCA 5HORA 2ETKA 4O21A 1ZYDA 1PXPA 3FI8A 4I5PA 3SGCA 4AQCA 4CMUA 5TF9A 5DM2A 1YZHA 4FA2A 4FSZA 1P39A 1OUYA 2WMRA 4IAYA 5EYMA 1PRYA 4NZWB 3UG1A 2NP8A 2UZLA 2XVMA 1XJ5A 3UC3A 3FTFA 3ZBFA 4L7VA 3P78A 4LL5A 2QLUA 3OFMA 4BHNA 4DEIA 3GC0A 4FSRA 4RVTA 2N47A 5JFVA 5AJQA 1RI1A 1X1DA 4HH4A 3CJFA 5LQJA 3NNUA 3ZLWA 5FTGA 2YCRA 2XKFA 1HCKA 5ANIA 2Y0AA 3ZSIA 3K54A 1EJ6A 4IJ9A 4YLKA 5J9ZA 2IGTA 2PXCA 3MCZA 4EKLA 3GIWA 4KWCA 1A48A 3R30A 3RNIA 4BN1A 3HV4A 3BKXA 4XUCA 4A6EA 1WBSA 2UZWE 4LOQA 5AX9A 5HHWA 3U55A 3KMWA 5EI2A 3E8CA 5CZIA 3VS6A 4HCVA 1NW6A 4MAOA 4R7IA 2CN8A 4C62A 4TYHA 3ORXA 4W4WA 5CALA 5IPJA 5FDXA 5E9WA 1W98A 3TNIA 3UO4A 3ZBXA 5LVOA 4E32A 2V7AA 2VX3A 4I6QA 3C3PA 5HG5A 2W1GA 3Q87B 3SA0A 1PXKA 3QZGA 3A7EA 3ORKA 5DX8A 2V7OA 2QO9A 3DA6A 2XEZA 4E4NA 2ETRA 3O71A 3QHRA 4JDIA 3AXWA 2JHCA 4EOMA 2CDZA 3LFDA 3EFWA 3AC5A 1KOBA 3G0FA 3R04A 3ME5A 5AP7A 4WRSA 3CGFA 4PRJA 4I0TA 4Y8DA 4YV1A 3A60A 3DAKA 4FZDB 4YTFA 1JBPE 1SYKA 5CYIA 5AUUA 5A4CA 3ULIA 4DH1A 4I21A 4FEQA 2HWKA 1TVOA 3FKLA 1AV6A 2J90A 1GJOA 4K33A 4IZAA 2BZHB 1JSTA 4E4LA 2OIDA 3GC8A 4BDEA 1SVEA 3FMKA 3BYSA 3KQTA 4PYKA 5HBJA 2HENA 3PIYA 3HVJA 2WTKB 4IDTA 3IGGA 3HMOA 4YTHA 1BUHA 1PMUA 3QQHA 4ZK5A 5DVRA 4PMTA 5T64A 3SOCA 3VO3A 4KIPA 4AWIA 3I9FA 4F1OA 3HP5A 4O84A 2Z7QA 3L9MA 4U6RA 2EXMA 4FIEA 5LVPA 4L9IA 4WRGA 2JJQA 4WNMA 3RW9A 3TRKA 2CKEA 4KWPA 1R00A 4AZFA 1BI8A 4RC3A 1XWSA 3R9XB 4FZ7A 3MB7A 1GZOA 2GS6A 2R3QA 1JKKA 4FNWA 4L3JA 5I9WA 3G8AA 1VQ1A 3LPMA 2C6TA 1NA7A 3H30A 4U80A 5IMXA 5LCKA 2XK9A 4X0MA 4EC8A 4LWOA 5FADA 1JAMA 3CC6A 3RM6A 5HU9A 5J9YA 4FYOA 3FKNA 3G15A 4FNXA 3DV3A 4L8MA 1EJ0A 4JX3A 5HX8A 5C4LA 3FZOA 5CI7A 3N4UA 2J5FA 2JIVA 4YC3A 5IUGA 5CZHA 4JAJA 4YPSA 2CGXA 4YO6A 2GHLA 2C68A 4C59A 5HNGA 5FDPA 3O7LB 2RKUA 4IX4A 2W9ZB 1MUOA 5IEVA 3ZEWA 1G3NA 5EC8A 3I5NA 4FNYA 4XBUA 5HVKA 5KX8A 2UV2A 4TYEA 2VWVA 3LDUA 2PX4A 2X6DA 2XYUA 4JQ8A 2ZULA 5EM6A 3RJCA 4Y30A 4HG2A 4CFFA 2WTDA 4F7NA 5CCXA 4QT1A 3MESA 1NW1A 2IZSA 3BE9A 4NM0A 3FPEA 3NTVA 3ZEPA 1SNUA 3RPYA 1WBVA 3DKCA 4ANBA 3OT3A 1ZKDA 2YXDA 2PY3A 4EOOA 3G2OA 1XH6A 3SXJA 4EHVA 4CSVA 4OT6A 3MS9A 3GU6A 5G6VA 2PHKA 3PRIA 4B8LA 4CMTA 5C4KA 5EVJA 4C4FA 3LLTA 4DE4A 2RFEA 3C4CA 1OM1A 2X81A 3KXHA 5KZIA 4F7SA 4PNKA 2ZBQA 5CUQA 4BP3A 4RTSA 2NP7A 4HCUA 3BLRA 4QMMA 5F2OA 3D5XA 4TKSA 5HI2A 1HOWA 3G2QA 3WZEA 4M3QA 3NVKI 4TWOA 3QRKA 1M7QA 1Q24A 1RJGA 4Q9ZA 1BYGA 2UW8A 3QTXA 3R2BA 4U40A 2F7ZE 2QO7A 2NYUA 2WU7A 3AT2A 3DMFA 3R7YA 5EMMA 4OT5A 1ZLTA 2H9VA 2OJ9A 4E5AX 4NW5A 5GJDA 5FUBA 2BKKA 3RALA 2VTQA 4EOPA 3K5UA 3PJCA 2GHGA 5ETAA 1H28A 1UKIA 2DUVA 2O64A 3OTUA 3Q5IA 2ZMCA 3QQKA 4PV0A 3C6MA 3LDFA 4G6OA 3RVGA 4QO9A 1JQDA 4OBXA 2WTKC 1W83A 3EFJA 2P7IA 3DU8A 3IOKA 1CKPA 3KN6A 3L8VA 2PL0A 3CKXA 3DTCA 2O07A 3EMBA 3LKDA 5IA2A 3VHKA 3LAUA 1R39A 4BIEA 1KSWA 3F69A 4MBLA 4DH3A 3EQRA 4FKIA 4EH3A 4IW0A 3OG7A 4O2PA 2QOBA 3CJTA 3E05A 2UYHA 4BDKA 1S9JA 2YIRA 2HNKA 4QDKA 5FHRA 4ACGA 3V8VA 3O8UA 3CTQA 3Q2JA 5D9HA 4EVIA 3NAYA 2G1PA 3MFSA 1J7LA 5HNBA 4EWHA 4YGAA 2JH8A 1XJDA 1SG9A 5BMSA 3PVCA 3G9NA 4MNEA 3DB8A 1FVTA 4PDSA 2P4IA 4A7CA 3JVSA 1GIJA 2HAKA 5CT0A 5CSWA 1B6CB 1V1KA 5HESA 4KS8A 1D2GA 3AWIA 4U97A 1W0XC 2ITVA 2YN8A 4M0YA 5E8SA 2PT6A 4JBPA 4I6FA 5L8KA 2AOTB 4RZWA 3F7WA 1BKYA 2YERA 5U4XA 2OI4X 3BIZA 4PL4A 5EKXA 4QMLA 2QG5A 3R6XA 5EM8A 2B7AA 2BRGA 2HW6A 2OIQA 2QC6A 2X8EA 3H4JA 5AP6A 4D58A 3LXKA 5GIOE 4L52A 2I7CA 2P2HA 4FTOA 1PXLA 4ANLA 4CFNA 3UYSA 3C0KA 3REOA 1DUSA 3LHJA 3UJCA 2IVUA 4ZJJA 4ANSA 5DWQA 4WUNA 3ATTA 3VW6A 1VR2A 4OBPA 3MA3A 5E8VA 4DG3E 2IJMA 1FPQA 2AVDA 5HLWA 3EEYA 1APME 4G5JA 4RTMA 4K18A 3BX5A 1P1BA 1ZARA 3PJ8A 2OJFE 2B9JA 4DC2A 3ELWA 4DZRA 4BP1A 3NS9A 4BHZA 2CNUA 2PZYA 4B0GA 4BTMA 5KMMA 4QMYA 1Y6AA 5HILA 3UJBA 4FKGA 3KRWA 4YHJA 3U6HA 5GINE 3FRIA 3Q32A 4MF1A 3QA8A 3D5WA 3E93A 5BW4A 3OHTA 4AG8A 4JT3A 3HCDA 4X6RA 4AT4A 1GOLA 2R2PA 2YQZA 2ZIFA 4U45A 5TKDA 4YNOA 5B2MA 2BALA 2PZPA 3FC2A 4PINA 2WB8A 4EJNA 4YUVA 3H10A 3UO6A 5LVNA 5FP5A 2CKDA 4F7JA 2R7IA 5FGKA 1U54A 3N9XA 3VF9A 4Z16A 3EGIA 3GCZA 3V5LA 4TWCA 3FYJX 2BR1A 2XS0A 3BU5A 4C3FA 4A9SA 4QTUB 3DKFA 2YJRA 3MTEA 3GVUA 2WA1A 2WHBA 2ZJWA 4O0SA 4M13A 1FPUA 2BVAA 4CZTA 3TFWA 2OZAB 4IMYA 4UEUA 4BGQA 3TR6A 2YZAA 2GNHA 4B8MA 4PYOA 4FIGA 3R1NA 3OE5A 2BHEA 1SQGA 2YVLA 3F88A 1LEZA 4MNFA 4BZOA 1ND4A 1SUIA 1Q8TA 3HDNA 5E8XA 1UFKA 2UZNA 2CN5A 3OT8A 4DGLC 1Q3DA 2C1AA 2RFSA 4F09A 3KRJA 4IM2A 3FPQA 1H24A 3PDTA 3PTGA 3GXOA 5FTWA 5IMEA 2XIKA 4C2VA 2ORED 2KW5A 4YNEA 4ZXTA 2W1FA 1ATPE 3Q9ZA 3EQCA 3F5GA 5T6KA 4DINA 4Z7HA 3VRYA 2XBJA 2JD5A 5E8UA 4ENYA 4LV5A 2GLUA 3D2IA 2IVTA 2PWPA 4RTRA 2JEDA 1ERKA 3EH9A 3L1SA 4I24A 4AZSA 2BIYA 3SSNA 3JWGA 3FKOA 2B9EA 5FQNA 2X4FA 2IH5A 4EHEA 5DNRA 1YOMA 2UVXA 2VTMA 4GT4A 3ORMA 5EKOA 4L67A 5L6WL 5M4IA 4DITA 1QMZA 5HE0A 3BWFA 2YX1A 3NDJA 3EQFA 2R4BA 3H0YA 3ZUUA 2WQMA 3GU5A 3L9NA 4D2RA 4RTKA 3CR0A 5E1EA 3IG7A 3OC1A 3BU3A 3RCDA 5LMKC 4DQ0A 4FV5A 1NVRA 3QOWA 4R7HA 4FT7A 2ZAZA 2VZ9A 1ZYSA 3TTIA 2REIA 3VF8A 4FP9A 3OEZA 3VBVA 3HUBA 1UU8A 4BTFA 4U43A 2EXCX 5CXZA 3TNQB 5FEQA 3OXIA 4RJ8A 3L8DA 4DCGA 1WBTA 2W5BA 3G51A 4YTCA 3TJDA 3QZIA 2QY6A 3MPTA 3HV5A 4OLIA 1K9AA 2W4KA 4L3PA 5EHIA 2UW6A 4FTQA 4BRXA 1XCJA 4MXAA 2PJDA 5ICFA 4N0SA 2H6DA 2HOGA 4BDJA 4BZNA 4BCOA 1L8TA 5CF4A 4X2FA 5EM5A 4P7JA 4EH8A 3TI1A 4JXFA 4RJ6A 2B9IA 4UYNA 1R8YA 3GEQA 4PYIA 3CQUA 2GQRA 2JKOA 4II5A 4V01A 3RAKA 4A9RA 4DGOA 2FYSA 4FL3A 4DGGA 5EKNA 2ONZA 2P8JA 2ERCA 5K4IA 2V55A 4MTLA 3S00A 4CV8A 1ORIA 4HTFA 3PSCA 1JG1A 3PVWA 1H25A 5HD4A 1EH4A 2C3IB 3DKGA 4DEGA 5E7RA 2PX2A 3EVDA 2UZBA 4O81A 1U59A 4DGNA 3KU1A 5HOQA 1W7HA 4BBMA 3TPZA 3KPJA 3TUDA 2Q83A 3BLHA 3UJGA 5CEIA 3TOSA 4LRMA 5AA8A 2UW0A 3QTIA 5AP1A 5GOZA 3CJRA 4FV1A 2VTTA 3ID6C 4ALUA 3P23A 2QYOA 1L1EA 4M38A 5CVHA 3HVCA 2VWUA 2O63A 2PUIA 3JY9A 3WF6A 1SQFA 4P4CA 2QRVA 2WTCA 1PMVA 4KDRA 3F5XA 4I6HA 1H01A 1IXKA 2EJTA 4RG0A 5E8WA 4X61A 2VTHA 4RIWA 3KULA 4CKEA 3P5KA 4DG2E 2HY0A 3S3IA 2CGVA 3C5UA 2BKZA 3GXLA 3ZS5A 4NIFB 1W8CA 2CJMA 2GCDA 3EB0A 2P55A 3ZO1A 3Q4CA 4O91A 5CANA 2XA4A 3AY0A 4PTGA 2VTJA 3DTNA 5ERGB 4DEEA 1T46A 2IZRA 3QCYA 1RJBA 4IAIA 3DUWA 5FTQA 4E2YA 2VNWA 3ZDUA 4MD8E 2OYRA 3PVBA 4XUFA 3ORPA 3EZVA 4Z55A 2CCHA 4U3ZA 4ZJVA 4XCXA 1UNLA 2YM8A 4RVFA 4BIBA 2OFUA 3SXFA 5EQJB 1UWHA 1DI9A 2WU6A 3PSDA 3IDPA 4LL0A 5DXAA 2WMVA 4V0RA 4M69B 3VC2A 3S1HA 3ERCA 2OH4A 3DPKA 4ZS0A 1IM8A 3V97A 2Y4PA 3COMA 3OXTA 3R0QA 3FLZA 3FMEA 4RWJA 3BWBA 4YZBA 3G8BA 4USEA 1Q8ZA 4L68A 5DBXA 3M6VA 4AA5A 2QNJA 3DOUA 1OPKA 3WZJA 2VO3A 4I3ZA 3UE4A 2XBMA 1JWHA 1URWA 1KE6A 3AJDA 2QI8A 4GUBA 5EYCA 4F0GA 3CCFA 5HX6A 3N4VA 5EQPA 5LVMA 3M70A 3KRLA 3RAIA 1LP4A 3R00A 4O96A 3PRFA 4LV8A 4DH7A 1DL5A 4AN9A 3LFAA 4AS0A 4ENXA 5JEBA 4E70A 2YAAA 3BHVA 4IANA 2R3MA 3PLSA 4RX8A 4DT9A 2BM8A 1VYWA 5BQ0A 2HTEA 3LFQA 5KS2A 3D5VA 3FZTA 2ZVJA 3COIA 3HEGA 3G6HA 3IW8A 4FEUA 4E73A 4J52A 2FPOA 4FG7A 3BQCA 4H05A 3FPJA 4UWCA 2VU3A 1JSXA 4ZZNA 5K5NA 3R2YA 2Q0BA 3OZSA 3NDMA 3G2FA 3I7CA 4QQTA 3QTZA 2GDOA 4HPUE 3VULA 4TYHB 1MRYA 4KRDA 5ANGA 3ZU7A 3DQWA 1R8XA 4TXCA 2I6GA 3VSEA 5DG5A 4QP6A 4MHAA 2YCQA 5K0CA 3KXZA 3ZXZA 3EQGA 3LW0A 5D7VA 4AW0A 4CKIA 1YKRA 3KVXA 4EK5A 3KQQA 3D14A 5EG5A 4FGRA 3D7TA 5HG9A 4XG7A 4EOLA 4FTIA 1GNGA 4BDGA 3CD8A 2XCHA 3TTJA 2WK1A 4K1BA 3A26A 1ZYJA 1NBIA 4DCMA 7MHTA 5L2SA 1H08A 3A4OX 2F2CB 3A8WA 2BROA 5K0JA 3FLNC 3QD3A 3THSA 3MB5A 2OGVA 5ANOA 2UVYA 2HIWA 3QTUA 4YP8A 5CM2Z 3PX2A 3SVVA 4ZTHA 1I4WA 4EOKA 3R1YA 2UW3A 1I44A 4QTCA 1N2XA 3BHYA 2GAFA 2BH2A 5CX9A 4CG8A 4IVBA 4GSBA 4CD0A 1VP3A 2BDJA 4NW6A 1R1WA 3PPZA 5DT0A 4L6QA 1KPIA 4P7GA 5MHTA 4OTWA 3UIMA 1L3RE 1WXXA 1B39A 3GU8A 3FI3A 4NK9A 3P9IA 4ER0A 2V74B 2C5YA 3ZO2A 4L44A 5D41A 2H00A 3A4TA 3OE4A 3QU0A 3HP7A 3VUKA 5AP2A 4Y85A 3KL8A 4QP2A 5HVYA 4C33A 3EVBA 3KA0A 3F7ZA 4TT7A 4KBCA 5K3YA 4V0GA 4EH6A 3TM5A 2W1HA 4BCHA 3RM7A 4HGEA 3ZRMA 1KE5A 5BPYA 4ZSLA 3FMJA 3CTHA 3I60A 4GL9A 3G5LA 3HVHA 2G2FA 4BKJA 2B52A 3GB2A 3VNTA 2OH0E 1XH5A 3SW4A 4EMSA 3CTJA 3BHTA 4L42A 4CGAA 2A27A 3M6XA 4E2XA 5C9CA 2O57A 2E9UA 3P4KA 5ICGA 4QNAA 1Y8YA 3FQSA 4JDHA 1V0OA 3ATSA 3EN4A 5FHQA 2VWYA 4BBEA 2C6IA 2PSSA 3GCSA 5M56A 3HLLA 3QCSA 1L3CA 2BDWA 4XBRA 3D0EA 1SVHA 4C4HA 3H0ZA 4X6QC 3TM4A 2VO0A 5BUJA 4TNBA 5L3AA 3DJ7A 1Y57A 5GIPE 1XH8A 2J2IB 2ERKA 2VTRA 2G72A 3VN9A 3DBDA 3RK5A 3RK9A 5K0NA 3RP9A 5JFWA 3B8QA 2WZJA 3FEGA 5E1DA 4I92A 2KTYA 4WNKA 3ORNA 2CHLA 2GS7A 3A7JA 4MK0A 4EK4A 4L7SA 4M8TA 3SRVB 1PJZA 3DXYA 4ONAA 4F65A 2OXXA 3DB6A 4DA5A 1IA9A 3NYXA 3HTXA 4AFJA 4MH7A 4YSMA 3T7SA 2I6LA 5BW5A 4CTJA 4XLIA 3U6IA 1IA8A 3LJ2A 1NKVA 3AC4A 4H1MA 4Q9SA 4PYQA 2WMQA 5FTOA 3LPBA 4E20A 4PYLA 2B3TA 3CXWA 3IKAA 4FT5A 3FQEA 4IM3A 5K0EA 2I0VA 3LMIA 2VAGA 4AW2A 3WBLA 1UWVA 4M68A 1UVRA 4YC6A 5HZMA 3VS7A 2ZFUA 4WA9A 3UJ9A 2YFXA 1QPDA 4PL3A 4FKRA 5CSVA 4LRJA 2WOTA 5DEYA 4EQCA 4TL0A 4DFBA 2VO7A 3HVKA 4WHZA 2E9PA 2JDOA 3HV3A 5DGZA 3BEGA 4ZTQA 3BZ3A 3T3VA 4GU9A 4FSMA 2VX0A 3UVRA 3NMUF 3LCUA 3M6UA 2JG3A 3QFVA 4GKIA 4LOOA 3AOXA 3QOXA 3ELJA 5I9YA 3MYGA 3OEFX 4HGTA 4PP9A 4XS2A 3R9HA 4BDHA 4RBLA 4ALVA 5M4UA 3AXSA 3SX0A 5DT4A 4N57A 4XG3A 4GMYA 4EOSA 2BZGA 1O6YA 3FMHA 3EVAA 3NDIA 4A9TA 3T7TA 3O17A 2UYCA 1ZZ2A 2WQNA 5JN2A 2YCFA 2PUPA 3A7FA 4JS8A 5K0GA 3GBZA 3DNEA 3FI2A 1AD5A 3IEIA 1M0EA 3RZBA 1JQEA 5M44A 2AOVA 3FBVA 3MVHA 3OD6X 4FZAB 3UJ8A 4GK2A 3AMBA 3PFHA 5IA1A 1YXXA 3C0GA 4KAOA 4RVMA 4XG8A 4BCKA 4HRAA 5CLPA 3AMYA 4RC2A 5HG8A 4NYEA 4G1WA 4RMZA 5K03A 2AS0A 3LKMA 1P4OA 2VNYA 2ZB1A 4C35A 3DXPA 5HZNA 5F1ZA 4OBWA 4C3PA 3HMPA 4O6LA 3ACKA 3EN5A 2YEXA 3QD2B 4GVAA 4IADA 4NU1A 3TXOA 3ZC6A 5HE2A 3FXXA 1PXIA 3ZCLA 5KMKA 1PJKA 2A19B 2VTPA 4JJRA 3R8VA 1KV2A 4IX3A 4EUTA 2OB2A 4DFXE 1RE8A 3BQRA 3IGOA 5BVFA 3HMIA 2QRVB 2CMHA 4CLIA 3QQLA 5E8JA 3F3VA 4WG4A 3U9CA 5FWDA 3UA3A 5GHVA 4DBXA 3S68A 2PU8A 5IZFA 3EEOA 2VGOA 3O8PA 1R18A 4FGBA 3LIJA 4G3CA 5TOZA 4FBXA 2OZOA 4BCQA 4YR8A 5DX0A 3KK9A 4XP3A 1PMNA 2BFYA 4GVJA 4J96A 3EN6A 4MKCA 5AM7A 4AA0A 4BBFA 4BDIA 1YUBA 3H3CA 3U81A 2YM3A 5IKMA 1BMKA 1P14A 2I9KA 2PVFA 5BYLA 2ZMDA 4B17A 1YF3A 1KE8A 3DK3A 4QTAA 4FIIA 3T9TA 4EH7A 1OUKA 5LARA 3CQWA 4IAFA 3ANQA 3OZTA 3PY0A 5CU0A 1WG8A 4FSXA 3KULB 3WILA 4DHFA 5JQ8A 2CMGA 1NVQA 2UW7A 2ESRA 3HA8A 3AC2A 5EFQA 2C6MA 3EZRA 4XG9A 3ZUVA 1XH9A 3G5TA 3RHKA 4G5PA 4HC4A 1V0BA 4QMQA 3I0QA 4YHTA 3QXPA 1IG1A 4UXLA 3S95A 4MTAA 3NWBA 4CFWA 4UWBA 2VRXA 3O7LD 4QMWA 4R3RA 4K77A 3MPAA 3PA3A 2GNJA 2OW3A 4ANMA 1ORHA 4C4AA 3P7BA 3UFBA 4FTTA 3SLSA 4E6QA 3E63A 4F0FA 3FTCA 3ZLYA 2OLCA 1OECA 2WTJA 4AAAA 2PT9A 1KWPA 2OO8X 4QPAA 5ETIA 3PXQA 3AQVA 4YBJA 4OA8A 3SC1A 2RG5A 4ITJA 3V5WA 1CKIA 3KB7A 3UGCA 4IV8A 3PY1A 5AUWA 4IQ6A 5I0BA 4M67A 2IWIA 1XVAA 1BX6A 3GENA 3V01A 3QGWA 1KYWA 4BI0A 4RIYB 4U8ZA 2RL5A 4F9YA 5LOHA 2R7BA 3NX8A 5L2WA 4CKRA 2H1RA 4G3GA 3OW3A 4YJVA 5EW8A 2WO6A 5F94A 3OROA 4D1ZA 4GJ3A 4O2ZA 1U5QA 4A6DA 5A4QA 3BYMA 5BXYA 3TNWA 3HUCA 5M51A 4NCTA 4MWHA 4RWZA 4GEOA 3WF8A 2ITPA 4IIRA 3TQSA 5A6OA 3TEIA 3UC4A 3OWPA 4BCPA 3W8LA 3WIKA 4DFLA 1G6Q1 3T0IA 4F84A 1IRKA 2YACA 4EBWA 1KPHA 2HZIA 4BICA 3ORLA 4G9CA 4BZDA 4FTUA 1VPTA 2FYTA 4D9UA 4Z7GA 5HFJA 4F1MA 5CU6A 1TW3A 4F7LA 3TZ9A 4HVHA 1EIZA 2ZB0A 3EL8A 3VBTA 2C1BA 3UQGA 2H8HA 2X7OA 3KQSA 4KINA 4YJUA 2UZOA 5EZSA 3LXNA 3MH2A 4H39A 4PUZA 3K3IA 3UZUA 4ITIA 4GS6A 4FS8A 3FHIA 4JG6A 1M7NA 3F2RA 2FUMA 2NXJA 3FPHA 2XNEA 4U41A 5GM2A 2NO3A 2C4GA 2EB3A 3BPRA 4E6CA 3R71A 2BIKB 4L53A 4YV0A 3PVUA 4K9YA 5JMSA 5LJJA 4QYFA 1Q62A 4ZZOA 4Y5QA 4FKLA 4IHPA 1JNKA 4ACCA 4B6LA 1LUFA 2FVDA 4J98A 4EI4A 2HMYB 2H34A 2XMYA 3D4QA 3UZRA 5KZ0A 5AAFA 4U9AA 3ZFMA 4AOIA 3KR0A 5H8EA 3QALE 4OTDA 1UU9A 3KCKA 3C4ZA 2XIZA 3G89A 2PX5A 2W99B 2Q41A 2ZTHA 5C9ZA 4WT6A 3TWJA 4PIPA 4FKJA 1G5SA 5HTBA 2A2AA 1Z5MA 2R0IA 3BBWA 4BDCA 2W7XA 3BU6A 4C58A 1NXKA 3F2AA 4FTRA 1H1PA 5JH6A 4L7FA 3R28A 3F5PA 2FCAA 1DAYA 5EKUA 3VRZA 3FPGA 3EWHA 3ETAA 3P7AA 4JX7A 5M4CA 3GRUA 5EW9A 5H8GA 1R74A 1H27A 3A2CA 3P79A 3RPSA 3F3UA 5AV4A 5CEPA 2YR0A 1JTFA 3GI3A 2YIWA 3PYYA 2YAKA 3QV2A 4HYIA 4PMMA 2P3GX 3TL8A 3W55A 3PFGA 2XNPA 2X2KA 3DT1A 4FEVA 1FQ1B 4PF4A 4AOJA 3TZMA 2G2HA 4EUUA 3OS3A 3FI4A 3VBWA 3PIXA 4HZRA 1PXNA 4O86A 1GZKA 5HE3A 3QAME 1OKYA 4BCNA 1AF7A 5I9XA 1X19A 4ISCA 5DSXA 1O6LA 4WG3A 1PXMA 1OBGA 5CVVA 3BGVA 4EJ7A 4X63A 3C3YA 3AD5A 2C6KA 3SM3A 4U7PB 2R3OA 2O06A 1E1XA 2W05A 3IK3A 3L8XA 3LMHA 2PMIA 3TKAA 4PDYA 5FEEA 4ZTNA 3ZTXA 3KR2A 2JDSA 3OUKA 2BHHA 5JZJA 3OTVA 3MCTA 5L8JA 3NUYA 4DLIA 2G9XA 4DTKA 1KE9A 3IQ7A 5CEOA 2CWWA 5KMOA 4QTEA 1XR1A 5ANEA 3WYYA 3MAGA 3IO7A 2LD4A 3D83A 2P3LA 4RWKA 4EH5A 3U51A 3UMXA 5T3QA 1Q3WA 3IW5A 3KEXA 2XIYA 3UDBA 2ZM1A 3MTIA 1FINA 5FXSA 3KC3A 4IB1A 1F5QA 1SVGA 4TWPA 4Y5HA 2KULA 4KIFA 2JFMA 4IFGA 4OUCA 3ACJA 4XRLA 1ZOEA 4A9YA 4HCTA 2E9NA 3GQIA 3DJ6A 3E87A 4IAZA 4X2JA 2B4SB 2AYPA 4CLJA 5KUPA 5JUWA 3UOKA 4RX7A 3DDQA 2IG7A 2YISA 5AUVA 4AF3A 4CFMA 5KO1A 4QTTB 3WIGA 1A9UA 2C0IA 3HCEA 4YPDA 3FLQA 4L46A 3QRTA 4MCVA 3E3BX 1PHKA 5EOBA 1RJFA 3EQHA 2QOFA 4QMPA 3NIZA 1YDRE 5EMKA 1D2CA 4EONA 3M42A 2QKRA 3E64A 4P7KA 4J95A 3HKOA 1U46A 3SDJA 4GFMA 4D0WA 5A6NA 1M6EX 2A14A 3DK7A 5DM1A 1M52A 1XDZA 5AUXA 3A61A 3PY3A 4PYMA 4BCGA 4GK3A 3MWUA 3E3PA 3QC4A 3MGGA 4GIIA 3SG8A 5EYDA 3EVZA 3DZQA 5FD2A 3ZFXA 1NBHA 4KW7A 4IM0A 2ZM4A 2WEIA 2CNVA 2WA2A 3ODZX 3HAVA 5FXQA 3Q6UA 4DKJA 4JQEA 4GUEA 5GM1A 3BKBA 1G60A 5K05A 4LI5A 5CWZA 4FG8A 4FTJA 5IQAA 1YXSA 3DFAA 4RYLA 4X3FA 2J50A 4IAKA 3FYCA 4MBIA 3EGVA 3GT8A 4W8DA 1WVXA 1P2AA 2BRHA 3NUSA 5LWMA 4OX9Y 4A4XA 1UU7A 1MRUA 3TUBA 1VZOA 5G1XA 4X60A 4X2GA 5EI6A 1XBAA 3DR5A 4BR3A 4EYJA 3THBA 1VJYA 4G16A 4F6WA 4XV2A 5IQDA 5F4NA 5T68A 3CGGA 1XO2B 2O8YA 3HZTA 3QF9A 4M84A 3LKZA 4F70A 1ZGAA 1JOWB 2PVHA 4S33A 2PWLA 3TG1A 3AGLA 2VZ6A 1INLA 5CIYA 2X4ZA 2Z7LA 2PE0A 3F3TA 2PKWA 4R05A 5DPVA 2Z6QA 5F9EA 3D2LA 5FRIA 3F3ZA 2G71A 5AUYA 2NNWB 4JXJA 3TLJA 3BT7A 2YIXA 4TTHB 3C50A 4H3BA 4L45A 2XKEA 1SKMA 3P9NA 3UOJA 4OR5A 3VJNA 4ASDA 1RI4A 3KCFA 4BVUA 3N4TA 3PP0A 3UP2A 3KQWA 4M97A 3MFUA 3POOA 2VDUE 1QCFA 2QU6A 4HSGA 1Q0TA 3I79A 1JKTA 3EQBA 3L9PA 3OZ6A 2IBTA 3G2MA 3KVWA 3OXZA 3UODA 4CCUA 2X1NA 4QP1A 5A46A 4D1SA 3F4KA 3F9NA 3MPMA 3VUDA 3PJ3A 2C47A 4KSPA 5AP3A 2BTRA 3DLIA 5KE0A 3TM0A 3KN5A 2FHPA 2UZ4A 3GC9A 4WNPA 1OKVA 2BFXA 2PVNA 2NPQA 4K2RA 4MXOA 4BI2A 4FE2A 1KOAA 3NWEA 3DOGA 4UN0C 4ZMEA 1YI6A 3RINA 3COKA 2PVLA 4MNEB 4E7WA 4MXZA 4IFCA 2GHMA 4XP2A 5BNJA 4FL2A 2B9FA 4HGYA 3ZO3A 3HNGA 4E4XA 4OTHA 3B5IA 2YTZA 2W0JA 1XDSA 4JBOA 4KBKA 4EYMA 4TYJA 3UOLA 4M37A 3RODA 4F64A 4YUYA 2W06A 3KXMA 2GS2A 2R0UA 5EM7A 3ELYA 3FUUA 5K9IA 4D4VA 3LX6A 3MJ1A 1QAOA 1VL5A 1K3AA 5LQUA 4D4YA 1KPGA 2O05A 2OBFA 3UVQA 4DH5A 5A3XA 1XCLA 1OIQA 2BCJA 4DFYA 3BLQA 4IB0A 4MEDA 4AZTA 2R3FA 2RFNA 4G2FA 5KNJA 1XQZA 3PJ2A 5M55A 4PP7A 2QQ7A 3TV4A 4F9CA 2XIRA 1NW7A 3FY2A 3Q7EA 4PIMA 5DTMA 5IQEA 3M33A 3KQMA 3ZM9A 3ZXTA 3ZM4A 4V0GB 3AD6A 4KIOA 3VUIA 1TKIA 3HCBA 3LCDA 3KRXA 1PYXA 3CLYA 1F3MC 2W4OA 2PMLX 2OF4A 1GZNA 1X8BA 1M2PA 3NCZA 2C7QA 4N4SA 5M07A 2XK8A 4D28A 5KYGA 4FKQA 3KREA 1P5EA 4BDBA 4ASZA 4N6YA 2W1DA 5CF6A 1YZ3A 4GW8A 5JK3A 4QVGA 4R6XA 5EGSA 4YBKA 4JR7A 3I5ZA 2I0EA 4LUEA 5J95A 3MH3A 3RPOA 3LCTA 3P08A 4IC7A 2VV9A 5C27A 4EK6A 3ZRKA 3ALOA 3DZOA 3HA6A 4AT5A 4BYJA 5EDRA 5CT7A 4BDDA 1Q97A 5CNOA 3MVMA 1AQ1A 4UB7A 4LM5A 2YM6A 4S34A 1NE2A 4FR0A 4PY1A 3DMGA 4RTOA 2OXDA 4JG8A 1JG2A 2VUWA 1UNGA 3R1QA 4HVIA 3NZ0A 3T3UA 3VS3A 3FTEA 5HNIX 5CTPA 4O7RA 1G55A 5E91A 5KCVA 2P3QA 3FRHA 1H4LA 2XRUA 2X2MA 4JRNA 5E1MA 4R77A 2Y9QA 1WVYA 5DOSA 3ZLXA 3MQ2A 1DM2A 4KD1A 5FM3A 4QMOA 1WZYA 3PA4A 4QMVA 4AOTA 5IEXA 1WBWA 3A27A 3K6RA 1SVUA 4I0RA 1ZQ9A 4WNOA 3C6KA 3QKLA 3LL7A 4FEXA 4EQMA 2VWZA 2YA9A 4QPSA 4MVFA 3B8RA 2J0MB 4JRVA 2ERZE 5CVUA 3V5PA 2OJIA 2WQBA 3NEWA 3OWJA 3PE2A 4O7ZA 1V0PA 3IW6A 3MH1A 4F9BA 3O31A 2ACXA 5EMLA 4PCLA 3R8UA 4E1ZA 4ACMA 3EVGA 3PPJA 4WXHA 4YMJA 2JBOA 3V5TA 1OR8A 2OSCA 4IZ7A 3UVPA 5DRTA 4FV0A 1AQJA 2R3IA 5M06A 4G3FA 1CSNA 1H0VA 3ORTA 3EQIA 3FWQA 5ANJA 3FHRA 4QMZA 2F57A 3OU2A 3FXWA 2PE1A 2XM9A 4HNFA 4OQDA 3M2WA 3SMQA 3UG2A 4FKUA 3LQ5A 4JG7A 2ZSUA 2JKMA 3O51A 2B55A 2OZVA 2HW7A 2YZLA 3BRBA 2C5OA 5IQHA 3RPRA 3LJ1A 3Q4UA 2RFDA 2W5AA 4AXAA 4C05A 2PSQA 4RTJA 4C34A 3EVCA 3RIEA 1DCTA 2VDVE 3C0IA 3I5UA 4A4LA 3VS4A 4F9AA 2PTKA 4FTCA 1NW3A 3ZSHA 2RG6A 4NM3A 1F38A 3C5IA 2PVJA 3F82A 2YDKA 3M11A 2G01A 3SOAA 4BIDA 5LMBA 1I09A 4KBAA 5B7VA 2W1CA 1QPJA 3V5JA 3ZO4A 2AVNA 4IWDA 4O0RA 1F3LA 4FGZA 4V0QA 5DLYA 3R8LA 3U9NA 4B99A 2HYYA 3PFQA 5D7AA 5JSMA 2UYOA 4OQEA 3P9JA 4QTBA 1JG4A 2X9FA 3MA6A 1OPLA 2ZDTA 3QX2A 3BGQA 4I22A 4FV2A 3UBTA 2WTIA 4HYSA 3R7IA 2XYVA 4LECA 3NSZA 4MHTA 5JZNA 5E9JA 3NW6A 2R3PA 2B78A 2VTLA 2I40A 2JC6A 2AOWA 2YHVA 5EDPA 2DYLA 5TR6A 4TN6A 4BGGA 2ZWVA 3GRRA 4XP0A 5DTRA 4YJNA 3W32A 5CF5A 4I23A 4FK3A 5E1OA 2IZTA 5CVDA 3F61A 4C02A 4IC8A 4D2SA 4OTIA 2EUFB 4FZFB 3OVVA 4MIKA 2WPAA 4R78A 1R0PA 2WMAA 4IE9A 4PYJA 1ZMVA 2GTNA 2VN9A 5HBHA 5IF1A 3ELUA 1KHHA 3DP7A 2XJ2A 3OUNB 3HECA 2C7PA 4ZEGA 1YFLA 3QTQA 4BTJA 4EORA 3GP0A 1YXVA 1G38A 3BGPA 5K8VA 4RFYA 3KQVA 4EKGA 2JKQA 1H00A 3LFSA 3MJ2A 4HNIA 4MBJA 3HA3A 4M36A 4PCAA 2G15A 5AUZA 2LAVA 4ZMFA 2GA9A 3E92A 4GV1A 3P7CA 5JRQA 2FSOX 3EFLA 3P9KA 3CBGA 1JSUA 3A7HA 3DNDA 4H1JA 3KQOA 2HCKA 3HL7A 4C08A 4FT4A 3GCQA 3KU2A 3NUPA 3DDPA 5AP4A 5TT7A 2JLDA 5KKRB 2R3LA 2DS1A 5IQCA 3O50A 2B54A 2PBFA 4CT2A 2VX1A 3A4PA 3CGOA 1ZMWA 3DQXA 4FKSA 4QRCA 3HV6A 4FSWA 2Z02A 4RVKA 4XG4A 1VEBA 2W96B 1XHAA 2X6EA 3KPWA 3SSOA 4ALWA 2CLQA 1KUTA 4FSYA 4EOIA 3DAEA 4EZ3A 4BCIA 5JFSA 4QPPA 4CTKA 4Q5EA 4QMTA 4ACDA 2EJUA 4YUZA 2A1AB 3IDCA 3OY1A 4C7TA 4NFMA 4D5KA 3QGYA 1CMKE 5LCJA 2FGIA 4O6EA 5L6PA 1AQIA 2GS9A 4ER7A 1Q41A 1VBFA 4ZIMA 3C4FA 3WYXA 4QDJA 5JGDA 4ZZMA 3QYZA 1LR4A 4QMUA 4X7QA 3P2KA 2BTSA 2JIIA 2JHAA 5CEKA 2XNGA 5HIBA 4EEVA 2G70A 4NM5A 5L8LA 3GWZA 5LR6A 3I6UA 4G6NA 4KIQA 5EH0A 4JAIA 4YU2A 2AOXA 2HWOA 3F5UA 3HEMA 5DT2A 1ZHFA 4QVKA 1OIRA 4FIFA 2DQ7X 2H11A 4R3PA 3S0OA 2V5QA 4AACA 4C07A 3GCUA 3TIYA 5IA3A 4ZJIA 4XLVA 3MI9A 3UO5A 1YXTA 4G56A 4HYUA 3MERA 5K09A 4C4JA 3HA7A 4E30A 4RZVA 5HKMA 3SXSA 4D4RA 5K01A 5E4HA 4DTBA 5CI6A 3G90X 2IW9A 3P97A 3EVEA 1MJFA 3PX3A 5KBRA 1KR5A 2PY6A 4FVQA 3QCQA 4G31A 4ZLOA 3FE3A 4LMNA 4RQKA 5LXMA 4WBOA 3VBYA 5E2BA 4FX3A 3FMNA 5JGBA 5B1SA 1Q8YA 3TNPC 5JGAA 2ITTA 3JS2A 2I7QA 1RI2A 1YHSA 2I1MA 3HVIA 2O3PA 2W1IA 5CS6A 3ENMA 4WIHA 4RSSA 2YXLA 2V22A 4X1OA 3DLZA 1QPCA 2XJ0A 4O0VA 4FKPA 4HGLA 2R3JA 2ZZMA 3NUAA 4EK8A 2R3RA 2IH2A 4ZY6A 3UBDA 1BOOA 4RC4A 4BI1A 5E90A 1UNHA 4O0XA 3ULZA 4C4IA 4KKHA 3UQFA 3ZHPC 3EQPA 3WOWA 3TIZA 5J9LA 4C04A 3ERKA 3BELA 3V6RA 4QP8A 3HGKA 4HGSA 4DEDA 5CXHA 3TUCA 4E31A 3E62A 1NV8A 1RI5A 3LDGA 4DMGA 2PZRA 4GRBA 2J51A 5M08A 3IPHA 4LRKA 5KHXA 2UW9A 4YJPA 1PF8A 3FL4A 3KQPA 3TV7A 4GC5A 1ZXEA 4A9UA 3VBXA 3KKZA 3AT4A 4ZTRA 3NW9A 3BZBA 3QZFA 4PTEA 3CQEA 2ZV9A 4MXYA 5CSHA 4RA4A 2XKCA 3KRRA 3WF9A 1WS6A 5FWAA 1X1CA 4WOVA 4FK6A 3GU4A 4CNHA 4F0IA 5EEHA 3PUPA 5CAQA 3R02A 5IQFA 2NRUA 4MD7E 3EMGA 3VJOA 3AT3A 3NNXA 2NXCA 3PB3A 1Q61A 5FULA 4C4EA 3FZ1A 4CKJA 4P2KA 2OU7A 3BBTB 4PMSA 4PL5A 1FMKA 4QQKA 3EIDA 3LCSA 5IQIA 2JFLA 2UZTA 4YURA 4IB5A 2P40A 1ZY4A 3OP5A 1OI9A 2ONLC 3AC1A 3E8NA 2FSTX 4JIAA 2PULA 2UUEA 3VS2A 4DYMA 4N6ZA 4LWPA 5I4NA 3Q9XA 2Z7SA 4MQ4A 2F4JA 3DAJA 1IAHA 5DR6A 4DCEA 1FP2A 3UJDA 5C03A 2Z8CA 3E8DA 4ASEA 3TZ7A 3B7PA 5G02A 1L3BA 5CVFA 5M4FA 3EKKA 1MQBA 3OBJA 4C38A 4TYIA 1BLXA 3MBLA 2ZIGA 4BDAA 3DJ5A 1U4DA 3BV3A 4FODA 4OTFA 3A7GA 1ZOHA 4EQUA 3IHTA 3DBFA 5EHLA 5CVGA 2IVVA 4WSYA 5HG7A 3OFKA 2QKWB 3OCTA 3GNLA 1CTPE 3MSSA 3PG3A 4IB3A 3G5DA 2YJSA 4RLKA 2PPQA 5LVLA 3SW7A 4PGGA 3C1XA 3JR1A 2WAJA 3OCJA 2YABA 1WBPA 1P1CA 3G0EA 4Z9LA 3MH0A 3C4XA 4FR4A 3EPPA 3OZRA 5F2KA 4ZSJA 1N7JA 4LMUA 3BE2A 3QKKA 4RPVA 4Y72A 2VDWA 3R7UA 5HIDA 2QD9A 2BMCA 1XDUA 3MN3A 5J1WA 2UZVA 4BTKA 4YO4A 5H9BA 4E33A 4P7FA 3P0MA 4RJ3A 4KNBA 1CKJA 4ZSGA 5IISA 1IR3A 3FMMA 3JY0A 4EKIA 5AWMA 4U3YA 3KXNA 3MIAA 1HNNA 3UNZA 2BRBA 3DXNA 2BAKA 2ADMA 3P2EA 4FC0A 4PWNA 3PXZA 4X3JA 4YZNA 4AN3A 5KMJA 4WKQA 4D9TA 1W84A 4KABA 2Y6OA 3W33A 3WI6A 5DXJA 4XUEA 4FKOA 4ITHA 5EHGA 4RIYA 2YM5A 3LQ8A 5IUIA 4O7NA 1R0EA 3NCGA 5AADA 5IA0A 5FA8A 3CE3A 3A7DA 1O6KA 2ITWA 2PUUA 1FGKA 3MDYA 2X9EA 1Z3CA 4ZTBA 3D7ZA 3PA5A 3TDWA 3GFWA 2XZSA 4QP9A 5HBEA 1ZZLA 3WE8A 3VUMA 5IH6A 3QRUA 2C6DA 3GOKA 3D15A 4JI9A 3U54A 1FJXA 3B3JA 4R8RA 4YUQA 3K0BA 1VIDA 5HEZA 3ORZA 5CNNA 3QQUA 2E9OA 3HCCA 5HIIA 1J3HA 1J7IA 2IBSA 2WMBA 3NVMB 2QHMA 4NM7A 3MGYA 4QQCA 4W8EA 2BR3A 3C4EA 3H9RA 3CBLA 5ICCA 3FMDA 3S4QA 3IV6A 3PT9A 4IVAA 1QAQA 2GFCA 2YDJA 4GIHA 1JPAA 5DR2A 4FTAA 4FYNA 4D5HA 5D12A 3DH0A 4V04A 1REJA 3NGAA 1E9HA 1PMEA 4LGGA 3TMAA 3IS5A 3IW7A 1NV9A 2O0LA 3EFKA 4DF3A 3M4XA 5E8RA 3L8SA 2CGWA 3PXRA 1U54B 1BL6A 4I93A 2BR4A 3R9RA 1O9GA 2WIPA 2C0OA 2FA2A 2PVMA 3WE4A 2YCSA 5K0FA 4W4XA 3LFEA 5FLFA 4IEBA 3Q53A 5A4EA 2CCIA 4O7VA 5AFVA 3PP1A 4C36A 3LSTA 2AN4A 4J1RA 1O9UA 2OBJA 1Q5KA 3QLFA 4JQ7A 2OZAA 4O7WA 3R9NA 5EIFA 5LQAA 2NP6A 5EG3A 5BUEA 2LGCA 2WNTA 1BL7A 4AU8A 5AEPA 3HX4A 2BPMA 3QQGA 3Q4ZA 1UKHA 3REPA 2DULA 1YXUA 3BHHA 3FMLA 2PVRA 1WBNA 2RGPA 3L8PA 4LFIA 1OL1A 4LUDA 4BCJA 4F4PA 4XMOA 4DFNA 3FQHA 4AGWA 1DI8A 3F66A 2GNFA 4XYFA 1XXLA 5JKGA 1OMWA 3VS1A 4P58A 1H8FA 4M7IA 3QQFA 3VAPA 3O7WA 3P1AA 3VYWA 3EGEA 3I0OA 3NYVA 3QUDA 3R8PA 4FT9A 3UQCA 2BM9A 4GT3A 3CD3A 2CMWA 3FUPA 4H58A 4IJPA 1NW5A 2QCSA 4HW7A 2PK9A 3KXXA 4NUSA 2O0UA 3QQJA 4OW8A 2XRWA 4QP3A 4G34A 4HPTE 1QPEA 4BCMA 4ZLYA 5BX0A 3ZUTA 4D55A 4QYGA 5BUIA 2QOIA 2EG5A 2X8DA 4RIXB 4JDJA 4KRCA 3GU3A 4QMNA 4JL9A 4A06A 5IH3A 4LGHA 3FZPA 3D2KA 1SMHA 4ERWA 3V04A 4KKEA 4UV0A 1VYZA 4CZUA 3CKKA 2HZNA 2UZEA 3ORHA 1VE3A 3LJ0A 3ZYAA 2XNMA 1U2ZA 3BI6A 1GIIA 3B2TA 3CKWA 3MV5A 4IAAA 3A99A 4ACHA 4DG0E 3KMMA 4CEGA 5I9VA 5AM6A 2Z2WA 4YSJA 3W2PA 1LPUA 4E6DA 2P1DA 4ZTSA 3KY2A 1WBOA 4PQNA 4AE6A 2FSLX 3QC9A 1DAWA 3RHXA 4XOZA 2XEYA 4AX8A 4YJSA 4GEKA 2C7RA 1QZZA 2P33A 3FSKA 1PKDA 1OIYA 4H3PA 4FTKA 5E8ZA 1FP1D 3NUUA 2ZIEA 4KS7A 3FLSA 2XIXA 1GY3A 3R01A 2VO6A 5AUTA 2ZZKA 2XK3A 3E8SA 4XUDA 3ODYX 5M53A 2QOOA 2A0CX 4O22A 1B42A 5C1IA 3NIEA 3ELDA 2O2UA 3GO4A 2ZVAA 3H9FA 4QMXA 4IDVA 3LFCA 5BP7A 4YV2A 2QLQA 2WMWA 5KQSA 5EHOA 5ETFA 5F95A 3IONA 3TN8A 3LXLA 2X7GA 2CPKE 3CIKA 4JOAA 5HO7A 4FIHA 5DPMA 4BY9E 2PWYA 4DEBA 2C5NA 4Y95A 4PDOA 4CFVA 1IASA 4O0WA 3SHEA 1RJDA 4TW9A 4AP7A 4E5BA 1SNXA 3ZH8A 1RW8A 2OK1A 1T43A 2X8IA 4FV9A 4IBMA 5DRYA 3IOPA 1ZMUA 3VUGA 1SZMA 1YVJA 3HP2A 4G3EA 3TKYA 4ID7A 5C01A 2EVAA 3RAWA 2F8LA 2OY0A 2DWBA 3QYWA 2Z7RA 1J1BA 4YJTA 3QZHA 4FIJA 3V5QA 1GZ8A 5GWXA 3BGZA 2V62A 3TDVA 1YWRA 2ITNA 4RIWB 4I4FA 4LQMA 3B3FA 2WTWA 4O0YA 1OKZA 1YRPA 5CD1A 4BC6A 3I81A 3EMDA 4GG7A 4GFGA 4EH9A 3KF7A 5J8IA 4DEAA 4F1TA 3UZTA 2FRXA 3THRA 4Y46A 2F49A 3ZRLA 1JTEA 2UYQA 5EOLA 4XV1A 3BGDA 3RGFA 4IVCA 3QRJA 2IP2A 4GOND 3W2QA 5KMLA 3KQYA 4CWAA 1YQJA 3DFCB 4FZ6A 4ORKA 1LEWA 2OO3A 3LBYA 5ACKA 1QYRA 4B9DA 3BXOA 4BF2A 4GQBA 3DLSA 2EX4A 2IIPA 2JBPA 2OG8A 4GYIA 4UALA 4EZ7A 5JFXA 5HIMA 5JR3A 4EH2A 3RCJA 4RFMA 3MB6A 3NWWA 2XYNA 2PLWA 4FSDA 3KF4A 5JRSA 5FCDA 2P35A 3T7RA 3HAMA 5DE2A 5HD7A 2K4MA 4TWNA 3SGLA 4U7TB 1YI3A 2VTSA 4WBBB 4MWZA 2ZDUA 3MHTA 3MY5A 5FBOA 3QHWA 1YB2A 4FT2A 5LQFA 3R3HA 1PXOA 5EOVA 2VD5A 1Y8GA 2AN5A 3AMAA 3UNJA 5L2TA 3TKUA 2V7EA 4NECA 3LLAA 3FYKX 3I6WA 5DYJA 4YUXA 3OBGA 4R6VA 4EHZA 2GQSA 3GC7A 1J7UA 3AD4A 3QWKA 5FM2A 3I1AA 3LFBA 2GB4A 3PTAA 3FDNA 4YUWA 3UOHA 3KKVA 2BUJA 5DI1A 2C3KA 3W2CA 2C6OA 2CLXA 2ZV8A 4YZDA 3QBNA 2R6ZA 3FSFA 4AZVA 3EN9A 1JVPP 4MQ1A 4QQ5A 3OWKA 1PY5A 4FSTA 4N70A 2XUUA 5BVEA 4C4GA 2EB2A 5A14A 4P5ZA 2WKMA 5HICA 2HV9A 5CQUA 2BZJA 3BYVA 4BDFA 4FG9A 3Q2MA 4H0NA 2AUHA 1M14A 4RSRA 3TZ8A 4HZSA 1FMOE 3NRMA 4DEHA 3AC3A 5E8YA 2OICA 2G2IA 5E9QA 4E5WA 2W4JA 1YHWA 3QUPA 3G7UA 3PG1A 4EQZA 1ZY5A 4FUXA 3D7TB 2W1ZA 1MQ4A 1OL5A 1XBCA 3EYGA 4OTQA 5E1BA 4GUAA 3RWPA 1SUSA 3TKIA 3LZBA 4QMSA 3C51A 5CU3A 5CAUA 2B0QA 4RLLA 4GOLD 4PNEA 1H26A 4RJ7A 1BI7A 2GMXA 3HRBA 3ZONA 4WO5A 3ROYA 4E6AA 1DS5A 2F2UA 3RWQA 3FJQE 4RJ4A 2G1TA 4RA5A 4RQVA 3W16A 1HMYA 5BYZA 4RX5A 4GOOD 3X0DA 2HZ0A 3ZSGA 2B53A 3TV6A 3GGFA 3C4WA 5ANKA 2ESMA 3QX4A 5E92A 3W8QA 5K4JA 4CKCA 1I9GA 1Q0SA 3LM5A 1WCCA 5EHYA 3DULA 4F63A 4TYGA 3OF0A 4XJ0A 3UMWA 3FUVA 3MFTA 3NAXA 3R21A 5KMIA 1CM8A 4TPTA 4K11A 3OU6A 2UW5A 4RTQA 3TACA 4M0ZA 3KR9A 4CV9A 3HMNA 3MVLA 5HQ0A 3E5AA 4CRLA 3LBFA 4F08A 3LFNA 4LG1A 2WEVA 3ZMMA 4KDCA 4RTNA 4K0YA 5LQKA 5HIKA 1NT2A 3VUHA 2C6EA 2CGUA 4HGZA 5EQEA 5C0OE 2C0TA 3KPVA 3DBEA 1XTPA 3II5A 3SV0A 2IFTA 4WVLA 4RFZA 5ITAA 4R5YA 2HELA 5EDQA 3W18A 5J7HA 4H36A 5DHJA 3RAHA 2FO0A 4EBVA 1ZGJA 5EEGA 2I0HA 2Z6UA 5KVAA 4XRJA 4APCA 4TNDA 2CNQA 2JHPA 2QE6A 4FV7A 3FUTA 2OF2A 3CY2A 2CKQA 2OIBA 4G17A 3UPXA 4DBNA 4I20A 1A06A 1WFCA 4RT7A 3ER8A 1EQAA 2PXXA 2YM7A 5KKRC 2IZUA 3Q5ZA 3FPFA 4RWIA 1K2PA 4XV3A 4R6WA 1Y91A 3OPNA 3BGIA 3R24A 4C03A 4R1VA 1PXJA 5H8BA 2OJJA 3LGAA 3MY0A 1RQQA 2XP2A 2PMNX 3KFAA 5BMMA 3U87A 3GOPA 3EQDA 4U81A 5DRBA 5DSTA 4O38A 4GF5A 2R9SA 3NUXA 2P41A 2QR7A 3PXYA 4AZEA 2QVSE 3AG9A 5HTCA 2IDJA 3DTWA 3QXOA 3KGAA 4EOJA 5KQRA 1J1CA 5AV3A 4CTCA 3AGMA 2VTOA 2AN3A 3E7VA 4UOEA 5B0XA 3FLWA 4IZ5A 5DT3A 5K0BA 1FVVA 3VIDA 2HR1A 5AV1A 1GAGA 3MTFA 2PVYA 4FVRA 3GFEA 3NNWA 2OXYA 5DWRA 4C2WA 3PLAE 2I62A 3BUSA 5CEQA 2NXNA 4BLVA 4KKGA 1CDKA 1WZNA 3KHKA 4MX9A 4S2ZA 4I4EA 4F86A 2GU8A 3TKHA 5DM0A 1WMKA 3FZSA 4Q2AA 4QQJA 3LECA 5CF8A 5L2IA 2PXAA 4GC9A 2GQGA 2PVKA 4HVSA 2BZKB 3FAAA 3B3GA 2F7XE 3R1SA 5CU2A 4KSQA 4MXCA 4UY9A 4ATNA 4GG5A 1PW2A 4NH1A 4HVDA 1R6AA 1WXWA 2IN6A 5BVNA 3P9CA 1QANA 4QPNA 1GIHA 4U0IA 4HVGA 4UX9A 4RTPA 4LG4A 2OKRA 1UU3A 2X39A 4L43A 3GRYA 5E8TA 2ITUA 2ONLA 4P5QA 5C8NA 3QA0A 3D5UA 3OCGA 2IPXA 4FUYA 5DX1A 3R63A 4GK4A 4ZLZA 2OB1A 1JKLA 2QOKA 4XNEA 5GP1A 1TW2A 1SM2A 2JAVA 3JVRA 3QRIA 3NPCA 2C5XA 2J4ZA 3QKMA 3FLYA 4JIKA 2YIQA 3HCFA 3V8SA 2W5HA 3VS5A 1ZG3A 3ER9A 2J0IA 3CPCA 4KVZA 4R5SA 3LHDA 5HIEA 3C13A 4J8NA 3RPVA 3BEAA 2XF0A 3RI1A 5LQNA 3V8TA 4RX9A 3EVFA 2GSFA 4EZ5A 4I6BA 2C3LA 3N51A 4YJRA 3PXFA 2VS1A 2XK7A 3MTLA 4U42A 3R7EA 3AC8A 3UNKA 3VS0A 3QTRA 5ICEA 3Q9YA 9MHTA 1XH7A 2C6LA 1STCE 1XH4A 2YITA 3A7IA 3CPBA 3Q60A 2Z6AA 4EWQA 4DFUA 4U7ZA 1JSZA 4Y83A 1XBBA 1JR4A 3R6TA 5IUHA 5AV2A 4HJOA 4FV4A 5D11A 2Y4IB 2X7FA 3OW4A 3JWHA 4FKVA 2VTIA 4XX9A 1FOTA 5BVKA 4R7BA 5H3QA 2R5TA 4O29A 1H1WA 4PDPA 4X2NA 1UV5A 1NW8A 4P90A 2JH9A 5I5ZA 4WUAA 2QOCA 3O0GA 5EW3A 3OWLA 3FXZA 3PZHA 5IDNA 2Y1WA 5IH4A 5DIAA 2C7OA 4FICA 2HY81 4QTDA 3R7OA 2WOUA 3UIXA 3A25A 3JWIA 4PWYA 1M17A 4BLUA 4ER6A 4FV8A 3IYLW 2FSMX 2BRMA 2Y7JA 3DK6A 2ITZA 2HWPA 3KK8A 4JR3A 4L3LA 4C3RA 4C61A 5HU3A 3OY3A 1L9KA 2RF9A 2AOUB 3FUXA 4E2WA 2O5KA 5HCXA 5IA4A 5HVJA 2I0YA 3ZFYA 4E8AA 3K3JA 3I58A 3M6WA 1O9HA 5E1SA 2Z60A 2C69A 4IH8A 3UA4A 1H1RA
chains in the Genus database with same CATH superfamily
1JIQA 4C88A 2W6QA 1H3NA 1WBDA 3DONA 2O3JA 3WJ2A 4CUKA 3W0PA 2E3JA 4XGQA 3VKGA 5AXBA 2PE2A 2XH5A 3KWMA 5HEKA 4H08A 2VKQA 4QHTA 5AOAA 4O0TA 1Y9DA 5FKJA 2IYOA 3T7EA 4F6UA 5JCZA 3V55A 2JFYA 1UZUA 1OB3A 2QOEA 3DL4A 3K53A 1ZN8A 3PSBA 3CG0A 2ZYBA 4UM8B 4RVLA 5TMBA 1AMOA 5DOVA 1U0EA 2O5CA 1YRAA 2E48A 3PHGA 4S1OA 3NHZA 2VUSA 3SQDA 1EM8B 4XDYA 2NSHA 1Z36A 1EG2A 3RK0A 5T3UA 1ZONA 4X2KA 1HRKA 1H4VB 1KDPA 4ID9A 3OEYA 4JLVA 3WKBA 4ZC1A 4AGUA 2I76A 1FBNA 1Y7PA 1ZWSA 2UW4A 1FJHA 1XYVA 2BFFB 1DTWB 4AO8A 2NO9A 1MABA 2NV0A 3GLFE 1E79D 5KYYA 3LMGA 4DG3E 2F67A 1P9LA 1I3LA 3C3KA 3SR4A 4B7XA 3WFIA 2WFAA 3SKXA 3O2MA 3A9VA 1C9MA 4J7BA 1C3JA 1CUDA 4I5CA 1E1VA 4K1XA 3UAWA 3JXWA 3VWAA 3KFVA 2VWGA 3OP4A 4Z9XA 1TEZA 2XH8A 5GOTA 1JNYA 1Y6QA 2FZVA 4ITVA 2V8OA 5DN3A 1JQLB 3FZRA 4Q6WA 3PQEA 1M2QA 3A6GA 4YY3B 5L7YA 3O8RA 1T13A 5AV0A 2QIPA 3IC5A 2HBZA 3KXLA 1A8HA 3P2IA 2SRCA 4FFLA 1Z3IX 2C7VA 5AP0A 1AUVA 3TG2A 4GXNA 1C29B 4TV8B 4J71A 3D2BA 5JNRA 4QLOA 2XK6A 3ZN2A 3LV8A 5IQBA 1ETHA 2ATEA 1YZKA 3ESCA 2QG7A 3UK7A 2BFAA 3DDCA 2PVCA 3ENHA 3FPMA 4FEWA 1EXNA 3PFIA 3O2JA 1NDQA 4A0RA 2NO1A 4LZWA 5GAJA 3ORYA 5M7EA 3URMA 5L6OA 3QM1A 1HG1A 2Q3BA 4DSAA 4BGHA 4RD1A 1ZRNA 3TR5A 3Q5GA 2I3AA 3H1GA 4HSGA 4TTVA 3SXRA 4FHZA 1G7CA 4XDZA 3CZ9A 2Z9CA 4FYYA 1W2HA 3RFTA 1DAHA 4GLOA 4AS2A 2GWHA 5DFPA 1AC5A 1OQAA 1PW5A 1ZYCA 3NYNA 1W5FA 4RIOA 2ZV7A 4IOMA 3NBQA 1RRVA 3OA0A 4CQEA 1H4QA 4ROSA 2FR0A 2ZANA 3SQQA 4UU8A 1DNPA 1G59A 3IMEA 3UPZA 3IR5A 3RYCA 3KMUA 5C37A 3SD7A 3F8WA 5IAJA 2HN9A 3N2KB 5CVEA 1B23P 4D0LB 1EDBA 4AQDA 1QQTA 4M54A 4RXUA 1N92A 3DLAA 3QLVC 1KP3A 2XK4A 4CDGA 1VP9A 4B7TA 1K8QA 2J6CA 5GGXA 4CCWA 3P86A 2ZIXA 3H6GA 4Y7CA 4TXNA 4BAGA 4NKSA 5I9ZA 4V3BA 4USDA 1RT9A 2EARA 4I36A 1WVMA 5CA1A 4E14A 3DZDA 4DREA 1XN1A 3G6GA 1KV1A 1JH8A 4LE0A 5K0BA 2X7HA 4YTEA 2CVQA 2AG1A 1KS2A 1UKAA 1H6DA 1XJ5A 4R31A 4XM1A 3K8ZA 3JQCA 3QJ5A 1U2RA 1HFWA 2UVPB 4Y9SA 3ZLWA 2CK3A 2HWWA 4YLKA 4CKXA 4DIOA 1NVAA 1PBTA 4C62A 1AE1A 1QYIA 4MI3A 3O38A 4HNHA 3RVNA 5JS8A 3QHRA 3S1SA 3ZZNA 1KOBA 3ME5A 1EA5A 1ML3A 2QJOA 4RDHA 4YTFA 5AUUA 2W8BA 3ZLBA 1JLLA 1WKCA 4C2BA 4PSCA 4F4UA 5KOJA 3IJEB 3E1KA 5CDFA 4YQYA 3BE8A 1VQ1A 3B6EA 5DHTA 5AKXA 1NYRA 4EZEA 2ECOA 1T91A 3V4OA 3ASUA 2J9RA 4TN1A 2JIVA 3LC0A 3BDAA 3CO0S 4RQTA 5IEVA 5EC8A 1G3NA 4I1OA 1Y7TA 5EM6A 3ILYA 3ZS9A 2HRRA 4NM0A 3HVIA 1BGVA 3AVYA 5CDFE 3MWYW 2EKBA 1YL6A 1SAYA 5IXYA 2E82A 5IYZF 3QRKA 1M7QA 4U40A 2QO7A 1GYQA 2JCBA 4P9NA 4NYMR 2O64A 1I6WA 5A4IS 3E22A 1R39A 2PCJA 5CGZA 1NI4B 3WL4A 3RTCA 2ZITA 3AF1A 1VMKA 3UPDA 1J7LA 1XJDA 3LCMA 2HCTA 4LI3X 4PLPA 1ODKA 3DKKA 4PL4A 5KX5A 1FTGA 4WBXC 4ZJJA 4WUNA 4UVDA 2CUKA 4OHOA 1K4KA 5KMMA 1CQIB 3UJBA 1EK5A 3TTSA 2OPHA 3Q32A 4C7BA 1QGYA 3N76A 4ED9A 4LSZA 2X0KA 1QP4A 3TSZA 1XMJA 4Z16A 5E7QA 1NHWA 3OZGA 1KI2A 3GVUA 4EG0A 4BNLA 4Y1FA 1BWSA 5JS2A 4FIGA 4FGLA 4HQ0A 1Q3DA 3EMVA 3KRJA 5DGHA 2ZSBA 4HI0E 3KEFA 4Z7HA 5AVRA 4Q7LA 4RTRA 3GXBA 4PO9A 2IH5A 1BJRE 3CEPB 1T8PA 3NDJA 4K6CA 5C4IA 3MJVA 3OZUA 4RTKA 3CR0A 2CJPA 2XMQA 1KMHB 3D7KA 1VE7A 4F92B 1SUCA 1HGXA 1G8FA 1YE5A 5EHIA 4ZAWA 4BDJA 4BZNA 1YZNA 3E3AA 3HKCB 4JC8A 2F64A 2I2XB 1R8YA 3DHVA 2GQRA 4A9RA 2CXQA 2GN2A 4CV8A 4FYJA 3PSCA 3UAXA 1CQXA 2UW0A 4JQZA 4FBLA 2PE5A 2DBQA 1DEHA 1RWXA 1C9JA 1N3IA 3F5XA 1O96A 3AF5A 3IRVA 2VTHA 2H07A 2F3QA 2ZJ7A 3ZDUA 4WLFA 3IBFA 4CKZA 1JHQA 3DPKA 1IM8A 4RGBA 2JGNA 3G8BA 4LQDA 5DBXA 3TRJA 1OPKA 3UE4A 5EQPA 3WGLA 1ZM3A 4BN4A 4HL6A 4YUAA 4CIAA 3IURA 5IZ4A 2R0QC 5BR4A 4K26A 4IUYA 4AJIA 4UUOA 1TLLA 4CMHA 3VSEA 3JZFA 3PTZA 4QP6A 1Z62A 3T7AA 4US2R 3EXFA 3DEHA 1W6RA 3HJTA 4FGRA 1ABFA 4Y2YA 1TT5A 4M60A 3W2GA 4Y2QA 2X2OA 2Q2OA 4LY3A 3QTUA 3COVA 3WDKA 1A5ZA 3R1YA 2H2AA 3INGA 1OFIA 4GZ5A 1N2XA 4JEHA 5DK4A 4CG8A 1ZK4A 3PPZA 2JIBA 1TAGA 1F9EA 1SHTX 2LUOA 1NBMD 4FE7A 3A4TA 1IH8A 3QU0A 2ZUEA 2QJTA 1NNI1 1E1QD 3IQHX 1E5VA 2OM2A 3GJ0A 1WDMA 2WT4A 2GEKA 4UM9B 3IQIX 2MIIA 2GOYA 1F2TB 2G06A 4E2XA 3STYA 2BFNA 3L79A 1YBHA 1D3AA 3JCZA 4YHHB 2XUIA 4Z0TA 3EN4A 4G41A 3RYIA 2GWRA 4GS5A 4H18A 4C7VA 2ADFA 3HL4A 1H42A 5DBOA 2KTYA 3KKOA 4CLEA 5CITA 4KR6A 4MK0A 2VQ6A 4F65A 3IEVA 1IA9A 1U9YA 4NF2A 3U6IA 1NKVA 4M68A 5HZMA 4X20A 2VO7A 3IAUA 5BSFA 1A8SA 1NP3A 1CY8A 2OCYC 3RM3A 3EGCA 3HYCA 2YY5A 1P6QA 2YCFA 3CBQA 1EFPA 3Q7IA 1NVVR 1L6RA 4KJZA 1HLGA 5M44A 3ANLA 1GLGA 1RHJA 3CN9A 1J0CA 3BMXA 3P2YA 1YVDA 4M9ZA 5HZNA 4OBWA 4C3PA 3NBFA 4ZXFA 5HE2A 3FXXA 1RQGA 4LYAA 5HTKA 3NUGA 1RCTE 5ABPA 1RE8A 3IGOA 1J1UA 5JDCA 4ND4A 4WG4A 1RAIA 5GHVA 3CG4A 3JRWA 3LIJA 1XMXA 5JLJA 2VBGA 2LDBA 3CLSD 1XZ8A 4BO7A 1YD7A 5F1KA 5CU0A 3BA1A 2SCUB 2CMGA 2QLTA 4HC4A 1YRHA 1GG2A 4UXLA 3S95A 1FL9A 4MTAA 1T9HA 1W30A 2GNJA 3P7BA 3LA6A 2WZDA 1NW9B 4ERXA 4KLNA 1RC1A 1AUOA 3AOEA 4N0PA 2OD2A 2D5BA 1X92A 2P5SA 3GUHA 5JFOA 3W0NA 2O59A 2R4UA 2IWIA 1WLYA 1A95A 1FFDA 3ZZMA 1D0IA 1OHHD 1M8KA 4MWHA 3WF8A 5JECA 5ENDA 3N1UA 3EJ6A 2R87A 1NATA 1EIZA 2OCGA 3EL8A 4L50A 4BQRA 2OSVA 4D97A 3FPHA 4D9MA 3TCKA 3ONVA 5JMSA 4PX2A 4ACCA 1BDHA 3JR7A 4TYMA 4JNCA 4GI2A 2YWDA 2XIZA 2W99B 5A1TA 3BBWA 4UQPA 1NONA 3CUTA 1QGUA 3P7AA 5IUNC 3GRUA 4Q9HA 3WWEA 3P79A 1UQUA 3ODPA 3QV2A 2P3GX 2MU1A 4DA7A 3E5MA 3JASB 4EUUA 2OL4A 5HE3A 2VTEA 4X63A 4WOCA 8ABPA 1X14A 5FEEA 3OUKA 3ANSA 4TKVA 4QTEA 1G21B 4ZVMA 1EFVB 3BF7A 3IO7A 2DAPA 1I4DD 2XPCA 3G8CA 5FXSA 4WI1A 4Y5HA 4IFGA 3ZJVA 3GQIA 3DJ6A 2E18A 4TYPA 5KO1A 1E4OA 2BGWA 1AZLA 3T1HB 1WMDA 2OHFA 2BP7B 5A6NA 2ZETA 1BE6A 3OLXA 3FNEA 3F9IA 4MV0A 4KPYA 3QC4A 1GARA 1WL8A 1NBHA 3CPHA 3ZTTA 2AUMA 4JLWA 4DR6B 5FXQA 5EP4A 4CBVA 2BBWA 4Q02A 4MJLA 2D8AA 3ASYA 1Z82A 3BBLA 4WN3A 4BR3A 4F6WA 2CHFA 3THYA 4M84A 3DE3X 2PVHA 2I2WA 1PCXA 2Y92A 1N6KA 5CIYA 1HLPA 2X4ZA 3F3ZA 3C50A 1SFRA 4H7FA 1TE2A 3A6DA 2LTAA 5DGCA 5BSGA 2RI6A 2B3DA 3F4KA 4EHLA 4MDFA 2PGIA 1EHCA 3VR5A 4R0VA 3AETA 3COKA 3ED5A 1USIA 3SM9A 5AK0A 2RHCA 2W0JA 2ACWA 3V4RA 4EF6A 4QEZA 3RUCA 1BE0A 1H66A 3RVBA 5LDDC 2AFIB 5CFRA 2XUDA 1JHUA 3OFSA 3VUIA 1F3MC 4UNSA 1X8BA 1BRTA 1KVUA 4MO2A 4CTKA 5JK3A 4XWOA 3MH3A 3WYAA 2VV9A 3K8QA 1MGPA 4O59O 4CMIA 4EENA 1GD1O 3I23A 3WVNA 3N6RA 1JG2A 5LJLA 4I1YA 4XGRA 3R76A 4BX9A 1UODA 3T94A 2BMEA 1WBBA 4QMOA 2IUTA 1MXFA 3K6RA 3X1ZA 5JZSA 3HY3A 4AZ3A 4CEIB 3CZAA 3SCZA 1L8XA 3N9IA 5I7WA 4ZAFA 9LDBA 4PGMA 4CM4B 3LQ5A 4UNRA 4J9UE 2X5OA 4RF4A 1UCFA 5LXTA 3RPRA 5CMLA 2WABA 3P4YA 3KVOA 1F5SA 3N3AC 2RG6A 3ZHVA 3U9NA 3A3PA 2DWOA 1H2EA 1BQ3A 1LUAA 1K7SN 4CDRA 1T4DA 4GM0A 3BDIA 3OLYA 1MPTA 2QLFA 4RK4A 1ZMVA 3BAFA 1ZC4A 2C7PA 3ODGA 3R09A 3X1XA 3UDTA 2ZI3A 3W5VA 4ARUA 4WK0B 4ZMFA 3P7CA 2GNAA 4I19A 4I5FA 2HCKA 4FKSA 5C2JB 3MJTA 1WU8A 1DHRA 1KUTA 2IOYA 5J5VA 2LNDA 4JZYA 1R5NA 5LWQA 4DR4B 1G5HA 3QGYA 2O7QA 1CS0A 3A2MA 3AMVA 3RYHB 4TZTA 1H94A 3THXB 4KKVA 1E1YA 5MGNA 1I1OA 3MERA 1E6LA 3H5LA 1RRFA 4B4UA 1DX6A 2XNDA 3N39C 1MJFA 4FVQA 5KTSA 1IBLB 1S8OA 5GJCA 3NATA 2ITTA 2DTXA 4IIJF 2WTBA 3WGVA 3UT0A 1BOOA 2ZVQX 2XW6A 1HQKA 4C04A 4EHNA 4BGIA 4YAIA 3E62A 3DM5A 3VZSA 1QKKA 3L01A 1T8TA 4WOJA 3TV7A 3KKZA 3O8CA 5CSHA 1RW4A 4UTXA 1XRRA 5DYYA 4KXUA 2IOHA 2RK6A 1G5FA 3CKYA 4MD7E 2NXCA 2SNIE 2VKTA 1SA0B 1OI2A 1H65A 3OD1A 4U7WA 4M22A 4BO2A 1FMKA 4QQKA 4EJFA 4YURA 2ZVDA 1QJCA 3TNFA 1AHPA 5DR6A 3EZNA 2ATXA 1OLSA 2AF3C 3SX4A 3QFSA 3B38A 5DB4A 5I48A 3T5TA 2ZRPA 2C94A 2X23A 1JFVA 1IEVA 2OQ2A 3L1KA 3HJBA 1TF7A 2HZ7A 3AFGA