5C4KA

Aph(2")-iva in complex with get (g418) at room temperature
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
RTYTFDQVEKAIEQLYPDFTINTIQISGKGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords APH(2'')-Id
publication title Aminoglycoside binding and catalysis specificity of aminoglycoside 2-phosphotransferase IVa: A thermodynamic, structural and kinetic study.
pubmed doi rcsb
source organism Enterococcus casseliflavus
total genus 99
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c4kA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 5c4kA02
4WD5A 2G15A 4YTHA 2PTKA 1Y8YA 3LVPA 2BIKB 2PVLA 4PX6A 1IEPA 2PPQA 4FYOA 1XHAA 4IM2A 4FT9A 4YHTA 1GIHA 2QKWB 2A1AB 3ZSHA 4DT8A 5M53A 3MBLA 5HNGA 5B2MA 2WO6A 3BU5A 4O22A 3ZRLA 2VTTA 3IO7A 3ZO2A 4F99A 4F4PA 4NL0A 4GCJA 5E8YA 3SAYA 3AC8A 3FAAA 4XJ0A 4UN0C 3KY2A 1OL7A 4JLCA 4FK6A 2IPXA 2X6EA 2BPMA 3V04A 4RRVA 1OL6A 3MIAA 1O6YA 4HW7A 1IAJA 4F08A 4O0SA 3ZS5A 5AV4A 4NM7A 3VN9A 2FUMA 3U6JA 5BUJA 2A2AA 3C51A 3FLWA 3PJ2A 4C33A 3QQGA 2WD1A 5DEYA 3C0GA 2XNBA 3TI1A 4EUTA 2FGIA 4YZNA 3NIZA 1OPKA 2W99B 5A4CA 5LMAA 1PF8A 4C61A 1VEBA 4TW9A 1Z9XA 3F82A 4OLIA 4M68A 3NNVA 3KMWA 1JKTA 4BC6A 4HCTA 1OPLA 1DI8A 1IG1A 3DY7A 4O38A 4FV2A 2VTSA 5JQ5A 2XKCA 3G0EA 1QL6A 3EQHA 3G51A 1X8BA 4XRLA 2C68A 3GNIB 2QO2A 3UG1A 5L2IA 4G16A 4EOLA 2WZJA 4U8ZA 1YKRA 4AW0A 3WZJA 3FC2A 4ASEA 4KBCA 2W4KA 3ZM4A 4CMOA 5A4LA 3W0SA 2ZB1A 2VN9A 3VULA 3SG8A 2FVDA 2BDWA 4A06A 3G9NA 4UALA 2GTNA 4L3LA 5HEZA 4R5SA 4YU2A 3QU0A 2OXYA 5JFXA 3ORPA 4U40A 3COMA 4O0UA 4X3JA 4L45A 4FUXA 3NUNA 1Y6BA 5E8TA 4IWQA 3UQFA 3RAWA 3OMVA 3WYXA 2R9SA 1MQBA 4OR5A 4F1TA 5IU2A 2EXCX 3KQ7A 3P5KA 2J2IB 3RWQA 3BELA 4TYGA 3QD2B 4GS6A 5IQEA 4E7WA 4AX8A 4H36A 1ZMVA 4ZMFA 3QKMA 4R3CA 3WIKA 3V01A 1P5EA 1R78A 1XH5A 1UKHA 2CCHA 4UWCA 3OS3A 1YRPA 2WELA 3CGOA 5F94A 4ASZA 3F5PA 4LYNA 5BVFA 3VBQA 2VX1A 3NDMA 2VWZA 4NYEA 4WT6A 3TN8A 5CAVA 2BZHB 5AJQA 3HYHA 3NYOA 3Q5IA 2ETKA 3PWDA 2C1BA 5C8NA 3PVWA 4YURA 4IZ7A 5DRDA 3JVRA 3AD5A 4Y95A 4YC6A 3I0OA 4O0TA 5AX3A 2YISA 5EM7A 5JGDA 5CLPA 4D2SA 3ULZA 4FBXA 2O64A 4G3CA 3WI6A 3DCVA 3IONA 3ENHA 3I4BA 3W0RA 4FR4A 3VW6A 4JQ7A 1A06A 2G2IA 3VQHA 3NNUA 2J0JA 1ZMWA 5AV3A 1OIUA 3FKOA 3RPOA 4CFFA 2HZ0A 4FNXA 3U4WA 2BTSA 5KKRC 4A9TA 3ZEPA 3LXPA 5K9IA 3OEFX 4DLIA 3WZDA 4U97A 5C03A 3FI8A 3AT4A 4M97A 4H1JA 1YWRA 3LOKA 1PMUA 1Q62A 2CLXA 1T45A 2B9HA 4FZ6A 4HJOA 3ZLSA 5JN2A 4LUEA 3UO6A 2Y7JA 4BI2A 2CSNA 2QR7A 5IQFA 3HMMA 3IS5A 4EYMA 5J9LA 4OT5A 5CSVA 4E4MA 1YOJA 3QTSA 3ELJA 3F66A 1E1VA 3HUBA 3JUHA 5HORA 5GIPE 2BRBA 3V5JA 4FSRA 4C4IA 5AUXA 2BRMA 1BL7A 2VO0A 5HG9A 3OCGA 1YVJA 2IVVA 3QKKA 2JEDA 2GS7A 2REIA 4O7WA 5AP2A 3Q3BA 1PKDA 2FB8A 4DH1A 2IW6A 3Q2JA 2WB8A 4BTFA 3HA6A 1JKSA 4J95A 3COHA 4CFWA 2GNGA 3TDVA 3ZSIA 4AT4A 2VNYA 3CTQA 4RC2A 1WAKA 4QPAA 4L68A 3PLSA 1CKIA 3EN9A 2BZKB 1FMOE 5DHJA 4F7JA 1Z57A 1ZRZA 3R22A 3BYVA 3UIBA 1WBPA 3KRXA 5EOBA 2VUWA 5AP6A 2JFMA 4ZY4A 3EQIA 2YHVA 1Q8ZA 2W1IA 4BBMA 3BGQA 3WE4A 1KE7A 3EKNA 3F5UA 4IDVA 4DAWA 4EH3A 2R64A 5K4JA 3NX8A 2OF4A 3PRIA 3QCSA 5D1JA 2YAAA 2C5XA 3PVGA 3VBTA 5IH4A 2H6DA 4Z16A 2ZAZA 4QTBA 4TN6A 5B2KA 2PMOX 2W1HA 5IDNA 2ACXA 3KK9A 5AA8A 2WU6A 5HD7A 3R9RA 4IVCA 4BDKA 5J5SA 3B8RA 5CAPA 2XMYA 2W1FA 3N4UA 4LL5A 3NVKI 4YPDA 2G2FA 3NEWA 4L44A 4G3FA 2VTLA 5HI2A 3VF8A 5L8LA 3FYJX 3MY5A 4FTIA 5TF9A 5M09A 4M8TA 1NW1A 4FIFA 1OI9A 3ORLA 2JIUA 4EBVA 4AGWA 2OJIA 2BDFA 3KKVA 5E8WA 2OZAA 4F9WA 3JR1A 2J7TA 5DFPA 3LAUA 4FEXA 4KKGA 4IZAA 1FGKA 4XG8A 3C4EA 1UV5A 2RFSA 3CPBA 3I6UA 3NPCA 5DOSA 4YSJA 3IW4A 1FPUA 1EH4A 4AQCA 4XHKB 3WILA 2QVSE 3CD8A 3ORNA 3PG3A 3FI4A 4M67A 3H4JA 3DDPA 4MVFA 4PMMA 3W8LA 2E9PA 4P7EA 2QOFA 5I4NA 4BHZA 2QOBA 2YM6A 3TACA 5E92A 1ZLTA 4YUQA 3O50A 1XH4A 4GK2A 3VRZA 4USEA 4IAIA 4WNKA 1U54A 1IA8A 3E3BX 3N51A 4I1ZA 1LEWA 2C5YA 4EH4A 4I6QA 4F6SA 1M2QA 4O7OA 2RG6A 2QOOA 3U87A 2GTMA 4IW0A 2W5AA 1J7UA 5C27A 2E9OA 4TYEA 2OI4X 5JK3A 4XV9A 4AZEA 3PXRA 4EI4A 2XP2A 1GNGA 2CJMA 4QYEA 3TKUA 5CY3A 3PE1A 1SNUA 2C1AA 2VAGA 3FZSA 4AACA 5BQ0A 3HMPA 2XM9A 4FVRA 3C1XA 3DXQA 4U81A 5K5XA 4LQMA 4X2GA 3VHEA 3BGZA 4UWYA 3A61A 5DR6A 4BDEA 5IA2A 4EJ7A 2BKKA 3LHJA 1GZKA 2ZB0A 2C6TA 4J8NA 4J99A 4KRCA 3TZ8A 3MA3A 4AE6A 2HENA 5H8EA 4QMYA 3FSFA 4HVGA 2YM4A 2WTVA 3RPVA 5CF8A 3LM5A 4PDPA 4TXCA 3EQGA 2IW9A 2GU8A 2G2HA 3SRVB 4B9DA 2HCKA 3OW3A 3PP0A 1M17A 4G9RA 1Q8YA 4RIWA 4FTMA 2OJ9A 1V1KA 4PNIA 4QP9A 5JFVA 3H0ZA 1Y91A 1AGWA 2WNTA 4IZ5A 1WBTA 4QNAA 3QQJA 5AV2A 3R1YA 4QO9A 4FG8A 5FXSA 4W8EA 3T9TA 1OKYA 2Z8CA 4BTJA 2VTAA 3ZO1A 5CU2A 3KL8A 1U54B 3CY2A 2XCKA 4KNBA 5KMIA 2X4FA 4KIQA 3R9DA 5FDXA 5B2LA 2C3LA 4HYUA 3RP9A 4I5PA 5HO7A 4LRJA 3V5LA 2RFNA 3IOKA 3E3PA 3F5GA 4LGGA 3P7CA 3FL4A 3C9WA 3TKIA 4ZJJA 2AUHA 3W18A 3RWPA 4CSVA 4DFUA 2ZV8A 1WBNA 3AMAA 3HP5A 3P0MA 4RVLA 2XUUA 3AC1A 3F3WA 3QL8A 5I9ZA 5J9ZA 2CGWA 3C7QA 4FKVA 1ERKA 4CD0A 4JBVA 2EB3A 4L46A 3ODZX 2I7QA 1XO2B 3HX4A 4FTRA 4ZJIA 3RKBA 4GUBA 4KSPA 2ERZE 4AW5A 4IANA 2C4GA 4MAOA 1JKLA 5LARA 2R3PA 4FT5A 5CSPA 3PSDA 2CCIA 4NH1A 5GHVA 2RF9A 1PXPA 4RIWB 4DF3A 2C47A 4AF3A 5LCJA 3O8UA 3AMYA 5CNOA 2R2PA 4AOTA 5L2WA 3FMMA 3PJCA 4FKJA 5ANEA 1BYGA 3GU7A 3W32A 3UIMA 3PLAE 1ATPE 4G34A 3MY0A 4U9AA 4RJ5A 5HG8A 2WMUA 4QP7A 3ZBXA 3QGYA 4YTIA 4WUAA 2BFXA 2G01A 4P2KA 4AZFA 3U4UA 4YO4A 5E1SA 2B9IA 4NK9A 4OTHA 3L8SA 4FOBA 4RIOA 3UP2A 2OWBA 1U5QA 5BYLA 3BLRA 1UU3A 3U6HA 3K5UA 2XNEA 5EM5A 1OM1A 3RAIA 3EHAA 5C01A 2HY81 3AOXA 3KU2A 3RPRA 5A54A 3QD4A 4C4EA 3OXTA 3OY3A 4KD1A 2VRXA 4DCAA 4NCTC 2GHGA 3OBGA 2W1DA 1O6LA 3QAME 4RVKA 3KXXA 4FC0A 4I0RA 4D58A 1GJOA 3AG9A 5HVYA 3TUDA 5DWRA 5E8SA 3KEXA 4DFXE 2PULA 3QRJA 4GKIA 1NXKA 1PW2A 2R3NA 4FKGA 4OTWA 4L53A 4C4GA 4IM3A 4GFOA 4LI5A 3BV2A 2F7EE 2G9XA 5BNJA 3ATSA 3I7CA 2DYLA 4BDFA 1ZYDA 3OTVA 1UU9A 3TV6A 4MD9E 4B0GA 4F70A 4PMSA 1TQPA 4FKOA 2RGPA 1ZY5A 3QTWA 4D4SA 3D2IA 1W98A 2IN6A 4NTSA 4GEOA 3F2NA 5DR2A 5IQBA 2UZNA 3KRLA 5EHYA 1ZY4A 4WNOA 5EFQA 2CKOA 5BVKA 1DAWA 4BDAA 1IA9A 3JYAA 4FMQA 2YIRA 3BI6A 2OBJA 4EH6A 4ZSLA 4J96A 4TWNA 2QNJA 3POOA 5CZHA 1H24A 1UWJA 2HAKA 3OC1A 4F0FA 3NWWA 3GFWA 2XZSA 2QD9A 2WTIA 3FBVA 2XYUA 3G33A 4DTKA 3LFBA 4ZEGA 2ZMDA 3QD0A 5HGIA 3ZUTA 3BIZA 4RX9A 4MBJA 4B8LA 1PXIA 4QTDA 4AWIA 4NZWB 5ETFA 3VS6A 3BEGA 3EB0A 3KULA 3K3IA 3NR9A 3TNQB 1YXUA 5EYMA 5KKRB 4KS8A 3ZFMA 5HLWA 5IEXA 1PXLA 4E5AX 2ITZA 4HNIA 2VNWA 2P4IA 5EOLA 4YBKA 3BHTA 3MS9A 3R7UA 2PVYA 1O9UA 4NKSA 4C2WA 4JI9A 2WTWA 4FKQA 4JRNA 3KF4A 2WEVA 3EN6A 5E90A 1JSVA 1URWA 4MWHA 4MWIA 4F7NA 3D94A 1HCLA 5IEVA 2C0TA 3ORZA 3R30A 4OTDA 3CR0A 2ZV2A 4OW8A 3WBLA 4YC8A 2JAMA 2YEXA 2PL0A 1W8CA 5FG8A 2CLQA 3DNEA 3ZFXA 4BZDA 2XEZA 3UVPA 5J7HA 4D9TA 4IC8A 4O7RA 4UX9A 3C4WA 4BDJA 4QMSA 4F1OA 4QYGA 4C35A 4NJ3A 1H1RA 3P86A 3BEAA 4CEGA 3QKLA 3LQ5A 5AP1A 2YDJA 4FKRA 5IA1A 2UV2A 3O8PA 4OTFA 4CTBA 2P2HA 3IDCA 4GG5A 2C3JA 4MF1A 4RJ3A 4IAAA 4EZ5A 3I60A 1ZMUA 4AW1A 5JFSA 4ZIMA 4G17A 3FMJA 4JQ8A 4H3PA 4Q9ZA 2O8YA 2HYYA 5KMMA 2GFCA 5GJGA 3AD6A 3HDNA 4MQ2A 3KGAA 4OTGA 5BUEA 5J1VA 2A19B 1G8AA 1XJDA 3KULB 4RBLA 2PUNA 2JITA 3FSKA 1YDRE 4O7YA 3RVGA 4YTCA 4PMTA 4PL5A 5EW9A 1RE8A 3BWFA 2UZTA 4KRDA 4JX7A 5GNKA 5JKGA 3AQVA 2X6DA 4DH8A 3BHYA 1Q4LA 3CE3A 4FNWA 3DJ5A 4P90A 5IQHA 3DU8A 3ZO3A 4IWPA 5FTOA 4QYFA 2C6MA 4G3GA 1RW8A 4O7VA 4YJPA 4I3ZA 3MPAA 3U9NA 3NGAA 3Q32A 4IFCA 4TNDA 3PIZA 4MHAA 4W4YA 2Y9QA 1F5QA 2ITXA 3EQFA 5DIAA 3ZDUA 3I7BA 4D4RA 3W0NA 3GFEA 5DA3A 4H1MA 4TWOA 3QWKA 3BHHA 2QOLA 2F9GA 2XIRA 4FNZA 4B8MA 4BCMA 5E8UA 1IAHA 4DG2E 4FSMA 1GAGA 3SX9A 3UOJA 3QZGA 1ZYCA 3D2KA 3AC5A 2ITWA 2C6LA 4AGCA 3TUCA 2GNFA 3QF9A 1T46A 3CQUA 4W4VA 1YXTA 4FZDB 1QPJA 2Z60A 2X0GA 4Y73A 3BV3A 4GW8A 5CXHA 4NW6A 5KZ0A 2X1NA 1DM2A 1YXSA 1KE8A 3R7YA 4RC4A 1NVQA 5CENA 5AIKA 3FLNC 4A4LA 2WMQA 3H0YA 3R00A 4RC3A 3REPA 5CANA 3VNTA 2QLQA 2O3PA 2V5QA 2XCHA 2WTKC 4QP6A 3NAXA 2XRWA 3KMMA 2WQMA 3D7ZA 4RFMA 3R04A 2BTRA 3E88A 4XBRA 4LV8A 1B6CB 5HE1A 3F2AA 3UYTA 2YIQA 3UO4A 3A4OX 1R1WA 4DC2A 3AT2A 2Y4IC 3PVUA 5M51A 3SA0A 1PXJA 2QKRA 3SLSA 3EFJA 2R0UA 2PUPA 3PY3A 3HV3A 4Y8DA 5EQEA 2HXLA 4ZSJA 2XB7A 5I9XA 4D1ZA 1TQMA 5T3QA 1O6KA 3CLYA 4DHFA 2X8IA 2Y0AA 2W0JA 4RJ4A 4I21A 3T3UA 3WYYA 2J0MB 1AD5A 2VGPA 1KV1A 4RWKA 4ENXA 3L9LA 4MYGA 4DFLA 3EIDA 4QMTA 4RLKA 5AFVA 3RK7A 2VWIA 4K8AA 2E9UA 2R3OA 4GT4A 4BB4A 2ZYBA 1P14A 5TR6A 3AC4A 4D1SA 3QTZA 3EKKA 5CAQA 4I0TA 5M55A 2OLCA 2B1PA 3FI2A 4GUEA 4K0YA 5BX0A 3TJCA 1FINA 4EZ7A 2NRUA 4EOOA 2HXQA 5IUGA 1H1SA 1VYWA 3NYXA 4L7FA 1KE5A 3EL8A 4C38A 1PMNA 4GKHA 5H3QA 3W16A 3P78A 4QYHA 3QLGA 5HG5A 4A4OA 3FLYA 2JDVA 3W2OA 2OXDA 4CXAA 4L7SA 3FKNA 4EJNA 3GXLA 4FIHA 3R8VA 3IW8A 2WEIA 3IG7A 2NO3A 2QHNA 3SQQA 4XG2A 5FM3A 4DEAA 3HZTA 1Y6AA 2J6MA 4FV9A 4XRJA 5EH0A 5EQPA 4DFBA 1V0BA 4ZS0A 4EOJA 4FOCA 4RX5A 3SW7A 2C69A 4IAZA 2X7FA 5KMLA 3PA4A 4HVSA 1P2AA 4BZOA 3ETAA 3ID6C 2C3IB 3D5UA 2OF2A 4DEDA 4DFNA 4NCTA 4CFVA 1NY3A 3ZOSA 3UO5A 5DT3A 4DGMA 2BFYA 3PWYA 5IG1A 3TJDA 3O7LD 3NNXA 3PYYA 1KOAA 4X3FC 2B55A 2QOHA 5CASA 5HX6A 5F20A 2VD5A 4RX8A 3CEKA 1K2PA 1OITA 1ZAOA 2I40A 3O0GA 5ETAA 3FJQE 2YZAA 2UZBA 4EOQA 4W4WA 3PZEA 4D4YA 2DQ7X 4LUDA 1VYZA 4GVJA 4JIKA 3VS1A 4HYSA 3ZFYA 3VAPA 4AXAA 4GK4A 4EHZA 4PDOA 2RKUA 4B6LA 5J9YA 3MSSA 2YITA 1ZARA 2XH5A 3JY9A 3O2MA 3QC9A 1MRUA 5HNIX 3DAJA 5DGZA 2XNNA 3QZFA 1IASA 4QP8A 3GQIA 3QWJA 4IX3A 3TZ7A 4BZNA 4DEGA 2YABA 4IX6A 4EKKA 1NVSA 4FT7A 4L42A 2B52A 3H3CA 4K33A 1M14A 4TNBA 2PUUA 4LMUA 3KC3A 4CMUA 5IA3A 4QQCA 4YNEA 2XIKA 3C4CA 2B54A 3KN6A 5HIEA 5AUZA 3QUEA 4E8AA 1E1XA 3PE2A 4Z7GA 3COIA 4XMOA 5F95A 3TZ9A 2XYNA 1OVEA 4GL9A 3VS2A 4FK3A 5EI2A 3S4QA 5M07A 5M4FA 3E63A 4L6QA 3E8NA 4IQ6A 4QP4A 2YCFA 4JX3A 4G6OA 3LPBA 1VR2A 4HGLA 3MYGA 5HCZA 3G6HA 4D2RA 4ZSAA 1OKVA 1Q8TA 4X6QC 4XH6A 3GU6A 2ZM3A 5JGAA 3MH1A 5CT0A 3QRUA 4YGAA 3PXQA 1R0EA 4IAYA 3Q5ZA 2X2MA 4ZTSA 3OCTA 5L6WL 1PXNA 5C8MA 3DBDA 4BRXA 2VWUA 4JVGA 3W0QA 3M2WA 5BMSA 3MPMA 1NT2A 2CNQA 3G15A 3S00A 3IGGA 3LLTA 4O0RA 4R7BA 3ZC5A 2UW7A 4AAAA 3VVHA 2XKEA 1PY5A 3KXNA 3V6SA 4M3QA 4K11A 3BU3A 3MI9A 4I20A 3K2LA 3POZA 4P5ZA 2GNHA 4CKRA 2UW0A 4S2ZA 4IVDA 3OVVA 4C4JA 1XWSA 2Z7RA 3MV5A 5AM6A 3DFCB 4G2FA 4QQ5A 5HE2A 5CAOA 1A9UA 3M42A 3F3ZA 4AT5A 4DGGA 3RCJA 5A4EA 3HEGA 4FTAA 4UYNA 4BDGA 4AN9A 2PVMA 2A27A 2NRYA 2OSCA 3KREA 4A07A 5F1ZA 2OH4A 2GFSA 4QMXA 3CBLA 5IQDA 5F9EA 4RFYA 5EHOA 2CKPA 2BKZA 3FHRA 4Y72A 2YDKA 2UVXA 2F57A 3IK3A 2BAQA 4FTNA 4TWCA 4M12A 3OBJA 4YZMA 5ANKA 2IZUA 2R3JA 4K9YA 4U41A 4FSNA 3CKXA 4BDCA 2ITPA 4YBJA 4FSUA 3DTCA 4E4LA 2J50A 3FLQA 4JDKA 3IPHA 3NCGA 3R8LA 4G6NA 5HBJA 4R3PA 4A4XA 5AMNA 1L3RE 5IMEA 4R6VA 2HOGA 4S31A 4KAOA 3ZLWA 2XK4A 2UW5A 3ZYAA 2QI8A 3HMOA 3CJGA 2QG5A 3ORMA 3DLZA 2BUJA 4ITJA 3TYKA 2IZSA 3ALNA 3LFDA 4EBWA 5IPJA 3BYUA 2C6DA 2ETMA 3CD3A 3KXHA 4UZHA 4BY9E 3QHRA 3KRWA 3OHTA 1QMZA 3PXFA 4BGHA 3EQRA 2ITYA 2X9EA 3FC1X 3MJ2A 3BCEA 4BICA 4FIIA 3HL7A 5CWZA 5D11A 4XBUA 4IM0A 1ZYJA 4AS0A 3ZUUA 3ORXA 3OWKA 4MXAA 2CNVA 4WRGA 3L1SA 4PL3A 2WMTA 1P4OA 3PPKA 3A7GA 4HGEA 4CGAA 4EC9A 3BBWA 2IVUA 1PMEA 5C4LA 3EFLA 5BVEA 4C34A 1S9JA 4L43A 3FXXA 2B4SB 3EZRA 5D10A 5AV1A 5CU6A 2Q83A 1IRKA 3B2WA 4NWMA 4U3ZA 5C1QB 4RSSA 3U55A 4CRLA 3S3IA 3KA0A 3PXYA 4XG9A 2UZDA 3IDPA 4AN3A 3V5PA 4AT3A 4EONA 4X2KA 5CEOA 4WZYA 3OWJA 4IX4A 5DI1A 2BALA 3QTXA 3G5DA 5T68A 4EWHA 4I41A 3EZVA 2WAJA 2HW6A 3NNWA 4ZXTA 4C3FA 4C58A 4XLIA 4MK0A 4DEBA 4C59A 4R7IA 4N0SA 3SOCA 2XIZA 2XIXA 3AGMA 3DQXA 4JAJA 1PRYA 2EB2A 3BQRA 4JBOA 4C7TA 2O63A 4F63A 4V04A 1XBCA 4ZS4A 4FEWA 2X81A 2PZ5A 4MEDA 4AUAA 3DJ7A 3Q2MA 4YSMA 3TV4A 2EXMA 3MFUA 4RVMA 4E6DA 1WZYA 3B8QA 3Q4UA 1VJYA 3U54A 5DYJA 4M13A 3WOWA 3C0IA 4O6LA 4R78A 2ZDUA 4L3JA 3UIXA 4EHVA 3I0QA 2B9FA 1NA7A 3LMGA 4BYJA 3LQ8A 5JRSA 3LIJA 4H58A 1JQHA 4EOKA 2JBPA 2JC6A 3BYMA 2HWOA 3OCBA 4GFGA 4U5JA 5AADA 3GCSA 4ZOGA 5HKMA 2WU7A 4QTAA 4D1XA 4LL0A 3GI3A 5J87A 1B38A 4XG4A 3IECA 4ERWA 4D4VA 4O91A 1QPCA 2ZMCA 2OH0E 2W5HA 2PE1A 2WTKB 3THBA 4WIHA 4A9RA 2EU9A 3OY1A 4QMZA 4WA9A 4X7QA 5FQDC 4B99A 4C0TA 3JS2A 3COKA 2E2BA 3FI3A 4CT1A 5CI6A 4X21A 4FZFB 2GS6A 5IDPA 5FP5A 2Y4IB 4K18A 2WMAA 3V5QA 1RQQA 2QHMA 5HCXA 3HKOA 3TDWA 4AW2A 3LKMA 3CXWA 3JXWA 4F1MA 3VUHA 1YDSE 2WHBA 5K5NA 1JSUA 3KF7A 5CVHA 3A7JA 3BHUA 2CGXA 3EYHA 4GH2A 3KMUA 4S33A 3R7EA 2V62A 2AC3A 2YCQA 4C3PA 1L8TA 1FVTA 4S30A 3KRRA 4JG6A 4L67A 4X3FA 2Z7LA 2PMNX 3ZZWA 4XV3A 4PTCA 3LJ2A 5AP0A 3VIDA 3AMBA 2I0EA 4FZAB 3CTHA 5LOHA 2V22A 1M7QA 2F4JA 4CKJA 5IQGA 3QQKA 2UZOA 4LOPA 5AP4A 1QPDA 5M06A 4E4XA 3E8DA 3ANRA 3LMHA 2E9VA 2GHMA 1GZNA 2WGJA 2W9ZB 3EN4A 1Q24A 4ACGA 2R3RA 3MA6A 4FTTA 3P4KA 3IW7A 4AE9A 3E87A 2BCJA 3QA0A 1Q99A 4J52A 4W4XA 3SVVA 3K54A 3R28A 3FMDA 3S0OA 1UVRA 3EMGA 1ZWSA 4KBAA 4XYFA 3UTOA 4EL9A 2R5TA 2PZYA 4FV8A 2OZAB 5BVOA 4MXCA 4MTAA 1LP4A 1I44A 3DFAA 4BCHA 1H08A 2XIYA 4ACMA 5JGBA 3U6IA 3SKCA 4PWNA 1OECA 4FEVA 4BHNA 2HY0A 4FL3A 4JL9A 4GU6A 5HIDA 3TNPC 1OL2A 4JXFA 5J1WA 3EN5A 2YWPA 5EDQA 4LMNA 4CG9A 2R3MA 3H10A 3QQHA 1FGIA 1JKKA 3UNJA 4EORA 2FH9A 3BGPA 2YWVA 2ZJWA 3DDQA 3R02A 4Z55A 2W9FB 2XF0A 4PMPA 4PY1A 2BHHA 5HZNA 5L2SA 1F3MC 4WHZA 4KA3A 5HBEA 5M57A 4FODA 3HUCA 5A9UA 3SDJA 3W2SA 5JZJA 4K2RA 4X3FB 4TTHB 4TY1A 3II5A 4FKIA 4NM0A 4GIHA 4EKLA 3LFSA 3NUYA 3FEGA 5TT7A 4ACDA 5GINE 2PMIA 2EUFB 3FXWA 4FX3A 3AD4A 2OK1A 3QRTA 4BTKA 5KHWA 4BKJA 3I81A 2Y6MA 2LGCA 3MVJA 2C0IA 4O7ZA 4O0WA 2ZV7A 3OP5A 2UZVA 2W4OA 2OKRA 3JPVA 3CQEA 1GOLA 1XH6A 3FQSA 3HNGA 2OIDA 4I24A 4AZSA 2XJ0A 4C4HA 4ZZOA 3I5ZA 2PZPA 4XG6A 2R7IA 5AV0A 5CEIA 4CFMA 3VC4A 3QTQA 4CTCA 4XP0A 4AP7A 3O17A 4F09A 3F9NA 4YZBA 5AUTA 4EEVA 2BVAA 3GC8A 3TNHA 4CLJA 4PTEA 3VBWA 4OUCA 3LW0A 3KCKA 3O23A 4A9UA 2ZM4A 3GCVA 1FBNA 4CV8A 4CRSA 3ROCA 2CKQA 4MBLA 1WFCA 3OFMA 4QPSA 1CMKE 3OOGA 4U44A 4ZY6A 2JKOA 2J4ZA 2PMLX 2NPQA 3RMFA 2YIXA 3AC3A 3MB6A 3NSZA 3AC2A 3QTRA 1BMKA 3UQGA 1GZOA 1OBDA 3FZRA 4RIXA 4UWBA 4M69B 4ALWA 4ZLZA 3TM0A 2XM8A 1KV2A 2RFEA 3KB7A 4CLIA 2WMRA 5HIBA 4EK8A 3DB8A 4O27B 3R73A 3A4PA 3W2PA 4DA5A 3KVWA 3QQLA 1WBSA 5I9VA 2VTHA 3HRCA 3RPYA 1E9HA 3FPQA 3V8WA 3Q9XA 3N4VA 4CT2A 3BE9A 3OZ6A 3MFRA 4EK6A 3OROA 4DGNA 4Z7HA 3RM6A 2ITOA 3HP2A 2X4ZA 2DS1A 2UVYA 4YP8A 4HCVA 5LVOA 2BHEA 3P7AA 3KRJA 2WMBA 4U7ZA 3AXWA 3ZH8A 1FVRA 3BE2A 1OB3A 4NW5A 3LXKA 2O2UA 4FV7A 5HE0A 3KVXA 4BCKA 1J1CA 3M1SA 3TEIA 3RNIA 5A4TA 3LCDA 5A6NA 3UPZA 4QQTA 3FQEA 3EN7A 3QZIA 3QTIA 3CY3A 4FSQA 5IA0A 4IIRA 2ONLC 3BKBA 2FSMX 3BU6A 5HICA 2ITTA 3EQBA 3MN3A 3ORTA 4CFNA 5K3YA 5CF6A 3F7WA 3ACJA 4GJ3A 3DKCA 3ULIA 4EQCA 4TKSA 3GEQA 5IISA 1SVGA 5FRIA 2YJSA 4GIIA 3RI1A 1YHWA 3VUDA 2YAKA 2OXXA 4UB7A 4X6RA 2C6EA 5KMKA 3F61A 4PF4A 4KSQA 4RWLA 2WTJA 2PVHA 3D7TA 5EK7A 1OMWA 4O6EA 2WQNA 3LCSA 4QMNA 4CMTA 3TWJA 4YZCA 1BUHA 4DT9A 5AAGA 4J7BA 4G3DA 2VTMA 3SXFA 4E6CA 2ZV9A 3VJNA 4QMPA 3MDYA 3NUAA 4DGLC 3OF0A 4FEUA 4YJQA 1W0XC 2O0UA 2ZDTA 3NS9A 5L2TA 2O5KA 3UVQA 2I1MA 2Z7SA 4XNEA 2ITUA 2WKMA 3P7BA 3ENMA 4S32A 4DINA 3QFVA 5KZIA 1PJKA 5IA5A 4EYJA 5KMNA 3IW6A 3DK3A 3Q53A 4FGBA 1YOMA 2W06A 4MXOA 4QMOA 4O7SA 4R3RA 4XOYA 3R8UA 3TNWA 1OKWA 2PZRA 4IVBA 4CKIA 4DTAA 3WIGA 3MVMA 4PNKA 3I5NA 4EZ3A 3NW5A 4I23A 3R1NA 4NJDA 3KXGA 3H9FA 4DYMA 5KCVA 3VS3A 4JG8A 2R0IA 3UMXA 5ANJA 1LPUA 1W83A 2CKEA 1M52A 2BZIB 1OL5A 3ZLYA 4JNWA 5CSXA 4ZTNA 4MH7A 4WKQA 5DRBA 4XG7A 2PU8A 2W1GA 1WVWA 3QALE 4FG7A 4HPTE 2VTJA 3PFQA 3E8CA 3O51A 4OGRA 4YZDA 5C4KA 2XNOA 3W1FA 2FO0A 3F3TA 1JAMA 3D7TB 2W1EA 2OG8A 3ZLXA 3LLAA 5FD2A 3QUPA 3QXPA 4MQ1A 2VWXA 3OEZA 3R1SA 1M7NA 1YI3A 4IFGA 2KTYA 3E8EA 5CS6A 4BDDA 2LAVA 5FTGA 2HIWA 2JD5A 4L8MA 1TQIA 3UZPA 2VTQA 4Y83A 3R8MA 3S95A 4I94A 3PRFA 2C6IA 2QONA 5EM8A 2GNJA 2QOIA 2BROA 3FQHA 2HZNA 4BYIA 4D0XA 3V5TA 3EYGA 2V7OA 3Q9YA 2DUVA 2VWWA 4F6WA 1OZ1A 4JS8A 2XKFA 2X7GA 5AEPA 3A99A 4PRJA 4JDJA 5LVPA 5H8GA 3FY2A 5BUIA 4CCUA 4ASDA 5CXZA 3DT1A 4ANLA 2VTIA 1WVYA 3GB2A 3CP9A 5IH5A 2DWBA 5EI6A 3UE4A 1H28A 3RGFA 4WG5A 3A7IA 2AC5A 2FYSA 3W2CA 3R8ZA 5CU0A 2YN8A 2VGOA 2HK5A 3OT3A 4I5CA 2JDOA 1REJA 4QTEA 3GC0A 3ORIA 4FGRA 3SOAA 2OIQA 5AX9A 3VS7A 4IACA 3S1HA 5AUYA 4F65A 4IEBA 2WTDA 4F9AA 3QX4A 3W2RA 5CEKA 5ACBC 3DGKA 4HYHA 5KHXA 1OIQA 3FMKA 1DS5A 3GU8A 4GVAA 4NFMA 3DXPA 3BBTB 3NCZA 3OWLA 5EDPA 2JAVA 5AP5A 5AP3A 4O0YA 5E91A 1BKXA 3EFWA 3Q96A 4F9BA 4FTKA 4FZ7A 4BF2A 2RG5A 3JY0A 3NRMA 3UOHA 3DLSA 3ACKA 2E9NA 4XP2A 4ZTLA 2X8EA 4FSWA 4J97A 2F49A 4QQJA 3SD0A 3NUUA 4I5HA 3NMUF 2BR1A 3QYWA 4FV3A 1Y8GA 2YCRA 1CKPA 4OBQA 2QOQA 2X2KA 2CMWA 4MCVA 2PYWA 3OD6X 2P3GX 2JKKA 2VO3A 2X9FA 3EQDA 2PZIA 4FI1A 5IEYA 3LFFA 5D7VA 4AN2A 5AWMA 4FKPA 4GSBA 4KB8A 4FKTA 4F64A 2W1CA 3E93A 5G1XA 5HNBA 3SG9A 1H4LA 3VBVA 2GS2A 4EHGA 3EJ1A 1JBPE 1OIYA 3D9VA 4EUUA 3HRFA 1J91A 4ZP5A 5ITAA 3UNZA 2C5VA 4Q5HA 3WE8A 3RTPA 4O7TA 4FTOA 5JRQA 3DBFA 5IF1A 4YC3A 1WBWA 1YHSA 2W17A 1BX6A 2OICA 5IQAA 1JLUE 4IWDA 3HLLA 4GT3A 5EDRA 4ZSEA 5JMSA 2WQBA 3GBZA 2B7AA 4P4CA 2VWVA 3HMNA 3ZRKA 2ETRA 4XUFA 3F3VA 3MESA 4A9YA 2QU5A 4DG0E 5HX8A 4HGSA 3D15A 3O7LB 5CZIA 2IW8A 4AOIA 5C26A 1BI7A 3E64A 3R2YA 2R3QA 2QOKA 2YM8A 1ZOGA 4G1WA 4NTTA 3RM7A 2Z7QA 3QQFA 5GJDA 5EYKA 1OUYA 3Q4CA 2ZOQA 1S9IA 3FL5A 4JBQA 4MNEA 4ONAA 3HRBA 3E92A 1JNKA 1QCFA 2KULA 3NLBA 4DCEA 4BIEA 4KIOA 5ACKA 4C62A 3HV4A 3C4XA 1Q3DA 4RA4A 1Q5KA 2QODA 3QXOA 3TZMA 4WO5A 4DEHA 5HTCA 1KWPA 2X2LA 1YW2A 4E4NA 3TIYA 1Q8WA 3NW6A 3UZRA 4BCOA 1OPJA 3F6XA 4IC7A 5LVMA 5LVLA 3TUBA 2VU3A 2VWYA 5FEDA 1ZXEA 3G0FA 3PA3A 4BIBA 4FTCA 1WBVA 4IAFA 2I6LA 4DN5A 3TNIA 3QGWA 1H26A 5FEEA 4E6QA 2EWAA 3UOLA 3CIKA 3G90X 5DH3A 2G1TA 2IO6A 3ALOA 4RMZA 2JKMA 4I6HA 1SM2A 3VUGA 3W0MA 1LR4A 4RJ8A 3UBDA 3SXSA 5AM7A 3PY1A 3VJOA 1TVOA 4TRLA 3TT0A 3RZBA 3I1AA 3HVCA 3C13A 5KMOA 1YDTE 1H1QA 3LCKA 1YWNA 1PHKA 4ID7A 1URCA 2UZLA 4GU9A 3PDTA 5HESA 5HTBA 3FWQA 4Y5HA 4II5A 3DKFA 2JDRA 2VTNA 2WIPA 5IA4A 5LMKC 5HQ0A 4XCUA 3NIEA 1K3AA 4J98A 2I0HA 2ONLA 3IQ7A 1WVXA 2OZOA 4GT5A 1J3HA 5HG7A 3F2RA 4L9IA 4MD7E 3WZKA 4TL0A 4I6BA 4ACCA 4C4FA 3ODYX 4I22A 3GC7A 4HYIA 5AUWA 2HZIA 2YDIA 5I5ZA 2PVKA 2XA4A 3FUPA 4KS7A 4MNEB 4PV0A 4Q9SA 2H96A 2JFLA 4YJRA 5AIRA 5CALA 5EG3A 4TYJA 1KE9A 5A46A 4YJNA 4X2FA 4C02A 4DH3A 3DXNA 2GDOA 5CVGA 2VO6A 4WBBB 4WOVA 4QRCA 2OFUA 4RFZA 3HV6A 1KE6A 3TCPA 4QP2A 5DG5A 4AA0A 4D9UA 1ZYSA 4L52A 4PDSA 1UKIA 1Y57A 2VTPA 4F7LA 1JOWB 2C0OA 4O84A 4EK3A 4FV6A 3C5UA 3VUKA 2P33A 4XG3A 4X0MA 3R83A 2GHLA 3UYSA 2IWIA 3MGYA 3V5WA 3IDBA 1J7IA 5E8VA 4ZZMA 2CHLA 1XH8A 1K9AA 3IW5A 3WARA 4AZVA 4D5KA 3OW4A 1SMHA 4KWPA 2PWLA 4BBFA 3UJGA 3WF8A 2WIHA 2UW8A 4NT4A 3RHKA 1U46A 4EH2A 3EOCA 3A2CA 3E62A 5DT4A 4MXXA 2VWBA 3LJ0A 3HAMA 3R9NA 3MVHA 3GVUA 3RALA 1PMVA 5A3XA 4LOOA 1PYXA 4O0VA 5G6VA 4ZJVA 2VX3A 5IUIA 4WSYA 5ICPA 5CSHA 3MPTA 2XNMA 5LMBA 1YXVA 3MFSA 1H1WA 2Y6OA 2PVJA 2XK8A 4K6ZA 5CSWA 4EOPA 4YLLA 4IVAA 2VZ6A 3O71A 4EC8A 3ZBFA 1LEZA 2CDZA 1SZMA 2BMCA 3RPSA 4BCPA 2BAJA 4BI0A 2YIWA 5L8KA 4H05A 4DFYA 4FVQA 3VBYA 1SNXA 4MXYA 3ZTXA 4BCQA 3OXIA 1HCKA 4IBMA 1CSNA 3DQWA 3T9IA 2UZWE 4BDHA 5L3AA 2WTCA 4RJ7A 4FIJA 3PG1A 2P55A 4U43A 3W8QA 4PDYA 3DB6A 5LVNA 3P08A 3ITZA 5FTQA 4O7PA 1J1BA 3DKOA 2GCDA 2PVRA 3LXNA 4PP9A 4ZLOA 3VO3A 2XNGA 5IMXA 3FDNA 1MUOA 3L8VA 4H3BA 3PVBA 4ANSA 3UGCA 4ZTMA 4U80A 3V51A 2UZEA 2Y8OA 1V0OA 2ITQA 3ZXZA 4D5HA 4E26A 3R9HA 4O96A 2J0LA 2QOCA 4PTGA 4JRVA 5CX9A 1H01A 2BRGA 1U4DA 2AYPA 4LGHA 1M2RA 4ANBA 4LV5A 3KK8A 1CTPE 1ZZLA 2XK9A 4ACHA 3UZTA 2VX0A 5HCYA 3BRBA 3GCQA 3AGLA 2H8HA 2QR8A 3BWJA 5FDPA 1JPAA 3EQCA 4V05A 4BGGA 3FHIA 3MTFA 3RK5A 3FMEA 4FL1A 5ETCA 3OT8A 5H2UA 4YMJA 3DA6A 1NVRA 3DBEA 4YJTA 1GY3A 3D4QA 4FTLA 3UVRA 4F0IA 2WXVA 2WMSA 3FMHA 4L01A 4AFJA 5EM6A 3Q4TA 4APCA 2IZRA 2GQSA 1GIJA 4OTRA 4L3PA 4RWIA 4F9CA 2R3GA 5E7RA 2ITVA 4P5QA 5AAFA 4QMQA 3TTJA 3A60A 3QTUA 3H9OA 4TT7A 4G31A 5DNRA 3VQUA 1G8SA 3E5AA 3NUPA 4DG3E 4XOZA 3MB7A 4RIYA 4M0ZA 3BHVA 1BLXA 4IB5A 2PUIA 2YM3A 3LCTA 3PJ1A 4UEUA 1G3NA 5TO8A 3FXZA 3ANQA 4FA2A 4RJ6A 1AQ1A 4ZMEA 2BZJA 3LZBA 3ERKA 5BYYA 2UW4A 1R0PA 3HGKA 3CC6A 4JBPA 4KUJA 4R1YA 1Q8UA 2IVTA 2XK7A 3CGFA 1OIRA 1MRVA 3Q4ZA 4YR8A 2V0DA 3C5IA 3GQLA 3RK9A 4RQVA 4EH9A 3OUKA 1OBGA 5CQUA 1OUKA 4R5YA 1TKIA 4YLKA 5FEQA 2RL5A 2J90A 3N9XA 3LCOA 5JEBA 2H9VA 2R3FA 2VTRA 2SRCA 3C4FA 2HWPA 2YZLA 3PSCA 2PVFA 1JSTA 5DLSA 5ANDA 4CZTA 3KCFA 4N6YA 4QP1A 5H8BA 2JLDA 3PPJA 3R01A 4FYNA 3D0EA 3FLZA 5BVDA 5JFWA 3OOMA 3PPZA 4MNFA 4H39A 1GIIA 3GT8A 3QZHA 4IJ9A 5DN3A 4YHJA 4R77A 5DEWA 1XQZA 1JWHA 2J0IA 3R21A 1H0WA 3L8XA 3PZHA 4G6LA 4I6FA 3VUMA 1H00A 4S34A 4NM3A 3LMIA 3ZSGA 3PY0A 4Q5EA 3RAHA 3WF7A 5B0XA 3BLQA 2F2UA 4NSTA 4ZK5A 3FYKX 3MTLA 1UU7A 4RIYB 4NU1A 4WRSA 4D55A 5M56A 2QO7A 4XP3A 2RIOA 3PUPA 3WF9A 1CDKA 3R6XA 3W0OA 2FSTX 4O21A 4RGJA 4QTCA 3T8OA 4CFXA 3FMLA 1FMKA 2V55A 3NYNA 4I93A 3FZOA 4RG0A 4RWJA 3UDBA 4YJVA 4NUSA 3FY0A 3V3VA 4FL2A 4FT3A 4CG8A 5CEMA 3IOPA 5GJFA 4FEQA 2QG7A 3QUDA 4G3EA 2YA9A 4FV0A 4HZSA 3KN5A 2R3HA 3QX2A 4D0WA 1H1PA 2R3LA 1H07A 3TTIA 4UY9A 3GCUA 4J53A 4FKLA 4ANMA 4BI1A 4EWQA 5HU3A 3UG2A 4BR3A 2XVDA 4RLLA 3UQCA 5AAEA 1YXXA 4I4FA 5D12A 2UW9A 5KX8A 4FTJA 5E1EA 4DLJA 3GU5A 4LM5A 5E9EA 3IGOA 4JOAA 4MBIA 3SRVA 4V01A 4ERKA 2A4LA 5HU9A 3RHXA 3D14A 1PXMA 4I4EA 4AFEA 3MVLA 4ITHA 4DH7A 3CSVA 4GMYA 3V8SA 4ZY5A 2R4BA 1BI8A 5ANGA 3L9MA 2XKDA 1W7HA 2GQGA 3I6WA 1QPEA 4XX9A 3A7HA 4GYIA 3ET7A 3N4TA 3GCPA 4QMWA 4RQKA 4FKSA 3OCSA 3DKGA 3VHKA 2X8DA 3QRIA 5EKOA 3ZUVA 3SXRA 3QYZA 3LFCA 4YJSA 3KXMA 4NM5A 4Q2AA 3L9PA 5LMKA 1MRYA 4HZRA 3WF6A 5FXQA 2B0QA 3R7IA 3HAVA 4W8DA 2B9JA 2VV9A 3D5WA 3Q52A 4R7HA 5JSMA 2VO7A 1OL1A 3F69A 4HOKA 4LFIA 3DZQA 1FQ1B 1PXOA 4JDIA 4WNPA 4O7NA 4JQEA 4C37A 4EH5A 4H3QA 4FV5A 4CZUA 5I9UA 3DS6A 1JVPP 2QLUA 3BQCA 2C30A 4UBAA 3FV8A 2CGVA 3EFKA 5ANIA 4OBOA 3A8XA 3BYSA 4WNMA 5L6PA 2PE0A 1XBAA 3FMNA 2CNUA 4RZWA 3PIXA 2XJ1A 5JQ8A 4YTFA 4CCBA 3P1AA 2GNIA 3QC4A 2NP8A 1W84A 2YIYA 3ROYA 2CGUA 4F0GA 1OGUA 2FSLX 3F88A 4A9SA 5IZFA 1UNGA 3KFAA 4CNHA 4ALVA 1MQ4A 1VZOA 4QT1A 4MKCA 2PE2A 3PP1A 1Q97A 4ZTHA 3VRYA 1SVHA 5M4UA 4O86A 2GSFA 4K1BA 3P9JA 3Q9WA 4BDBA 3BX5A 4EK4A 2QC6A 1DI9A 5CU4A 3ZO4A 1I09A 4BCJA 1PXKA 3ZM9A 2QCSA 1YI4A 4ALUA 5JT2A 5BYZA 2OJFE 3HA8A 5LWNA 2PK9A 3R63A 1ZZ2A 5J95A 2GNLA 5KO1A 4LOQA 5A6OA 2XRUA 4FTUA 1U5RA 4IB3A 1XBBA 1BL6A 3DK6A 4WG4A 1XH7A 4GG7A 3MIYA 1XR1A 4BCGA 2OFVA 2A0CX 3GOKA 3UPXA 4XV2A 5CEQA 3UIUA 3ZEWA 1XKKA 4FT0A 3AT3A 4KINA 4GRBA 4TYHA 3GP0A 5CNNA 2XJ2A 2QURA 4GJ2A 1R3CA 4HPUE 4KKHA 5EKNA 2GPHA 4CV9A 3F5XA 1DAYA 4ARKA 1YHVA 2FSOX 4U3YA 3PXKA 4AG8A 3WF5A 3R7VA 4F9YA 2J9MA 5FGKA 3UOKA 4AA5A 1A48A 2F2CB 5CEPA 3C50A 5HVKA 2J51A 4G5PA 5CI7A 5CTPA 4GK3A 1YQJA 5AA9A 4RX7A 4GYGA 3C0HA 4N57A 3GOPA 4E5BA 3DAKA 2CPKE 3PA5A 3Q6WA 3QCQA 4GV1A 1YWVA 4FSTA 1W82A 4MXZA 4QYYA 2J0KA 2H34A 5EW8A 3SW4A 4JDHA 4IDTA 5DR9A 3SGCA 3VF9A 4E73A 4FIGA 4EOSA 4BIDA 3CPCA 3RJCA 5HLNA 2O65A 5FBNC 2W5BA 4RT7A 2R3KA 3HDMA 4IAKA 4JT3A 3LFNA 3W10A 4IX5A 2F7ZE 3B2TA 3O8TA 4AA4A 4EQMA 4IE9A 4LG4A 3PXZA 2R7BA 4O2ZA 4R1VA 3GUBA 5DVRA 2XBJA 3CTJA 4E1ZA 4FV4A 4Z3VA 3ZMMA 3R71A 4GFMA 5CU3A 2ESMA 2FA2A 4O81A 1KSWA 1FOTA 1ND4A 3DZOA 4FSYA 4A7CA 4C3RA 4BTMA 2W96B 3G6GA 4O2PA 3LFQA 3W33A 4XLVA 3NYVA 1P4FA 4U45A 5EW3A 5CYIA 3ZCLA 2B53A 4MX9A 4TYHB 3TG1A 5GIOE 2HW7A 5J8IA 1WBOA 2Z02A 5IQCA 4AGDA 2QQ7A 1H27A 4IB1A 4HGTA 2J5EA 4DFZE 2Y4PA 2GQRA 1UA2A 3PJ3A 4QMMA 4N6ZA 3BYOA 4TPTA 5CT7A 3UMWA 4PQNA 5D9HA 1MP8A 3A62A 3BPRA 3LFAA 3MW1A 3R1QA 1Q3WA 3EH9A 1STCE 1UNHA 5TKDA 3RAKA 4KBKA 3ZU7A 5CF5A 1FVVA 2WMVA 5FM2A 3W0PA 5HO8A 4ZLYA 5HVJA 1APME 5HD4A 5IQIA 5KBQA 2YCSA 4EQUA 2UZUE 3FZTA 3VS5A 1M2PA 3RCDA 2ERKA 3EL7A 4E5WA 3ORKA 2W1ZA 4RIXB 4IH8A 4OT6A 4WBOA 4FTQA 3TL8A 2X39A 3HV7A 4JR7A 2CN8A 3E7OA 4V0GA 4NKAA 4YO6A 3TKHA 4CVAA 5KMJA 5KNJA 3DAEA 3G9LX 5KE0A 4XEYA 4UZDA 3W55A 4RZVA 1J7LA 4FSZA 1U59A 4JJRA 3QA8A 2JKQA 2V7AA 3OTUA 4RPVA 5H9BA 2UW3A 4UV0A 4YZ9A 5CF4A 4J71A 4XV1A 5HE3A 1KOBA 5EYCA 5LJJA 3CS9A 2JGZA 4MD8E 5JZNA 4XS2A 4USDA 2JDSA 4FNYA 5L6OA 2P2IA 1RJBA 2Z2WA 5ETIA 3VUIA 3HECA 4ENYA 5I0BA 2WMXA 4ZZNA 3G2FA 4ORKA 3W2QA 2QO9A 3OWPA 3IKAA 3TIZA 5HLPA 3R7OA 2C5NA 2XBAA 1HOWA 2OIBA 4PL4A 4EH7A 4D28A 5F4NA 3QQUA 4QMLA 2IZTA 4AU8A 4BDIA 2WMWA 4L00A 5C9CA 4U79A 4UXLA 2J5FA 3ZC6A 4F7SA 1CM8A 3MJ1A 3LFEA 2C3KA 4NFNA 4DBXA 3DTWA 4DTBA 5M44A 5D41A 4C2VA 1UU8A 3CQWA 3NAYA 5IUHA 2I0VA 4FKWA 4LRMA 2HELA 3DPKA 2YFXA 1WCCA 4BGQA 2NNWB 3VS0A 4BCNA 2IVSA 3DK7A 3QHWA 3NZ0A 4ZTRA 4AZTA 3MY1A 4V0GB 4AGUA 4EH8A 5AUUA 1Q61A 2C5OA 5LXMA 2BIYA 2WQOA 4DE4A 4G5JA 4IMYA 3ZONA 2ZVAA 3F3UA 3NVMB 1H25A 4TYIA 2XEYA 3RINA 4JIAA 4BVUA 2IJMA 4O0XA 1CKJA 4Y5QA 4AZWA 3BLHA 3QCXA 3FE3A 3NW7A 3QRKA 5T6KA 3DNDA 3EQPA 4I92A 5FLFA 4QNYA 5DT0A 4RVTA 2WFYA 4EHEA 4UXQA 5I9WA 3Q9ZA 3MH2A 5FXRA 4OBPA 2F7XE 1YOLA 3ZXTA 2JBOA 4LRKA 4DEIA 1UNLA 4DGOA 4Y85A 1B39A 4TZRA 4DEEA 3MH3A 2YERA 4U42A 3PJ8A 1F0QA 2OW3A 3HMIA 2WQEA 4O83A 2YACA 3L8PA 5BPYA 5M4IA 4PUZA 4CFUA 3CJFA 3P79A 5CQWA 4YJUA 4Z9LA 2ZM1A 4FICA 5I9YA 4M7IA 3UODA 4ZTQA 4YNOA 5LCKA 4ANQA 3R2BA 3M11A 4G9CA 1ZOHA 3CKWA 5AUVA 3U8WA 3TV7A 4U0IA 3DBCA 4YHFA 4QP3A 4HVIA 4M0YA 4O82A 3V8TA 5C8KA 5EYDA 1Z5MA 2OGVA 2OJGA 3K3JA 3KXZA 5BMMA 3P23A 3K5VA 4OTIA 5FP6A 3U51A 4FV1A 4JR3A 4FUYA 4EOIA 2XK3A 3S2PA 3MFTA 4KIPA 4HNFA 5TOZA 4C36A 4I0SA 4YLJA 2I0YA 1PYEA 2IG7A 4N4SA 3GU4A 3VW8A 3GENA 2CN5A 3QD3A 3Q60A 2JDTA 5A14A 3O96A 1Q41A 3PIYA 3FZ1A 4QMUA 4BCFA 3MWUA 4U6RA 2HZ4A 3UP7A 3VS4A 4JAIA 1H8FA 1SYKA 2PSQA 2BRHA 2OU7A 3EWHA 4O7LA 3DOGA 5FUTA 3TXOA 3U9CA 1UWHA 4FVPA 4HCUA 4WG3A 5L8JA 3Q6UA 3R9OA 2W05A 3UC3A 3ZHPC 1IR3A 4AOJA 2C6KA 4PP7A 3VWAA 2QU6A 5BVWA 4QMVA 4BCIA 4OTQA 4FE2A 3LJ1A 5EI8A 1G5SA 3ZZEA 3D5XA 4JG7A 4EK5A 3H9RA 3DBQA 4U94A 1LUFA 2JIIA 3QBNA 2W7XA 4K77A 3FZPA 5HBHA 3JVSA 3VBXA 5M08A 3ZRMA 4E20A 4FG9A 3LM0A 4J8MA 4IZYA 3WZEA 5DPVA 3ATTA 2EVAA 3NUSA 5E8XA 1PKGA 5DBXA 4DITA 4HVDA 5LWMA 4E93A 2WPAA 4ASXA 3OXZA 5DE2A 3BZ3A 1SVEA 2UVZA 3D5VA 3DV3A 4M84A 2YM5A 4IJPA 4FIEA 2UW6A 2BILB 2W4JA 3UNKA 2Q0BA 3R0TA 4YPSA 1REKA 3CCNA 3FPMA 3OG7A 2R3IA 5EHLA 2XS0A 5A4QA 4FKUA 3DJ6A 2RFDA 3HV5A 4M15A 5HHWA 3QLFA 5KUPA 2YJRA 3R8PA 2X7OA 5ANOA 2OO8X 4DBNA 5M4CA 4CQEA 3PTGA 5EQYA 3SHEA 3ZDIA 3NUXA 4E6AA 4ZAUA 2PY3A 4APPA 2JIVA 2C6OA 1GZ8A 4ITIA 2XNPA 3T3VA 4U98A 3GGFA 3GC9A 5LQFA 4IHPA 2VTOA 2XK6A 2YM7A 2P0CA 1OKZA 2PHKA 4IADA 1YI6A 3V6RA 5IH6A 1H0VA 5CVFA 3FKLA 5FBOA 5CAUA 2ITNA 4IWOA 3LQ3A 2BDJA 2PVNA 4QOXA 3PSBA 3L9NA 3MH0A 4X2NA 5BVNA 2WOTA 3Q04A 4N70A 3D83A 4B7TA 3QCYA 5B7VA 1WMKA 5K4IA 3F7ZA 1ZOEA 4I5MA 4TWPA 3A8WA 4X2JA 4DH5A 5KBRA 3A7FA 5D7AA 4BBEA 3SC1A 4UYAA 4KABA 2WOUA 1KUTA 4Y46A 4J1RA 3UC4A 4B4LA 5JH6A 4HVHA 2GMXA 2OJJA 2BAKA 3LE6A 4RA5A 4NIFB 1R39A 4WUNA 5E8ZA 2UUEA 4M14A 3LXLA 5AP7A 1XH9A 3C4ZA 1RDQE 4EOMA 2Q0NA 3SV0A 3WZUA 1V0PA 3OUNB 4YJOA 4ZSGA 2BRNA 5E4HA 3E7VA 4KKEA 4BN1A 4USFA 3FLSA 4F6UA 3H30A 4IB0A 3I79A
chains in the Genus database with same CATH superfamily
4WD5A 2G15A 4YTHA 2PTKA 1Y8YA 3LVPA 2BIKB 2PVLA 4PX6A 1IEPA 2PPQA 4FYOA 1XHAA 4IM2A 4FT9A 4YHTA 1GIHA 2QKWB 2A1AB 3ZSHA 4BJJB 4DT8A 3MBLA 5HNGA 5B2MA 2WO6A 3BU5A 4O22A 3ZRLA 2VTTA 3IO7A 3ZO2A 4F99A 4F4PA 4NL0A 4GCJA 5E8YA 3SAYA 3AC8A 3FAAA 4XJ0A 4UN0C 3KY2A 1OL7A 4JLCA 4FK6A 2IPXA 2X6EA 2BPMA 3V04A 4RRVA 1OL6A 3MIAA 4F78A 1O6YA 4HW7A 1IAJA 4F08A 4O0SA 3ZS5A 5AV4A 4NM7A 3VN9A 2FUMA 3U6JA 5BUJA 2A2AA 3C51A 3FLWA 3PJ2A 4C33A 3QQGA 2WD1A 5DEYA 3C0GA 2XNBA 3TI1A 4EUTA 2FGIA 4YZNA 3NIZA 1OPKA 2W99B 5A4CA 5LMAA 1PF8A 4C61A 1VEBA 4TW9A 1Z9XA 3F82A 4OLIA 4M68A 3NNVA 3KMWA 1JKTA 4BC6A 4HCTA 1OPLA 1DI8A 1IG1A 3DY7A 4O38A 4FV2A 2VTSA 5JQ5A 2XKCA 3G0EA 1QL6A 3EQHA 3G51A 1X8BA 4XRLA 2C68A 3GNIB 2QO2A 3UG1A 5L2IA 4G16A 4EOLA 2WZJA 4U8ZA 1YKRA 4AW0A 3WZJA 3FC2A 4ASEA 4KBCA 2W4KA 3ZM4A 4CMOA 3W0SA 5A4LA 2ZB1A 2VN9A 3VULA 3SG8A 2FVDA 2BDWA 4A06A 3G9NA 4UALA 2GTNA 4L3LA 5HEZA 4R5SA 4YU2A 3QU0A 2OXYA 5JFXA 3ORPA 4U40A 3COMA 4O0UA 4X3JA 4L45A 4FUXA 3NUNA 1Y6BA 5E8TA 4IWQA 3UQFA 3RAWA 3OMVA 3WYXA 2R9SA 1MQBA 4OR5A 4F1TA 5IU2A 2EXCX 3KQ7A 3P5KA 2J2IB 3RWQA 3BELA 4TYGA 3QD2B 4GS6A 5IQEA 4E7WA 4AX8A 4H36A 1ZMVA 4ZMFA 3QKMA 4R3CA 3WIKA 3V01A 1P5EA 1R78A 1XH5A 1UKHA 2CCHA 4UWCA 3OS3A 1YRPA 2WELA 3CGOA 5F94A 4ASZA 3F5PA 3UDSA 4LYNA 5BVFA 3VBQA 2VX1A 3NDMA 2VWZA 4NYEA 4WT6A 3TN8A 5CAVA 2BZHB 5AJQA 3HYHA 3NYOA 3Q5IA 2ETKA 3PWDA 2C1BA 5C8NA 3PVWA 4YURA 4IZ7A 5DRDA 3JVRA 3AD5A 4Y95A 4YC6A 3I0OA 4O0TA 5AX3A 2YISA 5EM7A 5JGDA 5CLPA 4D2SA 3ULZA 4FBXA 2O64A 4G3CA 3WI6A 3DCVA 3IONA 3ENHA 3I4BA 3W0RA 4FR4A 3VW6A 4JQ7A 1A06A 2G2IA 3VQHA 3NNUA 2J0JA 1ZMWA 5AV3A 1OIUA 3FKOA 3RPOA 4CFFA 2HZ0A 3BL9A 4FNXA 3U4WA 2BTSA 5KKRC 4A9TA 3ZEPA 3LXPA 5K9IA 3OEFX 4DLIA 3WZDA 4U97A 5C03A 3FI8A 3AT4A 4M97A 4H1JA 1YWRA 3LOKA 1PMUA 1Q62A 2CLXA 1T45A 2B9HA 4FZ6A 4HJOA 3ZLSA 5JN2A 4LUEA 3UO6A 2Y7JA 4BI2A 4DHIB 2CSNA 2QR7A 5IQFA 3HMMA 3IS5A 4JMQA 4EYMA 5J9LA 4OT5A 5CSVA 4E4MA 3NFFB 1YOJA 3QTSA 3ELJA 3F66A 1E1VA 3HUBA 3JUHA 5HORA 5GIPE 2BRBA 3V5JA 4FSRA 4C4IA 5AUXA 2BRMA 1BL7A 2VO0A 5HG9A 3OCGA 1YVJA 2IVVA 3QKKA 2JEDA 2GS7A 2REIA 4O7WA 5AP2A 3Q3BA 1PKDA 2FB8A 4DH1A 2IW6A 3Q2JA 2WB8A 4BTFA 3HA6A 1JKSA 4J95A 3COHA 4CFWA 2GNGA 3TDVA 3ZSIA 4AT4A 2VNYA 3CTQA 4RC2A 1WAKA 4QPAA 4L68A 3PLSA 1CKIA 3EN9A 1ST4A 2BZKB 1FMOE 5DHJA 4F7JA 1Z57A 1ZRZA 3R22A 3BYVA 3UIBA 1WBPA 3KRXA 5EOBA 2VUWA 5AP6A 2JFMA 4ZY4A 3EQIA 2YHVA 1Q8ZA 2W1IA 4BBMA 3BGQA 3WE4A 1KE7A 3EKNA 3F5UA 4IDVA 4DAWA 4EH3A 2R64A 5K4JA 3NX8A 2OF4A 3PRIA 3QCSA 5D1JA 2YAAA 2C5XA 3PVGA 3VBTA 5IH4A 2H6DA 4Z16A 2ZAZA 4QTBA 4TN6A 5B2KA 2PMOX 2W1HA 5IDNA 2ACXA 3KK9A 5AA8A 2WU6A 5HD7A 3R9RA 4IVCA 4BDKA 5J5SA 3B8RA 5CAPA 2XMYA 2W1FA 3N4UA 4LL5A 3NVKI 4YPDA 2G2FA 3NEWA 4L44A 4G3FA 2VTLA 5HI2A 3VF8A 5L8LA 3FYJX 3MY5A 4FTIA 5TF9A 5M09A 4M8TA 1NW1A 4FIFA 1OI9A 3ORLA 2JIUA 4EBVA 4AGWA 2OJIA 2BDFA 3KKVA 5E8WA 2OZAA 4F9WA 3JR1A 2J7TA 5DFPA 3LAUA 4FEXA 4KKGA 4IZAA 1FGKA 4XG8A 3C4EA 1UV5A 2RFSA 3CPBA 3I6UA 3NPCA 5DOSA 4YSJA 3IW4A 1FPUA 1EH4A 4AQCA 4XHKB 3WILA 2QVSE 3CD8A 3ORNA 3PG3A 3FI4A 4M67A 3H4JA 3DDPA 4MVFA 4PMMA 3W8LA 2E9PA 4P7EA 2QOFA 5I4NA 4BHZA 2QOBA 2YM6A 3TACA 5E92A 1ZLTA 4YUQA 3O50A 1XH4A 4GK2A 3VRZA 4USEA 4IAIA 4WNKA 1U54A 1IA8A 3E3BX 3N51A 4I1ZA 1LEWA 2C5YA 4EH4A 4I6QA 4F6SA 1M2QA 4O7OA 4LDTA 2RG6A 2QOOA 3U87A 2GTMA 4IW0A 2W5AA 1J7UA 5C27A 2E9OA 4TYEA 2OI4X 5JK3A 4XV9A 4AZEA 3PXRA 4EI4A 2XP2A 1GNGA 2CJMA 4QYEA 3TKUA 5CY3A 3PE1A 1SNUA 2C1AA 2VAGA 3FZSA 4AACA 5BQ0A 3HMPA 2XM9A 4FVRA 3C1XA 3DXQA 4U81A 5K5XA 4LQMA 4X2GA 3VHEA 3BGZA 4UWYA 3A61A 5DR6A 4BDEA 5IA2A 4AQKA 4EJ7A 2BKKA 3LHJA 1GZKA 2ZB0A 2C6TA 4J8NA 4J99A 4KRCA 3TZ8A 3MA3A 4AE6A 2HENA 5H8EA 4QMYA 3FSFA 4HVGA 2YM4A 2WTVA 3RPVA 5CF8A 3LM5A 4PDPA 4TXCA 3EQGA 2IW9A 2GU8A 2G2HA 3SRVB 4B9DA 2HCKA 3OW3A 3PP0A 1M17A 4G9RA 1Q8YA 4RIWA 4FTMA 2OJ9A 1V1KA 4PNIA 4QP9A 5JFVA 3H0ZA 1Y91A 1AGWA 2WNTA 4IZ5A 1WBTA 4QNAA 3QQJA 5AV2A 3R1YA 4QO9A 4FG8A 5FXSA 4W8EA 3T9TA 1OKYA 2Z8CA 4BTJA 2VTAA 3ZO1A 5CU2A 3KL8A 1U54B 3CY2A 2XCKA 4KNBA 5KMIA 2X4FA 4KIQA 3R9DA 5FDXA 5B2LA 2C3LA 4HYUA 3RP9A 4I5PA 5HO7A 4LRJA 3V5LA 2RFNA 3IOKA 3E3PA 3F5GA 4LGGA 3P7CA 3FL4A 3C9WA 3TKIA 4ZJJA 2AUHA 3W18A 3RWPA 4CSVA 4DFUA 2ZV8A 1WBNA 3AMAA 3HP5A 3P0MA 4RVLA 2XUUA 3AC1A 3F3WA 3QL8A 5I9ZA 5J9ZA 2CGWA 3C7QA 4FKVA 1ERKA 4CD0A 4JBVA 2EB3A 4L46A 3ODZX 2I7QA 1XO2B 3HX4A 4FTRA 4ZJIA 3RKBA 4GUBA 4KSPA 2ERZE 4AW5A 4IANA 2C4GA 4MAOA 1JKLA 5LARA 2R3PA 4FT5A 5CSPA 3PSDA 2CCIA 4NH1A 5GHVA 2RF9A 1PXPA 4RIWB 4DF3A 2C47A 4AF3A 5LCJA 3O8UA 3AMYA 5CNOA 2R2PA 4AOTA 5L2WA 3FMMA 3PJCA 4FKJA 5ANEA 5BV3A 1BYGA 3GU7A 3W32A 3UIMA 3PLAE 1ATPE 4G34A 3MY0A 4U9AA 4RJ5A 5HG8A 2WMUA 4QP7A 3ZBXA 3QGYA 4YTIA 4WUAA 2BFXA 2G01A 4P2KA 4AZFA 3U4UA 4YO4A 5E1SA 2B9IA 4NK9A 4OTHA 3L8SA 4FOBA 4RIOA 3UP2A 2OWBA 1U5QA 5BYLA 3BLRA 1UU3A 3U6HA 3K5UA 2XNEA 5EM5A 1G8JA 1OM1A 3RAIA 3EHAA 5C01A 2HY81 3AOXA 3KU2A 3RPRA 5A54A 3QD4A 4C4EA 3OXTA 3OY3A 4KD1A 2VRXA 4DCAA 4NCTC 2GHGA 3OBGA 2W1DA 1O6LA 3QAME 4RVKA 3KXXA 4FC0A 4I0RA 4D58A 1GJOA 3AG9A 5HVYA 3TUDA 5DWRA 5E8SA 3KEXA 4DFXE 2PULA 3QRJA 4GKIA 1NXKA 1PW2A 2R3NA 4FKGA 4OTWA 4L53A 4C4GA 4IM3A 4GFOA 4LI5A 3BV2A 2F7EE 2G9XA 5BNJA 3ATSA 3I7CA 2DYLA 4BDFA 1ZYDA 3OTVA 1UU9A 3TV6A 4MD9E 4B0GA 4F70A 4PMSA 1TQPA 4FKOA 2RGPA 1ZY5A 3QTWA 4D4SA 3D2IA 1W98A 2IN6A 4NTSA 4GEOA 3F2NA 5DR2A 5IQBA 2UZNA 3KRLA 5EHYA 1ZY4A 4WNOA 5EFQA 2CKOA 5BVKA 1DAWA 4BDAA 1IA9A 3JYAA 4FMQA 2YIRA 3BI6A 2OBJA 4EH6A 4ZSLA 4J96A 4TWNA 2QNJA 3POOA 5CZHA 4QDEA 1H24A 1UWJA 2HAKA 3OC1A 4F0FA 3NWWA 3GFWA 2XZSA 2QD9A 2WTIA 3FBVA 2XYUA 3G33A 4LV7A 3LFBA 4ZEGA 2ZMDA 3QD0A 5HGIA 4DTKA 3ZUTA 3BIZA 4RX9A 4MBJA 4B8LA 4DHZA 1PXIA 4QTDA 4AWIA 4NZWB 5ETFA 3VS6A 3BEGA 3EB0A 3KULA 3K3IA 3NR9A 3TNQB 1YXUA 5EYMA 5KKRB 4KS8A 3ZFMA 5HLWA 5IEXA 1PXLA 4E5AX 2ITZA 4HNIA 2VNWA 2P4IA 5EOLA 4YBKA 3BHTA 3MS9A 3R7UA 2PVYA 1O9UA 4NKSA 4C2WA 4JI9A 2WTWA 4FKQA 4JRNA 3KF4A 2WEVA 3EN6A 5E90A 1JSVA 1URWA 4MWHA 4MWIA 4F7NA 3D94A 1HCLA 5IEVA 2C0TA 3ORZA 3R30A 4OTDA 3CR0A 2ZV2A 4OW8A 3WBLA 4YC8A 2JAMA 2YEXA 2PL0A 1W8CA 5FG8A 2CLQA 3DNEA 3ZFXA 4BZDA 2XEZA 3UVPA 5J7HA 4D9TA 4IC8A 4O7RA 4UX9A 3C4WA 4BDJA 4QMSA 4F1OA 4QYGA 4C35A 4NJ3A 1H1RA 3P86A 3BEAA 4CEGA 3QKLA 3LQ5A 5AP1A 2YDJA 4FKRA 5IA1A 2UV2A 3O8PA 4OTFA 4CTBA 2P2HA 3IDCA 4GG5A 2C3JA 4MF1A 4RJ3A 4IAAA 4EZ5A 3I60A 1ZMUA 4AW1A 5JFSA 4ZIMA 4G17A 3FMJA 4JQ8A 4H3PA 4Q9ZA 2O8YA 2HYYA 5KMMA 2GFCA 5GJGA 3AD6A 3HDNA 4MQ2A 3KGAA 4OTGA 3UDZA 5BUEA 5J1VA 2A19B 1G8AA 1XJDA 3KULB 4RBLA 2PUNA 2JITA 3FSKA 1YDRE 4O7YA 3RVGA 4YTCA 4PMTA 4PL5A 5EW9A 1RE8A 3BWFA 2UZTA 4KRDA 4JX7A 5GNKA 5JKGA 3AQVA 2X6DA 4DH8A 3BHYA 1Q4LA 3CE3A 4FNWA 3DJ5A 4P90A 5IQHA 3DU8A 3ZO3A 3AKLA 4IWPA 5FTOA 4QYFA 2C6MA 4G3GA 1RW8A 4O7VA 4YJPA 4I3ZA 3MPAA 3U9NA 3NGAA 3Q32A 4IFCA 4TNDA 3PIZA 4MHAA 4W4YA 2Y9QA 1F5QA 2ITXA 3EQFA 5DIAA 3W0NA 3I7BA 3ZDUA 4D4RA 3BLAA 3GFEA 5DA3A 4H1MA 4TWOA 3ML1A 3QWKA 3BHHA 2QOLA 2F9GA 2XIRA 4FNZA 4B8MA 4BCMA 5E8UA 1IAHA 4DG2E 4FSMA 1GAGA 3SX9A 3UOJA 3QZGA 1ZYCA 3D2KA 3AC5A 2ITWA 2C6LA 4QEBA 4AGCA 3TUCA 2GNFA 3QF9A 1T46A 3CQUA 4W4VA 1YXTA 4FZDB 1QPJA 2Z60A 2X0GA 4Y73A 3BV3A 4GW8A 5CXHA 4NW6A 5KZ0A 2X1NA 1DM2A 1YXSA 1KE8A 3R7YA 4RC4A 1NVQA 5CENA 5AIKA 3FLNC 4A4LA 2WMQA 3H0YA 3R00A 4RC3A 3REPA 5CANA 3VNTA 2QLQA 2O3PA 2V5QA 2XCHA 2WTKC 4QP6A 3NAXA 2XRWA 3KMMA 2WQMA 3D7ZA 4RFMA 3R04A 2BTRA 3E88A 4XBRA 4LV8A 1B6CB 5HE1A 3F2AA 3UYTA 2YIQA 3UO4A 3A4OX 1R1WA 4DC2A 3AT2A 2Y4IC 3PVUA 4AAYA 5M51A 1PXJA 2QKRA 3SLSA 3SA0A 3EFJA 2R0UA 2PUPA 3PY3A 3HV3A 4Y8DA 5EQEA 2HXLA 4ZSJA 2XB7A 5I9XA 4D1ZA 1TQMA 5T3QA 1O6KA 3CLYA 4DHFA 2X8IA 2Y0AA 2W0JA 4RJ4A 4I21A 3T3UA 3WYYA 2J0MB 1AD5A 2VGPA 1KV1A 4RWKA 4ENXA 3L9LA 4MYGA 4DFLA 3EIDA 4QMTA 4RLKA 5AFVA 3RK7A 2VWIA 4K8AA 2E9UA 2R3OA 4GT4A 4BB4A 2ZYBA 1P14A 5TR6A 3AC4A 4D1SA 3QTZA 3EKKA 5CAQA 4I0TA 5M55A 2OLCA 2B1PA 3FI2A 4GUEA 4K0YA 5BX0A 3TJCA 1FINA 4EZ7A 2NRUA 4EOOA 2HXQA 5IUGA 1H1SA 1VYWA 3NYXA 4L7FA 1KE5A 3EL8A 4C38A 1PMNA 4GKHA 5H3QA 3W16A 3P78A 4QYHA 3QLGA 5HG5A 4A4OA 3FLYA 2JDVA 3W2OA 2OXDA 4CXAA 4L7SA 3FKNA 4EJNA 3GXLA 4FIHA 3R8VA 3IW8A 2WEIA 3IG7A 2NO3A 2QHNA 3SQQA 4XG2A 5FM3A 2XANA 4DEAA 3HZTA 1Y6AA 2J6MA 4FV9A 4XRJA 5EH0A 5EQPA 4DFBA 1V0BA 4ZS0A 4EOJA 4FOCA 4RX5A 3SW7A 2C69A 4IAZA 2X7FA 5KMLA 3PA4A 4HVSA 1P2AA 4BZOA 3ETAA 3ID6C 2C3IB 3D5UA 2OF2A 4DEDA 4DFNA 4NCTA 4CFVA 1NY3A 3ZOSA 3UO5A 5DT3A 4DGMA 2BFYA 3PWYA 5IG1A 3TJDA 3O7LD 3NNXA 3PYYA 1KOAA 4X3FC 2B55A 2QOHA 5CASA 5HX6A 5F20A 2VD5A 4RX8A 3CEKA 1K2PA 1OITA 1ZAOA 2I40A 3O0GA 5ETAA 3FJQE 2YZAA 2UZBA 4EOQA 4W4WA 3PZEA 4D4YA 2DQ7X 4LUDA 1VYZA 4GVJA 4JIKA 3VS1A 4HYSA 3ZFYA 3VAPA 4AXAA 4GK4A 4EHZA 4PDOA 2RKUA 4B6LA 5J9YA 3MSSA 2YITA 1ZARA 2XH5A 3JY9A 3O2MA 3QC9A 1MRUA 5HNIX 3DAJA 5DGZA 2XNNA 3QZFA 1IASA 4QP8A 3GQIA 3QWJA 4IX3A 3TZ7A 4BZNA 4DEGA 2YABA 4IX6A 4EKKA 1NVSA 4FT7A 4L42A 2B52A 3H3CA 4K33A 1M14A 4TNBA 2PUUA 4LMUA 3KC3A 4CMUA 5IA3A 4QQCA 4YNEA 2XIKA 3C4CA 2B54A 3KN6A 5HIEA 5AUZA 3QUEA 4E8AA 1E1XA 3PE2A 4Z7GA 3COIA 4XMOA 5F95A 3TZ9A 2XYNA 1OGYA 1OVEA 4GL9A 3VS2A 4FK3A 5EI2A 3S4QA 5M07A 5M4FA 3E63A 4L6QA 3E8NA 4IQ6A 4QP4A 2YCFA 4JX3A 4G6OA 3LPBA 1VR2A 4HGLA 3MYGA 5HCZA 3G6HA 4D2RA 4ZSAA 1OKVA 1Q8TA 4X6QC 4XH6A 3GU6A 2ZM3A 5JGAA 3MH1A 5CT0A 3QRUA 4YGAA 3PXQA 1R0EA 4IAYA 3Q5ZA 2X2MA 4ZTSA 3OCTA 5L6WL 1PXNA 5C8MA 3DBDA 4BRXA 2VWUA 4JVGA 3W0QA 3M2WA 5BMSA 3MPMA 1NT2A 2CNQA 3G15A 3S00A 3IGGA 3LLTA 4O0RA 4R7BA 3ZC5A 2UW7A 4AAAA 3VVHA 2XKEA 1PY5A 3KXNA 3V6SA 4M3QA 4K11A 3BU3A 3MI9A 4I20A 3K2LA 3POZA 4P5ZA 2GNHA 4CKRA 2UW0A 4S2ZA 4IVDA 3OVVA 4C4JA 1XWSA 2Z7RA 3MV5A 5AM6A 3DFCB 4G2FA 4QQ5A 5HE2A 5CAOA 1A9UA 3M42A 3F3ZA 4AT5A 4DGGA 3RCJA 5A4EA 3HEGA 4FTAA 4UYNA 4BDGA 4AN9A 2PVMA 2A27A 2NRYA 2OSCA 3KREA 4A07A 5F1ZA 2OH4A 2GFSA 4QMXA 3CBLA 5IQDA 5F9EA 4RFYA 5EHOA 2XARA 2CKPA 2BKZA 3FHRA 4Y72A 2YDKA 2UVXA 2F57A 3IK3A 2BAQA 4FTNA 4TWCA 4M12A 3OBJA 4YZMA 5ANKA 3TMOA 2IZUA 2R3JA 4K9YA 4U41A 4FSNA 3CKXA 4BDCA 2ITPA 4YBJA 4FSUA 3DTCA 4E4LA 2J50A 3FLQA 4JDKA 3IPHA 3NCGA 3R8LA 4G6NA 5HBJA 4R3PA 4A4XA 5AMNA 1L3RE 5IMEA 4R6VA 2HOGA 4S31A 4KAOA 3ZLWA 2XK4A 2UW5A 3ZYAA 2QI8A 3HMOA 3CJGA 2QG5A 3ORMA 3DLZA 2BUJA 4ITJA 3TYKA 2IZSA 3ALNA 3LFDA 4EBWA 5IPJA 3BYUA 2C6DA 2ETMA 3CD3A 3KXHA 4UZHA 4BY9E 3QHRA 3KRWA 3OHTA 1QMZA 3PXFA 4BGHA 3EQRA 2ITYA 2X9EA 3FC1X 3MJ2A 3BCEA 4BICA 4FIIA 3HL7A 5CWZA 5D11A 4XBUA 4IM0A 1ZYJA 4AS0A 3ZUUA 3ORXA 3OWKA 4MXAA 2CNVA 4WRGA 3L1SA 4PL3A 2WMTA 1P4OA 3PPKA 3A7GA 4HGEA 4CGAA 4EC9A 3BBWA 2IVUA 1PMEA 5C4LA 3EFLA 5BVEA 4C34A 1S9JA 4L43A 3FXXA 2B4SB 3EZRA 5D10A 5AV1A 5CU6A 2Q83A 1IRKA 3B2WA 4NWMA 4U3ZA 5C1QB 4RSSA 3U55A 4CRLA 3S3IA 3KA0A 3PXYA 4XG9A 2UZDA 3IDPA 4AN3A 3V5PA 4AT3A 4EONA 4X2KA 5CEOA 4WZYA 3OWJA 4IX4A 5DI1A 2BALA 3QTXA 3G5DA 5T68A 4EWHA 4I41A 3EZVA 2WAJA 2HW6A 3NNWA 4ZXTA 4C3FA 4C58A 4XLIA 3RNYA 4MK0A 4DEBA 4C59A 4R7IA 4N0SA 3PUFC 3SOCA 2XIZA 2XIXA 3AGMA 3DQXA 4AXFA 4JAJA 1PRYA 2EB2A 3BQRA 4JBOA 4C7TA 2O63A 4F63A 4V04A 1XBCA 4ZS4A 4FEWA 2X81A 2PZ5A 4MEDA 4AUAA 3DJ7A 3Q2MA 4YSMA 3TV4A 2EXMA 3MFUA 4RVMA 4E6DA 1WZYA 3B8QA 3Q4UA 1VJYA 3U54A 5DYJA 4M13A 3WOWA 3C0IA 4O6LA 4R78A 2ZDUA 4L3JA 3UIXA 4EHVA 3I0QA 2B9FA 1NA7A 3LMGA 4BYJA 3LQ8A 5JRSA 3LIJA 4H58A 1JQHA 4EOKA 2JBPA 2JC6A 3BYMA 2HWOA 3OCBA 4GFGA 4U5JA 5AADA 3GCSA 4ZOGA 5HKMA 2WU7A 4QTAA 4D1XA 4LL0A 3GI3A 5J87A 1B38A 4XG4A 3IECA 4ERWA 4D4VA 4O91A 1QPCA 2ZMCA 2OH0E 2W5HA 2PE1A 2WTKB 3THBA 4WIHA 4A9RA 2EU9A 3OY1A 4QMZA 4WA9A 4X7QA 5FQDC 4B99A 4C0TA 3JS2A 3COKA 2E2BA 3FI3A 4CT1A 5CI6A 4X21A 4QDVA 4FZFB 2GS6A 5IDPA 5FP5A 2Y4IB 4K18A 2WMAA 3V5QA 1RQQA 4DHJA 2QHMA 5HCXA 3HKOA 3TDWA 4AW2A 3LKMA 3CXWA 3JXWA 4F1MA 3VUHA 1YDSE 2WHBA 5K5NA 1JSUA 3KF7A 5CVHA 3A7JA 3BHUA 2CGXA 3EYHA 4GH2A 3KMUA 4S33A 3R7EA 2V62A 2AC3A 2YCQA 4C3PA 1L8TA 1FVTA 4S30A 3KRRA 4JG6A 4L67A 4X3FA 2Z7LA 2PMNX 3ZZWA 4XV3A 4PTCA 3LJ2A 5AP0A 3VIDA 3AMBA 2I0EA 4FZAB 3CTHA 5LOHA 2V22A 1M7QA 2F4JA 4CKJA 5IQGA 3QQKA 2UZOA 4LOPA 5AP4A 1QPDA 5M06A 4E4XA 3E8DA 3ANRA 3LMHA 2E9VA 2GHMA 1GZNA 2WGJA 2W9ZB 3EN4A 1Q24A 4ACGA 2R3RA 3MA6A 4FTTA 3P4KA 3IW7A 4AE9A 3E87A 2BCJA 3QA0A 1Q99A 4J52A 4W4XA 3SVVA 3K54A 3R28A 3FMDA 3S0OA 1UVRA 3EMGA 1ZWSA 4KBAA 4XYFA 3UTOA 4EL9A 2R5TA 2PZYA 4FV8A 2OZAB 5BVOA 4MXCA 4MTAA 1LP4A 1I44A 3DFAA 4BCHA 1H08A 2XIYA 3NFGB 4ACMA 5JGBA 3U6IA 3SKCA 4PWNA 1OECA 4FEVA 4BHNA 2HY0A 4FL3A 4JL9A 4GU6A 5HIDA 3TNPC 1OL2A 4JXFA 5J1WA 3EN5A 2YWPA 5EDQA 4LMNA 4CG9A 2R3MA 3H10A 3QQHA 1FGIA 1JKKA 3UNJA 4EORA 2FH9A 3BGPA 2YWVA 2ZJWA 3DDQA 3R02A 4Z55A 2W9FB 2XF0A 4PMPA 4PY1A 2BHHA 5HZNA 5L2SA 1F3MC 4WHZA 4KA3A 5HBEA 5M57A 4FODA 3HUCA 5A9UA 3SDJA 3W2SA 5JZJA 4K2RA 4X3FB 4TTHB 4TY1A 3II5A 4FKIA 4NM0A 4GIHA 4EKLA 3LFSA 3NUYA 3FEGA 5TT7A 4ACDA 5GINE 2PMIA 2EUFB 3FXWA 4FX3A 3AD4A 2OK1A 3QRTA 4BTKA 5KHWA 4BKJA 3I81A 2Y6MA 2LGCA 3MVJA 2C0IA 2XAOA 4DDGA 4O7ZA 4O0WA 2ZV7A 3OP5A 2UZVA 2W4OA 2OKRA 3JPVA 3CQEA 1GOLA 1XH6A 3FQSA 3HNGA 2OIDA 4I24A 4AZSA 2XJ0A 4C4HA 4ZZOA 3I5ZA 2PZPA 4XG6A 2R7IA 5AV0A 5CEIA 4AXEA 4CFMA 3VC4A 3QTQA 4CTCA 4XP0A 4AP7A 3O17A 4F09A 3F9NA 4YZBA 5AUTA 4EEVA 2BVAA 3GC8A 3TNHA 4CLJA 4PTEA 3VBWA 4OUCA 3LW0A 3KCKA 3O23A 4A9UA 2ZM4A 3GCVA 1FBNA 4CV8A 4CRSA 3ROCA 2CKQA 4MBLA 1WFCA 3OFMA 4QPSA 1CMKE 3OOGA 4U44A 4ZY6A 2JKOA 2J4ZA 2PMLX 2NPQA 3RMFA 2YIXA 3AC3A 3MB6A 3NSZA 3AC2A 3QTRA 1BMKA 3UQGA 1GZOA 1OBDA 3FZRA 4RIXA 4UWBA 4M69B 4ALWA 4ZLZA 3TM0A 2XM8A 1KV2A 2RFEA 3KB7A 4CLIA 2WMRA 5HIBA 4EK8A 3DB8A 4O27B 3R73A 3KIOC 3A4PA 3W2PA 4DA5A 3KVWA 3QQLA 1WBSA 5I9VA 2VTHA 3HRCA 3RPYA 1E9HA 3FPQA 3V8WA 3Q9XA 3N4VA 4CT2A 3BE9A 3OZ6A 3MFRA 4EK6A 3OROA 4DGNA 4Z7HA 3RM6A 2ITOA 3HP2A 2X4ZA 2DS1A 2UVYA 4YP8A 4HCVA 5LVOA 2BHEA 3P7AA 3KRJA 2WMBA 4U7ZA 3AXWA 3ZH8A 1FVRA 3BE2A 1OB3A 4NW5A 3LXKA 2O2UA 4FV7A 5HE0A 3KVXA 4BCKA 1J1CA 3M1SA 3TEIA 3RNIA 5A4TA 3LCDA 5A6NA 3UPZA 4QQTA 3FQEA 3EN7A 3QZIA 3QTIA 3CY3A 4FSQA 5IA0A 4IIRA 2ONLC 3BKBA 2FSMX 3BU6A 5HICA 2ITTA 3EQBA 3MN3A 3ORTA 4CFNA 5K3YA 5CF6A 3F7WA 3ACJA 4GJ3A 3DKCA 3ULIA 4EQCA 4TKSA 3GEQA 5IISA 1SVGA 5FRIA 2YJSA 4GIIA 3RI1A 1YHWA 3VUDA 2YAKA 2OXXA 4UB7A 4X6RA 2C6EA 5KMKA 3F61A 4PF4A 4KSQA 4RWLA 2WTJA 2PVHA 3D7TA 5EK7A 1OMWA