3TYKA

Crystal structure of aminoglycoside phosphotransferase aph(4)-ia
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
296
structure length
295
Chain Sequence
TATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
publication title Structure and function of APH(4)-Ia, a hygromycin B resistance enzyme.
pubmed rcsb
source organism Escherichia coli
total genus 89
structure length 295
sequence length 296
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tykA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3tykA02
4ORKA 3ZM9A 2PULA 4R7BA 2Q83A 4FEWA 1ND4A 4R77A 5C4LA 3W0PA 3TDVA 2PU8A 2PYWA 3N4VA 2PUNA 4EJ7A 5IQIA 3W0RA 4DTAA 3TDWA 2IG7A 2PUIA 4DE4A 4O7OA 1J7IA 5C4KA 4BR3A 5IQBA 2PUPA 5EQPA 4FEVA 4U94A 4WZYA 2PPQA 4DA5A 3W0OA 5IQFA 3DXQA 2QG7A 3SGCA 3ATTA 5BYLA 2B0QA 3ATSA 3HAVA 1NW1A 4DFUA 3DXPA 2I7QA 3HAMA 5EQEA 3SG9A 4DBXA 2CKPA 2CKQA 2BKKA 5FUTA 3C5IA 4FEUA 3CSVA 3F2RA 4DFBA 2OLCA 1J7UA 3W0MA 4DTBA 5IQHA 5IQAA 3G15A 3JR1A 4GKHA 3LQ3A 4CGAA 3W0QA 4FEXA 5AFVA 5FTGA 1J7LA 3TM0A 3W0NA 3SG8A 3TYKA 4DT9A 5EQYA 3N4TA 4PDYA 4DT8A 4N57A 5IQDA 4CG8A 4H05A 1L8TA 4DCAA 5IQGA 4U98A 4O7PA 4GKIA 3UZRA 4CG9A 3FEGA 4R78A 5IQCA 3FI8A 2CKOA 3Q2JA 5IQEA 3N4UA 3W0SA 3MESA
chains in the Genus database with same CATH superfamily
4MUQA 4YR8A 4B99A 2BRHA 3PJ1A 4B4LA 1W84A 2B9HA 3QQJA 4Y5QA 5BVWA 3DKFA 2GFSA 3VRZA 3QWKA 4NTTA 3OEZA 4N4SA 2BKZA 1OL2A 1CKJA 3HLLA 1UWJA 4AACA 3KREA 4FKSA 4BY9E 2XA4A 4BBMA 4ZTQA 3LJ0A 5AADA 3MH1A 4JQ8A 1SYKA 2PU8A 5ETCA 4F4PA 1OGUA 4RWIA 4HVHA 2VWWA 5M57A 3R8ZA 3LMGA 2F9GA 2CSNA 3LFFA 5IH5A 4J71A 3W0RA 2CGUA 2XAOA 3MJ2A 1YXTA 4FTTA 2BAKA 4HGTA 1U54A 2IZTA 2I0HA 3G2FA 3QD3A 4RRVA 4DE4A 4DINA 4EOQA 5B2MA 1JLUE 4LUDA 4OTWA 3GUBA 4ZXTA 1OB3A 3C0GA 3A8XA 3V5PA 3BBWA 5AP1A 3DXNA 4ID7A 4D4RA 3PXFA 2WEVA 2J5EA 1BX6A 2UUEA 1ZZLA 4FKTA 3DTWA 3LKMA 1CKIA 3L1SA 5DI1A 4E93A 3R9RA 3LXKA 4IB5A 4E20A 1KE6A 4I0TA 3FHRA 4EH6A 3EYGA 2OK1A 2BDFA 3A60A 4LGGA 5JZNA 3MFSA 2JBOA 3COIA 4BCGA 4EZ7A 4Y73A 3MYGA 3WE4A 4S2ZA 4GUEA 1B6CB 5CQUA 3PLSA 3S95A 4C38A 4YJSA 4R1VA 5BV3A 3QUPA 4Z7GA 1ST0A 1FPUA 4I94A 3CJGA 4X0MA 3HAVA 4X3FB 4NFNA 5AP6A 4BCKA 2E9PA 2I7QA 4BKJA 4DITA 4CMTA 3SRVB 3BIZA 1Q8ZA 4WKQA 2O64A 3QHWA 2ONLA 4ZTHA 5E7RA 4HVDA 4LMNA 4MNEA 2R3QA 4QQCA 5CQWA 5E8TA 4AT4A 1VYZA 2JIUA 4RC2A 5B2KA 4X2JA 1OKWA 2XIRA 3RAKA 2QHNA 2JDOA 2IVVA 4G3EA 1TVOA 3UG1A 3UP7A 3UG2A 4C4EA 3QBNA 5CU0A 2C0IA 3NAYA 2W1CA 4KA3A 5CU6A 3PSDA 5LJJA 2KULA 2QU5A 4ZZMA 1PKGA 1BI8A 2YEXA 4R7HA 4FIFA 2V5QA 3TV4A 4DN5A 1QCFA 4EHVA 4RIXB 3O8UA 4HCUA 4XP2A 2XAMA 4O81A 3DBFA 1OPKA 5J87A 5KKRB 3N4TA 4ONAA 2V22A 4UXQA 4QP7A 1Q8YA 4FICA 3QC4A 4Y5HA 5HIBA 5B2LA 1H0WA 4DC2A 3PUFC 3NRMA 3QTQA 4X6RA 3U9CA 2X9EA 5HCYA 4C0TA 3ACKA 3JS2A 3SOAA 4F64A 4FT7A 1K2PA 1YOJA 2OJFE 3PP0A 1YXUA 2E9UA 4PTCA 1KUTA 4CV9A 4FTQA 4M13A 4NU1A 4FK6A 3UO6A 3ZLYA 4YNEA 5J7HA 5HD4A 4RLKA 3OY1A 3PA5A 2R3RA 2YDJA 3GU8A 4IZYA 3ORXA 4CT1A 4BDJA 3AD6A 4KBCA 3NYNA 2YISA 4D1SA 3QTZA 3PFYA 4G3FA 3COMA 3G9LX 3GGFA 2IVSA 3KRWA 4K9YA 4MWHA 5HD7A 4G17A 3PY1A 3Q5IA 4OBPA 1QPEA 2WTKB 4EOPA 3L8XA 4CRSA 3MVMA 4A4LA 1BMKA 2WMVA 3RVGA 5AAGA 4ZLZA 1UV5A 3ZUUA 2UW4A 4W8DA 4OT6A 4X2NA 1JSVA 1U46A 2VTHA 4HPTE 4UWCA 5E8UA 1DI9A 2R3LA 2C6EA 2BUJA 3LFNA 4RJ5A 4ITHA 5CAVA 2IWIA 1OI9A 2IG7A 1RQQA 1YW2A 3OS3A 2WU6A 2WMQA 3NFGB 2C0TA 4HYHA 1MRYA 3RHXA 2F2CB 4LV8A 4RJ8A 4O82A 5IPJA 4P5QA 3CC6A 1Q8UA 3Q5ZA 4DFXE 3FLSA 3VHKA 4AE6A 2ITXA 2YM3A 4K33A 4CZUA 2GFCA 3NW6A 4U94A 4AP7A 4CFUA 1ST4A 4FTCA 4WZYA 2R4BA 3E8NA 3ZUTA 1KOAA 4XV1A 2C47A 4USFA 5F1ZA 2R7IA 3JVRA 2BIYA 3QTXA 5CZIA 4APCA 3EQDA 3LFBA 4U9AA 3V5WA 5CF4A 2BVAA 3DLZA 4CD0A 2O5KA 2G2IA 3KCKA 4X7QA 5BVNA 2UZUE 4EH3A 4TNBA 1QPDA 2G9XA 2XVDA 2GNJA 1H1QA 3EJ1A 3PXYA 4ZTNA 5L2SA 4UY9A 2XF0A 5IEYA 3HAMA 3MPMA 3L8VA 2VWVA 4L44A 4IMYA 4I3ZA 4G34A 4MBIA 4RT7A 5E1EA 5F20A 5EYKA 4C35A 4EH8A 4ZMFA 3KQ7A 5H8GA 4DFLA 2W5BA 4GIHA 2Y4IB 4FVQA 4CEGA 5BUEA 3FLWA 4HVSA 3OHTA 3QRJA 3OWKA 2I0VA 3R0TA 3P5JC 3UNZA 4AGWA 4YC8A 2G01A 3P78A 4QYFA 2ZDUA 4FYOA 4RG0A 5AAEA 4MD8E 3F61A 3F5UA 3NDMA 1OL6A 2OBJA 3BLRA 3RAIA 3FL4A 2FSMX 1WBNA 4UWYA 4Y95A 5DRDA 1NT2A 2ZJWA 3DDQA 4FTJA 3V5QA 2WO6A 2CCHA 2V7AA 1WVYA 5HX6A 5H8BA 2JDRA 2BZIB 4PDOA 2A0CX 1RJBA 5AUWA 4Q5HA 5C8KA 2YJSA 2PVLA 3AGLA 3NUPA 3O17A 2IW6A 2WMAA 4WG5A 4WRSA 3TZ9A 3C4CA 1XHAA 3W8QA 3WF6A 1OMWA 1U5QA 2YITA 4C4JA 5K4IA 4DT8A 3CKXA 3BRBA 3UVPA 2PMNX 3R2BA 2V7OA 4BDGA 3D5XA 4EOIA 3OROA 3OUKA 3ORIA 4WG4A 2WMRA 3K54A 5JH6A 4ZSJA 3SXRA 4A4XA 4J96A 4C3PA 3ORKA 5IA5A 4A9TA 2YWVA 2WMTA 3JPVA 4G1WA 2UZDA 4QRCA 4CTBA 3BI6A 5AP0A 2QOKA 2RG5A 3DK3A 4K0YA 5CI7A 3ZH8A 3QC9A 4BCMA 3BQRA 3IECA 4HPUE 5JK3A 3RI1A 4AZVA 5AA9A 3CTHA 4F65A 4FKOA 3QAME 1PXMA 1XMMA 3LM5A 5CZHA 3ZFXA 5M4IA 5C4LA 2O0UA 2B9FA 2CJMA 2R64A 1H1RA 5T68A 5CEOA 2HCKA 4MCVA 2LGCA 3CLYA 3FSKA 3ZZEA 2UW3A 3CEKA 4EOKA 2UW0A 4IHPA 2P0CA 3NFFB 5FQDC 1IAHA 2BRBA 4NSTA 5JFXA 2BRGA 4JT3A 3UPXA 1M52A 3MH0A 3R9OA 4C61A 3NYVA 4FV6A 3BGZA 4HYUA 2PL0A 2OF4A 2WMWA 4IVBA 3U6HA 1PMNA 2GQSA 4IVDA 1DI8A 3AQVA 4LOOA 3VQHA 3ML1A 3G5DA 4AU8A 2PVKA 3AMAA 1J7IA 2JBPA 1YRPA 5C8MA 4O7LA 2XKEA 4ZK5A 3OOMA 5AV3A 2XIXA 3DZQA 5I9YA 2WOTA 2OGVA 2XUUA 5BUIA 1J91A 1OITA 1VJYA 2OJJA 3KCFA 5EQPA 2Y6MA 3FV8A 5IG1A 3TACA 3U51A 3II5A 3S0OA 3HGKA 3P1AA 3E64A 4G2FA 4F99A 5AX3A 4EQCA 3POZA 2P2HA 2E9VA 2HXLA 3AMBA 3LMHA 5CU4A 4YP8A 2R3GA 3AC5A 3Q32A 3MVHA 5KBQA 5BYLA 2X4ZA 3QFVA 3E3PA 1PXKA 4FZ6A 4QT1A 4EEVA 4KRDA 4NM0A 5E8SA 4ZSLA 4JR7A 4M12A 4YJPA 1PXNA 2NRYA 2YCRA 2QVSE 4FGBA 4I6HA 4J99A 4WUNA 3WF5A 4AOJA 5J9YA 3DBEA 3QKLA 3V8WA 4F7SA 5EOLA 3W2PA 3F69A 3QHRA 4UXLA 4XS2A 3O8TA 5FUTA 3DLSA 5CASA 2ITNA 2C5YA 4LV7A 3WZJA 3DNDA 4GSBA 5L8LA 5J1WA 2YDIA 5E92A 4O0UA 2RG6A 3LCKA 2VWYA 1T46A 4FV4A 4RZVA 4CFVA 5EHLA 1XO2B 4YJVA 2WGJA 4DFBA 4PMSA 3DNEA 3PE2A 1Q8TA 3MY0A 3TT0A 4PDSA 2AC3A 3BHTA 2YERA 4FZAB 4EHZA 5KO1A 4GKHA 3KKVA 2QOLA 3R1YA 5JEBA 4O86A 3KF4A 3KXGA 4KBKA 3JY0A 2IZUA 4PRJA 4QMVA 1ZYCA 2EUFB 4TTHB 2A27A 2JAVA 5JRSA 3RCDA 4B8MA 4D9TA 4IX3A 3UP2A 1FINA 5FP6A 1LR4A 3FQSA 3SAYA 2AYPA 5LVNA 4GU9A 4NCTC 5L2IA 4CCUA 3DS6A 4P2KA 2W5HA 4JDHA 3LFSA 4QMZA 5AP3A 4N6YA 4F0IA 4ERWA 5IQCA 1W83A 2VO6A 2HIWA 3QA0A 3FMNA 4FG8A 3F3TA 3ZZWA 4X3JA 3RCJA 3LJ2A 2PE0A 4R1YA 1Q97A 2BILB 3UZTA 3NEWA 4CQEA 4Q9ZA 3CXWA 3VBQA 3QQKA 3GC8A 3R1SA 1S9IA 5FG8A 2SRCA 3LW0A 1XH6A 1H00A 2JIVA 1XBCA 4BDCA 2ETMA 4GK4A 1NVRA 2H6DA 2REIA 2ZV8A 2ETRA 2ZVAA 4EH2A 4L53A 3G6GA 4IVCA 2WTWA 3QZGA 3VW8A 3H30A 4U0IA 4HGSA 3ZU7A 5ETIA 1UA2A 3B2TA 4FSZA 4EUUA 3FUPA 4PP9A 3EQPA 5K5NA 4FUXA 3LPBA 2QO9A 1APME 2WQEA 3KMMA 3OW3A 3PJ3A 5EH0A 4FKGA 4X6QC 4AE9A 3VS7A 3PIYA 2W4JA 4O0VA 5CT7A 4KSPA 3FBVA 5IQBA 4FKPA 3KC3A 4YTIA 4E73A 3FE3A 3PP1A 4CSVA 5CAUA 3PLAE 4RLLA 3GQIA 3IW4A 3BX5A 4IQ6A 3FZ1A 3SQQA 4IW0A 2Q0NA 2XMYA 2YM6A 3O8PA 2P2IA 3GCUA 3FLZA 4L9IA 3GCPA 1XH4A 2C69A 4I0RA 4DA5A 2BRMA 5CVFA 2ZMDA 4HJOA 3C1XA 4FNWA 4I5PA 4OW8A 3AD5A 4BDKA 1H24A 2QG5A 2WQMA 2B0QA 4UBAA 4RFZA 5I4NA 3FZSA 3MY5A 4IX4A 3LCOA 2YCFA 3V5LA 3ZLWA 4M69B 3SG9A 3H9RA 4JX3A 3KK8A 3VC4A 4FNYA 4C02A 4UEUA 3CBLA 4MKCA 4ZMEA 2WTCA 3MH2A 1IAJA 3C9WA 3L9LA 3C0HA 3BYSA 4FG7A 4XG8A 2J0MB 2UW7A 4FV1A 1R78A 3R7YA 3VS5A 5A4CA 3P79A 3LFAA 1UNLA 3Q4TA 4QNYA 4V04A 5GHVA 4D2SA 5HE3A 3CSVA 3PFQA 5D10A 2XKDA 3QUEA 3BV2A 5IQHA 4I0SA 3VWAA 5I9WA 5LMKA 3ZBFA 3PXRA 3AC8A 4JBQA 3RP9A 3PJ2A 3LXPA 2C5NA 5AFVA 5KZ0A 3RNYA 3DBCA 1J7LA 3ZSIA 5F94A 3COHA 4MD9E 2Z2WA 1S9JA 2XJ1A 3OUNB 1R1WA 4YLKA 4IZ7A 4AZTA 1H1SA 5IUGA 4PDYA 3JY9A 3BU5A 5DH3A 3EFJA 2R0UA 3LLAA 1XMLA 1K3AA 5F9EA 3BWJA 3L9NA 2CLQA 5IA1A 3ANRA 1PMEA 2BCJA 2OJ9A 5FEQA 4O7PA 3C0IA 2HENA 4BDIA 3VUDA 3FKLA 4EC8A 2CNVA 2PZYA 3F7ZA 4D0WA 4ITJA 5LCJA 1YOMA 2CKOA 4NJ3A 3KRXA 5IA4A 5IQEA 5A4EA 3W0SA 4CT2A 2PE2A 4XG6A 5EDQA 2KTYA 4O6LA 4E5WA 3NCZA 5CAQA 5EM8A 5G1XA 3FXWA 3SW7A 3O0GA 4C62A 5LQFA 3MY1A 3I81A 3R02A 4WO5A 4GFOA 4H58A 4F6SA 3VUKA 4YHJA 3QLGA 5DA3A 5H2UA 3U4UA 2FH9A 4YZNA 5ACBC 5JGBA 3T3VA 2EU9A 4CTCA 2QLQA 2OIDA 2OZOA 4C2VA 1GIHA 4X2GA 4KB8A 5E91A 3W33A 4CXAA 3G33A 1Q8WA 4L6QA 4FUYA 4O0TA 5HO8A 4II5A 3P7AA 2R3JA 5ANEA 4AW0A 4Q9SA 5CVGA 3UOHA 3W32A 3ZTXA 1W7HA 4NM3A 3TWJA 3QQHA 4JJRA 2J6MA 4GU6A 4LL0A 4YLJA 4I92A 2AEGA 4O7OA 4A9UA 4U5JA 3GOPA 3NVKI 4IWPA 5KHWA 4LL5A 3DJ5A 4FIIA 2X6EA 4EHEA 1W98A 4M8TA 3UBDA 3P08A 2ZAZA 2XK9A 4BDAA 1GJOA 4EH9A 4BZDA 1Q41A 3PSCA 4EC9A 4O27B 3R8UA 3TV7A 5CAPA 4WG3A 4JG8A 2F49A 5AMNA 1W8CA 3BYUA 4FA2A 1OIYA 3B8QA 3SGCA 3UO5A 3UJGA 3R71A 4D5KA 4PF4A 3S2PA 3EZVA 3QTRA 4DHJA 4U81A 4ZY4A 2EB3A 4A9YA 4U80A 4D5HA 5IEXA 4WNPA 5JSMA 1QMZA 1HCLA 4BZOA 5FDXA 4Y83A 4AFJA 3OF0A 4IVAA 3HECA 2B52A 4MNFA 3BGQA 4RVTA 3ZBXA 1OECA 2ZM4A 3E7OA 2NPQA 4D1XA 3VW6A 4E4NA 3ID6C 3ZEWA 2C1BA 4RWLA 5KZIA 5L8JA 4ARKA 1ZZ2A 3TNHA 4CFMA 3WARA 2VV9A 2QI8A 3R8LA 3O7LD 3LAUA 5KNJA 4PNKA 4GUBA 3LHJA 1YI6A 4L3LA 3PJ8A 4IC7A 1YXSA 4G3DA 3ZSGA 4KS8A 4PV0A 4IM3A 3AC1A 1LEZA 4PX6A 4YZBA 3T8OA 2W06A 4QEBA 4KKGA 5BMMA 1BLXA 2UZNA 1BI7A 5FTGA 4C36A 3PWYA 1GZ8A 4N70A 3P4KA 4AQKA 4AW5A 1XR1A 4YC3A 2X2KA 2BDWA 3D14A 4QTBA 4GT5A 4OTRA 3PZEA 4FTAA 4UALA 4QMTA 3BLHA 5CU2A 2WQOA 3F88A 3IQ7A 1IA9A 3FMLA 4KIPA 5E4HA 5TKDA 4DEGA 4YJRA 1GY3A 2QHMA 1W0XC 2P33A 3AMYA 3FMDA 3GENA 4BIDA 4RZWA 4U98A 3FI4A 2XYNA 4V0GA 3FY2A 3PRFA 2RF9A 4WT6A 3UZRA 4AAAA 2HZ0A 5HNBA 4DDGA 3QD4A 2Y9QA 3IDPA 2EXCX 1AQ1A 3CTJA 3FC2A 1SNUA 5M53A 5T6KA 1O6LA 2ITZA 1UWHA 2WIHA 2QD9A 5EM7A 1Y57A 4ZP5A 4GIIA 4AG8A 2OG8A 1BL6A 5D7VA 3DBDA 3QQFA 2W1DA 1ZOGA 5HIDA 1U54B 4JBOA 3HKOA 5JN2A 2X4FA 2Y0AA 3BL9A 3FKOA 5H9BA 4BIEA 3HA8A 2B54A 2XJ2A 4IJ9A 3MPTA 3ORMA 3S00A 3RGFA 4BYIA 4HGEA 4I6BA 1KE7A 5ITAA 2XYUA 4TPTA 3ZO4A 2RFDA 4MF1A 5AUXA 4EZ3A 2A4LA 3FPQA 2OF2A 4AT3A 4MXZA 4OTDA 4JRVA 4ZAUA 5M08A 1YDTE 5CSHA 3C4WA 2W9FB 4I22A 3Q96A 4F09A 3BEAA 2QO7A 2Z60A 3I0OA 3OW4A 3WZUA 3ZHPC 5IUIA 4EOLA 3TKUA 1NVSA 3AKLA 4XJ0A 3ZRMA 2G1TA 3GU5A 4FL3A 4B7TA 1GZOA 2O2UA 4TL0A 3IOPA 4IM0A 2YAKA 2CN5A 1KE9A 4JDKA 2JGZA 2V55A 3QA8A 3EQIA 3ZXZA 3QUDA 5KMLA 5A14A 3MS9A 5AIRA 1ZOHA 3BELA 4MNEB 2R3NA 1SVEA 2DWBA 4RVKA 4ITIA 1U59A 5BVOA 4QMQA 3DCVA 4Z3VA 2VWUA 2X7OA 4KBAA 1SM2A 4KUJA 2GS6A 1PXLA 3EMGA 3LM0A 2BR1A 3DXPA 3BL7A 4A7CA 2OIBA 3G6HA 3QKKA 4LM5A 5L6PA 4PUZA 5LMKC 4YO4A 4XV9A 3IO7A 2C30A 4IC8A 2CGVA 2ZV7A 4CLIA 3EFLA 3R8MA 4DG2E 1MP8A 1ZARA 2YJRA 3DTCA 4Y72A 4O83A 4ANBA 3OWJA 1SVHA 4S31A 4B6LA 4F1TA 4AGDA 4EH4A 2OH0E 1UU7A 1OKZA 2W05A 4FEUA 4DGOA 3E93A 5J95A 2QR7A 4PWNA 1YWRA 1ZOEA 5CNNA 3VAPA 4AW1A 4E6QA 3VIDA 3WBLA 1YXVA 3OCGA 2H8HA 3AXWA 5CY3A 1TQMA 5IMEA 4ACHA 3R00A 3W2CA 4DH8A 4DCEA 3ZFMA 4IADA 1I09A 4EYMA 3TM0A 4O21A 4J53A 2XBAA 4ZIMA 1I44A 3C4EA 2OWBA 4QMMA 4RIYA 3RWPA 3VNTA 4E6AA 2EXMA 3A7IA 3FMHA 4DLJA 3TCPA 1R3CA 4CKIA 3K5UA 1XQZA 4XUFA 5EKOA 2LAVA 3C13A 5FM2A 3ZMMA 4YURA 2XH5A 3QLFA 1G8AA 2R3PA 5EHYA 3EL7A 3PPJA 4IANA 1GOLA 4BI2A 3GFEA 3SDJA 5HBJA 1E9HA 3Q9ZA 4QP4A 4RWKA 1RDQE 2RFNA 4I4EA 1UKHA 2QOBA 3QL8A 3KN6A 4AXAA 4B0GA 4Z55A 4QYHA 2VTJA 2WHBA 3MB6A 3OCBA 4U3YA 3JYAA 3FI2A 4JDJA 3O71A 4O0XA 1ND4A 2FSOX 2R7BA 4S33A 3SHEA 4EOMA 2VTLA 2VWZA 4RX9A 3KU2A 3L8SA 5KBRA 3R7OA 4NFMA 3NNWA 4W4VA 1A9UA 3HRFA 3TDVA 2VN9A 4QP6A 4F7JA 3HRCA 4P90A 4S32A 3QX2A 3R73A 4LI5A 3SOCA 5CU3A 3DJ7A 5IQIA 2JFMA 1Q3WA 2OZAA 2YCQA 3T3UA 1TFFA 4TT7A 5M06A 2JD5A 2JIIA 3OT8A 4AN2A 2HY0A 4BTJA 1URCA 3ODYX 2VZ6A 1H8FA 4JAJA 4I6LA 3RAHA 2ESMA 3Q04A 4MXCA 4U97A 4D55A 1JQHA 5H3QA 4ZTRA 4O7NA 3AKJA 3KULA 2WFYA 3HV7A 4GL9A 4L52A 2BTRA 3F3WA 2BZJA 2CNUA 4HZRA 3GB2A 3IKAA 4WHZA 4FV3A 2X9FA 4NCTA 3V3VA 3RM7A 4AWIA 5E90A 2QURA 2YDKA 1Y91A 2WEIA 3ETAA 2O65A 3I5ZA 2O8YA 3FWQA 1BUHA 3QCQA 5DIAA 3OEFX 4E8AA 1H26A 4AN3A 5IH4A 2J90A 1YHSA 3A2CA 2PPQA 4IAIA 4U3ZA 3OP5A 2Z7QA 3IW7A 2YAAA 3TV6A 4ERKA 1F5QA 5HLWA 4EORA 2Z7LA 3VBYA 4YUQA 2R3OA 2XRWA 3ATTA 4NM7A 4NK9A 1P14A 1ZYJA 2PZPA 4CVAA 1H1PA 4KRCA 4FSTA 4HCTA 2RIOA 5HO7A 2C6MA 4YZCA 3D2KA 1PW2A 3BGPA 3U9NA 2FSTX 3BYOA 5D9HA 3EKKA 3HMPA 2BTSA 4F1MA 3NNXA 5CSVA 4GW8A 5DNRA 2W7XA 3ZO2A 1JBPE 1XJDA 2XZSA 4ANMA 1Z5MA 4JG6A 5AAFA 5CSXA 1H27A 4XMOA 4QTCA 4D9UA 4HVGA 2VO3A 5HG8A 2OW3A 4FKLA 4KNBA 4D4SA 3I1AA 2ETKA 3PDTA 3D4QA 1OL5A 1OVEA 2P4IA 3HDMA 4KIQA 4EQUA 3WZDA 2IZSA 3SLSA 5E8XA 2WMBA 3FZRA 4QMSA 3MA6A 4TN6A 3DPKA 1PKDA 2IW8A 5DPVA 2E9NA 4JIKA 5C01A 1OKYA 5A4TA 1QL6A 4H1MA 4EKKA 4H3QA 4U79A 4XNEA 3I7CA 3ZM4A 1OBDA 2OI4X 2NYAA 5IDNA 3JVSA 4GJ3A 4TKSA 3WOWA 3FLNC 2YM5A 4ANQA 2IZRA 1JKLA 1Q62A 4U44A 2YIRA 1WVWA 1GZKA 4E5AX 2G15A 3D7ZA 3A4PA 4FV2A 4WIHA 5EM5A 4DCAA 5ANDA 2V0DA 3R7VA 4ZLOA 3EQHA 2VX3A 3MVJA 5A6NA 5JGAA 5BMSA 2WQNA 2ZFYA 3HEGA 3OCTA 3BLAA 4PMMA 4R78A 3MTLA 1RE8A 3VBWA 2C0OA 2XEYA 3MN3A 1Y6BA 5CI6A 3R9DA 5M4FA 1KV2A 2FVDA 2HZNA 1JKTA 3DAKA 4EYJA 4IAFA 4NYEA 5HG7A 2RFEA 3ZRLA 5HU9A 5AP2A 3F2AA 3Q9XA 2JDSA 2R3HA 1Z9XA 1FOTA 4AT5A 3V51A 4JVGA 3LCTA 1WZYA 5CENA 1ZMWA 3R01A 2WOUA 4ZS4A 1JOWB 3VBTA 3M42A 3W18A 4O2PA 1REJA 3WF8A 4A9SA 2OSCA 4J8NA 5IEVA 3NUUA 5D1JA 2PVMA 4NKSA 5JZJA 4M14A 4F9YA 4WSYA 3E63A 3UIXA 4X2KA 4LG4A 2Y4PA 1UNGA 4QQTA 3EN5A 4C2WA 4FT9A 1G8SA 2ITPA 1B39A 3QCYA 3V01A 1WVXA 5A54A 3F3UA 4F63A 3UMXA 4I20A 5EYDA 4AXFA 5AEPA 2FA2A 3G51A 3U4WA 4UZDA 3CIKA 2YA9A 5K5XA 2I0EA 1TQPA 2WELA 5EKNA 2C3KA 4BHNA 1JKKA 5B0XA 2E2BA 3PE1A 4BJJA 2HAKA 4ZSGA 5CEQA 3D9VA 2PVRA 3EKNA 4LYNA 5LARA 5AUTA 1FQ1B 3CGFA 4NL0A 4DGLC 3PXQA 5AWMA 4IJPA 4JXFA 1V1KA 4BBFA 4YPDA 2QOHA 4I6FA 4RSSA 5HX8A 3VUGA 2ERKA 2FSLX 5EOBA 4ASEA 4BZNA 1VR2A 3C5UA 4XG4A 3ULZA 2OICA 5D12A 2XM8A 2ITQA 5C26A 3R21A 4JX7A 3U6IA 4I6QA 3IK3A 4NJDA 2W1GA 3GU6A 2DYLA 1PMVA 4ZZNA 4FV5A 3LLTA 4TYHA 3HX4A 3MPAA 4MTAA 4P7EA 2X8IA 4M7IA 3CTQA 4FKUA 4L46A 2CCIA 2GS2A 3FY0A 3IW6A 2OJIA 2AUHA 2J9MA 3PXKA 4G5PA 2CKPA 3K5VA 5EG3A 2R3IA 3TI1A 2BKKA 3AD4A 3BPRA 3QYWA 4MBJA 1IEPA 3TKIA 3TTIA 4DEAA 5CEKA 3TUCA 3HV3A 3C5IA 1WCCA 4NWMA 1JVPP 5JQ8A 2J0JA 1SZMA 2NP8A 1J7UA 4RIWB 3NW5A 2PTKA 4YGAA 2UZOA 1V0BA 4L3JA 2YM8A 3UE4A 3D83A 3GQLA 4CGAA 3BU3A 3BHYA 3CD3A 2W4KA 2XNMA 3W0QA 3PG3A 1WBSA 4MXYA 2R3FA 3ZSHA 3SG8A 1CKPA 4CFXA 4G9RA 4I5CA 3POOA 5EQYA 4H3PA 1PF8A 4J98A 4AOIA 3NWWA 4ANLA 3DB8A 4BDHA 4YTCA 3K3IA 4QYEA 5TO8A 3PVWA 3NZ0A 2YIQA 4J1RA 5AM6A 2H34A 1JWHA 3NAXA 3GNIB 1XBAA 4GEOA 3W2QA 2YIXA 1KWPA 4FV9A 5ANKA 4H05A 5M56A 1UU9A 2B9IA 4BCHA 4IDVA 3UOKA 3ZXTA 2OU7A 1XH8A 2XCKA 5GJFA 3PIXA 4AZWA 2QOIA 1WBPA 3A7FA 4R6VA 4RBLA 3TNIA 1ZY4A 4M97A 2PVFA 3F9NA 3RM6A 5ANOA 3OT3A 4NIFB 2C68A 3RAWA 4EHGA 1KE8A 2OFVA 5HVYA 2YHVA 2JKQA 3NS9A 3EWHA 4FEWA 2WTIA 2XKCA 4Y85A 2GHMA 3Q9WA 4MD7E 3RPRA 4CCBA 5M51A 3IPHA 3PVUA 1MQ4A 2XNOA 4CKRA 4QMYA 3RPVA 3BKBA 4AA0A 4C58A 4BDBA 4RIWA 5A6OA 3QRIA 3HMMA 3N4VA 3UC4A 2HZIA 4EJ7A 3FHIA 3BHHA 2ITOA 1ZYSA 2R9SA 1YQJA 4O91A 5AV4A 2C4GA 2IPXA 3BV3A 4JDIA 4N6ZA 5IMXA 3VJNA 1SNXA 4ZJVA 2PUIA 3CGOA 5AV1A 4ASDA 2NO3A 3OOGA 5D11A 2YABA 2GNLA 3BWFA 5CANA 1H08A 3P23A 3SXSA 1RW8A 5CEPA 4AA4A 4AXEA 3OBJA 1H07A 1OGYA 3PYYA 3R1QA 4TXCA 3CQUA 1M7NA 4EQMA 3BEGA 3A7HA 2H9VA 4S34A 5E9EA 1OUYA 5M44A 2GS7A 3A61A 2QONA 3TXOA 4O96A 4QYGA 4FEVA 5CNOA 2R3MA 3SA0A 3DBQA 5BVEA 3E92A 3PVBA 5IQFA 5EDRA 4IZAA 2GHLA 3NUAA 2J51A 3WIGA 2JFLA 5JFSA 2C1AA 5AV2A 3U8WA 4GCJA 3HL7A 2VD5A 4X21A 5FXSA 3UYSA 1DM2A 1KOBA 3BHVA 2CHLA 4FYNA 1P2AA 1CM8A 3VBXA 5KKRC 1J1BA 1V0OA 2CMWA 1NVQA 2UVZA 4DAWA 2ITWA 4IZ5A 4QTDA 4GJ2A 4XP3A 4QP2A 4N0SA 4ZTSA 2G2HA 5KCVA 4FV7A 4DF3A 4FBXA 4ZS0A 3R8VA 3KF7A 4WOVA 4F9BA 3VS6A 3JXWA 3OXTA 1G5SA 5GJDA 3WYYA 2Y6OA 2J0KA 4PMTA 1MRUA 3SXFA 4AZEA 3QWJA 4BCOA 3CQEA 3GC7A 5J9LA 3I79A 3KRJA 2CGWA 3JR1A 3JUHA 3QGWA 3VO3A 5JFVA 4DEHA 4FEXA 4XLVA 4BGGA 4RJ4A 1A06A 3DKCA 3DAEA 4ANSA 2QU6A 4HYSA 3W0NA 3C4XA 3CCNA 3NLBA 4TW9A 2W1ZA 3MTFA 2IVTA 3D5WA 2WTKC 4RIOA 4L67A 4U45A 4IX6A 5GJGA 4C7TA 2O3PA 5TR6A 5CF8A 2BZKB 4JR3A 4G6OA 4Q5EA 5LMAA 3VUMA 5IQDA 5DHJA 1YOLA 5E8WA 2UW8A 3CY2A 5KX8A 3W2OA 2VWIA 5JRQA 5L3AA 4FOBA 4QP9A 5IZFA 2QO2A 1WFCA 2PVNA 3LXNA 3RWQA 3TZ7A 2UW9A 3UIBA 4DLIA 2W1FA 1WBVA 3FEGA 2W5AA 2YWPA 3C7QA 4EK3A 1YDSE 3FI8A 5K3YA 1JSTA 4OTQA 4KABA 3QU0A 2BFXA 5CVHA 5HE1A 4DDIA 4IACA 1YKRA 3FYJX 2X81A 3B2WA 1O6KA 4FKVA 2XARA 1PY5A 4QMUA 4HNIA 3EQCA 3QTSA 4HCVA 2Q83A 4RPVA 2C6KA 4JL9A 3V04A 4ALUA 4F70A 4KAOA 4OR5A 4MK0A 3ZLXA 3TNWA 4JRNA 4AX8A 4GRBA 5IUHA 2PE1A 5GIPE 3DAJA 4F7LA 1CMKE 4EZ5A 3FMKA 4JLCA 3ZYAA 5JMSA 3GBZA 3RKBA 4FMQA 5K4JA 5EW9A 4CV8A 5HNGA 4YBKA 1LEWA 3BLQA 5EW8A 3RK5A 1T45A 4FR4A 5JGDA 1FBNA 1M2QA 4FTIA 3ZLSA 3LJ1A 4CNHA 3FQHA 3NYXA 3F82A 5M4CA 2GDOA 1QPCA 3VS1A 3RTPA 4TYJA 3V8SA 4WRGA 4BTMA 4YSJA 5JQ5A 3ZDIA 4F0GA 4GS6A 4G6LA 5FBNC 3E3BX 4FSQA 4UV0A 4E4LA 5FGKA 4MXOA 4UZHA 3F7WA 2BROA 4GVJA 1H01A 3LQ8A 2W9ZB 2RL5A 4Z7HA 1A48A 1PXPA 4IB0A 3WIKA 1Y6AA 3D2IA 4IH8A 4W8EA 5ETAA 3UTOA 5KUPA 4CMOA 5JKGA 2QNJA 4ZTLA 3ORZA 2B4SB 3MVLA 1ATPE 4JBVA 4GYGA 4TY1A 5DN3A 1OM1A 5EI8A 3UZPA 2VRXA 2GU8A 4FI1A 2J2IB 2J0IA 3MSSA 4HW7A 3NUNA 4KSQA 2VNYA 3L8PA 3ELJA 2PZ5A 1Y8GA 5DR2A 1VYWA 4MQ2A 2PVHA 3L9PA 4MQ1A 5DRBA 5LCKA 1CSNA 2JDVA 5L6WL 1M7QA 2ACXA 2HZ4A 2OXXA 3AC2A 3KRRA 3R22A 4AGUA 2FYSA 3F5GA 5C1QB 4WA9A 2UZBA 5L8KA 1O6YA 4IAKA 2PWLA 4OT5A 4QMPA 4YJOA 3ENHA 3BQCA 3NNVA 2VGOA 3MWUA 4KKHA 4FIEA 4QQ5A 5BPYA 4ZSAA 5KE0A 2F7EE 3UQFA 1DS5A 3IS5A 4BDDA 3LVPA 5CLPA 2XRUA 4YHTA 1CDKA 4EL9A 4F78A 4XOZA 5IQAA 3TTJA 3OVVA 4V0GB 2QODA 3QRTA 3EHAA 3O50A 3GCQA 3HA6A 5FXRA 2CLXA 2W1HA 4FSMA 3OG7A 4NM5A 3HMOA 5B7VA 2W4OA 4JQEA 2PHKA 3FZPA 3TYKA 1OPJA 2AC5A 3CQWA 3PSBA 4ACGA 4MYGA 3EFWA 1V0PA 2UZVA 2W99B 4NW5A 3BE2A 2W17A 4QMXA 4QO9A 3S4QA 4V01A 4FTKA 5F95A 4USEA 4Z16A 3LQ5A 5HE2A 4FVRA 3NW7A 5L2WA 3VJOA 4QMOA 2DUVA 1GIJA 3RPYA 3R63A 3SD0A 4ALVA 4DHFA 3D94A 3PIZA 3DZOA 4LUEA 4G3GA 2ZOQA 3GT8A 5AJQA 4R5SA 4DEIA 1Q5KA 1DAYA 1ZAOA 3DY7A 3IG7A 4FZ7A 4DH5A 3THBA 3UOLA 4AS0A 4RC3A 4IEBA 4BI0A 1WBWA 3R8PA 4D0XA 3GC0A 3UDTA 3ZCLA 2DS1A 1IR3A 2WMUA 3EL8A 3PZHA 4LGHA 3FMEA 4CZTA 3AT3A 4DGGA 5DGZA 2VTPA 4RA4A 2R2PA 4GT3A 3HMNA 3D5UA 3QALE 4FJVA 4PQNA 3TN8A 4U43A 5C27A 5HLNA 5J1VA 4MH7A 4XLIA 1W82A 4FV8A 3HV4A 5C9CA 3PG1A 5FRIA 4G5JA 2QKWB 1UNHA 4YTHA 5HG9A 4YZDA 1EH4A 1STCE 3E7VA 5LVLA 3L9MA 3UO4A 1XH5A 4OBOA 3MJ1A 1XBBA 4YNOA 3I5NA 3DV3A 3NYOA 2GNIA 4RX5A 2RGPA 4R5YA 3VF9A 2YIWA 3ZFYA 3KA0A 2XEZA 4O7RA 3LCSA 3BBTB 2GMXA 1B38A 3DK7A 3FMMA 5HEZA 2YIYA 4IB1A 4DH1A 5IISA 4OTFA 4RJ7A 5DT0A 3O2MA 3ANQA 4RVMA 2VWXA 3QRUA 4LFIA 1PJKA 2F7ZE 4WD5A 3TUDA 4C4IA 4MHAA 1YDRE 3FL5A 3G0FA 2A2AA 3ERKA 4DFZE 3NVMB 3NR9A 4ACCA 3ROCA 3QZHA 4MAOA 2EVAA 2GQGA 1ZYDA 3SV0A 5FEEA 2C5VA 4D4YA 3TEIA 1XWSA 4TWCA 2OO8X 1U5RA 1FGIA 1JSUA 2GTNA 3D7TA 5LVMA 3VN9A 1YI4A 5LWNA 3TIYA 3I0QA 4AW2A 3ORLA 4NW6A 4E7WA 4DHIB 4FIHA 3UDZA 4TZRA 5TOZA 4YU2A 3FYKX 4UB7A 5AUZA 3DOGA 3R9NA 2VTSA 2XK3A 3BYVA 3PPKA 1BL7A 3NIZA 4R3PA 2UW5A 4QP1A 3UQGA 4XG7A 4DGNA 3AKKA 3I7BA 2CNQA 4RMZA 4ENXA 3N9XA 2BIKB 3AC3A 4MVFA 5DFPA 3ZC5A 3ITZA 4FTLA 1GAGA 4ACMA 4ZSEA 4RIYB 4EONA 3ZEPA 4TYIA 4AZFA 5BYYA 4TNDA 4AA5A 4Q2AA 2C6OA 2OH4A 3NSZA 3KXXA 4O38A 2X1NA 3MW1A 3W1FA 3W2RA 4D58A 4EK6A 4E5BA 4ZTMA 4FSNA 5HIEA 4DTBA 5GIOE 3V6SA 2UW6A 2X0GA 3A8WA 3UIUA 3TNPC 4C4FA 3G15A 4I21A 4I4FA 4O7YA 4C33A 1OUKA 3W10A 5ICPA 4O7TA 3FSFA 4PDPA 4GK3A 4D1ZA 3EN9A 3AGMA 4E1ZA 4FVPA 3EZRA 3Q53A 2WPAA 2P55A 1XH7A 4XV3A 1UU3A 3EFKA 1FVRA 2I1MA 2J4ZA 3OC1A 2C3IB 1FMOE 4O0SA 3OMVA 2XK8A 4IFCA 4YBJA 5M09A 2W1IA 3IDBA 4GKIA 1YXXA 4UX9A 4JIAA 3O5AA 2VTTA 5C8NA 4CFFA 2JLDA 2NNWB 4RC4A 3TJCA 3VF8A 3WYXA 3VRYA 5BVDA 1ERKA 2ITUA 4AUAA 5K9IA 4F6WA 2X2LA 4JNWA 4ALWA 2OZAB 4XG3A 2PULA 2WTJA 4YJQA 5KMJA 3BCEA 3O7LB 2B1PA 3CPBA 4GG7A 5FTOA 4F9WA 3KXHA 2QR8A 2XKFA 4YZMA 1IG1A 2Z7RA 2HY81 4XYFA 4DG3E 2QCSA 3DT1A 3VS2A 3O51A 5L2TA 3F5PA 3KULB 4D4VA 3C50A 3NX8A 3PWDA 3R2YA 1WMKA 3NNUA 4O7ZA 3K3JA 5HZNA 3DGKA 4LOQA 4ZEGA 3IGGA 4KWPA 2BAJA 4GYIA 4QQJA 2W96B 1J1CA 2C5XA 3QZFA 4NUSA 5AM7A 4I23A 4QYYA 4XBUA 2VTNA 2BAQA 4O0RA 4BIBA 2CDZA 1ZY5A 2X2MA 4RQKA 4EBVA 5BUJA 1UU8A 2JEDA 5I0BA 3LZBA 5AP5A 3HRBA 2G2FA 2CKEA 3P86A 4DEBA 3W16A 3FXZA 4BCQA 4BTFA 2C3JA 4C34A 3OXIA 4XG2A 3OWLA 1DAWA 4UYNA 4W4YA 2Y8OA 4U40A 1OBGA 5FDPA 2P3GX 2PUUA 3QRKA 2W1EA 4EI4A 4RFMA 3BZ3A 3DFAA 4C3FA 4UYAA 4K8AA 1IRKA 3EH9A 3F3ZA 4E6CA 2PK9A 3EYHA 3W0OA 3OFMA 4JOAA 4LOPA 2IJMA 5KMIA 3P7BA 2C6LA 3F3VA 4JMQA 3C4ZA 3F66A 4GV1A 1Q61A 3IGOA 3KY2A 3F5XA 3FC1X 4FODA 4U41A 4E4MA 5KMNA 3OCSA 1GZNA 1VZOA 2B55A 3ROYA 2WU7A 3KL8A 3G90X 4BBEA 4WBBB 4WNMA 4L8MA 3RHKA 4DBXA 1Z57A 3S3IA 1HOWA 3WZEA 2PVYA 3C51A 2GPHA 4M67A 4O0WA 5A3XA 3NPCA 2IO6A 2PMOX 3TJDA 2UVYA 2BZHB 4AXDA 4A4OA 4V05A 4M15A 4WNOA 5TF9A 2C5OA 3TG1A 2ITYA 3UC3A 1PYXA 5EDPA 3EQRA 4YLLA 5I9ZA 4RJ6A 1PRYA 4FKJA 4GVAA 4EH7A 4XRLA 3P7CA 4X3FA 3F2RA 2OXDA 3LFDA 5A9UA 4IIRA 3V6RA 3Q52A 1YHWA 3FLYA 3K2LA 1M17A 2VTAA 2YZLA 4IAZA 5DYJA 3SRVA 4BYJA 3R7IA 4B9DA 2R0IA 3EQFA 3ALNA 3AOXA 5I9VA 4MWIA 3ZUVA 5DOSA 1ZRZA 5EM6A 5AA8A 4KS7A 3O23A 4FG9A 1H25A 2H96A 4DG0E 3OD6X 4H3BA 4K6ZA 4AGCA 3DA6A 3EOCA 4FTOA 3QXOA 3WE8A 2XNGA 4BCPA 4EWHA 4TRLA 5DT4A 4IWDA 1TQIA 4IE9A 4BGQA 4F7NA 2JDTA 4FNZA 5AP4A 1L8TA 4JI9A 1X8BA 3H10A 2DQ7X 4WBOA 4DEDA 3COKA 4RIXA 4GFGA 1AGWA 4L00A 1GIIA 3KFAA 3PRIA 5IF1A 2F7XE 3FDNA 4XH6A 2QOOA 3R9HA 3GU7A 5FBOA 3H9OA 4LRMA 3MESA 5HBHA 3KXMA 5E1SA 1XKKA 3QQLA 1SMHA 3LFCA 1H4LA 3Q4UA 1E1XA 4I41A 3OY3A 5I9XA 1ZMVA 2UV2A 1KV1A 2VWBA 3A99A 3FI3A 1QPJA 3OWPA 4XV2A 4I1ZA 3UDSA 4CFWA 5CALA 3R1NA 4BCIA 3DKGA 4E6DA 1YWNA 3PXZA 4IWOA 5AUUA 3DB6A 3M11A 5T3QA 4QMLA 3W0PA 2V62A 2FB8A 3QTIA 4U7ZA 5CYIA 4YHFA 3KK9A 4I5MA 2GSFA 2PUNA 3IONA 5BX0A 4BJJB 1YI3A 2JAMA 3LMIA 4K77A 4OTIA 2ZYBA 4GK2A 2XIYA 1PMUA 2YCSA 4BDFA 3QX4A 2XNNA 4FTRA 4J97A 4CMUA 4F9CA 2F57A 3AT2A 2HYYA 3TDWA 3P0MA 2UZEA 4O84A 4YZ9A 2Z7SA 4C59A 3M1SA 5CSWA 3U6JA 3FLQA 2R3KA 4MXXA 2VTQA 3R04A 3F2NA 2QLUA 4FK3A 4XCUA 1URWA 1JNKA 3ODZX 3HP5A 4L42A 5FM3A 3UYTA 3U55A 4L68A 4K1BA 1KSWA 2VUWA 3DQWA 4I24A 4TYHB 5HGIA 5G6VA 2PZIA 4FE2A 4F9AA 4DGMA 4PL3A 3GP0A 3ZDUA 3RZBA 2HW7A 4TWPA 2PMIA 2YM4A 3RJCA 1Q24A 2OIQA 3CR0A 4MXAA 1J3HA 3LFQA 5IU2A 4HNFA 3MBLA 3KRLA 5L6OA 2GNGA 3RPOA 3ZONA 4DFUA 1JPAA 4EJNA 1ZWSA 2VU3A 2B9JA 4FNXA 5BYZA 2YZAA 5DT3A 3WZKA 4EKLA 2QOQA 3UNKA 4F6UA 1OIQA 1PXIA 1VEBA 4KD1A 4FSUA 3QCSA 4HOKA 4L7FA 1R39A 4E26A 3SC1A 3UIMA 4CLJA 3BHUA 3AG9A 5KMMA 3GU4A 4YJTA 3RALA 3KVXA 3ACJA 4WUAA 3FKNA 5HE0A 2F4JA 3VUHA 3W0MA 4P5ZA 4I93A 3UNJA 3W2SA 4F08A 5HCXA 3LQ3A 5M07A 5M55A 4BRXA 1Y8YA 3NUSA 4KINA 2X7GA 3MA3A 3ORNA 5FP5A 4NZWB 5DLSA 4DYMA 3UVRA 4M68A 5H8EA 4FKIA 3ZS5A 4K11A 4PNIA 4DBNA 3GC9A 4BCJA 5A46A 4F0FA 4FGRA 2ITTA 5CEMA 4G16A 3E8CA 2XNBA 4ZLYA 2I0YA 2WD1A 4QMNA 3KXZA 3I6UA 1OIRA 3HYHA 4G6NA 4IFGA 3UGCA 2WTVA 2HXQA 2RKUA 4AXCA 4APPA 5DBXA 1OL1A 5IDPA 3MFUA 1H1WA 4O7SA 4MBLA 2C3LA 1FMKA 4AF3A 4IDTA 2WMXA 1G8KA 3QQUA 4RA5A 3Q2JA 4M0ZA 5ACKA 3N4UA 4EH5A 4NT4A 4ZOGA 3ENMA 4MX9A 5HICA 4ACDA 4A06A 3CKWA 3DQXA 4ASXA 2QC6A 3CPCA 1ZYLA 4L3PA 2PVJA 4DFNA 3VULA 5LVPA 1Q99A 4J7BA 3KMWA 4H39A 3Q4ZA 1MUOA 3Q6WA 2EWAA 5I9UA 3KXNA 4RQVA 4W4XA 3H3CA 2J5FA 3MFRA 3C4FA 5TT7A 2CGXA 2ZM3A 4C4GA 2ONLC 4O0YA 5AP7A 1GNGA 1HCKA 4J52A 1OKVA 3UVQA 5HVJA 4PL4A 2HWOA 2XK7A 3ALOA 4DTAA 1UKIA 2VX0A 3ORPA 5DR6A 5IA3A 1TKIA 2XNEA 5HI2A 5HU3A 3VONA 3H0YA 3NUYA 4LDTA 3PPZA 5GNKA 3DU8A 3VS4A 5BVFA 1PXJA 5HORA 2BMCA 1R0EA 1MRVA 4GFMA 5DE2A 3VUIA 4O7VA 3HMIA 3N51A 5AX9A 2C6TA 3A4OX 3MB7A 2XCHA 2FUMA 3MIYA 3KGAA 4XBRA 3EQBA 5DEYA 2Q0BA 2XB7A 2ZB0A 3REPA 2CPKE 2WKMA 4BTKA 2PUPA 3QD0A 3QTUA 3AC4A 2RFSA 4QTAA 4RX7A 2ZMCA 5BVKA 2JKKA 3A7JA 5LWMA 2YACA 4IM2A 4JG7A 3GOKA 3QD2B 3DXQA 4BB4A 3B8RA 4TWNA 1P4OA 5HLPA 3NUXA 4CFNA 4D2RA 4F1OA 4RX8A 2XP2A 3Q60A 4HGLA 3RINA 3TZ8A 4EOSA 2QQ7A 3SW4A 1UVRA 3PA3A 5LXMA 4BN1A 5M4UA 4X3FC 1NW1A 2X8EA 4IBMA 5C03A 4O22A 2BALA 1P4FA 5EI6A 5LMBA 1CTPE 4L01A 5D41A 3CP9A 4DTKA 5CSPA 4C4HA 2XNPA 5DWRA 4DEEA 4EUTA 3NGAA 3A7GA 2EB2A 1KE5A 2CKQA 3HUBA 3KVWA 2VTRA 4YJUA 5CXZA 4L43A 3QTWA 5EI2A 3KMUA 5AIKA 3ZO1A 5HTBA 3WF7A 3QXPA 1M14A 2VX1A 4TWOA 2ZM1A 3GI3A 3QKMA 1G8JA 2JC6A 1LPUA 3E5AA 2I6LA 2X7FA 3OTUA 2J7TA 4QP3A 3RPSA 5HCZA 4BF2A 3VS3A 3S1HA 1Q4LA 3EN7A 4EBWA 3TUBA 1VLRA 4H36A 4DHZA 3UQCA 3ZC6A 5AUYA 3T9TA 3OTVA 4PY1A 4BICA 4LMUA 4Z9LA 3W8LA 3GCSA 4FKWA 4RGJA 2X39A 4XX9A 2YN8A 4BC6A 5CAOA 4XP0A 4N57A 4RJ3A 3UMWA 2C6DA 3PVGA 2WMSA 4FL2A 3TL8A 5A4LA 3PUPA 1ZLTA 5ANIA 1U4DA 4CG9A 3CE3A 1M2PA 5AV0A 5CF6A 4PTEA 4Y8DA 4GT4A 4H1JA 2PY3A 4RFYA 3RK9A 2WNTA 4EK8A 4KKEA 1H0VA 3OXZA 5HQ0A 4FX3A 3U54A 3UPZA 3HNGA 3TMOA 4LRJA 3GXLA 1YWVA 5LOHA 1ZMUA 1AD5A 3IW5A 3NCGA 4OBQA 1R0PA 1JAMA 1WBTA 2UZLA 2VO7A 2WQBA 3MDYA 3QQGA 4FSRA 3TIZA 5LVOA 4USDA 1F3MC 2E9OA 2WXVA 5J5SA 1MQBA 4FT0A 4BGHA 4UN0C 4ZY5A 3PY3A 4A07A 4YPSA 3EN6A 4B8LA 2PYWA 3CY3A 3OZ6A 2YFXA 2XS0A 3EN4A 3I4BA 3WI6A 4JBPA 2F2UA 2XIKA 3MFTA 1E1VA 2HWPA 3HP2A 4FT3A 2B7AA 2JITA 4ZJJA 2WIPA 4ZZOA 3V8TA 1LP4A 2PMLX 4R3CA 3I60A 5DEWA 4ZJIA 5E8YA 4HVIA 2HOGA 4I5HA 3R6XA 4UWBA 5IA0A 1JKSA 2HW6A 4J8MA 4OTGA 2BHHA 5DR9A 4BCNA 5CWZA 2JKMA 4M84A 4XEYA 5HG5A 4BR3A 5EYMA 5CEIA 4WNKA 5HNIX 5KHXA 2NRUA 2GTMA 3IDCA 4AQCA 5F4NA 4FTNA 4FSYA 5HVKA 4M0YA 4Y46A 2C6IA 3H0ZA 4QMWA 4AFEA 4XHKB 2PZRA 3E62A 4QPAA 5JFWA 3FXXA 3A62A 5HTCA 5DG5A 3TZMA 2QG7A 1PXOA 3KN5A 1NY3A 5HHWA 5AUVA 3W55A 4YMJA 2J50A 5ETFA 2GNFA 3ATSA 4GMYA 3V5JA 4R3RA 1FGKA 2CN8A 5CX9A 2YM7A 3QZIA 3U87A 4U6RA 2UZWE 4JQ7A 5EFQA 5EQEA 3Q4CA 2R5TA 4D28A 4DH3A 3H9FA 2WAJA 2Y4IC 4C37A 2HELA 1IA8A 4FC0A 4CRLA 2O63A 3LIJA 5GINE 2XANA 4TYEA 3BE9A 3V5TA 2BRNA 2XJ0A 4JAIA 4NTSA 5EYCA 4FSWA 4J95A 5J8IA 3KB7A 4C3RA 2BDJA 3P9JA 5HBEA 4ZY6A 2FO0A 3D15A 3G9NA 3GVUA 4QTEA 4G31A 5EHOA 2I40A 3HZTA 2OLCA 3TKHA 3KIOC 4HYIA 4U8ZA 2JKOA 3NMUF 4XRJA 1WAKA 2A19B 4O2ZA 3F6XA 4FEQA 4G3CA 4E4XA 3FJQE 5A4QA 4G9CA 1REKA 3VVHA 4DT9A 3D5VA 1OPLA 2IW9A 4CKJA 5E8ZA 2VAGA 4YO6A 2XK4A 1L3RE 3HV6A 4NKAA 3FPMA 5D7AA 3G0EA 3VQUA 4FIGA 2VTIA 4LV5A 3ZOSA 3Q2MA 4K2RA 4CG8A 5IQGA 2GCDA 3E88A 4AZSA 3UODA 4AN9A 4BHZA 4QP8A 3SX9A 4BVUA 3SKCA 4EWQA 5CXHA 1YHVA 5JT2A 4BI1A 1WBOA 1M2RA 4ORKA 3ZM9A 3GFWA 3IW8A 3Q3BA 4FIJA 4FTUA 3GEQA 4R7BA 4QOXA 4R77A 4AOTA 2ZV9A 1BKXA 2VNWA 2IVUA 1Q3DA 3CJFA 3DFCB 3LXLA 4PP7A 2WZJA 4L45A 3FAAA 4IAAA 4YJNA 3EB0A 3HUCA 3KEXA 4OGRA 4PTGA 3LFEA 3RK7A 4EOJA 4LQMA 3DKOA 4FZDB 4FZFB 3SVVA 3BYMA 3LOKA 3O96A 1OZ1A 3MGYA 2IN6A 3P5KA 2XM9A 4GG5A 2GHGA 4NH1A 4RWJA 5CT0A 2OXYA 3CD8A 4IWQA 2QOCA 3I6WA 3D7TB 1ZXEA 4W4WA 3T9IA 4A9RA 4S30A 2VTOA 1FVVA 4IAYA 2ZB1A 5E8VA 3TNQB 2ZV2A 2Y7JA 5KMKA 3E8DA 3ORTA 3FMJA 3UOJA 3WF9A 1F0QA 4RVLA 3EQGA 3VBVA 2BHEA 4FKQA 4GH2A 5FEDA 1LUFA 5IH6A 4ASZA 3HDNA 4JS8A 5C4KA 4BCFA 3NIEA 1IASA 2BFYA 2VTMA 3E87A 2BPMA 1NXKA 4DH7A 1YVJA 1SVGA 3AT4A 4EK4A 2GNHA 4P4CA 3VHEA 3FZOA 3ZO3A 3WILA 3GCVA 1FVTA 3IOKA 3PTGA 3QF9A 1G3NA 4DFYA 1PYEA 4OUCA 4ENYA 3Q9YA 2X6DA 4X2FA 1K9AA 2WB8A 5FD2A 5HESA 4EK5A 5IA2A 3E8EA 4XG9A 4LRKA 3H4JA 4MEDA 4QPSA 5FXQA 2VGPA 2A1AB 5J9ZA 5KMOA 3DJ6A 4IX5A 5FTQA 4EOOA 4HZSA 2W0JA 3PA4A 4O7WA 3FZTA 3R7EA 3RMFA 3ULIA 3M2WA 2Z8CA 4TYGA 4XOYA 5DVRA 2XK6A 3R30A 5HKMA 3PY0A 5ANJA 2UZTA 2WTDA 2XALA 4YTFA 3HVCA 3DK6A 5CTPA 2ERZE 4YC6A 4AAYA 2HK5A 3FQEA 3OBGA 3R83A 4M3QA 2UVXA 2QKRA 3MI9A 1PHKA 3Q6UA 4K18A 4PL5A 5EK7A 3R7UA 3BU6A 4QDEA 2PSQA 4BDEA 2B53A 2XIZA 1OIUA 4FKRA 3R28A 5CF5A 4FV0A 4PMPA 4FT5A 2XBJA 2ITVA 3LCDA 1H28A 3HV5A 3QGYA 4FTMA 3QYZA 4IB3A 4U42A 1P5EA 2X8DA 3UDBA 3PJCA 4OTHA 3LE6A 4QDVA 5ANGA 3D0EA 5CS6A 3QCXA 4R7IA 4FL1A 4OLIA 3ZRKA 2OKRA 3VS0A 5BQ0A 1BYGA 5FLFA 4L7SA 1OL7A 1NA7A 4QNAA 1O9UA 2FGIA 2VO0A 1XH9A 2J0LA 2OJGA 2QOFA 3MIAA 3DDPA 3MH3A 2GQRA 4FOCA 2Z02A 3RNIA 5EW3A 5BNJA 5I5ZA 3CS9A 2ZDTA 4YSMA 4O6EA 4KIOA 2OFUA 3MV5A 3EIDA 3ET7A
chains in the Genus database with same CATH topology
4MUQA 4YR8A 4B99A 2BRHA 3PJ1A 4B4LA 1W84A 2B9HA 3QQJA 4Y5QA 5BVWA 3DKFA 2GFSA 3VRZA 3QWKA 4NTTA 3OEZA 4N4SA 2BKZA 1OL2A 1CKJA 3HLLA 1UWJA 4AACA 3KREA 4FKSA 4BY9E 2XA4A 4BBMA 4ZTQA 3LJ0A 5AADA 3MH1A 4JQ8A 1SYKA 2PU8A 5ETCA 4F4PA 1OGUA 4RWIA 4HVHA 2VWWA 5M57A 3R8ZA 3LMGA 2F9GA 2CSNA 3LFFA 5IH5A 4J71A 3W0RA 2CGUA 2XAOA 3MJ2A 1YXTA 4FTTA 2BAKA 4HGTA 1U54A 2IZTA 2I0HA 3G2FA 3QD3A 4RRVA 4DE4A 4DINA 4EOQA 5B2MA 1JLUE 4LUDA 4OTWA 3GUBA 4ZXTA 1OB3A 3C0GA 3A8XA 3V5PA 3BBWA 5AP1A 3DXNA 4ID7A 4D4RA 3PXFA 2WEVA 2J5EA 1BX6A 2UUEA 1ZZLA 4FKTA 3DTWA 3LKMA 1CKIA 3L1SA 5DI1A 4E93A 3R9RA 3LXKA 4IB5A 4E20A 1KE6A 4I0TA 3FHRA 4EH6A 3EYGA 2OK1A 2BDFA 3A60A 4LGGA 5JZNA 3MFSA 2JBOA 3COIA 4BCGA 4EZ7A 4Y73A 3MYGA 3WE4A 4S2ZA 4GUEA 1B6CB 5CQUA 3PLSA 3S95A 4C38A 4YJSA 4R1VA 5BV3A 3QUPA 4Z7GA 1ST0A 1FPUA 4I94A 3CJGA 4X0MA 3HAVA 4X3FB 4NFNA 5AP6A 4BCKA 2E9PA 2I7QA 4BKJA 4DITA 4CMTA 3SRVB 3BIZA 1Q8ZA 4WKQA 2O64A 3QHWA 2ONLA 4ZTHA 5E7RA 4HVDA 4LMNA 4MNEA 2R3QA 4QQCA 5CQWA 5E8TA 4AT4A 1VYZA 2JIUA 4RC2A 5B2KA 4X2JA 1OKWA 2XIRA 3RAKA 2QHNA 2JDOA 2IVVA 4G3EA 1TVOA 3UG1A 3UP7A 3UG2A 4C4EA 3QBNA 5CU0A 2C0IA 3NAYA 2W1CA 4KA3A 5CU6A 3PSDA 5LJJA 2KULA 2QU5A 4ZZMA 1PKGA 1BI8A 2YEXA 4R7HA 4FIFA 2V5QA 3TV4A 4DN5A 1QCFA 4EHVA 4RIXB 3O8UA 4HCUA 4XP2A 2XAMA 4O81A 3DBFA 1OPKA 5J87A 5KKRB 3N4TA 4ONAA 2V22A 4UXQA 4QP7A 1Q8YA 4FICA 3QC4A 4Y5HA 5HIBA 5B2LA 1H0WA 4DC2A 3PUFC 3NRMA 3QTQA 4X6RA 3U9CA 2X9EA 5HCYA 4C0TA 3ACKA 3JS2A 3SOAA 4F64A 4FT7A 1K2PA 1YOJA 2OJFE 3PP0A 1YXUA 2E9UA 4PTCA 1KUTA 4CV9A 4FTQA 4M13A 4NU1A 4FK6A 3UO6A 3ZLYA 4YNEA 5J7HA 5HD4A 4RLKA 3OY1A 3PA5A 2R3RA 2YDJA 3GU8A 4IZYA 3ORXA 4CT1A 4BDJA 3AD6A 4KBCA 3NYNA 2YISA 4D1SA 3QTZA 3PFYA 4G3FA 3COMA 3G9LX 3GGFA 2IVSA 3KRWA 4K9YA 4MWHA 5HD7A 4G17A 3PY1A 3Q5IA 4OBPA 1QPEA 2WTKB 4EOPA 3L8XA 4CRSA 3MVMA 4A4LA 1BMKA 2WMVA 3RVGA 5AAGA 4ZLZA 1UV5A 3ZUUA 2UW4A 4W8DA 4OT6A 4X2NA 1JSVA 1U46A 2VTHA 4HPTE 4UWCA 5E8UA 1DI9A 2R3LA 2C6EA 2BUJA 3LFNA 4RJ5A 4ITHA 5CAVA 2IWIA 1OI9A 2IG7A 1RQQA 1YW2A 3OS3A 2WU6A 2WMQA 3NFGB 2C0TA 4HYHA 1MRYA 3RHXA 2F2CB 4LV8A 4RJ8A 4O82A 5IPJA 4P5QA 3CC6A 1Q8UA 3Q5ZA 4DFXE 3FLSA 3VHKA 4AE6A 2ITXA 2YM3A 4K33A 4CZUA 2GFCA 3NW6A 4U94A 4AP7A 4CFUA 1ST4A 4FTCA 4WZYA 2R4BA 3E8NA 3ZUTA 1KOAA 4XV1A 2C47A 4USFA 5F1ZA 2R7IA 3JVRA 2BIYA 3QTXA 5CZIA 4APCA 3EQDA 3LFBA 4U9AA 3V5WA 5CF4A 2BVAA 3DLZA 4CD0A 2O5KA 2G2IA 3KCKA 4X7QA 5BVNA 2UZUE 4EH3A 4TNBA 1QPDA 2G9XA 2XVDA 2GNJA 1H1QA 3EJ1A 3PXYA 4ZTNA 5L2SA 4UY9A 2XF0A 5IEYA 3HAMA 3MPMA 3L8VA 2VWVA 4L44A 4IMYA 4I3ZA 4G34A 4MBIA 4RT7A 5E1EA 5F20A 5EYKA 4C35A 4EH8A 4ZMFA 3KQ7A 5H8GA 4DFLA 2W5BA 4GIHA 2Y4IB 4FVQA 4CEGA 5BUEA 3FLWA 4HVSA 3OHTA 3QRJA 3OWKA 2I0VA 3R0TA 3P5JC 3UNZA 4AGWA 4YC8A 2G01A 3P78A 4QYFA 2ZDUA 4FYOA 4RG0A 5AAEA 4MD8E 3F61A 3F5UA 3NDMA 1OL6A 2OBJA 3BLRA 3RAIA 3FL4A 2FSMX 1WBNA 4UWYA 4Y95A 5DRDA 1NT2A 2ZJWA 3DDQA 4FTJA 3V5QA 2WO6A 2CCHA 2V7AA 1WVYA 5HX6A 5H8BA 2JDRA 2BZIB 4PDOA 2A0CX 1RJBA 5AUWA 4Q5HA 5C8KA 2YJSA 2PVLA 3AGLA 3NUPA 3O17A 2IW6A 2WMAA 4WG5A 4WRSA 3TZ9A 3C4CA 1XHAA 3W8QA 3WF6A 1OMWA 1U5QA 2YITA 4C4JA 5K4IA 4DT8A 3CKXA 3BRBA 3UVPA 2PMNX 3R2BA 2V7OA 4BDGA 3D5XA 4EOIA 3OROA 3OUKA 3ORIA 4WG4A 2WMRA 3K54A 5JH6A 4ZSJA 3SXRA 4A4XA 4J96A 4C3PA 3ORKA 5IA5A 4A9TA 2YWVA 2WMTA 3JPVA 4G1WA 2UZDA 4QRCA 4CTBA 3BI6A 5AP0A 2QOKA 2RG5A 3DK3A 4K0YA 5CI7A 3ZH8A 3QC9A 4BCMA 3BQRA 3IECA 4HPUE 5JK3A 3RI1A 4AZVA 5AA9A 3CTHA 4F65A 4FKOA 3QAME 1PXMA 1XMMA 3LM5A 5CZHA 3ZFXA 5M4IA 5C4LA 2O0UA 2B9FA 2CJMA 2R64A 1H1RA 5T68A 5CEOA 2HCKA 4MCVA 2LGCA 3CLYA 3FSKA 3ZZEA 2UW3A 3CEKA 4EOKA 2UW0A 4IHPA 2P0CA 3NFFB 5FQDC 1IAHA 2BRBA 4NSTA 5JFXA 2BRGA 4JT3A 3UPXA 1M52A 3MH0A 3R9OA 4C61A 3NYVA 4FV6A 3BGZA 4HYUA 2PL0A 2OF4A 2WMWA 4IVBA 3U6HA 1PMNA 2GQSA 4IVDA 1DI8A 3AQVA 4LOOA 3VQHA 3ML1A 3G5DA 4AU8A 2PVKA 3AMAA 1J7IA 2JBPA 1YRPA 5C8MA 4O7LA 2XKEA 4ZK5A 3OOMA 5AV3A 2XIXA 3DZQA 5I9YA 2WOTA 2OGVA 2XUUA 5BUIA 1J91A 1OITA 1VJYA 2OJJA 3KCFA 5EQPA 2Y6MA 3FV8A 5IG1A 3TACA 3U51A 3II5A 3S0OA 3HGKA 3P1AA 3E64A 4G2FA 4F99A 5AX3A 4EQCA 3POZA 2P2HA 2E9VA 2HXLA 3AMBA 3LMHA 5CU4A 4YP8A 2R3GA 3AC5A 3Q32A 3MVHA 5KBQA 5BYLA 2X4ZA 3QFVA 3E3PA 1PXKA 4FZ6A 4QT1A 4EEVA 4KRDA 4NM0A 5E8SA 4ZSLA 4JR7A 4M12A 4YJPA 1PXNA 2NRYA 2YCRA 2QVSE 4FGBA 4I6HA 4J99A 4WUNA 3WF5A 4AOJA 5J9YA 3DBEA 3QKLA 3V8WA 4F7SA 5EOLA 3W2PA 3F69A 3QHRA 4UXLA 4XS2A 3O8TA 5FUTA 3DLSA 5CASA 2ITNA 2C5YA 4LV7A 3WZJA 3DNDA 4GSBA 5L8LA 5J1WA 2YDIA 5E92A 4O0UA 2RG6A 3LCKA 2VWYA 1T46A 4FV4A 4RZVA 4CFVA 5EHLA 1XO2B 4YJVA 2WGJA 4DFBA 4PMSA 3DNEA 3PE2A 1Q8TA 3MY0A 3TT0A 4PDSA 2AC3A 3BHTA 2YERA 4FZAB 4EHZA 5KO1A 4GKHA 3KKVA 2QOLA 3R1YA 5JEBA 4O86A 3KF4A 3KXGA 4KBKA 3JY0A 2IZUA 4PRJA 4QMVA 1ZYCA 2EUFB 4TTHB 2A27A 2JAVA 5JRSA 3RCDA 4B8MA 4D9TA 4IX3A 3UP2A 1FINA 5FP6A 1LR4A 3FQSA 3SAYA 2AYPA 5LVNA 4GU9A 4NCTC 5L2IA 4CCUA 3DS6A 4P2KA 2W5HA 4JDHA 3LFSA 4QMZA 5AP3A 4N6YA 4F0IA 4ERWA 5IQCA 1W83A 2VO6A 2HIWA 3QA0A 3FMNA 4FG8A 3F3TA 3ZZWA 4X3JA 3RCJA 3LJ2A 2PE0A 4R1YA 1Q97A 2BILB 3UZTA 3NEWA 4CQEA 4Q9ZA 3CXWA 3VBQA 3QQKA 3GC8A 3R1SA 1S9IA 5FG8A 2SRCA 3LW0A 1XH6A 1H00A 2JIVA 1XBCA 4BDCA 2ETMA 4GK4A 1NVRA 2H6DA 2REIA 2ZV8A 2ETRA 2ZVAA 4EH2A 4L53A 3G6GA 4IVCA 2WTWA 3QZGA 3VW8A 3H30A 4U0IA 4HGSA 3ZU7A 5ETIA 1UA2A 3B2TA 4FSZA 4EUUA 3FUPA 4PP9A 3EQPA 5K5NA 4FUXA 3LPBA 2QO9A 1APME 2WQEA 3KMMA 3OW3A 3PJ3A 5EH0A 4FKGA 4X6QC 4AE9A 3VS7A 3PIYA 2W4JA 4O0VA 5CT7A 4KSPA 3FBVA 5IQBA 4FKPA 3KC3A 4YTIA 4E73A 3FE3A 3PP1A 4CSVA 5CAUA 3PLAE 4RLLA 3GQIA 3IW4A 3BX5A 4IQ6A 3FZ1A 3SQQA 4IW0A 2Q0NA 2XMYA 2YM6A 3O8PA 2P2IA 3GCUA 3FLZA 4L9IA 3GCPA 1XH4A 2C69A 4I0RA 4DA5A 2BRMA 5CVFA 2ZMDA 4HJOA 3C1XA 4FNWA 4I5PA 4OW8A 3AD5A 4BDKA 1H24A 2QG5A 2WQMA 2B0QA 4UBAA 4RFZA 5I4NA 3FZSA 3MY5A 4IX4A 3LCOA 2YCFA 3V5LA 3ZLWA 4M69B 3SG9A 3H9RA 4JX3A 3KK8A 3VC4A 4FNYA 4C02A 4UEUA 3CBLA 4MKCA 4ZMEA 2WTCA 3MH2A 1IAJA 3C9WA 3L9LA 3C0HA 3BYSA 4FG7A 4XG8A 2J0MB 2UW7A 4FV1A 1R78A 3R7YA 3VS5A 5A4CA 3P79A 3LFAA 1UNLA 3Q4TA 4QNYA 4V04A 5GHVA 4D2SA 5HE3A 3CSVA 3PFQA 5D10A 2XKDA 3QUEA 3BV2A 5IQHA 4I0SA 3VWAA 5I9WA 5LMKA 3ZBFA 3PXRA 3AC8A 4JBQA 3RP9A 3PJ2A 3LXPA 2C5NA 5AFVA 5KZ0A 3RNYA 3DBCA 1J7LA 3ZSIA 5F94A 3COHA 4MD9E 2Z2WA 1S9JA 2XJ1A 3OUNB 1R1WA 4YLKA 4IZ7A 4AZTA 1H1SA 5IUGA 4PDYA 3JY9A 3BU5A 5DH3A 3EFJA 2R0UA 3LLAA 1XMLA 1K3AA 5F9EA 3BWJA 3L9NA 2CLQA 5IA1A 3ANRA 1PMEA 2BCJA 2OJ9A 5FEQA 4O7PA 3C0IA 2HENA 4BDIA 3VUDA 3FKLA 4EC8A 2CNVA 2PZYA 3F7ZA 4D0WA 4ITJA 5LCJA 1YOMA 2CKOA 4NJ3A 3KRXA 5IA4A 5IQEA 5A4EA 3W0SA 4CT2A 2PE2A 4XG6A 5EDQA 2KTYA 4O6LA 4E5WA 3NCZA 5CAQA 5EM8A 5G1XA 3FXWA 3SW7A 3O0GA 4C62A 5LQFA 3MY1A 3I81A 3R02A 4WO5A 4GFOA 4H58A 4F6SA 3VUKA 4YHJA 3QLGA 5DA3A 5H2UA 3U4UA 2FH9A 4YZNA 5ACBC 5JGBA 3T3VA 2EU9A 4CTCA 2QLQA 2OIDA 2OZOA 4C2VA 1GIHA 4X2GA 4KB8A 5E91A 3W33A 4CXAA 3G33A 1Q8WA 4L6QA 4FUYA 4O0TA 5HO8A 4II5A 3P7AA 2R3JA 5ANEA 4AW0A 4Q9SA 5CVGA 3UOHA 3W32A 3ZTXA 1W7HA 4NM3A 3TWJA 3QQHA 4JJRA 2J6MA 4GU6A 4LL0A 4YLJA 4I92A 2AEGA 4O7OA 4A9UA 4U5JA 3GOPA 3NVKI 4IWPA 5KHWA 4LL5A 3DJ5A 4FIIA 2X6EA 4EHEA 1W98A 4M8TA 3UBDA 3P08A 2ZAZA 2XK9A 4BDAA 1GJOA 4EH9A 4BZDA 1Q41A 3PSCA 4EC9A 4O27B 3R8UA 3TV7A 5CAPA 4WG3A 4JG8A 2F49A 5AMNA 1W8CA 3BYUA 4FA2A 1OIYA 3B8QA 3SGCA 3UO5A 3UJGA 3R71A 4D5KA 4PF4A 3S2PA 3EZVA 3QTRA 4DHJA 4U81A 4ZY4A 2EB3A 4A9YA 4U80A 4D5HA 5IEXA 4WNPA 5JSMA 1QMZA 1HCLA 4BZOA 5FDXA 4Y83A 4AFJA 3OF0A 4IVAA 3HECA 2B52A 4MNFA 3BGQA 4RVTA 3ZBXA 1OECA 2ZM4A 3E7OA 2NPQA 4D1XA 3VW6A 4E4NA 3ID6C 3ZEWA 2C1BA 4RWLA 5KZIA 5L8JA 4ARKA 1ZZ2A 3TNHA 4CFMA 3WARA 2VV9A 2QI8A 3R8LA 3O7LD 3LAUA 5KNJA 4PNKA 4GUBA 3LHJA 1YI6A 4L3LA 3PJ8A 4IC7A 1YXSA 4G3DA 3ZSGA 4KS8A 4PV0A 4IM3A 3AC1A 1LEZA 4PX6A 4YZBA 3T8OA 2W06A 4QEBA 4KKGA 5BMMA 1BLXA 2UZNA 1BI7A 5FTGA 4C36A 3PWYA 1GZ8A 4N70A 3P4KA 4AQKA 4AW5A 1XR1A 4YC3A 2X2KA 2BDWA 3D14A 4QTBA 4GT5A 4OTRA 3PZEA 4FTAA 4UALA 4QMTA 3BLHA 5CU2A 2WQOA 3F88A 3IQ7A 1IA9A 3FMLA 4KIPA 5E4HA 5TKDA 4DEGA 4YJRA 1GY3A 2QHMA 1W0XC 2P33A 3AMYA 3FMDA 3GENA 4BIDA 4RZWA 4U98A 3FI4A 2XYNA 4V0GA 3FY2A 3PRFA 2RF9A 4WT6A 3UZRA 4AAAA 2HZ0A 5HNBA 4DDGA 3QD4A 2Y9QA 3IDPA 2EXCX 1AQ1A 3CTJA 3FC2A 1SNUA 5M53A 5T6KA 1O6LA 2ITZA 1UWHA 2WIHA 2QD9A 5EM7A 1Y57A 4ZP5A 4GIIA 4AG8A 2OG8A 1BL6A 5D7VA 3DBDA 3QQFA 2W1DA 1ZOGA 5HIDA 1U54B 4JBOA 3HKOA 5JN2A 2X4FA 2Y0AA 3BL9A 3FKOA 5H9BA 4BIEA 3HA8A 2B54A 2XJ2A 4IJ9A 3MPTA 3ORMA 3S00A 3RGFA 4BYIA 4HGEA 4I6BA 1KE7A 5ITAA 2XYUA 4TPTA 3ZO4A 2RFDA 4MF1A 5AUXA 4EZ3A 2A4LA 3FPQA 2OF2A 4AT3A 4MXZA 4OTDA 4JRVA 4ZAUA 5M08A 1YDTE 5CSHA 3C4WA 2W9FB 4I22A 3Q96A 4F09A 3BEAA 2QO7A 2Z60A 3I0OA 3OW4A 3WZUA 3ZHPC 5IUIA 4EOLA 3TKUA 1NVSA 3AKLA 4XJ0A 3ZRMA 2G1TA 3GU5A 4FL3A 4B7TA 1GZOA 2O2UA 4TL0A 3IOPA 4IM0A 2YAKA 2CN5A 1KE9A 4JDKA 2JGZA 2V55A 3QA8A 3EQIA 3ZXZA 3QUDA 5KMLA 5A14A 3MS9A 5AIRA 1ZOHA 3BELA 4MNEB 2R3NA 1SVEA 2DWBA 4RVKA 4ITIA 1U59A 5BVOA 4QMQA 3DCVA 4Z3VA 2VWUA 2X7OA 4KBAA 1SM2A 4KUJA 2GS6A 1PXLA 3EMGA 3LM0A 2BR1A 3DXPA 3BL7A 4A7CA 2OIBA 3G6HA 3QKKA 4LM5A 5L6PA 4PUZA 5LMKC 4YO4A 4XV9A 3IO7A 2C30A 4IC8A 2CGVA 2ZV7A 4CLIA 3EFLA 3R8MA 4DG2E 1MP8A 1ZARA 2YJRA 3DTCA 4Y72A 4O83A 4ANBA 3OWJA 1SVHA 4S31A 4B6LA 4F1TA 4AGDA 4EH4A 2OH0E 1UU7A 1OKZA 2W05A 4FEUA 4DGOA 3E93A 5J95A 2QR7A 4PWNA 1YWRA 1ZOEA 5CNNA 3VAPA 4AW1A 4E6QA 3VIDA 3WBLA 1YXVA 3OCGA 2H8HA 3AXWA 5CY3A 1TQMA 5IMEA 4ACHA 3R00A 3W2CA 4DH8A 4DCEA 3ZFMA 4IADA 1I09A 4EYMA 3TM0A 4O21A 4J53A 2XBAA 4ZIMA 1I44A 3C4EA 2OWBA 4QMMA 4RIYA 3RWPA 3VNTA 4E6AA 2EXMA 3A7IA 3FMHA 4DLJA 3TCPA 1R3CA 4CKIA 3K5UA 1XQZA 4XUFA 5EKOA 2LAVA 3C13A 5FM2A 3ZMMA 4YURA 2XH5A 3QLFA 1G8AA 2R3PA 5EHYA 3EL7A 3PPJA 4IANA 1GOLA 4BI2A 3GFEA 3SDJA 5HBJA 1E9HA 3Q9ZA 4QP4A 4RWKA 1RDQE 2RFNA 4I4EA 1UKHA 2QOBA 3QL8A 3KN6A 4AXAA 4B0GA 4Z55A 4QYHA 2VTJA 2WHBA 3MB6A 3OCBA 4U3YA 3JYAA 3FI2A 4JDJA 3O71A 4O0XA 1ND4A 2FSOX 2R7BA 4S33A 3SHEA 4EOMA 2VTLA 2VWZA 4RX9A 3KU2A 3L8SA 5KBRA 3R7OA 4NFMA 3NNWA 4W4VA 1A9UA 3HRFA 3TDVA 2VN9A 4QP6A 4F7JA 3HRCA 4P90A 4S32A 3QX2A 3R73A 4LI5A 3SOCA 5CU3A 3DJ7A 5IQIA 2JFMA 1Q3WA 2OZAA 2YCQA 3T3UA 1TFFA 4TT7A 5M06A 2JD5A 2JIIA 3OT8A 4AN2A 2HY0A 4BTJA 1URCA 3ODYX 2VZ6A 1H8FA 4JAJA 4I6LA 3RAHA 2ESMA 3Q04A 4MXCA 4U97A 4D55A 1JQHA 5H3QA 4ZTRA 4O7NA 3AKJA 3KULA 2WFYA 3HV7A 4GL9A 4L52A 2BTRA 3F3WA 2BZJA 2CNUA 4HZRA 3GB2A 3IKAA 4WHZA 4FV3A 2X9FA 4NCTA 3V3VA 3RM7A 4AWIA 5E90A 2QURA 2YDKA 1Y91A 2WEIA 3ETAA 2O65A 3I5ZA 2O8YA 3FWQA 1BUHA 3QCQA 5DIAA 3OEFX 4E8AA 1H26A 4AN3A 5IH4A 2J90A 1YHSA 3A2CA 2PPQA 4IAIA 4U3ZA 3OP5A 2Z7QA 3IW7A 2YAAA 3TV6A 4ERKA 1F5QA 5HLWA 4EORA 2Z7LA 3VBYA 4YUQA 2R3OA 2XRWA 3ATTA 4NM7A 4NK9A 1P14A 1ZYJA 2PZPA 4CVAA 1H1PA 4KRCA 4FSTA 4HCTA 2RIOA 5HO7A 2C6MA 4YZCA 3D2KA 1PW2A 3BGPA 3U9NA 2FSTX 3BYOA 5D9HA 3EKKA 3HMPA 2BTSA 4F1MA 3NNXA 5CSVA 4GW8A 5DNRA 2W7XA 3ZO2A 1JBPE 1XJDA 2XZSA 4ANMA 1Z5MA 4JG6A 5AAFA 5CSXA 1H27A 4XMOA 4QTCA 4D9UA 4HVGA 2VO3A 5HG8A 2OW3A 4FKLA 4KNBA 4D4SA 3I1AA 2ETKA 3PDTA 3D4QA 1OL5A 1OVEA 2P4IA 3HDMA 4KIQA 4EQUA 3WZDA 2IZSA 3SLSA 5E8XA 2WMBA 3FZRA 4QMSA 3MA6A 4TN6A 3DPKA 1PKDA 2IW8A 5DPVA 2E9NA 4JIKA 5C01A 1OKYA 5A4TA 1QL6A 4H1MA 4EKKA 4H3QA 4U79A 4XNEA 3I7CA 3ZM4A 1OBDA 2OI4X 2NYAA 5IDNA 3JVSA 4GJ3A 4TKSA 3WOWA 3FLNC 2YM5A 4ANQA 2IZRA 1JKLA 1Q62A 4U44A 2YIRA 1WVWA 1GZKA 4E5AX 2G15A 3D7ZA 3A4PA 4FV2A 4WIHA 5EM5A 4DCAA 5ANDA 2V0DA 3R7VA 4ZLOA 3EQHA 2VX3A 3MVJA 5A6NA 5JGAA 5BMSA 2WQNA 2ZFYA 3HEGA 3OCTA 3BLAA 4PMMA 4R78A 3MTLA 1RE8A 3VBWA 2C0OA 2XEYA 3MN3A 1Y6BA 5CI6A 3R9DA 5M4FA 1KV2A 2FVDA 2HZNA 1JKTA 3DAKA 4EYJA 4IAFA 4NYEA 5HG7A 2RFEA 3ZRLA 5HU9A 5AP2A 3F2AA 3Q9XA 2JDSA 2R3HA 1Z9XA 1FOTA 4AT5A 3V51A 4JVGA 3LCTA 1WZYA 5CENA 1ZMWA 3R01A 2WOUA 4ZS4A 1JOWB 3VBTA 3M42A 3W18A 4O2PA 1REJA 3WF8A 4A9SA 2OSCA 4J8NA 5IEVA 3NUUA 5D1JA 2PVMA 4NKSA 5JZJA 4M14A 4F9YA 4WSYA 3E63A 3UIXA 4X2KA 4LG4A 2Y4PA 1UNGA 4QQTA 3EN5A 4C2WA 4FT9A 1G8SA 2ITPA 1B39A 3QCYA 3V01A 1WVXA 5A54A 3F3UA 4F63A 3UMXA 4I20A 5EYDA 4AXFA 5AEPA 2FA2A 3G51A 3U4WA 4UZDA 3CIKA 2YA9A 5K5XA 2I0EA 1TQPA 2WELA 5EKNA 2C3KA 4BHNA 1JKKA 5B0XA 2E2BA 3PE1A 4BJJA 2HAKA 4ZSGA 5CEQA 3D9VA 2PVRA 3EKNA 4LYNA 5LARA 5AUTA 1FQ1B 3CGFA 4NL0A 4DGLC 3PXQA 5AWMA 4IJPA 4JXFA 1V1KA 4BBFA 4YPDA 2QOHA 4I6FA 4RSSA 5HX8A 3VUGA 2ERKA 2FSLX 5EOBA 4ASEA 4BZNA 1VR2A 3C5UA 4XG4A 3ULZA 2OICA 5D12A 2XM8A 2ITQA 5C26A 3R21A 4JX7A 3U6IA 4I6QA 3IK3A 4NJDA 2W1GA 3GU6A 2DYLA 1PMVA 4ZZNA 4FV5A 3LLTA 4TYHA 3HX4A 3MPAA 4MTAA 4P7EA 2X8IA 4M7IA 3CTQA 4FKUA 4L46A 2CCIA 2GS2A 3FY0A 3IW6A 2OJIA 2AUHA 2J9MA 3PXKA 4G5PA 2CKPA 3K5VA 5EG3A 2R3IA 3TI1A 2BKKA 3AD4A 3BPRA 3QYWA 4MBJA 1IEPA 3TKIA 3TTIA 4DEAA 5CEKA 3TUCA 3HV3A 3C5IA 1WCCA 4NWMA 1JVPP 5JQ8A 2J0JA 1SZMA 2NP8A 1J7UA 4RIWB 3NW5A 2PTKA 4YGAA 2UZOA 1V0BA 4L3JA 2YM8A 3UE4A 3D83A 3GQLA 4CGAA 3BU3A 3BHYA 3CD3A 2W4KA 2XNMA 3W0QA 3PG3A 1WBSA 4MXYA 2R3FA 3ZSHA 3SG8A 1CKPA 4CFXA 4G9RA 4I5CA 3POOA 5EQYA 4H3PA 1PF8A 4J98A 4AOIA 3NWWA 4ANLA 3DB8A 4BDHA 4YTCA 3K3IA 4QYEA 5TO8A 3PVWA 3NZ0A 2YIQA 4J1RA 5AM6A 2H34A 1JWHA 3NAXA 3GNIB 1XBAA 4GEOA 3W2QA 2YIXA 1KWPA 4FV9A 5ANKA 4H05A 5M56A 1UU9A 2B9IA 4BCHA 4IDVA 3UOKA 3ZXTA 2OU7A 1XH8A 2XCKA 5GJFA 3PIX<