4AXCA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase apo form
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
432
structure length
394
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLARVNAANVDTSHDSALILNDHSLCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 126
structure length 394
sequence length 432
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axcA01
4AXDA 4AXEA 3UDZA 4AQKA 2XARA 3UDTA 4AXCA 2XALA 2XANA 4LV7A 3UDSA 2XAOA 2XAMA 4AXFA
chains in the Genus database with same CATH superfamily
3U87A 4FKJA 4FZ6A 2YABA 4FIEA 5TT7A 4BBFA 4L7SA 4JLCA 4DAWA 3CSVA 1G8AA 1VYWA 2E9UA 2QQ7A 3K3IA 4ACHA 3NAXA 4DHJA 5J1WA 2BRGA 4N4SA 4TWPA 4FTOA 3NLBA 4JAIA 5HVYA 3VS4A 3QUEA 2F2CB 4DCAA 1IR3A 4ZY5A 2A19B 2IG7A 2YAAA 3BE9A 2VTHA 3F5UA 5HU9A 1Q3WA 3G6HA 1FVTA 5IA1A 4DFNA 1U54A 4UYAA 4TTHB 2VWWA 4G31A 3Q04A 4U8ZA 5HLWA 5TR6A 4R7HA 4MK0A 4QPAA 4USFA 3UO5A 4LRMA 3KULB 2YIXA 3S4QA 5HCZA 1R78A 3QTUA 1SVEA 4BI0A 4DFUA 4JQ7A 3EOCA 3ERKA 4QTAA 2JKMA 5CI6A 2VX3A 4EK4A 5JZJA 4PL3A 4DA5A 5AUZA 3QZGA 2UVZA 5E8TA 5I5ZA 1IEPA 3PVGA 5CU0A 4S34A 3F3TA 2W7XA 5I9YA 3RM6A 4EH9A 3QF9A 4BN1A 1LEWA 3CQEA 3PRIA 4AN3A 1AQ1A 2W05A 2GNIA 3H9RA 4QP2A 3DBFA 5CVFA 4AG8A 3COMA 1E1VA 3BX5A 5JFWA 1Q4LA 3LFNA 3KN5A 4E4LA 3LKMA 2X6DA 3RM7A 5JZNA 1V1KA 1H0VA 4JQEA 1WVYA 3TKIA 2VD5A 3NYNA 2VTIA 4C59A 1Z9XA 3PA3A 4RC2A 1WBSA 1SZMA 3F5XA 2ZM3A 3BHYA 4DT8A 5HD4A 4IHPA 5FXQA 4UX9A 3OOGA 3MESA 2WMBA 5IQBA 1OKWA 1CM8A 4YJPA 5CQWA 2QHNA 5F1ZA 5HD7A 5IA2A 5F95A 2F2UA 2ZM1A 2ZYBA 2B9HA 4OUCA 3CIKA 3AC3A 2R3MA 3QUPA 5H8GA 5JGAA 1M7QA 2ETMA 3WE4A 3UMWA 5BQ0A 1KE9A 4IFCA 2JAMA 4O84A 1FGKA 3W55A 5EW3A 2CGXA 3GC7A 1Z57A 4JDJA 4FA2A 2ITQA 2W17A 1RJBA 1AD5A 2PZIA 4QP8A 5L2SA 5CEIA 4X6QC 4AQKA 2JFLA 2ITPA 3HP2A 4RJ6A 2BPMA 3A4OX 5EW8A 5E8YA 3GU4A 2HYYA 4A4LA 4FTMA 4XV3A 1H4LA 1TQMA 3LAUA 3LVPA 3NYVA 4BYJA 2Y7JA 2J51A 4XNEA 3UQFA 1LUFA 3W0MA 5AUUA 3ROCA 4LMUA 3RCDA 3PLSA 3C4EA 3F7ZA 5AUWA 4GK4A 5BUJA 5B2MA 2BDFA 3NFFB 3LCOA 4N6ZA 3EN4A 4BJJA 2G2FA 1U5QA 4GJ2A 5IA3A 3R7EA 3QWKA 4X2KA 2YWPA 4DFYA 4DEDA 2PULA 3FYKX 2X8EA 4RG0A 3UC3A 3MBLA 5HE0A 5DA3A 5BYYA 2XKFA 3CJFA 4F64A 3R30A 4E26A 2B4SB 4IVDA 4FJVA 2QONA 3MVJA 2X2LA 3HV3A 3HRCA 4A4OA 4JIAA 5FXRA 4I6FA 1OPLA 5A9UA 2X9EA 2VTQA 2WIPA 2ZAZA 3KVWA 3DS6A 3M1SA 5JRSA 3QTRA 3OY3A 2Y4IC 1JBPE 5BVKA 4ANQA 4R5SA 5HLNA 1RE8A 3OROA 5E9EA 4NTTA 2YM6A 3QD0A 2XZSA 3ORLA 2BUJA 1IA8A 3MWUA 3NZ0A 3ROYA 4MX9A 4PMMA 3EQBA 4MBIA 4IWPA 4S30A 4YTHA 3KK9A 4RPVA 3R71A 4D1XA 4X0MA 3FKOA 2UV2A 3QC4A 4R6VA 4DYMA 5C1QB 3V5TA 3CQWA 4EK8A 1Q41A 4O96A 3QQJA 2IJMA 4GH2A 2W4KA 5A6NA 4GL9A 4QQCA 2JAVA 2X6EA 3DA6A 4G17A 5DGZA 4ZJJA 3S1HA 2DYLA 2JFMA 3HMPA 4ZSLA 3E8DA 4AACA 4GJ3A 3DPKA 3V8SA 5HHWA 4EC9A 2X2MA 2QNJA 2E9NA 4EUTA 3R8UA 2CLXA 3FAAA 3WZUA 3ZTXA 1REKA 4BDFA 4ONAA 3VJOA 1WVWA 3LOKA 2J7TA 3DFCB 4CZTA 2O5KA 3D0EA 3OW4A 5HVKA 4EQCA 1VJYA 2XEYA 4FSYA 2R3GA 3QQLA 5L2TA 2JDTA 4NZWB 1WCCA 3GI3A 3MIYA 3AOXA 3VUDA 4FV8A 1G3NA 3UIBA 4AZVA 3VVHA 3THBA 4FC0A 2XH5A 3KMWA 3F3UA 5JSMA 4HCTA 4W4XA 4JRNA 4V01A 2W5HA 4ZTLA 4MKCA 4YNEA 3UDSA 2QI8A 3JUHA 3LCDA 1CSNA 2ERZE 4GIHA 3W18A 2XK6A 2IVUA 5HE3A 5TF9A 4EHEA 4Y5QA 2V22A 2XAMA 2C6EA 4NW6A 5IMXA 2BAQA 3TACA 2WKMA 4FUXA 5KMOA 3OT8A 2Z8CA 2UUEA 5EHOA 4R78A 4E6DA 1V0BA 3UZTA 4FTNA 2VRXA 2F49A 5KE0A 3IOPA 3ODYX 4AT3A 4EH6A 4ACDA 3IGOA 4RLLA 1U59A 4JQ8A 4RJ7A 4TKSA 2CN8A 4YZCA 1NW1A 2QG7A 2A0CX 3I79A 4O27B 3ULZA 3MFSA 4USEA 3FZPA 1R0EA 4IM2A 2BFYA 4E4XA 4MD9E 5L8JA 4BVUA 4H58A 2W1GA 4AGWA 4Y8DA 4F08A 3BYMA 3CTQA 3AT3A 3I7BA 4G16A 4DEAA 2XJ0A 4IZYA 2QOKA 3N51A 5FP5A 4DH8A 4LUEA 2C3IB 4YJUA 2OI4X 4F6UA 3KRJA 4MNEA 5HIEA 3O96A 4YZMA 2I0VA 4N70A 2B55A 5E8ZA 3UQCA 3JR1A 4QYYA 4C61A 3IW6A 3H0ZA 4XMOA 2OJGA 5FXSA 1CKPA 2Y6MA 1JVPP 1KE5A 4PUZA 3R9NA 4QTEA 2JIVA 4ZZNA 1H1SA 2JDSA 5I4NA 4DFBA 5GNKA 2OGVA 2VTAA 3QXPA 3KL8A 3ZRKA 3MA3A 4IQ6A 3SG8A 4IWQA 3DDPA 1OL6A 4IZ7A 4UN0C 1YVJA 3OTUA 3UDBA 3JS2A 5LVNA 3DAEA 4ENYA 3ZDIA 4P7EA 3QQKA 3WBLA 4YJQA 4RVTA 4BIEA 4ZAUA 4D5HA 2JKOA 2PZYA 3GU5A 2PVNA 2J9MA 2WU6A 4M68A 5HBJA 4TNBA 3QD2B 5KHWA 3RKBA 3A99A 3A2CA 5ICPA 3QL8A 3LFDA 4QNYA 4YHFA 3RZBA 4O0XA 4EHZA 5CF5A 4ITJA 2PE1A 4OT6A 3BHHA 2Z7RA 4EH7A 3D9VA 3FLNC 2XNEA 4FT9A 5E91A 5IQGA 4LGGA 5FP6A 2JITA 4FBXA 1V0PA 4IM3A 1WMKA 5AA8A 3UGCA 4IWDA 4DBXA 3CPCA 4RWLA 3T8OA 3BHUA 3VHEA 4ARKA 3U9CA 3QTXA 4A7CA 2C6TA 2KULA 4I5PA 1Q99A 1Y57A 2GU8A 2YHVA 1T45A 3GC8A 4MVFA 3GU7A 3W2CA 3T9TA 4A4XA 4CLJA 3FMHA 5IH4A 2ITYA 3II5A 4ZJVA 3E92A 1XH5A 2GTMA 4NKSA 3Q53A 1Q62A 4KNBA 2XIRA 3GC9A 3FL5A 3QA8A 3MY0A 3OWJA 5EQPA 3NX8A 4AT4A 5AX9A 3MDYA 3FJQE 1WZYA 3O2MA 3H3CA 2XALA 2PZPA 4Q5HA 3LPBA 4C7TA 2OF2A 2BKKA 3HA6A 4UZHA 3CP9A 3HYHA 1JLUE 2VGOA 2WU7A 1MUOA 1PMUA 2B54A 4PP7A 5C9CA 4J96A 3A60A 1SMHA 1KE8A 2E9PA 2QO2A 2WTWA 4O0WA 3CEKA 4TYIA 5B2LA 3HNGA 4E5AX 1FMOE 3KF7A 4R3PA 3V5QA 3FV8A 3AKJA 3QTIA 4HVIA 3MY5A 3F2AA 3H30A 4G6OA 3VS5A 2RIOA 3HP5A 1JSVA 2ONLA 1JAMA 3QRIA 4WRGA 4FKPA 3OHTA 1BLXA 2X81A 3FZTA 1J3HA 3QU0A 4IJ9A 4QMWA 3ZO2A 3PIZA 3WYYA 4C02A 4JXFA 5J7HA 3UE4A 3R28A 4FZFB 2ZMDA 4CCBA 1PRYA 3Q4ZA 1Q3DA 3ZCLA 1ZMWA 3W2QA 5ACKA 4CSVA 1QPJA 3EQCA 5CENA 4PX6A 4W4WA 1JPAA 1XQZA 1Z5MA 2OJFE 4MXAA 5BMMA 5IUIA 3PYYA 4IVAA 1H8FA 1NVSA 3NIEA 4NUSA 2VO6A 5CAQA 3SRVA 3FC2A 5EHYA 3DNDA 3B8QA 4V0GA 3ZEWA 4DINA 4X6RA 3UODA 3P1AA 4MQ2A 4RFMA 4ZTQA 3D15A 3FHIA 3FKNA 4KBKA 5LVMA 4M97A 5LVOA 5C01A 3HV7A 4KKHA 5B0XA 3ZLXA 5HLPA 4EWQA 4FGRA 3OWKA 1KE6A 1LP4A 4XG7A 4U81A 3ORZA 1OI9A 1YHWA 3EN7A 5L3AA 1JKKA 2O63A 3OCSA 1VZOA 3PDTA 4PTCA 3R01A 2OW3A 1CMKE 1QPCA 2PSQA 3LJ2A 2NO3A 4EBWA 5CVGA 5I9WA 4X21A 3NNXA 1OL2A 2GS2A 3A8XA 4FKUA 3ALOA 2UW7A 4V05A 4YP8A 1F5QA 5CF8A 3FKLA 4FG9A 3RP9A 5C8NA 4TPTA 2UZWE 3PWYA 1ZY5A 2ACXA 2FO0A 3L1SA 3NUUA 3OMVA 4I41A 4JBOA 2XVDA 4ORKA 1ST4A 4YTFA 2J0KA 3EKKA 2NPQA 5ETAA 4O21A 2BIKB 4LV7A 4ZXTA 3IDBA 4IX4A 1SYKA 1F3MC 1B39A 5AV3A 5HTCA 3I7CA 2J5FA 3W32A 4C2VA 3S3IA 5JEBA 4F1TA 3T3UA 5HZNA 3R2BA 5CSXA 4IC7A 4DDIA 5DH3A 4W4YA 4I93A 4ALWA 5JN2A 4YO6A 4XLVA 5BNJA 3MYGA 2YCQA 3EYGA 4RJ3A 3ZLSA 2J5EA 3FLSA 3C5IA 3RCJA 4FV2A 4E20A 2RG5A 4QRCA 3VS2A 1YKRA 4O83A 1NVRA 1P5EA 3AC5A 4K8AA 3TT0A 2FB8A 5KMLA 2WOTA 4G6NA 3KEXA 5EOBA 2G1TA 2VWZA 3TWJA 1YXSA 4ACGA 3T3VA 3FSKA 5BV3A 5KHXA 3DZOA 3ZLWA 5M53A 1J1CA 4PL4A 4S31A 2GHMA 4GKHA 4TRLA 4XEYA 3COIA 4O2PA 3CS9A 4IB5A 2LAVA 2YFXA 3V8TA 2VWVA 3AMAA 4PMSA 1YOJA 3KB7A 2HW7A 5FQDC 2X0GA 3EQIA 3UOKA 2EXCX 2PE0A 2GTNA 4I21A 3NVKI 4F9BA 2VAGA 3PA5A 2QOIA 4BDJA 2OIBA 4WNOA 3EKNA 3ZEPA 4LG4A 2JKQA 3HA8A 2PZRA 3ZC6A 2AEGA 4XV1A 5HNBA 5JFXA 2C6LA 5CQUA 4QMVA 3EL8A 3QLGA 4GFMA 4JJRA 4LM5A 2HZNA 5CEOA 3SG9A 2ZM4A 2CLQA 4XUFA 2UZNA 3QA0A 3GU8A 4YJNA 2WPAA 3EHAA 2R3IA 2WO6A 4D28A 3ZXZA 3BLAA 3RPRA 1REJA 5CWZA 3R63A 3MVHA 4II5A 3O71A 4O7WA 5IU2A 5EK7A 2WB8A 4XCUA 4AP7A 5D9HA 3TTJA 1FOTA 2C6IA 4DH1A 4FIIA 5FG8A 3VBTA 3VQHA 2EB2A 3NUXA 2WHBA 4KD1A 3EN6A 4RJ4A 4KIQA 2CNUA 4B99A 2C68A 2JC6A 4R7BA 2BMCA 5AX3A 3TMOA 5A46A 1R3CA 4WG4A 2C3KA 4BCGA 1T46A 3R8PA 2UZLA 1YWVA 1MRUA 3LMGA 3ORNA 4Y5HA 3BWJA 2XMYA 4AXCA 4ZTNA 4D9TA 5KKRC 4M8TA 2C69A 5AP3A 3OWLA 1H1PA 3DLZA 2BKZA 3ZO3A 4C0TA 4I20A 3ML1A 4RIXB 3MPTA 2R3FA 5ANKA 4YHTA 4DFXE 3IOKA 2VV9A 5KBQA 3E7VA 4DF3A 4H39A 3RNIA 3KVXA 4R3RA 4EONA 2PMLX 4LGHA 5EDQA 1PMNA 3KN6A 4C3RA 2CNVA 4G9CA 3UDTA 4F70A 1M52A 1ZLTA 1BUHA 2I0YA 1UNLA 2I0EA 4O7YA 3OXTA 2ZJWA 3BU6A 3IPHA 4WIHA 4XG4A 2B53A 4G34A 3IO7A 4AGCA 3ZFMA 3BWFA 5LQFA 4Y85A 5HCXA 2EWAA 4TYHB 1YQJA 3U54A 3A4PA 2BZJA 3UG1A 1W98A 4GVJA 4I23A 3KXHA 3C4CA 4BZDA 4MXCA 4FKOA 1OMWA 3L9MA 5CNOA 4EJNA 2HZIA 4B4LA 3D7ZA 3OF0A 1P2AA 4RWKA 4YBJA 5FDXA 4QMYA 3VQUA 4CZUA 3MV5A 4J95A 4EQUA 5IMEA 1ZARA 4NFMA 4DCEA 3ET7A 1BYGA 5AP2A 1YXTA 3NYOA 3SD0A 2PY3A 3QRTA 2GNJA 2ITWA 3MIAA 2CKPA 4OTQA 3FLQA 4DG3E 4Z3VA 3R7IA 4QQJA 3R8VA 3R9OA 4A9TA 3BKBA 4RVLA 1B6CB 1ST0A 4M69B 1YI3A 5CNNA 4BDAA 4V04A 3OXZA 2HCKA 1PJKA 3DTCA 3NW7A 4FTLA 4ZOGA 4C4GA 3V8WA 5LCJA 3K2LA 4AXEA 4F7JA 3RWQA 2Y4PA 4YJSA 5KO1A 5K3YA 3G33A 3I6WA 3H9OA 5CY3A 1OGUA 1S9IA 4E73A 4MEDA 2O2UA 4I3ZA 4I4FA 2PPQA 5HO7A 1W83A 1AGWA 1A48A 3U4WA 3V6RA 2GNGA 1K2PA 2YCSA 3V5WA 4TN6A 4FYOA 4GCJA 4V0GB 5EHLA 3TJCA 1PXJA 3C4ZA 3EFLA 3QKLA 4L8MA 3O8UA 2QKRA 4QO9A 3AKKA 2V0DA 1UKHA 4KKGA 4RJ5A 4HGEA 2XNPA 4BICA 3QKMA 4L7FA 4QP1A 4YLKA 3BHTA 4X3JA 3HVCA 1U4DA 4PTEA 3CKXA 4KSPA 3TZ8A 3BGQA 4OBOA 1A9UA 4DG2E 5B2KA 3MPAA 2WTDA 3LXKA 2QO7A 5FEEA 1FBNA 4ZSAA 1Q97A 3PSBA 3NUSA 2XS0A 2V5QA 4MQ1A 5IQCA 2ZVAA 3BCEA 3UNZA 4FIFA 4FNXA 3VONA 4BTFA 4G5JA 4MWHA 3OCBA 3H4JA 4FZDB 3LFQA 2VX0A 3AT4A 3KXNA 3PG3A 1Q8WA 2OFVA 3GQLA 4EOJA 2JDVA 3NUAA 3PUPA 2CJMA 4CCUA 4JBVA 3GQIA 1ZZLA 4IMYA 2BRNA 5I9UA 4H1JA 4X3FC 2VO7A 4CLIA 4EOPA 3BYVA 2WMWA 3I6UA 4FYNA 1ZZ2A 3AMYA 2WTCA 3O8PA 4QMQA 4TWCA 2WXVA 2G2HA 3FZ1A 2R3LA 2JD5A 4FV5A 4FEUA 1PKDA 3QCQA 1KE7A 2W0JA 5E1SA 4J71A 1ZYDA 4IW0A 5H9BA 3SOCA 4GK2A 3QWJA 4I5MA 4F1MA 5L8KA 2UZTA 4CRLA 4G2FA 1JWHA 3TJDA 2G9XA 4LOPA 4Q2AA 5DR2A 3BL7A 3RTPA 4ERWA 1PXPA 3PE2A 5LMKA 2WZJA 1O6KA 5CF6A 2H9VA 3LCTA 4O0SA 3AC1A 2ETKA 5AAGA 2Q0NA 4MTAA 4EL9A 2X2KA 4XG8A 4UXQA 1XR1A 3BL9A 3IECA 3UZPA 1XH4A 3K5UA 2OFUA 3TUBA 1EH4A 5F94A 4I5HA 3FMMA 3VS3A 4BBEA 2OKRA 4M0ZA 1Q8TA 3NYXA 4UZDA 5T3QA 3TZMA 5A54A 3F88A 3RAIA 3ZONA 4D4YA 3FHRA 4O38A 2OICA 1MP8A 5J9LA 2C0IA 3W16A 4FKIA 2VTMA 5IH6A 5J1VA 1PXIA 3D5XA 5K9IA 5FEQA 5HG5A 5D10A 2QU5A 4MHAA 4WRSA 3DB8A 1J7LA 4I0RA 4U79A 4PY1A 3EL7A 3BEGA 3ENMA 4I1ZA 1IG1A 4GT4A 3W10A 2ZDUA 4ZZMA 2FGIA 4GG7A 5D7AA 4BB4A 1ZAOA 3PJ3A 3TG1A 4F6WA 4FKSA 2ZV8A 3QYZA 2UVXA 4M7IA 2X7FA 5DR9A 3NSZA 1XBCA 4G3FA 1O6LA 2I0HA 4FVQA 4FT7A 4BCOA 2GQRA 2XCKA 3QQHA 4HVHA 2R3PA 2YA9A 3QHRA 1BKXA 2IZTA 3PA4A 3I0QA 2F7ZE 3NCZA 3IQ7A 2QG5A 4IE9A 1PYXA 4U41A 4L44A 3B8RA 2UW5A 4AFJA 3VF9A 4BDCA 3ELJA 4PP9A 3VS6A 4NT4A 4FTAA 4JT3A 1NY3A 3BHVA 3ORTA 2O65A 5EW9A 3E3BX 4HGLA 4I6LA 4QMPA 3PWDA 4PQNA 1KUTA 2CGVA 2R3RA 2ZB0A 1WFCA 1QCFA 3ZSGA 4AS0A 1UNHA 5CANA 4QP7A 4CGAA 1Y6BA 4FTUA 2F9GA 4NU1A 4LYNA 5KMKA 2HENA 3CD3A 3DKCA 2QD9A 2VWXA 4FODA 3QQUA 3VS7A 3W0QA 2HZ4A 3ENHA 3FMJA 1YXXA 3GOKA 3TKUA 4A9YA 4QMLA 3AT2A 4YNOA 5AP7A 2PVKA 2C3JA 1QL6A 5AV2A 1ZMUA 3MB6A 4AA5A 3MH2A 3DGKA 4O81A 2C6DA 5BVNA 5M4CA 4G3GA 4KKEA 5HCYA 2UZDA 3WIGA 3BIZA 3LM5A 4O0YA 2OJ9A 1M2RA 4CG8A 4BCPA 3R2YA 2BALA 4U40A 1UA2A 5CSHA 4PDYA 2J0JA 3LMIA 4KBCA 2W1DA 4FSNA 3E88A 2ZV9A 3F82A 5BMSA 1SNUA 3ZOSA 4BC6A 2BILB 2REIA 5AAFA 4LOOA 4RQKA 5H3QA 4CMTA 4FTKA 4IEBA 4QQ5A 3U6IA 3AC4A 1ZWSA 2ITNA 3O23A 3D94A 4BGGA 4TZRA 4RRVA 4WUNA 5DEYA 3R21A 3UVQA 3ZS5A 2VWYA 3VULA 4A9RA 4AW0A 2UW4A 4F0IA 4K1BA 2P3GX 3ORMA 4JG6A 5H8BA 2IW9A 2VTSA 2ITZA 3VAPA 2RFNA 3FLZA 3ZFYA 4AA4A 1O9UA 1WBWA 4NTSA 3KMUA 4J99A 4JDKA 4RC3A 3H10A 4EYMA 2YJSA 3C4WA 4YMJA 2BZHB 2CGWA 2W96B 3P5KA 2RGPA 1HCLA 2C6KA 4QYFA 3S0OA 4GS6A 4P2KA 2C5VA 1E1XA 2OJIA 3SXFA 4DEEA 3BV3A 4QNAA 4DGOA 3MSSA 2OXYA 4H1MA 4O6LA 5IQDA 3MS9A 3NIZA 3F2NA 3PSCA 1ND4A 3KIOC 5LARA 3VBVA 5M56A 3EB0A 3PUFC 2JBPA 5CLPA 2W1HA 5GHVA 4EK5A 5GINE 3PXKA 2W1CA 1G5SA 2VX1A 4FNYA 4CG9A 3Q6UA 3R04A 1YI6A 3MJ2A 5CF4A 4YZBA 2ONLC 4UXLA 4WG5A 3TZ7A 4EOSA 2DQ7X 4JS8A 4YC6A 3N4UA 4B7TA 2HOGA 3OBGA 2V7OA 4EHGA 3A7IA 4N0SA 4BDEA 1H26A 2YIRA 2O64A 3ANRA 1DI9A 3NCGA 4EH8A 3HEGA 4EOLA 5EI8A 5HVJA 3I5ZA 2BTSA 2FSOX 2P33A 3D5VA 3CKWA 3Q4UA 4YJRA 3ZZEA 1FPUA 3MTLA 4WHZA 4FGBA 5EM5A 2IZUA 2PUUA 1H27A 5CI7A 4Y72A 3TI1A 4Z55A 5B7VA 3P86A 3DXNA 4B8MA 3AMBA 3UP2A 3HECA 3BQCA 4OR5A 3ID6C 3ZM4A 1JSUA 4IVCA 2PZ5A 4FV6A 2P4IA 2OH4A 1W84A 3QTZA 4L00A 2BAJA 2J0IA 3DV3A 3JY0A 3LFBA 4M3QA 4D1SA 1RW8A 2E9OA 5IQFA 4EI4A 3CTJA 2DS1A 2J0MB 3OG7A 5G6VA 4FTJA 2XA4A 4JIKA 4U44A 5K4IA 3PPZA 4MD8E 4R1VA 3F3ZA 3ODZX 5I9VA 5EDPA 4CKJA 4UV0A 1NA7A 4HGSA 4YZ9A 2C5OA 3JVRA 2EVAA 4DFZE 3Q52A 2X9FA 4AA0A 4E6QA 2R7BA 2FH9A 3R8LA 4GFGA 5CT0A 5HU3A 2NRUA 4AAAA 1YW2A 2ITXA 3GVUA 3P23A 3P7CA 4RA4A 4TT7A 3MN3A 4K0YA 3V04A 5JFSA 2CHLA 3SVVA 3VS0A 5E8WA 2QHMA 3GCUA 3W1FA 2YM7A 3GFEA 1LPUA 4JL9A 3SLSA 3ZM9A 5HIBA 4FKVA 4DTAA 4BDDA 3DLSA 4HVGA 2GS7A 4WNMA 4I92A 3QTWA 1H1WA 4D2SA 3IDPA 1Q61A 3RJCA 5J8IA 3WZJA 2CKEA 5I9XA 4FV3A 1XO2B 2UW8A 4CFFA 2VNWA 3I5NA 4S33A 4EJ7A 1Q24A 2G15A 1LEZA 4JNWA 4ZSJA 5HEZA 2PWLA 4BCJA 5L6WL 5CU6A 5A4EA 5A6OA 4XLIA 4EBVA 5HNIX 2C4GA 4GVAA 3KKVA 4ZEGA 5JMSA 4FSMA 4NYEA 3BYOA 4M14A 4XH6A 4BCIA 1J1BA 2YM5A 4FSRA 4YGAA 4NCTC 3RWPA 1FQ1B 4QDEA 3UVPA 3ETAA 1VEBA 3IW7A 4OTGA 4XOZA 4EYJA 5L2WA 3L8SA 2YIQA 2H34A 4RIYA 4FEQA 3NWWA 3DK3A 5FTGA 2QLQA 3NRMA 2HW6A 3PPJA 4MCVA 3DBQA 5E8VA 4ERKA 1ZY4A 5A14A 4FL3A 2W1FA 4IANA 1STCE 3PIYA 3QLFA 4IX3A 2YWVA 3PXFA 2GDOA 3PJCA 2BDJA 4FV0A 2ZFYA 4GT3A 4O0UA 5IA5A 4AWIA 2UZBA 5CTPA 4IB3A 2GNLA 5EG3A 2CGUA 4J97A 2O3PA 5EM7A 5CXZA 1UNGA 4LMNA 4IM0A 5DWRA 2QODA 5M08A 5LWMA 1TVOA 4U3ZA 2B52A 2WIHA 4MH7A 4WT6A 1YXVA 3F69A 4XP0A 4PDOA 3PZHA 4RZWA 4EH4A 5IPJA 5DLSA 3L8XA 3FBVA 5CEMA 4J7BA 1OIUA 4RIXA 3RPYA 5F9EA 3NW5A 5C8MA 5HORA 3KCFA 2W06A 3BBWA 5AUTA 2XUUA 5AM7A 2WTKB 5KNJA 3LFFA 4G6LA 2XNMA 4FICA 1M2QA 3E3PA 2IW6A 1YWRA 2XCHA 4HYSA 4ZK5A 5A4TA 3FDNA 4MYGA 2BZIB 3C0GA 4YURA 4F9WA 2H6DA 4JI9A 1VLRA 1M2PA 3D4QA 2XNNA 4JOAA 3DAJA 3AQVA 2B7AA 4R77A 5FEDA 5HBHA 4BCNA 2WGJA 3SA0A 4G3DA 3DKOA 4L42A 4TYHA 2CSNA 2R9SA 4AXFA 3W0RA 4YSJA 2JIIA 2UZUE 4BCQA 1E9HA 4CRSA 5CEPA 2RFDA 3SGCA 4FZAB 4ITHA 3VUHA 3O5AA 5AADA 5GIOE 4FL2A 3TZ9A 3VHKA 1WBOA 3F5GA 3V51A 3P5JC 3SXRA 1WBVA 3KA0A 2ZV7A 3PSDA 3TNHA 3QZHA 1SNXA 4O82A 1XJDA 4H05A 4FSQA 2PYWA 1G8SA 4FV9A 5CT7A 3UBDA 3AD5A 2W1ZA 1FVRA 2WQOA 3RALA 4UWCA 4IZ5A 4PL5A 2BRMA 3PJ2A 3C4FA 3FZRA 4MD7E 3BYSA 3ZXTA 5BPYA 3WZDA 4JX7A 2CPKE 3DK6A 2R2PA 3BGZA 3AG9A 4MNFA 2GPHA 2EU9A 5HIDA 5LCKA 1YOMA 5IEXA 4I5CA 4YJVA 3RK7A 4ZJIA 2W4JA 3DJ5A 4C2WA 3HDNA 3HL7A 4QYGA 2VWIA 4TL0A 2W1EA 3FXWA 3MY1A 3Q9WA 4LDTA 3F7WA 4D9UA 4ZY4A 4L52A 5ITAA 1O6YA 3REPA 1Q5KA 3O7LD 4TWNA 4CQEA 5LXMA 1OB3A 2QOQA 4F0GA 4WSYA 2YISA 2W4OA 3JYAA 4LUDA 4RLKA 4XG6A 5LMAA 2XK9A 4GEOA 4EEVA 3O51A 2R7IA 4FOBA 4IX5A 1ZOHA 5LVLA 5HNGA 4AFEA 2VWUA 1B38A 2BDWA 2JIUA 2NRYA 3DY7A 3ZUUA 3A61A 5IA0A 3BELA 4L6QA 3I1AA 1GNGA 2XNBA 4AE6A 3W2PA 4CKRA 3FLWA 3LXPA 4O0VA 5ACBC 5FD2A 4UEUA 4C37A 1M14A 3P78A 4TYGA 5BVEA 3VBYA 3W2RA 4EH2A 3VF8A 3VWAA 2W9FB 3S95A 3LLAA 4U43A 5AJQA 5C4LA 3CC6A 5GIPE 1A06A 4GMYA 4EZ3A 4WUAA 2PE2A 4XBRA 3FI2A 3UIUA 4JR7A 4C38A 2VTTA 4NIFB 2GCDA 4GYIA 3UMXA 2PU8A 2HELA 4DH7A 1V0OA 4OTRA 4ZLOA 5IDPA 1OUKA 3G6GA 4J98A 3JVSA 2I6LA 3PP0A 1PXKA 3POZA 3A7GA 3TV6A 4FKLA 5ANGA 1W0XC 1YDTE 2GNHA 2OZOA 1BI8A 4KS8A 3QC9A 3AGLA 5CEKA 1H08A 4QP9A 5EM6A 1OECA 4FMQA 4OBQA 5IH5A 4MXZA 5KMIA 2RG6A 4YZNA 3LW0A 4C3FA 3EQHA 1OL1A 4WO5A 4HZSA 4F9YA 3ZRMA 2WEVA 3I4BA 4AZTA 3GU6A 4CT1A 4E1ZA 3DJ7A 3R02A 3FZSA 4GW8A 4RX7A 4ZS4A 5A4LA 2QO9A 3P9JA 1TFFA 4LV5A 4NWMA 2WMVA 1KOBA 4Y95A 5DFPA 2I1MA 3C51A 5FBOA 3ZDUA 5HE1A 4CFNA 1PXLA 2WEIA 4IAZA 3QYWA 3UOJA 2R3KA 3TM0A 2HWOA 2VU3A 4AXDA 2WFYA 5IQIA 5KMJA 4FG7A 4XV2A 1BMKA 2B1PA 3KU2A 4U80A 2C30A 2YM3A 3CJGA 4K18A 3UIXA 3C0IA 4CXAA 3SAYA 1UU7A 4FK6A 4GU9A 3QUDA 2XK8A 3NUYA 4CMUA 5HI2A 5TOZA 5LMKC 2A4LA 2GS6A 3BEAA 3OEZA 1UWJA 4AN9A 4AZWA 2YITA 3RNYA 4C34A 5AV0A 2C6OA 4MBJA 4DEHA 4RIYB 2VUWA 3UIMA 5AV4A 4HYIA 4FEXA 4PF4A 1QMZA 2GSFA 3D83A 2DWBA 5BVWA 1OL5A 3UZRA 4M84A 4DEIA 3EJ1A 4W8EA 4FVRA 3FUPA 3OFMA 2GQSA 3UO4A 4FT0A 4QYEA 1GZ8A 4EOOA 5EYCA 2X7GA 5HESA 5DHJA 4F09A 1XBAA 1TQPA 4WBOA 2HWPA 3ZRLA 5ETCA 4I6QA 3IS5A 4C62A 4AGUA 3CGOA 3GCQA 3W2SA 3FL4A 3HAMA 1CTPE 3WOWA 4DEBA 4GSBA 4YHJA 4AQCA 3QRUA 3OY1A 2V7AA 3IK3A 2QOCA 3IKAA 4IB0A 4XHKB 3HX4A 4FT5A 5ANIA 3Q9XA 3EN9A 1Y91A 4O7RA 4QYHA 5IA4A 3JPVA 4L68A 3R8ZA 4BTJA 1K9AA 5I9ZA 1J91A 2CNQA 4OLIA 5D7VA 3EH9A 1X8BA 2OZAA 4RT7A 5ETIA 4RMZA 5L2IA 2F7EE 4R7IA 3HV4A 4QT1A 2EXMA 5IDNA 4BHNA 4TWOA 1JOWB 3Q5IA 4H3PA 3FYJX 4EKLA 2VTNA 4C4HA 3E8CA 3LQ3A 5CU4A 3EFJA 2B9FA 3R7VA 4DT9A 2V55A 3U9NA 5HX8A 1JKLA 2PVFA 2H8HA 3QX2A 4FEWA 3D2KA 3VUGA 4BBMA 3AC8A 4AZFA 2XBJA 3PFYA 3DNEA 4HCVA 1SM2A 3CY2A 3DKGA 2GFSA 2Z7SA 3F2RA 2XBAA 4FSZA 4H3BA 5JFVA 1URWA 3AD4A 2XRWA 3KGAA 2B9IA 4D58A 4O7SA 5C8KA 2WQEA 3G0EA 4X2GA 1RQQA 2YDKA 3QQFA 4K11A 4TYJA 1JQHA 5C27A 2CCIA 3C13A 3D5UA 3OC1A 4DHZA 4I94A 3CLYA 3DKFA 4HPUE 1ZRZA 4ANSA 3L9LA 3R7YA 4N57A 3KF4A 4QMOA 3BPRA 4O86A 5FM2A 1ZYSA 2Y4IB 4FKGA 1JKTA 3Q6WA 4M13A 4ALUA 4O22A 4I0SA 3UDZA 4CD0A 2Y0AA 4HYHA 5E8UA 2UZVA 2FSTX 2YM8A 2YZAA 4EH5A 1J7UA 5D11A 2OF4A 3LMHA 3FE3A 2R3JA 4B9DA 2WMXA 4BDGA 3GEQA 3QCSA 2W5AA 4NJ3A 4ZS0A 4KIOA 3VC4A 4BKJA 1GY3A 1KSWA 4RSSA 3F61A 3HRBA 2GNFA 4FV4A 3KXGA 5J87A 3KFAA 4WKQA 4L3LA 3FMLA 4KRDA 3W2OA 4IAIA 4DHFA 3V01A 3PXZA 3Q2MA 4QP6A 3V6SA 1OL7A 4PV0A 3RAWA 1YDRE 2PVYA 4FNZA 3VNTA 5L6OA 4UWYA 2C3LA 3ZUVA 1PW2A 3U55A 1WBTA 3NVMB 4WA9A 4ZMEA 5M4UA 4GYGA 3I0OA 5EH0A 3NNVA 3SW7A 3FWQA 4QQTA 3KRWA 4K2RA 2R5TA 4C3PA 4IIRA 4QMNA 4JX3A 4MF1A 4QMTA 4CTCA 3G5DA 3FXXA 3DBCA 3A7FA 3VJNA 3P7AA 3TDVA 4MXYA 5ANOA 3HLLA 3C0HA 4ID7A 2IVSA 3D5WA 4KIPA 3E8EA 5KZ0A 2B0QA 3UG2A 3TUDA 4XG3A 5CALA 4QTBA 4ZIMA 3SV0A 4PTGA 5J9ZA 3HMIA 4WNPA 1QPEA 5E1EA 1OPJA 3DT1A 1LR4A 4Q5EA 3RHXA 2H96A 4RZVA 5AFVA 5AV1A 3CGFA 4FR4A 4ZTSA 4EWHA 5IEVA 3HV6A 2OLCA 3R1YA 3GENA 3W33A 5CAOA 2VO3A 4G3CA 2IVVA 3DK7A 4KINA 4UYNA 4X7QA 5E8XA 2FSMX 4AGDA 4GV1A 4W4VA 4F99A 3BI6A 3UPZA 2QC6A 3FPMA 3NAYA 4HVSA 4B6LA 3FLYA 2RKUA 4EOQA 2WMSA 2XM9A 1APME 4DITA 2XRUA 3RPVA 1OVEA 2C6MA 4YJOA 4OT5A 4O0TA 5DYJA 3ORPA 5IEYA 5M09A 2VTLA 4EKKA 3L9PA 1MQBA 4A06A 4BDHA 4U45A 3G2FA 4BI2A 4U6RA 2QKWB 3DU8A 3VUIA 3WIKA 4F1OA 4QMZA 2UW0A 1L8TA 3FY0A 2PUIA 3DZQA 2BR1A 2W99B 1Y6AA 3GP0A 4K77A 5FLFA 4FUYA 2RF9A 3HMNA 3L8PA 3RGFA 3C5UA 4AZEA 3C9WA 4IH8A 4TW9A 1H00A 4FKTA 3IONA 5M06A 4O7TA 3H0YA 4O7LA 1W82A 1FVVA 1Q8UA 4JVGA 3EWHA 1IAJA 4YU2A 3P7BA 1CKJA 2WNTA 4APPA 3ACJA 3R6XA 3DDQA 3QCXA 3QTSA 3FI8A 4LOQA 3NUNA 3PFQA 2P2IA 4L53A 4LFIA 5HE2A 3U6JA 2WMRA 2WQMA 3RVGA 3DXQA 5DE2A 1OBGA 3GCPA 4MAOA 5E92A 3CCNA 5M44A 2XIKA 4WD5A 5HG8A 5AWMA 2IN6A 2XARA 3LQ8A 4YZDA 1PKGA 2ITVA 4ASEA 3OTVA 3Q3BA 2ZOQA 1PYEA 3BE2A 2DUVA 2LGCA 3EQDA 3IDCA 1IAHA 3N4VA 5DT0A 3RAKA 1URCA 2CDZA 3MW1A 1U5RA 2GHGA 3OWPA 3QQGA 4ENXA 2VWBA 3FI4A 1OIQA 5A4QA 3RAHA 3TIZA 4D4SA 4BCHA 4QTCA 5M51A 3KRXA 3O7LB 2YIWA 5AP1A 3SW4A 1XMLA 4A07A 4WBBB 2E9VA 2UVYA 2OZAB 1KV2A 3LFSA 3ZYAA 3L9NA 3TV7A 2W9ZB 2WMTA 3AGMA 1Q8YA 5KCVA 3ATSA 1I44A 4DBNA 3AD6A 3VBWA 4FTTA 2CKQA 3QZIA 3AXWA 3BU3A 1G8JA 2J50A 3R1SA 3ZMMA 4GFOA 4C4EA 5CSVA 4DLIA 5K5NA 1TQIA 4M67A 2BHHA 3KCKA 4JAJA 1XWSA 4CT2A 3GCSA 3FI3A 3VUKA 4JMQA 1YXUA 4QOXA 4E6CA 2XF0A 3QZFA 4J52A 4XS2A 4BYIA 3AKLA 3PP1A 2BZKB 5CXHA 2Z7QA 4K6ZA 4DGNA 4E8AA 2A2AA 4Z9LA 3DJ6A 4RFYA 3UNKA 3I81A 1FINA 3G9LX 1BX6A 4ZLYA 1WBNA 3FY2A 2IWIA 2CKOA 3MPMA 4CKIA 4DHIB 5FUTA 4F0FA 4EOIA 3EQFA 4G3EA 1R0PA 3DBDA 3A7JA 4B0GA 1OM1A 1R1WA 3Q32A 3EYHA 3TNPC 5JRQA 4C58A 5C4KA 2VTJA 2R4BA 3MJ1A 3LZBA 1WVXA 2OO8X 3W0NA 5CZHA 3GXLA 4L01A 3V5JA 3QD3A 3TIYA 5GJDA 3ZSIA 3QKKA 4L45A 4G5PA 2J0LA 2W1IA 2YEXA 3GFWA 5IG1A 5K4JA 3D7TA 4CVAA 4LV8A 2IW8A 5H2UA 3VRZA 4A9SA 5EQYA 1GZNA 1YI4A 3MTFA 3IG7A 3TNWA 3EQPA 2OIDA 2YZLA 3Q9ZA 4IX6A 4MUQA 4TNDA 3R9DA 3PRFA 3HUCA 4BCFA 3R22A 2OH0E 4KBAA 4D0WA 2VTOA 3PZEA 4DDGA 4HPTE 1P4OA 4DTKA 3W8QA 4IC8A 4FE2A 3U4UA 1H25A 3QCYA 4GIIA 1XMMA 3EMGA 4EOMA 3MFRA 3C1XA 3UC4A 5DR6A 4AU8A 2FSLX 2G2IA 4RA5A 1MRVA 3N4TA 1M17A 3ZBXA 1MQ4A 1UVRA 2QOOA 4AOIA 5M57A 1NVQA 1ZYCA 4YSMA 2GQGA 3TL8A 2AYPA 3Q5ZA 4J8MA 4FV7A 1L3RE 2BRHA 3I60A 5CZIA 3DAKA 3RPOA 5E8SA 2FYSA 4KRCA 3VBQA 2SRCA 2WOUA 4C33A 2G01A 5JK3A 2ITTA 4L3PA 4DC2A 3OUKA 4FK3A 2GFCA 2HZ0A 3VW6A 1UKIA 4JG8A 2CMWA 4NKAA 5FTQA 4X2FA 5HBEA 4FNWA 3BRBA 1XH9A 4HOKA 4RIOA 3Q96A 4KS7A 4U9AA 5CU2A 3EFKA 2AC3A 3LM0A 4USDA 4ZLZA 3LIJA 4L3JA 5AP6A 2C47A 2PL0A 4K9YA 4R3CA 4WOVA 3ZSHA 3OZ6A 4DH5A 2YDIA 4XRLA 5DIAA 5TKDA 4O7NA 2QURA 3TTIA 3GC0A 1OKVA 2QR7A 2WELA 3POOA 4JBQA 1OPKA 4X3FA 4R5YA 4Y73A 4QMUA 2VNYA 4YTCA 1HOWA 3HKOA 2HXLA 5AA9A 1OKZA 1ZXEA 5F20A 2XK7A 3BV2A 2R0IA 5KX8A 4ZSGA 3HAVA 4FIGA 1SVHA 4Y46A 1XKKA 3IW4A 2XKDA 4AN2A 3Q4TA 4IAKA 2JLDA 2XKCA 4YPDA 2PUPA 2R64A 2J2IB 2YIYA 5L6PA 3A7HA 2P0CA 3ACKA 3U8WA 5C03A 3IW8A 3PXQA 2IO6A 1QPDA 4XG2A 4CMOA 4GT5A 4ZP5A 4ALVA 1DAYA 4DH3A 4FL1A 5JKGA 4YUQA 4BGHA 3O17A 3CQUA 1P4FA 1R39A 2EB3A 3WILA 4HJOA 5DN3A 4M12A 1MRYA 1BL7A 3VBXA 5JGBA 4AW5A 2W5BA 3OCTA 2JBOA 4R1YA 4FKQA 4GU6A 3W8LA 1GIJA 3FQSA 4P90A 5CYIA 5E4HA 5M4IA 2PVHA 3DOGA 2XNGA 3GCVA 3GGFA 3HGKA 3NR9A 3CBLA 2XM8A 4NSTA 2PVLA 2UZOA 1Q8ZA 4X2JA 3VN9A 4F7SA 5I0BA 5T6KA 4D1ZA 3ORIA 2JDRA 2GHLA 3LFCA 2QR8A 4XG9A 2X39A 4S32A 4FI1A 4YBKA 4BR3A 2VO0A 5KMMA 2J6MA 5IQEA 2XNOA 1W8CA 2XAOA 3CPBA 4TYEA 2C0OA 4NL0A 4FX3A 4ZY6A 2NP8A 3OEFX 2UW9A 5JT2A 3KRRA 1PXMA 5IF1A 1XHAA 4GUEA 5KKRB 3DFAA 1U54B 4YJTA 3G9NA 4ANBA 3Q4CA 5BVOA 1UV5A 3R1QA 3QGYA 4RX9A 4F7NA 5CSPA 1YHSA 2GMXA 3W0PA 1FGIA 1DM2A 3EZRA 4LL0A 4E5BA 1XH6A 2Q0BA 2WMAA 5AUVA 4BDKA 5J9YA 1Y8YA 1ATPE 4HVDA 3KY2A 4CFVA 2OBJA 2OIQA 4I4EA 1I09A 3LCKA 2WTVA 4O2ZA 4OBPA 3UPXA 4CV8A 4RBLA 3GBZA 3N9XA 5EFQA 2WTJA 5DBXA 2Y9QA 3G51A 2YN8A 4O7VA 4E6AA 1KOAA 5HG7A 3VIDA 2RL5A 4RIWA 4MXXA 5BUIA 4Z7HA 4KA3A 1BL6A 3HZTA 4IVBA 3R9HA 1UWHA 5HKMA 5AAEA 3VO3A 4P5ZA 3A8WA 4HCUA 5FRIA 3MI9A 3TUCA 4YPSA 2WD1A 2Z02A 4NK9A 2WMQA 3PE1A 4PRJA 3KQ7A 4QP4A 4QMSA 4FSTA 3ULIA 3ZFXA 3EZVA 1WAKA 5IZFA 2P2HA 3OD6X 3R73A 3R8MA 1CDKA 3MH1A 3E5AA 4AE9A 4AT5A 4DE4A 3EFWA 3G0FA 3BBTB 5K5XA 3V5PA 1DAWA 5BUEA 2ESMA 3COHA 4AW2A 3EN5A 2BROA 3BQRA 3CTHA 4EK3A 4F78A 3B2TA 3LJ0A 2YACA 3BYUA 2P55A 3ZO4A 5AIRA 4OTDA 4OGRA 3ZLYA 3LXNA 4O0RA 1PY5A 4QPSA 4U3YA 5AP5A 4ZTRA 5CEQA 3TV4A 3WZKA 4D4RA 2X7OA 3UQGA 2C5NA 2O8YA 3U6HA 3BU5A 3ZU7A 3H9FA 2F57A 3RHKA 4Z7GA 5KZIA 4CTBA 3QBNA 3D7TB 4YO4A 4DEGA 2BHEA 1OBDA 4O6EA 3QALE 5G1XA 4ASXA 3QXOA 5JQ8A 3CXWA 3RINA 2Z7LA 5LMBA 4Y83A 2R3NA 4I0TA 4IB1A 2VZ6A 2IVTA 2Y6OA 3UOHA 2XB7A 4FIJA 4O7ZA 2BVAA 3UJGA 4D0XA 4NFNA 3HUBA 3RPSA 3LFAA 4RWIA 2YCRA 5KBRA 1CKIA 3E62A 4GK3A 5T68A 2X1NA 5D12A 3ZHPC 4BGQA 5DPVA 2C1AA 4DFLA 2ZV2A 3F9NA 4PWNA 4JRVA 2XJ2A 3R7UA 2FUMA 4ANMA 2Z2WA 2HIWA 2XIZA 3FMNA 1GAGA 4QP3A 3FMKA 3V3VA 3VW8A 3WF6A 4BJJB 5AEPA 2X8IA 1P14A 1GIHA 2PVRA 3GUBA 3R0TA 5EKNA 4PMTA 5F4NA 3PY1A 1PMEA 3QFVA 4K33A 4I22A 2OU7A 2F7XE 2R3QA 1OZ1A 1ZYLA 3GB2A 3PJ8A 2R3OA 2FA2A 5DT4A 3D14A 5EKOA 3VRYA 3K5VA 1H24A 1F0QA 3LLTA 3TCPA 1ERKA 3FMEA 1OITA 4UB7A 2J90A 4IZAA 2YERA 4H36A 3ZO1A 3MVLA 4L46A 3WF5A 1G8KA 4KABA 4RWJA 4BZOA 4CFXA 3KXXA 5ETFA 2ETRA 4HYUA 4F7LA 4YLJA 4J8NA 5FGKA 3SDJA 4X2NA 4Q9ZA 2PHKA 2JKKA 2XK4A 5AIKA 3F6XA 3PXYA 5CX9A 2XANA 1YWNA 1ZOEA 3Q9YA 4X3FB 3WYXA 1H1QA 3SKCA 3IW5A 4M0YA 1H01A 3QRJA 2ITUA 2RFSA 2CCHA 2WAJA 4APCA 4UY9A 5BYLA 1UU8A 3KRLA 1GJOA 4G9RA 1IRKA 2BFXA 3G90X 3PVUA 2JEDA 4E5WA 4UWBA 3Q60A 5DEWA 3E8NA 4PMPA 4UBAA 5EI2A 4AX8A 5IUGA 2XP2A 4YLLA 4B8LA 3GOPA 1JKSA 3JY9A 4HGTA 2C5XA 3LHJA 3PVBA 4U97A 3E93A 4F63A 3O8TA 4P5QA 4XOYA 4YTIA 4QTDA 4F65A 3R9RA 2B9JA 4O91A 3TYKA 3OCGA 2NYAA 4BZNA 3BLRA 3K54A 1OKYA 4KAOA 4PDPA 4W8DA 4ANLA 5IQHA 2NNWB 3GT8A 4RX8A 3NNWA 2QOLA 3QGWA 4N6YA 3BLHA 4U7ZA 1W7HA 3LQ5A 4FV1A 4KB8A 5CU3A 5DOSA 3U51A 4XP3A 5EOLA 2IZRA 2HY0A 3V5LA 4CFWA 4E4NA 3CE3A 4P4CA 5ANDA 3SC1A 4XRJA 3G15A 3NDMA 4L9IA 4BCMA 2A1AB 4Z16A 2I7QA 2VN9A 4MWIA 4JBPA 5EDRA 2QOFA 1YHVA 3LXLA 4HNIA 4MXOA 4AZSA 4I6HA 4IWOA 4FEVA 4F6SA 1VR2A 3AC2A 4JDIA 1XBBA 5LWNA 2C0TA 3Q2JA 4FG8A 3MH0A 4FTCA 3HMOA 3PG1A 4FTQA 3NUPA 4IBMA 3W0OA 4E93A 2YCFA 5CVHA 2QVSE 4GRBA 5CAPA 2OSCA 1H07A 1H1RA 2QCSA 5CASA 4XYFA 3F66A 3FZOA 4TXCA 4NM3A 5DVRA 3S00A 2OK1A 5BVDA 1PHKA 4LL5A 3WZEA 4EHVA 2OXXA 4PNKA 4PDSA 3TEIA 3PPKA 4BRXA 3OS3A 3ZUTA 3OOMA 3QTQA 1ZOGA 3HV5A 2CN5A 4IADA 4RGJA 4KUJA 5AMNA 5HG9A 3UYSA 4D5KA 4DLJA 4EORA 4FSWA 1YDSE 2FVDA 4NCTA 5EM8A 3M11A 3TDWA 2X8DA 3ALNA 4MNEB 2YAKA 3UO6A 2OWBA 3HRFA 3DB6A 5HTBA 3SQQA 3BLQA 5AM6A 4Q9SA 1H0WA 4LRJA 3E63A 1PXOA 3ZZWA 5IUHA 1DS5A 2VTRA 5DG5A 2VGPA 3ATTA 5BX0A 2PVJA 4BDBA 4AOTA 4EZ7A 5L8LA 1IASA 4IDTA 2OG8A 4RVKA 4DGMA 3F5PA 4RIWB 2YM4A 3T9IA 2R0UA 4U5JA 4RVMA 4IAYA 2C5YA 2UW6A 3OBJA 2AUHA 1IA9A 3KREA 3QRKA 4JDHA 2Y8OA 3DBEA 3RMFA 3UVRA 3QX4A 4BTMA 5LVPA 3FQEA 3K3JA 4WNKA 4FKRA 5FM3A 4D4VA 1JNKA 1K3AA 3FSFA 4EK6A 4D55A 3KULA 2O0UA 4IAAA 4ZMFA 2WMUA 5CAVA 2KTYA 2OJJA 4IFGA 1GIIA 4I24A 4PNIA 3QHWA 2BIYA 5H8EA 5FBNC 3SHEA 3UP7A 3NMUF 4L67A 4F9CA 4C35A 1U46A 3PIXA 4YC3A 5DI1A 3DTWA 1WBPA 2A27A 4FZ7A 4S2ZA 3NW6A 5HGIA 3DQXA 5E7RA 2HY81 4LI5A 1M7NA 2IPXA 4EH3A 5KMNA 4ZTMA 4C4IA 4XBUA 5AP0A 5HQ0A 5D1JA 3R00A 3FXZA 1YOLA 3MFUA 4NJDA 5D41A 1GOLA 1HCKA 3P4KA 4M15A 3BZ3A 4BTKA 3IGGA 5EI6A 1FMKA 4ASZA 5A4CA 3ORXA 5DRBA 3NPCA 2PMIA 2XIXA 3LCSA 5JH6A 4C4FA 2OXDA 4EUUA 4DG0E 3LFEA 3PXRA 3QAME 4QMMA 3ZC5A 4XX9A 2PMNX 4IACA 4NM5A 3D2IA 4AOJA 3OUNB 2PMOX 2ITOA 4XJ0A 2JGZA 4ITIA 3EQGA 1NT2A 4OTFA 4HW7A 2HAKA 4E7WA 3O0GA 3E64A 3QD4A 2QU6A 3P08A 4U0IA 3LJ1A 4HNFA 4HZRA 5FTOA 3DQWA 4AAYA 4BDIA 4EOKA 3M2WA 3OXIA 5DT3A 2XEZA 2AC5A 4FKWA 3WARA 5ANEA 2X4FA 2BCJA 3SOAA 3COKA 4RC4A 4JG7A 2WTKC 4GG5A 4ZSEA 4CEGA 3PVWA 1PXNA 2IZSA 3KK8A 3LE6A 4CFUA 4E4MA 2YDJA 4DTBA 2PK9A 3VUMA 2F4JA 1GZOA 1S9JA 3A62A 3TXOA 2XK3A 5DNRA 3OP5A 4BCKA 3NFGB 3FPQA 3PJ1A 4WG3A 3F3WA 3C50A 3SXSA 4EZ5A 3KC3A 4ZTHA 4NH1A 4BY9E 2WTIA 3RK9A 1PMVA 4MBLA 2EUFB 5CSWA 3CY3A 3WF7A 4CFMA 3CD8A 4FT3A 5CAUA 2ZB1A 5J5SA 4XV9A 4QMXA 3PY0A 2Q83A 3C4XA 3P79A 2R3HA 1KV1A 2ERKA 4LQMA 1NXKA 3R7OA 3JXWA 4BF2A 4UALA 3RK5A 5LOHA 2HXQA 3MFTA 3W0SA 3MH3A 4FSUA 2XYNA 5AUXA 4CNHA 1UU9A 2J4ZA 4KSQA 1DI8A 3CR0A 1ZMVA 3ZH8A 4FIHA 3MA6A 1KWPA 3FQHA 4BHZA 2BTRA 1XH7A 1J7IA 4U42A 5HICA 3KMMA 2WQNA 4FVPA 4BIBA 3B2WA 5JGDA 2PVMA 3TKHA 4GKIA 2E2BA 3L8VA 3ZBFA 4H3QA 5ANJA 3C7QA 4OTHA 3OW3A 4QEBA 3SRVB 2V62A 2XIYA 3MVMA 4IAFA 1OUYA 2HK5A 1TKIA 3UYTA 4AW1A 3PLAE 4NM7A 1PF8A 3SX9A 4CV9A 3WI6A 4FOCA 1BI7A 4A9UA 4GUBA 5C26A 5J95A 4G1WA 2BAKA 2PUNA 1OIYA 4C36A 2X4ZA 3O50A 5HX6A 4BI1A 1XH8A 3GNIB 3KXMA 4OTIA 5M4FA 3NEWA 3TNIA 3KXZA 4YR8A 4IJPA 5FDPA 2I40A 3TNQB 4IDVA 4RJ8A 3BGPA 4RFZA 4ACCA 3HMMA 3E87A 3OT3A 4ACMA 2UW3A 1H28A 1ZYJA 2QLUA 2RFEA 3NNUA 3EQRA 5GJFA 4C4JA 4RX5A 3FEGA 5A3XA 5KUPA 3PTGA 5BYZA 5E90A 3UNJA 4EC8A 4FTRA 5AUYA 3MB7A 4I6BA 1YRPA 3R83A 3HDMA 5EYDA 5EYKA 5CS6A 2ZMCA 4L43A 4EQMA 1OIRA 4AXAA 1SVGA 1RDQE 1Y8GA 3MGYA 3OVVA 3UOLA 3NGAA 5IQAA 3RI1A 4J53A 2Z60A 3ITZA 2BRBA 3P0MA 5GJGA 4XP2A 4BIDA 2UZEA 3FMDA 5AP4A 4AF3A 3NS9A 3UTOA 2QOHA 4NW5A 3VS1A 5EQEA 4DGLC 4YC8A 3EIDA 4DGGA 4OW8A 3WF8A 2VTPA 4OTWA 4KWPA 2JDOA 4J1RA 2XYUA 4NM0A 4D2RA 2C1BA 3DXPA 3R1NA 3E7OA 4AUAA 3S2PA 4F9AA 5BVFA 3FC1X 5JQ5A 3PY3A 5M55A 3M42A 2PTKA 3DCVA 2WQBA 4TY1A 4LRKA 3WE8A 5LJJA 4FTIA 2YJRA 4JR3A 5M07A 1VYZA 4DN5A 4ZZOA 5DRDA 5TO8A 4ASDA 1OGYA 4F4PA 4RQVA 5IISA 2XJ1A 1UU3A 5HO8A 3F3VA 2ZDTA 1GZKA 3ANQA 3ORKA 4QDVA 3TN8A 3WF9A 1JSTA 2QOBA 5EYMA 2XKEA
chains in the Genus database with same CATH topology
3U87A 4FKJA 4FZ6A 2YABA 4FIEA 5TT7A 4BBFA 4L7SA 4JLCA 4DAWA 3CSVA 1G8AA 1VYWA 2E9UA 2QQ7A 3K3IA 4ACHA 3NAXA 4DHJA 5J1WA 2BRGA 4N4SA 4TWPA 4FTOA 3NLBA 4JAIA 5HVYA 3VS4A 3QUEA 2F2CB 4DCAA 1IR3A 4ZY5A 2A19B 2IG7A 2YAAA 3BE9A 2VTHA 3F5UA 5HU9A 1Q3WA 3G6HA 1FVTA 5IA1A 4DFNA 1U54A 4UYAA 4TTHB 2VWWA 4G31A 3Q04A 4U8ZA 5HLWA 5TR6A 4R7HA 4MK0A 4QPAA 4USFA 3UO5A 4LRMA 3KULB 2YIXA 3S4QA 5HCZA 1R78A 3QTUA 1SVEA 4BI0A 4DFUA 4JQ7A 3EOCA 3ERKA 4QTAA 2JKMA 5CI6A 2VX3A 4EK4A 5JZJA 4PL3A 4DA5A 5AUZA 3QZGA 2UVZA 5E8TA 5I5ZA 1IEPA 3PVGA 5CU0A 4S34A 3F3TA 2W7XA 5I9YA 3RM6A 4EH9A 3QF9A 4BN1A 1LEWA 3CQEA 3PRIA 4AN3A 1AQ1A 2W05A 2GNIA 3H9RA 4QP2A 3DBFA 5CVFA 4AG8A 3COMA 1E1VA 3BX5A 5JFWA 1Q4LA 3LFNA 3KN5A 4E4LA 3LKMA 2X6DA 3RM7A 5JZNA 1V1KA 1H0VA 4JQEA 1WVYA 3TKIA 2VD5A 3NYNA 2VTIA 4C59A 1Z9XA 3PA3A 4RC2A 1WBSA 1SZMA 3F5XA 2ZM3A 3BHYA 4DT8A 5HD4A 4IHPA 5FXQA 4UX9A 3OOGA 3MESA 2WMBA 5IQBA 1OKWA 1CM8A 4YJPA 5CQWA 2QHNA 5F1ZA 5HD7A 5IA2A 5F95A 2F2UA 2ZM1A 2ZYBA 2B9HA 4OUCA 3CIKA 3AC3A 2R3MA 3QUPA 5H8GA 5JGAA 1M7QA 2ETMA 3WE4A 3UMWA 5BQ0A 1KE9A 4IFCA 2JAMA 4O84A 1FGKA 3W55A 5EW3A 2CGXA 3GC7A 1Z57A 4JDJA 4FA2A 2ITQA 2W17A 1RJBA 1AD5A 2PZIA 4QP8A 5L2SA 5CEIA 4X6QC 4AQKA 2JFLA 2ITPA 3HP2A 4RJ6A 2BPMA 3A4OX 5EW8A 5E8YA 3GU4A 2HYYA 4A4LA 4FTMA 4XV3A 1H4LA 1TQMA 3LAUA 3LVPA 3NYVA 4BYJA 2Y7JA 2J51A 4XNEA 3UQFA 1LUFA 3W0MA 5AUUA 3ROCA 4LMUA 3RCDA 3PLSA 3C4EA 3F7ZA 5AUWA 4GK4A 5BUJA 5B2MA 2BDFA 3NFFB 3LCOA 4N6ZA 3EN4A 4BJJA 2G2FA 1U5QA 4GJ2A 5IA3A 3R7EA 3QWKA 4X2KA 2YWPA 4DFYA 4DEDA 2PULA 3FYKX 2X8EA 4RG0A 3UC3A 3MBLA 5HE0A 5DA3A 5BYYA 2XKFA 3CJFA 4F64A 3R30A 4E26A 2B4SB 4IVDA 4FJVA 2QONA 3MVJA 2X2LA 3HV3A 3HRCA 4A4OA 4JIAA 5FXRA 4I6FA 1OPLA 5A9UA 2X9EA 2VTQA 2WIPA 2ZAZA 3KVWA 3DS6A 3M1SA 5JRSA 3QTRA 3OY3A 2Y4IC 1JBPE 5BVKA 4ANQA 4R5SA 5HLNA 1RE8A 3OROA 5E9EA 4NTTA 2YM6A 3QD0A 2XZSA 3ORLA 2BUJA 1IA8A 3MWUA 3NZ0A 3ROYA 4MX9A 4PMMA 3EQBA 4MBIA 4IWPA 4S30A 4YTHA 3KK9A 4RPVA 3R71A 4D1XA 4X0MA 3FKOA 2UV2A 3QC4A 4R6VA 4DYMA 5C1QB 3V5TA 3CQWA 4EK8A 1Q41A 4O96A 3QQJA 2IJMA 4GH2A 2W4KA 5A6NA 4GL9A 4QQCA 2JAVA 2X6EA 3DA6A 4G17A 5DGZA 4ZJJA 3S1HA 2DYLA 2JFMA 3HMPA 4ZSLA 3E8DA 4AACA 4GJ3A 3DPKA 3V8SA 5HHWA 4EC9A 2X2MA 2QNJA 2E9NA 4EUTA 3R8UA 2CLXA 3FAAA 3WZUA 3ZTXA 1REKA 4BDFA 4ONAA 3VJOA 1WVWA 3LOKA 2J7TA 3DFCB 4CZTA 2O5KA 3D0EA 3OW4A 5HVKA 4EQCA 1VJYA 2XEYA 4FSYA 2R3GA 3QQLA 5L2TA 2JDTA 4NZWB 1WCCA 3GI3A 3MIYA 3AOXA 3VUDA 4FV8A 1G3NA 3UIBA 4AZVA 3VVHA 3THBA 4FC0A 2XH5A 3KMWA 3F3UA 5JSMA 4HCTA 4W4XA 4JRNA 4V01A 2W5HA 4ZTLA 4MKCA 4YNEA 3UDSA 2QI8A 3JUHA 3LCDA 1CSNA 2ERZE 4GIHA 3W18A 2XK6A 2IVUA 5HE3A 5TF9A 4EHEA 4Y5QA 2V22A 2XAMA 2C6EA 4NW6A 5IMXA 2BAQA 3TACA 2WKMA 4FUXA 5KMOA 3OT8A 2Z8CA 2UUEA 5EHOA 4R78A 4E6DA 1V0BA 3UZTA 4FTNA 2VRXA 2F49A 5KE0A 3IOPA 3ODYX 4AT3A 4EH6A 4ACDA 3IGOA 4RLLA 1U59A 4JQ8A 4RJ7A 4TKSA 2CN8A 4YZCA 1NW1A 2QG7A 2A0CX 3I79A 4O27B 3ULZA 3MFSA 4USEA 3FZPA 1R0EA 4IM2A 2BFYA 4E4XA 4MD9E 5L8JA 4BVUA 4H58A 2W1GA 4AGWA 4Y8DA 4F08A 3BYMA 3CTQA 3AT3A 3I7BA 4G16A 4DEAA 2XJ0A 4IZYA 2QOKA 3N51A 5FP5A 4DH8A 4LUEA 2C3IB 4YJUA 2OI4X 4F6UA 3KRJA 4MNEA 5HIEA 3O96A 4YZMA 2I0VA 4N70A 2B55A 5E8ZA 3UQCA 3JR1A 4QYYA 4C61A 3IW6A 3H0ZA 4XMOA 2OJGA 5FXSA 1CKPA 2Y6MA 1JVPP 1KE5A 4PUZA 3R9NA 4QTEA 2JIVA 4ZZNA 1H1SA 2JDSA 5I4NA 4DFBA 5GNKA 2OGVA 2VTAA 3QXPA 3KL8A 3ZRKA 3MA3A 4IQ6A 3SG8A 4IWQA 3DDPA 1OL6A 4IZ7A 4UN0C 1YVJA 3OTUA 3UDBA 3JS2A 5LVNA 3DAEA 4ENYA 3ZDIA 4P7EA 3QQKA 3WBLA 4YJQA 4RVTA 4BIEA 4ZAUA 4D5HA 2JKOA 2PZYA 3GU5A 2PVNA 2J9MA 2WU6A 4M68A 5HBJA 4TNBA 3QD2B 5KHWA 3RKBA 3A99A 3A2CA 5ICPA 3QL8A 3LFDA 4QNYA 4YHFA 3RZBA 4O0XA 4EHZA 5CF5A 4ITJA 2PE1A 4OT6A 3BHHA 2Z7RA 4EH7A 3D9VA 3FLNC 2XNEA 4FT9A 5E91A 5IQGA 4LGGA 5FP6A 2JITA 4FBXA 1V0PA 4IM3A 1WMKA 5AA8A 3UGCA 4IWDA 4DBXA 3CPCA 4RWLA 3T8OA 3BHUA 3VHEA 4ARKA 3U9CA 3QTXA 4A7CA 2C6TA 2KULA 4I5PA 1Q99A 1Y57A 2GU8A 2YHVA 1T45A 3GC8A 4MVFA 3GU7A 3W2CA 3T9TA 4A4XA 4CLJA 3FMHA 5IH4A 2ITYA 3II5A 4ZJVA 3E92A 1XH5A 2GTMA 4NKSA 3Q53A 1Q62A 4KNBA 2XIRA 3GC9A 3FL5A 3QA8A 3MY0A 3OWJA 5EQPA 3NX8A 4AT4A 5AX9A 3MDYA 3FJQE 1WZYA 3O2MA 3H3CA 2XALA 2PZPA 4Q5HA 3LPBA 4C7TA 2OF2A 2BKKA 3HA6A 4UZHA 3CP9A 3HYHA 1JLUE 2VGOA 2WU7A 1MUOA 1PMUA 2B54A 4PP7A 5C9CA 4J96A 3A60A 1SMHA 1KE8A 2E9PA 2QO2A 2WTWA 4O0WA 3CEKA 4TYIA 5B2LA 3HNGA 4E5AX 1FMOE 3KF7A 4R3PA 3V5QA 3FV8A 3AKJA 3QTIA 4HVIA 3MY5A 3F2AA 3H30A 4G6OA 3VS5A 2RIOA 3HP5A 1JSVA 2ONLA 1JAMA 3QRIA 4WRGA 4FKPA 3OHTA 1BLXA 2X81A 3FZTA 1J3HA 3QU0A 4IJ9A 4QMWA 3ZO2A 3PIZA 3WYYA 4C02A 4JXFA 5J7HA 3UE4A 3R28A 4FZFB 2ZMDA 4CCBA 1PRYA 3Q4ZA 1Q3DA 3ZCLA 1ZMWA 3W2QA 5ACKA 4CSVA 1QPJA 3EQCA 5CENA 4PX6A 4W4WA 1JPAA 1XQZA 1Z5MA 2OJFE 4MXAA 5BMMA 5IUIA 3PYYA 4IVAA 1H8FA 1NVSA 3NIEA 4NUSA 2VO6A 5CAQA 3SRVA 3FC2A 5EHYA 3DNDA 3B8QA 4V0GA 3ZEWA 4DINA 4X6RA 3UODA 3P1AA 4MQ2A 4RFMA 4ZTQA 3D15A 3FHIA 3FKNA 4KBKA 5LVMA 4M97A 5LVOA 5C01A 3HV7A 4KKHA 5B0XA 3ZLXA 5HLPA 4EWQA 4FGRA 3OWKA 1KE6A 1LP4A 4XG7A 4U81A 3ORZA 1OI9A 1YHWA 3EN7A 5L3AA 1JKKA 2O63A 3OCSA 1VZOA 3PDTA 4PTCA 3R01A 2OW3A 1CMKE 1QPCA 2PSQA 3LJ2A 2NO3A 4EBWA 5CVGA 5I9WA 4X21A 3NNXA 1OL2A 2GS2A 3A8XA 4FKUA 3ALOA 2UW7A 4V05A 4YP8A 1F5QA 5CF8A 3FKLA 4FG9A 3RP9A 5C8NA 4TPTA 2UZWE 3PWYA 1ZY5A 2ACXA 2FO0A 3L1SA 3NUUA 3OMVA 4I41A 4JBOA 2XVDA 4ORKA 1ST4A 4YTFA 2J0KA 3EKKA 2NPQA 5ETAA 4O21A 2BIKB 4LV7A 4ZXTA 3IDBA 4IX4A 1SYKA 1F3MC 1B39A 5AV3A 5HTCA 3I7CA 2J5FA 3W32A 4C2VA 3S3IA 5JEBA 4F1TA 3T3UA 5HZNA 3R2BA 5CSXA 4IC7A 4DDIA 5DH3A 4W4YA 4I93A 4ALWA 5JN2A 4YO6A 4XLVA 5BNJA 3MYGA 2YCQA 3EYGA 4RJ3A 3ZLSA 2J5EA 3FLSA 3C5IA 3RCJA 4FV2A 4E20A 2RG5A 4QRCA 3VS2A 1YKRA 4O83A 1NVRA 1P5EA 3AC5A 4K8AA 3TT0A 2FB8A 5KMLA 2WOTA 4G6NA 3KEXA 5EOBA 2G1TA 2VWZA 3TWJA 1YXSA 4ACGA 3T3VA 3FSKA 5BV3A 5KHXA 3DZOA 3ZLWA 5M53A 1J1CA 4PL4A 4S31A 2GHMA 4GKHA 4TRLA 4XEYA 3COIA 4O2PA 3CS9A 4IB5A 2LAVA 2YFXA 3V8TA 2VWVA 3AMAA 4PMSA 1YOJA 3KB7A 2HW7A 5FQDC 2X0GA 3EQIA 3UOKA 2EXCX 2PE0A 2GTNA 4I21A 3NVKI 4F9BA 2VAGA 3PA5A 2QOIA 4BDJA 2OIBA 4WNOA 3EKNA 3ZEPA 4LG4A 2JKQA 3HA8A 2PZRA 3ZC6A 2AEGA 4XV1A 5HNBA 5JFXA 2C6LA 5CQUA 4QMVA 3EL8A 3QLGA 4GFMA 4JJRA 4LM5A 2HZNA 5CEOA 3SG9A 2ZM4A 2CLQA 4XUFA 2UZNA 3QA0A 3GU8A 4YJNA 2WPAA 3EHAA 2R3IA 2WO6A 4D28A 3ZXZA 3BLAA 3RPRA 1REJA 5CWZA 3R63A 3MVHA 4II5A 3O71A 4O7WA 5IU2A 5EK7A 2WB8A 4XCUA 4AP7A 5D9HA 3TTJA 1FOTA 2C6IA 4DH1A 4FIIA 5FG8A 3VBTA 3VQHA 2EB2A 3NUXA 2WHBA 4KD1A 3EN6A 4RJ4A 4KIQA 2CNUA 4B99A 2C68A 2JC6A 4R7BA 2BMCA 5AX3A 3TMOA 5A46A 1R3CA 4WG4A 2C3KA 4BCGA 1T46A 3R8PA 2UZLA 1YWVA 1MRUA 3LMGA 3ORNA 4Y5HA 3BWJA 2XMYA 4AXCA 4ZTNA 4D9TA 5KKRC 4M8TA 2C69A 5AP3A 3OWLA 1H1PA 3DLZA 2BKZA 3ZO3A 4C0TA 4I20A 3ML1A 4RIXB 3MPTA 2R3FA 5ANKA 4YHTA 4DFXE 3IOKA 2VV9A 5KBQA 3E7VA 4DF3A 4H39A 3RNIA 3KVXA 4R3RA 4EONA 2PMLX 4LGHA 5EDQA 1PMNA 3KN6A 4C3RA 2CNVA 4G9CA 3UDTA 4F70A 1M52A 1ZLTA 1BUHA 2I0YA 1UNLA 2I0EA 4O7YA 3OXTA 2ZJWA 3BU6A 3IPHA 4WIHA 4XG4A 2B53A 4G34A 3IO7A 4AGCA 3ZFMA 3BWFA 5LQFA 4Y85A 5HCXA 2EWAA 4TYHB 1YQJA 3U54A 3A4PA 2BZJA 3UG1A 1W98A 4GVJA 4I23A 3KXHA 3C4CA 4BZDA 4MXCA 4FKOA 1OMWA 3L9MA 5CNOA 4EJNA 2HZIA 4B4LA 3D7ZA 3OF0A 1P2AA 4RWKA 4YBJA 5FDXA 4QMYA 3VQUA 4CZUA 3MV5A 4J95A 4EQUA 5IMEA 1ZARA 4NFMA 4DCEA 3ET7A 1BYGA 5AP2A 1YXTA 3NYOA 3SD0A 2PY3A 3QRTA 2GNJA 2ITWA 3MIAA 2CKPA 4OTQA 3FLQA 4DG3E 4Z3VA 3R7IA 4QQJA 3R8VA 3R9OA 4A9TA 3BKBA 4RVLA 1B6CB 1ST0A 4M69B 1YI3A 5CNNA 4BDAA 4V04A 3OXZA 2HCKA 1PJKA 3DTCA 3NW7A 4FTLA 4ZOGA 4C4GA 3V8WA 5LCJA 3K2LA 4AXEA 4F7JA 3RWQA 2Y4PA 4YJSA 5KO1A 5K3YA 3G33A 3I6WA 3H9OA 5CY3A 1OGUA 1S9IA 4E73A 4MEDA 2O2UA 4I3ZA 4I4FA 2PPQA 5HO7A 1W83A 1AGWA 1A48A 3U4WA 3V6RA 2GNGA 1K2PA 2YCSA 3V5WA 4TN6A 4FYOA 4GCJA 4V0GB 5EHLA 3TJCA 1PXJA 3C4ZA 3EFLA 3QKLA 4L8MA 3O8UA 2QKRA 4QO9A 3AKKA 2V0DA 1UKHA 4KKGA 4RJ5A 4HGEA 2XNPA 4BICA 3QKMA 4L7FA 4QP1A 4YLKA 3BHTA 4X3JA 3HVCA 1U4DA 4PTEA 3CKXA 4KSPA 3TZ8A 3BGQA 4OBOA 1A9UA 4DG2E 5B2KA 3MPAA 2WTDA 3LXKA 2QO7A 5FEEA 1FBNA 4ZSAA 1Q97A 3PSBA 3NUSA 2XS0A 2V5QA 4MQ1A 5IQCA 2ZVAA 3BCEA 3UNZA 4FIFA 4FNXA 3VONA 4BTFA 4G5JA 4MWHA 3OCBA 3H4JA 4FZDB 3LFQA 2VX0A 3AT4A 3KXNA 3PG3A 1Q8WA 2OFVA 3GQLA 4EOJA 2JDVA 3NUAA 3PUPA 2CJMA 4CCUA 4JBVA 3GQIA 1ZZLA 4IMYA 2BRNA 5I9UA 4H1JA 4X3FC 2VO7A 4CLIA 4EOPA 3BYVA 2WMWA 3I6UA 4FYNA 1ZZ2A 3AMYA 2WTCA 3O8PA 4QMQA 4TWCA 2WXVA 2G2HA 3FZ1A 2R3LA 2JD5A 4FV5A 4FEUA 1PKDA 3QCQA 1KE7A 2W0JA 5E1SA 4J71A 1ZYDA 4IW0A 5H9BA 3SOCA 4GK2A 3QWJA 4I5MA 4F1MA 5L8KA 2UZTA 4CRLA 4G2FA 1JWHA 3TJDA 2G9XA 4LOPA 4Q2AA 5DR2A 3BL7A 3RTPA 4ERWA 1PXPA 3PE2A 5LMKA 2WZJA 1O6KA 5CF6A 2H9VA 3LCTA 4O0SA 3AC1A 2ETKA 5AAGA 2Q0NA 4MTAA 4EL9A 2X2KA 4XG8A 4UXQA 1XR1A 3BL9A 3IECA 3UZPA 1XH4A 3K5UA 2OFUA 3TUBA 1EH4A 5F94A 4I5HA 3FMMA 3VS3A 4BBEA 2OKRA 4M0ZA 1Q8TA 3NYXA 4UZDA 5T3QA 3TZMA 5A54A 3F88A 3RAIA 3ZONA 4D4YA 3FHRA 4O38A 2OICA 1MP8A 5J9LA 2C0IA 3W16A 4FKIA 2VTMA 5IH6A 5J1VA 1PXIA 3D5XA 5K9IA 5FEQA 5HG5A 5D10A 2QU5A 4MHAA 4WRSA 3DB8A 1J7LA 4I0RA 4U79A 4PY1A 3EL7A 3BEGA 3ENMA 4I1ZA 1IG1A 4GT4A 3W10A 2ZDUA 4ZZMA 2FGIA 4GG7A 5D7AA 4BB4A 1ZAOA 3PJ3A 3TG1A 4F6WA 4FKSA 2ZV8A 3QYZA 2UVXA 4M7IA 2X7FA 5DR9A 3NSZA 1XBCA 4G3FA 1O6LA 2I0HA 4FVQA 4FT7A 4BCOA 2GQRA 2XCKA 3QQHA 4HVHA 2R3PA 2YA9A 3QHRA 1BKXA 2IZTA 3PA4A 3I0QA 2F7ZE 3NCZA 3IQ7A 2QG5A 4IE9A 1PYXA 4U41A 4L44A 3B8RA 2UW5A 4AFJA 3VF9A 4BDCA 3ELJA 4PP9A 3VS6A 4NT4A 4FTAA 4JT3A 1NY3A 3BHVA 3ORTA 2O65A 5EW9A 3E3BX 4HGLA 4I6LA 4QMPA 3PWDA 4PQNA 1KUTA 2CGVA 2R3RA 2ZB0A 1WFCA 1QCFA 3ZSGA 4AS0A 1UNHA 5CANA 4QP7A 4CGAA 1Y6BA 4FTUA 2F9GA 4NU1A 4LYNA 5KMKA 2HENA 3CD3A 3DKCA 2QD9A 2VWXA 4FODA 3QQUA 3VS7A 3W0QA 2HZ4A 3ENHA 3FMJA 1YXXA 3GOKA 3TKUA 4A9YA 4QMLA 3AT2A 4YNOA 5AP7A 2PVKA 2C3JA 1QL6A 5AV2A 1ZMUA 3MB6A 4AA5A 3MH2A 3DGKA 4O81A 2C6DA 5BVNA 5M4CA 4G3GA 4KKEA 5HCYA 2UZDA 3WIGA 3BIZA 3LM5A 4O0YA 2OJ9A 1M2RA 4CG8A 4BCPA 3R2YA 2BALA 4U40A 1UA2A 5CSHA 4PDYA 2J0JA 3LMIA 4KBCA 2W1DA 4FSNA 3E88A 2ZV9A 3F82A 5BMSA 1SNUA 3ZOSA 4BC6A 2BILB 2REIA 5AAFA 4LOOA 4RQKA 5H3QA 4CMTA 4FTKA 4IEBA 4QQ5A 3U6IA 3AC4A 1ZWSA 2ITNA 3O23A 3D94A 4BGGA 4TZRA 4RRVA 4WUNA 5DEYA 3R21A 3UVQA 3ZS5A 2VWYA 3VULA 4A9RA 4AW0A 2UW4A 4F0IA 4K1BA 2P3GX 3ORMA 4JG6A 5H8BA 2IW9A 2VTSA 2ITZA 3VAPA 2RFNA 3FLZA 3ZFYA 4AA4A 1O9UA 1WBWA 4NTSA 3KMUA 4J99A 4JDKA 4RC3A 3H10A 4EYMA 2YJSA 3C4WA 4YMJA 2BZHB 2CGWA 2W96B 3P5KA 2RGPA 1HCLA 2C6KA 4QYFA 3S0OA 4GS6A 4P2KA 2C5VA 1E1XA 2OJIA 3SXFA 4DEEA 3BV3A 4QNAA 4DGOA 3MSSA 2OXYA 4H1MA 4O6LA 5IQDA 3MS9A 3NIZA 3F2NA 3PSCA 1ND4A 3KIOC 5LARA 3VBVA 5M56A 3EB0A 3PUFC 2JBPA 5CLPA 2W1HA 5GHVA 4EK5A 5GINE 3PXKA 2W1CA 1G5SA 2VX1A 4FNYA 4CG9A 3Q6UA 3R04A 1YI6A 3MJ2A 5CF4A 4YZBA 2ONLC 4UXLA 4WG5A 3TZ7A 4EOSA 2DQ7X 4JS8A 4YC6A 3N4UA 4B7TA 2HOGA 3OBGA 2V7OA 4EHGA 3A7IA 4N0SA 4BDEA 1H26A 2YIRA 2O64A 3ANRA 1DI9A 3NCGA 4EH8A 3HEGA 4EOLA 5EI8A 5HVJA 3I5ZA 2BTSA 2FSOX 2P33A 3D5VA 3CKWA 3Q4UA 4YJRA 3ZZEA 1FPUA 3MTLA 4WHZA 4FGBA 5EM5A 2IZUA 2PUUA 1H27A 5CI7A 4Y72A 3TI1A 4Z55A 5B7VA 3P86A 3DXNA 4B8MA 3AMBA 3UP2A 3HECA 3BQCA 4OR5A 3ID6C 3ZM4A 1JSUA 4IVCA 2PZ5A 4FV6A 2P4IA 2OH4A 1W84A 3QTZA 4L00A 2BAJA 2J0IA 3DV3A 3JY0A 3LFBA 4M3QA 4D1SA 1RW8A 2E9OA 5IQFA 4EI4A 3CTJA 2DS1A 2J0MB 3OG7A 5G6VA 4FTJA 2XA4A 4JIKA 4U44A 5K4IA 3PPZA 4MD8E 4R1VA 3F3ZA 3ODZX 5I9VA 5EDPA 4CKJA 4UV0A 1NA7A 4HGSA 4YZ9A 2C5OA 3JVRA 2EVAA 4DFZE 3Q52A 2X9FA 4AA0A 4E6QA 2R7BA 2FH9A 3R8LA 4GFGA 5CT0A 5HU3A 2NRUA 4AAAA 1YW2A 2ITXA 3GVUA 3P23A 3P7CA 4RA4A 4TT7A 3MN3A 4K0YA 3V04A 5JFSA 2CHLA 3SVVA 3VS0A 5E8WA 2QHMA 3GCUA 3W1FA 2YM7A 3GFEA 1LPUA 4JL9A 3SLSA 3ZM9A 5HIBA 4FKVA 4DTAA 4BDDA 3DLSA 4HVGA 2GS7A 4WNMA 4I92A 3QTWA 1H1WA 4D2SA 3IDPA 1Q61A 3RJCA 5J8IA 3WZJA 2CKEA 5I9XA 4FV3A 1XO2B 2UW8A 4CFFA 2VNWA 3I5NA 4S33A 4EJ7A 1Q24A 2G15A 1LEZA 4JNWA 4ZSJA 5HEZA 2PWLA 4BCJA 5L6WL 5CU6A 5A4EA 5A6OA 4XLIA 4EBVA 5HNIX 2C4GA 4GVAA 3KKVA 4ZEGA 5JMSA 4FSMA 4NYEA 3BYOA 4M14A 4XH6A 4BCIA 1J1BA 2YM5A 4FSRA 4YGAA 4NCTC 3RWPA 1FQ1B 4QDEA 3UVPA 3ETAA 1VEBA 3IW7A 4OTGA 4XOZA 4EYJA 5L2WA 3L8SA 2YIQA 2H34A 4RIYA 4FEQA 3NWWA 3DK3A 5FTGA 2QLQA 3NRMA 2HW6A 3PPJA 4MCVA 3DBQA 5E8VA 4ERKA 1ZY4A 5A14A 4FL3A 2W1FA 4IANA 1STCE 3PIYA 3QLFA 4IX3A 2YWVA 3PXFA 2GDOA 3PJCA 2BDJA 4FV0A 2ZFYA 4GT3A 4O0UA 5IA5A 4AWIA 2UZBA 5CTPA 4IB3A 2GNLA 5EG3A 2CGUA 4J97A 2O3PA 5EM7A 5CXZA 1UNGA 4LMNA 4IM0A 5DWRA 2QODA 5M08A 5LWMA 1TVOA 4U3ZA 2B52A 2WIHA 4MH7A 4WT6A 1YXVA 3F69A 4XP0A 4PDOA 3PZHA 4RZWA 4EH4A 5IPJA 5DLSA 3L8XA 3FBVA 5CEMA 4J7BA 1OIUA 4RIXA 3RPYA 5F9EA 3NW5A 5C8MA 5HORA 3KCFA 2W06A 3BBWA 5AUTA 2XUUA 5AM7A 2WTKB 5KNJA 3LFFA 4G6LA 2XNMA 4FICA 1M2QA 3E3PA 2IW6A 1YWRA 2XCHA 4HYSA 4ZK5A 5A4TA 3FDNA 4MYGA 2BZIB 3C0GA 4YURA 4F9WA 2H6DA 4JI9A 1VLRA 1M2PA 3D4QA 2XNNA 4JOAA 3DAJA 3AQVA 2B7AA 4R77A 5FEDA 5HBHA 4BCNA 2WGJA 3SA0A 4G3DA 3DKOA 4L42A 4TYHA 2CSNA 2R9SA 4AXFA 3W0RA 4YSJA 2JIIA 2UZUE 4BCQA 1E9HA 4CRSA 5CEPA 2RFDA 3SGCA 4FZAB 4ITHA 3VUHA 3O5AA 5AADA 5GIOE 4FL2A 3TZ9A 3VHKA 1WBOA 3F5GA 3V51A 3P5JC 3SXRA 1WBVA 3KA0A 2ZV7A 3PSDA 3TNHA 3QZHA 1SNXA 4O82A 1XJDA 4H05A 4FSQA 2PYWA 1G8SA 4FV9A 5CT7A 3UBDA 3AD5A 2W1ZA 1FVRA 2WQOA 3RALA 4UWCA 4IZ5A 4PL5A 2BRMA 3PJ2A 3C4FA 3FZRA 4MD7E 3BYSA 3ZXTA 5BPYA 3WZDA 4JX7A 2CPKE 3DK6A 2R2PA 3BGZA 3AG9A 4MNFA 2GPHA 2EU9A 5HIDA 5LCKA 1YOMA 5IEXA 4I5CA 4YJVA 3RK7A 4ZJIA 2W4JA 3DJ5A 4C2WA 3HDNA 3HL7A 4QYGA 2VWIA 4TL0A 2W1EA 3FXWA 3MY1A 3Q9WA 4LDTA 3F7WA 4D9UA 4ZY4A 4L52A 5ITAA 1O6YA 3REPA 1Q5KA 3O7LD 4TWNA 4CQEA 5LXMA 1OB3A 2QOQA 4F0GA 4WSYA 2YISA 2W4OA 3JYAA 4LUDA 4RLKA 4XG6A 5LMAA 2XK9A 4GEOA 4EEVA 3O51A 2R7IA 4FOBA 4IX5A 1ZOHA 5LVLA 5HNGA 4AFEA 2VWUA 1B38A 2BDWA 2JIUA 2NRYA 3DY7A 3ZUUA 3A61A 5IA0A 3BELA 4L6QA 3I1AA 1GNGA 2XNBA 4AE6A 3W2PA 4CKRA 3FLWA 3LXPA 4O0VA 5ACBC 5FD2A 4UEUA 4C37A 1M14A 3P78A 4TYGA 5BVEA 3VBYA 3W2RA 4EH2A