4AXCA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase apo form
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
432
structure length
394
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLARVNAANVDTSHDSALILNDHSLCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 126
structure length 394
sequence length 432
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axcA01
2XAMA 4AXFA 3UDSA 4AXDA 2XANA 4AQKA 4AXCA 2XAOA 4AXEA 2XALA 2XARA 3UDZA 4LV7A 3UDTA
chains in the Genus database with same CATH superfamily
3E93A 5CXHA 5DR2A 4M0ZA 3O23A 4CQEA 4FV0A 3C4EA 3VHKA 5A4EA 4O7ZA 4XV1A 3OTVA 3V5QA 3DZQA 5D7AA 5HG8A 4AFJA 4FV3A 2V62A 3EFJA 4ZTQA 3BV3A 2JAMA 1X8BA 4XJ0A 4F1OA 2IG7A 3ACJA 4UWBA 4DFYA 3U6HA 1GIIA 1PXMA 3G33A 1UU3A 2O5KA 3BEAA 3VJOA 4USFA 4BB4A 3FMEA 2F4JA 2UW0A 3L1SA 5DGZA 3UYTA 3WF5A 3P86A 2ZAZA 3FYKX 2BCJA 3H3CA 4D1XA 4F4PA 3SW7A 3PYYA 2OZOA 4IHPA 5HU3A 3D7ZA 2Y8OA 2E9UA 2XNBA 4FEWA 4QMWA 5IA2A 4FV8A 4ZSLA 2X1NA 4AG8A 2EVAA 4RC2A 4YZ9A 1OVEA 3DNDA 5EW9A 1B6CB 4D55A 4E20A 5KE0A 3EYGA 5EDQA 3NX8A 2FO0A 4CFUA 4J53A 3I5ZA 5GJGA 2ZFYA 5M53A 4BVUA 2GCDA 3JY9A 4AUAA 4XOZA 4H58A 4FZ6A 3MN3A 2HWPA 1GAGA 4QP4A 4BICA 1A48A 4TZRA 2QCSA 4ZMFA 5AX9A 2WMVA 3FYJX 4FMQA 1I44A 4YSJA 2WMAA 3MH0A 2XJ0A 1R39A 3KRLA 4FGBA 2XP2A 4LDTA 2GNLA 2XANA 4FYOA 4TN6A 4X3FA 5AV4A 4HZSA 4IX3A 2VNWA 3UZTA 3MESA 4FI1A 3VW6A 5ANJA 5BUJA 4YHFA 3V8WA 3Q9XA 4N6YA 4WHZA 5AP7A 2J5EA 3G0EA 4X7QA 1GY3A 4BZOA 1XH5A 4CEGA 2BRHA 3VW8A 3MH3A 2B9FA 4FG8A 1JOWB 1SVHA 3SLSA 3RCJA 2IW6A 1L8TA 2JLDA 4C4IA 5EHLA 4XV2A 5HBEA 4I92A 3U54A 3FI3A 3AQVA 2RIOA 2X9EA 1IR3A 3PWYA 3D5VA 3HDMA 5J8IA 4YTFA 2HIWA 1OL7A 5TT7A 4FKQA 4USEA 4OTQA 1PMEA 3W2SA 3AC2A 4QP7A 3SW4A 4OTFA 3FEGA 5CQWA 4BZNA 2C3JA 2E9VA 4GYGA 1JSVA 4FTKA 1NY3A 5D9HA 4TYEA 3PPJA 3BHYA 4CT2A 5J1VA 3ZUVA 1P4OA 3VONA 3PZHA 3C0IA 2BAKA 1UA2A 3Q3BA 2VTQA 3E7OA 2WTJA 3MY1A 3M42A 3VRYA 2FA2A 2PVHA 4Y5QA 4FNWA 2C5YA 4DEIA 3OWJA 4FKLA 4GG5A 4QDEA 2W99B 4YNEA 4ZTMA 4DGOA 3KMWA 5DHJA 5H2UA 2ITPA 2V7AA 4R5SA 3WARA 2YZLA 4I6FA 4IDVA 3GXLA 3FL5A 4RPVA 3PE1A 5JZJA 1PF8A 1TKIA 3KVXA 1AGWA 5CSHA 1JKKA 4NKSA 3OROA 1WBWA 5AP0A 3I7BA 3H10A 4ZJVA 3Q5IA 1MQBA 4RBLA 4FV2A 1ZZLA 3DXNA 2A19B 1SVGA 2XARA 1Y57A 2XKCA 3O8UA 3MA3A 1WCCA 3CQWA 4EBWA 5DIAA 3VS0A 2ITQA 3K5VA 3VVHA 4BDEA 4JIAA 2GTMA 1KOAA 2F7XE 2OBJA 4FIGA 5DNRA 3W2PA 3GEQA 3KB7A 3QZGA 5CSXA 3HMOA 4QQCA 4LGHA 3QHRA 2PL0A 4DA5A 2XEZA 3AGMA 2BDWA 3F9NA 2YCFA 3KULB 4KRDA 5AADA 3FQHA 4EWHA 4G6OA 4EOLA 3TZMA 4C38A 3I6WA 3FWQA 4ZY5A 5LCJA 3VNTA 2FH9A 2OU7A 3HP2A 1CSNA 1M14A 3KREA 4YLJA 3V04A 4I6HA 2DS1A 4WKQA 1M7NA 3PG1A 2XJ1A 4JDHA 3ITZA 3QC4A 4PRJA 4RIXB 4IBMA 3DY7A 2P2HA 1TFFA 2Q83A 2UW7A 3FY2A 4RFMA 4WIHA 3E8NA 3PPZA 4DE4A 5EQEA 3ATSA 2IWIA 1R0PA 2QOKA 3DFCB 4RRVA 4RJ6A 4X2KA 3DBEA 3SGCA 4BGQA 1ZLTA 2G15A 3EZVA 2OH0E 4QMMA 2F2UA 2PVJA 5LVNA 4CTCA 4F63A 3CCNA 1XKKA 2HOGA 2R0IA 3R1SA 2OF4A 5CWZA 3HECA 4EOJA 4BR3A 5HTCA 2B55A 4U43A 2P3GX 4FVQA 5FRIA 5M44A 3EN7A 4EKKA 3EN5A 4ANMA 4LRJA 3PPKA 4BI0A 4CFWA 2WTKB 2VNYA 4YC6A 2BPMA 3P7AA 4BY9E 5L2WA 1O6YA 4BCHA 3QX4A 4EH8A 5LVOA 3VO3A 3P5JC 3WYXA 4Y72A 2YJSA 5IH5A 5E1EA 3GVUA 4RFZA 4D58A 3DAJA 4O27B 3F88A 3D7TA 2QI8A 3A61A 5FEDA 3B2TA 3ZU7A 4DBNA 3FBVA 1OPKA 3KXNA 4I0RA 3AT3A 2PUUA 4YLKA 5D12A 3W2QA 4ALVA 2ZB1A 1H1PA 1RQQA 2PSQA 3CBLA 4GIHA 3EOCA 1E1XA 3KXHA 4N70A 3V01A 2F7ZE 3TCPA 3QGWA 5E8XA 2XZSA 5LMKC 1ZARA 2BALA 3FLQA 3HAVA 3B8QA 2BZKB 3QCQA 3UO5A 4NM3A 5JFWA 3A62A 4YZCA 4RZVA 4RG0A 3GQLA 1Q3WA 5DR9A 5LQFA 2A27A 5GNKA 4EH5A 2QNJA 1FVTA 3DDPA 2VTHA 2XIZA 4OTRA 4C4EA 2AC3A 3OT3A 3II5A 3RHXA 4TWOA 4AGDA 2PMLX 4QPSA 3I4BA 4IVDA 1FMKA 4YPSA 3PXKA 4YTHA 5JN2A 1XH6A 2C4GA 2CPKE 4JR7A 4YNOA 1V0OA 2HZ0A 4P7EA 1JQHA 2Y6OA 2QHNA 5F20A 2JIIA 3DXPA 3MVLA 3TUBA 4BHNA 1YRPA 3AC3A 3NZ0A 3NUAA 4L43A 2PWLA 4AGUA 3KVWA 3F3VA 2NYAA 2QKRA 3FMJA 4LV7A 3I1AA 3VBXA 4D1SA 3LJ0A 1WBOA 2ITVA 5BPYA 5KMOA 2CKOA 3AKKA 4ZTLA 5L6WL 3EQFA 2VN9A 3NCGA 3MDYA 3QGYA 4OUCA 2PPQA 4RJ7A 2QC6A 1LPUA 4M13A 2VX0A 4A9UA 5EI8A 2R3RA 1M52A 4IJ9A 2R3PA 2W17A 3HKOA 2NO3A 3AMAA 4I41A 2IVTA 3FQEA 3HLLA 2F9GA 4IM2A 4RQKA 5EI6A 4B4LA 3HMMA 2ZM1A 3IW4A 3C1XA 3WYYA 2VRXA 3MS9A 2QOLA 4MHAA 4YGAA 5KKRC 2IO6A 4AZSA 4JBQA 2Z2WA 1UNHA 2JKQA 2XBJA 4PTEA 3UVRA 3ZFYA 1Q99A 4F08A 2GS6A 5HNIX 1H27A 4EH9A 3I79A 1VZOA 5M4FA 3LCTA 4I6QA 3NFFB 2J50A 2B9JA 1FPUA 2XB7A 4YLLA 5IQBA 2C5NA 3CD8A 2PUNA 2R3JA 2W1CA 1J91A 2WGJA 2OXYA 3ZDUA 4OBOA 4XG2A 3U9CA 2QONA 3DBFA 4TWNA 4L7SA 5HEZA 4NW5A 4M8TA 3KXXA 3ZSHA 4CSVA 5FXRA 3AT4A 4YC8A 3WZJA 4PTGA 2XIRA 4U44A 5CTPA 3WZEA 3D15A 3IW7A 3NYOA 4WG4A 2C3LA 3CPCA 4LV8A 3R1QA 4I23A 3TNHA 2CGWA 1IA8A 4FTAA 2XCKA 3QQUA 2OFUA 4IW0A 5CENA 2XS0A 3ZLXA 2WTWA 1Z9XA 3GOPA 4RLKA 1O9UA 3ZFXA 3W33A 3FE3A 4TYJA 3SQQA 3CIKA 2J6MA 1W83A 3QA8A 1LEWA 2Y0AA 1UU7A 3OXTA 3BELA 1B39A 4NJ3A 4A4XA 3SXRA 3BU5A 4YR8A 3EH9A 1ZY5A 5AIKA 3GFWA 5AAGA 1K3AA 3VWAA 3MPAA 2UW5A 4DLJA 3O51A 5BX0A 2NRYA 2WTDA 2QU5A 4KRCA 2R3OA 3LKMA 4WRSA 3F2NA 4NYEA 4GT5A 1RDQE 2EU9A 3NAXA 5HNGA 3UZRA 2J0MB 3H4JA 4LOOA 3IGOA 3RPRA 1ERKA 5K9IA 3BQCA 4KINA 5DA3A 4YZBA 4RGJA 3S1HA 4GMYA 3VBWA 1Q8TA 2JBOA 1RJBA 2YM5A 5EYMA 3NDMA 3FI8A 3KXGA 3LJ1A 3ORLA 3QQHA 4MBLA 2ONLC 4PUZA 3QUPA 4CD0A 4R78A 4F7JA 5T3QA 5HX6A 4H05A 3H9FA 3TJDA 4FKIA 4BDKA 2CKPA 5C26A 5JGDA 5M4CA 4A9RA 2PZPA 3FPMA 2CLXA 2WMXA 2YAKA 3VS3A 3KU2A 5IEVA 3QRJA 3ZXTA 5AP3A 5M56A 5IQCA 3D5WA 4IADA 4QNYA 1YWNA 4FV6A 3ZO4A 4QMUA 4TXCA 3QZFA 2XKDA 3G9LX 4MNEB 1OIUA 3BWJA 4TRLA 3FSKA 2BR1A 2LGCA 4RJ5A 2WMUA 3V5TA 4F0IA 1J7IA 2BZJA 2EB3A 4DH1A 4U45A 4HVSA 2IZSA 4ZZNA 3UQCA 3RKBA 3QKMA 4M97A 2W4JA 2G2FA 2RFSA 3L9MA 5HQ0A 2R3GA 2W7XA 4IE9A 3AXWA 2UVYA 3ZSIA 3KGAA 2C5VA 4FOBA 3UQGA 5ETCA 4FEUA 4FJVA 4CCUA 1PXOA 2CJMA 3BYMA 3LMHA 4UWCA 4PP7A 3F5GA 5CF6A 3PIYA 4QMPA 2ESMA 4WRGA 2XKEA 5EKNA 4BCOA 5DPVA 5M51A 3FLSA 3E62A 1SM2A 2QO9A 4E5WA 4ZMEA 5HCZA 4PQNA 2UW8A 3SA0A 4O86A 4AN9A 4ANLA 5GINE 4FICA 3MI9A 1JKSA 5IA0A 5F1ZA 4NCTC 1VYZA 2J2IB 3DBQA 3ODYX 5HIEA 2VWUA 5J1WA 3I6UA 3PRFA 4D4SA 3HNGA 4EOMA 3PJCA 4E4LA 4R77A 2WIPA 2X6DA 2YZAA 4GKIA 3V5WA 5FM2A 2OXDA 3QHWA 3MVMA 3IW8A 4B6LA 4BCIA 2GS7A 3R7EA 4ONAA 4C2WA 4QMSA 3DKCA 3TM0A 3SG8A 3R7VA 2CN8A 4UYNA 3ZO1A 2B52A 4ACCA 4RLLA 5HVJA 3BV2A 3DGKA 1VJYA 2QOQA 4EYMA 1K2PA 2B0QA 3GT8A 3PJ3A 5ANGA 5BQ0A 4RIYA 3KF7A 3I81A 3ORTA 4MXAA 2JKMA 3C4XA 2EUFB 4FEQA 3R9HA 3WOWA 1XO2B 2X9FA 5L2SA 1OKVA 3C4ZA 2IW8A 4EK4A 4DEGA 4G3CA 1YKRA 1O6KA 5B0XA 1Q8YA 1S9JA 4Y46A 3QRTA 3W0NA 4A9TA 3LFNA 3AMYA 1Y6BA 2YM6A 3BX5A 3GU8A 1NXKA 3WBLA 4FIIA 3WE8A 3COIA 4FC0A 3F3UA 3FC1X 1YXXA 3QCSA 4YP8A 4I5CA 1CMKE 4YC3A 5H3QA 5LARA 5TKDA 4QMYA 4FT9A 1A06A 3R8VA 4EQMA 4FA2A 1JPAA 4FNZA 4O21A 5IA5A 2OK1A 5CT0A 3T9TA 2YCRA 4QTCA 3HYHA 1GIJA 5AA8A 4F9AA 5CEPA 5CNOA 2CLQA 4HGEA 4O6LA 4BHZA 2W1HA 5J9YA 4FZFB 5L8KA 4V0GB 4QDVA 2A2AA 3FLZA 2W05A 2Y9QA 2W1ZA 3COKA 3IKAA 3HP5A 4FSWA 3RINA 4A7CA 4AN3A 4LRMA 1PJKA 2UZWE 4RVMA 3RGFA 2VTTA 5IH4A 1MRVA 1PMUA 5E8WA 3UOHA 4AF3A 1Y91A 1UV5A 3E5AA 4FV9A 5C9CA 1TQIA 2UZLA 2W96B 4KD1A 3W0SA 5FUTA 4G1WA 3RNIA 4DTKA 2H96A 3NUSA 3QQKA 4C4FA 2B7AA 4EQCA 4CGAA 5AAEA 5HG9A 3MJ2A 4XOYA 3H0YA 2XIYA 5L3AA 1REKA 1IASA 3RM6A 3OF0A 4RVTA 1R0EA 3FI2A 2PTKA 2QU6A 4NT4A 3R8PA 1HCKA 3TMOA 2A1AB 2JDOA 2W1DA 1GNGA 3C9WA 3DXQA 3FZOA 3G15A 3G90X 3LLAA 3OBJA 3QC9A 1NVQA 1KV1A 2PVLA 2I0EA 3EN9A 4FSUA 2IN6A 3RK7A 1HOWA 4BTJA 4ZSAA 3EHAA 4ZTSA 2VAGA 4M67A 1APME 3NSZA 4RFYA 3TZ9A 5BVFA 3FDNA 5CF5A 4GUEA 4XG7A 3QYZA 5M4UA 2FSMX 3BYSA 3KL8A 5CU4A 4FTMA 4FV1A 2Z8CA 4A9YA 1XBBA 2QO2A 4AGCA 4HJOA 5BUEA 3LM0A 5I9YA 3N9XA 4ZIMA 1FINA 3ZH8A 2WU7A 3RTPA 2KULA 4F0FA 3BE9A 2UZEA 3QQFA 2XF0A 4K11A 4MKCA 5DE2A 3CY2A 4FTRA 4BBFA 4BN1A 1PXJA 4AU8A 3NVMB 4DINA 1Q24A 1U46A 2AC5A 5HCYA 2ZYBA 4BDCA 2R3LA 5KKRB 3SXSA 2OFVA 4H3QA 4NK9A 3ANRA 3D2KA 1DS5A 2PULA 3FAAA 3R1YA 4GU6A 3VS4A 4ANQA 2VO3A 3OUKA 5FG8A 4AZTA 5E92A 3KF4A 4EOKA 3HV4A 4GCJA 4JNWA 4WA9A 3ZYAA 5EQYA 5JFXA 4J95A 4FTUA 4X21A 2WMBA 3ZO2A 3Q6UA 4EOPA 4DHIB 5BV3A 4O84A 4R7IA 3CGOA 4G6NA 4DTAA 4JMQA 1FQ1B 4X2JA 4FODA 3TKIA 4FL1A 1OL2A 3DB8A 3C50A 2BRNA 3KXMA 2QO7A 2LAVA 3U55A 4I6BA 4C35A 3ZLYA 3PA4A 1ZYJA 1SNUA 2H34A 4V01A 2C69A 2XJ2A 3ZTXA 5HESA 5HVKA 3JYAA 2C5OA 1UNLA 3TV4A 1SZMA 3F3TA 4AA0A 2G1TA 2WO6A 3DLZA 4MXOA 2HZNA 3H9OA 4M0YA 5FBOA 3SG9A 2X2KA 4AA5A 3PXZA 2W9FB 4R3PA 5EM6A 4BI2A 1BL7A 3VS6A 4CMUA 4C62A 1OIYA 4L7FA 4J71A 3QTUA 3PJ1A 4ALUA 4EHGA 4M68A 1UNGA 4EK6A 3MYGA 4IZAA 4AN2A 4BIBA 4ANSA 5E90A 5T6KA 4FX3A 3ZS5A 3VIDA 4FSTA 3GC7A 3RAWA 4G31A 1M2PA 5BUIA 5AP1A 4ASZA 4QYEA 2R3KA 3LCOA 2JGZA 3OFMA 3EQRA 3Q4CA 3PY0A 4K2RA 5DG5A 3UG2A 2BRBA 3W1FA 5D10A 5DRBA 1JNKA 1J1CA 2YM4A 4CZTA 4E5BA 4H3PA 2CN5A 2X7GA 4L3JA 4EOQA 1YWRA 3TNPC 1SMHA 3ZONA 1KOBA 1OL1A 2C6MA 4FTQA 5DYJA 3FKOA 3T3UA 1IA9A 2XYUA 3IK3A 1OIQA 4RA5A 3BBTB 4HOKA 4IACA 4YJPA 2YM7A 3ZM4A 4O0RA 2VO6A 1PHKA 2R64A 2V22A 4ITJA 1URCA 4JT3A 1YDSE 2Z7SA 3HV3A 3LJ2A 4RMZA 4YSMA 1OKZA 1W8CA 4ORKA 5LVLA 3OWPA 4IM0A 4DGGA 3DU8A 1YI4A 4J7BA 2W1IA 2JC6A 4KNBA 4U3YA 4B7TA 3OY1A 2J0LA 4S32A 4BBMA 4FNXA 3FXXA 2X7FA 3NRMA 4XX9A 2B54A 3G51A 3ZZWA 1FOTA 4E6CA 5M09A 4RSSA 4AACA 5D1JA 2CHLA 1Q8ZA 3CTJA 4FSYA 2B4SB 2W1GA 5AUYA 5FTOA 4ENXA 5IMXA 3K3IA 5B7VA 2WMQA 2CKQA 5HIDA 2OXXA 4IX5A 4R5YA 3R9NA 2PZ5A 4ID7A 2J9MA 3ZSGA 3PLSA 4PDSA 3F6XA 4ZS0A 4WOVA 3HA6A 4EL9A 3NUNA 3ZHPC 4Q5HA 4O22A 5JFSA 3Q4TA 4KSQA 3MFTA 5FEQA 4YJOA 4I5PA 4ZLZA 2OIQA 5C8NA 1FGIA 3ZBXA 2VWIA 4BZDA 5HTBA 3F82A 2JKKA 1STCE 3AKLA 3OY3A 1YDTE 3UMWA 5IISA 3COMA 4E4MA 3EL7A 4JAJA 2IVUA 4JQ7A 1CKIA 4DGMA 4JR3A 2WU6A 3V8SA 5C4LA 3TEIA 2VTMA 3P7CA 3TJCA 4FTLA 4X6QC 4Z7GA 3EFKA 3RNYA 3A7HA 3AD6A 5DH3A 3MH2A 4U3ZA 2WAJA 2ZDTA 5E8UA 4C4HA 2ITOA 5I9WA 4IVBA 5IPJA 5IU2A 4W4XA 5L2IA 3B2WA 4O0TA 4DH3A 2P0CA 3CR0A 4I5MA 3U4WA 4CV8A 3QD3A 3OWKA 2R4BA 4YBJA 3RMFA 4E6DA 2UW6A 1QPCA 5B2MA 1OUKA 3NCZA 5AUXA 4BYIA 5CANA 3CD3A 1YXTA 3NGAA 3UQFA 2X2MA 2X81A 2XK8A 4CFVA 4C61A 3BWFA 3PDTA 1QPDA 2R3HA 4DH8A 5DR6A 3D5UA 3ORXA 2XIKA 4O82A 2VWXA 1MRUA 1OL5A 1UU8A 3PVWA 4KKGA 3VUMA 5HGIA 5K5XA 4IB3A 1MUOA 5IQIA 3UOKA 1Q61A 4WG3A 2VWZA 5GIOE 3N4UA 4AOJA 2O65A 1P4FA 3MTFA 3P79A 4U81A 3KC3A 4R1VA 2OO8X 3CKXA 1KE5A 1BI8A 2OSCA 1TQPA 3NUUA 2PVNA 5A4CA 5BVKA 5CF4A 4I6LA 2OJFE 3LOKA 2CNQA 2O0UA 3D4QA 2VTRA 4LG4A 3PP0A 4LOQA 2NNWB 4LL5A 4YUQA 3DTCA 5EK7A 2PZIA 4QEBA 3ZRKA 5D11A 4FR4A 5M55A 3NS9A 4JBPA 4TYHA 3UDSA 5IG1A 5AP4A 3TDVA 4AGWA 4ENYA 3NUPA 3CLYA 4WUAA 2NPQA 3RWPA 3ZFMA 2H9VA 3EJ1A 3QXOA 4QYGA 4EKLA 4L45A 5CSPA 3ULZA 3P5KA 2RFNA 3NNVA 1YXSA 3OD6X 5IQHA 2VGOA 3PSCA 4JDIA 5ITAA 3FSFA 1XH4A 2O2UA 5EH0A 4IZ7A 2WPAA 2BTRA 3E3BX 1GZNA 2ZMDA 2R3IA 4LMNA 3ZEPA 1G8KA 5DVRA 3PY3A 5HLPA 3ZDIA 2HY0A 5CU2A 3SC1A 4XYFA 1TVOA 3R7UA 2SRCA 3LPBA 3BKBA 2C3IB 3NW6A 4JQEA 4RVLA 3LCSA 4F64A 2WMTA 5F4NA 3Q96A 3DDQA 3MA6A 4ZSJA 4O6EA 2H6DA 3R1NA 4TWPA 5G1XA 1UU9A 4D4YA 2WKMA 2BFXA 2PE1A 3BU3A 4RX9A 4O81A 2E2BA 2PMOX 4NTTA 4AW5A 4PMSA 4DFZE 1QMZA 4ITIA 4GK3A 2ZV7A 2YCSA 4PV0A 3AG9A 3BL7A 3QTSA 4L3LA 2RG6A 4JL9A 5AP6A 2ZOQA 5TOZA 1JSTA 2QR8A 1UKHA 3R71A 2UW3A 3MTLA 3U4UA 1V0PA 4B99A 3MVJA 2PY3A 2JBPA 3MBLA 4IB1A 1J7LA 4RJ3A 3ZLWA 4I93A 2BRGA 2WQNA 3QAME 4FV5A 4PY1A 1ST4A 1PYXA 1G5SA 3PTGA 3QL8A 3ZCLA 4AA4A 2BVAA 2J90A 2XAMA 3SAYA 3I60A 2BHEA 1JVPP 5A4TA 2V7OA 4M84A 4AAYA 4NFMA 3W32A 3VUHA 1BI7A 3FUPA 5CI7A 4F6WA 5IA1A 3ZOSA 5CS6A 3HUBA 4L44A 4APCA 4YHTA 2OZAA 3IDCA 3TDWA 4E7WA 1L3RE 2VTNA 4TW9A 5KNJA 4AZEA 3Q4UA 1H8FA 3QTQA 3AD5A 5AV0A 4FZAB 2XK7A 1ZMVA 3MY5A 3OC1A 3D94A 3QFVA 4CT1A 4GFMA 5A6OA 2PK9A 3E64A 2WIHA 1CDKA 3HRFA 4EK8A 4IAIA 5J87A 2GNFA 2UZOA 3G6HA 4UWYA 3NR9A 5EHYA 3SOCA 3ZBFA 4ACDA 4IZ5A 2VGPA 1H0WA 3GCVA 1XH8A 1U54B 3EYHA 3KEXA 4X3FC 3O8TA 2PVKA 3RAIA 4RIWB 4PDYA 4FV7A 2P55A 2J4ZA 4KIPA 4OTGA 4I0SA 4U7ZA 4CKRA 1UWJA 3FMMA 4BDFA 4JRVA 4FE2A 5KHWA 4EH3A 4V05A 3IO7A 2I0YA 3WI6A 3Q2MA 2C6IA 2F57A 3QLGA 5AV3A 3RVGA 4BDGA 2E9PA 4DITA 4KS7A 5BVWA 4U8ZA 4WUNA 4ZTHA 3ZRLA 1CKPA 4Z9LA 5TO8A 4QTEA 3QTIA 3JUHA 4AOIA 3KCFA 4MUQA 2AUHA 2HW7A 4NKAA 5KMKA 2X7OA 5AM7A 5HE0A 4TT7A 2ZB0A 2ERZE 4IAZA 4XG4A 4J97A 3RK5A 5ANEA 3DT1A 3P78A 3R6XA 4D2RA 2OH4A 4A4OA 3LMGA 3R2YA 4FKPA 3A7JA 3JY0A 1Q62A 1YOMA 3VULA 5CEKA 4FKTA 4J98A 2WMWA 4O83A 3ROCA 5E9EA 4C4GA 5CVGA 4ZJJA 5BNJA 3ALOA 3EKNA 4XG8A 4B0GA 4DEHA 3BPRA 1IG1A 2XMYA 4WNOA 3VS5A 2BMCA 4BRXA 1J3HA 4BJJA 2V5QA 2GHMA 4EK5A 1NW1A 3QTZA 4L67A 5BYZA 5E4HA 3O0GA 4KKEA 2C5XA 2HW6A 3IW5A 4PNKA 4IANA 4AE6A 2O8YA 1AQ1A 2OLCA 3PXQA 4F65A 1CTPE 4NL0A 2CCIA 2XYNA 2VD5A 4P90A 4OT6A 2ZM4A 3VUGA 4BBEA 3IW6A 1XMMA 1NA7A 3OCBA 4NM0A 3WF6A 2PE2A 3ZC5A 3RPOA 4AFEA 3FLNC 2VTAA 3JXWA 3GENA 4KSPA 3PY1A 4WBBB 4CCBA 4FKOA 2F2CB 2OW3A 3A99A 5DOSA 1BUHA 4J8MA 4BIEA 4KBKA 4JS8A 2XCHA 5ANOA 3ALNA 4IWQA 5CZHA 4DH5A 1G8SA 4CV9A 2VU3A 3L9NA 4PDOA 1DM2A 2UZUE 3NAYA 5CLPA 5M08A 2J0IA 3Q9YA 1ZMUA 5JK3A 2YM8A 1PKGA 1AD5A 4GRBA 3BGPA 4EC9A 4F78A 3F61A 2IZRA 3ATTA 1R3CA 2OGVA 5G6VA 3UJGA 3GCPA 2C6KA 1ZYCA 3M2WA 1ZOHA 2Z02A 3A7IA 4QMTA 2QLUA 5GJFA 2XRWA 5CAQA 4YJRA 3QD4A 5JH6A 2PVRA 2EB2A 5E8VA 4CFXA 3UC4A 2G01A 3OP5A 4NUSA 5DEYA 1MRYA 3HAMA 5ETAA 3NIEA 1Q4LA 4BF2A 2E9OA 4FT7A 4OW8A 4IWOA 3ZUTA 5HE2A 4LQMA 1H01A 3TTJA 4XNEA 4MXXA 2I1MA 3U9NA 2YFXA 4DAWA 3E87A 2GNJA 3FMDA 5J5SA 3OBGA 4XMOA 4H1JA 4K6ZA 2DWBA 4CMOA 5HO7A 5CZIA 4QQTA 4C33A 3KKVA 4NM7A 5EI2A 2WTVA 3OT8A 4X6RA 1OKYA 2YIRA 4R7BA 5KZ0A 3CY3A 4S2ZA 3UBDA 5LWNA 3TL8A 1U59A 4G2FA 4LFIA 2R7BA 4GT3A 3K2LA 4NH1A 4S31A 4Y5HA 2WQMA 4GK2A 5HD7A 3F2RA 5HIBA 1R1WA 1CM8A 3DCVA 1JSUA 4PL5A 3UODA 4ZTRA 3MW1A 4KAOA 4GJ2A 5KHXA 4HW7A 1T46A 4DYMA 3BE2A 3TNWA 2GSFA 3FHRA 5LWMA 4KBAA 5JQ8A 3DB6A 1G3NA 4NCTA 4AXDA 4FKVA 4Y85A 1ZRZA 4TNBA 4ITHA 4MXZA 4ACGA 4W4VA 1LP4A 4FTNA 5CX9A 2BZIB 3FZSA 3DK3A 2X0GA 3HDNA 3PUPA 3ID6C 3KRXA 1OECA 1WZYA 2YDKA 3FXZA 4GJ3A 3S3IA 3UP7A 4C7TA 5I4NA 4EHZA 4I0TA 1DAYA 5EYKA 4F7SA 5K3YA 4UV0A 2XIXA 3IG7A 2XH5A 4EZ7A 1W7HA 3QKLA 3D14A 5ETFA 4II5A 3GP0A 3LM5A 4G5PA 4FSQA 1OBDA 5B2LA 2G2HA 3KRRA 3UOLA 5FEEA 3KN6A 5CEMA 3E88A 3MB7A 3F5UA 4YJNA 4ZS4A 5AUTA 1WFCA 5AP5A 3HGKA 3ANQA 2I6LA 3V5PA 4DEDA 2OG8A 4HGLA 1BL6A 4WO5A 2YABA 1P5EA 2JD5A 1GJOA 1IAHA 2EWAA 4KB8A 3W0OA 4HPTE 3ZM9A 3Q4ZA 4BCMA 5AX3A 3NUXA 4USDA 2PUPA 4Y8DA 2W4OA 4DT8A 4IDTA 4ZZMA 3JPVA 4EZ3A 2P4IA 5EW8A 1XR1A 3F5XA 3UDZA 5AUVA 4XH6A 3S2PA 3PXYA 3W16A 5BVNA 3C13A 5LXMA 3NMUF 3TWJA 3MSSA 3NPCA 1GZKA 3LQ8A 4K77A 4IWDA 3GC8A 3R22A 3HX4A 4YTCA 2WB8A 4YTIA 1Y8GA 5AAFA 2XM9A 1PY5A 4O96A 1PYEA 3TNQB 4LM5A 4UALA 3TT0A 2XAOA 4CG8A 5CI6A 4XUFA 1ZOEA 3MY0A 5L2TA 2UZBA 2ZVAA 3UGCA 2C6OA 2CNUA 4ZP5A 1LUFA 4PL4A 4E1ZA 1YDRE 2YIYA 5A6NA 2VTJA 4WNKA 3IDBA 2JEDA 1PKDA 3GU5A 4O0YA 3F7ZA 2DUVA 4O7RA 5DI1A 2FVDA 3BYOA 4GYIA 3U87A 4S33A 5IEYA 3PLAE 2YM3A 3E3PA 2YWVA 1Q5KA 3GCQA 5IUIA 4RWLA 1H08A 4F70A 2G9XA 3FKLA 3R9DA 2BROA 3RJCA 1GZ8A 2WQOA 3LXLA 4X3FB 3SD0A 3A2CA 3BZ3A 2VWBA 3FZRA 4IVAA 3BBWA 3DKOA 2JDSA 3A8XA 3EWHA 3LFSA 3HVCA 4FTIA 4NFNA 4MD9E 5FQDC 1K9AA 1SNXA 4ARKA 1JAMA 1OUYA 2GQSA 1ZAOA 2CKEA 3AC5A 3C5IA 4N4SA 3G2FA 4QP9A 2HK5A 2WOUA 4M7IA 2AEGA 1XBCA 1M7QA 3RHKA 2OIDA 4BDJA 2GNHA 4WNMA 3FZPA 4QMOA 1ZOGA 3EL8A 4LGGA 3DK6A 4QT1A 2ITTA 4AAAA 4H1MA 1WBPA 1M2QA 5HG7A 3O7LD 2BUJA 2IW9A 4CMTA 4MX9A 3ETAA 4FTTA 3U51A 1BMKA 4OBPA 5LJJA 3QQGA 1FMOE 3QUEA 4WD5A 1WVXA 3EN4A 1DI9A 5E1SA 2JDRA 3E8DA 3NLBA 4Y95A 3KULA 4UZHA 5DT3A 4XP3A 4IZYA 1KSWA 2CDZA 3BCEA 3FXWA 3EKKA 2Y4PA 2UZNA 2WNTA 4IAYA 4YJUA 4C3RA 4CRSA 3T8OA 3MIAA 4JJRA 5E7RA 3SXFA 4DFLA 3MFRA 3RALA 4I1ZA 5J9LA 1PXPA 2ETRA 3EQIA 3QUDA 4QPAA 4RIXA 4ZEGA 3R01A 4PMMA 4UEUA 3TG1A 3ULIA 4XBUA 2HY81 4GW8A 4ZY6A 4B8LA 4EH2A 1U54A 3AC8A 4GV1A 2BKKA 4F99A 2GNGA 5EYCA 1E9HA 1V0BA 2ITXA 3OCGA 4XS2A 4BDIA 1UWHA 2ETMA 3FY0A 2HCKA 3EQGA 3PA5A 4FVRA 4Q5EA 4GS6A 3ZC6A 3UOJA 4CVAA 4PP9A 2VTIA 4AQKA 3L9PA 2IZTA 3R8ZA 3IONA 2IZUA 3PG3A 3NUYA 3L8VA 4F9WA 3P9JA 4YZNA 2FYSA 3AKJA 3C4CA 3DPKA 4JRNA 4O7LA 1YHWA 4FK3A 3TACA 3W18A 4D1ZA 3UPZA 4C58A 4HVIA 4MD8E 2G2IA 4ZK5A 4CG9A 4DN5A 2JFMA 4J52A 2CMWA 4CNHA 4BTFA 2HZIA 4UYAA 3VF8A 4EBVA 3DZOA 4L3PA 4AX8A 3H9RA 4FIFA 3VJNA 4BYJA 3ORMA 1ZYDA 2C3KA 3CKWA 2QR7A 5DRDA 3BL9A 3FMLA 4HGSA 2ITZA 3PA3A 4QMZA 2WD1A 3KXZA 3KRWA 3HMPA 5AUWA 2ZV2A 3OWLA 3CC6A 3K5UA 1ZMWA 3R28A 5CF8A 1Y8YA 2C6LA 2X4FA 4FT0A 4D9UA 4EQUA 3CXWA 1PXLA 4ZTNA 5FD2A 4BDBA 4R3CA 5FTGA 4NIFB 4H39A 3WF8A 2ERKA 2FUMA 5D41A 4HYSA 4L8MA 4AWIA 5FDPA 4R3RA 1J1BA 1OBGA 1GIHA 3I0QA 3LFEA 4QQJA 5KCVA 4L6QA 3CQEA 4Q2AA 3BHHA 4EC8A 5BVOA 4MWHA 2JDVA 3KMUA 3LE6A 2CSNA 2BDFA 4FTCA 3UNJA 1ZYSA 3REPA 4D4RA 3P23A 4P5QA 3VUIA 3QWKA 4XV3A 5JKGA 4D0XA 4XBRA 4IAKA 5EOBA 1MQ4A 5KX8A 3UDBA 3QLFA 4BTKA 4MNFA 3RCDA 4BIDA 3LLTA 4AW2A 5A46A 5L6PA 4GH2A 4L00A 3FMNA 4AE9A 4OLIA 3D7TB 4TNDA 2C1AA 1YI3A 5H9BA 4BI1A 5DEWA 4O7WA 2UW9A 1JWHA 2W4KA 4OBQA 1ATPE 2WQEA 3ENMA 4EH7A 5CAUA 2QOHA 4CKJA 4FNYA 3F5PA 4DDIA 4F9BA 3Q53A 5I9ZA 5CEQA 5HKMA 4N57A 3RZBA 3BGZA 2YACA 3FI4A 4QP2A 3PUFC 3LCDA 1Q8UA 4Z3VA 3NVKI 2VTLA 2O64A 4FTJA 4V04A 1Q97A 3NWWA 3OS3A 3OG7A 1H28A 4NWMA 3MPMA 2YERA 5HBHA 1VEBA 3AC4A 3I5NA 5FXQA 4AT3A 3O17A 3R8MA 4FOCA 3LXKA 2W1FA 4ZLYA 5GHVA 4ZLOA 3BU6A 2W06A 2VX1A 2YIWA 3LFCA 3W2RA 5A4QA 3WIKA 2RL5A 4EORA 3AMBA 3R02A 4GVAA 4GU9A 3CTQA 4C3PA 5C27A 2XVDA 5AJQA 1KUTA 3RK9A 4DFBA 4EI4A 3EFLA 3R30A 4JAIA 2UVZA 5CEIA 1G8JA 4UB7A 3R00A 2P33A 4MXCA 4CFNA 4AT4A 4DGLC 4XRLA 2XKFA 4JIKA 3UP2A 3P1AA 2V0DA 4FG9A 3EZRA 3LCKA 4YJSA 2C6EA 4O0SA 4KIQA 2VUWA 5KUPA 3CGFA 3HV7A 2C47A 4IX4A 1YVJA 3DOGA 5JZNA 2I40A 3Q04A 5JEBA 1XH9A 1W98A 4YZDA 1JKTA 4ZAUA 2IVVA 5E8ZA 5EM7A 3VS2A 3KFAA 3GGFA 4CFMA 5F9EA 2CCHA 3PZEA 4TY1A 1JLUE 3VC4A 4L53A 1FGKA 5AV1A 4F0GA 3GU4A 3F3ZA 2IPXA 2X8EA 4ZZOA 4KA3A 3MJ1A 4TL0A 4QRCA 4U79A 4E4NA 3FZTA 5AMNA 4JX3A 5A3XA 3UG1A 4DHZA 3WF9A 4FSMA 2ZM3A 3R7IA 4F6UA 3R0TA 1B38A 1OGUA 2ETKA 3S95A 4DT9A 4JDJA 2H8HA 3GNIB 4L68A 4O0UA 4OTHA 4FEVA 4ZSGA 5HE1A 4PL3A 3UMXA 4OT5A 3A4OX 2R3QA 1PMVA 3LVPA 4FKGA 1H25A 2BDJA 3QRIA 4JXFA 3CE3A 1H1WA 3VUDA 4XRJA 4HNFA 4DCAA 4D9TA 4B8MA 5K4JA 4G34A 4EHEA 4AS0A 3Q52A 2OF2A 2XK9A 2XNMA 3EQHA 1G8AA 3DQWA 2GU8A 4FKRA 4C3FA 4ZOGA 2VO7A 4ASEA 5HZNA 5C8MA 2XEYA 3HV6A 4HNIA 2RFEA 4HYIA 4IH8A 3ORZA 2UVXA 5I5ZA 1RW8A 2C6DA 3PFYA 1NT2A 2OJIA 2P2IA 5BVEA 3SOAA 4MNEA 4LL0A 2BILB 2RGPA 3GBZA 5ANDA 2YN8A 4ZXTA 3V6RA 3WZUA 3U6IA 3C0HA 3BGQA 3R04A 4KBCA 4EUUA 4R7HA 5AM6A 4JOAA 5HE3A 3UNZA 4R1YA 5FGKA 4J96A 4D0WA 4DG3E 3DQXA 4UY9A 3R73A 4QTBA 4MBIA 4BCKA 4CZUA 5EG3A 2OI4X 2QOBA 2J51A 1H24A 2QG5A 1A9UA 4L42A 4O0XA 4MTAA 4BGGA 2Y4IC 4DFNA 4DFUA 3W0RA 1DI8A 2O3PA 3TZ8A 4HGTA 2C0IA 4QMQA 3R63A 1T45A 1Z57A 1NVSA 4QYFA 5DBXA 4Y83A 5JSMA 3P08A 4H36A 4KS8A 4IVCA 4G3DA 2JKOA 4IM3A 4C02A 2WHBA 3LXPA 3TUCA 4EZ5A 1YI6A 5CASA 2BFYA 3DNEA 4M14A 2V55A 1REJA 1VYWA 3FL4A 3AOXA 4KIOA 4O2ZA 4U9AA 5EHOA 2R7IA 4BDAA 3D83A 4FIEA 4O7TA 1IEPA 5FP6A 4E4XA 3HRBA 4GG7A 4IB5A 4MVFA 5ANIA 4F9CA 2YEXA 3SV0A 1Q3DA 5CAVA 4K9YA 3ET7A 3DBDA 4XLIA 3F2AA 5LVMA 2GTNA 3BYVA 4YHJA 3Q9WA 4O2PA 3FMKA 4ZJIA 2UW4A 4HVHA 4MQ1A 5BMSA 3WZDA 2UV2A 2W1EA 3AD4A 4XG6A 3O7LB 4YPDA 4FL3A 2ITYA 2RG5A 3A7GA 5AFVA 3VBTA 3PVUA 2ACXA 3QCYA 3QWJA 1H26A 2YWPA 1NVRA 2BAJA 3DJ6A 2QD9A 2J7TA 3GQIA 2YITA 3KQ7A 2QVSE 3KK8A 5TF9A 3TV7A 5IMEA 1OITA 5M07A 3LQ5A 3DAKA 2ITWA 2XNPA 2WELA 2EXMA 2XK3A 4GVJA 3P4KA 4O38A 3O96A 4EWQA 5IQGA 4IAFA 2X2LA 4BKJA 1YHSA 2UZTA 2QLQA 3ODZX 4XCUA 2PYWA 2Y7JA 1CKJA 5CSVA 3KIOC 4NJDA 5B2KA 4AXAA 1SYKA 3LZBA 4QMNA 3AGLA 5CT7A 1OI9A 4QYHA 1PXNA 3GU6A 4IEBA 4BCQA 3W0QA 3LXNA 3E8EA 3L8PA 4EH6A 1V1KA 2QODA 1WBTA 2HWOA 5DFPA 5IQDA 4MEDA 2JIUA 3LMIA 3BRBA 5LMKA 2XNNA 5EDPA 4AW1A 3QU0A 5E8YA 3TTIA 3TV6A 4PMTA 5IZFA 4V0GA 3NEWA 4FG7A 1YXUA 4X2NA 1WMKA 3V5LA 4HVGA 3OEFX 3KY2A 4TPTA 5IUGA 3POZA 5HHWA 4QTDA 4DG2E 2GHGA 2QG7A 3QZHA 2ZV8A 4JI9A 3W2OA 3BLQA 5F95A 5I9UA 3UYSA 3UO6A 1OMWA 3VUKA 4GFGA 4C2VA 3I0OA 4HVDA 3I7CA 3ELJA 3P7BA 3EQBA 2R0UA 4DFXE 4W4WA 3GC9A 5EOLA 1ST0A 5CXZA 3V3VA 3R83A 1OL6A 4RIYB 3D5XA 4EEVA 1J7UA 3NYXA 3W0PA 1WVYA 4S30A 1OM1A 3BHUA 2GS2A 4F09A 3F66A 3BEGA 2WMSA 5IQAA 4FT3A 3O71A 4AT5A 3PXRA 5KMNA 4RJ8A 3UC3A 3BI6A 1OKWA 3EQPA 4GIIA 3PIZA 3MV5A 3ZO3A 4YZMA 4FSRA 2C6TA 4AW0A 4TKSA 5ACKA 3UIUA 3NNUA 4CKIA 3QD0A 4HYUA 4I24A 4DTBA 3VQHA 5C1QB 3LW0A 1XHAA 4XP0A 3CJFA 4CFFA 4CLJA 2RKUA 3A4PA 4S34A 4BC6A 2DQ7X 2I0HA 2IVSA 2HENA 3ACKA 3QQJA 4FT5A 4HYHA 4RC4A 1EH4A 3C4WA 3QBNA 4RWKA 4XHKB 5IDPA 5DT4A 1H1QA 2WTIA 2NP8A 5JGBA 3QZIA 3PWDA 4B9DA 4DC2A 4IC7A 4NSTA 3PP1A 2W5AA 5H8GA 4N6ZA 4X2FA 3CJGA 3IPHA 3ZZEA 3FQSA 2WXVA 4FTOA 4K1BA 4FSNA 3CEKA 3UDTA 2VTOA 3FPQA 5JFVA 2C1BA 4M69B 2I7QA 1BLXA 5IA3A 3ORIA 4I20A 3FC2A 3Q6WA 4M12A 3T3VA 3ZEWA 4EK3A 4ACHA 5IA4A 2JAVA 1LR4A 2C30A 3C0GA 3ML1A 1ZWSA 2OJJA 2VWVA 2VWYA 3EFWA 1M2RA 3S00A 3OVVA 1URWA 3HZTA 3KK9A 4F7NA 3LIJA 4IQ6A 4QMLA 4MK0A 4R6VA 3W8LA 3QRUA 4K8AA 3R21A 4RX7A 3OW4A 3SHEA 3VS7A 4I4EA 3NYNA 5AUZA 2E9NA 3D2IA 1R78A 4DDGA 3GCUA 3DTWA 2Z7LA 2OJ9A 3DAEA 4MCVA 4A06A 5BYLA 3JVRA 1F3MC 4MYGA 4Z55A 1FVRA 1WAKA 5FM3A 3IECA 3ENHA 4EONA 3PXFA 2YAAA 2W5BA 1UKIA 3HV5A 3F7WA 5T68A 3IS5A 2YDIA 2PU8A 3V8TA 4JBVA 4Z16A 3V6SA 1PRYA 3RM7A 5A54A 3JS2A 3RPVA 1TQMA 4JX7A 4D5KA 3LFBA 3EB0A 4BCJA 4H3BA 5KMJA 3QRKA 4I22A 1KWPA 5KMIA 3QXPA 3TUDA 4PDPA 3O8PA 3OMVA 4XG3A 4GT4A 5EW3A 1S9IA 2RF9A 4WT6A 3PVBA 3TXOA 4APPA 1E1VA 1GZOA 3ZRMA 1IRKA 4YU2A 4GKHA 4C37A 2WOTA 3HMIA 2ZV9A 4E5AX 1H0VA 1U4DA 1OPLA 3LFAA 1WBNA 2X39A 3VQUA 4YURA 3ORNA 4UN0C 4U42A 5D7VA 2PMNX 5EM8A 3Q9ZA 3G5DA 2FSLX 4LYNA 5CEOA 3S0OA 5H8BA 2XK4A 3LQ3A 2BIYA 3RAHA 3H0ZA 2QOOA 4CTBA 2ONLA 5DT0A 5IDNA 2WZJA 2XALA 3EN6A 4QO9A 3BLHA 5HNBA 4RIOA 2R2PA 4PF4A 5CYIA 2X8IA 3FJQE 5FP5A 3THBA 1XBAA 4MQ2A 3HL7A 3GI3A 3UIXA 4J99A 4CLIA 2B53A 5BVDA 2QKWB 4YO4A 5LOHA 3BYUA 4YJQA 5M06A 4LUEA 4AZVA 3AC1A 4JG8A 4IWPA 2XM8A 4OGRA 4F6SA 4JLCA 3RP9A 2C68A 4E26A 4QOXA 3OXZA 4I94A 5KO1A 2GDOA 3GCSA 3GFEA 3SRVB 4NTSA 1HCLA 4IAAA 2Y4IB 4U97A 3BIZA 4TYIA 3OEZA 1ND4A 3Q5ZA 5IEXA 3GUBA 3KN5A 2YA9A 3C7QA 1XWSA 4O7NA 3DKGA 3IOKA 1I09A 4DLIA 3DS6A 2CGUA 4RX5A 3MH1A 4FUXA 4O91A 4BDDA 2WMRA 5A9UA 5J7HA 2VTSA 5KZIA 3QQLA 2XK6A 4O7VA 4MF1A 3PRIA 4EOSA 3C4FA 3IDPA 4PNIA 4NW6A 5IQFA 4HPUE 1F0QA 5FLFA 5TR6A 1H1RA 3CSVA 5A14A 4U40A 5JGAA 1YOJA 5JT2A 4UX9A 3VHEA 4UXQA 4F1MA 5I9VA 4GFOA 4UBAA 4PWNA 3KA0A 4HZRA 3W10A 4YO6A 2WQBA 2CGVA 4QP1A 4AXCA 4QNAA 5CU0A 4G3EA 2PMIA 2B9HA 3G9NA 4WBOA 2A0CX 2X4ZA 5LCKA 3U6JA 3E92A 2GQGA 2FSOX 2QOCA 4I21A 2Y6MA 1P14A 4O0WA 4X3JA 5AV2A 1OGYA 3MIYA 2REIA 4QQ5A 4FSZA 3O5AA 2GNIA 4I3ZA 1JKLA 2FSTX 2R3MA 2PZYA 3PSBA 4IJPA 3MFSA 5JRSA 4E6QA 3TKUA 2C0TA 4BTMA 4OTIA 2QURA 3E7VA 3BLRA 4HCTA 4N0SA 3O50A 2OICA 3G6GA 3Q60A 2O63A 4CXAA 4EHVA 2B1PA 5EQPA 2W5HA 3CS9A 3NW7A 2IJMA 4DEAA 4IFCA 4MBJA 2JIVA 5DLSA 3FLWA 4MD7E 3KMMA 3PSDA 1Q41A 4QMXA 5C8KA 3MB6A 4GK4A 4FK6A 2XNEA 3LAUA 4IMYA 2OWBA 2PUIA 2B9IA 2ZMCA 2VV9A 2J0KA 4UXLA 3QF9A 5HORA 5LMBA 2BAQA 5GJDA 2UZVA 3HMNA 4U41A 4BCGA 3NNWA 5C01A 1BKXA 1WVWA 4FZ7A 4RX8A 2HELA 5CVFA 4RZWA 3SX9A 2OKRA 5AA9A 5I0BA 3MFUA 1H07A 2GQRA 4K33A 3QA0A 4GUBA 3GC0A 4L46A 3VAPA 3UPXA 5M57A 3G0FA 5FXSA 4U80A 3FZ1A 3VF9A 3OUNB 4W8EA 1F5QA 1QCFA 2JFLA 3UE4A 2VX3A 3EMGA 4P2KA 1XQZA 2CNVA 2Q0BA 4K0YA 4ANBA 3DKFA 4F9YA 5I9XA 1QPJA 3E63A 3EQCA 4ERKA 2XNGA 4C59A 4AXFA 5H8EA 3QTRA 4EH4A 3R7OA 4AQCA 4BCPA 2HXLA 4D5HA 1ZYLA 1W82A 3QD2B 4Q9SA 3IOPA 3ROYA 4G5JA 4J8NA 3NNXA 3W2CA 5K4IA 3S4QA 3UVPA 2BRMA 3NYVA 3DK7A 2R3FA 1YWVA 4M15A 4EJNA 4TYGA 3M11A 4QYYA 5GIPE 1KE6A 4UZDA 3HA8A 3WF7A 4M3QA 4Q9ZA 3MVHA 2WTCA 2QQ7A 4K18A 3BQRA 3OXIA 2OIBA 2BHHA 1XMLA 3L8XA 4Z7HA 1QL6A 3M1SA 3TYKA 3PJ8A 3R7YA 3RPYA 3MGYA 3W0MA 5CSWA 5IQEA 3HRCA 4X0MA 4BGHA 5HLNA 4Y73A 1OPJA 4ASDA 1YOLA 3FV8A 2A4LA 1ZZ2A 1PW2A 4O0VA 4PMPA 4HCVA 5J95A 1Y6AA 3UIMA 5AUUA 4RQVA 4RJ4A 5AEPA 4TYHB 1O6LA 2GHLA 4OTWA 1U5QA 2Z60A 5KMLA 5HD4A 3CPBA 3ORKA 2QOIA 1KE8A 4G9RA 4PTCA 3R9RA 3OCSA 4FGRA 4LV5A 2KTYA 4G16A 4D2SA 2FB8A 4F7LA 2R5TA 1H4LA 3FKNA 3KRJA 5E8SA 3SVVA 2Z7QA 3OW3A 2BZHB 3JVSA 5L8JA 3EQDA 3D0EA 3R8UA 3UVQA 4DG0E 3OHTA 4F1TA 1UVRA 1H1SA 5EFQA 2ITUA 3A7FA 3EIDA 3NFGB 2YIXA 4W8DA 4ACMA 2VWWA 4C34A 2CGXA 2RFDA 4DEEA 3TIZA 4E8AA 3C5UA 4FKJA 3QX2A 5CU3A 4BCNA 3OTUA 3OOGA 3DA6A 5F94A 4YBKA 2X6EA 3IGGA 4RIWA 3UNKA 2GMXA 4ASXA 4NU1A 4FBXA 2C0OA 3VBYA 3UIBA 4FKSA 2FGIA 5C03A 1PXIA 4G9CA 5LMAA 3R8LA 1OIRA 3BLAA 5JMSA 3HEGA 4FIJA 5HICA 1GOLA 4FEXA 3P0MA 4W4YA 4HCUA 3AT2A 4A07A 4JQ8A 3DBCA 3TIYA 5K5NA 2F7EE 4RVKA 4C4JA 5BMMA 4ALWA 3R2BA 5HCXA 1FBNA 4DF3A 3H30A 5AWMA 3WILA 4WG5A 4MWIA 4EOOA 4LOPA 3RWQA 4AZFA 4BCFA 2YDJA 4FVPA 5CQUA 4DGNA 3PFQA 4QTAA 3OCTA 4PX6A 4RC3A 5KBRA 4DCEA 4E93A 2DYLA 2OZAB 2HXQA 2PVFA 2YJRA 5HO8A 5HVYA 3CQUA 3LFFA 2XA4A 4TTHB 1OB3A 3R9OA 1KV2A 2HZ4A 2R9SA 4FIHA 5J9ZA 4JBOA 5ACBC 3ZMMA 4C0TA 3VBQA 3E8CA 3Q32A 4FKWA 3QALE 3WE4A 1YW2A 2EXCX 4YJVA 5DWRA 3TN8A 3WIGA 1PMNA 4RWIA 5KMMA 5EDRA 4MAOA 4AOTA 4IIRA 4FYNA 4J1RA 3DJ5A 3DV3A 3VN9A 4XG9A 4DBXA 4ZY4A 5AP2A 1Z5MA 3BHVA 2QOFA 3N4VA 2X8DA 4OR5A 4OTDA 3UO4A 3VRZA 1VLRA 3O2MA 4O7YA 1XJDA 2BKZA 3F3WA 3LFQA 4FV4A 1W84A 3T9IA 3ZXZA 4DHFA 4JDKA 2YCQA 1BX6A 4IC8A 2PZRA 4GSBA 5C4KA 1YHVA 4ERWA 3Q2JA 3TZ7A 4QP6A 3GOKA 4U6RA 4GL9A 2XUUA 5HX8A 5JRQA 4LRKA 1KE7A 4XLVA 5HG5A 5ICPA 4RT7A 3ZLSA 1VR2A 1WBVA 4A4LA 3OOMA 4G17A 3RI1A 2WEIA 5HBJA 4DH7A 4D28A 3FMHA 3NIZA 2VZ6A 5CAPA 3N4TA 4EOIA 5L8LA 2PE0A 3ERKA 3W8QA 5L6OA 3POOA 3PIXA 4QP3A 3SKCA 3BHTA 2R3NA 2PHKA 2AYPA 3TI1A 1ZXEA 5EYDA 3RAKA 4IFGA 2HAKA 5ETIA 3A60A 4DEBA 4G3GA 2UZDA 4KUJA 2QHMA 1IAJA 3NW5A 2ITNA 5EM5A 3SDJA 4EUTA 2XRUA 4FUYA 4NZWB 2Z7RA 1OZ1A 4IX6A 4BJJB 3PE2A 3L8SA 2BTSA 3PVGA 2VO0A 3LHJA 2ZJWA 3RPSA 4I4FA 5CNNA 4G6LA 3VS1A 3COHA 3GB2A 4AP7A 5IUHA 1LEZA 4FL2A 4ZSEA 5CVHA 3MPTA 2VTPA 3W55A 2JITA 1DAWA 1W0XC 3HUCA 4MH7A 4QP8A 3VBVA 5FBNC 4A9SA 4AZWA 5IF1A 2GFSA 2J5FA 1WBSA 4MXYA 3WZKA 4JG6A 4KABA 3OZ6A 1SVEA 4E6AA 3JR1A 1YXVA 3QTXA 3SRVA 2PVMA 3DLSA 2WTKC 1ZY4A 2WFYA 4XV9A 3LFDA 2XNOA 3QKKA 4O7SA 3DFAA 1PXKA 3IQ7A 2OJGA 3D9VA 4X2GA 4I5HA 4YJTA 3QYWA 2YHVA 3K54A 5CALA 4U0IA 3CP9A 5EKOA 4KWPA 2NRUA 5ANKA 4RA4A 2GPHA 4YMJA 1U5RA 2UUEA 5DN3A 4EYJA 3UTOA 3TNIA 5E8TA 3L9LA 4WSYA 3CTHA 4L52A 4NM5A 5HI2A 3TKHA 3U8WA 3PJ2A 2Q0NA 5CY3A 3ZUUA 4EJ7A 5KBQA 4XEYA 5HU9A 3C51A 3ORPA 4DHJA 4CRLA 2F49A 2BIKB 4KKHA 5E91A 4JVGA 3GU7A 1YQJA 1XH7A 3KCKA 4XP2A 1MP8A 2PVYA 4C36A 5CAOA 1P2AA 1QPEA 1FVVA 1Q8WA 3MWUA 3QTWA 4LMUA 1BYGA 3QCXA 3UZPA 3N51A 4U5JA 4TWCA 5CU6A 4LI5A 3FLYA 3K3JA 5AIRA 4L01A 4AXEA 3V51A 5BYYA 4L9IA 2YISA 1KE9A 4P5ZA 2I0VA 3A8WA 1JBPE 2GFCA 4FKUA 3V5JA 2XBAA 4P4CA 3B8RA 4WNPA 2JDTA 3DJ7A 4E73A 1M17A 3F69A 5FDXA 3FHIA 4JG7A 1H00A 2W9ZB 4QMVA 4D4VA 4IB0A 1RE8A 5A4LA 5JQ5A 2ZDUA 5LVPA 4BDHA 4FZDB 4RWJA 5FTQA 5IH6A 5M4IA 2HYYA 2YIQA 4LUDA 2J0JA 2WEVA 4G3FA 4GEOA 5HLWA 2W0JA
chains in the Genus database with same CATH topology
3E93A 5CXHA 5DR2A 4M0ZA 3O23A 4CQEA 4FV0A 3C4EA 3VHKA 5A4EA 4O7ZA 4XV1A 3OTVA 3V5QA 3DZQA 5D7AA 5HG8A 4AFJA 4FV3A 2V62A 3EFJA 4ZTQA 3BV3A 2JAMA 1X8BA 4XJ0A 4F1OA 2IG7A 3ACJA 4UWBA 4DFYA 3U6HA 1GIIA 1PXMA 3G33A 1UU3A 2O5KA 3BEAA 3VJOA 4USFA 4BB4A 3FMEA 2F4JA 2UW0A 3L1SA 5DGZA 3UYTA 3WF5A 3P86A 2ZAZA 3FYKX 2BCJA 3H3CA 4D1XA 4F4PA 3SW7A 3PYYA 2OZOA 4IHPA 5HU3A 3D7ZA 2Y8OA 2E9UA 2XNBA 4FEWA 4QMWA 5IA2A 4FV8A 4ZSLA 2X1NA 4AG8A 2EVAA 4RC2A 4YZ9A 1OVEA 3DNDA 5EW9A 1B6CB 4D55A 4E20A 5KE0A 3EYGA 5EDQA 3NX8A 2FO0A 4CFUA 4J53A 3I5ZA 5GJGA 2ZFYA 5M53A 4BVUA 2GCDA 3JY9A 4AUAA 4XOZA 4H58A 4FZ6A 3MN3A 2HWPA 1GAGA 4QP4A 4BICA 1A48A 4TZRA 2QCSA 4ZMFA 5AX9A 2WMVA 3FYJX 4FMQA 1I44A 4YSJA 2WMAA 3MH0A 2XJ0A 1R39A 3KRLA 4FGBA 2XP2A 4LDTA 2GNLA 2XANA 4FYOA 4TN6A 4X3FA 5AV4A 4HZSA 4IX3A 2VNWA 3UZTA 3MESA 4FI1A 3VW6A 5ANJA 5BUJA 4YHFA 3V8WA 3Q9XA 4N6YA 4WHZA 5AP7A 2J5EA 3G0EA 4X7QA 1GY3A 4BZOA 1XH5A 4CEGA 2BRHA 3VW8A 3MH3A 2B9FA 4FG8A 1JOWB 1SVHA 3SLSA 3RCJA 2IW6A 1L8TA 2JLDA 4C4IA 5EHLA 4XV2A 5HBEA 4I92A 3U54A 3FI3A 3AQVA 2RIOA 2X9EA 1IR3A 3PWYA 3D5VA 3HDMA 5J8IA 4YTFA 2HIWA 1OL7A 5TT7A 4FKQA 4USEA 4OTQA 1PMEA 3W2SA 3AC2A 4QP7A 3SW4A 4OTFA 3FEGA 5CQWA 4BZNA 2C3JA 2E9VA 4GYGA 1JSVA 4FTKA 1NY3A 5D9HA 4TYEA 3PPJA 3BHYA 4CT2A 5J1VA 3ZUVA 1P4OA 3VONA 3PZHA 3C0IA 2BAKA 1UA2A 3Q3BA 2VTQA 3E7OA 2WTJA 3MY1A 3M42A 3VRYA 2FA2A 2PVHA 4Y5QA 4FNWA 2C5YA 4DEIA 3OWJA 4FKLA 4GG5A 4QDEA 2W99B 4YNEA 4ZTMA 4DGOA 3KMWA 5DHJA 5H2UA 2ITPA 2V7AA 4R5SA 3WARA 2YZLA 4I6FA 4IDVA 3GXLA 3FL5A 4RPVA 3PE1A 5JZJA 1PF8A 1TKIA 3KVXA 1AGWA 5CSHA 1JKKA 4NKSA 3OROA 1WBWA 5AP0A 3I7BA 3H10A 4ZJVA 3Q5IA 1MQBA 4RBLA 4FV2A 1ZZLA 3DXNA 2A19B 1SVGA 2XARA 1Y57A 2XKCA 3O8UA 3MA3A 1WCCA 3CQWA 4EBWA 5DIAA 3VS0A 2ITQA 3K5VA 3VVHA 4BDEA 4JIAA 2GTMA 1KOAA 2F7XE 2OBJA 4FIGA 5DNRA 3W2PA 3GEQA 3KB7A 3QZGA 5CSXA 3HMOA 4QQCA 4LGHA 3QHRA 2PL0A 4DA5A 2XEZA 3AGMA 2BDWA 3F9NA 2YCFA 3KULB 4KRDA 5AADA 3FQHA 4EWHA 4G6OA 4EOLA 3TZMA 4C38A 3I6WA 3FWQA 4ZY5A 5LCJA 3VNTA 2FH9A 2OU7A 3HP2A 1CSNA 1M14A 3KREA 4YLJA 3V04A 4I6HA 2DS1A 4WKQA 1M7NA 3PG1A 2XJ1A 4JDHA 3ITZA 3QC4A 4PRJA 4RIXB 4IBMA 3DY7A 2P2HA 1TFFA 2Q83A 2UW7A 3FY2A 4RFMA 4WIHA 3E8NA 3PPZA 4DE4A 5EQEA 3ATSA 2IWIA 1R0PA 2QOKA 3DFCB 4RRVA 4RJ6A 4X2KA 3DBEA 3SGCA 4BGQA 1ZLTA 2G15A 3EZVA 2OH0E 4QMMA 2F2UA 2PVJA 5LVNA 4CTCA 4F63A 3CCNA 1XKKA 2HOGA 2R0IA 3R1SA 2OF4A 5CWZA 3HECA 4EOJA 4BR3A 5HTCA 2B55A 4U43A 2P3GX 4FVQA 5FRIA 5M44A 3EN7A 4EKKA 3EN5A 4ANMA 4LRJA 3PPKA 4BI0A 4CFWA 2WTKB 2VNYA 4YC6A 2BPMA 3P7AA 4BY9E 5L2WA 1O6YA 4BCHA 3QX4A 4EH8A 5LVOA 3VO3A 3P5JC 3WYXA 4Y72A 2YJSA 5IH5A 5E1EA 3GVUA 4RFZA 4D58A 3DAJA 4O27B 3F88A 3D7TA 2QI8A 3A61A 5FEDA 3B2TA 3ZU7A 4DBNA 3FBVA 1OPKA 3KXNA 4I0RA 3AT3A 2PUUA 4YLKA 5D12A 3W2QA 4ALVA 2ZB1A 1H1PA 1RQQA 2PSQA 3CBLA 4GIHA 3EOCA 1E1XA 3KXHA 4N70A 3V01A 2F7ZE 3TCPA 3QGWA 5E8XA 2XZSA 5LMKC 1ZARA 2BALA 3FLQA 3HAVA 3B8QA 2BZKB 3QCQA 3UO5A 4NM3A 5JFWA 3A62A 4YZCA 4RZVA 4RG0A 3GQLA 1Q3WA 5DR9A 5LQFA 2A27A 5GNKA 4EH5A 2QNJA 1FVTA 3DDPA 2VTHA 2XIZA 4OTRA 4C4EA 2AC3A 3OT3A 3II5A 3RHXA 4TWOA 4AGDA 2PMLX 4QPSA 3I4BA 4IVDA 1FMKA 4YPSA 3PXKA 4YTHA 5JN2A 1XH6A 2C4GA 2CPKE 4JR7A 4YNOA 1V0OA 2HZ0A 4P7EA 1JQHA 2Y6OA 2QHNA 5F20A 2JIIA 3DXPA 3MVLA 3TUBA 4BHNA 1YRPA 3AC3A 3NZ0A 3NUAA 4L43A 2PWLA 4AGUA 3KVWA 3F3VA 2NYAA 2QKRA 3FMJA 4LV7A 3I1AA 3VBXA 4D1SA 3LJ0A 1WBOA 2ITVA 5BPYA 5KMOA 2CKOA 3AKKA 4ZTLA 5L6WL 3EQFA 2VN9A 3NCGA 3MDYA 3QGYA 4OUCA 2PPQA 4RJ7A 2QC6A 1LPUA 4M13A 2VX0A 4A9UA 5EI8A 2R3RA 1M52A 4IJ9A 2R3PA 2W17A 3HKOA 2NO3A 3AMAA 4I41A 2IVTA 3FQEA 3HLLA 2F9GA 4IM2A 4RQKA 5EI6A 4B4LA 3HMMA 2ZM1A 3IW4A 3C1XA 3WYYA 2VRXA 3MS9A 2QOLA 4MHAA 4YGAA 5KKRC 2IO6A 4AZSA 4JBQA 2Z2WA 1UNHA 2JKQA 2XBJA 4PTEA 3UVRA 3ZFYA 1Q99A 4F08A 2GS6A 5HNIX 1H27A 4EH9A 3I79A 1VZOA 5M4FA 3LCTA 4I6QA 3NFFB 2J50A 2B9JA 1FPUA 2XB7A 4YLLA 5IQBA 2C5NA 3CD8A 2PUNA 2R3JA 2W1CA 1J91A 2WGJA 2OXYA 3ZDUA 4OBOA 4XG2A 3U9CA 2QONA 3DBFA 4TWNA 4L7SA 5HEZA 4NW5A 4M8TA 3KXXA 3ZSHA 4CSVA 5FXRA 3AT4A 4YC8A 3WZJA 4PTGA 2XIRA 4U44A 5CTPA 3WZEA 3D15A 3IW7A 3NYOA 4WG4A 2C3LA 3CPCA 4LV8A 3R1QA 4I23A 3TNHA 2CGWA 1IA8A 4FTAA 2XCKA 3QQUA 2OFUA 4IW0A 5CENA 2XS0A 3ZLXA 2WTWA 1Z9XA 3GOPA 4RLKA 1O9UA 3ZFXA 3W33A 3FE3A 4TYJA 3SQQA 3CIKA 2J6MA 1W83A 3QA8A 1LEWA 2Y0AA 1UU7A 3OXTA 3BELA 1B39A 4NJ3A 4A4XA 3SXRA 3BU5A 4YR8A 3EH9A 1ZY5A 5AIKA 3GFWA 5AAGA 1K3AA 3VWAA 3MPAA 2UW5A 4DLJA 3O51A 5BX0A 2NRYA 2WTDA 2QU5A 4KRCA 2R3OA 3LKMA 4WRSA 3F2NA 4NYEA 4GT5A 1RDQE 2EU9A 3NAXA 5HNGA 3UZRA 2J0MB 3H4JA 4LOOA 3IGOA 3RPRA 1ERKA 5K9IA 3BQCA 4KINA 5DA3A 4YZBA 4RGJA 3S1HA 4GMYA 3VBWA 1Q8TA 2JBOA 1RJBA 2YM5A 5EYMA 3NDMA 3FI8A 3KXGA 3LJ1A 3ORLA 3QQHA 4MBLA 2ONLC 4PUZA 3QUPA 4CD0A 4R78A 4F7JA 5T3QA 5HX6A 4H05A 3H9FA 3TJDA 4FKIA 4BDKA 2CKPA 5C26A 5JGDA 5M4CA 4A9RA 2PZPA 3FPMA 2CLXA 2WMXA 2YAKA 3VS3A 3KU2A 5IEVA 3QRJA 3ZXTA 5AP3A 5M56A 5IQCA 3D5WA 4IADA 4QNYA 1YWNA 4FV6A 3ZO4A 4QMUA 4TXCA 3QZFA 2XKDA 3G9LX 4MNEB 1OIUA 3BWJA 4TRLA 3FSKA 2BR1A 2LGCA 4RJ5A 2WMUA 3V5TA 4F0IA 1J7IA 2BZJA 2EB3A 4DH1A 4U45A 4HVSA 2IZSA 4ZZNA 3UQCA 3RKBA 3QKMA 4M97A 2W4JA 2G2FA 2RFSA 3L9MA 5HQ0A 2R3GA 2W7XA 4IE9A 3AXWA 2UVYA 3ZSIA 3KGAA 2C5VA 4FOBA 3UQGA 5ETCA 4FEUA 4FJVA 4CCUA 1PXOA 2CJMA 3BYMA 3LMHA 4UWCA 4PP7A 3F5GA 5CF6A 3PIYA 4QMPA 2ESMA 4WRGA 2XKEA 5EKNA 4BCOA 5DPVA 5M51A 3FLSA 3E62A 1SM2A 2QO9A 4E5WA 4ZMEA 5HCZA 4PQNA 2UW8A 3SA0A 4O86A 4AN9A 4ANLA 5GINE 4FICA 3MI9A 1JKSA 5IA0A 5F1ZA 4NCTC 1VYZA 2J2IB 3DBQA 3ODYX 5HIEA 2VWUA 5J1WA 3I6UA 3PRFA 4D4SA 3HNGA 4EOMA 3PJCA 4E4LA 4R77A 2WIPA 2X6DA 2YZAA 4GKIA 3V5WA 5FM2A 2OXDA 3QHWA 3MVMA 3IW8A 4B6LA 4BCIA 2GS7A 3R7EA 4ONAA 4C2WA 4QMSA 3DKCA 3TM0A 3SG8A 3R7VA 2CN8A 4UYNA 3ZO1A 2B52A 4ACCA 4RLLA 5HVJA 3BV2A 3DGKA 1VJYA 2QOQA 4EYMA 1K2PA 2B0QA 3GT8A 3PJ3A 5ANGA 5BQ0A 4RIYA 3KF7A 3I81A 3ORTA 4MXAA 2JKMA 3C4XA 2EUFB 4FEQA 3R9HA 3WOWA 1XO2B 2X9FA 5L2SA 1OKVA 3C4ZA 2IW8A 4EK4A 4DEGA 4G3CA 1YKRA 1O6KA 5B0XA 1Q8YA 1S9JA 4Y46A 3QRTA 3W0NA 4A9TA 3LFNA 3AMYA 1Y6BA 2YM6A 3BX5A 3GU8A 1NXKA 3WBLA 4FIIA 3WE8A 3COIA 4FC0A 3F3UA 3FC1X 1YXXA 3QCSA 4YP8A 4I5CA 1CMKE 4YC3A 5H3QA 5LARA 5TKDA 4QMYA 4FT9A 1A06A 3R8VA 4EQMA 4FA2A 1JPAA 4FNZA 4O21A 5IA5A 2OK1A 5CT0A 3T9TA 2YCRA 4QTCA 3HYHA 1GIJA 5AA8A 4F9AA 5CEPA 5CNOA 2CLQA 4HGEA 4O6LA 4BHZA 2W1HA 5J9YA 4FZFB 5L8KA 4V0GB 4QDVA 2A2AA 3FLZA 2W05A 2Y9QA 2W1ZA 3COKA 3IKAA 3HP5A 4FSWA 3RINA 4A7CA 4AN3A 4LRMA 1PJKA 2UZWE 4RVMA 3RGFA 2VTTA 5IH4A 1MRVA 1PMUA 5E8WA 3UOHA 4AF3A 1Y91A 1UV5A 3E5AA 4FV9A 5C9CA 1TQIA 2UZLA 2W96B 4KD1A 3W0SA 5FUTA 4G1WA 3RNIA 4DTKA 2H96A 3NUSA 3QQKA 4C4FA 2B7AA 4EQCA 4CGAA 5AAEA 5HG9A 3MJ2A 4XOYA 3H0YA 2XIYA 5L3AA 1REKA 1IASA 3RM6A 3OF0A 4RVTA 1R0EA 3FI2A 2PTKA 2QU6A 4NT4A 3R8PA 1HCKA 3TMOA 2A1AB 2JDOA 2W1DA 1GNGA 3C9WA 3DXQA 3FZOA 3G15A 3G90X 3LLAA 3OBJA 3QC9A 1NVQA 1KV1A 2PVLA 2I0EA 3EN9A 4FSUA 2IN6A 3RK7A 1HOWA 4BTJA 4ZSAA 3EHAA 4ZTSA 2VAGA 4M67A 1APME 3NSZA 4RFYA 3TZ9A 5BVFA 3FDNA 5CF5A 4GUEA 4XG7A 3QYZA 5M4UA 2FSMX 3BYSA 3KL8A 5CU4A 4FTMA 4FV1A 2Z8CA 4A9YA 1XBBA 2QO2A 4AGCA 4HJOA 5BUEA 3LM0A 5I9YA 3N9XA 4ZIMA 1FINA 3ZH8A 2WU7A 3RTPA 2KULA 4F0FA 3BE9A 2UZEA 3QQFA 2XF0A 4K11A 4MKCA 5DE2A 3CY2A 4FTRA 4BBFA 4BN1A 1PXJA 4AU8A 3NVMB 4DINA 1Q24A 1U46A 2AC5A 5HCYA 2ZYBA 4BDCA 2R3LA 5KKRB 3SXSA 2OFVA 4H3QA 4NK9A 3ANRA 3D2KA 1DS5A 2PULA 3FAAA 3R1YA 4GU6A 3VS4A 4ANQA 2VO3A 3OUKA 5FG8A 4AZTA 5E92A 3KF4A 4EOKA 3HV4A 4GCJA 4JNWA 4WA9A 3ZYAA 5EQYA 5JFXA 4J95A 4FTUA 4X21A 2WMBA 3ZO2A 3Q6UA 4EOPA 4DHIB 5BV3A 4O84A 4R7IA 3CGOA 4G6NA 4DTAA 4JMQA 1FQ1B 4X2JA 4FODA 3TKIA 4FL1A 1OL2A 3DB8A 3C50A 2BRNA 3KXMA 2QO7A 2LAVA 3U55A 4I6BA 4C35A 3ZLYA 3PA4A 1ZYJA 1SNUA 2H34A 4V01A 2C69A 2XJ2A 3ZTXA 5HESA 5HVKA 3JYAA 2C5OA 1UNLA 3TV4A 1SZMA 3F3TA 4AA0A 2G1TA 2WO6A 3DLZA 4MXOA 2HZNA 3H9OA 4M0YA 5FBOA 3SG9A 2X2KA 4AA5A 3PXZA 2W9FB 4R3PA 5EM6A 4BI2A 1BL7A 3VS6A 4CMUA 4C62A 1OIYA 4L7FA 4J71A 3QTUA 3PJ1A 4ALUA 4EHGA 4M68A 1UNGA 4EK6A 3MYGA 4IZAA 4AN2A 4BIBA 4ANSA 5E90A 5T6KA 4FX3A 3ZS5A 3VIDA 4FSTA 3GC7A 3RAWA 4G31A 1M2PA 5BUIA 5AP1A 4ASZA 4QYEA 2R3KA 3LCOA 2JGZA 3OFMA 3EQRA 3Q4CA 3PY0A 4K2RA 5DG5A 3UG2A 2BRBA 3W1FA 5D10A 5DRBA 1JNKA 1J1CA 2YM4A 4CZTA 4E5BA 4H3PA 2CN5A 2X7GA 4L3JA 4EOQA 1YWRA 3TNPC 1SMHA 3ZONA 1KOBA 1OL1A 2C6MA 4FTQA 5DYJA 3FKOA 3T3UA 1IA9A 2XYUA 3IK3A 1OIQA 4RA5A 3BBTB 4HOKA 4IACA 4YJPA 2YM7A 3ZM4A 4O0RA 2VO6A 1PHKA 2R64A 2V22A 4ITJA 1URCA 4JT3A 1YDSE 2Z7SA 3HV3A 3LJ2A 4RMZA 4YSMA 1OKZA 1W8CA 4ORKA 5LVLA 3OWPA 4IM0A 4DGGA 3DU8A 1YI4A 4J7BA 2W1IA 2JC6A 4KNBA 4U3YA 4B7TA 3OY1A 2J0LA 4S32A 4BBMA 4FNXA 3FXXA 2X7FA 3NRMA 4XX9A 2B54A 3G51A 3ZZWA 1FOTA 4E6CA 5M09A 4RSSA 4AACA 5D1JA 2CHLA 1Q8ZA 3CTJA 4FSYA 2B4SB 2W1GA 5AUYA 5FTOA 4ENXA 5IMXA 3K3IA 5B7VA 2WMQA 2CKQA 5HIDA 2OXXA 4IX5A 4R5YA 3R9NA 2PZ5A 4ID7A 2J9MA 3ZSGA 3PLSA 4PDSA 3F6XA 4ZS0A 4WOVA 3HA6A 4EL9A 3NUNA 3ZHPC 4Q5HA 4O22A 5JFSA 3Q4TA 4KSQA 3MFTA 5FEQA 4YJOA 4I5PA 4ZLZA 2OIQA 5C8NA 1FGIA 3ZBXA 2VWIA 4BZDA 5HTBA 3F82A 2JKKA 1STCE 3AKLA 3OY3A 1YDTE 3UMWA 5IISA 3COMA 4E4MA 3EL7A 4JAJA 2IVUA 4JQ7A 1CKIA 4DGMA 4JR3A 2WU6A 3V8SA 5C4LA 3TEIA 2VTMA 3P7CA 3TJCA 4FTLA 4X6QC 4Z7GA 3EFKA 3RNYA 3A7HA 3AD6A 5DH3A 3MH2A 4U3ZA 2WAJA 2ZDTA 5E8UA 4C4HA 2ITOA 5I9WA 4IVBA 5IPJA 5IU2A 4W4XA 5L2IA 3B2WA 4O0TA 4DH3A 2P0CA 3CR0A 4I5MA 3U4WA 4CV8A 3QD3A 3OWKA 2R4BA 4YBJA 3RMFA 4E6DA 2UW6A 1QPCA 5B2MA 1OUKA 3NCZA 5AUXA 4BYIA 5CANA 3CD3A 1YXTA 3NGAA 3UQFA 2X2MA 2X81A 2XK8A 4CFVA 4C61A 3BWFA 3PDTA 1QPDA 2R3HA 4DH8A 5DR6A 3D5UA 3ORXA 2XIKA 4O82A 2VWXA 1MRUA 1OL5A 1UU8A 3PVWA 4KKGA 3VUMA 5HGIA 5K5XA 4IB3A 1MUOA 5IQIA 3UOKA 1Q61A 4WG3A 2VWZA 5GIOE 3N4UA 4AOJA 2O65A 1P4FA 3MTFA 3P79A 4U81A 3KC3A 4R1VA 2OO8X 3CKXA 1KE5A 1BI8A 2OSCA 1TQPA 3NUUA 2PVNA 5A4CA 5BVKA 5CF4A 4I6LA 2OJFE 3LOKA 2CNQA 2O0UA 3D4QA 2VTRA 4LG4A 3PP0A 4LOQA 2NNWB 4LL5A 4YUQA 3DTCA 5EK7A 2PZIA 4QEBA 3ZRKA 5D11A 4FR4A 5M55A 3NS9A 4JBPA 4TYHA 3UDSA 5IG1A 5AP4A 3TDVA 4AGWA 4ENYA 3NUPA 3CLYA 4WUAA 2NPQA 3RWPA 3ZFMA 2H9VA 3EJ1A 3QXOA 4QYGA 4EKLA 4L45A 5CSPA 3ULZA 3P5KA 2RFNA 3NNVA 1YXSA 3OD6X 5IQHA 2VGOA 3PSCA 4JDIA 5ITAA 3FSFA 1XH4A 2O2UA 5EH0A 4IZ7A 2WPAA 2BTRA 3E3BX 1GZNA 2ZMDA 2R3IA 4LMNA 3ZEPA 1G8KA 5DVRA 3PY3A 5HLPA 3ZDIA 2HY0A 5CU2A 3SC1A 4XYFA 1TVOA 3R7UA 2SRCA 3LPBA 3BKBA 2C3IB 3NW6A 4JQEA 4RVLA 3LCSA 4F64A 2WMTA 5F4NA 3Q96A 3DDQA 3MA6A 4ZSJA 4O6EA 2H6DA 3R1NA 4TWPA 5G1XA 1UU9A 4D4YA 2WKMA 2BFXA 2PE1A 3BU3A 4RX9A 4O81A 2E2BA 2PMOX 4NTTA 4AW5A 4PMSA 4DFZE 1QMZA 4ITIA 4GK3A 2ZV7A 2YCSA 4PV0A 3AG9A 3BL7A 3QTSA 4L3LA 2RG6A 4JL9A 5AP6A 2ZOQA 5TOZA 1JSTA 2QR8A 1UKHA 3R71A 2UW3A 3MTLA 3U4UA 1V0PA 4B99A 3MVJA 2PY3A 2JBPA 3MBLA 4IB1A 1J7LA 4RJ3A 3ZLWA 4I93A 2BRGA 2WQNA 3QAME 4FV5A 4PY1A 1ST4A 1PYXA 1G5SA 3PTGA 3QL8A 3ZCLA 4AA4A 2BVAA 2J90A 2XAMA 3SAYA 3I60A 2BHEA 1JVPP 5A4TA 2V7OA 4M84A 4AAYA 4NFMA 3W32A 3VUHA 1BI7A 3FUPA 5CI7A 4F6WA 5IA1A 3ZOSA 5CS6A 3HUBA 4L44A 4APCA 4YHTA 2OZAA 3IDCA 3TDWA 4E7WA 1L3RE 2VTNA 4TW9A 5KNJA 4AZEA 3Q4UA 1H8FA 3QTQA 3AD5A 5AV0A 4FZAB 2XK7A 1ZMVA 3MY5A 3OC1A 3D94A 3QFVA 4CT1A 4GFMA 5A6OA 2PK9A 3E64A 2WIHA 1CDKA 3HRFA 4EK8A 4IAIA 5J87A 2GNFA 2UZOA 3G6HA 4UWYA 3NR9A 5EHYA 3SOCA 3ZBFA 4ACDA 4IZ5A 2VGPA 1H0WA 3GCVA 1XH8A 1U54B 3EYHA 3KEXA 4X3FC 3O8TA 2PVKA 3RAIA 4RIWB 4PDYA 4FV7A 2P55A 2J4ZA 4KIPA 4OTGA 4I0SA 4U7ZA 4CKRA 1UWJA 3FMMA 4BDFA 4JRVA 4FE2A 5KHWA 4EH3A 4V05A 3IO7A 2I0YA 3WI6A 3Q2MA 2C6IA 2F57A 3QLGA 5AV3A 3RVGA 4BDGA 2E9PA 4DITA 4KS7A 5BVWA 4U8ZA 4WUNA 4ZTHA 3ZRLA 1CKPA 4Z9LA 5TO8A 4QTEA 3QTIA 3JUHA 4AOIA 3KCFA 4MUQA 2AUHA 2HW7A 4NKAA 5KMKA 2X7OA 5AM7A 5HE0A 4TT7A 2ZB0A 2ERZE 4IAZA 4XG4A 4J97A 3RK5A 5ANEA 3DT1A 3P78A 3R6XA 4D2RA 2OH4A 4A4OA 3LMGA 3R2YA 4FKPA 3A7JA 3JY0A 1Q62A 1YOMA 3VULA 5CEKA 4FKTA 4J98A 2WMWA 4O83A 3ROCA 5E9EA 4C4GA 5CVGA 4ZJJA 5BNJA 3ALOA 3EKNA 4XG8A 4B0GA 4DEHA 3BPRA 1IG1A 2XMYA 4WNOA 3VS5A 2BMCA 4BRXA 1J3HA 4BJJA 2V5QA 2GHMA 4EK5A 1NW1A 3QTZA 4L67A 5BYZA 5E4HA 3O0GA 4KKEA 2C5XA 2HW6A 3IW5A 4PNKA 4IANA 4AE6A 2O8YA 1AQ1A 2OLCA 3PXQA 4F65A 1CTPE 4NL0A 2CCIA 2XYNA 2VD5A 4P90A 4OT6A 2ZM4A 3VUGA 4BBEA 3IW6A 1XMMA 1NA7A 3OCBA 4NM0A 3WF6A 2PE2A 3ZC5A 3RPOA 4AFEA 3FLNC 2VTAA 3JXWA 3GENA 4KSPA 3PY1A 4WBBB 4CCBA 4FKOA 2F2CB 2OW3A 3A99A 5DOSA 1BUHA 4J8MA 4BIEA 4KBKA 4JS8A 2XCHA 5ANOA 3ALNA 4IWQA 5CZHA 4DH5A 1G8SA 4CV9A 2VU3A 3L9NA 4PDOA 1DM2A 2UZUE 3NAYA 5CLPA 5M08A 2J0IA 3Q9YA 1ZMUA 5JK3A 2YM8A 1PKGA 1AD5A 4GRBA 3BGPA 4EC9A 4F78A 3F61A 2IZRA 3ATTA 1R3CA 2OGVA 5G6VA 3UJGA 3GCPA 2C6KA 1ZYCA 3M2WA 1ZOHA 2Z02A 3A7IA 4QMTA 2QLUA 5GJFA 2XRWA 5CAQA 4YJRA 3QD4A 5JH6A 2PVRA 2EB2A 5E8VA 4CFXA 3UC4A 2G01A 3OP5A 4NUSA 5DEYA 1MRYA 3HAMA 5ETAA 3NIEA 1Q4LA 4BF2A 2E9OA 4FT7A 4OW8A 4IWOA 3ZUTA 5HE2A 4LQMA 1H01A 3TTJA 4XNEA 4MXXA 2I1MA 3U9NA 2YFXA 4DAWA 3E87A 2GNJA 3FMDA 5J5SA 3OBGA 4XMOA 4H1JA 4K6ZA 2DWBA 4CMOA 5HO7A 5CZIA 4QQTA 4C33A 3KKVA 4NM7A 5EI2A 2WTVA 3OT8A 4X6RA 1OKYA 2YIRA 4R7BA 5KZ0A 3CY3A 4S2ZA 3UBDA 5LWNA 3TL8A 1U59A 4G2FA 4LFIA 2R7BA 4GT3A 3K2LA 4NH1A 4S31A 4Y5HA 2WQMA 4GK2A 5HD7A 3F2RA 5HIBA 1R1WA 1CM8A 3DCVA 1JSUA 4PL5A 3UODA 4ZTRA 3MW1A 4KAOA 4GJ2A 5KHXA 4HW7A 1T46A 4DYMA 3BE2A 3TNWA 2GSFA 3FHRA 5LWMA 4KBAA 5JQ8A 3DB6A 1G3NA 4NCTA 4AXDA 4FKVA 4Y85A 1ZRZA 4TNBA 4ITHA 4MXZA 4ACGA 4W4VA 1LP4A 4FTNA 5CX9A 2BZIB 3FZSA 3DK3A 2X0GA 3HDNA 3PUPA 3ID6C 3KRXA 1OECA 1WZYA 2YDKA 3FXZA 4GJ3A 3S3IA 3UP7A 4C7TA 5I4NA 4EHZA 4I0TA 1DAYA 5EYKA 4F7SA 5K3YA 4UV0A 2XIXA 3IG7A 2XH5A 4EZ7A 1W7HA 3QKLA 3D14A 5ETFA 4II5A 3GP0A 3LM5A 4G5PA 4FSQA 1OBDA 5B2LA 2G2HA 3KRRA 3UOLA 5FEEA 3KN6A 5CEMA 3E88A 3MB7A 3F5UA 4YJNA 4ZS4A 5AUTA 1WFCA 5AP5A 3HGKA 3ANQA 2I6LA 3V5PA 4DEDA 2OG8A 4HGLA 1BL6A 4WO5A 2YABA 1P5EA 2JD5A 1GJOA 1IAHA 2EWAA 4KB8A 3W0OA 4HPTE 3ZM9A 3Q4ZA