4AXCA

Inositol 1,3,4,5,6-pentakisphosphate 2-kinase apo form
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
432
structure length
394
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRLTSDEQHLWRENNELISSPNKEVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLARVNAANVDTSHDSALILNDHSLCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL-PENTAKISPHOSPHATE 2-KINASE
publication title Conformational Changes Undergone by Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Upon Substrate Binding: The Role of N-Lobe and Enantiomeric Substrate Preference
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 126
structure length 394
sequence length 432
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4axcA01
2XARA 4AXCA 4AXEA 2XAMA 3UDSA 4AXDA 2XANA 2XAOA 3UDTA 4AXFA 4AQKA 4LV7A 3UDZA 2XALA
chains in the Genus database with same CATH superfamily
1M2RA 3P7CA 4IIRA 3FMJA 4RIXB 1YXSA 5AUZA 4QRCA 3R71A 2Z7SA 1J7UA 4O86A 2YM6A 3MDYA 4IAZA 4C4FA 4W4WA 2H34A 2ERZE 3A8WA 3NYOA 5E90A 4AGDA 3FBVA 2VV9A 5B2MA 5JN2A 4FTMA 3ZEWA 4DHFA 3FYKX 1Q3WA 3LLAA 4BDDA 2ITWA 5DYJA 3V6SA 4YNEA 4H1MA 5DT0A 4EBWA 3OXIA 3Q4ZA 3PZHA 2GHGA 4IX3A 5C27A 4ACMA 4G34A 3D7TB 3IOPA 4JIKA 5E1SA 3RHKA 4MD7E 4F64A 3AOXA 2HIWA 2BFXA 3Q2MA 4GYIA 3BX5A 1PXMA 4FEVA 4DEAA 2VO3A 5M56A 4EYMA 2BHHA 4QMPA 3HA8A 5H8EA 4ZXTA 4F0GA 2VZ6A 2YCFA 3ZTXA 3VUHA 3VS1A 4HYUA 2YABA 1AD5A 2BRMA 4BCMA 4L00A 3R8VA 2OKRA 1NW1A 4CG8A 4EUUA 3FKLA 4I0TA 4FIGA 2ITPA 3RZBA 4DH7A 2Q0NA 1ZOEA 3FQEA 5ANKA 2B1PA 4EORA 4X0MA 4CNHA 5DG5A 4D4SA 2R3OA 4MBIA 4RJ7A 3BHUA 4RFZA 3I79A 4ZSLA 5HLWA 5M4FA 4C3FA 3PSBA 5AADA 5BVFA 4LYNA 2BZIB 2VWZA 4AGUA 1OKVA 3BHVA 4FVQA 2PVLA 3LM0A 5KUPA 1ZMUA 3LFQA 3SXRA 2Q0BA 2R0IA 4FTOA 4I0RA 3H0ZA 1J7IA 4I93A 2PK9A 3Q4CA 2XNGA 3TZ9A 1QMZA 3KMUA 2QHMA 3NWWA 4OTRA 4TYEA 5HG8A 5LOHA 4FT7A 4YLKA 3EYGA 4QTBA 4GK3A 4PNIA 3NYXA 5F95A 4M0ZA 4N6ZA 5CXZA 1FVTA 1ZMWA 2XKDA 3MY0A 1JOWB 2ZDUA 4RZVA 4XRJA 1WBTA 5E8YA 1H07A 4ZLZA 4LUEA 3KF4A 3PLSA 2Y4IC 2JGZA 5D41A 4Z7GA 3QRIA 3CQWA 1FGKA 2VTIA 3IW4A 2QODA 5KMMA 1H0VA 3ERKA 4IMYA 3MJ2A 3P5JC 4WBOA 5BVEA 5BV3A 4GS6A 3W0PA 3TNHA 5KZIA 3I4BA 4I5HA 3UOHA 1QPCA 4KUJA 2ONLC 5JH6A 3R8PA 4CFNA 4IB3A 4FZDB 4IFCA 5E91A 5T68A 3PE2A 4M97A 4LQMA 2G2IA 4ANMA 5C8NA 1WBWA 5CSWA 2C5XA 2XCKA 3OWJA 3II5A 3PWDA 3RM7A 2C5OA 4Z16A 4G3DA 3I7BA 4ONAA 3CIKA 1ZRZA 5AUYA 3T9IA 2C68A 3G0FA 3SLSA 4FSNA 2BVAA 3AD5A 3S2PA 3A4OX 3R9RA 3QF9A 3CLYA 2BCJA 2W06A 5JEBA 3DS6A 5IQBA 1VZOA 2PE0A 3TV7A 2Z8CA 3CD3A 4C02A 4EKLA 4X2FA 4O2PA 4EEVA 2EVAA 4MEDA 3LIJA 1ZOHA 3DXQA 1WCCA 4JNWA 4A9RA 4XV1A 2B9FA 2IVUA 3LLTA 2YISA 3C4EA 4YSMA 4YO4A 4MD8E 3UNZA 4E1ZA 3CPCA 2W1EA 5HICA 2EXMA 5CX9A 3VJNA 2H96A 4FSTA 2JITA 3TKHA 3NS9A 3PXYA 3F3UA 1G3NA 1WBPA 3SDJA 2Y9QA 2FVDA 4IZYA 1W8CA 4O83A 3MA3A 4OTDA 2G2HA 4JOAA 4K11A 4OBPA 5B2LA 2YEXA 1ND4A 1JPAA 2Z7LA 4CSVA 3ZYAA 3V8WA 2XANA 2LGCA 5LVNA 5HGIA 2VWIA 1SVEA 4BTJA 5EM7A 3PY0A 3L8SA 2UZWE 3FC1X 4YSJA 5CEKA 4ZS4A 1YWNA 3AKLA 4BDHA 4DGOA 1XWSA 1YHSA 1UU3A 2IZRA 5E92A 3QQFA 3VVHA 3IG7A 2ZM3A 4KNBA 4CQEA 1RW8A 3QA0A 4AE9A 2OFUA 5M55A 2QG5A 4L9IA 4F9CA 4ZMFA 2NRYA 3LVPA 3QD4A 3C5UA 4YURA 1Q5KA 3CSVA 4LMNA 1OKZA 5CEOA 3GU7A 3R04A 1MP8A 4J1RA 5HG9A 1F5QA 2PVMA 1UU8A 3S0OA 3W10A 3ODZX 5HCZA 2WQOA 5HE0A 4QMMA 3Q04A 2BMCA 2XIKA 4M67A 3WI6A 1AGWA 1KWPA 3UIUA 3QTZA 4IB5A 4JIAA 4YZBA 3JS2A 4M8TA 3HP2A 3V5TA 2GNHA 4FTTA 5HIEA 3ACKA 5B2KA 1GZ8A 2VTOA 4Y83A 2E9OA 3I7CA 3PSDA 4DG2E 4O38A 3UODA 2PZ5A 1JQHA 4FSYA 1OBDA 3EKNA 5IISA 5LMKA 4RIYA 1BUHA 1REJA 4FNYA 1T45A 4RQVA 2F57A 4CZUA 5JSMA 5L2SA 3BHYA 1TQMA 3NUAA 4O84A 2FSMX 3DV3A 4FL3A 3ID6C 3DLSA 4DITA 1PXOA 2HXLA 4ZSAA 3BYOA 2W5AA 3MB7A 3JVSA 2CJMA 4TW9A 5CVFA 1PW2A 2IO6A 4MXOA 4R7BA 5A9UA 3AMBA 2UZBA 3TT0A 3F61A 1O6LA 5LCKA 2R2PA 3RPRA 4DEGA 2P55A 3EQFA 4GCJA 4J96A 4X3JA 4YLJA 4O0SA 4FIHA 4QP7A 4TWCA 1KOAA 2YCRA 3F5GA 2F4JA 4BDJA 1H08A 5ETIA 3SA0A 5AMNA 3SHEA 1UVRA 3FZRA 5J9YA 3WIKA 4J8MA 3A8XA 1Q4LA 3MTLA 4TXCA 3R8MA 3IDBA 1NVQA 2C6OA 3MS9A 3Q9WA 4JG6A 3QU0A 5A54A 3HDNA 4FV9A 3FUPA 3DKGA 4O6LA 4AF3A 3OROA 3ULZA 1JVPP 4BICA 2OF4A 3SAYA 2BTRA 1BI7A 5I9YA 5KHWA 5JKGA 4D9TA 2F2UA 2XNEA 1ZYCA 4TNBA 4AZEA 4EI4A 3EB0A 2PMIA 4Y95A 2YZAA 2RG5A 3V3VA 3CR0A 3GU5A 3B2TA 3K5VA 4CKIA 2VX0A 5L6OA 4FT9A 4FX3A 3ZLSA 2ETKA 2OLCA 1ZYDA 5BPYA 4QQCA 1SNUA 5KKRB 3LOKA 1YHVA 3JXWA 4NM7A 1J3HA 4LV7A 4XG9A 2J0MB 3U6IA 3LCOA 3NUUA 3QC9A 3R02A 2GMXA 1PXKA 1VJYA 3QXPA 2B54A 5ACKA 3RAKA 4YBKA 2I0HA 4JI9A 5L6PA 3GCPA 4PMSA 4QYFA 5BUEA 2P3GX 3BLRA 4GK4A 4BCPA 3KF7A 1VR2A 2ITQA 3RPVA 3BYVA 3NIZA 4ENYA 3AXWA 3FMEA 4F78A 1JWHA 4BCNA 2BIKB 3O23A 3ZC6A 1V0BA 2H9VA 4DCEA 4O0YA 3SRVA 3QKLA 3LKMA 5DA3A 5M4CA 4TYHA 4FSUA 5AM7A 4A4LA 4PTCA 3BE2A 4F9WA 5IPJA 3F6XA 4HVGA 1A48A 3MN3A 3LCTA 2A27A 5HNIX 3G90X 3FDNA 2ONLA 3P0MA 4MVFA 4BGQA 4U5JA 3C5IA 3HMIA 2W4JA 4YHFA 3V6RA 5KCVA 5HO7A 1H1WA 4B9DA 3TUBA 3I6WA 1OL6A 5HBHA 1Q97A 3WZUA 1XHAA 4WG4A 4NZWB 3A60A 1M14A 4D4VA 3S4QA 3UNKA 2ITTA 2I6LA 1GNGA 3AGMA 4M69B 1FBNA 3GOPA 5ANGA 2J0KA 4E8AA 3R9OA 1CMKE 5KBRA 2PULA 4IC8A 4BJJB 2RGPA 4K6ZA 2W5BA 1JKTA 1U59A 4HVIA 4I6FA 4AW5A 3NNVA 4EOLA 2VGPA 5C4LA 3G5DA 1PXNA 4FSWA 4MH7A 5ICPA 4W8EA 4IJPA 3DAEA 2B7AA 4HPUE 4IAKA 4I23A 3HECA 2I0EA 4ZSJA 4P5ZA 5CVHA 3R83A 4XX9A 2HW6A 3PXFA 3FMKA 4NM3A 4QYHA 4XNEA 3BELA 4ACCA 4RX5A 5I9ZA 2DYLA 4G3EA 3R7OA 4IB0A 5IG1A 3PTGA 1LEWA 1ZYSA 4PMPA 4H1JA 4PDOA 4FV3A 4WRSA 3ZLYA 3ZBXA 5GINE 4JRNA 3TJCA 1OKWA 1PKGA 2KTYA 3ORKA 2P0CA 4O0XA 4EQCA 2NYAA 3U4WA 4FYNA 5M4UA 3BQRA 3LMHA 4HYIA 2BROA 3ZEPA 4J98A 1QCFA 3ML1A 4DN5A 2WU7A 5IDNA 5KMIA 5CS6A 5DGZA 4KB8A 5CSXA 4FZAB 1PKDA 4CD0A 2GHLA 1TQPA 3BU3A 3UJGA 4JBOA 2VTNA 2XK4A 3QKMA 3UNJA 5EI2A 4UX9A 3L8XA 2PUIA 4GIIA 4RJ5A 3W2QA 4R7IA 5EYDA 4IACA 3G6GA 3UC3A 2CMWA 3AT3A 5DR2A 5M09A 1OGYA 4BGHA 2R0UA 2BRNA 1IAJA 3EN6A 3ORMA 4FTNA 4UZDA 2IVSA 2W7XA 2GTNA 2RL5A 3O50A 4I20A 3ORTA 4HVSA 1U54A 3HV4A 2HZ0A 3KXMA 4AOIA 4DLIA 2DS1A 3OXTA 4R5SA 4GFGA 5E8XA 3TIYA 2R9SA 2XM8A 2OZOA 3DBDA 4U3YA 2XYUA 1H4LA 3NW7A 2YERA 4FKUA 2Y6MA 3NX8A 2IZSA 5T3QA 1Q99A 2J90A 2WO6A 2WZJA 3MESA 3TZ7A 3LJ1A 4DA5A 5C4KA 2BZKB 5KBQA 2RG6A 4AW1A 4USFA 4CRLA 3SV0A 3ORZA 2UZVA 3QCQA 3V5JA 3ACJA 3VF9A 4X21A 3IK3A 5F20A 3W18A 1YWVA 3UG1A 2OK1A 2WMQA 1XBBA 2R4BA 3DDPA 4FG8A 3VS4A 4DT9A 4G3GA 1G5SA 3UZTA 1J91A 4FL1A 3D0EA 3JPVA 4CCBA 2ZDTA 1ATPE 2UZTA 3E8EA 5JZNA 1Z57A 1W98A 2ETMA 2JAVA 3DJ6A 4I6QA 3Q4TA 3PIXA 5F9EA 4G6NA 4R6VA 2WMTA 3BIZA 2PVFA 3AT2A 2I40A 4XH6A 4JMQA 3W8LA 3KRXA 4MNEA 4YJQA 3MPAA 2JFLA 3O8UA 2JAMA 2W05A 4GG7A 2BDJA 3S3IA 4F63A 1W0XC 2RFSA 1SVHA 2GU8A 4XP2A 3UMXA 4F09A 4ERWA 3C0IA 3QD0A 4AFEA 3UO4A 2P4IA 3PFQA 4JT3A 2EU9A 4MF1A 2OICA 2PWLA 2YJSA 4W4YA 2JDSA 4EZ7A 3FHRA 3UOJA 5A4LA 3HAVA 2HWPA 2E2BA 3UMWA 4DFNA 3R7YA 4RJ4A 2X7FA 4GJ2A 2RIOA 3FXXA 4MWIA 4AA4A 3CY3A 3UYSA 2OIBA 3G9LX 3M2WA 4XBUA 4JQ7A 3VONA 5IA1A 3NR9A 3GB2A 5DT3A 3PG3A 5IA2A 4PWNA 3H9FA 5AAFA 3AT4A 4YTHA 2VO7A 3ENHA 3E62A 3GCSA 3NAXA 4X6QC 4R1VA 4HVHA 4GT3A 3QFVA 4YNOA 2DUVA 3O71A 4EONA 4AAYA 3GC7A 4FI1A 3GCVA 4FUXA 3SC1A 3KKVA 5K4IA 4WD5A 3OG7A 5LMAA 4BCJA 1IA9A 3QX2A 3DBCA 5FUTA 4BGGA 4I6LA 2C0OA 1H00A 3IOKA 2R3GA 5HX6A 3LMIA 4IDVA 4CV9A 1OIUA 4FIIA 3OVVA 5CNOA 4EH9A 4L42A 5BQ0A 1CSNA 3IO7A 2OH4A 2HK5A 4C2WA 4C34A 5LMBA 3TUDA 2YWPA 4OT6A 3QUEA 4NM5A 3ZU7A 5JQ5A 3LXPA 1BKXA 3W1FA 2V22A 4FEWA 5K3YA 4RX9A 1VYWA 3F9NA 3SXSA 3AKKA 2W1CA 4N0SA 4X2JA 3HAMA 5CXHA 3ROYA 3OBJA 4XJ0A 4H39A 4AAAA 3QYWA 3ZRKA 2PVNA 1PF8A 2PMNX 1KSWA 3MI9A 3TKUA 2WIHA 3DY7A 4QTAA 5I9VA 1NT2A 3RINA 4DEDA 2XARA 4D28A 3TNQB 1B39A 2R7IA 4LFIA 4TPTA 3G0EA 4U43A 2ZB0A 4YJUA 2XP2A 1PRYA 2W1DA 3BYMA 4FG9A 4JBPA 4AGWA 2HAKA 3BGQA 5KMKA 4XS2A 4N70A 4HVDA 1GZOA 3WF8A 2AEGA 4YHTA 4MXAA 2W96B 4OBOA 3LJ0A 3PSCA 3OW3A 4V0GA 3E92A 4J52A 4KAOA 3ZLXA 4U9AA 4GU9A 4MXXA 3EN4A 4Q9SA 5IZFA 4F7JA 4F0IA 4EH6A 3DT1A 3OY3A 3Q60A 4QMQA 1NA7A 3R21A 4EQMA 1FMKA 3KY2A 1M2QA 3MFRA 5CI7A 2B4SB 4APPA 1R0EA 1R0PA 4QQTA 1OPKA 1EH4A 4R78A 2UZLA 3C1XA 4P4CA 5E7RA 5EYCA 4ZK5A 4A07A 3CQEA 3QZIA 4QMLA 4EOMA 3LFFA 3VUGA 4RBLA 4BIEA 1JKSA 3NIEA 3KMMA 4F6UA 4RLLA 1AQ1A 5I9UA 2G2FA 1FOTA 2O0UA 5D9HA 2I1MA 4EOPA 4GL9A 4XV9A 4I4FA 4NT4A 2CN5A 3VS3A 1URWA 4TYIA 3BQCA 1LR4A 3EMGA 3PXKA 5L8JA 3RM6A 3TL8A 1APME 1G8AA 3OC1A 4YTIA 2YCSA 4UWBA 5DEWA 1H1RA 3MPMA 4HNFA 3R73A 4A06A 4P90A 4FKWA 4HGLA 4AG8A 4F0FA 5CF4A 5ITAA 4O7VA 3WZJA 5IA5A 2VTHA 2WEVA 3ZSIA 1YVJA 3A62A 4APCA 3PVBA 5HKMA 3FQHA 3EIDA 3MPTA 5D10A 4AU8A 5KMJA 3RWPA 4IAIA 4YC8A 2YM8A 3E7OA 4PV0A 3ZMMA 3CJGA 3GXLA 3DTWA 5BUJA 3W2SA 2CN8A 2W4OA 2YM7A 3EFJA 4QYYA 2WU6A 5CSVA 2VO6A 1YOLA 3H10A 3M42A 3OEZA 1XJDA 2CKEA 2ERKA 4KKEA 4QQ5A 4YC6A 2WHBA 4TL0A 2JD5A 4B99A 1WBVA 4G5JA 3DFCB 2XZSA 2IW8A 5IUHA 2XS0A 4YJTA 3R9DA 4B8LA 5HTBA 5IEVA 2CPKE 1T46A 2QHNA 3GUBA 2B55A 3LAUA 3RPYA 4O22A 2IN6A 3RAHA 4C4IA 3F3TA 3RK7A 2B9JA 4K0YA 4JX3A 3P9JA 3LQ3A 4L43A 4RGJA 5HESA 3FWQA 5EM5A 4YLLA 4A4XA 3PJ1A 4DFBA 4HW7A 1OBGA 4XG2A 1E1VA 4EH4A 5LVOA 4R3PA 4WG3A 3ZXZA 3TI1A 2QKWB 4LV5A 4P2KA 4FV6A 3CS9A 4M84A 5EM6A 5ETAA 1ZOGA 2HXQA 2OJGA 2WMVA 4FGBA 5CQWA 2XAOA 4MAOA 4MNFA 3QZGA 4ZTLA 4EOSA 2WQEA 5E1EA 3S95A 1PY5A 3TTIA 2BDFA 2YIXA 2V5QA 2CCIA 4GUBA 4DTBA 5I5ZA 3VRYA 5FEQA 3JVRA 4BR3A 3I5NA 4JAIA 3PRIA 1S9JA 5E9EA 3BRBA 4F7NA 3QTRA 2VGOA 2QOQA 2XJ2A 5EKNA 4FEUA 3HP5A 3T3VA 3UG2A 4RRVA 2VTAA 4PX6A 5A6OA 4WHZA 2QR8A 3PP1A 4G5PA 4YTFA 3QUPA 3ZO1A 4WNKA 1K3AA 1H1SA 2WTKB 4ZTMA 2O2UA 2GFSA 5HI2A 3DK7A 4RIOA 3R63A 3WOWA 3KQ7A 3KU2A 4JDJA 3EQRA 4RIYB 4KBAA 4FKRA 2YM4A 4PDYA 3DFAA 1J1CA 3KRLA 2C69A 4EWHA 4BCIA 5CVGA 2GQSA 3PPJA 4UYNA 3CEKA 3LM5A 2WEIA 2XB7A 4BDEA 3KRJA 4EH5A 3L9NA 4IM0A 3BEAA 4F7SA 2R3FA 3FV8A 2C6IA 4DFZE 1VYZA 4FKTA 1YOMA 4CMOA 5BMSA 3CXWA 2V55A 2Y0AA 3GQIA 5D12A 3HV5A 3H3CA 1IEPA 3MVLA 4BZNA 1Y8GA 5FBNC 3QTQA 3QTSA 2CNQA 2ESMA 3P78A 4E6QA 2RF9A 4E6DA 2W5HA 3A7FA 5IUGA 3VS5A 3E5AA 3GC0A 4L6QA 3LCDA 2J0IA 3EJ1A 1KE6A 5LVMA 4PP9A 5FD2A 3TXOA 2PL0A 3QWJA 2ZV8A 1YDRE 3SKCA 3I0OA 3OTUA 4QNAA 4ZP5A 3KL8A 5HCYA 2AC3A 2CGUA 4IH8A 3ZZWA 4QT1A 5EDQA 4QO9A 2JC6A 3ZM9A 3P4KA 4GRBA 3FI3A 3JR1A 4PL5A 1RE8A 2CNVA 3DK6A 5AV2A 3ZDIA 5FQDC 5A6NA 5CAVA 3D5UA 2QD9A 2UZEA 2ITOA 4XEYA 3U9CA 3U6HA 4FKJA 3MFUA 5AUVA 4ZEGA 5LVLA 5C9CA 3GOKA 3L1SA 3KULA 5D7AA 2ZFYA 1ZLTA 4F6WA 3G33A 4PL3A 2BFYA 4KBKA 3EFLA 2FSTX 4WUNA 3IONA 4LGGA 4CRSA 4AXFA 2OU7A 3K2LA 3EN5A 5GNKA 3VBWA 2OZAA 4TKSA 3QQKA 4QMXA 3EQPA 4K18A 4KBCA 4X3FC 1OUYA 2Z60A 2A1AB 3R8LA 1U5RA 2J50A 2BDWA 4FIJA 2XKEA 2Y4IB 3OWLA 4YPDA 4EZ3A 3RK5A 2FYSA 4O7WA 1HCKA 5BYLA 4NL0A 3ZHPC 2WMRA 3FY2A 3WARA 3SRVB 1Y6AA 2G9XA 4FODA 2WXVA 4UXLA 5CWZA 5BUIA 1U5QA 1WVWA 4TYHB 3M11A 1OGUA 4PDPA 2QO2A 2OH0E 4CFFA 4ZJIA 5AUWA 2F7EE 1BMKA 5AP0A 4C35A 3P7AA 4F08A 4Z55A 3L8PA 1CKPA 3BGZA 1YWRA 2IZUA 3EQHA 5KMLA 5HE3A 5E8WA 4HNIA 2J5EA 1WMKA 3C4XA 4UWCA 4I4EA 4XG6A 4EZ5A 5M53A 2C1AA 3U55A 3KXXA 4AZFA 4PRJA 4QMYA 4DCAA 1XH6A 5I4NA 5IQCA 3E7VA 3VS6A 2QURA 4I6HA 3HVCA 3D14A 4IQ6A 4YR8A 4DFYA 4BI2A 4OTHA 2BRBA 4QNYA 3QGYA 4M14A 3D4QA 3OP5A 5CLPA 4IW0A 1GAGA 4I21A 5H3QA 5BVWA 1TQIA 5HLPA 2V62A 1U4DA 2YDJA 4U41A 4AXDA 3W2PA 4ZJVA 1M7QA 4Z3VA 3C13A 1MRYA 4QTEA 3FI4A 4FC0A 4EC9A 5CYIA 5FP5A 4MXZA 4EOQA 4WOVA 3WILA 4FV5A 1VLRA 4LDTA 1OPJA 3E8CA 3HGKA 3W0QA 3QZFA 3W8QA 3ZDUA 2YIRA 1GIIA 3THBA 5AP7A 1H01A 2R3IA 2C30A 2PUNA 3QKKA 4HZRA 3PPZA 2XK8A 2ZVAA 4LGHA 4MTAA 5TO8A 4GEOA 4BKJA 4BCOA 5LQFA 2UW3A 4DG0E 4MXYA 4I5PA 3UVRA 4TYJA 3VBYA 1QPDA 4DFXE 3QCXA 2QOOA 3COKA 4KSQA 2QOCA 4J99A 4O96A 4PNKA 3FI2A 3RKBA 1WFCA 5AP6A 3FQSA 5CSHA 4DINA 4L45A 3EQDA 4Y5HA 5EK7A 4EUTA 3FLNC 3O5AA 1Q61A 5EQYA 3UYTA 1P4OA 3E64A 3QHWA 3QD3A 2BILB 4IC7A 4QOXA 3ZUVA 1NXKA 3KMWA 4O7LA 3VBXA 4DFLA 2UW0A 2XNMA 4JL9A 4C3PA 1E1XA 3NYVA 2UW9A 3DB8A 3EYHA 3ITZA 3OUKA 4JDHA 4I22A 4DHIB 3UO5A 4BRXA 3H9OA 4AN9A 2JEDA 4PDSA 4D9UA 5T6KA 1H27A 3O8TA 5HIBA 3GGFA 4IE9A 4O81A 2GDOA 1U54B 4FSQA 4EK5A 3FMMA 4NCTC 4QMSA 4BI0A 1YQJA 3DQXA 5C26A 4K8AA 4O0RA 2R3PA 5GHVA 1KUTA 1PMNA 3L9PA 3RJCA 5IH5A 4J7BA 4I94A 2X4FA 1F0QA 3FZSA 3VHEA 3VS7A 3FYJX 5FP6A 3KRRA 4HCUA 4FKSA 3HX4A 1OL1A 4TY1A 2UZUE 5IA3A 2W1ZA 4GFOA 4FV2A 5IQIA 3UDTA 1Q8UA 4NW6A 4F65A 5C8MA 3GFWA 4IX5A 3G6HA 4RA4A 1UV5A 5AUUA 5LVPA 1YXUA 3HEGA 3T9TA 3MY5A 3ZFXA 2A19B 3CY2A 2WNTA 1UWHA 1XO2B 4IBMA 4BIDA 3MH0A 4M3QA 2W99B 2OI4X 5EYKA 5K9IA 3PIZA 4CFXA 2PUUA 2PTKA 5CU2A 3QRUA 3TYKA 1XBAA 3I6UA 5GJGA 4AGCA 4AXCA 3MYGA 3QX4A 4U3ZA 4DEIA 2GQGA 4MNEB 2YDKA 4NYEA 4M0YA 5M08A 2P33A 1W84A 4PMMA 1J7LA 2B9HA 2XA4A 3CGOA 3LQ8A 4Q2AA 2GCDA 3DBFA 3R28A 3REPA 2WMSA 2IW6A 3QQGA 4E7WA 4NK9A 4G6OA 2J7TA 5IQDA 4B8MA 2RFEA 3R1QA 2BZHB 5HEZA 2PU8A 4D0WA 3D94A 4BCQA 3MW1A 3PRFA 4F1MA 4MQ2A 5DR9A 4C4HA 3C4WA 1KE5A 3E93A 2PUPA 4L3LA 3DCVA 4U6RA 2YFXA 2CSNA 4QMZA 1ZYJA 3VBTA 3LHJA 1OL2A 4IADA 3ELJA 5JFVA 2Q83A 2V0DA 4FTRA 2WTCA 4RWLA 3ALOA 3ATTA 2VU3A 4CLJA 4AXAA 4E5BA 4D5KA 1YXXA 3COHA 2FGIA 2XM9A 3R1SA 3SOAA 2J9MA 2CKPA 3QYZA 3GFEA 1Y57A 2C6MA 3BKBA 4L46A 5HQ0A 4O21A 5BYZA 2UZDA 1OKYA 3BU6A 3ULIA 2YAAA 3CKWA 5A46A 3D5VA 3EFKA 2OSCA 3NUXA 2GNJA 4LM5A 4X3FA 5HHWA 3ZM4A 4D58A 4ZLYA 1JKKA 3K54A 4BDGA 2FB8A 3KC3A 1SM2A 3R7VA 2R7BA 4WKQA 3DAJA 4AP7A 4Q9ZA 2ZM4A 1Q41A 3VUIA 5EW3A 3U9NA 5AUTA 5KE0A 4QMUA 4L7SA 5EQEA 4JLCA 3POZA 2WMWA 3DJ5A 5E4HA 5A4EA 5AAGA 4J53A 4OTFA 2GNIA 5L8LA 4RFYA 3W55A 1MRVA 3FLZA 3MH3A 5L2WA 2W1GA 4XP3A 3UDBA 3G9NA 1A06A 4XG8A 4C59A 1OIQA 5JK3A 5CAPA 4I0SA 3PLAE 3KN6A 3HV7A 3CPBA 4C36A 4U0IA 2PZYA 4R5YA 5FTOA 4QP4A 3SQQA 3LFBA 5GJFA 3AC1A 4BCGA 4DG3E 4N57A 1LEZA 3FLQA 3QQLA 5EYMA 3RNIA 3VQUA 3LCSA 5A4QA 4CFUA 2C5VA 4WNOA 1UNHA 3P79A 4XV3A 3FJQE 3UP2A 2CLQA 4O27B 3E3PA 3GU6A 3TM0A 3F7WA 3UZPA 2CCHA 3TTJA 4QQJA 5FBOA 2QC6A 3WZEA 4BBEA 3BE9A 2VWUA 3U87A 1YI4A 3OT8A 2UVXA 4LI5A 3ZBFA 4AACA 1O6YA 3OCTA 5JRSA 4CMTA 3D7ZA 4CVAA 3QQHA 4FG7A 1HCLA 3WZKA 3IW8A 4ZLOA 1I09A 2SRCA 1PMUA 1ZYLA 2UW6A 4LOOA 3IGGA 3R7EA 3O2MA 3RP9A 3QQJA 3OTVA 2IWIA 5EHLA 3A7IA 2NPQA 1ST0A 3NUNA 3W0OA 3OBGA 4V0GB 2JDVA 2REIA 5CAOA 3W16A 4RA5A 3FMDA 1LPUA 1R3CA 2WTVA 4QP6A 5AIKA 4DHJA 5FG8A 1HOWA 3W2RA 4CT1A 4D2RA 2JDTA 4KS8A 5HVJA 3PZEA 3BV3A 5ETFA 5H9BA 3FHIA 5IU2A 5CU4A 2Z02A 3RPOA 4C4GA 2G15A 2FSLX 3KCFA 2XIXA 4O91A 3RPSA 4LOPA 2E9NA 3VBQA 4D55A 3UQCA 2XALA 3L9LA 4RFMA 3DGKA 3ROCA 3OOMA 3O17A 5DOSA 3DA6A 3JUHA 2GTMA 3P23A 4S2ZA 5CQUA 3GBZA 2GS6A 2X6EA 4DF3A 5AAEA 4PUZA 5EKOA 3BL7A 3S00A 3GT8A 2UZOA 4XG4A 5CENA 2B53A 4FTJA 1H24A 2ITYA 4G17A 4NTSA 1OECA 4ALWA 3PVUA 4L7FA 2G1TA 3HMOA 1KV2A 5AX9A 4I3ZA 4BIBA 3PVGA 4GKIA 4K77A 3BWJA 4OTGA 3SD0A 4RZWA 3P1AA 2RFNA 2RKUA 1KE8A 4C2VA 4XMOA 1VEBA 4ZTNA 4DH1A 1YW2A 3HRFA 4QP2A 2VAGA 3G15A 2VTJA 1WBNA 3MFTA 4NCTA 4GT4A 4HPTE 2WOTA 1REKA 3F5XA 5HU3A 3RAIA 3MFSA 2BIYA 4C4EA 5DEYA 4IX6A 2W0JA 2PVYA 4FICA 1Y91A 4OLIA 3BV2A 4ZAUA 1YI6A 4GK2A 3ZS5A 4EK6A 3DDQA 2WMBA 1JBPE 4DHZA 4F7LA 5M51A 4FV1A 3KFAA 1X8BA 3RGFA 5CSPA 4BDKA 2JLDA 2HZIA 3KXZA 3QGWA 3MJ1A 3OWPA 3ZXTA 2FA2A 1PXPA 4TYGA 4BTKA 2X2MA 4AQKA 3LE6A 5HVKA 1Q8WA 3W0NA 4NFMA 1BX6A 2XVDA 3TEIA 1GIHA 3K5UA 2PZRA 2YIWA 4B0GA 3ZUTA 1IRKA 2YIQA 3H30A 4Y8DA 2QU6A 4TTHB 4MYGA 4OTQA 5AM6A 3RK9A 4YJPA 3OT3A 4D0XA 3UQFA 3C0HA 5KMOA 3NMUF 4RLKA 3MIYA 3QA8A 3W0SA 2QG7A 4G3CA 3O7LD 2WOUA 1UWJA 4KD1A 3AD4A 3GCUA 4U45A 4YP8A 1O6KA 1YXVA 2VX3A 5FRIA 2WQNA 2AYPA 2JKQA 3EFWA 3TZMA 2VUWA 3UP7A 4BTMA 4FA2A 2HZNA 1TKIA 3VO3A 4AX8A 3BCEA 4ANQA 3WIGA 3A7HA 3KVWA 4EOIA 4CEGA 4J71A 3F2AA 3Q5IA 2HY81 2W17A 3EH9A 2X8EA 1DM2A 5FDXA 1QL6A 1FINA 3Q96A 4C33A 2ITXA 3D9VA 3HUCA 2J2IB 3QTUA 4MBJA 4EBVA 3K3JA 5IEXA 4ASZA 3E88A 4MQ1A 3ET7A 3LFAA 1XH4A 5E8UA 1JSTA 4WSYA 3LCKA 5FEDA 1YOJA 3GP0A 3MIAA 5JZJA 2X1NA 2EB2A 1FMOE 4ZJJA 4HOKA 3SG8A 2DQ7X 4UXQA 4E4NA 5KHXA 4Y73A 4OGRA 4G2FA 4RX7A 4M13A 3A61A 3Q2JA 1XR1A 2RFDA 3S1HA 4BYIA 2DWBA 4GG5A 3MSSA 3UQGA 2P2HA 1MQ4A 4OTWA 4CLIA 3DU8A 3QZHA 4HGEA 1E9HA 4A9SA 2BHEA 1H8FA 3UDSA 2VNWA 5ANIA 1RJBA 3F82A 5CEQA 4EH3A 1OVEA 3EZRA 3ZLWA 4FNXA 2IVTA 5DVRA 5EFQA 2J0JA 1DAYA 3PG1A 2QQ7A 4G31A 2C3LA 4UALA 3W33A 4E5WA 1L8TA 1ZZ2A 4FSMA 4XLVA 3R22A 4BI1A 1JSUA 5KO1A 4GJ3A 3I1AA 4FV4A 4A7CA 4CTCA 4DEHA 3IW6A 5BVKA 2Y4PA 2BKZA 2QVSE 2XIRA 5ETCA 5AUXA 3MA6A 3PY3A 5HCXA 4D4RA 4E6AA 4HJOA 3CE3A 3LXNA 2C1BA 4YJVA 5LWMA 2O5KA 2FO0A 4IAYA 4TWNA 5I9WA 5AP3A 3MV5A 4IVAA 1STCE 5JT2A 2OXDA 4E5AX 1PXIA 5CNNA 2A2AA 2X81A 3F2RA 3UO6A 4BB4A 4FBXA 2YWVA 2F7ZE 3TIZA 1A9UA 1JSVA 4FGRA 2JIUA 4G16A 4D1ZA 5F1ZA 2NO3A 4OUCA 4RJ3A 3I81A 4G6LA 4O2ZA 3NRMA 4GIHA 2XAMA 3AC3A 5DRBA 5CT7A 5FXQA 4DC2A 4EOKA 4AWIA 4RC2A 3UC4A 3HLLA 3KXGA 2ZYBA 1GOLA 3TMOA 4PL4A 3EHAA 3PA5A 3Q32A 3TNPC 3ZFYA 3NCZA 3GVUA 3F3ZA 4Q5HA 3OHTA 3WF9A 4F70A 5JRQA 2BTSA 4PMTA 5M07A 4UBAA 2C6EA 4K33A 3KULB 2HELA 2X8IA 1CKJA 4DLJA 3Q53A 2QCSA 4E4LA 2XH5A 2OWBA 3QRJA 5B0XA 3VAPA 3NUPA 4ZZNA 4FTIA 4HCVA 1H1QA 2YJRA 1H25A 1BL7A 4JRVA 4O0WA 4C61A 4IAFA 4FTUA 2OZAB 2VWXA 4JQ8A 2Y8OA 2VRXA 3QHRA 4H3QA 5A14A 2UV2A 5AFVA 3WYXA 3ZO4A 3T3UA 1WAKA 1CTPE 3FZPA 4BBFA 3CGFA 1UNGA 3GU8A 3P7BA 2X9EA 1ZAOA 3JYAA 4O82A 2Z7QA 4ITIA 3EWHA 1ERKA 3MBLA 4KIPA 4NKSA 1M7NA 4ANBA 2PPQA 2C6KA 4BN1A 3PY1A 5IQHA 2GSFA 1V0PA 4ASEA 3KK8A 4NJ3A 3DTCA 3N51A 2QR7A 1ZMVA 3FKNA 4ITHA 4YZ9A 4DE4A 4JR7A 4DTAA 2PVJA 2QOLA 4P5QA 4E4MA 3B8RA 3BEGA 2R3NA 3BU5A 3NNXA 4TT7A 3FXZA 4EHEA 2WB8A 3ZONA 3NZ0A 4GVAA 2C0TA 4EK3A 1PMEA 4QDEA 4ACGA 3O96A 1DI8A 4QDVA 4YJRA 4E26A 3QBNA 1OM1A 2VWYA 2WD1A 1H0WA 3VHKA 3HMPA 5J1VA 4Y5QA 3DK3A 3FEGA 5L3AA 3OF0A 4HYSA 2YHVA 3NUSA 3BYSA 3OUNB 4JR3A 2XRWA 3O7LB 4ITJA 4V04A 5EI6A 3IKAA 4IJ9A 5I9XA 4L68A 4AQCA 4H05A 4WNPA 3PXZA 2V7OA 3QLGA 3W32A 3N9XA 3R0TA 4AOTA 5H8GA 4FKOA 5C1QB 2VWBA 3SG9A 5M06A 1OZ1A 4DH8A 3NYNA 4YGAA 3TUCA 3NNUA 2OW3A 2WTWA 3QAME 3VUDA 4EWQA 3PUPA 2EB3A 2C5YA 4QP3A 2QOHA 5CAQA 3SW7A 2JBPA 4DBXA 3DZQA 1BYGA 1SYKA 2VTMA 4Z9LA 5I0BA 4GH2A 4GW8A 4RC4A 3COMA 5KX8A 4YUQA 3D83A 3ZUUA 3U54A 3AD6A 3HZTA 4ZOGA 4QP1A 3CP9A 1YHWA 5FLFA 5EQPA 3GQLA 1W83A 4UYAA 3FL5A 1OB3A 3LQ5A 2A4LA 2PSQA 3SW4A 2WKMA 4XG3A 5D1JA 5HNGA 4ALVA 2E9PA 4ARKA 4A9TA 5IH4A 2QI8A 2R64A 4G1WA 4KSPA 2FUMA 2C6DA 3BL9A 1LP4A 5AA8A 2OXYA 1SMHA 2OXXA 5C8KA 4HYHA 5IQGA 4RPVA 2CLXA 4NJDA 4XHKB 3NNWA 3DNDA 5FXSA 4JBQA 4QPAA 4FSZA 5AP5A 3DKFA 1XH9A 2BRGA 4NTTA 1MQBA 4X6RA 4EH2A 4NKAA 3ZZEA 4L01A 3LFEA 5CT0A 3FLYA 4ZY6A 3GNIB 4RJ8A 4WO5A 4TN6A 2JIVA 5CF5A 3OEFX 4M7IA 1WBOA 3V5QA 2C4GA 3ZRMA 2GNGA 3ANQA 4FL2A 4QMVA 5DR6A 3GENA 4YC3A 1BLXA 2IZTA 4O0UA 3DZOA 3OY1A 1ZY4A 4YO6A 1YDSE 4N4SA 4C58A 4FOBA 5HZNA 3Q9ZA 3I0QA 1TVOA 5ANOA 4EJ7A 5CEMA 1WZYA 4CCUA 3EQIA 4YZNA 2XBJA 3WYYA 4PF4A 2XNNA 3KN5A 5KZ0A 4FV0A 4AN3A 5AP4A 5FM3A 4NSTA 5IQEA 1FQ1B 4H58A 4L44A 2PZPA 3FLSA 5DI1A 4YHJA 3KEXA 3MVHA 3CJFA 1NY3A 4FVRA 4HGSA 3IPHA 3UPXA 3VF8A 4ZY4A 3A2CA 2OJIA 3CCNA 3PDTA 4TWOA 3WE8A 5CU6A 3HV3A 5AP2A 5TT7A 4F99A 3QC4A 4FT3A 3FXWA 5CEIA 3RMFA 4D4YA 2X9FA 3DLZA 1M2PA 2QO9A 3LFSA 2XKCA 3ORIA 3RI1A 3QXOA 3TKIA 1Z9XA 1OL5A 2WQBA 3IECA 4R7HA 4WT6A 3D15A 4L8MA 5LXMA 3F5UA 4F6SA 4XV2A 4ZIMA 4J8NA 3W2OA 5M4IA 2OGVA 3ZO2A 3FL4A 2VWVA 1DS5A 3KXHA 4JDKA 3W2CA 4BCKA 1BL6A 3U6JA 4EK4A 2XK9A 1OIYA 4KABA 5HBJA 2WIPA 5FXRA 4D1XA 5M44A 3FSKA 4YBJA 4C37A 3W0MA 5TOZA 3ZO3A 3MGYA 5AV1A 1GZKA 1IG1A 5BYYA 4RIWA 2B0QA 4XOZA 5LCJA 4S30A 3UIMA 1PXJA 4A4OA 3QTWA 1RQQA 1WVYA 4EHGA 2ZM1A 1ZY5A 5HVYA 2AUHA 2JBOA 4FTKA 2EXCX 4IWQA 4FOCA 3RCJA 2HWOA 3GC8A 4P7EA 2ZMCA 2UW7A 5CAUA 1DI9A 1CDKA 1MRUA 2ZOQA 1BI8A 1P5EA 1UKHA 2UVZA 4IWPA 5DIAA 4ZTSA 5EH0A 5B7VA 4MXCA 4CFVA 3G51A 2PMOX 3Q9XA 3UTOA 2J51A 2CGWA 3V5PA 4X3FB 4DDGA 4I5MA 3ZRLA 2B52A 2VTSA 5JFWA 2IVVA 2BKKA 3HA6A 4WBBB 1H26A 3KXNA 5AA9A 5JGDA 3KVXA 4UEUA 2GFCA 3FAAA 2IPXA 2VN9A 1PHKA 2J4ZA 5CZHA 5J7HA 3ZC5A 1RDQE 3R6XA 3LMGA 1Y6BA 3C0GA 4NIFB 3COIA 4IM2A 3VUKA 4KRDA 3VRZA 5E8TA 4QYGA 5GJDA 3R30A 4FV7A 4X2GA 2VTPA 2WFYA 5FEEA 3BHHA 1IR3A 5ANEA 2JKOA 3OD6X 4Y46A 3KREA 5EW8A 2WGJA 2GS2A 2FSOX 2YACA 3LFNA 4F9AA 1CKIA 2XNBA 4XG7A 3FMLA 4FE2A 2KULA 4FMQA 4JDIA 4KA3A 3RCDA 4ANSA 3QCSA 2CDZA 4WNMA 2O65A 3K3IA 1ST4A 2OG8A 2BAJA 1W82A 2HCKA 3LZBA 3PJ3A 4JJRA 2QKRA 2BR1A 2ZMDA 4O7SA 1NVSA 3HDMA 4E4XA 4DFUA 4BZOA 3PWYA 4W4XA 4MKCA 4USDA 5DRDA 4AN2A 3R1YA 5FM2A 5J8IA 1YRPA 4IAAA 1MUOA 1DAWA 4FZFB 3FMHA 3R8UA 3H9RA 4NWMA 5DE2A 2WAJA 3OZ6A 4I1ZA 4MD9E 5J87A 4AZTA 2O63A 4NUSA 3DKCA 2Y6OA 4GT5A 4AS0A 3IQ7A 2WMUA 3BLHA 3AC8A 2WTJA 5LARA 4AT3A 4C62A 4DGLC 1WVXA 4PTGA 4DDIA 1SVGA 4I41A 4DBNA 1ZWSA 4IX4A 3TCPA 2QLUA 5A4TA 3SVVA 4YMJA 5HG5A 4NU1A 1OITA 3UBDA 3UGCA 4AA0A 3NAYA 3R7UA 4ZS0A 4CTBA 3SOCA 3TN8A 3HMNA 3NCGA 3QRKA 4EC8A 4O7ZA 4QMNA 1Q8ZA 5AV0A 2VTQA 1FPUA 4RVLA 5AIRA 2HENA 2X39A 3ZH8A 5E8VA 4UY9A 5EM8A 2JKMA 5HG7A 1GY3A 4O7TA 1H28A 3LPBA 4ENXA 1IASA 3VBVA 4RVTA 3LFCA 3HRBA 4JQEA 2YM5A 1B6CB 2OJJA 4BVUA 2YA9A 1P14A 4XCUA 2ITUA 5AV3A 4LG4A 2PVRA 3OFMA 4FKPA 2XNOA 3FLWA 4ZMEA 4II5A 4O7NA 4LL5A 4GKHA 2HY0A 5DN3A 4H36A 4RIXA 4AW0A 2V7AA 3R01A 3OCBA 2PVHA 3DXPA 3NVKI 4YJNA 4U44A 5HE1A 3FZ1A 1PYXA 3D5WA 2VO0A 3V51A 2XEYA 1YXTA 1KV1A 2IJMA 1PXLA 2WMAA 4ZTQA 5CF8A 2F7XE 3WBLA 1JAMA 4WRGA 5DPVA 2VNYA 4DT8A 3MH2A 5AWMA 3BHTA 4G9CA 2UUEA 4FKGA 1PYEA 4U8ZA 2P2IA 5L2TA 5HLNA 4EYJA 4FKQA 5DT4A 2GNFA 3D7TA 3NFFB 5F4NA 3ZSGA 4FT5A 4DEBA 5GIPE 3QTIA 4BCFA 2CHLA 3GC9A 5E8ZA 1P4FA 5C01A 3UZRA 4N6YA 4DAWA 3ORXA 4FYOA 5BNJA 5BVDA 3WZDA 3PJ8A 4FV8A 4RWKA 2F2CB 2X8DA 4XP0A 3CD8A 3QQUA 4YZMA 3FZTA 3Q9YA 3V5LA 4CKJA 4GU6A 4JBVA 2W4KA 4LMUA 1PMVA 2X2KA 4L3JA 4M15A 5TR6A 4AXEA 2OFVA 3UVPA 5CI6A 5FDPA 4FKIA 2W9FB 4JS8A 2R5TA 5D7VA 3FKOA 2YM3A 3HRCA 3NDMA 4TNDA 4S32A 4K2RA 4DEEA 2QONA 5J9LA 5CANA 2Z2WA 5CZIA 2ZJWA 1JLUE 2BAKA 2BZJA 4MK0A 4AOJA 5K5XA 4FT0A 3EOCA 3P5KA 4YZDA 3NEWA 3F5PA 3WE4A 1G8SA 3AMYA 1KE9A 3V5WA 2E9VA 1O9UA 5H2UA 1Q8TA 5KKRC 3EL8A 1R1WA 3C4ZA 3CBLA 3OCSA 4R3RA 3QTXA 1XH5A 3LJ2A 4BCHA 4BDBA 5J5SA 2VD5A 4AE6A 4MX9A 2R3KA 3BBWA 2EUFB 4KIQA 3ZOSA 3F3VA 2QU5A 5DFPA 4BHZA 2ZV9A 4XUFA 2H8HA 4RMZA 3E8NA 2BUJA 2GPHA 4MBLA 3HYHA 3NUYA 3R00A 3VNTA 4EKKA 2XK7A 1Y8YA 2PHKA 3Q52A 4B6LA 2QNJA 2PVKA 4QEBA 2YN8A 3H4JA 4L3PA 3V04A 5K5NA 3DXNA 1XKKA 4PY1A 2HZ4A 4FNZA 3UIXA 5L8KA 3R2YA 5AX3A 4ZSGA 4CFMA 4KINA 3SGCA 4CXAA 3TACA 3T8OA 3AQVA 4AFJA 3TWJA 4MHAA 5F94A 2C6TA 5CEPA 3VW6A 1ZZLA 3A4PA 3RVGA 4IVDA 5EHYA 1CM8A 4C7TA 5HTCA 2CNUA 3CKXA 3ORNA 4EK8A 3I5ZA 4WIHA 5EOBA 3EN7A 3SX9A 5HD7A 3GCQA 3VN9A 5DNRA 3BLQA 5IMXA 4L52A 3Q3BA 3FC2A 3HMMA 3KA0A 3N4UA 3POOA 3UOLA 4FTQA 4LUDA 4IANA 2UZNA 3LW0A 4QYEA 4IM3A 5TKDA 3BI6A 1K9AA 3TNWA 4EL9A 4XOYA 2PZIA 3TDVA 3OOGA 2I7QA 3CQUA 4ID7A 5FTGA 3AGLA 4IHPA 3DNEA 3QRTA 2NRUA 2W1IA 4KS7A 2X2LA 4F1TA 2WQMA 1W7HA 3B2WA 4IZ5A 3Q4UA 4O0VA 5CALA 2XJ0A 4CMUA 1OL7A 2XJ1A 2XEZA 3KCKA 2OIQA 4D5HA 3C9WA 5JFSA 2X6DA 5E8SA 4QMWA 3VJOA 4FK6A 4CKRA 4G3FA 2OJ9A 2Y7JA 1F3MC 2QOKA 5DLSA 3VC4A 3PE1A 2LAVA 4HZSA 4DYMA 2X7GA 2HOGA 2CKOA 4IEBA 2R3LA 1B38A 5J1WA 3RNYA 5J9ZA 2CGXA 3PA4A 3Q6UA 1FVRA 3IW5A 1YDTE 4IVCA 4AUAA 2OBJA 1UU7A 5A3XA 4DGMA 2XRUA 2XUUA 3RHXA 2PE1A 4FTCA 3EKKA 3F2NA 4BC6A 1ZARA 3QCYA 4AZWA 2OJFE 1V0OA 2O64A 3OS3A 2YIYA 3GEQA 3QD2B 4W4VA 5EHOA 1NVRA 4U40A 3R2BA 4Q5EA 3D2KA 3F69A 4FZ6A 4IWDA 3D2IA 3FZOA 4CFWA 4WG5A 4OT5A 4EJNA 5DH3A 4U97A 4YJOA 3F88A 3PJCA 2J6MA 5D11A 3TV6A 4AW2A 4LRMA 3LFDA 5IQFA 2C5NA 5CU3A 4FUYA 3CTQA 5FGKA 3JY0A 3AC2A 4R77A 5LWNA 3Q6WA 3VS0A 3DB6A 4JX7A 5KMNA 1FVVA 4ZY5A 4EOOA 2JKKA 4IDTA 3V8SA 4GUEA 4MWHA 3NW5A 4FIEA 1S9IA 3ZFMA 3QALE 2Z7RA 4I5CA 4O6EA 4X2NA 5JMSA 5L2IA 4DGNA 1R78A 2R3QA 4S34A 3DOGA 5CY3A 4RG0A 4RQKA 4J97A 3PPKA 2QLQA 2ZAZA 1GJOA 3BBTB 4FKLA 3P86A 4OR5A 4AZSA 4FIFA 4ZZOA 1L3RE 3SXFA 2B9IA 2PYWA 1Q62A 1QPJA 1KE7A 5EW9A 4GVJA 3RWQA 3PUFC 2J0LA 3R9HA 3NSZA 4TWPA 3FY0A 5HBEA 1GZNA 4BDAA 2HYYA 2UW8A 4EHZA 1URCA 2VWWA 3PA3A 4GFMA 2PMLX 5G6VA 4CG9A 5EOLA 5IF1A 4AA5A 3VQHA 3HKOA 1Q8YA 5GIOE 4NH1A 2QO7A 4WA9A 5HX8A 2XYNA 4QPSA 5KNJA 1OMWA 3FMNA 4RVKA 2GS7A 3DJ7A 3FE3A 4I92A 4XYFA 4ZSEA 4UWYA 4BF2A 2BRHA 3IDPA 2ZB1A 3AMAA 4UN0C 3VS2A 4FEQA 3AG9A 1JKLA 4KKHA 3UIBA 2I0YA 3IGOA 1WBSA 3MTFA 4YPSA 2XIZA 4S33A 1SZMA 3G2FA 3FPQA 3FPMA 1LUFA 3N4TA 2JFMA 3NVMB 4IZ7A 2X0GA 2QOBA 1Q3DA 3NFGB 2GHMA 3PJ2A 3ETAA 4MUQA 3MY1A 4ZTRA 3WF5A 3WF6A 4F9YA 3UPZA 2J5FA 3EQGA 3WF7A 3CTHA 4KWPA 5HU9A 2O8YA 2GQRA 4LRKA 2W9ZB 3DAKA 4U7ZA 1YI3A 4G9RA 5CF6A 3EN9A 4D2SA 2VTLA 4EQUA 5AV4A 3NPCA 4IZAA 5A4CA 2W1HA 4V05A 5JFXA 4UV0A 5HIDA 3OW4A 3MVMA 5CU0A 3RALA 4TZRA 2R3MA 4RC3A 3CTJA 2WTDA 3L8VA 4M68A 3R8ZA 4TRLA 1J1BA 4M12A 5DHJA 3VW8A 4Z7HA 2F9GA 4FEXA 4XRLA 4JAJA 4BY9E 4A9YA 4LV8A 4BHNA 4K9YA 3DBQA 4KKGA 3D5XA 4FZ7A 1OIRA 5HNBA 5AEPA 2IG7A 2ACXA 2BPMA 3IW7A 5CTPA 3PFYA 3TDWA 4BDIA 5JGAA 1UU9A 3OXZA 3OMVA 3E8DA 3F66A 5J95A 2R3RA 3OWKA 5IA0A 3ORLA 4R3CA 4R1YA 5AP1A 5JGBA 3A99A 3O8PA 3TZ8A 3UOKA 4UZHA 4ZTHA 3ODYX 4H3BA 3QLFA 4IWOA 5EI8A 5IDPA 4RSSA 4EOJA 4GV1A 3E87A 5BVNA 4IB1A 4ACHA 2YCQA 4BTFA 4B7TA 5EDRA 2ITZA 4K1BA 4RWJA 3MVJA 3BGPA 1GIJA 3VUMA 4F4PA 4E73A 3QUDA 3FI8A 4FK3A 2X4ZA 3R7IA 4FNWA 4BJJA 2C3JA 3KRWA 5H8BA 3KB7A 2QOIA 5DBXA 4RWIA 2XK6A 4HCTA 3U8WA 3VIDA 2EWAA 3EL7A 4QP9A 5ANDA 3GU4A 1I44A 2BAQA 1ZXEA 2PY3A 1PJKA 2YDIA 4BDCA 4PQNA 1QPEA 4CT2A 4D1SA 1M17A 4ASXA 4NFNA 4F9BA 1Q24A 2JDOA 1YKRA 3E3BX 4RVMA 1G8JA 2OIDA 3C7QA 2XIYA 4U79A 4IFGA 1OI9A 1Z5MA 4GYGA 3C4FA 4WUAA 3V8TA 4O0TA 4DGGA 3V01A 2R3JA 4DTKA 4MCVA 4X2KA 4EH7A 4YTCA 2I0VA 3HNGA 3TG1A 3C51A 3AC4A 4HGTA 4CV8A 1IAHA 3LXLA 4Y85A 3BYUA 3FSFA 2G01A 1XBCA 3HL7A 4L67A 4RIWB 3C50A 3MB6A 1UNLA 3PYYA 4BDFA 3ENMA 5IH6A 4U42A 4AZVA 2NP8A 3ANRA 4J95A 4YU2A 5HO8A 3RAWA 3EQCA 1P2AA 4FR4A 3HUBA 3MH1A 2UW5A 4B4LA 2XNPA 2C3KA 2ITNA 2UVYA 2X7OA 2XK3A 3TJDA 4AT4A 4QP8A 4CZTA 5K4JA 3NLBA 5IUIA 3TV4A 3IS5A 2BALA 3I60A 3JY9A 4JXFA 5L6WL 5IEYA 4FVPA 3QL8A 4E6CA 3DQWA 1KOBA 4O7YA 4RJ6A 4F1OA 5C03A 4V01A 2VX1A 3L9MA 4KIOA 4QTCA 1V1KA 3IDCA 3O51A 4FKVA 2GNLA 3DKOA 4FSRA 3R1NA 2VTTA 3LXKA 3RTPA 4GSBA 5EG3A 4DH3A 2FH9A 2C6LA 3H0YA 3W0RA 4W8DA 5BVOA 5DWRA 2UW4A 2XCHA 2OO8X 1XH7A 4A9UA 1JNKA 3E63A 3TNIA 5JQ8A 1UKIA 2XMYA 3AC5A 3EZVA 2YITA 5FTQA 2ZV7A 3PXQA 4EH8A 2CGVA 4OW8A 2C47A 3BPRA 3MWUA 2IW9A 3NW6A 4IVBA 4PP7A 2F49A 4XBRA 5ACBC 4I6BA 3UVQA 2QOFA 2O3PA 4KRCA 5IQAA 4BYJA 2WPAA 1R39A 3VULA 3EQBA 3KGAA 3F7ZA 2ZV2A 4H3PA 5BX0A 5CASA 1XMMA 4RT7A 5G1XA 1H1PA 5EDPA 2WTIA 1XH8A 4FTAA 5HE2A 5IMEA 2ITVA 2WMXA 3R9NA 2HW7A 4BBMA 3PXRA 2AC5A 3F3WA 3DBEA 1G8KA 4QMTA 4FJVA 3A7GA 3ZCLA 3BLAA 1U46A 3KIOC 3ALNA 1XMLA 3CC6A 5BMMA 3PIYA 4JG8A 4UB7A 3AKJA 3HV6A 1TFFA 3NGAA 3P08A 4YJSA 3DPKA 4QTDA 4YZCA 4BZDA 4L53A 4Y72A 2C0IA 2XF0A 1OUKA 4LL0A 2NNWB 1M52A 4ZZMA 3QWKA 2R3HA 4LRJA 4DH5A 4ACDA 3PP0A 3O0GA 3Q5ZA 3UDZA 2CKQA 4OTIA 4EHVA 3N4VA 3PVWA 4QMOA 3GI3A 4NM0A 3C4CA 4U81A 4ERKA 1XQZA 4ANLA 4CGAA 3U4UA 4GMYA 4RX8A 2YZLA 3UE4A 2YAKA 4O7RA 4C4JA 3VWAA 3B8QA 2W1FA 2ETRA 4C0TA 4XLIA 4C3RA 5HD4A 4USEA 5HORA 1K2PA 5M57A 1IA8A 2C3IB 2E9UA 3ORPA 5ANJA 5LJJA 4E93A 5IA4A 4E20A 2XKFA 4PTEA 4U80A 3ZSHA 4I24A 2OF2A 4X7QA 1SNXA 2A0CX 3M1SA 5TF9A 4JVGA 2PE2A 4LOQA 3U51A 4ORKA 3KK9A 4ASDA 2VTRA 2JIIA 2WTKC 3ATSA 3BZ3A 4S31A 1OPLA 5AJQA 2H6DA 3BWFA 1FGIA 1UA2A 4NW5A 2WELA 4C38A 5LMKC 4OBQA 2XBAA 2JDRA 4FTLA 4AT5A 4ALUA 3A7JA 3OCGA 4JG7A
chains in the Genus database with same CATH topology
1M2RA 3P7CA 4IIRA 3FMJA 4RIXB 1YXSA 5AUZA 4QRCA 3R71A 2Z7SA 1J7UA 4O86A 2YM6A 3MDYA 4IAZA 4C4FA 4W4WA 2H34A 2ERZE 3A8WA 3NYOA 5E90A 4AGDA 3FBVA 2VV9A 5B2MA 5JN2A 4FTMA 3ZEWA 4DHFA 3FYKX 1Q3WA 3LLAA 4BDDA 2ITWA 5DYJA 3V6SA 4YNEA 4H1MA 5DT0A 4EBWA 3OXIA 3Q4ZA 3PZHA 2GHGA 4IX3A 5C27A 4ACMA 4G34A 3D7TB 3IOPA 4JIKA 5E1SA 3RHKA 4MD7E 4F64A 3AOXA 2HIWA 2BFXA 3Q2MA 4GYIA 3BX5A 1PXMA 4FEVA 4DEAA 2VO3A 5M56A 4EYMA 2BHHA 4QMPA 3HA8A 5H8EA 4ZXTA 4F0GA 2VZ6A 2YCFA 3ZTXA 3VUHA 3VS1A 4HYUA 2YABA 1AD5A 2BRMA 4BCMA 4L00A 3R8VA 2OKRA 1NW1A 4CG8A 4EUUA 3FKLA 4I0TA 4FIGA 2ITPA 3RZBA 4DH7A 2Q0NA 1ZOEA 3FQEA 5ANKA 2B1PA 4EORA 4X0MA 4CNHA 5DG5A 4D4SA 2R3OA 4MBIA 4RJ7A 3BHUA 4RFZA 3I79A 4ZSLA 5HLWA 5M4FA 4C3FA 3PSBA 5AADA 5BVFA 4LYNA 2BZIB 2VWZA 4AGUA 1OKVA 3BHVA 4FVQA 2PVLA 3LM0A 5KUPA 1ZMUA 3LFQA 3SXRA 2Q0BA 2R0IA 4FTOA 4I0RA 3H0ZA 1J7IA 4I93A 2PK9A 3Q4CA 2XNGA 3TZ9A 1QMZA 3KMUA 2QHMA 3NWWA 4OTRA 4TYEA 5HG8A 5LOHA 4FT7A 4YLKA 3EYGA 4QTBA 4GK3A 4PNIA 3NYXA 5F95A 4M0ZA 4N6ZA 5CXZA 1FVTA 1ZMWA 2XKDA 3MY0A 1JOWB 2ZDUA 4RZVA 4XRJA 1WBTA 5E8YA 1H07A 4ZLZA 4LUEA 3KF4A 3PLSA 2Y4IC 2JGZA 5D41A 4Z7GA 3QRIA 3CQWA 1FGKA 2VTIA 3IW4A 2QODA 5KMMA 1H0VA 3ERKA 4IMYA 3MJ2A 3P5JC 4WBOA 5BVEA 5BV3A 4GS6A 3W0PA 3TNHA 5KZIA 3I4BA 4I5HA 3UOHA 1QPCA 4KUJA 2ONLC 5JH6A 3R8PA 4CFNA 4IB3A 4FZDB 4IFCA 5E91A 5T68A 3PE2A 4M97A 4LQMA 2G2IA 4ANMA 5C8NA 1WBWA 5CSWA 2C5XA 2XCKA 3OWJA 3II5A 3PWDA 3RM7A 2C5OA 4Z16A 4G3DA 3I7BA 4ONAA 3CIKA 1ZRZA 5AUYA 3T9IA 2C68A 3G0FA 3SLSA 4FSNA 2BVAA 3AD5A 3S2PA 3A4OX 3R9RA 3QF9A 3CLYA 2BCJA 2W06A 5JEBA 3DS6A 5IQBA 1VZOA 2PE0A 3TV7A 2Z8CA 3CD3A 4C02A 4EKLA 4X2FA 4O2PA 4EEVA 2EVAA 4MEDA 3LIJA 1ZOHA 3DXQA 1WCCA 4JNWA 4A9RA 4XV1A 2B9FA 2IVUA 3LLTA 2YISA 3C4EA 4YSMA 4YO4A 4MD8E 3UNZA 4E1ZA 3CPCA 2W1EA 5HICA 2EXMA 5CX9A 3VJNA 2H96A 4FSTA 2JITA 3TKHA 3NS9A 3PXYA 3F3UA 1G3NA 1WBPA 3SDJA 2Y9QA 2FVDA 4IZYA 1W8CA 4O83A 3MA3A 4OTDA 2G2HA 4JOAA 4K11A 4OBPA 5B2LA 2YEXA 1ND4A 1JPAA 2Z7LA 4CSVA 3ZYAA 3V8WA 2XANA 2LGCA 5LVNA 5HGIA 2VWIA 1SVEA 4BTJA 5EM7A 3PY0A 3L8SA 2UZWE 3FC1X 4YSJA 5CEKA 4ZS4A 1YWNA 3AKLA 4BDHA 4DGOA 1XWSA 1YHSA 1UU3A 2IZRA 5E92A 3QQFA 3VVHA 3IG7A 2ZM3A 4KNBA 4CQEA 1RW8A 3QA0A 4AE9A 2OFUA 5M55A 2QG5A 4L9IA 4F9CA 4ZMFA 2NRYA 3LVPA 3QD4A 3C5UA 4YURA 1Q5KA 3CSVA 4LMNA 1OKZA 5CEOA 3GU7A 3R04A 1MP8A 4J1RA 5HG9A 1F5QA 2PVMA 1UU8A 3S0OA 3W10A 3ODZX 5HCZA 2WQOA 5HE0A 4QMMA 3Q04A 2BMCA 2XIKA 4M67A 3WI6A 1AGWA 1KWPA 3UIUA 3QTZA 4IB5A 4JIAA 4YZBA 3JS2A 4M8TA 3HP2A 3V5TA 2GNHA 4FTTA 5HIEA 3ACKA 5B2KA 1GZ8A 2VTOA 4Y83A 2E9OA 3I7CA 3PSDA 4DG2E 4O38A 3UODA 2PZ5A 1JQHA 4FSYA 1OBDA 3EKNA 5IISA 5LMKA 4RIYA 1BUHA 1REJA 4FNYA 1T45A 4RQVA 2F57A 4CZUA 5JSMA 5L2SA 3BHYA 1TQMA 3NUAA 4O84A 2FSMX 3DV3A 4FL3A 3ID6C 3DLSA 4DITA 1PXOA 2HXLA 4ZSAA 3BYOA 2W5AA 3MB7A 3JVSA 2CJMA 4TW9A 5CVFA 1PW2A 2IO6A 4MXOA 4R7BA 5A9UA 3AMBA 2UZBA 3TT0A 3F61A 1O6LA 5LCKA 2R2PA 3RPRA 4DEGA 2P55A 3EQFA 4GCJA 4J96A 4X3JA 4YLJA 4O0SA 4FIHA 4QP7A 4TWCA 1KOAA 2YCRA 3F5GA 2F4JA 4BDJA 1H08A 5ETIA 3SA0A 5AMNA 3SHEA 1UVRA 3FZRA 5J9YA 3WIKA 4J8MA 3A8XA 1Q4LA 3MTLA 4TXCA 3R8MA 3IDBA 1NVQA 2C6OA 3MS9A 3Q9WA 4JG6A 3QU0A 5A54A 3HDNA 4FV9A 3FUPA 3DKGA 4O6LA 4AF3A 3OROA 3ULZA 1JVPP 4BICA 2OF4A 3SAYA 2BTRA 1BI7A 5I9YA 5KHWA 5JKGA 4D9TA 2F2UA 2XNEA 1ZYCA 4TNBA 4AZEA 4EI4A 3EB0A 2PMIA 4Y95A 2YZAA 2RG5A 3V3VA 3CR0A 3GU5A 3B2TA 3K5VA 4CKIA 2VX0A 5L6OA 4FT9A 4FX3A 3ZLSA 2ETKA 2OLCA 1ZYDA 5BPYA 4QQCA 1SNUA 5KKRB 3LOKA 1YHVA 3JXWA 4NM7A 1J3HA 4LV7A 4XG9A 2J0MB 3U6IA 3LCOA 3NUUA 3QC9A 3R02A 2GMXA 1PXKA 1VJYA 3QXPA 2B54A 5ACKA 3RAKA 4YBKA 2I0HA 4JI9A 5L6PA 3GCPA 4PMSA 4QYFA 5BUEA 2P3GX 3BLRA 4GK4A 4BCPA 3KF7A 1VR2A 2ITQA 3RPVA 3BYVA 3NIZA 4ENYA 3AXWA 3FMEA 4F78A 1JWHA 4BCNA 2BIKB 3O23A 3ZC6A 1V0BA 2H9VA 4DCEA 4O0YA 3SRVA 3QKLA 3LKMA 5DA3A 5M4CA 4TYHA 4FSUA 5AM7A 4A4LA 4PTCA 3BE2A 4F9WA 5IPJA 3F6XA 4HVGA 1A48A 3MN3A 3LCTA 2A27A 5HNIX 3G90X 3FDNA 2ONLA 3P0MA 4MVFA 4BGQA 4U5JA 3C5IA 3HMIA 2W4JA 4YHFA 3V6RA 5KCVA 5HO7A 1H1WA 4B9DA 3TUBA 3I6WA 1OL6A 5HBHA 1Q97A 3WZUA 1XHAA 4WG4A 4NZWB 3A60A 1M14A 4D4VA 3S4QA 3UNKA 2ITTA 2I6LA 1GNGA 3AGMA 4M69B 1FBNA 3GOPA 5ANGA 2J0KA 4E8AA 3R9OA 1CMKE 5KBRA 2PULA 4IC8A 4BJJB 2RGPA 4K6ZA 2W5BA 1JKTA 1U59A 4HVIA 4I6FA 4AW5A 3NNVA 4EOLA 2VGPA 5C4LA 3G5DA 1PXNA 4FSWA 4MH7A 5ICPA 4W8EA 4IJPA 3DAEA 2B7AA 4HPUE 4IAKA 4I23A 3HECA 2I0EA 4ZSJA 4P5ZA 5CVHA 3R83A 4XX9A 2HW6A 3PXFA 3FMKA 4NM3A 4QYHA 4XNEA 3BELA 4ACCA 4RX5A 5I9ZA 2DYLA 4G3EA 3R7OA 4IB0A 5IG1A 3PTGA 1LEWA 1ZYSA 4PMPA 4H1JA 4PDOA 4FV3A 4WRSA 3ZLYA 3ZBXA 5GINE 4JRNA 3TJCA 1OKWA 1PKGA 2KTYA 3ORKA 2P0CA 4O0XA 4EQCA 2NYAA 3U4WA 4FYNA 5M4UA 3BQRA 3LMHA 4HYIA 2BROA 3ZEPA 4J98A 1QCFA 3ML1A 4DN5A 2WU7A 5IDNA 5KMIA 5CS6A 5DGZA 4KB8A 5CSXA 4FZAB 1PKDA 4CD0A 2GHLA 1TQPA 3BU3A 3UJGA 4JBOA 2VTNA 2XK4A 3QKMA 3UNJA 5EI2A 4UX9A 3L8XA 2PUIA 4GIIA 4RJ5A 3W2QA 4R7IA 5EYDA 4IACA 3G6GA 3UC3A 2CMWA 3AT3A 5DR2A 5M09A 1OGYA 4BGHA 2R0UA 2BRNA 1IAJA 3EN6A 3ORMA 4FTNA 4UZDA 2IVSA 2W7XA 2GTNA 2RL5A 3O50A 4I20A 3ORTA 4HVSA 1U54A 3HV4A 2HZ0A 3KXMA 4AOIA 4DLIA 2DS1A 3OXTA 4R5SA 4GFGA 5E8XA 3TIYA 2R9SA 2XM8A 2OZOA 3DBDA 4U3YA 2XYUA 1H4LA 3NW7A 2YERA 4FKUA 2Y6MA 3NX8A 2IZSA 5T3QA 1Q99A 2J90A 2WO6A 2WZJA 3MESA 3TZ7A 3LJ1A 4DA5A 5C4KA 2BZKB 5KBQA 2RG6A 4AW1A 4USFA 4CRLA 3SV0A 3ORZA 2UZVA 3QCQA 3V5JA 3ACJA 3VF9A 4X21A 3IK3A 5F20A 3W18A 1YWVA 3UG1A 2OK1A 2WMQA 1XBBA 2R4BA 3DDPA 4FG8A 3VS4A 4DT9A 4G3GA 1G5SA 3UZTA 1J91A 4FL1A 3D0EA 3JPVA 4CCBA 2ZDTA 1ATPE 2UZTA 3E8EA 5JZNA 1Z57A 1W98A 2ETMA 2JAVA 3DJ6A 4I6QA 3Q4TA 3PIXA 5F9EA 4G6NA 4R6VA 2WMTA 3BIZA 2PVFA 3AT2A 2I40A 4XH6A 4JMQA 3W8LA 3KRXA 4MNEA 4YJQA 3MPAA 2JFLA 3O8UA 2JAMA 2W05A 4GG7A 2BDJA 3S3IA 4F63A 1W0XC 2RFSA 1SVHA 2GU8A 4XP2A 3UMXA 4F09A 4ERWA 3C0IA 3QD0A 4AFEA 3UO4A 2P4IA 3PFQA 4JT3A 2EU9A 4MF1A 2OICA 2PWLA 2YJSA 4W4YA 2JDSA 4EZ7A 3FHRA 3UOJA 5A4LA 3HAVA 2HWPA 2E2BA 3UMWA 4DFNA 3R7YA 4RJ4A 2X7FA 4GJ2A 2RIOA 3FXXA 4MWIA 4AA4A 3CY3A 3UYSA 2OIBA 3G9LX 3M2WA 4XBUA 4JQ7A 3VONA 5IA1A 3NR9A 3GB2A 5DT3A 3PG3A 5IA2A 4PWNA 3H9FA 5AAFA 3AT4A 4YTHA 2VO7A 3ENHA 3E62A 3GCSA 3NAXA 4X6QC 4R1VA 4HVHA 4GT3A 3QFVA 4YNOA 2DUVA 3O71A 4EONA 4AAYA 3GC7A 4FI1A 3GCVA 4FUXA 3SC1A 3KKVA 5K4IA 4WD5A 3OG7A 5LMAA 4BCJA 1IA9A 3QX2A 3DBCA 5FUTA 4BGGA 4I6LA 2C0OA 1H00A 3IOKA 2R3GA 5HX6A 3LMIA 4IDVA 4CV9A 1OIUA 4FIIA 3OVVA 5CNOA 4EH9A 4L42A 5BQ0A 1CSNA 3IO7A 2OH4A 2HK5A 4C2WA 4C34A 5LMBA 3TUDA 2YWPA 4OT6A 3QUEA 4NM5A 3ZU7A 5JQ5A 3LXPA 1BKXA 3W1FA 2V22A 4FEWA 5K3YA 4RX9A 1VYWA 3F9NA 3SXSA 3AKKA 2W1CA 4N0SA 4X2JA 3HAMA 5CXHA 3ROYA 3OBJA 4XJ0A 4H39A 4AAAA 3QYWA 3ZRKA 2PVNA 1PF8A 2PMNX 1KSWA 3MI9A 3TKUA 2WIHA 3DY7A 4QTAA 5I9VA 1NT2A 3RINA 4DEDA 2XARA 4D28A 3TNQB 1B39A 2R7IA 4LFIA 4TPTA 3G0EA 4U43A 2ZB0A 4YJUA 2XP2A 1PRYA 2W1DA 3BYMA 4FG9A 4JBPA 4AGWA 2HAKA 3BGQA 5KMKA 4XS2A 4N70A 4HVDA 1GZOA 3WF8A 2AEGA 4YHTA 4MXAA 2W96B 4OBOA 3LJ0A 3PSCA 3OW3A 4V0GA 3E92A 4J52A 4KAOA 3ZLXA 4U9AA 4GU9A 4MXXA 3EN4A 4Q9SA 5IZFA 4F7JA 4F0IA 4EH6A 3DT1A 3OY3A 3Q60A 4QMQA 1NA7A 3R21A 4EQMA 1FMKA 3KY2A 1M2QA 3MFRA 5CI7A 2B4SB 4APPA 1R0EA 1R0PA 4QQTA 1OPKA 1EH4A 4R78A 2UZLA 3C1XA 4P4CA 5E7RA 5EYCA 4ZK5A 4A07A 3CQEA 3QZIA 4QMLA 4EOMA 3LFFA 3VUGA 4RBLA 4BIEA 1JKSA 3NIEA 3KMMA 4F6UA 4RLLA 1AQ1A 5I9UA 2G2FA 1FOTA 2O0UA 5D9HA 2I1MA 4EOPA 4GL9A 4XV9A 4I4FA 4NT4A 2CN5A 3VS3A 1URWA 4TYIA 3BQCA 1LR4A 3EMGA 3PXKA 5L8JA 3RM6A 3TL8A 1APME 1G8AA 3OC1A 4YTIA 2YCSA 4UWBA 5DEWA 1H1RA 3MPMA 4HNFA 3R73A 4A06A 4P90A 4FKWA 4HGLA 4AG8A 4F0FA 5CF4A 5ITAA 4O7VA 3WZJA 5IA5A 2VTHA 2WEVA 3ZSIA 1YVJA 3A62A 4APCA 3PVBA 5HKMA 3FQHA 3EIDA 3MPTA 5D10A 4AU8A 5KMJA 3RWPA 4IAIA 4YC8A 2YM8A 3E7OA 4PV0A 3ZMMA 3CJGA 3GXLA 3DTWA 5BUJA 3W2SA 2CN8A 2W4OA 2YM7A 3EFJA 4QYYA 2WU6A 5CSVA 2VO6A 1YOLA 3H10A 3M42A 3OEZA 1XJDA 2CKEA 2ERKA 4KKEA 4QQ5A 4YC6A 2WHBA 4TL0A 2JD5A 4B99A 1WBVA 4G5JA 3DFCB 2XZSA 2IW8A 5IUHA 2XS0A 4YJTA 3R9DA 4B8LA 5HTBA 5IEVA 2CPKE 1T46A 2QHNA 3GUBA 2B55A 3LAUA 3RPYA 4O22A 2IN6A 3RAHA 4C4IA 3F3TA 3RK7A 2B9JA 4K0YA 4JX3A 3P9JA 3LQ3A 4L43A 4RGJA 5HESA 3FWQA 5EM5A 4YLLA 4A4XA 3PJ1A 4DFBA 4HW7A 1OBGA 4XG2A 1E1VA 4EH4A 5LVOA 4R3PA 4WG3A 3ZXZA 3TI1A 2QKWB 4LV5A 4P2KA 4FV6A 3CS9A 4M84A 5EM6A 5ETAA 1ZOGA 2HXQA 2OJGA 2WMVA 4FGBA 5CQWA 2XAOA 4MAOA 4MNFA 3QZGA 4ZTLA 4EOSA 2WQEA 5E1EA 3S95A 1PY5A 3TTIA 2BDFA 2YIXA 2V5QA 2CCIA 4GUBA 4DTBA 5I5ZA 3VRYA 5FEQA 3JVRA 4BR3A 3I5NA 4JAIA 3PRIA 1S9JA 5E9EA 3BRBA 4F7NA 3QTRA 2VGOA 2QOQA 2XJ2A 5EKNA 4FEUA 3HP5A 3T3VA 3UG2A 4RRVA 2VTAA 4PX6A 5A6OA 4WHZA 2QR8A 3PP1A 4G5PA 4YTFA 3QUPA 3ZO1A 4WNKA 1K3AA 1H1SA 2WTKB 4ZTMA 2O2UA 2GFSA 5HI2A 3DK7A 4RIOA 3R63A 3WOWA 3KQ7A 3KU2A 4JDJA 3EQRA 4RIYB 4KBAA 4FKRA 2YM4A 4PDYA 3DFAA 1J1CA 3KRLA 2C69A 4EWHA 4BCIA 5CVGA 2GQSA 3PPJA 4UYNA 3CEKA 3LM5A 2WEIA 2XB7A 4BDEA 3KRJA 4EH5A 3L9NA 4IM0A 3BEAA 4F7SA 2R3FA 3FV8A 2C6IA 4DFZE 1VYZA 4FKTA 1YOMA 4CMOA 5BMSA 3CXWA 2V55A 2Y0AA 3GQIA 5D12A 3HV5A 3H3CA 1IEPA 3MVLA 4BZNA 1Y8GA 5FBNC 3QTQA 3QTSA 2CNQA 2ESMA 3P78A 4E6QA 2RF9A 4E6DA 2W5HA 3A7FA 5IUGA 3VS5A 3E5AA 3GC0A 4L6QA 3LCDA 2J0IA 3EJ1A 1KE6A 5LVMA 4PP9A 5FD2A 3TXOA 2PL0A 3QWJA 2ZV8A 1YDRE 3SKCA 3I0OA 3OTUA 4QNAA 4ZP5A 3KL8A 5HCYA 2AC3A 2CGUA 4IH8A 3ZZWA 4QT1A 5EDQA 4QO9A 2JC6A 3ZM9A 3P4KA 4GRBA 3FI3A 3JR1A 4PL5A 1RE8A 2CNVA 3DK6A 5AV2A 3ZDIA 5FQDC 5A6NA 5CAVA 3D5UA 2QD9A 2UZEA 2ITOA 4XEYA 3U9CA 3U6HA 4FKJA 3MFUA 5AUVA 4ZEGA 5LVLA 5C9CA 3GOKA 3L1SA 3KULA 5D7AA 2ZFYA 1ZLTA 4F6WA 3G33A 4PL3A 2BFYA 4KBKA 3EFLA 2FSTX 4WUNA 3IONA 4LGGA 4CRSA 4AXFA 2OU7A 3K2LA 3EN5A 5GNKA 3VBWA 2OZAA 4TKSA 3QQKA 4QMXA 3EQPA 4K18A 4KBCA 4X3FC 1OUYA 2Z60A 2A1AB 3R8LA 1U5RA 2J50A 2BDWA 4FIJA 2XKEA 2Y4IB 3OWLA 4YPDA 4EZ3A 3RK5A 2FYSA 4O7WA 1HCKA 5BYLA 4NL0A 3ZHPC 2WMRA 3FY2A 3WARA 3SRVB 1Y6AA 2G9XA 4FODA 2WXVA 4UXLA 5CWZA 5BUIA 1U5QA 1WVWA 4TYHB 3M11A 1OGUA 4PDPA 2QO2A 2OH0E 4CFFA 4ZJIA 5AUWA 2F7EE 1BMKA 5AP0A 4C35A 3P7AA 4F08A 4Z55A 3L8PA 1CKPA 3BGZA 1YWRA 2IZUA 3EQHA 5KMLA 5HE3A 5E8WA 4HNIA 2J5EA 1WMKA 3C4XA 4UWCA 4I4EA 4XG6A 4EZ5A 5M53A 2C1AA 3U55A 3KXXA 4AZFA 4PRJA 4QMYA 4DCAA 1XH6A 5I4NA 5IQCA 3E7VA 3VS6A 2QURA 4I6HA 3HVCA 3D14A 4IQ6A 4YR8A 4DFYA 4BI2A 4OTHA 2BRBA 4QNYA 3QGYA 4M14A 3D4QA 3OP5A 5CLPA 4IW0A 1GAGA 4I21A 5H3QA 5BVWA 1TQIA 5HLPA 2V62A 1U4DA 2YDJA 4U41A 4AXDA 3W2PA 4ZJVA 1M7QA 4Z3VA 3C13A 1MRYA 4QTEA 3FI4A 4FC0A 4EC9A 5CYIA 5FP5A 4MXZA 4EOQA 4WOVA 3WILA 4FV5A 1VLRA 4LDTA 1OPJA 3E8CA 3HGKA 3W0QA 3QZFA 3W8QA 3ZDUA 2YIRA 1GIIA 3THBA 5AP7A 1H01A 2R3IA 2C30A 2PUNA 3QKKA 4HZRA 3PPZA 2XK8A 2ZVAA 4LGHA 4MTAA 5TO8A 4GEOA 4BKJA 4BCOA 5LQFA 2UW3A 4DG0E 4MXYA 4I5PA 3UVRA 4TYJA 3VBYA 1QPDA 4DFXE 3QCXA 2QOOA 3COKA 4KSQA 2QOCA 4J99A 4O96A 4PNKA 3FI2A 3RKBA 1WFCA 5AP6A 3FQSA 5CSHA 4DINA 4L45A 3EQDA 4Y5HA 5EK7A 4EUTA 3FLNC 3O5AA 1Q61A 5EQYA 3UYTA 1P4OA 3E64A 3QHWA 3QD3A 2BILB 4IC7A 4QOXA 3ZUVA 1NXKA 3KMWA 4O7LA 3VBXA 4DFLA 2UW0A 2XNMA 4JL9A 4C3PA 1E1XA 3NYVA 2UW9A 3DB8A 3EYHA 3ITZA 3OUKA 4JDHA 4I22A 4DHIB 3UO5A 4BRXA 3H9OA 4AN9A 2JEDA 4PDSA 4D9UA 5T6KA 1H27A 3O8TA 5HIBA 3GGFA 4IE9A 4O81A 2GDOA 1U54B 4FSQA 4EK5A 3FMMA 4NCTC 4QMSA 4BI0A 1YQJA 3DQXA 5C26A 4K8AA 4O0RA 2R3PA 5GHVA 1KUTA 1PMNA 3L9PA 3RJCA 5IH5A 4J7BA 4I94A 2X4FA 1F0QA 3FZSA 3VHEA 3VS7A 3FYJX 5FP6A 3KRRA 4HCUA 4FKSA 3HX4A 1OL1A 4TY1A 2UZUE 5IA3A 2W1ZA 4GFOA 4FV2A 5IQIA 3UDTA 1Q8UA 4NW6A 4F65A 5C8MA 3GFWA 4IX5A 3G6HA 4RA4A 1UV5A 5AUUA 5LVPA 1YXUA 3HEGA 3T9TA 3MY5A 3ZFXA 2A19B 3CY2A 2WNTA 1UWHA 1XO2B 4IBMA 4BIDA 3MH0A 4M3QA 2W99B 2OI4X 5EYKA 5K9IA 3PIZA 4CFXA 2PUUA 2PTKA 5CU2A 3QRUA 3TYKA 1XBAA 3I6UA 5GJGA 4AGCA 4AXCA 3MYGA 3QX4A 4U3ZA 4DEIA 2GQGA 4MNEB 2YDKA 4NYEA 4M0YA 5M08A 2P33A 1W84A 4PMMA 1J7LA 2B9HA 2XA4A 3CGOA 3LQ8A 4Q2AA 2GCDA 3DBFA 3R28A 3REPA 2WMSA 2IW6A 3QQGA 4E7WA 4NK9A 4G6OA 2J7TA 5IQDA 4B8MA 2RFEA 3R1QA 2BZHB 5HEZA 2PU8A 4D0WA 3D94A 4BCQA 3MW1A 3PRFA 4F1MA 4MQ2A 5DR9A 4C4HA 3C4WA 1KE5A 3E93A 2PUPA 4L3LA 3DCVA 4U6RA 2YFXA 2CSNA 4QMZA 1ZYJA 3VBTA 3LHJA 1OL2A 4IADA 3ELJA 5JFVA 2Q83A 2V0DA 4FTRA 2WTCA 4RWLA 3ALOA 3ATTA 2VU3A 4CLJA 4AXAA 4E5BA 4D5KA 1YXXA 3COHA 2FGIA 2XM9A 3R1SA 3SOAA 2J9MA 2CKPA 3QYZA 3GFEA 1Y57A 2C6MA 3BKBA 4L46A 5HQ0A 4O21A 5BYZA 2UZDA 1OKYA 3BU6A 3ULIA 2YAAA 3CKWA 5A46A 3D5VA 3EFKA 2OSCA 3NUXA 2GNJA 4LM5A 4X3FA 5HHWA 3ZM4A 4D58A 4ZLYA 1JKKA 3K54A 4BDGA 2FB8A 3KC3A 1SM2A 3R7VA 2R7BA 4WKQA 3DAJA 4AP7A 4Q9ZA 2ZM4A 1Q41A 3VUIA 5EW3A 3U9NA 5AUTA 5KE0A 4QMUA 4L7SA 5EQEA 4JLCA 3POZA 2WMWA 3DJ5A 5E4HA 5A4EA 5AAGA 4J53A 4OTFA 2GNIA 5L8LA 4RFYA 3W55A 1MRVA 3FLZA 3MH3A 5L2WA 2W1GA 4XP3A 3UDBA 3G9NA 1A06A 4XG8A 4C59A 1OIQA 5JK3A 5CAPA 4I0SA 3PLAE 3KN6A 3HV7A 3CPBA 4C36A 4U0IA 2PZYA 4R5YA 5FTOA 4QP4A 3SQQA 3LFBA 5GJFA 3AC1A 4BCGA 4DG3E 4N57A 1LEZA 3FLQA 3QQLA 5EYMA 3RNIA 3VQUA 3LCSA 5A4QA 4CFUA 2C5VA 4WNOA 1UNHA 3P79A 4XV3A 3FJQE 3UP2A 2CLQA 4O27B 3E3PA 3GU6A 3TM0A 3F7WA 3UZPA 2CCHA 3TTJA 4QQJA 5FBOA 2QC6A 3WZEA 4BBEA 3BE9A 2VWUA 3U87A 1YI4A 3OT8A 2UVXA 4LI5A 3ZBFA 4AACA 1O6YA 3OCTA 5JRSA 4CMTA 3D7ZA 4CVAA 3QQHA 4FG7A 1HCLA 3WZKA 3IW8A 4ZLOA 1I09A 2SRCA 1PMUA 1ZYLA 2UW6A 4LOOA 3IGGA 3R7EA 3O2MA 3RP9A 3QQJA 3OTVA 2IWIA 5EHLA 3A7IA 2NPQA 1ST0A 3NUNA 3W0OA 3OBGA 4V0GB 2JDVA 2REIA 5CAOA 3W16A 4RA5A 3FMDA 1LPUA 1R3CA 2WTVA 4QP6A 5AIKA 4DHJA 5FG8A 1HOWA 3W2RA 4CT1A 4D2RA 2JDTA 4KS8A 5HVJA 3PZEA 3BV3A 5ETFA 5H9BA 3FHIA 5IU2A 5CU4A 2Z02A 3RPOA 4C4GA 2G15A 2FSLX 3KCFA 2XIXA 4O91A 3RPSA 4LOPA 2E9NA 3VBQA 4D55A 3UQCA 2XALA 3L9LA 4RFMA 3DGKA 3ROCA 3OOMA 3O17A 5DOSA 3DA6A 3JUHA 2GTMA 3P23A 4S2ZA 5CQUA 3GBZA 2GS6A 2X6EA 4DF3A 5AAEA 4PUZA 5EKOA 3BL7A 3S00A 3GT8A 2UZOA 4XG4A 5CENA 2B53A 4FTJA 1H24A 2ITYA 4G17A 4NTSA 1OECA 4ALWA 3PVUA 4L7FA 2G1TA 3HMOA 1KV2A 5AX9A 4I3ZA 4BIBA 3PVGA 4GKIA 4K77A 3BWJA 4OTGA