4PDYA

Crystal structure of aminoglycoside phosphotransferase from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
337
structure length
332
Chain Sequence
RLGSRSQAPLIPQAVVSKYDLAIQQRHADGNIEVWTDSKGRRYAAKRSSIAPAHCRIMVQCLRHAQEQGFTKFARFVTTSSNAPYVRHGDFTYYVTEWVSGQPANFGLPEHVAQTAYTLAQFHEATRSFRTDWKDDVFGLFQARWRDLRQMWLGADRKREKDAFDQLLLSMRDELHRDAAESLALFEDRDVIAYLEAERSSGGWCHLDVIPSNCLYTPQHQVVLIDFELARPAPRALDMAHLLRRSLERGNWDGHLAYACFLHFDAVRNIPKSEYRAVEAILRFPYLPWRIAHARYHFAADPSQLDALQQYAVQAEKRQAFLASLRQQVEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Transferase
total genus 119
structure length 332
sequence length 337
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdyA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4pdyA02
5IU2A 3A4PA 3KRXA 2XMYA 3MFUA 2O65A 4IZAA 3G6HA 3HA8A 4CMTA 3U9CA 2VTOA 3COIA 4GJ3A 3K3JA 4BVUA 4LMNA 2RFEA 5HIEA 5E92A 1JSTA 4GUBA 2Y8OA 2QHNA 3CKXA 2IW8A 4RWKA 5LMKA 4CZUA 5EDQA 2YDKA 3L8SA 5M07A 2VWZA 2GSFA 3CTQA 4DCEA 2ZV8A 3FI3A 3IDCA 4RGJA 4PL5A 4DA5A 2JFMA 5KKRB 4IWQA 5HU3A 2GHGA 2YIXA 2QONA 1DM2A 2X8EA 4CKJA 4PL4A 2JBOA 3E7VA 3Q9YA 3KVXA 1V0BA 2GPHA 3OUKA 3V5PA 1XH9A 5C9CA 3RTPA 3HMMA 4XCUA 4KINA 5DR2A 4BYJA 3IDBA 3LJ1A 3PJ8A 5E8WA 3AQVA 5H9BA 3TEIA 3ZBXA 1Q8WA 2HK5A 2BPMA 4AA5A 5L8JA 4CSVA 3FZSA 1RDQE 3DBQA 2PZRA 4EZ5A 4Q5HA 3F3TA 2J90A 1J7LA 3DFCB 3MDYA 5AUXA 2YABA 2BROA 1RW8A 3LOKA 2JD5A 3ZFYA 1GZKA 3BBWA 3UVRA 4QRCA 3DNDA 3EFWA 4O7RA 3KXZA 3FMEA 4L00A 4BDIA 5A4LA 5LVOA 1Q8TA 2NO3A 1CSNA 3MFRA 2ITWA 5FQDC 4XG4A 1ZYSA 1T46A 4UN0C 5C4KA 3F5UA 4EJNA 1U46A 1G3NA 3FYJX 4AG8A 4X2KA 4B7TA 2WQOA 3Q2MA 5FTGA 3V04A 2JLDA 3VJNA 2PVLA 3BZ3A 4IDVA 1YWNA 3G9NA 4XV3A 4ZZMA 4EOQA 3MA3A 5CXZA 4TYGA 4USDA 5AP6A 3AOXA 3NNXA 3FMKA 2LAVA 2RG5A 1M7NA 2UZLA 2Y0AA 3UVPA 4AT3A 4HVSA 3TTJA 4AQCA 4CV9A 5CZIA 2E9PA 2I0VA 4L8MA 4AOJA 2VX0A 4YTCA 2HAKA 3MFTA 5DOSA 4BDFA 4CVAA 4O0RA 4N0SA 4L68A 3VUMA 2PVNA 5BYYA 3BYMA 2C4GA 3QTSA 3ERKA 3VBQA 2NNWB 2XKDA 4TKSA 5CWZA 3C5IA 1YWRA 3JVRA 5BVKA 5KZIA 4BI0A 2YWPA 2XF0A 1KE5A 3KU2A 4J98A 4DAWA 1QPEA 3SLSA 4KKGA 5HE0A 2F9GA 2OFVA 2EUFB 3FY2A 3HL7A 3LKMA 3NVMB 1R0EA 3P79A 4N57A 3UO4A 5FBOA 3N4VA 4MD9E 4I3ZA 3GCPA 1JKTA 4I41A 4USFA 3TTIA 4ID7A 3QTIA 4D1SA 3W2OA 5T3QA 1E1VA 2FSMX 2Y9QA 4EWHA 3HAMA 3COHA 2OIDA 2VTNA 3C7QA 4RG0A 5E9EA 2IW6A 4IMYA 4CRLA 3L9PA 4LOQA 4X3FA 2OIQA 2Z7SA 3C4FA 4GVAA 4O7ZA 4ZY5A 4O7TA 4FGBA 4TWOA 4MNEB 3FZPA 4IADA 4OTIA 5L6WL 5EM7A 2WTJA 3QKKA 4TY1A 4YJTA 3SV0A 4UBAA 3PUPA 4WUNA 5LXMA 5EQEA 2PUNA 4FZ7A 4PF4A 4LGGA 5C8KA 1H0WA 4ZMEA 4MYGA 1OIQA 1V0OA 3UQGA 4IX3A 3R7YA 2PUUA 3VQHA 4AACA 3VW6A 5DVRA 3I1AA 3W33A 2OIBA 2X4FA 4YZBA 3FY0A 3E64A 3PVBA 4X2GA 4AWIA 3DBCA 1H0VA 1UKHA 2A19B 1YXSA 5KUPA 3DLSA 3GQLA 4NIFB 4RLLA 5KMOA 4F1MA 3GCSA 3ZYAA 4R3RA 2PVRA 2R7BA 3PXKA 4O21A 4AGCA 2ETRA 1GJOA 4UXQA 3R63A 4BCNA 5HG8A 1AGWA 5EI2A 3R8PA 3CC6A 3KXHA 3E88A 5J1VA 1FINA 5LWMA 2QOBA 2X39A 3FLNC 3IS5A 5JFSA 4XOZA 3WZUA 3PA5A 3HKOA 3GT8A 4O2ZA 3TI1A 3SA0A 3HV4A 3I5NA 4M68A 3NYOA 1JVPP 4MXOA 3RI1A 3WE4A 3ZCLA 2AC5A 5AP1A 3BE9A 4ZS0A 5TR6A 4C61A 2ITQA 4FTRA 2G1TA 5IQBA 2GHLA 3QQLA 4AOTA 3QYZA 2W5BA 3P5KA 5CXHA 4JLCA 4B8LA 5FRIA 3UG1A 4EL9A 5A6NA 4IAZA 1CDKA 3DAKA 3QC4A 2SRCA 4ALWA 5ETCA 4I6HA 3GU6A 4NT4A 4QP1A 4V0GA 5E8TA 2WOTA 2I0EA 4C59A 4TYHA 4YNOA 4A4XA 4JDJA 4DLIA 3LFFA 4L6QA 4F7NA 3MTFA 3EQBA 4NZWB 1ZYJA 3H9RA 5J87A 3CE3A 3ZDIA 4EOSA 4F99A 3HDMA 4IANA 3W0NA 4LM5A 2E9OA 4M8TA 1R1WA 3KXNA 3OY3A 5CALA 1PF8A 2H96A 3AMBA 4DFNA 1ZLTA 5CEIA 2GDOA 4L7SA 3KMUA 4WG3A 4BIEA 4M3QA 3H0YA 2ERZE 4JDIA 4E5BA 4Z55A 4H1MA 1W83A 3BX5A 3UO5A 4OBOA 2FYSA 1YI3A 3PVGA 3B8QA 1OKZA 1Q8ZA 4GFGA 4FSQA 4DFBA 3E63A 2CCIA 4AN3A 4W4WA 5JFVA 2W5AA 2C3KA 3FPQA 3FHRA 4MKCA 4IB1A 5KO1A 4I1ZA 1PMUA 1YXTA 3GC8A 2W4JA 4WRSA 1ZARA 3LQ5A 4XV9A 4QMLA 5EQYA 3FXZA 2B4SB 4UXLA 5AP4A 5JGAA 3ULIA 5F94A 3KEXA 4PMTA 4YO4A 1YVJA 4I24A 3AC2A 4DGOA 3ODYX 4EI4A 3R22A 4ASZA 4GV1A 3M2WA 2CGXA 1SYKA 2C47A 4QMPA 4UV0A 4V05A 4YJSA 4RSSA 3FLSA 4FODA 3QC9A 2UZNA 3KVWA 2UW3A 5EH0A 4E1ZA 4BRXA 1Y6BA 3TL8A 3D5WA 3ZXZA 4V0GB 4GFMA 4GK3A 2QO2A 5HIBA 4TYHB 3VBXA 4XS2A 3W10A 5IF1A 3P0MA 2XA4A 4ZJJA 4O7OA 2QO7A 4K18A 2XIZA 3A62A 5HCZA 3UNJA 4QYYA 5BVDA 4AE9A 5I9WA 4CG8A 1OVEA 2IPXA 3NUPA 4MWIA 3F82A 3KREA 1YW2A 4J71A 4CXAA 1AQ1A 2WTKB 4FUYA 3T9TA 3TJDA 2YN8A 5IQGA 2ZDTA 3AD4A 2PMNX 3DLZA 3QTXA 4KKHA 4HVHA 5L6PA 5HLPA 4YGAA 4BCJA 3PG3A 4BZDA 4XBRA 4D4SA 2GQGA 2O64A 5CS6A 4CMOA 3PXZA 3D4QA 3DXNA 4MXYA 2WMRA 4WSYA 3DKOA 4CEGA 3BYSA 3P7BA 4DEAA 5DYJA 2BTSA 3POOA 3Q53A 4YPSA 3N4UA 4UY9A 5FDXA 3TN8A 3ROYA 3E5AA 3UNKA 2R3GA 5HG5A 2W1GA 2R4BA 1B38A 3R9RA 3KXXA 3Q9ZA 1UU8A 5IZFA 3A61A 1DS5A 4YC8A 3R8MA 3W1FA 3MJ1A 2BKKA 2VNYA 1PMVA 1OKWA 3F2NA 2BHHA 2CSNA 2W1ZA 4MVFA 3IECA 2V7OA 5EFQA 4L3JA 4AW0A 4F7LA 3AC3A 2VWVA 2J51A 1L8TA 4BF2A 3UIUA 3ZFXA 3ZRKA 3A8XA 4WG4A 2Y4PA 4IM3A 3UDBA 4DE4A 5IG1A 5E8SA 4FTOA 2GNLA 1SNUA 2UZDA 3LZBA 3ORNA 3ZO2A 3P23A 4U7ZA 2PVYA 3ZUUA 3AG9A 4YJRA 2O2UA 2E9UA 4AP7A 2B53A 1OL7A 1A48A 4ITJA 3SRVA 3FQSA 2WEIA 4N70A 3GI3A 4PNIA 4L42A 5CYIA 5EW3A 2W1CA 3QFVA 4LGHA 3A7FA 4B4LA 4F9BA 2WXVA 4S30A 5IUGA 4GS6A 2JEDA 2X1NA 3R83A 4X2JA 3Q4CA 4XG2A 2VU3A 4U81A 1W8CA 5EM6A 3LM0A 4OTFA 2I40A 2YFXA 4W4XA 2W99B 2XM8A 3SDJA 4KBAA 2VTQA 4OT5A 2OXDA 4CT1A 3PJ2A 2Z7LA 5AAEA 4J7BA 5JFWA 5J9YA 2R3OA 4PDYA 5CVHA 3EN9A 5HNIX 2I1MA 3D15A 5FEQA 1A9UA 3ATSA 2W7XA 4IZ7A 3O50A 3UO6A 5E7RA 3D7ZA 3MH3A 1ATPE 4IX6A 3BI6A 1LPUA 4U80A 4YHJA 2O63A 5CX9A 5HHWA 4DGGA 5BQ0A 2J5FA 5AAGA 4Y95A 5HZNA 1PHKA 3NSZA 4L45A 3EWHA 3B8RA 4S31A 5G1XA 3AT4A 4E8AA 3WOWA 3ELJA 3E8CA 3OP5A 1JQHA 4LRKA 2UW6A 4F6SA 3ZBFA 4GIIA 3D2IA 2J0MB 3TZMA 3ORKA 3HMNA 1UNGA 5CSXA 4E93A 3P78A 5D12A 4EQUA 4JT3A 4PMSA 3W55A 1PRYA 3I7BA 4IEBA 4RIYB 1WVWA 1UNHA 3R02A 2UZBA 2WTCA 4FV8A 3KRRA 2B9JA 3T8OA 3UIBA 4A9RA 3EYHA 3JR1A 4RPVA 2UZOA 4NW6A 4AW1A 4ZZOA 4F9WA 5HG7A 2C68A 2QODA 3VIDA 5AV1A 3SC1A 3SOCA 4ZZNA 4DEEA 3PYYA 4M67A 3SRVB 4EEVA 3CY3A 2WMAA 5AA9A 2GNFA 3C0IA 1ZMVA 4GEOA 4CTBA 4AX8A 3KMWA 4FBXA 1PY5A 4O7YA 3G0EA 4E20A 4FKGA 1DI8A 4Q9SA 3I81A 4PQNA 4DCAA 2XRUA 3H9OA 3U51A 5HLWA 5I9YA 4XLIA 3DAJA 4FICA 1TQMA 4FZFB 1JKLA 2KULA 4TT7A 4BB4A 5C1QB 3BEGA 2UW4A 1CM8A 3R9HA 1CMKE 2PZYA 2C6EA 3V6RA 5LVMA 4G31A 3QQKA 5AP0A 3ZSHA 1WBOA 3ZLSA 2WQBA 2GS6A 3KC3A 4IWPA 2B1PA 2B9FA 2R7IA 5TO8A 1F5QA 3WZJA 3PSBA 3F5PA 4ANQA 1PXJA 3GFWA 4YLKA 4ZK5A 5HO7A 4O6LA 1L3RE 4FSUA 4ZTRA 3RVGA 4FSNA 4BICA 2FO0A 4FTKA 3ORMA 4TPTA 2BZJA 4CFFA 4IJ9A 5KCVA 3FC2A 3QCYA 2P4IA 3PFQA 4JL9A 4HYUA 4GCJA 4B6LA 1H1RA 5AADA 5CANA 2FVDA 3ZM4A 4CFNA 3VC4A 4PDSA 2BCJA 2FH9A 4K1BA 4PUZA 5J9ZA 3R1YA 4QMYA 5I9UA 4IVDA 5IH5A 3WBLA 4EOIA 3FPMA 3C13A 4CKIA 4CMUA 4I23A 2BAKA 4JBVA 3VS6A 3KN5A 4YSJA 3QD4A 3NEWA 3MN3A 4F6UA 2XK3A 4J53A 4V04A 3UP2A 3GOPA 5K5NA 2XKFA 2FSOX 3QF9A 4QNAA 4ZLYA 3NW7A 4M0YA 2VGPA 5ANEA 5AV0A 4D5HA 4IAYA 3WIKA 1W84A 4C02A 3R9DA 5IDNA 4PDOA 1URCA 4F9CA 3F9NA 1FMOE 4QMWA 4WNOA 5IQCA 1FOTA 4HGLA 2QOIA 3ACJA 2BZKB 4AAAA 4EKKA 2UW8A 4G9CA 4GL9A 3PXQA 2XUUA 3HMIA 2PWLA 4BHNA 2BZHB 4KABA 3VAPA 2NRYA 1KOAA 3R8UA 4U0IA 5FP5A 3Q32A 4CFVA 1GZOA 3C5UA 3CPBA 4CLIA 4EC9A 3TNHA 4M12A 3ZZWA 2O3PA 1U5RA 5BYLA 5IQHA 1XR1A 2G2FA 3QXPA 3G2FA 1PXKA 2WO6A 3V5QA 5D7VA 2ZB1A 3EJ1A 3ZHPC 2YIWA 3C50A 3QA8A 1XH6A 4X6QC 3FUPA 2C6LA 5EW8A 4QO9A 4MX9A 5L8LA 3OT3A 4FIIA 3FJQE 4NFNA 3AMAA 2JFLA 2VWIA 4FZAB 4HCVA 3QD3A 5AUUA 2JAVA 3FSFA 3O2MA 4C37A 2WIPA 3WI6A 1HOWA 3PY3A 5AMNA 3C4WA 3EIDA 3DQWA 3PE1A 4IB0A 5CI7A 3GC7A 4PTGA 1ZOHA 3ALOA 4F70A 3VBTA 3FZ1A 2X4ZA 4FTTA 4GG5A 2IJMA 2R0IA 5CVGA 4E26A 1OPLA 1PXNA 2ITXA 1ND4A 5EHOA 1PXPA 4DINA 1XBBA 3TT0A 2VWYA 2DWBA 1JBPE 3WZKA 5K4IA 2CNQA 2EB2A 3CS9A 4YHFA 3OOGA 3SXFA 2Q83A 2UVZA 5GHVA 3KFAA 3FC1X 5KKRC 3KCFA 4LUDA 4IQ6A 2XB7A 4YJNA 1ZXEA 2PU8A 5CSWA 3WYXA 3ENMA 4TYJA 4B8MA 2V7AA 5KHWA 1PKGA 3I79A 4AFJA 1H27A 4BCKA 1BYGA 1Q8YA 1M2PA 4K0YA 2XIKA 3V6SA 1UA2A 4EH7A 3UQCA 4IVBA 4JG8A 5IEXA 5HBHA 3O0GA 3QQGA 4MCVA 4XRJA 3NNUA 3GCQA 3T3VA 1MUOA 2QG7A 5DLSA 5FXQA 1JAMA 3BCEA 3EHAA 5LMAA 3OTUA 1YOMA 3PTGA 5AX9A 2QOFA 4FT7A 2BRBA 2O0UA 2B9HA 4KSQA 3AC4A 1J7IA 3QBNA 1JSUA 5CTPA 4C0TA 4NKSA 5M4IA 4NWMA 4UZHA 3DY7A 4FSTA 1TQPA 3QTZA 4IAKA 5ETFA 5EOLA 5M4UA 1R78A 4CLJA 3HNGA 3OCBA 2C69A 4TW9A 1KE7A 4JG6A 3UC3A 1IAJA 2VO7A 2EB3A 1ZRZA 3DZOA 2QR8A 3EL7A 3OF0A 4RVMA 3HEGA 4R78A 3HVCA 3LLTA 1EH4A 1YXXA 3LFDA 3UZTA 3W2QA 2QURA 5JRSA 1BKXA 4QMTA 4FNYA 3ULZA 1H4LA 3DXQA 4EBVA 3LHJA 4DYMA 5BNJA 5J5SA 3ZO4A 4XHKB 5DFPA 5AUVA 4G6LA 2CKQA 3EZRA 5CEMA 3BYVA 2ZJWA 2JIVA 4MXAA 2OKRA 1JLUE 4P5ZA 4X6RA 4A07A 3F88A 4IB3A 3QCQA 5LMKC 2RFDA 5EYDA 2JIUA 3QRUA 3FKNA 1IEPA 4ALUA 1ZAOA 1UWJA 5FTOA 1KOBA 3K3IA 2BRHA 3QLGA 2WB8A 3MWUA 2BAJA 2ZV9A 5IA5A 1S9JA 4G3DA 2WIHA 2X9FA 1UU3A 1J91A 1WMKA 2PPQA 3QA0A 4U8ZA 2QI8A 3OY1A 4WZYA 2YCSA 1ZMWA 4U3YA 4ZSEA 4ZXTA 2Z02A 1MP8A 3Q52A 4R3CA 5HI2A 3NAXA 4C36A 3OG7A 1YHSA 3DK7A 4BI1A 3WE8A 1UU9A 2GTNA 5F20A 4M14A 1BX6A 5HE1A 4RQKA 1OB3A 2V0DA 4ZS4A 4RC4A 1REKA 2VO3A 3A7GA 4QMOA 2YCQA 2UZWE 2YCRA 3HV3A 4A9UA 4NM7A 2KTYA 4O0YA 3M42A 4CGAA 1PXMA 3TKUA 5DHJA 3MIYA 5AV2A 4G16A 2XK4A 3Q4ZA 2J0IA 4D4RA 4WKQA 5A6OA 1Q3DA 2CNUA 4BZNA 3Q96A 2PUIA 3VF8A 3VJOA 4E5AX 5BUEA 5CSHA 2YM5A 1XWSA 2X8DA 4NCTA 4M84A 4RQVA 4XP3A 3O7LB 5CI6A 5DR6A 5IDPA 2W06A 2H34A 3RK9A 4EUUA 1GOLA 4J8MA 3LFEA 3CGFA 4LFIA 4MAOA 4F1TA 5M4FA 4I0RA 2WMWA 2OJFE 4YTHA 5FG8A 4PX6A 4BTFA 5JMSA 2W17A 5CEPA 2VTHA 3OROA 2XS0A 3V5JA 3S95A 2XYUA 3E7OA 1AD5A 3BKBA 4RJ7A 3S00A 4AT5A 3ET7A 4G3FA 3NGAA 3UJGA 3G9LX 5CZHA 5L8KA 3BQCA 4NM3A 2OI4X 3FYKX 3POZA 3TZ7A 3V8WA 4XG3A 3OTVA 5FUTA 4GKHA 3NYNA 4L9IA 5L2TA 3DZQA 4I4FA 3AMYA 5BUIA 3ZC5A 4ZAUA 1UVRA 5IH4A 4RJ4A 4TYEA 4FEUA 5BX0A 4HYHA 2GQRA 4W4VA 2F57A 1OL6A 2BIKB 2OJGA 3MH1A 4IIRA 2R0UA 3QWJA 3UYSA 4AN2A 4QQ5A 4YC3A 3GGFA 5BMMA 5JZNA 4D9TA 2PMIA 3LFCA 3PWYA 4GT3A 4J1RA 4D9UA 3EN6A 4DTBA 3SXRA 4C4JA 3QZFA 1FQ1B 4PY1A 4NU1A 4UWYA 3F66A 1QCFA 4OGRA 4AZTA 4FOCA 4XV2A 3HLLA 3CJFA 2PVFA 3OMVA 3TV6A 3GENA 5CNOA 4WD5A 3ZXTA 5IMXA 4NUSA 2EXCX 3R71A 3RMFA 4X3FC 2W1FA 1ZYDA 2ZMDA 3DBDA 2GFSA 4TTHB 5EI8A 3ORTA 3I7CA 4C4EA 4E6AA 1ERKA 4I6BA 1ZY4A 3CY2A 3MVMA 4ACGA 2BR1A 4F64A 5EW9A 3Q4TA 4JS8A 3P7AA 2VO0A 1UNLA 2CGVA 2E9VA 4QP2A 5EK7A 3WF5A 3Q6WA 4IAAA 4N6YA 3LVPA 4K9YA 4EH3A 2C3LA 4BR3A 3E93A 3HP5A 3UIXA 3VS2A 3EQCA 3EFLA 5DRDA 1Q41A 4XEYA 4E4XA 2C5XA 3PZEA 3TKIA 1XJDA 5LCJA 3BYOA 3EQRA 2WU7A 3OCGA 3N4TA 1H26A 3ANRA 2NP8A 1Y91A 2XKEA 5F1ZA 4JXFA 5IQAA 4KWPA 4BHZA 3GB2A 4AA4A 4ANLA 4QTBA 1XQZA 4YBJA 4H3PA 4H36A 4Y8DA 3THBA 2V62A 4GFOA 1JSVA 4FTUA 4U40A 3TUBA 3AC5A 4DHFA 4FT9A 2WMUA 1OPJA 3F69A 4GSBA 4FIFA 2IVVA 4IAIA 3QUEA 3W0QA 1YKRA 1XH8A 2PVMA 1IASA 4EK3A 4F7SA 3DFAA 2Z8CA 3SG9A 1WAKA 3D5VA 3FL4A 4N6ZA 4OTWA 5J95A 4D0XA 4ENXA 3RALA 2YIYA 4YC6A 3F2AA 5DBXA 5CAVA 2G15A 3P9JA 1YQJA 2OW3A 1H1QA 4FG9A 3GOKA 3EYGA 3KXGA 3P7CA 1MQ4A 3PJCA 2IO6A 4JAIA 2C5OA 2QOQA 2RGPA 3L8PA 1O6LA 4FEQA 2PMOX 3ODZX 2G01A 3O51A 3C4ZA 4U43A 4AU8A 2I6LA 2WOUA 5BVEA 4ORKA 4GU6A 4KS8A 5LVLA 4LQMA 4A9TA 4GT5A 3BBTB 5DRBA 3U4WA 2OSCA 5HTCA 2YM3A 3OW4A 3KRWA 4WHZA 3PA4A 1KV2A 4F0IA 4O7PA 1IG1A 3R6XA 1IA9A 2GCDA 4HPTE 3UMXA 3T3UA 4FL3A 1WBNA 2WTKC 4KB8A 5DT3A 5H8BA 5KE0A 2W96B 5C8MA 3LQ8A 2X81A 2OG8A 5CQUA 4BTJA 4TN6A 2JITA 3A7HA 5LARA 2R64A 4FKSA 4IWOA 5JQ5A 4EQCA 4FNXA 4RJ3A 3LJ0A 4ZTQA 5L6OA 1KSWA 4NFMA 3REPA 4C2VA 5HE2A 4UB7A 1XBAA 3OBGA 5ITAA 2YITA 4HCTA 2HZ0A 3P4KA 4O86A 5HEZA 3Q5ZA 2FSTX 3V51A 3DK3A 3SOAA 5BVFA 3MVJA 1Z5MA 2BILB 1J7UA 5D10A 3NUNA 5CEKA 3SGCA 2UVXA 3MPAA 4RC3A 4IJPA 2GNJA 2YIQA 3FXWA 3H9FA 2FGIA 1YOLA 4FSWA 4JIAA 4QP9A 1OKYA 2VWUA 4F09A 3BE2A 4BTKA 1Y57A 2B7AA 2W1DA 4U45A 3RPRA 1PKDA 3PJ1A 3KULA 4TWPA 4JBQA 4CTCA 2XCHA 5IA2A 3EOCA 3F5XA 2JKOA 1OI9A 2VX3A 4KS7A 3TV4A 3U54A 4IM2A 4WUAA 4LV5A 4QMZA 3UYTA 5E4HA 3G5DA 2ETMA 3EFJA 2J7TA 3LFBA 2HZ4A 1LUFA 3FBVA 3HAVA 4QYEA 4F63A 1PXIA 1FBNA 1SM2A 4ZY6A 3AT3A 4FTIA 3OWJA 5A4TA 2BALA 2CNVA 2O8YA 3NCZA 4PMMA 2JC6A 3E8EA 4X3FB 3JY0A 5DG5A 5TT7A 4AOIA 2ZV7A 3BV2A 3QQFA 4BCMA 3UGCA 4H05A 2XEZA 3ATTA 4G3CA 1VR2A 3QTUA 1KE8A 2CKEA 2XNOA 1R3CA 3H3CA 3NW5A 3TKHA 2HWPA 4O0VA 3W2SA 1SVGA 2XBAA 2X7OA 4D5KA 2GNGA 5A46A 5M44A 5FGKA 2PY3A 1Q97A 1W0XC 3GFEA 4FUXA 4I92A 4BDHA 3ORLA 4EC8A 4DH3A 4J97A 5AM6A 5HCYA 4L01A 3O17A 3CLYA 3CTHA 3DKFA 3QCSA 3JPVA 2R3FA 4FR4A 5JH6A 2EXMA 2XK8A 2CHLA 5DPVA 4IFGA 5AIKA 4IX4A 2YEXA 2ITYA 3K5VA 1OGUA 1RQQA 4LV8A 4CFXA 5M06A 5H3QA 5EKNA 3JY9A 1NXKA 1F0QA 2XK7A 4FKVA 4F0GA 4E4NA 3S4QA 2F49A 2WELA 2QLQA 3IW8A 1ZY5A 3AC1A 3RAKA 1O6KA 4C7TA 3GC9A 2BIYA 3OWPA 3NUAA 4BCQA 4DC2A 3R30A 3FMMA 4AGWA 2Z60A 3BLHA 2J0KA 3L1SA 3HMPA 1CKJA 3FLYA 4Y72A 5EI6A 2C6MA 2Q0BA 2JKMA 4XLVA 4ASXA 1K9AA 4RBLA 1XKKA 3U87A 1FPUA 4ITIA 4AW2A 4D1ZA 2UZTA 4C3FA 3R9OA 2H9VA 1ZOEA 3EQGA 3OS3A 4X2NA 4F65A 3MIAA 2OGVA 4D58A 3UOJA 4BBEA 5IA3A 4FSMA 3IG7A 3FQEA 3PIYA 5JN2A 4ZSAA 3SVVA 4RX9A 4FVPA 2QKWB 1YHVA 3PLAE 4M69B 2VTSA 5KHXA 2JDOA 3QQJA 3ROCA 3ANQA 3MTLA 4D1XA 4UWCA 4FV9A 3AC8A 2VTAA 3MB6A 4JDKA 3TXOA 4UALA 4DTKA 3GU7A 4I22A 4QQCA 1WBSA 2C6IA 3H30A 2UZUE 3D5XA 3WILA 2YZLA 2X7FA 2WMSA 3F7WA 3PY1A 3KA0A 3VS4A 1YXVA 4J96A 3WF8A 2PVKA 4ALVA 1ZYCA 2HYYA 4G9RA 4IACA 3RJCA 5BVOA 2GNIA 1RE8A 3G6GA 2XNEA 4EKLA 1TQIA 5AP5A 5AP7A 2AUHA 2WMQA 4D4VA 5KX8A 2WTVA 2YISA 4RVKA 5AFVA 1FVTA 1LP4A 3G33A 3COMA 4HNFA 4Y83A 3UG2A 1BI8A 3HV6A 3FEGA 3HX4A 4PV0A 3KK8A 3CKWA 4HZSA 5HESA 4BGGA 4DG3E 4OBQA 1LR4A 3FLZA 1PXLA 2XBJA 4G6OA 3NNWA 2IW9A 5EQPA 3VRYA 4D28A 1QPJA 2BVAA 4HNIA 3VS5A 3ZSIA 3QZHA 3ZTXA 2B9IA 4KA3A 1BI7A 2PSQA 4TRLA 1GIJA 4OR5A 4S33A 4G3GA 1S9IA 2WEVA 4X21A 4FEWA 4O7VA 3EQIA 1QL6A 2GMXA 4FKWA 3IQ7A 3QRTA 3PSDA 3VUDA 3PPZA 2W0JA 5CU4A 3EKNA 3DJ7A 4YO6A 4C62A 5LMBA 1OL5A 4ZSGA 5FLFA 1Y8YA 5KMIA 4YZCA 5AUWA 3DPKA 5GJFA 2BAQA 4FKRA 4DEHA 2HY0A 3EQHA 5B0XA 3DDPA 2YWVA 2HY81 4YMJA 2HCKA 4EH4A 5LVNA 4ZEGA 5HX8A 4FG7A 3E3BX 3NCGA 4I6FA 3IOPA 3QCXA 4HCUA 1VYWA 2F7EE 3HMOA 2RL5A 4MHAA 1JPAA 2WKMA 3D9VA 4K11A 1NY3A 3RGFA 4E4MA 3DKGA 3CQEA 4C35A 2G2HA 2P3GX 3C4CA 4ZTNA 5HD7A 3VVHA 3L9MA 3ZM9A 4ASDA 3UP7A 5KBRA 2PE1A 4AN9A 3DBEA 5DIAA 5J7HA 3PIZA 1VJYA 4GW8A 3ZH8A 3UOHA 2REIA 3NX8A 3O8TA 1FVRA 1Q5KA 3CIKA 2W5HA 2Y6MA 2JDVA 5CAQA 5I9VA 3HUBA 1WBTA 1YDTE 4QP4A 3UE4A 5DI1A 4E73A 4ZJIA 3DAEA 4N4SA 1QPCA 2EU9A 3PDTA 3QGYA 3QZGA 3NPCA 4FV2A 3C0GA 3GU4A 4O22A 4RC2A 5KMKA 4QMSA 1U4DA 3GEQA 4QPAA 5GJDA 5EDRA 3O8UA 2QNJA 5H2UA 3SD0A 4FTLA 4EHGA 4QQTA 3QHWA 4U97A 5CT0A 3WF7A 3TZ9A 1YRPA 1LEZA 3I4BA 2B54A 4NM0A 4GK2A 5G6VA 2ITNA 2NRUA 4FG8A 4HVDA 4BTMA 1G5SA 4A4LA 2WAJA 2DQ7X 3LAUA 4MD7E 4HGTA 4C3PA 4DGMA 4F9YA 4ZTMA 5L3AA 2C0TA 5EYCA 3DA6A 3GU8A 4ZOGA 2BKZA 5EOBA 2OF4A 3FZTA 5HTBA 4X2FA 4L3LA 2R2PA 4KD1A 4YZDA 3V5TA 4LMUA 3KF4A 4CT2A 3BV3A 2J5EA 2X2MA 5A14A 3TACA 3BYUA 4EH2A 2VTMA 4CFWA 1NVRA 4FT5A 3PG1A 1IR3A 3ZSGA 4YJPA 4DGLC 3OFMA 5ETIA 4C2WA 2BDFA 2C5NA 1SZMA 3LFAA 4HJOA 2FUMA 4MH7A 4JQ8A 3FXXA 3HRCA 5LCKA 3VS7A 5E1SA 1E9HA 4XUFA 4AT4A 5IA1A 3R7UA 3OW3A 3R2BA 5KMMA 2AYPA 2HXLA 2X2LA 5CU6A 5IMEA 3MPTA 3HA6A 3R7VA 3PXYA 1GIIA 5BVWA 3GNIB 3PVWA 1GAGA 4DBXA 5DEWA 5EKOA 3MJ2A 3RHXA 4K77A 3EB0A 4GIHA 4JI9A 4ZSLA 4AZEA 4RWIA 4RMZA 4LI5A 3ZO1A 3BHVA 3ZEPA 4KIOA 3PPKA 2CDZA 2XVDA 4O0WA 2OO8X 1U59A 3BGPA 3JUHA 4G5JA 4DITA 5T68A 5LOHA 1O6YA 4BCIA 3QRKA 1M7QA 4PWNA 5BMSA 5KBQA 3GBZA 2XNBA 2C6KA 2CKOA 3BHUA 4HGEA 1SNXA 2CGWA 3QUDA 4AZWA 2YDJA 4MXCA 4CG9A 3F2RA 4RVTA 5LWNA 4RZWA 3PXFA 3RPSA 3I6WA 4AA0A 4FV6A 3DK6A 4UZDA 3MFSA 2PL0A 3MB7A 2R3LA 2BMCA 4ANMA 4CFMA 2ERKA 3JS2A 4BCPA 4M13A 2WGJA 1U5QA 3MS9A 4O7NA 1BMKA 4RJ8A 3NVKI 4GMYA 4ACCA 2O5KA 3SHEA 3U6HA 2YAAA 3TNIA 2IVSA 5JRQA 4KBCA 5HBJA 3R0TA 3F3WA 2UV2A 4W4YA 1XO2B 2R5TA 2GQSA 2I0HA 2XZSA 3S2PA 4AUAA 2R9SA 4NKAA 4QMNA 4Y5HA 5I9XA 2PE2A 4NTTA 4O81A 3F5GA 1HCLA 2ACXA 1P14A 3E87A 3OC1A 3ITZA 3FMNA 1VEBA 3R2YA 5BUJA 3RPOA 3EQFA 4M15A 4Z3VA 5K5XA 3GC0A 3WIGA 3OXZA 4Y73A 3LCSA 3QAME 4JNWA 4X0MA 4KRDA 3HRBA 4EOKA 3BWJA 4EONA 3D7TA 4FIEA 3FHIA 5B2LA 4AZFA 4I0TA 1Z57A 3JXWA 4K8AA 3H4JA 3HRFA 5EM5A 4QTAA 4UEUA 3GU5A 4JG7A 4BYIA 5L2SA 3AXWA 4RX8A 3U6JA 3LPBA 3L9NA 2OFUA 3OXTA 3E8DA 3ID6C 5M08A 1WVXA 2W4OA 5DNRA 4OTGA 3NRMA 3BWFA 3PIXA 4K2RA 1MRVA 1PYXA 5F4NA 4BDCA 3F6XA 4O0TA 1KWPA 4F1OA 2OZOA 2R3KA 4HZRA 3LXNA 5E90A 4XMOA 4EK5A 2E2BA 2GS7A 5HU9A 2BHEA 3DJ5A 3RPYA 4O7SA 2YHVA 3LCDA 2BRNA 1Q99A 4Q5EA 1WCCA 2QVSE 4MF1A 4KKEA 4MQ2A 4GYGA 5EYMA 3SQQA 3ZUTA 4AFEA 3BELA 4JBOA 3ZRMA 5D7AA 4YURA 2WQEA 4H1JA 4O7LA 3F3VA 5FP6A 4EOOA 5IQFA 1WVYA 4C4HA 1B39A 4FSZA 5HNBA 4EH6A 1M52A 1Q8UA 3C51A 3TM0A 4O6EA 5DE2A 4HVGA 3FMHA 2J2IB 3FI4A 4NCTC 2XIXA 3C9WA 2DS1A 4XNEA 2RIOA 3CP9A 4QMMA 3LM5A 3IW5A 4R6VA 4XG8A 2CLXA 3C1XA 4H3QA 1NW1A 2Z7QA 4CFUA 3VULA 5CVFA 4OT6A 2GS2A 5CU3A 3TNPC 4EHEA 4QMUA 4QP8A 4FVQA 4GU9A 5IPJA 2VZ6A 3R9NA 3D7TB 4L53A 3IW4A 3OVVA 1U54A 4J95A 4XP0A 4I5PA 4TL0A 4WOVA 4L43A 3MVHA 2QKRA 4FC0A 5AP3A 4Z7HA 4ACDA 2CMWA 3GUBA 5C26A 5JZJA 2VUWA 2FB8A 3KGAA 2CPKE 4DFYA 5L2WA 4DFZE 2V5QA 3FKLA 1CKPA 1OMWA 4XX9A 4APPA 3W8QA 1H1WA 3OZ6A 3PA3A 3OEFX 4IVAA 4PNKA 5I0BA 3FZOA 3KRJA 4JJRA 3QX2A 2VTIA 4NH1A 2OBJA 4OTRA 4AZVA 4M97A 3NAYA 3WZDA 4LL0A 4ERWA 4J99A 4U3ZA 4IC8A 4ZTHA 4L3PA 3TZ8A 5K9IA 4F0FA 4FV5A 4NW5A 3FKOA 2XH5A 3RWQA 4K33A 4EZ3A 3MESA 2XRWA 3RAIA 4IH8A 5CASA 5AIRA 2HENA 2LGCA 4C4GA 4C34A 2QD9A 1PW2A 2BDWA 4PDPA 3S1HA 4QP6A 3LXLA 4RJ6A 4B0GA 1TKIA 3RK7A 4B9DA 5LVPA 2WTDA 4FEXA 4DBNA 1W82A 4PP7A 2QU6A 4WRGA 1H24A 4ZJVA 3UOLA 4EHZA 3DQXA 3SKCA 2P0CA 5ACKA 2XNGA 3RM6A 1FVVA 3U8WA 3RWPA 3O8PA 5A4CA 5HKMA 2VTRA 4GH2A 4XG6A 4B99A 3MY5A 4WA9A 3U6IA 3RAWA 4HOKA 3CEKA 3A60A 1UV5A 5B7VA 4EBWA 4FKLA 3W2RA 2IWIA 4G17A 5CSVA 4YSMA 2ZM3A 3VN9A 2YDIA 5F95A 1U54B 3LXKA 3OCSA 3VUKA 3IDPA 2FA2A 4XG7A 2P2HA 4IFCA 5E8ZA 4CQEA 3IW7A 2X8IA 3PY0A 3BHYA 3RK5A 3EZVA 2DUVA 4C3RA 4YTFA 2CN8A 4EQMA 5C27A 3FI2A 2JIIA 3GVUA 4WNMA 4RT7A 3PRFA 4QYFA 5HGIA 5HNGA 4D4YA 1KV1A 3TDVA 5B2MA 3B2WA 2VWXA 2XEYA 3A7IA 3KF7A 2H8HA 4G3EA 3OOMA 4RIXA 3TNQB 1IAHA 4H58A 4CCBA 5DH3A 1KE9A 2ITTA 4I5HA 3E92A 2RFNA 3OUNB 4FTAA 3D5UA 4G5PA 4MNFA 2XP2A 4U6RA 5E1EA 3RCDA 3TUDA 4H3BA 5I5ZA 4O83A 3V01A 3R73A 5IH6A 3SW4A 2XJ1A 4TZRA 4JX3A 3EN4A 2UVYA 1BUHA 2WMVA 4DH7A 2PULA 3AGMA 2UW9A 4I6QA 2OICA 2F2CB 3R04A 3BQRA 3QZIA 2F7ZE 4P7EA 4NK9A 4XRLA 3NIEA 2HXQA 2RKUA 2CCHA 3HDNA 4MK0A 4DTAA 3NWWA 3M1SA 4ERKA 5AX3A 4IW0A 1PXOA 2VTPA 3EQPA 1H01A 1VZOA 2C0OA 4C58A 2F4JA 2A4LA 2W9ZB 3NR9A 4Q9ZA 3OBJA 5GIOE 4EOPA 1JNKA 3GXLA 3MI9A 3R1NA 3HUCA 4WG5A 5T6KA 4ZLZA 5CSPA 2CLQA 4OW8A 1E1XA 2BFXA 4Z9LA 5F9EA 4UX9A 4FV7A 1IA8A 2OK1A 3LXPA 4RIWA 3P1AA 4BDKA 1H1PA 2JKKA 3HYHA 5ANIA 4FE2A 5FEDA 3IOKA 3RHKA 4KAOA 2VAGA 1FMKA 3BGZA 1P2AA 3TUCA 3R8VA 3UIMA 1M14A 2ZB0A 5EHLA 5TKDA 3V8TA 3ZO3A 3ZOSA 3I6UA 3CCNA 1UU7A 3QLFA 3DXPA 3BU6A 4FK3A 4DEIA 3VS3A 4IAFA 4V01A 3RP9A 4RIXB 3E3PA 4ENYA 1R39A 4WNKA 5ANGA 3I5ZA 3FSKA 3QUPA 4PTCA 3NUYA 4R5YA 2C6OA 3R21A 3NW6A 4ZIMA 3NUSA 3QL8A 3ZONA 5DT4A 1K3AA 5J1WA 4RRVA 2BFYA 5E8XA 4IM0A 2C6TA 2HIWA 4I0SA 4O0SA 3QTRA 2GHMA 4EYMA 2VV9A 3ORPA 1OM1A 3A4OX 3CTJA 3UOKA 2A1AB 4CD0A 1OUKA 4FNZA 4PRJA 5IA0A 4MXXA 5GNKA 1NVQA 1Y8GA 3W2PA 5AP2A 4BDBA 5CU0A 3DTWA 3LE6A 3R1QA 3KN6A 5M55A 3DJ6A 4ANSA 4DH1A 4MNEA 3SG8A 1P4FA 4NJ3A 2YCFA 3K54A 4JBPA 3RKBA 4BCGA 5HLNA 3ENHA 3O96A 4TWNA 3IPHA 2ONLA 3AD6A 3PPJA 5KMLA 1WFCA 5I4NA 4DFXE 4IB5A 3PJ3A 3IONA 4XOYA 4YUQA 5CAUA 4MTAA 4OLIA 3TDWA 5DT0A 2OXXA 4RIWB 4DG2E 3D0EA 4Y46A 4EK8A 3Q6UA 2R3JA 3ETAA 4FSRA 2VO6A 2X2KA 1GZNA 3WF9A 3VW8A 4CRSA 5AUZA 2HELA 4EYJA 3MW1A 2WTWA 3MPMA 3UTOA 4U9AA 1XH7A 2QQ7A 3A99A 3DB6A 3U55A 4FYOA 3GCVA 3NNVA 4E5WA 5KMNA 1GNGA 3WZEA 1OZ1A 1Q62A 4RFYA 4FZDB 3R7OA 5FBNC 4BDDA 3ZS5A 2C0IA 3QQUA 2RFSA 3BLQA 4G6NA 3ZDUA 5IQIA 1RJBA 2XCKA 2QCSA 4IZYA 4RVLA 3V3VA 4LYNA 5L2IA 3Q9XA 3FMLA 1YHWA 3QXOA 4CV8A 1OKVA 3SXSA 3TIYA 4UYNA 4WBBB 1ZZLA 1STCE 3BPRA 4A9YA 3RM7A 4DFLA 5ANOA 3P08A 2XIRA 5CAOA 5CF6A 3OWLA 4II5A 4BCFA 1NT2A 2YJSA 3AD5A 4G34A 3M11A 2XK9A 3BEAA 4D55A 3Q60A 5HO8A 5A4QA 3BU5A 5FDPA 4G2FA 1I09A 2G2IA 4DH5A 3G51A 2PHKA 5D1JA 3PWDA 1JKKA 2BRGA 5DEYA 4YJOA 2QOOA 4RWLA 5D11A 5JK3A 1DAYA 3DOGA 4FA2A 3IGGA 3IW6A 5DWRA 4MBJA 3V5WA 4RX5A 3VS1A 3OD6X 1XHAA 5AM7A 4EOLA 4LG4A 2PZ5A 3V5LA 3ZEWA 5AAFA 3DU8A 3AT2A 3EFKA 2OWBA 2F7XE 3QU0A 3RZBA 2OJJA 4GG7A 3S0OA 4UYAA 3VO3A 2A2AA 4QTDA 5D9HA 3LCOA 3S3IA 4R7HA 1BL7A 1MRYA 4YHTA 5AUYA 4X3JA 3KL8A 4ANBA 4EHVA 1OIYA 4DF3A 4QT1A 1UKIA 4NYEA 1KE6A 2UW0A 4FL2A 3ZC6A 3Q04A 1OECA 1PMNA 4I5MA 4C33A 2I0YA 3LIJA 3QX4A 3C4XA 4BIBA 1SVEA 2W1IA 3FL5A 3FMDA 4DH8A 5J9LA 5EDPA 2W1EA 3MY0A 2J0LA 2XNNA 5DR9A 2J6MA 2R3HA 1ZZ2A 2CJMA 4A4OA 2VN9A 2QOHA 4C4FA 2YA9A 4LOPA 4EJ7A 3CGOA 4RA5A 1R0PA 4CCUA 2P55A 1YWVA 3MGYA 1BL6A 3O7LD 4KSPA 4RWJA 3UZRA 5JT2A 2BDJA 3R01A 2VTLA 2UZVA 4EK6A 2QOCA 4D2RA 3WARA 2PK9A 5CEOA 3IKAA 3R28A 1GZ8A 5IUHA 1F3MC 3PP1A 5E8VA 5HCXA 2EWAA 4MBLA 4AXAA 4I20A 5H8GA 4QOXA 3KULB 4DFUA 3FWQA 4CKRA 2C30A 3RAHA 4BZOA 2PVJA 4IHPA 3DB8A 3NYXA 4FYNA 1A06A 3WF6A 2QO9A 1TVOA 1WZYA 2XYNA 4MBIA 3FLQA 5LJJA 4XP2A 5BPYA 4E6DA 2VNWA 5JGBA 4YZ9A 2ZYBA 5K4JA 2HW6A 2PVHA 4ZSJA 4BCOA 1REJA 2GNHA 2ITOA 3KK9A 3LMHA 5M53A 2Y4IC 3ZLYA 3UPXA 5J8IA 3IK3A 4FMQA 1YI6A 3KKVA 4BDGA 3LLAA 5A3XA 4BKJA 2WPAA 3NDMA 1J3HA 4C38A 3W8LA 4GYIA 3LFQA 1LEWA 1OPKA 3MH2A 4O96A 4O84A 4BGQA 1PJKA 4LL5A 5KZ0A 4E6QA 2XKCA 2CKPA 1VYZA 3DNEA 4O91A 2HWOA 2V22A 3PVUA 3QALE 2GTMA 5HICA 3W0OA 3PXRA 4EOJA 3DBFA 5DGZA 4P5QA 2PUPA 2XNMA 2C5VA 3I60A 5HVYA 4IX5A 2C1AA 2VTJA 4FKIA 2PTKA 4KIPA 3ALNA 3ORIA 3UODA 2ITUA 4FKJA 4D0WA 2QR7A 2IZSA 4TXCA 4YP8A 4TWCA 4DN5A 3G15A 3A8WA 1WBWA 2C3JA 4CZTA 1YDRE 3NZ0A 4YLJA 5AV3A 3D2KA 3MV5A 4DEDA 1UWHA 2OF2A 3UNZA 2IZUA 3OCTA 2P2IA 2PZPA 5CF4A 3NYVA 3H0ZA 5IQDA 5ANKA 3MYGA 4MWHA 2ZDUA 2C6DA 3HV7A 3IGOA 4QPSA 4YJVA 4FV1A 5GJGA 3PP0A 5M4CA 2JKQA 2XIYA 1KUTA 3H10A 5JKGA 1H1SA 3U9NA 3VF9A 4EOMA 4EUTA 3Q2JA 4BCHA 2OXYA 4K6ZA 4L52A 3LFNA 4IE9A 4ACMA 4A06A 4A7CA 5FEEA 4FGRA 1V0PA 4YZMA 4ACHA 3UQFA 4FT0A 5IQEA 5FXRA 3PSCA 2WMBA 4R3PA 1OBDA 1V1KA 3QTQA 4ARKA 2EVAA 4RJ5A 2DYLA 2YM8A 3HGKA 4RA4A 2JGZA 3CR0A 4P90A 5DN3A 5FTQA 4MD8E 5ACBC 4KBKA 2QG5A 3CJGA 4TNBA 2QOLA 5E91A 3LW0A 2B55A 3U4UA 5EG3A 3VBYA 3KMMA 4MQ1A 4IBMA 2B0QA 2IZTA 2XJ0A 5CF5A 2C5YA 1OUYA 4IZ5A 2JDSA 3ACKA 3TNWA 4FEVA 4I94A 4IVCA 4J52A 4NJDA 3QYWA 2B52A 1XH5A 5M56A 5M51A 3ZLXA 3QTWA 2VWBA 3II5A 3N51A 4FTNA 4M0ZA 4XYFA 4FTJA 4JQ7A 2YJRA 4R1YA 1WBPA 3Q3BA 5AEPA 3BHHA 3VNTA 3D83A 3DKCA 4BN1A 4FSYA 4RIYA 5E8YA 4F6WA 4GRBA 3MBLA 4HGSA 3VBVA 4BBFA 4E7WA 3FLWA 4QYGA 3R00A 4O27B 1NA7A 5C03A 5EM8A 3QKLA 3EN5A 4NL0A 1O9UA 4MXZA 4FIHA 2X9EA 4BC6A 4U44A 4O38A 4X7QA 3LMGA 4DG0E 5TOZA 5D41A 3Q4UA 4ONAA 4QTEA 4PMPA 4O2PA 3BU3A 2I7QA 3PE2A 5C01A 3HP2A 4I21A 4IWDA 4WIHA 3F7ZA 2ITZA 4FT3A 4EWQA 5CF8A 4L7FA 2PYWA 3QRIA 3G90X 4YNEA 2YM6A 4O7WA 1JWHA 2ZMCA 5DA3A 4DT9A 3O23A 5A54A 3HZTA 4YU2A 1XBCA 1I44A 2Y6OA 3NUUA 4WBOA 4FKOA 2WD1A 2CGUA 4F4PA 1MQBA 3FZRA 3E62A 5JEBA 2R3QA 1Y6AA 4EH5A 2NPQA 4OBPA 3R8LA 2PE0A 4JX7A 4EZ7A 3W0RA 4FK6A 4LRJA 4JVGA 1OL1A 3QHRA 4HVIA 4HW7A 2XJ2A 3BLRA 3D94A 4ZTSA 4DEBA 1DI9A 1JOWB 2YACA 1SMHA 4FV4A 3W18A 4S32A 5HX6A 2V55A 2J0JA 2VX1A 3V8SA 3CD8A 4ASEA 4XBUA 5FM3A 2Y4IB 2WFYA 2YIRA 4KIQA 4P4CA 2E9NA 1URWA 1WBVA 4RLKA 3B2TA 2BUJA 3QQHA 1PMEA 1APME 4HPUE 2HOGA 1H07A 4FKUA 5ETAA 3SAYA 3VHEA 3OXIA 4CNHA 5AWMA 3T9IA 3EQDA 3NUXA 3LCKA 5CY3A 4DLJA 3D14A 2X6EA 3CBLA 5IISA 3F3UA 5FD2A 3QD0A 4I4EA 2WMTA 2PZIA 5A9UA 1W98A 3I0OA 2OJIA 3MH0A 4KRCA 1OIUA 4QMVA 2XM9A 3EL8A 4Z16A 2OJ9A 2IN6A 3C4EA 2X6DA 1H00A 3ORZA 4GT4A 1M2QA 1P4OA 3LJ2A 5HE3A 3QRJA 4E4LA 4FTMA 1P5EA 1ZOGA 2C3IB 1GY3A 2C1BA 4FVRA 4WNPA 3VUHA 4ZY4A 5CAPA 2RG6A 2WQMA 5CENA 3DCVA 4OUCA 3ZU7A 3EMGA 2ITVA 3FAAA 4XH6A 4HYSA 1X8BA 3EH9A 4FZ6A 3TCPA 3KXMA 2J4ZA 1QMZA 1YI4A 2X0GA 5ANJA 4NM5A 2QU5A 1FGIA 2BTRA 3ZMMA 2R3IA 2A0CX 2IZRA 3TV7A 2W1HA 3VQUA 2QOKA 3QKMA 2BRMA 4A9SA 3PLSA 4EK4A 3DS6A 4DGNA 4ITHA 4L46A 3VHKA 4UWBA 5ANDA 5HD4A 4FIGA 4R7IA 3NLBA 5IEYA 5M09A 5CEQA 3EKKA 2AC3A 4O0UA 2ITPA 4OTDA 5EHYA 2Z2WA 3P86A 2BZIB 4AZSA 2VWWA 2R3NA 5BVNA 4LRMA 5C4LA 4OTHA 4TYIA 2QC6A 3GCUA 4GKIA 2JAMA 3A2CA 4FTCA 5A4EA 4RFMA 4ZMFA 2R3MA 5TF9A 2ZV2A 3UPZA 3DV3A 4G1WA 4WT6A 1Q24A 1B6CB 3MSSA 3TJCA 5FXSA 5ICPA 4U5JA 4L67A 3RCJA 2WMXA 4PL3A 1NVSA 2HZIA 3K5UA 1H25A 4H39A 4XV1A 5CQWA 4DT8A 4R5SA 4QMQA 1J1CA 4ZLOA 2GU8A 4U42A 5HG9A 3MVLA 3TG1A 5KNJA 1JKSA 4S2ZA 2W05A 5JGDA 3FQHA 4FX3A 3FDNA 4JOAA 4C4IA 3KB7A 5HBEA 3UMWA 3ORXA 1M2RA 1QPDA 1ZWSA 2W9FB 3LFSA 4P2KA 4FV3A 1J1BA 3BHTA 4JRVA 2W4KA 4FKQA 4Y5QA 3BGQA 1G8SA 4BIDA 4JRNA 3GQIA 4GJ2A 3UVQA 3A7JA 2UZEA 3RPVA 2XNPA 3BIZA 2YERA 3F61A 3PZHA 3COKA 3FE3A 3VUGA 1W7HA 4QQJA 4JIKA 4QYHA 4YR8A 5KMJA 3CQUA 4AS0A 1YDSE 4U41A 3VWAA 1M17A 1SVHA 3L8VA 2WQNA 4EH8A 3QGWA 5AUTA 4JR3A 2WNTA 3CPCA 4Q2AA 2UUEA 5K3YA 3C0HA 4LOOA 2YM4A 4OTQA 1FGKA 4R77A 3CD3A 3KQ7A 4ZP5A 4AGDA 2X7GA 3R7IA 3I0QA 4F9AA 3BRBA 3ZLWA 1Z9XA 2VGOA 4BDJA 5GINE 4Z7GA 3E8NA 1Q61A 4U98A 2WHBA 2Z7RA 4MEDA 4W8DA 4BGHA 5HIDA 2OLCA 3WYYA 1Q3WA 2WZJA 4QP3A 1Q4LA 2J9MA 3OWKA 1H08A 3R1SA 4JR7A 4AE6A 3DT1A 1HCKA 3NMUF 3DTCA 5FM2A 4FNWA 5BYZA 2ZOQA 2ZM4A 3RNIA 4U94A 4YPDA 3ZFMA 2ZVAA 3TWJA 4YBKA 4FL1A 2UW5A 4AGUA 4KNBA 1YOJA 3UBDA 3PRIA 2QHMA 3OT8A 4BI2A 2IVTA 5M57A 3JYAA 4M7IA 4XG9A 5JFXA 2ESMA 3SW7A 1OIRA 4Y85A 1T45A 2F2UA 2OZAA 3QD2B 2OH4A 4QTCA 3W0SA 3OHTA 2CN5A 3FI8A 4F7JA 2XK6A 1PYEA 3VUIA 4AF3A 4USEA 2G9XA 5CLPA 3CSVA 4RZVA 4D2SA 3ZUVA 3LQ3A 2ETKA 3FMJA 3W0PA 3SX9A 4F08A 4JQEA 5I9ZA 4I93A 4NSTA 3W2CA 3CQWA 3Q5IA 1MRUA 1OITA 3LMIA 4YZNA 2FSLX 3CXWA 3IO7A 2WTIA 3EN7A 3VRZA 4R7BA 2VTTA 1OL2A 5IEVA 4FTQA 4I5CA 3W16A 3ZZEA 2H6DA 3F3ZA 2YZAA 5CT7A 4JDHA 1CKIA 3DGKA 2OH0E 4ZTLA 3TYKA 5IUIA 2OU7A 4EORA 3L8XA 2HZNA 3L9LA 3NIZA 5HVKA 1IRKA 2ZAZA 3DDQA 5CNNA 4AW5A 4FKPA 2Y7JA 4QMXA 5AV4A 2RF9A 3R8ZA 2PMLX 1H28A 5AA8A 5GIPE 4FOBA 1CTPE 2P33A 4QNYA 3ZRLA 2VD5A 1K2PA 3OEZA 4FKTA 3VBWA 2ZM1A 2R3PA 1H8FA 4YJUA 4YTIA 4LUEA 3R7EA 5H8EA 1XH4A 5B2KA 4BBMA 2HW7A 2JDRA 3NS9A 4FV0A 4GUEA 5C8NA 4BDAA 4S34A 4FI1A 2UW7A 1YXUA 5EYKA 2A27A 2IVUA 2JBPA 3JVSA 3AGLA 1BLXA 3GP0A 3MY1A 4RX7A 4JAJA 3HECA 3Q9WA 4L44A 1GIHA 1OBGA 3KCKA 4O82A 3HV5A 4RFZA 5JSMA 2VRXA 2GFCA 2OZAB 3K2LA 4APCA 4R1VA 3W32A 4HYIA 3KY2A 5LQFA 4DEGA 4QP7A 4J8NA 2JDTA 4FIJA 4GK4A 3FV8A 4KUJA 1ZMUA 2YAKA 4RIOA 3RINA 2IG7A 3UC4A 4E6CA 3LCTA 4W8EA 3TIZA 2WU6A 4BDEA 3G0FA 4TNDA 5JQ8A 4WO5A 2ONLC 4YJQA 5HVJA 3KRLA 4U79A 2YM7A 3W0MA 4NTSA 4O0XA 3VS0A 3MA6A 4PP9A 2Q0NA 4IDTA 3O71A 4PTEA 4BY9E 5E8UA 4IC7A 2R3RA 5HQ0A 4YLLA 1DAWA 5CU2A 2J50A 4GVJA 5AJQA 2QLUA 3N9XA 5HORA 3UZPA 4EH9A 1G8AA 3QWKA 5IA4A 4XJ0A
chains in the Genus database with same CATH superfamily
5IU2A 3A4PA 3KRXA 2XMYA 3MFUA 2O65A 4IZAA 3G6HA 3HA8A 4CMTA 3U9CA 2VTOA 3COIA 4GJ3A 3K3JA 4BVUA 4LMNA 2RFEA 5HIEA 5E92A 1JSTA 4GUBA 2Y8OA 2QHNA 3CKXA 2IW8A 4RWKA 5LMKA 4CZUA 5EDQA 2YDKA 3L8SA 5M07A 2VWZA 2GSFA 3CTQA 4DCEA 2ZV8A 3FI3A 3IDCA 4RGJA 4PL5A 4DA5A 2JFMA 5KKRB 4IWQA 5HU3A 2GHGA 2YIXA 2QONA 1DM2A 2X8EA 4CKJA 4PL4A 2JBOA 3E7VA 3Q9YA 3KVXA 1V0BA 2GPHA 3OUKA 3V5PA 1XH9A 5C9CA 3RTPA 3HMMA 4XCUA 4KINA 5DR2A 4BYJA 3IDBA 3LJ1A 3PJ8A 5E8WA 3AQVA 5H9BA 3TEIA 3ZBXA 1Q8WA 2HK5A 2BPMA 4AA5A 5L8JA 4CSVA 3FZSA 1RDQE 3DBQA 2PZRA 4EZ5A 4Q5HA 3F3TA 2J90A 1J7LA 3DFCB 3MDYA 5AUXA 2YABA 2BROA 1RW8A 3LOKA 2JD5A 3ZFYA 1GZKA 3BBWA 3UVRA 4QRCA 3DNDA 3EFWA 4O7RA 3KXZA 3FMEA 4L00A 4BDIA 5A4LA 5LVOA 1Q8TA 2NO3A 1CSNA 3MFRA 2ITWA 5FQDC 4XG4A 1ZYSA 1T46A 4UN0C 5C4KA 3F5UA 4EJNA 1U46A 1G3NA 3FYJX 4AG8A 4X2KA 4B7TA 2WQOA 3Q2MA 5FTGA 3V04A 2JLDA 3VJNA 2PVLA 3BZ3A 4IDVA 1YWNA 3G9NA 4XV3A 4ZZMA 4EOQA 3MA3A 5CXZA 4TYGA 4USDA 5AP6A 3AOXA 3NNXA 3FMKA 2LAVA 2RG5A 1M7NA 2UZLA 2Y0AA 3UVPA 4AT3A 4HVSA 3TTJA 4AQCA 4CV9A 5CZIA 2E9PA 2I0VA 4L8MA 4AOJA 2VX0A 4YTCA 2HAKA 3MFTA 5DOSA 4BDFA 4CVAA 4O0RA 4N0SA 4L68A 3VUMA 2PVNA 5BYYA 3BYMA 2C4GA 3QTSA 4F78A 3ERKA 3VBQA 2NNWB 2XKDA 4TKSA 5CWZA 3C5IA 1YWRA 3JVRA 5BVKA 5KZIA 4BI0A 2YWPA 2XF0A 1KE5A 3KU2A 4J98A 4DAWA 1QPEA 3SLSA 4KKGA 5HE0A 2F9GA 2OFVA 2EUFB 3FY2A 3HL7A 3LKMA 3NVMB 1R0EA 3P79A 4N57A 3UO4A 5FBOA 3N4VA 4MD9E 4I3ZA 3GCPA 1JKTA 4I41A 4USFA 3TTIA 4ID7A 2XAOA 3QTIA 4D1SA 3W2OA 5T3QA 1E1VA 2FSMX 2Y9QA 4EWHA 3HAMA 3COHA 2OIDA 2VTNA 3C7QA 4RG0A 5E9EA 2IW6A 4IMYA 4CRLA 3L9PA 4LOQA 4X3FA 2OIQA 2Z7SA 3C4FA 4GVAA 4O7ZA 4ZY5A 4O7TA 4FGBA 4TWOA 4MNEB 3FZPA 4IADA 4OTIA 5L6WL 5EM7A 2WTJA 3QKKA 4TY1A 4YJTA 3SV0A 4UBAA 3PUPA 4WUNA 5LXMA 5EQEA 2PUNA 4FZ7A 4PF4A 4LGGA 5C8KA 1H0WA 4ZMEA 4MYGA 1OIQA 1V0OA 3UQGA 4IX3A 3R7YA 2PUUA 3VQHA 4AACA 3VW6A 5DVRA 3I1AA 3W33A 2OIBA 2X4FA 4YZBA 3FY0A 3E64A 3PVBA 4X2GA 4AWIA 3DBCA 1H0VA 1UKHA 2A19B 1YXSA 5KUPA 3DLSA 3GQLA 4NIFB 4RLLA 5KMOA 4F1MA 3GCSA 4QDEA 4R3RA 2PVRA 2R7BA 3PXKA 4O21A 3ZYAA 4AGCA 2ETRA 1GJOA 4UXQA 3R63A 4BCNA 5HG8A 1AGWA 5EI2A 3R8PA 3CC6A 3KXHA 3E88A 5J1VA 1FINA 5LWMA 2QOBA 2X39A 3FLNC 3IS5A 5JFSA 4XOZA 3WZUA 3PA5A 3HKOA 3GT8A 4O2ZA 3TI1A 3SA0A 3HV4A 3I5NA 4M68A 3NYOA 1JVPP 4MXOA 3RI1A 3WE4A 3ZCLA 2AC5A 5AP1A 3BE9A 4ZS0A 5TR6A 4C61A 2ITQA 4FTRA 2G1TA 5IQBA 2GHLA 3QQLA 4AOTA 3QYZA 2W5BA 3P5KA 5CXHA 4JLCA 4B8LA 5FRIA 3UG1A 4EL9A 5A6NA 4IAZA 1CDKA 3DAKA 3QC4A 2SRCA 4ALWA 5ETCA 4I6HA 3GU6A 4NT4A 4QP1A 4V0GA 5E8TA 2WOTA 2I0EA 4C59A 4TYHA 4YNOA 4A4XA 4JDJA 4DLIA 3LFFA 4L6QA 4F7NA 3MTFA 3EQBA 4NZWB 1ZYJA 3H9RA 5J87A 3CE3A 3ZDIA 4EOSA 4F99A 3HDMA 4IANA 3W0NA 4LM5A 2E9OA 4M8TA 1R1WA 3KXNA 3OY3A 5CALA 1PF8A 2H96A 3AMBA 4DFNA 1ZLTA 5CEIA 2GDOA 4L7SA 3KMUA 4WG3A 4BIEA 4M3QA 3H0YA 2ERZE 4JDIA 4E5BA 4Z55A 4H1MA 1W83A 3BX5A 3UO5A 4OBOA 2FYSA 1YI3A 3PVGA 3B8QA 1OKZA 1Q8ZA 4GFGA 4FSQA 4DFBA 3E63A 2CCIA 4AN3A 4W4WA 5JFVA 2W5AA 2C3KA 3FPQA 3FHRA 4MKCA 4IB1A 5KO1A 4I1ZA 1PMUA 1YXTA 3GC8A 2W4JA 4WRSA 1ZARA 3LQ5A 4XV9A 4QMLA 5EQYA 3FXZA 2B4SB 4UXLA 5AP4A 5JGAA 3ULIA 5F94A 3KEXA 4PMTA 4YO4A 1YVJA 4I24A 3AC2A 4DGOA 3ODYX 4EI4A 3R22A 4ASZA 4GV1A 3M2WA 2CGXA 1SYKA 2C47A 4QMPA 4UV0A 4V05A 4YJSA 4RSSA 1ST4A 3FLSA 4FODA 3QC9A 4I6LA 2UZNA 3KVWA 2UW3A 5EH0A 4E1ZA 4BRXA 1Y6BA 3TL8A 3D5WA 3ZXZA 4V0GB 4GFMA 4GK3A 2QO2A 5HIBA 4TYHB 3VBXA 4XS2A 3W10A 5IF1A 3P0MA 2XA4A 4ZJJA 4O7OA 2QO7A 4K18A 2XIZA 3A62A 5HCZA 3UNJA 4QYYA 5BVDA 4AE9A 5I9WA 4CG8A 1OVEA 2IPXA 3NUPA 4MWIA 3F82A 3KREA 1YW2A 4J71A 4CXAA 1AQ1A 2WTKB 4FUYA 3T9TA 3TJDA 2YN8A 5IQGA 2ZDTA 3AD4A 2PMNX 3DLZA 3QTXA 4KKHA 4HVHA 5L6PA 5HLPA 4YGAA 4BCJA 3PG3A 4BZDA 4XBRA 4D4SA 2GQGA 2O64A 5CS6A 4CMOA 3PXZA 3D4QA 3DXNA 4MXYA 2WMRA 4WSYA 3DKOA 4CEGA 3BYSA 3P7BA 4DEAA 5DYJA 2BTSA 3POOA 3Q53A 4YPSA 3N4UA 4UY9A 5FDXA 3TN8A 3ROYA 3E5AA 3UNKA 2R3GA 5HG5A 2W1GA 2R4BA 1B38A 3R9RA 3KXXA 3Q9ZA 1UU8A 5IZFA 3A61A 1DS5A 4YC8A 3R8MA 3W1FA 3MJ1A 2BKKA 2VNYA 1PMVA 1OKWA 3F2NA 2BHHA 2CSNA 2W1ZA 4MVFA 3IECA 2V7OA 5EFQA 4L3JA 4AW0A 4F7LA 3AC3A 2VWVA 2J51A 1L8TA 4BF2A 3UIUA 3ZFXA 3ZRKA 3A8XA 4WG4A 2Y4PA 4IM3A 3UDBA 4DE4A 5IG1A 5E8SA 4FTOA 2GNLA 1SNUA 2UZDA 3LZBA 3ORNA 3ZO2A 3P23A 4U7ZA 2PVYA 3ZUUA 3AG9A 4YJRA 2O2UA 2E9UA 4AP7A 2B53A 1OL7A 1A48A 4ITJA 3SRVA 3FQSA 2WEIA 4N70A 3GI3A 4PNIA 4L42A 5CYIA 5EW3A 2W1CA 3QFVA 4LGHA 3A7FA 4B4LA 4F9BA 2WXVA 4S30A 5IUGA 4GS6A 2JEDA 2X1NA 3R83A 4X2JA 3Q4CA 4XG2A 3TMOA 2VU3A 4QDVA 1W8CA 4U81A 5EM6A 3LM0A 4OTFA 2I40A 2YFXA 4W4XA 2W99B 2XM8A 3SDJA 4KBAA 2VTQA 4OT5A 2OXDA 4CT1A 3PJ2A 2Z7LA 5AAEA 4J7BA 5JFWA 5J9YA 2R3OA 4PDYA 5CVHA 3EN9A 5HNIX 2I1MA 3D15A 5FEQA 1A9UA 3ATSA 2W7XA 4IZ7A 3O50A 3UO6A 5E7RA 3D7ZA 3MH3A 1ATPE 4IX6A 3BI6A 1LPUA 4U80A 4YHJA 2O63A 5CX9A 5HHWA 4DGGA 5BQ0A 2J5FA 5AAGA 4Y95A 5HZNA 1PHKA 3NSZA 4L45A 3EWHA 3B8RA 4S31A 5G1XA 3AT4A 4E8AA 3WOWA 3ELJA 3E8CA 3OP5A 1JQHA 4LRKA 2ZFYA 2UW6A 4F6SA 3ZBFA 4GIIA 3D2IA 2J0MB 3TZMA 3ORKA 3HMNA 1UNGA 5CSXA 4E93A 3P78A 5D12A 4EQUA 4JT3A 4PMSA 3W55A 1PRYA 3I7BA 4IEBA 4RIYB 1WVWA 1UNHA 3R02A 2UZBA 2WTCA 4FV8A 3KRRA 2B9JA 3T8OA 3UIBA 4A9RA 3EYHA 3JR1A 4RPVA 2UZOA 4NW6A 4AW1A 4ZZOA 4F9WA 5HG7A 5BV3A 2C68A 2QODA 3VIDA 5AV1A 3SC1A 3SOCA 4ZZNA 4DEEA 3PYYA 4M67A 3SRVB 4EEVA 3CY3A 2WMAA 5AA9A 2GNFA 3C0IA 1ZMVA 4GEOA 4CTBA 4AX8A 3KMWA 4FBXA 1PY5A 4O7YA 3G0EA 4E20A 4FKGA 1DI8A 4Q9SA 3I81A 4PQNA 4DCAA 2XRUA 3H9OA 3U51A 5HLWA 5I9YA 4XLIA 3DAJA 3KIOC 4FICA 1TQMA 4FZFB 1JKLA 2KULA 4TT7A 4BB4A 5C1QB 3BEGA 2UW4A 1CM8A 3R9HA 1CMKE 2PZYA 2C6EA 3V6RA 5LVMA 4G31A 3QQKA 5AP0A 3ZSHA 1WBOA 3ZLSA 2WQBA 2GS6A 3KC3A 4IWPA 2B1PA 2B9FA 2R7IA 5TO8A 1F5QA 3WZJA 3PSBA 3F5PA 4ANQA 1PXJA 3GFWA 4YLKA 4ZK5A 5HO7A 4O6LA 1L3RE 4FSUA 4ZTRA 3RVGA 4FSNA 4BICA 2FO0A 4FTKA 3ORMA 4TPTA 2BZJA 4CFFA 4IJ9A 5KCVA 3FC2A 3QCYA 2P4IA 3PFQA 4JL9A 4HYUA 4GCJA 4B6LA 1H1RA 5AADA 5CANA 2FVDA 3ZM4A 4CFNA 3VC4A 4PDSA 2BCJA 2FH9A 4K1BA 4PUZA 5J9ZA 3R1YA 4QMYA 5I9UA 4IVDA 5IH5A 3WBLA 4EOIA 4QEBA 3FPMA 3C13A 4CKIA 4CMUA 4I23A 2BAKA 4JBVA 3VS6A 3KN5A 4YSJA 3QD4A 3NEWA 3MN3A 4F6UA 2XK3A 3AKJA 4J53A 4V04A 3UP2A 3GOPA 5K5NA 2XKFA 2FSOX 3QF9A 4QNAA 4ZLYA 3NW7A 4M0YA 2VGPA 5ANEA 5AV0A 4D5HA 4IAYA 3WIKA 1W84A 4C02A 3R9DA 5IDNA 4PDOA 1URCA 4F9CA 3F9NA 1FMOE 4QMWA 4WNOA 5IQCA 1FOTA 4HGLA 2QOIA 3ACJA 2BZKB 4AAAA 4EKKA 2UW8A 4G9CA 4GL9A 3PXQA 2XUUA 3HMIA 2PWLA 4BHNA 2BZHB 4KABA 3VAPA 2NRYA 1KOAA 3R8UA 4U0IA 5FP5A 3Q32A 4CFVA 1GZOA 3C5UA 3CPBA 4CLIA 4EC9A 3TNHA 4M12A 3ZZWA 2O3PA 1U5RA 5BYLA 5IQHA 1XR1A 2G2FA 3QXPA 3G2FA 1PXKA 2WO6A 3V5QA 5D7VA 2ZB1A 3EJ1A 3ZHPC 2YIWA 3C50A 3QA8A 1XH6A 4X6QC 3FUPA 2C6LA 5EW8A 4QO9A 4MX9A 5L8LA 3OT3A 4FIIA 3FJQE 4NFNA 3AMAA 2JFLA 2VWIA 4FZAB 4HCVA 3QD3A 5AUUA 2JAVA 3FSFA 3O2MA 4C37A 2WIPA 3WI6A 1HOWA 3PY3A 5AMNA 3C4WA 3EIDA 3DQWA 3PE1A 4IB0A 5CI7A 3GC7A 4PTGA 1ZOHA 3ALOA 4F70A 3VBTA 3FZ1A 2X4ZA 4FTTA 4GG5A 2IJMA 2R0IA 5CVGA 4E26A 1OPLA 1PXNA 2ITXA 1ND4A 5EHOA 1PXPA 4DINA 1XBBA 3TT0A 2VWYA 2DWBA 1JBPE 3WZKA 5K4IA 2CNQA 2EB2A 3CS9A 4YHFA 3OOGA 3SXFA 2Q83A 2UVZA 5GHVA 3KFAA 3FC1X 5KKRC 3KCFA 4LUDA 4IQ6A 2XB7A 4YJNA 1ZXEA 2PU8A 5CSWA 3WYXA 3ENMA 4TYJA 4B8MA 2V7AA 5KHWA 1PKGA 3I79A 4AFJA 1H27A 4BCKA 1BYGA 1Q8YA 1M2PA 4K0YA 2XIKA 3V6SA 1UA2A 4EH7A 3UQCA 4IVBA 4JG8A 5IEXA 5HBHA 3O0GA 3QQGA 4MCVA 4XRJA 3NNUA 3GCQA 3T3VA 1MUOA 2QG7A 5DLSA 5FXQA 1JAMA 3BCEA 3EHAA 5LMAA 3OTUA 1YOMA 3PTGA 5AX9A 2QOFA 4FT7A 2BRBA 2O0UA 2B9HA 4KSQA 3AC4A 1J7IA 3QBNA 1JSUA 5CTPA 4C0TA 4NKSA 5M4IA 4NWMA 4UZHA 3DY7A 4FSTA 1TQPA 3QTZA 4IAKA 5ETFA 5EOLA 5M4UA 1R78A 4CLJA 3HNGA 3OCBA 2C69A 4TW9A 1KE7A 4JG6A 3UC3A 1IAJA 4DHJA 2VO7A 2EB3A 1ZRZA 3DZOA 2QR8A 3EL7A 3OF0A 4RVMA 3HEGA 4R78A 3HVCA 3LLTA 1EH4A 1YXXA 3LFDA 3UZTA 3W2QA 2QURA 5JRSA 1BKXA 4QMTA 4FNYA 3ULZA 1H4LA 3DXQA 4EBVA 3LHJA 4DYMA 5BNJA 5J5SA 3ZO4A 4XHKB 5DFPA 5AUVA 4G6LA 2CKQA 3EZRA 5CEMA 3BYVA 2ZJWA 2JIVA 2XANA 4MXAA 2OKRA 1JLUE 4P5ZA 4X6RA 4A07A 3F88A 4IB3A 3QCQA 5LMKC 2RFDA 5EYDA 2JIUA 3QRUA 3FKNA 1IEPA 4ALUA 1ZAOA 1UWJA 5FTOA 1KOBA 3K3IA 2BRHA 3QLGA 2WB8A 3MWUA 2BAJA 2ZV9A 5IA5A 1S9JA 4G3DA 2WIHA 2X9FA 1UU3A 1J91A 1WMKA 2PPQA 3QA0A 4U8ZA 2QI8A 3OY1A 4WZYA 2YCSA 1ZMWA 4U3YA 4ZSEA 4ZXTA 2Z02A 1MP8A 3Q52A 4R3CA 5HI2A 3NAXA 4C36A 3OG7A 1YHSA 3DK7A 4BI1A 3WE8A 1UU9A 2GTNA 5F20A 4M14A 1BX6A 5HE1A 4RQKA 1OB3A 2V0DA 4LDTA 4ZS4A 4RC4A 1REKA 2VO3A 3A7GA 4QMOA 2YCQA 2UZWE 2YCRA 3HV3A 4A9UA 4NM7A 2KTYA 4O0YA 3M42A 4CGAA 1PXMA 3TKUA 5DHJA 3MIYA 5AV2A 4G16A 2XK4A 3Q4ZA 2J0IA 4D4RA 4WKQA 5A6OA 1Q3DA 2CNUA 4BZNA 3Q96A 2PUIA 3VF8A 3VJOA 4E5AX 5BUEA 5CSHA 2YM5A 1XWSA 2X8DA 4NCTA 4M84A 4RQVA 4XP3A 3O7LB 5CI6A 5DR6A 5IDPA 2W06A 2H34A 3RK9A 4EUUA 1GOLA 4J8MA 3LFEA 3CGFA 4LFIA 4MAOA 4F1TA 5M4FA 4I0RA 2WMWA 2OJFE 4YTHA 5FG8A 4PX6A 4BTFA 4AAYA 5JMSA 2W17A 5CEPA 2VTHA 3OROA 2XS0A 3V5JA 3S95A 2XYUA 3E7OA 1AD5A 3BKBA 4RJ7A 3S00A 4AT5A 3ET7A 4G3FA 3NGAA 3UJGA 3G9LX 5CZHA 5L8KA 3BQCA 4NM3A 2OI4X 3FYKX 3POZA 3TZ7A 3V8WA 4XG3A 3OTVA 5FUTA 4GKHA 3NYNA 4L9IA 5L2TA 3DZQA 4I4FA 3AMYA 5BUIA 3ZC5A 4ZAUA 1UVRA 5IH4A 4RJ4A 4TYEA 4FEUA 5BX0A 4HYHA 2GQRA 4W4VA 2F57A 1OL6A 2BIKB 2OJGA 3MH1A 4IIRA 2R0UA 3QWJA 3UYSA 4AN2A 4QQ5A 4YC3A 3GGFA 5BMMA 5JZNA 4D9TA 2PMIA 3LFCA 3PWYA 4GT3A 4J1RA 4D9UA 3EN6A 4DTBA 3SXRA 4C4JA 3QZFA 1FQ1B 4PY1A 4NU1A 4UWYA 3F66A 1QCFA 4OGRA 4AZTA 4FOCA 4XV2A 3HLLA 3CJFA 2PVFA 3OMVA 3TV6A 3GENA 5CNOA 4WD5A 3ZXTA 5IMXA 4NUSA 2EXCX 3R71A 3RMFA 4X3FC 1ZYLA 2W1FA 1ZYDA 2ZMDA 3DBDA 2GFSA 4TTHB 5EI8A 3ORTA 3I7CA 4C4EA 4E6AA 1ERKA 4I6BA 1ZY4A 3CY2A 3MVMA 4ACGA 2BR1A 4F64A 5EW9A 3Q4TA 4JS8A 3P7AA 2VO0A 1UNLA 2CGVA 2E9VA 4QP2A 5EK7A 3WF5A 3Q6WA 4IAAA 4N6YA 3LVPA 4K9YA 4EH3A 2C3LA 4BR3A 3E93A 3HP5A 3UIXA 3VS2A 3EQCA 3EFLA 5DRDA 1Q41A 4XEYA 4E4XA 2C5XA 3PZEA 3TKIA 1XJDA 5LCJA 3BYOA 3EQRA 2WU7A 3OCGA 3N4TA 1H26A 3ANRA 2NP8A 1Y91A 2XKEA 5F1ZA 4JXFA 5IQAA 4KWPA 4BHZA 3GB2A 4AA4A 4ANLA 4QTBA 1XQZA 4YBJA 4H3PA 4H36A 4Y8DA 3THBA 2V62A 4GFOA 1JSVA 4FTUA 4U40A 3TUBA 3AC5A 4DHFA 4FT9A 2WMUA 1OPJA 3F69A 4GSBA 4FIFA 2IVVA 4IAIA 3QUEA 3W0QA 1YKRA 1XH8A 2PVMA 1IASA 4EK3A 4F7SA 3DFAA 2Z8CA 3SG9A 1WAKA 3D5VA 3FL4A 4N6ZA 4OTWA 5J95A 4D0XA 4ENXA 3RALA 2YIYA 4YC6A 3F2AA 5DBXA 5CAVA 2G15A 3P9JA 1YQJA 2OW3A 1H1QA 4FG9A 3GOKA 3EYGA 3KXGA 3P7CA 1MQ4A 3PJCA 2IO6A 4JAIA 2C5OA 2QOQA 2RGPA 3L8PA 1O6LA 4FEQA 2PMOX 3ODZX 2G01A 3O51A 3C4ZA 4U43A 4AU8A 2I6LA 2WOUA 5BVEA 4ORKA 4GU6A 4KS8A 5LVLA 4LQMA 4A9TA 4GT5A 3BBTB 5DRBA 3U4WA 2OSCA 5HTCA 2YM3A 3OW4A 3KRWA 4WHZA 3PA4A 1KV2A 4F0IA 4O7PA 1IG1A 3R6XA 1IA9A 2GCDA 4HPTE 3UMXA 3T3UA 4FL3A 1WBNA 2WTKC 4KB8A 5DT3A 5H8BA 5KE0A 2W96B 5C8MA 3LQ8A 2X81A 2OG8A 5CQUA 4BTJA 4TN6A 2JITA 3A7HA 5LARA 2R64A 4FKSA 4IWOA 5JQ5A 4EQCA 4FNXA 4RJ3A 3LJ0A 4ZTQA 5L6OA 1KSWA 4NFMA 3REPA 4C2VA 5HE2A 4UB7A 1XBAA 3OBGA 5ITAA 2YITA 4HCTA 2HZ0A 3P4KA 4O86A 5HEZA 3Q5ZA 2FSTX 3V51A 3DK3A 3SOAA 5BVFA 3BL7A 3MVJA 1Z5MA 2BILB 1J7UA 5D10A 3NUNA 5CEKA 3SGCA 2UVXA 3MPAA 4RC3A 4IJPA 2GNJA 2YIQA 3FXWA 3H9FA 2FGIA 1YOLA 4FSWA 4JIAA 4QP9A 1OKYA 2VWUA 4F09A 3BE2A 4BTKA 1Y57A 2B7AA 2W1DA 4U45A 3RPRA 1PKDA 3PJ1A 3KULA 4TWPA 4JBQA 4CTCA 2XCHA 5IA2A 3EOCA 3F5XA 2JKOA 1OI9A 2VX3A 4KS7A 3TV4A 3U54A 4IM2A 4WUAA 4LV5A 4QMZA 3UYTA 5E4HA 3G5DA 2ETMA 3EFJA 2J7TA 3LFBA 2HZ4A 4JMQA 1LUFA 3FBVA 3HAVA 4QYEA 4F63A 1PXIA 1FBNA 1SM2A 4ZY6A 3AT3A 4FTIA 3OWJA 5A4TA 2BALA 2CNVA 2O8YA 3NCZA 4PMMA 2JC6A 3E8EA 4X3FB 3JY0A 5DG5A 5TT7A 4AOIA 2ZV7A 3BV2A 3QQFA 4BCMA 3UGCA 4H05A 2XEZA 3ATTA 4G3CA 1VR2A 3QTUA 1KE8A 2CKEA 2XNOA 1R3CA 3H3CA 3NW5A 2XALA 1OGYA 2HWPA 3TKHA 4O0VA 3W2SA 1SVGA 2XBAA 2X7OA 3UDZA 4D5KA 2GNGA 5A46A 5M44A 5FGKA 2PY3A 1Q97A 1W0XC 3GFEA 4FUXA 4I92A 4BDHA 3ORLA 4EC8A 4DH3A 4J97A 5AM6A 5HCYA 4L01A 3O17A 3CLYA 1G8JA 3CTHA 3DKFA 3QCSA 3JPVA 2R3FA 4FR4A 5JH6A 2EXMA 2XK8A 2CHLA 5DPVA 4IFGA 5AIKA 4IX4A 2YEXA 2ITYA 3K5VA 1OGUA 1RQQA 4LV8A 4CFXA 5M06A 5H3QA 5EKNA 3JY9A 1NXKA 1F0QA 2XK7A 4FKVA 4F0GA 4E4NA 3S4QA 2F49A 2WELA 2QLQA 3IW8A 1ZY5A 3AC1A 3RAKA 1O6KA 4C7TA 3RNYA 3GC9A 2BIYA 3OWPA 3NUAA 4BCQA 4DC2A 3R30A 3FMMA 4AGWA 2Z60A 3BLHA 2J0KA 3L1SA 3HMPA 1CKJA 3FLYA 4Y72A 5EI6A 2C6MA 2Q0BA 2JKMA 4XLVA 4ASXA 1K9AA 4RBLA 1XKKA 3U87A 1FPUA 4ITIA 4AW2A 4D1ZA 2UZTA 4C3FA 3R9OA 2H9VA 1ZOEA 3EQGA 3OS3A 4X2NA 2XARA 4F65A 3MIAA 2OGVA 4D58A 3UOJA 4BBEA 5IA3A 4FSMA 3IG7A 3FQEA 3PIYA 5JN2A 4ZSAA 3SVVA 4RX9A 4AXDA 4FVPA 2QKWB 1YHVA 3PLAE 4M69B 2VTSA 5KHXA 2JDOA 3QQJA 3ROCA 3ANQA 3MTLA 4D1XA 4UWCA 4FV9A 3AC8A 2VTAA 3MB6A 4JDKA 3TXOA 4UALA 4DTKA 3GU7A 4I22A 4QQCA 1WBSA 2C6IA 3H30A 2UZUE 3D5XA 3WILA 2YZLA 2X7FA 2WMSA 3F7WA 3PY1A 3KA0A 3VS4A 1YXVA 4J96A 3WF8A 2PVKA 4ALVA 1ZYCA 2HYYA 4G9RA 4IACA 3RJCA 5BVOA 2GNIA 1RE8A 3G6GA 2XNEA 4EKLA 1TQIA 5AP5A 5AP7A 2AUHA 2WMQA 4D4VA 5KX8A 2WTVA 2YISA 4RVKA 5AFVA 1FVTA 1LP4A 3G33A 3COMA 3BLAA 4HNFA 4Y83A 3UG2A 1BI8A 3HV6A 3FEGA 3HX4A 4PV0A 3KK8A 3CKWA 4HZSA 5HESA 4BGGA 4DG3E 4OBQA 1LR4A 3FLZA 1PXLA 2XBJA 4G6OA 3NNWA 2IW9A 5EQPA 3VRYA 4D28A 1QPJA 2BVAA 4HNIA 3VS5A 3ZSIA 3QZHA 3ZTXA 2B9IA 4KA3A 1BI7A 2PSQA 4TRLA 1GIJA 4OR5A 4S33A 4G3GA 1S9IA 2WEVA 4X21A 4FEWA 4O7VA 3EQIA 1QL6A 2GMXA 4FKWA 3IQ7A 3QRTA 3PSDA 3VUDA 3PPZA 2W0JA 5CU4A 3EKNA 3DJ7A 4YO6A 4C62A 5LMBA 1OL5A 4ZSGA 5FLFA 1Y8YA 5KMIA 4YZCA 5AUWA 3DPKA 5GJFA 2BAQA 4FKRA 4DEHA 2HY0A 3EQHA 5B0XA 3DDPA 2YWVA 2HY81 4YMJA 2HCKA 4EH4A 5LVNA 4ZEGA 5HX8A 4FG7A 3E3BX 4DHZA 3NCGA 2AEGA 4I6FA 3IOPA 3QCXA 4HCUA 1VYWA 2F7EE 3HMOA 2RL5A 4MHAA 1JPAA 2WKMA 3D9VA 4K11A 1NY3A 3RGFA 4E4MA 3DKGA 3CQEA 4C35A 2G2HA 2P3GX 3C4CA 4ZTNA 5HD7A 3VVHA 3L9MA 3ZM9A 4ASDA 3UP7A 5KBRA 2PE1A 4AN9A 3DBEA 5DIAA 5J7HA 3PIZA 1VJYA 4GW8A 3ZH8A 3UOHA 2REIA 3NX8A 3O8TA 1FVRA 1Q5KA 3CIKA 2W5HA 2Y6MA 2JDVA 5CAQA 5I9VA 3HUBA 1WBTA 1YDTE 4QP4A 3UE4A 5DI1A 4E73A 4ZJIA 3DAEA 4N4SA 1QPCA 2EU9A 3PDTA 3QGYA 3QZGA 3NPCA 4FV2A 3C0GA 3GU4A 4O22A 4RC2A 5KMKA 4QMSA 1U4DA 3GEQA 4QPAA 5GJDA 5EDRA 3O8UA 2QNJA 5H2UA 3SD0A 4FTLA 4EHGA 4QQTA 3QHWA 4U97A 5CT0A 3WF7A 3TZ9A 1YRPA 1LEZA 3I4BA 2B54A 4NM0A 4GK2A 5G6VA 2ITNA 2NRUA 4FG8A 4HVDA 4BTMA 1G5SA 4A4LA 2WAJA 2DQ7X 3LAUA 4MD7E 4HGTA 4C3PA 4DGMA 4F9YA 4ZTMA 5L3AA 2C0TA 5EYCA 3DA6A 3GU8A 4ZOGA 2BKZA 5EOBA 2OF4A 3FZTA 5HTBA 4X2FA 4L3LA 2R2PA