4PDYA

Crystal structure of aminoglycoside phosphotransferase from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
337
structure length
332
Chain Sequence
b'RLGSRSQAPLIPQAVVSKYDLAIQQRHADGNIEVWTDSKGRRYAAKRSSIAPAHCRIMVQCLRHAQEQGFTKFARFVTTSSNAPYVRHGDFTYYVTEWVSGQPANFGLPEHVAQTAYTLAQFHEATRSFRTDWKDDVFGLFQARWRDLRQMWLGADRKREKDAFDQLLLSMRDELHRDAAESLALFEDRDVIAYLEAERSSGGWCHLDVIPSNCLYTPQHQVVLIDFELARPAPRALDMAHLLRRSLERGNWDGHLAYACFLHFDAVRNIPKSEYRAVEAILRFPYLPWRIAHARYHFAADPSQLDALQQYAVQAEKRQAFLASLRQQVEHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Transferase
total genus 119
structure length 332
sequence length 337
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdyA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4pdyA02
3VUDA 3QQFA 5EI2A 3SW7A 4CMUA 4YSMA 1PXIA 3A4OX 4RVKA 3DU8A 4U9AA 5CZHA 4ALWA 2I0EA 3Q9WA 4EK4A 3QTQA 2WAJA 4B8LA 3PRIA 3D9VA 3FI4A 3C4CA 2VZ6A 4IAYA 4O6EA 4LOPA 5CAQA 3HV4A 2ITPA 3FHIA 3OC1A 5J9LA 3I79A 4FGRA 2C6MA 4K18A 3AC8A 3AT2A 4EH8A 5E1SA 4A9SA 4IH8A 2C30A 3EB0A 2XKCA 2B55A 4PY1A 4XCUA 3KC3A 5CU2A 4YJNA 3NW6A 3IG7A 4L44A 3IDPA 3RK9A 5BX0A 3KEXA 2J5EA 5AP6A 2R64A 3ORKA 4EONA 3F5PA 4C34A 2HYYA 2IO6A 2FGIA 5AIRA 2VGOA 2UZVA 5AP0A 1GAGA 4GT4A 5K4JA 4BI2A 3MTLA 3NRMA 4IZ7A 5H9BA 5M55A 2ITQA 3VF8A 2QOOA 2GS6A 4KAOA 4H3PA 3KF7A 4IAAA 4NZWB 1JSUA 4NM0A 4GJ2A 3FZSA 4NTSA 3OEFX 4KSPA 3KA0A 4XS2A 2VWZA 4AZTA 1RW8A 4FV4A 3N4UA 3KB7A 4KS7A 3QF9A 2HIWA 3DZQA 4FKOA 4F4PA 4H39A 3BE9A 2YIQA 4C3RA 3NR9A 3V5WA 4KKEA 4IQ6A 4IWQA 5EQPA 5CF6A 4XLIA 2XNOA 3EMGA 1UU7A 4KIQA 5BVEA 2AUHA 4F1TA 3AOXA 3R21A 5JFSA 4QTDA 3DBDA 4C3FA 5CVGA 2JDTA 3TKUA 4YZCA 4GG7A 4FNWA 5AP7A 2ITOA 4HVSA 2PMOX 2E9UA 3NDMA 4FTUA 4QYHA 4XOZA 2YJRA 2FSOX 4IAZA 3PXFA 4ANLA 4RQVA 1VR2A 1ZRZA 4LV8A 3NUXA 3OW3A 4DGGA 5JN2A 5M57A 4JI9A 2UZOA 2HZ0A 1VJYA 4ERKA 1WVXA 1H00A 3O51A 1YXXA 2Y6OA 2W4JA 3FZOA 4O7SA 3QKLA 3UIMA 5LQFA 3W1FA 2JGZA 3LFQA 4U81A 4XRLA 2BRMA 4U45A 4V0GA 4C4HA 4EHEA 4C4IA 3EFWA 2F9GA 3JR1A 3CKWA 4RJ3A 1OPJA 1ZZ2A 5AV2A 4DBXA 3ZH8A 5KBQA 5AM7A 1OPKA 2R0UA 3F3UA 3HMMA 3R7IA 3Q2MA 5AV1A 5M4UA 5CU3A 2W1GA 3I5ZA 3QKKA 3QQKA 5A9UA 2GU8A 3TUDA 3K3IA 2R3FA 3Q96A 4P4CA 3FSKA 5LMBA 3LLAA 2DYLA 2CMWA 4EOOA 2QODA 5IUHA 5CX9A 5FDXA 2XYNA 3BHVA 3UYTA 3NUYA 5KMIA 1WZYA 3CC6A 3MH3A 4IVDA 4D0XA 4PNKA 3QQGA 4PDYA 4YO6A 5FEQA 3ZRKA 3W0MA 3E8NA 3FL5A 3PVGA 3KL8A 5EHOA 4HVHA 3DKCA 3DK6A 5AP1A 5CSPA 5BYYA 2HAKA 1I09A 1REKA 3GC9A 4U44A 3VRYA 3VBWA 3CGFA 3JPVA 4E8AA 1CKIA 2W1CA 4D0WA 4Y5QA 3U6HA 4NU1A 3FI3A 4F6WA 4QTCA 3QKMA 4M68A 3EKNA 4TW9A 4M0ZA 4OTRA 3KKVA 3PFQA 2BDWA 5H8GA 2I6LA 2UZEA 1SNUA 1P4OA 1U4DA 4R5SA 1ZMWA 3KRWA 3OUKA 4WZYA 3G0FA 1H28A 4RRVA 5FD2A 5H8BA 2BAQA 2RG6A 3BHHA 3NAXA 4X2KA 4HZRA 5AV3A 4BCQA 5DA3A 3WF5A 4E5BA 2RG5A 3FQSA 2JDVA 4BZOA 2F7XE 3KMMA 2WIHA 4I94A 4JX3A 3IO7A 1M52A 2QVSE 5D7AA 1KE8A 3RPVA 4YO4A 4O7OA 2CCIA 3WARA 3QQJA 4EL9A 2XIYA 1CSNA 3QTXA 3EQBA 2WPAA 4BKJA 3F5XA 3JS2A 2J0IA 4IADA 5C26A 1ZY4A 3FKNA 3ET7A 3DTWA 3NVKI 1K3AA 4G16A 5TO8A 3QRJA 4QP3A 5EYDA 3LFFA 4UXQA 3R9HA 5AJQA 3ODYX 4JIKA 3R9RA 4U94A 3ZFYA 2WMWA 3ZM4A 3KRXA 2IZTA 4K9YA 5CU4A 3RCDA 1G8AA 5D9HA 5J1VA 2YCQA 4EK3A 2CJMA 4JBOA 4TPTA 4JRNA 4I5MA 3UNKA 4XG7A 1ZARA 1M7NA 3CBLA 3IECA 3Q5ZA 4N6ZA 4X2GA 5HG7A 1NW1A 4YJTA 3SRVB 5AUUA 4LUDA 4G3CA 4I22A 4R5YA 4IWOA 4TNBA 5DH3A 3TDVA 3H10A 5IZFA 3U54A 2XEYA 4ZTRA 3BGQA 2F7ZE 3NCGA 4NL0A 1U59A 2ZDUA 3Q32A 4JDIA 2YM8A 4QT1A 4EOJA 2BDJA 4LOOA 3G6GA 2VGPA 2ZM4A 3Q3BA 4J52A 1OL5A 4X6RA 1PXMA 4U3ZA 5CVFA 2R0IA 2YEXA 5JT2A 2PE2A 1ZXEA 4JIAA 5EG3A 1FOTA 4EH4A 3C0IA 2ZV7A 3ATTA 2Z2WA 2CGUA 2YCRA 4AU8A 4ANBA 4JX7A 3NUNA 2VTOA 3PWDA 5JK3A 2Y9QA 2GQGA 4XBUA 4I41A 4QYYA 2E9VA 3HRBA 5L2IA 4RVLA 2YDIA 3F61A 3PTGA 4ZP5A 4M67A 3VRZA 3MVJA 2DWBA 3O96A 3WIGA 4S31A 3ZUTA 3OMVA 3MY5A 3O71A 3MPAA 5HLWA 2XNEA 3DNEA 4L42A 4FTQA 2O3PA 3ACJA 3ORPA 4GIHA 2BFYA 3W8LA 3DKOA 4EZ3A 5ACKA 1OKVA 2VAGA 3Q9XA 3JVSA 3RTPA 4CKIA 3PJ2A 4K33A 3UJGA 4BGQA 4K77A 2QC6A 3FEGA 2OFVA 4UWYA 5HKMA 4O96A 4QQCA 3D7TA 3W2SA 4JVGA 1QPEA 4L9IA 4O7YA 1ZOHA 3I4BA 4BICA 4X7QA 2PSQA 2J4ZA 3AD6A 4XJ0A 4YJRA 2HXQA 2WMAA 3Q4CA 3E3BX 4K1BA 4EQMA 5IQHA 2W96B 2PWLA 2HW7A 3FMJA 4I3ZA 4HGSA 4L6QA 2RIOA 4C58A 3VJNA 3HA6A 5DBXA 3FXWA 3K5UA 4WNMA 4BRXA 4DG2E 3RPSA 3OXZA 2UW3A 3ZFMA 4TWPA 4QP6A 3ZLSA 2E9OA 4Q9SA 4U79A 3GCVA 2ZB0A 1MRVA 2PZRA 1DAYA 4BHZA 3ZCLA 1XH6A 3Q4UA 4QMUA 1J7IA 2J5FA 3A99A 4UEUA 1JQHA 2QG7A 3LXPA 3TUCA 1WBTA 1NY3A 1XH5A 5L3AA 5JH6A 2BZHB 2CKOA 3F3TA 2OO8X 1J7UA 3C13A 3QFVA 5I5ZA 5L8KA 3QA8A 3CP9A 4RIYA 3B2WA 4XHKB 4BC6A 1YI6A 2XNBA 4YHFA 4OTFA 4JDJA 3VS5A 5CZIA 3FXZA 3AT4A 4HCVA 4LM5A 2NO3A 2XK6A 2C6LA 3QD0A 4ACCA 4RC2A 2UZUE 3G90X 2YM6A 2PK9A 3LFNA 4FTLA 4WG4A 4MHAA 3KU2A 1BI8A 3R1YA 4L53A 3EL8A 4N0SA 3ELJA 2X7OA 1XH4A 3LJ1A 3G9LX 5IH5A 3RWQA 3FI2A 1OKZA 2IN6A 4CFFA 3IQ7A 5DLSA 2J9MA 5AV0A 4CQEA 4HVIA 3GEQA 4FT7A 3TZ7A 2EB2A 4FV1A 2B4SB 4F64A 3EQGA 4MXOA 3OZ6A 5F95A 5FM3A 3BZ3A 3GC7A 2QOCA 3ENMA 3LM5A 5EW8A 3VS3A 4E6AA 4XH6A 3ULIA 2QLQA 1YW2A 5EHYA 3FLYA 4FVPA 1PKGA 4TYIA 3ZZWA 2C5YA 3C0HA 4LQMA 3V6SA 3UO6A 2JAMA 3WILA 3Q4ZA 1AD5A 4KBKA 2JAVA 2QOLA 4OUCA 4U43A 5C03A 2O5KA 3NIZA 1JVPP 4HCUA 5LVPA 5CEMA 4QNYA 4ZZMA 5EYKA 3EYGA 2WMUA 2GSFA 2W9ZB 3DS6A 4OR5A 2W5AA 2LAVA 4E20A 1OMWA 3IDCA 5JQ5A 4ZJVA 4RC4A 5FXQA 2C0IA 2ERZE 2VTRA 4O0SA 4BDDA 2QONA 5AP4A 2O8YA 4J53A 4WNKA 4CG8A 3EKKA 4G3DA 4TNDA 3ZO2A 1ZLTA 3COHA 3W0SA 4ZTMA 3ZLYA 4KRDA 1T45A 3A7HA 3PVBA 1H24A 2J50A 4R3CA 1XWSA 4UXLA 5FTGA 5M09A 4MAOA 3GQIA 3KRRA 4HZSA 3PYYA 4QYGA 4FTNA 1XH9A 2J0JA 3SXFA 3EFJA 3UIBA 4BR3A 2YISA 2OF2A 2EXMA 4L45A 1DI9A 4CT1A 4AA0A 1UU9A 3QGYA 4NUSA 2JEDA 2R3GA 4I6BA 3VULA 4BDHA 4U3YA 2FB8A 4E4MA 1BL6A 4IHPA 4MXCA 5CEPA 4Y5HA 3ZC5A 3OHTA 3FLNC 4CTBA 2O65A 3OOMA 4NKSA 5BYZA 2OZOA 2A4LA 3HMIA 3NPCA 4J98A 3VBTA 2VWXA 5AUYA 3LCDA 1GZOA 5DRBA 2VV9A 3UBDA 5IQDA 2BIYA 5CEKA 2X8EA 3RJCA 3RM6A 4DTKA 4JG6A 4JS8A 3EQCA 3Q9ZA 3ZSIA 4EOKA 4PF4A 3NYVA 1NXKA 2ITZA 4QMPA 3LZBA 4R7IA 4YR8A 4QMTA 3N4TA 5FGKA 4UN0C 2ZMCA 5TOZA 5DPVA 2VTHA 5E1EA 4EH9A 2XM9A 2FO0A 3OWPA 5D7VA 3C50A 3HP5A 4AZVA 1PYEA 2C3IB 3EQHA 4TYEA 4CVAA 1CDKA 3ITZA 4WT6A 5DHJA 1BX6A 2NNWB 4YBKA 4A07A 3EOCA 4FOCA 5CEQA 4AE6A 1WBOA 2YFXA 1OB3A 3UO5A 2J0MB 3REPA 4EH7A 5H8EA 4TRLA 3ZBXA 1PHKA 3AC3A 1UNGA 2X2MA 3MY1A 5FLFA 1M2PA 5HG5A 4YHJA 4EQCA 5I9VA 4L3PA 4OBPA 2RFSA 2JD5A 2PULA 3DZOA 4PTCA 4FEXA 3QZFA 3AC2A 4IWPA 1XO2B 1Q3WA 3Q9YA 3UTOA 1W0XC 2HY0A 2VTLA 4WRSA 2OXYA 1MQBA 1AQ1A 4FTAA 5KMNA 3QLGA 4KINA 4MK0A 4R6VA 4ASDA 1UWJA 4ZK5A 4FMQA 4JG7A 4YGAA 5AX3A 3H3CA 1YI4A 3C7QA 2GNJA 3ACKA 3KXHA 4O7WA 1YQJA 3V5QA 3PIYA 4TN6A 3ZHPC 4IM3A 4BCKA 5LCJA 4G9CA 3O0GA 1MUOA 4IANA 4E4NA 5KKRB 2CNUA 4AGDA 4IX6A 3CPCA 4GKHA 4L00A 5C1QB 1JBPE 5CXHA 2G01A 2WHBA 5LVNA 1WAKA 1YXSA 4FEQA 5C8NA 3N4VA 1XH8A 3BWFA 5FXRA 4YLJA 4QMXA 4EOPA 3SDJA 1H4LA 4FZDB 4O38A 1GZ8A 5LWMA 1ZYJA 3OCBA 4MH7A 1Y6BA 4KUJA 4NH1A 4AZFA 1UNHA 1LEZA 2CLQA 3CSVA 4FL1A 3QRTA 4QP8A 4U8ZA 4HJOA 5A14A 4ZS4A 3MPMA 4M12A 3G9NA 3LMGA 4TTHB 1CKJA 3P78A 4I0RA 3VN9A 2HWOA 3N9XA 2PE0A 2W5BA 4NKAA 5LJJA 1Q8ZA 3UVRA 3LJ2A 4KBCA 4S32A 4QMOA 3VVHA 1L3RE 1Q97A 2YM5A 4HYIA 4D2SA 1Z5MA 3FPMA 4MBLA 5L2WA 2C6KA 2GHGA 2YDJA 5JSMA 3COMA 4QMWA 5HQ0A 1IEPA 3QZIA 2OFUA 3DKFA 4IC7A 4B4LA 4RVMA 3NSZA 1G5SA 3MVMA 5DFPA 5J87A 3MWUA 4XP3A 4JXFA 4D4YA 3FHRA 4UX9A 1XQZA 4MXYA 4O7TA 5AADA 3DJ5A 5KUPA 4DGLC 4JQ8A 2GQRA 3BV2A 1U46A 1U5RA 4FKVA 3R7OA 3SRVA 4K6ZA 4KRCA 4BBFA 2QHNA 2H6DA 3DXNA 3RZBA 3I0OA 4BDBA 4F99A 1OITA 3VS6A 4XP0A 4FIJA 1P14A 4EC9A 3E8DA 4NM5A 3MFSA 4XMOA 5FEEA 4RLLA 3VBQA 3IONA 5CF4A 4DFYA 4O21A 4Z3VA 3HA8A 5DOSA 4YTHA 1GJOA 3SXSA 1JAMA 1NVRA 5EKOA 5M4CA 2J2IB 2W1ZA 2C6TA 4G6NA 2YABA 3RK5A 3KXMA 3NX8A 2I0HA 2Z02A 2CGVA 1W83A 3THBA 5I4NA 5JMSA 2IZRA 3MW1A 2NRUA 4F6SA 3ANQA 4S33A 3UQGA 3ZUVA 4JQ7A 4FL3A 2G9XA 3BX5A 4OW8A 1APME 3HRCA 4FZ6A 1K2PA 4QO9A 3NWWA 4XG8A 3V8WA 4B7TA 5ANGA 4CTCA 2XNGA 2WTWA 4PQNA 3KK9A 3ZONA 1QPJA 3HLLA 2JBOA 2UZBA 2XKEA 5DT0A 3GGFA 2JC6A 1FQ1B 4KA3A 4RVTA 3TNWA 4PUZA 5EM7A 3UYSA 2XH5A 4AE9A 4FI1A 2J6MA 2ZMDA 4QMMA 1FVRA 2IVSA 5DR9A 4A06A 4TWCA 1FVVA 4ENXA 5GNKA 3U4UA 1URWA 2R3QA 4RJ7A 5EQYA 2E9NA 4KD1A 3U6JA 2YWVA 2YIXA 4EHGA 3LXNA 4ACDA 1HOWA 4XYFA 4CCUA 4CNHA 3OCGA 1H1RA 4DLJA 2X2KA 4AF3A 3RMFA 4PRJA 2XZSA 4FV2A 4L68A 3ZXZA 5EH0A 4CMTA 4U5JA 4IAIA 3UG1A 4XV3A 5HIEA 3D5WA 3F3ZA 3G33A 1LPUA 4FKSA 3PXKA 3FLSA 3DJ6A 2BTRA 4JT3A 5FBNC 1OL2A 5C8MA 2DQ7X 3OCSA 3UP2A 3V5PA 4PP7A 3T8OA 3WZJA 3T9TA 5DI1A 2Y4IC 4DCEA 2GFCA 4YJVA 5IH4A 3ID6C 3GNIB 5L6WL 4GL9A 3AC5A 4RMZA 2QKRA 3BLRA 5EHLA 2W0JA 3TNIA 4O0TA 2XBJA 3P7CA 3VHEA 3ZYAA 4EJNA 5HTCA 3MA6A 5HVKA 1H1PA 1YOJA 4RT7A 3FMEA 3CTJA 4QMZA 4ARKA 4BTKA 2VX1A 2RFNA 3LHJA 4S34A 5AX9A 1Q41A 2Z8CA 4F9YA 2Z7LA 2ZVAA 1O6LA 3TL8A 4F9CA 4L7FA 3K3JA 3MI9A 3R00A 4JG8A 4D9TA 3C4EA 4FG7A 5ETIA 3KULB 3LFBA 5IQAA 5HTBA 4L3JA 3F7WA 4MD9E 4B9DA 5G1XA 2V55A 3SKCA 3S2PA 4O6LA 3EN4A 3GCSA 2IZSA 2JKOA 2WMQA 4TY1A 4U7ZA 1W82A 2ETKA 4UZDA 3RWPA 5CAPA 4G9RA 2WFYA 2YZLA 4R1YA 2X8DA 4WUNA 4Y95A 3LFDA 4UZHA 2VX0A 3QWKA 4IBMA 5IPJA 4X2FA 4NYEA 3QTSA 3MIYA 3FYKX 4J95A 5DNRA 5LARA 5BVDA 5ANJA 4DC2A 2XK4A 2UW6A 4U41A 5HLPA 4ACHA 2G2HA 4FZ7A 5CEIA 1OUKA 2YWPA 3HNGA 5HBEA 2PVHA 3NNVA 5IMXA 4IAKA 2X7GA 3NYNA 1BLXA 2OH4A 2W4KA 3KN5A 2JITA 4W4YA 5B0XA 2HOGA 3R83A 3FJQE 4CFUA 1OI9A 2HWPA 4IM0A 4EWHA 2R3NA 4WA9A 3O8UA 3TN8A 4ZMEA 2ONLC 2WELA 5IDNA 5DE2A 4CFXA 2B52A 4I21A 4C4JA 2BUJA 4J7BA 4WBOA 3ENHA 2HZIA 4C3PA 1FINA 1YXTA 2FUMA 2I1MA 4D1SA 2BR1A 5EM5A 2R2PA 2ETMA 2GNFA 4L46A 4RFMA 3BLHA 2H9VA 3F2NA 4FG8A 1R0PA 4DT9A 1BKXA 1WBNA 3H30A 4ITIA 2E2BA 4AX8A 3DB6A 3R73A 3RP9A 5L8JA 4JR7A 4FR4A 2PUNA 3A2CA 3H9RA 1ZOGA 2PVKA 5IA2A 5GHVA 2YIWA 2QOKA 3PLSA 2Q83A 2BILB 3E63A 3O8TA 4PL5A 3U9NA 2JDRA 1BYGA 1GZKA 3EQIA 4O2PA 4D4SA 3BELA 5T6KA 2PPQA 4RX8A 4PX6A 5GJGA 3VBYA 1CKPA 3FZ1A 3PVWA 4GT5A 3FAAA 4ZTNA 3V8SA 2J7TA 3FE3A 3CIKA 5IQGA 4AW1A 5JKGA 3NEWA 2ZM3A 3WYYA 4I4FA 3FUPA 4BDJA 3HMPA 5AUVA 3RAWA 5AUXA 1PY5A 3ZZEA 4EUUA 4G5JA 2G2IA 3SA0A 3T3UA 3HV3A 1YVJA 5A6OA 4L01A 1U5QA 1WVWA 3BYUA 4FE2A 1CTPE 5KNJA 1Q24A 4FTIA 4D1ZA 4F9AA 2QR7A 4W4XA 1B6CB 3IDBA 3ORTA 3PVUA 4YC6A 3MYGA 3H9FA 4O7VA 3QU0A 1RE8A 3EZRA 4FIIA 4FNYA 3FZRA 4IWDA 4RX5A 4JJRA 1SM2A 3DV3A 4R7BA 2Z7SA 4ZSGA 4BCNA 4F7JA 2CPKE 4LUEA 3K2LA 1YHWA 2VRXA 5CNOA 2XEZA 4X3FB 1KOBA 3O17A 2R7BA 3BCEA 2XUUA 1Q8WA 3TJDA 3E7VA 4LYNA 3WZKA 1E1VA 3GP0A 5K4IA 4BIBA 5C8KA 4RLKA 2R3MA 4AW2A 3DNDA 4C02A 2PZYA 4MXXA 3VUHA 3KMWA 4DA5A 2ITNA 4FL2A 4H58A 5CWZA 4BDGA 2H34A 2UW8A 2OXDA 3I7BA 2VTIA 4MBIA 3BYOA 3RCJA 4DH7A 4AZSA 3UOLA 5I9UA 1SVHA 1H25A 4AQCA 4KSQA 3TIZA 4I5CA 1J1CA 4RX9A 2CGXA 4DITA 1OKWA 3VUKA 3LW0A 1UU3A 3DQXA 3R1NA 3DKGA 2BZJA 3BHYA 5HESA 2B54A 3PRFA 3WIKA 2HW6A 2ZYBA 3P79A 5BVOA 3W0RA 1K9AA 3BPRA 1OL6A 4QQ5A 4FVQA 4U97A 5IEVA 5JGBA 4YZDA 3CQWA 5E9EA 4DH8A 2KTYA 2IW6A 4I5PA 1IA8A 4DAWA 4O0VA 1PMNA 3R7UA 3CJFA 4MYGA 5HVJA 4IFGA 2VNWA 3CXWA 4CFNA 2B9HA 2BCJA 3IOKA 2QOQA 2JIVA 3PXZA 1JPAA 3P23A 3RHKA 3TNPC 4R1VA 2VO6A 2OI4X 3FMHA 3HAVA 2P55A 3KRLA 3IKAA 4FKRA 4OTQA 3BEAA 3FMNA 4JLCA 3QD2B 4QPAA 1BL7A 4KS8A 2QG5A 3U8WA 3R71A 5BVFA 5E91A 1O6YA 5HORA 5EYMA 1A06A 2P0CA 1YHVA 4BI1A 5C01A 4YJUA 1WBSA 4ERWA 2Y4IB 2A27A 4GFGA 3OXTA 1WCCA 4ONAA 4DEEA 1DI8A 4DCAA 4PMMA 3VUGA 3QYZA 4HOKA 4JL9A 4YZNA 4GU9A 4AFEA 4WSYA 3NVMB 2QU6A 5FXSA 3V5TA 4R3RA 4EZ7A 1IG1A 3R2YA 2WTDA 4D58A 4OBOA 2UZNA 3PDTA 3C0GA 2OSCA 2RL5A 1PXLA 3F2RA 3HMNA 4HYHA 4GH2A 3R8PA 4ANMA 4CZUA 5CALA 1W8CA 1AGWA 4X21A 2VO3A 4W4WA 5KZ0A 4D5HA 4TZRA 1R3CA 3HUBA 3UGCA 3C5IA 3ZS5A 5DR6A 4KKHA 1FBNA 2C1BA 2UW5A 4DINA 3MGYA 4JOAA 5EK7A 5FQDC 5E8ZA 5A4LA 3MB6A 2FVDA 4FNXA 1KE6A 4RJ8A 3FMLA 5CQWA 4HPUE 1BI7A 1OIRA 2V62A 5AA9A 2GTMA 4EOLA 3PA5A 4MNEB 4I4EA 4NJDA 4NSTA 3OT8A 3MH2A 3NUAA 2IJMA 3UNZA 2QOFA 4MTAA 2YERA 4AFJA 2R3HA 3SOCA 3W55A 3LAUA 4MWIA 3HVCA 3UIUA 3GOPA 2BAKA 4PTGA 2CKQA 4NWMA 4OTIA 1R1WA 5J7HA 4CT2A 2OH0E 3PG1A 5EDPA 5CANA 1R78A 2XNPA 3DAKA 2R5TA 3EN9A 1PXPA 4GRBA 3DXQA 4O81A 4F6UA 2VO7A 4JNWA 4IJPA 4NM7A 3FMKA 5CENA 3RI1A 4DGOA 4GK4A 1WFCA 4IVCA 2UZLA 2G1TA 4KABA 5GIPE 2PMNX 3OTUA 5HNGA 2QO2A 2R3KA 3Q2JA 1Q99A 4CLJA 5KKRC 4FK6A 2C6DA 4KB8A 4E26A 3S1HA 3CGOA 1F0QA 3OY1A 4CXAA 5D1JA 4ID7A 4IZYA 2YHVA 4O7NA 4TYJA 5LOHA 2XK8A 3K5VA 2QU5A 4D28A 5CAVA 5HCYA 4FEVA 5CU6A 3BGPA 3QHWA 2PUIA 3MIAA 4HCTA 4DEIA 5ANIA 4BI0A 3E87A 4APCA 5D12A 2GNLA 3GFEA 3LFSA 2XCKA 1SZMA 2WXVA 4IB5A 4JQEA 4Y8DA 5DR2A 1KV2A 4FKLA 4EYMA 3JXWA 3D7ZA 4IACA 5FTQA 2XK7A 4RIOA 1B39A 4F1MA 4LRKA 3GCUA 4DG3E 3FZPA 2WZJA 4J8MA 5FEDA 4CGAA 4U98A 5FP5A 2R3RA 3KULA 3GU4A 3AC1A 4DYMA 3ANRA 5FM2A 3PA3A 2BZKB 2YJSA 4AOTA 2OW3A 4F9WA 3JYAA 2OF4A 3UOJA 5IA0A 3GVUA 4XG6A 3E64A 5L8LA 4R77A 2YITA 3F69A 1ZMUA 3C4WA 1XBBA 4EH6A 4TYHB 3ZU7A 3PPJA 4BYIA 4O0WA 2PZIA 4Z55A 3RM7A 3MH1A 3EN5A 3NNUA 2WTKC 4MNFA 4JAIA 5AP3A 5C4LA 3HL7A 1Q5KA 4JAJA 4AN9A 4C35A 2W9FB 5DYJA 2WMXA 5KHWA 4EOIA 2ZJWA 4IZ5A 3EH9A 5E8XA 3UMWA 2X9FA 2OZAA 1V1KA 3NS9A 2W7XA 4IM2A 1OBDA 3BKBA 3CQEA 5HG9A 1GIIA 3WF8A 4DT8A 4H05A 4CD0A 2Y4PA 5J1WA 4FV6A 4I6QA 4HGLA 5KMLA 2PVFA 1XHAA 4UY9A 5FTOA 5EM8A 1HCLA 3LOKA 2FH9A 5M4IA 3CQUA 3NYXA 4GU6A 1R39A 4M14A 4MX9A 1SMHA 2XJ2A 1KE7A 1DAWA 3CY3A 3FKLA 3R02A 4RGJA 5HICA 2AC3A 4CRLA 4EOSA 3CKXA 3ORXA 5FDPA 5HEZA 5DIAA 3AQVA 3SLSA 3QUEA 1WBVA 4C37A 4G1WA 4WOVA 2X7FA 1UWHA 4XG4A 5G6VA 4L52A 3AMAA 2QOIA 2W06A 3ORZA 5T68A 3ZRMA 2BFXA 4BTFA 1YKRA 4IW0A 4J96A 4CFWA 2OU7A 2R3PA 2C3JA 4PV0A 1FPUA 4GK2A 3ZO3A 4IEBA 4KIOA 1JKSA 3F6XA 4X2NA 3NAYA 4Y85A 3PP0A 5EW3A 5HE0A 3T3VA 3TXOA 1Q61A 1VEBA 2WOUA 4LG4A 4E4XA 5E8WA 3OFMA 5BUEA 1QCFA 5AM6A 1Z9XA 2F2UA 1UNLA 3QCQA 2IVVA 3EL7A 4EORA 1FGKA 2PHKA 3RPRA 2OKRA 5AUWA 3UVPA 4OT6A 3D94A 4MQ1A 3OF0A 2XJ1A 2WMBA 3VIDA 3FQHA 2XB7A 3G6HA 4LRJA 2B9JA 4KIPA 3V6RA 2PTKA 4QYEA 2A2AA 3WZEA 2WTIA 5KMKA 5IISA 1OPLA 3KXGA 4MWHA 2OK1A 2C3KA 3MVHA 4YPDA 2ZV9A 4EK6A 1TQMA 3ETAA 1TQPA 2OLCA 3G51A 4NM3A 1OKYA 3QXOA 3Q60A 2PVRA 3CD3A 4U42A 4ZSLA 4S30A 4I1ZA 2ZDTA 3MPTA 3QX4A 3TTJA 4RJ5A 3I0QA 2C0OA 3TUBA 4EBWA 4EOMA 3UVQA 3VS4A 2VWIA 4EK8A 3GCPA 2P4IA 2IZUA 2P2IA 1IR3A 1PW2A 4C62A 4RFZA 5M51A 5HI2A 4IVAA 3R8VA 2VWBA 4BTJA 2UUEA 4EOQA 3TNQB 2ITTA 4O7LA 4F08A 3DAEA 4W8DA 3EQPA 2PUUA 4FYNA 3SG9A 1S9JA 1XKKA 2BAJA 4O0YA 4B0GA 3I1AA 4ITHA 4EWQA 5HIBA 1Q8YA 3OP5A 2JFMA 4FV3A 4GFMA 4O22A 5HU9A 4IIRA 4YJQA 1PXKA 3M42A 3P7BA 5ANEA 4ZTQA 4I0TA 4BCJA 3UPXA 4DH5A 3GOKA 3PJCA 5HNIX 1UA2A 3A7GA 3AXWA 3GUBA 2WU7A 3EIDA 3A60A 5LVLA 2F4JA 3DPKA 3R8UA 5LVOA 3Q6UA 3HDNA 2OIQA 4AXAA 3QCYA 4QMYA 4PNIA 1UVRA 2OXXA 3ZO1A 4FT5A 2ZAZA 4RJ4A 4B99A 1A9UA 4FICA 3BRBA 1BUHA 2R3LA 2EXCX 3MV5A 4FIGA 2VTJA 4A9RA 3LXLA 5E90A 4DFZE 4L7SA 4UWBA 1GOLA 3KFAA 5HD7A 3TI1A 3V5LA 4P7EA 3ZOSA 4HVDA 1J3HA 1Q4LA 2X1NA 3VHKA 4ZY6A 4RZVA 1YWRA 4RPVA 4UBAA 5AP2A 4ASXA 4A4LA 3NUPA 4H1JA 5HBJA 3PWYA 2Y7JA 4Z16A 2XNNA 2XRWA 4JBQA 4TT7A 3U9CA 4O27B 3SHEA 4S2ZA 4M69B 3RPOA 4X0MA 3P1AA 4M97A 5HLNA 5IA4A 1IAHA 4ITJA 3MTFA 3HRFA 4OT5A 3A62A 2XJ0A 2V7OA 4FT3A 4ZZOA 3OOGA 4BVUA 4QQJA 2FA2A 3BHTA 4XG2A 2XMYA 5HBHA 3TWJA 3UODA 3SD0A 5DEYA 4H36A 1YWVA 2V22A 4KWPA 2B9FA 4E6DA 5I9XA 1ZAOA 3DJ7A 3FQEA 4Q9ZA 3C4ZA 4BTMA 2VTSA 4ALUA 1SVEA 3OY3A 3TYKA 4NFMA 4FV8A 2OIDA 3FY0A 5I9ZA 1F5QA 2I40A 3P5KA 2PVMA 3ZLWA 4Y72A 2PVNA 4YZBA 2PMLX 4QMLA 4EHZA 4OBQA 4K11A 4YLLA 2J0KA 3D15A 4FSQA 3D14A 3DB8A 4JDKA 4QNAA 2KULA 3SXRA 1Y91A 2F7EE 4QYFA 2XVDA 4XX9A 3R8LA 5HE1A 3TKHA 3O2MA 3MESA 4D4RA 3OT3A 5DT3A 1XBAA 1YDSE 5DG5A 3L8XA 3N51A 5CI6A 3QQHA 5F4NA 2X6EA 3U87A 4EK5A 4IAFA 1KE5A 1GIJA 2EB3A 3ORIA 2FSLX 4J1RA 5IQEA 2ERKA 3POZA 1FMKA 4IC8A 4V04A 4ZIMA 4XUFA 4K2RA 2C1AA 2DS1A 2QURA 1ERKA 5CYIA 3COIA 3UOKA 3ZFXA 1XH7A 5HU3A 2W17A 4AT5A 5JRQA 1NVQA 2B1PA 3PE2A 5CSHA 3WE4A 4ZS0A 2R9SA 1LP4A 2IPXA 2C5NA 3D83A 3QYWA 4JBVA 3BQCA 4AWIA 2XIKA 4BGGA 4E7WA 3KXXA 1OIYA 1ATPE 4MXZA 2C68A 4EZ5A 2WTKB 3LJ0A 3QRKA 4H3QA 4MD7E 3I6UA 2XIZA 4X3FC 2ITVA 3NYOA 4HYUA 1J1BA 3DFCB 1NA7A 2XBAA 2PL0A 2W5HA 3F3WA 4YP8A 3MJ1A 2XKFA 5CXZA 5M4FA 2FSTX 2VWUA 3I7CA 5K3YA 3JVRA 4I23A 2P33A 3F88A 4TWOA 4GK3A 2ONLA 1RQQA 2HCKA 3ORNA 5IQIA 3W18A 3UPZA 3FC2A 4O82A 4RWLA 3HKOA 4BDEA 4DGMA 3QX2A 4MXAA 4QP9A 4TKSA 3VAPA 4C38A 1PYXA 3PZEA 1WMKA 2CNVA 5DGZA 5AA8A 4WO5A 3IGOA 2QO9A 2UV2A 2QHMA 3IK3A 4A4XA 3FZTA 3S00A 2CNQA 2WQBA 4LI5A 4D5KA 3E7OA 5LMAA 3T9IA 5LMKC 3KMUA 4NCTC 5DEWA 1V0OA 4C4GA 4AGWA 2ZV2A 3DBEA 3FKOA 3DY7A 3BV3A 4Q2AA 4DN5A 4E1ZA 4FUYA 5KMJA 4O7PA 3W2CA 4ZLYA 3BI6A 2JIUA 3Q6WA 3UO4A 3TZMA 3ZDUA 4M84A 3PJ1A 2PMIA 5IEXA 1FVTA 3M1SA 4D9UA 3W0NA 4LL5A 4EHVA 2BRGA 3WF9A 3H4JA 1REJA 3GU5A 3R01A 2CHLA 3IW4A 5CI7A 4AT4A 4FX3A 5EM6A 5I0BA 1XBCA 3D2IA 2X8IA 3OROA 4PMTA 3QL8A 5CLPA 4BHNA 4BZNA 4EI4A 1OVEA 3MA3A 3ZLXA 4ANSA 1T46A 4XV1A 4IZAA 4FSTA 1PXNA 5DVRA 4C36A 4C0TA 3PUPA 4MVFA 3A7JA 3PXYA 4GIIA 4XBRA 5EFQA 5TT7A 3Q52A 1GNGA 5EKNA 3OWLA 4GUBA 4TYHA 2XKDA 1SVGA 3OVVA 3ZM9A 3F2AA 4GG5A 4NIFB 5BUJA 3U6IA 2X4ZA 2YA9A 4ZOGA 3LCSA 3TM0A 1OZ1A 5E7RA 1Y8GA 4MBJA 3KXNA 4DEGA 3ALOA 5AMNA 4YBJA 1KUTA 4U0IA 5EDRA 4RA4A 4IX5A 1OECA 3HDMA 4FV5A 3VBXA 2PZ5A 5CF5A 3LFEA 3MB7A 4BDIA 4BGHA 3A8WA 4FSWA 4R3PA 4ZLOA 5EI8A 3PJ8A 4FSZA 3C4XA 2CKPA 4B8MA 3QQLA 5GINE 2PYWA 3R22A 3I6WA 4DG0E 3LCOA 4D55A 4ANQA 2WTVA 2BROA 3BGZA 2BKKA 2QLUA 3R1QA 3NCZA 5CSVA 3MS9A 1G8SA 2XP2A 4RWJA 1CM8A 4FZFB 4G2FA 5B2KA 5D41A 1PMEA 4CLIA 1YXVA 3OWKA 3VS2A 4GVJA 3KVWA 2YM7A 3TZ8A 1I44A 2H8HA 5AP5A 3ZO4A 1STCE 2WMRA 3POOA 2J0LA 3VUIA 4WRGA 3D5VA 5BNJA 3CS9A 3PPKA 3OWJA 4RX7A 3LQ3A 2C6IA 3KK8A 3GC0A 3A61A 3LFAA 3NNXA 5HO7A 2X6DA 2JKMA 2J90A 3IW8A 4G31A 2WD1A 5BQ0A 4IVBA 4ACMA 3QUDA 3HEGA 3F3VA 3V01A 3FYJX 2IW8A 3ZEWA 3MBLA 2PU8A 4YNOA 2WTJA 3P7AA 4RIYB 4C4EA 3D4QA 3AMYA 5A6NA 2QNJA 3BEGA 4XEYA 4YLKA 4BCHA 3EYHA 2VU3A 4U40A 4WNPA 4AZWA 3PA4A 5E8TA 1XR1A 1J91A 5KE0A 2ZV8A 4Y73A 3CD8A 4HNFA 1YWNA 5FP6A 5IA5A 4B6LA 3UDBA 2C3LA 3QRUA 4GYGA 2XK3A 3QA0A 3UE4A 4FV9A 2ITXA 4MD8E 1URCA 2YN8A 2QKWB 3D0EA 3JUHA 2Y0AA 3HYHA 2WKMA 5TKDA 3OS3A 5AIKA 3GQLA 2WQNA 3ZTXA 1IRKA 4DEHA 4EUTA 3CJGA 2WTCA 3NNWA 4PL3A 5E92A 4FKWA 2QO7A 4I6FA 2GHLA 3IPHA 4QMSA 1EH4A 3PJ3A 4J71A 4EH3A 4IDVA 3E93A 4G6LA 3PXQA 3WBLA 4RIWB 3LQ8A 3KCFA 4IB3A 2X2LA 2W1DA 4QMVA 2J51A 4R78A 4W4VA 3OXIA 3V5JA 4USEA 1YDRE 5E8UA 5JEBA 3I81A 4UB7A 2FSMX 4DFBA 2AC5A 3COKA 4GEOA 4XG9A 5GJDA 4AN3A 2XYUA 5ICPA 3RAHA 4BIEA 4YUQA 3F66A 2W4OA 4NTTA 3S3IA 3PP1A 3UC4A 3M11A 3W16A 4OLIA 3CR0A 5IU2A 2XIRA 2R3OA 2HXLA 3O8PA 2AYPA 2WQOA 3BBTB 4AN2A 5HX6A 1JLUE 3LPBA 3VO3A 1O9UA 3BU3A 2JBPA 2OGVA 5JGDA 4FTTA 1A48A 2WEVA 5D10A 1MRYA 4ZAUA 3UQFA 2WO6A 5HG8A 2BRHA 4BDKA 5A4EA 2CSNA 4TL0A 5AEPA 3RHXA 3KN6A 2PVLA 3W2RA 1H26A 3W0OA 5M53A 4FKJA 5K5NA 3FXXA 3VC4A 3PIXA 4IB0A 1H1SA 3WI6A 2JLDA 3BYSA 4EQUA 1OIUA 3QD3A 4A9UA 4YHTA 2HK5A 3EFKA 4M0YA 5BMSA 4O2ZA 2HY81 4CMOA 3QC4A 4FYOA 3QAME 3ZXTA 4DTAA 1F3MC 2WNTA 4C59A 1KV1A 4FKPA 4F7NA 3R9NA 1OL1A 3C1XA 4FBXA 4C4FA 2P2HA 3KXZA 5F9EA 1J7LA 2W1FA 3TZ9A 4RIXB 4ZMFA 5JZJA 5K9IA 4G17A 4C61A 3HP2A 1DS5A 2OJJA 3CPBA 1NVSA 1JKTA 3R8ZA 4KKGA 4F0IA 1OGUA 4PMSA 2VTNA 3DAJA 5IMEA 3BWJA 4WBBB 3VW6A 1TKIA 5FBOA 2O2UA 4AOIA 3BU5A 1U54B 3CEKA 5KX8A 4EEVA 2QR8A 2GMXA 2RKUA 3BQRA 3PSBA 5JFWA 4L8MA 4IB1A 1JSVA 3QCXA 5BMMA 3R7EA 2UVXA 1V0BA 3JY0A 2CCHA 2XIXA 2V0DA 1W98A 4YSJA 4EBVA 2R3JA 2QOBA 3LFCA 3MFRA 4BZDA 3Q04A 4YU2A 3QZGA 2PE1A 5C9CA 2XF0A 1SYKA 4GJ3A 5JGAA 3EWHA 3TJCA 2I7QA 3R2BA 2R3IA 4BY9E 4GW8A 3Q4TA 1E1XA 1PKDA 3JY9A 3DGKA 2VWWA 4FIHA 3KF4A 4AUAA 2C0TA 4IMYA 4FA2A 3GU8A 4DEDA 1QPCA 3G2FA 4YNEA 2WGJA 3CTQA 5HO8A 4CFVA 4XV2A 4CCBA 3F5UA 2A19B 2BDFA 3VS1A 4E93A 5ANDA 4FKTA 4C2WA 2GDOA 2PY3A 3ZRLA 2B53A 3TKIA 2F57A 3OBJA 3EQDA 5IG1A 2Z60A 4GUEA 5IH6A 5J5SA 1P4FA 5L2TA 3EN7A 3RVGA 5CSWA 4UALA 4WG5A 4A4OA 3F7ZA 3OEZA 5BYLA 1KOAA 2WOTA 3H0YA 2OICA 3F5GA 3FBVA 4GSBA 2QI8A 4NW6A 5CQUA 5M08A 1LUFA 3VF9A 4DFUA 5CAUA 3BBWA 3RKBA 1R0EA 5FUTA 4LL0A 1B38A 3MN3A 4NT4A 4IFCA 1H08A 5HCZA 4FKUA 2GQSA 1O6KA 3BLQA 4FNZA 1ZYCA 4FTOA 4MKCA 1BMKA 3ULZA 4ZSEA 4BCPA 4O91A 4FV7A 4DBNA 4BB4A 5A54A 2YAAA 2OWBA 3OD6X 3DCVA 2Z7RA 4JRVA 4BCIA 1H0VA 3KY2A 3ZC6A 4Q5HA 5CTPA 3BYMA 3QTUA 4M7IA 4CFMA 4NK9A 5M07A 4QTBA 4F7LA 1P2AA 3QQUA 4R7HA 4UWCA 5ITAA 1GIHA 3U4WA 3MJ2A 5H3QA 3TDWA 3EQRA 3S4QA 5EI6A 2VN9A 2IVTA 3ZMMA 3QUPA 3ROYA 5CNNA 3AGLA 5J95A 1VZOA 4EKKA 3BU6A 3E8EA 2OG8A 5IF1A 5F20A 3QGWA 1YXUA 4MF1A 2W1IA 3P86A 2XS0A 4FSRA 2Y8OA 5L6OA 3L8SA 4YTCA 1VYZA 4G3FA 4XG3A 4YPSA 2HZ4A 4AOJA 1S9IA 1LR4A 5DN3A 2VX3A 5A4QA 2UW9A 2HENA 3WYXA 2ZB1A 2C5VA 4HGEA 3SX9A 1MQ4A 4M3QA 4AAAA 4BN1A 3MDYA 4CRSA 1JKKA 2XRUA 1PJKA 4PMPA 4J97A 5K5XA 3UZPA 4D2RA 3HECA 3IS5A 2YZAA 4FGBA 2UW7A 4HGTA 1RJBA 4ALVA 4E73A 4CKRA 2GS2A 3D2KA 4FSUA 4N70A 2UVZA 5C27A 1YI3A 4MEDA 4QP4A 4Y46A 2UVYA 5KZIA 2R4BA 1QMZA 1ZZLA 3DDQA 3E92A 3UP7A 1SNXA 3KRJA 2YM3A 3LCKA 2CLXA 3FDNA 3FWQA 3MFTA 3LLTA 1JKLA 2XNMA 5E8SA 4ZY5A 5JFVA 4ZY4A 4GV1A 4FVRA 4ASEA 4FSYA 4C7TA 4FKQA 4RJ6A 4CG9A 4LOQA 2B9IA 2BHHA 4WG3A 1Y8YA 4UYAA 2VD5A 1YOMA 3DTCA 4F7SA 3PZHA 4FTKA 2P3GX 4XNEA 2IG7A 4XRJA 5CY3A 4CV9A 3PPZA 4O7ZA 1PRYA 5ETCA 4EYJA 3W32A 3O23A 4ZJJA 4G34A 4AS0A 3M2WA 4QMQA 4UV0A 3AG9A 2C47A 5ETAA 5J8IA 4IDTA 3NZ0A 1JOWB 2YAKA 1TVOA 4ZLZA 4J8NA 1Z57A 1ZY5A 3MY0A 3QC9A 4BF2A 2UW4A 4YJOA 3SOAA 2VTAA 3KREA 1PMUA 3CTHA 3P4KA 4DH3A 1V0PA 1H0WA 2GHMA 1ZOEA 3A8XA 4DEBA 1YHSA 5AFVA 4E6CA 5AV4A 5CEOA 3HV6A 5J9ZA 3GFWA 3L8VA 3QHRA 4FTMA 2X0GA 1M17A 3DBFA 4FIFA 1JWHA 3R0TA 4LMNA 4AGCA 2O64A 4YC8A 3VBVA 2ACXA 4LV5A 4E4LA 3DBQA 5KMOA 5EOLA 5IQFA 3DLSA 3HUCA 1UU8A 4DTBA 5EDQA 1H07A 3FY2A 4USFA 2ITWA 1GZNA 3UIXA 4FSNA 4RBLA 3IW5A 3RGFA 3R7YA 3TCPA 3L1SA 3Q53A 4LFIA 1JSTA 3GC8A 4RQKA 4WUAA 4FIEA 2VTMA 3WZDA 3CE3A 4TWNA 4AG8A 5IQCA 4FKIA 4ZSJA 5J9YA 3QZHA 3LQ5A 1M2QA 2Q0BA 2IWIA 3SV0A 5AWMA 3HGKA 1VYWA 2OIBA 3I60A 3RAKA 4O86A 2O0UA 3L9PA 4D1XA 2BHEA 4RC3A 2VTQA 4F1OA 4OTHA 5JQ8A 5L2SA 3R30A 3QD4A 2JKKA 1IASA 1UKHA 4XLVA 3NW7A 4LMUA 4DFNA 5CAOA 3AT3A 1Y6AA 3W0QA 2QOHA 4QP1A 5JFXA 3QLFA 4Y83A 4Z7HA 3ERKA 2F49A 3K54A 4JBPA 3C5UA 4I5HA 4WIHA 1YDTE 4H1MA 3UMXA 2BMCA 1H8FA 2X4FA 2WQEA 4HYSA 4OGRA 2X9EA 4AP7A 4W8EA 4FZAB 4E5WA 3E3PA 4FKGA 2R7IA 1UKIA 4RIWA 4WNOA 2JFLA 3KVXA 4F09A 4DFXE 3D5XA 1IAJA 3HAMA 2B7AA 2WMVA 3BHUA 3VJOA 5I9WA 3UZTA 1YOLA 3UQCA 4DE4A 2GNIA 4I0SA 4FT0A 4LGGA 1OBGA 4P90A 4N57A 3LMHA 4K0YA 1ZWSA 3L9NA 4X2JA 2EU9A 4F0GA 2QQ7A 1KE9A 2XM8A 3B8RA 2YDKA 4GMYA 4U80A 4V05A 3ODZX 3DQWA 5AAFA 5AAEA 1ZMVA 2WB8A 3GB2A 4F9BA 3IOPA 3I5NA 3QBNA 1TQIA 1M7QA 4GCJA 4MCVA 3R9OA 3CLYA 2OJIA 1XJDA 5KO1A 4DFLA 5A4TA 3OBGA 2C4GA 3QTWA 5IA3A 5T3QA 3RNIA 4X3FA 3VQUA 4V01A 4DEAA 4BDCA 4RA5A 3UNJA 2Q0NA 1NT2A 1L8TA 4P2KA 4UYNA 4HVGA 4QPSA 4YC3A 3ZDIA 1W7HA 3TACA 4X6QC 4G3EA 3UZRA 4PDOA 3W2QA 1KWPA 5CT0A 5B2MA 1YRPA 5HZNA 4CKJA 5KMMA 2OJ9A 5EOBA 2VUWA 4RIXA 4BDAA 3R6XA 2E9PA 4IX4A 4O0XA 4YJPA 2CN8A 5CF8A 3AC4A 4ENYA 3SC1A 4HPTE 2PZPA 3OUNB 2CDZA 2VWVA 5D11A 2EVAA 3O7LB 5HIDA 1KSWA 4XOYA 1U54A 2W99B 2VO0A 4JDHA 3WZUA 5LMKA 4PWNA 4NCTA 3AMBA 1PF8A 4L3LA 3VW8A 5F94A 4G3GA 3P9JA 3NLBA 4U6RA 3FLZA 4C33A 5CU0A 4YTIA 4I6HA 2RF9A 4Q5EA 3VS7A 3PSCA 2REIA 2UZWE 4RSSA 2ESMA 3S95A 3LCTA 3U55A 3ZSGA 4AACA 3OW4A 1Y57A 4NFNA 4HNIA 3E8CA 5AUTA 2GS7A 3ZSHA 4GVAA 4RZWA 3AGMA 4PL4A 1WBWA 3GBZA 3WOWA 1FGIA 4BIDA 2C5OA 4GS6A 2QCSA 4TXCA 4BYJA 5GIOE 4FEWA 4ZEGA 4HW7A 3GCQA 5M44A 5ANOA 3R9DA 3WF6A 1OL7A 4Z7GA 4X3JA 3FLWA 2QD9A 3EN6A 3GT8A 5BVKA 3L9LA 3SGCA 4FTRA 4PP9A 3SQQA 5HX8A 4YZ9A 4BDFA 1QL6A 4A9YA 3E62A 2JIIA 5FRIA 4II5A 4CSVA 3W33A 5B7VA 5BUIA 1H1QA 1E9HA 5CSXA 3B2TA 4A7CA 3G0EA 4V0GB 5I9YA 2Y6MA 3NUSA 4FUXA 4AA4A 2RFDA 3PSDA 4YJSA 5E8YA 2BRNA 4G5PA 3R7VA 3QTZA 5F1ZA 3B8QA 3F9NA 3FPQA 2SRCA 4FTJA 3DDPA 4FODA 3TV7A 4RFYA 3ZEPA 3PXRA 2CN5A 4WHZA 3ZUUA 4C2VA 3GENA 4OTGA 2B0QA 3D5UA 1H1WA 5M06A 3NGAA 3QXPA 2WIPA 4DH1A 5CT7A 2ITUA 4BCFA 1PXOA 4PDSA 2VWYA 3BYVA 1Q62A 3ZBFA 3EJ1A 4IJ9A 3UOHA 2ZOQA 4FTCA 3MSSA 4ZXTA 3VNTA 5LWNA 5IUGA 2G2FA 2YCSA 2I0VA 1ZYDA 4FT9A 5AAGA 5EW9A 3QALE 4MNEA 3SVVA 3UG2A 5BVWA 2PUPA 2GPHA 2PVJA 3FI8A 3RALA 4I93A 3FV8A 4F65A 3R8MA 2VTTA 3QCSA 1G3NA 2BPMA 2FYSA 3OG7A 4MQ2A 3W2PA 2OBJA 3IW7A 3LVPA 4AZEA 3KQ7A 5FG8A 4KBAA 4GFOA 1H27A 1ZYSA 5CS6A 4ACGA 4CV8A 2CGWA 1Q3DA 2V5QA 1JNKA 2IVUA 3PLAE 4AW0A 4BCGA 3HZTA 3DXPA 4N6YA 4QTAA 4QQTA 3R04A 5IQBA 3ORLA 3PE1A 4A9TA 3C9WA 4BCMA 4ASZA 4L67A 3AD5A 5AUZA 1IA9A 3DT1A 3RPYA 5KCVA 3KCKA 5LVMA 3TV4A 3F82A 4G6OA 2GNHA 3P0MA 4FK3A 3S0OA 4ZZNA 2HELA 4IX3A 4YZMA 2F2CB 5HVYA 3FLQA 3DOGA 4RWIA 4QMNA 2UZDA 4H3BA 5IUIA 2X81A 4BBEA 4E6QA 4CEGA 4DLIA 4AA5A 3G15A 4M13A 5B2LA 3TTIA 5DT4A 5M56A 4M8TA 2PVYA 3TNHA 5LCKA 2JKQA 4GT3A 4NJ3A 5CVHA 4Z9LA 4WD5A 3SAYA 3VWAA 3E5AA 1H01A 3EFLA 5JZNA 2G15A 4KNBA 3PG3A 3OCTA 3VQHA 3LMIA 2CKEA 4EH2A 3VUMA 3ORMA 1CMKE 2YCFA 4OTDA 5KBRA 3FMDA 4LGHA 3RK7A 2C6EA 4D4VA 3V8TA 2BIKB 2BRBA 3ROCA 2A1AB 2GCDA 3DLZA 4AGUA 2BALA 3GU7A 4I92A 2ZM1A 3O50A 2ITYA 4YURA 5HD4A 2O63A 2W1EA 3Q5IA 2C6OA 2C69A 3TIYA 4APPA 5BVNA 3W0PA 2RFEA 3C51A 4AW5A 4N4SA 4ZTHA 5E4HA 5LXMA 3V04A 3CY2A 2GNGA 3HV5A 3MH0A 4PDPA 4BCOA 5HE3A 2BTSA 3WF7A 2BVAA 4EH5A 3IGGA 5GJFA 5HHWA 1ND4A 3BE2A 5C4KA 3EQFA 1UV5A 2X39A 3KGAA 3R1SA 5KHXA 3U51A 4QRCA 4WKQA 4CZTA 3QWJA 4O84A 5DRDA 1OM1A 3DFAA 4FEUA 4FSMA 2EUFB 4K8AA 3WE8A 2Z7QA 2OJGA 3H9OA 3GI3A 4AT3A 1MP8A 3NMUF 5JRSA 1W84A 3DA6A 5TR6A 3V51A 4QP2A 5HCXA 2YIYA 4FV0A 4L43A 3OTVA 4QOXA 2JDOA 4E5AX 2OJFE 3TV6A 2WMTA 4FC0A 3W10A 4RWKA 4TYGA 1X8BA 2C5XA 4XP2A 4F63A 1WBPA 3SW4A 2NRYA 3HX4A 3LXKA 3VS0A 2NP8A 2VNYA 3FL4A 3O7LD 3RAIA 1OUYA 3SG8A 3DBCA 4P5ZA 2IW9A 4I24A 4O7RA 4P5QA 2GTNA 2WEIA 3D7TB 3RINA 5H2UA 4ORKA 4F0FA 4OTWA 5EYCA 3EZVA 2WMSA 4EC8A 5L6PA 3TG1A 4GKIA 4IE9A 4QP7A 3LKMA 3R63A 4FG9A 2V7AA 4O0RA 3ALNA 3C4FA 3FSFA 3GXLA 4JR3A 5CASA 3GU6A 1P5EA 3IW6A 3LIJA 3W8QA 3AD4A 3BIZA 5EQEA 3V3VA 2W1HA 2YIRA 3A7IA 2UZTA 4I20A 3E88A 3FMMA 4EKLA 3L9MA 1FMOE 4ZJIA 2NPQA 5DWRA 2UW0A 5A4CA 4J99A 4FOBA 5ANKA 3EHAA 2WU6A 4ZTLA 3DK7A 1RDQE 5HNBA 1M14A 3A4PA 2YACA 2EWAA 4DF3A 3FC1X 3CCNA 3NW5A 3QTIA 3G5DA 5TF9A 3A7FA 1PMVA 2ETRA 2GFSA 3PY0A 2RGPA 4YMJA 3NUUA 1LEWA 1Q8UA 3NIEA 5HGIA 2W05A 3MVLA 5A46A 4BBMA 1Q8TA 1PXJA 5HE2A 1DM2A 4DGNA 4F70A 3MFUA 4PTEA 2HZNA 3QRIA 2WQMA 1M2RA 2XCHA 4EJ7A 3ATSA 4O83A 3W2OA 2BKZA 3TT0A 3PY1A 3TEIA 1QPDA 3PY3A 4RG0A 4XV9A 3LM0A 1HCKA 2OZAB 4YTFA 5E8VA 1OIQA 3L8PA 4GYIA 1MRUA 5A3XA 3P08A 4NW5A 3II5A 4M15A 4USDA 5BPYA 2YM4A 5IEYA 2A0CX 2DUVA 1WVYA 2JDSA 2BZIB 3HV7A 2LGCA 5ETFA 2XA4A 3R28A 5IA1A 1GY3A 4LRMA 3UC3A 4O0UA 2VTPA 4ZTSA 4QTEA 3QTRA 3H0ZA 3HMOA 3PIZA 2H96A 2XK9A 3LE6A 4ZSAA 5IDPA 3DK3A 2I0YA 4DHFA 5ACBC
chains in the Genus database with same CATH superfamily
3VUDA 3QQFA 5EI2A 3SW7A 4CMUA 4YSMA 1PXIA 3A4OX 4RVKA 3DU8A 4U9AA 5CZHA 4ALWA 2I0EA 3Q9WA 4EK4A 3QTQA 2WAJA 4B8LA 3PRIA 3D9VA 3FI4A 3C4CA 2VZ6A 3AKKA 4IAYA 4LOPA 4O6EA 5CAQA 3HV4A 2ITPA 3FHIA 3OC1A 5J9LA 3I79A 4FGRA 2C6MA 4K18A 3AC8A 3AT2A 4EH8A 5E1SA 4A9SA 4IH8A 2C30A 3EB0A 2XKCA 2B55A 4PY1A 4XCUA 3KC3A 5CU2A 4YJNA 3NW6A 3IG7A 4L44A 3IDPA 3RK9A 5BX0A 3KEXA 2J5EA 5AP6A 2R64A 3ORKA 4EONA 3F5PA 4C34A 2HYYA 2IO6A 2FGIA 5AIRA 2VGOA 2UZVA 5AP0A 1GAGA 4GT4A 5K4JA 4BI2A 3MTLA 3NRMA 4IZ7A 5H9BA 5M55A 2ITQA 3VF8A 2QOOA 2GS6A 4KAOA 4H3PA 3KF7A 4IAAA 4NZWB 1JSUA 4NM0A 4GJ2A 3FZSA 4NTSA 3OEFX 4KSPA 3KA0A 4XS2A 2VWZA 1VLRA 4AZTA 1RW8A 4FV4A 3N4UA 3KB7A 4KS7A 3QF9A 2HIWA 3DZQA 4FKOA 4F4PA 4H39A 3BE9A 2YIQA 4C3RA 3NR9A 3V5WA 4KKEA 4IQ6A 4IWQA 5EQPA 5CF6A 4XLIA 2XNOA 3EMGA 1UU7A 4KIQA 5BVEA 2AUHA 4F1TA 3AOXA 3R21A 5JFSA 4QTDA 4AQKA 3DBDA 4C3FA 5CVGA 2JDTA 3TKUA 4YZCA 4GG7A 4FNWA 5AP7A 2ITOA 4HVSA 2PMOX 2E9UA 3NDMA 4FTUA 4QYHA 4XOZA 2YJRA 2FSOX 4IAZA 3PXFA 4ANLA 4RQVA 1VR2A 1ZRZA 4LV8A 3NUXA 3OW3A 4DGGA 5JN2A 5M57A 4JI9A 2UZOA 2HZ0A 1VJYA 4ERKA 1WVXA 1H00A 3O51A 1YXXA 2Y6OA 2W4JA 3FZOA 4O7SA 3QKLA 3UIMA 5LQFA 3W1FA 2JGZA 3LFQA 4U81A 4XRLA 2BRMA 4U45A 4V0GA 4C4HA 4EHEA 4C4IA 3EFWA 2F9GA 3JR1A 3CKWA 4RJ3A 1OPJA 1ZZ2A 5AV2A 4DBXA 3ZH8A 5KBQA 5AM7A 1OPKA 2R0UA 3F3UA 3HMMA 3R7IA 3Q2MA 5AV1A 5M4UA 5CU3A 2W1GA 3I5ZA 3QKKA 3QQKA 5A9UA 2GU8A 3TUDA 3K3IA 2R3FA 3Q96A 4P4CA 3FSKA 5LMBA 3LLAA 2DYLA 2CMWA 4EOOA 2QODA 5IUHA 5CX9A 5FDXA 2XYNA 3BHVA 3UYTA 3NUYA 5KMIA 1WZYA 3CC6A 3MH3A 4IVDA 4D0XA 4PNKA 3QQGA 4PDYA 4YO6A 5FEQA 3ZRKA 3W0MA 3E8NA 3FL5A 3PVGA 3KL8A 5EHOA 4HVHA 3DKCA 3DK6A 5AP1A 5CSPA 5BYYA 2HAKA 1I09A 1REKA 3GC9A 4U44A 3VRYA 3VBWA 3CGFA 3JPVA 4E8AA 1CKIA 2W1CA 4D0WA 4Y5QA 3U6HA 4NU1A 3FI3A 4F6WA 4QTCA 3QKMA 4M68A 3EKNA 4TW9A 4M0ZA 4OTRA 3KKVA 3PFQA 2BDWA 5H8GA 2I6LA 2UZEA 1SNUA 1P4OA 1U4DA 4R5SA 1ZMWA 3KRWA 3OUKA 4WZYA 3G0FA 1H28A 4RRVA 5FD2A 5H8BA 2BAQA 2RG6A 3BHHA 3NAXA 4X2KA 4HZRA 5AV3A 4BCQA 5DA3A 3WF5A 4E5BA 2RG5A 3FQSA 2JDVA 4BZOA 2F7XE 3KMMA 2WIHA 4I94A 4JX3A 3IO7A 1M52A 2QVSE 5D7AA 1KE8A 3RPVA 4YO4A 4O7OA 2CCIA 3WARA 3QQJA 4EL9A 2XIYA 1CSNA 3QTXA 3EQBA 2WPAA 4BKJA 3F5XA 3JS2A 2J0IA 4IADA 5C26A 1ZY4A 3FKNA 3ET7A 3DTWA 3NVKI 1K3AA 4G16A 5TO8A 3QRJA 4QP3A 5EYDA 3LFFA 4UXQA 3R9HA 5AJQA 3ODYX 4JIKA 3R9RA 4U94A 3ZFYA 2WMWA 3ZM4A 3KRXA 2IZTA 4K9YA 5CU4A 3RCDA 1G8AA 5D9HA 5J1VA 2YCQA 4EK3A 2CJMA 4JBOA 4TPTA 4JRNA 4I5MA 3UNKA 4XG7A 1ZARA 1M7NA 3CBLA 3IECA 3Q5ZA 4N6ZA 4X2GA 5HG7A 1NW1A 4YJTA 3SRVB 1TFFA 5AUUA 4LUDA 4G3CA 4I22A 4R5YA 4IWOA 4TNBA 5DH3A 3TDVA 3H10A 5IZFA 3U54A 2XEYA 4ZTRA 3BGQA 2F7ZE 3NCGA 4NL0A 1U59A 2ZDUA 3Q32A 4JDIA 2YM8A 4QT1A 4EOJA 2BDJA 4LOOA 3G6GA 2VGPA 2ZM4A 3Q3BA 4J52A 1OL5A 4X6RA 1PXMA 4U3ZA 5CVFA 2R0IA 2YEXA 5JT2A 2PE2A 1ZXEA 4JIAA 5EG3A 1FOTA 4EH4A 3C0IA 2ZV7A 3ATTA 2Z2WA 2CGUA 2YCRA 4AU8A 4ANBA 4JX7A 3NUNA 2VTOA 3PWDA 5JK3A 2Y9QA 2GQGA 4XBUA 4I41A 4QYYA 2E9VA 3HRBA 5L2IA 4RVLA 2YDIA 3F61A 3PTGA 4ZP5A 4M67A 3VRZA 3MVJA 2DWBA 3O96A 3WIGA 4S31A 3ZUTA 3OMVA 3MY5A 3O71A 3MPAA 5HLWA 2XNEA 3DNEA 4L42A 3AKJA 4FTQA 2O3PA 3ACJA 3ORPA 4GIHA 2BFYA 3W8LA 3DKOA 4EZ3A 5ACKA 1OKVA 2VAGA 3Q9XA 3JVSA 3RTPA 4CKIA 3PJ2A 4K33A 3UJGA 4BGQA 4K77A 2QC6A 3FEGA 2OFVA 4UWYA 5HKMA 4O96A 4QQCA 3D7TA 3W2SA 4JVGA 1QPEA 4L9IA 4O7YA 1ZOHA 2NYAA 3I4BA 4BICA 4X7QA 2PSQA 2J4ZA 3AD6A 4XJ0A 4YJRA 2HXQA 2WMAA 3Q4CA 3E3BX 4K1BA 4EQMA 5IQHA 2W96B 2PWLA 2HW7A 3FMJA 4I3ZA 4HGSA 4L6QA 2RIOA 4C58A 3VJNA 3HA6A 5DBXA 3FXWA 3K5UA 4WNMA 4BRXA 4DG2E 3RPSA 3OXZA 2UW3A 3ZFMA 4TWPA 4QP6A 3ZLSA 2E9OA 4Q9SA 4U79A 3GCVA 2ZB0A 1MRVA 2PZRA 1DAYA 4BHZA 3ZCLA 1XH6A 3Q4UA 4QMUA 1J7IA 2J5FA 3A99A 4UEUA 1JQHA 2QG7A 3LXPA 3TUCA 1WBTA 1NY3A 1XH5A 5L3AA 5JH6A 2BZHB 2CKOA 3F3TA 2OO8X 1J7UA 3C13A 3QFVA 5I5ZA 5L8KA 3QA8A 3CP9A 4RIYA 3B2WA 4XHKB 4BC6A 1YI6A 2XNBA 4YHFA 4OTFA 4JDJA 3VS5A 5CZIA 3FXZA 3AT4A 4HCVA 4LM5A 2NO3A 2XK6A 2C6LA 3QD0A 4ACCA 4RC2A 2UZUE 3G90X 2YM6A 2PK9A 3LFNA 4FTLA 4WG4A 4MHAA 3KU2A 1BI8A 3R1YA 4L53A 3EL8A 4N0SA 3ELJA 2X7OA 1XH4A 3LJ1A 3G9LX 5IH5A 3RWQA 3FI2A 1OKZA 2IN6A 4CFFA 3IQ7A 5DLSA 2J9MA 5AV0A 4CQEA 4HVIA 3GEQA 4FT7A 3TZ7A 2EB2A 4FV1A 2B4SB 4F64A 3EQGA 4MXOA 3OZ6A 5F95A 5FM3A 3BZ3A 3GC7A 2QOCA 3ENMA 3LM5A 5EW8A 3VS3A 4E6AA 4XH6A 3ULIA 2QLQA 1YW2A 5EHYA 3FLYA 4FVPA 1PKGA 4TYIA 3ZZWA 2C5YA 3C0HA 4LQMA 3V6SA 3UO6A 2JAMA 3WILA 3Q4ZA 1AD5A 4KBKA 2JAVA 2QOLA 4OUCA 4U43A 5C03A 2O5KA 3NIZA 1JVPP 4HCUA 5LVPA 5CEMA 4QNYA 4ZZMA 5EYKA 3EYGA 2WMUA 2GSFA 2W9ZB 3DS6A 4OR5A 2W5AA 2LAVA 4E20A 1OMWA 3IDCA 5JQ5A 4ZJVA 4RC4A 5FXQA 2C0IA 2ERZE 2VTRA 4O0SA 4BDDA 2QONA 5AP4A 2O8YA 4J53A 4WNKA 4CG8A 3EKKA 4G3DA 4TNDA 3ZO2A 1ZLTA 3COHA 3W0SA 4ZTMA 3ZLYA 4KRDA 1T45A 3A7HA 3PVBA 1H24A 2J50A 4R3CA 1XWSA 4UXLA 5FTGA 5M09A 4MAOA 3GQIA 3KRRA 4HZSA 3PYYA 4QYGA 4FTNA 1XH9A 2J0JA 3SXFA 3EFJA 3UIBA 4BR3A 2YISA 2OF2A 2EXMA 4L45A 1DI9A 4CT1A 4AA0A 1UU9A 3QGYA 4NUSA 2JEDA 2R3GA 4I6BA 3VULA 4BDHA 4U3YA 2FB8A 4E4MA 1BL6A 4IHPA 4MXCA 5CEPA 4Y5HA 3ZC5A 3OHTA 3FLNC 4CTBA 2O65A 3OOMA 4NKSA 5BYZA 2OZOA 2A4LA 3HMIA 3NPCA 4J98A 3VBTA 2VWXA 5AUYA 3LCDA 1GZOA 5DRBA 2VV9A 3UBDA 5IQDA 2BIYA 5CEKA 2X8EA 3RJCA 3RM6A 4DTKA 4JG6A 4JS8A 3EQCA 3Q9ZA 3ZSIA 4EOKA 4PF4A 3NYVA 1NXKA 2ITZA 4QMPA 3LZBA 4R7IA 4YR8A 4QMTA 3N4TA 5FGKA 4UN0C 2ZMCA 5TOZA 5DPVA 2VTHA 4DHZA 5E1EA 4EH9A 2XM9A 2FO0A 3OWPA 5D7VA 3C50A 3HP5A 4AZVA 1PYEA 2C3IB 3EQHA 4TYEA 4CVAA 1CDKA 3ITZA 4WT6A 5DHJA 1BX6A 2NNWB 4YBKA 4A07A 3EOCA 4FOCA 5CEQA 4AE6A 1WBOA 2YFXA 1OB3A 3UO5A 2J0MB 3REPA 4EH7A 5H8EA 4TRLA 3ZBXA 1PHKA 3AC3A 1UNGA 2X2MA 3MY1A 5FLFA 1M2PA 5HG5A 4YHJA 4EQCA 5I9VA 4L3PA 4OBPA 2RFSA 2JD5A 2PULA 3DZOA 4PTCA 4FEXA 4I6LA 3QZFA 3AC2A 4IWPA 1XO2B 1Q3WA 3Q9YA 3UTOA 1W0XC 2HY0A 4CTCA 2VTLA 3PUFC 4WRSA 2OXYA 1MQBA 1AQ1A 4FTAA 5KMNA 3QLGA 4KINA 4MK0A 4R6VA 4ASDA 1UWJA 4ZK5A 4FMQA 4JG7A 4YGAA 5AX3A 3H3CA 1YI4A 3C7QA 2GNJA 3ACKA 3KXHA 4O7WA 1YQJA 3V5QA 3PIYA 4TN6A 3ZHPC 4IM3A 4BCKA 5LCJA 4G9CA 3O0GA 1MUOA 4IANA 4E4NA 5KKRB 2CNUA 4AGDA 4IX6A 3CPCA 4GKHA 4L00A 5C1QB 1JBPE 5CXHA 2G01A 2WHBA 4AXFA 5LVNA 1WAKA 1YXSA 4FEQA 5C8NA 3N4VA 1XH8A 3BWFA 5FXRA 4YLJA 4QMXA 4EOPA 3SDJA 1H4LA 4FZDB 4O38A 1GZ8A 5LWMA 1ZYJA 3OCBA 4MH7A 1XMLA 1Y6BA 4KUJA 4NH1A 1UNHA 4AZFA 1LEZA 2CLQA 3CSVA 4FL1A 3QRTA 4QP8A 4U8ZA 4HJOA 5A14A 4ZS4A 3MPMA 4M12A 3G9NA 3LMGA 4TTHB 1CKJA 3P78A 4I0RA 3VN9A 2HWOA 3N9XA 2PE0A 2W5BA 4NKAA 5LJJA 1Q8ZA 3UVRA 2XARA 3LJ2A 4KBCA 4S32A 4QMOA 3VVHA 1L3RE 1Q97A 2YM5A 4HYIA 4D2SA 1Z5MA 3FPMA 4MBLA 5L2WA 2C6KA 2GHGA 2YDJA 5JSMA 3COMA 4QMWA 5HQ0A 1IEPA 3QZIA 2OFUA 3DKFA 4IC7A 4B4LA 4RVMA 3NSZA 1G5SA 3MVMA 5DFPA 5J87A 3MWUA 4XP3A 4JXFA 4D4YA 3FHRA 4UX9A 1XQZA 4MUQA 4MXYA 4O7TA 5AADA 3DJ5A 5KUPA 4DGLC 4JQ8A 2GQRA 3BV2A 1U46A 1U5RA 4FKVA 3R7OA 3SRVA 4K6ZA 4KRCA 4BBFA 2QHNA 2H6DA 3DXNA 3RZBA 3BL9A 3I0OA 4BDBA 1OITA 3VS6A 4F99A 4XP0A 4FIJA 1P14A 4EC9A 3ML1A 3UDZA 3E8DA 4NM5A 3MFSA 4XMOA 5FEEA 4RLLA 3VBQA 3IONA 5CF4A 4DFYA 4O21A 4Z3VA 3HA8A 5DOSA 4YTHA 1GJOA 3SXSA 1JAMA 1NVRA 5EKOA 5M4CA 2J2IB 2W1ZA 2C6TA 4G6NA 2YABA 3RK5A 3KXMA 3NX8A 2I0HA 2Z02A 2CGVA 1W83A 3THBA 5I4NA 5JMSA 2IZRA 3MW1A 2NRUA 4F6SA 3ANQA 4S33A 3UQGA 3ZUVA 4JQ7A 4FL3A 2G9XA 3BX5A 4OW8A 1APME 3HRCA 4FZ6A 1K2PA 4QO9A 3NWWA 4XG8A 3V8WA 3VONA 5ANGA 4B7TA 2XNGA 2WTWA 4PQNA 3KK9A 3ZONA 1QPJA 3HLLA 2JBOA 2UZBA 2XKEA 5DT0A 3GGFA 2JC6A 1FQ1B 4KA3A 4RVTA 3TNWA 4PUZA 5EM7A 3UYSA 2XH5A 4AE9A 4FI1A 2J6MA 2ZMDA 4QMMA 1FVRA 2IVSA 5DR9A 4A06A 4TWCA 1FVVA 4ENXA 5GNKA 3U4UA 1URWA 2R3QA 4RJ7A 5EQYA 2E9NA 4KD1A 3U6JA 2YWVA 2YIXA 4EHGA 3LXNA 4ACDA 1HOWA 4XYFA 4CCUA 4CNHA 3OCGA 1H1RA 2XAMA 2X2KA 4DLJA 4AF3A 3RMFA 4PRJA 2XZSA 4FV2A 4L68A 3ZXZA 5EH0A 4CMTA 4U5JA 4IAIA 3UG1A 4XV3A 5HIEA 3D5WA 3F3ZA 3G33A 1LPUA 4FKSA 3PXKA 3FLSA 3DJ6A 2BTRA 4JT3A 5FBNC 1OL2A 5C8MA 2DQ7X 3OCSA 3UP2A 3V5PA 4PP7A 3T8OA 3WZJA 3T9TA 5DI1A 2Y4IC 4DCEA 2GFCA 4YJVA 5IH4A 3ID6C 3GNIB 5L6WL 4GL9A 3AC5A 4RMZA 2QKRA 3BLRA 5EHLA 2W0JA 3TNIA 4O0TA 2XBJA 3P7CA 3VHEA 3ZYAA 4EJNA 5HTCA 3MA6A 5HVKA 1H1PA 1YOJA 4RT7A 3FMEA 3CTJA 4QMZA 4ARKA 4BTKA 2VX1A 2RFNA 3LHJA 4S34A 5AX9A 1Q41A 2Z8CA 4F9YA 2Z7LA 2ZVAA 1O6LA 3TL8A 4F9CA 4L7FA 3K3JA 3MI9A 3R00A 4JG8A 4D9TA 3C4EA 4FG7A 5ETIA 3KULB 3LFBA 5IQAA 5HTBA 4L3JA 3F7WA 4MD9E 4B9DA 5G1XA 2V55A 3SKCA 3S2PA 4O6LA 3EN4A 3GCSA 2IZSA 2JKOA 2WMQA 4TY1A 4U7ZA 1W82A 2ETKA 4UZDA 3RWPA 5CAPA 4G9RA 2WFYA 2YZLA 4R1YA 2X8DA 4WUNA 4Y95A 3LFDA 4UZHA 2VX0A 3QWKA 4IBMA 5IPJA 4X2FA 4NYEA 3QTSA 3MIYA 3FYKX 4J95A 5DNRA 5LARA 5BVDA 5ANJA 4DC2A 2XK4A 2UW6A 4U41A 5HLPA 4ACHA 2G2HA 4FZ7A 5CEIA 1OUKA 2YWPA 3HNGA 5HBEA 2PVHA 3NNVA 5IMXA 4IAKA 2X7GA 3NYNA 1BLXA 2OH4A 2W4KA 3KN5A 2JITA 4W4YA 5B0XA 2HOGA 3R83A 3FJQE 4CFUA 1OI9A 2HWPA 4IM0A 4EWHA 2R3NA 4WA9A 3O8UA 3TN8A 4ZMEA 2ONLC 2WELA 5IDNA 5DE2A 4CFXA 2B52A 4I21A 4C4JA 2BUJA 2ZFYA 4J7BA 3ENHA 2HZIA 4WBOA 4C3PA 1FINA 1YXTA 2FUMA 2I1MA 4D1SA 2BR1A 5EM5A 2R2PA 2ETMA 2GNFA 4L46A 4RFMA 3BLHA 2H9VA 3F2NA 4FG8A 1R0PA 4DT9A 1BKXA 1WBNA 3H30A 4ITIA 2E2BA 4AX8A 3DB6A 3R73A 3RP9A 5L8JA 4JR7A 4FR4A 2PUNA 3A2CA 3H9RA 1ZOGA 2PVKA 5IA2A 5GHVA 2YIWA 2QOKA 3PLSA 2Q83A 2BILB 3E63A 3O8TA 4PL5A 3U9NA 2JDRA 1BYGA 1GZKA 3EQIA 4O2PA 4D4SA 3BELA 5T6KA 2PPQA 4RX8A 4PX6A 5GJGA 3VBYA 1CKPA 3FZ1A 3PVWA 4GT5A 3FAAA 4ZTNA 3V8SA 2J7TA 3FE3A 3CIKA 5IQGA 4AW1A 5JKGA 3NEWA 2ZM3A 3WYYA 4I4FA 3FUPA 4BDJA 3HMPA 5AUVA 3RAWA 5AUXA 1PY5A 3ZZEA 4EUUA 4G5JA 2G2IA 3SA0A 3T3UA 3HV3A 1YVJA 5A6OA 4L01A 1U5QA 1WVWA 3BYUA 4FE2A 1CTPE 5KNJA 1Q24A 4FTIA 4D1ZA 4F9AA 2QR7A 4W4XA 1B6CB 3IDBA 3ORTA 3PVUA 4YC6A 3MYGA 3H9FA 4O7VA 3QU0A 1RE8A 3EZRA 4FIIA 4FNYA 3FZRA 4IWDA 4RX5A 4JJRA 1SM2A 4DDIA 3DV3A 4R7BA 2Z7SA 4ZSGA 4BCNA 4F7JA 2CPKE 4LUEA 3K2LA 1YHWA 1ST0A 2VRXA 5CNOA 2XEZA 4X3FB 1KOBA 3O17A 2R7BA 3BCEA 2XUUA 1Q8WA 3TJDA 3E7VA 4LYNA 3WZKA 1E1VA 3GP0A 5K4IA 4BIBA 5C8KA 4RLKA 2R3MA 4AW2A 3DNDA 3AKLA 4C02A 2PZYA 4MXXA 3VUHA 3KMWA 4DA5A 2ITNA 4FL2A 4H58A 5CWZA 4BDGA 2H34A 2UW8A 2OXDA 3I7BA 2VTIA 4MBIA 3BYOA 3RCJA 4DH7A 4AZSA 3UOLA 5I9UA 1SVHA 1H25A 4AQCA 4KSQA 3TIZA 4I5CA 1J1CA 4RX9A 2CGXA 4DITA 1OKWA 3VUKA 3LW0A 1UU3A 3DQXA 3R1NA 3DKGA 2BZJA 3BHYA 5HESA 2B54A 3PRFA 3WIKA 2HW6A 2ZYBA 3P79A 5BVOA 3W0RA 1K9AA 3BPRA 1OL6A 4QQ5A 4FVQA 4U97A 5IEVA 5JGBA 4YZDA 3CQWA 5E9EA 4DH8A 2KTYA 2IW6A 4I5PA 1IA8A 4DAWA 4O0VA 1PMNA 3R7UA 3CJFA 4MYGA 5HVJA 4IFGA 2VNWA 3CXWA 4CFNA 2B9HA 2BCJA 3IOKA 2QOQA 2JIVA 3PXZA 1JPAA 2AEGA 3P23A 3RHKA 3TNPC 4R1VA 2VO6A 2OI4X 3FMHA 3HAVA 2P55A 3KRLA 3IKAA 4FKRA 4OTQA 3BEAA 3FMNA 4JLCA 3QD2B 4QPAA 1BL7A 4KS8A 2QG5A 3U8WA 3R71A 5BVFA 5E91A 1O6YA 5HORA 5EYMA 4AXDA 1A06A 2P0CA 1YHVA 4BI1A 5C01A 4YJUA 1WBSA 4ERWA 2Y4IB 2A27A 4GFGA 3OXTA 1WCCA 4ONAA 4DEEA 1DI8A 4DCAA 4PMMA 3VUGA 3QYZA 4HOKA 4JL9A 4YZNA 4GU9A 4AFEA 4WSYA 3NVMB 2QU6A 5FXSA 3V5TA 4R3RA 4EZ7A 1IG1A 3R2YA 2WTDA 4D58A 4OBOA 2UZNA 3PDTA 3C0GA 2OSCA 2RL5A 1PXLA 3F2RA 3HMNA 4HYHA 4GH2A 3R8PA 4ANMA 4CZUA 5CALA 1W8CA 1AGWA 4X21A 2VO3A 4W4WA 5KZ0A 4D5HA 4TZRA 1R3CA 3HUBA 3UGCA 3C5IA 3ZS5A 5DR6A 4KKHA 1FBNA 2C1BA 2UW5A 4DINA 3MGYA 4JOAA 5EK7A 5FQDC 5E8ZA 5A4LA 3MB6A 2FVDA 4FNXA 1KE6A 4RJ8A 3FMLA 5CQWA 4HPUE 1BI7A 1OIRA 2V62A 5AA9A 2GTMA 4EOLA 3PA5A 4MNEB 4I4EA 4NJDA 4NSTA 3OT8A 3MH2A 3NUAA 2IJMA 3UNZA 2QOFA 4MTAA 2YERA 4AFJA 2R3HA 3SOCA 3W55A 3LAUA 4MWIA 3HVCA 3UIUA 3GOPA 2BAKA 4PTGA 2CKQA 4NWMA 4OTIA 1R1WA 5J7HA 4CT2A 2OH0E 3PG1A 5EDPA 5CANA 1R78A 2XNPA 3DAKA 2R5TA 3EN9A 1PXPA 4GRBA 3DXQA 4O81A 4F6UA 2VO7A 4JNWA 4IJPA 4NM7A 3FMKA 5CENA 3RI1A 4DGOA 4GK4A 1WFCA 4IVCA 2UZLA 2G1TA 4KABA 5GIPE 2PMNX 3OTUA 5HNGA 2QO2A 2R3KA 3Q2JA 1Q99A 4CLJA 5KKRC 4FK6A 2C6DA 4KB8A 4E26A 3S1HA 3CGOA 1F0QA 3OY1A 4CXAA 5D1JA 4ID7A 4IZYA 2YHVA 4O7NA 4TYJA 5LOHA 2XK8A 3K5VA 2QU5A 4D28A 5CAVA 5HCYA 4FEVA 5CU6A 3BGPA 3QHWA 2PUIA 3MIAA 4HCTA 4DEIA 5ANIA 4BI0A 3E87A 4APCA 5D12A 2GNLA 3GFEA 3LFSA 2XCKA 1SZMA 2WXVA 4IB5A 4JQEA 4Y8DA 5DR2A 4LV7A 1KV2A 4FKLA 4EYMA 3JXWA 3D7ZA 4IACA 5FTQA 2XK7A 4RIOA 1B39A 4F1MA 4LRKA 3GCUA 4DG3E 3FZPA 2WZJA 4J8MA 5FEDA 4CGAA 4U98A 5FP5A 2R3RA 3KULA 3GU4A 3AC1A 4DYMA 3ANRA 5FM2A 3PA3A 2BZKB 2YJSA 4AOTA 2OW3A 4F9WA 3JYAA 2OF4A 3UOJA 5IA0A 3GVUA 4XG6A 3E64A 5L8LA 4R77A 2YITA 3F69A 1ZMUA 3C4WA 1XBBA 4EH6A 4TYHB 1ST4A 3ZU7A 3PPJA 4BYIA 4O0WA 2PZIA 4Z55A 3RM7A 3MH1A 2XAOA 3BL7A 3EN5A 3NNUA 2WTKC 4MNFA 4JAIA 5AP3A 5C4LA 3HL7A 1Q5KA 4JAJA 4AN9A 4C35A 2W9FB 5DYJA 2WMXA 5KHWA 4EOIA 2ZJWA 4IZ5A 3EH9A 5E8XA 3UMWA 2X9FA 2OZAA 1V1KA 3NS9A 2W7XA 4IM2A 1OBDA 3BKBA 3CQEA 5HG9A 1GIIA 3WF8A 4DT8A 4H05A 4CD0A 2Y4PA 5J1WA 4FV6A 4I6QA 4HGLA 5KMLA 2PVFA 1XHAA 4UY9A 5FTOA 5EM8A 1HCLA 3LOKA 2FH9A 5M4IA 3CQUA 3NYXA 4GU6A 1R39A 4M14A 4MX9A 1SMHA 2XJ2A 1KE7A 1DAWA 3CY3A 3FKLA 3R02A 4RGJA 5HICA 2AC3A 4CRLA 4EOSA 3CKXA 3ORXA 5FDPA 5HEZA 5DIAA 3AQVA 1G8KA 3SLSA 3QUEA 1WBVA 4C37A 4G1WA 4WOVA 2X7FA 1UWHA 4XG4A 5G6VA 4L52A 3AMAA 2QOIA 2W06A 3ORZA 5T68A 3ZRMA 2BFXA 4BTFA 1YKRA 4IW0A 4J96A 4CFWA 2OU7A 2R3PA 2C3JA 4PV0A 1FPUA 4GK2A 3ZO3A 4IEBA 4KIOA 1JKSA 3F6XA 4X2NA 3NAYA 4Y85A 3PP0A 5EW3A 5HE0A 3T3VA 3TXOA 1Q61A 1VEBA 2WOUA 4LG4A 4E4XA 5E8WA 3OFMA 4JMQA 5BUEA 1QCFA 5AM6A 1Z9XA 2F2UA 1UNLA 3QCQA 2IVVA 3EL7A 4EORA 1FGKA 2PHKA 3RPRA 2OKRA 5AUWA 3UVPA 4OT6A 3D94A 4MQ1A 3OF0A 2XJ1A 2WMBA 3VIDA 3FQHA 2XB7A 3G6HA 4LRJA 2B9JA 4KIPA 3V6RA 2PTKA 4QYEA 2A2AA 3WZEA 2WTIA 5KMKA 5IISA 1OPLA 3KXGA 4MWHA 2OK1A 2C3KA 3MVHA 4YPDA 2ZV9A 4EK6A 1TQMA 3ETAA 1TQPA 2OLCA 3G51A 4NM3A 1OKYA 3QXOA 3Q60A 2PVRA 3CD3A 4U42A 4ZSLA 4S30A 4I1ZA 2ZDTA 3MPTA 3QX4A 3TTJA 1XMMA 3O5AA 4RJ5A 3I0QA 2C0OA 3TUBA 4EBWA 4EOMA 3UVQA 3VS4A 2VWIA 4EK8A 3GCPA 2P4IA 2IZUA 2P2IA 1IR3A 1PW2A 4C62A 4RFZA 5M51A 5HI2A 4IVAA 3R8VA 2VWBA 4BTJA 2UUEA 4EOQA 3TNQB 2ITTA 4O7LA 4F08A 3DAEA 4W8DA 3EQPA 2PUUA 4FYNA 3SG9A 1S9JA 1XKKA 2BAJA 4O0YA 4B0GA 3I1AA 4ITHA 4EWQA 5HIBA 1Q8YA 3OP5A 2JFMA 4FV3A 4GFMA 4O22A 5HU9A 4IIRA 4YJQA 1PXKA 3M42A 3P7BA 5ANEA 4ZTQA 4I0TA 4BCJA 3UPXA 4BJJB 3GOKA 3PJCA 1ZYLA 5HNIX 1UA2A 3A7GA 3AXWA 3GUBA 2WU7A 3EIDA 3A60A 5LVLA 2F4JA 3DPKA 4QEBA 3R8UA 5LVOA 3Q6UA 3HDNA 2OIQA 4AXAA 4AAYA 3QCYA 4QMYA 4PNIA 1UVRA 2OXXA 3ZO1A 4FT5A 2ZAZA 4RJ4A 4B99A 1A9UA 4FICA 3BRBA 1BUHA 2R3LA 2EXCX