4PDYA

Crystal structure of aminoglycoside phosphotransferase from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
337
structure length
332
Chain Sequence
RLGSRSQAPLIPQAVVSKYDLAIQQRHADGNIEVWTDSKGRRYAAKRSSIAPAHCRIMVQCLRHAQEQGFTKFARFVTTSSNAPYVRHGDFTYYVTEWVSGQPANFGLPEHVAQTAYTLAQFHEATRSFRTDWKDDVFGLFQARWRDLRQMWLGADRKREKDAFDQLLLSMRDELHRDAAESLALFEDRDVIAYLEAERSSGGWCHLDVIPSNCLYTPQHQVVLIDFELARPAPRALDMAHLLRRSLERGNWDGHLAYACFLHFDAVRNIPKSEYRAVEAILRFPYLPWRIAHARYHFAADPSQLDALQQYAVQAEKRQAFLASLRQQVEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside phosphotransferase
publication title Crystal structure of aminoglycoside phosphotransferase from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
total genus 119
structure length 332
sequence length 337
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdyA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4pdyA02
3FV8A 2JKKA 4AOJA 2XYUA 4GW8A 4DH3A 4M14A 2R3KA 1OVEA 3GC8A 2CGUA 3RM6A 2I1MA 4E73A 3PE2A 5C8NA 4AZFA 3BWJA 3G6GA 2UZTA 4O81A 3QXOA 4YU2A 5DR9A 3RZBA 3TV4A 4B7TA 4YTFA 2WOTA 1MRVA 4FIHA 2I0HA 3MDYA 2IZUA 3QD3A 4JDIA 5D9HA 4ENYA 3FPQA 1ZZ2A 3PVUA 3E62A 2EU9A 3KRRA 4FIGA 1FBNA 4O91A 5EOBA 2QG7A 4L3PA 3EQRA 3PZHA 3I5NA 4R3CA 4XUFA 4RFYA 2YDKA 4MAOA 4QTAA 5HNBA 1WBNA 3EQFA 3ITZA 3GC9A 3NNUA 3RVGA 3VS1A 4C62A 3ID6C 3PVBA 3TNWA 1Q8TA 3AD6A 2EWAA 4BDIA 3KB7A 4EI4A 4NW5A 1IASA 3E64A 4FSZA 5E92A 3I7CA 3FXZA 5CU6A 4ZLOA 2YM5A 4UB7A 2R4BA 4XBRA 4XV3A 2BHHA 3HMPA 3P23A 2VO6A 1OITA 3RPYA 1WFCA 2XNPA 3FBVA 3NVKI 3EL8A 2I0VA 4RRVA 2HZ0A 3CD8A 3DDPA 3G0FA 3LCOA 5DR6A 4E7WA 2Q83A 2W5BA 3W2SA 4E4LA 5LJJA 4UYNA 2WQMA 3D5VA 4I24A 3S1HA 3P9JA 4W8EA 3O96A 4O7SA 3UP2A 3ZRLA 5AUYA 3AC2A 4TNBA 3FL5A 4X6RA 4ERKA 2QOKA 1I09A 2H8HA 2FSTX 4HGLA 3UG2A 4BGGA 4HYHA 4QMMA 3V8SA 5KZIA 3TNHA 1PXLA 2VAGA 3G0EA 3OEFX 3ZXZA 3HRBA 3S3IA 3ZDIA 3U54A 3SKCA 4F1TA 1ZYSA 3ATSA 4KAOA 5KHWA 4RJ4A 3NNVA 5JK3A 1FVVA 5KMNA 2W1ZA 5ANGA 4IVDA 4FV0A 4AZSA 1IG1A 3CC6A 4IX5A 4KRCA 3ULIA 3OMVA 3BE9A 1ZLTA 3BIZA 4MD8E 1FGIA 2QKRA 3NCGA 5AP0A 3WZKA 1ZOEA 2OIQA 3A60A 4LM5A 4QMYA 4CLIA 4EONA 4AW5A 3HL7A 2AYPA 4I93A 3C4CA 5EHYA 3FMHA 3VNTA 4FKWA 3RP9A 1FPUA 4N4SA 2ITVA 5HE2A 4W4XA 2OJJA 4DFYA 4QTBA 3MESA 3IDCA 3FL4A 2YDIA 3CQEA 5IISA 1ZY4A 3FC2A 1WVXA 5AP4A 3WYYA 2QLQA 3PG1A 4AZVA 1M17A 1DI8A 1CMKE 1QCFA 5CEPA 4NTSA 5HX6A 1FGKA 5CENA 5IUGA 2B9JA 2UZDA 3GOPA 3HLLA 3QTWA 4IAZA 1U54A 1QPDA 3KRXA 3QYWA 3PWDA 3UTOA 3EFWA 5HE1A 2AC5A 3TKUA 4BHZA 3R63A 4XLIA 3PXQA 4XP0A 3PPKA 5AIKA 4DCAA 2XKCA 4Z9LA 5ACKA 5EQEA 4HCUA 5TR6A 2OIBA 4CSVA 2G1TA 3H10A 4L3LA 3WYXA 4ALWA 3MW1A 4FT0A 4WA9A 2ITWA 3D15A 2BRMA 3LFFA 1W82A 4MQ1A 4QPAA 1GY3A 3NZ0A 4PUZA 4TYEA 2FSMX 4Y72A 3NAXA 3DAEA 4MNEB 2EB3A 2J0KA 2GPHA 2C5NA 1Z57A 3KY2A 4ZS4A 3OOGA 4P4CA 4FZFB 3DBQA 3PJ1A 5CS6A 4AG8A 3EZVA 4L45A 3KXZA 2C0IA 3NNWA 3GFWA 1BL7A 2ITXA 3QX2A 2QQ7A 5FQDC 3G33A 4XRLA 1FVRA 1MQ4A 3G51A 3QKKA 4L01A 2QD9A 3NUUA 4KBAA 4WNKA 4XG6A 4TRLA 2VWBA 4EQMA 4V05A 3R01A 5C8KA 5L6WL 2P55A 3C4ZA 4AGWA 1OPJA 3ZSGA 3RPVA 1Q8UA 3IKAA 1P14A 3IW5A 2REIA 3FMMA 4LFIA 2VGPA 4XLVA 3RAWA 2WZJA 4I41A 3TG1A 3LCDA 3NYXA 1IAHA 1KE7A 3IK3A 3QQJA 3AT4A 1H1QA 3I6UA 4EHGA 1VEBA 3MY0A 3PJ8A 3FHRA 2XA4A 5AM6A 2XK3A 3AC3A 3K5UA 3LQ5A 1H1PA 1TQIA 2ERZE 2C5VA 4JR7A 4UEUA 4U8ZA 3MH1A 4FVPA 3OROA 4QQJA 5L8JA 1YI6A 3CE3A 1BKXA 5CU0A 4RA4A 2R5TA 4TY1A 3R9OA 5FP6A 2CNVA 4H36A 5DHJA 2BRNA 3FKLA 1UU3A 2CSNA 2RFEA 4CLJA 3PXRA 2PZRA 4C61A 3FZTA 3ZYAA 4C4GA 3ZC5A 4RJ7A 5I9VA 3OD6X 2ITZA 4OT6A 3W32A 3W10A 1PYXA 3VUDA 2VWIA 3CPBA 1YRPA 3U6JA 3RPOA 3IECA 4BZDA 4LQMA 4QMNA 3E63A 3C51A 3EIDA 2FGIA 4WBBB 3KXXA 4EUTA 3FWQA 3H3CA 3OBJA 2OW3A 4XP2A 4G6LA 4PL3A 3DJ6A 2WTDA 3DJ5A 1ZYDA 5LCJA 3KXMA 4GS6A 3GB2A 3A4OX 3I7BA 2XKDA 3NYNA 2WD1A 4NFNA 2BRGA 4UN0C 3IO7A 3NVMB 1REKA 3FQSA 5HCXA 3CD3A 3MH2A 3OEZA 4TWOA 3R2YA 4AX8A 3VBXA 4BTMA 5FXRA 5EQPA 2YIQA 3DGKA 4Q5HA 5JQ5A 3H4JA 4ENXA 3D2IA 2NNWB 4JQ7A 3DLZA 3GC7A 4ZP5A 1M7QA 2HZ4A 2UZLA 3QQGA 3CR0A 4ZK5A 5TKDA 1KV2A 1U4DA 3BHYA 3CJFA 3R7YA 3SHEA 3UZRA 4DG3E 2BDWA 4RWKA 4ZLYA 3FC1X 3RWQA 3UVQA 2HAKA 3R00A 3NR9A 3CS9A 3EFLA 4FC0A 4YNEA 4C02A 2ZMCA 2XBAA 3O8TA 4LG4A 4CFUA 5M4FA 2VTLA 3R7EA 4CQEA 3S00A 3R1QA 5EM7A 2WTCA 1W83A 3O8UA 4JLCA 4YC3A 4N57A 3SXRA 4QP6A 3W16A 4EOKA 5AAGA 2XH5A 5BPYA 5JEBA 2ESMA 4FG9A 3EQBA 1ZOGA 3MIYA 4TYJA 5EYKA 4QP8A 1G3NA 5AJQA 4B9DA 3EB0A 1Q8WA 4AFEA 3W0SA 4L52A 4LRJA 3OG7A 3I79A 2G2HA 3FZRA 5HO7A 2F7EE 3QQUA 4FKGA 4JR3A 3F2RA 5F1ZA 3HVCA 2IVTA 3LKMA 4NKSA 4GK4A 4EBVA 4I5HA 2WTKB 3PXYA 3TL8A 1JAMA 5CXHA 4RJ6A 3EJ1A 4G31A 3RTPA 4X2KA 3ZRKA 3G9LX 4G1WA 3OWKA 3SVVA 2ITPA 1U5QA 1SVHA 2IN6A 4QYEA 2PUNA 4IZAA 3SX9A 2J0JA 2XNNA 3AMYA 3DPKA 3QUPA 4MXCA 4OGRA 4WZYA 4J52A 4IW0A 2PZYA 3GOKA 3NNXA 4ZY4A 5K5XA 2JDOA 4BCKA 2FH9A 2VWWA 2PMNX 4TZRA 4JI9A 2C0TA 5EDRA 4J95A 4Z55A 5AUTA 1OPKA 5EYDA 4ITIA 2BUJA 4IWOA 2WIPA 4WKQA 4ERWA 4FTQA 5E8TA 3IGOA 5AUWA 1YOMA 4WG4A 3DNEA 2C0OA 4HNFA 4ZXTA 3SDJA 1DAWA 3ORNA 2WMRA 4RFZA 4ZY5A 3F69A 4JX3A 5CQUA 3W2OA 2P2IA 3H9FA 5M4CA 3OWLA 1CKIA 2VTSA 4J71A 4ASXA 3WE8A 1V0BA 2ZM4A 1B39A 2W4KA 2NPQA 3O51A 5EI2A 5D10A 5BMMA 3QQKA 3P1AA 2ZOQA 5ETFA 1BX6A 3TTIA 3OS3A 3NUAA 4W4WA 4B4LA 4C3FA 4CFVA 1O6YA 5HORA 3ORTA 5L3AA 4M67A 4X7QA 3D7TB 1Y6AA 4ACGA 3RWPA 1F5QA 3BPRA 2NO3A 5TF9A 4M0YA 4JG7A 4K1BA 4AWIA 4CEGA 2OXXA 4O0WA 1G8AA 3PSDA 3D5WA 3RMFA 3ZO1A 5A6OA 2ITUA 3DXPA 3CQUA 2Y4IC 2PY3A 4F7JA 4FZAB 5FGKA 4ZJVA 2X7FA 2KULA 3EN9A 4GMYA 1GZNA 4G3EA 4TWNA 4UZHA 3QCXA 4FTJA 3F66A 4CV9A 4NK9A 3VUGA 4E6QA 1OUYA 1MRYA 3DZQA 4EOJA 3WF8A 5L6PA 4ORKA 4QMTA 1Q97A 3LAUA 4FKJA 4JDJA 4XG2A 2A2AA 2BDFA 4XJ0A 4RIWA 3R7IA 4ALVA 5IH4A 5JN2A 4LOQA 2XJ2A 2XIKA 1VR2A 3GNIB 3L9NA 2XK8A 3QTXA 4Y5HA 3EHAA 5HKMA 3VS0A 1REJA 4TXCA 3R02A 3VS4A 4D1ZA 3PP1A 3SLSA 5JFWA 5LVMA 3BHVA 4V04A 3A7JA 3KGAA 5DA3A 3VWAA 4D1XA 4HYUA 3CY3A 5C01A 4HCVA 3ORPA 4O0RA 4RFMA 3SW4A 3EN6A 4G6NA 3ACJA 4GFOA 1BUHA 5M4UA 5JMSA 4LYNA 2GTMA 5CU4A 5B2KA 2C6IA 3BYVA 2CGWA 4FTNA 3QUDA 4IM0A 1XR1A 2QOBA 1ZYJA 5DWRA 1OECA 5LMKC 3ORXA 3LOKA 3MTLA 4ZTQA 5GNKA 2YM7A 3V6SA 4GRBA 3UBDA 4EZ7A 5E8WA 1SZMA 3AOXA 4BI2A 3AC4A 5CTPA 1KSWA 4R6VA 1UKHA 4GG7A 1J3HA 4X3FB 5CY3A 1AD5A 3GENA 2UZEA 3PRIA 3BWFA 3UIUA 3BGPA 4AACA 3CKWA 5AA9A 4DH7A 4AS0A 2XS0A 5I9YA 2XKEA 3MFTA 3ODYX 2GCDA 3JR1A 4GL9A 3TV6A 3W2RA 2OU7A 2PL0A 2YM6A 3KMWA 3P0MA 4RZWA 4UYAA 4Y73A 3RK5A 3W8LA 4ZAUA 5DI1A 2WO6A 1T45A 4FODA 4KA3A 3AC5A 4FKSA 4H3BA 3UOLA 1YHSA 4XRJA 4JG6A 2GNLA 4EHZA 4ANSA 5IPJA 3E92A 4XG9A 1UNLA 1NVRA 4R3PA 2A19B 1YXXA 4GYGA 3H9OA 2Y7JA 3QTZA 3BLHA 3GC0A 4YJOA 2DUVA 3A2CA 3RKBA 4KD1A 4XHKB 4EK3A 5A9UA 4X6QC 5HG9A 3AGMA 2XNEA 5EM8A 3EH9A 1PXMA 3KRLA 5IEXA 4XOYA 2IVVA 3BYMA 4M84A 3MA6A 4O96A 4A9SA 2B52A 2UW3A 4MXYA 1G8SA 3RALA 3PDTA 1PXJA 4FKOA 4H3QA 4ANMA 3GQLA 3HMOA 3OCSA 3QYZA 4PMSA 5BVKA 4DEGA 5BUJA 1Y8YA 5LWMA 1OPLA 5AFVA 5F4NA 4O7PA 3ELJA 3K3IA 3CTQA 2YDJA 2PUIA 4FICA 4ANQA 1YDSE 3GT8A 4EK5A 3NW7A 4QP4A 2B4SB 3GU7A 1H0WA 5M51A 4YSMA 3S0OA 5AADA 2E9UA 2JITA 2VO3A 5IQCA 3NIZA 1E1XA 2W06A 4IWPA 5LARA 5J9ZA 2QOIA 5HG5A 4XG7A 3O8PA 4EYJA 3RHKA 3U4UA 3NUSA 3U9CA 2JBPA 3KF4A 4I6QA 3C0IA 1YXSA 4EOQA 4QNYA 3CXWA 2O65A 3UZPA 2WU7A 3IDBA 3LFNA 4H39A 4KWPA 3R83A 3MVHA 3HP2A 3COIA 3DK7A 4XEYA 2GFCA 5C1QB 5E8XA 4IE9A 2YA9A 2W4JA 2WEIA 3DQWA 4R3RA 1CKJA 2HXQA 3R9RA 1VYWA 4HVDA 5IDPA 2WOUA 5F95A 1VZOA 1MP8A 2WTIA 2I0EA 4QMQA 4A9YA 3KULB 5EHLA 3ZO3A 2J2IB 2YZLA 3R28A 4PRJA 2R3JA 4DF3A 2ONLC 2YCRA 3FSFA 4QMVA 4YJRA 1VJYA 2UZOA 2OH4A 3W2CA 4C59A 2X2MA 5HESA 3ZBFA 4IH8A 2BZKB 1NT2A 3CPCA 3LJ1A 4DAWA 3RK7A 1JSUA 3BGZA 3ORIA 2BHEA 4BDGA 5E8SA 3TZMA 4D28A 2IPXA 3C1XA 5IH6A 4DYMA 2IVUA 5KMOA 3VS2A 3ZXTA 4RIYA 4FG8A 4G9RA 5CSHA 3N4VA 5J95A 5IQHA 4F4PA 2GDOA 1NXKA 4GK2A 4DEBA 2YM8A 1TQPA 4WHZA 3WIKA 4RJ5A 3UOKA 4F0GA 5A6NA 2XM9A 3DNDA 2OZOA 5CAPA 2BIKB 2OJ9A 4MD7E 2P33A 3OC1A 1LR4A 4G3CA 5HIDA 3LIJA 1M52A 5M4IA 4XNEA 5GJDA 2FUMA 4G17A 2W1EA 3AXWA 5HZNA 3UGCA 3ORMA 5J1WA 3G15A 3Q5IA 3C0HA 3ZH8A 3UVRA 5IA3A 5CEIA 2E9OA 4QTDA 1OM1A 5LXMA 5TO8A 2GTNA 4XH6A 4FE2A 4TYGA 4NM7A 3DXNA 4YPSA 4BB4A 1GIHA 2GS7A 3IW8A 5CSXA 1O6LA 4ACDA 4O6EA 4NT4A 4H58A 5HLPA 4I4FA 4N70A 3TTJA 1H1SA 3L1SA 5BUIA 3DOGA 2ITNA 4U43A 5DVRA 1ZOHA 3A99A 1WBTA 3TKHA 3QD2B 4IZ7A 4L00A 5DT0A 3V01A 4KS8A 4E93A 4EK8A 4HVIA 4O0UA 3UIBA 5LVPA 4OR5A 3ORZA 2Z7QA 4L7SA 4JDKA 3HV5A 3FZ1A 5DIAA 4HVHA 2C5XA 4GKIA 4BDCA 4FTTA 3DQXA 4CVAA 4GFMA 2OBJA 2Y8OA 3QX4A 4EHEA 3BEAA 5H2UA 4DEDA 3FQHA 3COHA 2X8EA 4C4JA 2I0YA 4EL9A 5J87A 5G1XA 4NWMA 3Q53A 4O82A 3HKOA 3QTSA 4IQ6A 4KIQA 3U55A 3KMUA 3MJ1A 5F94A 3GUBA 1QL6A 2CCIA 4DFNA 2UW5A 4W4YA 3GCVA 1T46A 3R30A 5HE3A 3CTJA 4FUXA 3BZ3A 4RVKA 2SRCA 4LOOA 4C36A 4ACMA 4F70A 3R73A 3ULZA 4IBMA 3FSKA 2R3OA 4I22A 5H8EA 3DTWA 3LJ2A 2PVMA 2X2LA 3COMA 4K33A 3F5UA 2YWVA 3VUMA 2EUFB 1BI8A 5ANDA 5EDPA 4TYHB 2GQGA 2IWIA 2CKOA 2XEZA 5AP3A 5JRQA 4U41A 4ITHA 3Q96A 3R6XA 5A4QA 3IGGA 1P5EA 1Y57A 3QTRA 4FZDB 2XJ1A 5EHOA 4FSWA 4O7RA 1UWJA 3JY9A 1XJDA 4USDA 2E9VA 4QMPA 3HECA 1O9UA 4FA2A 4I0TA 3C9WA 4L68A 4X2GA 4FR4A 4WD5A 3DB8A 3ROCA 3JVRA 3TUBA 3POOA 4CNHA 5HEZA 1OUKA 3HNGA 4C35A 3L8SA 3RGFA 3FPMA 4NYEA 3F3WA 4YLKA 2YERA 3QZHA 4W8DA 4PNKA 4DG2E 4GUEA 1BI7A 3TNIA 3DBEA 2OZAA 3WZDA 1JQHA 3OZ6A 1OGUA 1WCCA 4PY1A 1HCLA 1PYEA 4CCBA 3RAKA 5A4TA 3BYUA 2VTAA 4JBVA 4CRLA 5T3QA 1YI3A 3FLWA 3F7WA 3I4BA 4I0RA 4D4SA 2VO7A 2R7BA 5LWNA 3OVVA 3IONA 3PIXA 1JWHA 4YZNA 1M2RA 2C3IB 2W5AA 3FY0A 3U4WA 1XWSA 2VN9A 4LGHA 2R7IA 4IX4A 2HW6A 4M0ZA 4WSYA 4ZEGA 3VBVA 5CNNA 2J7TA 2H96A 3V3VA 3MH3A 4YZ9A 5HCZA 3R1NA 4YJNA 3Q4UA 5DRDA 5T6KA 4A9RA 5CSPA 4XG8A 5D1JA 5M53A 2F57A 4LV5A 4R1YA 4RX7A 3W0PA 3LFSA 4ZTSA 2C3LA 3D14A 5KMIA 2CLQA 2GHMA 3R9HA 3V5PA 4EJ7A 4APCA 2PVRA 3GP0A 3LMGA 3HV3A 3MYGA 4FBXA 2BIYA 2ETKA 5EG3A 5A3XA 4EC8A 5KHXA 3N9XA 3V04A 4D55A 3ZONA 5ETIA 4MNFA 4QYFA 4K0YA 4YJSA 3EQCA 3UC3A 3QA8A 4A4OA 2QO2A 4DEIA 2YJRA 3W18A 4G9CA 1P4OA 4WOVA 3CGFA 3BLRA 4BCNA 2CGXA 3HUBA 2B9HA 2R3RA 2X9FA 4LUEA 4CTBA 1KOAA 1OL1A 4WUAA 3DKOA 3UYTA 2GU8A 1W84A 2ZAZA 3ZUUA 3Q52A 3QF9A 4BCFA 2JIIA 4WIHA 3WARA 1FINA 4ACHA 4A7CA 3GCPA 4R77A 3HEGA 1UNGA 3Q04A 3S4QA 5FBNC 3F7ZA 2ERKA 3HMMA 3I60A 4IWQA 4OTDA 3ZHPC 3ZLSA 4NU1A 2LAVA 2A0CX 2DWBA 1PRYA 5E4HA 1WBVA 3ZSHA 4CKRA 2YWPA 2QCSA 2PVHA 4WG3A 5I4NA 4MXXA 5E1EA 3UIMA 2GS6A 2WKMA 2JIVA 5HHWA 1YHVA 4QPSA 2X4ZA 4MBJA 2X7OA 4FKLA 4C2VA 5KKRB 1ERKA 1RDQE 2X8DA 5DG5A 4BHNA 3M11A 1QPCA 4EK6A 3WZUA 2XM8A 3RNIA 4UWCA 3HP5A 2R3NA 4FYNA 3ZFXA 2PVFA 4YMJA 1YXTA 3CKXA 2F2UA 3GFEA 4K8AA 3RK9A 4PMPA 1NY3A 4C4IA 4BF2A 4IVCA 3LCTA 4ZSAA 3FXWA 3ORLA 2HELA 5H8BA 5HNGA 4Q9SA 4GKHA 3NUPA 3PVWA 2WMAA 4J53A 1YWVA 4DT8A 2YAKA 3PXKA 2UVZA 2QI8A 4M8TA 3C4FA 3BI6A 5AX3A 3UNZA 1JLUE 5I0BA 2CNQA 3HRCA 4B6LA 2WELA 5HIBA 3FMKA 3VBWA 3WILA 2R3QA 4E6DA 4F63A 3KRJA 2UVYA 3EN7A 3UMWA 3THBA 3DY7A 2XRUA 3C5UA 1Z9XA 3HV6A 4IAKA 3NYVA 4Y8DA 2JIUA 5IA4A 3HDNA 4JIAA 4FTAA 2CNUA 3QC4A 5JH6A 2VTJA 4L44A 4USEA 3BHUA 2WNTA 3DKCA 3TCPA 3VBQA 3ZTXA 5JQ8A 5CF8A 5M09A 1KUTA 2FVDA 3E87A 5CVHA 2HXLA 1R1WA 1CKPA 4D1SA 2PTKA 3MA3A 4U98A 3R8ZA 4A9UA 5CANA 3CLYA 3FY2A 5HCYA 1VYZA 4HYIA 4E1ZA 1IAJA 2OJFE 4JIKA 4ZTNA 3QRKA 3PLAE 2R3IA 4U45A 2QC6A 4YBJA 4X21A 3GU6A 4BBEA 2JKQA 4HYSA 3UPXA 5FDPA 5IQFA 2RF9A 1E9HA 4FIFA 4YLJA 4YLLA 5CAUA 4FV8A 5KCVA 3BKBA 5DRBA 3TKIA 5EDQA 4FEXA 1OL5A 1XHAA 3P4KA 2BALA 2EXMA 2BCJA 1GZKA 2KTYA 4AAAA 5JGDA 5C03A 4GCJA 1IA9A 2XIZA 2RL5A 5JGBA 5GJFA 1KV1A 5CX9A 5L2SA 4I6HA 4MKCA 5BX0A 4EH9A 2HY81 3R2BA 2O5KA 4BCPA 5HE0A 4V0GA 5DNRA 3LFQA 3F5GA 4YHJA 4UY9A 3NAYA 4JG8A 2UW7A 4F0FA 1BMKA 2OJGA 3HDMA 4YGAA 5HQ0A 5E7RA 3D2KA 4I21A 4EOSA 4HPUE 3D4QA 5B0XA 4GT5A 4FKVA 3VJNA 4YNOA 1FOTA 5I9WA 3TNPC 4EH2A 4BYIA 3O23A 5CQWA 3MFSA 1OIYA 4RWIA 4R1VA 2W1DA 2OSCA 3SQQA 3UO4A 2J4ZA 4KBKA 4FV3A 4AP7A 1WBPA 3BRBA 2QHMA 2RKUA 2BVAA 5BYYA 1OB3A 4YZDA 4ZS0A 3KN5A 4UX9A 3E7VA 5B2LA 2UUEA 4IB1A 3A4PA 3OHTA 4YJQA 4RVMA 3EOCA 4EK4A 5IF1A 4PTCA 4EH4A 4FL3A 2C6MA 4GH2A 1YKRA 4D9TA 4BICA 5BVDA 3Q60A 4P2KA 3WF5A 4EWQA 3E5AA 2J51A 2OO8X 3F6XA 3DK6A 3OXIA 3PSCA 2OF4A 2X7GA 5HO8A 4H1MA 3LJ0A 5BYLA 5JT2A 3NW5A 1AQ1A 4MXAA 4I92A 4PWNA 3NUNA 4MWHA 1ZY5A 3CY2A 2Z02A 3I1AA 4P7EA 4DEHA 2BROA 4KKEA 3T9TA 4OBOA 1H0VA 4QP2A 4FTRA 5BVEA 3DAJA 5AV3A 2UV2A 3BU5A 1YQJA 2OIDA 1ZARA 3MBLA 5FXSA 4DEAA 3V5QA 5CSVA 2YIYA 4FNWA 4PMTA 4EEVA 3QRTA 5LOHA 3QQLA 4U3YA 4BI1A 4O7YA 4U42A 5ANIA 3BEGA 5H8GA 2JBOA 3OOMA 4G16A 4DGLC 4DTAA 2IG7A 3KEXA 3VVHA 3OW4A 2B53A 2XCKA 3ZSIA 2GHGA 5E8YA 4JS8A 3NUYA 2BTSA 5E1SA 4RGJA 4FEUA 2WEVA 4NIFB 4EKKA 3DLSA 4G3DA 3O7LB 3NGAA 1PY5A 4MX9A 3TNQB 5HD4A 1OKWA 1K2PA 5EYCA 3W8QA 5HBJA 4CTCA 4PF4A 4U97A 3VAPA 2YZAA 2NRUA 4H05A 5EM5A 3MPAA 3LHJA 2UW6A 3JXWA 2P2HA 4FMQA 2W96B 3F82A 4FV1A 4KSQA 3H0ZA 4NL0A 3LLTA 5CXZA 2XBJA 3VQHA 4WRSA 3UP7A 4FIEA 2ZM1A 3LCKA 4S34A 5E9EA 4DINA 4FEWA 1H26A 4UXLA 3Q5ZA 5EOLA 2PU8A 5AWMA 5AUZA 3S2PA 3F3VA 2Q0NA 3R7UA 4FIJA 1L3RE 3MN3A 3GU5A 5LMKA 1OBGA 4HGTA 5CEMA 2WAJA 1JOWB 3N4TA 2WMQA 2W5HA 4II5A 2R0IA 4UV0A 5IDNA 3OCTA 1OZ1A 2PMLX 4RIXA 3OTVA 3NSZA 5IU2A 2CKPA 1YW2A 3P79A 3QD4A 3Q9WA 4U3ZA 5CU2A 4DG0E 2YFXA 3TACA 4AZEA 2DS1A 2OKRA 4CT2A 3W2QA 1ZZLA 3HYHA 5HVKA 2GMXA 3RPSA 2HENA 3OUKA 3QZGA 5AV1A 4DE4A 4PP9A 2JKMA 2VUWA 4FZ7A 4OTQA 3WIGA 4LUDA 5IUHA 5K9IA 3GXLA 1LEWA 3N4UA 2WMUA 4TTHB 2WHBA 4O0SA 2XB7A 2C6TA 3T8OA 5HLNA 3Q6UA 2EB2A 4B0GA 2QOFA 4GU6A 4ZZOA 2HIWA 5FP5A 2OF2A 2QOQA 3AC1A 4FV2A 4PDPA 2W7XA 3PA5A 3SG9A 3L9LA 4IZYA 1J7UA 3SOCA 4F99A 3TXOA 2IJMA 3PIZA 4IB5A 3D83A 3KQ7A 4IACA 2QR8A 3QKMA 4OTWA 4BCMA 4GSBA 3PFQA 4Z7GA 1H00A 5J1VA 2UZBA 3O0GA 3VHKA 2VTIA 4R7HA 5CAOA 2EXCX 2NRYA 1RW8A 1YWRA 4CXAA 2PSQA 3DZOA 3EWHA 3TUDA 1BLXA 1PMVA 3D7TA 2JDSA 3TEIA 5CAVA 1WBWA 3PPZA 4DGMA 3CJGA 2XUUA 4UWBA 5ITAA 2XIXA 2YM3A 3NWWA 4AQCA 4J8MA 4RVLA 3MV5A 4A4XA 2C68A 3QTQA 4HJOA 4A07A 1SVGA 3ZBXA 2UW9A 5L2IA 4MH7A 3UVPA 3LXKA 3NUXA 4XG3A 3WE4A 3LFEA 1PF8A 1WBOA 2JGZA 2QONA 5A14A 4KNBA 1MRUA 1OIUA 1ZAOA 2IZTA 4TYIA 1QMZA 3C7QA 4FV4A 2CDZA 4N6YA 4IJ9A 5EK7A 3LFAA 2X39A 5A4EA 1SMHA 4BCJA 3AC8A 2FA2A 1NVSA 3EFKA 4Z3VA 5FLFA 4FL1A 3QC9A 2JDVA 3GVUA 5I9XA 4EKLA 1PXPA 5DT4A 5DEWA 4RWJA 3W0NA 2C6KA 2J0IA 4IHPA 3R8UA 4JX7A 4USFA 3QXPA 4ACCA 5BVOA 5CVFA 4EUUA 2WMTA 5CNOA 5HBHA 1ZMWA 1Y6BA 2QURA 3QRJA 4DH8A 3SA0A 2BZIB 5EQYA 4D4YA 4Z7HA 2VNYA 2XRWA 3LQ3A 2BRBA 2HY0A 3UNKA 3C50A 3R1YA 4JAIA 2PVKA 3UOJA 2J0LA 4C3RA 5HNIX 5D12A 2W1IA 3EFJA 4O7TA 2VRXA 4U6RA 3W1FA 3A7GA 4AF3A 4CG8A 4HVGA 3E3BX 3R8VA 4D58A 3MVLA 5ETAA 2X8IA 4YHTA 3AMBA 2ONLA 2Z60A 3QGWA 5AUUA 1Y91A 2C6EA 4QMLA 5FD2A 4GG5A 2PVNA 3DU8A 4LI5A 3WOWA 2X9EA 3IW7A 2VX1A 5D41A 3UQGA 2F4JA 4Q9ZA 2V55A 5TT7A 2WTKC 4FUYA 5F9EA 2BKKA 3FHIA 3QQHA 2C5OA 2VNWA 2WTJA 3K3JA 3OW3A 4QQTA 2W17A 2GFSA 4EBWA 5JRSA 4ZZNA 2WQOA 3A61A 3EZRA 4RJ8A 3DXQA 4RJ3A 3LCSA 4IX3A 3PG3A 4QMUA 4U9AA 3VS5A 3TIYA 4BBMA 4DGOA 4ZMEA 3KXNA 2ZMDA 5B2MA 3ZLWA 3U6HA 2ACXA 4AT5A 5ICPA 2R0UA 5E90A 4N0SA 4OBQA 2VTQA 1J1CA 3DBFA 3FMLA 4DGNA 4FSRA 2B9IA 1NVQA 2YJSA 3NPCA 3EQDA 4YP8A 2R9SA 3WBLA 4FGRA 1PXNA 5FTOA 3FXXA 3O71A 2WPAA 4OT5A 2C1AA 4ZJIA 5LVNA 1UU8A 1KE6A 4PDYA 2YACA 4DBXA 3VS7A 2QLUA 2QHNA 5HX8A 3OUNB 4HPTE 5CAQA 3DKFA 4RX9A 4YR8A 3BCEA 1UA2A 3MPMA 2ITQA 3MVMA 4BCGA 3AG9A 5IQIA 3EMGA 5IMXA 4E26A 4CFMA 4IM3A 3PYYA 4JRNA 1QPEA 3WZEA 3HRFA 2ZV7A 3LW0A 3G6HA 4FKRA 4DTKA 4DLJA 3NLBA 2UVXA 4TL0A 5C9CA 2OFVA 3AT2A 4CT1A 3OFMA 4MQ2A 4ZSLA 2J9MA 2XK4A 4K2RA 2XCHA 1A9UA 3QRIA 1PXOA 5HIEA 2XK7A 3L9MA 4HVSA 5A4CA 4LRMA 1SNUA 4O7VA 1XH6A 4QMSA 4EH3A 2OXYA 3UPZA 5K4IA 1ZWSA 4RZVA 3HV4A 5FBOA 1K3AA 5IG1A 3A8XA 4O83A 4O7OA 2H34A 3R8LA 2WMSA 3KVXA 1JBPE 2JAMA 5CZIA 1OBDA 4IIRA 4QYYA 3IOKA 4JVGA 3DBDA 5KE0A 3Q6WA 3W0RA 3VUIA 4JDHA 2E2BA 2GNFA 2WMXA 3REPA 4AW0A 4E5BA 2PZIA 4QQ5A 2JFMA 1SYKA 4PP7A 5EW8A 4ZSGA 4J7BA 4IJPA 4O21A 3H30A 4O7LA 3FLZA 4F65A 5CF6A 5D7AA 2G01A 5HTCA 2VTHA 1HCKA 4S30A 3JVSA 4JT3A 4M3QA 3WF9A 1R0PA 4F1MA 3FE3A 4E4XA 1GJOA 4R7IA 2WQEA 4AN9A 2X6DA 3KMMA 4GEOA 4AGDA 3V5LA 4MK0A 5D11A 3KULA 4NFMA 1Y8GA 5C8MA 5LMBA 2F9GA 3R1SA 3RPRA 2P4IA 3W2PA 3HMIA 4L43A 2YCSA 4F9CA 2HZNA 4RX5A 5FM3A 2VO0A 4M15A 2W1HA 2JFLA 1LEZA 2WMBA 3FKNA 1WBSA 3E7OA 2VX0A 5BVFA 2UW4A 2QU6A 5FDXA 4WNPA 3PY3A 4RBLA 4CFNA 2UZWE 4FK3A 3QQFA 2YABA 4X3FC 2W9ZB 3KA0A 2J0MB 2PUUA 3TJDA 2VTPA 4M68A 1W98A 4KB8A 2PZ5A 2BZHB 3QHWA 3FLNC 1EH4A 4NSTA 1IA8A 2WMVA 5FXQA 2RG5A 4CMOA 2O2UA 4M12A 3E8DA 1UU7A 3JPVA 3AGLA 2J50A 4FEQA 4JXFA 4MXOA 5HVYA 5J9YA 4EOPA 4QQCA 5AMNA 5KBQA 3QAME 5CF5A 1RE8A 3MIAA 4U5JA 4FV6A 5G6VA 2X0GA 5ETCA 4E4NA 1Q61A 2FSLX 3E88A 4AZWA 3L8VA 4PNIA 2BAQA 2R3PA 4KSPA 3DT1A 5KUPA 2ZDTA 3QCYA 5CEKA 4XV2A 3P5KA 4HZSA 3IQ7A 2VWYA 4ASZA 3EYGA 3LVPA 3BLQA 4C4HA 4HGSA 3RAIA 4EH5A 4E6AA 4FT9A 3UIXA 1OL2A 2BAKA 2QO7A 3K2LA 3DBCA 4GIHA 4I23A 2O0UA 4O7WA 4BGHA 2J5FA 1OIQA 3QA0A 3PXZA 3SOAA 5A46A 5CYIA 2DYLA 5AA8A 3OCGA 4O84A 1Z5MA 5CZHA 4X3JA 3K54A 2CN8A 3Q4CA 4XS2A 5E8ZA 4C7TA 4F0IA 3ZMMA 2ITOA 4RLKA 4X2JA 4D0WA 2X6EA 2B7AA 3C0GA 4EZ3A 4J96A 2YIRA 4FNXA 3H0YA 5JKGA 3KRWA 2BAJA 3BU3A 4IDTA 4C3PA 1Q41A 2XIYA 4IC7A 2OK1A 3P7CA 4BDFA 3SRVA 2YISA 3TZ8A 4CMTA 4TN6A 2J90A 3MWUA 2W05A 1J7LA 3AMAA 1H08A 3TYKA 3IW6A 3FI4A 4IWDA 3L9PA 4FIIA 4LMUA 1O6KA 4FOCA 5I9UA 3VULA 4CV8A 5J5SA 3UC4A 3Q9YA 3ZZEA 5IUIA 3NEWA 4ZJJA 4GT3A 5IQBA 1PXIA 2W1FA 4IAYA 4DA5A 5KO1A 4LOPA 2QOHA 4TYHA 4E20A 4AT4A 2CN5A 3C4XA 3IDPA 4NM5A 5HI2A 3QFVA 5IQDA 4NUSA 2V62A 1Q3DA 4DCEA 3OXTA 3PSBA 1HOWA 2B9FA 4OTHA 4FTCA 4PX6A 4KS7A 1Q4LA 2VTOA 3OF0A 2WXVA 5M07A 3TZ9A 4L9IA 5HGIA 5M44A 4OUCA 4R5YA 2Z7RA 3C4EA 1TQMA 4JAJA 2C6OA 3KVWA 4RT7A 1M7NA 1V0PA 4E6CA 3HV7A 2PUPA 5CT7A 1R3CA 4GIIA 4QP7A 5CT0A 4BDKA 3KXHA 3TWJA 4JBPA 4TW9A 1YDTE 3U9NA 4P5QA 4IAAA 4RC3A 1V1KA 2R3LA 3KF7A 3R21A 5DEYA 3Q4ZA 4XV9A 3OP5A 3CQWA 3ORKA 5EW3A 3U51A 5M08A 3QUEA 5EFQA 4MF1A 5ANJA 2JKOA 4I6FA 2W99B 4AU8A 5JFSA 2O3PA 2XMYA 2QVSE 3CCNA 1PMEA 5IQGA 1F0QA 4NM3A 1K9AA 1XH8A 3LM5A 4GV1A 4A06A 3QHRA 5GINE 3EQHA 3W0OA 5KNJA 3FI3A 2V0DA 3ENMA 3UYSA 2W4OA 1H07A 5HICA 5CF4A 4MBLA 5D7VA 1PKGA 4C58A 4BRXA 3LQ8A 2XIRA 5K4JA 4UWYA 1CDKA 3JY0A 4F64A 4KKGA 2PE0A 2PK9A 3GBZA 3PJ2A 1Q3WA 2WTVA 3R22A 3F2AA 4FSYA 3LLAA 1Q8ZA 4FTOA 4IMYA 4QMWA 2V22A 3BYSA 3HAMA 4FZ6A 3SXSA 3TN8A 5A4LA 1SNXA 1DM2A 5CI6A 3EQGA 2AC3A 4AZTA 5ANEA 3V5WA 2CMWA 4IVAA 2JC6A 4M97A 4BDEA 3BU6A 4I20A 3HAVA 1R39A 2CJMA 2OZAB 4ZLZA 2VZ6A 2C6DA 4I5PA 5HBEA 5CEQA 2HWPA 4O2ZA 2AUHA 3Q9XA 2YEXA 5CALA 1XBAA 3LMHA 1KE9A 4F9WA 4ZTMA 5DLSA 2QNJA 4ZOGA 5IA1A 1LUFA 4YURA 1DS5A 4F1OA 3TJCA 4BDJA 3MB7A 3Q3BA 3QWJA 4L7FA 3FMDA 4OTGA 4QP1A 5ANOA 3KCKA 2ZDUA 5LCKA 3G5DA 5LMAA 1PJKA 2HW7A 3EN5A 2CGVA 3MPTA 5FTQA 3ZEWA 3V6RA 3FAAA 5DBXA 4WT6A 3SC1A 3QD0A 3A7IA 4BCOA 4IB3A 4MEDA 2E9PA 3HA8A 5M57A 4F09A 5CLPA 4C0TA 2VTMA 5J8IA 5JFXA 4DEEA 3IPHA 5LVOA 4F08A 5ANKA 2YITA 4IX6A 5H9BA 4NJ3A 4FV9A 4I5CA 2PVLA 2IO6A 3MVJA 2PMIA 4FKIA 4ZSEA 4DH1A 2XF0A 3LFCA 4YO6A 3UOHA 1OKZA 2XJ0A 1FMKA 4O6LA 5L2TA 3BYOA 1UKIA 2PMOX 2WFYA 4H3PA 4RIOA 4BBFA 2BDJA 4F7NA 4P90A 3F3TA 4HNIA 4D2SA 1WVWA 3MI9A 3F5XA 2IW8A 3V8WA 2FO0A 1X8BA 2PPQA 3DTCA 4QO9A 4ID7A 3BV3A 1ATPE 4IDVA 4NCTC 4S32A 4FK6A 4M13A 1OKVA 4RPVA 2R3MA 3ZUTA 4Z16A 5C27A 5T68A 3UQCA 1RJBA 2OGVA 1JNKA 2C5YA 2OWBA 3NYOA 3Q32A 5AUXA 5L8LA 4DBNA 4I4EA 5EW9A 3UDBA 3L8PA 3G90X 2C4GA 3MFUA 4JBOA 2VWUA 4BDDA 2P3GX 4D4VA 5CI7A 5GIOE 2UZUE 2PE2A 4U7ZA 4MVFA 4YPDA 2ZVAA 1IR3A 4IB0A 3TIZA 2BRHA 3ZM4A 4BZNA 4FL2A 2HWOA 3HMNA 5KMLA 1XQZA 4O27B 1U59A 3B2WA 3N51A 4U44A 5M06A 1ND4A 1Q24A 4I3ZA 2Y4PA 1JSVA 4IADA 4J99A 5EKOA 3FZPA 2QKWB 3P7AA 4XCUA 2YIWA 4OLIA 3KL8A 2CLXA 1JVPP 4QT1A 1Q62A 4AGUA 3GCUA 2ZJWA 2ZM3A 4NKAA 2IVSA 5HG7A 4JQEA 4OW8A 4F7LA 2B55A 2UW0A 3WF6A 3R7OA 2RFDA 2GNHA 2HOGA 4ZTHA 4BTJA 2JEDA 3DJ7A 3OBGA 2WGJA 1WVYA 3A62A 4K77A 4MNEA 5IEVA 4GVJA 3QLGA 3FMEA 4RMZA 2XK9A 1YXVA 3BE2A 3LPBA 3UZTA 3E8CA 3D0EA 4NM0A 3KN6A 1U54B 2ZB0A 3VUHA 3FI2A 3QTUA 3ZLXA 3BBTB 3LXPA 3FZOA 4FG7A 2B0QA 2B54A 4AN3A 1TVOA 4XOZA 5IQAA 2JD5A 5IZFA 4FT5A 3HZTA 4Y5QA 3FQEA 4DC2A 1YDRE 4IANA 3ROYA 2V7AA 2RGPA 2PVJA 4C4FA 3SGCA 2Q0BA 2XNOA 4RQKA 2VTTA 2XYNA 4FSTA 3RHXA 1H1WA 3CSVA 3PPJA 4FYOA 4YTIA 3ZS5A 3FLYA 1XBCA 2PHKA 3G2FA 4GUBA 1DI9A 4DTBA 2C1BA 2OICA 1S9JA 3V51A 1V0OA 3ERKA 1OL7A 4GT4A 4YJTA 4JNWA 3D5UA 4TNDA 4U81A 1XH7A 3ZZWA 4Y95A 4AT3A 3V8TA 3JS2A 4RC2A 2G9XA 3HGKA 4UXQA 3D94A 2OH0E 5AP5A 4YSJA 3MS9A 3QTIA 5FEQA 2X81A 4DN5A 3DA6A 3WF7A 5DR2A 5KKRC 5FEDA 5BQ0A 4V0GB 4ZTRA 4G5JA 4K18A 3E8NA 3ZO4A 3P86A 1YI4A 3PE1A 3VW6A 4DHFA 4O0XA 4HW7A 2YM4A 2RFNA 2XVDA 2F7ZE 3LZBA 1W0XC 2WQNA 4BN1A 1W8CA 4F9AA 4BIBA 3NRMA 1KE5A 4YC8A 3AD4A 3ANRA 1H24A 2QR7A 3LM0A 1IEPA 4FSUA 3T9IA 1Q5KA 2C3KA 4FNYA 4FTLA 4XG4A 4MBIA 2RG6A 3MY1A 4F6WA 3ATTA 3PJ3A 4GFGA 4O0TA 5AUVA 4UALA 2WTWA 3R04A 5L2WA 4FI1A 4LGGA 3NS9A 3F3UA 3SG8A 2UW8A 4DFZE 4EH7A 3R8PA 4FVQA 1W7HA 4J1RA 3VJOA 5BUEA 3QZFA 4BIEA 2PYWA 4EOIA 1J7IA 1URCA 5LVLA 3K5VA 2O63A 4ZTLA 1PKDA 2G2IA 5EI6A 3AT3A 4IVBA 1JKKA 3PRFA 4RWLA 1H27A 3O17A 4FTUA 5CWZA 4EQUA 1QPJA 3G9NA 3MY5A 3Q4TA 4IAIA 3MB6A 5DGZA 5IA5A 1B38A 5B7VA 4B8LA 3LE6A 2C47A 4KABA 1OL6A 4FV5A 1M2QA 4TKSA 5AV0A 4AN2A 4KIPA 4ASDA 2Y4IB 5CEOA 3GI3A 1J91A 1AGWA 5DYJA 4BDBA 3AQVA 4RSSA 2A1AB 4RA5A 4WNMA 2R64A 3VN9A 1UV5A 4NTTA 2ITTA 1KWPA 5JFVA 4X2FA 2PVYA 4YTHA 4A9TA 5EKNA 2UZVA 4YBKA 1YXUA 4O0YA 2CKQA 1CSNA 1PW2A 4KKHA 2A27A 1TKIA 1UU9A 2WU6A 2Y6MA 3P08A 4JJRA 4S33A 3ET7A 5DPVA 1YOLA 2GNIA 1JKSA 4EHVA 4FT7A 1KE8A 3T3UA 2YCFA 2WQBA 5K3YA 1GZOA 5E8VA 2VWZA 2NP8A 3I5ZA 3NCZA 2CKEA 3GQIA 1PMNA 3EQIA 5IH5A 5CASA 3ZCLA 2Z2WA 5JSMA 4IFCA 3IOPA 3A8WA 5AP1A 4L8MA 2PWLA 3GU4A 3RINA 3RCDA 4F7SA 5C4KA 4D4RA 3ZOSA 3VIDA 1GNGA 4C4EA 1OMWA 4CG9A 5HD7A 2IZSA 3PVGA 4H1JA 3VF9A 2GS2A 4DLIA 1R78A 3M2WA 4BIDA 3IG7A 1FQ1B 4ANLA 4YZMA 2I6LA 2I40A 3ACKA 5C26A 3GCSA 2R3GA 3QCQA 4YJUA 4KINA 2R3FA 3QRUA 4RIXB 4EH6A 3LXNA 5H3QA 4AOTA 2GHLA 3NX8A 3ZFYA 1GOLA 3PIYA 4GJ3A 4JRVA 3R9DA 2ZV8A 5K5NA 2VTNA 4IEBA 5HLWA 1OIRA 3C4WA 1A48A 3CTHA 4JQ8A 2V5QA 4U80A 2J5EA 4O86A 3VHEA 4I6BA 3QL8A 2OG8A 4FKUA 3R0TA 3EYHA 3SV0A 4PQNA 4OTIA 3BGQA 2OI4X 3MSSA 4X2NA 3ZDUA 3R8MA 3VC4A 3RCJA 4QTCA 3KC3A 1YVJA 4MXZA 4CFWA 1BYGA 2CHLA 1CM8A 4G34A 4BCIA 2JDRA 3EKKA 4LL5A 4QNAA 1H01A 4V01A 1KOBA 1G5SA 4D5HA 4KBCA 4OTRA 3HX4A 3GGFA 4RX8A 3ZLYA 4CMUA 4D0XA 2PZPA 1OI9A 1M2PA 1OKYA 2XP2A 3JYAA 3DAKA 3EQPA 2VU3A 4OTFA 3RI1A 3M42A 1U5RA 3SAYA 4O38A 4WG5A 4YUQA 3FDNA 1P2AA 2QOCA 4QRCA 3TZ7A 4PDOA 5J7HA 4PTEA 1APME 2ZB1A 5KBRA 4RC4A 5KX8A 3EN4A 3UJGA 2JLDA 4ANBA 1XH9A 3W33A 4WRGA 2Z7LA 5BYZA 5HG8A 3V5TA 2XKFA 3PLSA 4IAFA 2BTRA 2H6DA 3BELA 3LFBA 3RM7A 4I0SA 4J97A 2R2PA 4X0MA 3OXZA 3P7BA 3TM0A 4YTCA 1U46A 2BILB 5IQEA 2XEYA 2H9VA 4DH5A 4U94A 4O7ZA 2VX3A 2QOOA 4C38A 4DFLA 3DB6A 4TT7A 4LRKA 3R7VA 4APPA 4RIWB 3MGYA 5BVNA 2WMWA 3W0QA 4LL0A 3QU0A 3OY1A 1SM2A 2ZV9A 2G2FA 2FSOX 4FNZA 4MTAA 4FTMA 5A54A 1WAKA 4X3FA 3TV7A 4BC6A 2GNGA 2C69A 3MJ2A 2YCQA 4JOAA 4EH8A 4I1ZA 4DFBA 1NW1A 5FTGA 1DAYA 1LPUA 2VD5A 5M55A 3SXFA 4C33A 1E1VA 3VO3A 2XNGA 5HTBA 5CU3A 4AW2A 1GIJA 4CFXA 2C30A 4C2WA 4R5SA 3QCSA 2EVAA 4WBOA 3GEQA 5FG8A 2F2CB 4CZTA 3C13A 3VBYA 3KK8A 4O7NA 3I81A 3ZUVA 3E93A 1H1RA 4B8MA 2BMCA 3RAHA 4XYFA 4ITJA 4AA0A 4QMOA 4YZBA 3QKLA 4B99A 4K11A 4K6ZA 2OLCA 4YHFA 4S2ZA 4EJNA 3ZM9A 3DFAA 4L67A 4UBAA 4N6ZA 5JZNA 3U6IA 4CKIA 1J1BA 3EKNA 4MHAA 3PJCA 5IMEA 5DFPA 2ETMA 1PHKA 4ARKA 4QYGA 3UODA 4IZ5A 2B1PA 3FMNA 3BQCA 4G2FA 3HA6A 4NW6A 3DK3A 3UE4A 2ITYA 4PTGA 4U40A 4BDAA 4FTIA 5HU3A 4EYMA 4D9UA 1I44A 5CSWA 5BVWA 3ZC6A 4Q2AA 4U0IA 2BKZA 3L8XA 2IW6A 4ZIMA 4EOMA 4OBPA 5E8UA 4YJVA 3NW6A 1URWA 4AA4A 4FSQA 4C34A 3NIEA 4FKQA 5FUTA 3FLQA 4DGGA 4Y46A 2GNJA 3I6WA 5AP2A 4A4LA 4AGCA 3PY0A 3A7FA 3F88A 3MFRA 4CFFA 3F61A 1YHWA 1A06A 3CEKA 4FOBA 4QP9A 2LGCA 5CVGA 4QTEA 4K9YA 3KCFA 3COKA 4M69B 4QYHA 5JZJA 3I0OA 1MUOA 4IM2A 3VF8A 4DFXE 4EOOA 3WI6A 4AUAA 1H25A 3TDVA 3D7ZA 2C3JA 3VRYA 3OT3A 4NJDA 1Q8YA 4ONAA 2G15A 5AIRA 3U87A 2GSFA 5KMKA 4DFUA 1XH5A 4CCUA 2VWVA 4P5ZA 4FTKA 3VQUA 1XH4A 3R71A 4O0VA 4BDHA 3LFDA 1M14A 1XKKA 2ZYBA 3QWKA 3SD0A 4FX3A 4W4VA 3UG1A 4CD0A 2X2KA 5TOZA 3TUCA 3F2NA 3CP9A 3FMJA 4BCQA 1STCE 4ZZMA 4LMNA 5FM2A 5I9ZA 4E5AX 1ZMVA 3VW8A 4FKPA 3FKOA 5HVJA 4I94A 4EZ5A 4KUJA 3OY3A 3DCVA 4ASEA 4BTKA 4G3FA 1NA7A 4AOIA 3DKGA 1CTPE 3C5IA 4KRDA 3BQRA 3IS5A 4TPTA 2HZIA 4S31A 1P4FA 3AD5A 3NMUF 3FJQE 2QU5A 2Y9QA 4MCVA 1JKLA 5E91A 2BPMA 3ALNA 3CGOA 4EQCA 4HCTA 4L42A 3EL7A 5AX9A 4FGBA 4O22A 3BHHA 3DDQA 3KK9A 4EORA 1H4LA 3KU2A 4D2RA 5EH0A 5GJGA 5EYMA 4XBUA 3VRZA 3B2TA 4F6UA 3UQFA 3SW7A 1ZMUA 2RFSA 2XZSA 4D5KA 4E4MA 4GYIA 4Y83A 3FLSA 2O8YA 3PWYA 5AP6A 4ALUA 5AEPA 5AV4A 1BL6A 2QO9A 2QG5A 3FZSA 3POZA 2BZJA 3Q9ZA 3F9NA 3PXFA 5AAFA 4C37A 2O64A 2RIOA 4FKTA 5DH3A 3QBNA 4ZY6A 4J98A 4BZOA 3MH0A 4QP3A 3Q2MA 1LP4A 4G3GA 3KKVA 1Q99A 2IW9A 2BR1A 3QLFA 2YAAA 4CKJA 4CRSA 3ZEPA 2GQSA 2W0JA 4XMOA 4GVAA 2QODA 5EI8A 3A7HA 4M7IA 3DV3A 4I5MA 3M1SA 4RIYB 3BX5A 2W1GA 3QGYA 1GIIA 1ZYCA 4CZUA 2BFYA 5AM7A 2WIHA 4MD9E 4F9YA 3V5JA 1IRKA 2FYSA 1WZYA 2VV9A 3LXLA 3O2MA 2YHVA 3I0QA 4UZDA 3QZIA 2C6LA 3BV2A 3FYJX 4L46A 4U79A 3ZFMA 3VS3A 4F9BA 1XBBA 1YWNA 4XX9A 1PXKA 2Y0AA 1WMKA 1B6CB 3T3VA 4YJPA 3ALOA 2I7QA 3F3ZA 3OTUA 3PP0A 3FI8A 2Z8CA 4FEVA 4QMZA 4TWPA 3TT0A 3II5A 2A4LA 3PA4A 3JUHA 4BTFA 3OWPA 5J9LA 5ACBC 3W55A 4XP3A 3PTGA 4AA5A 3KREA 2PE1A 3VUKA 4CGAA 3RJCA 5JGAA 1PMUA 3H9RA 1UWHA 3MTFA 3NDMA 3FUPA 3O50A 5BMSA 4NZWB 4FV7A 3R9NA 5IEYA 4WNOA 3VBTA 1JPAA 2PULA 2HK5A 2DQ7X 5DN3A 1UNHA 2ZV2A 5C4LA 4BYJA 3DS6A 3CBLA 1SVEA 4GK3A 3FEGA 4LV8A 4RQVA 2J6MA 4EWHA 1H8FA 3HUCA 2XNBA 2Z7SA 2YIXA 4HGEA 2X1NA 4YC6A 2OXDA 1S9IA 3KXGA 2CPKE 3LMIA 4ZSJA 5F20A 3BHTA 4BVUA 4HZRA 4AXAA 5DOSA 4AE6A 4FSMA 2F49A 5KZ0A 1FMOE 4PV0A 1L8TA 4PL5A 3D5XA 4DITA 4E5WA 4EOLA 5DT3A 4RLLA 3S95A 1YOJA 2OJIA 5I5ZA 5DE2A 4GJ2A 5GHVA 2QOLA 1ZRZA 4XV1A 1F3MC 3PY1A 3SRVB 4NH1A 4R7BA 3ENHA 5KMJA 4NCTA 3ZU7A 4Q5EA 5LQFA 4ZMFA 2XNMA 2OFUA 4AE9A 4MWIA 3TDWA 4MYGA 2ETRA 4WUNA 5AV2A 3ODZX 3PUPA 4L3JA 5L6OA 5GIPE 4Y85A 3PA3A 3F5PA 2IZRA 1FVTA 3BBWA 3CIKA 4R78A 2R3HA 2W9FB 3DFCB 3E3PA 3TI1A 3E8EA 3UMXA 4QOXA 4G6OA 4PDSA 3ETAA 2WB8A 4IFGA 3U8WA 4EC9A 5M56A 2HYYA 4L6QA 4TWCA 4RG0A 2GQRA 2Y6OA 2YN8A 4IC8A 4PMMA 5IA2A 1H28A 4BY9E 2FB8A 4AW1A 1MQBA 2JDTA 2V7OA 3B8RA 2F7XE 4JBQA 5AP7A 2CCHA 3VS6A 3D9VA 4YO4A 5FEEA 3UNJA 2VGOA 2W1CA 5L8KA 4BR3A 3GU8A 4BCHA 5AAEA 1R0EA 3PZEA 3Q2JA 4YZCA 4PL4A 3WZJA 4JL9A 4BI0A 1GAGA 4J8NA 2VWXA 1JKTA 3GCQA 3QALE 5EM6A 3KFAA 3P78A 3B8QA 3OT8A 4F6SA 2JAVA 3ANQA 4DT9A 1XO2B 1RQQA 3ZO2A 3ZRMA 3OWJA 5BNJA 4FSNA 4RVTA 2UZNA 4O2PA 3O7LD 3UO6A 3UO5A 5KMMA 2HCKA 5FRIA 1ZXEA 4BGQA 4HOKA 4L53A 3OCBA 4QMXA 1JSTA 4FVRA 4AFJA 4E8AA 3W0MA 2VTRA 3FYKX 2E9NA 2BFXA 1UVRA 2X4FA 5HU9A 4BKJA 4WO5A 2XK6A 3IW4A 4G5PA 1GZ8A 4KIOA 5IA0A 4FT3A 2P0CA 4GU9A
chains in the Genus database with same CATH superfamily
3FV8A 2JKKA 4AOJA 2XYUA 4GW8A 4DH3A 4M14A 2R3KA 1OVEA 3GC8A 2CGUA 3RM6A 3KIOC 2I1MA 4E73A 3PE2A 5C8NA 4AZFA 3BWJA 3G6GA 2UZTA 4O81A 3QXOA 4YU2A 5DR9A 3RZBA 3TV4A 4B7TA 4YTFA 2WOTA 1MRVA 4FIHA 2I0HA 3MDYA 2IZUA 3QD3A 4JDIA 5D9HA 4ENYA 3FPQA 1ZZ2A 3PVUA 3E62A 2EU9A 3KRRA 4FIGA 1FBNA 4O91A 5EOBA 2QG7A 4L3PA 3EQRA 3PZHA 3I5NA 4R3CA 4XUFA 4RFYA 2YDKA 4MAOA 4QTAA 5HNBA 1WBNA 3EQFA 3ITZA 3GC9A 3NNUA 3RVGA 3VS1A 4C62A 3ID6C 3PVBA 3TNWA 1Q8TA 3AD6A 2EWAA 4BDIA 3KB7A 4EI4A 4NW5A 1IASA 3E64A 4FSZA 5E92A 3I7CA 3FXZA 5CU6A 4ZLOA 2YM5A 4UB7A 2R4BA 4XBRA 4XV3A 2BHHA 3HMPA 3P23A 2VO6A 1OITA 3RPYA 1WFCA 2XNPA 3FBVA 3NVKI 3EL8A 2I0VA 4RRVA 2HZ0A 3CD8A 3DDPA 3G0FA 3LCOA 5DR6A 4E7WA 2Q83A 2W5BA 3W2SA 4E4LA 5LJJA 4UYNA 2WQMA 3D5VA 4I24A 3S1HA 3P9JA 4W8EA 3O96A 4O7SA 3UP2A 3ZRLA 5AUYA 3AC2A 4TNBA 3FL5A 4X6RA 4ERKA 2QOKA 1I09A 2H8HA 2FSTX 4HGLA 3UG2A 4BGGA 4HYHA 4QMMA 3V8SA 5KZIA 3TNHA 1PXLA 2VAGA 3G0EA 3OEFX 3ZXZA 3HRBA 3S3IA 3ZDIA 3U54A 3SKCA 4F1TA 1ZYSA 3ATSA 4KAOA 5KHWA 4RJ4A 3NNVA 5JK3A 1FVVA 5KMNA 2W1ZA 5ANGA 4IVDA 4FV0A 4AZSA 1IG1A 3CC6A 4IX5A 4KRCA 3ULIA 3OMVA 3BE9A 1ZLTA 3BIZA 4MD8E 1FGIA 2QKRA 3NCGA 5AP0A 3WZKA 1ZOEA 2OIQA 3A60A 4LM5A 4QMYA 4CLIA 4EONA 4AW5A 3HL7A 2AYPA 4I93A 3C4CA 5EHYA 3BLAA 3FMHA 3VNTA 4FKWA 3RP9A 1FPUA 4N4SA 2ITVA 5HE2A 4W4XA 2OJJA 4DFYA 4QTBA 3MESA 3IDCA 3FL4A 2YDIA 3CQEA 5IISA 1ZY4A 3FC2A 1WVXA 5AP4A 3WYYA 2QLQA 3PG1A 4AZVA 1M17A 1DI8A 1CMKE 1QCFA 5CEPA 4NTSA 5HX6A 1FGKA 5CENA 5IUGA 2B9JA 2UZDA 3GOPA 3HLLA 3QTWA 4IAZA 1U54A 1QPDA 3KRXA 3QYWA 3PWDA 3UTOA 3EFWA 5HE1A 2AC5A 3TKUA 4BHZA 3R63A 4XLIA 3PXQA 4XP0A 3PPKA 5AIKA 4DCAA 2XKCA 4Z9LA 5ACKA 5EQEA 4HCUA 5TR6A 2OIBA 4CSVA 2G1TA 3H10A 4L3LA 3WYXA 4ALWA 3MW1A 4FT0A 4WA9A 2ITWA 3D15A 2BRMA 3LFFA 1W82A 4MQ1A 4QPAA 1GY3A 3NZ0A 4PUZA 4TYEA 2FSMX 4Y72A 3NAXA 3DAEA 4MNEB 2EB3A 2J0KA 2GPHA 2C5NA 1Z57A 3KY2A 4ZS4A 3OOGA 4P4CA 4FZFB 3DBQA 3PJ1A 5CS6A 4AG8A 3EZVA 4L45A 3KXZA 2C0IA 3NNWA 3GFWA 1BL7A 2ITXA 3QX2A 2QQ7A 5FQDC 3G33A 4XRLA 1FVRA 1MQ4A 3G51A 3QKKA 4L01A 2QD9A 3NUUA 4KBAA 4LV7A 4WNKA 4TRLA 2VWBA 4XG6A 4V05A 3R01A 5C8KA 5L6WL 2P55A 3C4ZA 4AGWA 1OPJA 3ZSGA 3RPVA 1Q8UA 3IKAA 1P14A 3IW5A 2REIA 3FMMA 4LFIA 2VGPA 4XLVA 3RAWA 2WZJA 4I41A 3TG1A 3LCDA 3NYXA 1IAHA 1KE7A 3IK3A 3QQJA 3AT4A 1H1QA 3I6UA 4EHGA 1VEBA 3MY0A 3PJ8A 3FHRA 2XA4A 5AM6A 2XK3A 3AC3A 3K5UA 3LQ5A 1H1PA 1TQIA 2ERZE 2C5VA 4JR7A 4UEUA 4U8ZA 3MH1A 4FVPA 3OROA 4QQJA 5L8JA 1YI6A 3CE3A 1BKXA 5CU0A 4RA4A 2R5TA 4TY1A 3R9OA 5FP6A 2CNVA 4H36A 5DHJA 2BRNA 3FKLA 1UU3A 2CSNA 2RFEA 4CLJA 3PXRA 2PZRA 4C61A 3FZTA 3ZYAA 4C4GA 3ZC5A 4RJ7A 5I9VA 3OD6X 2ITZA 4OT6A 3W32A 3W10A 1PYXA 3VUDA 2VWIA 3CPBA 1YRPA 3U6JA 3RPOA 3IECA 4BZDA 4LQMA 4QMNA 3E63A 3C51A 3EIDA 2FGIA 4WBBB 3KXXA 4EUTA 3FWQA 3H3CA 3OBJA 2OW3A 4XP2A 4G6LA 4PL3A 3DJ6A 2WTDA 3DJ5A 1ZYDA 5LCJA 3KXMA 4GS6A 3GB2A 3A4OX 3I7BA 2XKDA 3NYNA 2WD1A 4NFNA 2BRGA 4UN0C 3IO7A 3NVMB 1REKA 3FQSA 5HCXA 3CD3A 3MH2A 3OEZA 4TWOA 3R2YA 4AX8A 3VBXA 4BTMA 5FXRA 5EQPA 2YIQA 3DGKA 4Q5HA 5JQ5A 3H4JA 4ENXA 3D2IA 2NNWB 4JQ7A 3DLZA 3GC7A 4ZP5A 1M7QA 2HZ4A 2UZLA 3QQGA 3CR0A 4ZK5A 5TKDA 1KV2A 1U4DA 3BHYA 3CJFA 3R7YA 3SHEA 3UZRA 4DG3E 2BDWA 4RWKA 4ZLYA 3FC1X 3RWQA 3UVQA 2HAKA 3R00A 3NR9A 3CS9A 3EFLA 4FC0A 4YNEA 4C02A 2ZMCA 2XBAA 3O8TA 4LG4A 4CFUA 5M4FA 2VTLA 3R7EA 4CQEA 3S00A 3R1QA 5EM7A 2WTCA 1W83A 3O8UA 4JLCA 4YC3A 4N57A 3SXRA 4QP6A 3W16A 4EOKA 5AAGA 2XH5A 5BPYA 5JEBA 2ESMA 4FG9A 3EQBA 1ZOGA 3MIYA 4TYJA 5EYKA 4EQMA 4QP8A 1G3NA 5AJQA 4B9DA 3EB0A 1Q8WA 4AFEA 3W0SA 4L52A 4LRJA 3OG7A 3I79A 2G2HA 3FZRA 5HO7A 2F7EE 3QQUA 4FKGA 4JR3A 3F2RA 5F1ZA 3HVCA 2IVTA 3LKMA 4NKSA 4GK4A 4EBVA 4I5HA 2WTKB 3PXYA 3TL8A 1JAMA 5CXHA 4RJ6A 3EJ1A 4G31A 3RTPA 4X2KA 3ZRKA 3G9LX 4G1WA 3OWKA 3SVVA 2ITPA 1U5QA 1SVHA 2IN6A 4QYEA 2PUNA 4IZAA 3SX9A 2J0JA 2XNNA 3AMYA 3DPKA 3QUPA 4MXCA 4OGRA 4WZYA 4J52A 4IW0A 2PZYA 3GOKA 3NNXA 4ZY4A 5K5XA 2JDOA 4BCKA 2FH9A 2VWWA 2PMNX 4TZRA 4JI9A 2C0TA 5EDRA 4J95A 4Z55A 5AUTA 1OPKA 5EYDA 4ITIA 2BUJA 4IWOA 2WIPA 4WKQA 4ERWA 4FTQA 5E8TA 3IGOA 5AUWA 1YOMA 4WG4A 3DNEA 2C0OA 4HNFA 4ZXTA 3SDJA 1DAWA 3ORNA 2WMRA 4RFZA 4ZY5A 3F69A 4JX3A 5CQUA 3W2OA 2P2IA 3H9FA 5M4CA 3OWLA 1CKIA 2VTSA 4J71A 4ASXA 3WE8A 1V0BA 2ZM4A 1B39A 2W4KA 2NPQA 3O51A 5EI2A 5D10A 5BMMA 3QQKA 3P1AA 2ZOQA 5ETFA 1BX6A 3TTIA 3OS3A 3NUAA 4W4WA 4B4LA 4C3FA 4CFVA 1O6YA 5HORA 3ORTA 5L3AA 4M67A 4X7QA 3D7TB 1Y6AA 4ACGA 3RWPA 1F5QA 3P5JC 3BPRA 2NO3A 5TF9A 4M0YA 4JG7A 4K1BA 4AWIA 4CEGA 2OXXA 4O0WA 1G8AA 3PSDA 3D5WA 3RMFA 3ZO1A 5A6OA 2ITUA 3DXPA 4AXDA 3CQUA 2Y4IC 2PY3A 4F7JA 4FZAB 5FGKA 4ZJVA 2X7FA 2KULA 3EN9A 4GMYA 1GZNA 4G3EA 4TWNA 4UZHA 3QCXA 4FTJA 3F66A 4CV9A 4NK9A 3VUGA 4E6QA 1OUYA 1MRYA 3DZQA 4EOJA 3WF8A 5L6PA 4ORKA 4QMTA 1Q97A 3LAUA 4FKJA 4JDJA 4XG2A 2A2AA 2BDFA 4XJ0A 4RIWA 3R7IA 4ALVA 5IH4A 5JN2A 4LOQA 2XJ2A 2XIKA 1VR2A 3GNIB 3L9NA 2XK8A 3QTXA 4Y5HA 3EHAA 5HKMA 3VS0A 1REJA 4TXCA 3R02A 3VS4A 4D1ZA 3PP1A 3SLSA 3PFYA 5JFWA 5LVMA 3BHVA 4V04A 3A7JA 3KGAA 5DA3A 3VWAA 4D1XA 4HYUA 3CY3A 5C01A 4HCVA 3ORPA 4O0RA 4RFMA 3SW4A 3EN6A 4G6NA 3ACJA 4GFOA 1BUHA 5M4UA 5JMSA 4LYNA 2GTMA 5CU4A 5B2KA 5BV3A 2C6IA 3BYVA 2CGWA 4FTNA 3QUDA 4IM0A 1XR1A 2QOBA 1ZYJA 5DWRA 1OECA 5LMKC 3ORXA 3LOKA 3MTLA 4ZTQA 5GNKA 2YM7A 3V6SA 4GRBA 3UBDA 4EZ7A 5E8WA 1SZMA 3AOXA 4BI2A 3AC4A 5CTPA 1KSWA 4R6VA 1UKHA 4GG7A 1J3HA 4X3FB 5CY3A 1AD5A 3GENA 2UZEA 3PRIA 3BWFA 3UIUA 3BGPA 4AACA 3CKWA 5AA9A 4DH7A 4AS0A 2XS0A 5I9YA 2XKEA 3MFTA 3ODYX 2GCDA 3JR1A 4GL9A 3TV6A 3W2RA 2OU7A 2PL0A 2YM6A 3KMWA 3P0MA 4RZWA 4UYAA 4Y73A 3RK5A 3W8LA 4ZAUA 5DI1A 2WO6A 1T45A 4FODA 4KA3A 3AC5A 4FKSA 4H3BA 3UOLA 1YHSA 4XRJA 4JG6A 2GNLA 4EHZA 4ANSA 5IPJA 3E92A 4XG9A 1UNLA 1NVRA 4R3PA 2A19B 1YXXA 4GYGA 3H9OA 2Y7JA 3QTZA 3BLHA 3GC0A 4YJOA 2DUVA 3A2CA 3RKBA 4KD1A 4XHKB 4EK3A 5A9UA 4X6QC 5HG9A 3AGMA 2XNEA 5EM8A 3EH9A 1PXMA 3KRLA 5IEXA 4XOYA 2IVVA 1TFFA 3BYMA 4M84A 3MA6A 4O96A 4A9SA 2B52A 2UW3A 4MXYA 1G8SA 3RALA 3PDTA 1PXJA 4FKOA 4H3QA 4ANMA 3GQLA 3HMOA 3OCSA 3QYZA 4PMSA 5BVKA 4DEGA 5BUJA 1Y8YA 5LWMA 2ZFYA 1OPLA 5AFVA 5F4NA 4O7PA 3ELJA 3K3IA 3CTQA 2YDJA 2PUIA 4FICA 4ANQA 1YDSE 3GT8A 4EK5A 3NW7A 4QP4A 2B4SB 3GU7A 1H0WA 5M51A 4YSMA 3S0OA 1ST4A 5AADA 2E9UA 2JITA 2VO3A 5IQCA 3NIZA 1E1XA 2W06A 4IWPA 5LARA 5J9ZA 2QOIA 5HG5A 4XG7A 3O8PA 4EYJA 3RHKA 3U4UA 3NUSA 3U9CA 2JBPA 3KF4A 4I6QA 3C0IA 1YXSA 4EOQA 4QNYA 3CXWA 2O65A 3UZPA 2WU7A 3IDBA 3LFNA 4H39A 4KWPA 3R83A 3MVHA 3HP2A 3COIA 3DK7A 4XEYA 2GFCA 5C1QB 5E8XA 4IE9A 2YA9A 2W4JA 2WEIA 3DQWA 4R3RA 1CKJA 2HXQA 3R9RA 1VYWA 4HVDA 5IDPA 2WOUA 5F95A 1VZOA 1MP8A 2WTIA 2I0EA 4QMQA 4A9YA 3KULB 5EHLA 3ZO3A 2J2IB 2YZLA 3R28A 4PRJA 2R3JA 4DF3A 2ONLC 2YCRA 3FSFA 4QMVA 4YJRA 1VJYA 2UZOA 2OH4A 3W2CA 4C59A 2X2MA 5HESA 3ZBFA 4IH8A 2BZKB 1NT2A 3CPCA 3LJ1A 4DAWA 3RK7A 1JSUA 3BGZA 3ORIA 2BHEA 4BDGA 5E8SA 3TZMA 4D28A 2IPXA 3C1XA 5IH6A 4DYMA 2IVUA 5KMOA 3VS2A 3ZXTA 4RIYA 4FG8A 4G9RA 4QDEA 3N4VA 5CSHA 5J95A 5IQHA 4F4PA 2GDOA 1NXKA 4GK2A 4DEBA 2YM8A 1TQPA 4WHZA 3WIKA 4RJ5A 3UOKA 4F0GA 5A6NA 2XM9A 3DNDA 2OZOA 5CAPA 2BIKB 2OJ9A 4MD7E 2P33A 3OC1A 1LR4A 4G3CA 5HIDA 3LIJA 1M52A 4AQKA 5M4IA 4XNEA 5GJDA 2FUMA 4G17A 2W1EA 3AXWA 5HZNA 3UGCA 3ORMA 5J1WA 3G15A 3Q5IA 3C0HA 3ZH8A 3UVRA 5IA3A 5CEIA 2E9OA 4QTDA 1OM1A 5LXMA 5TO8A 2GTNA 4XH6A 4FE2A 4TYGA 4NM7A 3DXNA 4YPSA 4BB4A 1GIHA 2GS7A 3IW8A 5CSXA 1O6LA 4ACDA 4O6EA 4NT4A 4H58A 5HLPA 4I4FA 4N70A 3TTJA 1H1SA 3L1SA 5BUIA 2XANA 3DOGA 2ITNA 4U43A 5DVRA 1ZOHA 3A99A 1WBTA 3TKHA 3QD2B 4IZ7A 4L00A 5DT0A 3V01A 4KS8A 4E93A 4EK8A 4HVIA 4O0UA 3UIBA 5CEOA 5LVPA 4OR5A 3ORZA 2Z7QA 4L7SA 4JDKA 3HV5A 3FZ1A 5DIAA 4HVHA 2C5XA 4GKIA 4BDCA 4FTTA 3DQXA 4CVAA 4GFMA 2OBJA 2Y8OA 3QX4A 4EHEA 3BEAA 5H2UA 4DEDA 3FQHA 3COHA 2X8EA 4C4JA 2I0YA 4EL9A 5J87A 5G1XA 4NWMA 3Q53A 4O82A 3HKOA 3QTSA 4IQ6A 4KIQA 3U55A 3KMUA 3MJ1A 5F94A 3GUBA 1QL6A 2CCIA 4DFNA 2UW5A 4W4YA 3GCVA 4AAYA 1T46A 3R30A 5HE3A 3CTJA 4FUXA 3BZ3A 4RVKA 2SRCA 4LOOA 4C36A 4ACMA 4F70A 3R73A 3ULZA 4IBMA 3FSKA 2R3OA 4I22A 5H8EA 3DTWA 3LJ2A 2PVMA 2X2LA 3COMA 4K33A 3F5UA 2YWVA 3VUMA 2EUFB 1BI8A 5ANDA 5EDPA 4TYHB 2GQGA 2IWIA 2CKOA 2XEZA 5AP3A 5JRQA 4U41A 4ITHA 3Q96A 3R6XA 5A4QA 3IGGA 1P5EA 1Y57A 3QTRA 4FZDB 2XJ1A 5EHOA 4FSWA 4O7RA 1UWJA 3JY9A 1XJDA 4USDA 2E9VA 4QMPA 3HECA 1O9UA 4FA2A 4I0TA 3C9WA 4L68A 4X2GA 4FR4A 4WD5A 3DB8A 3ROCA 3JVRA 3TUBA 3POOA 4CNHA 5HEZA 1OUKA 3HNGA 4C35A 3L8SA 3RGFA 3FPMA 4NYEA 3F3WA 4YLKA 2YERA 3QZHA 4W8DA 4PNKA 4DG2E 4GUEA 1BI7A 3TNIA 3DBEA 2OZAA 3WZDA 1JQHA 3OZ6A 1OGUA 1WCCA 4PY1A 1HCLA 1PYEA 4CCBA 3RAKA 4AXCA 5A4TA 3BYUA 2VTAA 4JBVA 4CRLA 5T3QA 1YI3A 3FLWA 3F7WA 3I4BA 4I0RA 4D4SA 2VO7A 2R7BA 5LWNA 3OVVA 3IONA 3PIXA 1JWHA 4YZNA 1M2RA 2C3IB 2W5AA 3FY0A 3U4WA 1XWSA 2VN9A 4LGHA 2R7IA 4IX4A 2HW6A 4M0ZA 4WSYA 4ZEGA 3VBVA 5CNNA 2J7TA 2H96A 3V3VA 3MH3A 4YZ9A 5HCZA 3R1NA 4YJNA 3Q4UA 5DRDA 3NFGB 5T6KA 4A9RA 5CSPA 4XG8A 5D1JA 5M53A 2F57A 4LV5A 4R1YA 4RX7A 3W0PA 3LFSA 4ZTSA 2C3LA 3D14A 5KMIA 2CLQA 2GHMA 3R9HA 3V5PA 4EJ7A 4APCA 2PVRA 3GP0A 3LMGA 3HV3A 3MYGA 4FBXA 2BIYA 2ETKA 5EG3A 5A3XA 4EC8A 5KHXA 3N9XA 3V04A 4D55A 3ZONA 5ETIA 4MNFA 4QYFA 3UDZA 4K0YA 4YJSA 3EQCA 3UC3A 3QA8A 4A4OA 2QO2A 4DEIA 2YJRA 3W18A 4G9CA 1P4OA 4WOVA 3CGFA 3BLRA 4BCNA 2CGXA 3HUBA 2B9HA 2R3RA 2X9FA 4LUEA 4MUQA 4CTBA 1KOAA 1OL1A 4WUAA 3DKOA 3UYTA 2GU8A 1W84A 2ZAZA 3ZUUA 3Q52A 3QF9A 4BCFA 2JIIA 4WIHA 3WARA 1FINA 4ACHA 4A7CA 3GCPA 4R77A 3HEGA 1UNGA 3Q04A 3S4QA 5FBNC 3F7ZA 2ERKA 3HMMA 3I60A 4IWQA 4OTDA 3ZHPC 3ZLSA 4NU1A 2LAVA 2A0CX 2DWBA 1PRYA 5E4HA 1WBVA 3ZSHA 4CKRA 2YWPA 2QCSA 2PVHA 4QEBA 4WG3A 5I4NA 4MXXA 5E1EA 3UIMA 2GS6A 2WKMA 2JIVA 5HHWA 1YHVA 4QPSA 2X4ZA 4MBJA 2X7OA 4FKLA 4C2VA 5KKRB 1ERKA 1RDQE 2X8DA 5DG5A 4BHNA 3M11A 1QPCA 4EK6A 3WZUA 2XM8A 3RNIA 4UWCA 3HP5A 2R3NA 4FYNA 3ZFXA 2PVFA 4YMJA 1YXTA 3CKXA 2F2UA 3GFEA 4K8AA 3RK9A 4PMPA 1NY3A 4C4IA 4BF2A 4IVCA 3LCTA 4ZSAA 3FXWA 3ORLA 2HELA 5H8BA 5HNGA 4Q9SA 4GKHA 3NUPA 3PVWA 2WMAA 4J53A 1YWVA 4DT8A 2YAKA 3PXKA 2UVZA 2QI8A 4M8TA 3C4FA 3BI6A 5AX3A 3UNZA 1JLUE 5I0BA 2CNQA 3HRCA 4B6LA 2WELA 5HIBA 3FMKA 3VBWA 3WILA 2R3QA 4E6DA 4F63A 3KRJA 2UVYA 3EN7A 3UMWA 3THBA 3DY7A 2XRUA 3C5UA 1Z9XA 3HV6A 4IAKA 3NYVA 4Y8DA 2JIUA 5IA4A 3HDNA 4JIAA 4FTAA 2CNUA 3QC4A 5JH6A 2VTJA 4L44A 4USEA 3BHUA 2WNTA 3DKCA 3TCPA 3VBQA 3ZTXA 5JQ8A 5CF8A 5M09A 1KUTA 2FVDA 3E87A 5CVHA 2HXLA 1R1WA 1CKPA 4D1SA 2PTKA 3MA3A 4U98A 3R8ZA 4A9UA 5CANA 3CLYA 3FY2A 5HCYA 1VYZA 4HYIA 4E1ZA 1IAJA 2OJFE 4JIKA 4ZTNA 3QRKA 3PLAE 2R3IA 4U45A 2QC6A 4YBJA 4X21A 3GU6A 4BBEA 2JKQA 4HYSA 3UPXA 5FDPA 5IQFA 2RF9A 1E9HA 4FIFA 4YLJA 4YLLA 5CAUA 4FV8A 5KCVA 3BKBA 5DRBA 3TKIA 5EDQA 4FEXA 1OL5A 1XHAA 3P4KA 2BALA 2EXMA 2BCJA 1GZKA 2KTYA 4AAAA 5JGDA 5C03A 4GCJA 1IA9A 2XIZA 2RL5A 5JGBA 5GJFA 1KV1A 5CX9A 5L2SA 4I6HA 4MKCA 5BX0A 4EH9A 2HY81 3R2BA 2O5KA 4BCPA 5HE0A 4V0GA 5DNRA 3LFQA 3F5GA 4YHJA 4UY9A 3NAYA 4JG8A 2UW7A 4F0FA 1BMKA 2OJGA 3HDMA 4YGAA 5HQ0A 5E7RA 3D2KA 4I21A 4EOSA 4HPUE 3D4QA 5B0XA 4GT5A 4FKVA 3VJNA 4YNOA 1FOTA 5I9WA 3TNPC 4EH2A 4BYIA 3O23A 4FJVA 5CQWA 3MFSA 1OIYA 4RWIA 4R1VA 2W1DA 2OSCA 3SQQA 3UO4A 2J4ZA 4KBKA 4FV3A 4AP7A 1WBPA 2QHMA 2RKUA 3BRBA 2BVAA 5BYYA 1OB3A 1XMMA 4YZDA 3KN5A 4ZS0A 4UX9A 3E7VA 5B2LA 4BJJA 2UUEA 4IB1A 3AKJA 3A4PA 3OHTA 4YJQA 4RVMA 3EOCA 4EK4A 5IF1A 4PTCA 4EH4A 4FL3A 2C6MA 4GH2A 1YKRA 4D9TA 4DHZA 4BICA 5BVDA 3Q60A 4P2KA 3WF5A 4DDGA 3E5AA 2J51A 2OO8X 3F6XA 3DK6A 3OXIA 3PSCA 2OF4A 2X7GA 5HO8A 4H1MA 3LJ0A 5BYLA 5JT2A 3NW5A 1AQ1A 4MXAA 4I92A 4PWNA 3NUNA 4MWHA 1ZY5A 3CY2A 2Z02A 3I1AA 4P7EA 4DEHA 2BROA 4KKEA 3T9TA 4OBOA 1H0VA 4QP2A 4FTRA 5BVEA 3DAJA 5AV3A 2UV2A 3BU5A 1YQJA 2OIDA 1ZARA 3MBLA 5FXSA 4DEAA 3V5QA 5CSVA 2YIYA 4FNWA 4PMTA 4EEVA 3QRTA 5LOHA 3QQLA 4U3YA 4BI1A 4O7YA 4U42A 5ANIA 3BEGA 5H8GA 2JBOA 3OOMA 4G16A 4DGLC 4DTAA 2IG7A 3KEXA 3VVHA 3OW4A 2B53A 2XCKA 3ZSIA 2GHGA 5E8YA 4JS8A 3NUYA 2BTSA 5E1SA 4RGJA 4FEUA 2WEVA 4NIFB 4EKKA 3DLSA 4G3DA 3O7LB 3NGAA 1PY5A 4MX9A 3TNQB 5HD4A 1OKWA 1K2PA 5EYCA 3W8QA 5HBJA 4CTCA 4PF4A 4U97A 3VAPA 2YZAA 2NRUA 4H05A 5EM5A 3MPAA 3LHJA 2UW6A 3JXWA 2P2HA 4FMQA 2W96B 3F82A 4FV1A 4KSQA 3H0ZA 4NL0A 3LLTA 5CXZA 2XBJA 3VQHA 4WRSA 3UP7A 4FIEA 2ZM1A 3LCKA 4S34A 5E9EA 4DINA 3UDSA 4FEWA 1H26A 4UXLA 3Q5ZA 5EOLA 2PU8A 5AWMA 5AUZA 3S2PA 3F3VA 2Q0NA 3R7UA 4FIJA 1L3RE 3MN3A 3GU5A 5LMKA 1OBGA 4HGTA 5CEMA 2WAJA 1JOWB 3N4TA 2WMQA 2W5HA 4II5A 2R0IA 4UV0A 5IDNA 3OCTA 1OZ1A 2PMLX 4RIXA 3OTVA 3NSZA 5IU2A 2CKPA 1YW2A 3P79A 3QD4A 3Q9WA 4U3ZA 5CU2A 4DG0E 2YFXA 3TACA 4AZEA 2DS1A 2OKRA 4CT2A 3W2QA 1ZZLA 3HYHA 5HVKA 4DHJA 2GMXA 3RPSA 2HENA 3OUKA 3QZGA 5AV1A 4DE4A 4PP9A 2JKMA 2VUWA 3AKKA 4FZ7A 4OTQA 4LUDA 3WIGA 5IUHA 3GXLA 1LEWA 3N4UA 5K9IA 2WMUA 4TTHB 2WHBA 4O0SA 2XB7A 2C6TA 3T8OA 5HLNA 3Q6UA 2EB2A 4B0GA 2QOFA 4GU6A 4ZZOA 2HIWA 5FP5A 2OF2A 2QOQA 3AC1A 4FV2A 4PDPA 2W7XA 3PA5A 3SG9A 3L9LA 4IZYA 1J7UA 3SOCA 4F99A 3TXOA 2IJMA 3PIZA 4IB5A 3D83A 3KQ7A 1G8JA 4IACA 2QR8A 3QKMA 4OTWA 4BCMA 4GSBA 3PFQA 4Z7GA 1H00A 5J1VA 2UZBA 3O0GA 3VHKA 2VTIA 4R7HA 5CAOA 2EXCX 2NRYA 1RW8A 1YWRA 4CXAA 2PSQA 3DZOA 3EWHA 3TUDA 1BLXA 1PMVA 3D7TA 2JDSA 3TEIA 5CAVA 1WBWA 3PPZA 4DGMA 3CJGA 2XUUA 4UWBA 5ITAA 2XIXA 2YM3A 3NWWA 4AQCA 4J8MA 4RVLA 3MV5A 4A4XA 2C68A 3QTQA 4HJOA 4A07A 1SVGA 3ZBXA 2UW9A 5L2IA 4MH7A 3UVPA 3LXKA 3NUXA 4XG3A 3WE4A 3LFEA 1PF8A 1WBOA 2JGZA 2QONA 5A14A 4KNBA 1MRUA 1OIUA 1ZAOA 2IZTA 4TYIA 1QMZA 3C7QA 4FV4A 2CDZA 4N6YA 4IJ9A 5EK7A 3LFAA 2X39A 5A4EA 1SMHA 4BCJA 3AC8A 2FA2A 1NVSA 3EFKA 4Z3VA 5FLFA 4FL1A 3QC9A 2JDVA 3GVUA 5I9XA 4EKLA 1PXPA 5DT4A 5DEWA 4RWJA 3W0NA 2C6KA 2J0IA 4IHPA 3R8UA 4JX7A 4USFA 3QXPA 4ACCA 5BVOA 5CVFA 4EUUA 2WMTA 5CNOA 5HBHA 1ZMWA 1Y6BA 2QURA 3QRJA 4DH8A 3SA0A 2BZIB 5EQYA 4D4YA 4Z7HA 2VNYA 2XRWA 3LQ3A 2BRBA 2HY0A 3UNKA 3C50A 3R1YA 4JAIA 2PVKA 3UOJA 2J0LA 4C3RA 5HNIX 5D12A 2W1IA 3EFJA 4O7TA 2VRXA 4U6RA 3W1FA 3A7GA 4AF3A 4CG8A 4HVGA 3E3BX 3R8VA 4D58A 3MVLA 5ETAA 2X8IA 4YHTA 3AMBA 2ONLA 2Z60A 3QGWA 5AUUA 1Y91A 2C6EA 4QMLA 5FD2A 4GG5A 2PVNA 3DU8A 4LI5A 3WOWA 2X9EA 3IW7A 2VX1A 5D41A 3UQGA 2F4JA 4Q9ZA 2V55A 5TT7A 2WTKC 4FUYA 5F9EA 2BKKA 3FHIA 3QQHA 2C5OA 2VNWA 2WTJA 3K3JA 3OW3A 4QQTA 2W17A 2GFSA 4EBWA 5JRSA 4ZZNA 2WQOA 3A61A 3EZRA 4RJ8A 3DXQA 4RJ3A 3LCSA 4IX3A 3PG3A 4QMUA 4U9AA 3VS5A