4PDYA

Crystal structure of aminoglycoside phosphotransferase from alicyclobacillus acidocaldarius subsp. acidocaldarius dsm 446
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
337
structure length
332
Chain Sequence
RLGSRSQAPLIPQAVVSKYDLAIQQRHADGNIEVWTDSKGRRYAAKRSSIAPAHCRIMVQCLRHAQEQGFTKFARFVTTSSNAPYVRHGDFTYYVTEWVSGQPANFGLPEHVAQTAYTLAQFHEATRSFRTDWKDDVFGLFQARWRDLRQMWLGADRKREKDAFDQLLLSMRDELHRDAAESLALFEDRDVIAYLEAERSSGGWCHLDVIPSNCLYTPQHQVVLIDFELARPAPRALDMAHLLRRSLERGNWDGHLAYACFLHFDAVRNIPKSEYRAVEAILRFPYLPWRIAHARYHFAADPSQLDALQQYAVQAEKRQAFLASLRQQVEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminoglycoside phosphotransferase from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Transferase
molecule keywords Aminoglycoside phosphotransferase
total genus 119
structure length 332
sequence length 337
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4pdyA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4pdyA02
2W1ZA 4EWHA 2UZTA 3ZO2A 3BX5A 2B55A 2XCHA 4S2ZA 2IO6A 5M07A 3DAJA 3G33A 3KK9A 1U46A 2R0IA 5HZNA 2PE2A 3LFCA 1PRYA 1V0BA 1GIJA 3PIXA 5KX8A 3WOWA 2JITA 4B7TA 1RE8A 4CLIA 1NA7A 2BZKB 5AX9A 2XK4A 4UXLA 5DBXA 1KV1A 1P4FA 3BI6A 5T3QA 3BZ3A 4JNWA 5AWMA 4AX8A 2WMXA 3QTWA 4G3EA 4X6QC 5BYYA 4WNKA 2R9SA 3LCOA 1Y6BA 4C33A 3II5A 3EJ1A 3F7WA 3OFMA 4RVLA 4H1MA 5J95A 5LMKC 4FIIA 4QQJA 2F57A 4TYHB 5AUVA 1DAWA 1PKDA 2BRGA 2JIIA 3OP5A 2BRMA 3P7BA 3RHKA 3EQPA 4CG9A 3I81A 2ITQA 3RCDA 5IQAA 4JDHA 3GB2A 4O7ZA 4D4YA 3F5XA 3ORMA 2W7XA 3MVJA 4UWCA 3ZS5A 4GK4A 3OHTA 4B6LA 3MSSA 4BVUA 2XKEA 4IVBA 4U80A 1FGIA 5IH6A 2OI4X 4RIYB 4UYAA 3EFWA 3OS3A 4UY9A 5EM6A 5D7AA 4XYFA 3WF6A 5FBNC 3D5VA 4H3PA 4MQ2A 3LXLA 5BVEA 4L3LA 4XLIA 3ZM9A 4F6WA 3KMMA 4OLIA 3CGOA 4G1WA 4U41A 2HXLA 2R3KA 2UVZA 3AMAA 4XNEA 4RLLA 2FA2A 4I24A 1MQ4A 4FODA 3RK5A 1OGUA 3KRRA 3S3IA 4UX9A 3BLHA 4FT0A 3R9OA 2A4LA 3DDQA 4O0TA 5AP3A 4E4LA 2WZJA 1KWPA 4O38A 3PE2A 1J1CA 3AT2A 5C27A 4R7IA 3HV6A 2PUPA 3QQJA 4HW7A 2YM5A 3FQHA 3FZPA 1NT2A 4CV9A 4RWKA 2A0CX 2XNMA 3I79A 4J95A 3KGAA 4X6RA 4ZSJA 4C38A 5ANJA 4GIHA 1BI7A 3SVVA 4I93A 4Z7HA 3VVHA 2QONA 3KVXA 5B0XA 2GSFA 2CNQA 4FMQA 4RMZA 3MY5A 4FC0A 1J1BA 2O8YA 1P4OA 1ZOGA 1UU3A 2OJFE 4GT4A 2FYSA 5TOZA 5KZIA 5K5NA 3I5NA 2R3MA 3REPA 3NVMB 4TYGA 4DH3A 1J7LA 3QQHA 4ASZA 1URCA 3VBQA 4EYJA 4AQCA 4I41A 4AFJA 4OTDA 4FZ7A 4ZS4A 2CLQA 3W0RA 1F0QA 4BCOA 1E1XA 2V55A 4JR7A 1NVQA 1SVHA 1QCFA 3EQCA 3F69A 3MFTA 3R2BA 2CNVA 2F2UA 4AZFA 4D0XA 3FC1X 4IADA 4BC6A 4R7HA 3LJ1A 2CN8A 2Z8CA 1A48A 3AC5A 2PZ5A 5CNNA 3AD6A 4RA4A 1H00A 4H58A 2OXDA 4IE9A 1BYGA 3ZXZA 2GDOA 4RQVA 5EOBA 2C6IA 3SG9A 4LFIA 2YDKA 3NUNA 4I0RA 1XBAA 5AP0A 4FSNA 3VS2A 4ERKA 2G9XA 3SRVB 1GZKA 2WGJA 2UW5A 2EU9A 4LM5A 3A60A 4IAFA 3MDYA 4BDHA 3QTSA 4O0WA 3BWFA 4ANLA 5CI6A 4MEDA 5LVOA 1MP8A 5LWMA 2ZOQA 3CPCA 4IANA 4AT4A 4QTEA 2YJSA 3EOCA 3LQ3A 3VBWA 5HTCA 5G1XA 3DB6A 4U81A 4CV8A 2XUUA 4C36A 5CXZA 4BTKA 2I0YA 2WMTA 4OT5A 5F9EA 4FI1A 5CANA 2LAVA 1OKWA 4EUTA 4KBKA 5D7VA 4OUCA 3QBNA 2UW6A 3LLTA 4U44A 5HD4A 4RWJA 1YI3A 2C5VA 2OK1A 2XM8A 3R8MA 3VBVA 4YPDA 3ORTA 5CEOA 1OI9A 5KE0A 3WYXA 4JQ8A 4GVJA 2C69A 5A3XA 4I20A 3SOAA 3JR1A 3VS0A 1UWHA 3VUIA 2FGIA 3VWAA 3VW8A 1SNUA 5HU3A 3ZLXA 4AZSA 4IWQA 2VTHA 4O7SA 3RNIA 3COMA 3GOKA 2Y7JA 1Q3DA 2HCKA 3KXMA 4PL4A 2BCJA 4L68A 2R3OA 2PK9A 3N4UA 4X3FC 1IA8A 4FG7A 4QMNA 3O8PA 3GU6A 4IBMA 3TI1A 2BAQA 5DI1A 3ACJA 5K9IA 3R1YA 1R0PA 2JFMA 4UBAA 4KA3A 5LOHA 5IDPA 3W55A 3DKGA 3NW7A 3JVRA 1LUFA 2XA4A 2GNFA 3KB7A 3P79A 4K0YA 4L3JA 2YISA 3I4BA 3BV2A 4RQKA 4F08A 3EN4A 1OIUA 4QQTA 5I9WA 2BRHA 1GNGA 4CRLA 2HELA 2BZIB 3UMWA 4GK3A 3OW4A 5AP2A 1W82A 2ITVA 3QKMA 4J98A 2OF2A 2R3NA 2W4JA 2UZLA 3BGPA 2ZV7A 3SD0A 4DFLA 4FKPA 4RIWB 1WVWA 1BL7A 4QMLA 2C5OA 1S9IA 2UZVA 3IW4A 4YLKA 5CVHA 4YP8A 2PU8A 3PXKA 3LQ8A 4FVQA 2YM3A 3R1QA 4Y5QA 2WB8A 3FMHA 4KAOA 5CSPA 3CS9A 3CEKA 2BIYA 3HEGA 3MN3A 2W96B 2VTQA 4FSTA 5E92A 3EB0A 4C35A 1SMHA 4JJRA 4IC7A 1LEWA 4UZHA 5CEMA 3VO3A 1W8CA 1APME 2QU5A 5A4QA 3RAKA 4FTIA 3LAUA 4GCJA 4GJ2A 3RGFA 3ZUUA 4LRKA 4JG7A 3DKFA 3O50A 4FUYA 3BYUA 4YJRA 5T6KA 1Q8ZA 2NP8A 4NFMA 2WELA 4XG8A 5EI6A 2WMBA 3HMPA 5HE2A 4DA5A 3F5PA 2YEXA 3QLFA 4JL9A 5ANIA 2X8IA 2FSMX 2AYPA 3TTJA 3RTPA 2Y8OA 4TYHA 3VJOA 4O0VA 2J0JA 4I5PA 4UALA 4F65A 4D5HA 1M2QA 4DFBA 3I7BA 4RRVA 2B1PA 3QUPA 4AG8A 3SW4A 4GUEA 4NH1A 4PL5A 4QQCA 3W2CA 3G9LX 3WZDA 4DGOA 3HMOA 3NIEA 3VBYA 4E26A 4IAZA 3FL5A 2E9PA 1W98A 4YNOA 4FV5A 4ZEGA 1URWA 5DHJA 4NM3A 4YJTA 4BB4A 1BI8A 2HK5A 5HG8A 3ATSA 3DDPA 3NAYA 3KN5A 4XRLA 2GFSA 4RFMA 2IN6A 3HLLA 5CVFA 3OCBA 5EW8A 2B9IA 2G2HA 3PPKA 4PDOA 4EH5A 2FSTX 5I9XA 2R7BA 3R00A 4XG2A 1H24A 3CJGA 2EUFB 3C4XA 3OTUA 2DUVA 4KD1A 5CT0A 2CSNA 4B8LA 3EWHA 4DEDA 4YC3A 4XG7A 1FPUA 2VTMA 4YZNA 5B7VA 2NO3A 3FXWA 4MD7E 1GZ8A 2BZHB 5FBOA 2Y4PA 1NVRA 5H9BA 4FKWA 4ZZNA 2BVAA 2W1CA 4PUZA 5AUUA 1BLXA 5CF6A 1IAJA 4YJNA 3SC1A 3KKVA 2YITA 2VNWA 4AU8A 4FTKA 4C2WA 3QUEA 4E6DA 1WVYA 3R8ZA 3PSDA 4ALVA 4DH1A 4FUXA 4GK2A 1O6LA 5CQWA 3MY0A 4LG4A 3VHKA 5LVLA 4ERWA 3CQUA 4TWPA 3COKA 4BDDA 4NSTA 4O82A 4RJ3A 3QHWA 5IISA 3HECA 1PY5A 3GGFA 4L00A 3DB8A 4P5ZA 3GBZA 2ZDTA 5H8BA 5C4KA 3DXQA 1M7NA 3TNPC 3WZUA 1BMKA 3BPRA 4FIHA 3QCQA 4ID7A 5CSXA 4G5PA 4FT3A 4IM2A 3A61A 2OO8X 3ZFMA 1OPJA 2XYNA 3ZLSA 1XH5A 2YM4A 4FV3A 3QGYA 4FKVA 1OL1A 4AXAA 4WKQA 1GZNA 5IQIA 3FYJX 4QYHA 3SOCA 4LV5A 3DV3A 3CP9A 3SLSA 4L45A 2G2FA 3AMBA 4QMUA 4N4SA 4D1SA 2R2PA 3DAEA 3BEGA 4A9YA 4EK4A 3RM7A 5E9EA 4DFNA 2Q0NA 3OD6X 2IPXA 4DAWA 2G1TA 3GQIA 3EH9A 3HP5A 4NKAA 4EK8A 2HWPA 4Y85A 4FSMA 4D2RA 1H27A 3R7IA 4GT5A 5L2SA 1PXLA 4Z3VA 2P2IA 3OT8A 3KULB 4FG8A 1VZOA 3PY3A 4QMPA 3Q32A 2CDZA 2OICA 2HZNA 2UW8A 3IG7A 5AM7A 4C0TA 3SW7A 3DKCA 3IECA 3QD4A 4R7BA 4K8AA 2FO0A 2V0DA 3U8WA 4X3FA 4EQMA 2YIYA 2VUWA 3LMIA 3BU6A 3G9NA 3V5TA 3KU2A 2X81A 3WI6A 4L7SA 4FV7A 2QO7A 2I40A 2QOBA 4FEWA 3VUGA 4XG3A 4JBPA 5HIDA 1GJOA 3BLRA 3BQRA 2VTSA 1DM2A 3SXRA 5JH6A 4R78A 4Y8DA 2WQEA 5ACBC 3WARA 5ANOA 3W8QA 2J90A 4GUBA 2QOKA 5EHYA 4FZ6A 5L6PA 4LOOA 1EH4A 4PMSA 1UKIA 3BIZA 4M97A 4R3CA 4MD8E 3R22A 2XNPA 2YA9A 2XH5A 2WIHA 3F82A 5FXQA 2J0MB 1V0OA 1GAGA 3ALOA 5B2LA 5M08A 2VO3A 4L6QA 4I6HA 3O7LB 3TG1A 2QD9A 2I0HA 2VN9A 4ZSGA 2E9UA 4HZRA 4O22A 4YJPA 4IX4A 4NKSA 3U6IA 4JX7A 3LMHA 2OBJA 3H0YA 5JMSA 1YOMA 2FUMA 2HZIA 3QZIA 5FM3A 4PP7A 2EB3A 4NM0A 2YIQA 2GMXA 2WHBA 3PZHA 4NJ3A 4I5HA 5HG7A 4AGWA 5LMBA 1REKA 1IAHA 4IVCA 4XOZA 4BTFA 2IVTA 2QG5A 3OCSA 2F7ZE 4BGGA 4AT5A 4QMQA 5AP1A 4H3QA 4RIWA 3D5XA 3R7VA 5F95A 2BALA 3QTZA 1V1KA 3EYGA 3L8VA 4AFEA 3TUCA 2XP2A 5FP6A 5HESA 2GQSA 2ZM3A 5EW3A 4D4RA 1QL6A 1JNKA 3QWJA 2YIXA 4LYNA 4R5SA 3LHJA 4USFA 2OU7A 1R1WA 2OZAA 5DYJA 3BELA 3D9VA 3FI4A 2BROA 3KXXA 5A6NA 2GS6A 1UA2A 1MQBA 3WIKA 3LCTA 4Y83A 4RIYA 5E8ZA 4BN1A 4QYFA 4F0GA 3ETAA 4IB0A 4KBAA 5E8UA 2GTNA 3MESA 4MKCA 3EQBA 4EOKA 2C3JA 5A4CA 5CQUA 2RG5A 1M2RA 4MXAA 2A2AA 5HORA 3FZOA 1I09A 2VO7A 1KSWA 3QTXA 2F7EE 4YZCA 5AMNA 4E5BA 4WIHA 3PSBA 4FTOA 5H2UA 2IZRA 5IU2A 2WQBA 4O0XA 3GU7A 2WMVA 3EN9A 2WEVA 5DT0A 4HVHA 1A9UA 2OJJA 4IACA 2VWWA 2IVVA 3DBDA 3F88A 4RJ4A 4KSPA 4RIOA 4E5WA 3SXSA 3U6JA 3R9NA 2DQ7X 3A62A 3F2NA 3LXKA 2UW3A 3IS5A 5AP5A 4EEVA 5F1ZA 1H01A 1Q62A 2YCRA 4IZAA 1HCKA 4ZOGA 2OKRA 5CASA 5A4LA 2OSCA 3Q52A 2J51A 3QXPA 3V3VA 1OPLA 5FRIA 3GVUA 3CSVA 1K9AA 2W5BA 4GS6A 5C01A 2Y6OA 3DXNA 3DJ7A 4OBOA 2BDFA 3L9MA 3UVPA 4F9CA 4OTHA 3OXZA 1O6YA 1XJDA 4IM3A 4EH4A 3GENA 4B4LA 3P1AA 4E6QA 3L8SA 4CFFA 3UTOA 5C26A 5CF8A 4TN6A 3BE9A 4MBIA 5D1JA 4ACGA 3KMWA 5EW9A 3IW6A 3DJ5A 4ZJJA 2P2HA 3WF7A 5E8SA 2OJIA 5LWNA 4FV2A 4ZXTA 1QPJA 2OWBA 2OFVA 5GJDA 4YHFA 1STCE 4UYNA 4YTFA 3R30A 1Q41A 1PKGA 3FV8A 4TYEA 4DGGA 4F64A 3UG1A 2ITNA 2UW9A 3R9DA 5KMLA 1X8BA 4AOIA 3E8NA 3BU3A 2R4BA 3F61A 3MFSA 5E4HA 4XLVA 3TNWA 4CFUA 1PYEA 2NRUA 4BDBA 3I1AA 4D58A 4KABA 4MK0A 3HYHA 3UE4A 2ZV8A 5A14A 4PTEA 3LFEA 3W32A 4YU2A 5CT7A 3ALNA 4FYOA 3U9CA 5HE1A 2QCSA 1XR1A 2HXQA 3NIZA 2PUUA 1KE7A 4IDVA 3BYSA 5FQDC 3S0OA 4P4CA 3ZLYA 4FSRA 2NNWB 3UPZA 3WF5A 4D9TA 5A4TA 3OMVA 5KMJA 3G0FA 3UIBA 1JAMA 4MNEB 2C3IB 2HW7A 4G31A 3UNZA 4M7IA 2YIRA 2JKQA 3ODYX 4FIFA 5DWRA 2ZVAA 3ANRA 3WYYA 3B8RA 1IR3A 1YOLA 1E9HA 4AAAA 2X7OA 4F0IA 4XRJA 3ZCLA 3LMGA 4HVSA 3FI2A 4C61A 3AMYA 2B0QA 2EWAA 2UUEA 2WFYA 1PMVA 3DBFA 3MA3A 3TUBA 2CHLA 2XKCA 4IZ5A 4YC6A 2C6TA 4RBLA 3QHRA 3G6GA 4IHPA 5CEPA 5I9VA 2XB7A 3KY2A 2WO6A 5D12A 3I5ZA 4G6LA 2RF9A 4K77A 3PPZA 5HIEA 1OL2A 1QPEA 4CMTA 4CMUA 3CY2A 5AV0A 3FL4A 4AW2A 3EFJA 3C9WA 2QOFA 2XJ2A 4ITJA 4RIXB 4U97A 2CLXA 3AXWA 2WTCA 4M69B 3FUPA 4WO5A 4FV6A 5I0BA 5DR2A 4WRSA 4ZLZA 1YHSA 3TJDA 4P2KA 1ZYJA 1M52A 4C3PA 5KHWA 4CVAA 4ITHA 5TF9A 3GNIB 1OPKA 4AF3A 2OF4A 2PMLX 4NW6A 1Y57A 4FGRA 1Q8YA 2F4JA 3DA6A 4K2RA 2VRXA 4CZTA 3E88A 3HUCA 1JOWB 3L9PA 1U5QA 4RWLA 1Y8YA 1OB3A 3QRTA 3MPTA 2G15A 4L3PA 4UN0C 2G01A 5A6OA 3UDBA 3ODZX 4NT4A 2WOUA 5J8IA 5M57A 3EKKA 5CZIA 3ZM4A 1ND4A 1CM8A 2FH9A 3NDMA 4ZTHA 3VAPA 3W2RA 3HRFA 1SZMA 5JKGA 2AC5A 3D5WA 4GL9A 3QRIA 2PTKA 3QCSA 5CLPA 3EN5A 3LXNA 2CNUA 4E6AA 4HVDA 4CCUA 4JR3A 2ESMA 3ERKA 5EDQA 4X2FA 3RKBA 3RALA 4DF3A 1U54B 2BRNA 3QA0A 2I1MA 2IW9A 4DGNA 4RVKA 3QRUA 5FXRA 4MXCA 4XUFA 3K3IA 4ZAUA 2GQRA 3PWYA 5HVYA 4YLJA 4DH7A 2QLUA 4RVTA 5BYLA 3GU8A 4FKJA 5EG3A 4CT1A 3PVBA 3SA0A 2WTJA 3UODA 1OZ1A 2B53A 2YAAA 3BBTB 3EZRA 3QC4A 4IC8A 3T3VA 4AGUA 3OBJA 5F20A 4HYUA 3DLZA 4N6ZA 3U54A 3UQGA 3MTLA 4G16A 4RJ5A 3RM6A 1YDSE 4L9IA 3ZBFA 3ZH8A 4BHZA 5C8NA 4ZTSA 5HX6A 3L9NA 4FSZA 4UV0A 4D0WA 3B2TA 2C5NA 3H0ZA 3BYVA 1YVJA 4EHZA 5HIBA 4OTQA 3FPQA 1FINA 4QYYA 2RL5A 3F66A 2HENA 4V05A 5DNRA 3DLSA 2VTJA 1RDQE 1YI4A 1HOWA 3RPRA 4Y95A 5CEQA 4WNPA 5J9YA 1WBWA 3E92A 4CFWA 3RPSA 4TRLA 5FTOA 3VUDA 1NVSA 2PVJA 3UVQA 5LMAA 2J0KA 4YNEA 3JY0A 4O2ZA 3CR0A 4YR8A 2DS1A 2EXCX 4D1XA 3OOGA 2XNEA 3O17A 4WD5A 3LVPA 4OT6A 4BCHA 2WU7A 3FHIA 3AQVA 1ERKA 4WNMA 3SKCA 4QP9A 2XIXA 3FE3A 2PYWA 5HU9A 5A46A 1HCLA 5IMXA 4BIDA 4OTWA 2VTPA 2CJMA 4F9YA 1OUKA 3HX4A 3LJ2A 5DVRA 2Z60A 3QLGA 4YO4A 4RX7A 3LKMA 1J7UA 2PZRA 1KE9A 3Q6WA 3E7VA 2C6EA 3V8SA 5CU2A 2HY0A 2ZMCA 4FEQA 3FQEA 3KCKA 3K54A 5HBEA 2ETMA 3VS4A 4QYEA 3SGCA 2BR1A 4QO9A 5ACKA 1A06A 5HCXA 4G3FA 3ELJA 2UZNA 2BHHA 1F5QA 4HCUA 4MH7A 5M56A 1UVRA 1WCCA 3BKBA 4O21A 4HPUE 3W0QA 5IUGA 4U98A 3G5DA 2BIKB 3DY7A 4O7OA 2WQOA 2J2IB 2W1EA 4FICA 3MH3A 3JUHA 3LQ5A 4RFZA 3TNIA 1YOJA 4CT2A 3NAXA 4UB7A 5HEZA 1H1WA 4N57A 5DR6A 4FKSA 2WTKC 2RFNA 4RC2A 3IKAA 4G3GA 3DBQA 4GKIA 4NIFB 3K2LA 1R39A 3GCPA 2EB2A 3Q4TA 3R83A 2RFEA 1B39A 4YJSA 5E8VA 3V5QA 1OL5A 5HVJA 4FR4A 4PL3A 3NW5A 1PF8A 3VRZA 1FQ1B 3UNKA 2QU6A 3BRBA 4NYEA 5GJFA 3VS1A 4NCTC 3DPKA 3LFDA 4IB1A 4U79A 4ARKA 4DBXA 5J9LA 3UC3A 5IA2A 2VWIA 5E90A 1OM1A 3ZDUA 4BI0A 3G51A 3QCXA 4GYGA 4EJ7A 5KMMA 3KREA 3P9JA 3W33A 4DFXE 3LW0A 2QG7A 1CDKA 5FTGA 5AIKA 3ROYA 5DIAA 4AZTA 4UXQA 3IDBA 3QQUA 3H9OA 2F7XE 2R7IA 3DAKA 3IOKA 4HJOA 5KMKA 1H4LA 1JSVA 1QMZA 3N4VA 5F4NA 3MA6A 3WF8A 4O7WA 4BZNA 4C62A 4AZEA 5BVWA 3TEIA 5IA4A 1PXIA 4IEBA 3ZDIA 3RVGA 3NNUA 4X0MA 2C6KA 2VWXA 4J71A 3V5PA 1Q24A 3PRFA 3VHEA 4EL9A 5LJJA 4U45A 4FKUA 1OVEA 2XK3A 4KIQA 4E8AA 5FM2A 4EORA 2XEYA 3UP2A 1R78A 1O6KA 3T3UA 4LRJA 3EQFA 2Z7QA 3CY3A 4USEA 4FEVA 3EQDA 4AT3A 5IA0A 3MBLA 5HGIA 3O71A 5E8WA 4BCIA 4O6LA 2B9FA 2XS0A 2W1FA 3CQWA 4JBQA 1SVEA 3PG1A 4APPA 4ALWA 3AC2A 1J3HA 3RCJA 1RQQA 3UGCA 4I5CA 3MY1A 1KV2A 4I4EA 3BHHA 2GHMA 3CBLA 3ZU7A 1CTPE 1PMEA 4KUJA 4AGCA 2QR8A 1BUHA 2PVMA 3BHVA 2WEIA 4DITA 2R3HA 4G3DA 3WF9A 5BNJA 5K5XA 5AA8A 2XBAA 2X8EA 4GG5A 3HZTA 3WZKA 3FMDA 4PWNA 3MJ2A 3VN9A 3Q96A 1FVRA 4FL3A 4IFGA 4U9AA 4EYMA 5BYZA 4BY9E 4AN9A 4QP3A 4DEIA 5A9UA 2A1AB 3K5VA 1WVXA 1MRVA 4IX6A 4CTBA 4IAAA 4XS2A 1IA9A 4HYSA 2IG7A 1IASA 3CKXA 5AV1A 4GH2A 3R7EA 2R3JA 5K4JA 3Q4UA 1ZOHA 3B8QA 3R7OA 3A2CA 3FLWA 4Q5HA 3PJ2A 3FLSA 4YGAA 2J5FA 4QMVA 5JFWA 4M14A 2WMWA 3E93A 4ZZOA 1S9JA 2GTMA 4FNXA 4EUUA 5DLSA 1ZMVA 3JVSA 3W1FA 3TL8A 3I0QA 3O23A 2WXVA 3IPHA 4TT7A 3ZSIA 2W1HA 5L3AA 3RAWA 3ZEWA 4AWIA 4K6ZA 4A4XA 2W5HA 2UZBA 3PJ3A 2YIWA 3ORIA 1QPCA 3LOKA 4EBVA 5AAGA 2WAJA 2PE0A 3E5AA 2QODA 5IEYA 3LCKA 2C0TA 1W84A 4F7SA 3BV3A 3Q04A 4XCUA 3POOA 3PLSA 4BDCA 1UWJA 1WBNA 3FKOA 4S34A 4PTGA 1AQ1A 3KXHA 3PVUA 2PE1A 4P5QA 2OG8A 4YZBA 5BQ0A 3NEWA 2BPMA 2O3PA 4A9TA 1YKRA 3QFVA 3RK9A 4QTDA 4FIEA 3ULIA 4J8NA 4JQEA 2PWLA 3FZRA 4QP6A 3UZTA 3F5UA 5DRDA 3UO5A 2X2MA 5JT2A 2C1AA 4HVIA 3W16A 3HVCA 3H9FA 4L67A 4RPVA 5HX8A 4QNYA 2UZOA 5JSMA 5DFPA 3F2AA 4QMZA 3QGWA 5EYCA 2C6DA 3ZFXA 3BQCA 2F2CB 2P33A 3QWKA 4O7RA 4RC3A 2C47A 4I0SA 2GNHA 4HGLA 1UU8A 3PYYA 3U4WA 2AUHA 3ZC6A 3RZBA 1IRKA 4IVAA 4DEGA 2X6EA 4F6SA 3KF4A 3CTQA 1R3CA 4M68A 3DJ6A 4JIAA 3IQ7A 3R01A 4M67A 1U59A 4M8TA 4RJ6A 3UZRA 5LQFA 1YXVA 4QP8A 5A4EA 4G9CA 2ZV9A 2XKDA 3QU0A 4XP2A 3TKHA 5CAVA 3QALE 4DE4A 4QTCA 1Q61A 4TYIA 5ANGA 3OBGA 4TWCA 3S95A 4BR3A 3D4QA 5L8KA 4BCMA 5LCJA 5BX0A 3BEAA 3O8UA 3UQCA 5EYMA 3W0PA 3QXOA 4FKQA 1VYZA 2OZOA 2QC6A 2UVXA 1CKJA 1WBOA 2PVRA 3FYKX 4XMOA 3D14A 1XH9A 2HYYA 2QOLA 4AN3A 3IW8A 1ZMUA 4JXFA 4ZTNA 1FVVA 5AP7A 2X2KA 2X4ZA 3ZUVA 4O96A 3HKOA 3R21A 3FC2A 3UYTA 3AC3A 3GI3A 2VWZA 5EOLA 3MVMA 2JDTA 3ZLWA 4ZSEA 3SQQA 4O7TA 2J6MA 3CLYA 3DQXA 1YDTE 3KCFA 2JEDA 4LOPA 4V0GA 4ACDA 5ITAA 2YERA 3MTFA 4CNHA 3MH0A 5JFSA 4G5JA 2B54A 4TW9A 1PXPA 3QL8A 2Y4IB 3EYHA 1IEPA 3BHYA 3H10A 4S31A 5HD7A 3KMUA 2V7OA 4MCVA 3RI1A 5M53A 1R0EA 3FMEA 2Z7SA 4FG9A 2O2UA 4A9SA 1SYKA 4NZWB 1XH6A 3IW7A 2UW0A 2BFYA 5TKDA 2XIZA 4MWHA 4DFZE 4KS7A 4ZMEA 3HDMA 5F94A 2PY3A 3T8OA 4EOOA 5EQPA 4ZY6A 3DOGA 3V5WA 3HNGA 3Q9WA 4RWIA 3KK8A 4F9BA 4BTJA 1FBNA 4HCTA 4BDJA 3MIAA 3GFWA 4YUQA 5IPJA 2PHKA 2PVKA 2ITZA 3NUSA 4XHKB 1TQPA 3TV4A 2YABA 4CGAA 1H8FA 2ETKA 2Z7LA 2WKMA 4L43A 2O0UA 5BVOA 3RWQA 5KMIA 3IDPA 3W0OA 3VF8A 5M51A 4CEGA 1MRUA 5CX9A 2VD5A 3Q2JA 3QRKA 4X7QA 4RG0A 1H1RA 2YN8A 3E3BX 3VIDA 2WMAA 1VJYA 4XEYA 3FMKA 5JZNA 3UMXA 5BVFA 4FT5A 2Z02A 5CY3A 5IH4A 2BKKA 4TNBA 3FJQE 3WE4A 5H3QA 4HGEA 2UZEA 2VTRA 4C02A 3GQLA 3ZRLA 4YTHA 4C37A 1XH7A 1P14A 2GNGA 5HVKA 1JSTA 4LL5A 3M11A 2VTLA 2VWYA 3EHAA 3R8UA 2HIWA 1Q99A 2VGOA 3ZXTA 4BCPA 3ZHPC 5FLFA 3PDTA 4EKKA 1H1SA 2PMOX 1B6CB 1BX6A 3QQFA 2YWPA 1ZARA 3HA6A 1YWRA 4ZP5A 4XV3A 3Q5IA 1UNLA 4L8MA 4F63A 1MUOA 3FLNC 3I0OA 3GOPA 5EYKA 4YTIA 5KKRC 4DG2E 4EOLA 3RPVA 4A06A 2VWVA 5AUTA 3DQWA 3T9TA 2QOQA 4CSVA 4DN5A 3TZMA 5LVMA 4EOSA 3PA3A 4FOBA 3EN7A 5JK3A 3Q9XA 3QQGA 3CPBA 4CRSA 2WTKB 4MXZA 3P7CA 4P90A 1WFCA 4QTAA 5C1QB 4FTNA 4D4VA 2FSOX 1NXKA 2C6MA 3F6XA 4MNFA 4LV8A 1NY3A 3H4JA 4D1ZA 2O65A 4AW1A 3F3WA 1TKIA 4L01A 4M84A 1LP4A 3E62A 4K11A 2QOIA 3PP0A 4FE2A 4D55A 4F0FA 3ZBXA 2R3PA 3QKKA 2A19B 3R9RA 3D15A 4F7LA 3QTUA 4NW5A 5JGAA 2QKWB 3VBXA 3A8XA 3THBA 3DT1A 5FEDA 4F09A 3NS9A 4UWBA 3TXOA 3BBWA 3FBVA 3UPXA 4M0ZA 3JS2A 2OXYA 4AE6A 2JDOA 5JFVA 2X1NA 2PVFA 4KRCA 1ATPE 3MIYA 5FXSA 5KBQA 2OH0E 4ZY5A 5IQHA 4RX8A 2W4KA 3I6WA 3BHUA 3DGKA 3V8WA 2WQMA 5AA9A 1H26A 3UIMA 3A7IA 2ITTA 3CQEA 3SDJA 5IQFA 2VTOA 4U94A 3BE2A 3UC4A 4ANMA 4JDJA 4APCA 4MVFA 5A54A 4EOQA 1XO2B 5JZJA 3VQUA 2FB8A 3QZFA 2VAGA 2ZB1A 4YZMA 3UO4A 2NRYA 3CTHA 5FG8A 4NU1A 5FGKA 3FKNA 4EK3A 4J1RA 2BRBA 3NNVA 1K3AA 3O51A 4J96A 4BDFA 3TNQB 4RFYA 3ZO3A 2XKFA 5JN2A 2WTVA 3ORZA 4YSMA 2P4IA 2OIQA 4A7CA 4EBWA 2JGZA 2RG6A 4L52A 1P5EA 3C0GA 4U7ZA 5M55A 4E93A 4IAIA 2CN5A 4QMMA 5M06A 3OVVA 3RWPA 4ZJIA 3ANQA 3VW6A 2QOCA 3NWWA 3C7QA 4FKGA 5D11A 3AG9A 4H05A 4YMJA 1ZYSA 2HAKA 2IJMA 1OIQA 3KL8A 4O7YA 2W1GA 2X9EA 3E8CA 5AUXA 2XJ1A 3HL7A 3F3ZA 4YJVA 2C4GA 3HAMA 4IAKA 4O0RA 3ENMA 3VS7A 4DLIA 4ACMA 1Q97A 3MFUA 4FV9A 1SM2A 4QRCA 5FUTA 1PYXA 3F7ZA 3EQRA 4ZS0A 3JXWA 1ZWSA 3ZC5A 1H0VA 4XOYA 2WNTA 3MPMA 3FI3A 3DZQA 4GKHA 2CGVA 5DR9A 4PP9A 4HYHA 2GS7A 3V6RA 4CMOA 3D2IA 4OBQA 3BU5A 3TDWA 2BDJA 4TL0A 3VC4A 2RIOA 2BZJA 5FD2A 2E9OA 4EH9A 5EFQA 2OJGA 4XV9A 3ZONA 3NNXA 3TTIA 3KRLA 5IEVA 4CQEA 4Z7GA 4I92A 2UW4A 5CI7A 3DFCB 1QPDA 3OT3A 3Q9ZA 3QD2B 2ZMDA 4U5JA 3W18A 4IW0A 2IVUA 3V5JA 4AGDA 4HNIA 5J1WA 4GFGA 5M44A 3TZ8A 3L8XA 4LGGA 3FXZA 3ZEPA 3MGYA 4CZUA 2JC6A 1REJA 2X39A 5CYIA 3ZFYA 2C68A 3NUXA 3ZTXA 2AC3A 3R9HA 4GG7A 3DK6A 3WBLA 4ZSAA 3A7FA 3SX9A 4RZWA 5D41A 2PMNX 4OBPA 2C30A 2VTTA 5AUZA 4BBFA 3GXLA 3HV4A 3PE1A 3PXRA 3ORNA 3GCUA 4XJ0A 4ONAA 4CG8A 1DI9A 5TO8A 3ATTA 1GY3A 4TZRA 3PXFA 5CNOA 4PNIA 5BUEA 3CTJA 4FA2A 2Q0BA 3GC0A 4FVPA 4O7NA 1SNXA 1V0PA 4YC8A 4LGHA 4TY1A 2WU6A 3HMIA 4JBVA 4Z55A 5HTBA 5IF1A 2X7GA 3PSCA 4O83A 1WZYA 3QCYA 5E1SA 2QO9A 5ETAA 1OBGA 4C7TA 5DE2A 1H07A 3B2WA 1O9UA 1Y91A 3NR9A 4FOCA 3GCSA 5EKNA 1LR4A 4NWMA 2JDRA 4ZTQA 5LVNA 5M4UA 1XWSA 3LCSA 2ETRA 2E9VA 3WILA 3Q3BA 4E4XA 3VQHA 4BF2A 2WTIA 4ZTLA 4UWYA 5HBHA 3MWUA 3D94A 3MB7A 3DTCA 3PFQA 4NK9A 2GHGA 1VR2A 4FTLA 4JRVA 4PDYA 3DCVA 3W2QA 5C8MA 4V04A 2QURA 5ANDA 2EXMA 1Z57A 2WOTA 3PA4A 4TKSA 2HY81 3FDNA 4IB5A 3R8LA 4AN2A 3A4OX 5HHWA 3I7CA 4IB3A 3KEXA 4W4YA 3TKUA 5JQ8A 2R3QA 4XP3A 3NRMA 5E7RA 2IW8A 4J52A 4AUAA 5DN3A 3TNHA 4B99A 2OIDA 3D7TB 3K3JA 4RSSA 5D9HA 3FAAA 3PTGA 2W1IA 5HG5A 5J1VA 3CCNA 4V0GB 2YWVA 3OF0A 4R3RA 4E5AX 1OKVA 3FSFA 4IVDA 2YM6A 3WE8A 1W83A 3OWJA 3RPYA 1JPAA 1GZOA 5G6VA 4JT3A 4MD9E 3LFAA 4O0UA 2HZ4A 5HI2A 1YDRE 4O27B 3LPBA 4QMWA 5D10A 4XG6A 3TT0A 2YZAA 4BHNA 5K3YA 1DI8A 3AT3A 4HNFA 3EQGA 2E2BA 3DK7A 4PRJA 3HV7A 2GFCA 4IX3A 4U42A 4BRXA 2YFXA 4FTTA 4DEBA 4FNZA 4FL2A 3CXWA 4GJ3A 1Y8GA 5LCKA 5BMSA 4IQ6A 3W2SA 2IZSA 3O0GA 5GINE 3PIZA 2PZPA 2V62A 4ZY4A 1XQZA 3EFKA 1PXJA 2VV9A 4U3YA 3PXYA 4BDAA 4IMYA 2WIPA 5H8EA 3EL7A 4EH7A 3PA5A 3PJ8A 2B9JA 3ROCA 3FMNA 5I9ZA 2ITPA 4E6CA 3SV0A 3CC6A 3GC9A 4AA0A 4KB8A 3GU5A 4XG4A 3QQKA 3TIZA 1JKLA 1NW1A 4GVAA 5HO7A 5HNIX 5JFXA 4NUSA 2PZIA 4R3PA 4WHZA 1YHWA 1YWVA 1XH8A 2GQGA 4E1ZA 4DT9A 5DH3A 5FEQA 4QP2A 5DEWA 3D83A 2VTNA 4TWNA 2KTYA 2GNLA 3L9LA 4K9YA 4B9DA 3BGZA 4FKIA 3PIYA 3FMJA 3VBTA 3PWDA 3IGOA 5JQ5A 4AZWA 1DS5A 2GHLA 2WMQA 4O2PA 4P7EA 4RJ8A 2CMWA 3TACA 2XRWA 2JIUA 2RKUA 3G90X 4J8MA 4LRMA 2IVSA 5CSVA 4IZYA 3FMLA 4FV8A 3LZBA 4PX6A 4F1TA 2A27A 2R64A 5IH5A 2OZAB 3BCEA 2O5KA 3C1XA 1FVTA 3Q4CA 4WUNA 2WTDA 4QT1A 3LE6A 3HRCA 5CU4A 3RP9A 3KULA 3DU8A 2BAJA 3MH1A 2ERZE 1ZLTA 3FXXA 2R3LA 1OECA 5LVPA 1J7IA 2ZAZA 5BVKA 1PHKA 3TV6A 5HBJA 3OWPA 2JDVA 3JY9A 5LARA 1U54A 1ZOEA 4MYGA 4D28A 5BVDA 1PMUA 2WMRA 4IDTA 4IJPA 4MTAA 3NVKI 1PXNA 1H0WA 3AC8A 5JRSA 4ZIMA 5IZFA 1XHAA 3BYMA 2ZDUA 3KVWA 2PULA 2I6LA 2XIRA 3FPMA 4QMSA 5CAPA 5HQ0A 5FDPA 2ITXA 3GT8A 4G6NA 5EK7A 4WNOA 3MB6A 4F99A 2OW3A 4YJQA 5I9YA 2ZYBA 5HLNA 1ZMWA 3CD3A 5GIOE 3G0EA 5HLWA 2OJ9A 4GU9A 3TV7A 3VS3A 3FLQA 5EQEA 5DPVA 4XBRA 3P23A 4J7BA 4DLJA 4M0YA 4EOIA 4A4LA 4KKEA 1JSUA 3V5LA 3EFLA 3U4UA 4GIIA 2XF0A 4HGTA 4DC2A 1PXMA 3P4KA 3PY1A 2JAMA 1GIHA 4Z16A 5EHOA 2J50A 2W06A 4RIXA 5CXHA 3VF9A 1KOAA 2IZTA 4IIRA 2H9VA 4NJDA 4YBKA 4C58A 4X3FB 3A4PA 4CFNA 3PJ1A 3EKNA 5DT3A 4OTRA 4AOTA 4O7PA 2H8HA 2VNYA 4OGRA 4DFYA 4ORKA 4WUAA 3OXIA 4QP7A 4XH6A 3RINA 5JGBA 5EQYA 2O64A 3CKWA 3ZO1A 2PUIA 3S4QA 5CAUA 3BGQA 4HVGA 3QD0A 3WIGA 4JAIA 3MW1A 2BTRA 4RC4A 4FL1A 3NYNA 4V01A 4TYJA 2J7TA 3NMUF 3HAVA 3AD5A 4ASXA 5CF5A 4EONA 2JAVA 5BUJA 4I22A 4FZDB 5IA3A 4XG9A 2YJRA 1ZYDA 4NCTA 4Q9SA 4XV2A 4E20A 4WZYA 5BMMA 5FTQA 1M14A 3PLAE 3D5UA 4O0SA 3OXTA 3Q2MA 4I3ZA 4LI5A 4BBEA 2PSQA 4KWPA 4EZ7A 3H30A 3Q6UA 3SRVA 1XKKA 2YCQA 5GNKA 2Q83A 1YHVA 3OG7A 3C4FA 4NM7A 4DTKA 3C4CA 2XCKA 2XYUA 1YXXA 5CAOA 2WMSA 4RJ7A 3A7HA 3WZJA 3H3CA 4E73A 5AX3A 4FZAB 4FZFB 2W9ZB 4I6QA 3GP0A 4FYNA 5AUWA 4BDIA 3QYZA 3TN8A 3U9NA 5IQDA 2VX1A 3A7JA 4OTFA 2XZSA 3FWQA 1OL6A 4E7WA 3G6HA 5DG5A 1WBSA 2X4FA 3PRIA 3EZVA 2QNJA 1VEBA 3OCTA 5AV2A 3TDVA 3E7OA 3ZYAA 4KS8A 5KMNA 5CWZA 2GNIA 5IUIA 3LM0A 2CPKE 2RFSA 2ERKA 3E3PA 5CVGA 3W0NA 5M4CA 3ENHA 5L6WL 3O8TA 2IWIA 5IQGA 4DEEA 1AGWA 3FZTA 4G34A 4BBMA 3OWKA 4TXCA 1JLUE 4O84A 1FOTA 1YRPA 2XNOA 1M17A 2H34A 2FVDA 4YBJA 4ENXA 4YHTA 3DBEA 4BKJA 4FV4A 2CGXA 3NZ0A 2CKOA 4FKTA 3IOPA 3LFBA 2W4OA 3QYWA 4JDIA 4M15A 3RK7A 3ORLA 5CU0A 2W17A 1PXOA 2P3GX 4TPTA 4WOVA 4G3CA 1Q3WA 3S2PA 4BCQA 2V5QA 4HGSA 4A4OA 4FV1A 4HZSA 1KE6A 2JBOA 3MPAA 4O0YA 5FP5A 5JGDA 2RGPA 5CALA 3HV5A 1ZXEA 2UVYA 2B7AA 1XBCA 3C5UA 2QQ7A 3OWLA 4FEXA 4USDA 4ZZMA 4EZ5A 3W0MA 4C4GA 4EH3A 3QTQA 1TQIA 4J99A 1H1PA 4FIGA 3V8TA 2PVLA 1KE8A 2XM9A 4PDSA 2CGUA 3R6XA 2ZM1A 3N51A 4W4XA 4DEHA 3DFAA 4K1BA 4YZDA 5GHVA 4QMXA 2Z2WA 4AOJA 4EWQA 3PUPA 4L42A 3HMMA 3VUHA 3WZEA 5CAQA 5E8XA 3VUMA 4ANBA 2YDJA 4CKJA 5EKOA 4RX5A 2GNJA 3QQLA 2C0IA 4FK3A 3FEGA 4FX3A 3CE3A 3NYVA 1LPUA 4I4FA 4GRBA 2PVYA 4CLJA 3QKLA 1KUTA 4FTQA 2VTIA 3R02A 4H3BA 5C03A 2R0UA 1TQMA 4MHAA 4RA5A 4QP4A 5DT4A 3ZSGA 4QPSA 4WSYA 5E8TA 5AUYA 3MS9A 4O81A 2I0VA 4FK6A 4LOQA 4X3JA 5CSWA 2R3RA 2X2LA 3LFQA 4OR5A 5CTPA 4DCAA 3R71A 4F9AA 4NTTA 2QOOA 3NPCA 2YACA 3R73A 4YJUA 4X21A 3ZOSA 3OY3A 4EJNA 1OUYA 3TIYA 4M12A 1ZZLA 2YDIA 3UOKA 3ORKA 2I0EA 1WAKA 3TJCA 3PXZA 2VWUA 4MXOA 1U4DA 3HGKA 4FNYA 3F9NA 4Y72A 4YZ9A 4PF4A 2P0CA 2J5EA 4PNKA 5L6OA 2JDSA 4FKRA 2IZUA 2HW6A 3UYSA 4BIEA 3F3VA 4RLKA 5IA5A 4BCGA 5E91A 4NM5A 2R3FA 3U6HA 3L1SA 4M3QA 5KHXA 2XNNA 4JDKA 5TT7A 2F49A 1CKPA 4DTAA 5T68A 5TR6A 3UOHA 4C34A 3UIXA 4BI1A 4A07A 2VU3A 2HWOA 1JQHA 1OL7A 4EHVA 3H9RA 4CKRA 2C3KA 2GCDA 3GC7A 3K5UA 3R8VA 1W7HA 3KRJA 4O86A 5CSHA 2VTAA 5DRBA 4B0GA 5I4NA 4CFVA 4C4FA 4PQNA 4YURA 3M1SA 2QHNA 4QYGA 3E64A 3G2FA 4BCJA 5IMEA 1FMKA 4BYJA 3N9XA 2VO0A 3POZA 2P55A 4R77A 5C9CA 4Z9LA 2Y4IC 1RJBA 2YZLA 3HUBA 4B8MA 5C8KA 2CCIA 4LMUA 1OBDA 5FDXA 3QC9A 2YCSA 4D4SA 2W0JA 3COIA 4O7LA 1Q8UA 4PY1A 4FBXA 4EC8A 2PUNA 3UIUA 4JVGA 3UQFA 1MRYA 4X2GA 3TZ7A 5CZHA 4EI4A 5DA3A 3KXZA 3U87A 5I5ZA 2PL0A 3UJGA 2ITYA 4YSJA 3KF7A 5AAEA 3N4TA 2SRCA 1U5RA 3AOXA 3PY0A 4G2FA 3BLQA 2HZ0A 3FY2A 5B2KA 2BFXA 3AT4A 4I1ZA 4MX9A 3GEQA 3HV3A 4HCVA 4EK5A 5GIPE 4EHGA 2JKOA 2JIVA 4X2KA 5HNGA 4BCNA 4XX9A 3V6SA 3NNWA 1CMKE 4GFOA 3P78A 5AEPA 3W0SA 2WPAA 2KULA 3ZMMA 2J4ZA 5EDRA 1ZAOA 3NX8A 4IWOA 4X2JA 4EOPA 2ZB0A 2CCHA 3IW5A 4KIOA 4BDGA 3M2WA 4WG4A 3UNJA 3NYOA 2PZYA 3EIDA 1UKHA 1W0XC 1OITA 2CKQA 3A7GA 4FNWA 2X8DA 3P7AA 4E4MA 4G9RA 4WT6A 2LGCA 3DNDA 4CKIA 4KNBA 4YJOA 1OIRA 2JLDA 4GFMA 4U6RA 3LFNA 1H28A 4RGJA 5CU3A 4DBNA 1KOBA 4IFCA 4FGBA 4QMYA 5IA1A 3UOJA 4CFMA 3NUYA 4PMPA 1PMNA 2BAKA 5CENA 3EL8A 5ICPA 3GU4A 1H08A 4KINA 3C5IA 4QNAA 5KZ0A 2WQNA 3MFRA 3QTRA 4W8DA 4W4VA 4X2NA 3LJ0A 2ITOA 4GU6A 4IZ7A 2XK6A 4R1YA 4RX9A 4AA5A 4U43A 2V22A 4YPSA 4I5MA 3U55A 2ONLA 3JPVA 3W8LA 4WG3A 3HMNA 3ACKA 4BICA 4U3ZA 2UW7A 3U51A 4EK6A 3E8EA 3TM0A 5BVNA 3DK3A 4YTCA 3KA0A 5AM6A 5BUIA 3R0TA 5EDPA 5J7HA 4BGQA 2ZV2A 4O6EA 3VS5A 4MNEA 4QMTA 4IX5A 4ZLYA 4EHEA 3UG2A 2XBJA 3I60A 1WMKA 3RHXA 4FKOA 4TNDA 3HP2A 5KNJA 2ACXA 3Q53A 2Z7RA 4ZTMA 5AAFA 4EC9A 2CKEA 4R6VA 3OEZA 4U40A 5ANEA 4ZSLA 2OGVA 4BCFA 5JRQA 5KBRA 1G5SA 5L8LA 4U8ZA 4BZDA 3UOLA 4DEAA 3KQ7A 4TWOA 5EI8A 3LLAA 3NUPA 3R1NA 3W10A 4GSBA 1J91A 3IK3A 2GPHA 3CGFA 5AJQA 2C3LA 3GCVA 1ZYCA 3A99A 3QAME 3MH2A 4DTBA 4L44A 3D0EA 2X7FA 5GJGA 2XVDA 4FVRA 4CFXA 3PP1A 4AS0A 1UU7A 1YXTA 1YXUA 3COHA 4KBCA 3E63A 2VX3A 3HDNA 2B9HA 3Q4ZA 5IG1A 1LEZA 2Y9QA 5HCYA 3LFSA 3AC4A 5HCZA 2XMYA 3IGGA 4DFUA 2J0IA 4L46A 2C1BA 2QKRA 4ALUA 3C51A 3Q60A 2YHVA 3R04A 3QF9A 1IG1A 2REIA 4LQMA 5IQEA 3FKLA 4F7JA 2X0GA 4PMMA 4XV1A 4II5A 2ITUA 5H8GA 3FLZA 2WTWA 4PV0A 5EH0A 5LXMA 4F9WA 1JVPP 4IJ9A 4G17A 5KUPA 4JRNA 3FHRA 3PJCA 4JG6A 3F2RA 1UU9A 4AZVA 2UZUE 3ID6C 2QVSE 4AACA 4A9UA 2W1DA 1WBVA 4MQ1A 1JBPE 4ACCA 1FGKA 2C5YA 3BHTA 4C4HA 4EZ3A 4DYMA 2H6DA 3AGLA 5K4IA 3OY1A 4Q9ZA 4I6BA 4JQ7A 3TYKA 3FSKA 3DS6A 4I6FA 3TCPA 3E87A 4C59A 4FSQA 3MYGA 1E1VA 5J87A 4ZK5A 3R8PA 3A8WA 4CXAA 4QPAA 2BTSA 3AD4A 4MBJA 2ZM4A 3NUUA 3FZSA 3DNEA 5ANKA 4AW0A 3ET7A 2W99B 1GIIA 4GMYA 3LM5A 1PJKA 3MV5A 1SVGA 3QA8A 4C3RA 3NYXA 3V01A 3AGMA 1JKSA 3HRBA 4CCBA 1JKTA 4BYIA 2C6LA 3FMMA 1DAYA 4EH6A 1L8TA 3ZZEA 2V7AA 3IONA 3EQHA 5EHLA 3ULZA 3PXQA 5AV4A 1H25A 1JKKA 1YI6A 1L3RE 2NPQA 4WRGA 5E1EA 4BGHA 1VYWA 3OUKA 3ITZA 4GEOA 4BDEA 3QRJA 4H39A 4H36A 4KKHA 3ZSHA 4H1JA 4MWIA 5I9UA 4A9RA 3EN6A 4Q2AA 3O2MA 4F70A 2DYLA 2XIKA 4ASEA 3Q9YA 4IWDA 3KC3A 3OZ6A 5AIRA 2CGWA 2OFUA 3OC1A 1OKYA 3C13A 3BWJA 1PW2A 3OW3A 4FTCA 4Y46A 5B2MA 2FSLX 5KKRB 3LXPA 4R1VA 2PPQA 4HPTE 3P5KA 3QX2A 5HO8A 4FV0A 3CD8A 4KIPA 3QTIA 3D7TA 4C4IA 2OXXA 4F1MA 1G8SA 3V04A 2PMIA 3NCGA 4KKGA 3DBCA 1ZY5A 3C4EA 3CJFA 4RZVA 2JD5A 2X9FA 4GV1A 4O7VA 5HLPA 4F1OA 4MBLA 4BTMA 3R7UA 2UV2A 3W2OA 4JAJA 3UO6A 2H96A 3C4ZA 4G6OA 2YAKA 5L8JA 3FQSA 5CU6A 2ONLC 4FTJA 3FI8A 3PG3A 3P08A 4LUDA 3SXFA 3IDCA 4FKLA 4I94A 2C0OA 3VS6A 4DHFA 5ETCA 3OCGA 2I7QA 4BIBA 5CEKA 1YQJA 4CTCA 4JS8A 3QZHA 1Q4LA 3NLBA 3R63A 3I6UA 4IM0A 4UZDA 4ANQA 4ZMFA 4EOMA 2JBPA 3V51A 3AC1A 3RMFA 4FEUA 2G2IA 2PVHA 4LUEA 5IEXA 3G15A 4EOJA 1TVOA 4QMOA 1FMOE 2BHEA 2VX0A 3W2PA 5FEEA 5C4LA 1G8AA 4FTRA 4WBOA 4ZJVA 2QHMA 4EH2A 2JKKA 1PXKA 4WA9A 3T9IA 1ZZ2A 2Y6MA 3MI9A 2QLQA 4I21A 4QTBA 4RVMA 5DGZA 4ANSA 2XNBA 2R3IA 1YW2A 4F7NA 1YWNA 3ZZWA 5L2WA 4PTCA 4JG8A 5HICA 4GYIA 4WG5A 4U0IA 3O7LD 4GT3A 2W5AA 3QUDA 4YO6A 3RJCA 5M09A 2WD1A 2VWBA 3C4WA 3UP7A 4N6YA 3QD3A 5KCVA 1Q8TA 4LMNA 3SHEA 5EM7A 4F4PA 1BKXA 5EYDA 4OW8A 1Z9XA 5AFVA 2J0LA 1WBTA 3OTVA 1XBBA 1M2PA 3LCDA 4JI9A 2JFLA 1UNHA 3R2YA 4C2VA 4NFNA 4OTGA 2VZ6A 3M42A 4HOKA 4Q5EA 3TWJA 4ACHA 4MXYA 3DTWA 3L8PA 4W4WA 3SG8A 5HE0A 2Y0AA 3EMGA 2C6OA 3FZ1A 3MVLA 2XK7A 3VUKA 3GC8A 4AW5A 4EQUA 5EI2A 4I23A 2VGPA 3NSZA 3SAYA 1YXSA 5CF4A 4J97A 4C3FA 3PVGA 3UBDA 5AP4A 5BPYA 4N70A 2PVNA 3P86A 5KO1A 3NCZA 2ZJWA 3KRWA 1CKIA 4S32A 4D2SA 4ZLOA 3VRYA 5AV3A 3VNTA 2UZDA 2YM8A 5IQCA 4Y5HA 2EVAA 3ZO4A 2C5XA 4CD0A 1UV5A 4FTUA 2BILB 4J53A 5KMOA 4PDPA 5HG9A 2OH4A 1WBPA 4AA4A 3DXPA 1I44A 2RFDA 5AP6A 5ETIA 5J5SA 3TZ9A 4WBBB 4YHJA 4IAYA 1AD5A 2XRUA 1Y6AA 3FY0A 4BI2A 4NL0A 4DH5A 4NTSA 5EM5A 2BDWA 2E9NA 2XK8A 4AP7A 4W8EA 4DT8A 3TUDA 4DINA 4M13A 4UEUA 4RT7A 3ORPA 4FSUA 1T46A 3NUAA 4S30A 4YLLA 5L2TA 2BUJA 4FTAA 3RAIA 3PZEA 1Q5KA 2WMUA 4GW8A 3CIKA 4IWPA 3C0IA 1F3MC 4XBUA 4JBOA 4DGLC 5J9ZA 4K33A 3ZRMA 4F6UA 4DG0E 3OOMA 5M4FA 3R28A 1OKZA 3UZPA 3R7YA 2XK9A 3GCQA 4L53A 2GU8A 4E4NA 3TKIA 4PMTA 4I0TA 4D5KA 2W05A 3F5GA 4FIJA 1M7QA 3UVRA 3D2KA 4DH8A 3D7ZA 2B4SB 5DOSA 3EQIA 3OUNB 5M4IA 1OMWA 3BYOA 2XNGA 3KRXA 4DGMA 3QX4A 2YM7A 1T45A 3RAHA 5DEYA 4FSYA 4FT7A 4S33A 5IQBA 3R1SA 4MAOA 5HE3A 1XH4A 4QQ5A 3C0HA 2CKPA 2GS2A 3KN6A 5JEBA 2QO2A 3S1HA 3C50A 3VULA 2XIYA 2QR7A 3P0MA 2OLCA 3KXNA 4BDKA 3ZRKA 4ASDA 4FT9A 5IUHA 3HA8A 1CSNA 4HYIA 3KXGA 2R3GA 2BMCA 4EKLA 1GOLA 1G3NA 3NW6A 4EH8A 3MVHA 3VJNA 4JLCA 4DCEA 3OROA 5CS6A 3Q5ZA 3GFEA 3LFFA 4FTMA 4AE9A 1RW8A 5LMKA 3OEFX 3JYAA 4O91A 5AADA 2JKMA 1JWHA 2BKZA 1ZRZA 4K18A 4KRDA 5E8YA 2XJ0A 4D9UA 2UZWE 4DG3E 1K2PA 2F9GA 3DZOA 2R5TA 5ETFA 4IH8A 4LL0A 4XP0A 1KE5A 3DKOA 1B38A 1BL6A 1Q8WA 2J9MA 2O63A 1H1QA 3IO7A 1Z5MA 4ITIA 3GUBA 4JX3A 4JOAA 4QOXA 5HKMA 4C4EA 3S00A 3KFAA 3LIJA 3RPOA 4R5YA 2QI8A 3PVWA 2ITWA 4TTHB 4ZTRA 2VO6A 2X6DA 2QOHA 3E8DA 1ZY4A 3ORXA 2B52A 4N0SA 1UNGA 5HNBA 4L7FA 3F3UA 4QP1A 2XEZA 5L2IA 4C4JA 4Y73A 5IDNA 2HOGA 3QZGA 1OIYA 2OIBA 3PPJA 5EM8A 3FLYA 5CEIA 4BZOA 4JIKA 2W9FB 4MXXA 3O96A 4KSQA 4OTIA 4BCKA 3F3TA 4EQCA 4MF1A 3ZUTA 2IW6A 1P2AA 2YCFA 3MJ1A 3NGAA 4FSWA 2DWBA 4ENYA
chains in the Genus database with same CATH superfamily
2W1ZA 4EWHA 2UZTA 3ZO2A 3BX5A 3UDSA 2B55A 2XCHA 4S2ZA 2IO6A 5M07A 3DAJA 3G33A 3KK9A 1U46A 2R0IA 5HZNA 2PE2A 4JMQA 3LFCA 1PRYA 1V0BA 1GIJA 3PIXA 5KX8A 3WOWA 2JITA 4B7TA 1RE8A 4CLIA 1NA7A 2BZKB 5AX9A 2XK4A 4UXLA 5DBXA 1KV1A 1P4FA 3BI6A 5T3QA 3BZ3A 4JNWA 5AWMA 3AKKA 4AX8A 2WMXA 3QTWA 4G3EA 4X6QC 5BYYA 4WNKA 2R9SA 3LCOA 1Y6BA 4C33A 3II5A 3EJ1A 3F7WA 3OFMA 4I6LA 4RVLA 4H1MA 5J95A 5LMKC 4FIIA 4QQJA 2F57A 4TYHB 5AUVA 1DAWA 1PKDA 2BRGA 2JIIA 3OP5A 2BRMA 3P7BA 3RHKA 3EQPA 4CG9A 3I81A 2ITQA 3RCDA 5IQAA 4JDHA 3GB2A 4O7ZA 4D4YA 3F5XA 3ORMA 2W7XA 3MVJA 4UWCA 3ZS5A 4GK4A 3OHTA 4B6LA 3MSSA 4BVUA 2XKEA 4IVBA 4U80A 1FGIA 5IH6A 2OI4X 4RIYB 4UYAA 3EFWA 3OS3A 4UY9A 5EM6A 5D7AA 4XYFA 3WF6A 5FBNC 3D5VA 4H3PA 4MQ2A 3LXLA 5BVEA 4L3LA 4XLIA 3ZM9A 4F6WA 3KMMA 4OLIA 3CGOA 4G1WA 4U41A 2HXLA 2R3KA 2UVZA 3AMAA 4XNEA 4RLLA 2FA2A 4I24A 1MQ4A 4FODA 3RK5A 1OGUA 3KRRA 3PFYA 3S3IA 3BLHA 4UX9A 4FT0A 3R9OA 2A4LA 3DDQA 4O0TA 5AP3A 4E4LA 2WZJA 1KWPA 4O38A 3PE2A 1J1CA 3AT2A 5C27A 4R7IA 3HV6A 2PUPA 3QQJA 4HW7A 2YM5A 3FQHA 3FZPA 1NT2A 4CV9A 4RWKA 2A0CX 2XNMA 3I79A 4J95A 3KGAA 4X6RA 4ZSJA 4C38A 5ANJA 4GIHA 1BI7A 3SVVA 4I93A 4Z7HA 3VVHA 2QONA 3KVXA 5B0XA 2GSFA 2CNQA 4FMQA 4RMZA 3MY5A 4FC0A 1J1BA 2O8YA 1P4OA 1ZOGA 3TMOA 1UU3A 2OJFE 4GT4A 2FYSA 5TOZA 5KZIA 5K5NA 3I5NA 2R3MA 3REPA 3NVMB 4TYGA 4DH3A 1J7LA 3QQHA 4ASZA 1URCA 3VBQA 4EYJA 4AQCA 4I41A 4AFJA 4OTDA 4FZ7A 4ZS4A 2CLQA 3W0RA 1F0QA 4BCOA 1E1XA 2V55A 4JR7A 1NVQA 1SVHA 1QCFA 3EQCA 3F69A 3MFTA 3R2BA 2CNVA 2F2UA 4AZFA 4D0XA 3FC1X 4IADA 4BC6A 4R7HA 3LJ1A 2CN8A 2Z8CA 1A48A 3AC5A 2PZ5A 5CNNA 3AD6A 4RA4A 1H00A 4H58A 2OXDA 4IE9A 1BYGA 3ZXZA 2GDOA 4RQVA 5EOBA 2C6IA 3SG9A 4LFIA 2YDKA 3NUNA 4I0RA 1XBAA 5AP0A 4FSNA 3VS2A 4ERKA 2G9XA 3SRVB 1GZKA 2WGJA 2UW5A 2EU9A 4LM5A 3A60A 4IAFA 3MDYA 4BDHA 3QTSA 4O0WA 3BWFA 4ANLA 5CI6A 4MEDA 5LVOA 1MP8A 5LWMA 2ZOQA 3CPCA 4IANA 4AT4A 4QTEA 2YJSA 3EOCA 3LQ3A 3VBWA 5HTCA 5G1XA 3DB6A 4U81A 4CV8A 2XUUA 4C36A 5CXZA 4BTKA 2I0YA 2WMTA 4OT5A 5F9EA 4FI1A 5CANA 2LAVA 1OKWA 4EUTA 4KBKA 5D7VA 4OUCA 3QBNA 2UW6A 3LLTA 4U44A 5HD4A 4RWJA 1YI3A 2C5VA 2OK1A 2XM8A 3R8MA 3VBVA 4YPDA 3ORTA 5CEOA 1OI9A 5KE0A 3WYXA 4JQ8A 4GVJA 2C69A 5A3XA 4I20A 3SOAA 3JR1A 3VS0A 1UWHA 3VUIA 2FGIA 3VWAA 3VW8A 1SNUA 5HU3A 3ZLXA 4AZSA 4IWQA 2VTHA 4O7SA 3RNIA 3COMA 3GOKA 2Y7JA 1Q3DA 2HCKA 3KXMA 4PL4A 2BCJA 4L68A 2R3OA 2PK9A 3N4UA 4X3FC 1IA8A 4FG7A 4QMNA 3O8PA 3GU6A 4IBMA 3TI1A 2BAQA 5DI1A 3ACJA 5K9IA 3R1YA 1R0PA 2JFMA 4UBAA 4KA3A 5LOHA 5IDPA 3W55A 3DKGA 3NW7A 3JVRA 1LUFA 2XA4A 2GNFA 3KB7A 3P79A 4K0YA 4L3JA 2YISA 3I4BA 3BV2A 4RQKA 4F08A 3EN4A 1OIUA 4QQTA 5I9WA 2BRHA 1GNGA 4CRLA 2HELA 2BZIB 3UMWA 4GK3A 3OW4A 5AP2A 1W82A 2ITVA 3QKMA 4J98A 2OF2A 2R3NA 2W4JA 2UZLA 3BGPA 2ZV7A 3SD0A 4DFLA 4FKPA 4RIWB 1WVWA 1BL7A 4QMLA 2C5OA 1S9IA 2UZVA 3IW4A 4YLKA 5CVHA 4YP8A 2PU8A 3PXKA 3LQ8A 4FVQA 2YM3A 3R1QA 4Y5QA 2WB8A 3FMHA 4KAOA 5CSPA 3CS9A 3CEKA 2BIYA 3HEGA 3MN3A 2W96B 2VTQA 4FSTA 5E92A 3EB0A 4C35A 1SMHA 4JJRA 4IC7A 1LEWA 4UZHA 5CEMA 3VO3A 1W8CA 1APME 2QU5A 5A4QA 3RAKA 4FTIA 3LAUA 4GCJA 4GJ2A 3RGFA 3ZUUA 4LRKA 4JG7A 3DKFA 3O50A 4FUYA 3BYUA 4YJRA 5T6KA 1Q8ZA 2NP8A 4NFMA 2WELA 4XG8A 5EI6A 2WMBA 3HMPA 5HE2A 4DA5A 3F5PA 2YEXA 3QLFA 4JL9A 5ANIA 2X8IA 2FSMX 2AYPA 3TTJA 3RTPA 2Y8OA 4TYHA 3VJOA 4O0VA 2J0JA 4I5PA 4UALA 4F65A 4D5HA 1M2QA 4DFBA 3I7BA 4RRVA 2B1PA 3QUPA 4AG8A 3SW4A 4GUEA 4NH1A 4PL5A 4QQCA 3W2CA 3G9LX 3WZDA 4DGOA 3HMOA 3NIEA 3VBYA 4E26A 4IAZA 3FL5A 2E9PA 1W98A 4YNOA 4FV5A 4ZEGA 1URWA 5DHJA 4LV7A 4NM3A 4YJTA 4BB4A 1BI8A 2HK5A 5HG8A 3ATSA 3DDPA 3KIOC 3KN5A 3NAYA 4XRLA 2GFSA 4RFMA 2IN6A 3HLLA 5CVFA 3OCBA 5EW8A 2B9IA 2G2HA 3PPKA 4PDOA 4EH5A 2FSTX 5I9XA 2R7BA 3R00A 2ZFYA 1H24A 1TFFA 4XG2A 3CJGA 2EUFB 3C4XA 3OTUA 2DUVA 4KD1A 5CT0A 2CSNA 4B8LA 3EWHA 4DEDA 4YC3A 4XG7A 1FPUA 2VTMA 4YZNA 5B7VA 2NO3A 3FXWA 4MD7E 1GZ8A 2BZHB 5FBOA 2Y4PA 1NVRA 5H9BA 4FKWA 4ZZNA 2BVAA 2W1CA 4PUZA 5AUUA 1BLXA 5CF6A 1IAJA 4YJNA 3SC1A 3KKVA 2YITA 2VNWA 4AU8A 4FTKA 4C2WA 3QUEA 4E6DA 1WVYA 3R8ZA 3PSDA 4ALVA 4DH1A 4FUXA 4GK2A 1O6LA 5CQWA 3MY0A 4LG4A 3VHKA 5LVLA 4ERWA 3CQUA 4TWPA 3COKA 4BDDA 4NSTA 4O82A 4RJ3A 3QHWA 5IISA 3HECA 1PY5A 3GGFA 4L00A 3DB8A 4P5ZA 3GBZA 2ZDTA 5H8BA 5C4KA 3DXQA 1M7NA 3TNPC 3WZUA 1BMKA 3BPRA 4FIHA 3QCQA 4ID7A 5CSXA 4G5PA 4FT3A 4IM2A 3A61A 2OO8X 3ZFMA 1OPJA 2XYNA 3ZLSA 1XH5A 2YM4A 4FV3A 3QGYA 4FKVA 1OL1A 4AXAA 4WKQA 1GZNA 5IQIA 3FYJX 4QYHA 3SOCA 4LV5A 3DV3A 3CP9A 3SLSA 4L45A 2G2FA 3AMBA 4QMUA 4N4SA 4D1SA 2R2PA 3DAEA 3BEGA 4A9YA 4AAYA 3RM7A 5E9EA 4DFNA 4EK4A 2Q0NA 3OD6X 2IPXA 4DAWA 2G1TA 3GQIA 3EH9A 3HP5A 4NKAA 4EK8A 2HWPA 4Y85A 4FSMA 4D2RA 1H27A 3R7IA 4GT5A 5L2SA 1PXLA 4Z3VA 2P2IA 3OT8A 3KULB 4FG8A 1VZOA 3PY3A 4QMPA 3Q32A 2CDZA 2OICA 2HZNA 2UW8A 3IG7A 5AM7A 4C0TA 3SW7A 3DKCA 3IECA 3QD4A 4R7BA 4K8AA 2FO0A 2V0DA 3U8WA 4X3FA 4EQMA 2YIYA 2VUWA 3LMIA 3BU6A 3G9NA 3V5TA 3KU2A 2X81A 3WI6A 4L7SA 4FV7A 2QO7A 2I40A 2QOBA 4FEWA 3VUGA 4XG3A 4JBPA 5HIDA 1GJOA 3BLRA 3BQRA 2VTSA 1DM2A 3SXRA 5JH6A 4R78A 3BL9A 2WQEA 4Y8DA 5ACBC 3WARA 5ANOA 3W8QA 2J90A 4GUBA 2QOKA 5EHYA 4FZ6A 5L6PA 4LOOA 1EH4A 4PMSA 1UKIA 3BIZA 4M97A 4R3CA 4MD8E 3R22A 2XNPA 2YA9A 2XH5A 2WIHA 3F82A 5FXQA 2J0MB 1V0OA 1GAGA 3ALOA 5B2LA 5M08A 2VO3A 4L6QA 4I6HA 3O7LB 3TG1A 2QD9A 2I0HA 2VN9A 4ZSGA 2E9UA 4HZRA 4O22A 4YJPA 4IX4A 4NKSA 3U6IA 4JX7A 3LMHA 2OBJA 3H0YA 5JMSA 1YOMA 2FUMA 2HZIA 3QZIA 4QDVA 5FM3A 4PP7A 2EB3A 4NM0A 2YIQA 2GMXA 2WHBA 3PZHA 4NJ3A 4I5HA 5HG7A 4AGWA 5LMBA 1REKA 1IAHA 4IVCA 4XOZA 4BTFA 2IVTA 2QG5A 3OCSA 2F7ZE 4BGGA 4AT5A 4QMQA 5AP1A 4H3QA 4RIWA 3D5XA 3R7VA 5F95A 2BALA 3QTZA 1V1KA 3EYGA 3L8VA 4AFEA 3TUCA 2XP2A 5FP6A 5HESA 2GQSA 2ZM3A 5EW3A 4D4RA 1QL6A 1JNKA 3QWJA 2YIXA 4LYNA 4R5SA 3LHJA 4USFA 2OU7A 1R1WA 2OZAA 5DYJA 3BELA 3D9VA 3FI4A 2BROA 3KXXA 5A6NA 2GS6A 1UA2A 1MQBA 3WIKA 3LCTA 4Y83A 4RIYA 5E8ZA 4BN1A 4QYFA 4F0GA 3ETAA 4IB0A 4KBAA 5E8UA 2GTNA 3MESA 4MKCA 3EQBA 4EOKA 2C3JA 5A4CA 5CQUA 2RG5A 1M2RA 4MXAA 2A2AA 5HORA 3FZOA 1I09A 2VO7A 1KSWA 3QTXA 2F7EE 4YZCA 5AMNA 4E5BA 4WIHA 3PSBA 4FTOA 5H2UA 2IZRA 5IU2A 2WQBA 4O0XA 3GU7A 4MUQA 2WMVA 3EN9A 2WEVA 5DT0A 4HVHA 1A9UA 2OJJA 4IACA 2VWWA 2IVVA 3DBDA 3F88A 4RJ4A 4KSPA 4RIOA 4E5WA 3SXSA 3U6JA 3R9NA 2DQ7X 3A62A 3F2NA 3LXKA 2UW3A 3IS5A 5AP5A 4EEVA 5F1ZA 1H01A 1Q62A 2YCRA 4IZAA 1HCKA 4ZOGA 2OKRA 5CASA 5A4LA 2OSCA 3Q52A 2J51A 3QXPA 3V3VA 1OPLA 5FRIA 3GVUA 3CSVA 1K9AA 3BLAA 2W5BA 4GS6A 5C01A 2Y6OA 3DXNA 3DJ7A 4OBOA 2BDFA 3L9MA 3UVPA 4F9CA 4OTHA 3OXZA 1O6YA 1XJDA 4IM3A 4EH4A 3GENA 4B4LA 3P1AA 4E6QA 3L8SA 4CFFA 3UTOA 5C26A 5CF8A 4TN6A 3BE9A 4MBIA 5D1JA 4ACGA 3KMWA 5EW9A 3IW6A 3DJ5A 4ZJJA 2P2HA 3WF7A 5E8SA 2OJIA 5LWNA 4FV2A 4ZXTA 1QPJA 2OFVA 2OWBA 1VLRA 5GJDA 4YHFA 1STCE 4UYNA 4YTFA 3R30A 1Q41A 1PKGA 3FV8A 4TYEA 4DGGA 4F64A 3UG1A 2ITNA 2UW9A 3R9DA 5KMLA 1X8BA 4AOIA 3E8NA 3BU3A 2R4BA 3F61A 3MFSA 5E4HA 4XLVA 3TNWA 4CFUA 1PYEA 2NRUA 4BDBA 3I1AA 4D58A 4KABA 4MK0A 3HYHA 3UE4A 2ZV8A 5A14A 4PTEA 3LFEA 3W32A 4YU2A 5CT7A 3ALNA 4FYOA 3U9CA 5HE1A 2QCSA 1XR1A 2HXQA 3NIZA 2PUUA 1KE7A 4IDVA 3BYSA 5FQDC 3S0OA 4P4CA 3ZLYA 4FSRA 2NNWB 3UPZA 3WF5A 4D9TA 5A4TA 3OMVA 5KMJA 3G0FA 3UIBA 1JAMA 4MNEB 2C3IB 2HW7A 4G31A 3UNZA 4M7IA 2YIRA 2JKQA 3ODYX 4FIFA 5DWRA 2ZVAA 3ANRA 3WYYA 3B8RA 1IR3A 1YOLA 1E9HA 4AAAA 2X7OA 4F0IA 4XRJA 3ZCLA 3LMGA 4HVSA 3FI2A 4C61A 3AMYA 2B0QA 2EWAA 2UUEA 2WFYA 1PMVA 3DBFA 3MA3A 3TUBA 2CHLA 2XKCA 4IZ5A 4YC6A 2C6TA 4RBLA 3QHRA 3G6GA 4IHPA 5CEPA 5I9VA 2XB7A 3KY2A 2WO6A 5D12A 3I5ZA 4G6LA 2RF9A 4K77A 3PPZA 5HIEA 1OL2A 1QPEA 4CMTA 4CMUA 3CY2A 5AV0A 3FL4A 4AW2A 3EFJA 3C9WA 2QOFA 2XJ2A 4ITJA 4RIXB 4U97A 2CLXA 3AXWA 2WTCA 4M69B 3FUPA 4WO5A 4FV6A 5I0BA 5DR2A 4WRSA 4ZLZA 1YHSA 3TJDA 4P2KA 1ZYJA 1M52A 4C3PA 5KHWA 4CVAA 4ITHA 5TF9A 3GNIB 1OPKA 4AF3A 2OF4A 2PMLX 4NW6A 1Y57A 4FGRA 1Q8YA 2F4JA 3DA6A 4K2RA 2VRXA 4CZTA 3E88A 3HUCA 1JOWB 3L9PA 1U5QA 4RWLA 1Y8YA 1OB3A 3QRTA 3MPTA 2G15A 4L3PA 4UN0C 2G01A 5A6OA 3UDBA 3ODZX 4NT4A 2WOUA 5J8IA 5M57A 3EKKA 5CZIA 3ZM4A 1ND4A 1CM8A 2FH9A 3NDMA 4ZTHA 3VAPA 3W2RA 3HRFA 1SZMA 5JKGA 2AC5A 3D5WA 4AXDA 4GL9A 3QRIA 2PTKA 3QCSA 5CLPA 3EN5A 3LXNA 2CNUA 4E6AA 4HVDA 4CCUA 4JR3A 2ESMA 3ERKA 5EDQA 4X2FA 3RKBA 3RALA 4DF3A 1U54B 2BRNA 3QA0A 2I1MA 2IW9A 4DGNA 4RVKA 3QRUA 5FXRA 4MXCA 4XUFA 3K3IA 4ZAUA 2GQRA 3PWYA 5HVYA 4YLJA 4DH7A 2QLUA 4RVTA 5BYLA 3GU8A 4FKJA 5EG3A 4CT1A 3PVBA 3SA0A 2WTJA 3UODA 1OZ1A 2B53A 2YAAA 3BBTB 3EZRA 3QC4A 4IC8A 3T3VA 4AGUA 3OBJA 5F20A 4HYUA 3DLZA 4N6ZA 3U54A 3UQGA 3MTLA 4G16A 4RJ5A 3RM6A 1YDSE 4L9IA 3ZBFA 3ZH8A 4BHZA 5C8NA 4ZTSA 5HX6A 3L9NA 4FSZA 4UV0A 4D0WA 3B2TA 2C5NA 3H0ZA 3BYVA 1YVJA 4EHZA 5HIBA 4OTQA 3FPQA 1FINA 4QYYA 2RL5A 3F66A 2HENA 4V05A 5DNRA 3DLSA 2VTJA 1RDQE 1YI4A 1HOWA 3RPRA 4Y95A 5CEQA 4WNPA 5J9YA 1WBWA 3E92A 4CFWA 3RPSA 4TRLA 5FTOA 3VUDA 1NVSA 2PVJA 3UVQA 5LMAA 2J0KA 4YNEA 3JY0A 4O2ZA 3CR0A 4YR8A 2DS1A 2EXCX 4D1XA 3OOGA 2XNEA 3O17A 4WD5A 3LVPA 4OT6A 4BCHA 2WU7A 1G8KA 3FHIA 3AQVA 1ERKA 4WNMA 3SKCA 4QP9A 2XIXA 3FE3A 2PYWA 5HU9A 5A46A 1HCLA 5IMXA 4QEBA 4BIDA 4OTWA 2VTPA 2CJMA 4F9YA 1OUKA 3HX4A 3LJ2A 5DVRA 2Z60A 3QLGA 4YO4A 4RX7A 3LKMA 1J7UA 2PZRA 1KE9A 3Q6WA 3E7VA 2C6EA 3V8SA 5CU2A 2HY0A 2ZMCA 4FEQA 3FQEA 3KCKA 3K54A 5HBEA 2ETMA 3VS4A 4QYEA 3SGCA 2BR1A 4QO9A 5ACKA 1A06A 5HCXA 4G3FA 3ELJA 2UZNA 2BHHA 1F5QA 4AXCA 4HCUA 4MH7A 5M56A 1UVRA 1WCCA 3BKBA 4O21A 4HPUE 3W0QA 4BJJB 5IUGA 4U98A 3G5DA 2BIKB 3DY7A 4O7OA 2WQOA 2J2IB 2W1EA 4FICA 3MH3A 3JUHA 3LQ5A 4RFZA 3TNIA 1YOJA 4CT2A 3NAXA 4UB7A 5HEZA 1H1WA 4N57A 5DR6A 4FKSA 2WTKC 2RFNA 4RC2A 3IKAA 4G3GA 3DBQA 4GKIA 4NIFB 3K2LA 1R39A 3GCPA 2EB2A 3Q4TA 3R83A 2RFEA 1B39A 4YJSA 5E8VA 3V5QA 1OL5A 5HVJA 4FR4A 4PL3A 3NW5A 1PF8A 3VRZA 1FQ1B 3UNKA 2QU6A 3BRBA 4NYEA 5GJFA 3VS1A 4NCTC 3DPKA 3LFDA 4IB1A 4U79A 4ARKA 4DBXA 5J9LA 3UC3A 5IA2A 2VWIA 5E90A 1OM1A 3ZDUA 4BI0A 3G51A 3QCXA 4GYGA 4EJ7A 5KMMA 3KREA 3P9JA 3W33A 4DFXE 3LW0A 2QG7A 1CDKA 5FTGA 5AIKA 3ROYA 3NFGB 5DIAA 4AZTA 4UXQA 3IDBA 3QQUA 3H9OA 2F7XE 2R7IA 3DAKA 3IOKA 4HJOA 5KMKA 1H4LA 1JSVA 1QMZA 3N4VA 5F4NA 3MA6A 3WF8A 4O7WA 4BZNA 4C62A 4AZEA 5BVWA 3TEIA 5IA4A 1PXIA 4IEBA 3ZDIA 4DHIB 3RVGA 3NNUA 4X0MA 2C6KA 2VWXA 4J71A 3V5PA 1Q24A 3PRFA 3VHEA 4EL9A 5LJJA 4U45A 4FKUA 1OVEA 2XK3A 4KIQA 4E8AA 5FM2A 3RNYA 4EORA 2XEYA 3UP2A 1R78A 1O6KA 3T3UA 4LRJA 3EQFA 2Z7QA 3CY3A 4USEA 4FEVA 3EQDA 4AT3A 5IA0A 3MBLA 5HGIA 3O71A 5E8WA 4BCIA 4O6LA 2B9FA 2XS0A 2W1FA 3CQWA 4JBQA 1SVEA 3PG1A 4APPA 4ALWA 3AC2A 1J3HA 3RCJA 1RQQA 3UGCA 4I5CA 3MY1A 1KV2A 3P5JC 4I4EA 3BHHA 2GHMA 3CBLA 3ZU7A 1CTPE 1PMEA 4KUJA 4AGCA 2QR8A 1BUHA 2PVMA 3BHVA 2WEIA 4DITA 2R3HA 4G3DA 3WF9A 5BNJA 5K5XA 5AA8A 2XBAA 2X8EA 4GG5A 3HZTA 3WZKA 3FMDA 4PWNA 3MJ2A 3VN9A 3Q96A 1FVRA 4FL3A 4IFGA 4U9AA 4EYMA 5BYZA 4BY9E 4AN9A 4QP3A 4DEIA 5A9UA 2A1AB 3K5VA 1WVXA 1MRVA 4IX6A 4CTBA 4IAAA 4XS2A 1IA9A 4HYSA 2IG7A 1IASA 3CKXA 5AV1A 4GH2A 3R7EA 2R3JA 5K4JA 3Q4UA 1ZOHA 3B8QA 3R7OA 3A2CA 3FLWA 4Q5HA 3PJ2A 3FLSA 4YGAA 2J5FA 4QMVA 5JFWA 4M14A 2WMWA 3E93A 4ZZOA 1S9JA 2GTMA 4FNXA 4EUUA 5DLSA 1ZMVA 3JVSA 3W1FA 3TL8A 3I0QA 3O23A 2WXVA 3IPHA 4TT7A 3ZSIA 2W1HA 5L3AA 3RAWA 3ZEWA 4AWIA 4K6ZA 4A4XA 2W5HA 2UZBA 3PJ3A 2YIWA 3ORIA 1QPCA 3LOKA 4EBVA 5AAGA 2WAJA 2PE0A 3E5AA 2QODA 5IEYA 3LCKA 2C0TA 1W84A 4F7SA 3BV3A 3Q04A 4XCUA 3POOA 3PLSA 4BDCA 1UWJA 1WBNA 3FKOA 4S34A 4PTGA 1AQ1A 3KXHA 3PVUA 2PE1A 4P5QA 2OG8A 4YZBA 5BQ0A 3UDZA 3NEWA 2BPMA 2O3PA 4A9TA 1YKRA 3QFVA 3RK9A 4QTDA 4FIEA 3ULIA 4J8NA 4JQEA 2PWLA 3FZRA 4QP6A 3UZTA 3F5UA 5DRDA 3UO5A 2X2MA 5JT2A 2C1AA 4HVIA 3W16A 3HVCA 3H9FA 4L67A 4RPVA 5HX8A 4QNYA 2UZOA 5JSMA 5DFPA 3F2AA 4QMZA 3QGWA 5EYCA 2C6DA 3ZFXA 3BQCA 2F2CB 2P33A 3QWKA 4O7RA 4RC3A 2C47A 4I0SA 2GNHA 4HGLA 1UU8A 3PYYA 3U4WA 2AUHA 3ZC6A 3RZBA 1IRKA 4IVAA 4DEGA 2X6EA 4F6SA 3KF4A 3CTQA 1R3CA 4M68A 3DJ6A 4JIAA 3IQ7A 3R01A 4M67A 1U59A 4M8TA 4RJ6A 3UZRA 5LQFA 1YXVA 4QP8A 5A4EA 4G9CA 2ZV9A 2XKDA 3QU0A 4XP2A 3TKHA 5CAVA 3QALE 4DE4A 4QTCA 1Q61A 4TYIA 5ANGA 3OBGA 4TWCA 3S95A 4BR3A 3D4QA 5L8KA 4BCMA 5LCJA 5BX0A 3BEAA 3O8UA 3UQCA 5EYMA 3W0PA 3QXOA 4FKQA 1VYZA 1G8JA 2OZOA 2QC6A 2UVXA 1CKJA 1WBOA 2PVRA 3FYKX 4XMOA 3O5AA 3D14A 1XH9A 2HYYA 2QOLA 4AN3A 3IW8A 1ZMUA 4JXFA 4LDTA 4ZTNA 1FVVA 5AP7A 2X2KA 2X4ZA 3ZUVA 4O96A 3HKOA 3R21A 3FC2A 3UYTA 3AC3A 3GI3A 2VWZA 5EOLA 3MVMA 2JDTA 3ZLWA 4ZSEA 3SQQA 4O7TA 2J6MA 3CLYA 3DQXA 1YDTE 3KCFA 2JEDA 4LOPA 4V0GA 4ACDA 5ITAA 2YERA 3MTFA 4CNHA 3MH0A 5JFSA 4G5JA 2B54A 4TW9A 1PXPA 3QL8A 2Y4IB 3EYHA 1IEPA 3BHYA 3H10A 4S31A 5HD7A 3KMUA 2V7OA 4MCVA 3RI1A 5M53A 1R0EA 3FMEA 2Z7SA 4FG9A 2O2UA 4A9SA 1SYKA 4NZWB 1XH6A 3IW7A 2UW0A 2BFYA 5TKDA 2XIZA 4MWHA 4DFZE 4KS7A 4ZMEA 3HDMA 5F94A 2PY3A 3T8OA 4EOOA 5EQPA 4ZY6A 3DOGA 3V5WA 3HNGA 3Q9WA 4RWIA 3KK8A 4F9BA 4BTJA 1FBNA 4HCTA 4BDJA 3MIAA 3GFWA 4YUQA 5IPJA 2PHKA 2PVKA 2ITZA 3NUSA 4XHKB 1TQPA 3TV4A 2YABA 4CGAA 1H8FA 2ETKA 2Z7LA 2WKMA 4L43A 2O0UA 5BVOA 3RWQA 5KMIA 3IDPA 3W0OA 3VF8A 5M51A 4CEGA 1MRUA 5CX9A 2VD5A 3Q2JA 3QRKA 4X7QA 4RG0A 1H1RA 2YN8A 3E3BX 3VIDA 2WMAA 1VJYA 4XEYA 3FMKA 5JZNA 3UMXA 5BVFA 4FT5A 2Z02A 5CY3A 5IH4A 2BKKA 4TNBA 3FJQE 3WE4A 5H3QA 4HGEA 2UZEA 2VTRA 4C02A 3GQLA 3ZRLA 4YTHA 4C37A 1XH7A 1P14A 2GNGA 5HVKA 1JSTA 4LL5A 3M11A 2VTLA 2VWYA 3EHAA 3R8UA 2HIWA 1Q99A 2VGOA 3ZXTA 4BCPA 3ZHPC 5FLFA 3PDTA 4EKKA 1H1SA 2PMOX 1B6CB 1BX6A 3QQFA 2YWPA 1ZARA 3HA6A 1YWRA 4ZP5A 4XV3A 3Q5IA 1UNLA 4L8MA 4F63A 1MUOA 3FLNC 3I0OA 3GOPA 5EYKA 4YTIA 5KKRC 4DG2E 4EOLA 3RPVA 4A06A 2VWVA 5AUTA 3DQWA 3T9TA 2QOQA 4CSVA 4DN5A 3TZMA 5LVMA 4EOSA 3PA3A 4FOBA 3EN7A 5JK3A 3Q9XA 3QQGA 3CPBA 4CRSA 2WTKB 4MXZA 3P7CA 4P90A 1WFCA 4QTAA 5C1QB 4FTNA 4D4VA 2FSOX 1NXKA 2C6MA 3F6XA 4MNFA 4LV8A 1NY3A 3H4JA 4D1ZA 2O65A 4AW1A 3F3WA 1TKIA 4L01A 4M84A 1LP4A 3E62A 4K11A 2QOIA 3PP0A 4FE2A 4D55A 4F0FA 3ZBXA 2R3PA 3QKKA 2A19B 3R9RA 3D15A 4F7LA 3QTUA 4NW5A 5JGAA 2QKWB 3VBXA 3A8XA 3THBA 3DT1A 5FEDA 4F09A 3NS9A 4UWBA 3TXOA 3BBWA 3FBVA 3UPXA 4M0ZA 3JS2A 2OXYA 4AE6A 2JDOA 5JFVA 2X1NA 2PVFA 4KRCA 1ATPE 3MIYA 5FXSA 5KBQA 2OH0E 4ZY5A 5IQHA 4RX8A 2W4KA 3I6WA 3BHUA 3DGKA 3V8WA 2WQMA 5AA9A 1H26A 3UIMA 3A7IA 2ITTA 3CQEA 3SDJA 5IQFA 2VTOA 4U94A 3BE2A 3UC4A 4ANMA 4JDJA 4APCA 4MVFA 5A54A 4EOQA 1XO2B 5JZJA 3VQUA 2FB8A 3QZFA 2VAGA 2ZB1A 4YZMA 3UO4A 2NRYA 3CTHA