4LV7A

Crystal structure of inositol 1,3,4,5,6-pentakisphosphate 2-kinase e82c/s142c
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
390
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKCVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDCALILNDHSLFDCISVEIKPKCGFLPTSRFIGKENILKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICSLHALPLDESLKIVKEYLIAATAKDCSIMISFQYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol-pentakisphosphate 2-kinase
publication title Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 122
structure length 390
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lv7A01
3UDTA 4AXCA 4AXFA 4AXDA 4AQKA 2XANA 2XAMA 2XARA 2XAOA 3UDZA 4LV7A 2XALA 4AXEA 3UDSA
chains in the Genus database with same CATH superfamily
2HWPA 4AXCA 5J8IA 4AOIA 4W8DA 2QLQA 3G6HA 4M0ZA 4R3RA 1CMKE 2C30A 2YM4A 3KRWA 3V5WA 4HVHA 4F9BA 5CEMA 1SZMA 4AZEA 3OCTA 4YU2A 5IQIA 4C62A 4FKIA 3NUYA 3O96A 4RVLA 5CXHA 4NU1A 2JC6A 5EDPA 4G6LA 2C68A 2BFXA 3HKOA 2J51A 3R30A 5ANOA 4JT3A 3SC1A 2G15A 3FQSA 3CQWA 3OCBA 3DKGA 4QMWA 1JNKA 4C2VA 2R3RA 1WVXA 4FV1A 4GK3A 4KINA 4PWNA 3SXFA 3ORPA 2GHMA 1J1BA 3BKBA 3DQXA 3RM6A 3W0PA 3CCNA 5IISA 1ZAOA 1APME 5G1XA 3LE6A 3WF6A 2X0GA 3EIDA 4CV9A 2XNEA 2QOHA 3C4WA 4UYAA 4AACA 3MPAA 3ZC6A 2VWYA 5CU6A 1ZYJA 2J0JA 3KN6A 2WIHA 3R9RA 4QP6A 1GIHA 3BYSA 3LJ1A 3QYZA 1IRKA 4QPSA 2W5BA 5IMXA 3BHUA 2FO0A 3U4UA 4IAAA 3GQIA 5IA5A 4TYGA 5DIAA 4J7BA 1ZLTA 3LCSA 4X3FB 4QPAA 4PL3A 3DK7A 1SMHA 5IQBA 3BV2A 1KE9A 3DK6A 4M67A 4DFUA 3DZOA 3GOPA 4L3LA 4JDKA 4U45A 4H3PA 4DFZE 5A54A 4YLJA 4MBIA 5HQ0A 3KULA 3P78A 2VGOA 4GVJA 3R7YA 4EOLA 2WO6A 4DFLA 2OFVA 3C51A 3D9VA 5E90A 3ZC5A 4YHTA 3UNJA 4C33A 1VR2A 4RA5A 2C6MA 1X8BA 2W96B 1OL7A 4BCIA 3C4XA 5AX3A 3UMXA 5C01A 1IG1A 4GMYA 2R3PA 5EHYA 4BIEA 5D9HA 4EUUA 3FZPA 3TNIA 4QMQA 4H3BA 2JIIA 4PQNA 1NA7A 3EL8A 3IDCA 3QTRA 2A2AA 3UIMA 4AQKA 3NYVA 4FICA 3CLYA 4K9YA 3MIAA 1Q8WA 2XZSA 5AA8A 4NJ3A 4C37A 3C4EA 1NXKA 4R5YA 3LQ8A 5L2SA 3N4UA 2EB3A 4JJRA 5D41A 5CTPA 4C59A 3LJ0A 2AUHA 2B54A 2GSFA 2VO3A 1KE8A 3GQLA 1PXJA 1WBNA 1Q41A 3A60A 4IAKA 2O65A 3D4QA 3KU2A 5HE0A 3U8WA 1P14A 4HYSA 4YBKA 3EQBA 1LUFA 1QCFA 1PXIA 3O8PA 3UOLA 2HAKA 2EUFB 5L8JA 2XJ2A 3OP5A 4IB3A 2WIPA 1P5EA 3FMEA 5JGDA 1ZXEA 3KY2A 3WZUA 3KVWA 1XO2B 2QOCA 2XP2A 2IVTA 5FM2A 5L3AA 2BHHA 4X0MA 3SG9A 3R01A 4FV9A 4I0SA 2BUJA 5IU2A 3FZOA 2ITNA 3BPRA 1ZMUA 4UN0C 4ZTMA 3DY7A 3OWLA 4K33A 2W1CA 4G1WA 1JAMA 4K8AA 4EHVA 5BYYA 3LQ5A 3P86A 2PMNX 2ZMDA 3CTJA 4J71A 4U97A 3ZHPC 3WZDA 5HD7A 4F70A 1BKXA 3BYVA 3RAWA 2JLDA 5L8KA 1PXMA 5BX0A 1Q8ZA 4J53A 4GH2A 4CSVA 3NEWA 3FJQE 3C13A 4DHZA 3MVJA 4RWJA 4HGEA 2XCKA 5CU3A 1UKHA 3AC1A 4BCOA 5HLNA 2C5OA 4U5JA 4H1MA 2GCDA 2VTMA 5EH0A 2B52A 3Q9ZA 1XH5A 3CC6A 3KVXA 1FOTA 2GNLA 2V7AA 3BQRA 3W2QA 5JGBA 3EMGA 3W10A 2C6LA 4L01A 2WNTA 4OTDA 4DHJA 2BCJA 4YO4A 4DGGA 3A7IA 4Y73A 3CEKA 4O2PA 3V5PA 2A19B 1UKIA 5KMOA 4I6QA 4KBKA 5FD2A 3VBVA 4DDIA 5E8WA 5L2WA 5M4CA 4BBFA 3R21A 2JIUA 4MHAA 4CV8A 1B39A 3BQCA 3Q52A 2I7QA 4LV8A 4EOMA 2YDKA 3O17A 2CKPA 2P55A 2GU8A 1PYXA 4IQ6A 4CRLA 3VNTA 3IG7A 3PSCA 3Q2MA 3VS1A 3MPMA 4TYHA 3BL7A 5DHJA 1Q8UA 1L8TA 1HCKA 4KSQA 4C3PA 2C0TA 5CU4A 3C1XA 3WOWA 4QYGA 3FBVA 2NRYA 5E8YA 4XBRA 3GC0A 4ZZOA 2OZAA 4XJ0A 1NVSA 1TQIA 5CF4A 1BI8A 4HGTA 3LFQA 1YHSA 3OXZA 4FKRA 4O0UA 3BI6A 1YXUA 4OGRA 2F2UA 4F1OA 5CANA 3DBQA 5HZNA 1OUKA 3H3CA 1H25A 1R0EA 4IB1A 2VO0A 4LV5A 1UNLA 4N6ZA 3FMLA 1GIIA 1BI7A 2V22A 3Q4ZA 3QFVA 4WNOA 3UC4A 3OCSA 3PJ2A 4ZLYA 2CGUA 4EQUA 3IQ7A 4EC8A 2CGWA 3W0QA 3ZZEA 5IMEA 1IAJA 4AA5A 4DHFA 5A6NA 3JXWA 4DINA 5E8TA 2X2LA 2WTWA 3ANRA 2QG5A 2IVVA 4NUSA 3WARA 4MD8E 2B7AA 5BVOA 5IA1A 2IZTA 3LCDA 2X4FA 1ZRZA 2VTTA 1HOWA 5K4JA 5FQDC 1SVHA 1Z57A 4O0YA 3F3TA 4FKLA 3KXNA 2P2IA 1XMLA 3PRFA 3POOA 2UZWE 3ETAA 3R9NA 4F63A 3T9IA 1OPJA 4ANLA 3KCKA 4QO9A 2WB8A 2WZJA 5IA0A 3PXZA 4YNEA 2YERA 1KE7A 2R3HA 3TDWA 4FODA 2QONA 3TIYA 4QQTA 3BEAA 5HCZA 2QR8A 3NNXA 4AW5A 3O23A 2GTMA 3QTZA 5CAQA 3GFEA 5AIRA 3EFJA 4BDKA 2E9NA 4IAFA 3NW6A 1ST4A 4FV5A 4KIPA 4XBUA 5EW3A 3WF9A 4EH7A 5HU9A 3UPZA 1PW2A 2BRHA 3QLFA 4YZDA 5HTCA 3GEQA 3EQDA 3MIYA 4JOAA 4V0GA 1GIJA 3QTIA 4RIXA 5EK7A 3Q4TA 4G6NA 1O9UA 2ZB0A 3NAYA 5AMNA 1DS5A 2PHKA 3M11A 4BCJA 2J7TA 2YEXA 1R0PA 3HA6A 1ND4A 3JR1A 5JSMA 3FXZA 4IZ5A 2UZBA 4WOVA 2PVKA 2KTYA 3NW7A 3VBTA 5B2LA 2IVSA 1BYGA 2QKWB 5B0XA 3KXZA 2VNYA 3AT2A 3P5KA 1YOLA 4F1MA 5KKRB 4A06A 3DXQA 5HG9A 4B7TA 5IF1A 4XHKB 5CEQA 3AGMA 4JRVA 3DFCB 2QU6A 5AUZA 4AXEA 4M0YA 4O7SA 4YTHA 4ZSEA 2Y4PA 4MAOA 2X8IA 1YDTE 2OLCA 4M15A 3QQHA 2BALA 4R7BA 3FZSA 2QOBA 4AOJA 4AS0A 3K54A 2C5XA 3LQ3A 3R73A 4IVBA 3VUDA 1Q5KA 4RPVA 4ZS0A 2PUUA 3R8VA 5CF8A 3VF9A 2UZEA 1UU8A 3KXGA 4EH2A 2QLUA 2HY81 2GS7A 2W4KA 2X9EA 3P79A 4NTSA 4IM3A 3DDPA 3DFAA 4XV9A 1WBTA 4F7JA 5J9LA 1OGYA 4M3QA 3AC3A 2F7XE 4I23A 3ZU7A 4TPTA 2QC6A 3L8VA 4BDEA 4UBAA 4BCHA 2OJJA 1XHAA 2W05A 4AXAA 4IE9A 2UZVA 4D5KA 3QUEA 3ZZWA 4FZDB 4FIGA 4IX4A 2BMCA 3MY5A 3R02A 3W2SA 4F1TA 4EOOA 5LVNA 5A3XA 3Q9XA 2CNQA 3R7VA 3TUBA 3ZONA 4DFNA 2UVXA 1UVRA 4L67A 4YP8A 3ML1A 4F4PA 5IQGA 3FKNA 1J7LA 5AJQA 3N4TA 3I6UA 3T9TA 2BKKA 3SRVA 3MJ2A 3OC1A 4ZTRA 3OWJA 2XK7A 3TZ9A 4EK5A 3WE8A 5LJJA 5F9EA 3C4FA 4KIOA 4HCVA 4NW6A 5AV3A 4EOSA 5TOZA 2R64A 3BIZA 2R3JA 5HCXA 5C8MA 2CGVA 3MGYA 4BIDA 3FPQA 3QHWA 2YABA 2IZRA 2JKQA 4EC9A 3PVWA 4O7LA 4BZNA 2FGIA 3MA3A 4LUEA 5EFQA 1W84A 2QOLA 3EH9A 3PXYA 3QCYA 4RC4A 5FRIA 2GQSA 5EI8A 1V0PA 3S2PA 2QNJA 1ZYCA 3TWJA 5FXRA 4IIRA 4LMNA 3FY0A 2HXQA 3KMUA 5TO8A 2XMYA 3HMPA 2YM8A 4YGAA 3Q6WA 3TKUA 3HP2A 4BCGA 2BR1A 2E9VA 3FY2A 2DWBA 3AD4A 3DBCA 3Q6UA 5CASA 3BHVA 4I6BA 1WBPA 2VWIA 2PUNA 1WBOA 3G9NA 3KULB 5HE2A 1I44A 3QTUA 4I4FA 4EOJA 3VS5A 2J0IA 2J0LA 2JAMA 4FGBA 2VWZA 5BQ0A 4EK4A 1YW2A 4WSYA 4M7IA 3W2PA 4G5PA 3NYXA 2R3QA 3QX4A 4X6RA 2C1AA 2OO8X 2PL0A 2ZAZA 4A9SA 3F69A 2QHNA 3DJ5A 4MCVA 4BDHA 4FT0A 2WEVA 1GNGA 2XAMA 3EQRA 2F7ZE 3F3UA 1OL2A 1H24A 3UOJA 5BVEA 3FL4A 4KAOA 3ZRKA 4ITHA 2IPXA 2B4SB 1PY5A 2W5HA 2YISA 4GCJA 3E7VA 5E8XA 4QTEA 3TKIA 4FMQA 2OJIA 2YIQA 1GY3A 5LQFA 3FMDA 4FSWA 3IGGA 2HK5A 2OG8A 3BLHA 2PVLA 3VBQA 1Q61A 2XIZA 4L9IA 4Y5QA 5GJGA 1XH4A 4USDA 4BB4A 2WGJA 2XNMA 3EN7A 1GJOA 5ANEA 5A4LA 5M53A 3E63A 3FE3A 4JI9A 3B8RA 2BZKB 5HBEA 4D1SA 1FVVA 3FI2A 5K9IA 2C6IA 4XP2A 1ZZ2A 3DA6A 4O91A 2YM6A 4BGQA 3WYXA 3OY1A 4LM5A 4CFXA 3GC7A 2OI4X 2FSTX 4WBOA 1OL5A 2NO3A 1ATPE 5E4HA 2WTIA 3W55A 4X2JA 3ORLA 5CI7A 2WMSA 2PE2A 2JFMA 2OF2A 3NWWA 1CTPE 2XARA 4OT5A 5T3QA 2XEYA 3A7FA 1H1SA 4QMYA 5DNRA 1OL1A 2J5FA 3EFKA 4LGHA 1VZOA 4QMOA 5JN2A 2WKMA 3DCVA 5IA4A 4QNYA 1J3HA 2WU6A 3F7ZA 3D7TB 4D58A 3Q5ZA 5J1VA 1PKDA 4X2KA 1OKYA 2F9GA 3HYHA 5HNGA 3E87A 4EOQA 2WEIA 3ZUTA 2E9PA 2XYNA 2ZDUA 1REJA 3I0QA 1PXLA 2HZ0A 3I7CA 2BDFA 3IW7A 4RJ3A 5M4UA 2W4JA 3QRIA 3CY3A 2WMBA 2EXCX 4KB8A 5DOSA 4EOKA 3D94A 4OUCA 4ITJA 4ZY5A 1G5SA 2VV9A 4E7WA 4KRDA 3UVRA 4DDGA 4YMJA 5JQ5A 4DCEA 2G9XA 4DTBA 4ORKA 4XUFA 3I4BA 5CENA 2VWUA 2C5YA 4L3JA 3Q96A 3PZHA 4OBQA 4OTRA 3ZSHA 3R83A 4ANMA 4DEDA 4EHZA 3HV6A 2UW6A 5EKNA 4E4MA 4G9CA 1I09A 1M52A 3QF9A 4R7HA 4Z16A 4JR3A 1O6YA 4HVIA 3KXMA 4IDTA 5C8NA 5CQUA 2P0CA 5L2TA 1A48A 5LWMA 5B7VA 3U6IA 1PXOA 3M42A 4GT4A 4BDCA 5JEBA 1PXPA 3MDYA 3OF0A 3VAPA 5HNBA 3DAJA 3BWJA 5IQDA 1LEZA 1Q62A 2YAAA 4M68A 2IW8A 2EXMA 2HENA 4NL0A 3R7IA 2Y6MA 3LMGA 3KF4A 4CKRA 2OZAB 3HX4A 3TJCA 5FBOA 1OBGA 5IZFA 3RNIA 3NMUF 1RE8A 3LJ2A 3W0NA 1ZYSA 4R3PA 1SM2A 5HBHA 4UWBA 5KHXA 1U46A 2QI8A 4ZTHA 4AN2A 4QRCA 4FV6A 2QG7A 4NH1A 1OUYA 2VNWA 4RSSA 3UQCA 4XG6A 4XLIA 2W9ZB 3DLZA 3FYKX 4YTCA 3D5WA 1H1WA 2J2IB 3TYKA 4FVRA 5FG8A 5LMAA 3WBLA 3F6XA 2GNGA 1Y8GA 2VWBA 2FYSA 3NVKI 4QYYA 4LUDA 4LGGA 3NDMA 1KUTA 3A2CA 4FBXA 5JKGA 2JKKA 2C6EA 2UW7A 1Q3WA 3ORTA 3OHTA 4KWPA 1JPAA 3VS4A 3ZO1A 4QMLA 5I0BA 2PE0A 3P7BA 4E20A 4J8MA 3K3JA 3QZGA 5CVHA 3V8SA 4EQMA 2C3IB 4S34A 3UO5A 3UBDA 3F66A 5KBRA 3F2RA 2B9IA 3B2TA 1BL6A 2JKMA 3TV4A 2VTOA 4N70A 1G8SA 2YM7A 1K9AA 2ZJWA 3EZRA 5HHWA 2W1IA 4C61A 4WRSA 5E7RA 3S4QA 3FI8A 4I22A 1KSWA 2WMXA 4II5A 3R7UA 4BHZA 5HNIX 4RVTA 4GYIA 1AQ1A 4V01A 4IZ7A 1W98A 5HI2A 2XNNA 3MTFA 3RNYA 3V8WA 1V1KA 3I79A 2Z7RA 2PVMA 4FEXA 2I6LA 4F78A 5AAEA 3ZFMA 3LPBA 2IW6A 1WBVA 2RL5A 2YCQA 3QQFA 4GU9A 4JNWA 5TT7A 4E8AA 4EBWA 3BGQA 3BU5A 3R63A 4AZFA 4EWHA 2JDVA 5HIEA 5HG5A 2E9OA 1OKWA 5DEWA 3PXRA 3PJ3A 3CR0A 4PRJA 3ENHA 3L8PA 4PL4A 3GFWA 4RIXB 4V0GB 4F0FA 5KE0A 2W4OA 3WZEA 4JG7A 2WMWA 1Q99A 3OBJA 2OK1A 4RBLA 4ENXA 3E92A 1M2RA 5KMMA 4NZWB 4IADA 1W8CA 3VUMA 3QD0A 4I93A 3WYYA 5EYDA 4BGHA 4XEYA 5EI6A 3DKOA 3EL7A 3H9RA 3CTQA 4HYHA 3GC8A 1IASA 4ANBA 2CKOA 2PZIA 3PP1A 3I0OA 1KV1A 3AXWA 4XP3A 4AZWA 1M7NA 2XS0A 3NFFB 5D1JA 2UW4A 3TNWA 1DI8A 3HUBA 4YZNA 4EUTA 3U55A 3NR9A 4RC2A 2AC5A 4YURA 1OPKA 2ZB1A 4CFVA 5EHOA 4DBNA 4J52A 3BYUA 3DKCA 4R3CA 3BYOA 5CQWA 2IW9A 4PF4A 4EHEA 4CD0A 4ZY4A 2O63A 4EOIA 4CT2A 3DTCA 5G6VA 3ZS5A 2HXLA 2ZMCA 3C9WA 4JVGA 4MQ1A 1R39A 2OIBA 3NRMA 4F0GA 3RJCA 2X39A 3MY1A 2YIWA 2VTAA 3GU8A 3PUFC 3N4VA 2YITA 4Z55A 3ZXZA 4FL2A 1YDRE 3QUPA 3QLGA 5LXMA 3QC4A 3OS3A 3BRBA 1R78A 2V62A 5CEIA 4RX9A 5BVWA 5KHWA 3PVGA 3AMAA 3BLQA 4PNKA 4L7FA 4O7TA 3UIXA 2J9MA 4MQ2A 4L52A 4H1JA 4JG8A 3G2FA 4BI0A 5CYIA 3HRBA 4E5AX 2UW8A 2OGVA 4WA9A 5HG8A 2IZUA 3LFEA 3Q4CA 5I9ZA 4JQ7A 4CLIA 1T46A 3TNQB 2XNOA 2WMTA 4G31A 4Y46A 2QOIA 4FKJA 3R6XA 4BZOA 5I9VA 4RZWA 3H0YA 4JS8A 3ROCA 5JQ8A 3GU5A 5EG3A 2YWVA 3OEZA 1OIYA 4YZBA 2ZV8A 4IWPA 4RFMA 3PXFA 1H1QA 3OOGA 3SRVB 2JDOA 4KS7A 4O6LA 5BYZA 2WMAA 4O2ZA 2PE1A 4QQCA 1H0VA 5GIOE 4FIFA 5M44A 4AGWA 5I9XA 3ZLXA 4AA4A 1UWJA 3FLWA 4TRLA 1DAWA 4FTJA 2C5VA 3WILA 3D5XA 4B4LA 5E8ZA 1WAKA 2I0EA 2I1MA 4AAYA 4O7WA 4WO5A 2XVDA 3ORNA 4MD9E 3QQLA 4HYIA 3VF8A 3AD5A 4FT3A 4KSPA 3FLZA 4C4EA 2BDWA 3COHA 4PNIA 5C9CA 2FSLX 3LVPA 3CP9A 3E8DA 5KO1A 3KRLA 2R3LA 3SW7A 2UZNA 3HGKA 1G3NA 2WMVA 2XK4A 2OBJA 2ERZE 2XYUA 4NM7A 3GENA 5KMKA 4FTMA 4WNKA 1UA2A 4ASEA 2I0HA 5DWRA 5KNJA 4FNWA 2YDIA 3UG2A 4ZMEA 3F82A 1QPEA 2ZOQA 3QZIA 4YNOA 4BYJA 5LCKA 5EHLA 5HX8A 4FKVA 2P2HA 5IG1A 2R4BA 3ZOSA 5HICA 4HVSA 1XBCA 4L8MA 4QYFA 4PUZA 4X3JA 2OZOA 4S32A 2VTJA 4ZLZA 3GI3A 4ASZA 3VIDA 5EYMA 3TNPC 2Z2WA 1CKIA 4JBPA 3L9LA 5AP0A 4XH6A 5FEDA 4ASXA 4BICA 5C8KA 4BDFA 2WFYA 3SKCA 3VRYA 3FWQA 4WBBB 3D7ZA 4AW0A 3BGPA 2C5NA 3OVVA 4EJNA 4O83A 4QP9A 1KE6A 2JDTA 4PMMA 5C27A 1Y57A 2J0KA 5TR6A 4FNXA 3CIKA 4K77A 4ZK5A 1KOBA 5GNKA 4XRJA 5E92A 1ZZLA 2QOOA 4PTGA 3QA8A 3HDNA 5I9WA 5LVMA 3FV8A 3S0OA 3OZ6A 5CX9A 4BBMA 4N0SA 4CFUA 4CVAA 4W4VA 3K5UA 2W5AA 4GL9A 2CSNA 2YIRA 2JDSA 1PYEA 5JGAA 4FSMA 2FVDA 3HV7A 4ZSLA 4ZJJA 2A1AB 4BYIA 3ZFXA 1WVWA 5HVYA 3W32A 2PMOX 3KK9A 4U40A 1UNGA 1URWA 2REIA 1MRUA 2XH5A 4E73A 5AP6A 4CXAA 5AM7A 4EH4A 2VTSA 3OY3A 4O7VA 1PHKA 3H4JA 3PDTA 5FDPA 1SNUA 3SA0A 2PZYA 3ERKA 1JWHA 4HGLA 3R1SA 5CI6A 5M57A 2YAKA 4LQMA 4MXCA 3BHTA 3OW3A 3D83A 4O96A 2WU7A 4KKHA 3OTVA 1VYZA 4ALVA 2BILB 1H08A 5EM8A 4TL0A 3WIGA 3HAVA 4MBJA 2P3GX 4LYNA 4GRBA 2WMQA 4GKHA 3MB7A 3U51A 2XRWA 2OH4A 5DH3A 1YHVA 3TKHA 4CFFA 1ZY5A 3QXPA 3UPXA 3RTPA 4A07A 3KRXA 2WQEA 1VLRA 3D7TA 3DXPA 5AUXA 5BNJA 3FL5A 3RHXA 3VONA 4L7SA 4DTAA 3QTSA 5A9UA 3UDSA 3LXNA 3UZPA 1Y8YA 3BHYA 3QWJA 4MXYA 4WNPA 3ORKA 5DR2A 2ITQA 3R8ZA 5AP4A 2VD5A 3EN4A 3RWQA 3E8NA 2QOKA 3H10A 1MP8A 3BBTB 3FC2A 4XX9A 4TXCA 4WNMA 5AAGA 3WZJA 3MPTA 3NNUA 3A7JA 5AIKA 4BTFA 2FUMA 4P90A 4E4NA 3IW8A 5IQCA 5J5SA 5LVPA 3KC3A 3TV6A 2PSQA 4I4EA 5IH4A 4GYGA 4QDEA 5HD4A 4E1ZA 3KFAA 4OTGA 2XIKA 3ATTA 3DU8A 4O22A 2X6DA 3DLSA 4FTIA 5J9YA 3E3PA 3PY3A 5AUVA 5J87A 1LPUA 2BROA 4FV8A 1YI4A 3VS7A 1H8FA 5BUIA 3O0GA 2C0IA 4QDVA 3L9MA 2XB7A 3GUBA 4DEHA 3KA0A 2W9FB 4PX6A 4C36A 3NUNA 3F5UA 3DKFA 5FXSA 5GIPE 3UP7A 4MXXA 3RPRA 3R7EA 4YSJA 4U81A 3CSVA 2QCSA 4NWMA 2QOQA 4JAIA 5CSVA 4I41A 4X3FC 4NSTA 2Y7JA 3VJOA 4JDIA 4YJUA 1W83A 4YTIA 1ERKA 2C4GA 4GV1A 4PY1A 3CXWA 3UDBA 2Z60A 3SG8A 3NVMB 1ZOGA 4AXDA 4JLCA 1XJDA 4AF3A 4C4GA 2XANA 3KRJA 2O2UA 4XLVA 4IX5A 4C34A 2WHBA 3OEFX 1O6KA 3M2WA 2JBOA 4RQKA 4EK8A 4PV0A 2J5EA 3CBLA 3JS2A 2UW0A 3AC4A 2QO2A 2Y8OA 4G5JA 5CZIA 3THBA 3EOCA 3DT1A 3ZCLA 3RK9A 4DHIB 3QRUA 2WQBA 1SVGA 4FTLA 4EONA 2WELA 4FTAA 4JAJA 4RQVA 2B9JA 2BAQA 3AC2A 5CU0A 3NPCA 3R8PA 4IAZA 5E8UA 3OG7A 4FSZA 2R3OA 1XH8A 2WQMA 5GJDA 3VS0A 4UX9A 3L1SA 3PFQA 2UZTA 4LDTA 4MKCA 2YJRA 4F6WA 2E9UA 3CPCA 3RP9A 5AEPA 5ANIA 4JIAA 4P7EA 3KK8A 1PMVA 5ETCA 1S9JA 3QQUA 4DG3E 4PP7A 1K3AA 3W16A 5CAUA 4L43A 3NS9A 4IJPA 3ROYA 5HKMA 5I9UA 3PVBA 2R0IA 4E6CA 2XRUA 3QWKA 3ZUVA 4IBMA 3V51A 4IWDA 3EQIA 2ZV9A 4O6EA 2XKFA 3IW4A 2ITUA 3FQEA 2R3IA 2PVHA 2I40A 3DV3A 4C35A 3EKNA 3DBEA 4XYFA 4TNDA 2W1FA 5J9ZA 3QHRA 2W0JA 3CJFA 4JDJA 5AV2A 4MNEA 2DYLA 4K2RA 4EKKA 4QYEA 1MUOA 5DEYA 3VJNA 4AT3A 4CKIA 5EKOA 5IDPA 4KBAA 5M07A 2PK9A 4DFXE 2A4LA 4QMMA 5ACBC 2OFUA 2OH0E 3FEGA 3VC4A 5ACKA 2Y4IB 3PLAE 4MXOA 1H1PA 5ANGA 3A99A 2GS2A 4RX8A 4DEAA 3VWAA 5J7HA 3HL7A 3ULIA 4FKSA 3O2MA 3VVHA 4QP7A 2HIWA 3KL8A 4YPSA 4MF1A 1OVEA 5HU3A 5CSWA 1WBWA 3QCXA 3WI6A 1WBSA 3R9HA 4DEEA 4MX9A 5EQYA 4U42A 1MRYA 2AC3A 3ZLWA 4F08A 3LXKA 5HE1A 4H05A 3W0MA 4ACCA 4QQ5A 4FEVA 5EYCA 2G2IA 3GB2A 3NW5A 4FNYA 4R1VA 4QP4A 4KIQA 4J96A 3GBZA 4JBVA 4MEDA 3FSFA 1H00A 3PIXA 1WCCA 2XM9A 3IW6A 4DH8A 1GZKA 3WZKA 3V5LA 3PRIA 5BV3A 5IEYA 5JFWA 2XEZA 2XK3A 4FOBA 4TWCA 4RMZA 2CDZA 3MJ1A 3TL8A 1TKIA 4NFNA 5CALA 5DVRA 3EQHA 4L46A 3Q32A 2XNGA 2R3MA 1JKKA 3MFUA 3NUSA 2C6KA 2ZVAA 4LMUA 4MTAA 3SDJA 3TUCA 3OROA 3UOKA 3GNIB 5E91A 4FIEA 4YC3A 1SYKA 5D7VA 4D2SA 3PIYA 4GFGA 4XV3A 5HIDA 3A4PA 4ZEGA 4HZSA 3N51A 4RVKA 3C5UA 3QD2B 3FLSA 2CMWA 1OITA 4FVPA 4LL0A 3V5JA 5IEXA 3E64A 2OIQA 4D55A 3C4ZA 4H36A 4RT7A 3HLLA 3ZLYA 4BCMA 2RG5A 4EHGA 3MI9A 3ZEPA 2PVNA 4S33A 4I5PA 4XG7A 3TN8A 3V5QA 2QKRA 2WTKB 4UXLA 1OL6A 2W1EA 4TT7A 3QCSA 4Z7GA 1XKKA 1QPDA 4Q9SA 4XG9A 3Q53A 2YDJA 4Q2AA 4O27B 5HLWA 3EFWA 2OXYA 4PTCA 2QU5A 4TYIA 3RVGA 3BV3A 4NTTA 4FG7A 4GJ3A 3NYOA 3ZFYA 1JSVA 2YWPA 4QP8A 2B55A 1P2AA 4MYGA 1U59A 3LFSA 2GS6A 2LGCA 3W0OA 3I7BA 2V55A 5H8EA 2UW9A 5HE3A 5D12A 3V6RA 4ZTQA 3RK5A 2YZLA 4I6FA 2GNJA 2ETRA 2R0UA 3FHIA 4I6LA 4K0YA 4TZRA 4BHNA 5DBXA 4HYUA 3I81A 3G90X 5J95A 1BX6A 4R78A 5DRDA 5KMJA 4FIHA 3SHEA 4X2GA 4BTJA 2X9FA 3BE2A 3GCQA 5AUTA 1H27A 4MWIA 4U41A 4GFOA 2PULA 3Q9WA 4C0TA 4I0RA 3G33A 1PXKA 4AW2A 4QMZA 3Q5IA 4TWPA 4U6RA 3ZEWA 5ITAA 4RWKA 3PTGA 4FKPA 5I5ZA 3F3WA 2JFLA 3FPMA 3R2BA 4EWQA 1FGKA 4YJTA 3BWFA 1YXTA 3UE4A 3RINA 2CLQA 4P2KA 1YI6A 4L42A 4YZ9A 3DJ6A 3W2OA 4U3ZA 4H39A 2PUIA 5HBJA 4KD1A 5KMLA 4LFIA 4F9WA 1Z5MA 4PDSA 4EH3A 4EBVA 4BKJA 4JQEA 3KRRA 3ORXA 3HDMA 4R77A 3VUGA 3ZMMA 2GQGA 4BC6A 3R28A 3IW5A 4XOZA 5KKRC 3F5GA 4GT3A 4R5SA 2NPQA 4AE9A 2UZDA 4XG3A 3W2CA 2H34A 2O8YA 4ACMA 4DFBA 2VX0A 3R0TA 2WMRA 5AP7A 4CNHA 3KMMA 3GT8A 3ORZA 4RC3A 4UXQA 5DPVA 1KOAA 2C47A 4QYHA 2WQOA 4W8EA 1YDSE 3I1AA 5CLPA 3S95A 5DE2A 3HAMA 3TCPA 3V8TA 5AV1A 3GCPA 3ZTXA 4MXZA 3HZTA 1Z9XA 2BPMA 3UJGA 1Y6AA 1IEPA 4FOCA 5JMSA 5EM6A 5M55A 3CY2A 3FKLA 3ZBFA 3QBNA 4O0VA 3G5DA 1KE5A 3KXXA 2PVYA 4ARKA 3EB0A 2P33A 3L9PA 3L9NA 1KV2A 3PJ8A 5D11A 1WZYA 3NFGB 4Y95A 4DAWA 3QD3A 2WQNA 2FB8A 3R8MA 1YXXA 3NIEA 3OWPA 4IM2A 1OIQA 4AZSA 1Q4LA 5HIBA 4A9UA 4PDPA 5L6OA 1E9HA 3A61A 3C0HA 2VTLA 2YHVA 4TN6A 3BEGA 5AFVA 3AC8A 5E1EA 4FTRA 5IQEA 1YI3A 2BRMA 4O0TA 4RFZA 4WHZA 4DBXA 5LMBA 4FSQA 5EM5A 2PZRA 3ODYX 3QC9A 3FZRA 3HV5A 5FBNC 3KEXA 1S9IA 3LFNA 3PUPA 3DTWA 1W82A 3ORMA 2BZIB 4U80A 5I4NA 3P1AA 2NYAA 3FUPA 2XIRA 3QRJA 2IWIA 2OWBA 3W33A 3RPVA 2OXDA 1YQJA 3KXHA 5EQPA 4BCNA 4OTIA 4AFEA 4AOTA 2W1GA 3W8QA 4DH5A 3IK3A 3OWKA 4KKGA 1OKVA 5AP3A 1UU3A 3P0MA 4X6QC 1XBBA 2WTJA 4DA5A 4ZIMA 4J95A 4FJVA 3LKMA 3W2RA 3AT4A 4O84A 2ITOA 2R3FA 3EHAA 3AT3A 2BZHB 4FV3A 4I24A 2G2FA 5HEZA 2YCSA 3E62A 4KNBA 3PYYA 4C4FA 2RIOA 4F7SA 3PJ1A 5IH5A 3SXRA 4P5QA 4ITIA 4DEIA 1FMOE 2FSOX 2VWWA 4LL5A 4LRJA 4OTHA 4YC8A 1FPUA 2BIYA 5FP6A 3KREA 3UOHA 2UW3A 2GPHA 3C0GA 3UMWA 3QRKA 3HUCA 4F7NA 4P5ZA 4DE4A 2PY3A 3RKBA 3A8XA 3LM5A 1LR4A 1PF8A 2JEDA 2XM8A 4IHPA 4YPDA 3CQEA 3S3IA 3DZQA 3GOKA 3ZRMA 1XQZA 2PVJA 3TT0A 2UZOA 5A4TA 3R22A 4TWOA 4F65A 3CTHA 3MH2A 5IUGA 4CG9A 3FZ1A 4ANSA 4ACHA 4FYNA 4GIIA 4G2FA 4DLJA 1E1VA 4XS2A 4C38A 4Z3VA 5HG7A 4FT9A 4DG0E 4AT4A 3MV5A 4GG7A 5K5XA 4EL9A 5KUPA 4MWHA 2F2CB 5EW9A 4BI1A 2FA2A 2BVAA 3LLAA 4AT5A 1OI9A 3BHHA 2ERKA 4HNFA 3AOXA 5KZIA 4J99A 2UW5A 4MK0A 2RFSA 5H8GA 5CF5A 5HX6A 1TQPA 2VX3A 2W06A 4AWIA 2KULA 2RFEA 1H28A 5CNNA 3D0EA 3ATSA 3HMOA 4NCTA 5CVGA 1PKGA 2GNFA 2F7EE 3L8SA 3OMVA 4KA3A 4XMOA 5CNOA 4RGJA 1OGUA 2V5QA 3FMKA 4CT1A 3W18A 4M8TA 4EZ5A 4HCUA 4KRCA 4BI2A 5JZJA 3ZO3A 2OF4A 3PVUA 4N4SA 5BMSA 1URCA 3DBFA 2H6DA 4FR4A 1XBAA 3KQ7A 2CN8A 3F88A 4IC7A 4ZTLA 5H2UA 4I92A 4RA4A 3MB6A 4O0RA 4XNEA 3ZLSA 3MN3A 3UDTA 2HW7A 5IA3A 4E26A 3ZUUA 4WD5A 3V5TA 4MNEB 4DGNA 4TW9A 4HVGA 2GDOA 4FL1A 2B9FA 2X6EA 5IUIA 3RWPA 5JFXA 4MBLA 3VW8A 4ONAA 4IC8A 1STCE 2UVZA 4E6DA 3ENMA 4E6QA 3R00A 3QUDA 3P23A 4CFMA 2X7GA 3E3BX 1H1RA 4MXAA 5FEQA 1ZMVA 3AKJA 4N57A 2VTPA 3D15A 3R2YA 2IO6A 3S1HA 3NAXA 4GFMA 3PSBA 4FYOA 4I0TA 1FVTA 4O21A 3TACA 4AP7A 4QMNA 5IQFA 3LFBA 4QQJA 2ITVA 5F20A 3PWDA 4R6VA 2O3PA 4BDJA 4DG2E 5FLFA 2VTIA 4NKAA 3OT8A 3SOAA 2XF0A 1YXSA 3D2IA 4QNAA 4X21A 3UG1A 4Q9ZA 5FM3A 3R9OA 4G9RA 3O7LB 4YLLA 1FQ1B 4C3FA 3PG3A 3MVHA 4BDIA 4ACGA 2YM5A 4F9AA 4KS8A 3UNKA 3SGCA 2R5TA 4IAYA 2RF9A 4CCBA 3C4CA 3CQUA 3K3IA 1QMZA 4RIOA 5HVKA 3ODZX 4DN5A 5LMKA 5F1ZA 1QPJA 2IVUA 1T45A 3QYWA 2YA9A 4D4SA 1JKSA 4L00A 5LARA 4ZAUA 4FSRA 2UZLA 4G3GA 5ICPA 3UODA 3DDQA 3SX9A 1AGWA 3LFAA 4YSMA 5AUYA 3BZ3A 3P5JC 3E8EA 4A4LA 2R7IA 4WUNA 3HMIA 3F5XA 2QVSE 4BDGA 4IZAA 3EFLA 2ZDTA 2BKZA 4MH7A 1ZOEA 4GU6A 4QMXA 3BELA 5M56A 4WT6A 1MQ4A 4A9TA 3RGFA 3JUHA 3IGOA 3R1YA 4IH8A 4R7IA 4DT8A 3VS2A 4WKQA 4ZOGA 2X81A 2Q83A 4FIJA 3GXLA 1H26A 4DTKA 1Q97A 3UIUA 4DCAA 1P4FA 3G9LX 3NUXA 4FIIA 4TKSA 3UNZA 3W8LA 3P7CA 3KF7A 2VTQA 1OB3A 2C1BA 4EYMA 2VWXA 3VW6A 3LMHA 4WRGA 1NY3A 1GOLA 4KBCA 4GEOA 4UY9A 4AAAA 4BZDA 2PMLX 2O5KA 2WAJA 4IANA 3VBYA 3PIZA 1GZNA 4FSUA 1LP4A 3DAEA 1JLUE 4OBPA 5CSHA 3GU4A 5KZ0A 5CSXA 3E93A 3LAUA 4Y8DA 3M1SA 4ZZNA 4FTUA 1LEWA 4CEGA 4FL3A 4MVFA 3PXKA 1PXNA 4L45A 4FK3A 5DG5A 5A14A 3F5PA 4L68A 5CAPA 4FI1A 1RW8A 5BVKA 4A9YA 4CZUA 1ZY4A 3UP2A 3ZM4A 2Z7QA 5GHVA 1H07A 3HV3A 1JQHA 4GUBA 4IJ9A 4LRMA 5JH6A 2VWVA 5JZNA 3MA6A 4NM5A 5C03A 2VO7A 2W1HA 1NVRA 4BDDA 3RPOA 1UNHA 3UYTA 3EQPA 1A06A 2VU3A 3ZO2A 3DK3A 4O7YA 4APCA 3BLAA 5JFSA 3QKKA 3ZSGA 5DR9A 4FTOA 2FSMX 2ONLA 1JKLA 3DOGA 3V3VA 4I6HA 3NSZA 2ITTA 4BCKA 3BU3A 3FLYA 1RDQE 3NYNA 3MH3A 4BRXA 1ZARA 3NLBA 4JMQA 4O82A 3PZEA 1QPCA 3TZ8A 1M14A 3VQUA 2Y6OA 1K2PA 2PTKA 4G6OA 3AQVA 5IH6A 2RKUA 4WIHA 2GFSA 4K11A 1FMKA 3HECA 3RCDA 3JY0A 4BJJA 4FK6A 3R7OA 3EZVA 4EH5A 4O81A 2XUUA 4I20A 4TY1A 5K3YA 1Y6BA 4Y83A 3IECA 2CN5A 3PG1A 5CEKA 3IOPA 4GJ2A 2C0OA 2GNIA 2X2MA 3FI3A 3FYJX 3HEGA 4YJRA 5JRSA 2F57A 2C69A 3UDZA 4AX8A 4YJOA 5FTQA 4JL9A 3SV0A 3W0SA 2VRXA 4TNBA 4YJQA 1J1CA 3QKLA 4IFGA 4OR5A 2HW6A 1YRPA 2XIYA 3VRZA 4USFA 2R2PA 4JDHA 3EN5A 3FXXA 4V05A 3Q4UA 4XCUA 4QEBA 1CSNA 3CGOA 3UIBA 4NM0A 3UZRA 4B9DA 2PVFA 1FINA 4H3QA 5FDXA 1ZWSA 2YACA 4PMPA 4K18A 5C1QB 2G01A 4IAIA 4IB0A 3NIZA 4O0SA 4ASDA 5IQAA 1J91A 3AGLA 3KB7A 5H8BA 5L6WL 2DUVA 4I5MA 5DT4A 1H01A 3MSSA 3OXTA 3TG1A 4FTKA 3TXOA 4HW7A 4RX7A 2YJSA 1U5QA 3TM0A 4B8MA 4BCQA 1GZ8A 2HOGA 5HORA 5CZHA 4FKUA 5DT3A 1VYWA 5CSPA 1YWRA 2R7BA 3QTQA 4BGGA 2Z7LA 2Z7SA 3UVPA 4CLJA 4RLKA 4YC6A 3SLSA 4U9AA 2A0CX 4XV1A 5B2KA 4IEBA 5E8VA 5D10A 5BVNA 5DR6A 3FAAA 4ERWA 4FGRA 2YCRA 4GIHA 3LZBA 2XJ0A 3Q60A 2Q0BA 5KMNA 1Y91A 2HZNA 3DB8A 3NCZA 4X2FA 4N6YA 2C6TA 4TWNA 4TYEA 4CKJA 3NUUA 3PPKA 2RG6A 1U54A 3QA0A 3TI1A 2VX1A 5H3QA 1PJKA 2XK6A 4AN3A 1Q8TA 2HYYA 4HCTA 4GW8A 3QKMA 3ITZA 2O64A 3BLRA 5BPYA 3G51A 4EKLA 4NJDA 3P08A 4DLIA 4V04A 4XG2A 5M09A 5AP2A 3MS9A 1MRVA 4XG4A 1WFCA 4RIWA 1ZMWA 4RWIA 2C6OA 3Q04A 3I5ZA 3MESA 3WF7A 3MY0A 3E88A 3F9NA 4BDAA 5M06A 4BY9E 3TJDA 2NRUA 2W7XA 2GHLA 3BBWA 1UU9A 4RJ7A 2HZ4A 4RZVA 3HP5A 4ZTNA 3PFYA 3UGCA 3ALNA 4YZCA 5AP5A 1BLXA 2AYPA 4KUJA 2CNVA 3LCOA 3UZTA 2ZM1A 3QU0A 3IDPA 2HZIA 2XKDA 4O7ZA 4CMOA 3LFCA 3NUPA 1BUHA 2BRBA 2C3LA 4D5HA 5AV4A 1YOJA 4AN9A 4JBQA 3FLNC 4BDBA 4QT1A 4RX5A 1G8AA 2UVYA 3KGAA 4EI4A 2BTSA 1V0OA 2YIXA 3F3VA 3QTXA 3QQGA 4JIKA 2ETKA 4ZSAA 2C6DA 3BE9A 4DGLC 4FKGA 2WTDA 2CKEA 4C2WA 3PE1A 5BMMA 4NFMA 4AZTA 5CEOA 3ULZA 4OW8A 4A9RA 1B38A 3IOKA 4EZ3A 1M2QA 4YJNA 2WOUA 3CS9A 2QODA 3RCJA 5E9EA 3SOCA 3NZ0A 3EN9A 3I5NA 5CAVA 3VUHA 2WXVA 2G1TA 2F49A 2XKEA 3LCTA 3IS5A 2BRGA 4FVQA 4FZ6A 4MUQA 3RK7A 1YWVA 4GVAA 3UO6A 1H4LA 3LW0A 3D5VA 3PLSA 5IUHA 4GSBA 4F9CA 5FTOA 4YZMA 4UWCA 2CCHA 4C7TA 4XG8A 4DH3A 4EJ7A 3CD8A 5IA2A 2ZV2A 2WMUA 3I6WA 2YZAA 3KCFA 4F9YA 3D5UA 3DAKA 3R1QA 3CJGA 4U7ZA 5FGKA 3QX2A 3MVMA 4LOPA 3V01A 3KKVA 2RFDA 4RG0A 4BR3A 3AKLA 4R1YA 4YJPA 3A8WA 5EYKA 4D1XA 4ALWA 3G0FA 2OKRA 4FKWA 4ZTSA 1OKZA 2QO7A 3OCGA 4I3ZA 5EOBA 4L44A 3SVVA 4YJVA 3IKAA 4P4CA 3MVLA 2UUEA 4GK4A 3GU7A 4WG5A 4JQ8A 4IWQA 3LXPA 4ERKA 4HGSA 4HOKA 4ZXTA 4FEUA 2X8DA 5CS6A 4HZRA 1GAGA 5T68A 2ITYA 2B53A 2JITA 2C3KA 2R3KA 4G16A 4QMUA 2X2KA 4FZFB 5EM7A 4ZLOA 5BUJA 3SW4A 3H30A 3Q3BA 3RALA 4AW1A 5KCVA 3PPJA 3V6SA 4IMYA 5CY3A 5EQEA 4YUQA 5AX9A 3CKXA 1R3CA 3EQCA 4FT5A 2V7OA 3DS6A 1JKTA 4B99A 3ACJA 4U0IA 4FKTA 2GQRA 4QOXA 4BCFA 2Y9QA 2OW3A 1OIUA 3GVUA 1M7QA 2I0VA 3PSDA 4NT4A 1YOMA 3QZFA 5KBQA 3PA5A 1P4OA 3FMMA 1B6CB 2X4ZA 5LCJA 2YCFA 4FTCA 3DPKA 4E93A 3N9XA 4RIYA 3OUNB 3O8TA 1BMKA 2ZFYA 4IWOA 4QTDA 2JD5A 5DRBA 5EDQA 5BYLA 4FV0A 4BTKA 5HTBA 4QTBA 4RJ8A 3EJ1A 4IW0A 4FV2A 2G2HA 5HVJA 3Q9YA 4HJOA 4K6ZA 4J97A 4RRVA 4AGDA 4AQCA 4F99A 3B8QA 1TVOA 2CKQA 4ZJIA 4USEA 4AA0A 5K5NA 5AV0A 3IO7A 2XAOA 1W7HA 3ACKA 2SRCA 1DAYA 4QP3A 4RWLA 2VTRA 2OXXA 2PWLA 4FSNA 1ZYDA 2I0YA 2VAGA 5B2MA 4FG9A 4FSYA 2VGPA 2PYWA 3U87A 2X7FA 5HCYA 5M51A 2EVAA 2IZSA 3C7QA 3E5AA 1MQBA 1CDKA 5ETFA 3UTOA 4FA2A 4FX3A 2XIXA 2J4ZA 1U4DA 4EQCA 4JXFA 2H96A 3D14A 2BHEA 4J98A 2HY0A 3II5A 4ZSGA 4W4YA 3PP0A 4PL5A 2R3GA 1UU7A 2W1DA 3VULA 2QD9A 1F0QA 1JSUA 1U5RA 3MTLA 3QRTA 5AM6A 4AFJA 5AUUA 2GFCA 5AP1A 2JGZA 4WG3A 4DGMA 3GGFA 5E8SA 2XBJA 4G3DA 4UALA 5HO7A 1CKPA 3FMJA 3JYAA 3QGWA 3FHRA 4HPTE 5CWZA 4I1ZA 3GCVA 1Q3DA 3ZH8A 2WD1A 3LCKA 1IAHA 4JX7A 2UZUE 3ID6C 4CFNA 4ZMFA 3SXSA 4LI5A 4D28A 4FEWA 2EU9A 3PA3A 5EI2A 4Q5EA 3AMBA 3NX8A 4L3PA 5ANJA 4AGUA 5K4IA 2YFXA 1YVJA 3F3ZA 3HA8A 2WTCA 3KMWA 3MFRA 3LIJA 1IR3A 4U3YA 3T8OA 4F0IA 3DJ7A 2ZM4A 4M97A 3O50A 2QO9A 3AG9A 3ZDUA 3TMOA 3TZMA 2JKOA 3TDVA 3POZA 4O86A 4OLIA 4XP0A 2BDJA 5M08A 1EH4A 4KKEA 3QQJA 4XRLA 3GU6A 4XV2A 1GZOA 2X1NA 4NCTC 5CT7A 5F94A 3R8UA 4CMTA 4CRSA 4J8NA 5BVDA 4BIBA 4CTBA 4E4LA 4GS6A 2UV2A 3UYSA 4U44A 3B2WA 4QMPA 4BF2A 1RJBA 2ESMA 3VHEA 4TTHB 3QAME 4ALUA 4CG8A 3EQGA 2R3NA 3QZHA 4Y85A 2QQ7A 4E5BA 4PMSA 4AZVA 4IFCA 4IM0A 4M69B 3NNVA 4YBJA 4B6LA 3E7OA 1DI9A 2BAJA 2OIDA 3KIOC 1IA9A 3LM0A 4IVCA 2XNBA 4WG4A 5DA3A 1R1WA 2YIYA 4J1RA 4QMSA 4KABA 3RI1A 4DGOA 1L3RE 4D4VA 2VO6A 1XH9A 4JBOA 2X8EA 3SQQA 1JSTA 4BBEA 3L8XA 4IB5A 4M12A 3NCGA 4DYMA 1SVEA 4QMTA 4BJJB 4YJSA 4IX3A 5AWMA 3EYGA 5ANDA 4C58A 1UWHA 4Z9LA 5FTGA 5ANKA 5LVLA 4DEBA 5HLPA 4BCPA 2HWOA 3FQHA 3O8UA 2XNPA 1OECA 2A27A 3A62A 3DNEA 3QD4A 4ZS4A 4FC0A 4D9TA 2XA4A 3EWHA 2P4IA 1J7IA 4M84A 4WUAA 3F2AA 4PDOA 4JR7A 1RQQA 4NK9A 5EDRA 4ZY6A 4X7QA 4HNIA 4E5WA 3FC1X 5FEEA 4AG8A 1F3MC 3HRCA 4FTQA 4W4WA 4GKIA 4D4RA 1V0BA 4PP9A 3OW4A 5JT2A 4C4HA 3O71A 4PDYA 3VBXA 3W1FA 3EKKA 4UWYA 4F6UA 5AADA 2EB2A 5BUEA 2QR7A 5LMKC 4LG4A 2Y4IC 1REKA 2QURA 4NW5A 4X3FA 4ACDA 4EK3A 3A7HA 3HMMA 1YHWA 2H8HA 2ZM3A 3LFFA 4UZDA 3LHJA 5BVFA 3WIKA 4ZSJA 4ANQA 3ANQA 4JRNA 1PRYA 1IA8A 3MFSA 3QXOA 3VN9A 4OTWA 5HESA 4BN1A 3RAKA 4BTMA 3U6JA 4FUXA 4LOOA 2V0DA 4L53A 4ENYA 1ZYLA 2XALA 3F7WA 3C5IA 3CGFA 4L6QA 3BL9A 5CF6A 2JAVA 2W17A 4AU8A 2BTRA 3S00A 3JVSA 4FT7A 4RJ4A 5IDNA 3WF5A 3O51A 1H0WA 1CM8A 3UQGA 2B1PA 4EZ7A 2PVRA 5A6OA 4D9UA 2GNHA 2R9SA 5JFVA 3CD3A 3COKA 2CLXA 3ELJA 3SD0A 3DQWA 2BRNA 1JVPP 5EW8A 4CFWA 4F64A 3MBLA 1PMNA 4O0XA 2J6MA 4UB7A 4C4IA 1OM1A 5KMIA 3R9DA 3LMIA 4UV0A 4RFYA 3VO3A 1HCLA 2ACXA 3NNWA 4DFYA 5ETAA 3R04A 2QHMA 3K2LA 3P7AA 2GMXA 3DNDA 4QP2A 4S30A 2ETMA 3VUKA 4CMUA 2VTHA 3C0IA 2XKCA 4FEQA 3FLQA 1U54B 3DBDA 3ALOA 3FI4A 3FDNA 3OUKA 4LRKA 3RPYA 3IPHA 2Y0AA 4IVAA 4DITA 4M13A 2CPKE 2XK8A 3U54A 4A4OA 1VJYA 4Y72A 5DGZA 4RVMA 1YKRA 3LXLA 4I5HA 3UQFA 4QTAA 4RIWB 2ITWA 2CCIA 3AMYA 5EOLA 3EN6A 4O0WA 3O7LD 4BVUA 5IQHA 3RMFA 5L8LA 2RFNA 4ZJVA 4DEGA 3R8LA 5C26A 4OTFA 3FZTA 3IONA 4D4YA 3TTIA 5A46A 3F2NA 4JX3A 2J90A 3FSKA 3A4OX 3COIA 3RAIA 4LV7A 2ZYBA 5CVFA 4CGAA 4EYJA 4FV7A 4U8ZA 1SNXA 2WTKC 4AUAA 1W0XC 3BU6A 3HVCA 4F09A 3RPSA 4W4XA 1JBPE 2JBPA 5AUWA 1WVYA 3ZXTA 3MH0A 3VQHA 1O6LA 3HMNA 4DC2A 1KWPA 3SAYA 3ZRLA 4C3RA 5CU2A 5CXZA 3PXQA 3G0EA 3UC3A 3D2KA 3AD6A 4MNFA 3ZYAA 1G8JA 1BL7A 4NYEA 1FBNA 1M2PA 1J7UA 2NP8A 1QL6A 1TFFA 3OOMA 4RJ5A 2NNWB 5M4IA 3K5VA 2ONLC 4FKQA 4OBOA 3VS6A 3BCEA 4QMVA 1OPLA 4UEUA 3GC9A 4DH1A 4ID7A 4X2NA 5DLSA 2HCKA 4I94A 5D7AA 3T3VA 1NW1A 3EYHA 3OXIA 3TIZA 3H0ZA 3R71A 4YR8A 2F4JA 3CE3A 4TYHB 4Q5HA 5HGIA 2PUPA 4FNZA 4FTNA 4UYNA 3F61A 1YXVA 2EWAA 3FMHA 3W0RA 4G34A 4EH8A 1XR1A 2H9VA 1PMEA 4CQEA 3O5AA 2Q0NA 1XH6A 4D0WA 2WTVA 3AC5A 5GINE 2WPAA 3CKWA 4FKOA 3ZBXA 3NGAA 5A4CA 2ITZA 4EOPA 3GCSA 4IZYA 4A7CA 3COMA 4O38A 4IVDA 3VHKA 1XH7A 4YLKA 2VUWA 4ZZMA 5FP5A 5CAOA 3NUAA 4DH7A 4ZP5A 1G8KA 3HNGA 3CPBA 2XBAA 4EORA 5GJFA 2IN6A 3PPZA 4O7NA 3TZ7A 1OIRA 4AXFA 5DYJA 3MH1A 5IEVA 2BAKA 3FMNA 5I9YA 3OFMA 4OT6A 1DM2A 2CHLA 5JRQA 5FUTA 2LAVA 3H9FA 3UO4A 4Z7HA 2CNUA 3MYGA 1AD5A 4YO6A 4B0GA 4EEVA 1WMKA 4I5CA 5C4LA 3VBWA 2OSCA 3QTWA 5DT0A 4FZ7A 2DS1A 1UV5A 4M14A 5ETIA 4EK6A 2BIKB 4U43A 3KN5A 2QOFA 3MWUA 2OJGA 4MD7E 3GCUA 4QP1A 5FXQA 1A9UA 3MW1A 4YHJA 4CZTA 5JK3A 4EH6A 3FXWA 3WE4A 2PZPA 4FV4A 3BGZA 3PWYA 4NM3A 2CGXA 4TYJA 4IDVA 3OD6X 4K1BA 2OJ9A 4E6AA 5LOHA 3TTJA 2ZV7A 1Q8YA 3E8CA 4FZAB 4F7LA 2ITXA 2BFYA 2PPQA 4G3FA 3VUIA 2Z02A 2J0MB 3PA4A 4FUYA 4UZHA 3PY0A 4RLLA 5T6KA 1NT2A 1XMMA 4S31A 5J1WA 2Z8CA 4XOYA 4RIYB 4JG6A 2HELA 4RJ6A 4A4XA 4APPA 4GT5A 2BZJA 1OBDA 3R1NA 2VTNA 3ORIA 4NIFB 3REPA 4QTCA 2OJFE 4F6SA 3LOKA 2O0UA 3HV4A 5DI1A 4D1ZA 3G6GA 4PTEA 3QL8A 2VZ6A 4H58A 1PMUA 3P9JA 1TQMA 1Q24A 2XJ1A 4CTCA 2ITPA 4G17A 3TNHA 5HO8A 3LFDA 2XCHA 3TV7A 5A4EA 2GTNA 3A7GA 3QGYA 1NVQA 2FH9A 2JDRA 3BYMA 4FG8A 5TF9A 4PMTA 4YTFA 3JVRA 5LWNA 3JY9A 4Y5HA 3ZM9A 4IACA 4S2ZA 1E1XA 5L2IA 4LOQA 3RHKA 2J50A 5DN3A 3RZBA 3UVQA 1XWSA 2GHGA 3VS3A 4FSTA 2CJMA 2PU8A 3DXNA 2W1ZA 5L6PA 4GG5A 4CCUA 4DF3A 2YN8A 1ZOHA 3LLTA 4FE2A 4FTTA 5H9BA 5IPJA 3U4WA 2B9HA 2OU7A 4D2RA 3P4KA 4AGCA 2VN9A 3OTUA 5F95A 2E2BA 3GP0A 1ST0A 2WOTA 3PY1A 4O7RA 1FGIA 5CT0A 4C02A 1OZ1A 3PE2A 2JIVA 2OICA 3DGKA 2RGPA 5LVOA 2C3JA 4IX6A 5DFPA 4AE6A 2X7OA 4U79A 5CEPA 4DT9A 1CKJA 3ET7A 5TKDA 3RAHA 3U6HA 4HPUE 4YHFA 4EH9A 3HRFA 3ZSIA 2IJMA 3TUDA 3T3UA 3AKKA 3EQFA 3RM7A 1JOWB 2PMIA 4D0XA 3MFTA 4E4XA 3BX5A 3ZDIA 4HVDA 1F5QA 5M4FA 2AEGA 5F4NA 5E1SA 3OBGA 3C50A 1OMWA 1VEBA 5C4KA 1M17A 3V04A 3QALE 3PJCA 5AAFA 1FVRA 3U9CA 2B0QA 3OT3A 3JPVA 3Q2JA 5A4QA 4OTQA 2DQ7X 2YM3A 3I60A 2W99B 4G3CA 4GUEA 3QQKA 3QCQA 3IDBA 2IG7A 3FKOA 4NKSA 3H9OA 4GK2A 3WF8A 2PZ5A 5AA9A 1YWNA 3U9NA 2XK9A 3G15A 4C4JA 3ZO4A 5KX8A 3DB6A 3TEIA 4I21A 4G3EA 4B8LA
chains in the Genus database with same CATH topology
2HWPA 4AXCA 5J8IA 4AOIA 4W8DA 2QLQA 3G6HA 4M0ZA 4R3RA 1CMKE 2C30A 2YM4A 3KRWA 3V5WA 4HVHA 4F9BA 5CEMA 1SZMA 4AZEA 3OCTA 4YU2A 5IQIA 4C62A 4FKIA 3NUYA 3O96A 4RVLA 5CXHA 4NU1A 2JC6A 5EDPA 4G6LA 2C68A 2BFXA 3HKOA 2J51A 3R30A 5ANOA 4JT3A 3SC1A 2G15A 3FQSA 3CQWA 3OCBA 3DKGA 4QMWA 1JNKA 4C2VA 2R3RA 1WVXA 4FV1A 4GK3A 4KINA 4PWNA 3SXFA 3ORPA 2GHMA 1J1BA 3BKBA 3DQXA 3RM6A 3W0PA 3CCNA 5IISA 1ZAOA 1APME 5G1XA 3LE6A 3WF6A 2X0GA 3EIDA 4CV9A 2XNEA 2QOHA 3C4WA 4UYAA 4AACA 3MPAA 3ZC6A 2VWYA 5CU6A 1ZYJA 2J0JA 3KN6A 2WIHA 3R9RA 4QP6A 1GIHA 3BYSA 3LJ1A 3QYZA 1IRKA 4QPSA 2W5BA 5IMXA 3BHUA 2FO0A 3U4UA 4IAAA 3GQIA 5IA5A 4TYGA 5DIAA 4J7BA 1ZLTA 3LCSA 4X3FB 4QPAA 4PL3A 3DK7A 1SMHA 5IQBA 3BV2A 1KE9A 3DK6A 4M67A 4DFUA 3DZOA 3GOPA 4L3LA 4JDKA 4U45A 4H3PA 4DFZE 5A54A 4YLJA 4MBIA 5HQ0A 3KULA 3P78A 2VGOA 4GVJA 3R7YA 4EOLA 2WO6A 4DFLA 2OFVA 3C51A 3D9VA 5E90A 3ZC5A 4YHTA 3UNJA 4C33A 1VR2A 4RA5A 2C6MA 1X8BA 2W96B 1OL7A 4BCIA 3C4XA 5AX3A 3UMXA 5C01A 1IG1A 4GMYA 2R3PA 5EHYA 4BIEA 5D9HA 4EUUA 3FZPA 3TNIA 4QMQA 4H3BA 2JIIA 4PQNA 1NA7A 3EL8A 3IDCA 3QTRA 2A2AA 3UIMA 4AQKA 3NYVA 4FICA 3CLYA 4K9YA 3MIAA 1Q8WA 2XZSA 5AA8A 4NJ3A 4C37A 3C4EA 1NXKA 4R5YA 3LQ8A 5L2SA 3N4UA 2EB3A 4JJRA 5D41A 5CTPA 4C59A 3LJ0A 2AUHA 2B54A 2GSFA 2VO3A 1KE8A 3GQLA 1PXJA 1WBNA 1Q41A 3A60A 4IAKA 2O65A 3D4QA 3KU2A 5HE0A 3U8WA 1P14A 4HYSA 4YBKA 3EQBA 1LUFA 1QCFA 1PXIA 3O8PA 3UOLA 2HAKA 2EUFB 5L8JA 2XJ2A 3OP5A 4IB3A 2WIPA 1P5EA 3FMEA 5JGDA 1ZXEA 3KY2A 3WZUA 3KVWA 1XO2B 2QOCA 2XP2A 2IVTA 5FM2A 5L3AA 2BHHA 4X0MA 3SG9A 3R01A 4FV9A 4I0SA 2BUJA 5IU2A 3FZOA 2ITNA 3BPRA 1ZMUA 4UN0C 4ZTMA 3DY7A 3OWLA 4K33A 2W1CA 4G1WA 1JAMA 4K8AA 4EHVA 5BYYA 3LQ5A 3P86A 2PMNX 2ZMDA 3CTJA 4J71A 4U97A 3ZHPC 3WZDA 5HD7A 4F70A 1BKXA 3BYVA 3RAWA 2JLDA 5L8KA 1PXMA 5BX0A 1Q8ZA 4J53A 4GH2A 4CSVA 3NEWA 3FJQE 3C13A 4DHZA 3MVJA 4RWJA 4HGEA 2XCKA 5CU3A 1UKHA 3AC1A 4BCOA 5HLNA 2C5OA 4U5JA 4H1MA 2GCDA 2VTMA 5EH0A 2B52A 3Q9ZA 1XH5A 3CC6A 3KVXA 1FOTA 2GNLA 2V7AA 3BQRA 3W2QA 5JGBA 3EMGA 3W10A 2C6LA 4L01A 2WNTA 4OTDA 4DHJA 2BCJA 4YO4A 4DGGA 3A7IA 4Y73A 3CEKA 4O2PA 3V5PA 2A19B 1UKIA 5KMOA 4I6QA 4KBKA 5FD2A 3VBVA 4DDIA 5E8WA 5L2WA 5M4CA 4BBFA 3R21A 2JIUA 4MHAA 4CV8A 1B39A 3BQCA 3Q52A 2I7QA 4LV8A 4EOMA 2YDKA 3O17A 2CKPA 2P55A 2GU8A 1PYXA 4IQ6A 4CRLA 3VNTA 3IG7A 3PSCA 3Q2MA 3VS1A 3MPMA 4TYHA 3BL7A 5DHJA 1Q8UA 1L8TA 1HCKA 4KSQA 4C3PA 2C0TA 5CU4A 3C1XA 3WOWA 4QYGA 3FBVA 2NRYA 5E8YA 4XBRA 3GC0A 4ZZOA 2OZAA 4XJ0A 1NVSA 1TQIA 5CF4A 1BI8A 4HGTA 3LFQA 1YHSA 3OXZA 4FKRA 4O0UA 3BI6A 1YXUA 4OGRA 2F2UA 4F1OA 5CANA 3DBQA 5HZNA 1OUKA 3H3CA 1H25A 1R0EA 4IB1A 2VO0A 4LV5A 1UNLA 4N6ZA 3FMLA 1GIIA 1BI7A 2V22A 3Q4ZA 3QFVA 4WNOA 3UC4A 3OCSA 3PJ2A 4ZLYA 2CGUA 4EQUA 3IQ7A 4EC8A 2CGWA 3W0QA 3ZZEA 5IMEA 1IAJA 4AA5A 4DHFA 5A6NA 3JXWA 4DINA 5E8TA 2X2LA 2WTWA 3ANRA 2QG5A 2IVVA 4NUSA 3WARA 4MD8E 2B7AA 5BVOA 5IA1A 2IZTA 3LCDA 2X4FA 1ZRZA 2VTTA 1HOWA 5K4JA 5FQDC 1SVHA 1Z57A 4O0YA 3F3TA 4FKLA 3KXNA 2P2IA 1XMLA 3PRFA 3POOA 2UZWE 3ETAA 3R9NA 4F63A 3T9IA 1OPJA 4ANLA 3KCKA 4QO9A 2WB8A 2WZJA 5IA0A 3PXZA 4YNEA 2YERA 1KE7A 2R3HA 3TDWA 4FODA 2QONA 3TIYA 4QQTA 3BEAA 5HCZA 2QR8A 3NNXA 4AW5A 3O23A 2GTMA 3QTZA 5CAQA 3GFEA 5AIRA 3EFJA 4BDKA 2E9NA 4IAFA 3NW6A 1ST4A 4FV5A 4KIPA 4XBUA 5EW3A 3WF9A 4EH7A 5HU9A 3UPZA 1PW2A 2BRHA 3QLFA 4YZDA 5HTCA 3GEQA 3EQDA 3MIYA 4JOAA 4V0GA 1GIJA 3QTIA 4RIXA 5EK7A 3Q4TA 4G6NA 1O9UA 2ZB0A 3NAYA 5AMNA 1DS5A 2PHKA 3M11A 4BCJA 2J7TA 2YEXA 1R0PA 3HA6A 1ND4A 3JR1A 5JSMA 3FXZA 4IZ5A 2UZBA 4WOVA 2PVKA 2KTYA 3NW7A 3VBTA 5B2LA 2IVSA 1BYGA 2QKWB 5B0XA 3KXZA 2VNYA 3AT2A 3P5KA 1YOLA 4F1MA 5KKRB 4A06A 3DXQA 5HG9A 4B7TA 5IF1A 4XHKB 5CEQA 3AGMA 4JRVA 3DFCB 2QU6A 5AUZA 4AXEA 4M0YA 4O7SA 4YTHA 4ZSEA 2Y4PA 4MAOA 2X8IA 1YDTE 2OLCA 4M15A 3QQHA 2BALA 4R7BA 3FZSA 2QOBA 4AOJA 4AS0A 3K54A 2C5XA 3LQ3A 3R73A 4IVBA 3VUDA 1Q5KA 4RPVA 4ZS0A 2PUUA 3R8VA 5CF8A 3VF9A 2UZEA 1UU8A 3KXGA 4EH2A 2QLUA 2HY81 2GS7A 2W4KA 2X9EA 3P79A 4NTSA 4IM3A 3DDPA 3DFAA 4XV9A 1WBTA 4F7JA 5J9LA 1OGYA 4M3QA 3AC3A 2F7XE 4I23A 3ZU7A 4TPTA 2QC6A 3L8VA 4BDEA 4UBAA 4BCHA 2OJJA 1XHAA 2W05A 4AXAA 4IE9A 2UZVA 4D5KA 3QUEA 3ZZWA 4FZDB 4FIGA 4IX4A 2BMCA 3MY5A 3R02A 3W2SA 4F1TA 4EOOA 5LVNA 5A3XA 3Q9XA 2CNQA 3R7VA 3TUBA 3ZONA 4DFNA 2UVXA 1UVRA 4L67A 4YP8A 3ML1A 4F4PA 5IQGA 3FKNA 1J7LA 5AJQA 3N4TA 3I6UA 3T9TA 2BKKA 3SRVA 3MJ2A 3OC1A 4ZTRA 3OWJA 2XK7A 3TZ9A 4EK5A 3WE8A 5LJJA 5F9EA 3C4FA 4KIOA 4HCVA 4NW6A 5AV3A 4EOSA 5TOZA 2R64A 3BIZA 2R3JA 5HCXA 5C8MA 2CGVA 3MGYA 4BIDA 3FPQA 3QHWA 2YABA 2IZRA 2JKQA 4EC9A 3PVWA 4O7LA 4BZNA 2FGIA 3MA3A 4LUEA 5EFQA 1W84A 2QOLA 3EH9A 3PXYA 3QCYA 4RC4A 5FRIA 2GQSA 5EI8A 1V0PA 3S2PA 2QNJA 1ZYCA 3TWJA 5FXRA 4IIRA 4LMNA 3FY0A 2HXQA 3KMUA 5TO8A 2XMYA 3HMPA 2YM8A 4YGAA 3Q6WA 3TKUA 3HP2A 4BCGA 2BR1A 2E9VA 3FY2A 2DWBA 3AD4A 3DBCA 3Q6UA 5CASA 3BHVA 4I6BA 1WBPA 2VWIA 2PUNA 1WBOA 3G9NA 3KULB 5HE2A 1I44A 3QTUA 4I4FA 4EOJA 3VS5A 2J0IA 2J0LA 2JAMA 4FGBA 2VWZA 5BQ0A 4EK4A 1YW2A 4WSYA 4M7IA 3W2PA 4G5PA 3NYXA 2R3QA 3QX4A 4X6RA 2C1AA 2OO8X 2PL0A 2ZAZA 4A9SA 3F69A 2QHNA 3DJ5A 4MCVA 4BDHA 4FT0A 2WEVA 1GNGA 2XAMA 3EQRA 2F7ZE 3F3UA 1OL2A 1H24A 3UOJA 5BVEA 3FL4A 4KAOA 3ZRKA 4ITHA 2IPXA 2B4SB 1PY5A 2W5HA 2YISA 4GCJA 3E7VA 5E8XA 4QTEA 3TKIA 4FMQA 2OJIA 2YIQA 1GY3A 5LQFA 3FMDA 4FSWA 3IGGA 2HK5A 2OG8A 3BLHA 2PVLA 3VBQA 1Q61A 2XIZA 4L9IA 4Y5QA 5GJGA 1XH4A 4USDA 4BB4A 2WGJA 2XNMA 3EN7A 1GJOA 5ANEA 5A4LA 5M53A 3E63A 3FE3A 4JI9A 3B8RA 2BZKB 5HBEA 4D1SA 1FVVA 3FI2A 5K9IA 2C6IA 4XP2A 1ZZ2A 3DA6A 4O91A 2YM6A 4BGQA 3WYXA 3OY1A 4LM5A 4CFXA 3GC7A 2OI4X 2FSTX 4WBOA 1OL5A 2NO3A 1ATPE 5E4HA 2WTIA 3W55A 4X2JA 3ORLA 5CI7A 2WMSA 2PE2A 2JFMA 2OF2A 3NWWA 1CTPE 2XARA 4OT5A 5T3QA 2XEYA 3A7FA 1H1SA 4QMYA 5DNRA 1OL1A 2J5FA 3EFKA 4LGHA 1VZOA 4QMOA 5JN2A 2WKMA 3DCVA 5IA4A 4QNYA 1J3HA 2WU6A 3F7ZA 3D7TB 4D58A 3Q5ZA 5J1VA 1PKDA 4X2KA 1OKYA 2F9GA 3HYHA 5HNGA 3E87A 4EOQA 2WEIA 3ZUTA 2E9PA 2XYNA 2ZDUA 1REJA 3I0QA 1PXLA 2HZ0A 3I7CA 2BDFA 3IW7A 4RJ3A 5M4UA 2W4JA 3QRIA 3CY3A 2WMBA 2EXCX 4KB8A 5DOSA 4EOKA 3D94A 4OUCA 4ITJA 4ZY5A 1G5SA 2VV9A 4E7WA 4KRDA 3UVRA 4DDGA 4YMJA 5JQ5A 4DCEA 2G9XA 4DTBA 4ORKA 4XUFA 3I4BA 5CENA 2VWUA 2C5YA 4L3JA 3Q96A 3PZHA 4OBQA 4OTRA 3ZSHA 3R83A 4ANMA 4DEDA 4EHZA 3HV6A 2UW6A 5EKNA 4E4MA 4G9CA 1I09A 1M52A 3QF9A 4R7HA 4Z16A 4JR3A 1O6YA 4HVIA 3KXMA 4IDTA 5C8NA 5CQUA 2P0CA 5L2TA 1A48A 5LWMA 5B7VA 3U6IA 1PXOA 3M42A 4GT4A 4BDCA 5JEBA 1PXPA 3MDYA 3OF0A 3VAPA 5HNBA 3DAJA 3BWJA 5IQDA 1LEZA 1Q62A 2YAAA 4M68A 2IW8A 2EXMA 2HENA 4NL0A 3R7IA 2Y6MA 3LMGA 3KF4A 4CKRA 2OZAB 3HX4A 3TJCA 5FBOA 1OBGA 5IZFA 3RNIA 3NMUF 1RE8A 3LJ2A 3W0NA 1ZYSA 4R3PA 1SM2A 5HBHA 4UWBA 5KHXA 1U46A 2QI8A 4ZTHA 4AN2A 4QRCA 4FV6A 2QG7A 4NH1A 1OUYA 2VNWA 4RSSA 3UQCA 4XG6A 4XLIA 2W9ZB 3DLZA 3FYKX 4YTCA 3D5WA 1H1WA 2J2IB 3TYKA 4FVRA 5FG8A 5LMAA 3WBLA 3F6XA 2GNGA 1Y8GA 2VWBA 2FYSA 3NVKI 4QYYA 4LUDA 4LGGA 3NDMA 1KUTA 3A2CA 4FBXA 5JKGA 2JKKA 2C6EA 2UW7A 1Q3WA 3ORTA 3OHTA 4KWPA 1JPAA 3VS4A 3ZO1A 4QMLA 5I0BA 2PE0A 3P7BA 4E20A 4J8MA 3K3JA 3QZGA 5CVHA 3V8SA 4EQMA 2C3IB 4S34A 3UO5A 3UBDA 3F66A 5KBRA 3F2RA 2B9IA 3B2TA 1BL6A 2JKMA 3TV4A 2VTOA 4N70A 1G8SA 2YM7A 1K9AA 2ZJWA 3EZRA 5HHWA 2W1IA 4C61A 4WRSA 5E7RA 3S4QA 3FI8A 4I22A 1KSWA 2WMXA 4II5A 3R7UA 4BHZA 5HNIX 4RVTA 4GYIA 1AQ1A 4V01A 4IZ7A 1W98A 5HI2A 2XNNA 3MTFA 3RNYA 3V8WA 1V1KA 3I79A 2Z7RA 2PVMA 4FEXA 2I6LA 4F78A 5AAEA 3ZFMA 3LPBA 2IW6A 1WBVA 2RL5A 2YCQA 3QQFA 4GU9A 4JNWA 5TT7A 4E8AA 4EBWA 3BGQA 3BU5A 3R63A 4AZFA 4EWHA 2JDVA 5HIEA 5HG5A 2E9OA 1OKWA 5DEWA 3PXRA 3PJ3A 3CR0A 4PRJA 3ENHA 3L8PA 4PL4A 3GFWA 4RIXB 4V0GB 4F0FA 5KE0A 2W4OA 3WZEA 4JG7A 2WMWA 1Q99A 3OBJA 2OK1A 4RBLA 4ENXA 3E92A 1M2RA 5KMMA 4NZWB 4IADA 1W8CA 3VUMA 3QD0A 4I93A 3WYYA 5EYDA 4BGHA 4XEYA 5EI6A 3DKOA 3EL7A 3H9RA 3CTQA 4HYHA 3GC8A 1IASA 4ANBA 2CKOA 2PZIA 3PP1A 3I0OA 1KV1A 3AXWA 4XP3A 4AZWA 1M7NA 2XS0A 3NFFB 5D1JA 2UW4A 3TNWA 1DI8A 3HUBA 4YZNA 4EUTA 3U55A 3NR9A 4RC2A 2AC5A 4YURA 1OPKA 2ZB1A 4CFVA 5EHOA 4DBNA 4J52A 3BYUA 3DKCA 4R3CA 3BYOA 5CQWA 2IW9A 4PF4A 4EHEA 4CD0A 4ZY4A 2O63A 4EOIA 4CT2A 3DTCA 5G6VA 3ZS5A 2HXLA 2ZMCA 3C9WA 4JVGA 4MQ1A 1R39A 2OIBA 3NRMA 4F0GA 3RJCA 2X39A 3MY1A 2YIWA 2VTAA 3GU8A 3PUFC 3N4VA 2YITA 4Z55A 3ZXZA 4FL2A 1YDRE 3QUPA 3QLGA 5LXMA 3QC4A 3OS3A 3BRBA 1R78A 2V62A 5CEIA 4RX9A 5BVWA 5KHWA 3PVGA 3AMAA 3BLQA 4PNKA 4L7FA 4O7TA 3UIXA 2J9MA 4MQ2A 4L52A 4H1JA 4JG8A 3G2FA 4BI0A 5CYIA 3HRBA 4E5AX 2UW8A 2OGVA 4WA9A 5HG8A 2IZUA 3LFEA 3Q4CA 5I9ZA 4JQ7A 4CLIA 1T46A 3TNQB 2XNOA 2WMTA 4G31A 4Y46A 2QOIA 4FKJA 3R6XA 4BZOA 5I9VA 4RZWA 3H0YA 4JS8A 3ROCA 5JQ8A 3GU5A 5EG3A 2YWVA 3OEZA 1OIYA 4YZBA 2ZV8A 4IWPA 4RFMA 3PXFA 1H1QA 3OOGA 3SRVB 2JDOA 4KS7A 4O6LA 5BYZA 2WMAA 4O2ZA 2PE1A 4QQCA 1H0VA 5GIOE 4FIFA 5M44A 4AGWA 5I9XA 3ZLXA 4AA4A 1UWJA 3FLWA 4TRLA 1DAWA 4FTJA 2C5VA 3WILA 3D5XA 4B4LA 5E8ZA 1WAKA 2I0EA 2I1MA 4AAYA 4O7WA 4WO5A 2XVDA 3ORNA 4MD9E 3QQLA 4HYIA 3VF8A 3AD5A 4FT3A 4KSPA 3FLZA 4C4EA 2BDWA 3COHA 4PNIA 5C9CA 2FSLX 3LVPA 3CP9A 3E8DA 5KO1A 3KRLA 2R3LA 3SW7A 2UZNA 3HGKA 1G3NA 2WMVA 2XK4A 2OBJA 2ERZE 2XYUA 4NM7A 3GENA 5KMKA 4FTMA 4WNKA 1UA2A 4ASEA 2I0HA 5DWRA 5KNJA 4FNWA 2YDIA 3UG2A 4ZMEA 3F82A 1QPEA 2ZOQA 3QZIA 4YNOA 4BYJA 5LCKA 5EHLA 5HX8A 4FKVA 2P2HA 5IG1A 2R4BA 3ZOSA 5HICA 4HVSA 1XBCA 4L8MA 4QYFA 4PUZA 4X3JA 2OZOA 4S32A 2VTJA 4ZLZA 3GI3A 4ASZA 3VIDA 5EYMA 3TNPC 2Z2WA 1CKIA 4JBPA 3L9LA 5AP0A 4XH6A 5FEDA 4ASXA 4BICA 5C8KA 4BDFA 2WFYA 3SKCA 3VRYA 3FWQA 4WBBB 3D7ZA 4AW0A 3BGPA 2C5NA 3OVVA 4EJNA 4O83A 4QP9A 1KE6A 2JDTA 4PMMA 5C27A 1Y57A 2J0KA 5TR6A 4FNXA 3CIKA 4K77A 4ZK5A 1KOBA 5GNKA 4XRJA 5E92A 1ZZLA 2QOOA 4PTGA 3QA8A 3HDNA 5I9WA 5LVMA 3FV8A 3S0OA 3OZ6A 5CX9A 4BBMA 4N0SA 4CFUA 4CVAA 4W4VA 3K5UA 2W5AA 4GL9A 2CSNA 2YIRA 2JDSA 1PYEA 5JGAA 4FSMA 2FVDA 3HV7A 4ZSLA 4ZJJA 2A1AB 4BYIA 3ZFXA 1WVWA 5HVYA 3W32A 2PMOX 3KK9A 4U40A 1UNGA 1URWA 2REIA 1MRUA 2XH5A 4E73A 5AP6A 4CXAA 5AM7A 4EH4A 2VTSA 3OY3A 4O7VA 1PHKA 3H4JA 3PDTA 5FDPA 1SNUA 3SA0A 2PZYA 3ERKA 1JWHA 4HGLA 3R1SA 5CI6A 5M57A 2YAKA 4LQMA 4MXCA 3BHTA 3OW3A 3D83A 4O96A 2WU7A 4KKHA 3OTVA 1VYZA 4ALVA 2BILB 1H08A 5EM8A 4TL0A 3WIGA 3HAVA 4MBJA 2P3GX 4LYNA 4GRBA 2WMQA 4GKHA 3MB7A 3U51A 2XRWA 2OH4A 5DH3A 1YHVA 3TKHA 4CFFA 1ZY5A 3QXPA 3UPXA 3RTPA 4A07A 3KRXA 2WQEA 1VLRA 3D7TA 3DXPA 5AUXA 5BNJA 3FL5A 3RHXA 3VONA 4L7SA 4DTAA 3QTSA 5A9UA 3UDSA 3LXNA 3UZPA 1Y8YA 3BHYA 3QWJA 4MXYA 4WNPA 3ORKA 5DR2A 2ITQA 3R8ZA 5AP4A 2VD5A 3EN4A 3RWQA 3E8NA 2QOKA 3H10A 1MP8A 3BBTB 3FC2A 4XX9A 4TXCA 4WNMA 5AAGA 3WZJA 3MPTA 3NNUA 3A7JA 5AIKA 4BTFA 2FUMA 4P90A 4E4NA 3IW8A 5IQCA 5J5SA 5LVPA 3KC3A 3TV6A 2PSQA 4I4EA 5IH4A 4GYGA 4QDEA 5HD4A 4E1ZA 3KFAA 4OTGA 2XIKA 3ATTA 3DU8A 4O22A 2X6DA 3DLSA 4FTIA 5J9YA 3E3PA 3PY3A 5AUVA 5J87A 1LPUA 2BROA 4FV8A 1YI4A 3VS7A 1H8FA 5BUIA 3O0GA 2C0IA 4QDVA 3L9MA 2XB7A 3GUBA 4DEHA 3KA0A 2W9FB 4PX6A 4C36A 3NUNA 3F5UA 3DKFA 5FXSA 5GIPE 3UP7A 4MXXA 3RPRA 3R7EA 4YSJA 4U81A 3CSVA 2QCSA 4NWMA 2QOQA 4JAIA 5CSVA 4I41A 4X3FC 4NSTA 2Y7JA 3VJOA 4JDIA 4YJUA 1W83A 4YTIA 1ERKA 2C4GA 4GV1A 4PY1A 3CXWA 3UDBA 2Z60A 3SG8A 3NVMB 1ZOGA 4AXDA 4JLCA 1XJDA 4AF3A 4C4GA 2XANA 3KRJA 2O2UA 4XLVA 4IX5A 4C34A 2WHBA 3OEFX 1O6KA 3M2WA 2JBOA 4RQKA 4EK8A 4PV0A 2J5EA 3CBLA 3JS2A 2UW0A 3AC4A 2QO2A 2Y8OA 4G5JA 5CZIA 3THBA 3EOCA 3DT1A 3ZCLA 3RK9A 4DHIB 3QRUA 2WQBA 1SVGA 4FTLA 4EONA 2WELA 4FTAA 4JAJA 4RQVA 2B9JA 2BAQA 3AC2A 5CU0A 3NPCA 3R8PA 4IAZA 5E8UA 3OG7A 4FSZA 2R3OA 1XH8A 2WQMA 5GJDA 3VS0A 4UX9A 3L1SA 3PFQA 2UZTA 4LDTA 4MKCA 2YJRA 4F6WA 2E9UA 3CPCA 3RP9A 5AEPA 5ANIA 4JIAA 4P7EA 3KK8A 1PMVA 5ETCA 1S9JA 3QQUA 4DG3E 4PP7A 1K3AA 3W16A 5CAUA 4L43A 3NS9A 4IJPA 3ROYA 5HKMA 5I9UA 3PVBA 2R0IA 4E6CA 2XRUA 3QWKA 3ZUVA 4IBMA 3V51A 4IWDA 3EQIA 2ZV9A 4O6EA 2XKFA 3IW4A 2ITUA 3FQEA 2R3IA 2PVHA 2I40A 3DV3A 4C35A 3EKNA 3DBEA 4XYFA 4TNDA 2W1FA 5J9ZA 3QHRA 2W0JA 3CJFA 4JDJA 5AV2A 4MNEA 2DYLA 4K2RA 4EKKA 4QYEA 1MUOA 5DEYA 3VJNA 4AT3A 4CKIA 5EKOA 5IDPA 4KBAA 5M07A 2PK9A 4DFXE 2A4LA 4QMMA 5ACBC 2OFUA 2OH0E 3FEGA 3VC4A 5ACKA 2Y4IB 3PLAE 4MXOA 1H1PA 5ANGA 3A99A 2GS2A 4RX8A 4DEAA 3VWAA 5J7HA 3HL7A 3ULIA 4FKSA 3O2MA 3VVHA 4QP7A 2HIWA 3KL8A 4YPSA 4MF1A 1OVEA 5HU3A 5CSWA 1WBWA 3QCXA 3WI6A 1WBSA 3R9HA 4DEEA 4MX9A 5EQYA 4U42A 1MRYA 2AC3A 3ZLWA 4F08A 3LXKA 5HE1A 4H05A 3W0MA 4ACCA 4QQ5A 4FEVA 5EYCA 2G2IA 3GB2A 3NW5A 4FNYA 4R1VA 4QP4A 4KIQA 4J96A 3GBZA 4JBVA 4MEDA 3FSFA 1H00A 3PIXA 1WCCA 2XM9A 3IW6A 4DH8A 1GZKA 3WZKA 3V5LA 3PRIA 5BV3A 5IEYA 5JFWA 2XEZA 2XK3A 4FOBA 4TWCA 4RMZA 2CDZA 3MJ1A 3TL8A 1TKIA 4NFNA 5CALA 5DVRA 3EQHA 4L46A 3Q32A 2XNGA 2R3MA 1JKKA 3MFUA 3NUSA 2C6KA 2ZVAA 4LMUA 4MTAA 3SDJA 3TUCA 3OROA 3UOKA 3GNIB 5E91A 4FIEA 4YC3A 1SYKA 5D7VA 4D2SA 3PIYA 4GFGA 4XV3A 5HIDA 3A4PA 4ZEGA 4HZSA 3N51A 4RVKA 3C5UA 3QD2B 3FLSA 2CMWA 1OITA 4FVPA 4LL0A 3V5JA 5IEXA 3E64A 2OIQA 4D55A 3C4ZA 4H36A 4RT7A 3HLLA 3ZLYA 4BCMA 2RG5A 4EHGA 3MI9A 3ZEPA 2PVNA 4S33A 4I5PA 4XG7A 3TN8A 3V5QA 2QKRA 2WTKB 4UXLA 1OL6A 2W1EA 4TT7A 3QCSA 4Z7GA 1XKKA 1QPDA 4Q9SA 4XG9A 3Q53A 2YDJA 4Q2AA 4O27B 5HLWA 3EFWA 2OXYA 4PTCA 2QU5A 4TYIA 3RVGA 3BV3A 4NTTA 4FG7A 4GJ3A 3NYOA 3ZFYA 1JSVA 2YWPA 4QP8A 2B55A 1P2AA 4MYGA 1U59A 3LFSA 2GS6A 2LGCA 3W0OA 3I7BA 2V55A 5H8EA 2UW9A 5HE3A 5D12A 3V6RA 4ZTQA 3RK5A 2YZLA 4I6FA 2GNJA 2ETRA 2R0UA 3FHIA 4I6LA 4K0YA 4TZRA 4BHNA 5DBXA 4HYUA 3I81A 3G90X 5J95A 1BX6A 4R78A 5DRDA 5KMJA 4FIHA 3SHEA 4X2GA 4BTJA 2X9FA 3BE2A 3GCQA 5AUTA 1H27A 4MWIA 4U41A 4GFOA 2PULA 3Q9WA 4C0TA 4I0RA 3G33A 1PXKA 4AW2A 4QMZA 3Q5IA 4TWPA 4U6RA 3ZEWA 5ITAA 4RWKA 3PTGA 4FKPA 5I5ZA 3F3WA 2JFLA 3FPMA 3R2BA 4EWQA 1FGKA 4YJTA 3BWFA 1YXTA 3UE4A 3RINA 2CLQA 4P2KA 1YI6A 4L42A 4YZ9A 3DJ6A 3W2OA 4U3ZA 4H39A 2PUIA 5HBJA 4KD1A 5KMLA 4LFIA 4F9WA 1Z5MA 4PDSA 4EH3A 4EBVA 4BKJA 4JQEA 3KRRA 3ORXA 3HDMA 4R77A 3VUGA 3ZMMA 2GQGA