4LV7A

Crystal structure of inositol 1,3,4,5,6-pentakisphosphate 2-kinase e82c/s142c
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
390
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKCVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDCALILNDHSLFDCISVEIKPKCGFLPTSRFIGKENILKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICSLHALPLDESLKIVKEYLIAATAKDCSIMISFQYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Inositol-pentakisphosphate 2-kinase
publication title Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 122
structure length 390
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lv7A01
2XALA 4AXFA 4AXCA 2XAMA 2XAOA 2XANA 4AQKA 2XARA 4LV7A 3UDZA 3UDSA 4AXDA 3UDTA 4AXEA
chains in the Genus database with same CATH superfamily
3DTCA 4R5YA 4X2GA 2PWLA 3P79A 3ZM9A 3R02A 3UJGA 4KSPA 3FMEA 2RGPA 5AV4A 5CU3A 2VX3A 4CTBA 4J52A 5J95A 4CCUA 5AWMA 1NVRA 3P08A 2WPAA 2UZWE 4C0TA 3O71A 4GKHA 5HE3A 1Q8TA 2GU8A 4G6LA 5DNRA 3AMBA 4RMZA 5I9XA 4FKQA 4X3FB 4H1JA 4CLJA 4MF1A 4YC8A 4X3JA 2YIQA 2VWIA 2XCHA 1ZLTA 3F82A 4Q5HA 3TMOA 3ACKA 2HYYA 3L9LA 3LFFA 4IEBA 3C1XA 5HE0A 3JVRA 3SG8A 4TXCA 5EW9A 3MB6A 4AAAA 3O8UA 3ALOA 3DQXA 3QRTA 4WD5A 4X21A 3FSFA 4LRKA 5DOSA 3RAKA 3UNZA 3OTVA 3ZLSA 4TWOA 5E92A 5FXRA 4L00A 4JQEA 2XRWA 4L6QA 5KMOA 1Q8WA 1YDTE 5E7RA 2JDSA 1WBNA 2UZTA 3G51A 4AA4A 2C6KA 3QKKA 5LMBA 4CKJA 4D5HA 4RWJA 5CENA 3RTPA 1KE5A 5GHVA 3NUSA 2ZB0A 4HYIA 5CF4A 3O7LB 1O6KA 4AGDA 4C3PA 4KBCA 3C51A 5AP7A 2HW6A 2B55A 4RVLA 3RCDA 3O51A 4HNFA 4C3RA 3II5A 3RVGA 4PRJA 4E7WA 4M13A 4FEWA 4R78A 3FE3A 3QX4A 5IUIA 3ZCLA 3CS9A 3WZDA 4ASZA 4B99A 4CFMA 5E8ZA 3ORIA 5CU4A 3U55A 3Q32A 4O7ZA 3HYHA 4F78A 3E3BX 1W82A 4JOAA 5JGAA 4BVUA 2PZRA 3AD6A 4PNIA 4XNEA 1OPKA 4EBWA 3M11A 4FODA 2YM6A 4Y72A 4QMUA 4ZTHA 5JRQA 4IDVA 3OFMA 4QMNA 3BRBA 4U45A 4BDAA 2BROA 4Z16A 3FUPA 5L2WA 4ALUA 4KRCA 1YI6A 3EYHA 3WF9A 3SGCA 3DBDA 3EFJA 4QMPA 3ZEWA 4YMJA 3WE4A 2HAKA 4I6BA 4OTWA 3ZO3A 2XRUA 1DI8A 4TZRA 3PG3A 3UG2A 4PNKA 3L8XA 4JT3A 5HNGA 3A4OX 2C5OA 2X7FA 3GCUA 3A7GA 3KN6A 4QMTA 5BUJA 4DDGA 3QHWA 3GCVA 1OI9A 2A4LA 1BX6A 3P1AA 1SZMA 5IDNA 4MQ1A 3TKIA 3UO5A 2V5QA 3HMOA 2VO7A 3NLBA 5JN2A 1P2AA 1Q3DA 3HV6A 2WMBA 4GYIA 3UP7A 1ZOGA 2PUIA 2WB8A 3AD5A 4I6FA 4NKAA 5AV3A 3QCSA 3DLSA 3DBQA 3ULIA 4BB4A 4WG4A 3OCGA 5E9EA 4RJ4A 4FV3A 4O6LA 5JZJA 1JWHA 4FTCA 4F08A 2ITPA 4IDTA 2AEGA 3C0HA 4K1BA 2C3KA 4EHGA 3PA3A 2Z02A 3OXTA 5EW8A 1GY3A 4XP2A 3FZPA 5LMAA 5LQFA 4YLLA 1GJOA 2J9MA 5BPYA 2VX0A 1Z9XA 2OZAA 3BQCA 4OTQA 5EHYA 4ZIMA 4AOJA 4RFYA 2J50A 4LUEA 4PL5A 2GQRA 5EYKA 4DF3A 4DEGA 2WIHA 4EZ5A 4ZJVA 5EM8A 1VLRA 2PK9A 4DT9A 4XP0A 2GNIA 3COMA 3PXYA 3LFNA 4O38A 4WG5A 4O0YA 2QONA 3QZHA 1YHWA 5HG8A 4A9TA 1FMOE 3EOCA 3QBNA 1HCLA 1Q8ZA 2YDIA 3OP5A 1SNUA 2RIOA 4EBVA 2VWZA 3LCDA 4CSVA 2GTNA 3F2RA 5K4IA 4WKQA 3R1SA 4G1WA 4CMOA 2CCIA 3FKLA 4QMZA 2G15A 4QYHA 4OT6A 4DGOA 2JIUA 1T46A 4O7WA 3NYOA 2Z7LA 3DA6A 4BR3A 4C4EA 2XIXA 2ETRA 2W1IA 3QYWA 4X7QA 4ZJIA 3I1AA 3ITZA 2G2FA 3T3UA 5M57A 3Q5ZA 4E73A 1PYEA 2B53A 4XG3A 4QTEA 3HAMA 5ANEA 5BVDA 5AADA 2ONLC 3ZZWA 1XBBA 3QTIA 5A4LA 1H1RA 3SVVA 3GXLA 4MWHA 3WZEA 3LAUA 3R7IA 3PG1A 2O5KA 2JKKA 1OM1A 2X6EA 2JKMA 4G3CA 4RRVA 4M0YA 3SV0A 3UC3A 2OI4X 3EQFA 3GU8A 2EXCX 3FLQA 1T45A 3H0ZA 5CTPA 1H01A 3N9XA 3E87A 2WNTA 4FX3A 4AA5A 2C30A 2F7XE 3LFCA 4YNOA 3KMWA 4AXFA 4L68A 4TPTA 3UPZA 3AC2A 1XMLA 1FGKA 3DJ7A 4FG9A 4N57A 4XP3A 3POOA 4KINA 3RPYA 3TNQB 5KKRB 2ONLA 3ZBXA 4PL3A 2WOUA 5HVJA 4TL0A 4CT1A 2R0UA 1OL2A 5AP3A 4GG7A 3EQHA 4YP8A 3HL7A 2Q0BA 4GSBA 1UKHA 3TZMA 5HTCA 5M4FA 5FM2A 1ZYJA 4FC0A 4CNHA 2GCDA 4C59A 1ZWSA 2QG7A 5DT0A 4GJ3A 2IWIA 4BDFA 4EOOA 1RE8A 2H34A 4ZSGA 3MDYA 4USEA 3FY0A 2BILB 2W05A 2W06A 1OMWA 1WBSA 3ERKA 1MQBA 3Q60A 3QD0A 4FSTA 4FT0A 4FTNA 4JQ7A 4YLKA 5CX9A 2P33A 4DFNA 4J95A 4H39A 4QNYA 4O0SA 4RQVA 3K3IA 3REPA 3PIYA 3ODYX 4ZTQA 2XYNA 1B6CB 5H8BA 4HVHA 4IC7A 2PTKA 4I5CA 4AWIA 4MXYA 5BVOA 5KCVA 3MYGA 3ZRMA 4O6EA 3PZHA 1KE8A 2R3OA 4E4XA 1HOWA 3EQRA 5JMSA 2YHVA 3C0IA 1MRVA 4GVJA 3W2PA 4I92A 3BPRA 5DG5A 4AT5A 5JSMA 5JFWA 4DFXE 5CALA 4NTTA 4C7TA 4TT7A 1ZOEA 4EH6A 3W0QA 1IAHA 3LFBA 3ANQA 1UNLA 5KBRA 4YTCA 2FSTX 3MPAA 1YHVA 3QD2B 4FI1A 3NNWA 5EYMA 1LR4A 4E4MA 4R3PA 3MTLA 3EJ1A 3NIZA 5E1SA 3W32A 2C6EA 3Q6WA 2XBJA 1KSWA 1TKIA 4MK0A 1NVSA 5DRDA 3U4WA 4E26A 3D5VA 3IKAA 1JPAA 1BMKA 3LQ8A 4IIRA 4WBOA 5A3XA 4O0TA 2ZJWA 1M17A 4O7NA 4DG3E 4X0MA 2GDOA 4BTKA 4C4GA 4LOOA 3K3JA 4V0GA 2NPQA 2P3GX 3OBJA 4F1MA 4D0WA 2O0UA 2VN9A 3TZ9A 4IC8A 4UYAA 4YBKA 3SRVA 3F5GA 2UZEA 4EC9A 4NW5A 2VUWA 3FAAA 4TYGA 5CAQA 3HRBA 4MBJA 3OCBA 3D4QA 3LKMA 4WIHA 1MRYA 2BAKA 3UYTA 1Y91A 4BDDA 5KMIA 3SDJA 4GCJA 1LEZA 3MY1A 1MP8A 1TQIA 2PL0A 2RFSA 3VS0A 4EJNA 1OBGA 1XO2B 3MTFA 2OH4A 3RHXA 4UB7A 2NYAA 1O6LA 3AT4A 1K3AA 2IZRA 2JKOA 4O0VA 5G1XA 4BCNA 3TNPC 1GIIA 4RA4A 2PSQA 3U6HA 2BFXA 1FGIA 2UW5A 1XWSA 5IQGA 1UV5A 2WQEA 1Y57A 5E8VA 1JOWB 4XG6A 1I44A 5HGIA 4O7RA 2BZJA 3EQDA 2IJMA 3BZ3A 4QP8A 3THBA 5HD4A 5J9YA 3B2TA 2CKPA 3C4FA 3OS3A 4G2FA 2FVDA 4DFLA 3DKFA 4FG8A 2XJ0A 3FL5A 4MX9A 4AW2A 3WYXA 3OG7A 3OHTA 3GCSA 4G5PA 4WA9A 2J2IB 4RWLA 4S31A 2YEXA 3IW8A 4GK3A 4AFEA 3SLSA 2OJIA 1H25A 2GQSA 4RLLA 3BLAA 1G5SA 1H27A 4LGHA 1G8KA 4DGNA 1YOMA 3FL4A 3G0EA 4FSYA 4DCEA 3KC3A 4CFUA 2EVAA 3BWJA 3NDMA 2WQOA 3LCOA 5J5SA 3TN8A 1ATPE 5FEEA 2YM8A 3TWJA 3DPKA 1G8SA 4GIIA 3R8VA 1V0PA 1M2PA 2FB8A 2YIYA 2C1BA 4A7CA 4AN9A 2WO6A 4IAAA 4E4LA 3W8LA 3AT2A 1VZOA 4G3EA 5C8MA 3W2OA 3NR9A 2ESMA 5M44A 4O7SA 3E8EA 2RL5A 3A4PA 3AC3A 4EWQA 5K4JA 1A48A 2OXXA 2XJ1A 3BU3A 4F7LA 2WTWA 3I7CA 4XEYA 4AZFA 1XH9A 4CGAA 3GUBA 4YJNA 3PA4A 4RG0A 4RIYB 3E8NA 5KO1A 2PZPA 3ORXA 3EIDA 4TYHA 4F0GA 4IAFA 5DIAA 4FKOA 4WUNA 2JDRA 2OBJA 1CM8A 4J97A 4C4FA 4JR7A 4L9IA 5IA1A 2CHLA 4O21A 1UNHA 2W96B 4X2KA 4PDSA 5FBOA 2I40A 5K9IA 3QXOA 4FTQA 5EFQA 3DJ5A 4FVPA 3DAJA 4FTUA 4H36A 4ID7A 2QKWB 2HELA 5BVNA 2CGVA 2UZLA 3SKCA 1R3CA 5FRIA 4DLIA 1ZMUA 3QL8A 4FTMA 3NSZA 4FEQA 5IQFA 4UX9A 2WKMA 3HMMA 1J1BA 3BEGA 1SVEA 4L8MA 3RZBA 3BU5A 1RJBA 4U8ZA 3CY3A 4FIFA 4BICA 4EH7A 5HX6A 3WZJA 3FI3A 4U81A 3GU6A 2P0CA 3ORNA 3C0GA 4LQMA 3D7TB 2PZYA 1H24A 2BIYA 2ZM3A 4IJPA 4AQCA 2WZJA 3PWDA 2WTKB 3U9CA 2KULA 1V0BA 2R9SA 2W5HA 4HPTE 2XMYA 2WHBA 4TWPA 3TJDA 5KX8A 5J87A 3UIMA 2C5VA 3FMNA 3UOLA 2WELA 3BWFA 4OTFA 4EL9A 1H26A 2ITVA 2ZV7A 3EN5A 3LFDA 4RGJA 5HICA 3R9DA 5AA8A 4NIFB 2YDKA 4F9CA 4DGLC 2QOIA 4EOLA 4PMTA 3A2CA 2CNQA 2VTAA 3FZSA 4ACCA 3CPCA 4B9DA 5BVKA 4PWNA 3VBVA 2PVJA 4FG7A 4D4RA 2WXVA 4FA2A 4YJOA 4O7TA 5D12A 4MD8E 2UW0A 2X81A 4I1ZA 4PDYA 2WMSA 4HZRA 3Q6UA 3I4BA 3HRFA 2UZOA 4ZTRA 1YHSA 2R64A 3TACA 3RWQA 3CEKA 3KF4A 1IEPA 2XCKA 4FV5A 3W18A 2XNMA 2HK5A 3IDCA 4PMMA 4HNIA 4M3QA 5AV2A 5HEZA 3TKHA 2QKRA 3RWPA 3MA6A 3BYOA 4WNOA 4DG2E 3ALNA 2XIZA 4YU2A 1MRUA 5HBHA 2C6LA 3CTJA 5JZNA 3SW7A 4DH7A 2C5XA 4I6LA 4YO4A 2XNGA 2YISA 4IBMA 5EQEA 5CNNA 2Q0NA 2REIA 2X7GA 2JC6A 1ZOHA 3IOPA 3NWWA 5CSXA 4YSMA 4BCKA 5C01A 4BGQA 5GIOE 5FG8A 2ITQA 5AM7A 2CGXA 3PY1A 3FLSA 4CVAA 3UMWA 4IX4A 1UVRA 2CN5A 4EI4A 4NUSA 4FT5A 3IPHA 3FV8A 3V5JA 2WQNA 3VJNA 3ZO1A 4EEVA 1REJA 3P4KA 4MNFA 4F0FA 4U3ZA 4YHJA 3W0RA 5IUGA 4A9UA 4AOTA 3GQLA 5GIPE 4QDEA 4YHTA 3TUBA 2BRNA 4YO6A 2XKDA 2IW8A 4UN0C 1UU8A 3R63A 5AX3A 3VUDA 3FYKX 3KK9A 3RHKA 5CY3A 3NYVA 4QP7A 3MGYA 2VGPA 5I9ZA 1ZZ2A 3EN7A 4GVAA 2IG7A 3DBCA 1PF8A 2PVKA 3HNGA 4C02A 3MIAA 3EN4A 1P4OA 1ZARA 3FI4A 3CXWA 3QF9A 4BDJA 4EYJA 4L3LA 1PMVA 3R7VA 2RF9A 4XOZA 1BYGA 4FEVA 5BYYA 4WO5A 2QHMA 3NCGA 4KS8A 5A4CA 3L1SA 3PXFA 3UMXA 3IGOA 3NZ0A 4C38A 4CMTA 1SM2A 1XQZA 3M2WA 5AP1A 2JFMA 4O86A 2W5AA 3ZLYA 4Z7GA 4BBFA 1E9HA 5CU6A 3RP9A 1ZYCA 4O84A 2O8YA 3DFAA 1W8CA 4ZJJA 5A4QA 5LWNA 5AV0A 2Y4IB 4YJPA 4ZXTA 4IWPA 5FGKA 4XG9A 3C13A 4A07A 3Q4UA 4WT6A 3RALA 2DWBA 4I4EA 5TF9A 4Z7HA 2QI8A 5HNBA 3HP2A 4G6OA 1PXJA 3VBWA 3ZEPA 4MNEB 4F7NA 2XNEA 5EHOA 2GNHA 2PUNA 5ANJA 3TT0A 4K33A 3EFWA 2C0OA 3JY0A 5EW3A 4KUJA 4AW5A 4BDEA 5K5NA 3NUAA 5CT7A 4N0SA 5I9UA 3TDWA 3UDZA 5FXSA 2Y8OA 3DAEA 3Q9YA 4FKJA 1IA8A 4JR3A 3AOXA 4BIDA 3BE2A 4MEDA 2XZSA 3FMLA 3ZLXA 3ZZEA 4ANQA 5F9EA 3SXRA 3KULA 2HXLA 2BPMA 3NRMA 3O17A 5AP2A 5LCKA 2OH0E 1NA7A 2R3HA 3POZA 3RPOA 4GU9A 3UQCA 4JBVA 3ZU7A 1YDSE 2Z7RA 4FSWA 4PTGA 4L46A 5IQIA 3GP0A 1MUOA 3KGAA 4QMLA 1JKTA 3NYXA 4MYGA 4IJ9A 4QYYA 3PJCA 4NFMA 3HV4A 3AKKA 3KRLA 5DH3A 4LI5A 3QGYA 5HG9A 3PSCA 3PXKA 2FSLX 1GZKA 1KOAA 3KVXA 2R5TA 4AXCA 5FD2A 1FOTA 2IPXA 2P2IA 2VWVA 2VZ6A 2Z60A 3L8VA 4I41A 4QP3A 3P7AA 1XBAA 2F57A 1F0QA 2FGIA 2RG6A 2XIYA 5L3AA 4Z9LA 2JEDA 5HQ0A 5ACKA 3VJOA 2UW4A 1W0XC 4QMOA 2WD1A 4I0TA 4LV8A 2WTDA 2OICA 3PE2A 2ZVAA 5DR6A 1HCKA 4IAKA 2R7BA 3FQSA 3DK6A 3WIKA 3N51A 3Q04A 2X6DA 2UVZA 3O96A 2X8EA 4AE6A 3ZLWA 1RDQE 3RAHA 4FOCA 4TYEA 3TNIA 4MAOA 2HZ0A 3ZOSA 4NM3A 3SHEA 4PY1A 4U97A 3VUIA 2HY81 4OUCA 4QMMA 4BBEA 4XJ0A 5C9CA 3F66A 3OXIA 4ACDA 2JITA 4G9RA 2WQBA 4DHIB 4EOJA 1U5RA 3LW0A 4GS6A 4FSRA 4L43A 4MCVA 4P5QA 4IB0A 4XLIA 5AP4A 4BI2A 3PP1A 3SOCA 1YQJA 3BLRA 1CMKE 3V04A 2QOQA 3SD0A 4DGGA 4CV9A 1OECA 3MS9A 2C6IA 3D94A 4K2RA 4PUZA 2DYLA 3CD3A 4USFA 4RQKA 5EKOA 4QQJA 2W1DA 4S33A 2XK9A 4E20A 2R4BA 1Q3WA 3VQHA 3ZFMA 1OKVA 4DH1A 1Y8GA 1H07A 2ITTA 3KCFA 3KN5A 3TEIA 4DA5A 4EK4A 3HKOA 4NM7A 3QCYA 3CKXA 2AUHA 2CLQA 5DT3A 5L8LA 3P5JC 4DDIA 4CEGA 1M52A 2VO6A 3C50A 1V1KA 4FL1A 4NT4A 4R77A 4QMYA 1Y8YA 2GNJA 2O65A 2VAGA 2GHMA 4KABA 4M68A 2QOLA 5IQBA 3TZ8A 3W0OA 4Q2AA 3S0OA 5J9LA 2YIRA 3I6WA 3C4CA 4MTAA 4DEHA 2R2PA 3MFRA 2UZVA 4ZAUA 4G17A 4K0YA 1UU9A 3DAKA 2C6MA 3PDTA 3PUPA 4LRJA 5FXQA 3PVWA 2BALA 2OWBA 3JPVA 3MSSA 4APPA 2PMIA 4AT3A 5F94A 3DZQA 3LQ3A 4NK9A 5A6NA 4ITJA 3CJFA 4E6DA 3PIXA 3RAWA 3H10A 1VJYA 3HZTA 2B9JA 3UOHA 4FKWA 5EH0A 2Q83A 2V22A 3DXNA 3RM7A 3GC7A 3KRWA 2W17A 3A7JA 1SNXA 2R3LA 2G2HA 4FR4A 4DHZA 3AC4A 5BVFA 3IDPA 3VW6A 4U7ZA 4Q5EA 2VTSA 3CY2A 2VV9A 4RWIA 4TYJA 4DTKA 5E8XA 5IMXA 3W2RA 4J71A 5FTQA 4XV9A 4MXXA 2E9VA 3H30A 2ZV8A 3COKA 3QTSA 2JKQA 4KRDA 4RC4A 3WI6A 3BKBA 1A06A 4BI1A 4M0ZA 2CN8A 5HNIX 2B7AA 4U3YA 3Q4TA 2QLUA 3U87A 3M1SA 3OMVA 3OOMA 4XX9A 5IQEA 5HO7A 2OK1A 4L52A 4FKPA 2YITA 1ST4A 1KUTA 3LLTA 2XS0A 2GMXA 4CFFA 4QOXA 1JQHA 5KMNA 2OJGA 5HX8A 3N4UA 1G8AA 2UW9A 4MD9E 4KKGA 4X2JA 4AF3A 4O91A 4CKIA 3QRJA 3EFLA 2WU6A 5IA2A 1R39A 4EOQA 4C2WA 4U41A 3AT3A 1OL5A 3UODA 3CGOA 3S4QA 4DGMA 4L53A 5I4NA 4YZ9A 5CAUA 4HYHA 2PVHA 3RINA 4YNEA 3UBDA 4I0RA 3G33A 5A14A 4XH6A 2CNUA 3R2BA 4EONA 2QU5A 4XHKB 2GQGA 2YIWA 3DDQA 3NUXA 5E4HA 4A9YA 2XYUA 2QOCA 5LARA 4RBLA 3HV7A 5ETFA 1O6YA 3TM0A 2IVTA 3TZ7A 1GZNA 4JG7A 2HW7A 3CLYA 4NKSA 3LFEA 3I60A 3F3UA 2YAKA 3F69A 4HVGA 3R7YA 2ZDTA 2OXYA 5EYDA 4U9AA 3FLWA 3DXQA 2ZMCA 1H0WA 4FE2A 3UIUA 3ZYAA 3DY7A 5I9YA 5FDXA 4AZEA 3U6IA 4FIEA 5FTGA 4EJ7A 5DYJA 2WTCA 2J0KA 3W0PA 4GH2A 4XV1A 1ZYSA 5EYCA 5JQ8A 3LFQA 3ATSA 3LCSA 4IWOA 3C4WA 2R3JA 4ZY6A 4C37A 5CXZA 4WOVA 4XBRA 3W1FA 3O8PA 3OWPA 1PXNA 5DR9A 1JKLA 4F9WA 1P5EA 1GZOA 1Q97A 2WMXA 3LMGA 4EKLA 1XBCA 3V5TA 5IEVA 4OTDA 5CEIA 3VS1A 4FK3A 3W8QA 5HLNA 3CCNA 1JLUE 2JDOA 2VWBA 4BCHA 4J96A 5M06A 3ZM4A 3CQWA 2B9HA 3HDNA 4S2ZA 4D0XA 4I94A 5J7HA 2RFNA 2CGUA 1OB3A 2SRCA 3GFWA 1NXKA 2E9PA 5DBXA 2BDJA 5EDPA 4OTHA 3W2QA 2OKRA 4ZMFA 4EZ3A 1YXSA 5AIKA 3HEGA 2PULA 5EI6A 2ACXA 5FLFA 5H9BA 5B2KA 5JK3A 4FV2A 3QUDA 4C4JA 4P4CA 2GHGA 3F5UA 3ET7A 4DEBA 4H58A 3GB2A 3PIZA 4JX3A 2R7IA 1Q62A 4R7BA 4ZK5A 5FP5A 2PYWA 4BCOA 4LV7A 3LM5A 4I0SA 2F7EE 4AGCA 4RIXA 4IWDA 4DYMA 2BMCA 4R1YA 3VHEA 3ORKA 1Q99A 4FYNA 4FSQA 5DA3A 3W0NA 4QQTA 1WVXA 4FTKA 2X2KA 3D5XA 5LVOA 4TRLA 3R8UA 4ENXA 1Y6BA 4G34A 4DEIA 2VWWA 3FKOA 3KXMA 1P14A 3G2FA 3PXQA 4RSSA 4QTBA 4PTCA 4XYFA 2Y0AA 2O63A 3IO7A 1PJKA 5DI1A 2C0TA 4UWCA 3GI3A 4B6LA 1UWJA 2W1GA 3BHTA 3Q52A 5T68A 5IH5A 4MBIA 5D41A 5D7VA 3A99A 3W0SA 4FEXA 2C47A 3NX8A 2A19B 2OXDA 2UVYA 2XVDA 4YZCA 3BV3A 3V6RA 3DU8A 4ZOGA 3FPQA 5A4EA 2XKEA 4AE9A 5AX9A 4DLJA 4XRJA 4H1MA 2WTIA 4DC2A 2BHEA 4CZUA 1Q8YA 2VTRA 4FGBA 5H2UA 3W55A 3UZPA 2JD5A 3MH3A 5M4CA 2C5YA 4Q9SA 2YCSA 3S2PA 4GUEA 1ZZLA 2AC3A 3RK7A 4D4VA 3BIZA 2UZBA 1U54A 4NJDA 1XHAA 3FZ1A 5DVRA 3VS4A 1YOJA 5J1WA 2OO8X 3CQUA 3W16A 4FMQA 3ZDUA 2QODA 3NW7A 3BBTB 5CWZA 1QPDA 3HECA 5DFPA 3AMAA 4A4OA 4BBMA 3B8QA 2DQ7X 3P86A 2A2AA 2RFEA 3M42A 5CI7A 5CVFA 3WIGA 2NP8A 4KD1A 3QZGA 3W10A 4PMSA 4YGAA 3ZXTA 4C61A 2X8IA 5EHLA 5HG7A 3SOAA 2QOBA 4X2FA 4AFJA 5L2TA 4IWQA 4JBPA 3OXZA 4MKCA 4TNDA 4RIWB 4ZTMA 4HVSA 3ORPA 3ZUUA 4G3FA 4AN3A 5L2IA 4FSZA 3HUCA 2XK3A 4N70A 4UY9A 5IU2A 4BDKA 1QMZA 4CXAA 2OZAB 1PHKA 2XAOA 4FEUA 4L42A 5ETIA 1BUHA 2F49A 5KMJA 4RJ6A 2YCRA 1GIJA 2IW9A 5ANDA 4EUTA 3NUUA 4DEEA 1WCCA 5IH6A 1ZY5A 3WF5A 2WGJA 4ANMA 3CQEA 5I9WA 1FMKA 2YERA 3JY9A 3NEWA 4OR5A 5EKNA 3QC9A 3DK7A 3Q9WA 5EM5A 4L7FA 4DH3A 4KSQA 4BRXA 2PMLX 1XH8A 5I0BA 4HGTA 1STCE 3VN9A 3VRYA 3ZO2A 3E63A 5CANA 3QC4A 3R21A 3Q4CA 3VO3A 4G6NA 4DEDA 3DXPA 1IA9A 2YCQA 5M55A 4CD0A 2W1HA 1VYZA 3FMJA 4RJ8A 4YJSA 4AX8A 4ZLZA 1JSUA 1VEBA 1PYXA 2YZAA 2BRHA 4Y5QA 1SMHA 4NU1A 2XBAA 4EC8A 2C3IB 4QMXA 2W7XA 3EZVA 4F9YA 3RMFA 5BMMA 2E9NA 5M56A 2CPKE 2W5BA 1J3HA 2IZSA 3GOPA 3L9MA 2PE2A 4H3PA 4CV8A 3Q5IA 4D4SA 4D9TA 2WMRA 5E8UA 4GG5A 3TV4A 3A7HA 2YN8A 3EQGA 4G9CA 2EXMA 3SW4A 4QO9A 1CKPA 5AP0A 5F20A 2WOTA 3RNYA 3PLAE 5CSPA 2J0IA 2BCJA 2J6MA 5B2MA 2W1CA 3FMDA 3ZUVA 4F6WA 2Y7JA 2X0GA 2C3LA 5KHWA 3R04A 4F6SA 2BRMA 2VTNA 2CNVA 4G16A 4CT2A 4S32A 2A27A 1OKYA 2UW6A 3QYZA 4ZSEA 4LYNA 3Q53A 1AQ1A 2YACA 3AKLA 3CKWA 4BF2A 4JQ8A 3GOKA 4YTIA 1M2QA 4KA3A 4BTFA 5BVEA 3P78A 5TT7A 5FEQA 4QP4A 4WNMA 3JYAA 4HYSA 4MD7E 4Y46A 2JAVA 4XG4A 2O64A 1ST0A 4IAYA 3DGKA 5M4IA 2AYPA 3GFEA 3TKUA 4EK5A 1L8TA 5LVNA 3ANRA 1QL6A 3PJ8A 4RIYA 4G3DA 2XK7A 4L3PA 4L67A 3GEQA 3AMYA 4B0GA 4V05A 2PVNA 3RK5A 4DH5A 1URCA 4J1RA 3V3VA 5M51A 5HZNA 1OKZA 2ZFYA 4FZ6A 5TR6A 3UYSA 3R83A 3ZHPC 2XF0A 1WAKA 4YZBA 5AA9A 3F2AA 2W9ZB 5IISA 4JRNA 3TJCA 1K2PA 1YWRA 2HWPA 3OWLA 3MV5A 1FQ1B 3OWKA 3WE8A 3OEZA 4F6UA 3O7LD 3PLSA 2B0QA 4FOBA 5BUEA 4IACA 3I5ZA 4DFYA 3OW4A 2QLQA 1JNKA 3TL8A 2YM7A 4J8MA 1OZ1A 4X6QC 2H8HA 3GENA 4LFIA 3NW5A 4FV1A 4M67A 2QQ7A 3BBWA 3NGAA 4R7HA 4YHFA 4U79A 3V8WA 3V01A 4ZZMA 3CR0A 4NCTA 3OY1A 4ACMA 2GS2A 1OIQA 3KXHA 3NMUF 4A9SA 3WZUA 5CXHA 4JG8A 3ZSHA 3D7TA 3WYYA 2FH9A 1GIHA 1PW2A 5IQCA 5IA4A 3TV7A 4HOKA 5C8KA 3BHYA 3TTJA 4E6QA 4EQUA 4UBAA 3QCQA 4O7LA 4FKUA 3VQUA 5DRBA 5I5ZA 5CQWA 2C6DA 4AXDA 4UV0A 4II5A 4V0GB 3R8LA 4HVDA 3HRCA 1H1PA 1OIYA 2VTJA 4FIJA 4O0RA 4BHNA 2PZ5A 3LIJA 4I5MA 3UC4A 3CJGA 3P23A 4LV5A 4F70A 2XM9A 1DM2A 2R3GA 3QGWA 4BY9E 4FBXA 2ITUA 4R3CA 4I24A 3A7FA 4CLIA 5HTBA 3QTWA 3UNJA 5JRSA 4JX7A 2HY0A 4P2KA 3PJ3A 4R6VA 5CF8A 3O23A 2I6LA 1E1VA 2NRYA 1CSNA 3QXPA 2R3MA 3TV6A 3F6XA 1OL1A 3C4ZA 3O0GA 5DPVA 1ZY4A 3ROYA 2CDZA 4C2VA 1OIRA 3V5WA 5AUUA 3NVKI 5ETAA 3EHAA 3ZSGA 4QP9A 4RX7A 2UW8A 5HCYA 2ITZA 4RZWA 4Y85A 5CAOA 3HMNA 3E5AA 4FZDB 2QO7A 5FTOA 2QG5A 2FSOX 3EQBA 2OZOA 3BLQA 4W8DA 3QRIA 3UZTA 4YZNA 3VBYA 3BYUA 3GU4A 4S30A 4AZTA 1OGUA 3F7WA 4QDVA 3FI2A 5CEMA 3NFGB 4X2NA 3MIYA 2H96A 3MVLA 2EB2A 3BX5A 3D5UA 4IMYA 4N6YA 4WRSA 2W0JA 5AJQA 4DN5A 3LXLA 1KE6A 3U51A 3HX4A 4H3BA 3VWAA 4GYGA 2PE0A 1VR2A 4HVIA 5IF1A 3DQWA 1I09A 2B9IA 4FT9A 1JBPE 3UQFA 3MFSA 3DB8A 3CSVA 3SXFA 2X9EA 3S1HA 3IK3A 4P90A 5A4TA 5HBJA 4D9UA 4UXLA 1U5QA 5L8KA 3U54A 1UNGA 1GNGA 3VUMA 4O2PA 4O22A 3FY2A 3EQIA 2VU3A 2PU8A 5CQUA 3GCPA 4XG2A 3BL9A 1KE9A 2XH5A 4LGGA 2P55A 1YXUA 1DAWA 3MY5A 5KHXA 3K2LA 4IB5A 4K6ZA 3UIXA 4C35A 4HCTA 4QQCA 5LMKC 3DNDA 3OD6X 2CCHA 4IZAA 4EHVA 4EK8A 4BDGA 3IQ7A 4FKVA 4ERKA 4KWPA 4EK3A 5ANGA 3VULA 3C5UA 4HYUA 5K5XA 3QQHA 4ZTSA 4CRLA 2VNYA 4TYHB 3SG9A 3P5KA 1ZAOA 3DTWA 4I93A 3S95A 3LJ2A 2GSFA 1JKKA 3LFSA 4RC2A 5AUTA 3QFVA 1WBTA 1YI4A 4JS8A 2HOGA 4O27B 4E6CA 3WF7A 3W2SA 3QQLA 4YPSA 5KMMA 4I6HA 4AZSA 2LAVA 2G01A 3AC8A 3HGKA 4U0IA 3NCZA 3FDNA 3NNXA 3QQJA 1O9UA 3DDPA 2RFDA 4HPUE 4PP9A 2UUEA 3I5NA 5LMKA 3E62A 5FEDA 1CKJA 1Y6AA 1H4LA 1PKDA 4MNEA 2V55A 4ZSAA 5A46A 4ZZNA 3OT8A 4J7BA 4QP1A 5JKGA 1SVHA 3KXXA 5HVYA 4Q9ZA 5HVKA 4FIHA 2F9GA 4E8AA 5CU2A 1Q24A 3H9OA 3LM0A 4I22A 4I23A 5ACBC 4EH8A 4IH8A 3DB6A 3VF9A 4W4YA 3BYVA 1ZRZA 3L9PA 3FQHA 2QURA 2YCFA 4QP2A 1A9UA 4FV0A 2I1MA 4ASXA 3AC5A 3Q9XA 4ZP5A 3KIOC 4K8AA 3V5PA 3R1YA 5D1JA 1LEWA 5GINE 3HA6A 2PY3A 2J7TA 2ZV2A 4QTDA 4FGRA 4I5HA 3CBLA 4IE9A 3RI1A 3ZMMA 1JAMA 3DKGA 3OY3A 3FSKA 4EH3A 4CKRA 4EH4A 5IA3A 1YOLA 3OW3A 2OJ9A 3BLHA 2BIKB 4U80A 2GNGA 4BJJB 3UOKA 3R22A 1SYKA 5CT0A 5T6KA 2VO0A 2VD5A 1DI9A 2GS6A 2XNBA 3MW1A 4ZTLA 5GJFA 5JGBA 4BCMA 5BNJA 3MJ1A 3MB7A 4JL9A 4RIOA 2ETKA 2ZB1A 4NSTA 2QOHA 5CYIA 1H00A 5KMKA 1UU7A 3ORTA 3SA0A 5HO8A 4AXEA 5EOLA 3PRFA 1UWHA 2X8DA 2GS7A 2QO9A 3KL8A 3OROA 4UALA 5E8WA 4FV6A 4M8TA 3OBGA 4IADA 1PXLA 4EH5A 2OIQA 5TO8A 3TG1A 4U40A 4CFXA 1QPCA 2GTMA 3K54A 3R0TA 3W33A 1V0OA 3EL8A 4JBOA 2J5FA 3O8TA 4A06A 1PMNA 3ULZA 4GK4A 4FV9A 3TDVA 3ZUTA 4FZFB 1Z5MA 5E8TA 2XIRA 2XARA 3RJCA 2Z7SA 3BL7A 4DFBA 2VTOA 2YFXA 3QZFA 1J7LA 3CD8A 2C4GA 2XB7A 1YXXA 3WF6A 3QKLA 1YKRA 3KRXA 4F0IA 4KIOA 3F2NA 4JNWA 1APME 5C27A 4GK2A 3F7ZA 5E90A 4YLJA 2VTTA 5IMEA 4FV8A 1TQPA 4BI0A 2X39A 2ZV9A 3UGCA 3D2IA 3KFAA 4FUYA 5J9ZA 3N4VA 4FKLA 4H05A 1PXKA 2BR1A 3UOJA 1PXMA 3MA3A 1Z57A 3LCTA 3GT8A 3PE1A 1PXOA 2IVVA 3QUPA 4P5ZA 3ZO4A 4CFNA 1WBOA 2Z8CA 2OJFE 5CVGA 3IECA 5HLPA 1OBDA 4C3FA 4AU8A 4M97A 2CKEA 4FNYA 5AUZA 1W7HA 4BGGA 3D15A 1M7NA 2VTIA 2WMQA 3LXNA 4ZTNA 4ZMEA 5H3QA 1PKGA 3TXOA 3MVJA 1NVQA 4ENYA 4Y83A 4XV3A 2BTRA 4QYGA 1WBVA 5H8EA 3QA0A 5TOZA 1OGYA 2ZDUA 2BAJA 4FYOA 3WOWA 4JAJA 3MVMA 3C7QA 5B2LA 3R01A 3MI9A 3V5QA 3PSDA 4YBJA 4F09A 4RPVA 5BVWA 4R5SA 1OKWA 5FQDC 2VTLA 3PP0A 4X3FA 4RVKA 2OSCA 3KMMA 3RAIA 1QPJA 2YABA 3VIDA 4M14A 3RCJA 5L6WL 4R1VA 2XNPA 4BTJA 2BAQA 4FKTA 3NVMB 4IVBA 3E8CA 3BV2A 3PYYA 2VWUA 2IZUA 4QT1A 5ICPA 2E2BA 3TNWA 3G90X 4CG9A 2ZM4A 4GRBA 3KULB 3PJ2A 4IFCA 3UO6A 3AD4A 4UYNA 3FC1X 3W0MA 4C34A 5CSWA 4O82A 4BIEA 3ZRKA 1H08A 3MPMA 4L3JA 1XR1A 4RX8A 3JVSA 3E92A 4QQ5A 5CSVA 3PA5A 3ZC5A 3G9NA 3BE9A 3A7IA 4GL9A 1ZYDA 4KKEA 3PRIA 5D10A 5IZFA 4WNPA 4FZ7A 3QQGA 4YPDA 4NTSA 1Q41A 3ATTA 4AW0A 4IAZA 3COHA 2X2LA 5HCXA 5HORA 4DHFA 4FKIA 3ORMA 3VUHA 3DFCB 2NNWB 1JSTA 3BI6A 3P7CA 5AEPA 4GIHA 5IQHA 1WVWA 1RW8A 4NJ3A 4O7YA 4CZTA 2PMNX 4EOMA 3VAPA 4B8LA 4N6ZA 4IQ6A 1M2RA 5AM6A 4F9AA 2OIBA 1P4FA 3G6GA 3IW4A 3R71A 3R6XA 3DT1A 2DS1A 1B38A 3OF0A 3R8ZA 1E1XA 2YM5A 3F3TA 4L01A 5J1VA 4J98A 5EM6A 5EG3A 1OITA 3BELA 4UWBA 4YC3A 3ORZA 1J91A 2UZDA 1QCFA 3QWKA 3OT3A 3DK3A 3WF8A 2BTSA 2E9UA 4IZ5A 4BHZA 2PUUA 4GV1A 4R7IA 2W1FA 5E91A 3Q4ZA 3U9NA 4BDHA 4KBAA 4OBPA 5L6PA 1JVPP 4RC3A 4IM0A 3BGPA 2EU9A 3PFQA 5AUXA 1QPEA 4D2SA 3AC1A 2PE1A 3H0YA 4DBNA 3SQQA 2YWPA 3QUEA 2C69A 4FV7A 4AN2A 1PMEA 4CQEA 4FKSA 5DLSA 2GPHA 1WBWA 4IW0A 4F64A 2XALA 1WBPA 3QD4A 3WILA 5HCZA 1DAYA 4F99A 4KB8A 2WEIA 4NYEA 3TIYA 2EUFB 2V7OA 2Y6OA 2XKCA 1OL6A 4JDHA 1FVTA 1LP4A 2WQMA 4JG6A 4MXZA 4QNAA 4A4XA 4G5JA 3GCQA 5GJDA 5IUHA 2GFCA 1KE7A 2XUUA 5AUYA 3NPCA 2CKQA 3CTQA 3FLYA 5F95A 2YM3A 3WZKA 4EOPA 4F9BA 2XJ2A 2WEVA 1KV2A 3KB7A 5C8NA 3R00A 1R0PA 5IA5A 5IEYA 2VTQA 1REKA 4BCPA 2VGOA 4CCBA 1YW2A 4FTJA 2XK8A 3QQKA 4ZZOA 2HXQA 3D7ZA 4EH2A 4OBQA 2R3FA 4G31A 3MBLA 4DEAA 1UU3A 4EOSA 4JJRA 1IRKA 2JAMA 5JH6A 5FDPA 3FI8A 3P7BA 1WVYA 2F2CB 3JS2A 5DHJA 4C62A 4MH7A 1NW1A 4GT3A 5A54A 2J0MB 3FMHA 3KY2A 3ZSIA 1LPUA 3LMIA 4TN6A 3E88A 4C58A 3BYSA 4OTIA 1PMUA 4M15A 3IW5A 3VS7A 4IANA 2H9VA 3OZ6A 3P0MA 1R78A 3R30A 2WAJA 2XEZA 1W84A 3D0EA 4OLIA 5ITAA 1M14A 2FYSA 3F61A 3O50A 4RT7A 5KKRC 3NNUA 3DV3A 4LL5A 1YWNA 2DUVA 3EKNA 4RFZA 4D5KA 1JSVA 4RJ3A 3KA0A 5CAVA 5J8IA 2X7OA 4JDKA 3KREA 4FK6A 1TFFA 2XK6A 3HA8A 3F3WA 4OBOA 4ERWA 4L7SA 2JLDA 2VWYA 4MBLA 4D4YA 4K11A 4BCFA 4Y73A 1ZMWA 4NFNA 4QTAA 2YJRA 3OWJA 4I20A 4AUAA 5FUTA 4FNZA 4GFOA 4HCVA 4YJVA 3UVPA 3MVHA 2X2MA 3W2CA 5JT2A 4RLKA 2ITXA 1J7IA 2QU6A 3QALE 1CTPE 1G3NA 4TWNA 3UDSA 2V62A 4FTOA 3UE4A 3TNHA 4XRLA 3AG9A 4IB3A 4KKHA 4I5PA 5LVMA 1M7QA 5C26A 3Q96A 3UQGA 4ASEA 5JFVA 4ZLYA 4RIWA 3SXSA 3VBTA 4FV4A 3QAME 3L8PA 4YR8A 2ITNA 4YJUA 5EQPA 2Y4PA 1H1WA 3LLAA 4PV0A 2O2UA 2R3QA 4EWHA 1YXTA 4PF4A 3QQFA 1YXVA 3FHIA 4PP7A 2BDWA 2QHNA 2YA9A 4GUBA 3LZBA 1XH5A 4C33A 3R7OA 3SAYA 4O0WA 3A62A 2HCKA 2LGCA 5FBNC 4ANSA 4OW8A 3GBZA 1XH4A 3NAYA 4J99A 4JBQA 4UZHA 4BCQA 3UNKA 1BI7A 5EOBA 4L44A 2OFUA 3WARA 1CKIA 4BZNA 2IZTA 1Q4LA 3IGGA 4GW8A 4ALVA 4FNWA 4IM2A 4DT8A 1ZXEA 5CNOA 3FBVA 2W4OA 1XKKA 1F5QA 2C0IA 4ORKA 2GFSA 4B7TA 1UKIA 5DEWA 1Q61A 4ZSJA 5CAPA 4LL0A 2UW7A 4O96A 4HCUA 3ETAA 5LVPA 5IH4A 2W4JA 4F1TA 4ZY4A 2UVXA 3VUKA 4FZAB 1J7UA 5HD7A 4GU6A 5HG5A 2JDVA 3EMGA 1F3MC 1FPUA 4FTAA 1NY3A 3HLLA 4IVDA 3FWQA 4O81A 2Y6MA 4HGEA 3TCPA 2CJMA 2CLXA 4MUQA 5EK7A 4FVQA 3U8WA 4DE4A 4J53A 1B39A 3HVCA 3R73A 1LUFA 3H9FA 4OTRA 4BC6A 1W83A 3LE6A 3KKVA 2WIPA 3NYNA 5LVLA 1S9IA 2ZAZA 2OLCA 5HI2A 4JDIA 3QA8A 4ONAA 2O3PA 2XP2A 4KNBA 4RJ7A 4S34A 4B4LA 2PVRA 3GU5A 5C1QB 4U43A 4NWMA 5EM7A 3HUBA 3RPRA 2PVLA 3GVUA 4DG0E 4JI9A 5CEPA 3DKOA 2IW6A 4O2ZA 2Z7QA 2X9FA 2IVSA 4FT3A 2VWXA 2XA4A 2WMWA 3PPJA 2CKOA 4U44A 3FXWA 3KXNA 5AV1A 4RIXB 2UV2A 4RX5A 4PL4A 4QPAA 3QU0A 3PVGA 3UIBA 3UP2A 2BHHA 3K5VA 1H28A 5B0XA 3VVHA 2R3NA 3IW6A 3KVWA 3MH0A 4LOPA 3VRZA 3JXWA 4YC6A 5BUIA 4TWCA 3QRUA 3AGLA 5JGDA 2V0DA 3LPBA 2F7ZE 1OL7A 4LG4A 4M12A 4JAIA 3R8PA 4YTFA 1URWA 3IW7A 4PDOA 2EB3A 1OUYA 4QTCA 4AA0A 5I9VA 3R7UA 3RNIA 4Z3VA 3OCTA 4AZVA 3MWUA 3O5AA 1G8JA 1XH7A 3UPXA 3VBQA 2W4KA 2P2HA 4FIGA 4QMVA 2XM8A 5BQ0A 3UO4A 3F3VA 4FSMA 4K18A 4R3RA 4NW6A 2ERZE 3VHKA 4G3GA 4QYEA 3RK9A 1BL6A 3TYKA 4BKJA 3FMKA 3BHVA 1U54B 4AG8A 5IA0A 1U46A 3H3CA 4IVAA 4V04A 4EOIA 5JQ5A 5BYZA 4JVGA 1TVOA 2BZKB 3NAXA 3V8TA 4MXCA 2PHKA 3FEGA 4FT7A 3G5DA 1YDRE 2B1PA 2BZHB 4FTIA 3HMPA 1VYWA 3IG7A 4O0XA 4AZWA 4BZDA 5BV3A 5LWMA 3G6HA 1PRYA 4O83A 3I7BA 4M69B 4EYMA 2HENA 4H3QA 3PWYA 4IZ7A 4Z55A 3NW6A 2F2UA 5JFXA 3TIZA 2FA2A 2BRBA 3MPTA 3OEFX 4WSYA 4XOYA 5CZIA 3V6SA 5IPJA 1U4DA 1KV1A 4PQNA 5EDQA 2JFLA 4FSNA 1FVRA 3GGFA 4IZYA 2IO6A 3UZRA 1IAJA 2VNWA 4XLVA 5AP6A 3VF8A 4BZOA 5GJGA 4IM3A 3VS2A 3BGQA 4W4VA 4DAWA 3ENHA 3GU7A 3T3VA 3G0FA 5IG1A 4QEBA 3QQUA 2X1NA 4PX6A 3S00A 3FYJX 4KAOA 3GNIB 1GZ8A 3AGMA 3DCVA 1YWVA 4OGRA 5AIRA 5G6VA 5C03A 4I3ZA 1ZYLA 4U42A 4ACGA 4AP7A 4D1ZA 5HU3A 3EKKA 3QTZA 1WZYA 2PUPA 4TKSA 5F1ZA 4M7IA 5T3QA 2QOFA 1H1SA 3LJ0A 3Q2JA 5AMNA 2J0LA 1GAGA 4ITHA 4IX6A 1OIUA 4NCTC 5ANIA 3LXKA 3Q3BA 3LQ5A 4QRCA 5CF6A 5EI8A 3OUNB 4CRSA 3LHJA 1ND4A 3FKNA 3P9JA 3FZOA 4IVCA 4LRMA 2XK4A 1WFCA 3QKMA 4LUDA 4IX5A 3T9IA 4DBXA 2ZOQA 3R1QA 5FP6A 2WTKC 4QYFA 4D58A 3K5UA 3PUFC 2J5EA 3OCSA 4EKKA 3ML1A 2HIWA 1YVJA 4BCIA 5LCJA 4IX3A 2UZNA 2XNNA 3AQVA 5DWRA 4USDA 5CEKA 2R3RA 1BL7A 1AD5A 4AW1A 3BCEA 4BGHA 5TKDA 3LXPA 2OU7A 5CVHA 2KTYA 3H4JA 2ITWA 4PDPA 2EWAA 3JUHA 4A4LA 5A9UA 4LM5A 2FUMA 2AC5A 4V01A 4JRVA 3HV3A 4TYIA 3ZS5A 1X8BA 1BI8A 3F88A 3FMMA 3KF7A 2OG8A 1R0EA 2WMTA 4FTRA 2C5NA 4TTHB 3V51A 2F4JA 4NM0A 4FTTA 4NL0A 4DTBA 2QR7A 2VTMA 3FZRA 3PVBA 5ANKA 2A1AB 2ZYBA 3KEXA 3NUYA 4HGLA 1JKSA 2PPQA 2VTPA 4YSJA 3SRVB 4IFGA 3OVVA 4YURA 3TUCA 3ZBFA 5EDRA 3D14A 2FO0A 3DNEA 4UXQA 5CASA 4JXFA 3T8OA 2W1EA 3DBEA 3DZOA 2R0IA 3CC6A 3NS9A 3VS6A 2HZ4A 3FHRA 3LMHA 4BDCA 5AAEA 2XANA 3B8RA 2ZM1A 1IG1A 3G15A 3IS5A 4HJOA 4LDTA 4UEUA 4ZS0A 5L8JA 3PVUA 4JIAA 5DGZA 2ITYA 4YUQA 4F7JA 4WRGA 3KRJA 4GEOA 4XG8A 2QOKA 3QWJA 2JGZA 2QD9A 3IDBA 2XIKA 3ZRLA 4AS0A 3KQ7A 2B54A 2OF4A 4ARKA 2Y9QA 2YZLA 4EUUA 4D1XA 3PSBA 4GFMA 3E8DA 3HP5A 3L8SA 3QTRA 3DJ6A 3E64A 3UVQA 2VRXA 1YRPA 3QX2A 4A9RA 5DE2A 3OTUA 4ALWA 4F4PA 2XAMA 1AGWA 2PVYA 4IAIA 1U59A 3FZTA 2G1TA 3BGZA 4E6AA 4YTHA 4XS2A 4E5BA 3EN6A 5D7AA 2WTJA 3C4EA 2G9XA 3CGFA 3ODZX 1YI3A 5LXMA 4YJTA 2FSMX 2I0EA 1UA2A 3I79A 3RKBA 2OJJA 3PXZA 4F7SA 5L6OA 3DOGA 1H8FA 2PVMA 4B8MA 3IOKA 5IQDA 2BFYA 2JBOA 4JIKA 3RM6A 4EK6A 1FVVA 4HW7A 3EQPA 2OFVA 2QNJA 3MJ2A 3OOGA 4BDIA 4YJQA 4CFVA 4AQKA 2WMVA 4BCJA 3R9OA 5HESA 3C9WA 3VS5A 4BIBA 3NIEA 2C6OA 2P4IA 2B9FA 4CFWA 4FKRA 3VW8A 4DFZE 2R3IA 3PPZA 5E1EA 2OF2A 4MHAA 2H6DA 3C4XA 4NZWB 1NT2A 4KS7A 2QR8A 5KE0A 3UG1A 5LJJA 2VO3A 2Y4IC 5HE1A 2HZIA 2JDTA 2WMUA 5JFSA 3ROCA 3BYMA 2XKFA 3MN3A 3DKCA 4I6QA 3G9LX 3D5WA 2BVAA 3LCKA 4L45A 2YM4A 3R28A 1BLXA 4HZSA 4KIQA 2QVSE 4O0UA 3T9TA 1FBNA 5KZ0A 1BKXA 3BHHA 1OVEA 4ANLA 4BJJA 3R9NA 2BRGA 5CEQA 4Y8DA 5KMLA 3CE3A 4DH8A 2VX1A 1ERKA 1GOLA 3QHRA 4FSUA 1KOBA 4I21A 2J51A 4HGSA 3VS3A 3WBLA 4CG8A 3V8SA 2OIDA 3KXZA 2C6TA 4YZDA 3KRRA 2J90A 4I4FA 5H8GA 4C36A 4CMUA 2QC6A 4FL3A 2E9OA 5K3YA 5AAGA 2OW3A 2Z2WA 3OC1A 2HZNA 4U6RA 3MY0A 2VTHA 1Q5KA 5CS6A 3GC9A 3PTGA 4IB1A 4UWYA 5AAFA 3RPVA 3UDTA 4YJRA 4DFUA 2BUJA 3Q2MA 4EQCA 4WG3A 3BQRA 3TI1A 4EH9A 2YAAA 3TTIA 1RQQA 2CMWA 2I7QA 5DEYA 3RPSA 4D28A 4DHJA 4JMQA 3FQEA 3C5IA 3PY3A 2XNOA 3EH9A 3FJQE 3Q9ZA 5EQYA 2JIVA 3QLGA 2NO3A 4MQ2A 4PTEA 4J8NA 2BZIB 3QZIA 4BDBA 3KCKA 4FNXA 3R9RA 1CDKA 3KXGA 3N4TA 1OPLA 3DS6A 5FM3A 1XH6A 2PVFA 4MWIA 4LOQA 5CSHA 4PMPA 3NNVA 1SVGA 5ANOA 4AAYA 4DITA 3BU6A 3D2KA 4ZS4A 5DT4A 3ZFXA 4C4IA 3E93A 5HU9A 2WU7A 5IDPA 2X4ZA 3FPMA 3BHUA 4MXOA 1KWPA 3KMUA 4MVFA 3MFUA 3ZDIA 5M09A 3EZRA 5B7VA 4RWKA 4AT4A 4XMOA 3KK8A 5HE2A 2I0YA 4FL2A 5M08A 1S9JA 4Y5HA 3ZONA 3D9VA 1L3RE 4RVMA 3HAVA 5DR2A 3R8MA 3EQCA 3COIA 4IHPA 1K9AA 5HHWA 2UW3A 4WNKA 4D1SA 4EOKA 4JDJA 5JEBA 5CU0A 1Q8UA 4AXAA 3AXWA 3KU2A 4W8EA 5ETCA 5HBEA 3LJ1A 5BYLA 5M53A 4RZVA 1PXIA 1PY5A 4DCAA 3AKJA 3ZTXA 3I6UA 3F5PA 2JIIA 1DS5A 2OGVA 3QTQA 3SC1A 4ACHA 3A8XA 3QRKA 2IVUA 3ELJA 2IN6A 2R3KA 4K9YA 1J1CA 2WTVA 4RVTA 2QO2A 2YDJA 3F9NA 4P7EA 3FXZA 5IEXA 1XMMA 4W4XA 3H9RA 5CF5A 4FTLA 3ID6C 1OPJA 4BCGA 3LOKA 4WBBB 4ITIA 4YZMA 5KBQA 4ANBA 4LMUA 3VNTA 2PMOX 5KNJA 4D55A 2ITOA 3A61A 3I0QA 4UZDA 1H1QA 2A0CX 2W1ZA 2GHLA 3ENMA 1W98A 2PZIA 3I81A 4QPSA 3NUNA 3R7EA 3EFKA 4EHEA 2ERKA 2W99B 3UVRA 3CIKA 4E5AX 3VBXA 3EN9A 2BDFA 1IASA 5LOHA 4FUXA 5HIBA 3SX9A 3V5LA 4C4HA 3PXRA 5D9HA 3R9HA 3ORLA 1ZMVA 3ZFYA 4O7VA 4F65A 3S3IA 3O2MA 5BMSA 1H0VA 2C68A 4EORA 5F4NA 4GT4A 2YWVA 3FLNC 3U4UA 1XJDA 4WHZA 3MFTA 3GC8A 5HKMA 3U6JA 3ZXZA 4GMYA 4KBKA 2GNLA 2R3PA 5CEOA 1WMKA 4EHZA 3PJ1A 5AUWA 2X4FA 2RG5A 4BTMA 3FXXA 4NM5A 4W4WA 5C4LA 3VONA 5L2SA 2RKUA 3UDBA 4KIPA 4X3FC 5KZIA 4ZY5A 4XG7A 1IR3A 2GNFA 1R1WA 4U5JA 4X6RA 4XUFA 5BX0A 2CSNA 4EZ7A 3L9NA 4XCUA 4TNBA 3PFYA 3IONA 4K77A 3ZC6A 2YJSA 1MQ4A 3D83A 4NH1A 4OT5A 4AGUA 4ASDA 5CLPA 3F5XA 4LMNA 3CTHA 2BKKA 3OUKA 4GKIA 5C4KA 5EI2A 3ACJA 3EL7A 3LFAA 3R1NA 2G2IA 4AOIA 1OUKA 3HV5A 3PZEA 3EYGA 1TQMA 4E4NA 4OTGA 4QMWA 3PY0A 3BEAA 3PPKA 4AACA 4FJVA 3GQIA 3JR1A 4CTCA 4N4SA 1EH4A 3QTUA 5M4UA 5HIEA 5HLWA 4FVRA 5AFVA 2WMAA 3MESA 4RX9A 4RFMA 2QOOA 2B52A 2QCSA 2XEYA 4TY1A 4E5WA 5E8YA 4GFGA 3TUDA 4APCA 4GJ2A 3B2WA 3E7VA 3QD3A 3EB0A 4BN1A 4QMQA 4ZLOA 4DINA 2J4ZA 5E8SA 3RGFA 2I0HA 3HMIA 3E7OA 2NRUA 5GNKA 4F1OA 4E1ZA 3NFFB 4DTAA 2UZUE 1FINA 2JBPA 4RA5A 2ETMA 3F3ZA 5M07A 3A8WA 4QMSA 5AP5A 3NUPA 3EWHA 4BYIA 3DBFA 2J0JA 3DLZA 2C3JA 2WFYA 4ZSLA 2ZMDA 4E93A 4QP6A 3R2YA 2V7AA 3VC4A 2YIXA 4AGWA 3CPBA 5KUPA 3MH2A 2B4SB 2C1AA 3QTXA 4MXAA 4FKGA 4EQMA 4XBUA 3QLFA 5CZHA 5CI6A 4ZEGA 3A60A 3GC0A 3VUGA 2I0VA 2CGWA 3CP9A 5IQAA 3FLZA 4XV2A 3ZH8A 4JLCA 4F63A 4FIIA 4RJ5A 2W9FB 3E3PA 5D11A 3UTOA 1PXPA 3MH1A 5HIDA 4GT5A 4M84A 3I0OA 4FICA 4Y95A 5AUVA 3LVPA 3QCXA 2BKZA 4WUAA 3HDMA 5DN3A 4D2RA 2HWOA 4TW9A 5A6OA 4BYJA 3FC2A
chains in the Genus database with same CATH topology
3DTCA 4R5YA 4X2GA 2PWLA 3P79A 3ZM9A 3R02A 3UJGA 4KSPA 3FMEA 2RGPA 5AV4A 5CU3A 2VX3A 4CTBA 4J52A 5J95A 4CCUA 5AWMA 1NVRA 3P08A 2WPAA 2UZWE 4C0TA 3O71A 4GKHA 5HE3A 1Q8TA 2GU8A 4G6LA 5DNRA 3AMBA 4RMZA 5I9XA 4FKQA 4X3FB 4H1JA 4CLJA 4MF1A 4YC8A 4X3JA 2YIQA 2VWIA 2XCHA 1ZLTA 3F82A 4Q5HA 3TMOA 3ACKA 2HYYA 3L9LA 3LFFA 4IEBA 3C1XA 5HE0A 3JVRA 3SG8A 4TXCA 5EW9A 3MB6A 4AAAA 3O8UA 3ALOA 3DQXA 3QRTA 4WD5A 4X21A 3FSFA 4LRKA 5DOSA 3RAKA 3UNZA 3OTVA 3ZLSA 4TWOA 5E92A 5FXRA 4L00A 4JQEA 2XRWA 4L6QA 5KMOA 1Q8WA 1YDTE 5E7RA 2JDSA 1WBNA 2UZTA 3G51A 4AA4A 2C6KA 3QKKA 5LMBA 4CKJA 4D5HA 4RWJA 5CENA 3RTPA 1KE5A 5GHVA 3NUSA 2ZB0A 4HYIA 5CF4A 3O7LB 1O6KA 4AGDA 4C3PA 4KBCA 3C51A 5AP7A 2HW6A 2B55A 4RVLA 3RCDA 3O51A 4HNFA 4C3RA 3II5A 3RVGA 4PRJA 4E7WA 4M13A 4FEWA 4R78A 3FE3A 3QX4A 5IUIA 3ZCLA 3CS9A 3WZDA 4ASZA 4B99A 4CFMA 5E8ZA 3ORIA 5CU4A 3U55A 3Q32A 4O7ZA 3HYHA 4F78A 3E3BX 1W82A 4JOAA 5JGAA 4BVUA 2PZRA 3AD6A 4PNIA 4XNEA 1OPKA 4EBWA 3M11A 4FODA 2YM6A 4Y72A 4QMUA 4ZTHA 5JRQA 4IDVA 3OFMA 4QMNA 3BRBA 4U45A 4BDAA 2BROA 4Z16A 3FUPA 5L2WA 4ALUA 4KRCA 1YI6A 3EYHA 3WF9A 3SGCA 3DBDA 3EFJA 4QMPA 3ZEWA 4YMJA 3WE4A 2HAKA 4I6BA 4OTWA 3ZO3A 2XRUA 1DI8A 4TZRA 3PG3A 3UG2A 4PNKA 3L8XA 4JT3A 5HNGA 3A4OX 2C5OA 2X7FA 3GCUA 3A7GA 3KN6A 4QMTA 5BUJA 4DDGA 3QHWA 3GCVA 1OI9A 2A4LA 1BX6A 3P1AA 1SZMA 5IDNA 4MQ1A 3TKIA 3UO5A 2V5QA 3HMOA 2VO7A 3NLBA 5JN2A 1P2AA 1Q3DA 3HV6A 2WMBA 4GYIA 3UP7A 1ZOGA 2PUIA 2WB8A 3AD5A 4I6FA 4NKAA 5AV3A 3QCSA 3DLSA 3DBQA 3ULIA 4BB4A 4WG4A 3OCGA 5E9EA 4RJ4A 4FV3A 4O6LA 5JZJA 1JWHA 4FTCA 4F08A 2ITPA 4IDTA 2AEGA 3C0HA 4K1BA 2C3KA 4EHGA 3PA3A 2Z02A 3OXTA 5EW8A 1GY3A 4XP2A 3FZPA 5LMAA 5LQFA 4YLLA 1GJOA 2J9MA 5BPYA 2VX0A 1Z9XA 2OZAA 3BQCA 4OTQA 5EHYA 4ZIMA 4AOJA 4RFYA 2J50A 4LUEA 4PL5A 2GQRA 5EYKA 4DF3A 4DEGA 2WIHA 4EZ5A 4ZJVA 5EM8A 1VLRA 2PK9A 4DT9A 4XP0A 2GNIA 3COMA 3PXYA 3LFNA 4O38A 4WG5A 4O0YA 2QONA 3QZHA 1YHWA 5HG8A 4A9TA 1FMOE 3EOCA 3QBNA 1HCLA 1Q8ZA 2YDIA 3OP5A 1SNUA 2RIOA 4EBVA 2VWZA 3LCDA 4CSVA 2GTNA 3F2RA 5K4IA 4WKQA 3R1SA 4G1WA 4CMOA 2CCIA 3FKLA 4QMZA 2G15A 4QYHA 4OT6A 4DGOA 2JIUA 1T46A 4O7WA 3NYOA 2Z7LA 3DA6A 4BR3A 4C4EA 2XIXA 2ETRA 2W1IA 3QYWA 4X7QA 4ZJIA 3I1AA 3ITZA 2G2FA 3T3UA 5M57A 3Q5ZA 4E73A 1PYEA 2B53A 4XG3A 4QTEA 3HAMA 5ANEA 5BVDA 5AADA 2ONLC 3ZZWA 1XBBA 3QTIA 5A4LA 1H1RA 3SVVA 3GXLA 4MWHA 3WZEA 3LAUA 3R7IA 3PG1A 2O5KA 2JKKA 1OM1A 2X6EA 2JKMA 4G3CA 4RRVA 4M0YA 3SV0A 3UC3A 2OI4X 3EQFA 3GU8A 2EXCX 3FLQA 1T45A 3H0ZA 5CTPA 1H01A 3N9XA 3E87A 2WNTA 4FX3A 4AA5A 2C30A 2F7XE 3LFCA 4YNOA 3KMWA 4AXFA 4L68A 4TPTA 3UPZA 3AC2A 1XMLA 1FGKA 3DJ7A 4FG9A 4N57A 4XP3A 3POOA 4KINA 3RPYA 3TNQB 5KKRB 2ONLA 3ZBXA 4PL3A 2WOUA 5HVJA 4TL0A 4CT1A 2R0UA 1OL2A 5AP3A 4GG7A 3EQHA 4YP8A 3HL7A 2Q0BA 4GSBA 1UKHA 3TZMA 5HTCA 5M4FA 5FM2A 1ZYJA 4FC0A 4CNHA 2GCDA 4C59A 1ZWSA 2QG7A 5DT0A 4GJ3A 2IWIA 4BDFA 4EOOA 1RE8A 2H34A 4ZSGA 3MDYA 4USEA 3FY0A 2BILB 2W05A 2W06A 1OMWA 1WBSA 3ERKA 1MQBA 3Q60A 3QD0A 4FSTA 4FT0A 4FTNA 4JQ7A 4YLKA 5CX9A 2P33A 4DFNA 4J95A 4H39A 4QNYA 4O0SA 4RQVA 3K3IA 3REPA 3PIYA 3ODYX 4ZTQA 2XYNA 1B6CB 5H8BA 4HVHA 4IC7A 2PTKA 4I5CA 4AWIA 4MXYA 5BVOA 5KCVA 3MYGA 3ZRMA 4O6EA 3PZHA 1KE8A 2R3OA 4E4XA 1HOWA 3EQRA 5JMSA 2YHVA 3C0IA 1MRVA 4GVJA 3W2PA 4I92A 3BPRA 5DG5A 4AT5A 5JSMA 5JFWA 4DFXE 5CALA 4NTTA 4C7TA 4TT7A 1ZOEA 4EH6A 3W0QA 1IAHA 3LFBA 3ANQA 1UNLA 5KBRA 4YTCA 2FSTX 3MPAA 1YHVA 3QD2B 4FI1A 3NNWA 5EYMA 1LR4A 4E4MA 4R3PA 3MTLA 3EJ1A 3NIZA 5E1SA 3W32A 2C6EA 3Q6WA 2XBJA 1KSWA 1TKIA 4MK0A 1NVSA 5DRDA 3U4WA 4E26A 3D5VA 3IKAA 1JPAA 1BMKA 3LQ8A 4IIRA 4WBOA 5A3XA 4O0TA 2ZJWA 1M17A 4O7NA 4DG3E 4X0MA 2GDOA 4BTKA 4C4GA 4LOOA 3K3JA 4V0GA 2NPQA 2P3GX 3OBJA 4F1MA 4D0WA 2O0UA 2VN9A 3TZ9A 4IC8A 4UYAA 4YBKA 3SRVA 3F5GA 2UZEA 4EC9A 4NW5A 2VUWA 3FAAA 4TYGA 5CAQA 3HRBA 4MBJA 3OCBA 3D4QA 3LKMA 4WIHA 1MRYA 2BAKA 3UYTA 1Y91A 4BDDA 5KMIA 3SDJA 4GCJA 1LEZA 3MY1A 1MP8A 1TQIA 2PL0A 2RFSA 3VS0A 4EJNA 1OBGA 1XO2B 3MTFA 2OH4A 3RHXA 4UB7A 2NYAA 1O6LA 3AT4A 1K3AA 2IZRA 2JKOA 4O0VA 5G1XA 4BCNA 3TNPC 1GIIA 4RA4A 2PSQA 3U6HA 2BFXA 1FGIA 2UW5A 1XWSA 5IQGA 1UV5A 2WQEA 1Y57A 5E8VA 1JOWB 4XG6A 1I44A 5HGIA 4O7RA 2BZJA 3EQDA 2IJMA 3BZ3A 4QP8A 3THBA 5HD4A 5J9YA 3B2TA 2CKPA 3C4FA 3OS3A 4G2FA 2FVDA 4DFLA 3DKFA 4FG8A 2XJ0A 3FL5A 4MX9A 4AW2A 3WYXA 3OG7A 3OHTA 3GCSA 4G5PA 4WA9A 2J2IB 4RWLA 4S31A 2YEXA 3IW8A 4GK3A 4AFEA 3SLSA 2OJIA 1H25A 2GQSA 4RLLA 3BLAA 1G5SA 1H27A 4LGHA 1G8KA 4DGNA 1YOMA 3FL4A 3G0EA 4FSYA 4DCEA 3KC3A 4CFUA 2EVAA 3BWJA 3NDMA 2WQOA 3LCOA 5J5SA 3TN8A 1ATPE 5FEEA 2YM8A 3TWJA 3DPKA 1G8SA 4GIIA 3R8VA 1V0PA 1M2PA 2FB8A 2YIYA 2C1BA 4A7CA 4AN9A 2WO6A 4IAAA 4E4LA 3W8LA 3AT2A 1VZOA 4G3EA 5C8MA 3W2OA 3NR9A 2ESMA 5M44A 4O7SA 3E8EA 2RL5A 3A4PA 3AC3A 4EWQA 5K4JA 1A48A 2OXXA 2XJ1A 3BU3A 4F7LA 2WTWA 3I7CA 4XEYA 4AZFA 1XH9A 4CGAA 3GUBA 4YJNA 3PA4A 4RG0A 4RIYB 3E8NA 5KO1A 2PZPA 3ORXA 3EIDA 4TYHA 4F0GA 4IAFA 5DIAA 4FKOA 4WUNA 2JDRA 2OBJA 1CM8A 4J97A 4C4FA 4JR7A 4L9IA 5IA1A 2CHLA 4O21A 1UNHA 2W96B 4X2KA 4PDSA 5FBOA 2I40A 5K9IA 3QXOA 4FTQA 5EFQA 3DJ5A 4FVPA 3DAJA 4FTUA 4H36A 4ID7A 2QKWB 2HELA 5BVNA 2CGVA 2UZLA 3SKCA 1R3CA 5FRIA 4DLIA 1ZMUA 3QL8A 4FTMA 3NSZA 4FEQA 5IQFA 4UX9A 2WKMA 3HMMA 1J1BA 3BEGA 1SVEA 4L8MA 3RZBA 3BU5A 1RJBA 4U8ZA 3CY3A 4FIFA 4BICA 4EH7A 5HX6A 3WZJA 3FI3A 4U81A 3GU6A 2P0CA 3ORNA 3C0GA 4LQMA 3D7TB 2PZYA 1H24A 2BIYA 2ZM3A 4IJPA 4AQCA 2WZJA 3PWDA 2WTKB 3U9CA 2KULA 1V0BA 2R9SA 2W5HA 4HPTE 2XMYA 2WHBA 4TWPA 3TJDA 5KX8A 5J87A 3UIMA 2C5VA 3FMNA 3UOLA 2WELA 3BWFA 4OTFA 4EL9A 1H26A 2ITVA 2ZV7A 3EN5A 3LFDA 4RGJA 5HICA 3R9DA 5AA8A 4NIFB 2YDKA 4F9CA 4DGLC 2QOIA 4EOLA 4PMTA 3A2CA 2CNQA 2VTAA 3FZSA 4ACCA 3CPCA 4B9DA 5BVKA 4PWNA 3VBVA 2PVJA 4FG7A 4D4RA 2WXVA 4FA2A 4YJOA 4O7TA 5D12A 4MD8E 2UW0A 2X81A 4I1ZA 4PDYA 2WMSA 4HZRA 3Q6UA 3I4BA 3HRFA 2UZOA 4ZTRA 1YHSA 2R64A 3TACA 3RWQA 3CEKA 3KF4A 1IEPA 2XCKA 4FV5A 3W18A 2XNMA 2HK5A 3IDCA 4PMMA 4HNIA 4M3QA 5AV2A 5HEZA 3TKHA 2QKRA 3RWPA 3MA6A 3BYOA 4WNOA 4DG2E 3ALNA 2XIZA 4YU2A 1MRUA 5HBHA 2C6LA 3CTJA 5JZNA 3SW7A 4DH7A 2C5XA 4I6LA 4YO4A 2XNGA 2YISA 4IBMA 5EQEA 5CNNA 2Q0NA 2REIA 2X7GA 2JC6A 1ZOHA 3IOPA 3NWWA 5CSXA 4YSMA 4BCKA 5C01A 4BGQA 5GIOE 5FG8A 2ITQA 5AM7A 2CGXA 3PY1A 3FLSA 4CVAA 3UMWA 4IX4A 1UVRA 2CN5A 4EI4A 4NUSA 4FT5A 3IPHA 3FV8A 3V5JA 2WQNA 3VJNA 3ZO1A 4EEVA 1REJA 3P4KA 4MNFA 4F0FA 4U3ZA 4YHJA 3W0RA 5IUGA 4A9UA 4AOTA 3GQLA 5GIPE 4QDEA 4YHTA 3TUBA 2BRNA 4YO6A 2XKDA 2IW8A 4UN0C 1UU8A 3R63A 5AX3A 3VUDA 3FYKX 3KK9A 3RHKA 5CY3A 3NYVA 4QP7A 3MGYA 2VGPA 5I9ZA 1ZZ2A 3EN7A 4GVAA 2IG7A 3DBCA 1PF8A 2PVKA 3HNGA 4C02A 3MIAA 3EN4A 1P4OA 1ZARA 3FI4A 3CXWA 3QF9A 4BDJA 4EYJA 4L3LA 1PMVA 3R7VA 2RF9A 4XOZA 1BYGA 4FEVA 5BYYA 4WO5A 2QHMA 3NCGA 4KS8A 5A4CA 3L1SA 3PXFA 3UMXA 3IGOA 3NZ0A 4C38A 4CMTA 1SM2A 1XQZA 3M2WA 5AP1A 2JFMA 4O86A 2W5AA 3ZLYA 4Z7GA 4BBFA 1E9HA 5CU6A 3RP9A 1ZYCA 4O84A 2O8YA 3DFAA 1W8CA 4ZJJA 5A4QA 5LWNA 5AV0A 2Y4IB 4YJPA 4ZXTA 4IWPA 5FGKA 4XG9A 3C13A 4A07A 3Q4UA 4WT6A 3RALA 2DWBA 4I4EA 5TF9A 4Z7HA 2QI8A 5HNBA 3HP2A 4G6OA 1PXJA 3VBWA 3ZEPA 4MNEB 4F7NA 2XNEA 5EHOA 2GNHA 2PUNA 5ANJA 3TT0A 4K33A 3EFWA 2C0OA 3JY0A 5EW3A 4KUJA 4AW5A 4BDEA 5K5NA 3NUAA 5CT7A 4N0SA 5I9UA 3TDWA 3UDZA 5FXSA 2Y8OA 3DAEA 3Q9YA 4FKJA 1IA8A 4JR3A 3AOXA 4BIDA 3BE2A 4MEDA 2XZSA 3FMLA 3ZLXA 3ZZEA 4ANQA 5F9EA 3SXRA 3KULA 2HXLA 2BPMA 3NRMA 3O17A 5AP2A 5LCKA 2OH0E 1NA7A 2R3HA 3POZA 3RPOA 4GU9A 3UQCA 4JBVA 3ZU7A 1YDSE 2Z7RA 4FSWA 4PTGA 4L46A 5IQIA 3GP0A 1MUOA 3KGAA 4QMLA 1JKTA 3NYXA 4MYGA 4IJ9A 4QYYA 3PJCA 4NFMA 3HV4A 3AKKA 3KRLA 5DH3A 4LI5A 3QGYA 5HG9A 3PSCA 3PXKA 2FSLX 1GZKA 1KOAA 3KVXA 2R5TA 4AXCA 5FD2A 1FOTA 2IPXA 2P2IA 2VWVA 2VZ6A 2Z60A 3L8VA 4I41A 4QP3A 3P7AA 1XBAA 2F57A 1F0QA 2FGIA 2RG6A 2XIYA 5L3AA 4Z9LA 2JEDA 5HQ0A 5ACKA 3VJOA 2UW4A 1W0XC 4QMOA 2WD1A 4I0TA 4LV8A 2WTDA 2OICA 3PE2A 2ZVAA 5DR6A 1HCKA 4IAKA 2R7BA 3FQSA 3DK6A 3WIKA 3N51A 3Q04A 2X6DA 2UVZA 3O96A 2X8EA 4AE6A 3ZLWA 1RDQE 3RAHA 4FOCA 4TYEA 3TNIA 4MAOA 2HZ0A 3ZOSA 4NM3A 3SHEA 4PY1A 4U97A 3VUIA 2HY81 4OUCA 4QMMA 4BBEA 4XJ0A 5C9CA 3F66A 3OXIA 4ACDA 2JITA 4G9RA 2WQBA 4DHIB 4EOJA 1U5RA 3LW0A 4GS6A 4FSRA 4L43A 4MCVA 4P5QA 4IB0A 4XLIA 5AP4A 4BI2A 3PP1A 3SOCA 1YQJA 3BLRA 1CMKE 3V04A 2QOQA 3SD0A 4DGGA 4CV9A 1OECA 3MS9A 2C6IA 3D94A 4K2RA 4PUZA 2DYLA 3CD3A 4USFA 4RQKA 5EKOA 4QQJA 2W1DA 4S33A 2XK9A 4E20A 2R4BA 1Q3WA 3VQHA 3ZFMA 1OKVA 4DH1A 1Y8GA 1H07A 2ITTA 3KCFA 3KN5A 3TEIA 4DA5A 4EK4A 3HKOA 4NM7A 3QCYA 3CKXA 2AUHA 2CLQA 5DT3A 5L8LA 3P5JC 4DDIA 4CEGA 1M52A 2VO6A 3C50A 1V1KA 4FL1A 4NT4A 4R77A 4QMYA 1Y8YA 2GNJA 2O65A 2VAGA 2GHMA 4KABA 4M68A 2QOLA 5IQBA 3TZ8A 3W0OA 4Q2AA 3S0OA 5J9LA 2YIRA 3I6WA 3C4CA 4MTAA 4DEHA 2R2PA 3MFRA 2UZVA 4ZAUA 4G17A 4K0YA 1UU9A 3DAKA 2C6MA 3PDTA 3PUPA 4LRJA 5FXQA 3PVWA 2BALA 2OWBA 3JPVA 3MSSA 4APPA 2PMIA 4AT3A 5F94A 3DZQA 3LQ3A 4NK9A 5A6NA 4ITJA 3CJFA 4E6DA 3PIXA 3RAWA 3H10A 1VJYA 3HZTA 2B9JA 3UOHA 4FKWA 5EH0A 2Q83A 2V22A 3DXNA 3RM7A 3GC7A 3KRWA 2W17A 3A7JA 1SNXA 2R3LA 2G2HA 4FR4A 4DHZA 3AC4A 5BVFA 3IDPA 3VW6A 4U7ZA 4Q5EA 2VTSA 3CY2A 2VV9A 4RWIA 4TYJA 4DTKA 5E8XA 5IMXA 3W2RA 4J71A 5FTQA 4XV9A 4MXXA 2E9VA 3H30A 2ZV8A 3COKA 3QTSA 2JKQA 4KRDA 4RC4A 3WI6A 3BKBA 1A06A 4BI1A 4M0ZA 2CN8A 5HNIX 2B7AA 4U3YA 3Q4TA 2QLUA 3U87A 3M1SA 3OMVA 3OOMA 4XX9A 5IQEA 5HO7A 2OK1A 4L52A 4FKPA 2YITA 1ST4A 1KUTA 3LLTA 2XS0A 2GMXA 4CFFA 4QOXA 1JQHA 5KMNA 2OJGA 5HX8A 3N4UA 1G8AA 2UW9A 4MD9E 4KKGA 4X2JA 4AF3A 4O91A 4CKIA 3QRJA 3EFLA 2WU6A 5IA2A 1R39A 4EOQA 4C2WA 4U41A 3AT3A 1OL5A 3UODA 3CGOA 3S4QA 4DGMA 4L53A 5I4NA 4YZ9A 5CAUA 4HYHA 2PVHA 3RINA 4YNEA 3UBDA 4I0RA 3G33A 5A14A 4XH6A 2CNUA 3R2BA 4EONA 2QU5A 4XHKB 2GQGA 2YIWA 3DDQA 3NUXA 5E4HA 4A9YA 2XYUA 2QOCA 5LARA 4RBLA 3HV7A 5ETFA 1O6YA 3TM0A 2IVTA 3TZ7A 1GZNA 4JG7A 2HW7A 3CLYA 4NKSA 3LFEA 3I60A 3F3UA 2YAKA 3F69A 4HVGA 3R7YA 2ZDTA 2OXYA 5EYDA 4U9AA 3FLWA 3DXQA 2ZMCA 1H0WA 4FE2A 3UIUA 3ZYAA 3DY7A 5I9YA 5FDXA 4AZEA 3U6IA 4FIEA 5FTGA 4EJ7A 5DYJA 2WTCA 2J0KA 3W0PA 4GH2A 4XV1A 1ZYSA 5EYCA 5JQ8A 3LFQA 3ATSA 3LCSA 4IWOA 3C4WA 2R3JA 4ZY6A 4C37A 5CXZA 4WOVA 4XBRA 3W1FA 3O8PA 3OWPA 1PXNA 5DR9A 1JKLA 4F9WA 1P5EA 1GZOA 1Q97A 2WMXA 3LMGA 4EKLA 1XBCA 3V5TA 5IEVA 4OTDA 5CEIA 3VS1A 4FK3A 3W8QA 5HLNA 3CCNA 1JLUE 2JDOA 2VWBA 4BCHA 4J96A 5M06A 3ZM4A 3CQWA 2B9HA 3HDNA 4S2ZA 4D0XA 4I94A 5J7HA 2RFNA 2CGUA 1OB3A 2SRCA 3GFWA 1NXKA 2E9PA 5DBXA 2BDJA 5EDPA 4OTHA 3W2QA 2OKRA 4ZMFA 4EZ3A 1YXSA 5AIKA 3HEGA 2PULA 5EI6A 2ACXA 5FLFA 5H9BA 5B2KA 5JK3A 4FV2A 3QUDA 4C4JA 4P4CA 2GHGA 3F5UA 3ET7A 4DEBA 4H58A 3GB2A 3PIZA 4JX3A 2R7IA 1Q62A 4R7BA 4ZK5A 5FP5A 2PYWA 4BCOA 4LV7A 3LM5A 4I0SA 2F7EE 4AGCA 4RIXA 4IWDA 4DYMA 2BMCA 4R1YA 3VHEA 3ORKA 1Q99A 4FYNA 4FSQA 5DA3A 3W0NA 4QQTA 1WVXA 4FTKA 2X2KA 3D5XA 5LVOA 4TRLA 3R8UA 4ENXA 1Y6BA 4G34A 4DEIA 2VWWA 3FKOA 3KXMA 1P14A 3G2FA 3PXQA 4RSSA 4QTBA 4PTCA 4XYFA 2Y0AA 2O63A 3IO7A 1PJKA 5DI1A 2C0TA 4UWCA 3GI3A 4B6LA 1UWJA 2W1GA 3BHTA 3Q52A 5T68A 5IH5A 4MBIA 5D41A 5D7VA 3A99A 3W0SA 4FEXA 2C47A 3NX8A 2A19B 2OXDA 2UVYA 2XVDA 4YZCA 3BV3A 3V6RA 3DU8A 4ZOGA 3FPQA 5A4EA 2XKEA 4AE9A 5AX9A 4DLJA 4XRJA 4H1MA 2WTIA 4DC2A 2BHEA 4CZUA 1Q8YA 2VTRA 4FGBA 5H2UA 3W55A 3UZPA 2JD5A 3MH3A 5M4CA 2C5YA 4Q9SA 2YCSA 3S2PA 4GUEA 1ZZLA 2AC3A 3RK7A 4D4VA 3BIZA 2UZBA 1U54A 4NJDA 1XHAA 3FZ1A 5DVRA 3VS4A 1YOJA 5J1WA 2OO8X 3CQUA 3W16A 4FMQA 3ZDUA 2QODA 3NW7A 3BBTB 5CWZA 1QPDA 3HECA 5DFPA 3AMAA 4A4OA 4BBMA 3B8QA 2DQ7X 3P86A 2A2AA 2RFEA 3M42A 5CI7A 5CVFA 3WIGA 2NP8A 4KD1A 3QZGA 3W10A 4PMSA 4YGAA 3ZXTA 4C61A 2X8IA 5EHLA 5HG7A 3SOAA 2QOBA 4X2FA 4AFJA 5L2TA 4IWQA 4JBPA 3OXZA 4MKCA 4TNDA 4RIWB 4ZTMA 4HVSA 3ORPA 3ZUUA 4G3FA 4AN3A 5L2IA 4FSZA 3HUCA 2XK3A 4N70A 4UY9A 5IU2A 4BDKA 1QMZA 4CXAA 2OZAB 1PHKA 2XAOA 4FEUA 4L42A 5ETIA 1BUHA 2F49A 5KMJA 4RJ6A 2YCRA 1GIJA 2IW9A 5ANDA 4EUTA 3NUUA 4DEEA 1WCCA 5IH6A 1ZY5A 3WF5A 2WGJA 4ANMA 3CQEA 5I9WA 1FMKA 2YERA 3JY9A 3NEWA 4OR5A 5EKNA 3QC9A 3DK7A 3Q9WA 5EM5A 4L7FA 4DH3A 4KSQA 4BRXA 2PMLX 1XH8A 5I0BA 4HGTA 1STCE 3VN9A 3VRYA 3ZO2A 3E63A 5CANA 3QC4A 3R21A 3Q4CA 3VO3A 4G6NA 4DEDA 3DXPA 1IA9A 2YCQA 5M55A 4CD0A 2W1HA 1VYZA 3FMJA 4RJ8A 4YJSA 4AX8A 4ZLZA 1JSUA 1VEBA 1PYXA 2YZAA 2BRHA 4Y5QA 1SMHA 4NU1A 2XBAA 4EC8A 2C3IB 4QMXA 2W7XA 3EZVA 4F9YA 3RMFA 5BMMA 2E9NA 5M56A 2CPKE 2W5BA 1J3HA 2IZSA 3GOPA 3L9MA 2PE2A 4H3PA 4CV8A 3Q5IA 4D4SA 4D9TA 2WMRA 5E8UA 4GG5A 3TV4A 3A7HA 2YN8A 3EQGA 4G9CA 2EXMA 3SW4A 4QO9A 1CKPA 5AP0A 5F20A 2WOTA 3RNYA 3PLAE 5CSPA 2J0IA 2BCJA 2J6MA 5B2MA 2W1CA 3FMDA 3ZUVA 4F6WA 2Y7JA 2X0GA 2C3LA 5KHWA 3R04A 4F6SA 2BRMA 2VTNA 2CNVA 4G16A 4CT2A 4S32A 2A27A 1OKYA 2UW6A 3QYZA 4ZSEA 4LYNA 3Q53A 1AQ1A 2YACA 3AKLA 3CKWA 4BF2A 4JQ8A 3GOKA 4YTIA 1M2QA 4KA3A 4BTFA 5BVEA 3P78A 5TT7A 5FEQA 4QP4A 4WNMA 3JYAA 4HYSA 4MD7E 4Y46A 2JAVA 4XG4A 2O64A 1ST0A 4IAYA 3DGKA 5M4IA 2AYPA 3GFEA 3TKUA 4EK5A 1L8TA 5LVNA 3ANRA 1QL6A 3PJ8A 4RIYA 4G3DA 2XK7A 4L3PA 4L67A 3GEQA 3AMYA 4B0GA 4V05A 2PVNA 3RK5A 4DH5A 1URCA 4J1RA 3V3VA 5M51A 5HZNA 1OKZA 2ZFYA 4FZ6A 5TR6A 3UYSA 3R83A 3ZHPC 2XF0A 1WAKA 4YZBA 5AA9A 3F2AA 2W9ZB 5IISA 4JRNA 3TJCA 1K2PA 1YWRA 2HWPA 3OWLA 3MV5A 1FQ1B 3OWKA 3WE8A 3OEZA 4F6UA 3O7LD 3PLSA 2B0QA 4FOBA 5BUEA 4IACA 3I5ZA 4DFYA 3OW4A 2QLQA 1JNKA 3TL8A 2YM7A 4J8MA 1OZ1A 4X6QC 2H8HA 3GENA 4LFIA 3NW5A 4FV1A 4M67A 2QQ7A 3BBWA 3NGAA 4R7HA 4YHFA 4U79A 3V8WA 3V01A 4ZZMA 3CR0A 4NCTA 3OY1A 4ACMA 2GS2A 1OIQA 3KXHA 3NMUF 4A9SA 3WZUA 5CXHA 4JG8A 3ZSHA 3D7TA 3WYYA 2FH9A 1GIHA 1PW2A 5IQCA 5IA4A 3TV7A 4HOKA 5C8KA 3BHYA 3TTJA 4E6QA 4EQUA 4UBAA 3QCQA 4O7LA 4FKUA 3VQUA 5DRBA 5I5ZA 5CQWA 2C6DA 4AXDA 4UV0A 4II5A 4V0GB 3R8LA 4HVDA 3HRCA 1H1PA 1OIYA 2VTJA 4FIJA 4O0RA 4BHNA 2PZ5A 3LIJA 4I5MA 3UC4A 3CJGA 3P23A 4LV5A 4F70A 2XM9A 1DM2A 2R3GA 3QGWA 4BY9E 4FBXA 2ITUA 4R3CA 4I24A 3A7FA 4CLIA 5HTBA 3QTWA 3UNJA 5JRSA 4JX7A 2HY0A