4LV7A

Crystal structure of inositol 1,3,4,5,6-pentakisphosphate 2-kinase e82c/s142c
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
390
Chain Sequence
MILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRSVLTSDEQHLWRENNELISSPNKCVLEQRYVQNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDCALILNDHSLFDCISVEIKPKCGFLPTSRFIGKENILKTSVSRFKMHQLLKLEYIEISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPICSLHALPLDESLKIVKEYLIAATAKDCSIMISFQYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol-pentakisphosphate 2-kinase
publication title Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 122
structure length 390
sequence length 435
chains with identical sequence B
ec nomenclature ec 2.7.1.158: Inositol-pentakisphosphate 2-kinase.
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06090 Ins_P5_2-kin Inositol-pentakisphosphate 2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.110 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4lv7A01
2XAOA 4AQKA 2XANA 2XAMA 4AXEA 2XALA 3UDTA 3UDZA 2XARA 3UDSA 4AXDA 4AXCA 4AXFA 4LV7A
chains in the Genus database with same CATH superfamily
4F7NA 2PMNX 3QUDA 3MH3A 4NCTC 4CFMA 4JG8A 4QQJA 3PXFA 1Z57A 1PXNA 3RK7A 2A27A 2JIIA 3CTHA 4FUYA 4NM0A 4S2ZA 4DHZA 3OBJA 5IISA 3QA0A 4FV2A 1GIHA 2X81A 5HEZA 4O0UA 4X0MA 2ITVA 4D0XA 4DYMA 3KU2A 2LGCA 1G8JA 2ZM4A 4GU9A 2BDJA 4CCUA 4JQ8A 4A9UA 2VTSA 2QI8A 4ZP5A 2OZOA 4ZY5A 4FSZA 2W7XA 4W4WA 4ZLZA 2WD1A 4TPTA 3II5A 2PPQA 3CY2A 2PTKA 4YZBA 3BU5A 3LFAA 5EYMA 3OUKA 3UYTA 1R78A 4V0GB 4ASXA 3LIJA 3NFGB 4D2RA 3DJ5A 3FKLA 3Q53A 4RX9A 2JIVA 3TKHA 4Z7HA 2BPMA 3D94A 3FUPA 3WF5A 3BX5A 4CFXA 1Y57A 4CQEA 1UU7A 3LLAA 4WD5A 3QCQA 3GT8A 2PMOX 3T9TA 4D5HA 1PMVA 2VX1A 2FGIA 5AP3A 4EK3A 2YCFA 1YKRA 1B39A 1BKXA 2YDKA 4F09A 3G15A 3EN7A 4ZMEA 1L8TA 4ZMFA 3OY1A 3HAMA 2JD5A 3RPOA 3EQPA 5L2WA 4JIKA 4YU2A 3A8WA 4X2JA 5BX0A 5AEPA 1UNLA 4TWOA 1JVPP 4LOQA 2VTOA 5J9LA 2RF9A 4J97A 3NAXA 3KRJA 4FGBA 3FZPA 5FUTA 3C4EA 2GS6A 2XK8A 5CQUA 2WMQA 2XZSA 4CFNA 5KUPA 3HV6A 3VW6A 3K2LA 4AZSA 2YACA 4GL9A 5CU4A 4W8EA 3LQ3A 2OIQA 4RJ8A 2J0MB 2HWPA 3E8EA 3IGGA 1ND4A 4BYIA 3GOKA 3MBLA 4YZMA 4I5PA 2G15A 5ACBC 2J9MA 2GS7A 4WIHA 4EOOA 1YI4A 4I3ZA 5J5SA 3F3WA 3OP5A 4FVQA 4FL3A 3AC4A 4FE2A 2OG8A 3SAYA 1H24A 4J95A 2HIWA 4IW0A 3U55A 4B7TA 4ACDA 2HW6A 1ST4A 4GG5A 4EHEA 3MTFA 5DIAA 3D83A 3GCVA 3O8PA 3OHTA 4BGHA 3QKMA 3E7VA 4UV0A 3F5GA 4XG9A 4AT4A 4AX8A 1RDQE 4AUAA 1YDTE 4WG5A 4BDJA 2JKMA 2QOIA 4PTCA 5CXZA 2VAGA 3SX9A 5HLNA 3RPYA 4RA4A 2FSMX 3U6IA 1STCE 2XVDA 3DBQA 2VO0A 4L7FA 3R9HA 4CNHA 3TUCA 4IE9A 5DHJA 3G9NA 3OEFX 4XV2A 3UDTA 4WA9A 4BCMA 3VUHA 4NIFB 2X7GA 2C6LA 3EFLA 4R5SA 3TACA 4IM2A 5E90A 4EZ3A 4WNMA 4FIGA 3EB0A 2KTYA 3LFFA 3EQHA 2EU9A 4KABA 3I6UA 3QKKA 2OFVA 1GZNA 2YJSA 3F61A 4EKLA 5E8WA 3UO5A 2QKWB 3GGFA 4BCGA 4MQ2A 1OI9A 2BKZA 5AMNA 1V0BA 4GT4A 4HNIA 5E92A 4QO9A 4FBXA 4FG8A 3ORXA 5JGAA 3FQSA 3FSKA 3QRIA 4UBAA 5D12A 5FBNC 4MCVA 5CQWA 5BNJA 4FIEA 3OWLA 4FTQA 5E8VA 4QTAA 4ZLYA 3AG9A 2Y4PA 2DUVA 2QO2A 3BYOA 3R30A 2VTAA 4XOYA 4ZK5A 1OIQA 4L3PA 2C1BA 3W33A 4W4VA 5K4IA 4EQUA 5DN3A 3EJ1A 1YDRE 4A07A 4IDVA 1H0VA 1ZZ2A 2HK5A 2JGZA 2VWXA 1OBGA 1JSTA 3TZMA 4JBQA 3E63A 2R5TA 1XHAA 4JT3A 4YHTA 4ZJJA 3UIUA 4AXAA 4WBOA 2H96A 3HMMA 1RJBA 4DG0E 1M7QA 2IZRA 3RTPA 2BTSA 3UVPA 4IJ9A 4DCEA 3MB6A 2J50A 1P14A 3PY3A 2OIBA 3ENHA 3R02A 5I9UA 3QUPA 3KQ7A 4IB5A 4YTHA 1PY5A 4O6EA 5CTPA 3MFTA 3V5PA 4DG3E 4MH7A 5DR6A 3MJ2A 4M97A 2OF4A 4H05A 2RIOA 5FLFA 3COIA 5JGBA 1UA2A 3MW1A 5AM7A 3QYZA 4CG9A 4MXXA 4FOCA 4NKAA 4W4YA 3F5PA 1IA8A 4JAIA 4LQMA 1JBPE 4CZTA 3O8TA 3F88A 3E8CA 4D1XA 3PG3A 3QD3A 2EB2A 3COKA 2UW9A 5HKMA 4FKUA 4E26A 4BGGA 5FG8A 4FTMA 5EM6A 1OZ1A 3KREA 3U9CA 3ORLA 4FZFB 5AUWA 4U42A 4EHZA 3QX2A 1MUOA 2CLQA 5M06A 4QTDA 2JKQA 5GIPE 4GT5A 3UODA 1NA7A 2XS0A 3DS6A 3OROA 4D5KA 4F65A 4BDGA 4JBPA 4O7YA 4ZZOA 2YCQA 4RVKA 3BBWA 1FGIA 3U54A 4OLIA 4L3JA 4M68A 4O27B 3QTUA 4ENYA 1Q99A 3HV4A 3G51A 4PF4A 4DN5A 3PJ2A 2ZFYA 3ULZA 2BFYA 5JQ8A 5CT7A 2CCIA 5BPYA 2C6MA 2WQEA 4FZDB 3MTLA 4V05A 4TYHB 3WE8A 4CFWA 4RIXB 3ZO2A 4L01A 1YHVA 2WB8A 4AXCA 2BVAA 4F99A 2P0CA 3RHKA 2XM9A 3VQHA 4AP7A 4WNOA 4DH5A 2R3HA 5CSPA 3NAYA 4UXLA 5B0XA 3QRUA 2VTPA 5H8GA 2OF2A 3AQVA 4FG9A 4ALVA 3MA6A 3RWPA 5LVLA 1Z5MA 1E9HA 2OFUA 4K0YA 3M2WA 5FXQA 2UW4A 2PZIA 1H1RA 4FTJA 4ZEGA 4R3RA 3ATSA 2GNGA 3P08A 4XP2A 5DT3A 4AWIA 4FZ7A 3MB7A 1OUYA 4RJ3A 3JR1A 3AC1A 1IA9A 4MKCA 4B8MA 3CGFA 4WG3A 4U8ZA 2RG6A 4JQEA 4Q9ZA 2YERA 3GENA 4G5JA 5M55A 3FMMA 1XR1A 3R63A 4KBAA 4XBRA 3S95A 4EOIA 3DU8A 3V51A 1ZY4A 4C4IA 4HZRA 4D9TA 4DEBA 4XBUA 2ZV2A 3C4WA 3OBGA 1Q8YA 2B9HA 3IECA 4YJPA 1H28A 3PP0A 1QPDA 4Y5QA 3UZPA 3BYVA 4FT5A 1JKKA 2BHEA 2OZAB 4I21A 3QX4A 4DBXA 4E4NA 1KSWA 2PU8A 4F0IA 2HY0A 3NUUA 2JDSA 2YM8A 3GU8A 5KO1A 3IW7A 4AE6A 4BZNA 3P78A 2IW9A 4EZ7A 3PG1A 4FL2A 3ULIA 4MNEA 4D0WA 2Q0NA 2VWUA 4G3FA 5C8KA 5JFSA 3FV8A 3VS0A 4DHIB 5AP6A 4I6QA 1E1XA 1TFFA 4HOKA 3R9NA 4UXQA 2XIKA 1OIRA 3FI2A 4QMLA 3AKKA 3RZBA 3VRZA 2X6DA 4BDFA 3QQGA 4FNWA 4YJVA 3KF4A 2VZ6A 4Q2AA 4FG7A 4TN6A 4ALUA 4C62A 1Q97A 2C47A 3FEGA 4BCHA 5CU3A 2BROA 4ASZA 4ZTNA 2C6KA 4E5AX 4C59A 3REPA 2FB8A 5LCJA 5HORA 5CT0A 5EW8A 3VO3A 3L9LA 1M2QA 3UBDA 2JDRA 4DEGA 4EQMA 3F2RA 2OJGA 3UC4A 1FOTA 4FKVA 2ZB0A 4O7WA 5JK3A 3GFEA 3FQHA 3C51A 4EJ7A 4QMMA 4FT9A 2YIWA 4YSMA 3NUAA 4IADA 2YN8A 4N57A 2PWLA 5FGKA 2A1AB 2PVFA 4H1MA 2P2IA 4AZVA 1WVWA 2UVXA 2J0KA 4I93A 1S9JA 5TO8A 4MBJA 3QXPA 2ITZA 4NJ3A 4Y83A 5A54A 4CVAA 3LAUA 4O7RA 4XNEA 3HAVA 5HX8A 3PVWA 4QTEA 3BYMA 4BDEA 5CS6A 2IW8A 2UZWE 4BICA 3ZYAA 4RIOA 2FUMA 4XH6A 4C3RA 2CKOA 5EHLA 4DLIA 4FSWA 3V5QA 3MA3A 3EN5A 2F49A 2YM5A 1APME 2VGPA 1G5SA 3BWJA 3OEZA 4QT1A 3IDBA 4V0GA 4F9WA 1BL7A 4HCVA 2QURA 4LRMA 2FH9A 2F57A 3GNIB 4HYSA 5HBEA 3CTQA 4G3GA 4BCJA 5CEMA 4AGCA 2PL0A 3B2TA 4UB7A 1ZXEA 3GXLA 3R83A 5AAGA 3Q6UA 3GQLA 5LMBA 4I1ZA 2VTIA 3H9FA 2C4GA 4BIEA 3UPXA 1XKKA 2ITUA 3ELJA 1BX6A 3IQ7A 4HCUA 2QO9A 5CEPA 4FT7A 3NX8A 3RM7A 3QC4A 1YI3A 3ZCLA 4TRLA 2ZV9A 3LMHA 4ACMA 2QKRA 3NCZA 4B99A 4KWPA 4BZOA 1ZOGA 3PJ1A 3QTZA 4N6YA 1FMKA 4CZUA 2R64A 2W1IA 4J98A 3Q9ZA 4ERKA 4IZYA 3BWFA 4ACHA 1DAWA 4MD8E 3ZO3A 1UV5A 3SLSA 4PUZA 4DTAA 5KKRB 3L9NA 3HMNA 3R04A 3RKBA 3UPZA 4IC8A 4FV6A 2J0LA 3UG2A 3O51A 2WOTA 3OZ6A 1ZMUA 4XV9A 1B6CB 3VULA 4Y46A 3PIYA 1YXXA 4KINA 3UMXA 4JRVA 3KKVA 3ZFMA 4D4SA 1K2PA 1F0QA 2PZPA 3BRBA 4XOZA 4BJJA 3GC0A 1MQBA 3A61A 3TV7A 4CKRA 2AEGA 3QA8A 4P7EA 5HVJA 3RPSA 1A9UA 3R6XA 1RE8A 2EVAA 2PVYA 3GP0A 3TNQB 5CEOA 2GS2A 3FYKX 3DFCB 4LYNA 3Q52A 3D2IA 5DPVA 4RVMA 1OUKA 2V55A 4DGGA 5E8YA 1L3RE 4BTJA 5L8LA 3PZEA 4I0SA 5ANEA 3E88A 1Q3DA 3BELA 2UZBA 4RFMA 3EKNA 1FQ1B 1XMLA 3AOXA 3LFQA 4G34A 1H1WA 3Q4UA 4EH2A 4YHJA 2QVSE 3UJGA 4CXAA 1YXTA 4BGQA 2CN5A 3H3CA 3UVRA 3ZZWA 2OIDA 3QRJA 2G01A 1PXKA 1G8KA 4JX3A 5JFXA 2XF0A 3JY0A 2XA4A 1JSVA 1WAKA 3VNTA 3UOHA 3RNYA 3OS3A 5LVMA 2F7EE 5HLPA 3F5UA 2VTNA 5C8MA 2YEXA 3P1AA 3EKKA 3R28A 3NVMB 2XAOA 3DDPA 5AUXA 4RMZA 3R8VA 4M12A 3ZBXA 4IH8A 5JQ5A 1WBVA 3GU4A 3U6JA 3VF8A 3MH0A 4XCUA 1FVRA 3H10A 2QOKA 3W2SA 3KXMA 4C3PA 2XK6A 4QPAA 2G2FA 5AV2A 3FMJA 4O2PA 5JRQA 1ZYDA 5HX6A 4QQ5A 2RFSA 3C1XA 3R7VA 4IHPA 2XNBA 1OKWA 2B4SB 4P5QA 5HHWA 3H30A 4EK8A 3W0PA 4F08A 3VBVA 4RJ5A 3EFJA 3DY7A 2J4ZA 3A7IA 2ZJWA 3DBDA 4GFMA 3AT4A 4AOIA 3OW4A 3WZKA 3MY0A 2CCHA 1P4FA 5CVHA 5EK7A 3RHXA 4KIQA 3D7TB 5J1WA 4YUQA 4OTDA 4AN3A 2P55A 4CTCA 4YLLA 4DCAA 5CENA 3ZM4A 4RWJA 4BBMA 2R3KA 3LMIA 3R1YA 4HGLA 2ZVAA 2CKEA 4JBOA 1H1SA 2WEVA 4I6HA 5BMMA 4AGUA 2REIA 4O0VA 2CLXA 4QMQA 4EOSA 3H0ZA 4F7SA 2R7BA 4AQCA 4UZDA 1TKIA 5CAVA 4BTFA 2OBJA 3F7ZA 2W4JA 4NW6A 1H0WA 2XBJA 3I4BA 3PA4A 5HNGA 3QTQA 4EH7A 5HTCA 2EXMA 4IWOA 4I4EA 4EEVA 4I94A 2BFXA 3TMOA 1WBOA 4CFUA 2QHMA 4GCJA 4QYHA 1K9AA 3WF6A 1G8SA 5LCKA 1YHSA 3U9NA 2O8YA 3G6HA 3FMHA 3K5UA 3FLNC 4PTEA 4R3CA 4YNEA 3Q6WA 2CGWA 4F7JA 3LXPA 4FMQA 4DINA 2XNOA 3R2YA 4QP2A 3ZDUA 4XRLA 4F1TA 4BF2A 3HMPA 5DI1A 1XH9A 3D5UA 2GNFA 1FPUA 2W05A 4HZSA 5AAFA 4JMQA 1ZMVA 1K3AA 3VUDA 2GNJA 3IOKA 3JS2A 3QQFA 4MK0A 3I60A 5EKOA 1KWPA 2VU3A 3QZGA 3QZIA 2UZVA 3SDJA 3NWWA 2E9VA 4M3QA 5HU9A 3MVJA 1XH4A 4CKJA 3LHJA 3PSDA 4KS8A 3BLQA 1SM2A 3DLSA 4C35A 5FXRA 5CSWA 5K5XA 4XS2A 2VNWA 2C5YA 3E3BX 5F95A 3D9VA 2F7ZE 2GMXA 3PXRA 1OITA 3VF9A 4U7ZA 3DCVA 4YTCA 4EBVA 2SRCA 3CD3A 3UE4A 3R73A 3LXKA 4DFUA 3S3IA 3ZMMA 1P2AA 4DGNA 2HYYA 4IAIA 4DFYA 5IPJA 3DTWA 4G6OA 4QYFA 4AXDA 4J71A 5FDXA 1AQ1A 4OTIA 1ZZLA 3W2CA 3QGYA 4ZTQA 3R9DA 5BYYA 1KUTA 1GZKA 3ZLXA 4IIRA 5L2IA 3FI3A 2YZAA 1OKZA 2ITXA 4G31A 4IEBA 5ANIA 3MH2A 3GBZA 3SXFA 4GVJA 3OOMA 3ALNA 3TL8A 4RC4A 1UKIA 2ETRA 2CKQA 2YCSA 3LXLA 3HVCA 4KNBA 4EH6A 2NP8A 2YA9A 3VN9A 5GINE 1YWRA 2JBPA 5AX3A 2R3NA 5M09A 5AFVA 4L45A 4U97A 4O86A 4X2NA 3ZU7A 2HENA 4HGTA 2WIHA 3UP7A 5CLPA 2BCJA 4GFGA 1YI6A 4YO6A 4H3QA 2IG7A 3P86A 5D41A 2R7IA 3PXZA 1U59A 4ZSJA 1M17A 3BL9A 4E8AA 4G17A 3HUCA 4EH9A 5KMKA 3DTCA 2BRGA 3CS9A 1DI8A 4CRSA 1JNKA 2OZAA 4XG4A 3VAPA 3ZH8A 4AT5A 4EL9A 5L6OA 3C13A 2BZIB 4RT7A 3FQEA 4BI2A 3MY5A 4O0WA 1PMEA 3DXPA 4YTIA 3IDCA 4GU6A 5CZHA 4AZFA 4E6CA 4FSMA 2J0IA 3N4VA 1H8FA 1YWVA 4E4XA 4RIYA 3GI3A 5HVYA 3FJQE 3KXNA 1JPAA 3QGWA 4JDIA 4NCTA 5I9WA 3GVUA 3HX4A 3KXZA 3QBNA 3PY0A 3FZRA 4U80A 5M08A 2BRBA 4WG4A 5M4CA 5JKGA 4XJ0A 2X1NA 4WNKA 4RX5A 2IVSA 3RCDA 2PVRA 4I92A 3JVRA 1M2RA 2DS1A 4MYGA 3D5WA 3BYUA 4S33A 3L9PA 4QNYA 2V62A 4MWHA 4IFGA 4QP6A 3RAKA 3ZOSA 1WBNA 4AZEA 5CSXA 3TNPC 4TW9A 3MWUA 2J5FA 3PVGA 2VNYA 2QNJA 3ZXZA 2XK3A 4TYIA 3UOKA 3NW6A 3KVWA 5K9IA 2HW7A 4JAJA 3UOLA 4F9CA 4F9BA 3RP9A 3VJNA 1DS5A 4GKIA 3RINA 2WFYA 4FV7A 1WZYA 4HVDA 3DZQA 2EXCX 4OBPA 5C8NA 4YZDA 3IOPA 3IGOA 3HA8A 4R78A 4YJQA 4AU8A 3EZRA 4C38A 3FKOA 5IQHA 3EMGA 3IW4A 3H0YA 4FUXA 5DGZA 3GC7A 5IA2A 4QMPA 2XANA 2KULA 1YXUA 3PJCA 3LCKA 2QODA 1JLUE 2QOHA 2X39A 1OKVA 5FDPA 2OICA 3U4WA 2XK4A 3LCDA 3BBTB 3GB2A 3DLZA 3EFKA 2YCRA 3IW6A 2GFSA 5C4LA 2IPXA 5TOZA 1ST0A 2O0UA 4EHGA 1OGYA 2WMBA 3P0MA 4RWKA 3DOGA 2QR7A 1CKJA 2PUPA 5CX9A 4MAOA 2Y7JA 3BIZA 1CSNA 3WZUA 3DDQA 4TYJA 1GNGA 2ZV8A 2GHLA 2VTJA 3LM5A 5EYDA 4O0TA 3EQRA 3FLSA 4BTKA 3R71A 4QMSA 2ZB1A 4QP1A 3LMGA 1Y8YA 3P5KA 5LARA 2E9UA 3TKIA 3UDBA 3A7HA 3VQUA 4HW7A 3L8PA 5F1ZA 1IAJA 4UALA 3GOPA 4CT2A 4BYJA 1FGKA 4QYYA 2GNHA 4K33A 4R3PA 5GHVA 4DTBA 2W1HA 4A9RA 1NY3A 3BHUA 4FSRA 3DKFA 3TKUA 1H27A 3LZBA 3NUXA 4FX3A 3U51A 3PLAE 5AAEA 3KMMA 4AXEA 2ITTA 4E4LA 3HLLA 5IQAA 2GQSA 4M14A 4AF3A 3EL8A 1UU3A 5E1SA 5BV3A 5LJJA 3DGKA 4AN2A 2XRUA 4BCIA 1Y6AA 2BDFA 4M13A 2BAKA 3PSBA 3EQIA 3DKGA 2JDVA 5HLWA 4DEDA 4IAYA 4CMUA 3PA3A 4O7ZA 3TJCA 4DGMA 3OWKA 4LI5A 1AD5A 1O6KA 3EH9A 1HCKA 5HGIA 4R6VA 4D4RA 4LV7A 3NW7A 3WZJA 4FA2A 5M57A 3PVBA 4PDSA 1JKTA 4GRBA 4M7IA 4Y85A 5B2KA 3D2KA 4BRXA 1GZ8A 4JDJA 4FR4A 4QTBA 4F7LA 4IANA 1FBNA 5JEBA 3WOWA 3PUFC 1KV2A 4IMYA 5KKRC 3QU0A 5FP6A 2GFCA 2WTWA 3O7LB 5TT7A 3A8XA 1XQZA 2E9OA 3MSSA 4L46A 4RLLA 1OL7A 5DFPA 4OBOA 3DBFA 3SRVB 3V3VA 3HV5A 2WQMA 3NUNA 5EOBA 3SHEA 2OGVA 3V5WA 2EWAA 1PHKA 4E20A 4UYAA 2B0QA 4I24A 5A3XA 2WNTA 3TNHA 3F9NA 3ODZX 4A4OA 2W06A 4MD7E 4XHKB 4CMTA 3ML1A 3E8NA 5EQYA 3VC4A 2UZNA 3QCYA 3HP2A 4YJOA 5ANJA 3CR0A 4G1WA 3W1FA 4B4LA 2VWBA 2XNEA 4PMTA 2Z60A 4PL4A 3WILA 4OTGA 3T3UA 4A9TA 2X2KA 3SXRA 4EOQA 2XJ0A 2PVJA 2X2LA 4FL1A 3DBCA 3A99A 2PSQA 4GMYA 4WKQA 3ROYA 4O7TA 3UMWA 3F6XA 3LW0A 4OUCA 4Z55A 3NVKI 1W84A 1M2PA 3LKMA 1QPJA 1TVOA 4LUDA 2XARA 3B2WA 3R7EA 3TDWA 5C4KA 1R0PA 3QL8A 2RGPA 2X4ZA 3GU7A 3Q96A 4PV0A 5CSHA 3MJ1A 2XKFA 3C50A 4LGHA 2OI4X 2R3IA 3DKCA 1I44A 3KMWA 5D1JA 2UV2A 3F3ZA 4BC6A 3M1SA 4RG0A 2WMVA 4U44A 1YWNA 4EORA 3D7TA 3V5LA 5CASA 5KBQA 5HE0A 5AUYA 5IA1A 1JSUA 3HMIA 4F64A 2JDOA 2PVLA 3SG9A 4F9YA 4PMSA 2UW8A 3ERKA 3A2CA 2A4LA 2C3LA 3EZVA 4FYOA 4H3BA 3VBWA 4G3CA 5KHWA 5HBJA 3ITZA 2P3GX 4GK3A 1QMZA 3GCSA 3THBA 4IX4A 2WIPA 4ARKA 1NW1A 3E5AA 2Q83A 2CN8A 3KULA 1XH6A 3O8UA 3CQUA 4QMOA 1QPEA 4IX3A 4BIDA 3OFMA 1XMMA 5CI7A 2NNWB 4L8MA 4WBBB 4EH3A 2WHBA 3MDYA 4EZ5A 2R3RA 4UN0C 5BMSA 3TV6A 3TNWA 3CY3A 3UIMA 4KIPA 4O84A 3PJ3A 4GS6A 3UNJA 3DJ7A 4FOBA 5CALA 5CANA 1ZARA 3OXZA 2IZSA 4Y8DA 3FY2A 4AAAA 5BVOA 1WBWA 2OXDA 5DG5A 1YVJA 3DBEA 3FMLA 2PE2A 4NFNA 2Y4IB 2GHMA 2R3OA 3MIAA 2I6LA 2P2HA 4TYGA 5AP1A 5AP4A 4RIWB 4MNFA 4IM0A 2W99B 1BI7A 1SNXA 3CBLA 4J99A 4QMXA 3TT0A 3V5TA 1W8CA 3QZHA 4TY1A 3MI9A 5TR6A 3LJ2A 2GSFA 5LMAA 3RM6A 3TJDA 5DOSA 1WBPA 3O71A 2VWVA 3N4TA 3ANRA 2I7QA 4GYGA 3DT1A 3R8UA 4C58A 4D1SA 3L8XA 3N4UA 2C0OA 4LV8A 4ANLA 1H26A 3EFWA 2V7OA 4YR8A 4GUEA 3PJ8A 4BHZA 4JL9A 3VBTA 2XKCA 2RFNA 4D2SA 3HEGA 2BZJA 3KRLA 4H58A 4TXCA 3HDNA 1XBAA 4C4EA 4IJPA 3K5VA 1W98A 2C6DA 3PDTA 4L53A 4JOAA 3HDMA 4FKOA 3KF7A 5AWMA 3MFUA 2XKEA 4LRJA 4O83A 3DPKA 3DAJA 1BMKA 1OVEA 4MXCA 2X8DA 4X21A 3R2BA 1WBSA 4MUQA 2RFEA 4ZXTA 3QHWA 3O17A 5E1EA 4II5A 4WNPA 2YAKA 3MY1A 4ACGA 3F7WA 4BCQA 3NNUA 1H1QA 4KS7A 5DRBA 5KHXA 3B8QA 3TIZA 5HTBA 4EWQA 3FLWA 4XUFA 5L2SA 4D4VA 1CMKE 3FLYA 4TZRA 3WYYA 2VTHA 2XYUA 5IQGA 5AP2A 2CHLA 5AV0A 3TDVA 3WIGA 4ZTRA 2E9NA 4TWNA 3TXOA 5BVWA 5M4FA 3PZHA 3CPBA 2CKPA 3TUBA 2YHVA 2BIYA 2YDIA 3C0IA 5ETCA 5HCXA 3W0RA 4O0YA 4LGGA 4UZHA 3ANQA 3CLYA 3KXGA 5JZJA 1V0OA 4N0SA 4N6ZA 4NWMA 3RJCA 1ZMWA 3BGZA 3DXQA 1SVGA 4FKQA 4FKWA 5KMLA 1LPUA 5TKDA 4FSQA 3VIDA 4LMUA 4NL0A 3R9RA 5ACKA 3TEIA 3PSCA 1M52A 2HZ4A 2WTIA 2IVVA 4FIJA 4IC7A 5DE2A 5AV1A 4Z7GA 2C5VA 2FO0A 2VO6A 3UQFA 5D9HA 1PXPA 1Q5KA 2X4FA 4YC8A 2F2CB 4E6QA 2B53A 3NUSA 1BL6A 4EC9A 3VW8A 4C0TA 1OB3A 4QYEA 3QXOA 4Y72A 2J6MA 3I7BA 3KL8A 4MBLA 1Q8ZA 4AGDA 3FMKA 4FNYA 3GCUA 3QF9A 4U0IA 2G2IA 4U3YA 2LAVA 3C4CA 3EIDA 5ICPA 4FTKA 5HG5A 3NIZA 4UWYA 4ZSAA 1CTPE 2VWWA 1XWSA 2OWBA 4QMZA 3COMA 2XAMA 4I6BA 4EK4A 4PP7A 2FSOX 4YZCA 2OK1A 3MYGA 1ERKA 4R1YA 1H4LA 2ONLC 2EB3A 2W5AA 2F2UA 4GK2A 1CM8A 5EQPA 2OU7A 2QCSA 3SV0A 2ZDTA 4WT6A 3ZRLA 5ETAA 3NS9A 3BHVA 2WAJA 1MRVA 1R0EA 3POOA 4PL5A 4HJOA 2NPQA 4HNFA 3RVGA 3VS5A 1W83A 3KFAA 4LDTA 4ZTLA 5IUHA 3QD4A 2IW6A 3A4OX 4FKRA 3FPQA 3DKOA 1LUFA 2VRXA 2WMTA 3W0SA 3CJGA 1R3CA 4YLJA 3OXTA 4FV1A 1IG1A 2WEIA 5CU2A 2VX0A 4A4XA 4EJNA 5IH5A 3AT3A 3CQEA 2JEDA 4FI1A 4JR3A 4TT7A 4CV8A 3PFYA 2NRUA 4IZ5A 5A4EA 1ZYLA 4TYEA 2GTNA 2ZM1A 4OBQA 5EI6A 3HUBA 3LFEA 2C5NA 4FV9A 3ZFYA 5IQFA 3PPZA 3PA5A 5DA3A 5IMEA 3BEGA 3NYVA 2C68A 3UO6A 4GIHA 3OCSA 1NVSA 4NTSA 2XB7A 5EFQA 3R7OA 5A9UA 3LQ8A 5LMKA 3R7IA 2UW0A 2QG7A 1QCFA 4U43A 5E4HA 5IU2A 3CTJA 3PXKA 3DAEA 4KBKA 3UZRA 4L00A 4I41A 1PF8A 3HL7A 4L7SA 4I20A 3MV5A 4AA4A 5HIDA 2BZKB 2C6OA 2WMSA 4BCFA 3WARA 2I1MA 3HV7A 3C9WA 1VEBA 3FMDA 2XNGA 2G9XA 2PZ5A 3QAME 4BHNA 3SQQA 3NNWA 3VHKA 4YSJA 5F9EA 2WMXA 3NW5A 1W7HA 4GKHA 3I0QA 4WOVA 3PXYA 4J7BA 4QP8A 5HCYA 5CEKA 4XG7A 4ZLOA 1J7UA 5AUUA 3S1HA 1TQPA 5FD2A 3UOJA 4ZIMA 4RX8A 3IKAA 4CFFA 1JKLA 1WBTA 5HG9A 3EQGA 4A06A 4CGAA 3G90X 3BGQA 3KXXA 1OL1A 4NYEA 4GFOA 4R5YA 1LEWA 1PW2A 3Q9YA 5M56A 4YNOA 2XH5A 3FAAA 2ZYBA 5JRSA 5LMKC 2RKUA 4FTIA 4M8TA 3FI4A 2I0HA 5DVRA 2PYWA 3D5VA 4FZ6A 4OT5A 2PVNA 3F2AA 4NKSA 1PXMA 5KBRA 3FLZA 3IPHA 3VS1A 4EOMA 2PVHA 1OGUA 5CAPA 3U8WA 3AD4A 3ZHPC 2VGOA 5AP5A 5A4TA 5A4CA 1TQIA 5CAOA 3WE4A 2Z7LA 3P5JC 3BV3A 3U87A 3K54A 3ZO4A 3ORTA 3ZSGA 1O6YA 2X8EA 2XNPA 2CDZA 3AC2A 4FTRA 3O23A 3V8SA 4HYUA 4KD1A 4GIIA 4F78A 2YWPA 2GQGA 4BI1A 1URCA 3QC9A 2WQNA 4XEYA 4BR3A 2FSTX 4FKIA 5JN2A 5EH0A 4S34A 4JXFA 3I81A 4M67A 4YO4A 4RFZA 1OPKA 4H3PA 3DJ6A 4S31A 2BMCA 5CU0A 2YAAA 3TUDA 5CF4A 5IA4A 1ZOHA 2XNMA 5H8BA 4EONA 3C4ZA 1H08A 4XG3A 3Q2JA 1ZYSA 2PK9A 3EN4A 4K1BA 4PX6A 2PUIA 4C2WA 3AMAA 4JJRA 3ZTXA 3UZTA 3QQKA 3CGOA 1KE9A 3ORKA 2UZOA 4HCTA 3JXWA 1BUHA 4DH8A 3OC1A 5JGDA 2WELA 3LFBA 5H2UA 3ZXTA 2XBAA 3VUMA 3RK9A 4FTNA 4JNWA 4L3LA 5J7HA 4FKSA 3UQGA 3ZRMA 1YQJA 3KC3A 4G16A 4JBVA 3RAIA 5CEQA 3EHAA 3ZEWA 1KOAA 3VJOA 4IAZA 5IQBA 3O5AA 2R3GA 5HICA 3Q32A 4RZWA 4QMNA 1WFCA 1WVXA 4K11A 3RMFA 2YJRA 2B7AA 5JFVA 5D7AA 3S4QA 4XV3A 2I0EA 5BYZA 4MTAA 5EDRA 1JKSA 5KNJA 3RK5A 3H9RA 1NXKA 2BR1A 4DEHA 1YOJA 4J53A 2YDJA 4YJTA 5L2TA 1SNUA 3QUEA 4JDKA 4O0RA 5FTGA 3OTVA 4C4HA 4MXOA 4L68A 3VRYA 3QD2B 4FK6A 3WF9A 1VZOA 2HXLA 2OKRA 5G1XA 1J7IA 1YXVA 4AGWA 4C33A 4DBNA 5CF5A 4U45A 3W0MA 2NO3A 3MESA 3QHRA 3QQLA 4WRSA 1OIUA 3W2RA 4DFZE 5I0BA 4QMVA 3OWJA 4MX9A 1GZOA 4FTLA 5K3YA 3KMUA 4MHAA 1H00A 4RJ4A 1U5RA 2ZMDA 4MEDA 4DGOA 3IDPA 5J1VA 5CF6A 2UW6A 3DB8A 5E8TA 5EOLA 4C4FA 4IB0A 4QQTA 2GQRA 5A46A 4EH4A 3FZOA 4AZWA 1YXSA 5J8IA 4A7CA 1XO2B 5AJQA 4ZJIA 4FV8A 5AP0A 5HI2A 3S2PA 4OTQA 4F6SA 5EDQA 4C37A 2J5EA 2I0VA 3TCPA 4U3ZA 2Z8CA 4J1RA 2VWIA 3KK8A 2UZUE 3ZONA 4AZTA 1VYZA 1SYKA 1PRYA 1T46A 2AC5A 2IZTA 4EUUA 2W5BA 4IWQA 4X6QC 2WPAA 2C3KA 2H9VA 4IZ7A 4O0XA 3TWJA 2XNNA 4RIWA 5IH4A 3PPJA 4MD9E 5EKNA 2J7TA 3BE9A 3KXHA 4BY9E 2PHKA 4WUAA 2W0JA 3R00A 3H4JA 5ANGA 4I5MA 1RW8A 3P9JA 4TTHB 3EYHA 5DEWA 3BKBA 4BCNA 4EOJA 5LVPA 4AAYA 3HA6A 4AOTA 3DAKA 2VTQA 1AGWA 3CP9A 4F63A 2Y6MA 3EQDA 3C5IA 5HE2A 1SZMA 2A2AA 4RBLA 2JLDA 2PVMA 4MF1A 4RC2A 3UYSA 2XIYA 4RC3A 2V0DA 4FGRA 3RCJA 5JFWA 1PYEA 2BIKB 4E5BA 3NRMA 4YJRA 3OCGA 4UWCA 4QOXA 4FTCA 4WSYA 4X2GA 5M4IA 4FEWA 1DM2A 2VWZA 3R1QA 3QTRA 3I6WA 3QQJA 4JG7A 5IG1A 4TYHA 2DYLA 4RIXA 4FTAA 4ASEA 1WMKA 2YIRA 4FIIA 5EHOA 3LLTA 4D28A 2C5OA 2YIQA 3PUPA 3P23A 3BHTA 3TNIA 4AA0A 2Y4IC 2JAMA 1F5QA 2F4JA 5L8JA 4RQKA 4FNZA 3ID6C 3W16A 4U9AA 3ZLYA 3KK9A 4YZNA 2QOOA 4XMOA 3JY9A 5FP5A 4RJ6A 4DHFA 3EL7A 3WIKA 4JLCA 5KMMA 3UNKA 3UP2A 3CCNA 4HVIA 2XIZA 3LCSA 5KMIA 2YITA 4KSPA 2W4OA 3NPCA 3OVVA 4OGRA 4AQKA 3KVXA 1XH8A 2WU6A 3B8RA 5H8EA 2FA2A 5KMNA 1X8BA 3E62A 4YBJA 1VJYA 4C34A 3L8VA 4CRLA 3DV3A 3PE1A 4Q5HA 4ITJA 3SA0A 4EC8A 5EM8A 3UDZA 2C5XA 5CNNA 3FYJX 5ANKA 4ZTSA 5IMXA 3W0OA 2XK9A 4EK6A 5HE3A 3F3VA 1OMWA 4M15A 3SOCA 2ITYA 3VBXA 4WRGA 1MRUA 5DEYA 3PRFA 1SVEA 2QG5A 2XYNA 3P4KA 4IVCA 4QYGA 5IUIA 4EHVA 1RQQA 4GUBA 4EI4A 3BEAA 3MPMA 4L67A 3GEQA 4PP9A 4ANMA 5DT0A 3WI6A 4XLVA 3ZEPA 4JRNA 2XMYA 3EOCA 5DH3A 2WTCA 3OUNB 4O82A 2C6EA 2HZIA 4FK3A 4DE4A 5I9YA 1V1KA 1OL6A 4I5CA 2VWYA 2XK7A 3O7LD 2YFXA 4R7BA 3R22A 4TNBA 4AXFA 4YURA 5EW9A 4O7LA 2XUUA 3MVMA 4X3FB 4E6AA 5HIEA 1NT2A 2YM7A 3C0HA 4UWBA 1SMHA 3W32A 2NYAA 5TF9A 2R3LA 4NZWB 3TIYA 1PXIA 3NSZA 5ANDA 4MQ1A 2CGVA 1PMNA 3UG1A 3F2NA 5M4UA 5LVOA 3HRBA 2QC6A 2IWIA 4RGJA 5KMJA 5EYKA 4I0RA 3VBYA 1A06A 3R01A 1PXJA 4KKEA 4FEVA 4P2KA 4DG2E 5HQ0A 4DH3A 2Z7QA 5AP7A 2J90A 4F1MA 2HELA 3UNZA 5IUGA 2G1TA 5DRDA 4AW1A 1IRKA 2AYPA 3OTUA 4O6LA 5H3QA 2OJJA 4P90A 4Q9SA 3G0FA 4FT3A 1LEZA 3R9OA 4FTTA 3T9IA 4RQVA 1U54B 3C5UA 3O0GA 3A7GA 4DH7A 4NM5A 4EUTA 4BTMA 3QTIA 3MIYA 4OTRA 5IH6A 3SW7A 3SG8A 2ZOQA 3KRXA 4CLIA 5CI6A 1FINA 2R3PA 4I5HA 3HZTA 2E2BA 4OR5A 1WVYA 4IACA 4ZSLA 2CSNA 4AG8A 1Q8TA 4DITA 2XRWA 3N51A 4F1OA 2UZDA 5T6KA 4XG2A 5F4NA 2JITA 3D0EA 4KRCA 3QTXA 2UUEA 2Z7RA 2JKKA 1OL5A 3KCKA 3MFSA 4IB3A 3SC1A 4CG8A 2PUUA 5FBOA 3PRIA 2BAQA 4RFYA 2X7OA 4KBCA 5HO7A 3FHRA 4OW8A 5FEEA 3DXNA 4E5WA 4QP4A 1S9IA 4IM3A 4OTHA 2IVUA 4HVSA 5C9CA 3NFFB 4JS8A 3QLFA 2HY81 3JVSA 4IDTA 1UNHA 4YC6A 4BDHA 5IA0A 4R1VA 2ITWA 1KE5A 3MVHA 3R1NA 4ID7A 3U6HA 5AA8A 3BU6A 5D7VA 4FKTA 1REJA 3KRRA 3CD8A 4JR7A 1GJOA 1XH7A 1LP4A 2C0TA 2PMLX 4U5JA 2JAVA 3F69A 4FEUA 1UVRA 4ERWA 3BU3A 4LL0A 3ENMA 4QQCA 4KB8A 4AN9A 2BTRA 4PDYA 1JOWB 1WCCA 3CSVA 1KE8A 4UEUA 2IJMA 5HD4A 5EI2A 3TZ8A 4FTOA 4PQNA 1M14A 4C02A 5FRIA 1H25A 3D5XA 5CAUA 4E4MA 3BZ3A 2XALA 4RJ7A 3OMVA 4B0GA 4ZZNA 4GT3A 4R7HA 1J1CA 3AD6A 2JKOA 1J1BA 4PNIA 5AUTA 2YIYA 3EQFA 2WTVA 2X2MA 4ALWA 5AUVA 1Q3WA 5GJDA 4F70A 3C0GA 3EWHA 2X9EA 2OJFE 2VO7A 3G33A 4H36A 4CMOA 3NYXA 4DFXE 2WMWA 1UU9A 2WMUA 2WOUA 5CU6A 3S00A 4DDGA 3HMOA 2W1CA 4RRVA 3ZBFA 3EN6A 5E8UA 3BLHA 4L42A 2J0JA 3ZUTA 3ZDIA 3KN6A 3DB6A 4BB4A 2ETKA 1U4DA 5CAQA 4XP0A 2E9PA 4K9YA 2R3MA 4YJNA 3W10A 4ZTMA 2UW3A 2GPHA 5GNKA 2V7AA 4RLKA 3BQCA 4RX7A 3ZRKA 3QCXA 3W2PA 4CEGA 1ZWSA 4GEOA 1JWHA 4PTGA 4HYHA 2YM6A 2QR8A 1Y8GA 4YBKA 2OXYA 3SKCA 3FBVA 4IX6A 4G5PA 4BN1A 4L44A 3CC6A 2OJIA 1UNGA 5F94A 1OPJA 3ODYX 4KAOA 4UYNA 2GHGA 4ZOGA 2W96B 3A7JA 4I22A 4MWIA 3UTOA 2OH4A 4W4XA 5DBXA 3LM0A 5I9XA 2R3JA 4BJJB 3KIOC 4EOKA 3FXZA 1QL6A 5M44A 4AA5A 1UWJA 5I4NA 2VTLA 4ZAUA 5IA5A 4FIHA 1XBBA 3PYYA 4P5ZA 4FEXA 5FEQA 5FM2A 2BRMA 2JIUA 3Q4TA 5A4QA 4LM5A 1ZRZA 4RWLA 3CKWA 3MH1A 3OD6X 3UC3A 4ZTHA 4FV0A 1OPLA 2UZEA 2YISA 5BVFA 1ZYJA 4DEEA 4HYIA 3WYXA 4AFEA 3LVPA 4IVAA 4DA5A 4C7TA 4QP3A 4EQCA 4V01A 1HCLA 3A62A 2W1EA 3QWKA 4GJ2A 5IA3A 5BVKA 5LVNA 3KN5A 3TYKA 2B9IA 4ACCA 1R39A 2WTKB 3Q3BA 3ZUUA 2X7FA 3W0QA 1FMOE 5IDNA 5L3AA 4CKIA 3FI8A 4FSUA 1DI9A 2BDWA 2V22A 2XEYA 3BQRA 4RPVA 4W8DA 5BYLA 4DF3A 2FVDA 4ZZMA 3AXWA 2AC3A 4G3EA 4I6LA 5DYJA 3BLAA 1Q62A 2QHNA 3V8WA 2A19B 3MPAA 4O2ZA 4PWNA 2IO6A 4FVPA 3Q2MA 4NK9A 4XV1A 4EH5A 1E1VA 2J51A 3PTGA 3I5NA 4K8AA 5HE1A 1UU8A 2WTDA 3FXXA 4FSTA 2EUFB 3W55A 3MGYA 5DT4A 1PMUA 4AE9A 3FXWA 4ZJVA 4DFBA 3FL5A 4IWDA 3P7AA 4N4SA 5JH6A 3ETAA 5AIRA 3EYGA 4KKGA 1R1WA 2VO3A 4GG7A 4OT6A 2BILB 2Y6OA 1I09A 2OXXA 3ET7A 1V0PA 3FZ1A 2DWBA 2X9FA 3MN3A 4X3JA 5IF1A 4FZAB 4KUJA 3R7UA 3G0EA 3VS7A 3D7ZA 4YJUA 5LOHA 2W9FB 3A60A 3OW3A 3W8LA 3CQWA 2PY3A 3O96A 2QQ7A 4QMWA 3TTIA 2I0YA 2VX3A 3PWYA 3DK7A 3AC5A 3NLBA 5L6WL 4TL0A 4QP7A 3PVUA 5JMSA 1YW2A 3VUGA 4O7SA 4TWCA 1JAMA 4GH2A 4IB1A 3ZC5A 4DH1A 4ZS4A 4J52A 3OT8A 4BZDA 3NR9A 1YDSE 2V5QA 4KIOA 5JSMA 3R7YA 5L6PA 4TWPA 3LPBA 5DR9A 5LQFA 3NYOA 5EG3A 5E8SA 4FTUA 4IWPA 2PZRA 2XP2A 1BYGA 2WQBA 3IO7A 4FKJA 4LL5A 4XG8A 2Z7SA 1U46A 3BL7A 3ZSHA 4XP3A 4L6QA 1JQHA 3KA0A 3FDNA 2BUJA 4GYIA 2G2HA 1H01A 3C4XA 3GCQA 3ZSIA 4UY9A 3K3IA 3AGLA 3F5XA 3QALE 1O9UA 3TV4A 5EYCA 4CCBA 4LOPA 1OKYA 3HKOA 3ORNA 4DGLC 3D4QA 3VS4A 1SVHA 2CNVA 4IFCA 3TI1A 4APCA 2C69A 4WO5A 2W17A 3LFSA 2Y0AA 3PFQA 3UDSA 4CLJA 2WTJA 3CKXA 4HPTE 4YTFA 2YM3A 4NW5A 5H9BA 3ZM9A 5LWNA 5EM7A 3R8ZA 4O7NA 4I23A 3I0OA 1CDKA 5AA9A 2R2PA 4M0ZA 3OF0A 3BHHA 4J8MA 4QTCA 5HBHA 2QOCA 3RAHA 3TZ9A 4D55A 4DHJA 3V6SA 3KRWA 3KGAA 3F82A 3VS2A 3D14A 4ZSGA 3UIXA 3LJ0A 4CD0A 3E7OA 2W1FA 4HGSA 4JQ7A 2VTTA 3AC8A 2OLCA 3OT3A 5E7RA 3RPVA 5BVNA 2B52A 4ONAA 3AC3A 3UGCA 5BVDA 5K5NA 2VTRA 3ACKA 3EQCA 3LFNA 4FNXA 2R4BA 4LOOA 4S32A 4DEAA 3VBQA 2ONLA 4V04A 4IX5A 2HCKA 3DFAA 3RAWA 4FV4A 4C36A 1BLXA 3DA6A 1Q61A 4NSTA 4LMNA 2GCDA 1O6LA 3MVLA 1REKA 3IW5A 2XJ2A 3LE6A 1VYWA 4R7IA 4O91A 4JVGA 5IEYA 2UVZA 2BRNA 1GAGA 2VV9A 3KCFA 3NGAA 5HNBA 3F3UA 3W18A 5IQEA 4ZY6A 3R1SA 2W9ZB 2F7XE 3AT2A 4BVUA 4F9AA 5HO8A 2UZTA 2H8HA 3LFDA 4DLJA 4X3FA 3AMYA 4GK4A 3R8LA 5BUJA 3QD0A 1EH4A 4G2FA 4N70A 4AW5A 2R9SA 4G6NA 5KZ0A 3MS9A 4IAFA 5ANOA 3VUKA 3HGKA 4B6LA 2ZM3A 4Y73A 5B2LA 5J87A 3F66A 3BV2A 1H07A 4O7VA 5M07A 5J9ZA 1KE7A 5GJFA 4PDOA 5HG7A 4PL3A 4XYFA 1J7LA 4NUSA 3PLSA 3ZO1A 4YP8A 3OCTA 3T8OA 2JFMA 2ZMCA 3BHYA 3ALOA 5B2MA 3ORPA 4BDDA 2XIRA 3DK6A 4O96A 2O64A 4ANBA 5J95A 3V6RA 2Q0BA 1U54A 4M0YA 2PE0A 4FSNA 4IQ6A 3GUBA 4XX9A 1MQ4A 1URWA 2PULA 2ZAZA 3CIKA 3KB7A 4RIYB 5HCZA 3Q5IA 2PZYA 1G8AA 4QPSA 2UZLA 1IR3A 2RL5A 4D58A 5CWZA 5T3QA 3ZLWA 4YC3A 4X3FC 2RG5A 4YPSA 4C61A 3GCPA 2AUHA 1FVTA 3CXWA 1MP8A 3R0TA 3P7BA 3E87A 4EK5A 5LXMA 2QONA 2B55A 3PXQA 3SXSA 3C7QA 4JDHA 3FMNA 3FL4A 3SVVA 1PXOA 5AADA 1GIJA 2CMWA 2Y9QA 3HP5A 4G3DA 4RVLA 4C4JA 4PNKA 4XLIA 2QO7A 3ORIA 4JG6A 1OECA 1TQMA 3WF8A 2B9FA 4Z9LA 4K6ZA 4L52A 1PKGA 3W2QA 5IEXA 2R0IA 4JIAA 5IQDA 2YM4A 4G9RA 1F3MC 1P4OA 1Y6BA 3HRFA 5FQDC 2P4IA 2CNUA 4BCOA 2QD9A 2O2UA 3LJ1A 4EBWA 3AKLA 4E6DA 2YWVA 4ORKA 5KZIA 3NCGA 2GDOA 3QTWA 4KA3A 4AS0A 2XCKA 1PYXA 2XCHA 2C6IA 3D15A 2W1DA 1GIIA 3E3PA 3FPMA 4Y95A 3RGFA 4B8LA 4PMPA 4O0SA 3ROCA 2VD5A 3EQBA 2J2IB 5DR2A 3IS5A 5KE0A 4Z3VA 2B1PA 4G6LA 2P33A 3FZSA 3QRTA 5A6NA 2CJMA 4U41A 1GY3A 4M84A 3FHIA 4XRJA 2FYSA 1IAHA 3SGCA 5IZFA 1OL2A 3RWQA 4C3FA 3NYNA 3BCEA 1H1PA 4CTBA 4FSYA 4IVDA 2HXQA 4GVAA 1XH5A 2PMIA 4ENXA 2W1ZA 1PKDA 1Q24A 2W5HA 4EYMA 2HZ0A 5F20A 4U81A 1M7NA 2GTMA 2WU7A 4IAKA 4IAAA 4C2VA 4ANQA 4YHFA 3ZS5A 3TN8A 5FTQA 4DEIA 5AX9A 3W8QA 1YOLA 2FSLX 3BI6A 3UVQA 2B54A 4HGEA 3RNIA 4X2FA 4DC2A 1GOLA 3PIXA 4L9IA 4Z16A 3G5DA 2QOFA 3ATTA 2PE1A 3VVHA 1A48A 3W2OA 4AACA 4BBFA 1Y91A 2YABA 4RSSA 2WKMA 5IQCA 3N9XA 4QMUA 1YOMA 4NT4A 4GW8A 4LUEA 2WQOA 5AM6A 4X7QA 2XM8A 4Q5EA 5J9YA 1XBCA 2ACXA 5A4LA 3FSFA 3ZUVA 5CF8A 2ERZE 2ERKA 5KX8A 4YJSA 3G6GA 3BYSA 3PE2A 3BE2A 3KY2A 3I79A 4PMMA 3SRVA 3BPRA 2A0CX 4J96A 3LCOA 3COHA 5CVGA 3R8PA 4DAWA 4USEA 4E73A 4YMJA 2JBOA 5A14A 4X2KA 1OM1A 2BHHA 3CEKA 4NJDA 2QOLA 4BDAA 4FC0A 3IONA 3WZEA 1VLRA 3O50A 1IEPA 3AKJA 3L8SA 5EDPA 4NFMA 4QP9A 1MRYA 4E7WA 3EN9A 2C30A 4QEBA 4OTWA 4FVRA 2OO8X 2GNLA 3JYAA 4JI9A 3GFWA 3RPRA 2R3QA 4O22A 2CPKE 2ITNA 3NNVA 2H6DA 3LQ5A 4YLKA 5JT2A 5CZIA 2CGXA 2JC6A 4C4GA 5IEVA 2YZLA 3NUYA 3MFRA 5E8ZA 3BGPA 3GQIA 3ZZEA 2O5KA 4CT1A 3GU6A 1NVQA 3Q4ZA 3A4PA 4NTTA 4CFVA 3E8DA 3ORMA 1Z9XA 1J91A 3TZ7A 2X8IA 2HWOA 4J8NA 3OG7A 4RA5A 4FKPA 5L8KA 1Q4LA 4IZAA 3PY1A 3G2FA 5EQEA 2BRHA 4FICA 2QLQA 3R21A 4EWHA 3NZ0A 2QOQA 3AMBA 3LCTA 3VWAA 4PY1A 4H1JA 2BALA 4FEQA 4KKHA 4ZSEA 5C27A 1UKHA 1W0XC 3T3VA 4GJ3A 1J3HA 4LV5A 3QTSA 3CJFA 5BVEA 1ZYCA 3FWQA 4FKGA 2X6EA 3ZC6A 2F9GA 5CYIA 2CNQA 3KEXA 4HVHA 4FJVA 3I1AA 4YZ9A 4RWIA 4BIBA 3UO4A 3ORZA 2QU5A 2WZJA 1QPCA 3LFCA 4LRKA 4HPUE 2CGUA 1U5QA 4D9UA 1HOWA 2JFLA 3AGMA 3M11A 4MVFA 2JDTA 4K2RA 4O21A 4WHZA 3OOGA 3Q04A 4QDEA 4G9CA 5EHYA 3V01A 2I40A 4FODA 2C6TA 4NM3A 5AUZA 4F0FA 4BDKA 3QRKA 2WTKC 3BLRA 3QQUA 4A9YA 3QQHA 4U6RA 4DDIA 4I0TA 1CKIA 5CEIA 2UW7A 4FT0A 4QRCA 2O63A 2BAJA 3FC1X 3QZFA 3M42A 3VONA 3GC8A 2GNIA 3TM0A 3W0NA 4ASDA 2QU6A 1BI8A 1Q8WA 2Z02A 3KULB 3NDMA 3O2MA 4QMYA 4WUNA 5CVFA 5AV3A 2DQ7X 5HIBA 5EW3A 1ZAOA 2UW5A 3NIEA 3FMEA 1KOBA 4X6RA 3G9LX 2BZHB 5D10A 4NM7A 4BDCA 1G3NA 4AT3A 1LR4A 4DT9A 4ZY4A 5C01A 3ZLSA 5FXSA 2OH0E 4K77A 3H9OA 4USDA 4AW0A 3V8TA 5E91A 1VR2A 2W1GA 2ZV7A 3DNDA 5ITAA 2WXVA 3FY0A 3DK3A 3JUHA 3PP1A 4QMTA 2C3IB 4S30A 3C4FA 3K3JA 2YIXA 3OWPA 2Y8OA 3TG1A 3VS6A 4BI0A 3GC9A 2PVKA 4FV5A 5ETIA 5HU3A 5M53A 4ANSA 1YRPA 3QLGA 3Q60A 2O3PA 4EOPA 3GU5A 5FM3A 2R3FA 3ZFXA 3NNXA 3A7FA 1Q8UA 3Q4CA 5IDPA 2QLUA 3QKLA 4EKKA 5CNOA 1UWHA 4MXZA 1KV1A 1PJKA 2HOGA 2W4KA 4LFIA 3V5JA 3VHEA 4F4PA 5HVKA 3HV3A 4JX7A 3FE3A 2ITOA 3QWJA 2GU8A 4GV1A 5DWRA 5EM5A 5ETFA 4NH1A 4CV9A 2XIXA 4AW2A 5HG8A 4EYJA 4AFJA 2VUWA 1OIYA 2C3JA 2XKDA 3L1SA 3UIBA 4USFA 2B9JA 2ZDUA 5AIKA 2UVYA 4F0GA 4E1ZA 2WO6A 4TNDA 2IVTA 2RFDA 4L43A 1ATPE 4HVGA 4UX9A 1W82A 3SW4A 4BDBA 4FV3A 3I7CA 5GJGA 5C1QB 4MBIA 3DNEA 3OY3A 1P5EA 4PRJA 4U40A 5K4JA 4P4CA 3HRCA 2PUNA 3RI1A 5A6OA 2QOBA 1YHWA 3WF7A 3LXNA 2VTMA 4MXAA 3IK3A 4KRDA 4QNAA 1Q41A 4DT8A 3L9MA 4F6WA 3FZTA 4PDPA 5HESA 3HNGA 1FVVA 2Z2WA 3LOKA 4A4LA 5KMOA 4DTKA 3NMUF 2HZNA 4D4YA 3VUIA 4DFNA 2XEZA 4E93A 4EH8A 3NEWA 3IG7A 3PPKA 4F6UA 3SOAA 4CSVA 4K18A 3E64A 4RVTA 3POZA 3HECA 5JZNA 4O38A 1ZY5A 3TTJA 5G6VA 3DQWA 5BQ0A 5GIOE 1ZLTA 3PIZA 4EOLA 2XJ1A 4RZVA 4IBMA 2O65A 4H39A 5FEDA 4BKJA 5DNRA 3DQXA 3FLQA 3OCBA 4BCPA 4D1ZA 2ITQA 5E8XA 5C03A 3RALA 3HYHA 4YPDA 4GSBA 3E93A 4NU1A 5C26A 4YGAA 5HD7A 4FKLA 3I5ZA 4BDIA 5HZNA 2IZUA 2H34A 3E92A 1B38A 3CE3A 3Q9WA 4ITIA 5D11A 2X0GA 4MXYA 3IW8A 1ZOEA 3QCSA 4LG4A 2OW3A 1IASA 4M69B 1PXLA 2VN9A 5FTOA 5CY3A 3MPTA 4APPA 4TKSA 5M51A 3OXIA 3Q9XA 5EI8A 4R77A 4I6FA 3DZOA 5LWMA 4MNEB 1CKPA 3SD0A 5BUIA 3P79A 2ITPA 5I9VA 5KCVA 3QFVA 4QDVA 3WBLA 4FIFA 1NVRA 2ESMA 3P7CA 4O81A 4Y5HA 3CPCA 4U79A 2R0UA 2C0IA 2OSCA 4XG6A 4ZS0A 2NRYA 4BCKA 1XJDA 2ETMA 3AD5A 4I4FA 5CXHA 5B7VA 1OBDA 3NUPA 5BUEA 3F3TA 5T68A 5DLSA 1T45A 3ACJA 3V04A 2C1AA 3WZDA 4AOJA 5I5ZA 4FYNA 5CSVA 2IN6A 3S0OA 2WGJA 3R8MA 3VS3A 5IQIA 3PWDA 4B9DA 3QYWA 4KSQA 5I9ZA 1KE6A 2BKKA 4DFLA 3UQCA 2OJ9A 1DAYA 3FKNA 4A9SA 5AV4A 3Q5ZA 5HNIX 4BBEA 2HAKA 2WMAA 4IVBA 4OTFA 3FC2A 2WMRA 3U4UA 5E9EA 4ITHA 3JPVA
chains in the Genus database with same CATH topology
4F7NA 2PMNX 3QUDA 3MH3A 4NCTC 4CFMA 4JG8A 4QQJA 3PXFA 1Z57A 1PXNA 3RK7A 2A27A 2JIIA 3CTHA 4FUYA 4NM0A 4S2ZA 4DHZA 3OBJA 5IISA 3QA0A 4FV2A 1GIHA 2X81A 5HEZA 4O0UA 4X0MA 2ITVA 4D0XA 4DYMA 3KU2A 2LGCA 1G8JA 2ZM4A 4GU9A 2BDJA 4CCUA 4JQ8A 4A9UA 2VTSA 2QI8A 4ZP5A 2OZOA 4ZY5A 4FSZA 2W7XA 4W4WA 4ZLZA 2WD1A 4TPTA 3II5A 2PPQA 3CY2A 2PTKA 4YZBA 3BU5A 3LFAA 5EYMA 3OUKA 3UYTA 1R78A 4V0GB 4ASXA 3LIJA 3NFGB 4D2RA 3DJ5A 3FKLA 3Q53A 4RX9A 2JIVA 3TKHA 4Z7HA 2BPMA 3D94A 3FUPA 3WF5A 3BX5A 4CFXA 1Y57A 4CQEA 1UU7A 3LLAA 4WD5A 3QCQA 3GT8A 2PMOX 3T9TA 4D5HA 1PMVA 2VX1A 2FGIA 5AP3A 4EK3A 2YCFA 1YKRA 1B39A 1BKXA 2YDKA 4F09A 3G15A 3EN7A 4ZMEA 1L8TA 4ZMFA 3OY1A 3HAMA 2JD5A 3RPOA 3EQPA 5L2WA 4JIKA 4YU2A 3A8WA 4X2JA 5BX0A 5AEPA 1UNLA 4TWOA 1JVPP 4LOQA 2VTOA 5J9LA 2RF9A 4J97A 3NAXA 3KRJA 4FGBA 3FZPA 5FUTA 3C4EA 2GS6A 2XK8A 5CQUA 2WMQA 2XZSA 4CFNA 5KUPA 3HV6A 3VW6A 3K2LA 4AZSA 2YACA 4GL9A 5CU4A 4W8EA 3LQ3A 2OIQA 4RJ8A 2J0MB 2HWPA 3E8EA 3IGGA 1ND4A 4BYIA 3GOKA 3MBLA 4YZMA 4I5PA 2G15A 5ACBC 2J9MA 2GS7A 4WIHA 4EOOA 1YI4A 4I3ZA 5J5SA 3F3WA 3OP5A 4FVQA 4FL3A 3AC4A 4FE2A 2OG8A 3SAYA 1H24A 4J95A 2HIWA 4IW0A 3U55A 4B7TA 4ACDA 2HW6A 1ST4A 4GG5A 4EHEA 3MTFA 5DIAA 3D83A 3GCVA 3O8PA 3OHTA 4BGHA 3QKMA 3E7VA 4UV0A 3F5GA 4XG9A 4AT4A 4AX8A 1RDQE 4AUAA 1YDTE 4WG5A 4BDJA 2JKMA 2QOIA 4PTCA 5CXZA 2VAGA 3SX9A 5HLNA 3RPYA 4RA4A 2FSMX 3U6IA 1STCE 2XVDA 3DBQA 2VO0A 4L7FA 3R9HA 4CNHA 3TUCA 4IE9A 5DHJA 3G9NA 3OEFX 4XV2A 3UDTA 4WA9A 4BCMA 3VUHA 4NIFB 2X7GA 2C6LA 3EFLA 4R5SA 3TACA 4IM2A 5E90A 4EZ3A 4WNMA 4FIGA 3EB0A 2KTYA 3LFFA 3EQHA 2EU9A 4KABA 3I6UA 3QKKA 2OFVA 1GZNA 2YJSA 3F61A 4EKLA 5E8WA 3UO5A 2QKWB 3GGFA 4BCGA 4MQ2A 1OI9A 2BKZA 5AMNA 1V0BA 4GT4A 4HNIA 5E92A 4QO9A 4FBXA 4FG8A 3ORXA 5JGAA 3FQSA 3FSKA 3QRIA 4UBAA 5D12A 5FBNC 4MCVA 5CQWA 5BNJA 4FIEA 3OWLA 4FTQA 5E8VA 4QTAA 4ZLYA 3AG9A 2Y4PA 2DUVA 2QO2A 3BYOA 3R30A 2VTAA 4XOYA 4ZK5A 1OIQA 4L3PA 2C1BA 3W33A 4W4VA 5K4IA 4EQUA 5DN3A 3EJ1A 1YDRE 4A07A 4IDVA 1H0VA 1ZZ2A 2HK5A 2JGZA 2VWXA 1OBGA 1JSTA 3TZMA 4JBQA 3E63A 2R5TA 1XHAA 4JT3A 4YHTA 4ZJJA 3UIUA 4AXAA 4WBOA 2H96A 3HMMA 1RJBA 4DG0E 1M7QA 2IZRA 3RTPA 2BTSA 3UVPA 4IJ9A 4DCEA 3MB6A 2J50A 1P14A 3PY3A 2OIBA 3ENHA 3R02A 5I9UA 3QUPA 3KQ7A 4IB5A 4YTHA 1PY5A 4O6EA 5CTPA 3MFTA 3V5PA 4DG3E 4MH7A 5DR6A 3MJ2A 4M97A 2OF4A 4H05A 2RIOA 5FLFA 3COIA 5JGBA 1UA2A 3MW1A 5AM7A 3QYZA 4CG9A 4MXXA 4FOCA 4NKAA 4W4YA 3F5PA 1IA8A 4JAIA 4LQMA 1JBPE 4CZTA 3O8TA 3F88A 3E8CA 4D1XA 3PG3A 3QD3A 2EB2A 3COKA 2UW9A 5HKMA 4FKUA 4E26A 4BGGA 5FG8A 4FTMA 5EM6A 1OZ1A 3KREA 3U9CA 3ORLA 4FZFB 5AUWA 4U42A 4EHZA 3QX2A 1MUOA 2CLQA 5M06A 4QTDA 2JKQA 5GIPE 4GT5A 3UODA 1NA7A 2XS0A 3DS6A 3OROA 4D5KA 4F65A 4BDGA 4JBPA 4O7YA 4ZZOA 2YCQA 4RVKA 3BBWA 1FGIA 3U54A 4OLIA 4L3JA 4M68A 4O27B 3QTUA 4ENYA 1Q99A 3HV4A 3G51A 4PF4A 4DN5A 3PJ2A 2ZFYA 3ULZA 2BFYA 5JQ8A 5CT7A 2CCIA 5BPYA 2C6MA 2WQEA 4FZDB 3MTLA 4V05A 4TYHB 3WE8A 4CFWA 4RIXB 3ZO2A 4L01A 1YHVA 2WB8A 4AXCA 2BVAA 4F99A 2P0CA 3RHKA 2XM9A 3VQHA 4AP7A 4WNOA 4DH5A 2R3HA 5CSPA 3NAYA 4UXLA 5B0XA 3QRUA 2VTPA 5H8GA 2OF2A 3AQVA 4FG9A 4ALVA 3MA6A 3RWPA 5LVLA 1Z5MA 1E9HA 2OFUA 4K0YA 3M2WA 5FXQA 2UW4A 2PZIA 1H1RA 4FTJA 4ZEGA 4R3RA 3ATSA 2GNGA 3P08A 4XP2A 5DT3A 4AWIA 4FZ7A 3MB7A 1OUYA 4RJ3A 3JR1A 3AC1A 1IA9A 4MKCA 4B8MA 3CGFA 4WG3A 4U8ZA 2RG6A 4JQEA 4Q9ZA 2YERA 3GENA 4G5JA 5M55A 3FMMA 1XR1A 3R63A 4KBAA 4XBRA 3S95A 4EOIA 3DU8A 3V51A 1ZY4A 4C4IA 4HZRA 4D9TA 4DEBA 4XBUA 2ZV2A 3C4WA 3OBGA 1Q8YA 2B9HA 3IECA 4YJPA 1H28A 3PP0A 1QPDA 4Y5QA 3UZPA 3BYVA 4FT5A 1JKKA 2BHEA 2OZAB 4I21A 3QX4A 4DBXA 4E4NA 1KSWA 2PU8A 4F0IA 2HY0A 3NUUA 2JDSA 2YM8A 3GU8A 5KO1A 3IW7A 4AE6A 4BZNA 3P78A 2IW9A 4EZ7A 3PG1A 4FL2A 3ULIA 4MNEA 4D0WA 2Q0NA 2VWUA 4G3FA 5C8KA 5JFSA 3FV8A 3VS0A 4DHIB 5AP6A 4I6QA 1E1XA 1TFFA 4HOKA 3R9NA 4UXQA 2XIKA 1OIRA 3FI2A 4QMLA 3AKKA 3RZBA 3VRZA 2X6DA 4BDFA 3QQGA 4FNWA 4YJVA 3KF4A 2VZ6A 4Q2AA 4FG7A 4TN6A 4ALUA 4C62A 1Q97A 2C47A 3FEGA 4BCHA 5CU3A 2BROA 4ASZA 4ZTNA 2C6KA 4E5AX 4C59A 3REPA 2FB8A 5LCJA 5HORA 5CT0A 5EW8A 3VO3A 3L9LA 1M2QA 3UBDA 2JDRA 4DEGA 4EQMA 3F2RA 2OJGA 3UC4A 1FOTA 4FKVA 2ZB0A 4O7WA 5JK3A 3GFEA 3FQHA 3C51A 4EJ7A 4QMMA 4FT9A 2YIWA 4YSMA 3NUAA 4IADA 2YN8A 4N57A 2PWLA 5FGKA 2A1AB 2PVFA 4H1MA 2P2IA 4AZVA 1WVWA 2UVXA 2J0KA 4I93A 1S9JA 5TO8A 4MBJA 3QXPA 2ITZA 4NJ3A 4Y83A 5A54A 4CVAA 3LAUA 4O7RA 4XNEA 3HAVA 5HX8A 3PVWA 4QTEA 3BYMA 4BDEA 5CS6A 2IW8A 2UZWE 4BICA 3ZYAA 4RIOA 2FUMA 4XH6A 4C3RA 2CKOA 5EHLA 4DLIA 4FSWA 3V5QA 3MA3A 3EN5A 2F49A 2YM5A 1APME 2VGPA 1G5SA 3BWJA 3OEZA 4QT1A 3IDBA 4V0GA 4F9WA 1BL7A 4HCVA 2QURA 4LRMA 2FH9A 2F57A 3GNIB 4HYSA 5HBEA 3CTQA 4G3GA 4BCJA 5CEMA 4AGCA 2PL0A 3B2TA 4UB7A 1ZXEA 3GXLA 3R83A 5AAGA 3Q6UA 3GQLA 5LMBA 4I1ZA 2VTIA 3H9FA 2C4GA 4BIEA 3UPXA 1XKKA 2ITUA 3ELJA 1BX6A 3IQ7A 4HCUA 2QO9A 5CEPA 4FT7A 3NX8A 3RM7A 3QC4A 1YI3A 3ZCLA 4TRLA 2ZV9A 3LMHA 4ACMA 2QKRA 3NCZA 4B99A 4KWPA 4BZOA 1ZOGA 3PJ1A 3QTZA 4N6YA 1FMKA 4CZUA 2R64A 2W1IA 4J98A 3Q9ZA 4ERKA 4IZYA 3BWFA 4ACHA 1DAWA 4MD8E 3ZO3A 1UV5A 3SLSA 4PUZA 4DTAA 5KKRB 3L9NA 3HMNA 3R04A 3RKBA 3UPZA 4IC8A 4FV6A 2J0LA 3UG2A 3O51A 2WOTA 3OZ6A 1ZMUA 4XV9A 1B6CB 3VULA 4Y46A 3PIYA 1YXXA 4KINA 3UMXA 4JRVA 3KKVA 3ZFMA 4D4SA 1K2PA 1F0QA 2PZPA 3BRBA 4XOZA 4BJJA 3GC0A 1MQBA 3A61A 3TV7A 4CKRA 2AEGA 3QA8A 4P7EA 5HVJA 3RPSA 1A9UA 3R6XA 1RE8A 2EVAA 2PVYA 3GP0A 3TNQB 5CEOA 2GS2A 3FYKX 3DFCB 4LYNA 3Q52A 3D2IA 5DPVA 4RVMA 1OUKA 2V55A 4DGGA 5E8YA 1L3RE 4BTJA 5L8LA 3PZEA 4I0SA 5ANEA 3E88A 1Q3DA 3BELA 2UZBA 4RFMA 3EKNA 1FQ1B 1XMLA 3AOXA 3LFQA 4G34A 1H1WA 3Q4UA 4EH2A 4YHJA 2QVSE 3UJGA 4CXAA 1YXTA 4BGQA 2CN5A 3H3CA 3UVRA 3ZZWA 2OIDA 3QRJA 2G01A 1PXKA 1G8KA 4JX3A 5JFXA 2XF0A 3JY0A 2XA4A 1JSVA 1WAKA 3VNTA 3UOHA 3RNYA 3OS3A 5LVMA 2F7EE 5HLPA 3F5UA 2VTNA 5C8MA 2YEXA 3P1AA 3EKKA 3R28A 3NVMB 2XAOA 3DDPA 5AUXA 4RMZA 3R8VA 4M12A 3ZBXA 4IH8A 5JQ5A 1WBVA 3GU4A 3U6JA 3VF8A 3MH0A 4XCUA 1FVRA 3H10A 2QOKA 3W2SA 3KXMA 4C3PA 2XK6A 4QPAA 2G2FA 5AV2A 3FMJA 4O2PA 5JRQA 1ZYDA 5HX6A 4QQ5A 2RFSA 3C1XA 3R7VA 4IHPA 2XNBA 1OKWA 2B4SB 4P5QA 5HHWA 3H30A 4EK8A 3W0PA 4F08A 3VBVA 4RJ5A 3EFJA 3DY7A 2J4ZA 3A7IA 2ZJWA 3DBDA 4GFMA 3AT4A 4AOIA 3OW4A 3WZKA 3MY0A 2CCHA 1P4FA 5CVHA 5EK7A 3RHXA 4KIQA 3D7TB 5J1WA 4YUQA 4OTDA 4AN3A 2P55A 4CTCA 4YLLA 4DCAA 5CENA 3ZM4A 4RWJA 4BBMA 2R3KA 3LMIA 3R1YA 4HGLA 2ZVAA 2CKEA 4JBOA 1H1SA 2WEVA 4I6HA 5BMMA 4AGUA 2REIA 4O0VA 2CLXA 4QMQA 4EOSA 3H0ZA 4F7SA 2R7BA 4AQCA 4UZDA 1TKIA 5CAVA 4BTFA 2OBJA 3F7ZA 2W4JA 4NW6A 1H0WA 2XBJA 3I4BA 3PA4A 5HNGA 3QTQA 4EH7A 5HTCA 2EXMA 4IWOA 4I4EA 4EEVA 4I94A 2BFXA 3TMOA 1WBOA 4CFUA 2QHMA 4GCJA 4QYHA 1K9AA 3WF6A 1G8SA 5LCKA 1YHSA 3U9NA 2O8YA 3G6HA 3FMHA 3K5UA 3FLNC 4PTEA 4R3CA 4YNEA 3Q6WA 2CGWA 4F7JA 3LXPA 4FMQA 4DINA 2XNOA 3R2YA 4QP2A 3ZDUA 4XRLA 4F1TA 4BF2A 3HMPA 5DI1A 1XH9A 3D5UA 2GNFA 1FPUA 2W05A 4HZSA 5AAFA 4JMQA 1ZMVA 1K3AA 3VUDA 2GNJA 3IOKA 3JS2A 3QQFA 4MK0A 3I60A 5EKOA 1KWPA 2VU3A 3QZGA 3QZIA 2UZVA 3SDJA 3NWWA 2E9VA 4M3QA 5HU9A 3MVJA 1XH4A 4CKJA 3LHJA 3PSDA 4KS8A 3BLQA 1SM2A 3DLSA 4C35A 5FXRA 5CSWA 5K5XA 4XS2A 2VNWA 2C5YA 3E3BX 5F95A 3D9VA 2F7ZE 2GMXA 3PXRA 1OITA 3VF9A 4U7ZA 3DCVA 4YTCA 4EBVA 2SRCA 3CD3A 3UE4A 3R73A 3LXKA 4DFUA 3S3IA 3ZMMA 1P2AA 4DGNA 2HYYA 4IAIA 4DFYA 5IPJA 3DTWA 4G6OA 4QYFA 4AXDA 4J71A 5FDXA 1AQ1A 4OTIA 1ZZLA 3W2CA 3QGYA 4ZTQA 3R9DA 5BYYA 1KUTA 1GZKA 3ZLXA 4IIRA 5L2IA 3FI3A 2YZAA 1OKZA 2ITXA 4G31A 4IEBA 5ANIA 3MH2A 3GBZA 3SXFA 4GVJA 3OOMA 3ALNA 3TL8A 4RC4A 1UKIA 2ETRA 2CKQA 2YCSA 3LXLA 3HVCA 4KNBA 4EH6A 2NP8A 2YA9A 3VN9A 5GINE 1YWRA 2JBPA 5AX3A 2R3NA 5M09A 5AFVA 4L45A 4U97A 4O86A 4X2NA 3ZU7A 2HENA 4HGTA 2WIHA 3UP7A 5CLPA 2BCJA 4GFGA 1YI6A 4YO6A 4H3QA 2IG7A 3P86A 5D41A 2R7IA 3PXZA 1U59A 4ZSJA 1M17A 3BL9A 4E8AA 4G17A 3HUCA 4EH9A 5KMKA 3DTCA 2BRGA 3CS9A 1DI8A 4CRSA 1JNKA 2OZAA 4XG4A 3VAPA 3ZH8A 4AT5A 4EL9A 5L6OA 3C13A 2BZIB 4RT7A 3FQEA 4BI2A 3MY5A 4O0WA 1PMEA 3DXPA 4YTIA 3IDCA 4GU6A 5CZHA 4AZFA 4E6CA 4FSMA 2J0IA 3N4VA 1H8FA 1YWVA 4E4XA 4RIYA 3GI3A 5HVYA 3FJQE 3KXNA 1JPAA 3QGWA 4JDIA 4NCTA 5I9WA 3GVUA 3HX4A 3KXZA 3QBNA 3PY0A 3FZRA 4U80A 5M08A 2BRBA 4WG4A 5M4CA 5JKGA 4XJ0A 2X1NA 4WNKA 4RX5A 2IVSA 3RCDA 2PVRA 4I92A 3JVRA 1M2RA 2DS1A 4MYGA 3D5WA 3BYUA 4S33A 3L9PA 4QNYA 2V62A 4MWHA 4IFGA 4QP6A 3RAKA 3ZOSA 1WBNA 4AZEA 5CSXA 3TNPC 4TW9A 3MWUA 2J5FA 3PVGA 2VNYA 2QNJA 3ZXZA 2XK3A 4TYIA 3UOKA 3NW6A 3KVWA 5K9IA 2HW7A 4JAJA 3UOLA 4F9CA 4F9BA 3RP9A 3VJNA 1DS5A 4GKIA 3RINA 2WFYA 4FV7A 1WZYA 4HVDA 3DZQA 2EXCX 4OBPA 5C8NA 4YZDA 3IOPA 3IGOA 3HA8A 4R78A 4YJQA 4AU8A 3EZRA 4C38A 3FKOA 5IQHA 3EMGA 3IW4A 3H0YA 4FUXA 5DGZA 3GC7A 5IA2A 4QMPA 2XANA 2KULA 1YXUA 3PJCA 3LCKA 2QODA 1JLUE 2QOHA 2X39A 1OKVA 5FDPA 2OICA 3U4WA 2XK4A 3LCDA 3BBTB 3GB2A 3DLZA 3EFKA 2YCRA 3IW6A 2GFSA 5C4LA 2IPXA 5TOZA 1ST0A 2O0UA 4EHGA 1OGYA 2WMBA 3P0MA 4RWKA 3DOGA 2QR7A 1CKJA 2PUPA 5CX9A 4MAOA 2Y7JA 3BIZA 1CSNA 3WZUA 3DDQA 4TYJA 1GNGA 2ZV8A 2GHLA 2VTJA 3LM5A 5EYDA 4O0TA 3EQRA 3FLSA 4BTKA 3R71A 4QMSA 2ZB1A 4QP1A 3LMGA 1Y8YA 3P5KA 5LARA 2E9UA 3TKIA 3UDBA 3A7HA 3VQUA 4HW7A 3L8PA 5F1ZA 1IAJA 4UALA 3GOPA 4CT2A 4BYJA 1FGKA 4QYYA 2GNHA 4K33A 4R3PA 5GHVA 4DTBA 2W1HA 4A9RA 1NY3A 3BHUA 4FSRA 3DKFA 3TKUA 1H27A 3LZBA 3NUXA 4FX3A 3U51A 3PLAE 5AAEA 3KMMA 4AXEA 2ITTA 4E4LA 3HLLA 5IQAA 2GQSA 4M14A 4AF3A 3EL8A 1UU3A 5E1SA 5BV3A 5LJJA 3DGKA 4AN2A 2XRUA 4BCIA 1Y6AA 2BDFA 4M13A 2BAKA 3PSBA 3EQIA 3DKGA 2JDVA 5HLWA 4DEDA 4IAYA 4CMUA 3PA3A 4O7ZA 3TJCA 4DGMA 3OWKA 4LI5A 1AD5A 1O6KA 3EH9A 1HCKA 5HGIA 4R6VA 4D4RA 4LV7A 3NW7A 3WZJA 4FA2A 5M57A 3PVBA 4PDSA 1JKTA 4GRBA 4M7IA 4Y85A 5B2KA 3D2KA 4BRXA 1GZ8A 4JDJA 4FR4A 4QTBA 4F7LA 4IANA 1FBNA 5JEBA 3WOWA 3PUFC 1KV2A 4IMYA 5KKRC 3QU0A 5FP6A 2GFCA 2WTWA 3O7LB 5TT7A 3A8XA 1XQZA 2E9OA 3MSSA 4L46A 4RLLA 1OL7A 5DFPA 4OBOA 3DBFA 3SRVB 3V3VA 3HV5A 2WQMA 3NUNA 5EOBA 3SHEA 2OGVA 3V5WA 2EWAA 1PHKA 4E20A 4UYAA 2B0QA 4I24A 5A3XA 2WNTA 3TNHA 3F9NA 3ODZX 4A4OA 2W06A 4MD7E 4XHKB 4CMTA 3ML1A 3E8NA 5EQYA 3VC4A 2UZNA 3QCYA 3HP2A 4YJOA 5ANJA 3CR0A 4G1WA 3W1FA 4B4LA 2VWBA 2XNEA 4PMTA 2Z60A 4PL4A 3WILA 4OTGA 3T3UA 4A9TA 2X2KA 3SXRA 4EOQA 2XJ0A 2PVJA 2X2LA 4FL1A 3DBCA 3A99A 2PSQA 4GMYA 4WKQA 3ROYA 4O7TA 3UMWA 3F6XA 3LW0A 4OUCA 4Z55A 3NVKI 1W84A 1M2PA 3LKMA 1QPJA 1TVOA 4LUDA 2XARA 3B2WA 3R7EA 3TDWA 5C4KA 1R0PA 3QL8A 2RGPA 2X4ZA 3GU7A 3Q96A 4PV0A 5CSHA 3MJ1A 2XKFA 3C50A 4LGHA 2OI4X 2R3IA 3DKCA 1I44A 3KMWA 5D1JA 2UV2A 3F3ZA 4BC6A 3M1SA 4RG0A 2WMVA 4U44A 1YWNA 4EORA 3D7TA 3V5LA 5CASA 5KBQA 5HE0A 5AUYA 5IA1A 1JSUA 3HMIA 4F64A 2JDOA 2PVLA 3SG9A 4F9YA 4PMSA 2UW8A 3ERKA 3A2CA 2A4LA 2C3LA 3EZVA 4FYOA 4H3BA 3VBWA 4G3CA 5KHWA 5HBJA 3ITZA 2P3GX 4GK3A 1QMZA 3GCSA 3THBA 4IX4A 2WIPA 4ARKA 1NW1A 3E5AA 2Q83A 2CN8A 3KULA 1XH6A 3O8UA 3CQUA 4QMOA 1QPEA 4IX3A 4BIDA 3OFMA 1XMMA 5CI7A 2NNWB 4L8MA 4WBBB 4EH3A 2WHBA 3MDYA 4EZ5A 2R3RA 4UN0C 5BMSA 3TV6A 3TNWA 3CY3A 3UIMA 4KIPA 4O84A 3PJ3A 4GS6A 3UNJA 3DJ7A 4FOBA 5CALA 5CANA 1ZARA 3OXZA 2IZSA 4Y8DA 3FY2A 4AAAA 5BVOA 1WBWA 2OXDA 5DG5A 1YVJA 3DBEA 3FMLA 2PE2A 4NFNA 2Y4IB 2GHMA 2R3OA 3MIAA 2I6LA 2P2HA 4TYGA 5AP1A 5AP4A 4RIWB 4MNFA 4IM0A 2W99B 1BI7A 1SNXA 3CBLA 4J99A 4QMXA 3TT0A 3V5TA 1W8CA 3QZHA 4TY1A 3MI9A 5TR6A 3LJ2A 2GSFA 5LMAA 3RM6A 3TJDA 5DOSA 1WBPA 3O71A 2VWVA 3N4TA 3ANRA 2I7QA 4GYGA 3DT1A 3R8UA 4C58A 4D1SA 3L8XA 3N4UA 2C0OA 4LV8A 4ANLA 1H26A 3EFWA 2V7OA 4YR8A 4GUEA 3PJ8A 4BHZA 4JL9A 3VBTA 2XKCA 2RFNA 4D2SA 3HEGA 2BZJA 3KRLA 4H58A 4TXCA 3HDNA 1XBAA 4C4EA 4IJPA 3K5VA 1W98A 2C6DA 3PDTA 4L53A 4JOAA 3HDMA 4FKOA 3KF7A 5AWMA 3MFUA 2XKEA 4LRJA 4O83A 3DPKA 3DAJA 1BMKA 1OVEA 4MXCA 2X8DA 4X21A 3R2BA 1WBSA 4MUQA 2RFEA 4ZXTA 3QHWA 3O17A 5E1EA 4II5A 4WNPA 2YAKA 3MY1A 4ACGA 3F7WA 4BCQA 3NNUA 1H1QA 4KS7A 5DRBA 5KHXA 3B8QA 3TIZA 5HTBA 4EWQA 3FLWA 4XUFA 5L2SA 4D4VA 1CMKE 3FLYA 4TZRA 3WYYA 2VTHA 2XYUA 5IQGA 5AP2A 2CHLA 5AV0A 3TDVA 3WIGA 4ZTRA 2E9NA 4TWNA 3TXOA 5BVWA 5M4FA 3PZHA 3CPBA 2CKPA 3TUBA 2YHVA 2BIYA 2YDIA 3C0IA 5ETCA 5HCXA 3W0RA 4O0YA 4LGGA 4UZHA 3ANQA 3CLYA 3KXGA 5JZJA 1V0OA 4N0SA 4N6ZA 4NWMA 3RJCA 1ZMWA 3BGZA 3DXQA 1SVGA 4FKQA 4FKWA 5KMLA 1LPUA 5TKDA 4FSQA 3VIDA 4LMUA 4NL0A 3R9RA 5ACKA 3TEIA 3PSCA 1M52A 2HZ4A 2WTIA 2IVVA 4FIJA 4IC7A 5DE2A 5AV1A 4Z7GA 2C5VA 2FO0A 2VO6A 3UQFA 5D9HA 1PXPA 1Q5KA 2X4FA 4YC8A 2F2CB 4E6QA 2B53A 3NUSA 1BL6A 4EC9A 3VW8A 4C0TA 1OB3A 4QYEA 3QXOA 4Y72A 2J6MA 3I7BA 3KL8A 4MBLA 1Q8ZA 4AGDA 3FMKA 4FNYA 3GCUA 3QF9A 4U0IA 2G2IA 4U3YA 2LAVA 3C4CA 3EIDA 5ICPA 4FTKA 5HG5A 3NIZA 4UWYA 4ZSAA 1CTPE 2VWWA 1XWSA 2OWBA 4QMZA 3COMA 2XAMA 4I6BA 4EK4A 4PP7A 2FSOX 4YZCA 2OK1A 3MYGA 1ERKA 4R1YA 1H4LA 2ONLC 2EB3A 2W5AA 2F2UA 4GK2A 1CM8A 5EQPA 2OU7A 2QCSA 3SV0A 2ZDTA 4WT6A 3ZRLA 5ETAA 3NS9A 3BHVA 2WAJA 1MRVA 1R0EA 3POOA 4PL5A 4HJOA 2NPQA 4HNFA 3RVGA 3VS5A 1W83A 3KFAA 4LDTA 4ZTLA 5IUHA 3QD4A 2IW6A 3A4OX 4FKRA 3FPQA 3DKOA 1LUFA 2VRXA 2WMTA 3W0SA 3CJGA 1R3CA 4YLJA 3OXTA 4FV1A 1IG1A 2WEIA 5CU2A 2VX0A 4A4XA 4EJNA 5IH5A 3AT3A 3CQEA 2JEDA 4FI1A 4JR3A 4TT7A 4CV8A 3PFYA 2NRUA 4IZ5A 5A4EA 1ZYLA 4TYEA 2GTNA 2ZM1A 4OBQA 5EI6A 3HUBA 3LFEA 2C5NA 4FV9A 3ZFYA 5IQFA 3PPZA 3PA5A 5DA3A 5IMEA 3BEGA 3NYVA 2C68A 3UO6A 4GIHA 3OCSA 1NVSA 4NTSA 2XB7A 5EFQA 3R7OA 5A9UA 3LQ8A 5LMKA 3R7IA 2UW0A 2QG7A 1QCFA 4U43A 5E4HA 5IU2A 3CTJA 3PXKA 3DAEA 4KBKA 3UZRA 4L00A 4I41A 1PF8A 3HL7A 4L7SA 4I20A 3MV5A 4AA4A 5HIDA 2BZKB 2C6OA 2WMSA 4BCFA 3WARA 2I1MA 3HV7A 3C9WA 1VEBA 3FMDA 2XNGA 2G9XA 2PZ5A 3QAME 4BHNA 3SQQA 3NNWA 3VHKA 4YSJA 5F9EA 2WMXA 3NW5A 1W7HA 4GKHA 3I0QA 4WOVA 3PXYA 4J7BA 4QP8A 5HCYA 5CEKA 4XG7A 4ZLOA 1J7UA 5AUUA 3S1HA 1TQPA 5FD2A 3UOJA 4ZIMA 4RX8A 3IKAA 4CFFA 1JKLA 1WBTA 5HG9A 3EQGA 4A06A 4CGAA 3G90X 3BGQA 3KXXA 1OL1A 4NYEA 4GFOA 4R5YA 1LEWA 1PW2A 3Q9YA 5M56A 4YNOA 2XH5A 3FAAA 2ZYBA 5JRSA 5LMKC 2RKUA 4FTIA 4M8TA 3FI4A 2I0HA 5DVRA 2PYWA 3D5VA