1A8EA

Human serum transferrin, recombinant n-terminal lobe
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron transport
molecule keywords SERUM TRANSFERRIN
publication title Two high-resolution crystal structures of the recombinant N-lobe of human transferrin reveal a structural change implicated in iron release.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 329
sequence length 329
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a8eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a8eA02
1WDNA 4NF8A 4AB5A 4HCYA 4YKJA 3QAXA 3H6WA 2Q88A 3KSJA 1ELJA 1OIBA 1DTGA 4FATA 3KOSA 4KHZE 2GHAA 3IORA 1Y4CA 5I56B 3DELB 4F2OA 4YICA 4YB6A 3EHSA 4GFRA 3DM0A 3QYTA 4WXJA 3T9XB 3A3CA 4QFOA 4WEPA 4U22A 1FQEA 3D4GA 3T66A 3OO6A 5I56A 3KN7A 5TPAA 4RYAA 2ZNSA 4OEUA 3UGWA 1A99A 3TDJA 3RPWA 1D9VA 3EN3A 3C34A 4LP2B 4IGRA 2DSFA 3THIA 3IB0A 1URGA 3K00A 4YB5A 4OQOA 3PD8A 5B70A 1ZTYA 3OEMA 4H67A 4XKPA 3QIMA 1JEVA 4R74A 3GBAA 1URSA 2QPQA 2O6AA 1OLAA 3EHUA 3UP9A 5HBCA 4GXAA 3N6TA 3G3KA 4M1VA 3O2AA 4ZZAA 5JK4A 2VGQA 1YCJA 4JXIA 4PP0A 1B3LA 1RYXA 3VLUA 5I57B 2PT2A 4OYVA 4RPNA 4KI0E 4ZZEA 1MPCA 2DVZA 3K1MA 4POWA 3O66A 3S9NC 3SERA 3UORA 2F34A 4ZS9A 3MVWA 1SW1A 4GQOA 1JNFA 1IQ7A 1MQDA 3IL1B 3FASA 4DCXA 2F7AA 2Q2CA 1XC1A 3CFXA 1VE4A 1AIVA 3OO7A 2ANJA 2HCAA 4EQ7A 1M5DA 5H8NA 2F97A 1LCTA 4U1OA 2ZXTA 2Q89A 1DPPA 4N6PA 5IKBA 3RGYA 1JQFA 1Y20A 4OVJA 2P2AA 2I4BA 3DLNA 3PD9A 1IZ1A 3C35A 1POY1 3TFLA 5DTBA 3PV0E 1Y3PA 3MC2A 1OVTA 5M2VA 5ICQA 4P0IA 4JWYA 1MS7A 2XD3A 2VD2A 2B65A 2H98A 3IOWA 4OESA 1M5CA 5DEXB 4QSDA 3BFUA 1MRPA 4OXVA 3O29A 3QXMA 1B0HA 2ZYMA 3S2VA 1VFDA 3H06B 1LAHE 3Q25A 5ITOA 1NH8A 4ECFA 1PC3A 2UVHA 3Q29A 1B6HA 1FTLA 2XHDA 1AOVA 3ODBA 3LR1A 4OFJA 4EF1A 4R6HA 2H99A 3IOVA 4XXUA 2W7YA 2X7PA 1QUIA 1ZU0A 3L6GA 3LSLA 5L9SA 1JW4A 2Z23A 5JEIA 4F22A 2E0SA 1QULA 1XT8A 1S50A 2ZNUA 4O3CA 3K01A 1LB9A 2H25A 2QSXA 1IIWA 3FVGA 2D21A 4DZ1A 2O1MA 1UQWA 5ELVA 1MM7A 5ICTA 3CFZA 2OLBA 4KCDA 2IA4A 1MM6A 3FIRA 4RK2A 3QUJA 1MY0A 3OMBA 1CB6A 2RKMA 3U72A 1R6ZA 3TUSA 3DP8A 4MLVA 4TLLB 3U94A 2NOOA 4NF6A 3QUFA 4P11A 2XXTA 3FVKA 4TOZA 1VFEA 3K0VA 4QFKA 1XOCA 3HO7A 1B7ZA 4QFPA 3T9VA 1A55A 4FEDA 3TYHA 1SW2A 3I3VA 4ELOA 3LC8A 1SYHA 3SETA 4AB6A 3R26A 4LZ7A 4NTLA 1D4NA 1P1QA 1Y9UA 4YB7A 2XXUA 2Y7KA 2YJPA 5JTYB 3PMXA 4MF3A 1FQFA 2UVIA 1H45A 2VP1A 4PFUA 2E1SA 1PBPA 3PMWA 2F7CA 2QL3A 4F29A 2CMOA 2FYIA 5DYHA 4XKNA 1EZOA 3KJ7A 4H5FA 3T22A 1P1WA 2PT1A 1F9BA 2Y7RA 1MY1A 1IITA 4QHQA 4MBPA 1MQHA 2I49A 4GWOA 5H8QA 4DXBA 1MQJA 3KGCA 4MFIA 2O68A 4AQ4A 1Q35A 4JDFA 5CI5A 4RPOA 3BFTA 1LLSA 3IB1A 3SEWA 2VHAA 3EPEA 3K1NA 3MUQA 3VDFA 2FA7A 2DWIA 1ZBMA 4NEDA 4NF4B 3MJNA 3MWBA 3IB2A 1Y4TA 4E0XA 3PUWE 3K6WA 3O6IA 1M5BA 3CG3A 1D9YA 4PFWA 4POXA 5CMKA 2DVCA 4LA9A 5I2NA 3TZAA 4F1YA 4R9GA 4DE8A 1TXFA 1EU8A 3LSXA 1I6BA 4F39A 4EDPA 1ZJLA 3KSXA 2YLNA 2DE2A 4DXCA 3QSLA 3IJXB 3TKDA 3U92A 3KN3A 3W9VA 3IR1A 1IUDA 3G3FA 4IO5A 4JWOA 1SDXA 1LB8A 5I84A 1KWHA 1B7HA 1SVXB 1WODA 2DXRA 5AA1A 3RLFE 1QUJA 5CMBA 4GD5A 1LBBA 4U4SA 1Y3NA 4QFNA 5I59B 4ELPA 4C1UA 4BDRA 3PMVA 2Z8FA 4G4PA 4R2FA 4ZE9A 4ZEFA 1O7TA 4IB2A 4G8HA 3K6XA 3ZKKA 1B3EA 2XXPA 5I2KA 1B3HA 2ZMBA 4XIGQ 2I4CA 2O51A 1EZPA 2GHBA 2XX9A 3RTFB 1Z7ME 3H03A 3O6HA 4ZE8A 4RXLA 4X1DA 1EZ9A 1SI1A 5I59A 5TPAB 1T0KA 5HPQA 1B1HA 2V3QA 3I6VA 3DP6A 1SBPA 1N0TA 1TFAA 2F36A 4IO2A 3EHTA 4BDMA 4H1XA 4IO6A 4R2BA 3MPLA 2Q9TA 1RYOA 1FQCA 2HAVA 1A54A 3H7MA 3TEPA 3MAMA 4BDOA 1FTMA 4MH5A 3PPNA 4N07A 5A5XA 2ZYOA 1SD3A 2H9BA 3MVZA 3OELA 2PMSA 4XTCQ 3SDFA 2QRYA 4ELQA 5HM4B 4GLIA 3C31A 1N84A 4HS7A 3HN0A 3G3IA 4KFQA 2I0CA 2XXQA 3MQ9A 2DQVA 2XXYA 4ZEIA 3WAFA 4IO4A 2RC9A 4H8IA 1B3FA 1AH5A 3KN8A 4Q8RA 4F3BA 3CVGA 4THIA 1UIUA 3H6VA 3H4ZA 4DDDA 2DP8A 5AE4A 3C4MA 1D3KA 1LBCA 4TLMB 1MXYA 4F31B 3E9XA 4ZEKA 3RTWB 2OCUA 1OMPA 2REJA 2A5TB 2R9JA 4JWXA 3O97A 4YKKA 4ESXA 1MY2A 3S4UA 1POTA 4NWCA 4LUBA 4LZ8A 3CI8A 1QW0A 2UXAA 1NNKA 3R7XA 3H6UA 1B5HA 2I48A 2UYFA 5H8NB 2O1LA 3O6GA 5BWJA 3DP4A 3OSQA 1P1NA 3TQLA 3VFJA 2A5TA 4PETA 3MVYA 1LFHA 1N7XA 2QMWA 1MXWA 3OENA 1B32A 3S9LC 4LONB 3K6VA 3TPAA 2I58A 3MZ9A 2P0SA 4DXUA 1B52A 4X1BA 2O7IA 1JW1A 2M8CA 1B05A 3CSBA 5CM6A 2GFEA 5FHOA 1US4A 2NXOA 2I3WA 4OMBA 2RCBA 1WVJA 5AA2D 3UN6A 4EQBA 5I58B 4OEVA 4OWDA 3ZSFA 2GRVA 2I6EA 4EUOA 1B4ZA 4PFYA 2H4IA 5KDTB 3V5AA 1PEBA 1Y1ZA 3T93B 3FXUA 4R75A 1B2HA 3SEUA 3FATA 1YPNA 4RJZA 3P7IA 3E13X 2HQ0A 5I58A 1OVBA 2F78A 4HTGA 5H8SA 3Q27A 3WAEA 1S7YA 2NUVA 3B6QA 4YAHX 1MDP1 1I69A 1DSNA 1Y1MA 5KDTA 2O7UA 3ZKLA 1SW5A 3UIFA 3TMGA 2HAUA 2XXXA 4WEDA 1RKMA 3C32A 3KG2A 3OO9A 2Q2AA 2RINA 3PPOA 3VXBA 4DLDA 1NL5A 2O84X 3G3GA 4KR5A 3D4CA 5IAIA 4NF6B 5H8HA 3MZ1A 2ZNTA 4QSEA 3F11A 3PUVE 4F2QA 1VR5A 3GZGA 2XXRA 1FW0A 3GBBA 2DOJA 1FQBA 1UTBA 1NFTA 2XXWA 3GXAA 4IO7A 1IXHA 2R71A 1LAFE 4PE5B 1I6QA 1R1NA 4KD5A 3M3KA 4F3PA 4I9DA 2ONKE 4TQUQ 3V8XB 1DPEA 2XXIA 2VOZA 1ANFA 4ELRA 1LFIA 2RC7A 3N5LA 3CFLA 4KPTA 1PDAA 3U1OA 1UTHA 4FORA 1PBQA 3SEVA 5L8DA 1QKBA 2LAOA 5L9MA 1DOTA 4LZ5A 1FCKA 3IO4A 3JYRA 4ESWA 4Z0IA 3L6HA 3VV5A 3TCHA 4F3GA 3ILTB 3BKIB 3HV1A 3N94A 4OENA 2R6GE 1EH3A 3EF7A 4F19A 4GOTA 3CR9A 1B5IA 2QJEA 4KCCA 4YMBA 5H8QB 5BUUA 3C36A 4Q0CA 1B58A 4Z7EA 1MH4A 3LUYA 4C1TA 1LFGA 4M4GA 3S9EA 4JSDA 1R9QA 3ILUB 4I1DA 3FV2A 2DS9A 5FTIA 3TTNA 2F5XA 2F6PA 1MQGA 1OQHA 2V93A 3RQTA 4UA8A 4IO3A 1MXUA 1PB7A 4N13A 5B7DA 2XX8A 1P1UA 2OJTA 3PUXE 1B1XA 4JB7A 4R9FA 3B7DA 5L9OA 2DWHA 2DXYA 1A8EA 5I2NB 1NNPA 4KYEA 2XD2A 4OTEA 2ESNA 2DWJA 1MPDA 3FZVA 3K2DA 2I3VA 2NWJA 4Q30B 2OWTA 3USDA 3IO6A 1N3XA 2RCAA 4BDNA 4IY5A 3IOTA 4KYDA 4FJPA 3JZJA 3A09A 1TT1A 3FVOA 5EHMA 1MY3A 3FJGA 1Q1KA 3TTKA 1PB8A 2DYXA 2QS3A 1A7LA 3N6UA 3TODA 5TP9A 4FE8A 3Q28A 3OXNA 3C33A 3RT8A 2AL4A 4YZZA 1LAXA 1BTJA 4QFLA 1XVXA 3O28A 2HFBA 1ZIUA 3HSTA 3G3HA 2ZYKA 1H44A 5I2KB 1MXVA 2PBWA 4LVQA 1MXXA 4F1UA 1DMBA 3TCFA 4FECA 3UK4A 4OFOA 1GR2A 4XKQA 3N26A 1TFDA 3ECRA 1NNTA 3E4RA 2F8DA 3FGSA 4ND9A 2G29A 3HCQA 3T9UA 3TAJA 5AA3A 2QS4A 5K2YA 1H43A 1O63A 2DE4A 5DVIA 3H3GA 1A40A 2A5SA 4WKMA 2DWAA 2I0BA 3M3FA 4IGTA 3TTRA 3MP8A 4G77A 5KCJA 3K1PA 1JEUA 1FQAA 3SESA 3TELA 4JBZA 3I5OA 1GGGA 5TU0A 5A5XB 2Y7IA 3OSRA 4YKIA 1M5EA 4U21A 1O64A 1OLCA 2O69A 2X26A 3ONMA 4EQ9A 4BLAA 5AA2B 2HZKA 3PGFA 4RY1A 1II5A 3V83A 1IXGA 4PQJA 3JV9A 3MZBA 4K3FA 5ISUA 1H3DA 1B0LA 3SEYA 3QK6A 3G3JA 3TTLA 3T96B 5AA2A 4F1VA 2D3IA 1SYIA 3VLWA 2CZLA 4G8MA 2OZZA 4G68C 3EQ1A 3OO8A 4LQ2A 4YU0A 3Q26A 2PVUA 1FTOA 3H6TA 4OERA 1QJMA 1Z7NE 4EF2A 4GL0A 2Z22A 1J1NA 1BP5A 5LOMA 4L17A 1HSJA 3K6UA 1QUKA 3V89B 1B4HA 1YAEA 3CIJA 1TWYA 4I8CA 4UACA 4O3BA 4NMYA 1AMFA 2OK2A 1BIYA 2KLFA 5ITPA 2ZYNA 5CMMA 4OHNA 3TQWA 3G7WA 3MBPA 2VD3A 1MY4A 2ABHA 4IY6A 4QF9A 3RUMA 4BDLA 4R72A 3HHGA 4EXLA 2PX1A 3MP1A 4DIGA 4ZEDA 3AXFA 4H5GA 3KEIA 1A8FA 5K2XA 2AIXA 2WKYA 4MLQA 4OFLA 5I57A 1H76A 2UVJA 3CG1A 1SI0A 4LATA 4RA1A 2X7QA 4GVOA 4H0WA 3FJ7A 3VE1B 1BLFA 4FIMA 2XXVA 3W15C 1B5JA 2F6GA 3SEXA 5DT6A 2D5WA 3VLVA 5KZTA 2OBGA 5J1DA 3PPQA 3PPRA 3PPPA 4U1ZA 1LAGE 4O3AA 4E0WA 2B3FA 5CBSA 4G2ZA 1FQDA 1DTZA 4OETA 2V3TA 4RNSA 2BJJX 1BKAA 1XS5A 2XX7A 2YPNA 1GTKA 3ZS6A 2DE3A 2HXWA 1IXIA 4YMAA 2QMXA 2IEEA 5CC2A 1S9TA 4NF5B 5H8HB 1JVYA 1B46A 4RK9A 3RN8A 4ISUA 1JVXA 3IX1A 1IEJA 4DCYA 1GV8A 3VVEA 4ZDMA 4FAJA 1US5A 3W9WA 3MP6A 1LGBC 5F1QA 1UTBB 4GXSB 5EHSA 5DEXA 1B51A 3FXRA 3KOTA 3OD7A 4NE4A 1MQIA 1M5FA 1MXZA 3MVXA 3LSFB 4NF5A 3B6WA 4F3SA 3PUYE 1SQYA 3MW0A 1AL3A 1MDQA 3TTMA 1USYE 1JW5A 1UTHB 4X48A 2F35A 3LSWA 4H6DA 1I6AA 3K02A 5CMCA 2OWSA 2Y84A 5H8FB 1URDA 2PYYA 5CRYA 1MH3A 4PFTA 3HPIA 1P1OA 1NKXA 3U8QA 2Y7PA 1N04A 3TCGA 3T9HB 4FEBA 3SKPA 4X9TA 1IXCA 1LCFA 1USYH 1YTVA 2ONSA 3PUZE 5H8FA 2QS2A 1QVSA 2P1SA 2F7BA 1UIVA 2XXHA 3IAZA 1ZMGA 4EXKA 3RT6B 1FTKA 1JETA 1OQGA 1SW4A 4HCWA 4I62A 4GF8A 2B3BA 3C9HA 2H5YA 3CRBA 2ONRA 4GRKA 1MPBA 1B3GA 1N7WA 2QS1A 2V84A 4KYSA 2Y7WA 5FHNA 5AA4B 4ONYA 2AYSA 3A3UA 3IK6B 2UYEA 4G68B 3U93A 1NMUA 4KQPA 2AL5A 1N3WA 5DVFA 1L5TA 2THIA 2Q8JA 3O9PA 1HSEA 4U23A 3RY3A 3E3KA 4NWDA 3VVFA 4JSOA 2NVUB 5JTYA 2V25A 2Z8EA 5AA4A 1P99A 4U4XA 2FNCA 4G68A 2G93A 1ATGA 4H65A 4HW8A 3FV1A 3KBRA 3IJOB 3VVDA 5DVJA 2GH9A 1MG1A 3BBRA 3S9MC 5TP9B 3LBSA 4ZECA 4U2RA 3CSGA 1LSTA 3GLBA 3FVNA 4ZEBA 5FHMA 4BDQA 1B40A 3VXCA 3K4UA 4Q5TA 4R6YA 1B9JA 1NNFA 1ZLQA 4R6KA 5CBRA 4C0RA 2Z8DA 4LQ5A 4OZ9A 1Y3QA 4XKRA 1PB9A 3OEKA 3M3LA 4GL8A 4NF4A 4H8JA 5FTHA 4GIZA 4QSCA 4YKPA 1N76A 3FXQA 1ZKBA 3FD3A 3KZGA 5KCJB 1GVCA 2UVGA 4G8NA 2HEUA 3OOAA 1B7UA 1VSOA 3B6TA 3KJTA 4NF8B 2RF1A 4F18A 2V3UA 1FTJA 3IOUA 4R73A 5F7VA 1XVYA 3PU5A 4P0GA 1HSLA 4QRZA 1XHYA 3KFMA 2ALUA 3FJMA 1CE2A 1R9LA 1NH7A 2REGA 3FUZA 1QKAA 3RNNA 3UA8A 2HZLA 3MPKA 5EYFA 3HHFA 3M8UA 2RC8A 3R6UA
chains in the Genus database with same CATH superfamily
1WDNA 4NF8A 4AB5A 4HCYA 4P1EA 1SPIA 4YKJA 3QAXA 3H6WA 2Q88A 3KSJA 1ELJA 5ESYA 4NN3A 1OIBA 1DTGA 4FATA 4PBHA 3KOSA 4KHZE 2GHAA 3IORA 1Y4CA 5I56B 3DELB 4F2OA 3KC1A 3GYYA 4YICA 4YB6A 3EHSA 4GFRA 3DM0A 3QYTA 4WXJA 3T9XB 4X04A 3A3CA 2B4LA 4QFOA 4WEPA 4U22A 1FQEA 3D4GA 3T66A 3OO6A 5I56A 4MMPA 3KN7A 5TPAA 5DW8A 4RYAA 2ZNSA 2CEXA 4OEUA 3IFAA 3UGWA 1FPIA 1A99A 4XEQA 3RPWA 1D9VA 3ISPA 3TDJA 4OVTA 3EN3A 3C34A 4LP2B 4IGRA 2DSFA 3THIA 3IB0A 1URGA 3K00A 4YB5A 4OQOA 3PD8A 2HHMA 5B70A 1ZTYA 3OEMA 4H67A 4XKPA 3QIMA 2P3VA 1JEVA 1LBZA 1FBEA 4R74A 3GBAA 1URSA 2QPQA 2O6AA 1OLAA 3EHUA 3UP9A 5HBCA 4GXAA 3N6TA 3G3KA 4M1VA 3O2AA 4ZZAA 4PFRA 5JK4A 2VGQA 1YCJA 4JXIA 4PP0A 1B3LA 1RYXA 3VLUA 4OVRA 5I57B 4MNCA 2PT2A 4OYVA 4RPNA 4KI0E 4ZZEA 1MPCA 2DVZA 3K1MA 4POWA 1YYZA 3O66A 3S9NC 3SERA 3UORA 1BK4A 2F34A 4ZS9A 3MVWA 1SW1A 4GQOA 5FBPA 1JNFA 2Q74A 1IQ7A 1MQDA 3B50A 3IL1B 3FASA 4DCXA 2F7AA 2Q2CA 1XC1A 3CFXA 1VE4A 1AIVA 3OO7A 2ANJA 2HCAA 4EQ7A 1M5DA 5H8NA 2F97A 1LCTA 4U1OA 2ZXTA 4HXVA 1EYIA 4P8BA 4GBVA 2Q89A 4O94A 1K9YA 1DPPA 4N6PA 5IKBA 3RGYA 1JQFA 1Y20A 1RDYA 4OVJA 5IZ1A 2P2AA 2I4BA 3DLNA 3PD9A 1IZ1A 3C35A 1POY1 3TFLA 5DTBA 3PV0E 1RDXA 1Y3PA 3MC2A 1OVTA 5M2VA 3T1BA 5ICQA 4P0IA 4JWYA 1MS7A 2XD3A 2VD2A 2B65A 2XWVA 2H98A 3IOWA 4OESA 1M5CA 5DEXB 1LBYA 4QSDA 1NV6A 3BFUA 5I5PA 1MRPA 2ZZXA 2WEFA 4GWWA 4OXVA 2QVRA 3O29A 3QXMA 1B0HA 2ZYMA 3S2VA 1VFDA 3H06B 1LAHE 3Q25A 3MSTA 5ITOA 1NH8A 4ECFA 1PC3A 2UVHA 3Q29A 1B6HA 1FTLA 2XHDA 1AOVA 3ODBA 3LR1A 4OFJA 4EF1A 4R6HA 2H99A 3IOVA 4XXUA 2W7YA 2X7PA 3FBPA 1QUIA 1ZU0A 3L6GA 3LSLA 5L9SA 1JW4A 2Z23A 5JEIA 4PDHA 3CHGA 4F22A 4IR8A 2E0SA 1QULA 4GWUA 1XT8A 2Q8MA 1S50A 2ZNUA 4O3CA 3K01A 1LB9A 2H25A 2QSXA 3IFCA 1IIWA 2ZZVA 3FVGA 2D21A 4DZ1A 2O1MA 1UQWA 4N6DA 1MM7A 5ELVA 5ICTA 3CFZA 2OLBA 4KCDA 2IA4A 1MM6A 3E79A 3FIRA 4RK2A 3QUJA 1MY0A 3OMBA 1CB6A 2RKMA 3U72A 1R6ZA 4XFEA 4N17A 3TUSA 5EQ8A 3DP8A 2QFLA 4MLVA 4TLLB 3U94A 2NOOA 4NF6A 3QUFA 4P11A 2XXTA 3FVKA 4TOZA 1VFEA 3K0VA 4QFKA 1XOCA 3HO7A 1B7ZA 4QFPA 3T9VA 1A55A 4FEDA 1IMFA 2BJIA 3TYHA 1SW2A 3BIHA 3I3VA 4ELOA 1NV0A 4PTKA 3LC8A 1SYHA 3SETA 4AB6A 3R26A 4LZ7A 4NTLA 1D4NA 1P1QA 1Y9UA 4YB7A 4OVQA 2XXUA 2Y7KA 2YJPA 5IM2A 5JTYB 3PMXA 4MF3A 1FRPA 2Y5KA 1FQFA 2UVIA 1H45A 1FPLA 2VP1A 4PFUA 2E1SA 1PBPA 3PMWA 2F7CA 1FBGA 2QL3A 4F29A 1NI9A 2CMOA 3RPLB 2KQZA 2FYIA 2OX3A 1YXIA 5DYHA 4XKNA 1EZOA 3KJ7A 4H5FA 3T22A 1P1WA 2PT1A 2PFZA 1F9BA 2Y7RA 1MY1A 1IITA 4QHQA 4MBPA 1MQHA 2I49A 4GWOA 1FSAA 5H8QA 3T0JA 4DXBA 1MQJA 3KGCA 4MFIA 1INPA 2O68A 2FHYA 4AQ4A 1NV4A 1Q35A 3RPLA 4JDFA 5CI5A 1D9QA 4RPOA 3BFTA 1LLSA 3IB1A 3SEWA 2VHAA 3EPEA 3K1NA 3MUQA 4N8GA 3VDFA 2FA7A 4P9KA 4N91A 4NAPA 2DWIA 1ZBMA 4NEDA 4NF4B 3MJNA 3MWBA 3IB2A 1Y4TA 4PC9A 4E0XA 3PUWE 3K6WA 3O6IA 1M5BA 3CG3A 2FVZA 1D9YA 4PFWA 4POXA 5CMKA 2DVCA 4LA9A 2XXKA 5I2NA 2DDKA 3TZAA 4F1YA 4R9GA 4GX3A 4DE8A 1TXFA 1EU8A 3LSXA 1I6BA 5F24A 4F39A 4EDPA 1ZJLA 3KSXA 2YLNA 2DE2A 4DXCA 3E78A 4JVIA 3QSLA 3IJXB 3TKDA 3U92A 3KN3A 3W9VA 4PGNA 3IR1A 1IUDA 3G3FA 4IO5A 1RDZA 4JWOA 1DCUA 1SDXA 4PFIA 1LB8A 5I84A 1KWHA 1B7HA 1SVXB 1WODA 4HE2A 2DXRA 5AA1A 3RLFE 1QUJA 5CMBA 4GD5A 1EYJA 1LBBA 4U4SA 1Y3NA 4NF0A 4QFNA 5I59B 4ELPA 4PF8A 4C1UA 4BDRA 3PMVA 2Z8FA 4G4PA 1EYKA 4MX6A 1QGXA 4PGPA 4R2FA 4ZE9A 4ZEFA 1O7TA 4IB2A 4G8HA 3K6XA 3ZKKA 1B3EA 2XXPA 5I2KA 1B3HA 2ZMBA 4XIGQ 3KC0A 2I4CA 2O51A 4GBWA 1EZPA 4NQ8A 2WBBA 2GHBA 2XX9A 3B8BA 1LBWA 3RTFB 1Z7ME 3H03A 3O6HA 4ZE8A 4RXLA 4X1DA 1EZ9A 1SI1A 5I59A 4PAIA 5LTCA 5TPAB 1T0KA 5HPQA 1B1HA 4OA4A 2FIEA 2V3QA 3I6VA 3DP6A 5I7IA 1SBPA 4DI3D 5J16A 2JJKA 1N0TA 1TFAA 2F36A 4IO2A 3EHTA 4BDMA 4H1XA 4IO6A 1FBDA 4R2BA 3MPLA 2Q9TA 1RYOA 1FQCA 2HAVA 1A54A 3H7MA 3TEPA 3MAMA 4BDOA 1FTMA 1FPJA 4MH5A 3PPNA 4N07A 5A5XA 2ZYOA 1SD3A 2H9BA 3MVZA 3OELA 2PMSA 4XTCQ 3SDFA 2QRYA 4ELQA 5HM4B 4GLIA 3C31A 1N84A 4HS7A 3HN0A 3G3IA 4KFQA 2I0CA 2XXQA 3MQ9A 1DK4A 2DQVA 2XXYA 5ET7A 4ZEIA 3WAFA 4IO4A 2RC9A 4H8IA 1B3FA 1AH5A 3KN8A 4Q8RA 4F3BA 3CVGA 4THIA 1UIUA 3H6VA 3H4ZA 1NV5A 4DDDA 1FJ9A 2DP8A 5AE4A 4I40A 3C4MA 1D3KA 1LBCA 4TLMB 1MXYA 4F31B 4P1LA 3E9XA 4ZEKA 3RTWB 2OCUA 1OMPA 2REJA 4NG7A 2A5TB 2R9JA 4JWXA 3O97A 4YKKA 4ESXA 1MY2A 3S4UA 1POTA 4NWCA 4LUBA 4LZ8A 3CI8A 1QW0A 2UXAA 1NNKA 3R7XA 3H6UA 1B5HA 4MAGA 2I48A 2UYFA 5H8NB 2O1LA 3O6GA 5BWJA 3DP4A 3OSQA 1P1NA 4O7MA 3TQLA 4DI4B 2FIXA 3VFJA 2A5TA 4PETA 3MVYA 1LFHA 2MKZA 1N7XA 2QMWA 1MXWA 3OENA 4MJOA 1B32A 3S9LC 4LONB 3K6VA 3TPAA 2I58A 2QVUA 3MZ9A 2P0SA 4HE0A 4DXUA 5LDZA 1B52A 4GX4A 4X1BA 2O7IA 1JW1A 2M8CA 2PCRA 1B05A 3CSBA 5CM6A 2GFEA 5FHOA 5IGAA 4PAKA 1US4A 2NXOA 2I3WA 4OMBA 2RCBA 1WVJA 5AA2D 3UN6A 4EQBA 5I58B 4OEVA 4OWDA 3ZSFA 2GRVA 2F3DA 2I6EA 4EUOA 1B4ZA 4PFYA 2H4IA 5KDTB 3V5AA 1PEBA 1Y1ZA 3T93B 3FXUA 4R75A 1B2HA 3SEUA 3FATA 1YPNA 4RJZA 3P7IA 3E13X 2HQ0A 5I58A 1OVBA 2F78A 4HTGA 5H8SA 3Q27A 3WAEA 1S7YA 2NUVA 3B6QA 4YAHX 1MDP1 1I69A 1NUWA 1NV1A 1DSNA 1Y1MA 5KDTA 2O7UA 3ZKLA 4GWYA 1SW5A 3UIFA 3TMGA 2HAUA 2XXXA 4WEDA 1RKMA 3C32A 3KG2A 1JP4A 3OO9A 2Q2AA 2RINA 3PPOA 3VXBA 1FPGA 4DLDA 1NL5A 2O84X 3G3GA 4KR5A 3D4CA 5IAIA 4NF6B 5H8HA 3MZ1A 2ZNTA 4QSEA 3F11A 3PUVE 4JVDA 4PCDA 4F2QA 2GQ1A 1IMBA 1VR5A 3GZGA 1DBZA 4GX6A 2XXRA 3A29A 1FW0A 3GBBA 2WX9A 2DOJA 1FQBA 1UTBA 1NFTA 2XXWA 2VPOA 1LBXA 1FTAA 2F3BA 3GXAA 4IO7A 1IXHA 2R71A 1LAFE 4PE5B 1I6QA 4FBPA 1R1NA 4KD5A 3M3KA 4F3PA 4I9DA 2ONKE 4I3YA 4TQUQ 3V8XB 3QMFA 4GWSA 2CZKA 2CEYA 1DPEA 2XXIA 2VOZA 1ANFA 3FXBA 4ELRA 1LFIA 2RC7A 5IZ3B 3N5LA 3CFLA 4KPTA 1PDAA 3U1OA 1UTHA 2V4CA 4FORA 1PBQA 3SEVA 5L8DA 1QKBA 2LAOA 4QXDA 5L9MA 1NV3A 2R8TA 1DOTA 4P56A 4LZ5A 1FCKA 3IO4A 3JYRA 4ESWA 4Z0IA 3L6HA 1NV7A 3VV5A 3TCHA 4F3GA 3ILTB 3BKIB 3HV1A 3N94A 4OENA 2R6GE 1EH3A 3EF7A 5IZ3A 4F19A 4GWXA 4GOTA 3CR9A 1B5IA 2QJEA 4KCCA 4YMBA 5H8QB 5BUUA 3C36A 4Q0CA 1B58A 2Y5LA 4Z7EA 1MH4A 3LUYA 1G0IA 4C1TA 1LFGA 4M4GA 3S9EA 4JSDA 1R9QA 3ILUB 4I1DA 3FV2A 2DS9A 5FTIA 3TTNA 2F5XA 2F6PA 1YZ0A 1MQGA 1OQHA 4NX1A 2V93A 3RQTA 4UA8A 4IO3A 1MXUA 2OWZA 1PB7A 4N13A 5B7DA 2XX8A 1P1UA 2OJTA 3PUXE 1B1XA 1KA0A 4JB7A 4O8MA 4R9FA 3B7DA 5L9OA 2DWHA 2DXYA 1A8EA 5I2NB 1NNPA 4KYEA 2XD2A 4OTEA 1NUYA 2ESNA 3D1RA 2DWJA 1MPDA 3FZVA 3K2DA 2I3VA 2NWJA 4P3LA 4Q30B 3SZPA 2OWTA 3USDA 3IO6A 2HXRA 1N3XA 2RCAA 4OVSA 4BDNA 4IY5A 3IOTA 4KYDA 3NOHA 4FJPA 3JZJA 2KR0A 1FBHA 3A09A 4NHBA 1TT1A 3FVOA 5EHMA 1MY3A 3FJGA 1Q1KA 3TTKA 1PB8A 2DYXA 2QS3A 1A7LA 3N6UA 3TODA 5TP9A 4FE8A 3Q28A 3OXNA 3C33A 3RT8A 2AL4A 4YZZA 1LAXA 1BTJA 4XF5A 4QFLA 1XVXA 3O28A 2HFBA 1ZIUA 3HSTA 3G3HA 2ZYKA 1H44A 5I2KB 1MXVA 2PBWA 4LVQA 1MXXA 4F1UA 1DMBA 3TCFA 4FECA 3UK4A 4OFOA 1GR2A 4XKQA 3N26A 1TFDA 3ECRA 1FPFA 2XWIA 1NNTA 3E4RA 2F8DA 2CZHA 3FGSA 4ND9A 2G29A 3HCQA 3T9UA 4PFBA 3TAJA 5AA3A 2QS4A 5K2YA 1H43A 1O63A 2DE4A 5DVIA 3H3GA 1A40A 2A5SA 4LN5A 4WKMA 2DWAA 2I0BA 3M3FA 4OANA 4IGTA 3TTRA 3MP8A 4G77A 5KCJA 3K1PA 1JEUA 1FQAA 5EQ9A 3SESA 3TELA 4JBZA 4PAFA 3I5OA 1GGGA 5TU0A 5A5XB 2Y7IA 3OSRA 4YKIA 1M5EA 4U21A 1O64A 1OLCA 2O69A 2X26A 3ONMA 4EQ9A 4BLAA 5AA2B 2HZKA 3PGFA 4RY1A 1II5A 3V83A 1IXGA 4PQJA 3JV9A 3MZBA 2XWOA 4K3FA 5ISUA 1H3DA 1B0LA 3SEYA 3QK6A 3G3JA 4X8RA 3TTLA 3T96B 2VPNA 4P47A 5AA2A 4F1VA 2D3IA 5EYGA 1SYIA 1VDWA 3VLWA 1LBVA 2CZLA 4G61A 5T3JA 4G8MA 2OZZA 4G68C 3EQ1A 3OO8A 4LQ2A 4YU0A 2ZZWA 3Q26A 2PVUA 1FTOA 2PFYA 3H6TA 4OERA 1QJMA 1Z7NE 4EF2A 4GL0A 2Z22A 1J1NA 1BP5A 5LOMA 4L17A 1HSJA 3K6UA 1QUKA 4AS4A 3V89B 4H45A 1B4HA 1YAEA 3CIJA 1TWYA 4I8CA 4UACA 4O3BA 4NMYA 1KZ8A 1AMFA 2OK2A 4MNIA 1BIYA 2KLFA 5ITPA 2ZYNA 4OVPA 5CMMA 4OHNA 3TQWA 3G7WA 1FPEA 3MBPA 2VD3A 1MY4A 2ABHA 4IY6A 4QF9A 1AWBA 3RUMA 4BDLA 4R72A 3HHGA 4EXLA 2PX1A 3MP1A 4DIGA 4ZEDA 3AXFA 4H5GA 3KEIA 1A8FA 5K2XA 2AIXA 2WKYA 4AS5A 4MLQA 4OFLA 5I57A 1H76A 2UVJA 1NUXA 3CG1A 1SI0A 4LATA 4MNPA 4RA1A 2FBPA 2X7QA 4GVOA 4H0WA 3FJ7A 4I3EA 3VE1B 1BLFA 4FIMA 2XXVA 3W15C 1B5JA 2F6GA 3SEXA 5DT6A 2D5WA 3VLVA 4PDDA 5KZTA 2OBGA 5J1DA 3PPQA 3PPRA 3PPPA 4U1ZA 1LAGE 4O3AA 1IMDA 4E0WA 2B3FA 5CBSA 4G2ZA 1FQDA 1DTZA 4OETA 2V3TA 4RNSA 2BJJX 1BKAA 1XS5A 2XX7A 4N81A 4N15A 2YPNA 2QVVA 1GTKA 3ZS6A 2DE3A 2HXWA 1IMAA 1IXIA 4YMAA 2QMXA 2IEEA 5CC2A 1S9TA 1LEVA 4NF5B 5H8HB 1JVYA 4KXPA 1B46A 4RK9A 3RN8A 4ISUA 3U65A 1JVXA 3IX1A 2B4MA 1FPDA 1IEJA 4DCYA 1GV8A 2VT5A 4ZDMA 3VVEA 4FAJA 1US5A 3W9WA 3MP6A 1LGBC 5F1QA 1UTBB 4GXSB 5EHSA 5DEXA 1B51A 1NV2A 3FXRA 1FBCA 3KOTA 3OD7A 4NE4A 1MQIA 1M5FA 1MXZA 3MVXA 3LSFB 4NF5A 3B6WA 4F3SA 5ET5A 3PUYE 1SQYA 3MW0A 1AL3A 1K9ZA 1MDQA 3TTMA 1USYE 3LUZA 1JW5A 5EYHA 1UTHB 3MYUA 4X48A 2F35A 4JVCA 3LSWA 4H6DA 1I6AA 3K02A 5CMCA 2OWSA 2Y84A 5H8FB 1URDA 4HE1A 2PYYA 5CRYA 1MH3A 4QBAA 4PFTA 3HPIA 1P1OA 1NKXA 3U8QA 2Y7PA 1N04A 3TCGA 3ROJA 2P3NA 3T9HB 4FEBA 1KA1A 3SKPA 4X9TA 4GWZA 1IXCA 1LCFA 1USYH 1G0HA 1YTVA 2ONSA 3HFUA 3PUZE 5H8FA 2QS2A 1QVSA 2P1SA 2F7BA 1UIVA 5A5LA 1FPBA 2XXHA 3IAZA 1ZMGA 4PF6A 4EXKA 4N4UA 3RT6B 2L5VA 3KBZA 1FTKA 1JETA 1OQGA 1SW4A 4HCWA 4I62A 4GF8A 2B3BA 3C9HA 2H5YA 3EKIA 3CRBA 2ONRA 4GRKA 1MPBA 1B3GA 1N7WA 2QS1A 2V84A 1XI6A 4N6KA 4KYSA 2Y7WA 5FHNA 5AA4B 4ONYA 2AYSA 2WYPA 3RYDA 3A3UA 3IK6B 2UYEA 4G68B 3U93A 1NMUA 4KQPA 2AL5A 1N3WA 5DVFA 1L5TA 2THIA 2Q8JA 3O9PA 1HSEA 4U23A 3RY3A 3E3KA 4NWDA 4MIJA 1FBPA 3VVFA 4JSOA 2NVUB 5JTYA 2V25A 2Z8EA 4O7IA 5AA4A 1P99A 4U4XA 2FNCA 4MHFA 4G68A 4N8YA 2G93A 1ATGA 4H65A 4H46A 4HW8A 3FV1A 3KBRA 2XWKA 3IJOB 3VVDA 5DVJA 1CNQA 2GH9A 5ET6A 2XA5A 1MG1A 3BBRA 3S9MC 5TP9B 3LBSA 4ZECA 4U2RA 5EQAA 1NUZA 3CSGA 5ET8A 1FJ6A 1LSTA 3GLBA 3FVNA 4ZEBA 4MCOA 5FHMA 4BDQA 1B40A 3VXCA 1FPKA 3K4UA 4Q5TA 4R6YA 2CZIA 1B9JA 2WYKA 1Q9DA 3BIGA 1IMCA 1NNFA 1ZLQA 4R6KA 5CBRA 4C0RA 5EQ7A 2Z8DA 4LQ5A 4OZ9A 1Y3QA 4XKRA 5IZZA 1PB9A 4UABA 3LV0A 3OEKA 3M3LA 4GL8A 2HPGA 4NF4A 4H8JA 5FTHA 4GIZA 4QSCA 4YKPA 1N76A 3FXQA 3PTYA 1IMEA 1ZKBA 3FD3A 3KZGA 5KCJB 1GVCA 2UVGA 4G8NA 2HEUA 3OOAA 1B7UA 4PE3A 1VSOA 3B6TA 3KJTA 4NF8B 2RF1A 4F18A 4PBQA 2V3UA 1FTJA 3IOUA 4NGUA 4R73A 5F7VA 1XVYA 5I3SA 3PU5A 4P0GA 1FBFA 1HSLA 4QRZA 1XHYA 3KFMA 2ALUA 3FJMA 1CE2A 1R9LA 4MEVA 1NH7A 2REGA 3FUZA 1QKAA 3RNNA 3UA8A 2HZLA 3MPKA 5EYFA 3HHFA 2WBDA 3M8UA 2RC8A 3R6UA
chains in the Genus database with same CATH topology
1WDNA 4NF8A 4AB5A 4HCYA 4YKJA 3QAXA 3H6WA 2Q88A 3KSJA 1ELJA 1OIBA 1DTGA 4FATA 3KOSA 4KHZE 2GHAA 3IORA 1Y4CA 5I56B 3DELB 4F2OA 4YICA 4YB6A 3EHSA 4GFRA 3DM0A 3QYTA 4WXJA 3T9XB 3A3CA 4QFOA 4WEPA 4U22A 1FQEA 3D4GA 3T66A 3OO6A 5I56A 3KN7A 5TPAA 4RYAA 2ZNSA 4OEUA 3UGWA 1A99A 3TDJA 3RPWA 1D9VA 3EN3A 3C34A 4LP2B 4IGRA 2DSFA 3THIA 3IB0A 1URGA 3K00A 4YB5A 4OQOA 3PD8A 5B70A 1ZTYA 3OEMA 4H67A 4XKPA 3QIMA 1JEVA 4R74A 3GBAA 1URSA 2QPQA 2O6AA 1OLAA 3EHUA 3UP9A 5HBCA 4GXAA 3N6TA 3G3KA 4M1VA 3O2AA 4ZZAA 5JK4A 2VGQA 1YCJA 4JXIA 4PP0A 1B3LA 1RYXA 3VLUA 5I57B 2PT2A 4OYVA 4RPNA 4KI0E 4ZZEA 1MPCA 2DVZA 3K1MA 4POWA 3O66A 3S9NC 3SERA 3UORA 2F34A 4ZS9A 3MVWA 1SW1A 4GQOA 1JNFA 1IQ7A 1MQDA 3IL1B 3FASA 4DCXA 2F7AA 2Q2CA 1XC1A 3CFXA 1VE4A 1AIVA 3OO7A 2ANJA 2HCAA 4EQ7A 1M5DA 5H8NA 2F97A 1LCTA 4U1OA 2ZXTA 2Q89A 1DPPA 4N6PA 5IKBA 3RGYA 1JQFA 1Y20A 4OVJA 2P2AA 2I4BA 3DLNA 3PD9A 1IZ1A 3C35A 1POY1 3TFLA 5DTBA 3PV0E 1Y3PA 3MC2A 1OVTA 5M2VA 5ICQA 4P0IA 4JWYA 1MS7A 2XD3A 2VD2A 2B65A 2H98A 3IOWA 4OESA 1M5CA 5DEXB 4QSDA 3BFUA 1MRPA 4OXVA 3O29A 3QXMA 1B0HA 2ZYMA 3S2VA 1VFDA 3H06B 1LAHE 3Q25A 5ITOA 1NH8A 4ECFA 1PC3A 2UVHA 3Q29A 1B6HA 1FTLA 2XHDA 1AOVA 3ODBA 3LR1A 4OFJA 4EF1A 4R6HA 2H99A 3IOVA 4XXUA 2W7YA 2X7PA 1QUIA 1ZU0A 3L6GA 3LSLA 5L9SA 1JW4A 2Z23A 5JEIA 4F22A 2E0SA 1QULA 1XT8A 1S50A 2ZNUA 4O3CA 3K01A 1LB9A 2H25A 2QSXA 1IIWA 3FVGA 2D21A 4DZ1A 2O1MA 1UQWA 5ELVA 1MM7A 5ICTA 3CFZA 2OLBA 4KCDA 2IA4A 1MM6A 3FIRA 4RK2A 3QUJA 1MY0A 3OMBA 1CB6A 2RKMA 3U72A 1R6ZA 3TUSA 3DP8A 4MLVA 4TLLB 3U94A 2NOOA 4NF6A 3QUFA 4P11A 2XXTA 3FVKA 4TOZA 1VFEA 3K0VA 4QFKA 1XOCA 3HO7A 1B7ZA 4QFPA 3T9VA 1A55A 4FEDA 3TYHA 1SW2A 3I3VA 4ELOA 3LC8A 1SYHA 3SETA 4AB6A 3R26A 4LZ7A 4NTLA 1D4NA 1P1QA 1Y9UA 4YB7A 2XXUA 2Y7KA 2YJPA 5JTYB 3PMXA 4MF3A 1FQFA 2UVIA 1H45A 2VP1A 4PFUA 2E1SA 1PBPA 3PMWA 2F7CA 2QL3A 4F29A 2CMOA 2FYIA 5DYHA 4XKNA 1EZOA 3KJ7A 4H5FA 3T22A 1P1WA 2PT1A 1F9BA 2Y7RA 1MY1A 1IITA 4QHQA 4MBPA 1MQHA 2I49A 4GWOA 5H8QA 4DXBA 1MQJA 3KGCA 4MFIA 2O68A 4AQ4A 1Q35A 4JDFA 5CI5A 4RPOA 3BFTA 1LLSA 3IB1A 3SEWA 2VHAA 3EPEA 3K1NA 3MUQA 3VDFA 2FA7A 2DWIA 1ZBMA 4NEDA 4NF4B 3MJNA 3MWBA 3IB2A 1Y4TA 4E0XA 3PUWE 3K6WA 3O6IA 1M5BA 3CG3A 1D9YA 4PFWA 4POXA 5CMKA 2DVCA 4LA9A 5I2NA 3TZAA 4F1YA 4R9GA 4DE8A 1TXFA 1EU8A 3LSXA 1I6BA 4F39A 4EDPA 1ZJLA 3KSXA 2YLNA 2DE2A 4DXCA 3QSLA 3IJXB 3TKDA 3U92A 3KN3A 3W9VA 3IR1A 1IUDA 3G3FA 4IO5A 4JWOA 1SDXA 1LB8A 5I84A 1KWHA 1B7HA 1SVXB 1WODA 2DXRA 5AA1A 3RLFE 1QUJA 5CMBA 4GD5A 1LBBA 4U4SA 1Y3NA 4QFNA 5I59B 4ELPA 4C1UA 4BDRA 3PMVA 2Z8FA 4G4PA 4R2FA 4ZE9A 4ZEFA 1O7TA 4IB2A 4G8HA 3K6XA 3ZKKA 1B3EA 2XXPA 5I2KA 1B3HA 2ZMBA 4XIGQ 2I4CA 2O51A 1EZPA 2GHBA 2XX9A 3RTFB 1Z7ME 3H03A 3O6HA 4ZE8A 4RXLA 4X1DA 1EZ9A 1SI1A 5I59A 5TPAB 1T0KA 5HPQA 1B1HA 2V3QA 3I6VA 3DP6A 1SBPA 1N0TA 1TFAA 2F36A 4IO2A 3EHTA 4BDMA 4H1XA 4IO6A 4R2BA 3MPLA 2Q9TA 1RYOA 1FQCA 2HAVA 1A54A 3H7MA 3TEPA 3MAMA 4BDOA 1FTMA 4MH5A 3PPNA 4N07A 5A5XA 2ZYOA 1SD3A 2H9BA 3MVZA 3OELA 2PMSA 4XTCQ 3SDFA 2QRYA 4ELQA 5HM4B 4GLIA 3C31A 1N84A 4HS7A 3HN0A 3G3IA 4KFQA 2I0CA 2XXQA 3MQ9A 2DQVA 2XXYA 4ZEIA 3WAFA 4IO4A 2RC9A 4H8IA 1B3FA 1AH5A 3KN8A 4Q8RA 4F3BA 3CVGA 4THIA 1UIUA 3H6VA 3H4ZA 4DDDA 2DP8A 5AE4A 3C4MA 1D3KA 1LBCA 4TLMB 1MXYA 4F31B 3E9XA 4ZEKA 3RTWB 2OCUA 1OMPA 2REJA 2A5TB 2R9JA 4JWXA 3O97A 4YKKA 4ESXA 1MY2A 3S4UA 1POTA 4NWCA 4LUBA 4LZ8A 3CI8A 1QW0A 2UXAA 1NNKA 3R7XA 3H6UA 1B5HA 2I48A 2UYFA 5H8NB 2O1LA 3O6GA 5BWJA 3DP4A 3OSQA 1P1NA 3TQLA 3VFJA 2A5TA 4PETA 3MVYA 1LFHA 1N7XA 2QMWA 1MXWA 3OENA 1B32A 3S9LC 4LONB 3K6VA 3TPAA 2I58A 3MZ9A 2P0SA 4DXUA 1B52A 4X1BA 2O7IA 1JW1A 2M8CA 1B05A 3CSBA 5CM6A 2GFEA 5FHOA 1US4A 2NXOA 2I3WA 4OMBA 2RCBA 1WVJA 5AA2D 3UN6A 4EQBA 5I58B 4OEVA 4OWDA 3ZSFA 2GRVA 2I6EA 4EUOA 1B4ZA 4PFYA 2H4IA 5KDTB 3V5AA 1PEBA 1Y1ZA 3T93B 3FXUA 4R75A 1B2HA 3SEUA 3FATA 1YPNA 4RJZA 3P7IA 3E13X 2HQ0A 5I58A 1OVBA 2F78A 4HTGA 5H8SA 3Q27A 3WAEA 1S7YA 2NUVA 3B6QA 4YAHX 1MDP1 1I69A 1DSNA 1Y1MA 5KDTA 2O7UA 3ZKLA 1SW5A 3UIFA 3TMGA 2HAUA 2XXXA 4WEDA 1RKMA 3C32A 3KG2A 3OO9A 2Q2AA 2RINA 3PPOA 3VXBA 4DLDA 1NL5A 2O84X 3G3GA 4KR5A 3D4CA 5IAIA 4NF6B 5H8HA 3MZ1A 2ZNTA 4QSEA 3F11A 3PUVE 4F2QA 1VR5A 3GZGA 2XXRA 1FW0A 3GBBA 2DOJA 1FQBA 1UTBA 1NFTA 2XXWA 3GXAA 4IO7A 1IXHA 2R71A 1LAFE 4PE5B 1I6QA 1R1NA 4KD5A 3M3KA 4F3PA 4I9DA 2ONKE 4TQUQ 3V8XB 1DPEA 2XXIA 2VOZA 1ANFA 4ELRA 1LFIA 2RC7A 3N5LA 3CFLA 4KPTA 1PDAA 3U1OA 1UTHA 4FORA 1PBQA 3SEVA 5L8DA 1QKBA 2LAOA 5L9MA 1DOTA 4LZ5A 1FCKA 3IO4A 3JYRA 4ESWA 4Z0IA 3L6HA 3VV5A 3TCHA 4F3GA 3ILTB 3BKIB 3HV1A 3N94A 4OENA 2R6GE 1EH3A 3EF7A 4F19A 4GOTA 3CR9A 1B5IA 2QJEA 4KCCA 4YMBA 5H8QB 5BUUA 3C36A 4Q0CA 1B58A 4Z7EA 1MH4A 3LUYA 4C1TA 1LFGA 4M4GA 3S9EA 4JSDA 1R9QA 3ILUB 4I1DA 3FV2A 2DS9A 5FTIA 3TTNA 2F5XA 2F6PA 1MQGA 1OQHA 2V93A 3RQTA 4UA8A 4IO3A 1MXUA 1PB7A 4N13A 5B7DA 2XX8A 1P1UA 2OJTA 3PUXE 1B1XA 4JB7A 4R9FA 3B7DA 5L9OA 2DWHA 2DXYA 1A8EA 5I2NB 1NNPA 4KYEA 2XD2A 4OTEA 2ESNA 2DWJA 1MPDA 3FZVA 3K2DA 2I3VA 2NWJA 4Q30B 2OWTA 3USDA 3IO6A 1N3XA 2RCAA 4BDNA 4IY5A 3IOTA 4KYDA 4FJPA 3JZJA 3A09A 1TT1A 3FVOA 5EHMA 1MY3A 3FJGA 1Q1KA 3TTKA 1PB8A 2DYXA 2QS3A 1A7LA 3N6UA 3TODA 5TP9A 4FE8A 3Q28A 3OXNA 3C33A 3RT8A 2AL4A 4YZZA 1LAXA 1BTJA 4QFLA 1XVXA 3O28A 2HFBA 1ZIUA 3HSTA 3G3HA 2ZYKA 1H44A 5I2KB 1MXVA 2PBWA 4LVQA 1MXXA 4F1UA 1DMBA 3TCFA 4FECA 3UK4A 4OFOA 1GR2A 4XKQA 3N26A 1TFDA 3ECRA 1NNTA 3E4RA 2F8DA 3FGSA 4ND9A 2G29A 3HCQA 3T9UA 3TAJA 5AA3A 2QS4A 5K2YA 1H43A 1O63A 2DE4A 5DVIA 3H3GA 1A40A 2A5SA 4WKMA 2DWAA 2I0BA 3M3FA 4IGTA 3TTRA 3MP8A 4G77A 5KCJA 3K1PA 1JEUA 1FQAA 3SESA 3TELA 4JBZA 3I5OA 1GGGA 5TU0A 5A5XB 2Y7IA 3OSRA 4YKIA 1M5EA 4U21A 1O64A 1OLCA 2O69A 2X26A 3ONMA 4EQ9A 4BLAA 5AA2B 2HZKA 3PGFA 4RY1A 1II5A 3V83A 1IXGA 4PQJA 3JV9A 3MZBA 4K3FA 5ISUA 1H3DA 1B0LA 3SEYA 3QK6A 3G3JA 3TTLA 3T96B 5AA2A 4F1VA 2D3IA 1SYIA 3VLWA 2CZLA 4G8MA 2OZZA 4G68C 3EQ1A 3OO8A 4LQ2A 4YU0A 3Q26A 2PVUA 1FTOA 3H6TA 4OERA 1QJMA 1Z7NE 4EF2A 4GL0A 2Z22A 1J1NA 1BP5A 5LOMA 4L17A 1HSJA 3K6UA 1QUKA 3V89B 1B4HA 1YAEA 3CIJA 1TWYA 4I8CA 4UACA 4O3BA 4NMYA 1AMFA 2OK2A 1BIYA 2KLFA 5ITPA 2ZYNA 5CMMA 4OHNA 3TQWA 3G7WA 3MBPA 2VD3A 1MY4A 2ABHA 4IY6A 4QF9A 3RUMA 4BDLA 4R72A 3HHGA 4EXLA 2PX1A 3MP1A 4DIGA 4ZEDA 3AXFA 4H5GA 3KEIA 1A8FA 5K2XA 2AIXA 2WKYA 4MLQA 4OFLA 5I57A 1H76A 2UVJA 3CG1A 1SI0A 4LATA 4RA1A 2X7QA 4GVOA 4H0WA 3FJ7A 3VE1B 1BLFA 4FIMA 2XXVA 3W15C 1B5JA 2F6GA 3SEXA 5DT6A 2D5WA 3VLVA 5KZTA 2OBGA 5J1DA 3PPQA 3PPRA 3PPPA 4U1ZA 1LAGE 4O3AA 4E0WA 2B3FA 5CBSA 4G2ZA 1FQDA 1DTZA 4OETA 2V3TA 4RNSA 2BJJX 1BKAA 1XS5A 2XX7A 2YPNA 1GTKA 3ZS6A 2DE3A 2HXWA 1IXIA 4YMAA 2QMXA 2IEEA 5CC2A 1S9TA 4NF5B 5H8HB 1JVYA 1B46A 4RK9A 3RN8A 4ISUA 1JVXA 3IX1A 1IEJA 4DCYA 1GV8A 3VVEA 4ZDMA 4FAJA 1US5A 3W9WA 3MP6A 1LGBC 5F1QA 1UTBB 4GXSB 5EHSA 5DEXA 1B51A 3FXRA 3KOTA 3OD7A 4NE4A 1MQIA 1M5FA 1MXZA 3MVXA 3LSFB 4NF5A 3B6WA 4F3SA 3PUYE 1SQYA 3MW0A 1AL3A 1MDQA 3TTMA 1USYE 1JW5A 1UTHB 4X48A 2F35A 3LSWA 4H6DA 1I6AA 3K02A 5CMCA 2OWSA 2Y84A 5H8FB 1URDA 2PYYA 5CRYA 1MH3A 4PFTA 3HPIA 1P1OA 1NKXA 3U8QA 2Y7PA 1N04A 3TCGA 3T9HB 4FEBA 3SKPA 4X9TA 1IXCA 1LCFA 1USYH 1YTVA 2ONSA 3PUZE 5H8FA 2QS2A 1QVSA 2P1SA 2F7BA 1UIVA 2XXHA 3IAZA 1ZMGA 4EXKA 3RT6B 1FTKA 1JETA 1OQGA 1SW4A 4HCWA 4I62A 4GF8A 2B3BA 3C9HA 2H5YA 3CRBA 2ONRA 4GRKA 1MPBA 1B3GA 1N7WA 2QS1A 2V84A 4KYSA 2Y7WA 5FHNA 5AA4B 4ONYA 2AYSA 3A3UA 3IK6B 2UYEA 4G68B 3U93A 1NMUA 4KQPA 2AL5A 1N3WA 5DVFA 1L5TA 2THIA 2Q8JA 3O9PA 1HSEA 4U23A 3RY3A 3E3KA 4NWDA 3VVFA 4JSOA 2NVUB 5JTYA 2V25A 2Z8EA 5AA4A 1P99A 4U4XA 2FNCA 4G68A 2G93A 1ATGA 4H65A 4HW8A 3FV1A 3KBRA 3IJOB 3VVDA 5DVJA 2GH9A 1MG1A 3BBRA 3S9MC 5TP9B 3LBSA 4ZECA 4U2RA 3CSGA 1LSTA 3GLBA 3FVNA 4ZEBA 5FHMA 4BDQA 1B40A 3VXCA 3K4UA 4Q5TA 4R6YA 1B9JA 1NNFA 1ZLQA 4R6KA 5CBRA 4C0RA 2Z8DA 4LQ5A 4OZ9A 1Y3QA 4XKRA 1PB9A 3OEKA 3M3LA 4GL8A 4NF4A 4H8JA 5FTHA 4GIZA 4QSCA 4YKPA 1N76A 3FXQA 1ZKBA 3FD3A 3KZGA 5KCJB 1GVCA 2UVGA 4G8NA 2HEUA 3OOAA 1B7UA 1VSOA 3B6TA 3KJTA 4NF8B 2RF1A 4F18A 2V3UA 1FTJA 3IOUA 4R73A 5F7VA 1XVYA 3PU5A 4P0GA 1HSLA 4QRZA 1XHYA 3KFMA 2ALUA 3FJMA 1CE2A 1R9LA 1NH7A 2REGA 3FUZA 1QKAA 3RNNA 3UA8A 2HZLA 3MPKA 5EYFA 3HHFA 3M8UA 2RC8A 3R6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDN A;  4NF8 A;  4AB5 A;  4HCY A;  4YKJ A;  3QAX A;  3H6W A;  2Q88 A;  3KSJ A;  1ELJ A;  1OIB A;  1DTG A;  4FAT A;  3KOS A;  4KHZ E;  2GHA A;  3IOR A;  1Y4C A;  5I56 B;  3DEL B;  4F2O A;  4YIC A;  4YB6 A;  3EHS A;  4GFR A;  3DM0 A;  3QYT A;  4WXJ A;  3T9X B;  3A3C A;  4QFO A;  4WEP A;  4U22 A;  1FQE A;  3D4G A;  3T66 A;  3OO6 A;  5I56 A;  3KN7 A;  5TPA A;  4RYA A;  2ZNS A;  4OEU A;  3UGW A;  1A99 A;  3TDJ A;  3RPW A;  1D9V A;  3EN3 A;  3C34 A;  4LP2 B;  4IGR A;  2DSF A;  3THI A;  3IB0 A;  1URG A;  3K00 A;  4YB5 A;  4OQO A;  3PD8 A;  5B70 A;  1ZTY A;  3OEM A;  4H67 A;  4XKP A;  3QIM A;  1JEV A;  4R74 A;  3GBA A;  1URS A;  2QPQ A;  2O6A A;  1OLA A;  3EHU A;  3UP9 A;  5HBC A;  4GXA A;  3N6T A;  3G3K A;  4M1V A;  3O2A A;  4ZZA A;  5JK4 A;  2VGQ A;  1YCJ A;  4JXI A;  4PP0 A;  1B3L A;  1RYX A;  3VLU A;  5I57 B;  2PT2 A;  4OYV A;  4RPN A;  4KI0 E;  4ZZE A;  1MPC A;  2DVZ A;  3K1M A;  4POW A;  3O66 A;  3S9N C;  3SER A;  3UOR A;  2F34 A;  4ZS9 A;  3MVW A;  1SW1 A;  4GQO A;  1JNF A;  1IQ7 A;  1MQD A;  3IL1 B;  3FAS A;  4DCX A;  2F7A A;  2Q2C A;  1XC1 A;  3CFX A;  1VE4 A;  1AIV A;  3OO7 A;  2ANJ A;  2HCA A;  4EQ7 A;  1M5D A;  5H8N A;  2F97 A;  1LCT A;  4U1O A;  2ZXT A;  2Q89 A;  1DPP A;  4N6P A;  5IKB A;  3RGY A;  1JQF A;  1Y20 A;  4OVJ A;  2P2A A;  2I4B A;  3DLN A;  3PD9 A;  1IZ1 A;  3C35 A;  1POY 1;  3TFL A;  5DTB A;  3PV0 E;  1Y3P A;  3MC2 A;  1OVT A;  5M2V A;  5ICQ A;  4P0I A;  4JWY A;  1MS7 A;  2XD3 A;  2VD2 A;  2B65 A;  2H98 A;  3IOW A;  4OES A;  1M5C A;  5DEX B;  4QSD A;  3BFU A;  1MRP A;  4OXV A;  3O29 A;  3QXM A;  1B0H A;  2ZYM A;  3S2V A;  1VFD A;  3H06 B;  1LAH E;  3Q25 A;  5ITO A;  1NH8 A;  4ECF A;  1PC3 A;  2UVH A;  3Q29 A;  1B6H A;  1FTL A;  2XHD A;  1AOV A;  3ODB A;  3LR1 A;  4OFJ A;  4EF1 A;  4R6H A;  2H99 A;  3IOV A;  4XXU A;  2W7Y A;  2X7P A;  1QUI A;  1ZU0 A;  3L6G A;  3LSL A;  5L9S A;  1JW4 A;  2Z23 A;  5JEI A;  4F22 A;  2E0S A;  1QUL A;  1XT8 A;  1S50 A;  2ZNU A;  4O3C A;  3K01 A;  1LB9 A;  2H25 A;  2QSX A;  1IIW A;  3FVG A;  2D21 A;  4DZ1 A;  2O1M A;  1UQW A;  5ELV A;  1MM7 A;  5ICT A;  3CFZ A;  2OLB A;  4KCD A;  2IA4 A;  1MM6 A;  3FIR A;  4RK2 A;  3QUJ A;  1MY0 A;  3OMB A;  1CB6 A;  2RKM A;  3U72 A;  1R6Z A;  3TUS A;  3DP8 A;  4MLV A;  4TLL B;  3U94 A;  2NOO A;  4NF6 A;  3QUF A;  4P11 A;  2XXT A;  3FVK A;  4TOZ A;  1VFE A;  3K0V A;  4QFK A;  1XOC A;  3HO7 A;  1B7Z A;  4QFP A;  3T9V A;  1A55 A;  4FED A;  3TYH A;  1SW2 A;  3I3V A;  4ELO A;  3LC8 A;  1SYH A;  3SET A;  4AB6 A;  3R26 A;  4LZ7 A;  4NTL A;  1D4N A;  1P1Q A;  1Y9U A;  4YB7 A;  2XXU A;  2Y7K A;  2YJP A;  5JTY B;  3PMX A;  4MF3 A;  1FQF A;  2UVI A;  1H45 A;  2VP1 A;  4PFU A;  2E1S A;  1PBP A;  3PMW A;  2F7C A;  2QL3 A;  4F29 A;  2CMO A;  2FYI A;  5DYH A;  4XKN A;  1EZO A;  3KJ7 A;  4H5F A;  3T22 A;  1P1W A;  2PT1 A;  1F9B A;  2Y7R A;  1MY1 A;  1IIT A;  4QHQ A;  4MBP A;  1MQH A;  2I49 A;  4GWO A;  5H8Q A;  4DXB A;  1MQJ A;  3KGC A;  4MFI A;  2O68 A;  4AQ4 A;  1Q35 A;  4JDF A;  5CI5 A;  4RPO A;  3BFT A;  1LLS A;  3IB1 A;  3SEW A;  2VHA A;  3EPE A;  3K1N A;  3MUQ A;  3VDF A;  2FA7 A;  2DWI A;  1ZBM A;  4NED A;  4NF4 B;  3MJN A;  3MWB A;  3IB2 A;  1Y4T A;  4E0X A;  3PUW E;  3K6W A;  3O6I A;  1M5B A;  3CG3 A;  1D9Y A;  4PFW A;  4POX A;  5CMK A;  2DVC A;  4LA9 A;  5I2N A;  3TZA A;  4F1Y A;  4R9G A;  4DE8 A;  1TXF A;  1EU8 A;  3LSX A;  1I6B A;  4F39 A;  4EDP A;  1ZJL A;  3KSX A;  2YLN A;  2DE2 A;  4DXC A;  3QSL A;  3IJX B;  3TKD A;  3U92 A;  3KN3 A;  3W9V A;  3IR1 A;  1IUD A;  3G3F A;  4IO5 A;  4JWO A;  1SDX A;  1LB8 A;  5I84 A;  1KWH A;  1B7H A;  1SVX B;  1WOD A;  2DXR A;  5AA1 A;  3RLF E;  1QUJ A;  5CMB A;  4GD5 A;  1LBB A;  4U4S A;  1Y3N A;  4QFN A;  5I59 B;  4ELP A;  4C1U A;  4BDR A;  3PMV A;  2Z8F A;  4G4P A;  4R2F A;  4ZE9 A;  4ZEF A;  1O7T A;  4IB2 A;  4G8H A;  3K6X A;  3ZKK A;  1B3E A;  2XXP A;  5I2K A;  1B3H A;  2ZMB A;  4XIG Q;  2I4C A;  2O51 A;  1EZP A;  2GHB A;  2XX9 A;  3RTF B;  1Z7M E;  3H03 A;  3O6H A;  4ZE8 A;  4RXL A;  4X1D A;  1EZ9 A;  1SI1 A;  5I59 A;  5TPA B;  1T0K A;  5HPQ A;  1B1H A;  2V3Q A;  3I6V A;  3DP6 A;  1SBP A;  1N0T A;  1TFA A;  2F36 A;  4IO2 A;  3EHT A;  4BDM A;  4H1X A;  4IO6 A;  4R2B A;  3MPL A;  2Q9T A;  1RYO A;  1FQC A;  2HAV A;  1A54 A;  3H7M A;  3TEP A;  3MAM A;  4BDO A;  1FTM A;  4MH5 A;  3PPN A;  4N07 A;  5A5X A;  2ZYO A;  1SD3 A;  2H9B A;  3MVZ A;  3OEL A;  2PMS A;  4XTC Q;  3SDF A;  2QRY A;  4ELQ A;  5HM4 B;  4GLI A;  3C31 A;  1N84 A;  4HS7 A;  3HN0 A;  3G3I A;  4KFQ A;  2I0C A;  2XXQ A;  3MQ9 A;  2DQV A;  2XXY A;  4ZEI A;  3WAF A;  4IO4 A;  2RC9 A;  4H8I A;  1B3F A;  1AH5 A;  3KN8 A;  4Q8R A;  4F3B A;  3CVG A;  4THI A;  1UIU A;  3H6V A;  3H4Z A;  4DDD A;  2DP8 A;  5AE4 A;  3C4M A;  1D3K A;  1LBC A;  4TLM B;  1MXY A;  4F31 B;  3E9X A;  4ZEK A;  3RTW B;  2OCU A;  1OMP A;  2REJ A;  2A5T B;  2R9J A;  4JWX A;  3O97 A;  4YKK A;  4ESX A;  1MY2 A;  3S4U A;  1POT A;  4NWC A;  4LUB A;  4LZ8 A;  3CI8 A;  1QW0 A;  2UXA A;  1NNK A;  3R7X A;  3H6U A;  1B5H A;  2I48 A;  2UYF A;  5H8N B;  2O1L A;  3O6G A;  5BWJ A;  3DP4 A;  3OSQ A;  1P1N A;  3TQL A;  3VFJ A;  2A5T A;  4PET A;  3MVY A;  1LFH A;  1N7X A;  2QMW A;  1MXW A;  3OEN A;  1B32 A;  3S9L C;  4LON B;  3K6V A;  3TPA A;  2I58 A;  3MZ9 A;  2P0S A;  4DXU A;  1B52 A;  4X1B A;  2O7I A;  1JW1 A;  2M8C A;  1B05 A;  3CSB A;  5CM6 A;  2GFE A;  5FHO A;  1US4 A;  2NXO A;  2I3W A;  4OMB A;  2RCB A;  1WVJ A;  5AA2 D;  3UN6 A;  4EQB A;  5I58 B;  4OEV A;  4OWD A;  3ZSF A;  2GRV A;  2I6E A;  4EUO A;  1B4Z A;  4PFY A;  2H4I A;  5KDT B;  3V5A A;  1PEB A;  1Y1Z A;  3T93 B;  3FXU A;  4R75 A;  1B2H A;  3SEU A;  3FAT A;  1YPN A;  4RJZ A;  3P7I A;  3E13 X;  2HQ0 A;  5I58 A;  1OVB A;  2F78 A;  4HTG A;  5H8S A;  3Q27 A;  3WAE A;  1S7Y A;  2NUV A;  3B6Q A;  4YAH X;  1MDP 1;  1I69 A;  1DSN A;  1Y1M A;  5KDT A;  2O7U A;  3ZKL A;  1SW5 A;  3UIF A;  3TMG A;  2HAU A;  2XXX A;  4WED A;  1RKM A;  3C32 A;  3KG2 A;  3OO9 A;  2Q2A A;  2RIN A;  3PPO A;  3VXB A;  4DLD A;  1NL5 A;  2O84 X;  3G3G A;  4KR5 A;  3D4C A;  5IAI A;  4NF6 B;  5H8H A;  3MZ1 A;  2ZNT A;  4QSE A;  3F11 A;  3PUV E;  4F2Q A;  1VR5 A;  3GZG A;  2XXR A;  1FW0 A;  3GBB A;  2DOJ A;  1FQB A;  1UTB A;  1NFT A;  2XXW A;  3GXA A;  4IO7 A;  1IXH A;  2R71 A;  1LAF E;  4PE5 B;  1I6Q A;  1R1N A;  4KD5 A;  3M3K A;  4F3P A;  4I9D A;  2ONK E;  4TQU Q;  3V8X B;  1DPE A;  2XXI A;  2VOZ A;  1ANF A;  4ELR A;  1LFI A;  2RC7 A;  3N5L A;  3CFL A;  4KPT A;  1PDA A;  3U1O A;  1UTH A;  4FOR A;  1PBQ A;  3SEV A;  5L8D A;  1QKB A;  2LAO A;  5L9M A;  1DOT A;  4LZ5 A;  1FCK A;  3IO4 A;  3JYR A;  4ESW A;  4Z0I A;  3L6H A;  3VV5 A;  3TCH A;  4F3G A;  3ILT B;  3BKI B;  3HV1 A;  3N94 A;  4OEN A;  2R6G E;  1EH3 A;  3EF7 A;  4F19 A;  4GOT A;  3CR9 A;  1B5I A;  2QJE A;  4KCC A;  4YMB A;  5H8Q B;  5BUU A;  3C36 A;  4Q0C A;  1B58 A;  4Z7E A;  1MH4 A;  3LUY A;  4C1T A;  1LFG A;  4M4G A;  3S9E A;  4JSD A;  1R9Q A;  3ILU B;  4I1D A;  3FV2 A;  2DS9 A;  5FTI A;  3TTN A;  2F5X A;  2F6P A;  1MQG A;  1OQH A;  2V93 A;  3RQT A;  4UA8 A;  4IO3 A;  1MXU A;  1PB7 A;  4N13 A;  5B7D A;  2XX8 A;  1P1U A;  2OJT A;  3PUX E;  1B1X A;  4JB7 A;  4R9F A;  3B7D A;  5L9O A;  2DWH A;  2DXY A;  1A8E A;  5I2N B;  1NNP A;  4KYE A;  2XD2 A;  4OTE A;  2ESN A;  2DWJ A;  1MPD A;  3FZV A;  3K2D A;  2I3V A;  2NWJ A;  4Q30 B;  2OWT A;  3USD A;  3IO6 A;  1N3X A;  2RCA A;  4BDN A;  4IY5 A;  3IOT A;  4KYD A;  4FJP A;  3JZJ A;  3A09 A;  1TT1 A;  3FVO A;  5EHM A;  1MY3 A;  3FJG A;  1Q1K A;  3TTK A;  1PB8 A;  2DYX A;  2QS3 A;  1A7L A;  3N6U A;  3TOD A;  5TP9 A;  4FE8 A;  3Q28 A;  3OXN A;  3C33 A;  3RT8 A;  2AL4 A;  4YZZ A;  1LAX A;  1BTJ A;  4QFL A;  1XVX A;  3O28 A;  2HFB A;  1ZIU A;  3HST A;  3G3H A;  2ZYK A;  1H44 A;  5I2K B;  1MXV A;  2PBW A;  4LVQ A;  1MXX A;  4F1U A;  1DMB A;  3TCF A;  4FEC A;  3UK4 A;  4OFO A;  1GR2 A;  4XKQ A;  3N26 A;  1TFD A;  3ECR A;  1NNT A;  3E4R A;  2F8D A;  3FGS A;  4ND9 A;  2G29 A;  3HCQ A;  3T9U A;  3TAJ A;  5AA3 A;  2QS4 A;  5K2Y A;  1H43 A;  1O63 A;  2DE4 A;  5DVI A;  3H3G A;  1A40 A;  2A5S A;  4WKM A;  2DWA A;  2I0B A;  3M3F A;  4IGT A;  3TTR A;  3MP8 A;  4G77 A;  5KCJ A;  3K1P A;  1JEU A;  1FQA A;  3SES A;  3TEL A;  4JBZ A;  3I5O A;  1GGG A;  5TU0 A;  5A5X B;  2Y7I A;  3OSR A;  4YKI A;  1M5E A;  4U21 A;  1O64 A;  1OLC A;  2O69 A;  2X26 A;  3ONM A;  4EQ9 A;  4BLA A;  5AA2 B;  2HZK A;  3PGF A;  4RY1 A;  1II5 A;  3V83 A;  1IXG A;  4PQJ A;  3JV9 A;  3MZB A;  4K3F A;  5ISU A;  1H3D A;  1B0L A;  3SEY A;  3QK6 A;  3G3J A;  3TTL A;  3T96 B;  5AA2 A;  4F1V A;  2D3I A;  1SYI A;  3VLW A;  2CZL A;  4G8M A;  2OZZ A;  4G68 C;  3EQ1 A;  3OO8 A;  4LQ2 A;  4YU0 A;  3Q26 A;  2PVU A;  1FTO A;  3H6T A;  4OER A;  1QJM A;  1Z7N E;  4EF2 A;  4GL0 A;  2Z22 A;  1J1N A;  1BP5 A;  5LOM A;  4L17 A;  1HSJ A;  3K6U A;  1QUK A;  3V89 B;  1B4H A;  1YAE A;  3CIJ A;  1TWY A;  4I8C A;  4UAC A;  4O3B A;  4NMY A;  1AMF A;  2OK2 A;  1BIY A;  2KLF A;  5ITP A;  2ZYN A;  5CMM A;  4OHN A;  3TQW A;  3G7W A;  3MBP A;  2VD3 A;  1MY4 A;  2ABH A;  4IY6 A;  4QF9 A;  3RUM A;  4BDL A;  4R72 A;  3HHG A;  4EXL A;  2PX1 A;  3MP1 A;  4DIG A;  4ZED A;  3AXF A;  4H5G A;  3KEI A;  1A8F A;  5K2X A;  2AIX A;  2WKY A;  4MLQ A;  4OFL A;  5I57 A;  1H76 A;  2UVJ A;  3CG1 A;  1SI0 A;  4LAT A;  4RA1 A;  2X7Q A;  4GVO A;  4H0W A;  3FJ7 A;  3VE1 B;  1BLF A;  4FIM A;  2XXV A;  3W15 C;  1B5J A;  2F6G A;  3SEX A;  5DT6 A;  2D5W A;  3VLV A;  5KZT A;  2OBG A;  5J1D A;  3PPQ A;  3PPR A;  3PPP A;  4U1Z A;  1LAG E;  4O3A A;  4E0W A;  2B3F A;  5CBS A;  4G2Z A;  1FQD A;  1DTZ A;  4OET A;  2V3T A;  4RNS A;  2BJJ X;  1BKA A;  1XS5 A;  2XX7 A;  2YPN A;  1GTK A;  3ZS6 A;  2DE3 A;  2HXW A;  1IXI A;  4YMA A;  2QMX A;  2IEE A;  5CC2 A;  1S9T A;  4NF5 B;  5H8H B;  1JVY A;  1B46 A;  4RK9 A;  3RN8 A;  4ISU A;  1JVX A;  3IX1 A;  1IEJ A;  4DCY A;  1GV8 A;  3VVE A;  4ZDM A;  4FAJ A;  1US5 A;  3W9W A;  3MP6 A;  1LGB C;  5F1Q A;  1UTB B;  4GXS B;  5EHS A;  5DEX A;  1B51 A;  3FXR A;  3KOT A;  3OD7 A;  4NE4 A;  1MQI A;  1M5F A;  1MXZ A;  3MVX A;  3LSF B;  4NF5 A;  3B6W A;  4F3S A;  3PUY E;  1SQY A;  3MW0 A;  1AL3 A;  1MDQ A;  3TTM A;  1USY E;  1JW5 A;  1UTH B;  4X48 A;  2F35 A;  3LSW A;  4H6D A;  1I6A A;  3K02 A;  5CMC A;  2OWS A;  2Y84 A;  5H8F B;  1URD A;  2PYY A;  5CRY A;  1MH3 A;  4PFT A;  3HPI A;  1P1O A;  1NKX A;  3U8Q A;  2Y7P A;  1N04 A;  3TCG A;  3T9H B;  4FEB A;  3SKP A;  4X9T A;  1IXC A;  1LCF A;  1USY H;  1YTV A;  2ONS A;  3PUZ E;  5H8F A;  2QS2 A;  1QVS A;  2P1S A;  2F7B A;  1UIV A;  2XXH A;  3IAZ A;  1ZMG A;  4EXK A;  3RT6 B;  1FTK A;  1JET A;  1OQG A;  1SW4 A;  4HCW A;  4I62 A;  4GF8 A;  2B3B A;  3C9H A;  2H5Y A;  3CRB A;  2ONR A;  4GRK A;  1MPB A;  1B3G A;  1N7W A;  2QS1 A;  2V84 A;  4KYS A;  2Y7W A;  5FHN A;  5AA4 B;  4ONY A;  2AYS A;  3A3U A;  3IK6 B;  2UYE A;  4G68 B;  3U93 A;  1NMU A;  4KQP A;  2AL5 A;  1N3W A;  5DVF A;  1L5T A;  2THI A;  2Q8J A;  3O9P A;  1HSE A;  4U23 A;  3RY3 A;  3E3K A;  4NWD A;  3VVF A;  4JSO A;  2NVU B;  5JTY A;  2V25 A;  2Z8E A;  5AA4 A;  1P99 A;  4U4X A;  2FNC A;  4G68 A;  2G93 A;  1ATG A;  4H65 A;  4HW8 A;  3FV1 A;  3KBR A;  3IJO B;  3VVD A;  5DVJ A;  2GH9 A;  1MG1 A;  3BBR A;  3S9M C;  5TP9 B;  3LBS A;  4ZEC A;  4U2R A;  3CSG A;  1LST A;  3GLB A;  3FVN A;  4ZEB A;  5FHM A;  4BDQ A;  1B40 A;  3VXC A;  3K4U A;  4Q5T A;  4R6Y A;  1B9J A;  1NNF A;  1ZLQ A;  4R6K A;  5CBR A;  4C0R A;  2Z8D A;  4LQ5 A;  4OZ9 A;  1Y3Q A;  4XKR A;  1PB9 A;  3OEK A;  3M3L A;  4GL8 A;  4NF4 A;  4H8J A;  5FTH A;  4GIZ A;  4QSC A;  4YKP A;  1N76 A;  3FXQ A;  1ZKB A;  3FD3 A;  3KZG A;  5KCJ B;  1GVC A;  2UVG A;  4G8N A;  2HEU A;  3OOA A;  1B7U A;  1VSO A;  3B6T A;  3KJT A;  4NF8 B;  2RF1 A;  4F18 A;  2V3U A;  1FTJ A;  3IOU A;  4R73 A;  5F7V A;  1XVY A;  3PU5 A;  4P0G A;  1HSL A;  4QRZ A;  1XHY A;  3KFM A;  2ALU A;  3FJM A;  1CE2 A;  1R9L A;  1NH7 A;  2REG A;  3FUZ A;  1QKA A;  3RNN A;  3UA8 A;  2HZL A;  3MPK A;  5EYF A;  3HHF A;  3M8U A;  2RC8 A;  3R6U A; 
#chains in the Genus database with same CATH topology
 1WDN A;  4NF8 A;  4AB5 A;  4HCY A;  4P1E A;  1SPI A;  4YKJ A;  3QAX A;  3H6W A;  2Q88 A;  3KSJ A;  1ELJ A;  5ESY A;  4NN3 A;  1OIB A;  1DTG A;  4FAT A;  4PBH A;  3KOS A;  4KHZ E;  2GHA A;  3IOR A;  1Y4C A;  5I56 B;  3DEL B;  4F2O A;  3KC1 A;  3GYY A;  4YIC A;  4YB6 A;  3EHS A;  4GFR A;  3DM0 A;  3QYT A;  4WXJ A;  3T9X B;  4X04 A;  3A3C A;  2B4L A;  4QFO A;  4WEP A;  4U22 A;  1FQE A;  3D4G A;  3T66 A;  3OO6 A;  5I56 A;  4MMP A;  3KN7 A;  5TPA A;  5DW8 A;  4RYA A;  2ZNS A;  2CEX A;  4OEU A;  3IFA A;  3UGW A;  1FPI A;  1A99 A;  4XEQ A;  3RPW A;  1D9V A;  3ISP A;  3TDJ A;  4OVT A;  3EN3 A;  3C34 A;  4LP2 B;  4IGR A;  2DSF A;  3THI A;  3IB0 A;  1URG A;  3K00 A;  4YB5 A;  4OQO A;  3PD8 A;  2HHM A;  5B70 A;  1ZTY A;  3OEM A;  4H67 A;  4XKP A;  3QIM A;  2P3V A;  1JEV A;  1LBZ A;  1FBE A;  4R74 A;  3GBA A;  1URS A;  2QPQ A;  2O6A A;  1OLA A;  3EHU A;  3UP9 A;  5HBC A;  4GXA A;  3N6T A;  3G3K A;  4M1V A;  3O2A A;  4ZZA A;  4PFR A;  5JK4 A;  2VGQ A;  1YCJ A;  4JXI A;  4PP0 A;  1B3L A;  1RYX A;  3VLU A;  4OVR A;  5I57 B;  4MNC A;  2PT2 A;  4OYV A;  4RPN A;  4KI0 E;  4ZZE A;  1MPC A;  2DVZ A;  3K1M A;  4POW A;  1YYZ A;  3O66 A;  3S9N C;  3SER A;  3UOR A;  1BK4 A;  2F34 A;  4ZS9 A;  3MVW A;  1SW1 A;  4GQO A;  5FBP A;  1JNF A;  2Q74 A;  1IQ7 A;  1MQD A;  3B50 A;  3IL1 B;  3FAS A;  4DCX A;  2F7A A;  2Q2C A;  1XC1 A;  3CFX A;  1VE4 A;  1AIV A;  3OO7 A;  2ANJ A;  2HCA A;  4EQ7 A;  1M5D A;  5H8N A;  2F97 A;  1LCT A;  4U1O A;  2ZXT A;  4HXV A;  1EYI A;  4P8B A;  4GBV A;  2Q89 A;  4O94 A;  1K9Y A;  1DPP A;  4N6P A;  5IKB A;  3RGY A;  1JQF A;  1Y20 A;  1RDY A;  4OVJ A;  5IZ1 A;  2P2A A;  2I4B A;  3DLN A;  3PD9 A;  1IZ1 A;  3C35 A;  1POY 1;  3TFL A;  5DTB A;  3PV0 E;  1RDX A;  1Y3P A;  3MC2 A;  1OVT A;  5M2V A;  3T1B A;  5ICQ A;  4P0I A;  4JWY A;  1MS7 A;  2XD3 A;  2VD2 A;  2B65 A;  2XWV A;  2H98 A;  3IOW A;  4OES A;  1M5C A;  5DEX B;  1LBY A;  4QSD A;  1NV6 A;  3BFU A;  5I5P A;  1MRP A;  2ZZX A;  2WEF A;  4GWW A;  4OXV A;  2QVR A;  3O29 A;  3QXM A;  1B0H A;  2ZYM A;  3S2V A;  1VFD A;  3H06 B;  1LAH E;  3Q25 A;  3MST A;  5ITO A;  1NH8 A;  4ECF A;  1PC3 A;  2UVH A;  3Q29 A;  1B6H A;  1FTL A;  2XHD A;  1AOV A;  3ODB A;  3LR1 A;  4OFJ A;  4EF1 A;  4R6H A;  2H99 A;  3IOV A;  4XXU A;  2W7Y A;  2X7P A;  3FBP A;  1QUI A;  1ZU0 A;  3L6G A;  3LSL A;  5L9S A;  1JW4 A;  2Z23 A;  5JEI A;  4PDH A;  3CHG A;  4F22 A;  4IR8 A;  2E0S A;  1QUL A;  4GWU A;  1XT8 A;  2Q8M A;  1S50 A;  2ZNU A;  4O3C A;  3K01 A;  1LB9 A;  2H25 A;  2QSX A;  3IFC A;  1IIW A;  2ZZV A;  3FVG A;  2D21 A;  4DZ1 A;  2O1M A;  1UQW A;  4N6D A;  1MM7 A;  5ELV A;  5ICT A;  3CFZ A;  2OLB A;  4KCD A;  2IA4 A;  1MM6 A;  3E79 A;  3FIR A;  4RK2 A;  3QUJ A;  1MY0 A;  3OMB A;  1CB6 A;  2RKM A;  3U72 A;  1R6Z A;  4XFE A;  4N17 A;  3TUS A;  5EQ8 A;  3DP8 A;  2QFL A;  4MLV A;  4TLL B;  3U94 A;  2NOO A;  4NF6 A;  3QUF A;  4P11 A;  2XXT A;  3FVK A;  4TOZ A;  1VFE A;  3K0V A;  4QFK A;  1XOC A;  3HO7 A;  1B7Z A;  4QFP A;  3T9V A;  1A55 A;  4FED A;  1IMF A;  2BJI A;  3TYH A;  1SW2 A;  3BIH A;  3I3V A;  4ELO A;  1NV0 A;  4PTK A;  3LC8 A;  1SYH A;  3SET A;  4AB6 A;  3R26 A;  4LZ7 A;  4NTL A;  1D4N A;  1P1Q A;  1Y9U A;  4YB7 A;  4OVQ A;  2XXU A;  2Y7K A;  2YJP A;  5IM2 A;  5JTY B;  3PMX A;  4MF3 A;  1FRP A;  2Y5K A;  1FQF A;  2UVI A;  1H45 A;  1FPL A;  2VP1 A;  4PFU A;  2E1S A;  1PBP A;  3PMW A;  2F7C A;  1FBG A;  2QL3 A;  4F29 A;  1NI9 A;  2CMO A;  3RPL B;  2KQZ A;  2FYI A;  2OX3 A;  1YXI A;  5DYH A;  4XKN A;  1EZO A;  3KJ7 A;  4H5F A;  3T22 A;  1P1W A;  2PT1 A;  2PFZ A;  1F9B A;  2Y7R A;  1MY1 A;  1IIT A;  4QHQ A;  4MBP A;  1MQH A;  2I49 A;  4GWO A;  1FSA A;  5H8Q A;  3T0J A;  4DXB A;  1MQJ A;  3KGC A;  4MFI A;  1INP A;  2O68 A;  2FHY A;  4AQ4 A;  1NV4 A;  1Q35 A;  3RPL A;  4JDF A;  5CI5 A;  1D9Q A;  4RPO A;  3BFT A;  1LLS A;  3IB1 A;  3SEW A;  2VHA A;  3EPE A;  3K1N A;  3MUQ A;  4N8G A;  3VDF A;  2FA7 A;  4P9K A;  4N91 A;  4NAP A;  2DWI A;  1ZBM A;  4NED A;  4NF4 B;  3MJN A;  3MWB A;  3IB2 A;  1Y4T A;  4PC9 A;  4E0X A;  3PUW E;  3K6W A;  3O6I A;  1M5B A;  3CG3 A;  2FVZ A;  1D9Y A;  4PFW A;  4POX A;  5CMK A;  2DVC A;  4LA9 A;  2XXK A;  5I2N A;  2DDK A;  3TZA A;  4F1Y A;  4R9G A;  4GX3 A;  4DE8 A;  1TXF A;  1EU8 A;  3LSX A;  1I6B A;  5F24 A;  4F39 A;  4EDP A;  1ZJL A;  3KSX A;  2YLN A;  2DE2 A;  4DXC A;  3E78 A;  4JVI A;  3QSL A;  3IJX B;  3TKD A;  3U92 A;  3KN3 A;  3W9V A;  4PGN A;  3IR1 A;  1IUD A;  3G3F A;  4IO5 A;  1RDZ A;  4JWO A;  1DCU A;  1SDX A;  4PFI A;  1LB8 A;  5I84 A;  1KWH A;  1B7H A;  1SVX B;  1WOD A;  4HE2 A;  2DXR A;  5AA1 A;  3RLF E;  1QUJ A;  5CMB A;  4GD5 A;  1EYJ A;  1LBB A;  4U4S A;  1Y3N A;  4NF0 A;  4QFN A;  5I59 B;  4ELP A;  4PF8 A;  4C1U A;  4BDR A;  3PMV A;  2Z8F A;  4G4P A;  1EYK A;  4MX6 A;  1QGX A;  4PGP A;  4R2F A;  4ZE9 A;  4ZEF A;  1O7T A;  4IB2 A;  4G8H A;  3K6X A;  3ZKK A;  1B3E A;  2XXP A;  5I2K A;  1B3H A;  2ZMB A;  4XIG Q;  3KC0 A;  2I4C A;  2O51 A;  4GBW A;  1EZP A;  4NQ8 A;  2WBB A;  2GHB A;  2XX9 A;  3B8B A;  1LBW A;  3RTF B;  1Z7M E;  3H03 A;  3O6H A;  4ZE8 A;  4RXL A;  4X1D A;  1EZ9 A;  1SI1 A;  5I59 A;  4PAI A;  5LTC A;  5TPA B;  1T0K A;  5HPQ A;  1B1H A;  4OA4 A;  2FIE A;  2V3Q A;  3I6V A;  3DP6 A;  5I7I A;  1SBP A;  4DI3 D;  5J16 A;  2JJK A;  1N0T A;  1TFA A;  2F36 A;  4IO2 A;  3EHT A;  4BDM A;  4H1X A;  4IO6 A;  1FBD A;  4R2B A;  3MPL A;  2Q9T A;  1RYO A;  1FQC A;  2HAV A;  1A54 A;  3H7M A;  3TEP A;  3MAM A;  4BDO A;  1FTM A;  1FPJ A;  4MH5 A;  3PPN A;  4N07 A;  5A5X A;  2ZYO A;  1SD3 A;  2H9B A;  3MVZ A;  3OEL A;  2PMS A;  4XTC Q;  3SDF A;  2QRY A;  4ELQ A;  5HM4 B;  4GLI A;  3C31 A;  1N84 A;  4HS7 A;  3HN0 A;  3G3I A;  4KFQ A;  2I0C A;  2XXQ A;  3MQ9 A;  1DK4 A;  2DQV A;  2XXY A;  5ET7 A;  4ZEI A;  3WAF A;  4IO4 A;  2RC9 A;  4H8I A;  1B3F A;  1AH5 A;  3KN8 A;  4Q8R A;  4F3B A;  3CVG A;  4THI A;  1UIU A;  3H6V A;  3H4Z A;  1NV5 A;  4DDD A;  1FJ9 A;  2DP8 A;  5AE4 A;  4I40 A;  3C4M A;  1D3K A;  1LBC A;  4TLM B;  1MXY A;  4F31 B;  4P1L A;  3E9X A;  4ZEK A;  3RTW B;  2OCU A;  1OMP A;  2REJ A;  4NG7 A;  2A5T B;  2R9J A;  4JWX A;  3O97 A;  4YKK A;  4ESX A;  1MY2 A;  3S4U A;  1POT A;  4NWC A;  4LUB A;  4LZ8 A;  3CI8 A;  1QW0 A;  2UXA A;  1NNK A;  3R7X A;  3H6U A;  1B5H A;  4MAG A;  2I48 A;  2UYF A;  5H8N B;  2O1L A;  3O6G A;  5BWJ A;  3DP4 A;  3OSQ A;  1P1N A;  4O7M A;  3TQL A;  4DI4 B;  2FIX A;  3VFJ A;  2A5T A;  4PET A;  3MVY A;  1LFH A;  2MKZ A;  1N7X A;  2QMW A;  1MXW A;  3OEN A;  4MJO A;  1B32 A;  3S9L C;  4LON B;  3K6V A;  3TPA A;  2I58 A;  2QVU A;  3MZ9 A;  2P0S A;  4HE0 A;  4DXU A;  5LDZ A;  1B52 A;  4GX4 A;  4X1B A;  2O7I A;  1JW1 A;  2M8C A;  2PCR A;  1B05 A;  3CSB A;  5CM6 A;  2GFE A;  5FHO A;  5IGA A;  4PAK A;  1US4 A;  2NXO A;  2I3W A;  4OMB A;  2RCB A;  1WVJ A;  5AA2 D;  3UN6 A;  4EQB A;  5I58 B;  4OEV A;  4OWD A;  3ZSF A;  2GRV A;  2F3D A;  2I6E A;  4EUO A;  1B4Z A;  4PFY A;  2H4I A;  5KDT B;  3V5A A;  1PEB A;  1Y1Z A;  3T93 B;  3FXU A;  4R75 A;  1B2H A;  3SEU A;  3FAT A;  1YPN A;  4RJZ A;  3P7I A;  3E13 X;  2HQ0 A;  5I58 A;  1OVB A;  2F78 A;  4HTG A;  5H8S A;  3Q27 A;  3WAE A;  1S7Y A;  2NUV A;  3B6Q A;  4YAH X;  1MDP 1;  1I69 A;  1NUW A;  1NV1 A;  1DSN A;  1Y1M A;  5KDT A;  2O7U A;  3ZKL A;  4GWY A;  1SW5 A;  3UIF A;  3TMG A;  2HAU A;  2XXX A;  4WED A;  1RKM A;  3C32 A;  3KG2 A;  1JP4 A;  3OO9 A;  2Q2A A;  2RIN A;  3PPO A;  3VXB A;  1FPG A;  4DLD A;  1NL5 A;  2O84 X;  3G3G A;  4KR5 A;  3D4C A;  5IAI A;  4NF6 B;  5H8H A;  3MZ1 A;  2ZNT A;  4QSE A;  3F11 A;  3PUV E;  4JVD A;  4PCD A;  4F2Q A;  2GQ1 A;  1IMB A;  1VR5 A;  3GZG A;  1DBZ A;  4GX6 A;  2XXR A;  3A29 A;  1FW0 A;  3GBB A;  2WX9 A;  2DOJ A;  1FQB A;  1UTB A;  1NFT A;  2XXW A;  2VPO A;  1LBX A;  1FTA A;  2F3B A;  3GXA A;  4IO7 A;  1IXH A;  2R71 A;  1LAF E;  4PE5 B;  1I6Q A;  4FBP A;  1R1N A;  4KD5 A;  3M3K A;  4F3P A;  4I9D A;  2ONK E;  4I3Y A;  4TQU Q;  3V8X B;  3QMF A;  4GWS A;  2CZK A;  2CEY A;  1DPE A;  2XXI A;  2VOZ A;  1ANF A;  3FXB A;  4ELR A;  1LFI A;  2RC7 A;  5IZ3 B;  3N5L A;  3CFL A;  4KPT A;  1PDA A;  3U1O A;  1UTH A;  2V4C A;  4FOR A;  1PBQ A;  3SEV A;  5L8D A;  1QKB A;  2LAO A;  4QXD A;  5L9M A;  1NV3 A;  2R8T A;  1DOT A;  4P56 A;  4LZ5 A;  1FCK A;  3IO4 A;  3JYR A;  4ESW A;  4Z0I A;  3L6H A;  1NV7 A;  3VV5 A;  3TCH A;  4F3G A;  3ILT B;  3BKI B;  3HV1 A;  3N94 A;  4OEN A;  2R6G E;  1EH3 A;  3EF7 A;  5IZ3 A;  4F19 A;  4GWX A;  4GOT A;  3CR9 A;  1B5I A;  2QJE A;  4KCC A;  4YMB A;  5H8Q B;  5BUU A;  3C36 A;  4Q0C A;  1B58 A;  2Y5L A;  4Z7E A;  1MH4 A;  3LUY A;  1G0I A;  4C1T A;  1LFG A;  4M4G A;  3S9E A;  4JSD A;  1R9Q A;  3ILU B;  4I1D A;  3FV2 A;  2DS9 A;  5FTI A;  3TTN A;  2F5X A;  2F6P A;  1YZ0 A;  1MQG A;  1OQH A;  4NX1 A;  2V93 A;  3RQT A;  4UA8 A;  4IO3 A;  1MXU A;  2OWZ A;  1PB7 A;  4N13 A;  5B7D A;  2XX8 A;  1P1U A;  2OJT A;  3PUX E;  1B1X A;  1KA0 A;  4JB7 A;  4O8M A;  4R9F A;  3B7D A;  5L9O A;  2DWH A;  2DXY A;  1A8E A;  5I2N B;  1NNP A;  4KYE A;  2XD2 A;  4OTE A;  1NUY A;  2ESN A;  3D1R A;  2DWJ A;  1MPD A;  3FZV A;  3K2D A;  2I3V A;  2NWJ A;  4P3L A;  4Q30 B;  3SZP A;  2OWT A;  3USD A;  3IO6 A;  2HXR A;  1N3X A;  2RCA A;  4OVS A;  4BDN A;  4IY5 A;  3IOT A;  4KYD A;  3NOH A;  4FJP A;  3JZJ A;  2KR0 A;  1FBH A;  3A09 A;  4NHB A;  1TT1 A;  3FVO A;  5EHM A;  1MY3 A;  3FJG A;  1Q1K A;  3TTK A;  1PB8 A;  2DYX A;  2QS3 A;  1A7L A;  3N6U A;  3TOD A;  5TP9 A;  4FE8 A;  3Q28 A;  3OXN A;  3C33 A;  3RT8 A;  2AL4 A;  4YZZ A;  1LAX A;  1BTJ A;  4XF5 A;  4QFL A;  1XVX A;  3O28 A;  2HFB A;  1ZIU A;  3HST A;  3G3H A;  2ZYK A;  1H44 A;  5I2K B;  1MXV A;  2PBW A;  4LVQ A;  1MXX A;  4F1U A;  1DMB A;  3TCF A;  4FEC A;  3UK4 A;  4OFO A;  1GR2 A;  4XKQ A;  3N26 A;  1TFD A;  3ECR A;  1FPF A;  2XWI A;  1NNT A;  3E4R A;  2F8D A;  2CZH A;  3FGS A;  4ND9 A;  2G29 A;  3HCQ A;  3T9U A;  4PFB A;  3TAJ A;  5AA3 A;  2QS4 A;  5K2Y A;  1H43 A;  1O63 A;  2DE4 A;  5DVI A;  3H3G A;  1A40 A;  2A5S A;  4LN5 A;  4WKM A;  2DWA A;  2I0B A;  3M3F A;  4OAN A;  4IGT A;  3TTR A;  3MP8 A;  4G77 A;  5KCJ A;  3K1P A;  1JEU A;  1FQA A;  5EQ9 A;  3SES A;  3TEL A;  4JBZ A;  4PAF A;  3I5O A;  1GGG A;  5TU0 A;  5A5X B;  2Y7I A;  3OSR A;  4YKI A;  1M5E A;  4U21 A;  1O64 A;  1OLC A;  2O69 A;  2X26 A;  3ONM A;  4EQ9 A;  4BLA A;  5AA2 B;  2HZK A;  3PGF A;  4RY1 A;  1II5 A;  3V83 A;  1IXG A;  4PQJ A;  3JV9 A;  3MZB A;  2XWO A;  4K3F A;  5ISU A;  1H3D A;  1B0L A;  3SEY A;  3QK6 A;  3G3J A;  4X8R A;  3TTL A;  3T96 B;  2VPN A;  4P47 A;  5AA2 A;  4F1V A;  2D3I A;  5EYG A;  1SYI A;  1VDW A;  3VLW A;  1LBV A;  2CZL A;  4G61 A;  5T3J A;  4G8M A;  2OZZ A;  4G68 C;  3EQ1 A;  3OO8 A;  4LQ2 A;  4YU0 A;  2ZZW A;  3Q26 A;  2PVU A;  1FTO A;  2PFY A;  3H6T A;  4OER A;  1QJM A;  1Z7N E;  4EF2 A;  4GL0 A;  2Z22 A;  1J1N A;  1BP5 A;  5LOM A;  4L17 A;  1HSJ A;  3K6U A;  1QUK A;  4AS4 A;  3V89 B;  4H45 A;  1B4H A;  1YAE A;  3CIJ A;  1TWY A;  4I8C A;  4UAC A;  4O3B A;  4NMY A;  1KZ8 A;  1AMF A;  2OK2 A;  4MNI A;  1BIY A;  2KLF A;  5ITP A;  2ZYN A;  4OVP A;  5CMM A;  4OHN A;  3TQW A;  3G7W A;  1FPE A;  3MBP A;  2VD3 A;  1MY4 A;  2ABH A;  4IY6 A;  4QF9 A;  1AWB A;  3RUM A;  4BDL A;  4R72 A;  3HHG A;  4EXL A;  2PX1 A;  3MP1 A;  4DIG A;  4ZED A;  3AXF A;  4H5G A;  3KEI A;  1A8F A;  5K2X A;  2AIX A;  2WKY A;  4AS5 A;  4MLQ A;  4OFL A;  5I57 A;  1H76 A;  2UVJ A;  1NUX A;  3CG1 A;  1SI0 A;  4LAT A;  4MNP A;  4RA1 A;  2FBP A;  2X7Q A;  4GVO A;  4H0W A;  3FJ7 A;  4I3E A;  3VE1 B;  1BLF A;  4FIM A;  2XXV A;  3W15 C;  1B5J A;  2F6G A;  3SEX A;  5DT6 A;  2D5W A;  3VLV A;  4PDD A;  5KZT A;  2OBG A;  5J1D A;  3PPQ A;  3PPR A;  3PPP A;  4U1Z A;  1LAG E;  4O3A A;  1IMD A;  4E0W A;  2B3F A;  5CBS A;  4G2Z A;  1FQD A;  1DTZ A;  4OET A;  2V3T A;  4RNS A;  2BJJ X;  1BKA A;  1XS5 A;  2XX7 A;  4N81 A;  4N15 A;  2YPN A;  2QVV A;  1GTK A;  3ZS6 A;  2DE3 A;  2HXW A;  1IMA A;  1IXI A;  4YMA A;  2QMX A;  2IEE A;  5CC2 A;  1S9T A;  1LEV A;  4NF5 B;  5H8H B;  1JVY A;  4KXP A;  1B46 A;  4RK9 A;  3RN8 A;  4ISU A;  3U65 A;  1JVX A;  3IX1 A;  2B4M A;  1FPD A;  1IEJ A;  4DCY A;  1GV8 A;  2VT5 A;  4ZDM A;  3VVE A;  4FAJ A;  1US5 A;  3W9W A;  3MP6 A;  1LGB C;  5F1Q A;  1UTB B;  4GXS B;  5EHS A;  5DEX A;  1B51 A;  1NV2 A;  3FXR A;  1FBC A;  3KOT A;  3OD7 A;  4NE4 A;  1MQI A;  1M5F A;  1MXZ A;  3MVX A;  3LSF B;  4NF5 A;  3B6W A;  4F3S A;  5ET5 A;  3PUY E;  1SQY A;  3MW0 A;  1AL3 A;  1K9Z A;  1MDQ A;  3TTM A;  1USY E;  3LUZ A;  1JW5 A;  5EYH A;  1UTH B;  3MYU A;  4X48 A;  2F35 A;  4JVC A;  3LSW A;  4H6D A;  1I6A A;  3K02 A;  5CMC A;  2OWS A;  2Y84 A;  5H8F B;  1URD A;  4HE1 A;  2PYY A;  5CRY A;  1MH3 A;  4QBA A;  4PFT A;  3HPI A;  1P1O A;  1NKX A;  3U8Q A;  2Y7P A;  1N04 A;  3TCG A;  3ROJ A;  2P3N A;  3T9H B;  4FEB A;  1KA1 A;  3SKP A;  4X9T A;  4GWZ A;  1IXC A;  1LCF A;  1USY H;  1G0H A;  1YTV A;  2ONS A;  3HFU A;  3PUZ E;  5H8F A;  2QS2 A;  1QVS A;  2P1S A;  2F7B A;  1UIV A;  5A5L A;  1FPB A;  2XXH A;  3IAZ A;  1ZMG A;  4PF6 A;  4EXK A;  4N4U A;  3RT6 B;  2L5V A;  3KBZ A;  1FTK A;  1JET A;  1OQG A;  1SW4 A;  4HCW A;  4I62 A;  4GF8 A;  2B3B A;  3C9H A;  2H5Y A;  3EKI A;  3CRB A;  2ONR A;  4GRK A;  1MPB A;  1B3G A;  1N7W A;  2QS1 A;  2V84 A;  1XI6 A;  4N6K A;  4KYS A;  2Y7W A;  5FHN A;  5AA4 B;  4ONY A;  2AYS A;  2WYP A;  3RYD A;  3A3U A;  3IK6 B;  2UYE A;  4G68 B;  3U93 A;  1NMU A;  4KQP A;  2AL5 A;  1N3W A;  5DVF A;  1L5T A;  2THI A;  2Q8J A;  3O9P A;  1HSE A;  4U23 A;  3RY3 A;  3E3K A;  4NWD A;  4MIJ A;  1FBP A;  3VVF A;  4JSO A;  2NVU B;  5JTY A;  2V25 A;  2Z8E A;  4O7I A;  5AA4 A;  1P99 A;  4U4X A;  2FNC A;  4MHF A;  4G68 A;  4N8Y A;  2G93 A;  1ATG A;  4H65 A;  4H46 A;  4HW8 A;  3FV1 A;  3KBR A;  2XWK A;  3IJO B;  3VVD A;  5DVJ A;  1CNQ A;  2GH9 A;  5ET6 A;  2XA5 A;  1MG1 A;  3BBR A;  3S9M C;  5TP9 B;  3LBS A;  4ZEC A;  4U2R A;  5EQA A;  1NUZ A;  3CSG A;  5ET8 A;  1FJ6 A;  1LST A;  3GLB A;  3FVN A;  4ZEB A;  4MCO A;  5FHM A;  4BDQ A;  1B40 A;  3VXC A;  1FPK A;  3K4U A;  4Q5T A;  4R6Y A;  2CZI A;  1B9J A;  2WYK A;  1Q9D A;  3BIG A;  1IMC A;  1NNF A;  1ZLQ A;  4R6K A;  5CBR A;  4C0R A;  5EQ7 A;  2Z8D A;  4LQ5 A;  4OZ9 A;  1Y3Q A;  4XKR A;  5IZZ A;  1PB9 A;  4UAB A;  3LV0 A;  3OEK A;  3M3L A;  4GL8 A;  2HPG A;  4NF4 A;  4H8J A;  5FTH A;  4GIZ A;  4QSC A;  4YKP A;  1N76 A;  3FXQ A;  3PTY A;  1IME A;  1ZKB A;  3FD3 A;  3KZG A;  5KCJ B;  1GVC A;  2UVG A;  4G8N A;  2HEU A;  3OOA A;  1B7U A;  4PE3 A;  1VSO A;  3B6T A;  3KJT A;  4NF8 B;  2RF1 A;  4F18 A;  4PBQ A;  2V3U A;  1FTJ A;  3IOU A;  4NGU A;  4R73 A;  5F7V A;  1XVY A;  5I3S A;  3PU5 A;  4P0G A;  1FBF A;  1HSL A;  4QRZ A;  1XHY A;  3KFM A;  2ALU A;  3FJM A;  1CE2 A;  1R9L A;  4MEV A;  1NH7 A;  2REG A;  3FUZ A;  1QKA A;  3RNN A;  3UA8 A;  2HZL A;  3MPK A;  5EYF A;  3HHF A;  2WBD A;  3M8U A;  2RC8 A;  3R6U A; 
#chains in the Genus database with same CATH homology
 1WDN A;  4NF8 A;  4AB5 A;  4HCY A;  4YKJ A;  3QAX A;  3H6W A;  2Q88 A;  3KSJ A;  1ELJ A;  1OIB A;  1DTG A;  4FAT A;  3KOS A;  4KHZ E;  2GHA A;  3IOR A;  1Y4C A;  5I56 B;  3DEL B;  4F2O A;  4YIC A;  4YB6 A;  3EHS A;  4GFR A;  3DM0 A;  3QYT A;  4WXJ A;  3T9X B;  3A3C A;  4QFO A;  4WEP A;  4U22 A;  1FQE A;  3D4G A;  3T66 A;  3OO6 A;  5I56 A;  3KN7 A;  5TPA A;  4RYA A;  2ZNS A;  4OEU A;  3UGW A;  1A99 A;  3TDJ A;  3RPW A;  1D9V A;  3EN3 A;  3C34 A;  4LP2 B;  4IGR A;  2DSF A;  3THI A;  3IB0 A;  1URG A;  3K00 A;  4YB5 A;  4OQO A;  3PD8 A;  5B70 A;  1ZTY A;  3OEM A;  4H67 A;  4XKP A;  3QIM A;  1JEV A;  4R74 A;  3GBA A;  1URS A;  2QPQ A;  2O6A A;  1OLA A;  3EHU A;  3UP9 A;  5HBC A;  4GXA A;  3N6T A;  3G3K A;  4M1V A;  3O2A A;  4ZZA A;  5JK4 A;  2VGQ A;  1YCJ A;  4JXI A;  4PP0 A;  1B3L A;  1RYX A;  3VLU A;  5I57 B;  2PT2 A;  4OYV A;  4RPN A;  4KI0 E;  4ZZE A;  1MPC A;  2DVZ A;  3K1M A;  4POW A;  3O66 A;  3S9N C;  3SER A;  3UOR A;  2F34 A;  4ZS9 A;  3MVW A;  1SW1 A;  4GQO A;  1JNF A;  1IQ7 A;  1MQD A;  3IL1 B;  3FAS A;  4DCX A;  2F7A A;  2Q2C A;  1XC1 A;  3CFX A;  1VE4 A;  1AIV A;  3OO7 A;  2ANJ A;  2HCA A;  4EQ7 A;  1M5D A;  5H8N A;  2F97 A;  1LCT A;  4U1O A;  2ZXT A;  2Q89 A;  1DPP A;  4N6P A;  5IKB A;  3RGY A;  1JQF A;  1Y20 A;  4OVJ A;  2P2A A;  2I4B A;  3DLN A;  3PD9 A;  1IZ1 A;  3C35 A;  1POY 1;  3TFL A;  5DTB A;  3PV0 E;  1Y3P A;  3MC2 A;  1OVT A;  5M2V A;  5ICQ A;  4P0I A;  4JWY A;  1MS7 A;  2XD3 A;  2VD2 A;  2B65 A;  2H98 A;  3IOW A;  4OES A;  1M5C A;  5DEX B;  4QSD A;  3BFU A;  1MRP A;  4OXV A;  3O29 A;  3QXM A;  1B0H A;  2ZYM A;  3S2V A;  1VFD A;  3H06 B;  1LAH E;  3Q25 A;  5ITO A;  1NH8 A;  4ECF A;  1PC3 A;  2UVH A;  3Q29 A;  1B6H A;  1FTL A;  2XHD A;  1AOV A;  3ODB A;  3LR1 A;  4OFJ A;  4EF1 A;  4R6H A;  2H99 A;  3IOV A;  4XXU A;  2W7Y A;  2X7P A;  1QUI A;  1ZU0 A;  3L6G A;  3LSL A;  5L9S A;  1JW4 A;  2Z23 A;  5JEI A;  4F22 A;  2E0S A;  1QUL A;  1XT8 A;  1S50 A;  2ZNU A;  4O3C A;  3K01 A;  1LB9 A;  2H25 A;  2QSX A;  1IIW A;  3FVG A;  2D21 A;  4DZ1 A;  2O1M A;  1UQW A;  5ELV A;  1MM7 A;  5ICT A;  3CFZ A;  2OLB A;  4KCD A;  2IA4 A;  1MM6 A;  3FIR A;  4RK2 A;  3QUJ A;  1MY0 A;  3OMB A;  1CB6 A;  2RKM A;  3U72 A;  1R6Z A;  3TUS A;  3DP8 A;  4MLV A;  4TLL B;  3U94 A;  2NOO A;  4NF6 A;  3QUF A;  4P11 A;  2XXT A;  3FVK A;  4TOZ A;  1VFE A;  3K0V A;  4QFK A;  1XOC A;  3HO7 A;  1B7Z A;  4QFP A;  3T9V A;  1A55 A;  4FED A;  3TYH A;  1SW2 A;  3I3V A;  4ELO A;  3LC8 A;  1SYH A;  3SET A;  4AB6 A;  3R26 A;  4LZ7 A;  4NTL A;  1D4N A;  1P1Q A;  1Y9U A;  4YB7 A;  2XXU A;  2Y7K A;  2YJP A;  5JTY B;  3PMX A;  4MF3 A;  1FQF A;  2UVI A;  1H45 A;  2VP1 A;  4PFU A;  2E1S A;  1PBP A;  3PMW A;  2F7C A;  2QL3 A;  4F29 A;  2CMO A;  2FYI A;  5DYH A;  4XKN A;  1EZO A;  3KJ7 A;  4H5F A;  3T22 A;  1P1W A;  2PT1 A;  1F9B A;  2Y7R A;  1MY1 A;  1IIT A;  4QHQ A;  4MBP A;  1MQH A;  2I49 A;  4GWO A;  5H8Q A;  4DXB A;  1MQJ A;  3KGC A;  4MFI A;  2O68 A;  4AQ4 A;  1Q35 A;  4JDF A;  5CI5 A;  4RPO A;  3BFT A;  1LLS A;  3IB1 A;  3SEW A;  2VHA A;  3EPE A;  3K1N A;  3MUQ A;  3VDF A;  2FA7 A;  2DWI A;  1ZBM A;  4NED A;  4NF4 B;  3MJN A;  3MWB A;  3IB2 A;  1Y4T A;  4E0X A;  3PUW E;  3K6W A;  3O6I A;  1M5B A;  3CG3 A;  1D9Y A;  4PFW A;  4POX A;  5CMK A;  2DVC A;  4LA9 A;  5I2N A;  3TZA A;  4F1Y A;  4R9G A;  4DE8 A;  1TXF A;  1EU8 A;  3LSX A;  1I6B A;  4F39 A;  4EDP A;  1ZJL A;  3KSX A;  2YLN A;  2DE2 A;  4DXC A;  3QSL A;  3IJX B;  3TKD A;  3U92 A;  3KN3 A;  3W9V A;  3IR1 A;  1IUD A;  3G3F A;  4IO5 A;  4JWO A;  1SDX A;  1LB8 A;  5I84 A;  1KWH A;  1B7H A;  1SVX B;  1WOD A;  2DXR A;  5AA1 A;  3RLF E;  1QUJ A;  5CMB A;  4GD5 A;  1LBB A;  4U4S A;  1Y3N A;  4QFN A;  5I59 B;  4ELP A;  4C1U A;  4BDR A;  3PMV A;  2Z8F A;  4G4P A;  4R2F A;  4ZE9 A;  4ZEF A;  1O7T A;  4IB2 A;  4G8H A;  3K6X A;  3ZKK A;  1B3E A;  2XXP A;  5I2K A;  1B3H A;  2ZMB A;  4XIG Q;  2I4C A;  2O51 A;  1EZP A;  2GHB A;  2XX9 A;  3RTF B;  1Z7M E;  3H03 A;  3O6H A;  4ZE8 A;  4RXL A;  4X1D A;  1EZ9 A;  1SI1 A;  5I59 A;  5TPA B;  1T0K A;  5HPQ A;  1B1H A;  2V3Q A;  3I6V A;  3DP6 A;  1SBP A;  1N0T A;  1TFA A;  2F36 A;  4IO2 A;  3EHT A;  4BDM A;  4H1X A;  4IO6 A;  4R2B A;  3MPL A;  2Q9T A;  1RYO A;  1FQC A;  2HAV A;  1A54 A;  3H7M A;  3TEP A;  3MAM A;  4BDO A;  1FTM A;  4MH5 A;  3PPN A;  4N07 A;  5A5X A;  2ZYO A;  1SD3 A;  2H9B A;  3MVZ A;  3OEL A;  2PMS A;  4XTC Q;  3SDF A;  2QRY A;  4ELQ A;  5HM4 B;  4GLI A;  3C31 A;  1N84 A;  4HS7 A;  3HN0 A;  3G3I A;  4KFQ A;  2I0C A;  2XXQ A;  3MQ9 A;  2DQV A;  2XXY A;  4ZEI A;  3WAF A;  4IO4 A;  2RC9 A;  4H8I A;  1B3F A;  1AH5 A;  3KN8 A;  4Q8R A;  4F3B A;  3CVG A;  4THI A;  1UIU A;  3H6V A;  3H4Z A;  4DDD A;  2DP8 A;  5AE4 A;  3C4M A;  1D3K A;  1LBC A;  4TLM B;  1MXY A;  4F31 B;  3E9X A;  4ZEK A;  3RTW B;  2OCU A;  1OMP A;  2REJ A;  2A5T B;  2R9J A;  4JWX A;  3O97 A;  4YKK A;  4ESX A;  1MY2 A;  3S4U A;  1POT A;  4NWC A;  4LUB A;  4LZ8 A;  3CI8 A;  1QW0 A;  2UXA A;  1NNK A;  3R7X A;  3H6U A;  1B5H A;  2I48 A;  2UYF A;  5H8N B;  2O1L A;  3O6G A;  5BWJ A;  3DP4 A;  3OSQ A;  1P1N A;  3TQL A;  3VFJ A;  2A5T A;  4PET A;  3MVY A;  1LFH A;  1N7X A;  2QMW A;  1MXW A;  3OEN A;  1B32 A;  3S9L C;  4LON B;  3K6V A;  3TPA A;  2I58 A;  3MZ9 A;  2P0S A;  4DXU A;  1B52 A;  4X1B A;  2O7I A;  1JW1 A;  2M8C A;  1B05 A;  3CSB A;  5CM6 A;  2GFE A;  5FHO A;  1US4 A;  2NXO A;  2I3W A;  4OMB A;  2RCB A;  1WVJ A;  5AA2 D;  3UN6 A;  4EQB A;  5I58 B;  4OEV A;  4OWD A;  3ZSF A;  2GRV A;  2I6E A;  4EUO A;  1B4Z A;  4PFY A;  2H4I A;  5KDT B;  3V5A A;  1PEB A;  1Y1Z A;  3T93 B;  3FXU A;  4R75 A;  1B2H A;  3SEU A;  3FAT A;  1YPN A;  4RJZ A;  3P7I A;  3E13 X;  2HQ0 A;  5I58 A;  1OVB A;  2F78 A;  4HTG A;  5H8S A;  3Q27 A;  3WAE A;  1S7Y A;  2NUV A;  3B6Q A;  4YAH X;  1MDP 1;  1I69 A;  1DSN A;  1Y1M A;  5KDT A;  2O7U A;  3ZKL A;  1SW5 A;  3UIF A;  3TMG A;  2HAU A;  2XXX A;  4WED A;  1RKM A;  3C32 A;  3KG2 A;  3OO9 A;  2Q2A A;  2RIN A;  3PPO A;  3VXB A;  4DLD A;  1NL5 A;  2O84 X;  3G3G A;  4KR5 A;  3D4C A;  5IAI A;  4NF6 B;  5H8H A;  3MZ1 A;  2ZNT A;  4QSE A;  3F11 A;  3PUV E;  4F2Q A;  1VR5 A;  3GZG A;  2XXR A;  1FW0 A;  3GBB A;  2DOJ A;  1FQB A;  1UTB A;  1NFT A;  2XXW A;  3GXA A;  4IO7 A;  1IXH A;  2R71 A;  1LAF E;  4PE5 B;  1I6Q A;  1R1N A;  4KD5 A;  3M3K A;  4F3P A;  4I9D A;  2ONK E;  4TQU Q;  3V8X B;  1DPE A;  2XXI A;  2VOZ A;  1ANF A;  4ELR A;  1LFI A;  2RC7 A;  3N5L A;  3CFL A;  4KPT A;  1PDA A;  3U1O A;  1UTH A;  4FOR A;  1PBQ A;  3SEV A;  5L8D A;  1QKB A;  2LAO A;  5L9M A;  1DOT A;  4LZ5 A;  1FCK A;  3IO4 A;  3JYR A;  4ESW A;  4Z0I A;  3L6H A;  3VV5 A;  3TCH A;  4F3G A;  3ILT B;  3BKI B;  3HV1 A;  3N94 A;  4OEN A;  2R6G E;  1EH3 A;  3EF7 A;  4F19 A;  4GOT A;  3CR9 A;  1B5I A;  2QJE A;  4KCC A;  4YMB A;  5H8Q B;  5BUU A;  3C36 A;  4Q0C A;  1B58 A;  4Z7E A;  1MH4 A;  3LUY A;  4C1T A;  1LFG A;  4M4G A;  3S9E A;  4JSD A;  1R9Q A;  3ILU B;  4I1D A;  3FV2 A;  2DS9 A;  5FTI A;  3TTN A;  2F5X A;  2F6P A;  1MQG A;  1OQH A;  2V93 A;  3RQT A;  4UA8 A;  4IO3 A;  1MXU A;  1PB7 A;  4N13 A;  5B7D A;  2XX8 A;  1P1U A;  2OJT A;  3PUX E;  1B1X A;  4JB7 A;  4R9F A;  3B7D A;  5L9O A;  2DWH A;  2DXY A;  1A8E A;  5I2N B;  1NNP A;  4KYE A;  2XD2 A;  4OTE A;  2ESN A;  2DWJ A;  1MPD A;  3FZV A;  3K2D A;  2I3V A;  2NWJ A;  4Q30 B;  2OWT A;  3USD A;  3IO6 A;  1N3X A;  2RCA A;  4BDN A;  4IY5 A;  3IOT A;  4KYD A;  4FJP A;  3JZJ A;  3A09 A;  1TT1 A;  3FVO A;  5EHM A;  1MY3 A;  3FJG A;  1Q1K A;  3TTK A;  1PB8 A;  2DYX A;  2QS3 A;  1A7L A;  3N6U A;  3TOD A;  5TP9 A;  4FE8 A;  3Q28 A;  3OXN A;  3C33 A;  3RT8 A;  2AL4 A;  4YZZ A;  1LAX A;  1BTJ A;  4QFL A;  1XVX A;  3O28 A;  2HFB A;  1ZIU A;  3HST A;  3G3H A;  2ZYK A;  1H44 A;  5I2K B;  1MXV A;  2PBW A;  4LVQ A;  1MXX A;  4F1U A;  1DMB A;  3TCF A;  4FEC A;  3UK4 A;  4OFO A;  1GR2 A;  4XKQ A;  3N26 A;  1TFD A;  3ECR A;  1NNT A;  3E4R A;  2F8D A;  3FGS A;  4ND9 A;  2G29 A;  3HCQ A;  3T9U A;  3TAJ A;  5AA3 A;  2QS4 A;  5K2Y A;  1H43 A;  1O63 A;  2DE4 A;  5DVI A;  3H3G A;  1A40 A;  2A5S A;  4WKM A;  2DWA A;  2I0B A;  3M3F A;  4IGT A;  3TTR A;  3MP8 A;  4G77 A;  5KCJ A;  3K1P A;  1JEU A;  1FQA A;  3SES A;  3TEL A;  4JBZ A;  3I5O A;  1GGG A;  5TU0 A;  5A5X B;  2Y7I A;  3OSR A;  4YKI A;  1M5E A;  4U21 A;  1O64 A;  1OLC A;  2O69 A;  2X26 A;  3ONM A;  4EQ9 A;  4BLA A;  5AA2 B;  2HZK A;  3PGF A;  4RY1 A;  1II5 A;  3V83 A;  1IXG A;  4PQJ A;  3JV9 A;  3MZB A;  4K3F A;  5ISU A;  1H3D A;  1B0L A;  3SEY A;  3QK6 A;  3G3J A;  3TTL A;  3T96 B;  5AA2 A;  4F1V A;  2D3I A;  1SYI A;  3VLW A;  2CZL A;  4G8M A;  2OZZ A;  4G68 C;  3EQ1 A;  3OO8 A;  4LQ2 A;  4YU0 A;  3Q26 A;  2PVU A;  1FTO A;  3H6T A;  4OER A;  1QJM A;  1Z7N E;  4EF2 A;  4GL0 A;  2Z22 A;  1J1N A;  1BP5 A;  5LOM A;  4L17 A;  1HSJ A;  3K6U A;  1QUK A;  3V89 B;  1B4H A;  1YAE A;  3CIJ A;  1TWY A;  4I8C A;  4UAC A;  4O3B A;  4NMY A;  1AMF A;  2OK2 A;  1BIY A;  2KLF A;  5ITP A;  2ZYN A;  5CMM A;  4OHN A;  3TQW A;  3G7W A;  3MBP A;  2VD3 A;  1MY4 A;  2ABH A;  4IY6 A;  4QF9 A;  3RUM A;  4BDL A;  4R72 A;  3HHG A;  4EXL A;  2PX1 A;  3MP1 A;  4DIG A;  4ZED A;  3AXF A;  4H5G A;  3KEI A;  1A8F A;  5K2X A;  2AIX A;  2WKY A;  4MLQ A;  4OFL A;  5I57 A;  1H76 A;  2UVJ A;  3CG1 A;  1SI0 A;  4LAT A;  4RA1 A;  2X7Q A;  4GVO A;  4H0W A;  3FJ7 A;  3VE1 B;  1BLF A;  4FIM A;  2XXV A;  3W15 C;  1B5J A;  2F6G A;  3SEX A;  5DT6 A;  2D5W A;  3VLV A;  5KZT A;  2OBG A;  5J1D A;  3PPQ A;  3PPR A;  3PPP A;  4U1Z A;  1LAG E;  4O3A A;  4E0W A;  2B3F A;  5CBS A;  4G2Z A;  1FQD A;  1DTZ A;  4OET A;  2V3T A;  4RNS A;  2BJJ X;  1BKA A;  1XS5 A;  2XX7 A;  2YPN A;  1GTK A;  3ZS6 A;  2DE3 A;  2HXW A;  1IXI A;  4YMA A;  2QMX A;  2IEE A;  5CC2 A;  1S9T A;  4NF5 B;  5H8H B;  1JVY A;  1B46 A;  4RK9 A;  3RN8 A;  4ISU A;  1JVX A;  3IX1 A;  1IEJ A;  4DCY A;  1GV8 A;  3VVE A;  4ZDM A;  4FAJ A;  1US5 A;  3W9W A;  3MP6 A;  1LGB C;  5F1Q A;  1UTB B;  4GXS B;  5EHS A;  5DEX A;  1B51 A;  3FXR A;  3KOT A;  3OD7 A;  4NE4 A;  1MQI A;  1M5F A;  1MXZ A;  3MVX A;  3LSF B;  4NF5 A;  3B6W A;  4F3S A;  3PUY E;  1SQY A;  3MW0 A;  1AL3 A;  1MDQ A;  3TTM A;  1USY E;  1JW5 A;  1UTH B;  4X48 A;  2F35 A;  3LSW A;  4H6D A;  1I6A A;  3K02 A;  5CMC A;  2OWS A;  2Y84 A;  5H8F B;  1URD A;  2PYY A;  5CRY A;  1MH3 A;  4PFT A;  3HPI A;  1P1O A;  1NKX A;  3U8Q A;  2Y7P A;  1N04 A;  3TCG A;  3T9H B;  4FEB A;  3SKP A;  4X9T A;  1IXC A;  1LCF A;  1USY H;  1YTV A;  2ONS A;  3PUZ E;  5H8F A;  2QS2 A;  1QVS A;  2P1S A;  2F7B A;  1UIV A;  2XXH A;  3IAZ A;  1ZMG A;  4EXK A;  3RT6 B;  1FTK A;  1JET A;  1OQG A;  1SW4 A;  4HCW A;  4I62 A;  4GF8 A;  2B3B A;  3C9H A;  2H5Y A;  3CRB A;  2ONR A;  4GRK A;  1MPB A;  1B3G A;  1N7W A;  2QS1 A;  2V84 A;  4KYS A;  2Y7W A;  5FHN A;  5AA4 B;  4ONY A;  2AYS A;  3A3U A;  3IK6 B;  2UYE A;  4G68 B;  3U93 A;  1NMU A;  4KQP A;  2AL5 A;  1N3W A;  5DVF A;  1L5T A;  2THI A;  2Q8J A;  3O9P A;  1HSE A;  4U23 A;  3RY3 A;  3E3K A;  4NWD A;  3VVF A;  4JSO A;  2NVU B;  5JTY A;  2V25 A;  2Z8E A;  5AA4 A;  1P99 A;  4U4X A;  2FNC A;  4G68 A;  2G93 A;  1ATG A;  4H65 A;  4HW8 A;  3FV1 A;  3KBR A;  3IJO B;  3VVD A;  5DVJ A;  2GH9 A;  1MG1 A;  3BBR A;  3S9M C;  5TP9 B;  3LBS A;  4ZEC A;  4U2R A;  3CSG A;  1LST A;  3GLB A;  3FVN A;  4ZEB A;  5FHM A;  4BDQ A;  1B40 A;  3VXC A;  3K4U A;  4Q5T A;  4R6Y A;  1B9J A;  1NNF A;  1ZLQ A;  4R6K A;  5CBR A;  4C0R A;  2Z8D A;  4LQ5 A;  4OZ9 A;  1Y3Q A;  4XKR A;  1PB9 A;  3OEK A;  3M3L A;  4GL8 A;  4NF4 A;  4H8J A;  5FTH A;  4GIZ A;  4QSC A;  4YKP A;  1N76 A;  3FXQ A;  1ZKB A;  3FD3 A;  3KZG A;  5KCJ B;  1GVC A;  2UVG A;  4G8N A;  2HEU A;  3OOA A;  1B7U A;  1VSO A;  3B6T A;  3KJT A;  4NF8 B;  2RF1 A;  4F18 A;  2V3U A;  1FTJ A;  3IOU A;  4R73 A;  5F7V A;  1XVY A;  3PU5 A;  4P0G A;  1HSL A;  4QRZ A;  1XHY A;  3KFM A;  2ALU A;  3FJM A;  1CE2 A;  1R9L A;  1NH7 A;  2REG A;  3FUZ A;  1QKA A;  3RNN A;  3UA8 A;  2HZL A;  3MPK A;  5EYF A;  3HHF A;  3M8U A;  2RC8 A;  3R6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...