1A8EA

Human serum transferrin, recombinant n-terminal lobe
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two high-resolution crystal structures of the recombinant N-lobe of human transferrin reveal a structural change implicated in iron release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Iron transport
molecule keywords SERUM TRANSFERRIN
total genus 107
structure length 329
sequence length 329
other databases KnotProt 2.0: K
ec nomenclature
pdb deposition date 1998-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a8eA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1a8eA02
4ESXA 4KFQA 3EQ1A 2IA4A 5ITOA 1Y9UA 3FATA 3RQTA 4F18A 1NNFA 4NF5A 3TCHA 1H45A 4ZE9A 5I59A 2OCUA 2X7PA 4L17A 3DELB 4YKJA 4ZZAA 1B3EA 4C1UA 3KOSA 3FGSA 4LP2B 3B6WA 1CE2A 4OERA 1NKXA 1YTVA 2B65A 2VP1A 2XXVA 3SEWA 1Z7ME 1T0KA 4R72A 1OVBA 3C32A 2I0CA 2XX7A 3CG1A 4IO5A 5DYHA 2ZYNA 2VOZA 3OEMA 4KI0E 5AA4A 3LSFB 3G7WA 4PE5B 3K6XA 2PX1A 5I58A 1MPDA 1N04A 4K3FA 3RGYA 3E9XA 3T9VA 1VFDA 3KFMA 3KJ7A 4R73A 4YKPA 5I56B 3L6GA 2E1SA 1B46A 3FJGA 4OHNA 2I3WA 4G77A 1BKAA 1PB9A 3FV1A 4OYVA 1S50A 2AL4A 1MXZA 1R6ZA 1WDNA 3IB1A 3UGWA 3V89B 3OO7A 5KCJA 2QS2A 5HPQA 1MQGA 2GFEA 2REGA 4GL8A 1B2HA 3QUFA 1OLCA 2V25A 3O66A 3Q28A 4ONYA 3KN8A 1FW0A 3KSXA 1P1NA 3LR1A 4LZ7A 2PVUA 5CM6A 1B40A 3UN6A 1IITA 1PB8A 1POTA 2O6AA 3KN7A 1SW4A 4KYSA 1VSOA 4XIGQ 3BKIB 3KN3A 2OJTA 3IL1B 3O6IA 1B0HA 1B3FA 5TPAB 3UA8A 5CBSA 1R9LA 2V3UA 2I4CA 3GZGA 4R9FA 4RA1A 2PBWA 2Q9TA 4PFYA 2AYSA 2ABHA 2GHAA 1SW2A 2PYYA 3FV2A 3E4RA 3S9NC 1PBPA 2R6GE 2V3QA 4HS7A 1TFDA 3R26A 1MXUA 3I6VA 5EHMA 5FTHA 5F7VA 2HCAA 4NTLA 1B7UA 4U1ZA 2O51A 3VLWA 1TT1A 2Q88A 2XXXA 5TPAA 1URDA 4NF4B 2ZMBA 4I8CA 1LGBC 1MY1A 2XD2A 3GBBA 1DPEA 4LVQA 3Q26A 4NF6B 2QMWA 2H9BA 4UACA 3KSJA 4F3SA 3IOVA 1B7ZA 2PMSA 3SDFA 3OMBA 1POY1 4GWOA 4MLQA 3TCFA 4G8MA 1B3LA 2NOOA 4G8NA 4ZEIA 3MC2A 5FHNA 1B7HA 1DTZA 1B5IA 2F36A 4Q0CA 2ONKE 3CI8A 3FVKA 2A5SA 4QF9A 1QJMA 1DTGA 1YAEA 2G29A 2PT1A 5H8QA 3T96B 3A3CA 3C9HA 4TLMB 3OD7A 1UQWA 4KHZE 4IO6A 3RN8A 1ZMGA 4EF1A 1EH3A 3KZGA 5I84A 2YLNA 3MBPA 5DVJA 2AIXA 4WXJA 5CMMA 4JBZA 3LC8A 3DP4A 5ICQA 1N3WA 1URGA 4RK9A 1MXVA 3H3GA 2FYIA 3EPEA 2Z8FA 4GLIA 3S9LC 2Z23A 3KJTA 3HHGA 4KD5A 1MM7A 4FE8A 2HZKA 2AL5A 3CSGA 3MZ1A 3MVYA 4EQBA 5IKBA 1P1QA 1MQIA 5FHOA 3S2VA 1BIYA 3E3KA 1SI1A 3D4CA 1MQJA 4YB7A 2DS9A 2F7BA 4NMYA 3CSBA 2P0SA 2W7YA 5I2KB 3GLBA 3R7XA 3ONMA 1IUDA 5F1QA 1B4ZA 3E13X 2QS4A 4F19A 2REJA 5EYFA 2H5YA 2RCAA 4G4PA 2QMXA 4LA9A 3EHUA 1IQ7A 2VD2A 3PPOA 3ODBA 5I57A 3TTRA 3VVFA 1VE4A 1Q35A 2RC7A 1LBCA 4OXVA 3O9PA 3PGFA 4DE8A 4RJZA 4ZEDA 5I2KA 1JEUA 4KPTA 3QK6A 3TTKA 1OQGA 2HFBA 1MY0A 1FCKA 1RYXA 2CZLA 3P7IA 4IY6A 4JSOA 3K1PA 1YCJA 1AL3A 1NMUA 5LOMA 1IXGA 1EZOA 1AMFA 2B3FA 1UIUA 2DQVA 3KOTA 3MQ9A 5JTYB 2Q2AA 3A3UA 3H03A 3ZS6A 4XKQA 2O1LA 3VLUA 3VVDA 1HSLA 3IAZA 3W15C 3VVEA 1A55A 4Q8RA 1LFIA 2I48A 4G68A 4OMBA 1B58A 1AH5A 2NVUB 3VXBA 4Q5TA 4FORA 1N3XA 5AA4B 4XKNA 3HV1A 3CRBA 1KWHA 2Z8DA 4ZECA 2B3BA 5A5XA 1GGGA 4OTEA 4YB5A 1XVYA 1FQFA 3EN3A 3IJXB 4ZS9A 4DXUA 1MXWA 1SVXB 4R6HA 2I58A 3TMGA 2DSFA 1S9TA 3F11A 4U22A 4JSDA 3KBRA 5M2VA 3K0VA 1LAHE 2DOJA 4IY5A 5KCJB 4EQ9A 4KYDA 3PPQA 2XHDA 1ZLQA 5HBCA 4XTCQ 1IXCA 1B51A 1I6QA 1SQYA 2F5XA 3JZJA 2F6PA 3K02A 4GD5A 2UVGA 4R75A 1TFAA 4ZZEA 1P1WA 3SETA 1UIVA 4LZ5A 3PMVA 3FJ7A 4RK2A 1I69A 1NH8A 1Y3PA 2F35A 3LBSA 3O97A 4GFRA 4LQ5A 4PETA 5TU0A 4RPOA 4BDRA 2XXUA 5KDTA 2QPQA 2V93A 5FHMA 2F7CA 1II5A 2O7IA 2RC8A 4NF8A 1LAXA 3A09A 1Y3QA 3VE1B 3SKPA 3G3IA 4JWOA 4NWDA 1FTMA 2HAVA 2LAOA 4EXKA 2DXYA 1Y1ZA 2RKMA 4KQPA 2HZLA 1BTJA 1I6AA 4O3CA 3OSRA 2ALUA 1M5CA 4GOTA 1MH4A 2R9JA 4M4GA 4Z0IA 1MXXA 3CIJA 3TYHA 3I5OA 1XHYA 5B70A 4AB6A 1H3DA 4F1YA 3N5LA 3OSQA 3V83A 5I57B 3IJOB 4EDPA 1QULA 5CMCA 1XT8A 4KCCA 4ELOA 2H25A 1QUIA 4U4XA 4Q30B 2E0SA 1USYH 4O3AA 3FVGA 3SEXA 4F29A 4RYAA 1B5JA 3FD3A 4OENA 3IORA 4P0IA 4U2RA 3WAEA 2XXQA 3OO8A 2ZYOA 3MVXA 1XC1A 1YPNA 2Q2CA 3MVWA 1B1XA 4JWYA 4NWCA 4QFOA 3G3GA 3THIA 5L9OA 3W9WA 1JW4A 1Q1KA 3MP1A 3R6UA 4GF8A 1L5TA 3WAFA 4DCXA 3QAXA 4YMAA 2DWIA 2FA7A 5JTYA 4F3GA 4JDFA 1WVJA 3K01A 3MP6A 3H7MA 4TOZA 1SI0A 2YPNA 1FQCA 3D4GA 1FTLA 4G8HA 4E0XA 1OIBA 1TXFA 1EU8A 1O64A 3OOAA 3OXNA 3Q25A 3UIFA 3LSWA 4AB5A 2I3VA 5H8FA 3KGCA 1LFHA 1ZU0A 3TKDA 1ZJLA 1LB8A 1RYOA 3FVNA 4U21A 1JW1A 2O84X 2Z8EA 1NNTA 2O1MA 2XXPA 3K6WA 3V5AA 1Y4TA 1B1HA 2QL3A 2DWHA 4FECA 5CMBA 3FUZA 2DE3A 2F97A 4LZ8A 4RY1A 1IXHA 1P99A 4ISUA 4FAJA 5TP9B 4X1DA 4LONB 1JNFA 3IOTA 1JVYA 2UXAA 3K00A 3PD9A 2DE4A 4PP0A 4ZEFA 3VFJA 3FVOA 2D3IA 1NNPA 4IO2A 4BDQA 4F39A 1P1OA 3K6UA 4OVJA 2OZZA 4H67A 5H8NB 4DZ1A 3BFTA 1H43A 1IZ1A 4FIMA 4JWXA 4OWDA 4F1VA 4EF2A 1PDAA 4N6PA 4C1TA 1B3GA 2ZYKA 4LATA 4R74A 4H65A 3ZKKA 2DXRA 4RXLA 4UA8A 3PPNA 2HAUA 4P0GA 3EHSA 3PPPA 3TQWA 4ESWA 4F2OA 4I9DA 1SBPA 2XXHA 5KZTA 4RNSA 2XXIA 2F6GA 2XD3A 5H8FB 4OETA 3QXMA 1VFEA 1FQBA 2Y7KA 3SESA 3QUJA 1A54A 4MLVA 2H99A 1EZPA 3FZVA 3H6WA 3GBAA 4Z7EA 5ITPA 2QS1A 1QKAA 3C36A 4F3PA 3RTWB 1M5EA 2QSXA 1AIVA 1LB9A 1MS7A 1PEBA 1ZIUA 3IK6B 3H4ZA 4EQ7A 5AA2D 4KYEA 5AA3A 1B4HA 2DYXA 4HTGA 5I59B 1GV8A 2RF1A 4JXIA 3FJMA 5H8NA 3HN0A 4XKPA 2RC9A 4DDDA 2HEUA 3OO9A 4FEDA 1ATGA 4OEVA 1O63A 3B6TA 5DVIA 3KG2A 4QSCA 1P1UA 2DVCA 4THIA 1D3KA 3N94A 4YZZA 3O28A 4NE4A 4QSDA 1NL5A 3B6QA 4H5FA 1FQDA 1URSA 4QFNA 3G3JA 4XXUA 1JQFA 5AA1A 1SYHA 3U1OA 2NXOA 4BDMA 3MUQA 2XX9A 3MZ9A 2XXRA 1DPPA 3V8XB 2I6EA 2OK2A 2ZNTA 2ONRA 2P1SA 4IGTA 3DLNA 4JB7A 3RLFE 3SEYA 3W9VA 3O2AA 3SERA 3K2DA 3C4MA 2QJEA 4NF8B 4DXBA 1XVXA 4ND9A 2F34A 1PBQA 2OLBA 3PMXA 3C31A 4ZEBA 4OFOA 3K4UA 1LSTA 3K6VA 3MWBA 4NEDA 3S4UA 3T9HB 3MVZA 2I4BA 2XXTA 4MH5A 1Y3NA 4ZEKA 3ILUB 3LUYA 4N07A 1UTBA 3FIRA 1M5DA 3PMWA 4YICA 4ELQA 4G2ZA 1S7YA 5H8HB 4LQ2A 1XS5A 4PFWA 1DSNA 4FJPA 3CFLA 4IO3A 4X48A 5K2XA 4OEUA 5AE4A 5TP9A 2VD3A 5I56A 3MAMA 3SEVA 3EHTA 4DCYA 1A8FA 1B9JA 1FTJA 3MZBA 1MY4A 1UTBB 2DVZA 3O29A 4GXSB 2HQ0A 3RTFB 3TODA 3VLVA 5A5XB 1US4A 2Q8JA 1Y4CA 1FQAA 1MPCA 1NFTA 3HO7A 4POXA 3M3KA 3U8QA 5BWJA 3LSXA 5DTBA 5J1DA 2XXWA 1MQHA 3PUWE 1TWYA 1MXYA 2D5WA 2A5TB 4I1DA 4XKRA 1IIWA 2ANJA 1A7LA 5HM4B 4F31B 3LSLA 1N0TA 1SDXA 4F2QA 4ELPA 1N84A 2WKYA 3IOWA 3UK4A 1O7TA 1BLFA 3H6TA 3T93B 2DWJA 3OENA 5KDTB 4H6DA 5BUUA 1CB6A 4QFKA 1USYE 3K1NA 3TTNA 1QKBA 1FQEA 4IO7A 2X26A 1QVSA 3HSTA 3MP8A 3ILTB 3MW0A 3PPRA 1EZ9A 1A8EA 5EHSA 2UVIA 1FTOA 3ZSFA 3T9XB 3VXCA 4BDNA 1B05A 2V3TA 3IX1A 1LCFA 4GIZA 2Q89A 4P11A 4U1OA 3TUSA 4U23A 3TFLA 1H44A 1ANFA 4GL0A 1B0LA 4N13A 2F7AA 2UVJA 4GRKA 5AA2A 4NF6A 1MG1A 1US5A 3C34A 4HCWA 4E0WA 1D9YA 1R9QA 1UTHB 3MPKA 4BLAA 1JW5A 5CBRA 2Y84A 3TAJA 1JVXA 1OVTA 3BFUA 4WKMA 1GVCA 4GXAA 2M8CA 3G3FA 1J1NA 3G3HA 2O7UA 4QSEA 3IB2A 2RCBA 4F22A 5L8DA 2UYFA 3RPWA 3QIMA 4H8IA 4C0RA 5I2NA 1OLAA 3S9EA 4MBPA 2Z22A 3FXRA 2R71A 1XOCA 2BJJX 2GRVA 2V84A 3N6UA 2OWSA 2THIA 2VGQA 4YKIA 5L9MA 2ZNUA 5JK4A 2YJPA 4QRZA 5DT6A 2IEEA 1FTKA 3U94A 1LCTA 1PC3A 3TEPA 3O6HA 3TQLA 1ZKBA 3DP8A 3U92A 5AA2B 2PT2A 5FTIA 3HHFA 4GQOA 4YB6A 5CI5A 3TZAA 4YKKA 4HW8A 1B52A 4H1XA 3RUMA 1PB7A 3B7DA 4O3BA 4AQ4A 1N76A 1RKMA 3DP6A 1SYIA 4KR5A 3U93A 3T9UA 1VR5A 1ZTYA 1D9VA 3EF7A 3TCGA 4RPNA 2F8DA 4QHQA 3TPAA 3C35A 3ZKLA 3IR1A 2ZNSA 1MY3A 3CFXA 4BDOA 3TDJA 4G68B 3AXFA 2D21A 2OWTA 4POWA 1MDQA 2UYEA 2UVHA 3ECRA 3H6VA 4H5GA 1F9BA 4IO4A 5DEXB 1M5BA 3PUZE 3G3KA 4R2BA 3IOUA 1LAFE 4WEDA 4YU0A 1JETA 3MPLA 5ISUA 3PUYE 4DIGA 1MH3A 4H8JA 3CVGA 1A40A 2DE2A 3BBRA 2QRYA 1I6BA 4X1BA 5B7DA 1HSEA 1HSJA 1NNKA 1WODA 1Y1MA 2XXYA 4IGRA 4TQUQ 1GTKA 4NF5B 4BDLA 1A99A 1AOVA 3M3LA 2GHBA 5H8HA 2X7QA 3FXUA 1OQHA 3M3FA 3SEUA 1N7WA 5DEXA 3C33A 4FEBA 5IAIA 4LUBA 5ELVA 2Y7IA 3IO6A 3CR9A 5H8SA 3CG3A 2RINA 3FASA 4GVOA 1B32A 2KLFA 4I62A 3K1MA 2H98A 4PQJA 3U72A 4ECFA 3M8UA 4NF4A 3JV9A 3RT8A 1MQDA 3IB0A 3N6TA 1DMBA 1IXIA 1M5FA 1MPBA 3OO6A 2ESNA 3QYTA 4MFIA 5K2YA 1GR2A 3TTLA 3VV5A 1JEVA 1ZBMA 4DXCA 2Y7WA 3IO4A 2VHAA 3GXAA 4IB2A 4OQOA 4X9TA 1Z7NE 4F1UA 2I49A 5CRYA 3T22A 4H0WA 1LAGE 1MM6A 2G93A 2A5TA 4QFLA 5I2NB 2QS3A 1IEJA 2H4IA 3RY3A 1BP5A 2ZYMA 3RT6B 1QW0A 1B6HA 2GH9A 4MF3A 1N7XA 4YMBA 2Y7PA 2FNCA 5H8QB 3TTMA 4EXLA 3JYRA 5CMKA 3OELA 4R6KA 2DWAA 3S9MC 1NH7A 3H6UA 4QFPA 3USDA 2ZXTA 3DM0A 3I3VA 1B3HA 3PUXE 1DOTA 3FXQA 1LLSA 4M1VA 4G68C 4R2FA 5L9SA 2NUVA 2XX8A 1Y20A 2O68A 4HCYA 4OFLA 4DLDA 1SD3A 3HCQA 3HPIA 3PV0E 1MY2A 4TLLB 5JEIA 2ONSA 4YAHX 2OBGA 5ICTA 4R6YA 1H76A 4OZ9A 2NWJA 3PU5A 1LBBA 3UORA 3QSLA 3VDFA 5DVFA 1SW1A 3MJNA 1MRPA 3L6HA 3PUVE 3UP9A 4U4SA 4EUOA 1D4NA 4WEPA 2I0BA 5CC2A 1OMPA 2P2AA 4OFJA 4ZE8A 4FATA 3KEIA 3O6GA 3Q29A 3PD8A 3RNNA 1SW5A 3T66A 4F3BA 3OEKA 3H06B 2O69A 1ELJA 1UTHA 1MDP1 4KCDA 4ELRA 5I58B 3Q27A 1R1NA 1LFGA 1QUJA 2CMOA 3CFZA 2Y7RA 2F78A 4ZDMA 4R9GA 2DP8A 3TELA 3N26A 1B5HA 2HXWA 4PFTA 4OESA 1QUKA 4PFUA
chains in the Genus database with same CATH superfamily
1FPDA 1Y9UA 4ZE9A 1EYKA 3TCHA 2X7PA 4YKJA 3DELB 1B3EA 1YYZA 3SEWA 1CE2A 1YTVA 2XXVA 1T0KA 4IO5A 2ZYNA 3LSFB 4PE5B 4HE1A 2PCRA 1N04A 3T9VA 1VFDA 3KFMA 3L6GA 4G77A 3FV1A 3OO7A 2QS2A 3O66A 4ONYA 3KSXA 3LR1A 4LZ7A 2PVUA 3UN6A 1IITA 1VSOA 3O6IA 3UA8A 5I59A 5CBSA 4OVQA 2I4CA 3GZGA 3FV2A 3E4RA 1PBPA 2R6GE 1MXUA 5EHMA 2HCAA 4P3LA 1TT1A 2Q88A 2XXXA 4I8CA 3GBBA 2QFLA 1DPEA 4LVQA 4O7IA 1B7ZA 1FPBA 2V4CA 4G8NA 4N17A 5FHNA 1B7HA 1B5IA 3CI8A 3FVKA 4QF9A 4N81A 3T96B 3A3CA 1Q9DA 3RN8A 2WBDA 3MBPA 3LV0A 4QBAA 3DP4A 1INPA 3EPEA 2Z8FA 3S9LC 4KD5A 2VPOA 1BIYA 1SI1A 3D4CA 1MQJA 2F7BA 5F1QA 3E13X 2QS4A 4F19A 2H5YA 1IQ7A 2VD2A 3PGFA 1JEUA 3TTKA 1OQGA 1KA1A 4JSOA 3NOHA 1IXGA 1AMFA 5JTYB 3A3UA 3VLUA 3VVDA 3IAZA 3W15C 3VVEA 1A55A 4G68A 4FORA 2Z8DA 4YB5A 2I58A 3F11A 3KBRA 1LAHE 4KYDA 4XTCQ 4R75A 3CHGA 3PMVA 1I69A 2QPQA 1IMEA 4NF8A 3A09A 3VE1B 3G3IA 1FTMA 2HAVA 4O3CA 1I6AA 1LBXA 1MH4A 3CIJA 4AB6A 4F1YA 5I57B 3IJOB 3FXBA 4KCCA 1QUIA 2E0SA 1FRPA 1B5JA 4OENA 1XC1A 1YPNA 2Q2CA 3MVWA 5L9OA 1Q1KA 3MP1A 3R6UA 4F3GA 1WVJA 1SI0A 2YPNA 5DW8A 1FTLA 1Y4TA 2QL3A 2DWHA 3FUZA 2F97A 4ISUA 1JVYA 4PP0A 2D3IA 2HHMA 3K6UA 2OZZA 4H67A 4DZ1A 1EYIA 1H43A 1IZ1A 4OWDA 3E79A 4R74A 4H65A 4RXLA 3TQWA 1NV1A 4RNSA 2XXIA 2F6GA 3QXMA 1VFEA 2Y7KA 3SESA 1A54A 1EZPA 3H6WA 4OANA 1FPKA 3C36A 1LB9A 4PCDA 1ZIUA 3IK6B 5AA2D 4KYEA 1B4HA 2DYXA 4HTGA 4XKPA 2HEUA 1ATGA 4GWSA 5DVIA 5LTCA 3EKIA 2DVCA 1NL5A 1FQDA 4XXUA 3G3JA 2OK2A 3RLFE 4DXBA 1PBQA 4PAFA 4ZEBA 2ZZWA 1LSTA 3K6VA 2XXTA 4MH5A 1Y3NA 4ZEKA 3ILUB 4N07A 3PMWA 1XS5A 4PFWA 4FJPA 4X48A 2OX3A 3KBZA 3MAMA 5IM2A 3EHTA 1A8FA 3VLVA 1IMAA 2Q8JA 1Y4CA 5BWJA 1MQHA 1MXYA 4NQ8A 1NI9A 1O7TA 3T93B 2DWJA 4H6DA 1QKBA 3ILTB 5EQAA 3MW0A 5EHSA 1NV7A 1FPLA 4N13A 1B0LA 5AA2A 2F7AA 2UVJA 4GRKA 3C34A 1D9YA 1UTHB 1JW5A 1XI6A 4WKMA 1DCUA 3G3FA 4PE3A 4MNIA 5L8DA 4AS5A 4GBWA 1OLAA 2Z22A 1XOCA 2GRVA 2THIA 4QRZA 3TEPA 3TQLA 4UABA 5AA2B 5CI5A 4HW8A 4H1XA 1PB7A 2P3VA 4O3BA 1N76A 3DP6A 3U93A 3LUZA 1D9VA 4OVRA 3ZKLA 3C35A 1MY3A 4G68B 1MDQA 4IO4A 4R2BA 1JETA 5ISUA 2DE2A 1HSJA 2XXYA 4BDLA 3U65A 1AOVA 3SEUA 5H8HA 2X7QA 1OQHA 5IAIA 5ELVA 3CR9A 4NF4A 1MQDA 3N6TA 4O8MA 2ESNA 3VV5A 3IO4A 2GQ1A 5EQ8A 1MM6A 4QFLA 2CEXA 4NGUA 3RT6B 4MF3A 3B50A 2Y7PA 2FNCA 4PF6A 3H6UA 3USDA 4R2FA 5L9SA 2NUVA 1NV0A 3HPIA 1MY2A 4O7MA 5ICTA 4R6YA 2WEFA 1H76A 4OZ9A 2NWJA 3PU5A 3MJNA 4U4SA 4EUOA 2I0BA 5CC2A 2P2AA 4OFJA 2CZHA 3Q29A 3PD8A 1SW5A 4MNPA 2O69A 1UTHA 4KXPA 4ELRA 2CMOA 4GX4A 1LBYA 1FPEA 1QUKA 3FATA 1NNFA 1H45A 4L17A 4DI4B 3B6WA 1NKXA 2VP1A 4MJOA 1Z7ME 3C32A 2I0CA 3OEMA 3G7WA 3E9XA 4YKPA 1NUZA 1B46A 3FJGA 4OHNA 1PB9A 1S50A 2AL4A 1MXZA 3IB1A 5KCJA 2BJIA 3V89B 5HPQA 1FTAA 2GFEA 3QUFA 1PB8A 1POTA 2O6AA 1SW4A 4KYSA 3BKIB 2OJTA 3IL1B 1R9LA 4R9FA 4PFBA 4PFYA 3BIGA 4HS7A 2V3QA 4NTLA 1B7UA 4U1ZA 3VLWA 4GBVA 4NF4B 1LBZA 1MY1A 2XD2A 3Q26A 2H9BA 3IOVA 3SDFA 4HE0A 4MLQA 4G8MA 2NOOA 3MC2A 4N8GA 2ONKE 2A5SA 1QJMA 2FIXA 1DTGA 1YAEA 2PT1A 1UQWA 4EF1A 1EH3A 5I84A 4WXJA 5ICQA 1N3WA 4RK9A 1FJ9A 2Z23A 3HHGA 1MM7A 4FE8A 3MZ1A 2F3DA 4PFRA 5FHOA 4ELOA 2WBBA 5EYFA 2RCAA 4G4PA 5I57A 2QVVA 2RC7A 1LBCA 3O9PA 5I2KA 4KPTA 4PGPA 3QK6A 2HFBA 1RYXA 4IY6A 3K1PA 1NMUA 1UIUA 3KOTA 2Q2AA 3H03A 3ZS6A 2O1LA 1HSLA 3VXBA 1N3XA 1KWHA 4ZECA 2B3BA 1GGGA 4OTEA 3IJXB 4DXUA 1MXWA 1SVXB 4R6HA 3TMGA 4PBHA 2DSFA 4U22A 1FPFA 2DOJA 4EQ9A 3PPQA 1I6QA 1SQYA 1K9YA 4ZZEA 1P1WA 3SETA 1Y3PA 3ISPA 3LBSA 4GFRA 4LQ5A 4PETA 5KDTA 2V93A 2O7IA 3T1BA 1Y3QA 4NWDA 1FBDA 2LAOA 4EXKA 2DXYA 2RKMA 1BTJA 4Z0IA 4GOTA 3I5OA 1XHYA 4GX6A 1H3DA 3GYYA 1LEVA 3OSQA 1QULA 1XT8A 4PC9A 4O3AA 4RYAA 3FD3A 3IORA 4P0IA 4U2RA 5IZ1A 2ZYOA 3THIA 1FBFA 4GF8A 4DCXA 4N8YA 4YMAA 2FA7A 3K01A 3MP6A 3D4GA 1OIBA 3OOAA 1EU8A 4AB5A 2B4MA 3LSWA 1ZU0A 3FVNA 1LB8A 4U21A 1IMBA 1B1HA 2DE3A 4LZ8A 2XWVA 4MNCA 4FAJA 5TP9B 1JNFA 3IOTA 2DE4A 1NNPA 5H8NB 4PTKA 4N6PA 4C1TA 4ESWA 3PPNA 3EHSA 4N15A 2XD3A 1NUXA 4MLVA 4Z7EA 2QS1A 3RPLB 4F3PA 4EQ7A 5I59B 3FJMA 5H8NA 3B6TA 3KG2A 2B4LA 4NE4A 4QSDA 3TTRA 5AA1A 1URSA 1SYHA 3U1OA 3MUQA 2XX9A 1NV5A 2ONRA 3DLNA 4JB7A 3O2AA 3C4MA 2QJEA 1XVXA 2F34A 4MHFA 4NEDA 3S4UA 3LUYA 3FIRA 4YICA 4G2ZA 1RDXA 1DSNA 3CFLA 4OEUA 2VD3A 4NX1A 1B9JA 1FTJA 1UTBB 3O29A 5A5XB 1NV6A 1US4A 4JVCA 1FQAA 1MPCA 4POXA 3U8QA 3LSXA 4I1DA 4XKRA 1IMDA 2ANJA 5HM4B 3LSLA 1SDXA 4GWYA 4ELPA 1BLFA 3H6TA 4X8RA 1CB6A 3K1NA 2X26A 2XA5A 3ZSFA 3PPRA 1EZ9A 2UVIA 1FTOA 4P11A 2V3TA 4GIZA 2WYPA 2Y5KA 3IFCA 1ANFA 4HCWA 4E0WA 1R9QA 1LBVA 3BFUA 3G3HA 4QSEA 1FSAA 4H8IA 2R71A 2IEEA 3U94A 4PBQA 2XWOA 5FTIA 4YB6A 5ET7A 5IZZA 1B52A 4P1EA 4AQ4A 1FBEA 3EF7A 4RPNA 3IR1A 3AXFA 2UYEA 2UVHA 1F9BA 1LAFE 4YU0A 4AS4A 3MPLA 4H8JA 4X1BA 1I6BA 5B7DA 5EYGA 1GTKA 1A99A 3FXUA 5DEXA 5I3SA 3C33A 4FEBA 4LUBA 1BK4A 3CG3A 4GVOA 2KLFA 4ECFA 1IXIA 4MFIA 3TTLA 1JEVA 4DXCA 2VHAA 3GXAA 4OQOA 4F1UA 2I49A 4H0WA 2A5TA 5I2NB 3RY3A 1QW0A 1B6HA 5H8QB 4EXLA 3JYRA 3OELA 1NH7A 5IZ3B 3PUXE 2XX8A 4QXDA 1D9QA 1SD3A 4GWWA 3HCQA 4YAHX 3UORA 5DVFA 3PUVE 1D4NA 4WEPA 1FBCA 1OMPA 4FATA 4ZE8A 3T66A 3RNNA 4F3BA 1MDP1 5I58B 1R1NA 4ZDMA 2HXWA 4ESXA 3EQ1A 2IA4A 5ITOA 3RQTA 4F18A 5CM6A 2OCUA 4C1UA 3KOSA 3FGSA 4OERA 4MX6A 2B65A 2VOZA 5AA4A 2PX1A 5I58A 4NF0A 1MPDA 1FPJA 5I56B 4MAGA 4OYVA 3UGWA 1WDNA 1MQGA 4GL8A 1B2HA 1FW0A 1P1NA 5DYHA 3KN3A 1B3FA 1KZ8A 2V3UA 4MEVA 4RA1A 2PBWA 2ABHA 5EQ9A 1TFDA 3R26A 5FTHA 5F7VA 1IMCA 2O51A 5TPAA 2ZMBA 1LGBC 2OWZA 1NUYA 2FVZA 4GWOA 4ZEIA 2F36A 4Q0CA 5H8QA 2G29A 3OD7A 5DVJA 2WYKA 4NHBA 5CMMA 4JBZA 3LC8A 1URGA 4PGNA 2AL5A 1AWBA 1MQIA 2DS9A 5I2KB 4NMYA 2W7YA 3R7XA 1B4ZA 2QMXA 3EHUA 3ODBA 3VVFA 1VE4A 1Q35A 4OXVA 4DE8A 4RJZA 4ZEDA 1MY0A 2CZLA 1AL3A 1EZOA 5IGAA 2DQVA 1LFIA 1AH5A 5AA4B 1FQFA 5ET8A 4G61A 5IZ3A 4JSDA 5M2VA 3K0VA 4IY5A 2QVRA 1ZLQA 1IXCA 4GD5A 3JZJA 2UVGA 2KR0A 4LZ5A 3FJ7A 4RK2A 1NH8A 5TU0A 4PAKA 2XXUA 5FHMA 2F7CA 1II5A 1LAXA 4GWXA 4N91A 4JWOA 4KQPA 3OSRA 1M5CA 4M4GA 2R9JA 1MXXA 3TYHA 3V83A 1IMFA 3SZPA 2H25A 4Q30B 1USYH 3FVGA 4XFEA 4JVDA 3WAEA 2XXQA 3OO8A 4PFUA 4O94A 4QFOA 3G3GA 3W9WA 1JW4A 3WAFA 1L5TA 3QAXA 4JDFA 3H7MA 4TOZA 1FQCA 4G8HA 5I56A 4GWUA 1TXFA 1LFHA 3B8BA 1RYOA 2JJKA 2O84X 1NNTA 2XXPA 4NG7A 5CMBA 1IXHA 4LONB 3K00A 3PD9A 4ZEFA 4BDQA 4IO2A 4P56A 2DDKA 1P1OA 4OVJA 4FIMA 4JWXA 4F1VA 4EF2A 4UA8A 2HAUA 1SBPA 1KA0A 1FQBA 3FZVA 3GBAA 1QKAA 1M5EA 3KC1A 4XF5A 3D1RA 4OVTA 1FJ6A 5AA3A 1GV8A 2RF1A 3HN0A 4DDDA 3OO9A 4FEDA 4OEVA 1O63A 2XWIA 4QSCA 4THIA 1D3KA 3N94A 4YZZA 3O28A 3TODA 4H5FA 4OA4A 4QFNA 4BDMA 2NXOA 1DPPA 3V8XB 2ZNTA 4IGTA 3W9VA 3K2DA 4NF8B 4ND9A 2OLBA 3C31A 4OFOA 3TUSA 3T9HB 3MVZA 2I4BA 1FBGA 1UTBA 1M5DA 5H8HB 4LQ2A 5K2XA 5AE4A 2P3NA 5TP9A 4DCYA 4I40A 3RTFB 2DVZA 4PFIA 5DTBA 2XXWA 3PUWE 2KQZA 1K9ZA 1A7LA 4F31B 1N0TA 1N84A 2WKYA 3IOWA 3UK4A 1USYE 1FQEA 4IO7A 1QVSA 3HSTA 1A8EA 2CZIA 2FHYA 1FBHA 3VXCA 1B05A 3IX1A 2Q89A 4P8BA 5ESYA 4U23A 3TFLA 1H44A 4GL0A 4NF6A 1MG1A 1FPIA 1US5A 4BLAA 1GVCA 4GXAA 2M8CA 3IB2A 2RCBA 5F24A 5I2NA 5I7IA 3FXRA 4F2OA 3N6UA 2OWSA 2VGQA 2ZNUA 2YJPA 1EYJA 1LCTA 1PC3A 3O6HA 2PT2A 3HHFA 4GQOA 1FPGA 3B7DA 5I5PA 1SYIA 3T9UA 1ZTYA 3TCGA 3TPAA 2ZNSA 3CFXA 3TDJA 2D21A 4POWA 1RDYA 5DEXB 1M5BA 3PUZE 4MIJA 3IOUA 4WEDA 3PUYE 1VDWA 1HSEA 1WODA 4TQUQ 4IGRA 4I3YA 4X04A 1N7WA 1NV3A 2FIEA 2Y7IA 3A29A 2RINA 1B32A 4I62A 3K1MA 4PQJA 3U72A 3M8UA 3IB0A 3QYTA 1DMBA 1M5FA 1MPBA 3OO6A 1YZ0A 1ZBMA 4X9TA 1Z7NE 3T22A 2G93A 2QS3A 1IEJA 1FBPA 1BP5A 2ZYMA 4YMBA 1N7XA 5CMKA 4R6KA 3DM0A 4M1VA 1B3HA 3FXQA 1LLSA 4HCYA 4OFLA 4DLDA 3PV0E 2QVUA 5JEIA 2OBGA 1LBBA 3RPLA 3QSLA 3UP9A 3L6HA 3OEKA 3H06B 1LFGA 1QUJA 2F78A 4R9GA 3N26A 1B5HA 4PFTA 1YXIA 4OESA 4KFQA 4HE2A 4NF5A 4ZZAA 4LP2B 4R72A 1OVBA 2XX7A 3CG1A 4KI0E 2PFYA 3K6XA 1NUWA 2CEYA 4K3FA 4LN5A 3RGYA 1NV2A 4R73A 3KJ7A 2E1SA 5FBPA 2I3WA 1BKAA 1R6ZA 3PTYA 4GX3A 2REGA 1OLCA 2V25A 3Q28A 3KN8A 1B40A 3KN7A 4XIGQ 1B0HA 5TPAB 2Q9TA 2AYSA 4IR8A 2GHAA 1SW2A 2PYYA 3S9NC 3I6VA 4PF8A 1URDA 4NF6B 2QMWA 4UACA 3KSJA 2HXRA 4F3SA 2PMSA 3OMBA 1POY1 3TCFA 1B3LA 1DTZA 2Q74A 3FBPA 3C9HA 4TLMB 4KHZE 4IO6A 1ZMGA 3KZGA 2YLNA 2AIXA 4NN3A 1MXVA 3H3GA 2FYIA 4GLIA 3KJTA 2HZKA 3CSGA 2WX9A 3MVYA 4EQBA 5IKBA 1P1QA 3IFAA 3S2VA 3E3KA 4YB7A 5CBRA 3CSBA 2P0SA 3GLBA 3ONMA 1IUDA 3QMFA 2REJA 4LA9A 3PPOA 5EQ7A 3RYDA 1FCKA 3P7IA 1YCJA 5LOMA 2B3FA 3MQ9A 3MYUA 4XKQA 4Q8RA 2VT5A 2I48A 4XEQA 4OMBA 1B58A 2NVUB 4Q5TA 4XKNA 3HV1A 3CRBA 5A5XA 1XVYA 3EN3A 4ZS9A 1S9TA 5EYHA 5KCJB 2XHDA 5HBCA 2F5XA 1B51A 3K02A 2F6PA 1TFAA 1UIVA 5ET5A 2F35A 3O97A 3MSTA 4BDRA 4H45A 4RPOA 2RC8A 4OVSA 3SKPA 2HPGA 4JVIA 1Y1ZA 3T0JA 2HZLA 3E78A 2ALUA 5B70A 3N5LA 4EDPA 2ZZVA 5CMCA 4U4XA 3HFUA 3SEXA 4F29A 1LBWA 4NWCA 3MVXA 1B1XA 4JWYA 5JTYA 2DWIA 1O64A 3OXNA 3UIFA 3Q25A 2I3VA 5H8FA 3KGCA 2XWKA 3TKDA 1ZJLA 1JW1A 2Z8EA 3K6WA 2O1MA 3V5AA 3ROJA 4FECA 4RY1A 1P99A 4X1DA 3BIHA 2UXAA 3VFJA 3FVOA 4OVPA 4F39A 1JP4A 3BFTA 1PDAA 1B3GA 2ZYKA 4LATA 3ZKKA 2Q8MA 2DXRA 4P0GA 5KZTA 3PPPA 1G0IA 4I9DA 2XXHA 5H8FB 4OETA 3QUJA 2H99A 5ITPA 5LDZA 3RTWB 2QSXA 1AIVA 1MS7A 1PEBA 2VPNA 3H4ZA 4JXIA 5T3JA 2RC9A 1G0HA 1P1UA 3B6QA 4MMPA 4PAIA 4E0XA 1JQFA 3MZ9A 2XXRA 4P1LA 4P47A 2I6EA 2P1SA 3SEYA 5A5LA 3SERA 3PMXA 3K4UA 3MWBA 1RDZA 2ZZXA 4ELQA 1S7YA 4P9KA 4IO3A 3SEVA 3MZBA 1MY4A 4GXSB 2HQ0A 1NFTA 3HO7A 3M3KA 4MCOA 5J1DA 4HXVA 1TWYA 2D5WA 2A5TB 1IIWA 4F2QA 3OENA 1CNQA 5BUUA 5KDTB 4QFKA 3TTNA 1SPIA 3MP8A 3KC0A 4BDNA 3T9XB 4U1OA 4DI3D 1LCFA 4PDHA 3MPKA 2Y84A 3TAJA 1JVXA 1OVTA 2PFZA 1J1NA 2O7UA 4F22A 2L5VA 2UYFA 3RPWA 3QIMA 4C0RA 4N6DA 4I3EA 3S9EA 4MBPA 2BJJX 5L9MA 2V84A 4YKIA 1NV4A 5JK4A 5DT6A 1FTKA 1ZKBA 3DP8A 3U92A 3TZAA 4YKKA 4PDDA 4FBPA 3RUMA 1QGXA 4NAPA 1RKMA 5ET6A 4KR5A 1VR5A 2F8DA 4QHQA 2F3BA 4BDOA 2Y5LA 2OWTA 4H46A 3ECRA 3H6VA 4H5GA 3G3KA 4DIGA 1MH3A 3CVGA 1A40A 3BBRA 2QRYA 1NNKA 1Y1MA 4NF5B 3M3LA 2GHBA 3M3FA 2XXKA 3IO6A 5H8SA 3FASA 2FBPA 2H98A 3JV9A 3RT8A 4N6KA 5K2YA 1GR2A 2Y7WA 4IB2A 5J16A 5CRYA 1LAGE 2H4IA 4GWZA 2GH9A 3TTMA 2DWAA 3S9MC 4QFPA 2ZXTA 3I3VA 1DOTA 4G68C 1Y20A 2O68A 1DBZA 4TLLB 2ONSA 4N4UA 3VDFA 1DK4A 1SW1A 1MRPA 2CZKA 3KEIA 3O6GA 2MKZA 1ELJA 4KCDA 3Q27A 3CFZA 2R8TA 2Y7RA 2DP8A 3TELA
chains in the Genus database with same CATH topology
4ESXA 4KFQA 3EQ1A 2IA4A 5ITOA 1Y9UA 3FATA 3RQTA 4F18A 1NNFA 4NF5A 3TCHA 1H45A 4ZE9A 5I59A 2OCUA 2X7PA 4L17A 3DELB 4YKJA 4ZZAA 1B3EA 4C1UA 3KOSA 3FGSA 4LP2B 3B6WA 1CE2A 4OERA 1NKXA 1YTVA 2B65A 2VP1A 2XXVA 3SEWA 1Z7ME 1T0KA 4R72A 1OVBA 3C32A 2I0CA 2XX7A 3CG1A 4IO5A 5DYHA 2ZYNA 2VOZA 3OEMA 4KI0E 5AA4A 3LSFB 3G7WA 4PE5B 3K6XA 2PX1A 5I58A 1MPDA 1N04A 4K3FA 3RGYA 3E9XA 3T9VA 1VFDA 3KFMA 3KJ7A 4R73A 4YKPA 5I56B 3L6GA 2E1SA 1B46A 3FJGA 4OHNA 2I3WA 4G77A 1BKAA 1PB9A 3FV1A 4OYVA 1S50A 2AL4A 1MXZA 1R6ZA 1WDNA 3IB1A 3UGWA 3V89B 3OO7A 5KCJA 2QS2A 5HPQA 1MQGA 2GFEA 2REGA 4GL8A 1B2HA 3QUFA 1OLCA 2V25A 3O66A 3Q28A 4ONYA 3KN8A 1FW0A 3KSXA 1P1NA 3LR1A 4LZ7A 2PVUA 5CM6A 1B40A 3UN6A 1IITA 1PB8A 1POTA 2O6AA 3KN7A 1SW4A 4KYSA 1VSOA 4XIGQ 3BKIB 3KN3A 2OJTA 3IL1B 3O6IA 1B0HA 1B3FA 5TPAB 3UA8A 5CBSA 1R9LA 2V3UA 2I4CA 3GZGA 4R9FA 4RA1A 2PBWA 2Q9TA 4PFYA 2AYSA 2ABHA 2GHAA 1SW2A 2PYYA 3FV2A 3E4RA 3S9NC 1PBPA 2R6GE 2V3QA 4HS7A 1TFDA 3R26A 1MXUA 3I6VA 5EHMA 5FTHA 5F7VA 2HCAA 4NTLA 1B7UA 4U1ZA 2O51A 3VLWA 1TT1A 2Q88A 2XXXA 5TPAA 1URDA 4NF4B 2ZMBA 4I8CA 1LGBC 1MY1A 2XD2A 3GBBA 1DPEA 4LVQA 3Q26A 4NF6B 2QMWA 2H9BA 4UACA 3KSJA 4F3SA 3IOVA 1B7ZA 2PMSA 3SDFA 3OMBA 1POY1 4GWOA 4MLQA 3TCFA 4G8MA 1B3LA 2NOOA 4G8NA 4ZEIA 3MC2A 5FHNA 1B7HA 1DTZA 1B5IA 2F36A 4Q0CA 2ONKE 3CI8A 3FVKA 2A5SA 4QF9A 1QJMA 1DTGA 1YAEA 2G29A 2PT1A 5H8QA 3T96B 3A3CA 3C9HA 4TLMB 3OD7A 1UQWA 4KHZE 4IO6A 3RN8A 1ZMGA 4EF1A 1EH3A 3KZGA 5I84A 2YLNA 3MBPA 5DVJA 2AIXA 4WXJA 5CMMA 4JBZA 3LC8A 3DP4A 5ICQA 1N3WA 1URGA 4RK9A 1MXVA 3H3GA 2FYIA 3EPEA 2Z8FA 4GLIA 3S9LC 2Z23A 3KJTA 3HHGA 4KD5A 1MM7A 4FE8A 2HZKA 2AL5A 3CSGA 3MZ1A 3MVYA 4EQBA 5IKBA 1P1QA 1MQIA 5FHOA 3S2VA 1BIYA 3E3KA 1SI1A 3D4CA 1MQJA 4YB7A 2DS9A 2F7BA 4NMYA 3CSBA 2P0SA 2W7YA 5I2KB 3GLBA 3R7XA 3ONMA 1IUDA 5F1QA 1B4ZA 3E13X 2QS4A 4F19A 2REJA 5EYFA 2H5YA 2RCAA 4G4PA 2QMXA 4LA9A 3EHUA 1IQ7A 2VD2A 3PPOA 3ODBA 5I57A 3TTRA 3VVFA 1VE4A 1Q35A 2RC7A 1LBCA 4OXVA 3O9PA 3PGFA 4DE8A 4RJZA 4ZEDA 5I2KA 1JEUA 4KPTA 3QK6A 3TTKA 1OQGA 2HFBA 1MY0A 1FCKA 1RYXA 2CZLA 3P7IA 4IY6A 4JSOA 3K1PA 1YCJA 1AL3A 1NMUA 5LOMA 1IXGA 1EZOA 1AMFA 2B3FA 1UIUA 2DQVA 3KOTA 3MQ9A 5JTYB 2Q2AA 3A3UA 3H03A 3ZS6A 4XKQA 2O1LA 3VLUA 3VVDA 1HSLA 3IAZA 3W15C 3VVEA 1A55A 4Q8RA 1LFIA 2I48A 4G68A 4OMBA 1B58A 1AH5A 2NVUB 3VXBA 4Q5TA 4FORA 1N3XA 5AA4B 4XKNA 3HV1A 3CRBA 1KWHA 2Z8DA 4ZECA 2B3BA 5A5XA 1GGGA 4OTEA 4YB5A 1XVYA 1FQFA 3EN3A 3IJXB 4ZS9A 4DXUA 1MXWA 1SVXB 4R6HA 2I58A 3TMGA 2DSFA 1S9TA 3F11A 4U22A 4JSDA 3KBRA 5M2VA 3K0VA 1LAHE 2DOJA 4IY5A 5KCJB 4EQ9A 4KYDA 3PPQA 2XHDA 1ZLQA 5HBCA 4XTCQ 1IXCA 1B51A 1I6QA 1SQYA 2F5XA 3JZJA 2F6PA 3K02A 4GD5A 2UVGA 4R75A 1TFAA 4ZZEA 1P1WA 3SETA 1UIVA 4LZ5A 3PMVA 3FJ7A 4RK2A 1I69A 1NH8A 1Y3PA 2F35A 3LBSA 3O97A 4GFRA 4LQ5A 4PETA 5TU0A 4RPOA 4BDRA 2XXUA 5KDTA 2QPQA 2V93A 5FHMA 2F7CA 1II5A 2O7IA 2RC8A 4NF8A 1LAXA 3A09A 1Y3QA 3VE1B 3SKPA 3G3IA 4JWOA 4NWDA 1FTMA 2HAVA 2LAOA 4EXKA 2DXYA 1Y1ZA 2RKMA 4KQPA 2HZLA 1BTJA 1I6AA 4O3CA 3OSRA 2ALUA 1M5CA 4GOTA 1MH4A 2R9JA 4M4GA 4Z0IA 1MXXA 3CIJA 3TYHA 3I5OA 1XHYA 5B70A 4AB6A 1H3DA 4F1YA 3N5LA 3OSQA 3V83A 5I57B 3IJOB 4EDPA 1QULA 5CMCA 1XT8A 4KCCA 4ELOA 2H25A 1QUIA 4U4XA 4Q30B 2E0SA 1USYH 4O3AA 3FVGA 3SEXA 4F29A 4RYAA 1B5JA 3FD3A 4OENA 3IORA 4P0IA 4U2RA 3WAEA 2XXQA 3OO8A 2ZYOA 3MVXA 1XC1A 1YPNA 2Q2CA 3MVWA 1B1XA 4JWYA 4NWCA 4QFOA 3G3GA 3THIA 5L9OA 3W9WA 1JW4A 1Q1KA 3MP1A 3R6UA 4GF8A 1L5TA 3WAFA 4DCXA 3QAXA 4YMAA 2DWIA 2FA7A 5JTYA 4F3GA 4JDFA 1WVJA 3K01A 3MP6A 3H7MA 4TOZA 1SI0A 2YPNA 1FQCA 3D4GA 1FTLA 4G8HA 4E0XA 1OIBA 1TXFA 1EU8A 1O64A 3OOAA 3OXNA 3Q25A 3UIFA 3LSWA 4AB5A 2I3VA 5H8FA 3KGCA 1LFHA 1ZU0A 3TKDA 1ZJLA 1LB8A 1RYOA 3FVNA 4U21A 1JW1A 2O84X 2Z8EA 1NNTA 2O1MA 2XXPA 3K6WA 3V5AA 1Y4TA 1B1HA 2QL3A 2DWHA 4FECA 5CMBA 3FUZA 2DE3A 2F97A 4LZ8A 4RY1A 1IXHA 1P99A 4ISUA 4FAJA 5TP9B 4X1DA 4LONB 1JNFA 3IOTA 1JVYA 2UXAA 3K00A 3PD9A 2DE4A 4PP0A 4ZEFA 3VFJA 3FVOA 2D3IA 1NNPA 4IO2A 4BDQA 4F39A 1P1OA 3K6UA 4OVJA 2OZZA 4H67A 5H8NB 4DZ1A 3BFTA 1H43A 1IZ1A 4FIMA 4JWXA 4OWDA 4F1VA 4EF2A 1PDAA 4N6PA 4C1TA 1B3GA 2ZYKA 4LATA 4R74A 4H65A 3ZKKA 2DXRA 4RXLA 4UA8A 3PPNA 2HAUA 4P0GA 3EHSA 3PPPA 3TQWA 4ESWA 4F2OA 4I9DA 1SBPA 2XXHA 5KZTA 4RNSA 2XXIA 2F6GA 2XD3A 5H8FB 4OETA 3QXMA 1VFEA 1FQBA 2Y7KA 3SESA 3QUJA 1A54A 4MLVA 2H99A 1EZPA 3FZVA 3H6WA 3GBAA 4Z7EA 5ITPA 2QS1A 1QKAA 3C36A 4F3PA 3RTWB 1M5EA 2QSXA 1AIVA 1LB9A 1MS7A 1PEBA 1ZIUA 3IK6B 3H4ZA 4EQ7A 5AA2D 4KYEA 5AA3A 1B4HA 2DYXA 4HTGA 5I59B 1GV8A 2RF1A 4JXIA 3FJMA 5H8NA 3HN0A 4XKPA 2RC9A 4DDDA 2HEUA 3OO9A 4FEDA 1ATGA 4OEVA 1O63A 3B6TA 5DVIA 3KG2A 4QSCA 1P1UA 2DVCA 4THIA 1D3KA 3N94A 4YZZA 3O28A 4NE4A 4QSDA 1NL5A 3B6QA 4H5FA 1FQDA 1URSA 4QFNA 3G3JA 4XXUA 1JQFA 5AA1A 1SYHA 3U1OA 2NXOA 4BDMA 3MUQA 2XX9A 3MZ9A 2XXRA 1DPPA 3V8XB 2I6EA 2OK2A 2ZNTA 2ONRA 2P1SA 4IGTA 3DLNA 4JB7A 3RLFE 3SEYA 3W9VA 3O2AA 3SERA 3K2DA 3C4MA 2QJEA 4NF8B 4DXBA 1XVXA 4ND9A 2F34A 1PBQA 2OLBA 3PMXA 3C31A 4ZEBA 4OFOA 3K4UA 1LSTA 3K6VA 3MWBA 4NEDA 3S4UA 3T9HB 3MVZA 2I4BA 2XXTA 4MH5A 1Y3NA 4ZEKA 3ILUB 3LUYA 4N07A 1UTBA 3FIRA 1M5DA 3PMWA 4YICA 4ELQA 4G2ZA 1S7YA 5H8HB 4LQ2A 1XS5A 4PFWA 1DSNA 4FJPA 3CFLA 4IO3A 4X48A 5K2XA 4OEUA 5AE4A 5TP9A 2VD3A 5I56A 3MAMA 3SEVA 3EHTA 4DCYA 1A8FA 1B9JA 1FTJA 3MZBA 1MY4A 1UTBB 2DVZA 3O29A 4GXSB 2HQ0A 3RTFB 3TODA 3VLVA 5A5XB 1US4A 2Q8JA 1Y4CA 1FQAA 1MPCA 1NFTA 3HO7A 4POXA 3M3KA 3U8QA 5BWJA 3LSXA 5DTBA 5J1DA 2XXWA 1MQHA 3PUWE 1TWYA 1MXYA 2D5WA 2A5TB 4I1DA 4XKRA 1IIWA 2ANJA 1A7LA 5HM4B 4F31B 3LSLA 1N0TA 1SDXA 4F2QA 4ELPA 1N84A 2WKYA 3IOWA 3UK4A 1O7TA 1BLFA 3H6TA 3T93B 2DWJA 3OENA 5KDTB 4H6DA 5BUUA 1CB6A 4QFKA 1USYE 3K1NA 3TTNA 1QKBA 1FQEA 4IO7A 2X26A 1QVSA 3HSTA 3MP8A 3ILTB 3MW0A 3PPRA 1EZ9A 1A8EA 5EHSA 2UVIA 1FTOA 3ZSFA 3T9XB 3VXCA 4BDNA 1B05A 2V3TA 3IX1A 1LCFA 4GIZA 2Q89A 4P11A 4U1OA 3TUSA 4U23A 3TFLA 1H44A 1ANFA 4GL0A 1B0LA 4N13A 2F7AA 2UVJA 4GRKA 5AA2A 4NF6A 1MG1A 1US5A 3C34A 4HCWA 4E0WA 1D9YA 1R9QA 1UTHB 3MPKA 4BLAA 1JW5A 5CBRA 2Y84A 3TAJA 1JVXA 1OVTA 3BFUA 4WKMA 1GVCA 4GXAA 2M8CA 3G3FA 1J1NA 3G3HA 2O7UA 4QSEA 3IB2A 2RCBA 4F22A 5L8DA 2UYFA 3RPWA 3QIMA 4H8IA 4C0RA 5I2NA 1OLAA 3S9EA 4MBPA 2Z22A 3FXRA 2R71A 1XOCA 2BJJX 2GRVA 2V84A 3N6UA 2OWSA 2THIA 2VGQA 4YKIA 5L9MA 2ZNUA 5JK4A 2YJPA 4QRZA 5DT6A 2IEEA 1FTKA 3U94A 1LCTA 1PC3A 3TEPA 3O6HA 3TQLA 1ZKBA 3DP8A 3U92A 5AA2B 2PT2A 5FTIA 3HHFA 4GQOA 4YB6A 5CI5A 3TZAA 4YKKA 4HW8A 1B52A 4H1XA 3RUMA 1PB7A 3B7DA 4O3BA 4AQ4A 1N76A 1RKMA 3DP6A 1SYIA 4KR5A 3U93A 3T9UA 1VR5A 1ZTYA 1D9VA 3EF7A 3TCGA 4RPNA 2F8DA 4QHQA 3TPAA 3C35A 3ZKLA 3IR1A 2ZNSA 1MY3A 3CFXA 4BDOA 3TDJA 4G68B 3AXFA 2D21A 2OWTA 4POWA 1MDQA 2UYEA 2UVHA 3ECRA 3H6VA 4H5GA 1F9BA 4IO4A 5DEXB 1M5BA 3PUZE 3G3KA 4R2BA 3IOUA 1LAFE 4WEDA 4YU0A 1JETA 3MPLA 5ISUA 3PUYE 4DIGA 1MH3A 4H8JA 3CVGA 1A40A 2DE2A 3BBRA 2QRYA 1I6BA 4X1BA 5B7DA 1HSEA 1HSJA 1NNKA 1WODA 1Y1MA 2XXYA 4IGRA 4TQUQ 1GTKA 4NF5B 4BDLA 1A99A 1AOVA 3M3LA 2GHBA 5H8HA 2X7QA 3FXUA 1OQHA 3M3FA 3SEUA 1N7WA 5DEXA 3C33A 4FEBA 5IAIA 4LUBA 5ELVA 2Y7IA 3IO6A 3CR9A 5H8SA 3CG3A 2RINA 3FASA 4GVOA 1B32A 2KLFA 4I62A 3K1MA 2H98A 4PQJA 3U72A 4ECFA 3M8UA 4NF4A 3JV9A 3RT8A 1MQDA 3IB0A 3N6TA 1DMBA 1IXIA 1M5FA 1MPBA 3OO6A 2ESNA 3QYTA 4MFIA 5K2YA 1GR2A 3TTLA 3VV5A 1JEVA 1ZBMA 4DXCA 2Y7WA 3IO4A 2VHAA 3GXAA 4IB2A 4OQOA 4X9TA 1Z7NE 4F1UA 2I49A 5CRYA 3T22A 4H0WA 1LAGE 1MM6A 2G93A 2A5TA 4QFLA 5I2NB 2QS3A 1IEJA 2H4IA 3RY3A 1BP5A 2ZYMA 3RT6B 1QW0A 1B6HA 2GH9A 4MF3A 1N7XA 4YMBA 2Y7PA 2FNCA 5H8QB 3TTMA 4EXLA 3JYRA 5CMKA 3OELA 4R6KA 2DWAA 3S9MC 1NH7A 3H6UA 4QFPA 3USDA 2ZXTA 3DM0A 3I3VA 1B3HA 3PUXE 1DOTA 3FXQA 1LLSA 4M1VA 4G68C 4R2FA 5L9SA 2NUVA 2XX8A 1Y20A 2O68A 4HCYA 4OFLA 4DLDA 1SD3A 3HCQA 3HPIA 3PV0E 1MY2A 4TLLB 5JEIA 2ONSA 4YAHX 2OBGA 5ICTA 4R6YA 1H76A 4OZ9A 2NWJA 3PU5A 1LBBA 3UORA 3QSLA 3VDFA 5DVFA 1SW1A 3MJNA 1MRPA 3L6HA 3PUVE 3UP9A 4U4SA 4EUOA 1D4NA 4WEPA 2I0BA 5CC2A 1OMPA 2P2AA 4OFJA 4ZE8A 4FATA 3KEIA 3O6GA 3Q29A 3PD8A 3RNNA 1SW5A 3T66A 4F3BA 3OEKA 3H06B 2O69A 1ELJA 1UTHA 1MDP1 4KCDA 4ELRA 5I58B 3Q27A 1R1NA 1LFGA 1QUJA 2CMOA 3CFZA 2Y7RA 2F78A 4ZDMA 4R9GA 2DP8A 3TELA 3N26A 1B5HA 2HXWA 4PFTA 4OESA 1QUKA 4PFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESX A;  4KFQ A;  3EQ1 A;  2IA4 A;  5ITO A;  1Y9U A;  3FAT A;  3RQT A;  4F18 A;  1NNF A;  4NF5 A;  3TCH A;  1H45 A;  4ZE9 A;  5I59 A;  2OCU A;  2X7P A;  4L17 A;  3DEL B;  4YKJ A;  4ZZA A;  1B3E A;  4C1U A;  3KOS A;  3FGS A;  4LP2 B;  3B6W A;  1CE2 A;  4OER A;  1NKX A;  1YTV A;  2B65 A;  2VP1 A;  2XXV A;  3SEW A;  1Z7M E;  1T0K A;  4R72 A;  1OVB A;  3C32 A;  2I0C A;  2XX7 A;  3CG1 A;  4IO5 A;  5DYH A;  2ZYN A;  2VOZ A;  3OEM A;  4KI0 E;  5AA4 A;  3LSF B;  3G7W A;  4PE5 B;  3K6X A;  2PX1 A;  5I58 A;  1MPD A;  1N04 A;  4K3F A;  3RGY A;  3E9X A;  3T9V A;  1VFD A;  3KFM A;  3KJ7 A;  4R73 A;  4YKP A;  5I56 B;  3L6G A;  2E1S A;  1B46 A;  3FJG A;  4OHN A;  2I3W A;  4G77 A;  1BKA A;  1PB9 A;  3FV1 A;  4OYV A;  1S50 A;  2AL4 A;  1MXZ A;  1R6Z A;  1WDN A;  3IB1 A;  3UGW A;  3V89 B;  3OO7 A;  5KCJ A;  2QS2 A;  5HPQ A;  1MQG A;  2GFE A;  2REG A;  4GL8 A;  1B2H A;  3QUF A;  1OLC A;  2V25 A;  3O66 A;  3Q28 A;  4ONY A;  3KN8 A;  1FW0 A;  3KSX A;  1P1N A;  3LR1 A;  4LZ7 A;  2PVU A;  5CM6 A;  1B40 A;  3UN6 A;  1IIT A;  1PB8 A;  1POT A;  2O6A A;  3KN7 A;  1SW4 A;  4KYS A;  1VSO A;  4XIG Q;  3BKI B;  3KN3 A;  2OJT A;  3IL1 B;  3O6I A;  1B0H A;  1B3F A;  5TPA B;  3UA8 A;  5CBS A;  1R9L A;  2V3U A;  2I4C A;  3GZG A;  4R9F A;  4RA1 A;  2PBW A;  2Q9T A;  4PFY A;  2AYS A;  2ABH A;  2GHA A;  1SW2 A;  2PYY A;  3FV2 A;  3E4R A;  3S9N C;  1PBP A;  2R6G E;  2V3Q A;  4HS7 A;  1TFD A;  3R26 A;  1MXU A;  3I6V A;  5EHM A;  5FTH A;  5F7V A;  2HCA A;  4NTL A;  1B7U A;  4U1Z A;  2O51 A;  3VLW A;  1TT1 A;  2Q88 A;  2XXX A;  5TPA A;  1URD A;  4NF4 B;  2ZMB A;  4I8C A;  1LGB C;  1MY1 A;  2XD2 A;  3GBB A;  1DPE A;  4LVQ A;  3Q26 A;  4NF6 B;  2QMW A;  2H9B A;  4UAC A;  3KSJ A;  4F3S A;  3IOV A;  1B7Z A;  2PMS A;  3SDF A;  3OMB A;  1POY 1;  4GWO A;  4MLQ A;  3TCF A;  4G8M A;  1B3L A;  2NOO A;  4G8N A;  4ZEI A;  3MC2 A;  5FHN A;  1B7H A;  1DTZ A;  1B5I A;  2F36 A;  4Q0C A;  2ONK E;  3CI8 A;  3FVK A;  2A5S A;  4QF9 A;  1QJM A;  1DTG A;  1YAE A;  2G29 A;  2PT1 A;  5H8Q A;  3T96 B;  3A3C A;  3C9H A;  4TLM B;  3OD7 A;  1UQW A;  4KHZ E;  4IO6 A;  3RN8 A;  1ZMG A;  4EF1 A;  1EH3 A;  3KZG A;  5I84 A;  2YLN A;  3MBP A;  5DVJ A;  2AIX A;  4WXJ A;  5CMM A;  4JBZ A;  3LC8 A;  3DP4 A;  5ICQ A;  1N3W A;  1URG A;  4RK9 A;  1MXV A;  3H3G A;  2FYI A;  3EPE A;  2Z8F A;  4GLI A;  3S9L C;  2Z23 A;  3KJT A;  3HHG A;  4KD5 A;  1MM7 A;  4FE8 A;  2HZK A;  2AL5 A;  3CSG A;  3MZ1 A;  3MVY A;  4EQB A;  5IKB A;  1P1Q A;  1MQI A;  5FHO A;  3S2V A;  1BIY A;  3E3K A;  1SI1 A;  3D4C A;  1MQJ A;  4YB7 A;  2DS9 A;  2F7B A;  4NMY A;  3CSB A;  2P0S A;  2W7Y A;  5I2K B;  3GLB A;  3R7X A;  3ONM A;  1IUD A;  5F1Q A;  1B4Z A;  3E13 X;  2QS4 A;  4F19 A;  2REJ A;  5EYF A;  2H5Y A;  2RCA A;  4G4P A;  2QMX A;  4LA9 A;  3EHU A;  1IQ7 A;  2VD2 A;  3PPO A;  3ODB A;  5I57 A;  3TTR A;  3VVF A;  1VE4 A;  1Q35 A;  2RC7 A;  1LBC A;  4OXV A;  3O9P A;  3PGF A;  4DE8 A;  4RJZ A;  4ZED A;  5I2K A;  1JEU A;  4KPT A;  3QK6 A;  3TTK A;  1OQG A;  2HFB A;  1MY0 A;  1FCK A;  1RYX A;  2CZL A;  3P7I A;  4IY6 A;  4JSO A;  3K1P A;  1YCJ A;  1AL3 A;  1NMU A;  5LOM A;  1IXG A;  1EZO A;  1AMF A;  2B3F A;  1UIU A;  2DQV A;  3KOT A;  3MQ9 A;  5JTY B;  2Q2A A;  3A3U A;  3H03 A;  3ZS6 A;  4XKQ A;  2O1L A;  3VLU A;  3VVD A;  1HSL A;  3IAZ A;  3W15 C;  3VVE A;  1A55 A;  4Q8R A;  1LFI A;  2I48 A;  4G68 A;  4OMB A;  1B58 A;  1AH5 A;  2NVU B;  3VXB A;  4Q5T A;  4FOR A;  1N3X A;  5AA4 B;  4XKN A;  3HV1 A;  3CRB A;  1KWH A;  2Z8D A;  4ZEC A;  2B3B A;  5A5X A;  1GGG A;  4OTE A;  4YB5 A;  1XVY A;  1FQF A;  3EN3 A;  3IJX B;  4ZS9 A;  4DXU A;  1MXW A;  1SVX B;  4R6H A;  2I58 A;  3TMG A;  2DSF A;  1S9T A;  3F11 A;  4U22 A;  4JSD A;  3KBR A;  5M2V A;  3K0V A;  1LAH E;  2DOJ A;  4IY5 A;  5KCJ B;  4EQ9 A;  4KYD A;  3PPQ A;  2XHD A;  1ZLQ A;  5HBC A;  4XTC Q;  1IXC A;  1B51 A;  1I6Q A;  1SQY A;  2F5X A;  3JZJ A;  2F6P A;  3K02 A;  4GD5 A;  2UVG A;  4R75 A;  1TFA A;  4ZZE A;  1P1W A;  3SET A;  1UIV A;  4LZ5 A;  3PMV A;  3FJ7 A;  4RK2 A;  1I69 A;  1NH8 A;  1Y3P A;  2F35 A;  3LBS A;  3O97 A;  4GFR A;  4LQ5 A;  4PET A;  5TU0 A;  4RPO A;  4BDR A;  2XXU A;  5KDT A;  2QPQ A;  2V93 A;  5FHM A;  2F7C A;  1II5 A;  2O7I A;  2RC8 A;  4NF8 A;  1LAX A;  3A09 A;  1Y3Q A;  3VE1 B;  3SKP A;  3G3I A;  4JWO A;  4NWD A;  1FTM A;  2HAV A;  2LAO A;  4EXK A;  2DXY A;  1Y1Z A;  2RKM A;  4KQP A;  2HZL A;  1BTJ A;  1I6A A;  4O3C A;  3OSR A;  2ALU A;  1M5C A;  4GOT A;  1MH4 A;  2R9J A;  4M4G A;  4Z0I A;  1MXX A;  3CIJ A;  3TYH A;  3I5O A;  1XHY A;  5B70 A;  4AB6 A;  1H3D A;  4F1Y A;  3N5L A;  3OSQ A;  3V83 A;  5I57 B;  3IJO B;  4EDP A;  1QUL A;  5CMC A;  1XT8 A;  4KCC A;  4ELO A;  2H25 A;  1QUI A;  4U4X A;  4Q30 B;  2E0S A;  1USY H;  4O3A A;  3FVG A;  3SEX A;  4F29 A;  4RYA A;  1B5J A;  3FD3 A;  4OEN A;  3IOR A;  4P0I A;  4U2R A;  3WAE A;  2XXQ A;  3OO8 A;  2ZYO A;  3MVX A;  1XC1 A;  1YPN A;  2Q2C A;  3MVW A;  1B1X A;  4JWY A;  4NWC A;  4QFO A;  3G3G A;  3THI A;  5L9O A;  3W9W A;  1JW4 A;  1Q1K A;  3MP1 A;  3R6U A;  4GF8 A;  1L5T A;  3WAF A;  4DCX A;  3QAX A;  4YMA A;  2DWI A;  2FA7 A;  5JTY A;  4F3G A;  4JDF A;  1WVJ A;  3K01 A;  3MP6 A;  3H7M A;  4TOZ A;  1SI0 A;  2YPN A;  1FQC A;  3D4G A;  1FTL A;  4G8H A;  4E0X A;  1OIB A;  1TXF A;  1EU8 A;  1O64 A;  3OOA A;  3OXN A;  3Q25 A;  3UIF A;  3LSW A;  4AB5 A;  2I3V A;  5H8F A;  3KGC A;  1LFH A;  1ZU0 A;  3TKD A;  1ZJL A;  1LB8 A;  1RYO A;  3FVN A;  4U21 A;  1JW1 A;  2O84 X;  2Z8E A;  1NNT A;  2O1M A;  2XXP A;  3K6W A;  3V5A A;  1Y4T A;  1B1H A;  2QL3 A;  2DWH A;  4FEC A;  5CMB A;  3FUZ A;  2DE3 A;  2F97 A;  4LZ8 A;  4RY1 A;  1IXH A;  1P99 A;  4ISU A;  4FAJ A;  5TP9 B;  4X1D A;  4LON B;  1JNF A;  3IOT A;  1JVY A;  2UXA A;  3K00 A;  3PD9 A;  2DE4 A;  4PP0 A;  4ZEF A;  3VFJ A;  3FVO A;  2D3I A;  1NNP A;  4IO2 A;  4BDQ A;  4F39 A;  1P1O A;  3K6U A;  4OVJ A;  2OZZ A;  4H67 A;  5H8N B;  4DZ1 A;  3BFT A;  1H43 A;  1IZ1 A;  4FIM A;  4JWX A;  4OWD A;  4F1V A;  4EF2 A;  1PDA A;  4N6P A;  4C1T A;  1B3G A;  2ZYK A;  4LAT A;  4R74 A;  4H65 A;  3ZKK A;  2DXR A;  4RXL A;  4UA8 A;  3PPN A;  2HAU A;  4P0G A;  3EHS A;  3PPP A;  3TQW A;  4ESW A;  4F2O A;  4I9D A;  1SBP A;  2XXH A;  5KZT A;  4RNS A;  2XXI A;  2F6G A;  2XD3 A;  5H8F B;  4OET A;  3QXM A;  1VFE A;  1FQB A;  2Y7K A;  3SES A;  3QUJ A;  1A54 A;  4MLV A;  2H99 A;  1EZP A;  3FZV A;  3H6W A;  3GBA A;  4Z7E A;  5ITP A;  2QS1 A;  1QKA A;  3C36 A;  4F3P A;  3RTW B;  1M5E A;  2QSX A;  1AIV A;  1LB9 A;  1MS7 A;  1PEB A;  1ZIU A;  3IK6 B;  3H4Z A;  4EQ7 A;  5AA2 D;  4KYE A;  5AA3 A;  1B4H A;  2DYX A;  4HTG A;  5I59 B;  1GV8 A;  2RF1 A;  4JXI A;  3FJM A;  5H8N A;  3HN0 A;  4XKP A;  2RC9 A;  4DDD A;  2HEU A;  3OO9 A;  4FED A;  1ATG A;  4OEV A;  1O63 A;  3B6T A;  5DVI A;  3KG2 A;  4QSC A;  1P1U A;  2DVC A;  4THI A;  1D3K A;  3N94 A;  4YZZ A;  3O28 A;  4NE4 A;  4QSD A;  1NL5 A;  3B6Q A;  4H5F A;  1FQD A;  1URS A;  4QFN A;  3G3J A;  4XXU A;  1JQF A;  5AA1 A;  1SYH A;  3U1O A;  2NXO A;  4BDM A;  3MUQ A;  2XX9 A;  3MZ9 A;  2XXR A;  1DPP A;  3V8X B;  2I6E A;  2OK2 A;  2ZNT A;  2ONR A;  2P1S A;  4IGT A;  3DLN A;  4JB7 A;  3RLF E;  3SEY A;  3W9V A;  3O2A A;  3SER A;  3K2D A;  3C4M A;  2QJE A;  4NF8 B;  4DXB A;  1XVX A;  4ND9 A;  2F34 A;  1PBQ A;  2OLB A;  3PMX A;  3C31 A;  4ZEB A;  4OFO A;  3K4U A;  1LST A;  3K6V A;  3MWB A;  4NED A;  3S4U A;  3T9H B;  3MVZ A;  2I4B A;  2XXT A;  4MH5 A;  1Y3N A;  4ZEK A;  3ILU B;  3LUY A;  4N07 A;  1UTB A;  3FIR A;  1M5D A;  3PMW A;  4YIC A;  4ELQ A;  4G2Z A;  1S7Y A;  5H8H B;  4LQ2 A;  1XS5 A;  4PFW A;  1DSN A;  4FJP A;  3CFL A;  4IO3 A;  4X48 A;  5K2X A;  4OEU A;  5AE4 A;  5TP9 A;  2VD3 A;  5I56 A;  3MAM A;  3SEV A;  3EHT A;  4DCY A;  1A8F A;  1B9J A;  1FTJ A;  3MZB A;  1MY4 A;  1UTB B;  2DVZ A;  3O29 A;  4GXS B;  2HQ0 A;  3RTF B;  3TOD A;  3VLV A;  5A5X B;  1US4 A;  2Q8J A;  1Y4C A;  1FQA A;  1MPC A;  1NFT A;  3HO7 A;  4POX A;  3M3K A;  3U8Q A;  5BWJ A;  3LSX A;  5DTB A;  5J1D A;  2XXW A;  1MQH A;  3PUW E;  1TWY A;  1MXY A;  2D5W A;  2A5T B;  4I1D A;  4XKR A;  1IIW A;  2ANJ A;  1A7L A;  5HM4 B;  4F31 B;  3LSL A;  1N0T A;  1SDX A;  4F2Q A;  4ELP A;  1N84 A;  2WKY A;  3IOW A;  3UK4 A;  1O7T A;  1BLF A;  3H6T A;  3T93 B;  2DWJ A;  3OEN A;  5KDT B;  4H6D A;  5BUU A;  1CB6 A;  4QFK A;  1USY E;  3K1N A;  3TTN A;  1QKB A;  1FQE A;  4IO7 A;  2X26 A;  1QVS A;  3HST A;  3MP8 A;  3ILT B;  3MW0 A;  3PPR A;  1EZ9 A;  1A8E A;  5EHS A;  2UVI A;  1FTO A;  3ZSF A;  3T9X B;  3VXC A;  4BDN A;  1B05 A;  2V3T A;  3IX1 A;  1LCF A;  4GIZ A;  2Q89 A;  4P11 A;  4U1O A;  3TUS A;  4U23 A;  3TFL A;  1H44 A;  1ANF A;  4GL0 A;  1B0L A;  4N13 A;  2F7A A;  2UVJ A;  4GRK A;  5AA2 A;  4NF6 A;  1MG1 A;  1US5 A;  3C34 A;  4HCW A;  4E0W A;  1D9Y A;  1R9Q A;  1UTH B;  3MPK A;  4BLA A;  1JW5 A;  5CBR A;  2Y84 A;  3TAJ A;  1JVX A;  1OVT A;  3BFU A;  4WKM A;  1GVC A;  4GXA A;  2M8C A;  3G3F A;  1J1N A;  3G3H A;  2O7U A;  4QSE A;  3IB2 A;  2RCB A;  4F22 A;  5L8D A;  2UYF A;  3RPW A;  3QIM A;  4H8I A;  4C0R A;  5I2N A;  1OLA A;  3S9E A;  4MBP A;  2Z22 A;  3FXR A;  2R71 A;  1XOC A;  2BJJ X;  2GRV A;  2V84 A;  3N6U A;  2OWS A;  2THI A;  2VGQ A;  4YKI A;  5L9M A;  2ZNU A;  5JK4 A;  2YJP A;  4QRZ A;  5DT6 A;  2IEE A;  1FTK A;  3U94 A;  1LCT A;  1PC3 A;  3TEP A;  3O6H A;  3TQL A;  1ZKB A;  3DP8 A;  3U92 A;  5AA2 B;  2PT2 A;  5FTI A;  3HHF A;  4GQO A;  4YB6 A;  5CI5 A;  3TZA A;  4YKK A;  4HW8 A;  1B52 A;  4H1X A;  3RUM A;  1PB7 A;  3B7D A;  4O3B A;  4AQ4 A;  1N76 A;  1RKM A;  3DP6 A;  1SYI A;  4KR5 A;  3U93 A;  3T9U A;  1VR5 A;  1ZTY A;  1D9V A;  3EF7 A;  3TCG A;  4RPN A;  2F8D A;  4QHQ A;  3TPA A;  3C35 A;  3ZKL A;  3IR1 A;  2ZNS A;  1MY3 A;  3CFX A;  4BDO A;  3TDJ A;  4G68 B;  3AXF A;  2D21 A;  2OWT A;  4POW A;  1MDQ A;  2UYE A;  2UVH A;  3ECR A;  3H6V A;  4H5G A;  1F9B A;  4IO4 A;  5DEX B;  1M5B A;  3PUZ E;  3G3K A;  4R2B A;  3IOU A;  1LAF E;  4WED A;  4YU0 A;  1JET A;  3MPL A;  5ISU A;  3PUY E;  4DIG A;  1MH3 A;  4H8J A;  3CVG A;  1A40 A;  2DE2 A;  3BBR A;  2QRY A;  1I6B A;  4X1B A;  5B7D A;  1HSE A;  1HSJ A;  1NNK A;  1WOD A;  1Y1M A;  2XXY A;  4IGR A;  4TQU Q;  1GTK A;  4NF5 B;  4BDL A;  1A99 A;  1AOV A;  3M3L A;  2GHB A;  5H8H A;  2X7Q A;  3FXU A;  1OQH A;  3M3F A;  3SEU A;  1N7W A;  5DEX A;  3C33 A;  4FEB A;  5IAI A;  4LUB A;  5ELV A;  2Y7I A;  3IO6 A;  3CR9 A;  5H8S A;  3CG3 A;  2RIN A;  3FAS A;  4GVO A;  1B32 A;  2KLF A;  4I62 A;  3K1M A;  2H98 A;  4PQJ A;  3U72 A;  4ECF A;  3M8U A;  4NF4 A;  3JV9 A;  3RT8 A;  1MQD A;  3IB0 A;  3N6T A;  1DMB A;  1IXI A;  1M5F A;  1MPB A;  3OO6 A;  2ESN A;  3QYT A;  4MFI A;  5K2Y A;  1GR2 A;  3TTL A;  3VV5 A;  1JEV A;  1ZBM A;  4DXC A;  2Y7W A;  3IO4 A;  2VHA A;  3GXA A;  4IB2 A;  4OQO A;  4X9T A;  1Z7N E;  4F1U A;  2I49 A;  5CRY A;  3T22 A;  4H0W A;  1LAG E;  1MM6 A;  2G93 A;  2A5T A;  4QFL A;  5I2N B;  2QS3 A;  1IEJ A;  2H4I A;  3RY3 A;  1BP5 A;  2ZYM A;  3RT6 B;  1QW0 A;  1B6H A;  2GH9 A;  4MF3 A;  1N7X A;  4YMB A;  2Y7P A;  2FNC A;  5H8Q B;  3TTM A;  4EXL A;  3JYR A;  5CMK A;  3OEL A;  4R6K A;  2DWA A;  3S9M C;  1NH7 A;  3H6U A;  4QFP A;  3USD A;  2ZXT A;  3DM0 A;  3I3V A;  1B3H A;  3PUX E;  1DOT A;  3FXQ A;  1LLS A;  4M1V A;  4G68 C;  4R2F A;  5L9S A;  2NUV A;  2XX8 A;  1Y20 A;  2O68 A;  4HCY A;  4OFL A;  4DLD A;  1SD3 A;  3HCQ A;  3HPI A;  3PV0 E;  1MY2 A;  4TLL B;  5JEI A;  2ONS A;  4YAH X;  2OBG A;  5ICT A;  4R6Y A;  1H76 A;  4OZ9 A;  2NWJ A;  3PU5 A;  1LBB A;  3UOR A;  3QSL A;  3VDF A;  5DVF A;  1SW1 A;  3MJN A;  1MRP A;  3L6H A;  3PUV E;  3UP9 A;  4U4S A;  4EUO A;  1D4N A;  4WEP A;  2I0B A;  5CC2 A;  1OMP A;  2P2A A;  4OFJ A;  4ZE8 A;  4FAT A;  3KEI A;  3O6G A;  3Q29 A;  3PD8 A;  3RNN A;  1SW5 A;  3T66 A;  4F3B A;  3OEK A;  3H06 B;  2O69 A;  1ELJ A;  1UTH A;  1MDP 1;  4KCD A;  4ELR A;  5I58 B;  3Q27 A;  1R1N A;  1LFG A;  1QUJ A;  2CMO A;  3CFZ A;  2Y7R A;  2F78 A;  4ZDM A;  4R9G A;  2DP8 A;  3TEL A;  3N26 A;  1B5H A;  2HXW A;  4PFT A;  4OES A;  1QUK A;  4PFU A; 
#chains in the Genus database with same CATH topology
 1FPD A;  1Y9U A;  4ZE9 A;  1EYK A;  3TCH A;  2X7P A;  4YKJ A;  3DEL B;  1B3E A;  1YYZ A;  3SEW A;  1CE2 A;  1YTV A;  2XXV A;  1T0K A;  4IO5 A;  2ZYN A;  3LSF B;  4PE5 B;  4HE1 A;  2PCR A;  1N04 A;  3T9V A;  1VFD A;  3KFM A;  3L6G A;  4G77 A;  3FV1 A;  3OO7 A;  2QS2 A;  3O66 A;  4ONY A;  3KSX A;  3LR1 A;  4LZ7 A;  2PVU A;  3UN6 A;  1IIT A;  1VSO A;  3O6I A;  3UA8 A;  5I59 A;  5CBS A;  4OVQ A;  2I4C A;  3GZG A;  3FV2 A;  3E4R A;  1PBP A;  2R6G E;  1MXU A;  5EHM A;  2HCA A;  4P3L A;  1TT1 A;  2Q88 A;  2XXX A;  4I8C A;  3GBB A;  2QFL A;  1DPE A;  4LVQ A;  4O7I A;  1B7Z A;  1FPB A;  2V4C A;  4G8N A;  4N17 A;  5FHN A;  1B7H A;  1B5I A;  3CI8 A;  3FVK A;  4QF9 A;  4N81 A;  3T96 B;  3A3C A;  1Q9D A;  3RN8 A;  2WBD A;  3MBP A;  3LV0 A;  4QBA A;  3DP4 A;  1INP A;  3EPE A;  2Z8F A;  3S9L C;  4KD5 A;  2VPO A;  1BIY A;  1SI1 A;  3D4C A;  1MQJ A;  2F7B A;  5F1Q A;  3E13 X;  2QS4 A;  4F19 A;  2H5Y A;  1IQ7 A;  2VD2 A;  3PGF A;  1JEU A;  3TTK A;  1OQG A;  1KA1 A;  4JSO A;  3NOH A;  1IXG A;  1AMF A;  5JTY B;  3A3U A;  3VLU A;  3VVD A;  3IAZ A;  3W15 C;  3VVE A;  1A55 A;  4G68 A;  4FOR A;  2Z8D A;  4YB5 A;  2I58 A;  3F11 A;  3KBR A;  1LAH E;  4KYD A;  4XTC Q;  4R75 A;  3CHG A;  3PMV A;  1I69 A;  2QPQ A;  1IME A;  4NF8 A;  3A09 A;  3VE1 B;  3G3I A;  1FTM A;  2HAV A;  4O3C A;  1I6A A;  1LBX A;  1MH4 A;  3CIJ A;  4AB6 A;  4F1Y A;  5I57 B;  3IJO B;  3FXB A;  4KCC A;  1QUI A;  2E0S A;  1FRP A;  1B5J A;  4OEN A;  1XC1 A;  1YPN A;  2Q2C A;  3MVW A;  5L9O A;  1Q1K A;  3MP1 A;  3R6U A;  4F3G A;  1WVJ A;  1SI0 A;  2YPN A;  5DW8 A;  1FTL A;  1Y4T A;  2QL3 A;  2DWH A;  3FUZ A;  2F97 A;  4ISU A;  1JVY A;  4PP0 A;  2D3I A;  2HHM A;  3K6U A;  2OZZ A;  4H67 A;  4DZ1 A;  1EYI A;  1H43 A;  1IZ1 A;  4OWD A;  3E79 A;  4R74 A;  4H65 A;  4RXL A;  3TQW A;  1NV1 A;  4RNS A;  2XXI A;  2F6G A;  3QXM A;  1VFE A;  2Y7K A;  3SES A;  1A54 A;  1EZP A;  3H6W A;  4OAN A;  1FPK A;  3C36 A;  1LB9 A;  4PCD A;  1ZIU A;  3IK6 B;  5AA2 D;  4KYE A;  1B4H A;  2DYX A;  4HTG A;  4XKP A;  2HEU A;  1ATG A;  4GWS A;  5DVI A;  5LTC A;  3EKI A;  2DVC A;  1NL5 A;  1FQD A;  4XXU A;  3G3J A;  2OK2 A;  3RLF E;  4DXB A;  1PBQ A;  4PAF A;  4ZEB A;  2ZZW A;  1LST A;  3K6V A;  2XXT A;  4MH5 A;  1Y3N A;  4ZEK A;  3ILU B;  4N07 A;  3PMW A;  1XS5 A;  4PFW A;  4FJP A;  4X48 A;  2OX3 A;  3KBZ A;  3MAM A;  5IM2 A;  3EHT A;  1A8F A;  3VLV A;  1IMA A;  2Q8J A;  1Y4C A;  5BWJ A;  1MQH A;  1MXY A;  4NQ8 A;  1NI9 A;  1O7T A;  3T93 B;  2DWJ A;  4H6D A;  1QKB A;  3ILT B;  5EQA A;  3MW0 A;  5EHS A;  1NV7 A;  1FPL A;  4N13 A;  1B0L A;  5AA2 A;  2F7A A;  2UVJ A;  4GRK A;  3C34 A;  1D9Y A;  1UTH B;  1JW5 A;  1XI6 A;  4WKM A;  1DCU A;  3G3F A;  4PE3 A;  4MNI A;  5L8D A;  4AS5 A;  4GBW A;  1OLA A;  2Z22 A;  1XOC A;  2GRV A;  2THI A;  4QRZ A;  3TEP A;  3TQL A;  4UAB A;  5AA2 B;  5CI5 A;  4HW8 A;  4H1X A;  1PB7 A;  2P3V A;  4O3B A;  1N76 A;  3DP6 A;  3U93 A;  3LUZ A;  1D9V A;  4OVR A;  3ZKL A;  3C35 A;  1MY3 A;  4G68 B;  1MDQ A;  4IO4 A;  4R2B A;  1JET A;  5ISU A;  2DE2 A;  1HSJ A;  2XXY A;  4BDL A;  3U65 A;  1AOV A;  3SEU A;  5H8H A;  2X7Q A;  1OQH A;  5IAI A;  5ELV A;  3CR9 A;  4NF4 A;  1MQD A;  3N6T A;  4O8M A;  2ESN A;  3VV5 A;  3IO4 A;  2GQ1 A;  5EQ8 A;  1MM6 A;  4QFL A;  2CEX A;  4NGU A;  3RT6 B;  4MF3 A;  3B50 A;  2Y7P A;  2FNC A;  4PF6 A;  3H6U A;  3USD A;  4R2F A;  5L9S A;  2NUV A;  1NV0 A;  3HPI A;  1MY2 A;  4O7M A;  5ICT A;  4R6Y A;  2WEF A;  1H76 A;  4OZ9 A;  2NWJ A;  3PU5 A;  3MJN A;  4U4S A;  4EUO A;  2I0B A;  5CC2 A;  2P2A A;  4OFJ A;  2CZH A;  3Q29 A;  3PD8 A;  1SW5 A;  4MNP A;  2O69 A;  1UTH A;  4KXP A;  4ELR A;  2CMO A;  4GX4 A;  1LBY A;  1FPE A;  1QUK A;  3FAT A;  1NNF A;  1H45 A;  4L17 A;  4DI4 B;  3B6W A;  1NKX A;  2VP1 A;  4MJO A;  1Z7M E;  3C32 A;  2I0C A;  3OEM A;  3G7W A;  3E9X A;  4YKP A;  1NUZ A;  1B46 A;  3FJG A;  4OHN A;  1PB9 A;  1S50 A;  2AL4 A;  1MXZ A;  3IB1 A;  5KCJ A;  2BJI A;  3V89 B;  5HPQ A;  1FTA A;  2GFE A;  3QUF A;  1PB8 A;  1POT A;  2O6A A;  1SW4 A;  4KYS A;  3BKI B;  2OJT A;  3IL1 B;  1R9L A;  4R9F A;  4PFB A;  4PFY A;  3BIG A;  4HS7 A;  2V3Q A;  4NTL A;  1B7U A;  4U1Z A;  3VLW A;  4GBV A;  4NF4 B;  1LBZ A;  1MY1 A;  2XD2 A;  3Q26 A;  2H9B A;  3IOV A;  3SDF A;  4HE0 A;  4MLQ A;  4G8M A;  2NOO A;  3MC2 A;  4N8G A;  2ONK E;  2A5S A;  1QJM A;  2FIX A;  1DTG A;  1YAE A;  2PT1 A;  1UQW A;  4EF1 A;  1EH3 A;  5I84 A;  4WXJ A;  5ICQ A;  1N3W A;  4RK9 A;  1FJ9 A;  2Z23 A;  3HHG A;  1MM7 A;  4FE8 A;  3MZ1 A;  2F3D A;  4PFR A;  5FHO A;  4ELO A;  2WBB A;  5EYF A;  2RCA A;  4G4P A;  5I57 A;  2QVV A;  2RC7 A;  1LBC A;  3O9P A;  5I2K A;  4KPT A;  4PGP A;  3QK6 A;  2HFB A;  1RYX A;  4IY6 A;  3K1P A;  1NMU A;  1UIU A;  3KOT A;  2Q2A A;  3H03 A;  3ZS6 A;  2O1L A;  1HSL A;  3VXB A;  1N3X A;  1KWH A;  4ZEC A;  2B3B A;  1GGG A;  4OTE A;  3IJX B;  4DXU A;  1MXW A;  1SVX B;  4R6H A;  3TMG A;  4PBH A;  2DSF A;  4U22 A;  1FPF A;  2DOJ A;  4EQ9 A;  3PPQ A;  1I6Q A;  1SQY A;  1K9Y A;  4ZZE A;  1P1W A;  3SET A;  1Y3P A;  3ISP A;  3LBS A;  4GFR A;  4LQ5 A;  4PET A;  5KDT A;  2V93 A;  2O7I A;  3T1B A;  1Y3Q A;  4NWD A;  1FBD A;  2LAO A;  4EXK A;  2DXY A;  2RKM A;  1BTJ A;  4Z0I A;  4GOT A;  3I5O A;  1XHY A;  4GX6 A;  1H3D A;  3GYY A;  1LEV A;  3OSQ A;  1QUL A;  1XT8 A;  4PC9 A;  4O3A A;  4RYA A;  3FD3 A;  3IOR A;  4P0I A;  4U2R A;  5IZ1 A;  2ZYO A;  3THI A;  1FBF A;  4GF8 A;  4DCX A;  4N8Y A;  4YMA A;  2FA7 A;  3K01 A;  3MP6 A;  3D4G A;  1OIB A;  3OOA A;  1EU8 A;  4AB5 A;  2B4M A;  3LSW A;  1ZU0 A;  3FVN A;  1LB8 A;  4U21 A;  1IMB A;  1B1H A;  2DE3 A;  4LZ8 A;  2XWV A;  4MNC A;  4FAJ A;  5TP9 B;  1JNF A;  3IOT A;  2DE4 A;  1NNP A;  5H8N B;  4PTK A;  4N6P A;  4C1T A;  4ESW A;  3PPN A;  3EHS A;  4N15 A;  2XD3 A;  1NUX A;  4MLV A;  4Z7E A;  2QS1 A;  3RPL B;  4F3P A;  4EQ7 A;  5I59 B;  3FJM A;  5H8N A;  3B6T A;  3KG2 A;  2B4L A;  4NE4 A;  4QSD A;  3TTR A;  5AA1 A;  1URS A;  1SYH A;  3U1O A;  3MUQ A;  2XX9 A;  1NV5 A;  2ONR A;  3DLN A;  4JB7 A;  3O2A A;  3C4M A;  2QJE A;  1XVX A;  2F34 A;  4MHF A;  4NED A;  3S4U A;  3LUY A;  3FIR A;  4YIC A;  4G2Z A;  1RDX A;  1DSN A;  3CFL A;  4OEU A;  2VD3 A;  4NX1 A;  1B9J A;  1FTJ A;  1UTB B;  3O29 A;  5A5X B;  1NV6 A;  1US4 A;  4JVC A;  1FQA A;  1MPC A;  4POX A;  3U8Q A;  3LSX A;  4I1D A;  4XKR A;  1IMD A;  2ANJ A;  5HM4 B;  3LSL A;  1SDX A;  4GWY A;  4ELP A;  1BLF A;  3H6T A;  4X8R A;  1CB6 A;  3K1N A;  2X26 A;  2XA5 A;  3ZSF A;  3PPR A;  1EZ9 A;  2UVI A;  1FTO A;  4P11 A;  2V3T A;  4GIZ A;  2WYP A;  2Y5K A;  3IFC A;  1ANF A;  4HCW A;  4E0W A;  1R9Q A;  1LBV A;  3BFU A;  3G3H A;  4QSE A;  1FSA A;  4H8I A;  2R71 A;  2IEE A;  3U94 A;  4PBQ A;  2XWO A;  5FTI A;  4YB6 A;  5ET7 A;  5IZZ A;  1B52 A;  4P1E A;  4AQ4 A;  1FBE A;  3EF7 A;  4RPN A;  3IR1 A;  3AXF A;  2UYE A;  2UVH A;  1F9B A;  1LAF E;  4YU0 A;  4AS4 A;  3MPL A;  4H8J A;  4X1B A;  1I6B A;  5B7D A;  5EYG A;  1GTK A;  1A99 A;  3FXU A;  5DEX A;  5I3S A;  3C33 A;  4FEB A;  4LUB A;  1BK4 A;  3CG3 A;  4GVO A;  2KLF A;  4ECF A;  1IXI A;  4MFI A;  3TTL A;  1JEV A;  4DXC A;  2VHA A;  3GXA A;  4OQO A;  4F1U A;  2I49 A;  4H0W A;  2A5T A;  5I2N B;  3RY3 A;  1QW0 A;  1B6H A;  5H8Q B;  4EXL A;  3JYR A;  3OEL A;  1NH7 A;  5IZ3 B;  3PUX E;  2XX8 A;  4QXD A;  1D9Q A;  1SD3 A;  4GWW A;  3HCQ A;  4YAH X;  3UOR A;  5DVF A;  3PUV E;  1D4N A;  4WEP A;  1FBC A;  1OMP A;  4FAT A;  4ZE8 A;  3T66 A;  3RNN A;  4F3B A;  1MDP 1;  5I58 B;  1R1N A;  4ZDM A;  2HXW A;  4ESX A;  3EQ1 A;  2IA4 A;  5ITO A;  3RQT A;  4F18 A;  5CM6 A;  2OCU A;  4C1U A;  3KOS A;  3FGS A;  4OER A;  4MX6 A;  2B65 A;  2VOZ A;  5AA4 A;  2PX1 A;  5I58 A;  4NF0 A;  1MPD A;  1FPJ A;  5I56 B;  4MAG A;  4OYV A;  3UGW A;  1WDN A;  1MQG A;  4GL8 A;  1B2H A;  1FW0 A;  1P1N A;  5DYH A;  3KN3 A;  1B3F A;  1KZ8 A;  2V3U A;  4MEV A;  4RA1 A;  2PBW A;  2ABH A;  5EQ9 A;  1TFD A;  3R26 A;  5FTH A;  5F7V A;  1IMC A;  2O51 A;  5TPA A;  2ZMB A;  1LGB C;  2OWZ A;  1NUY A;  2FVZ A;  4GWO A;  4ZEI A;  2F36 A;  4Q0C A;  5H8Q A;  2G29 A;  3OD7 A;  5DVJ A;  2WYK A;  4NHB A;  5CMM A;  4JBZ A;  3LC8 A;  1URG A;  4PGN A;  2AL5 A;  1AWB A;  1MQI A;  2DS9 A;  5I2K B;  4NMY A;  2W7Y A;  3R7X A;  1B4Z A;  2QMX A;  3EHU A;  3ODB A;  3VVF A;  1VE4 A;  1Q35 A;  4OXV A;  4DE8 A;  4RJZ A;  4ZED A;  1MY0 A;  2CZL A;  1AL3 A;  1EZO A;  5IGA A;  2DQV A;  1LFI A;  1AH5 A;  5AA4 B;  1FQF A;  5ET8 A;  4G61 A;  5IZ3 A;  4JSD A;  5M2V A;  3K0V A;  4IY5 A;  2QVR A;  1ZLQ A;  1IXC A;  4GD5 A;  3JZJ A;  2UVG A;  2KR0 A;  4LZ5 A;  3FJ7 A;  4RK2 A;  1NH8 A;  5TU0 A;  4PAK A;  2XXU A;  5FHM A;  2F7C A;  1II5 A;  1LAX A;  4GWX A;  4N91 A;  4JWO A;  4KQP A;  3OSR A;  1M5C A;  4M4G A;  2R9J A;  1MXX A;  3TYH A;  3V83 A;  1IMF A;  3SZP A;  2H25 A;  4Q30 B;  1USY H;  3FVG A;  4XFE A;  4JVD A;  3WAE A;  2XXQ A;  3OO8 A;  4PFU A;  4O94 A;  4QFO A;  3G3G A;  3W9W A;  1JW4 A;  3WAF A;  1L5T A;  3QAX A;  4JDF A;  3H7M A;  4TOZ A;  1FQC A;  4G8H A;  5I56 A;  4GWU A;  1TXF A;  1LFH A;  3B8B A;  1RYO A;  2JJK A;  2O84 X;  1NNT A;  2XXP A;  4NG7 A;  5CMB A;  1IXH A;  4LON B;  3K00 A;  3PD9 A;  4ZEF A;  4BDQ A;  4IO2 A;  4P56 A;  2DDK A;  1P1O A;  4OVJ A;  4FIM A;  4JWX A;  4F1V A;  4EF2 A;  4UA8 A;  2HAU A;  1SBP A;  1KA0 A;  1FQB A;  3FZV A;  3GBA A;  1QKA A;  1M5E A;  3KC1 A;  4XF5 A;  3D1R A;  4OVT A;  1FJ6 A;  5AA3 A;  1GV8 A;  2RF1 A;  3HN0 A;  4DDD A;  3OO9 A;  4FED A;  4OEV A;  1O63 A;  2XWI A;  4QSC A;  4THI A;  1D3K A;  3N94 A;  4YZZ A;  3O28 A;  3TOD A;  4H5F A;  4OA4 A;  4QFN A;  4BDM A;  2NXO A;  1DPP A;  3V8X B;  2ZNT A;  4IGT A;  3W9V A;  3K2D A;  4NF8 B;  4ND9 A;  2OLB A;  3C31 A;  4OFO A;  3TUS A;  3T9H B;  3MVZ A;  2I4B A;  1FBG A;  1UTB A;  1M5D A;  5H8H B;  4LQ2 A;  5K2X A;  5AE4 A;  2P3N A;  5TP9 A;  4DCY A;  4I40 A;  3RTF B;  2DVZ A;  4PFI A;  5DTB A;  2XXW A;  3PUW E;  2KQZ A;  1K9Z A;  1A7L A;  4F31 B;  1N0T A;  1N84 A;  2WKY A;  3IOW A;  3UK4 A;  1USY E;  1FQE A;  4IO7 A;  1QVS A;  3HST A;  1A8E A;  2CZI A;  2FHY A;  1FBH A;  3VXC A;  1B05 A;  3IX1 A;  2Q89 A;  4P8B A;  5ESY A;  4U23 A;  3TFL A;  1H44 A;  4GL0 A;  4NF6 A;  1MG1 A;  1FPI A;  1US5 A;  4BLA A;  1GVC A;  4GXA A;  2M8C A;  3IB2 A;  2RCB A;  5F24 A;  5I2N A;  5I7I A;  3FXR A;  4F2O A;  3N6U A;  2OWS A;  2VGQ A;  2ZNU A;  2YJP A;  1EYJ A;  1LCT A;  1PC3 A;  3O6H A;  2PT2 A;  3HHF A;  4GQO A;  1FPG A;  3B7D A;  5I5P A;  1SYI A;  3T9U A;  1ZTY A;  3TCG A;  3TPA A;  2ZNS A;  3CFX A;  3TDJ A;  2D21 A;  4POW A;  1RDY A;  5DEX B;  1M5B A;  3PUZ E;  4MIJ A;  3IOU A;  4WED A;  3PUY E;  1VDW A;  1HSE A;  1WOD A;  4TQU Q;  4IGR A;  4I3Y A;  4X04 A;  1N7W A;  1NV3 A;  2FIE A;  2Y7I A;  3A29 A;  2RIN A;  1B32 A;  4I62 A;  3K1M A;  4PQJ A;  3U72 A;  3M8U A;  3IB0 A;  3QYT A;  1DMB A;  1M5F A;  1MPB A;  3OO6 A;  1YZ0 A;  1ZBM A;  4X9T A;  1Z7N E;  3T22 A;  2G93 A;  2QS3 A;  1IEJ A;  1FBP A;  1BP5 A;  2ZYM A;  4YMB A;  1N7X A;  5CMK A;  4R6K A;  3DM0 A;  4M1V A;  1B3H A;  3FXQ A;  1LLS A;  4HCY A;  4OFL A;  4DLD A;  3PV0 E;  2QVU A;  5JEI A;  2OBG A;  1LBB A;  3RPL A;  3QSL A;  3UP9 A;  3L6H A;  3OEK A;  3H06 B;  1LFG A;  1QUJ A;  2F78 A;  4R9G A;  3N26 A;  1B5H A;  4PFT A;  1YXI A;  4OES A;  4KFQ A;  4HE2 A;  4NF5 A;  4ZZA A;  4LP2 B;  4R72 A;  1OVB A;  2XX7 A;  3CG1 A;  4KI0 E;  2PFY A;  3K6X A;  1NUW A;  2CEY A;  4K3F A;  4LN5 A;  3RGY A;  1NV2 A;  4R73 A;  3KJ7 A;  2E1S A;  5FBP A;  2I3W A;  1BKA A;  1R6Z A;  3PTY A;  4GX3 A;  2REG A;  1OLC A;  2V25 A;  3Q28 A;  3KN8 A;  1B40 A;  3KN7 A;  4XIG Q;  1B0H A;  5TPA B;  2Q9T A;  2AYS A;  4IR8 A;  2GHA A;  1SW2 A;  2PYY A;  3S9N C;  3I6V A;  4PF8 A;  1URD A;  4NF6 B;  2QMW A;  4UAC A;  3KSJ A;  2HXR A;  4F3S A;  2PMS A;  3OMB A;  1POY 1;  3TCF A;  1B3L A;  1DTZ A;  2Q74 A;  3FBP A;  3C9H A;  4TLM B;  4KHZ E;  4IO6 A;  1ZMG A;  3KZG A;  2YLN A;  2AIX A;  4NN3 A;  1MXV A;  3H3G A;  2FYI A;  4GLI A;  3KJT A;  2HZK A;  3CSG A;  2WX9 A;  3MVY A;  4EQB A;  5IKB A;  1P1Q A;  3IFA A;  3S2V A;  3E3K A;  4YB7 A;  5CBR A;  3CSB A;  2P0S A;  3GLB A;  3ONM A;  1IUD A;  3QMF A;  2REJ A;  4LA9 A;  3PPO A;  5EQ7 A;  3RYD A;  1FCK A;  3P7I A;  1YCJ A;  5LOM A;  2B3F A;  3MQ9 A;  3MYU A;  4XKQ A;  4Q8R A;  2VT5 A;  2I48 A;  4XEQ A;  4OMB A;  1B58 A;  2NVU B;  4Q5T A;  4XKN A;  3HV1 A;  3CRB A;  5A5X A;  1XVY A;  3EN3 A;  4ZS9 A;  1S9T A;  5EYH A;  5KCJ B;  2XHD A;  5HBC A;  2F5X A;  1B51 A;  3K02 A;  2F6P A;  1TFA A;  1UIV A;  5ET5 A;  2F35 A;  3O97 A;  3MST A;  4BDR A;  4H45 A;  4RPO A;  2RC8 A;  4OVS A;  3SKP A;  2HPG A;  4JVI A;  1Y1Z A;  3T0J A;  2HZL A;  3E78 A;  2ALU A;  5B70 A;  3N5L A;  4EDP A;  2ZZV A;  5CMC A;  4U4X A;  3HFU A;  3SEX A;  4F29 A;  1LBW A;  4NWC A;  3MVX A;  1B1X A;  4JWY A;  5JTY A;  2DWI A;  1O64 A;  3OXN A;  3UIF A;  3Q25 A;  2I3V A;  5H8F A;  3KGC A;  2XWK A;  3TKD A;  1ZJL A;  1JW1 A;  2Z8E A;  3K6W A;  2O1M A;  3V5A A;  3ROJ A;  4FEC A;  4RY1 A;  1P99 A;  4X1D A;  3BIH A;  2UXA A;  3VFJ A;  3FVO A;  4OVP A;  4F39 A;  1JP4 A;  3BFT A;  1PDA A;  1B3G A;  2ZYK A;  4LAT A;  3ZKK A;  2Q8M A;  2DXR A;  4P0G A;  5KZT A;  3PPP A;  1G0I A;  4I9D A;  2XXH A;  5H8F B;  4OET A;  3QUJ A;  2H99 A;  5ITP A;  5LDZ A;  3RTW B;  2QSX A;  1AIV A;  1MS7 A;  1PEB A;  2VPN A;  3H4Z A;  4JXI A;  5T3J A;  2RC9 A;  1G0H A;  1P1U A;  3B6Q A;  4MMP A;  4PAI A;  4E0X A;  1JQF A;  3MZ9 A;  2XXR A;  4P1L A;  4P47 A;  2I6E A;  2P1S A;  3SEY A;  5A5L A;  3SER A;  3PMX A;  3K4U A;  3MWB A;  1RDZ A;  2ZZX A;  4ELQ A;  1S7Y A;  4P9K A;  4IO3 A;  3SEV A;  3MZB A;  1MY4 A;  4GXS B;  2HQ0 A;  1NFT A;  3HO7 A;  3M3K A;  4MCO A;  5J1D A;  4HXV A;  1TWY A;  2D5W A;  2A5T B;  1IIW A;  4F2Q A;  3OEN A;  1CNQ A;  5BUU A;  5KDT B;  4QFK A;  3TTN A;  1SPI A;  3MP8 A;  3KC0 A;  4BDN A;  3T9X B;  4U1O A;  4DI3 D;  1LCF A;  4PDH A;  3MPK A;  2Y84 A;  3TAJ A;  1JVX A;  1OVT A;  2PFZ A;  1J1N A;  2O7U A;  4F22 A;  2L5V A;  2UYF A;  3RPW A;  3QIM A;  4C0R A;  4N6D A;  4I3E A;  3S9E A;  4MBP A;  2BJJ X;  5L9M A;  2V84 A;  4YKI A;  1NV4 A;  5JK4 A;  5DT6 A;  1FTK A;  1ZKB A;  3DP8 A;  3U92 A;  3TZA A;  4YKK A;  4PDD A;  4FBP A;  3RUM A;  1QGX A;  4NAP A;  1RKM A;  5ET6 A;  4KR5 A;  1VR5 A;  2F8D A;  4QHQ A;  2F3B A;  4BDO A;  2Y5L A;  2OWT A;  4H46 A;  3ECR A;  3H6V A;  4H5G A;  3G3K A;  4DIG A;  1MH3 A;  3CVG A;  1A40 A;  3BBR A;  2QRY A;  1NNK A;  1Y1M A;  4NF5 B;  3M3L A;  2GHB A;  3M3F A;  2XXK A;  3IO6 A;  5H8S A;  3FAS A;  2FBP A;  2H98 A;  3JV9 A;  3RT8 A;  4N6K A;  5K2Y A;  1GR2 A;  2Y7W A;  4IB2 A;  5J16 A;  5CRY A;  1LAG E;  2H4I A;  4GWZ A;  2GH9 A;  3TTM A;  2DWA A;  3S9M C;  4QFP A;  2ZXT A;  3I3V A;  1DOT A;  4G68 C;  1Y20 A;  2O68 A;  1DBZ A;  4TLL B;  2ONS A;  4N4U A;  3VDF A;  1DK4 A;  1SW1 A;  1MRP A;  2CZK A;  3KEI A;  3O6G A;  2MKZ A;  1ELJ A;  4KCD A;  3Q27 A;  3CFZ A;  2R8T A;  2Y7R A;  2DP8 A;  3TEL A; 
#chains in the Genus database with same CATH homology
 4ESX A;  4KFQ A;  3EQ1 A;  2IA4 A;  5ITO A;  1Y9U A;  3FAT A;  3RQT A;  4F18 A;  1NNF A;  4NF5 A;  3TCH A;  1H45 A;  4ZE9 A;  5I59 A;  2OCU A;  2X7P A;  4L17 A;  3DEL B;  4YKJ A;  4ZZA A;  1B3E A;  4C1U A;  3KOS A;  3FGS A;  4LP2 B;  3B6W A;  1CE2 A;  4OER A;  1NKX A;  1YTV A;  2B65 A;  2VP1 A;  2XXV A;  3SEW A;  1Z7M E;  1T0K A;  4R72 A;  1OVB A;  3C32 A;  2I0C A;  2XX7 A;  3CG1 A;  4IO5 A;  5DYH A;  2ZYN A;  2VOZ A;  3OEM A;  4KI0 E;  5AA4 A;  3LSF B;  3G7W A;  4PE5 B;  3K6X A;  2PX1 A;  5I58 A;  1MPD A;  1N04 A;  4K3F A;  3RGY A;  3E9X A;  3T9V A;  1VFD A;  3KFM A;  3KJ7 A;  4R73 A;  4YKP A;  5I56 B;  3L6G A;  2E1S A;  1B46 A;  3FJG A;  4OHN A;  2I3W A;  4G77 A;  1BKA A;  1PB9 A;  3FV1 A;  4OYV A;  1S50 A;  2AL4 A;  1MXZ A;  1R6Z A;  1WDN A;  3IB1 A;  3UGW A;  3V89 B;  3OO7 A;  5KCJ A;  2QS2 A;  5HPQ A;  1MQG A;  2GFE A;  2REG A;  4GL8 A;  1B2H A;  3QUF A;  1OLC A;  2V25 A;  3O66 A;  3Q28 A;  4ONY A;  3KN8 A;  1FW0 A;  3KSX A;  1P1N A;  3LR1 A;  4LZ7 A;  2PVU A;  5CM6 A;  1B40 A;  3UN6 A;  1IIT A;  1PB8 A;  1POT A;  2O6A A;  3KN7 A;  1SW4 A;  4KYS A;  1VSO A;  4XIG Q;  3BKI B;  3KN3 A;  2OJT A;  3IL1 B;  3O6I A;  1B0H A;  1B3F A;  5TPA B;  3UA8 A;  5CBS A;  1R9L A;  2V3U A;  2I4C A;  3GZG A;  4R9F A;  4RA1 A;  2PBW A;  2Q9T A;  4PFY A;  2AYS A;  2ABH A;  2GHA A;  1SW2 A;  2PYY A;  3FV2 A;  3E4R A;  3S9N C;  1PBP A;  2R6G E;  2V3Q A;  4HS7 A;  1TFD A;  3R26 A;  1MXU A;  3I6V A;  5EHM A;  5FTH A;  5F7V A;  2HCA A;  4NTL A;  1B7U A;  4U1Z A;  2O51 A;  3VLW A;  1TT1 A;  2Q88 A;  2XXX A;  5TPA A;  1URD A;  4NF4 B;  2ZMB A;  4I8C A;  1LGB C;  1MY1 A;  2XD2 A;  3GBB A;  1DPE A;  4LVQ A;  3Q26 A;  4NF6 B;  2QMW A;  2H9B A;  4UAC A;  3KSJ A;  4F3S A;  3IOV A;  1B7Z A;  2PMS A;  3SDF A;  3OMB A;  1POY 1;  4GWO A;  4MLQ A;  3TCF A;  4G8M A;  1B3L A;  2NOO A;  4G8N A;  4ZEI A;  3MC2 A;  5FHN A;  1B7H A;  1DTZ A;  1B5I A;  2F36 A;  4Q0C A;  2ONK E;  3CI8 A;  3FVK A;  2A5S A;  4QF9 A;  1QJM A;  1DTG A;  1YAE A;  2G29 A;  2PT1 A;  5H8Q A;  3T96 B;  3A3C A;  3C9H A;  4TLM B;  3OD7 A;  1UQW A;  4KHZ E;  4IO6 A;  3RN8 A;  1ZMG A;  4EF1 A;  1EH3 A;  3KZG A;  5I84 A;  2YLN A;  3MBP A;  5DVJ A;  2AIX A;  4WXJ A;  5CMM A;  4JBZ A;  3LC8 A;  3DP4 A;  5ICQ A;  1N3W A;  1URG A;  4RK9 A;  1MXV A;  3H3G A;  2FYI A;  3EPE A;  2Z8F A;  4GLI A;  3S9L C;  2Z23 A;  3KJT A;  3HHG A;  4KD5 A;  1MM7 A;  4FE8 A;  2HZK A;  2AL5 A;  3CSG A;  3MZ1 A;  3MVY A;  4EQB A;  5IKB A;  1P1Q A;  1MQI A;  5FHO A;  3S2V A;  1BIY A;  3E3K A;  1SI1 A;  3D4C A;  1MQJ A;  4YB7 A;  2DS9 A;  2F7B A;  4NMY A;  3CSB A;  2P0S A;  2W7Y A;  5I2K B;  3GLB A;  3R7X A;  3ONM A;  1IUD A;  5F1Q A;  1B4Z A;  3E13 X;  2QS4 A;  4F19 A;  2REJ A;  5EYF A;  2H5Y A;  2RCA A;  4G4P A;  2QMX A;  4LA9 A;  3EHU A;  1IQ7 A;  2VD2 A;  3PPO A;  3ODB A;  5I57 A;  3TTR A;  3VVF A;  1VE4 A;  1Q35 A;  2RC7 A;  1LBC A;  4OXV A;  3O9P A;  3PGF A;  4DE8 A;  4RJZ A;  4ZED A;  5I2K A;  1JEU A;  4KPT A;  3QK6 A;  3TTK A;  1OQG A;  2HFB A;  1MY0 A;  1FCK A;  1RYX A;  2CZL A;  3P7I A;  4IY6 A;  4JSO A;  3K1P A;  1YCJ A;  1AL3 A;  1NMU A;  5LOM A;  1IXG A;  1EZO A;  1AMF A;  2B3F A;  1UIU A;  2DQV A;  3KOT A;  3MQ9 A;  5JTY B;  2Q2A A;  3A3U A;  3H03 A;  3ZS6 A;  4XKQ A;  2O1L A;  3VLU A;  3VVD A;  1HSL A;  3IAZ A;  3W15 C;  3VVE A;  1A55 A;  4Q8R A;  1LFI A;  2I48 A;  4G68 A;  4OMB A;  1B58 A;  1AH5 A;  2NVU B;  3VXB A;  4Q5T A;  4FOR A;  1N3X A;  5AA4 B;  4XKN A;  3HV1 A;  3CRB A;  1KWH A;  2Z8D A;  4ZEC A;  2B3B A;  5A5X A;  1GGG A;  4OTE A;  4YB5 A;  1XVY A;  1FQF A;  3EN3 A;  3IJX B;  4ZS9 A;  4DXU A;  1MXW A;  1SVX B;  4R6H A;  2I58 A;  3TMG A;  2DSF A;  1S9T A;  3F11 A;  4U22 A;  4JSD A;  3KBR A;  5M2V A;  3K0V A;  1LAH E;  2DOJ A;  4IY5 A;  5KCJ B;  4EQ9 A;  4KYD A;  3PPQ A;  2XHD A;  1ZLQ A;  5HBC A;  4XTC Q;  1IXC A;  1B51 A;  1I6Q A;  1SQY A;  2F5X A;  3JZJ A;  2F6P A;  3K02 A;  4GD5 A;  2UVG A;  4R75 A;  1TFA A;  4ZZE A;  1P1W A;  3SET A;  1UIV A;  4LZ5 A;  3PMV A;  3FJ7 A;  4RK2 A;  1I69 A;  1NH8 A;  1Y3P A;  2F35 A;  3LBS A;  3O97 A;  4GFR A;  4LQ5 A;  4PET A;  5TU0 A;  4RPO A;  4BDR A;  2XXU A;  5KDT A;  2QPQ A;  2V93 A;  5FHM A;  2F7C A;  1II5 A;  2O7I A;  2RC8 A;  4NF8 A;  1LAX A;  3A09 A;  1Y3Q A;  3VE1 B;  3SKP A;  3G3I A;  4JWO A;  4NWD A;  1FTM A;  2HAV A;  2LAO A;  4EXK A;  2DXY A;  1Y1Z A;  2RKM A;  4KQP A;  2HZL A;  1BTJ A;  1I6A A;  4O3C A;  3OSR A;  2ALU A;  1M5C A;  4GOT A;  1MH4 A;  2R9J A;  4M4G A;  4Z0I A;  1MXX A;  3CIJ A;  3TYH A;  3I5O A;  1XHY A;  5B70 A;  4AB6 A;  1H3D A;  4F1Y A;  3N5L A;  3OSQ A;  3V83 A;  5I57 B;  3IJO B;  4EDP A;  1QUL A;  5CMC A;  1XT8 A;  4KCC A;  4ELO A;  2H25 A;  1QUI A;  4U4X A;  4Q30 B;  2E0S A;  1USY H;  4O3A A;  3FVG A;  3SEX A;  4F29 A;  4RYA A;  1B5J A;  3FD3 A;  4OEN A;  3IOR A;  4P0I A;  4U2R A;  3WAE A;  2XXQ A;  3OO8 A;  2ZYO A;  3MVX A;  1XC1 A;  1YPN A;  2Q2C A;  3MVW A;  1B1X A;  4JWY A;  4NWC A;  4QFO A;  3G3G A;  3THI A;  5L9O A;  3W9W A;  1JW4 A;  1Q1K A;  3MP1 A;  3R6U A;  4GF8 A;  1L5T A;  3WAF A;  4DCX A;  3QAX A;  4YMA A;  2DWI A;  2FA7 A;  5JTY A;  4F3G A;  4JDF A;  1WVJ A;  3K01 A;  3MP6 A;  3H7M A;  4TOZ A;  1SI0 A;  2YPN A;  1FQC A;  3D4G A;  1FTL A;  4G8H A;  4E0X A;  1OIB A;  1TXF A;  1EU8 A;  1O64 A;  3OOA A;  3OXN A;  3Q25 A;  3UIF A;  3LSW A;  4AB5 A;  2I3V A;  5H8F A;  3KGC A;  1LFH A;  1ZU0 A;  3TKD A;  1ZJL A;  1LB8 A;  1RYO A;  3FVN A;  4U21 A;  1JW1 A;  2O84 X;  2Z8E A;  1NNT A;  2O1M A;  2XXP A;  3K6W A;  3V5A A;  1Y4T A;  1B1H A;  2QL3 A;  2DWH A;  4FEC A;  5CMB A;  3FUZ A;  2DE3 A;  2F97 A;  4LZ8 A;  4RY1 A;  1IXH A;  1P99 A;  4ISU A;  4FAJ A;  5TP9 B;  4X1D A;  4LON B;  1JNF A;  3IOT A;  1JVY A;  2UXA A;  3K00 A;  3PD9 A;  2DE4 A;  4PP0 A;  4ZEF A;  3VFJ A;  3FVO A;  2D3I A;  1NNP A;  4IO2 A;  4BDQ A;  4F39 A;  1P1O A;  3K6U A;  4OVJ A;  2OZZ A;  4H67 A;  5H8N B;  4DZ1 A;  3BFT A;  1H43 A;  1IZ1 A;  4FIM A;  4JWX A;  4OWD A;  4F1V A;  4EF2 A;  1PDA A;  4N6P A;  4C1T A;  1B3G A;  2ZYK A;  4LAT A;  4R74 A;  4H65 A;  3ZKK A;  2DXR A;  4RXL A;  4UA8 A;  3PPN A;  2HAU A;  4P0G A;  3EHS A;  3PPP A;  3TQW A;  4ESW A;  4F2O A;  4I9D A;  1SBP A;  2XXH A;  5KZT A;  4RNS A;  2XXI A;  2F6G A;  2XD3 A;  5H8F B;  4OET A;  3QXM A;  1VFE A;  1FQB A;  2Y7K A;  3SES A;  3QUJ A;  1A54 A;  4MLV A;  2H99 A;  1EZP A;  3FZV A;  3H6W A;  3GBA A;  4Z7E A;  5ITP A;  2QS1 A;  1QKA A;  3C36 A;  4F3P A;  3RTW B;  1M5E A;  2QSX A;  1AIV A;  1LB9 A;  1MS7 A;  1PEB A;  1ZIU A;  3IK6 B;  3H4Z A;  4EQ7 A;  5AA2 D;  4KYE A;  5AA3 A;  1B4H A;  2DYX A;  4HTG A;  5I59 B;  1GV8 A;  2RF1 A;  4JXI A;  3FJM A;  5H8N A;  3HN0 A;  4XKP A;  2RC9 A;  4DDD A;  2HEU A;  3OO9 A;  4FED A;  1ATG A;  4OEV A;  1O63 A;  3B6T A;  5DVI A;  3KG2 A;  4QSC A;  1P1U A;  2DVC A;  4THI A;  1D3K A;  3N94 A;  4YZZ A;  3O28 A;  4NE4 A;  4QSD A;  1NL5 A;  3B6Q A;  4H5F A;  1FQD A;  1URS A;  4QFN A;  3G3J A;  4XXU A;  1JQF A;  5AA1 A;  1SYH A;  3U1O A;  2NXO A;  4BDM A;  3MUQ A;  2XX9 A;  3MZ9 A;  2XXR A;  1DPP A;  3V8X B;  2I6E A;  2OK2 A;  2ZNT A;  2ONR A;  2P1S A;  4IGT A;  3DLN A;  4JB7 A;  3RLF E;  3SEY A;  3W9V A;  3O2A A;  3SER A;  3K2D A;  3C4M A;  2QJE A;  4NF8 B;  4DXB A;  1XVX A;  4ND9 A;  2F34 A;  1PBQ A;  2OLB A;  3PMX A;  3C31 A;  4ZEB A;  4OFO A;  3K4U A;  1LST A;  3K6V A;  3MWB A;  4NED A;  3S4U A;  3T9H B;  3MVZ A;  2I4B A;  2XXT A;  4MH5 A;  1Y3N A;  4ZEK A;  3ILU B;  3LUY A;  4N07 A;  1UTB A;  3FIR A;  1M5D A;  3PMW A;  4YIC A;  4ELQ A;  4G2Z A;  1S7Y A;  5H8H B;  4LQ2 A;  1XS5 A;  4PFW A;  1DSN A;  4FJP A;  3CFL A;  4IO3 A;  4X48 A;  5K2X A;  4OEU A;  5AE4 A;  5TP9 A;  2VD3 A;  5I56 A;  3MAM A;  3SEV A;  3EHT A;  4DCY A;  1A8F A;  1B9J A;  1FTJ A;  3MZB A;  1MY4 A;  1UTB B;  2DVZ A;  3O29 A;  4GXS B;  2HQ0 A;  3RTF B;  3TOD A;  3VLV A;  5A5X B;  1US4 A;  2Q8J A;  1Y4C A;  1FQA A;  1MPC A;  1NFT A;  3HO7 A;  4POX A;  3M3K A;  3U8Q A;  5BWJ A;  3LSX A;  5DTB A;  5J1D A;  2XXW A;  1MQH A;  3PUW E;  1TWY A;  1MXY A;  2D5W A;  2A5T B;  4I1D A;  4XKR A;  1IIW A;  2ANJ A;  1A7L A;  5HM4 B;  4F31 B;  3LSL A;  1N0T A;  1SDX A;  4F2Q A;  4ELP A;  1N84 A;  2WKY A;  3IOW A;  3UK4 A;  1O7T A;  1BLF A;  3H6T A;  3T93 B;  2DWJ A;  3OEN A;  5KDT B;  4H6D A;  5BUU A;  1CB6 A;  4QFK A;  1USY E;  3K1N A;  3TTN A;  1QKB A;  1FQE A;  4IO7 A;  2X26 A;  1QVS A;  3HST A;  3MP8 A;  3ILT B;  3MW0 A;  3PPR A;  1EZ9 A;  1A8E A;  5EHS A;  2UVI A;  1FTO A;  3ZSF A;  3T9X B;  3VXC A;  4BDN A;  1B05 A;  2V3T A;  3IX1 A;  1LCF A;  4GIZ A;  2Q89 A;  4P11 A;  4U1O A;  3TUS A;  4U23 A;  3TFL A;  1H44 A;  1ANF A;  4GL0 A;  1B0L A;  4N13 A;  2F7A A;  2UVJ A;  4GRK A;  5AA2 A;  4NF6 A;  1MG1 A;  1US5 A;  3C34 A;  4HCW A;  4E0W A;  1D9Y A;  1R9Q A;  1UTH B;  3MPK A;  4BLA A;  1JW5 A;  5CBR A;  2Y84 A;  3TAJ A;  1JVX A;  1OVT A;  3BFU A;  4WKM A;  1GVC A;  4GXA A;  2M8C A;  3G3F A;  1J1N A;  3G3H A;  2O7U A;  4QSE A;  3IB2 A;  2RCB A;  4F22 A;  5L8D A;  2UYF A;  3RPW A;  3QIM A;  4H8I A;  4C0R A;  5I2N A;  1OLA A;  3S9E A;  4MBP A;  2Z22 A;  3FXR A;  2R71 A;  1XOC A;  2BJJ X;  2GRV A;  2V84 A;  3N6U A;  2OWS A;  2THI A;  2VGQ A;  4YKI A;  5L9M A;  2ZNU A;  5JK4 A;  2YJP A;  4QRZ A;  5DT6 A;  2IEE A;  1FTK A;  3U94 A;  1LCT A;  1PC3 A;  3TEP A;  3O6H A;  3TQL A;  1ZKB A;  3DP8 A;  3U92 A;  5AA2 B;  2PT2 A;  5FTI A;  3HHF A;  4GQO A;  4YB6 A;  5CI5 A;  3TZA A;  4YKK A;  4HW8 A;  1B52 A;  4H1X A;  3RUM A;  1PB7 A;  3B7D A;  4O3B A;  4AQ4 A;  1N76 A;  1RKM A;  3DP6 A;  1SYI A;  4KR5 A;  3U93 A;  3T9U A;  1VR5 A;  1ZTY A;  1D9V A;  3EF7 A;  3TCG A;  4RPN A;  2F8D A;  4QHQ A;  3TPA A;  3C35 A;  3ZKL A;  3IR1 A;  2ZNS A;  1MY3 A;  3CFX A;  4BDO A;  3TDJ A;  4G68 B;  3AXF A;  2D21 A;  2OWT A;  4POW A;  1MDQ A;  2UYE A;  2UVH A;  3ECR A;  3H6V A;  4H5G A;  1F9B A;  4IO4 A;  5DEX B;  1M5B A;  3PUZ E;  3G3K A;  4R2B A;  3IOU A;  1LAF E;  4WED A;  4YU0 A;  1JET A;  3MPL A;  5ISU A;  3PUY E;  4DIG A;  1MH3 A;  4H8J A;  3CVG A;  1A40 A;  2DE2 A;  3BBR A;  2QRY A;  1I6B A;  4X1B A;  5B7D A;  1HSE A;  1HSJ A;  1NNK A;  1WOD A;  1Y1M A;  2XXY A;  4IGR A;  4TQU Q;  1GTK A;  4NF5 B;  4BDL A;  1A99 A;  1AOV A;  3M3L A;  2GHB A;  5H8H A;  2X7Q A;  3FXU A;  1OQH A;  3M3F A;  3SEU A;  1N7W A;  5DEX A;  3C33 A;  4FEB A;  5IAI A;  4LUB A;  5ELV A;  2Y7I A;  3IO6 A;  3CR9 A;  5H8S A;  3CG3 A;  2RIN A;  3FAS A;  4GVO A;  1B32 A;  2KLF A;  4I62 A;  3K1M A;  2H98 A;  4PQJ A;  3U72 A;  4ECF A;  3M8U A;  4NF4 A;  3JV9 A;  3RT8 A;  1MQD A;  3IB0 A;  3N6T A;  1DMB A;  1IXI A;  1M5F A;  1MPB A;  3OO6 A;  2ESN A;  3QYT A;  4MFI A;  5K2Y A;  1GR2 A;  3TTL A;  3VV5 A;  1JEV A;  1ZBM A;  4DXC A;  2Y7W A;  3IO4 A;  2VHA A;  3GXA A;  4IB2 A;  4OQO A;  4X9T A;  1Z7N E;  4F1U A;  2I49 A;  5CRY A;  3T22 A;  4H0W A;  1LAG E;  1MM6 A;  2G93 A;  2A5T A;  4QFL A;  5I2N B;  2QS3 A;  1IEJ A;  2H4I A;  3RY3 A;  1BP5 A;  2ZYM A;  3RT6 B;  1QW0 A;  1B6H A;  2GH9 A;  4MF3 A;  1N7X A;  4YMB A;  2Y7P A;  2FNC A;  5H8Q B;  3TTM A;  4EXL A;  3JYR A;  5CMK A;  3OEL A;  4R6K A;  2DWA A;  3S9M C;  1NH7 A;  3H6U A;  4QFP A;  3USD A;  2ZXT A;  3DM0 A;  3I3V A;  1B3H A;  3PUX E;  1DOT A;  3FXQ A;  1LLS A;  4M1V A;  4G68 C;  4R2F A;  5L9S A;  2NUV A;  2XX8 A;  1Y20 A;  2O68 A;  4HCY A;  4OFL A;  4DLD A;  1SD3 A;  3HCQ A;  3HPI A;  3PV0 E;  1MY2 A;  4TLL B;  5JEI A;  2ONS A;  4YAH X;  2OBG A;  5ICT A;  4R6Y A;  1H76 A;  4OZ9 A;  2NWJ A;  3PU5 A;  1LBB A;  3UOR A;  3QSL A;  3VDF A;  5DVF A;  1SW1 A;  3MJN A;  1MRP A;  3L6H A;  3PUV E;  3UP9 A;  4U4S A;  4EUO A;  1D4N A;  4WEP A;  2I0B A;  5CC2 A;  1OMP A;  2P2A A;  4OFJ A;  4ZE8 A;  4FAT A;  3KEI A;  3O6G A;  3Q29 A;  3PD8 A;  3RNN A;  1SW5 A;  3T66 A;  4F3B A;  3OEK A;  3H06 B;  2O69 A;  1ELJ A;  1UTH A;  1MDP 1;  4KCD A;  4ELR A;  5I58 B;  3Q27 A;  1R1N A;  1LFG A;  1QUJ A;  2CMO A;  3CFZ A;  2Y7R A;  2F78 A;  4ZDM A;  4R9G A;  2DP8 A;  3TEL A;  3N26 A;  1B5H A;  2HXW A;  4PFT A;  4OES A;  1QUK A;  4PFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...