4R9GA

Cpmnbp1 with mannotriose bound
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
401
structure length
394
Chain Sequence
QVVLTLWYPWAGPDGDAVVSLAKEYSKTHPNVQIKAQMVSGAGIAAKFLSAVAAGNPPDLVLYWGQDALPGLADQGAIIPLDDYLKDVDTSKFFEAAYNAMKYKGKIYGLPEMVNVRVLFWNKDLFKQAGLDPNTPPKTIAELDQMAAKLTKTKNGTIEQMGFIPWIGQGVPHVMAGVFGTSLVDSNGNPILSPDKNPQLLNLLKWEVSYSDKYGAMNINKFIAGMSQNSSQANDPFVLGKVAMMISGEWQINANKQYNPKLNFGVGPIPQAPGGKPMPSLMDGNTWMIPKGSKHPQEAMDFIKWTMDPQRIADTADKVYNIAPIVEAAKIQKLNNDPYFKEVLNVAQKGSIYYTPAAKGMLSTETAANNAFQAAQYKKSTPEQALKNAQAEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords MBP1
publication title Structural and Biochemical Basis for Mannan Utilization by Caldanaerobius polysaccharolyticus Strain ATCC BAA-17.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
total genus 126
structure length 394
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r9gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r9gA01
3OENA 4X1DA 2DWIA 4TLLB 4YZZA 2IEEA 1PB9A 1NH8A 1IXHA 2QRYA 3PU5A 4F1UA 1SDXA 4PFTA 3QSLA 1B3LA 4LUBA 4IGRA 1DPEA 1B51A 3IAZA 5I57B 4I62A 5I58B 3K02A 3FASA 1B32A 1BP5A 3K6UA 1UIVA 3HPIA 1GTKA 3PUWE 3USDA 4PETA 3PUZE 4MBPA 3EPEA 4ESWA 3FUZA 2V3UA 3S9LC 4DLDA 5CC2A 1QKBA 2Q8JA 1MXUA 3MZ1A 1O64A 3V8XB 3K00A 3CIJA 5DEXA 5F7VA 1LAHE 3FV1A 1XS5A 3DP8A 5H8FB 3KGCA 1BKAA 1ZTYA 3TAJA 5ELVA 1A55A 4JSDA 3S2VA 3LC8A 3U92A 1I6QA 2XXVA 2E0SA 1FTMA 3MAMA 2XXTA 1Y3PA 5TP9A 4H6DA 3KZGA 4UACA 4XKQA 3EHUA 1LGBC 3I3VA 3OD7A 3ODBA 2CZLA 1FW0A 1SW4A 2PVUA 1USYE 3A09A 4TQUQ 3VE1B 3C35A 1LAXA 5KDTB 1NNKA 4PP0A 4LVQA 1R6ZA 1LLSA 3OOAA 4R75A 1R1NA 1DTGA 2ZNTA 1WDNA 5AA4B 3A3UA 2OCUA 2YLNA 4F19A 3FVOA 1DSNA 4ZEKA 3FIRA 3MP8A 4BDLA 4LONB 1Y4CA 4ZE8A 3N94A 4X48A 4UA8A 3ILUB 1SD3A 4Z7EA 1RYXA 3H6WA 4NF6B 3HO7A 5CRYA 3B6WA 4NTLA 4G68C 3OO8A 2VGQA 2D3IA 1XVYA 2F78A 4R6YA 1JW1A 3SETA 1WVJA 4QRZA 5H8QB 1D9YA 4E0XA 3CSBA 2F8DA 4F39A 3FZVA 4BLAA 3MZ9A 2OWTA 1SI0A 1JVXA 3KSJA 5L9OA 4ESXA 4JBZA 4R6KA 4IO3A 4JSOA 5I2KB 2Y7PA 3HHGA 3G3FA 5ICQA 3HHFA 2ZYOA 4JWOA 4LATA 1ZBMA 4GF8A 1B1HA 2D5WA 4DXBA 3O66A 3CG1A 4FJPA 5AA2A 5AA3A 1P1NA 3T93B 2O7UA 3PUVE 1MG1A 3K1MA 1B5HA 3FGSA 3MW0A 4U2RA 2O68A 5JEIA 2GFEA 4GXAA 4Z0IA 5DVFA 2B65A 5DT6A 2Y7RA 3O6GA 4GLIA 4NF5A 1B7HA 3T66A 2Z23A 2I4BA 3ZKKA 3IOTA 1B3GA 4EQBA 3K01A 1VFEA 2Q2AA 4IO7A 3O9PA 1IXCA 1Y4TA 2NUVA 5I84A 1N84A 4F3SA 2HQ0A 2O1LA 3M8UA 5CBSA 1B3FA 3OMBA 1FQEA 5CMMA 2THIA 3QK6A 3U72A 4R2BA 3G3HA 3C9HA 3ZKLA 5I56A 5HBCA 1GV8A 3FXRA 2XD2A 2RKMA 1N3XA 1JVYA 3UA8A 2F7BA 3IO4A 2X7PA 4ND9A 1NMUA 2XXIA 4U23A 1QKAA 1FTOA 2ONRA 1UTHA 3VDFA 1A7LA 3GBBA 3R26A 3PMXA 3FJMA 3TZAA 4O3BA 5CM6A 5J1DA 3I5OA 4GFRA 2OLBA 3N6UA 5EYFA 1TT1A 3MVZA 4WEPA 3H6VA 4LZ7A 5JK4A 2HAUA 2QL3A 3W9WA 5I2NB 1TFDA 3I6VA 4EF2A 4RA1A 2I3WA 1AOVA 4I8CA 2DWAA 4BDQA 3TCGA 1MPCA 2OK2A 3UN6A 1I6BA 4X9TA 2W7YA 3BFUA 1FCKA 4JXIA 2P1SA 4HS7A 4E0WA 3CFXA 3DELB 4YKIA 2X7QA 2F5XA 2DWJA 3O6IA 4OVJA 3VLWA 1O7TA 3TTLA 2AYSA 4XKRA 3KOTA 2XXRA 4ONYA 4OXVA 1VR5A 4TOZA 2O6AA 1N04A 3O97A 3HCQA 3GXAA 5CMKA 1BIYA 1NFTA 2NWJA 1ELJA 1MDQA 2DS9A 4DE8A 4F3GA 3ONMA 4ZEFA 3SESA 1FQCA 1EZPA 4KCDA 3PPRA 1N7XA 1B9JA 4QFPA 4KFQA 1B1XA 5M2VA 3MUQA 4LQ2A 4OZ9A 3RQTA 3OEMA 3TKDA 3Q27A 3KOSA 3N5LA 1EZOA 2O51A 1T0KA 1LCTA 1MXZA 4QHQA 5K2XA 1Y3QA 5DVIA 1TXFA 1DPPA 1MY2A 3H03A 3IOUA 1MXVA 4GL0A 4HW8A 3RTFB 4YB6A 3FJ7A 1VFDA 1DOTA 1PC3A 2QJEA 4YB5A 5DYHA 4EUOA 3MBPA 2HZKA 3IB2A 4FEBA 1OQHA 4G68A 3IJXB 1O63A 3V5AA 4F3PA 3DP4A 1MY0A 5B7DA 3TFLA 4AB5A 3A3CA 3RLFE 3H4ZA 3OSRA 1II5A 1ANFA 4DIGA 4DZ1A 5HM4B 4BDOA 4H8IA 2I4CA 4YKPA 3N6TA 2AIXA 4NEDA 2GRVA 1POY1 4ZEIA 4R9GA 1B05A 3RUMA 2P2AA 3RTWB 3CRBA 3PPNA 4QF9A 1B5JA 4YKKA 4RPOA 4FAJA 4Q0CA 1MPBA 5IAIA 3IK6B 5TPAB 2NOOA 3TEPA 2XXXA 1OLCA 4KI0E 2XXQA 3BBRA 2PYYA 1TFAA 2V25A 3TCFA 2VD2A 4KCCA 4PQJA 1OLAA 4ZZAA 2LAOA 3PGFA 4QFNA 4XKPA 3S9NC 5I56B 1HSEA 4FEDA 4POXA 4OHNA 2BJJX 4O3AA 4EDPA 2G93A 3U1OA 4ELPA 2X26A 3FD3A 1XT8A 5H8NA 1UTHB 3OO6A 4H5FA 2XXWA 3TUSA 3H6UA 1L5TA 5F1QA 1US4A 2I58A 5A5XA 5CMCA 5I59A 2NVUB 2PX1A 1MM6A 2V3TA 1Q1KA 3K2DA 1B0HA 4IY5A 3VVDA 4YMBA 3TTKA 1B58A 1S7YA 3EHTA 4YAHX 3SKPA 1MXXA 1FQAA 3U8QA 2NXOA 1ZJLA 4U4XA 3R6UA 4H67A 3KBRA 1B7ZA 4R74A 2ZNSA 1R9QA 3V83A 1MXYA 3LSLA 1FTJA 2O7IA 1ATGA 4GRKA 1AMFA 1JW4A 1ZU0A 1FTKA 2OBGA 3T9VA 2XD3A 4JWYA 3RY3A 4EQ7A 1MRPA 2AL4A 4IO2A 3EN3A 1XC1A 5AA2D 4R9FA 4F1VA 3IR1A 4OENA 1AIVA 3K0VA 4M1VA 1MQJA 1HSLA 4U1OA 3JV9A 3S9MC 5JTYA 1UTBA 4OTEA 1AL3A 1H76A 2UYEA 2QMXA 1S9TA 1QW0A 5ICTA 4ECFA 1H3DA 1OVBA 1IUDA 3MVXA 3TTNA 3H6TA 1IXIA 2V84A 1DMBA 4NWCA 3TTMA 1F9BA 3O2AA 2QPQA 3FVKA 4G2ZA 2I6EA 3MJNA 1LFIA 4BDMA 2H25A 2OWSA 1YPNA 4DCYA 1FTLA 5IKBA 2O69A 4PE5B 2XX9A 1MY3A 2R9JA 1M5FA 3H06B 1WODA 2DE3A 3T96B 4G68B 4Q5TA 3TPAA 3OEKA 3C33A 4H5GA 3ZS6A 1N0TA 1AH5A 1P1WA 1H44A 2DP8A 1A8FA 1P1QA 4OMBA 2RCAA 4OFOA 4FE8A 2CMOA 2HCAA 2VOZA 2QS4A 2REJA 4G8NA 4ELOA 2UYFA 4LZ8A 4OFJA 4ZDMA 3OXNA 2ONSA 2I49A 4GVOA 1M5DA 3VXCA 5HPQA 1JEUA 2ZYKA 2VD3A 1URSA 3PD8A 3PV0E 3M3KA 3FXUA 3T22A 5L9MA 1P1OA 3KJTA 2H99A 3R7XA 5FTIA 4F22A 1QVSA 3TCHA 2XXYA 1B7UA 3PMVA 4GWOA 1B40A 4RK2A 5B70A 4IO5A 5H8NB 1Y1ZA 2RINA 2ZXTA 5KZTA 1B2HA 1NNTA 1LBCA 1MY4A 2F35A 5DEXB 1URGA 2E1SA 1SI1A 4H0WA 4RNSA 5A5XB 4OERA 4GQOA 3RN8A 3MP1A 4OFLA 1D3KA 1QJMA 4FORA 1SW5A 2DXYA 2DSFA 1GR2A 1Z7NE 3W15C 2HEUA 3PPQA 3MVWA 1QUIA 5TP9B 5AE4A 1BLFA 3KEIA 2DVZA 3RPWA 3THIA 3M3FA 4OYVA 4F1YA 3B7DA 1YCJA 1P1UA 4OEVA 2YPNA 2Y7WA 1H45A 2OZZA 1BTJA 3G7WA 3G3GA 4DXUA 1B0LA 3UIFA 1CE2A 2RF1A 3C36A 3MPKA 5DVJA 4K3FA 1ZLQA 4H8JA 1XHYA 1JW5A 2XXPA 4RPNA 2Q9TA 2AL5A 4QFLA 2I0CA 3S4UA 3DM0A 3VFJA 4NE4A 4HCWA 1LCFA 4TLMB 1NH7A 4FIMA 4OETA 3TODA 3VLVA 3MQ9A 3ILTB 1MY1A 3LSFB 2G29A 1NKXA 1UTBB 5H8HA 2VHAA 1SVXB 3U94A 4XXUA 3PMWA 4GOTA 3U93A 2HZLA 4NF8A 1XOCA 2HAVA 3TELA 3K6XA 1IXGA 1SW1A 1FQDA 4GD5A 1PBPA 1OIBA 1S50A 1B3EA 2V3QA 1N7WA 2V93A 3B6QA 1RKMA 1LAGE 3CSGA 1MPDA 4U21A 4YKJA 3T9UA 3IO6A 1XVXA 1FQBA 4U22A 3BFTA 3IOVA 1CB6A 2UVJA 3FJGA 3EHSA 2RCBA 3OELA 3G3IA 1I6AA 3O6HA 3MZBA 4QSCA 3GLBA 5I2KA 5AA2B 3IOWA 1N76A 1PB7A 1MH4A 5L9SA 4R72A 1SBPA 3C4MA 2WKYA 3K4UA 4N07A 1B4HA 4HCYA 4EF1A 2DXRA 3E13X 4MH5A 4Q30B 4IO4A 2XXUA 3JYRA 5KCJA 4N6PA 4G8HA 3UGWA 4F2QA 1J1NA 2ZMBA 4N13A 2UVGA 4C1UA 1MQIA 4EXLA 2UVIA 5BWJA 3VLUA 4NF5B 1IIWA 2DE4A 1MH3A 3C32A 3C34A 1ZMGA 4I1DA 1A40A 1Q35A 2DE2A 1MDP1 2XHDA 2Q88A 2Z8DA 3UP9A 4YB7A 4GL8A 3TDJA 1PB8A 3H3GA 2H98A 1SYHA 1US5A 2F7AA 3Q29A 4G77A 4OWDA 5FHMA 3IL1B 4KYEA 5CBRA 2QMWA 3CVGA 3HSTA 1YTVA 5DTBA 3HV1A 4WXJA 4ZECA 5LOMA 1VE4A 3UORA 2R71A 1ZKBA 4F18A 4POWA 2GHBA 2F6GA 4OEUA 3TQLA 1M5BA 3MPLA 3SEVA 3DP6A 4MLVA 2Q89A 1LB8A 2IA4A 3CFLA 4C1TA 1FQFA 4Q8RA 5FHOA 5ITPA 1POTA 1QUKA 5TU0A 3QYTA 3MWBA 3IX1A 3G3JA 4LP2B 3E3KA 4ZZEA 1Y1MA 5ISUA 5I2NA 1D9VA 5FHNA 1MS7A 3G3KA 4P0GA 2D21A 2H9BA 4PFUA 2UXAA 3QIMA 3LBSA 4IB2A 3GZGA 4ELQA 1HSJA 4BDRA 2QSXA 1MQGA 4XKNA 3DLNA 4DXCA 4IO6A 3RT8A 3P7IA 1DTZA 4P11A 4QFOA 1B46A 2A5TA 3L6HA 2REGA 3CFZA 3T9XB 2P0SA 5FTHA 3QAXA 2F34A 4KYSA 2YJPA 1JEVA 3CG3A 4F3BA 2H5YA 4BDNA 5H8HB 4GXSB 4OESA 5ITOA 4C0RA 3TTRA 4FECA 3S9EA 3D4CA 3LUYA 1B52A 3IB1A 4NF8B 2I3VA 4KQPA 4ZE9A 4YICA 4AB6A 4PFWA 1EU8A 3KN3A 1Y3NA 2PMSA 3Q26A 2DQVA 4NF4A 3FATA 4YMAA 4DCXA 1NL5A 3EQ1A 4KPTA 2DWHA 4MFIA 3SEUA 1JQFA 4R6HA 4YU0A 2XX8A 1SQYA 4GIZA 3QUJA 1TWYA 3AXFA 4H65A 2XX7A 3K6WA 1B3HA 3QXMA 3JZJA 3TQWA 3PD9A 4O3CA 3QUFA 4RK9A 1SYIA 3MVYA 3TYHA 3N26A 4IGTA 2ZYNA 4XIGQ 1Z7ME 2GHAA 4QFKA 1I69A 3HN0A 2GH9A 5KCJB 1VSOA 5EHMA 4LZ5A 4DDDA 1SW2A 1N3WA 1R9LA 1A99A 3KN7A 1IEJA 2PT2A 1LSTA 3VVFA 3OSQA 4OQOA 4AQ4A 4NWDA 4M4GA 3PUXE 3WAFA 3O29A 1LFGA 3FVNA 4X1BA 1GGGA 1ZIUA 4LA9A 4F31B 4RYAA 4EQ9A 3SDFA 3CI8A 3IB0A 3VVEA 5TPAA 3MP6A 4R2FA 2F97A 1YAEA 3K6VA 2ANJA 2RC9A 3SEXA 4LQ5A 3OO7A 3SEWA 2ALUA 4F29A 2ESNA 2O84X 4U4SA 3F11A 3H7MA 5I57A 1LFHA 5I58A 4HTGA 4JWXA 2HXWA 1EH3A 5CMBA 3LSWA 1LB9A 3M3LA 2FA7A 2DYXA 3PPPA 4KR5A 1IQ7A 4R73A 1IITA 5I59B 3D4GA 2Y7IA 4NMYA 3Q25A 3LR1A 1A54A 1MM7A 3KFMA 3T9HB 1JETA 3L6GA 4ELRA 5H8FA 2ABHA 4P0IA 3RGYA 2Z8FA 4MLQA 3C31A 1USYH 4JB7A 1GVCA 1MXWA 2FNCA 3ECRA 1OVTA 2R6GE 1KWHA 4IY6A 4RXLA 2RC8A 2XXHA 2Z22A 3FVGA 4H1XA 3MC2A 2B3BA 1URDA 2Z8EA 3LSXA 1Y9UA 3IJOB 3KSXA 4QSEA 1M5CA 2F6PA 2M8CA 3O28A 2RC7A 3UK4A 1UIUA 3RNNA 2H4IA 3EF7A 4XTCQ 5AA1A 1H43A 2A5TB 1EZ9A 4KHZE 3PPOA 2QS1A 3B6TA 5KDTA 2O1MA 2QS2A 2ZYMA 5CI5A 3KG2A 3SEYA 5AA4A 5EHSA 4ISUA 5JTYB 1NNPA 4FATA 2VP1A 1B6HA 1QUJA 2F36A 3CR9A 4KD5A 4WKMA 5L8DA 4NF6A 3ZSFA 4G4PA 3FXQA 3VV5A 2B3FA 4THIA 4RJZA 1PDAA 2A5SA 4L17A 5H8SA 4NF4B 5BUUA 2F7CA 1M5EA 1MQDA 4G8MA 3RT6B 5H8QA 3PUYE 4JDFA 4RY1A 1UQWA 2I0BA 3VXBA 4F2OA 5K2YA 2Y7KA 1P99A 2OJTA 3TMGA 4ZEDA 3KN8A 1OQGA 3BKIB 2I48A 1B5IA 1LBBA 1PEBA 2HFBA 3KJ7A 4ZS9A 1LAFE 4ZEBA 4WEDA 2FYIA 1B4ZA 3Q28A 2DVCA 3K1PA 3E4RA 3GBAA 4I9DA 2QS3A 3V89B 2Q2CA 2DOJA 4EXKA 3K1NA 3W9VA 1JNFA 3WAEA 1IZ1A 1MQHA 3SERA 2Y84A 1PBQA 1QULA 4U1ZA 2UVHA 1D4NA 3FV2A 4MF3A 1OMPA 3IORA 4QSDA 3OO9A 1RYOA 2ONKE 2KLFA 1NNFA 3E9XA 1Y20A 1A8EA 4KYDA 2PBWA 2PT1A 4PFYA 2ZNUA
chains in the Genus database with same CATH superfamily
3OENA 4MEVA 4X1DA 2DWIA 4TLLB 4YZZA 2IEEA 1PB9A 3KC1A 4N8YA 1NH8A 1IXHA 4KXPA 2QRYA 1NV3A 3PU5A 1IMEA 4F1UA 1SDXA 4PFTA 3QSLA 1B3LA 4LUBA 4IGRA 1DPEA 1B51A 3IAZA 5I57B 4I62A 4OVTA 3K02A 3FASA 5I58B 1D9QA 1B32A 1BP5A 3K6UA 1UIVA 3HPIA 1GTKA 3PUWE 3USDA 4PETA 3PUZE 3B8BA 4MBPA 3ROJA 3EPEA 4ESWA 3FUZA 2V3UA 3S9LC 4DLDA 5CC2A 1QKBA 2Q8JA 1MXUA 3MZ1A 1O64A 3V8XB 3B50A 3K00A 3CIJA 5DEXA 5F7VA 1LAHE 3FV1A 1XS5A 3DP8A 5H8FB 3KGCA 1BKAA 1ZTYA 3TAJA 5ELVA 1A55A 4JSDA 3S2VA 5EQ8A 3LC8A 3U92A 1I6QA 2XXVA 2V4CA 2E0SA 2CEXA 5EQ7A 2QVUA 1FTMA 3MAMA 2XXTA 3EKIA 1Y3PA 5TP9A 4H6DA 3KZGA 4UACA 4XKQA 1DBZA 3EHUA 1LGBC 3I3VA 3OD7A 1FRPA 3ODBA 2CZLA 1FW0A 1SW4A 2PVUA 1USYE 3A09A 4GBWA 4TQUQ 3VE1B 3C35A 1LAXA 5KDTB 1NNKA 4PP0A 4LVQA 1R6ZA 1LLSA 3OOAA 4R75A 1R1NA 1DTGA 2ZNTA 1LBWA 1WDNA 5AA4B 3A3UA 2OCUA 2YLNA 4F19A 4DI4B 5IZ1A 3FVOA 1DSNA 4ZEKA 3FIRA 3MP8A 4BDLA 4LONB 1Y4CA 2XXKA 4ZE8A 3N94A 4X48A 4UA8A 3ILUB 1SD3A 4Z7EA 5I3SA 1RYXA 3H6WA 4NF6B 3HO7A 5CRYA 3B6WA 4NTLA 4G68C 3OO8A 4PAIA 2VGQA 5EYHA 2D3IA 1XVYA 2F78A 3LV0A 4R6YA 3E78A 1JW1A 3SETA 1WVJA 5ET5A 4XFEA 4QRZA 5H8QB 1D9YA 4E0XA 3CSBA 2F8DA 4F39A 3FZVA 4BLAA 5EQAA 3MZ9A 2OWTA 1SI0A 4MJOA 1JVXA 3KSJA 5L9OA 4ESXA 3FBPA 4JBZA 4R6KA 3D1RA 5IGAA 4IO3A 4JSOA 5I2KB 2Y7PA 3HHGA 3G3FA 5ICQA 3HHFA 2ZYOA 4JWOA 4LATA 1ZBMA 4GF8A 1B1HA 2D5WA 1FBCA 4DXBA 3O66A 4N17A 3CG1A 4FJPA 5AA2A 4PGPA 1FBPA 1Q9DA 5AA3A 1P1NA 3T93B 2O7UA 3PUVE 1MG1A 3K1MA 1B5HA 3FGSA 3MW0A 1K9ZA 4U2RA 2O68A 5JEIA 2GFEA 4GXAA 4Z0IA 5DVFA 2B65A 4NAPA 5DT6A 4GWWA 2Y7RA 3O6GA 4GLIA 3MSTA 4NF5A 1B7HA 2DDKA 3T66A 2Z23A 1IMDA 2I4BA 3RYDA 3ZKKA 3IOTA 1B3GA 4EQBA 1FJ6A 3K01A 1VFEA 2Q2AA 4IO7A 3O9PA 1IXCA 1Y4TA 2NUVA 5I84A 4NF0A 1N84A 5IZZA 4F3SA 2HQ0A 2O1LA 3M8UA 5CBSA 1B3FA 3OMBA 1FQEA 5CMMA 2THIA 3QK6A 2ZZWA 3U72A 4R2BA 3G3HA 3C9HA 3ZKLA 5I56A 5HBCA 1GV8A 4OA4A 3FXRA 2XD2A 2RKMA 4QXDA 1N3XA 1JVYA 3UA8A 2F7BA 3IO4A 2X7PA 4AS4A 4ND9A 1NMUA 2XXIA 4PCDA 4U23A 1CNQA 1NV4A 1QKAA 1FTOA 2ONRA 1UTHA 3VDFA 1YYZA 2QVVA 2QFLA 1A7LA 3GBBA 4GBVA 1RDZA 3R26A 2WYPA 3PMXA 3FJMA 3TZAA 4O3BA 5CM6A 5J1DA 3I5OA 4GFRA 2OLBA 3N6UA 5EYFA 1TT1A 3MVZA 4WEPA 3H6VA 4LZ7A 5JK4A 5EQ9A 2HAUA 2QL3A 3W9WA 5I2NB 5DW8A 1TFDA 1NUZA 3I6VA 4EF2A 4RA1A 2I3WA 1AOVA 4I8CA 3PTYA 2DWAA 1LEVA 4BDQA 3TCGA 1MPCA 4H45A 2OK2A 3UN6A 1I6BA 4X9TA 2W7YA 3BFUA 1FCKA 4JXIA 2P1SA 4HS7A 4E0WA 3KC0A 3CFXA 3DELB 4GWXA 4YKIA 5ET7A 2X7QA 2F5XA 2DWJA 3O6IA 4OVJA 3VLWA 1O7TA 3TTLA 2AYSA 4XKRA 3KOTA 2XXRA 4ONYA 4OXVA 1VR5A 4TOZA 2O6AA 1N04A 3O97A 3HCQA 3GXAA 5CMKA 1BIYA 1NFTA 2NWJA 1ELJA 1MDQA 2DS9A 4DE8A 4F3GA 3ONMA 4ZEFA 3SESA 1FQCA 1EZPA 4KCDA 3PPRA 1N7XA 1B9JA 2ZZXA 4PFRA 4QFPA 4IR8A 4KFQA 1B1XA 5M2VA 3MUQA 4LQ2A 4OZ9A 3RQTA 3OEMA 3TKDA 3Q27A 3KOSA 3N5LA 1EZOA 2O51A 1T0KA 1LCTA 3HFUA 1MXZA 4QHQA 5K2XA 4HXVA 1Y3QA 4HE2A 5DVIA 1TXFA 1DPPA 1MY2A 4N15A 1BK4A 3H03A 3IFCA 3IOUA 1MXVA 4GL0A 4HW8A 2KR0A 3RTFB 4YB6A 3FJ7A 1VFDA 1DOTA 1PC3A 3BIGA 2QJEA 4YB5A 5DYHA 4EUOA 3MBPA 2HZKA 1FPDA 3IB2A 4FEBA 1OQHA 4G68A 3LUZA 4O7IA 3IJXB 1O63A 3V5AA 4F3PA 3DP4A 1MY0A 5B7DA 3TFLA 4UABA 3A3CA 3RLFE 4AB5A 3H4ZA 3OSRA 5IM2A 1II5A 1ANFA 4DIGA 4DZ1A 5HM4B 4BDOA 4H8IA 2I4CA 4YKPA 3RPLA 3N6TA 2AIXA 1YXIA 4NEDA 5I5PA 2GRVA 1POY1 4ZEIA 4R9GA 2PFZA 1B05A 3RUMA 2P2AA 3RTWB 3CRBA 3PPNA 4QF9A 1B5JA 3NOHA 4YKKA 4RPOA 4FAJA 4Q0CA 1MPBA 5IAIA 3IK6B 4GX3A 5TPAB 4OVSA 2NOOA 2Q74A 3TEPA 2XXXA 1OLCA 4KI0E 2XXQA 3BBRA 2PYYA 1TFAA 2PCRA 2V25A 3TCFA 2VD2A 4GX4A 4KCCA 4PQJA 1OLAA 4ZZAA 2LAOA 3PGFA 4QFNA 4P56A 1EYKA 4XEQA 4XKPA 3S9NC 1NV2A 5I56B 1HSEA 5A5LA 4FEDA 4POXA 4OHNA 2BJJX 4O3AA 4EDPA 2G93A 3U1OA 4ELPA 2X26A 3FD3A 1XT8A 4AS5A 5H8NA 1UTHB 3OO6A 4H5FA 2XXWA 4H46A 3TUSA 3H6UA 1L5TA 5F1QA 1US4A 2I58A 5A5XA 5CMCA 5I59A 2NVUB 4N6KA 1FBDA 2PX1A 1MM6A 2V3TA 1Q1KA 3K2DA 1B0HA 1IMCA 4IY5A 3VVDA 4YMBA 3TTKA 1B58A 4QBAA 1S7YA 3EHTA 4YAHX 3SKPA 1MXXA 1FQAA 3U8QA 2NXOA 4MAGA 1ZJLA 4U4XA 3R6UA 4H67A 1LBZA 3KBRA 1B7ZA 4R74A 2ZNSA 1R9QA 3V83A 1MXYA 3LSLA 1FTJA 2O7IA 1ATGA 4GRKA 1AMFA 1JW4A 1ZU0A 1FPLA 1FTKA 1RDXA 2OBGA 4PGNA 5ET6A 3T9VA 5IZ3B 2XD3A 4JWYA 3RY3A 1FBGA 1MRPA 2AL4A 4EQ7A 4IO2A 3EN3A 1XC1A 5AA2D 1YZ0A 4R9FA 2WX9A 4F1VA 3IR1A 4PC9A 4OENA 4MNPA 1AIVA 3K0VA 2FVZA 4M1VA 1MQJA 1HSLA 4U1OA 3JV9A 3S9MC 5JTYA 1UTBA 4PAFA 1EYIA 4OTEA 1AL3A 1H76A 2UYEA 2QMXA 1S9TA 1QW0A 5ICTA 1FPFA 4ECFA 1H3DA 1OVBA 1IUDA 3MVXA 3TTNA 4PE3A 3H6TA 1IXIA 1NV6A 2Q8MA 2V84A 4JVCA 1DMBA 4NWCA 3TTMA 1FPEA 1F9BA 3SZPA 2WYKA 3O2AA 2QPQA 3FVKA 4G2ZA 2I6EA 3MJNA 1LFIA 4BDMA 2H25A 2CZKA 2OWSA 1NV7A 1YPNA 4DCYA 1FTLA 5IKBA 2O69A 4PE5B 2XX9A 1MY3A 2R9JA 1M5FA 4XF5A 2XWOA 3H06B 2CEYA 1WODA 2DE3A 3T96B 4G68B 4Q5TA 2HHMA 3TPAA 3OEKA 3C33A 4H5GA 3ZS6A 1N0TA 1AH5A 1P1WA 1H44A 2DP8A 1LBVA 1A8FA 1P1QA 3RPLB 4OMBA 4O7MA 2RCAA 4OFOA 4FE8A 2CMOA 2HCAA 2VOZA 2QS4A 2REJA 4G8NA 4ELOA 2UYFA 1FSAA 4LZ8A 2B4LA 4OFJA 4ZDMA 3OXNA 2L5VA 2ONSA 2I49A 4GVOA 2VT5A 1M5DA 3VXCA 5HPQA 1JEUA 1LBYA 2ZYKA 2VD3A 1URSA 3PD8A 3PV0E 3M3KA 1G0HA 4PBQA 3FXUA 3T22A 1FBEA 5L9MA 4HE0A 1P1OA 3KJTA 2H99A 3R7XA 5FTIA 4F22A 1QVSA 3TCHA 5EYGA 2XXYA 2VPNA 1B7UA 3PMVA 4GWOA 1B40A 4OANA 4RK2A 3E79A 5B70A 4IO5A 5H8NB 1Y1ZA 2RINA 2ZXTA 5KZTA 1B2HA 2CZIA 4PF8A 1NNTA 2XA5A 1LBCA 1MY4A 2F35A 5DEXB 1URGA 2E1SA 1SI1A 4H0WA 4RNSA 5A5XB 4OERA 4GQOA 3RN8A 1DCUA 3MP1A 4OFLA 4FBPA 1D3KA 1QJMA 2PFYA 3CHGA 4FORA 1SW5A 2DXYA 2DSFA 1GR2A 1Z7NE 3W15C 2HEUA 3PPQA 3MVWA 1QUIA 5TP9B 5AE4A 1BLFA 3KEIA 2DVZA 3RPWA 3THIA 3M3FA 4OYVA 4F1YA 3B7DA 1YCJA 1P1UA 4OEVA 2YPNA 2Y7WA 1H45A 2OZZA 1BTJA 3G7WA 1NV5A 3G3GA 4OVQA 4DXUA 1B0LA 3UIFA 1CE2A 2RF1A 3C36A 1FPBA 3MPKA 5DVJA 4K3FA 1ZLQA 4H8JA 1XHYA 1JW5A 1EYJA 2XXPA 4RPNA 2Q9TA 4NG7A 2AL5A 4QFLA 2I0CA 2XWIA 3S4UA 3DM0A 1FJ9A 3VFJA 4NE4A 4HCWA 1LCFA 4TLMB 1NH7A 4FIMA 4OETA 1XI6A 3TODA 3VLVA 3MQ9A 4MCOA 3ILTB 1MY1A 3LSFB 2G29A 1NKXA 1UTBB 5H8HA 2VHAA 1SVXB 3U94A 2WBDA 4XXUA 3PMWA 4GOTA 4GX6A 3U93A 2HZLA 4MIJA 4N81A 4NF8A 1XOCA 2HAVA 3TELA 3K6XA 1IXGA 1SW1A 1FQDA 4GD5A 1PBPA 1OIBA 1S50A 1B3EA 2V3QA 1N7WA 2V93A 2B4MA 3B6QA 1RKMA 1LAGE 3CSGA 1MPDA 4U21A 4YKJA 3T9UA 3IO6A 1JP4A 1XVXA 1FQBA 4U22A 3BFTA 3IOVA 1CB6A 2UVJA 3FJGA 3EHSA 2RCBA 3OELA 3G3IA 1I6AA 3O6HA 3MZBA 4QSCA 3GLBA 5I2KA 5AA2B 1FTAA 3IOWA 1N76A 5LDZA 1PB7A 4P8BA 1MH4A 5L9SA 4R72A 1SBPA 4OVRA 3C4MA 2WKYA 3K4UA 1FPKA 4N07A 1B4HA 4HCYA 4EF1A 2DXRA 3E13X 4MH5A 4Q30B 2FIXA 4IO4A 2XXUA 3JYRA 5KCJA 4N6PA 4G8HA 3UGWA 4F2QA 1J1NA 2ZMBA 4N13A 2UVGA 4C1UA 4MNIA 2R8TA 4NX1A 1MQIA 4EXLA 2UVIA 5BWJA 3VLUA 4JVDA 4NF5B 1NUWA 4I40A 1IIWA 2DE4A 1MH3A 1IMBA 3C32A 3C34A 1ZMGA 4I1DA 1A40A 1Q35A 2DE2A 1FPJA 1MDP1 2FHYA 2XHDA 3MYUA 2Q88A 4GWYA 2Z8DA 3UP9A 4YB7A 4GL8A 3TDJA 1PB8A 3H3GA 2H98A 1SYHA 1US5A 4P1EA 2QVRA 2F7AA 3Q29A 3ISPA 4G77A 5T3JA 4OWDA 2JJKA 3FXBA 5FHMA 3IL1B 4KYEA 4HE1A 5CBRA 2QMWA 3CVGA 3HSTA 1YTVA 5DTBA 3HV1A 4WXJA 4ZECA 4JVIA 5LOMA 1VE4A 3UORA 2R71A 1AWBA 4P3LA 1ZKBA 4F18A 4NQ8A 4POWA 2GHBA 2F6GA 4OEUA 3TQLA 1M5BA 3MPLA 2ZZVA 3SEVA 3DP6A 4MLVA 2Q89A 1LB8A 4PF6A 2IA4A 3CFLA 4C1TA 1FQFA 3IFAA 4Q8RA 5FHOA 5ITPA 4G61A 1POTA 1QUKA 5TU0A 3U65A 3QYTA 3MWBA 3IX1A 3G3JA 4LP2B 3E3KA 4ZZEA 1Y1MA 5ISUA 5I2NA 1D9VA 5FHNA 1MS7A 4X04A 4N6DA 3G3KA 4P0GA 2D21A 2H9BA 4PFUA 2UXAA 3QIMA 3LBSA 4IB2A 4N91A 3GZGA 4ELQA 1HSJA 4BDRA 2QSXA 1MQGA 4XKNA 3DLNA 4DXCA 4IO6A 3RT8A 3P7IA 1DTZA 2FIEA 4P11A 1IMFA 4QFOA 1B46A 2A5TA 3L6HA 2REGA 3CFZA 3T9XB 3GYYA 2P0SA 5FTHA 3QAXA 2F34A 4KYSA 2YJPA 2CZHA 1JEVA 3CG3A 4F3BA 2H5YA 1LBXA 4BDNA 5H8HB 4GXSB 4OESA 5ITOA 4C0RA 3TTRA 4FECA 3S9EA 2Y5KA 3D4CA 4MMPA 3LUYA 1B52A 4PTKA 3IB1A 4NF8B 2I3VA 4KQPA 4ZE9A 4YICA 4AB6A 4PFWA 1EU8A 3KN3A 1Y3NA 4GWZA 4MHFA 4MX6A 2PMSA 3Q26A 2DQVA 3BIHA 4NF4A 3FATA 4YMAA 4DCXA 2XWKA 1NL5A 3EQ1A 4KPTA 2DWHA 4MFIA 3SEUA 1JQFA 4R6HA 2XWVA 4P9KA 4YU0A 2XX8A 1SQYA 4GIZA 3QUJA 1TWYA 3AXFA 4H65A 2XX7A 3K6WA 3A29A 1K9YA 1B3HA 3QXMA 3JZJA 3TQWA 3PD9A 4O3CA 3QUFA 4RK9A 1SYIA 3MVYA 3TYHA 3N26A 4IGTA 2ZYNA 4XIGQ 1Z7ME 2GHAA 4QFKA 1I69A 3HN0A 2GH9A 5KCJB 1NV1A 1VSOA 5EHMA 4LZ5A 1NUYA 2WEFA 2F3DA 4DDDA 1SW2A 1N3WA 1R9LA 4GWUA 5I7IA 1A99A 3KN7A 1IEJA 2PT2A 1LSTA 3VVFA 3OSQA 4OQOA 4GWSA 4AQ4A 4NWDA 4M4GA 3PUXE 3WAFA 3O29A 1LFGA 2F3BA 3FVNA 4X1BA 1GGGA 1ZIUA 4NN3A 4LA9A 4F31B 4RYAA 4EQ9A 3SDFA 2HPGA 3CI8A 3IB0A 3VVEA 5TPAA 3MP6A 4N4UA 4R2FA 2F97A 1YAEA 3K6VA 2ANJA 2RC9A 3SEXA 4LQ5A 3OO7A 1INPA 1FPIA 3SEWA 2ALUA 2MKZA 4F29A 2ESNA 2O84X 4U4SA 3F11A 3H7MA 5I57A 1KZ8A 2P3NA 4P1LA 1LFHA 2WBBA 5F24A 5I58A 4HTGA 5ET8A 4JWXA 2HXWA 1EH3A 5CMBA 3LSWA 4O8MA 1LB9A 1RDYA 3M3LA 2FA7A 2FBPA 2DYXA 4O94A 3PPPA 4KR5A 1IQ7A 4R73A 5ESYA 1IITA 4X8RA 5I59B 3D4GA 2Y7IA 4NMYA 1IMAA 3Q25A 3LR1A 1A54A 1MM7A 3KFMA 3T9HB 1JETA 3L6GA 4ELRA 5H8FA 1NV0A 2ABHA 4P0IA 3RGYA 2Z8FA 4MNCA 2GQ1A 5J16A 4MLQA 3C31A 1USYH 4JB7A 2HXRA 1MXWA 1GVCA 2FNCA 3ECRA 1OVTA 2R6GE 1KWHA 4IY6A 4RXLA 3KBZA 2RC8A 2XXHA 4OVPA 2Z22A 3FVGA 4H1XA 3MC2A 2B3BA 1URDA 4NGUA 2Z8EA 3LSXA 4PFBA 1Y9UA 1SPIA 3IJOB 3KSXA 4QSEA 1M5CA 2F6PA 1FBHA 2M8CA 4P47A 3O28A 4NHBA 2RC7A 3UK4A 1UIUA 4PDDA 1G0IA 3RNNA 2H4IA 3EF7A 4XTCQ 5AA1A 1H43A 2A5TB 1EZ9A 4KHZE 4PBHA 3PPOA 4I3YA 2QS1A 3B6TA 5KDTA 4PAKA 2O1MA 2QS2A 2OWZA 2ZYMA 5IZ3A 4I3EA 1VDWA 5CI5A 3KG2A 3SEYA 5AA4A 5EHSA 4ISUA 5JTYB 1NNPA 5FBPA 4FATA 2VP1A 1NUXA 1B6HA 4PFIA 1QUJA 2BJIA 1FBFA 2OX3A 2F36A 3CR9A 4KD5A 4WKMA 5L8DA 4NF6A 3QMFA 3ZSFA 4G4PA 3FXQA 3VV5A 2B3FA 4THIA 4RJZA 1PDAA 2A5SA 4L17A 2P3VA 5H8SA 4NF4B 5BUUA 2F7CA 1M5EA 1MQDA 4G8MA 4LN5A 3RT6B 5H8QA 3PUYE 4JDFA 4RY1A 1UQWA 2I0BA 2VPOA 3VXBA 5LTCA 1KA0A 3T0JA 4F2OA 5K2YA 2Y7KA 1P99A 2OJTA 3TMGA 4ZEDA 3KN8A 1OQGA 2KQZA 2I48A 3BKIB 1B5IA 1LBBA 1PEBA 1FPGA 2HFBA 3KJ7A 4ZS9A 1LAFE 4ZEBA 4WEDA 4DI3D 2FYIA 1B4ZA 3Q28A 2DVCA 3T1BA 3K1PA 4N8GA 1NI9A 3E4RA 3GBAA 4I9DA 2QS3A 3V89B 2Q2CA 2DOJA 4EXKA 3K1NA 3W9VA 1JNFA 3WAEA 1IZ1A 1KA1A 1MQHA 3SERA 2Y84A 1PBQA 1QULA 4U1ZA 2UVHA 1D4NA 3FV2A 4MF3A 1OMPA 4QSDA 3IORA 3OO9A 1RYOA 4PDHA 2ONKE 2Y5LA 2KLFA 1NNFA 3E9XA 1Y20A 1QGXA 1DK4A 1A8EA 4KYDA 2PBWA 2PT1A 4PFYA 2ZNUA
chains in the Genus database with same CATH topology
3OENA 4X1DA 2DWIA 4TLLB 4YZZA 2IEEA 1PB9A 1NH8A 1IXHA 2QRYA 3PU5A 4F1UA 1SDXA 4PFTA 3QSLA 1B3LA 4LUBA 4IGRA 1DPEA 1B51A 3IAZA 5I57B 4I62A 5I58B 3K02A 3FASA 1B32A 1BP5A 3K6UA 1UIVA 3HPIA 1GTKA 3PUWE 3USDA 4PETA 3PUZE 4MBPA 3EPEA 4ESWA 3FUZA 2V3UA 3S9LC 4DLDA 5CC2A 1QKBA 2Q8JA 1MXUA 3MZ1A 1O64A 3V8XB 3K00A 3CIJA 5DEXA 5F7VA 1LAHE 3FV1A 1XS5A 3DP8A 5H8FB 3KGCA 1BKAA 1ZTYA 3TAJA 5ELVA 1A55A 4JSDA 3S2VA 3LC8A 3U92A 1I6QA 2XXVA 2E0SA 1FTMA 3MAMA 2XXTA 1Y3PA 5TP9A 4H6DA 3KZGA 4UACA 4XKQA 3EHUA 1LGBC 3I3VA 3OD7A 3ODBA 2CZLA 1FW0A 1SW4A 2PVUA 1USYE 3A09A 4TQUQ 3VE1B 3C35A 1LAXA 5KDTB 1NNKA 4PP0A 4LVQA 1R6ZA 1LLSA 3OOAA 4R75A 1R1NA 1DTGA 2ZNTA 1WDNA 5AA4B 3A3UA 2OCUA 2YLNA 4F19A 3FVOA 1DSNA 4ZEKA 3FIRA 3MP8A 4BDLA 4LONB 1Y4CA 4ZE8A 3N94A 4X48A 4UA8A 3ILUB 1SD3A 4Z7EA 1RYXA 3H6WA 4NF6B 3HO7A 5CRYA 3B6WA 4NTLA 4G68C 3OO8A 2VGQA 2D3IA 1XVYA 2F78A 4R6YA 1JW1A 3SETA 1WVJA 4QRZA 5H8QB 1D9YA 4E0XA 3CSBA 2F8DA 4F39A 3FZVA 4BLAA 3MZ9A 2OWTA 1SI0A 1JVXA 3KSJA 5L9OA 4ESXA 4JBZA 4R6KA 4IO3A 4JSOA 5I2KB 2Y7PA 3HHGA 3G3FA 5ICQA 3HHFA 2ZYOA 4JWOA 4LATA 1ZBMA 4GF8A 1B1HA 2D5WA 4DXBA 3O66A 3CG1A 4FJPA 5AA2A 5AA3A 1P1NA 3T93B 2O7UA 3PUVE 1MG1A 3K1MA 1B5HA 3FGSA 3MW0A 4U2RA 2O68A 5JEIA 2GFEA 4GXAA 4Z0IA 5DVFA 2B65A 5DT6A 2Y7RA 3O6GA 4GLIA 4NF5A 1B7HA 3T66A 2Z23A 2I4BA 3ZKKA 3IOTA 1B3GA 4EQBA 3K01A 1VFEA 2Q2AA 4IO7A 3O9PA 1IXCA 1Y4TA 2NUVA 5I84A 1N84A 4F3SA 2HQ0A 2O1LA 3M8UA 5CBSA 1B3FA 3OMBA 1FQEA 5CMMA 2THIA 3QK6A 3U72A 4R2BA 3G3HA 3C9HA 3ZKLA 5I56A 5HBCA 1GV8A 3FXRA 2XD2A 2RKMA 1N3XA 1JVYA 3UA8A 2F7BA 3IO4A 2X7PA 4ND9A 1NMUA 2XXIA 4U23A 1QKAA 1FTOA 2ONRA 1UTHA 3VDFA 1A7LA 3GBBA 3R26A 3PMXA 3FJMA 3TZAA 4O3BA 5CM6A 5J1DA 3I5OA 4GFRA 2OLBA 3N6UA 5EYFA 1TT1A 3MVZA 4WEPA 3H6VA 4LZ7A 5JK4A 2HAUA 2QL3A 3W9WA 5I2NB 1TFDA 3I6VA 4EF2A 4RA1A 2I3WA 1AOVA 4I8CA 2DWAA 4BDQA 3TCGA 1MPCA 2OK2A 3UN6A 1I6BA 4X9TA 2W7YA 3BFUA 1FCKA 4JXIA 2P1SA 4HS7A 4E0WA 3CFXA 3DELB 4YKIA 2X7QA 2F5XA 2DWJA 3O6IA 4OVJA 3VLWA 1O7TA 3TTLA 2AYSA 4XKRA 3KOTA 2XXRA 4ONYA 4OXVA 1VR5A 4TOZA 2O6AA 1N04A 3O97A 3HCQA 3GXAA 5CMKA 1BIYA 1NFTA 2NWJA 1ELJA 1MDQA 2DS9A 4DE8A 4F3GA 3ONMA 4ZEFA 3SESA 1FQCA 1EZPA 4KCDA 3PPRA 1N7XA 1B9JA 4QFPA 4KFQA 1B1XA 5M2VA 3MUQA 4LQ2A 4OZ9A 3RQTA 3OEMA 3TKDA 3Q27A 3KOSA 3N5LA 1EZOA 2O51A 1T0KA 1LCTA 1MXZA 4QHQA 5K2XA 1Y3QA 5DVIA 1TXFA 1DPPA 1MY2A 3H03A 3IOUA 1MXVA 4GL0A 4HW8A 3RTFB 4YB6A 3FJ7A 1VFDA 1DOTA 1PC3A 2QJEA 4YB5A 5DYHA 4EUOA 3MBPA 2HZKA 3IB2A 4FEBA 1OQHA 4G68A 3IJXB 1O63A 3V5AA 4F3PA 3DP4A 1MY0A 5B7DA 3TFLA 4AB5A 3A3CA 3RLFE 3H4ZA 3OSRA 1II5A 1ANFA 4DIGA 4DZ1A 5HM4B 4BDOA 4H8IA 2I4CA 4YKPA 3N6TA 2AIXA 4NEDA 2GRVA 1POY1 4ZEIA 4R9GA 1B05A 3RUMA 2P2AA 3RTWB 3CRBA 3PPNA 4QF9A 1B5JA 4YKKA 4RPOA 4FAJA 4Q0CA 1MPBA 5IAIA 3IK6B 5TPAB 2NOOA 3TEPA 2XXXA 1OLCA 4KI0E 2XXQA 3BBRA 2PYYA 1TFAA 2V25A 3TCFA 2VD2A 4KCCA 4PQJA 1OLAA 4ZZAA 2LAOA 3PGFA 4QFNA 4XKPA 3S9NC 5I56B 1HSEA 4FEDA 4POXA 4OHNA 2BJJX 4O3AA 4EDPA 2G93A 3U1OA 4ELPA 2X26A 3FD3A 1XT8A 5H8NA 1UTHB 3OO6A 4H5FA 2XXWA 3TUSA 3H6UA 1L5TA 5F1QA 1US4A 2I58A 5A5XA 5CMCA 5I59A 2NVUB 2PX1A 1MM6A 2V3TA 1Q1KA 3K2DA 1B0HA 4IY5A 3VVDA 4YMBA 3TTKA 1B58A 1S7YA 3EHTA 4YAHX 3SKPA 1MXXA 1FQAA 3U8QA 2NXOA 1ZJLA 4U4XA 3R6UA 4H67A 3KBRA 1B7ZA 4R74A 2ZNSA 1R9QA 3V83A 1MXYA 3LSLA 1FTJA 2O7IA 1ATGA 4GRKA 1AMFA 1JW4A 1ZU0A 1FTKA 2OBGA 3T9VA 2XD3A 4JWYA 3RY3A 4EQ7A 1MRPA 2AL4A 4IO2A 3EN3A 1XC1A 5AA2D 4R9FA 4F1VA 3IR1A 4OENA 1AIVA 3K0VA 4M1VA 1MQJA 1HSLA 4U1OA 3JV9A 3S9MC 5JTYA 1UTBA 4OTEA 1AL3A 1H76A 2UYEA 2QMXA 1S9TA 1QW0A 5ICTA 4ECFA 1H3DA 1OVBA 1IUDA 3MVXA 3TTNA 3H6TA 1IXIA 2V84A 1DMBA 4NWCA 3TTMA 1F9BA 3O2AA 2QPQA 3FVKA 4G2ZA 2I6EA 3MJNA 1LFIA 4BDMA 2H25A 2OWSA 1YPNA 4DCYA 1FTLA 5IKBA 2O69A 4PE5B 2XX9A 1MY3A 2R9JA 1M5FA 3H06B 1WODA 2DE3A 3T96B 4G68B 4Q5TA 3TPAA 3OEKA 3C33A 4H5GA 3ZS6A 1N0TA 1AH5A 1P1WA 1H44A 2DP8A 1A8FA 1P1QA 4OMBA 2RCAA 4OFOA 4FE8A 2CMOA 2HCAA 2VOZA 2QS4A 2REJA 4G8NA 4ELOA 2UYFA 4LZ8A 4OFJA 4ZDMA 3OXNA 2ONSA 2I49A 4GVOA 1M5DA 3VXCA 5HPQA 1JEUA 2ZYKA 2VD3A 1URSA 3PD8A 3PV0E 3M3KA 3FXUA 3T22A 5L9MA 1P1OA 3KJTA 2H99A 3R7XA 5FTIA 4F22A 1QVSA 3TCHA 2XXYA 1B7UA 3PMVA 4GWOA 1B40A 4RK2A 5B70A 4IO5A 5H8NB 1Y1ZA 2RINA 2ZXTA 5KZTA 1B2HA 1NNTA 1LBCA 1MY4A 2F35A 5DEXB 1URGA 2E1SA 1SI1A 4H0WA 4RNSA 5A5XB 4OERA 4GQOA 3RN8A 3MP1A 4OFLA 1D3KA 1QJMA 4FORA 1SW5A 2DXYA 2DSFA 1GR2A 1Z7NE 3W15C 2HEUA 3PPQA 3MVWA 1QUIA 5TP9B 5AE4A 1BLFA 3KEIA 2DVZA 3RPWA 3THIA 3M3FA 4OYVA 4F1YA 3B7DA 1YCJA 1P1UA 4OEVA 2YPNA 2Y7WA 1H45A 2OZZA 1BTJA 3G7WA 3G3GA 4DXUA 1B0LA 3UIFA 1CE2A 2RF1A 3C36A 3MPKA 5DVJA 4K3FA 1ZLQA 4H8JA 1XHYA 1JW5A 2XXPA 4RPNA 2Q9TA 2AL5A 4QFLA 2I0CA 3S4UA 3DM0A 3VFJA 4NE4A 4HCWA 1LCFA 4TLMB 1NH7A 4FIMA 4OETA 3TODA 3VLVA 3MQ9A 3ILTB 1MY1A 3LSFB 2G29A 1NKXA 1UTBB 5H8HA 2VHAA 1SVXB 3U94A 4XXUA 3PMWA 4GOTA 3U93A 2HZLA 4NF8A 1XOCA 2HAVA 3TELA 3K6XA 1IXGA 1SW1A 1FQDA 4GD5A 1PBPA 1OIBA 1S50A 1B3EA 2V3QA 1N7WA 2V93A 3B6QA 1RKMA 1LAGE 3CSGA 1MPDA 4U21A 4YKJA 3T9UA 3IO6A 1XVXA 1FQBA 4U22A 3BFTA 3IOVA 1CB6A 2UVJA 3FJGA 3EHSA 2RCBA 3OELA 3G3IA 1I6AA 3O6HA 3MZBA 4QSCA 3GLBA 5I2KA 5AA2B 3IOWA 1N76A 1PB7A 1MH4A 5L9SA 4R72A 1SBPA 3C4MA 2WKYA 3K4UA 4N07A 1B4HA 4HCYA 4EF1A 2DXRA 3E13X 4MH5A 4Q30B 4IO4A 2XXUA 3JYRA 5KCJA 4N6PA 4G8HA 3UGWA 4F2QA 1J1NA 2ZMBA 4N13A 2UVGA 4C1UA 1MQIA 4EXLA 2UVIA 5BWJA 3VLUA 4NF5B 1IIWA 2DE4A 1MH3A 3C32A 3C34A 1ZMGA 4I1DA 1A40A 1Q35A 2DE2A 1MDP1 2XHDA 2Q88A 2Z8DA 3UP9A 4YB7A 4GL8A 3TDJA 1PB8A 3H3GA 2H98A 1SYHA 1US5A 2F7AA 3Q29A 4G77A 4OWDA 5FHMA 3IL1B 4KYEA 5CBRA 2QMWA 3CVGA 3HSTA 1YTVA 5DTBA 3HV1A 4WXJA 4ZECA 5LOMA 1VE4A 3UORA 2R71A 1ZKBA 4F18A 4POWA 2GHBA 2F6GA 4OEUA 3TQLA 1M5BA 3MPLA 3SEVA 3DP6A 4MLVA 2Q89A 1LB8A 2IA4A 3CFLA 4C1TA 1FQFA 4Q8RA 5FHOA 5ITPA 1POTA 1QUKA 5TU0A 3QYTA 3MWBA 3IX1A 3G3JA 4LP2B 3E3KA 4ZZEA 1Y1MA 5ISUA 5I2NA 1D9VA 5FHNA 1MS7A 3G3KA 4P0GA 2D21A 2H9BA 4PFUA 2UXAA 3QIMA 3LBSA 4IB2A 3GZGA 4ELQA 1HSJA 4BDRA 2QSXA 1MQGA 4XKNA 3DLNA 4DXCA 4IO6A 3RT8A 3P7IA 1DTZA 4P11A 4QFOA 1B46A 2A5TA 3L6HA 2REGA 3CFZA 3T9XB 2P0SA 5FTHA 3QAXA 2F34A 4KYSA 2YJPA 1JEVA 3CG3A 4F3BA 2H5YA 4BDNA 5H8HB 4GXSB 4OESA 5ITOA 4C0RA 3TTRA 4FECA 3S9EA 3D4CA 3LUYA 1B52A 3IB1A 4NF8B 2I3VA 4KQPA 4ZE9A 4YICA 4AB6A 4PFWA 1EU8A 3KN3A 1Y3NA 2PMSA 3Q26A 2DQVA 4NF4A 3FATA 4YMAA 4DCXA 1NL5A 3EQ1A 4KPTA 2DWHA 4MFIA 3SEUA 1JQFA 4R6HA 4YU0A 2XX8A 1SQYA 4GIZA 3QUJA 1TWYA 3AXFA 4H65A 2XX7A 3K6WA 1B3HA 3QXMA 3JZJA 3TQWA 3PD9A 4O3CA 3QUFA 4RK9A 1SYIA 3MVYA 3TYHA 3N26A 4IGTA 2ZYNA 4XIGQ 1Z7ME 2GHAA 4QFKA 1I69A 3HN0A 2GH9A 5KCJB 1VSOA 5EHMA 4LZ5A 4DDDA 1SW2A 1N3WA 1R9LA 1A99A 3KN7A 1IEJA 2PT2A 1LSTA 3VVFA 3OSQA 4OQOA 4AQ4A 4NWDA 4M4GA 3PUXE 3WAFA 3O29A 1LFGA 3FVNA 4X1BA 1GGGA 1ZIUA 4LA9A 4F31B 4RYAA 4EQ9A 3SDFA 3CI8A 3IB0A 3VVEA 5TPAA 3MP6A 4R2FA 2F97A 1YAEA 3K6VA 2ANJA 2RC9A 3SEXA 4LQ5A 3OO7A 3SEWA 2ALUA 4F29A 2ESNA 2O84X 4U4SA 3F11A 3H7MA 5I57A 1LFHA 5I58A 4HTGA 4JWXA 2HXWA 1EH3A 5CMBA 3LSWA 1LB9A 3M3LA 2FA7A 2DYXA 3PPPA 4KR5A 1IQ7A 4R73A 1IITA 5I59B 3D4GA 2Y7IA 4NMYA 3Q25A 3LR1A 1A54A 1MM7A 3KFMA 3T9HB 1JETA 3L6GA 4ELRA 5H8FA 2ABHA 4P0IA 3RGYA 2Z8FA 4MLQA 3C31A 1USYH 4JB7A 1GVCA 1MXWA 2FNCA 3ECRA 1OVTA 2R6GE 1KWHA 4IY6A 4RXLA 2RC8A 2XXHA 2Z22A 3FVGA 4H1XA 3MC2A 2B3BA 1URDA 2Z8EA 3LSXA 1Y9UA 3IJOB 3KSXA 4QSEA 1M5CA 2F6PA 2M8CA 3O28A 2RC7A 3UK4A 1UIUA 3RNNA 2H4IA 3EF7A 4XTCQ 5AA1A 1H43A 2A5TB 1EZ9A 4KHZE 3PPOA 2QS1A 3B6TA 5KDTA 2O1MA 2QS2A 2ZYMA 5CI5A 3KG2A 3SEYA 5AA4A 5EHSA 4ISUA 5JTYB 1NNPA 4FATA 2VP1A 1B6HA 1QUJA 2F36A 3CR9A 4KD5A 4WKMA 5L8DA 4NF6A 3ZSFA 4G4PA 3FXQA 3VV5A 2B3FA 4THIA 4RJZA 1PDAA 2A5SA 4L17A 5H8SA 4NF4B 5BUUA 2F7CA 1M5EA 1MQDA 4G8MA 3RT6B 5H8QA 3PUYE 4JDFA 4RY1A 1UQWA 2I0BA 3VXBA 4F2OA 5K2YA 2Y7KA 1P99A 2OJTA 3TMGA 4ZEDA 3KN8A 1OQGA 3BKIB 2I48A 1B5IA 1LBBA 1PEBA 2HFBA 3KJ7A 4ZS9A 1LAFE 4ZEBA 4WEDA 2FYIA 1B4ZA 3Q28A 2DVCA 3K1PA 3E4RA 3GBAA 4I9DA 2QS3A 3V89B 2Q2CA 2DOJA 4EXKA 3K1NA 3W9VA 1JNFA 3WAEA 1IZ1A 1MQHA 3SERA 2Y84A 1PBQA 1QULA 4U1ZA 2UVHA 1D4NA 3FV2A 4MF3A 1OMPA 3IORA 4QSDA 3OO9A 1RYOA 2ONKE 2KLFA 1NNFA 3E9XA 1Y20A 1A8EA 4KYDA 2PBWA 2PT1A 4PFYA 2ZNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEN A;  4X1D A;  2DWI A;  4TLL B;  4YZZ A;  2IEE A;  1PB9 A;  1NH8 A;  1IXH A;  2QRY A;  3PU5 A;  4F1U A;  1SDX A;  4PFT A;  3QSL A;  1B3L A;  4LUB A;  4IGR A;  1DPE A;  1B51 A;  3IAZ A;  5I57 B;  4I62 A;  5I58 B;  3K02 A;  3FAS A;  1B32 A;  1BP5 A;  3K6U A;  1UIV A;  3HPI A;  1GTK A;  3PUW E;  3USD A;  4PET A;  3PUZ E;  4MBP A;  3EPE A;  4ESW A;  3FUZ A;  2V3U A;  3S9L C;  4DLD A;  5CC2 A;  1QKB A;  2Q8J A;  1MXU A;  3MZ1 A;  1O64 A;  3V8X B;  3K00 A;  3CIJ A;  5DEX A;  5F7V A;  1LAH E;  3FV1 A;  1XS5 A;  3DP8 A;  5H8F B;  3KGC A;  1BKA A;  1ZTY A;  3TAJ A;  5ELV A;  1A55 A;  4JSD A;  3S2V A;  3LC8 A;  3U92 A;  1I6Q A;  2XXV A;  2E0S A;  1FTM A;  3MAM A;  2XXT A;  1Y3P A;  5TP9 A;  4H6D A;  3KZG A;  4UAC A;  4XKQ A;  3EHU A;  1LGB C;  3I3V A;  3OD7 A;  3ODB A;  2CZL A;  1FW0 A;  1SW4 A;  2PVU A;  1USY E;  3A09 A;  4TQU Q;  3VE1 B;  3C35 A;  1LAX A;  5KDT B;  1NNK A;  4PP0 A;  4LVQ A;  1R6Z A;  1LLS A;  3OOA A;  4R75 A;  1R1N A;  1DTG A;  2ZNT A;  1WDN A;  5AA4 B;  3A3U A;  2OCU A;  2YLN A;  4F19 A;  3FVO A;  1DSN A;  4ZEK A;  3FIR A;  3MP8 A;  4BDL A;  4LON B;  1Y4C A;  4ZE8 A;  3N94 A;  4X48 A;  4UA8 A;  3ILU B;  1SD3 A;  4Z7E A;  1RYX A;  3H6W A;  4NF6 B;  3HO7 A;  5CRY A;  3B6W A;  4NTL A;  4G68 C;  3OO8 A;  2VGQ A;  2D3I A;  1XVY A;  2F78 A;  4R6Y A;  1JW1 A;  3SET A;  1WVJ A;  4QRZ A;  5H8Q B;  1D9Y A;  4E0X A;  3CSB A;  2F8D A;  4F39 A;  3FZV A;  4BLA A;  3MZ9 A;  2OWT A;  1SI0 A;  1JVX A;  3KSJ A;  5L9O A;  4ESX A;  4JBZ A;  4R6K A;  4IO3 A;  4JSO A;  5I2K B;  2Y7P A;  3HHG A;  3G3F A;  5ICQ A;  3HHF A;  2ZYO A;  4JWO A;  4LAT A;  1ZBM A;  4GF8 A;  1B1H A;  2D5W A;  4DXB A;  3O66 A;  3CG1 A;  4FJP A;  5AA2 A;  5AA3 A;  1P1N A;  3T93 B;  2O7U A;  3PUV E;  1MG1 A;  3K1M A;  1B5H A;  3FGS A;  3MW0 A;  4U2R A;  2O68 A;  5JEI A;  2GFE A;  4GXA A;  4Z0I A;  5DVF A;  2B65 A;  5DT6 A;  2Y7R A;  3O6G A;  4GLI A;  4NF5 A;  1B7H A;  3T66 A;  2Z23 A;  2I4B A;  3ZKK A;  3IOT A;  1B3G A;  4EQB A;  3K01 A;  1VFE A;  2Q2A A;  4IO7 A;  3O9P A;  1IXC A;  1Y4T A;  2NUV A;  5I84 A;  1N84 A;  4F3S A;  2HQ0 A;  2O1L A;  3M8U A;  5CBS A;  1B3F A;  3OMB A;  1FQE A;  5CMM A;  2THI A;  3QK6 A;  3U72 A;  4R2B A;  3G3H A;  3C9H A;  3ZKL A;  5I56 A;  5HBC A;  1GV8 A;  3FXR A;  2XD2 A;  2RKM A;  1N3X A;  1JVY A;  3UA8 A;  2F7B A;  3IO4 A;  2X7P A;  4ND9 A;  1NMU A;  2XXI A;  4U23 A;  1QKA A;  1FTO A;  2ONR A;  1UTH A;  3VDF A;  1A7L A;  3GBB A;  3R26 A;  3PMX A;  3FJM A;  3TZA A;  4O3B A;  5CM6 A;  5J1D A;  3I5O A;  4GFR A;  2OLB A;  3N6U A;  5EYF A;  1TT1 A;  3MVZ A;  4WEP A;  3H6V A;  4LZ7 A;  5JK4 A;  2HAU A;  2QL3 A;  3W9W A;  5I2N B;  1TFD A;  3I6V A;  4EF2 A;  4RA1 A;  2I3W A;  1AOV A;  4I8C A;  2DWA A;  4BDQ A;  3TCG A;  1MPC A;  2OK2 A;  3UN6 A;  1I6B A;  4X9T A;  2W7Y A;  3BFU A;  1FCK A;  4JXI A;  2P1S A;  4HS7 A;  4E0W A;  3CFX A;  3DEL B;  4YKI A;  2X7Q A;  2F5X A;  2DWJ A;  3O6I A;  4OVJ A;  3VLW A;  1O7T A;  3TTL A;  2AYS A;  4XKR A;  3KOT A;  2XXR A;  4ONY A;  4OXV A;  1VR5 A;  4TOZ A;  2O6A A;  1N04 A;  3O97 A;  3HCQ A;  3GXA A;  5CMK A;  1BIY A;  1NFT A;  2NWJ A;  1ELJ A;  1MDQ A;  2DS9 A;  4DE8 A;  4F3G A;  3ONM A;  4ZEF A;  3SES A;  1FQC A;  1EZP A;  4KCD A;  3PPR A;  1N7X A;  1B9J A;  4QFP A;  4KFQ A;  1B1X A;  5M2V A;  3MUQ A;  4LQ2 A;  4OZ9 A;  3RQT A;  3OEM A;  3TKD A;  3Q27 A;  3KOS A;  3N5L A;  1EZO A;  2O51 A;  1T0K A;  1LCT A;  1MXZ A;  4QHQ A;  5K2X A;  1Y3Q A;  5DVI A;  1TXF A;  1DPP A;  1MY2 A;  3H03 A;  3IOU A;  1MXV A;  4GL0 A;  4HW8 A;  3RTF B;  4YB6 A;  3FJ7 A;  1VFD A;  1DOT A;  1PC3 A;  2QJE A;  4YB5 A;  5DYH A;  4EUO A;  3MBP A;  2HZK A;  3IB2 A;  4FEB A;  1OQH A;  4G68 A;  3IJX B;  1O63 A;  3V5A A;  4F3P A;  3DP4 A;  1MY0 A;  5B7D A;  3TFL A;  4AB5 A;  3A3C A;  3RLF E;  3H4Z A;  3OSR A;  1II5 A;  1ANF A;  4DIG A;  4DZ1 A;  5HM4 B;  4BDO A;  4H8I A;  2I4C A;  4YKP A;  3N6T A;  2AIX A;  4NED A;  2GRV A;  1POY 1;  4ZEI A;  4R9G A;  1B05 A;  3RUM A;  2P2A A;  3RTW B;  3CRB A;  3PPN A;  4QF9 A;  1B5J A;  4YKK A;  4RPO A;  4FAJ A;  4Q0C A;  1MPB A;  5IAI A;  3IK6 B;  5TPA B;  2NOO A;  3TEP A;  2XXX A;  1OLC A;  4KI0 E;  2XXQ A;  3BBR A;  2PYY A;  1TFA A;  2V25 A;  3TCF A;  2VD2 A;  4KCC A;  4PQJ A;  1OLA A;  4ZZA A;  2LAO A;  3PGF A;  4QFN A;  4XKP A;  3S9N C;  5I56 B;  1HSE A;  4FED A;  4POX A;  4OHN A;  2BJJ X;  4O3A A;  4EDP A;  2G93 A;  3U1O A;  4ELP A;  2X26 A;  3FD3 A;  1XT8 A;  5H8N A;  1UTH B;  3OO6 A;  4H5F A;  2XXW A;  3TUS A;  3H6U A;  1L5T A;  5F1Q A;  1US4 A;  2I58 A;  5A5X A;  5CMC A;  5I59 A;  2NVU B;  2PX1 A;  1MM6 A;  2V3T A;  1Q1K A;  3K2D A;  1B0H A;  4IY5 A;  3VVD A;  4YMB A;  3TTK A;  1B58 A;  1S7Y A;  3EHT A;  4YAH X;  3SKP A;  1MXX A;  1FQA A;  3U8Q A;  2NXO A;  1ZJL A;  4U4X A;  3R6U A;  4H67 A;  3KBR A;  1B7Z A;  4R74 A;  2ZNS A;  1R9Q A;  3V83 A;  1MXY A;  3LSL A;  1FTJ A;  2O7I A;  1ATG A;  4GRK A;  1AMF A;  1JW4 A;  1ZU0 A;  1FTK A;  2OBG A;  3T9V A;  2XD3 A;  4JWY A;  3RY3 A;  4EQ7 A;  1MRP A;  2AL4 A;  4IO2 A;  3EN3 A;  1XC1 A;  5AA2 D;  4R9F A;  4F1V A;  3IR1 A;  4OEN A;  1AIV A;  3K0V A;  4M1V A;  1MQJ A;  1HSL A;  4U1O A;  3JV9 A;  3S9M C;  5JTY A;  1UTB A;  4OTE A;  1AL3 A;  1H76 A;  2UYE A;  2QMX A;  1S9T A;  1QW0 A;  5ICT A;  4ECF A;  1H3D A;  1OVB A;  1IUD A;  3MVX A;  3TTN A;  3H6T A;  1IXI A;  2V84 A;  1DMB A;  4NWC A;  3TTM A;  1F9B A;  3O2A A;  2QPQ A;  3FVK A;  4G2Z A;  2I6E A;  3MJN A;  1LFI A;  4BDM A;  2H25 A;  2OWS A;  1YPN A;  4DCY A;  1FTL A;  5IKB A;  2O69 A;  4PE5 B;  2XX9 A;  1MY3 A;  2R9J A;  1M5F A;  3H06 B;  1WOD A;  2DE3 A;  3T96 B;  4G68 B;  4Q5T A;  3TPA A;  3OEK A;  3C33 A;  4H5G A;  3ZS6 A;  1N0T A;  1AH5 A;  1P1W A;  1H44 A;  2DP8 A;  1A8F A;  1P1Q A;  4OMB A;  2RCA A;  4OFO A;  4FE8 A;  2CMO A;  2HCA A;  2VOZ A;  2QS4 A;  2REJ A;  4G8N A;  4ELO A;  2UYF A;  4LZ8 A;  4OFJ A;  4ZDM A;  3OXN A;  2ONS A;  2I49 A;  4GVO A;  1M5D A;  3VXC A;  5HPQ A;  1JEU A;  2ZYK A;  2VD3 A;  1URS A;  3PD8 A;  3PV0 E;  3M3K A;  3FXU A;  3T22 A;  5L9M A;  1P1O A;  3KJT A;  2H99 A;  3R7X A;  5FTI A;  4F22 A;  1QVS A;  3TCH A;  2XXY A;  1B7U A;  3PMV A;  4GWO A;  1B40 A;  4RK2 A;  5B70 A;  4IO5 A;  5H8N B;  1Y1Z A;  2RIN A;  2ZXT A;  5KZT A;  1B2H A;  1NNT A;  1LBC A;  1MY4 A;  2F35 A;  5DEX B;  1URG A;  2E1S A;  1SI1 A;  4H0W A;  4RNS A;  5A5X B;  4OER A;  4GQO A;  3RN8 A;  3MP1 A;  4OFL A;  1D3K A;  1QJM A;  4FOR A;  1SW5 A;  2DXY A;  2DSF A;  1GR2 A;  1Z7N E;  3W15 C;  2HEU A;  3PPQ A;  3MVW A;  1QUI A;  5TP9 B;  5AE4 A;  1BLF A;  3KEI A;  2DVZ A;  3RPW A;  3THI A;  3M3F A;  4OYV A;  4F1Y A;  3B7D A;  1YCJ A;  1P1U A;  4OEV A;  2YPN A;  2Y7W A;  1H45 A;  2OZZ A;  1BTJ A;  3G7W A;  3G3G A;  4DXU A;  1B0L A;  3UIF A;  1CE2 A;  2RF1 A;  3C36 A;  3MPK A;  5DVJ A;  4K3F A;  1ZLQ A;  4H8J A;  1XHY A;  1JW5 A;  2XXP A;  4RPN A;  2Q9T A;  2AL5 A;  4QFL A;  2I0C A;  3S4U A;  3DM0 A;  3VFJ A;  4NE4 A;  4HCW A;  1LCF A;  4TLM B;  1NH7 A;  4FIM A;  4OET A;  3TOD A;  3VLV A;  3MQ9 A;  3ILT B;  1MY1 A;  3LSF B;  2G29 A;  1NKX A;  1UTB B;  5H8H A;  2VHA A;  1SVX B;  3U94 A;  4XXU A;  3PMW A;  4GOT A;  3U93 A;  2HZL A;  4NF8 A;  1XOC A;  2HAV A;  3TEL A;  3K6X A;  1IXG A;  1SW1 A;  1FQD A;  4GD5 A;  1PBP A;  1OIB A;  1S50 A;  1B3E A;  2V3Q A;  1N7W A;  2V93 A;  3B6Q A;  1RKM A;  1LAG E;  3CSG A;  1MPD A;  4U21 A;  4YKJ A;  3T9U A;  3IO6 A;  1XVX A;  1FQB A;  4U22 A;  3BFT A;  3IOV A;  1CB6 A;  2UVJ A;  3FJG A;  3EHS A;  2RCB A;  3OEL A;  3G3I A;  1I6A A;  3O6H A;  3MZB A;  4QSC A;  3GLB A;  5I2K A;  5AA2 B;  3IOW A;  1N76 A;  1PB7 A;  1MH4 A;  5L9S A;  4R72 A;  1SBP A;  3C4M A;  2WKY A;  3K4U A;  4N07 A;  1B4H A;  4HCY A;  4EF1 A;  2DXR A;  3E13 X;  4MH5 A;  4Q30 B;  4IO4 A;  2XXU A;  3JYR A;  5KCJ A;  4N6P A;  4G8H A;  3UGW A;  4F2Q A;  1J1N A;  2ZMB A;  4N13 A;  2UVG A;  4C1U A;  1MQI A;  4EXL A;  2UVI A;  5BWJ A;  3VLU A;  4NF5 B;  1IIW A;  2DE4 A;  1MH3 A;  3C32 A;  3C34 A;  1ZMG A;  4I1D A;  1A40 A;  1Q35 A;  2DE2 A;  1MDP 1;  2XHD A;  2Q88 A;  2Z8D A;  3UP9 A;  4YB7 A;  4GL8 A;  3TDJ A;  1PB8 A;  3H3G A;  2H98 A;  1SYH A;  1US5 A;  2F7A A;  3Q29 A;  4G77 A;  4OWD A;  5FHM A;  3IL1 B;  4KYE A;  5CBR A;  2QMW A;  3CVG A;  3HST A;  1YTV A;  5DTB A;  3HV1 A;  4WXJ A;  4ZEC A;  5LOM A;  1VE4 A;  3UOR A;  2R71 A;  1ZKB A;  4F18 A;  4POW A;  2GHB A;  2F6G A;  4OEU A;  3TQL A;  1M5B A;  3MPL A;  3SEV A;  3DP6 A;  4MLV A;  2Q89 A;  1LB8 A;  2IA4 A;  3CFL A;  4C1T A;  1FQF A;  4Q8R A;  5FHO A;  5ITP A;  1POT A;  1QUK A;  5TU0 A;  3QYT A;  3MWB A;  3IX1 A;  3G3J A;  4LP2 B;  3E3K A;  4ZZE A;  1Y1M A;  5ISU A;  5I2N A;  1D9V A;  5FHN A;  1MS7 A;  3G3K A;  4P0G A;  2D21 A;  2H9B A;  4PFU A;  2UXA A;  3QIM A;  3LBS A;  4IB2 A;  3GZG A;  4ELQ A;  1HSJ A;  4BDR A;  2QSX A;  1MQG A;  4XKN A;  3DLN A;  4DXC A;  4IO6 A;  3RT8 A;  3P7I A;  1DTZ A;  4P11 A;  4QFO A;  1B46 A;  2A5T A;  3L6H A;  2REG A;  3CFZ A;  3T9X B;  2P0S A;  5FTH A;  3QAX A;  2F34 A;  4KYS A;  2YJP A;  1JEV A;  3CG3 A;  4F3B A;  2H5Y A;  4BDN A;  5H8H B;  4GXS B;  4OES A;  5ITO A;  4C0R A;  3TTR A;  4FEC A;  3S9E A;  3D4C A;  3LUY A;  1B52 A;  3IB1 A;  4NF8 B;  2I3V A;  4KQP A;  4ZE9 A;  4YIC A;  4AB6 A;  4PFW A;  1EU8 A;  3KN3 A;  1Y3N A;  2PMS A;  3Q26 A;  2DQV A;  4NF4 A;  3FAT A;  4YMA A;  4DCX A;  1NL5 A;  3EQ1 A;  4KPT A;  2DWH A;  4MFI A;  3SEU A;  1JQF A;  4R6H A;  4YU0 A;  2XX8 A;  1SQY A;  4GIZ A;  3QUJ A;  1TWY A;  3AXF A;  4H65 A;  2XX7 A;  3K6W A;  1B3H A;  3QXM A;  3JZJ A;  3TQW A;  3PD9 A;  4O3C A;  3QUF A;  4RK9 A;  1SYI A;  3MVY A;  3TYH A;  3N26 A;  4IGT A;  2ZYN A;  4XIG Q;  1Z7M E;  2GHA A;  4QFK A;  1I69 A;  3HN0 A;  2GH9 A;  5KCJ B;  1VSO A;  5EHM A;  4LZ5 A;  4DDD A;  1SW2 A;  1N3W A;  1R9L A;  1A99 A;  3KN7 A;  1IEJ A;  2PT2 A;  1LST A;  3VVF A;  3OSQ A;  4OQO A;  4AQ4 A;  4NWD A;  4M4G A;  3PUX E;  3WAF A;  3O29 A;  1LFG A;  3FVN A;  4X1B A;  1GGG A;  1ZIU A;  4LA9 A;  4F31 B;  4RYA A;  4EQ9 A;  3SDF A;  3CI8 A;  3IB0 A;  3VVE A;  5TPA A;  3MP6 A;  4R2F A;  2F97 A;  1YAE A;  3K6V A;  2ANJ A;  2RC9 A;  3SEX A;  4LQ5 A;  3OO7 A;  3SEW A;  2ALU A;  4F29 A;  2ESN A;  2O84 X;  4U4S A;  3F11 A;  3H7M A;  5I57 A;  1LFH A;  5I58 A;  4HTG A;  4JWX A;  2HXW A;  1EH3 A;  5CMB A;  3LSW A;  1LB9 A;  3M3L A;  2FA7 A;  2DYX A;  3PPP A;  4KR5 A;  1IQ7 A;  4R73 A;  1IIT A;  5I59 B;  3D4G A;  2Y7I A;  4NMY A;  3Q25 A;  3LR1 A;  1A54 A;  1MM7 A;  3KFM A;  3T9H B;  1JET A;  3L6G A;  4ELR A;  5H8F A;  2ABH A;  4P0I A;  3RGY A;  2Z8F A;  4MLQ A;  3C31 A;  1USY H;  4JB7 A;  1GVC A;  1MXW A;  2FNC A;  3ECR A;  1OVT A;  2R6G E;  1KWH A;  4IY6 A;  4RXL A;  2RC8 A;  2XXH A;  2Z22 A;  3FVG A;  4H1X A;  3MC2 A;  2B3B A;  1URD A;  2Z8E A;  3LSX A;  1Y9U A;  3IJO B;  3KSX A;  4QSE A;  1M5C A;  2F6P A;  2M8C A;  3O28 A;  2RC7 A;  3UK4 A;  1UIU A;  3RNN A;  2H4I A;  3EF7 A;  4XTC Q;  5AA1 A;  1H43 A;  2A5T B;  1EZ9 A;  4KHZ E;  3PPO A;  2QS1 A;  3B6T A;  5KDT A;  2O1M A;  2QS2 A;  2ZYM A;  5CI5 A;  3KG2 A;  3SEY A;  5AA4 A;  5EHS A;  4ISU A;  5JTY B;  1NNP A;  4FAT A;  2VP1 A;  1B6H A;  1QUJ A;  2F36 A;  3CR9 A;  4KD5 A;  4WKM A;  5L8D A;  4NF6 A;  3ZSF A;  4G4P A;  3FXQ A;  3VV5 A;  2B3F A;  4THI A;  4RJZ A;  1PDA A;  2A5S A;  4L17 A;  5H8S A;  4NF4 B;  5BUU A;  2F7C A;  1M5E A;  1MQD A;  4G8M A;  3RT6 B;  5H8Q A;  3PUY E;  4JDF A;  4RY1 A;  1UQW A;  2I0B A;  3VXB A;  4F2O A;  5K2Y A;  2Y7K A;  1P99 A;  2OJT A;  3TMG A;  4ZED A;  3KN8 A;  1OQG A;  3BKI B;  2I48 A;  1B5I A;  1LBB A;  1PEB A;  2HFB A;  3KJ7 A;  4ZS9 A;  1LAF E;  4ZEB A;  4WED A;  2FYI A;  1B4Z A;  3Q28 A;  2DVC A;  3K1P A;  3E4R A;  3GBA A;  4I9D A;  2QS3 A;  3V89 B;  2Q2C A;  2DOJ A;  4EXK A;  3K1N A;  3W9V A;  1JNF A;  3WAE A;  1IZ1 A;  1MQH A;  3SER A;  2Y84 A;  1PBQ A;  1QUL A;  4U1Z A;  2UVH A;  1D4N A;  3FV2 A;  4MF3 A;  1OMP A;  3IOR A;  4QSD A;  3OO9 A;  1RYO A;  2ONK E;  2KLF A;  1NNF A;  3E9X A;  1Y20 A;  1A8E A;  4KYD A;  2PBW A;  2PT1 A;  4PFY A;  2ZNU A; 
#chains in the Genus database with same CATH topology
 3OEN A;  4MEV A;  4X1D A;  2DWI A;  4TLL B;  4YZZ A;  2IEE A;  1PB9 A;  3KC1 A;  4N8Y A;  1NH8 A;  1IXH A;  4KXP A;  2QRY A;  1NV3 A;  3PU5 A;  1IME A;  4F1U A;  1SDX A;  4PFT A;  3QSL A;  1B3L A;  4LUB A;  4IGR A;  1DPE A;  1B51 A;  3IAZ A;  5I57 B;  4I62 A;  4OVT A;  3K02 A;  3FAS A;  5I58 B;  1D9Q A;  1B32 A;  1BP5 A;  3K6U A;  1UIV A;  3HPI A;  1GTK A;  3PUW E;  3USD A;  4PET A;  3PUZ E;  3B8B A;  4MBP A;  3ROJ A;  3EPE A;  4ESW A;  3FUZ A;  2V3U A;  3S9L C;  4DLD A;  5CC2 A;  1QKB A;  2Q8J A;  1MXU A;  3MZ1 A;  1O64 A;  3V8X B;  3B50 A;  3K00 A;  3CIJ A;  5DEX A;  5F7V A;  1LAH E;  3FV1 A;  1XS5 A;  3DP8 A;  5H8F B;  3KGC A;  1BKA A;  1ZTY A;  3TAJ A;  5ELV A;  1A55 A;  4JSD A;  3S2V A;  5EQ8 A;  3LC8 A;  3U92 A;  1I6Q A;  2XXV A;  2V4C A;  2E0S A;  2CEX A;  5EQ7 A;  2QVU A;  1FTM A;  3MAM A;  2XXT A;  3EKI A;  1Y3P A;  5TP9 A;  4H6D A;  3KZG A;  4UAC A;  4XKQ A;  1DBZ A;  3EHU A;  1LGB C;  3I3V A;  3OD7 A;  1FRP A;  3ODB A;  2CZL A;  1FW0 A;  1SW4 A;  2PVU A;  1USY E;  3A09 A;  4GBW A;  4TQU Q;  3VE1 B;  3C35 A;  1LAX A;  5KDT B;  1NNK A;  4PP0 A;  4LVQ A;  1R6Z A;  1LLS A;  3OOA A;  4R75 A;  1R1N A;  1DTG A;  2ZNT A;  1LBW A;  1WDN A;  5AA4 B;  3A3U A;  2OCU A;  2YLN A;  4F19 A;  4DI4 B;  5IZ1 A;  3FVO A;  1DSN A;  4ZEK A;  3FIR A;  3MP8 A;  4BDL A;  4LON B;  1Y4C A;  2XXK A;  4ZE8 A;  3N94 A;  4X48 A;  4UA8 A;  3ILU B;  1SD3 A;  4Z7E A;  5I3S A;  1RYX A;  3H6W A;  4NF6 B;  3HO7 A;  5CRY A;  3B6W A;  4NTL A;  4G68 C;  3OO8 A;  4PAI A;  2VGQ A;  5EYH A;  2D3I A;  1XVY A;  2F78 A;  3LV0 A;  4R6Y A;  3E78 A;  1JW1 A;  3SET A;  1WVJ A;  5ET5 A;  4XFE A;  4QRZ A;  5H8Q B;  1D9Y A;  4E0X A;  3CSB A;  2F8D A;  4F39 A;  3FZV A;  4BLA A;  5EQA A;  3MZ9 A;  2OWT A;  1SI0 A;  4MJO A;  1JVX A;  3KSJ A;  5L9O A;  4ESX A;  3FBP A;  4JBZ A;  4R6K A;  3D1R A;  5IGA A;  4IO3 A;  4JSO A;  5I2K B;  2Y7P A;  3HHG A;  3G3F A;  5ICQ A;  3HHF A;  2ZYO A;  4JWO A;  4LAT A;  1ZBM A;  4GF8 A;  1B1H A;  2D5W A;  1FBC A;  4DXB A;  3O66 A;  4N17 A;  3CG1 A;  4FJP A;  5AA2 A;  4PGP A;  1FBP A;  1Q9D A;  5AA3 A;  1P1N A;  3T93 B;  2O7U A;  3PUV E;  1MG1 A;  3K1M A;  1B5H A;  3FGS A;  3MW0 A;  1K9Z A;  4U2R A;  2O68 A;  5JEI A;  2GFE A;  4GXA A;  4Z0I A;  5DVF A;  2B65 A;  4NAP A;  5DT6 A;  4GWW A;  2Y7R A;  3O6G A;  4GLI A;  3MST A;  4NF5 A;  1B7H A;  2DDK A;  3T66 A;  2Z23 A;  1IMD A;  2I4B A;  3RYD A;  3ZKK A;  3IOT A;  1B3G A;  4EQB A;  1FJ6 A;  3K01 A;  1VFE A;  2Q2A A;  4IO7 A;  3O9P A;  1IXC A;  1Y4T A;  2NUV A;  5I84 A;  4NF0 A;  1N84 A;  5IZZ A;  4F3S A;  2HQ0 A;  2O1L A;  3M8U A;  5CBS A;  1B3F A;  3OMB A;  1FQE A;  5CMM A;  2THI A;  3QK6 A;  2ZZW A;  3U72 A;  4R2B A;  3G3H A;  3C9H A;  3ZKL A;  5I56 A;  5HBC A;  1GV8 A;  4OA4 A;  3FXR A;  2XD2 A;  2RKM A;  4QXD A;  1N3X A;  1JVY A;  3UA8 A;  2F7B A;  3IO4 A;  2X7P A;  4AS4 A;  4ND9 A;  1NMU A;  2XXI A;  4PCD A;  4U23 A;  1CNQ A;  1NV4 A;  1QKA A;  1FTO A;  2ONR A;  1UTH A;  3VDF A;  1YYZ A;  2QVV A;  2QFL A;  1A7L A;  3GBB A;  4GBV A;  1RDZ A;  3R26 A;  2WYP A;  3PMX A;  3FJM A;  3TZA A;  4O3B A;  5CM6 A;  5J1D A;  3I5O A;  4GFR A;  2OLB A;  3N6U A;  5EYF A;  1TT1 A;  3MVZ A;  4WEP A;  3H6V A;  4LZ7 A;  5JK4 A;  5EQ9 A;  2HAU A;  2QL3 A;  3W9W A;  5I2N B;  5DW8 A;  1TFD A;  1NUZ A;  3I6V A;  4EF2 A;  4RA1 A;  2I3W A;  1AOV A;  4I8C A;  3PTY A;  2DWA A;  1LEV A;  4BDQ A;  3TCG A;  1MPC A;  4H45 A;  2OK2 A;  3UN6 A;  1I6B A;  4X9T A;  2W7Y A;  3BFU A;  1FCK A;  4JXI A;  2P1S A;  4HS7 A;  4E0W A;  3KC0 A;  3CFX A;  3DEL B;  4GWX A;  4YKI A;  5ET7 A;  2X7Q A;  2F5X A;  2DWJ A;  3O6I A;  4OVJ A;  3VLW A;  1O7T A;  3TTL A;  2AYS A;  4XKR A;  3KOT A;  2XXR A;  4ONY A;  4OXV A;  1VR5 A;  4TOZ A;  2O6A A;  1N04 A;  3O97 A;  3HCQ A;  3GXA A;  5CMK A;  1BIY A;  1NFT A;  2NWJ A;  1ELJ A;  1MDQ A;  2DS9 A;  4DE8 A;  4F3G A;  3ONM A;  4ZEF A;  3SES A;  1FQC A;  1EZP A;  4KCD A;  3PPR A;  1N7X A;  1B9J A;  2ZZX A;  4PFR A;  4QFP A;  4IR8 A;  4KFQ A;  1B1X A;  5M2V A;  3MUQ A;  4LQ2 A;  4OZ9 A;  3RQT A;  3OEM A;  3TKD A;  3Q27 A;  3KOS A;  3N5L A;  1EZO A;  2O51 A;  1T0K A;  1LCT A;  3HFU A;  1MXZ A;  4QHQ A;  5K2X A;  4HXV A;  1Y3Q A;  4HE2 A;  5DVI A;  1TXF A;  1DPP A;  1MY2 A;  4N15 A;  1BK4 A;  3H03 A;  3IFC A;  3IOU A;  1MXV A;  4GL0 A;  4HW8 A;  2KR0 A;  3RTF B;  4YB6 A;  3FJ7 A;  1VFD A;  1DOT A;  1PC3 A;  3BIG A;  2QJE A;  4YB5 A;  5DYH A;  4EUO A;  3MBP A;  2HZK A;  1FPD A;  3IB2 A;  4FEB A;  1OQH A;  4G68 A;  3LUZ A;  4O7I A;  3IJX B;  1O63 A;  3V5A A;  4F3P A;  3DP4 A;  1MY0 A;  5B7D A;  3TFL A;  4UAB A;  3A3C A;  3RLF E;  4AB5 A;  3H4Z A;  3OSR A;  5IM2 A;  1II5 A;  1ANF A;  4DIG A;  4DZ1 A;  5HM4 B;  4BDO A;  4H8I A;  2I4C A;  4YKP A;  3RPL A;  3N6T A;  2AIX A;  1YXI A;  4NED A;  5I5P A;  2GRV A;  1POY 1;  4ZEI A;  4R9G A;  2PFZ A;  1B05 A;  3RUM A;  2P2A A;  3RTW B;  3CRB A;  3PPN A;  4QF9 A;  1B5J A;  3NOH A;  4YKK A;  4RPO A;  4FAJ A;  4Q0C A;  1MPB A;  5IAI A;  3IK6 B;  4GX3 A;  5TPA B;  4OVS A;  2NOO A;  2Q74 A;  3TEP A;  2XXX A;  1OLC A;  4KI0 E;  2XXQ A;  3BBR A;  2PYY A;  1TFA A;  2PCR A;  2V25 A;  3TCF A;  2VD2 A;  4GX4 A;  4KCC A;  4PQJ A;  1OLA A;  4ZZA A;  2LAO A;  3PGF A;  4QFN A;  4P56 A;  1EYK A;  4XEQ A;  4XKP A;  3S9N C;  1NV2 A;  5I56 B;  1HSE A;  5A5L A;  4FED A;  4POX A;  4OHN A;  2BJJ X;  4O3A A;  4EDP A;  2G93 A;  3U1O A;  4ELP A;  2X26 A;  3FD3 A;  1XT8 A;  4AS5 A;  5H8N A;  1UTH B;  3OO6 A;  4H5F A;  2XXW A;  4H46 A;  3TUS A;  3H6U A;  1L5T A;  5F1Q A;  1US4 A;  2I58 A;  5A5X A;  5CMC A;  5I59 A;  2NVU B;  4N6K A;  1FBD A;  2PX1 A;  1MM6 A;  2V3T A;  1Q1K A;  3K2D A;  1B0H A;  1IMC A;  4IY5 A;  3VVD A;  4YMB A;  3TTK A;  1B58 A;  4QBA A;  1S7Y A;  3EHT A;  4YAH X;  3SKP A;  1MXX A;  1FQA A;  3U8Q A;  2NXO A;  4MAG A;  1ZJL A;  4U4X A;  3R6U A;  4H67 A;  1LBZ A;  3KBR A;  1B7Z A;  4R74 A;  2ZNS A;  1R9Q A;  3V83 A;  1MXY A;  3LSL A;  1FTJ A;  2O7I A;  1ATG A;  4GRK A;  1AMF A;  1JW4 A;  1ZU0 A;  1FPL A;  1FTK A;  1RDX A;  2OBG A;  4PGN A;  5ET6 A;  3T9V A;  5IZ3 B;  2XD3 A;  4JWY A;  3RY3 A;  1FBG A;  1MRP A;  2AL4 A;  4EQ7 A;  4IO2 A;  3EN3 A;  1XC1 A;  5AA2 D;  1YZ0 A;  4R9F A;  2WX9 A;  4F1V A;  3IR1 A;  4PC9 A;  4OEN A;  4MNP A;  1AIV A;  3K0V A;  2FVZ A;  4M1V A;  1MQJ A;  1HSL A;  4U1O A;  3JV9 A;  3S9M C;  5JTY A;  1UTB A;  4PAF A;  1EYI A;  4OTE A;  1AL3 A;  1H76 A;  2UYE A;  2QMX A;  1S9T A;  1QW0 A;  5ICT A;  1FPF A;  4ECF A;  1H3D A;  1OVB A;  1IUD A;  3MVX A;  3TTN A;  4PE3 A;  3H6T A;  1IXI A;  1NV6 A;  2Q8M A;  2V84 A;  4JVC A;  1DMB A;  4NWC A;  3TTM A;  1FPE A;  1F9B A;  3SZP A;  2WYK A;  3O2A A;  2QPQ A;  3FVK A;  4G2Z A;  2I6E A;  3MJN A;  1LFI A;  4BDM A;  2H25 A;  2CZK A;  2OWS A;  1NV7 A;  1YPN A;  4DCY A;  1FTL A;  5IKB A;  2O69 A;  4PE5 B;  2XX9 A;  1MY3 A;  2R9J A;  1M5F A;  4XF5 A;  2XWO A;  3H06 B;  2CEY A;  1WOD A;  2DE3 A;  3T96 B;  4G68 B;  4Q5T A;  2HHM A;  3TPA A;  3OEK A;  3C33 A;  4H5G A;  3ZS6 A;  1N0T A;  1AH5 A;  1P1W A;  1H44 A;  2DP8 A;  1LBV A;  1A8F A;  1P1Q A;  3RPL B;  4OMB A;  4O7M A;  2RCA A;  4OFO A;  4FE8 A;  2CMO A;  2HCA A;  2VOZ A;  2QS4 A;  2REJ A;  4G8N A;  4ELO A;  2UYF A;  1FSA A;  4LZ8 A;  2B4L A;  4OFJ A;  4ZDM A;  3OXN A;  2L5V A;  2ONS A;  2I49 A;  4GVO A;  2VT5 A;  1M5D A;  3VXC A;  5HPQ A;  1JEU A;  1LBY A;  2ZYK A;  2VD3 A;  1URS A;  3PD8 A;  3PV0 E;  3M3K A;  1G0H A;  4PBQ A;  3FXU A;  3T22 A;  1FBE A;  5L9M A;  4HE0 A;  1P1O A;  3KJT A;  2H99 A;  3R7X A;  5FTI A;  4F22 A;  1QVS A;  3TCH A;  5EYG A;  2XXY A;  2VPN A;  1B7U A;  3PMV A;  4GWO A;  1B40 A;  4OAN A;  4RK2 A;  3E79 A;  5B70 A;  4IO5 A;  5H8N B;  1Y1Z A;  2RIN A;  2ZXT A;  5KZT A;  1B2H A;  2CZI A;  4PF8 A;  1NNT A;  2XA5 A;  1LBC A;  1MY4 A;  2F35 A;  5DEX B;  1URG A;  2E1S A;  1SI1 A;  4H0W A;  4RNS A;  5A5X B;  4OER A;  4GQO A;  3RN8 A;  1DCU A;  3MP1 A;  4OFL A;  4FBP A;  1D3K A;  1QJM A;  2PFY A;  3CHG A;  4FOR A;  1SW5 A;  2DXY A;  2DSF A;  1GR2 A;  1Z7N E;  3W15 C;  2HEU A;  3PPQ A;  3MVW A;  1QUI A;  5TP9 B;  5AE4 A;  1BLF A;  3KEI A;  2DVZ A;  3RPW A;  3THI A;  3M3F A;  4OYV A;  4F1Y A;  3B7D A;  1YCJ A;  1P1U A;  4OEV A;  2YPN A;  2Y7W A;  1H45 A;  2OZZ A;  1BTJ A;  3G7W A;  1NV5 A;  3G3G A;  4OVQ A;  4DXU A;  1B0L A;  3UIF A;  1CE2 A;  2RF1 A;  3C36 A;  1FPB A;  3MPK A;  5DVJ A;  4K3F A;  1ZLQ A;  4H8J A;  1XHY A;  1JW5 A;  1EYJ A;  2XXP A;  4RPN A;  2Q9T A;  4NG7 A;  2AL5 A;  4QFL A;  2I0C A;  2XWI A;  3S4U A;  3DM0 A;  1FJ9 A;  3VFJ A;  4NE4 A;  4HCW A;  1LCF A;  4TLM B;  1NH7 A;  4FIM A;  4OET A;  1XI6 A;  3TOD A;  3VLV A;  3MQ9 A;  4MCO A;  3ILT B;  1MY1 A;  3LSF B;  2G29 A;  1NKX A;  1UTB B;  5H8H A;  2VHA A;  1SVX B;  3U94 A;  2WBD A;  4XXU A;  3PMW A;  4GOT A;  4GX6 A;  3U93 A;  2HZL A;  4MIJ A;  4N81 A;  4NF8 A;  1XOC A;  2HAV A;  3TEL A;  3K6X A;  1IXG A;  1SW1 A;  1FQD A;  4GD5 A;  1PBP A;  1OIB A;  1S50 A;  1B3E A;  2V3Q A;  1N7W A;  2V93 A;  2B4M A;  3B6Q A;  1RKM A;  1LAG E;  3CSG A;  1MPD A;  4U21 A;  4YKJ A;  3T9U A;  3IO6 A;  1JP4 A;  1XVX A;  1FQB A;  4U22 A;  3BFT A;  3IOV A;  1CB6 A;  2UVJ A;  3FJG A;  3EHS A;  2RCB A;  3OEL A;  3G3I A;  1I6A A;  3O6H A;  3MZB A;  4QSC A;  3GLB A;  5I2K A;  5AA2 B;  1FTA A;  3IOW A;  1N76 A;  5LDZ A;  1PB7 A;  4P8B A;  1MH4 A;  5L9S A;  4R72 A;  1SBP A;  4OVR A;  3C4M A;  2WKY A;  3K4U A;  1FPK A;  4N07 A;  1B4H A;  4HCY A;  4EF1 A;  2DXR A;  3E13 X;  4MH5 A;  4Q30 B;  2FIX A;  4IO4 A;  2XXU A;  3JYR A;  5KCJ A;  4N6P A;  4G8H A;  3UGW A;  4F2Q A;  1J1N A;  2ZMB A;  4N13 A;  2UVG A;  4C1U A;  4MNI A;  2R8T A;  4NX1 A;  1MQI A;  4EXL A;  2UVI A;  5BWJ A;  3VLU A;  4JVD A;  4NF5 B;  1NUW A;  4I40 A;  1IIW A;  2DE4 A;  1MH3 A;  1IMB A;  3C32 A;  3C34 A;  1ZMG A;  4I1D A;  1A40 A;  1Q35 A;  2DE2 A;  1FPJ A;  1MDP 1;  2FHY A;  2XHD A;  3MYU A;  2Q88 A;  4GWY A;  2Z8D A;  3UP9 A;  4YB7 A;  4GL8 A;  3TDJ A;  1PB8 A;  3H3G A;  2H98 A;  1SYH A;  1US5 A;  4P1E A;  2QVR A;  2F7A A;  3Q29 A;  3ISP A;  4G77 A;  5T3J A;  4OWD A;  2JJK A;  3FXB A;  5FHM A;  3IL1 B;  4KYE A;  4HE1 A;  5CBR A;  2QMW A;  3CVG A;  3HST A;  1YTV A;  5DTB A;  3HV1 A;  4WXJ A;  4ZEC A;  4JVI A;  5LOM A;  1VE4 A;  3UOR A;  2R71 A;  1AWB A;  4P3L A;  1ZKB A;  4F18 A;  4NQ8 A;  4POW A;  2GHB A;  2F6G A;  4OEU A;  3TQL A;  1M5B A;  3MPL A;  2ZZV A;  3SEV A;  3DP6 A;  4MLV A;  2Q89 A;  1LB8 A;  4PF6 A;  2IA4 A;  3CFL A;  4C1T A;  1FQF A;  3IFA A;  4Q8R A;  5FHO A;  5ITP A;  4G61 A;  1POT A;  1QUK A;  5TU0 A;  3U65 A;  3QYT A;  3MWB A;  3IX1 A;  3G3J A;  4LP2 B;  3E3K A;  4ZZE A;  1Y1M A;  5ISU A;  5I2N A;  1D9V A;  5FHN A;  1MS7 A;  4X04 A;  4N6D A;  3G3K A;  4P0G A;  2D21 A;  2H9B A;  4PFU A;  2UXA A;  3QIM A;  3LBS A;  4IB2 A;  4N91 A;  3GZG A;  4ELQ A;  1HSJ A;  4BDR A;  2QSX A;  1MQG A;  4XKN A;  3DLN A;  4DXC A;  4IO6 A;  3RT8 A;  3P7I A;  1DTZ A;  2FIE A;  4P11 A;  1IMF A;  4QFO A;  1B46 A;  2A5T A;  3L6H A;  2REG A;  3CFZ A;  3T9X B;  3GYY A;  2P0S A;  5FTH A;  3QAX A;  2F34 A;  4KYS A;  2YJP A;  2CZH A;  1JEV A;  3CG3 A;  4F3B A;  2H5Y A;  1LBX A;  4BDN A;  5H8H B;  4GXS B;  4OES A;  5ITO A;  4C0R A;  3TTR A;  4FEC A;  3S9E A;  2Y5K A;  3D4C A;  4MMP A;  3LUY A;  1B52 A;  4PTK A;  3IB1 A;  4NF8 B;  2I3V A;  4KQP A;  4ZE9 A;  4YIC A;  4AB6 A;  4PFW A;  1EU8 A;  3KN3 A;  1Y3N A;  4GWZ A;  4MHF A;  4MX6 A;  2PMS A;  3Q26 A;  2DQV A;  3BIH A;  4NF4 A;  3FAT A;  4YMA A;  4DCX A;  2XWK A;  1NL5 A;  3EQ1 A;  4KPT A;  2DWH A;  4MFI A;  3SEU A;  1JQF A;  4R6H A;  2XWV A;  4P9K A;  4YU0 A;  2XX8 A;  1SQY A;  4GIZ A;  3QUJ A;  1TWY A;  3AXF A;  4H65 A;  2XX7 A;  3K6W A;  3A29 A;  1K9Y A;  1B3H A;  3QXM A;  3JZJ A;  3TQW A;  3PD9 A;  4O3C A;  3QUF A;  4RK9 A;  1SYI A;  3MVY A;  3TYH A;  3N26 A;  4IGT A;  2ZYN A;  4XIG Q;  1Z7M E;  2GHA A;  4QFK A;  1I69 A;  3HN0 A;  2GH9 A;  5KCJ B;  1NV1 A;  1VSO A;  5EHM A;  4LZ5 A;  1NUY A;  2WEF A;  2F3D A;  4DDD A;  1SW2 A;  1N3W A;  1R9L A;  4GWU A;  5I7I A;  1A99 A;  3KN7 A;  1IEJ A;  2PT2 A;  1LST A;  3VVF A;  3OSQ A;  4OQO A;  4GWS A;  4AQ4 A;  4NWD A;  4M4G A;  3PUX E;  3WAF A;  3O29 A;  1LFG A;  2F3B A;  3FVN A;  4X1B A;  1GGG A;  1ZIU A;  4NN3 A;  4LA9 A;  4F31 B;  4RYA A;  4EQ9 A;  3SDF A;  2HPG A;  3CI8 A;  3IB0 A;  3VVE A;  5TPA A;  3MP6 A;  4N4U A;  4R2F A;  2F97 A;  1YAE A;  3K6V A;  2ANJ A;  2RC9 A;  3SEX A;  4LQ5 A;  3OO7 A;  1INP A;  1FPI A;  3SEW A;  2ALU A;  2MKZ A;  4F29 A;  2ESN A;  2O84 X;  4U4S A;  3F11 A;  3H7M A;  5I57 A;  1KZ8 A;  2P3N A;  4P1L A;  1LFH A;  2WBB A;  5F24 A;  5I58 A;  4HTG A;  5ET8 A;  4JWX A;  2HXW A;  1EH3 A;  5CMB A;  3LSW A;  4O8M A;  1LB9 A;  1RDY A;  3M3L A;  2FA7 A;  2FBP A;  2DYX A;  4O94 A;  3PPP A;  4KR5 A;  1IQ7 A;  4R73 A;  5ESY A;  1IIT A;  4X8R A;  5I59 B;  3D4G A;  2Y7I A;  4NMY A;  1IMA A;  3Q25 A;  3LR1 A;  1A54 A;  1MM7 A;  3KFM A;  3T9H B;  1JET A;  3L6G A;  4ELR A;  5H8F A;  1NV0 A;  2ABH A;  4P0I A;  3RGY A;  2Z8F A;  4MNC A;  2GQ1 A;  5J16 A;  4MLQ A;  3C31 A;  1USY H;  4JB7 A;  2HXR A;  1MXW A;  1GVC A;  2FNC A;  3ECR A;  1OVT A;  2R6G E;  1KWH A;  4IY6 A;  4RXL A;  3KBZ A;  2RC8 A;  2XXH A;  4OVP A;  2Z22 A;  3FVG A;  4H1X A;  3MC2 A;  2B3B A;  1URD A;  4NGU A;  2Z8E A;  3LSX A;  4PFB A;  1Y9U A;  1SPI A;  3IJO B;  3KSX A;  4QSE A;  1M5C A;  2F6P A;  1FBH A;  2M8C A;  4P47 A;  3O28 A;  4NHB A;  2RC7 A;  3UK4 A;  1UIU A;  4PDD A;  1G0I A;  3RNN A;  2H4I A;  3EF7 A;  4XTC Q;  5AA1 A;  1H43 A;  2A5T B;  1EZ9 A;  4KHZ E;  4PBH A;  3PPO A;  4I3Y A;  2QS1 A;  3B6T A;  5KDT A;  4PAK A;  2O1M A;  2QS2 A;  2OWZ A;  2ZYM A;  5IZ3 A;  4I3E A;  1VDW A;  5CI5 A;  3KG2 A;  3SEY A;  5AA4 A;  5EHS A;  4ISU A;  5JTY B;  1NNP A;  5FBP A;  4FAT A;  2VP1 A;  1NUX A;  1B6H A;  4PFI A;  1QUJ A;  2BJI A;  1FBF A;  2OX3 A;  2F36 A;  3CR9 A;  4KD5 A;  4WKM A;  5L8D A;  4NF6 A;  3QMF A;  3ZSF A;  4G4P A;  3FXQ A;  3VV5 A;  2B3F A;  4THI A;  4RJZ A;  1PDA A;  2A5S A;  4L17 A;  2P3V A;  5H8S A;  4NF4 B;  5BUU A;  2F7C A;  1M5E A;  1MQD A;  4G8M A;  4LN5 A;  3RT6 B;  5H8Q A;  3PUY E;  4JDF A;  4RY1 A;  1UQW A;  2I0B A;  2VPO A;  3VXB A;  5LTC A;  1KA0 A;  3T0J A;  4F2O A;  5K2Y A;  2Y7K A;  1P99 A;  2OJT A;  3TMG A;  4ZED A;  3KN8 A;  1OQG A;  2KQZ A;  2I48 A;  3BKI B;  1B5I A;  1LBB A;  1PEB A;  1FPG A;  2HFB A;  3KJ7 A;  4ZS9 A;  1LAF E;  4ZEB A;  4WED A;  4DI3 D;  2FYI A;  1B4Z A;  3Q28 A;  2DVC A;  3T1B A;  3K1P A;  4N8G A;  1NI9 A;  3E4R A;  3GBA A;  4I9D A;  2QS3 A;  3V89 B;  2Q2C A;  2DOJ A;  4EXK A;  3K1N A;  3W9V A;  1JNF A;  3WAE A;  1IZ1 A;  1KA1 A;  1MQH A;  3SER A;  2Y84 A;  1PBQ A;  1QUL A;  4U1Z A;  2UVH A;  1D4N A;  3FV2 A;  4MF3 A;  1OMP A;  4QSD A;  3IOR A;  3OO9 A;  1RYO A;  4PDH A;  2ONK E;  2Y5L A;  2KLF A;  1NNF A;  3E9X A;  1Y20 A;  1QGX A;  1DK4 A;  1A8E A;  4KYD A;  2PBW A;  2PT1 A;  4PFY A;  2ZNU A; 
#chains in the Genus database with same CATH homology
 3OEN A;  4X1D A;  2DWI A;  4TLL B;  4YZZ A;  2IEE A;  1PB9 A;  1NH8 A;  1IXH A;  2QRY A;  3PU5 A;  4F1U A;  1SDX A;  4PFT A;  3QSL A;  1B3L A;  4LUB A;  4IGR A;  1DPE A;  1B51 A;  3IAZ A;  5I57 B;  4I62 A;  5I58 B;  3K02 A;  3FAS A;  1B32 A;  1BP5 A;  3K6U A;  1UIV A;  3HPI A;  1GTK A;  3PUW E;  3USD A;  4PET A;  3PUZ E;  4MBP A;  3EPE A;  4ESW A;  3FUZ A;  2V3U A;  3S9L C;  4DLD A;  5CC2 A;  1QKB A;  2Q8J A;  1MXU A;  3MZ1 A;  1O64 A;  3V8X B;  3K00 A;  3CIJ A;  5DEX A;  5F7V A;  1LAH E;  3FV1 A;  1XS5 A;  3DP8 A;  5H8F B;  3KGC A;  1BKA A;  1ZTY A;  3TAJ A;  5ELV A;  1A55 A;  4JSD A;  3S2V A;  3LC8 A;  3U92 A;  1I6Q A;  2XXV A;  2E0S A;  1FTM A;  3MAM A;  2XXT A;  1Y3P A;  5TP9 A;  4H6D A;  3KZG A;  4UAC A;  4XKQ A;  3EHU A;  1LGB C;  3I3V A;  3OD7 A;  3ODB A;  2CZL A;  1FW0 A;  1SW4 A;  2PVU A;  1USY E;  3A09 A;  4TQU Q;  3VE1 B;  3C35 A;  1LAX A;  5KDT B;  1NNK A;  4PP0 A;  4LVQ A;  1R6Z A;  1LLS A;  3OOA A;  4R75 A;  1R1N A;  1DTG A;  2ZNT A;  1WDN A;  5AA4 B;  3A3U A;  2OCU A;  2YLN A;  4F19 A;  3FVO A;  1DSN A;  4ZEK A;  3FIR A;  3MP8 A;  4BDL A;  4LON B;  1Y4C A;  4ZE8 A;  3N94 A;  4X48 A;  4UA8 A;  3ILU B;  1SD3 A;  4Z7E A;  1RYX A;  3H6W A;  4NF6 B;  3HO7 A;  5CRY A;  3B6W A;  4NTL A;  4G68 C;  3OO8 A;  2VGQ A;  2D3I A;  1XVY A;  2F78 A;  4R6Y A;  1JW1 A;  3SET A;  1WVJ A;  4QRZ A;  5H8Q B;  1D9Y A;  4E0X A;  3CSB A;  2F8D A;  4F39 A;  3FZV A;  4BLA A;  3MZ9 A;  2OWT A;  1SI0 A;  1JVX A;  3KSJ A;  5L9O A;  4ESX A;  4JBZ A;  4R6K A;  4IO3 A;  4JSO A;  5I2K B;  2Y7P A;  3HHG A;  3G3F A;  5ICQ A;  3HHF A;  2ZYO A;  4JWO A;  4LAT A;  1ZBM A;  4GF8 A;  1B1H A;  2D5W A;  4DXB A;  3O66 A;  3CG1 A;  4FJP A;  5AA2 A;  5AA3 A;  1P1N A;  3T93 B;  2O7U A;  3PUV E;  1MG1 A;  3K1M A;  1B5H A;  3FGS A;  3MW0 A;  4U2R A;  2O68 A;  5JEI A;  2GFE A;  4GXA A;  4Z0I A;  5DVF A;  2B65 A;  5DT6 A;  2Y7R A;  3O6G A;  4GLI A;  4NF5 A;  1B7H A;  3T66 A;  2Z23 A;  2I4B A;  3ZKK A;  3IOT A;  1B3G A;  4EQB A;  3K01 A;  1VFE A;  2Q2A A;  4IO7 A;  3O9P A;  1IXC A;  1Y4T A;  2NUV A;  5I84 A;  1N84 A;  4F3S A;  2HQ0 A;  2O1L A;  3M8U A;  5CBS A;  1B3F A;  3OMB A;  1FQE A;  5CMM A;  2THI A;  3QK6 A;  3U72 A;  4R2B A;  3G3H A;  3C9H A;  3ZKL A;  5I56 A;  5HBC A;  1GV8 A;  3FXR A;  2XD2 A;  2RKM A;  1N3X A;  1JVY A;  3UA8 A;  2F7B A;  3IO4 A;  2X7P A;  4ND9 A;  1NMU A;  2XXI A;  4U23 A;  1QKA A;  1FTO A;  2ONR A;  1UTH A;  3VDF A;  1A7L A;  3GBB A;  3R26 A;  3PMX A;  3FJM A;  3TZA A;  4O3B A;  5CM6 A;  5J1D A;  3I5O A;  4GFR A;  2OLB A;  3N6U A;  5EYF A;  1TT1 A;  3MVZ A;  4WEP A;  3H6V A;  4LZ7 A;  5JK4 A;  2HAU A;  2QL3 A;  3W9W A;  5I2N B;  1TFD A;  3I6V A;  4EF2 A;  4RA1 A;  2I3W A;  1AOV A;  4I8C A;  2DWA A;  4BDQ A;  3TCG A;  1MPC A;  2OK2 A;  3UN6 A;  1I6B A;  4X9T A;  2W7Y A;  3BFU A;  1FCK A;  4JXI A;  2P1S A;  4HS7 A;  4E0W A;  3CFX A;  3DEL B;  4YKI A;  2X7Q A;  2F5X A;  2DWJ A;  3O6I A;  4OVJ A;  3VLW A;  1O7T A;  3TTL A;  2AYS A;  4XKR A;  3KOT A;  2XXR A;  4ONY A;  4OXV A;  1VR5 A;  4TOZ A;  2O6A A;  1N04 A;  3O97 A;  3HCQ A;  3GXA A;  5CMK A;  1BIY A;  1NFT A;  2NWJ A;  1ELJ A;  1MDQ A;  2DS9 A;  4DE8 A;  4F3G A;  3ONM A;  4ZEF A;  3SES A;  1FQC A;  1EZP A;  4KCD A;  3PPR A;  1N7X A;  1B9J A;  4QFP A;  4KFQ A;  1B1X A;  5M2V A;  3MUQ A;  4LQ2 A;  4OZ9 A;  3RQT A;  3OEM A;  3TKD A;  3Q27 A;  3KOS A;  3N5L A;  1EZO A;  2O51 A;  1T0K A;  1LCT A;  1MXZ A;  4QHQ A;  5K2X A;  1Y3Q A;  5DVI A;  1TXF A;  1DPP A;  1MY2 A;  3H03 A;  3IOU A;  1MXV A;  4GL0 A;  4HW8 A;  3RTF B;  4YB6 A;  3FJ7 A;  1VFD A;  1DOT A;  1PC3 A;  2QJE A;  4YB5 A;  5DYH A;  4EUO A;  3MBP A;  2HZK A;  3IB2 A;  4FEB A;  1OQH A;  4G68 A;  3IJX B;  1O63 A;  3V5A A;  4F3P A;  3DP4 A;  1MY0 A;  5B7D A;  3TFL A;  4AB5 A;  3A3C A;  3RLF E;  3H4Z A;  3OSR A;  1II5 A;  1ANF A;  4DIG A;  4DZ1 A;  5HM4 B;  4BDO A;  4H8I A;  2I4C A;  4YKP A;  3N6T A;  2AIX A;  4NED A;  2GRV A;  1POY 1;  4ZEI A;  4R9G A;  1B05 A;  3RUM A;  2P2A A;  3RTW B;  3CRB A;  3PPN A;  4QF9 A;  1B5J A;  4YKK A;  4RPO A;  4FAJ A;  4Q0C A;  1MPB A;  5IAI A;  3IK6 B;  5TPA B;  2NOO A;  3TEP A;  2XXX A;  1OLC A;  4KI0 E;  2XXQ A;  3BBR A;  2PYY A;  1TFA A;  2V25 A;  3TCF A;  2VD2 A;  4KCC A;  4PQJ A;  1OLA A;  4ZZA A;  2LAO A;  3PGF A;  4QFN A;  4XKP A;  3S9N C;  5I56 B;  1HSE A;  4FED A;  4POX A;  4OHN A;  2BJJ X;  4O3A A;  4EDP A;  2G93 A;  3U1O A;  4ELP A;  2X26 A;  3FD3 A;  1XT8 A;  5H8N A;  1UTH B;  3OO6 A;  4H5F A;  2XXW A;  3TUS A;  3H6U A;  1L5T A;  5F1Q A;  1US4 A;  2I58 A;  5A5X A;  5CMC A;  5I59 A;  2NVU B;  2PX1 A;  1MM6 A;  2V3T A;  1Q1K A;  3K2D A;  1B0H A;  4IY5 A;  3VVD A;  4YMB A;  3TTK A;  1B58 A;  1S7Y A;  3EHT A;  4YAH X;  3SKP A;  1MXX A;  1FQA A;  3U8Q A;  2NXO A;  1ZJL A;  4U4X A;  3R6U A;  4H67 A;  3KBR A;  1B7Z A;  4R74 A;  2ZNS A;  1R9Q A;  3V83 A;  1MXY A;  3LSL A;  1FTJ A;  2O7I A;  1ATG A;  4GRK A;  1AMF A;  1JW4 A;  1ZU0 A;  1FTK A;  2OBG A;  3T9V A;  2XD3 A;  4JWY A;  3RY3 A;  4EQ7 A;  1MRP A;  2AL4 A;  4IO2 A;  3EN3 A;  1XC1 A;  5AA2 D;  4R9F A;  4F1V A;  3IR1 A;  4OEN A;  1AIV A;  3K0V A;  4M1V A;  1MQJ A;  1HSL A;  4U1O A;  3JV9 A;  3S9M C;  5JTY A;  1UTB A;  4OTE A;  1AL3 A;  1H76 A;  2UYE A;  2QMX A;  1S9T A;  1QW0 A;  5ICT A;  4ECF A;  1H3D A;  1OVB A;  1IUD A;  3MVX A;  3TTN A;  3H6T A;  1IXI A;  2V84 A;  1DMB A;  4NWC A;  3TTM A;  1F9B A;  3O2A A;  2QPQ A;  3FVK A;  4G2Z A;  2I6E A;  3MJN A;  1LFI A;  4BDM A;  2H25 A;  2OWS A;  1YPN A;  4DCY A;  1FTL A;  5IKB A;  2O69 A;  4PE5 B;  2XX9 A;  1MY3 A;  2R9J A;  1M5F A;  3H06 B;  1WOD A;  2DE3 A;  3T96 B;  4G68 B;  4Q5T A;  3TPA A;  3OEK A;  3C33 A;  4H5G A;  3ZS6 A;  1N0T A;  1AH5 A;  1P1W A;  1H44 A;  2DP8 A;  1A8F A;  1P1Q A;  4OMB A;  2RCA A;  4OFO A;  4FE8 A;  2CMO A;  2HCA A;  2VOZ A;  2QS4 A;  2REJ A;  4G8N A;  4ELO A;  2UYF A;  4LZ8 A;  4OFJ A;  4ZDM A;  3OXN A;  2ONS A;  2I49 A;  4GVO A;  1M5D A;  3VXC A;  5HPQ A;  1JEU A;  2ZYK A;  2VD3 A;  1URS A;  3PD8 A;  3PV0 E;  3M3K A;  3FXU A;  3T22 A;  5L9M A;  1P1O A;  3KJT A;  2H99 A;  3R7X A;  5FTI A;  4F22 A;  1QVS A;  3TCH A;  2XXY A;  1B7U A;  3PMV A;  4GWO A;  1B40 A;  4RK2 A;  5B70 A;  4IO5 A;  5H8N B;  1Y1Z A;  2RIN A;  2ZXT A;  5KZT A;  1B2H A;  1NNT A;  1LBC A;  1MY4 A;  2F35 A;  5DEX B;  1URG A;  2E1S A;  1SI1 A;  4H0W A;  4RNS A;  5A5X B;  4OER A;  4GQO A;  3RN8 A;  3MP1 A;  4OFL A;  1D3K A;  1QJM A;  4FOR A;  1SW5 A;  2DXY A;  2DSF A;  1GR2 A;  1Z7N E;  3W15 C;  2HEU A;  3PPQ A;  3MVW A;  1QUI A;  5TP9 B;  5AE4 A;  1BLF A;  3KEI A;  2DVZ A;  3RPW A;  3THI A;  3M3F A;  4OYV A;  4F1Y A;  3B7D A;  1YCJ A;  1P1U A;  4OEV A;  2YPN A;  2Y7W A;  1H45 A;  2OZZ A;  1BTJ A;  3G7W A;  3G3G A;  4DXU A;  1B0L A;  3UIF A;  1CE2 A;  2RF1 A;  3C36 A;  3MPK A;  5DVJ A;  4K3F A;  1ZLQ A;  4H8J A;  1XHY A;  1JW5 A;  2XXP A;  4RPN A;  2Q9T A;  2AL5 A;  4QFL A;  2I0C A;  3S4U A;  3DM0 A;  3VFJ A;  4NE4 A;  4HCW A;  1LCF A;  4TLM B;  1NH7 A;  4FIM A;  4OET A;  3TOD A;  3VLV A;  3MQ9 A;  3ILT B;  1MY1 A;  3LSF B;  2G29 A;  1NKX A;  1UTB B;  5H8H A;  2VHA A;  1SVX B;  3U94 A;  4XXU A;  3PMW A;  4GOT A;  3U93 A;  2HZL A;  4NF8 A;  1XOC A;  2HAV A;  3TEL A;  3K6X A;  1IXG A;  1SW1 A;  1FQD A;  4GD5 A;  1PBP A;  1OIB A;  1S50 A;  1B3E A;  2V3Q A;  1N7W A;  2V93 A;  3B6Q A;  1RKM A;  1LAG E;  3CSG A;  1MPD A;  4U21 A;  4YKJ A;  3T9U A;  3IO6 A;  1XVX A;  1FQB A;  4U22 A;  3BFT A;  3IOV A;  1CB6 A;  2UVJ A;  3FJG A;  3EHS A;  2RCB A;  3OEL A;  3G3I A;  1I6A A;  3O6H A;  3MZB A;  4QSC A;  3GLB A;  5I2K A;  5AA2 B;  3IOW A;  1N76 A;  1PB7 A;  1MH4 A;  5L9S A;  4R72 A;  1SBP A;  3C4M A;  2WKY A;  3K4U A;  4N07 A;  1B4H A;  4HCY A;  4EF1 A;  2DXR A;  3E13 X;  4MH5 A;  4Q30 B;  4IO4 A;  2XXU A;  3JYR A;  5KCJ A;  4N6P A;  4G8H A;  3UGW A;  4F2Q A;  1J1N A;  2ZMB A;  4N13 A;  2UVG A;  4C1U A;  1MQI A;  4EXL A;  2UVI A;  5BWJ A;  3VLU A;  4NF5 B;  1IIW A;  2DE4 A;  1MH3 A;  3C32 A;  3C34 A;  1ZMG A;  4I1D A;  1A40 A;  1Q35 A;  2DE2 A;  1MDP 1;  2XHD A;  2Q88 A;  2Z8D A;  3UP9 A;  4YB7 A;  4GL8 A;  3TDJ A;  1PB8 A;  3H3G A;  2H98 A;  1SYH A;  1US5 A;  2F7A A;  3Q29 A;  4G77 A;  4OWD A;  5FHM A;  3IL1 B;  4KYE A;  5CBR A;  2QMW A;  3CVG A;  3HST A;  1YTV A;  5DTB A;  3HV1 A;  4WXJ A;  4ZEC A;  5LOM A;  1VE4 A;  3UOR A;  2R71 A;  1ZKB A;  4F18 A;  4POW A;  2GHB A;  2F6G A;  4OEU A;  3TQL A;  1M5B A;  3MPL A;  3SEV A;  3DP6 A;  4MLV A;  2Q89 A;  1LB8 A;  2IA4 A;  3CFL A;  4C1T A;  1FQF A;  4Q8R A;  5FHO A;  5ITP A;  1POT A;  1QUK A;  5TU0 A;  3QYT A;  3MWB A;  3IX1 A;  3G3J A;  4LP2 B;  3E3K A;  4ZZE A;  1Y1M A;  5ISU A;  5I2N A;  1D9V A;  5FHN A;  1MS7 A;  3G3K A;  4P0G A;  2D21 A;  2H9B A;  4PFU A;  2UXA A;  3QIM A;  3LBS A;  4IB2 A;  3GZG A;  4ELQ A;  1HSJ A;  4BDR A;  2QSX A;  1MQG A;  4XKN A;  3DLN A;  4DXC A;  4IO6 A;  3RT8 A;  3P7I A;  1DTZ A;  4P11 A;  4QFO A;  1B46 A;  2A5T A;  3L6H A;  2REG A;  3CFZ A;  3T9X B;  2P0S A;  5FTH A;  3QAX A;  2F34 A;  4KYS A;  2YJP A;  1JEV A;  3CG3 A;  4F3B A;  2H5Y A;  4BDN A;  5H8H B;  4GXS B;  4OES A;  5ITO A;  4C0R A;  3TTR A;  4FEC A;  3S9E A;  3D4C A;  3LUY A;  1B52 A;  3IB1 A;  4NF8 B;  2I3V A;  4KQP A;  4ZE9 A;  4YIC A;  4AB6 A;  4PFW A;  1EU8 A;  3KN3 A;  1Y3N A;  2PMS A;  3Q26 A;  2DQV A;  4NF4 A;  3FAT A;  4YMA A;  4DCX A;  1NL5 A;  3EQ1 A;  4KPT A;  2DWH A;  4MFI A;  3SEU A;  1JQF A;  4R6H A;  4YU0 A;  2XX8 A;  1SQY A;  4GIZ A;  3QUJ A;  1TWY A;  3AXF A;  4H65 A;  2XX7 A;  3K6W A;  1B3H A;  3QXM A;  3JZJ A;  3TQW A;  3PD9 A;  4O3C A;  3QUF A;  4RK9 A;  1SYI A;  3MVY A;  3TYH A;  3N26 A;  4IGT A;  2ZYN A;  4XIG Q;  1Z7M E;  2GHA A;  4QFK A;  1I69 A;  3HN0 A;  2GH9 A;  5KCJ B;  1VSO A;  5EHM A;  4LZ5 A;  4DDD A;  1SW2 A;  1N3W A;  1R9L A;  1A99 A;  3KN7 A;  1IEJ A;  2PT2 A;  1LST A;  3VVF A;  3OSQ A;  4OQO A;  4AQ4 A;  4NWD A;  4M4G A;  3PUX E;  3WAF A;  3O29 A;  1LFG A;  3FVN A;  4X1B A;  1GGG A;  1ZIU A;  4LA9 A;  4F31 B;  4RYA A;  4EQ9 A;  3SDF A;  3CI8 A;  3IB0 A;  3VVE A;  5TPA A;  3MP6 A;  4R2F A;  2F97 A;  1YAE A;  3K6V A;  2ANJ A;  2RC9 A;  3SEX A;  4LQ5 A;  3OO7 A;  3SEW A;  2ALU A;  4F29 A;  2ESN A;  2O84 X;  4U4S A;  3F11 A;  3H7M A;  5I57 A;  1LFH A;  5I58 A;  4HTG A;  4JWX A;  2HXW A;  1EH3 A;  5CMB A;  3LSW A;  1LB9 A;  3M3L A;  2FA7 A;  2DYX A;  3PPP A;  4KR5 A;  1IQ7 A;  4R73 A;  1IIT A;  5I59 B;  3D4G A;  2Y7I A;  4NMY A;  3Q25 A;  3LR1 A;  1A54 A;  1MM7 A;  3KFM A;  3T9H B;  1JET A;  3L6G A;  4ELR A;  5H8F A;  2ABH A;  4P0I A;  3RGY A;  2Z8F A;  4MLQ A;  3C31 A;  1USY H;  4JB7 A;  1GVC A;  1MXW A;  2FNC A;  3ECR A;  1OVT A;  2R6G E;  1KWH A;  4IY6 A;  4RXL A;  2RC8 A;  2XXH A;  2Z22 A;  3FVG A;  4H1X A;  3MC2 A;  2B3B A;  1URD A;  2Z8E A;  3LSX A;  1Y9U A;  3IJO B;  3KSX A;  4QSE A;  1M5C A;  2F6P A;  2M8C A;  3O28 A;  2RC7 A;  3UK4 A;  1UIU A;  3RNN A;  2H4I A;  3EF7 A;  4XTC Q;  5AA1 A;  1H43 A;  2A5T B;  1EZ9 A;  4KHZ E;  3PPO A;  2QS1 A;  3B6T A;  5KDT A;  2O1M A;  2QS2 A;  2ZYM A;  5CI5 A;  3KG2 A;  3SEY A;  5AA4 A;  5EHS A;  4ISU A;  5JTY B;  1NNP A;  4FAT A;  2VP1 A;  1B6H A;  1QUJ A;  2F36 A;  3CR9 A;  4KD5 A;  4WKM A;  5L8D A;  4NF6 A;  3ZSF A;  4G4P A;  3FXQ A;  3VV5 A;  2B3F A;  4THI A;  4RJZ A;  1PDA A;  2A5S A;  4L17 A;  5H8S A;  4NF4 B;  5BUU A;  2F7C A;  1M5E A;  1MQD A;  4G8M A;  3RT6 B;  5H8Q A;  3PUY E;  4JDF A;  4RY1 A;  1UQW A;  2I0B A;  3VXB A;  4F2O A;  5K2Y A;  2Y7K A;  1P99 A;  2OJT A;  3TMG A;  4ZED A;  3KN8 A;  1OQG A;  3BKI B;  2I48 A;  1B5I A;  1LBB A;  1PEB A;  2HFB A;  3KJ7 A;  4ZS9 A;  1LAF E;  4ZEB A;  4WED A;  2FYI A;  1B4Z A;  3Q28 A;  2DVC A;  3K1P A;  3E4R A;  3GBA A;  4I9D A;  2QS3 A;  3V89 B;  2Q2C A;  2DOJ A;  4EXK A;  3K1N A;  3W9V A;  1JNF A;  3WAE A;  1IZ1 A;  1MQH A;  3SER A;  2Y84 A;  1PBQ A;  1QUL A;  4U1Z A;  2UVH A;  1D4N A;  3FV2 A;  4MF3 A;  1OMP A;  3IOR A;  4QSD A;  3OO9 A;  1RYO A;  2ONK E;  2KLF A;  1NNF A;  3E9X A;  1Y20 A;  1A8E A;  4KYD A;  2PBW A;  2PT1 A;  4PFY A;  2ZNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...