4R9GA

Cpmnbp1 with mannotriose bound
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
401
structure length
394
Chain Sequence
QVVLTLWYPWAGPDGDAVVSLAKEYSKTHPNVQIKAQMVSGAGIAAKFLSAVAAGNPPDLVLYWGQDALPGLADQGAIIPLDDYLKDVDTSKFFEAAYNAMKYKGKIYGLPEMVNVRVLFWNKDLFKQAGLDPNTPPKTIAELDQMAAKLTKTKNGTIEQMGFIPWIGQGVPHVMAGVFGTSLVDSNGNPILSPDKNPQLLNLLKWEVSYSDKYGAMNINKFIAGMSQNSSQANDPFVLGKVAMMISGEWQINANKQYNPKLNFGVGPIPQAPGGKPMPSLMDGNTWMIPKGSKHPQEAMDFIKWTMDPQRIADTADKVYNIAPIVEAAKIQKLNNDPYFKEVLNVAQKGSIYYTPAAKGMLSTETAANNAFQAAQYKKSTPEQALKNAQAEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Basis for Mannan Utilization by Caldanaerobius polysaccharolyticus Strain ATCC BAA-17.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
molecule tags Sugar binding protein
molecule keywords MBP1
total genus 126
structure length 394
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r9gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r9gA01
1MXZA 3FZVA 3K4UA 3GBBA 3A3CA 4ONYA 1IXGA 5AA2D 1FQEA 1MDQA 3K0VA 4IO6A 1H76A 3VDFA 1MY1A 1P99A 4R73A 2RCAA 4M4GA 4Q5TA 5FTIA 3WAFA 1JETA 4IGRA 3EHSA 3K6VA 4GVOA 1B4HA 3RTWB 5DVIA 3Q26A 3U8QA 4XKPA 1N0TA 2H99A 4NF6B 1IIWA 5CMKA 5H8NA 1US4A 2OCUA 4GL0A 4ZZAA 1UTBA 1ZJLA 4Z0IA 4R75A 3UN6A 2QS4A 3CFZA 2LAOA 2PYYA 1GTKA 4OVJA 2ANJA 4KQPA 5TP9B 3G7WA 3MPLA 2A5TA 1SW4A 5KDTB 1S7YA 3FUZA 1A7LA 3TTNA 1QVSA 3IX1A 3TCGA 3ECRA 1FQDA 4FAJA 3ZSFA 1UIVA 5TPAA 2VD3A 3KBRA 4EXLA 4ZE9A 1MQHA 3GZGA 3MC2A 3BKIB 4I9DA 2DSFA 1IZ1A 1YAEA 2ABHA 3FJMA 3Q25A 1PB8A 4KYEA 1EZ9A 4G8NA 4N6PA 4F3SA 4OESA 4OETA 5I59B 3N26A 1MG1A 5TP9A 2P1SA 2A5SA 1II5A 2OZZA 3M3FA 4MFIA 3P7IA 3UORA 3G3FA 3IK6B 4C1TA 5FHMA 3DM0A 1XS5A 4IO7A 5I2NA 4YB5A 4BDNA 2Q2CA 2XXYA 4LZ8A 1CE2A 4XIGQ 2NXOA 1B58A 3V5AA 3Q27A 5A5XA 2O1MA 1PB9A 2IEEA 1FQBA 1Y3PA 2O7UA 1NH7A 4OERA 3RT8A 4WXJA 3T22A 5ICQA 1QUIA 3D4CA 3PUWE 1B5IA 4HCYA 2REJA 4KHZE 2B3BA 1EU8A 4OFOA 3OXNA 1EZPA 3BFUA 4LZ5A 3EN3A 4POWA 2WKYA 2XXHA 1MXYA 3ONMA 3IORA 2NOOA 1OIBA 4U1OA 3VVDA 2Y7KA 2NUVA 2FA7A 2F7CA 3E3KA 3HN0A 3QXMA 1I6BA 5L9MA 4ZE8A 3KJTA 1FQAA 2Q2AA 1ZKBA 2AYSA 3K1NA 3WAEA 4TLMB 4G68B 1EH3A 1LCFA 3MZ1A 3PUVE 2F5XA 1R9QA 3H4ZA 3IB0A 3ZKLA 1B4ZA 1OVBA 3KOSA 4KI0E 1B5HA 2V3TA 5H8HA 2ZYOA 5CM6A 3TTMA 1ELJA 2V3UA 1MPBA 4MBPA 1BTJA 1SQYA 3VE1B 1B05A 3U93A 5AA1A 1PDAA 4DDDA 3S4UA 1B3HA 2NWJA 3H06B 4NF8B 2OLBA 2F8DA 4KCCA 4E0XA 4F1VA 1B3EA 5JTYA 1Y1ZA 3W15C 3T96B 4FATA 1D9VA 4BDMA 1B2HA 3Q28A 5EHMA 1CB6A 4NF6A 3VVEA 3Q29A 2E1SA 2HZLA 2D21A 2Y7WA 3FXRA 1MY4A 3HV1A 4H5GA 3LSWA 4NF8A 3VXBA 4ZZEA 1PBPA 3TTKA 5I2KA 2UVIA 4ELOA 3TELA 5BUUA 2E0SA 3U94A 3MAMA 2DS9A 3OSQA 3KZGA 5TU0A 4JBZA 4PFYA 5I56B 2UXAA 3VLWA 3IOTA 4BDQA 1SW5A 1Y3NA 1POY1 3IB2A 4RK9A 1UIUA 2OK2A 1SI0A 2R9JA 4HW8A 3VFJA 3V83A 2HFBA 1N3WA 1NKXA 4IO2A 1I6AA 1USYE 4OZ9A 4NWDA 1JW4A 1TFDA 2UYEA 2XX8A 3K00A 1MQIA 3FVKA 3IOUA 3CG1A 4R9GA 3IL1B 4YKPA 2AIXA 4L17A 1TFAA 4JSDA 2CZLA 2I4CA 4YKJA 4FE8A 3DP4A 1B32A 3FJGA 4PETA 2O68A 4P0IA 1FW0A 2V84A 1LCTA 4ZEFA 1M5EA 3C32A 1QW0A 1WDNA 1HSEA 3PUYE 3I6VA 4DXBA 2HAVA 1Q35A 3B6WA 5CMBA 3EHTA 4R72A 2DYXA 4MLVA 3K6UA 1N7WA 1JW1A 4HTGA 5M2VA 1JW5A 3LBSA 3O9PA 2HAUA 1HSLA 3KN7A 4THIA 5FHOA 2BJJX 3H3GA 3TQWA 4BLAA 1B6HA 1D3KA 3H7MA 2GRVA 4RPOA 2Y7PA 1BLFA 2F78A 1DTGA 1LFHA 1FTLA 3PMXA 1IEJA 4G68A 4GL8A 1BKAA 4U21A 2HEUA 1SYIA 3MVWA 5AA4A 5KDTA 2H4IA 2ONSA 2O1LA 3C36A 2Q9TA 2O7IA 2Q8JA 2XD3A 3F11A 1R9LA 1MQJA 3DP6A 3V89B 1Z7ME 2XXUA 3HSTA 2ZNUA 3U1OA 3IOWA 4RXLA 3D4GA 4FIMA 2DVCA 1Y4CA 4NWCA 4UA8A 3LSXA 4KCDA 2QMWA 2DXRA 1MY2A 4FECA 2A5TB 3KN8A 3H6UA 1JVXA 4GFRA 4MLQA 4GD5A 3K6WA 5AA2B 4PP0A 4H0WA 3SEXA 1B52A 4LA9A 1MM6A 2XXXA 2Y84A 3TFLA 3L6GA 3TEPA 2YLNA 4OTEA 2H98A 5H8SA 1J1NA 1TT1A 1MXUA 2V25A 2ZMBA 2VP1A 3OSRA 3OO9A 3G3IA 3RN8A 3RGYA 4JWOA 5KZTA 1MXWA 4F3BA 2D3IA 3K02A 4U4SA 4R6YA 3AXFA 2V93A 2PMSA 1RYXA 3CG3A 4NE4A 1JNFA 3ILUB 2B3FA 4RPNA 2R6GE 3MP6A 1QUKA 3CR9A 1NFTA 3UA8A 5IAIA 2DE2A 4NF4B 1DPEA 4U22A 3VLUA 4DZ1A 1MH3A 4QF9A 1NH8A 1B7ZA 5EHSA 4ELQA 5K2XA 1ATGA 4K3FA 4FJPA 4KR5A 1SD3A 4EQ9A 4G2ZA 4YKKA 5CI5A 1FQCA 5H8QB 2XXIA 2GHAA 3PUXE 2XXWA 3N6TA 4FORA 5ELVA 4YZZA 3ZKKA 1VR5A 3CVGA 4U23A 5ITOA 2DWJA 4MF3A 4F18A 3U92A 3H03A 1A99A 3I3VA 1BP5A 3IO4A 1H3DA 3FATA 4NTLA 4X1BA 3PV0E 1OVTA 2O69A 1B3LA 1MDP1 2V3QA 4QFPA 2F97A 4C1UA 4F2QA 2CMOA 1P1OA 3MP8A 4LVQA 2I4BA 5H8QA 3CI8A 2VHAA 1MRPA 4QSEA 4XKNA 4ESXA 4P0GA 1MPDA 3T9HB 2HQ0A 5DYHA 3JYRA 4OYVA 1IXHA 2DXYA 3IR1A 2X7QA 3VV5A 3CFLA 3T9VA 4EQBA 4Q8RA 3FV2A 4DXUA 4I62A 4EUOA 3RNNA 4KFQA 5B7DA 1B1HA 3PPNA 3QIMA 4NEDA 4IB2A 1L5TA 3G3KA 3MVYA 2H9BA 1NNPA 3QSLA 1PEBA 4AQ4A 3K1PA 5TPAB 1OLAA 3M3KA 1B9JA 4BDRA 2FYIA 1XVYA 4F1UA 4QFOA 5L9SA 4ZEIA 1O63A 2H25A 4LP2B 1DMBA 1QUJA 1LBBA 2OBGA 3OO6A 4GIZA 3TODA 3RPWA 3TZAA 3CSBA 4LATA 4Q30B 1N04A 2O6AA 1P1UA 3E13X 5HBCA 1I6QA 4F29A 2RINA 1FQFA 3MVZA 3CFXA 3A3UA 3O97A 2REGA 4X48A 5K2YA 1YPNA 3S9LC 1LBCA 5FTHA 4IO4A 1ZU0A 3O29A 5AA3A 2OWSA 1MQGA 4G8HA 1VFEA 3EPEA 1UTHB 3PU5A 4R9FA 5L9OA 4FEDA 4R74A 4IO3A 4UACA 5ITPA 4O3AA 2ZYMA 5DT6A 1OQHA 3SESA 3TTLA 4DXCA 4EF2A 1AOVA 1DPPA 2PVUA 3MJNA 3GLBA 1ZMGA 2QMXA 3K2DA 3MWBA 4QSDA 4XKQA 5DEXB 3E4RA 3PD9A 3TKDA 5AA4B 5HM4B 3USDA 4R6KA 3KSJA 3KFMA 2I58A 1O64A 2XX9A 4I8CA 1NMUA 3SEUA 4ISUA 1NNTA 3BBRA 3HCQA 4X1DA 3T66A 5ICTA 5KCJA 1B0HA 4HS7A 1P1QA 3LR1A 2PX1A 4OHNA 3TYHA 4C0RA 1M5DA 3C35A 2IA4A 4RK2A 4GXAA 4XTCQ 1O7TA 3RUMA 4EDPA 4U1ZA 4WKMA 1TXFA 3THIA 3N6UA 4OFLA 1F9BA 3I5OA 4JWXA 4PFUA 4IY5A 4FEBA 2ZNTA 3O6HA 1URGA 3K1MA 3KEIA 4PE5B 3QAXA 4GLIA 3VVFA 5J1DA 3VXCA 1R1NA 3U72A 3E9XA 3HO7A 3FJ7A 1B3GA 3VLVA 5B70A 5CBSA 4MH5A 3MVXA 5F1QA 2RF1A 2XD2A 2UYFA 4KYDA 4YAHX 2DQVA 1JVYA 1B40A 3OEKA 4TOZA 5IKBA 1ANFA 1PB7A 1US5A 1IUDA 2UVJA 2VOZA 3HHFA 4NF4A 1AMFA 2GFEA 3N5LA 4DE8A 1RKMA 4YU0A 1EZOA 2XXRA 4NF5A 3PGFA 3SERA 2AL5A 2DE3A 5I2KB 1NNFA 4R2BA 2I0BA 3SDFA 1T0KA 5I56A 1B0LA 4G77A 4JSOA 3DLNA 4ND9A 4XXUA 2H5YA 1MXVA 2ONKE 3B7DA 3H6WA 1FTJA 3ILTB 3MP1A 5CRYA 5F7VA 2Z8FA 5H8FB 5CC2A 2KLFA 1UTBB 4OEUA 1MY3A 4LZ7A 3S9EA 3GXAA 3S9NC 3OO7A 4EF1A 1A40A 4ECFA 1QJMA 3OEMA 2Y7IA 4PFWA 3S9MC 1NL5A 1JEVA 3RTFB 1SW2A 2M8CA 4H1XA 2DVZA 3LSFB 4F1YA 3FGSA 3IJOB 3MW0A 1P1NA 3FVNA 2XXQA 3SEYA 1MXXA 2I49A 4U2RA 4ZS9A 4YB6A 4OMBA 3G3HA 3PD8A 4YMAA 3W9WA 1P1WA 3RT6B 1HSJA 1OQGA 5DVJA 4DLDA 3PPQA 1M5CA 3SEVA 4ELPA 4IGTA 4BDLA 1B51A 4KD5A 3BFTA 5CMCA 3MPKA 1YTVA 3OO8A 4LONB 4XKRA 4ZEDA 5JK4A 4GXSB 1LAXA 2G29A 3O66A 4GQOA 2XXTA 4LQ2A 3M3LA 4KPTA 4HCWA 4ZEBA 4H8JA 3TCFA 1XVXA 1PC3A 4EQ7A 4R2FA 3FIRA 1URDA 2DOJA 4RA1A 2Z22A 2ONRA 3B6QA 4GWOA 1N84A 1UQWA 1TWYA 3TMGA 1IITA 1OLCA 1YCJA 4GF8A 1B7UA 4OENA 3KN3A 4RNSA 4F3PA 1USYH 1OMPA 2PT2A 1B7HA 2VD2A 3KGCA 2VGQA 3SEWA 2QRYA 2OWTA 4WEDA 2F6PA 3R7XA 5H8FA 2DE4A 3G3GA 1ZBMA 1Q1KA 1BIYA 3IAZA 4F19A 4NMYA 2QL3A 2QS1A 2Z8EA 4ZDMA 5JEIA 2I48A 2YJPA 3UIFA 3H6VA 3MZ9A 1JQFA 1VSOA 1S9TA 3GBAA 2F6GA 1DSNA 2DWHA 3T9UA 1LGBC 4ZECA 2O51A 4G8MA 1B5JA 1Y4TA 1A54A 1POTA 2HCAA 5H8HB 4PFTA 3OENA 4LUBA 1LAFE 3OD7A 1R6ZA 4F3GA 5A5XB 1LAGE 1AIVA 2UVHA 5CMMA 4YB7A 5KCJB 2O84X 2F34A 1DTZA 1QULA 2XHDA 3O6GA 5ISUA 1VE4A 3FVGA 3K6XA 1MPCA 2RC8A 4X9TA 1B3FA 4JWYA 4OFJA 1SW1A 3SKPA 2F7BA 3DELB 3QK6A 4QHQA 3JV9A 2RCBA 4H65A 3FXQA 4F2OA 1NNKA 3JZJA 4OQOA 2Q88A 1IXIA 1N76A 3TQLA 4JB7A 1B1XA 3FVOA 4R6HA 3FASA 2QSXA 2ALUA 1SDXA 1UTHA 1GGGA 4AB6A 3OOAA 1VFDA 2HZKA 3PPRA 4KYSA 3EQ1A 1N3XA 1XC1A 4G68C 4G4PA 2RC7A 3HPIA 3TCHA 3UK4A 4F22A 4QFLA 1D4NA 2PBWA 5CBRA 5I2NB 5I84A 5LOMA 2ZNSA 1MS7A 3DP8A 1A8EA 3KG2A 1B46A 2F36A 4U4XA 3O2AA 1XT8A 1I69A 4BDOA 1JEUA 4QFNA 4RYAA 2ZXTA 1KWHA 4NF5B 1MQDA 1Y1MA 2B65A 2QS2A 1LB9A 1LB8A 3HHGA 3L6HA 2Q89A 3ODBA 3PMVA 4TQUQ 5I58B 4RY1A 3O28A 3KJ7A 2Y7RA 1A8FA 2QPQA 3LUYA 1H43A 3RQTA 2UVGA 2ZYKA 2I6EA 3B6TA 4JDFA 4O3CA 3W9VA 2ZYNA 3TTRA 3C9HA 1MM7A 1GVCA 1FTMA 4QSCA 4GRKA 3MBPA 1IXCA 4YICA 5DTBA 4OEVA 2D5WA 1Z7NE 2XXVA 3KSXA 3TAJA 2I0CA 2HXWA 2THIA 4H67A 4ELRA 3LSLA 3G3JA 3MZBA 1Y3QA 3R26A 4P11A 3ZS6A 5I57A 2Z23A 3MQ9A 4QRZA 4POXA 5HPQA 1FCKA 5AA2A 1RYOA 1SBPA 1S50A 1D9YA 3C34A 4OXVA 2GHBA 2X7PA 3CRBA 1A55A 5L8DA 3SETA 3H6TA 3PMWA 4IO5A 4M1VA 1H44A 3CIJA 5AE4A 3TPAA 3EHUA 5EYFA 4N13A 2DWIA 2OJTA 3T93B 3N94A 3R6UA 4I1DA 2NVUB 4EXKA 3CSGA 5I57B 5JTYB 4ESWA 3PPOA 2G93A 2I3VA 4H8IA 4GOTA 1LLSA 2R71A 4H6DA 4YKIA 3QYTA 4F31B 2GH9A 4TLLB 4DCYA 1WVJA 4IY6A 3IJXB 2ESNA 4QFKA 1LFGA 4WEPA 4F39A 2F35A 2RC9A 3OELA 3RLFE 1H45A 2W7YA 1SVXB 3A09A 5BWJA 5I59A 2X26A 4H5FA 1XOCA 2XXPA 5DEXA 5I58A 4N07A 2AL4A 1MH4A 4E0WA 1DOTA 2Z8DA 3IOVA 3RY3A 1ZTYA 2QS3A 2P0SA 5FHNA 1N7XA 2DWAA 2RKMA 1SYHA 1Y9UA 3LC8A 3MUQA 1ZIUA 4ZEKA 3UP9A 1QKBA 3IB1A 5H8NB 1M5BA 1AL3A 3C33A 3FV1A 5DVFA 3C31A 1SI1A 3S2VA 1ZLQA 1GR2A 4PQJA 3TUSA 3FXUA 4Q0CA 3EF7A 3V8XB 1FTKA 2PT1A 1XHYA 2QJEA 3TDJA 4AB5A 3FD3A 3QUFA 3T9XB 4YMBA 3K01A 1QKAA 3M8UA 2F7AA 3PPPA 1LFIA 3KOTA 3PUZE 3QUJA 4JXIA 1PBQA 2XX7A 3C4MA 3O6IA 3UGWA 1URSA 4DIGA 3IO6A 1M5FA 4LQ5A 4Z7EA 1LSTA 2I3WA 1AH5A 1IQ7A 3OMBA 1FTOA 2YPNA 1LAHE 4O3BA 4RJZA 2FNCA 2P2AA 1WODA 1MY0A 4DCXA 1GV8A 4OWDA 2DP8A 1Y20A
chains in the Genus database with same CATH superfamily
3FZVA 2P3VA 1IXGA 3K0VA 1FRPA 1JETA 1IIWA 4GL0A 2LAOA 5TP9B 3G7WA 5A5LA 3IX1A 3TCGA 5EQ8A 1UIVA 3KBRA 4N15A 4F3SA 3BKIB 2DSFA 2ABHA 3FJMA 3Q25A 5ESYA 4GWXA 4OETA 2P1SA 3M3FA 4P47A 4C1TA 3IK6B 3DM0A 5I2NA 4XIGQ 3V5AA 1B58A 5A5XA 2WX9A 3RT8A 4OERA 3T22A 1NH7A 5ICQA 4WXJA 2B3BA 1EU8A 3OXNA 3BFUA 2WKYA 1MXYA 3FBPA 3VVDA 2Y7KA 2NUVA 2F7CA 3HN0A 2AYSA 4G68B 1LCFA 3PUVE 1OVBA 1MPBA 5AA1A 3T96B 4BDMA 3NOHA 2HZLA 1MY4A 3LSWA 4NF8A 4ZZEA 1PBPA 3TELA 3U94A 3KZGA 2UXAA 3VLWA 1Y3NA 1POY1 3VFJA 4N81A 1N3WA 5EQ9A 1TFDA 1MQIA 3IL1B 4YKPA 4YKJA 3FXBA 1B32A 3FJGA 4PETA 1FW0A 2V84A 4P8BA 1QW0A 5CMBA 4R72A 4GX4A 3K6UA 4HTGA 3MSTA 3KN7A 3H3GA 3TQWA 1B6HA 3PMXA 4NN3A 2HEUA 4N6KA 2O1LA 3F11A 1MQJA 3U1OA 4NWCA 4KCDA 1JVXA 4PP0A 4H0WA 1B52A 4LA9A 1MM6A 2XXXA 2YLNA 1J1NA 2ZMBA 4JVDA 5KZTA 3AXFA 3CG3A 4N8GA 3UA8A 2CEXA 4QF9A 5EHSA 4ELQA 1ATGA 4K3FA 4EQ9A 1SD3A 2XXWA 1VR5A 3CVGA 3T1BA 3H03A 4N4UA 2O69A 2F97A 1NUZA 4P0GA 3T9HB 1FPJA 1IXHA 3T9VA 4Q8RA 4NEDA 3A29A 3MVYA 4AQ4A 5TPAB 1OLAA 4NG7A 2OBGA 3CSBA 2O6AA 2QFLA 1I6QA 4H45A 2RINA 3MVZA 4F29A 3CFXA 3S9LC 1YPNA 4G8HA 3EPEA 3PU5A 4FEDA 4UACA 4O3AA 1OQHA 2KR0A 4DXCA 5ET6A 3GLBA 2Y5LA 3PD9A 3USDA 1NMUA 5KCJA 1P1QA 4O7MA 1M5DA 4RK2A 1O7TA 3RUMA 4WKMA 1TXFA 4PGNA 3I5OA 3VVFA 3VXCA 4I40A 3E9XA 5CBSA 2RF1A 2XD2A 2QVUA 3OEKA 1PB7A 1US5A 2UVJA 4YU0A 4NF5A 3PGFA 5I2KB 1NNFA 2I0BA 3BIGA 5I56A 4G77A 4XXUA 1MXVA 1FTJA 5CC2A 4OEUA 4P9KA 4EF1A 1A40A 1NV3A 2Y7IA 1JEVA 4O7IA 3RTFB 4PC9A 4ZS9A 3PD8A 3RT6B 1M5CA 4ELPA 4BDLA 1B51A 3KC0A 3BFTA 3MPKA 4N8YA 2G29A 4ZEBA 1XVXA 1PC3A 4RA1A 1URDA 4PCDA 2QVVA 1UQWA 1TWYA 2ZZVA 1B7UA 2PT2A 2VD2A 2VGQA 2DE4A 4MCOA 1ZBMA 3IAZA 2Z8EA 2F3DA 1VSOA 2O51A 2F3BA 1Y4TA 1A54A 5ET5A 1R6ZA 1LBZA 5A5XB 5IZZA 1VDWA 4NGUA 1QULA 3K6XA 4X9TA 1B3FA 1SW1A 3DELB 2RCBA 4H65A 3TQLA 4JB7A 1B1XA 4R6HA 2ALUA 1GGGA 1NV4A 3EQ1A 5CBRA 5LOMA 4U4XA 1XT8A 3SZPA 4BDOA 2ZXTA 1KWHA 2QS2A 3PMVA 1LB9A 1YZ0A 3ODBA 5I58B 3O28A 4P1EA 3RQTA 2ZYKA 3B6TA 1IMCA 1MM7A 4YICA 2HXWA 1Y3QA 5I57A 1S50A 3C34A 1LBWA 1H44A 3EHUA 3T93B 2NVUB 4H6DA 2R71A 4F31B 2GH9A 4MHFA 4NAPA 1WVJA 3IJXB 2ESNA 4PDHA 4WEPA 4F39A 1K9YA 3LUZA 4OA4A 5DEXA 5I58A 4E0WA 2Z8DA 3RY3A 1N7XA 4ZEKA 3MUQA 5H8NB 3FV1A 1ZLQA 4PQJA 4MMPA 3FXUA 2P3NA 1Q9DA 2PFZA 3FD3A 3T9XB 4YMBA 1FPDA 4JXIA 2XX7A 3C4MA 3O6IA 3UGWA 1URSA 4O8MA 1M5FA 1NUYA 2Y5KA 1AH5A 1FTOA 1LAHE 2P2AA 1WODA 1MY0A 1Y20A 1MXZA 3K4UA 3A3CA 4ONYA 1FQEA 1MDQA 4IO6A 2VPOA 1MY1A 4R73A 2RCAA 4M4GA 4Q5TA 3WAFA 4IGRA 3K6VA 4JVIA 5DVIA 3U8QA 1N0TA 5H8NA 2OCUA 3UN6A 1ZJLA 4R75A 2PYYA 4KQPA 3MPLA 1NV6A 1A7LA 3TTNA 1QVSA 4FAJA 5TPAA 2VD3A 4EXLA 1MQHA 3GZGA 3MC2A 4I9DA 4PTKA 1YAEA 4OESA 5I59B 3N26A 1MG1A 1II5A 5DW8A 2Q2CA 4LZ8A 4QXDA 3D4CA 1B5IA 4HCYA 4KHZE 4OFOA 4LZ5A 3EN3A 2XXHA 2XWIA 3ONMA 2NOOA 1OIBA 3QXMA 3KJTA 2Q2AA 3K1NA 5J16A 3WAEA 1NV2A 2F5XA 4H46A 3ZKLA 3KOSA 2V3TA 3TTMA 4P56A 1SQYA 1PDAA 3S4UA 2WEFA 4E0XA 2F8DA 1FPEA 1B3EA 1Y1ZA 3W15C 1D9VA 1CNQA 3LV0A 5EHMA 1CB6A 4NF6A 2Y7WA 3FXRA 4H5GA 3TTKA 4ELOA 3MAMA 3OSQA 5I56B 1UIUA 2OK2A 1SI0A 4HW8A 3V83A 3K00A 2R8TA 3CG1A 1TFAA 4JSDA 1NI9A 5I5PA 4P0IA 4GWSA 1LCTA 4ZEFA 1HSEA 2HAVA 1Q35A 3EHTA 2DYXA 1JW5A 3LBSA 4BLAA 3H7MA 1BLFA 2BJIA 4G68A 4GL8A 4U21A 1SYIA 1JP4A 1FJ9A 3DP6A 2XXUA 3HSTA 1QGXA 3T0JA 3IOWA 3D4GA 1Y4CA 3KN8A 3K6WA 5AA2B 2Y84A 3L6GA 3E79A 1TT1A 3OO9A 4F3BA 4NE4A 2PMSA 1FJ6A 4RPNA 4U22A 4DZ1A 1MH3A 2DDKA 1NH8A 5K2XA 4KR5A 4YKKA 1LBYA 5H8QB 3N6TA 5ELVA 4FORA 4U23A 5ITOA 4MF3A 3U92A 1A99A 3CHGA 3I3VA 1BP5A 3IO4A 4X1BA 1OVTA 4QFPA 2CMOA 1P1OA 3MP8A 3CI8A 2VHAA 4QSEA 4XKNA 4ESXA 2HQ0A 4DXUA 4EUOA 5B7DA 4KFQA 4IB2A 1DCUA 4HE2A 3M3KA 1B9JA 5L9SA 2FYIA 1XVYA 4F1UA 4ZEIA 4XEQA 1O63A 3TZAA 1LBBA 3TODA 4GWUA 4LATA 4Q30B 3E13X 5HBCA 3A3UA 5FTHA 4IO4A 3O29A 5AA3A 1VFEA 5ITPA 5DT6A 4EF2A 5DEXB 4QSDA 4R6KA 3KSJA 4I8CA 2I58A 3SEUA 2XX9A 3BBRA 4X1DA 5ICTA 3T66A 1XI6A 3LR1A 2PX1A 3THIA 4PFIA 3O6HA 1NV5A 3QAXA 3HO7A 3VLVA 1B3GA 5B70A 4MH5A 2DQVA 1JVYA 4TOZA 4NF4A 1RKMA 3SERA 2AL5A 2DE3A 2VT5A 4R2BA 3BIHA 1T0KA 2QVRA 3DLNA 5CRYA 2H5YA 3MP1A 3ILTB 4LZ7A 3S9EA 3OEMA 1FBCA 4PFWA 1NL5A 5FBPA 2XWVA 1SW2A 2M8CA 2DVZA 5EQAA 4GWYA 4O94A 3SEYA 3W9WA 1HSJA 4DLDA 3SEVA 4KD5A 5CMCA 4XF5A 1LAXA 3M3LA 4KPTA 1NV7A 4EQ7A 2DOJA 2Z22A 1N84A 1IITA 1OLCA 4GF8A 3KN3A 3SEWA 2F6PA 3G3GA 5JEIA 1BIYA 4MX6A 4HE0A 2I48A 2YJPA 3UIFA 3MZ9A 1S9TA 3GBAA 4ZECA 1LGBC 4I3YA 5H8HB 1POTA 4F3GA 1LAGE 1AIVA 2UVHA 2ZZWA 4YB7A 5KCJB 2O84X 5ISUA 4PBQA 3FVGA 1FPBA 2RC8A 3IFAA 3SKPA 3JV9A 3FXQA 4F2OA 3JZJA 1IXIA 4PFRA 2CZIA 3FASA 4AB6A 4N6DA 2HZKA 3PPRA 4MNPA 4KYSA 1XC1A 1N3XA 2Q8MA 4G4PA 5I84A 4QFLA 1D4NA 2PBWA 3DP8A 1MS7A 1A8EA 2F36A 2HPGA 2FIXA 1I69A 4PAFA 1JEUA 1MQDA 1Y1MA 4NHBA 2FHYA 1IMEA 2GQ1A 4RY1A 4AS4A 3W9VA 1FTMA 4GRKA 4NF0A 4H67A 4QRZA 4POXA 2XXKA 2X7PA 1A55A 4IO5A 4M1VA 1FBDA 3CIJA 5EYFA 4N13A 2DWIA 3R6UA 4I1DA 4EXKA 1YYZA 3CSGA 5I57B 1LFGA 3QMFA 3KC1A 2F35A 2RC9A 3RLFE 5BWJA 1SVXB 4H5FA 2AL4A 1ZTYA 2P0SA 5FHNA 1FPIA 2DWAA 1FPGA 2RKMA 2WBBA 1M5BA 4NX1A 1SI1A 3S2VA 1GR2A 3TUSA 1FTKA 2PT1A 4AB5A 1IMBA 3K01A 3QUJA 2WYKA 1PBQA 5LDZA 3IO6A 2I3WA 1IQ7A 3OMBA 4O3BA 2FNCA 5AA2D 5T3JA 3VDFA 1P99A 3EHSA 4GVOA 5I3SA 4XKPA 4NF6B 5CMKA 1US4A 1UTBA 4Z0IA 2XWOA 1GTKA 2FBPA 2A5TA 3RYDA 3ECRA 4PE3A 3ZSFA 4ZE9A 1IZ1A 4KYEA 2VPNA 3P7IA 3G3FA 1XS5A 4IO7A 4YB5A 2XXYA 2B4LA 1CE2A 3Q27A 1PB9A 2O7UA 1QUIA 3PUWE 2MKZA 3PTYA 1FBHA 1FPKA 2FA7A 4PAIA 1I6BA 5L9MA 4ZE8A 4TLMB 2XA5A 3MZ1A 1R9QA 3IB0A 1B4ZA 5CM6A 2ZYOA 4HXVA 1ELJA 2V3UA 1RDYA 4MBPA 4DDDA 3H06B 4KCCA 1LBXA 4F1VA 5JTYA 3VVEA 2E1SA 2D21A 1FSAA 2DS9A 5TU0A 4PFYA 5IZ3B 3IOTA 2Q74A 3IB2A 3E78A 2HFBA 1NV1A 2CZKA 4NWDA 2UYEA 2XX8A 3FVKA 2CZLA 2I4CA 4FE8A 2O68A 1M5EA 2PFYA 3C32A 3PUYE 3I6VA 4DXBA 1RDXA 4MLVA 4MAGA 4THIA 2BJJX 1D3KA 2GRVA 2F78A 2H4IA 3C36A 1R9LA 3V89B 1Z7ME 2ZNUA 2CZHA 4RXLA 4FIMA 2DVCA 4PBHA 4UA8A 2DXRA 1MY2A 5ET8A 2A5TB 4OANA 3H6UA 4MLQA 2FVZA 4MNCA 1EYIA 1G0HA 2H98A 5H8SA 1MXUA 1K9ZA 3RN8A 1MXWA 3RPLA 4U4SA 1NV0A 2V93A 1JNFA 3ILUB 1LEVA 3MP6A 1QUKA 3CR9A 2DE2A 4NF4B 2JJKA 1B7ZA 3EKIA 4FJPA 3ISPA 4G2ZA 3PUXE 4YZZA 1H3DA 4C1UA 4LVQA 5H8QA 1MRPA 4KXPA 1MPDA 2OWZA 3VV5A 3IR1A 2PCRA 3G3KA 1NNPA 1PEBA 4BDRA 4LP2B 1DMBA 1QUJA 4MEVA 5I7IA 3RPWA 1N04A 1FQFA 4X48A 4MIJA 1DK4A 4IO3A 2ZYMA 3SESA 3TTLA 1AOVA 1DPPA 2PVUA 4XKQA 3K2DA 2QMXA 3MWBA 4C0RA 5AA4B 5HM4B 3TKDA 5KDTB 3KFMA 1NNTA 1B0HA 4HS7A 4GXAA 4PF6A 4XTCQ 4EDPA 4U1ZA 4OFLA 1F9BA 3IFCA 4JWXA 4FEBA 3K1MA 3KEIA 3FJ7A 3U65A 3MVXA 5F1QA 4MNIA 5IKBA 1ANFA 1IUDA 3HHFA 1AMFA 2GFEA 1EZOA 4JVCA 1B0LA 4ND9A 3H6WA 2KLFA 1UTBB 1MY3A 3OO7A 4ECFA 1QJMA 2L5VA 5EYHA 4GBWA 3FGSA 3IJOB 5IGAA 2KQZA 3FVNA 2XXQA 4P1LA 1MXXA 4U2RA 4OMBA 3G3HA 4PGPA 4YMAA 1P1WA 2WYPA 4IGTA 1AWBA 1YTVA 3OO8A 4LONB 4GXSB 4LQ2A 2XXTA 3KBZA 4H8JA 3TCFA 4R2FA 3FIRA 3B6QA 4GWOA 4OVSA 1FTAA 4OENA 4RNSA 4F3PA 3KGCA 2QRYA 3R7XA 4F19A 1Q1KA 4NMYA 4ZDMA 3H6VA 1JQFA 1DSNA 2DWHA 4PDDA 1B5JA 4LUBA 1LAFE 5CMMA 5IZ1A 1VE4A 1MPCA 4JWYA 4OFJA 4QHQA 3QK6A 4DI3D 1NNKA 4OQOA 1KA0A 1IMDA 3OOAA 1FBPA 4XFEA 3TCHA 3B8BA 3KG2A 3O2AA 4GFRA 2B65A 3HHGA 3L6HA 1LB8A 5BUUA 3KJ7A 2Y7RA 3LUYA 4OVTA 4O3CA 2B4MA 4OEVA 2D5WA 1Z7NE 2XXVA 3KSXA 3TAJA 2THIA 3LSLA 3G3JA 3MZBA 4P11A 2Z23A 5AA2A 1RYOA 4OXVA 1D9YA 2GHBA 1EYKA 3H6TA 5AE4A 4H8IA 2G93A 2I3VA 1LLSA 4YKIA 3QYTA 4DCYA 3OELA 1H45A 1SPIA 2X26A 1XOCA 4N07A 1MH4A 1DOTA 5L9OA 3LC8A 1Y9UA 3UP9A 1ZIUA 1QKBA 3IB1A 1KZ8A 3V8XB 3TDJA 3QUFA 3M8UA 3PUZE 1LFIA 3KOTA 1D9QA 4DIGA 1KA1A 4Z7EA 1LSTA 2YPNA 4DCXA 4X04A 3GBBA 1LBVA 2FIEA 1H76A 5FTIA 1INPA 1B4HA 3RTWB 5EYGA 3Q26A 5F24A 2H99A 4AS5A 4ZZAA 2QS4A 3CFZA 4OVJA 2ANJA 1SW4A 1S7YA 3FUZA 1FQDA 4PFBA 4OVRA 4FATA 1PB8A 4N6PA 1EZ9A 4G8NA 5TP9A 2A5SA 2OZZA 3UORA 4MFIA 5FHMA 4PF8A 4BDNA 4FBPA 2NXOA 2O1MA 2IEEA 4PAKA 1FQBA 1Y3PA 2REJA 1EZPA 4POWA 3IORA 4U1OA 2WBDA 3E3KA 1FQAA 1ZKBA 1EH3A 3H4ZA 5IM2A 4GWWA 4KI0E 1B5HA 5H8HA 1BTJA 3VE1B 1B05A 3U93A 1B3HA 2NWJA 4NF8B 2OLBA 4IR8A 1FBGA 1B2HA 3Q28A 3Q29A 3HV1A 3VXBA 1G0IA 5I2KA 2UVIA 2E0SA 3S9MC 4JBZA 3HFUA 4BDQA 1SW5A 4RK9A 2R9JA 4HE1A 1NKXA 4IO2A 1I6AA 1USYE 4OZ9A 1JW4A 3IOUA 4R9GA 2AIXA 4L17A 3DP4A 1WDNA 3B6WA 4UABA 1N7WA 1JW1A 5M2VA 3O9PA 2HAUA 1HSLA 5FHOA 4RPOA 2Y7PA 1LFHA 1DTGA 1FTLA 1IEJA 1BKAA 3MVWA 5AA4A 5KDTA 2ONSA 2Q9TA 2O7IA 2Q8JA 2XD3A 3B50A 3LSXA 2QMWA 4FECA 4GD5A 3SEXA 3TFLA 3TEPA 4OTEA 2V25A 2VP1A 3OSRA 3G3IA 3RGYA 4JWOA 2D3IA 1DBZA 3K02A 4R6YA 1RYXA 1IMAA 5IZ3A 1BK4A 2B3FA 2R6GE 1NFTA 5IAIA 1DPEA 3VLUA 5CI5A 1FQCA 2XXIA 2GHAA 3ZKKA 2DWJA 4F18A 3FATA 4NTLA 1FPFA 3PV0E 2V3QA 1B3LA 1MDP1 4G61A 4F2QA 3MYUA 2I4BA 2XWKA 4N17A 5DYHA 3JYRA 4OYVA 2DXYA 2X7QA 3CFLA 4EQBA 3FV2A 4I62A 3RNNA 1B1HA 3PPNA 1FBFA 3QIMA 1L5TA 2H9BA 3QSLA 3K1PA 4QFOA 2H25A 3OO6A 4GIZA 1P1UA 3O97A 2REGA 5K2YA 1LBCA 1ZU0A 2OWSA 1MQGA 1UTHB 4R9FA 4R74A 4GWZA 2OX3A 2ZZXA 3MJNA 1ZMGA 3E4RA 1O64A 4QBAA 4ISUA 3HCQA 3TYHA 4OHNA 3C35A 2IA4A 4P3LA 3D1RA 3N6UA 1YXIA 3ROJA 4PFUA 4IY5A 2ZNTA 5J1DA 1URGA 4PE5B 4GLIA 1R1NA 3U72A 2UYFA 4KYDA 4YAHX 1B40A 2VOZA 4DE8A 3N5LA 2XXRA 3SDFA 4JSOA 2ONKE 3B7DA 5F7VA 5H8FB 2Z8FA 3GXAA 3S9NC 1FPLA 4GX6A 4H1XA 3LSFB 4F1YA 3MW0A 1P1NA 2I49A 4YB6A 1OQGA 5DVJA 3PPQA 4XKRA 5ET7A 4ZEDA 5JK4A 1IMFA 3O66A 4GQOA 4HCWA 4GX3A 2ONRA 3TMGA 1YCJA 1USYH 1OMPA 1B7HA 5LTCA 4WEDA 2OWTA 5H8FA 2HXRA 2QL3A 2QS1A 2V4CA 2F6GA 3T9UA 4G8MA 4MJOA 2HCAA 4PFTA 3OENA 3OD7A 4OVQA 2F34A 1DTZA 2XHDA 3O6GA 1RDZA 3RPLB 2F7BA 2Q88A 1N76A 4X8RA 3FVOA 3GYYA 2QSXA 1SDXA 1UTHA 1VFDA 1FBEA 4G68C 1NUXA 2RC7A 3HPIA 3UK4A 4F22A 5I2NB 2ZNSA 1B46A 4DI4B 4RYAA 4QFNA 4NF5B 4TQUQ 4N91A 2Q89A 1A8FA 2QPQA 1H43A 2UVGA 2I6EA 4JDFA 2ZYNA 3TTRA 3C9HA 1GVCA 4QSCA 2CEYA 3MBPA 1IXCA 4I3EA 5DTBA 2I0CA 4ELRA 3R26A 3ZS6A 3MQ9A 5HPQA 1FCKA 1SBPA 3CRBA 5L8DA 3SETA 3PMWA 3TPAA 2OJTA 3N94A 5JTYB 4ESWA 3PPOA 4GOTA 4TLLB 4IY6A 4QFKA 2W7YA 3A09A 4NQ8A 5I59A 2XXPA 5EQ7A 3IOVA 2QS3A 1SYHA 4LN5A 4GBVA 1AL3A 3C33A 5DVFA 3C31A 1EYJA 4Q0CA 1NUWA 3EF7A 1XHYA 2HHMA 2QJEA 4OVPA 1QKAA 3PPPA 2F7AA 4LQ5A 4RJZA 1GV8A 4OWDA 2DP8A
chains in the Genus database with same CATH topology
1MXZA 3FZVA 3K4UA 3GBBA 3A3CA 4ONYA 1IXGA 5AA2D 1FQEA 1MDQA 3K0VA 4IO6A 1H76A 3VDFA 1MY1A 1P99A 4R73A 2RCAA 4M4GA 4Q5TA 5FTIA 3WAFA 1JETA 4IGRA 3EHSA 3K6VA 4GVOA 1B4HA 3RTWB 5DVIA 3Q26A 3U8QA 4XKPA 1N0TA 2H99A 4NF6B 1IIWA 5CMKA 5H8NA 1US4A 2OCUA 4GL0A 4ZZAA 1UTBA 1ZJLA 4Z0IA 4R75A 3UN6A 2QS4A 3CFZA 2LAOA 2PYYA 1GTKA 4OVJA 2ANJA 4KQPA 5TP9B 3G7WA 3MPLA 2A5TA 1SW4A 5KDTB 1S7YA 3FUZA 1A7LA 3TTNA 1QVSA 3IX1A 3TCGA 3ECRA 1FQDA 4FAJA 3ZSFA 1UIVA 5TPAA 2VD3A 3KBRA 4EXLA 4ZE9A 1MQHA 3GZGA 3MC2A 3BKIB 4I9DA 2DSFA 1IZ1A 1YAEA 2ABHA 3FJMA 3Q25A 1PB8A 4KYEA 1EZ9A 4G8NA 4N6PA 4F3SA 4OESA 4OETA 5I59B 3N26A 1MG1A 5TP9A 2P1SA 2A5SA 1II5A 2OZZA 3M3FA 4MFIA 3P7IA 3UORA 3G3FA 3IK6B 4C1TA 5FHMA 3DM0A 1XS5A 4IO7A 5I2NA 4YB5A 4BDNA 2Q2CA 2XXYA 4LZ8A 1CE2A 4XIGQ 2NXOA 1B58A 3V5AA 3Q27A 5A5XA 2O1MA 1PB9A 2IEEA 1FQBA 1Y3PA 2O7UA 1NH7A 4OERA 3RT8A 4WXJA 3T22A 5ICQA 1QUIA 3D4CA 3PUWE 1B5IA 4HCYA 2REJA 4KHZE 2B3BA 1EU8A 4OFOA 3OXNA 1EZPA 3BFUA 4LZ5A 3EN3A 4POWA 2WKYA 2XXHA 1MXYA 3ONMA 3IORA 2NOOA 1OIBA 4U1OA 3VVDA 2Y7KA 2NUVA 2FA7A 2F7CA 3E3KA 3HN0A 3QXMA 1I6BA 5L9MA 4ZE8A 3KJTA 1FQAA 2Q2AA 1ZKBA 2AYSA 3K1NA 3WAEA 4TLMB 4G68B 1EH3A 1LCFA 3MZ1A 3PUVE 2F5XA 1R9QA 3H4ZA 3IB0A 3ZKLA 1B4ZA 1OVBA 3KOSA 4KI0E 1B5HA 2V3TA 5H8HA 2ZYOA 5CM6A 3TTMA 1ELJA 2V3UA 1MPBA 4MBPA 1BTJA 1SQYA 3VE1B 1B05A 3U93A 5AA1A 1PDAA 4DDDA 3S4UA 1B3HA 2NWJA 3H06B 4NF8B 2OLBA 2F8DA 4KCCA 4E0XA 4F1VA 1B3EA 5JTYA 1Y1ZA 3W15C 3T96B 4FATA 1D9VA 4BDMA 1B2HA 3Q28A 5EHMA 1CB6A 4NF6A 3VVEA 3Q29A 2E1SA 2HZLA 2D21A 2Y7WA 3FXRA 1MY4A 3HV1A 4H5GA 3LSWA 4NF8A 3VXBA 4ZZEA 1PBPA 3TTKA 5I2KA 2UVIA 4ELOA 3TELA 5BUUA 2E0SA 3U94A 3MAMA 2DS9A 3OSQA 3KZGA 5TU0A 4JBZA 4PFYA 5I56B 2UXAA 3VLWA 3IOTA 4BDQA 1SW5A 1Y3NA 1POY1 3IB2A 4RK9A 1UIUA 2OK2A 1SI0A 2R9JA 4HW8A 3VFJA 3V83A 2HFBA 1N3WA 1NKXA 4IO2A 1I6AA 1USYE 4OZ9A 4NWDA 1JW4A 1TFDA 2UYEA 2XX8A 3K00A 1MQIA 3FVKA 3IOUA 3CG1A 4R9GA 3IL1B 4YKPA 2AIXA 4L17A 1TFAA 4JSDA 2CZLA 2I4CA 4YKJA 4FE8A 3DP4A 1B32A 3FJGA 4PETA 2O68A 4P0IA 1FW0A 2V84A 1LCTA 4ZEFA 1M5EA 3C32A 1QW0A 1WDNA 1HSEA 3PUYE 3I6VA 4DXBA 2HAVA 1Q35A 3B6WA 5CMBA 3EHTA 4R72A 2DYXA 4MLVA 3K6UA 1N7WA 1JW1A 4HTGA 5M2VA 1JW5A 3LBSA 3O9PA 2HAUA 1HSLA 3KN7A 4THIA 5FHOA 2BJJX 3H3GA 3TQWA 4BLAA 1B6HA 1D3KA 3H7MA 2GRVA 4RPOA 2Y7PA 1BLFA 2F78A 1DTGA 1LFHA 1FTLA 3PMXA 1IEJA 4G68A 4GL8A 1BKAA 4U21A 2HEUA 1SYIA 3MVWA 5AA4A 5KDTA 2H4IA 2ONSA 2O1LA 3C36A 2Q9TA 2O7IA 2Q8JA 2XD3A 3F11A 1R9LA 1MQJA 3DP6A 3V89B 1Z7ME 2XXUA 3HSTA 2ZNUA 3U1OA 3IOWA 4RXLA 3D4GA 4FIMA 2DVCA 1Y4CA 4NWCA 4UA8A 3LSXA 4KCDA 2QMWA 2DXRA 1MY2A 4FECA 2A5TB 3KN8A 3H6UA 1JVXA 4GFRA 4MLQA 4GD5A 3K6WA 5AA2B 4PP0A 4H0WA 3SEXA 1B52A 4LA9A 1MM6A 2XXXA 2Y84A 3TFLA 3L6GA 3TEPA 2YLNA 4OTEA 2H98A 5H8SA 1J1NA 1TT1A 1MXUA 2V25A 2ZMBA 2VP1A 3OSRA 3OO9A 3G3IA 3RN8A 3RGYA 4JWOA 5KZTA 1MXWA 4F3BA 2D3IA 3K02A 4U4SA 4R6YA 3AXFA 2V93A 2PMSA 1RYXA 3CG3A 4NE4A 1JNFA 3ILUB 2B3FA 4RPNA 2R6GE 3MP6A 1QUKA 3CR9A 1NFTA 3UA8A 5IAIA 2DE2A 4NF4B 1DPEA 4U22A 3VLUA 4DZ1A 1MH3A 4QF9A 1NH8A 1B7ZA 5EHSA 4ELQA 5K2XA 1ATGA 4K3FA 4FJPA 4KR5A 1SD3A 4EQ9A 4G2ZA 4YKKA 5CI5A 1FQCA 5H8QB 2XXIA 2GHAA 3PUXE 2XXWA 3N6TA 4FORA 5ELVA 4YZZA 3ZKKA 1VR5A 3CVGA 4U23A 5ITOA 2DWJA 4MF3A 4F18A 3U92A 3H03A 1A99A 3I3VA 1BP5A 3IO4A 1H3DA 3FATA 4NTLA 4X1BA 3PV0E 1OVTA 2O69A 1B3LA 1MDP1 2V3QA 4QFPA 2F97A 4C1UA 4F2QA 2CMOA 1P1OA 3MP8A 4LVQA 2I4BA 5H8QA 3CI8A 2VHAA 1MRPA 4QSEA 4XKNA 4ESXA 4P0GA 1MPDA 3T9HB 2HQ0A 5DYHA 3JYRA 4OYVA 1IXHA 2DXYA 3IR1A 2X7QA 3VV5A 3CFLA 3T9VA 4EQBA 4Q8RA 3FV2A 4DXUA 4I62A 4EUOA 3RNNA 4KFQA 5B7DA 1B1HA 3PPNA 3QIMA 4NEDA 4IB2A 1L5TA 3G3KA 3MVYA 2H9BA 1NNPA 3QSLA 1PEBA 4AQ4A 3K1PA 5TPAB 1OLAA 3M3KA 1B9JA 4BDRA 2FYIA 1XVYA 4F1UA 4QFOA 5L9SA 4ZEIA 1O63A 2H25A 4LP2B 1DMBA 1QUJA 1LBBA 2OBGA 3OO6A 4GIZA 3TODA 3RPWA 3TZAA 3CSBA 4LATA 4Q30B 1N04A 2O6AA 1P1UA 3E13X 5HBCA 1I6QA 4F29A 2RINA 1FQFA 3MVZA 3CFXA 3A3UA 3O97A 2REGA 4X48A 5K2YA 1YPNA 3S9LC 1LBCA 5FTHA 4IO4A 1ZU0A 3O29A 5AA3A 2OWSA 1MQGA 4G8HA 1VFEA 3EPEA 1UTHB 3PU5A 4R9FA 5L9OA 4FEDA 4R74A 4IO3A 4UACA 5ITPA 4O3AA 2ZYMA 5DT6A 1OQHA 3SESA 3TTLA 4DXCA 4EF2A 1AOVA 1DPPA 2PVUA 3MJNA 3GLBA 1ZMGA 2QMXA 3K2DA 3MWBA 4QSDA 4XKQA 5DEXB 3E4RA 3PD9A 3TKDA 5AA4B 5HM4B 3USDA 4R6KA 3KSJA 3KFMA 2I58A 1O64A 2XX9A 4I8CA 1NMUA 3SEUA 4ISUA 1NNTA 3BBRA 3HCQA 4X1DA 3T66A 5ICTA 5KCJA 1B0HA 4HS7A 1P1QA 3LR1A 2PX1A 4OHNA 3TYHA 4C0RA 1M5DA 3C35A 2IA4A 4RK2A 4GXAA 4XTCQ 1O7TA 3RUMA 4EDPA 4U1ZA 4WKMA 1TXFA 3THIA 3N6UA 4OFLA 1F9BA 3I5OA 4JWXA 4PFUA 4IY5A 4FEBA 2ZNTA 3O6HA 1URGA 3K1MA 3KEIA 4PE5B 3QAXA 4GLIA 3VVFA 5J1DA 3VXCA 1R1NA 3U72A 3E9XA 3HO7A 3FJ7A 1B3GA 3VLVA 5B70A 5CBSA 4MH5A 3MVXA 5F1QA 2RF1A 2XD2A 2UYFA 4KYDA 4YAHX 2DQVA 1JVYA 1B40A 3OEKA 4TOZA 5IKBA 1ANFA 1PB7A 1US5A 1IUDA 2UVJA 2VOZA 3HHFA 4NF4A 1AMFA 2GFEA 3N5LA 4DE8A 1RKMA 4YU0A 1EZOA 2XXRA 4NF5A 3PGFA 3SERA 2AL5A 2DE3A 5I2KB 1NNFA 4R2BA 2I0BA 3SDFA 1T0KA 5I56A 1B0LA 4G77A 4JSOA 3DLNA 4ND9A 4XXUA 2H5YA 1MXVA 2ONKE 3B7DA 3H6WA 1FTJA 3ILTB 3MP1A 5CRYA 5F7VA 2Z8FA 5H8FB 5CC2A 2KLFA 1UTBB 4OEUA 1MY3A 4LZ7A 3S9EA 3GXAA 3S9NC 3OO7A 4EF1A 1A40A 4ECFA 1QJMA 3OEMA 2Y7IA 4PFWA 3S9MC 1NL5A 1JEVA 3RTFB 1SW2A 2M8CA 4H1XA 2DVZA 3LSFB 4F1YA 3FGSA 3IJOB 3MW0A 1P1NA 3FVNA 2XXQA 3SEYA 1MXXA 2I49A 4U2RA 4ZS9A 4YB6A 4OMBA 3G3HA 3PD8A 4YMAA 3W9WA 1P1WA 3RT6B 1HSJA 1OQGA 5DVJA 4DLDA 3PPQA 1M5CA 3SEVA 4ELPA 4IGTA 4BDLA 1B51A 4KD5A 3BFTA 5CMCA 3MPKA 1YTVA 3OO8A 4LONB 4XKRA 4ZEDA 5JK4A 4GXSB 1LAXA 2G29A 3O66A 4GQOA 2XXTA 4LQ2A 3M3LA 4KPTA 4HCWA 4ZEBA 4H8JA 3TCFA 1XVXA 1PC3A 4EQ7A 4R2FA 3FIRA 1URDA 2DOJA 4RA1A 2Z22A 2ONRA 3B6QA 4GWOA 1N84A 1UQWA 1TWYA 3TMGA 1IITA 1OLCA 1YCJA 4GF8A 1B7UA 4OENA 3KN3A 4RNSA 4F3PA 1USYH 1OMPA 2PT2A 1B7HA 2VD2A 3KGCA 2VGQA 3SEWA 2QRYA 2OWTA 4WEDA 2F6PA 3R7XA 5H8FA 2DE4A 3G3GA 1ZBMA 1Q1KA 1BIYA 3IAZA 4F19A 4NMYA 2QL3A 2QS1A 2Z8EA 4ZDMA 5JEIA 2I48A 2YJPA 3UIFA 3H6VA 3MZ9A 1JQFA 1VSOA 1S9TA 3GBAA 2F6GA 1DSNA 2DWHA 3T9UA 1LGBC 4ZECA 2O51A 4G8MA 1B5JA 1Y4TA 1A54A 1POTA 2HCAA 5H8HB 4PFTA 3OENA 4LUBA 1LAFE 3OD7A 1R6ZA 4F3GA 5A5XB 1LAGE 1AIVA 2UVHA 5CMMA 4YB7A 5KCJB 2O84X 2F34A 1DTZA 1QULA 2XHDA 3O6GA 5ISUA 1VE4A 3FVGA 3K6XA 1MPCA 2RC8A 4X9TA 1B3FA 4JWYA 4OFJA 1SW1A 3SKPA 2F7BA 3DELB 3QK6A 4QHQA 3JV9A 2RCBA 4H65A 3FXQA 4F2OA 1NNKA 3JZJA 4OQOA 2Q88A 1IXIA 1N76A 3TQLA 4JB7A 1B1XA 3FVOA 4R6HA 3FASA 2QSXA 2ALUA 1SDXA 1UTHA 1GGGA 4AB6A 3OOAA 1VFDA 2HZKA 3PPRA 4KYSA 3EQ1A 1N3XA 1XC1A 4G68C 4G4PA 2RC7A 3HPIA 3TCHA 3UK4A 4F22A 4QFLA 1D4NA 2PBWA 5CBRA 5I2NB 5I84A 5LOMA 2ZNSA 1MS7A 3DP8A 1A8EA 3KG2A 1B46A 2F36A 4U4XA 3O2AA 1XT8A 1I69A 4BDOA 1JEUA 4QFNA 4RYAA 2ZXTA 1KWHA 4NF5B 1MQDA 1Y1MA 2B65A 2QS2A 1LB9A 1LB8A 3HHGA 3L6HA 2Q89A 3ODBA 3PMVA 4TQUQ 5I58B 4RY1A 3O28A 3KJ7A 2Y7RA 1A8FA 2QPQA 3LUYA 1H43A 3RQTA 2UVGA 2ZYKA 2I6EA 3B6TA 4JDFA 4O3CA 3W9VA 2ZYNA 3TTRA 3C9HA 1MM7A 1GVCA 1FTMA 4QSCA 4GRKA 3MBPA 1IXCA 4YICA 5DTBA 4OEVA 2D5WA 1Z7NE 2XXVA 3KSXA 3TAJA 2I0CA 2HXWA 2THIA 4H67A 4ELRA 3LSLA 3G3JA 3MZBA 1Y3QA 3R26A 4P11A 3ZS6A 5I57A 2Z23A 3MQ9A 4QRZA 4POXA 5HPQA 1FCKA 5AA2A 1RYOA 1SBPA 1S50A 1D9YA 3C34A 4OXVA 2GHBA 2X7PA 3CRBA 1A55A 5L8DA 3SETA 3H6TA 3PMWA 4IO5A 4M1VA 1H44A 3CIJA 5AE4A 3TPAA 3EHUA 5EYFA 4N13A 2DWIA 2OJTA 3T93B 3N94A 3R6UA 4I1DA 2NVUB 4EXKA 3CSGA 5I57B 5JTYB 4ESWA 3PPOA 2G93A 2I3VA 4H8IA 4GOTA 1LLSA 2R71A 4H6DA 4YKIA 3QYTA 4F31B 2GH9A 4TLLB 4DCYA 1WVJA 4IY6A 3IJXB 2ESNA 4QFKA 1LFGA 4WEPA 4F39A 2F35A 2RC9A 3OELA 3RLFE 1H45A 2W7YA 1SVXB 3A09A 5BWJA 5I59A 2X26A 4H5FA 1XOCA 2XXPA 5DEXA 5I58A 4N07A 2AL4A 1MH4A 4E0WA 1DOTA 2Z8DA 3IOVA 3RY3A 1ZTYA 2QS3A 2P0SA 5FHNA 1N7XA 2DWAA 2RKMA 1SYHA 1Y9UA 3LC8A 3MUQA 1ZIUA 4ZEKA 3UP9A 1QKBA 3IB1A 5H8NB 1M5BA 1AL3A 3C33A 3FV1A 5DVFA 3C31A 1SI1A 3S2VA 1ZLQA 1GR2A 4PQJA 3TUSA 3FXUA 4Q0CA 3EF7A 3V8XB 1FTKA 2PT1A 1XHYA 2QJEA 3TDJA 4AB5A 3FD3A 3QUFA 3T9XB 4YMBA 3K01A 1QKAA 3M8UA 2F7AA 3PPPA 1LFIA 3KOTA 3PUZE 3QUJA 4JXIA 1PBQA 2XX7A 3C4MA 3O6IA 3UGWA 1URSA 4DIGA 3IO6A 1M5FA 4LQ5A 4Z7EA 1LSTA 2I3WA 1AH5A 1IQ7A 3OMBA 1FTOA 2YPNA 1LAHE 4O3BA 4RJZA 2FNCA 2P2AA 1WODA 1MY0A 4DCXA 1GV8A 4OWDA 2DP8A 1Y20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXZ A;  3FZV A;  3K4U A;  3GBB A;  3A3C A;  4ONY A;  1IXG A;  5AA2 D;  1FQE A;  1MDQ A;  3K0V A;  4IO6 A;  1H76 A;  3VDF A;  1MY1 A;  1P99 A;  4R73 A;  2RCA A;  4M4G A;  4Q5T A;  5FTI A;  3WAF A;  1JET A;  4IGR A;  3EHS A;  3K6V A;  4GVO A;  1B4H A;  3RTW B;  5DVI A;  3Q26 A;  3U8Q A;  4XKP A;  1N0T A;  2H99 A;  4NF6 B;  1IIW A;  5CMK A;  5H8N A;  1US4 A;  2OCU A;  4GL0 A;  4ZZA A;  1UTB A;  1ZJL A;  4Z0I A;  4R75 A;  3UN6 A;  2QS4 A;  3CFZ A;  2LAO A;  2PYY A;  1GTK A;  4OVJ A;  2ANJ A;  4KQP A;  5TP9 B;  3G7W A;  3MPL A;  2A5T A;  1SW4 A;  5KDT B;  1S7Y A;  3FUZ A;  1A7L A;  3TTN A;  1QVS A;  3IX1 A;  3TCG A;  3ECR A;  1FQD A;  4FAJ A;  3ZSF A;  1UIV A;  5TPA A;  2VD3 A;  3KBR A;  4EXL A;  4ZE9 A;  1MQH A;  3GZG A;  3MC2 A;  3BKI B;  4I9D A;  2DSF A;  1IZ1 A;  1YAE A;  2ABH A;  3FJM A;  3Q25 A;  1PB8 A;  4KYE A;  1EZ9 A;  4G8N A;  4N6P A;  4F3S A;  4OES A;  4OET A;  5I59 B;  3N26 A;  1MG1 A;  5TP9 A;  2P1S A;  2A5S A;  1II5 A;  2OZZ A;  3M3F A;  4MFI A;  3P7I A;  3UOR A;  3G3F A;  3IK6 B;  4C1T A;  5FHM A;  3DM0 A;  1XS5 A;  4IO7 A;  5I2N A;  4YB5 A;  4BDN A;  2Q2C A;  2XXY A;  4LZ8 A;  1CE2 A;  4XIG Q;  2NXO A;  1B58 A;  3V5A A;  3Q27 A;  5A5X A;  2O1M A;  1PB9 A;  2IEE A;  1FQB A;  1Y3P A;  2O7U A;  1NH7 A;  4OER A;  3RT8 A;  4WXJ A;  3T22 A;  5ICQ A;  1QUI A;  3D4C A;  3PUW E;  1B5I A;  4HCY A;  2REJ A;  4KHZ E;  2B3B A;  1EU8 A;  4OFO A;  3OXN A;  1EZP A;  3BFU A;  4LZ5 A;  3EN3 A;  4POW A;  2WKY A;  2XXH A;  1MXY A;  3ONM A;  3IOR A;  2NOO A;  1OIB A;  4U1O A;  3VVD A;  2Y7K A;  2NUV A;  2FA7 A;  2F7C A;  3E3K A;  3HN0 A;  3QXM A;  1I6B A;  5L9M A;  4ZE8 A;  3KJT A;  1FQA A;  2Q2A A;  1ZKB A;  2AYS A;  3K1N A;  3WAE A;  4TLM B;  4G68 B;  1EH3 A;  1LCF A;  3MZ1 A;  3PUV E;  2F5X A;  1R9Q A;  3H4Z A;  3IB0 A;  3ZKL A;  1B4Z A;  1OVB A;  3KOS A;  4KI0 E;  1B5H A;  2V3T A;  5H8H A;  2ZYO A;  5CM6 A;  3TTM A;  1ELJ A;  2V3U A;  1MPB A;  4MBP A;  1BTJ A;  1SQY A;  3VE1 B;  1B05 A;  3U93 A;  5AA1 A;  1PDA A;  4DDD A;  3S4U A;  1B3H A;  2NWJ A;  3H06 B;  4NF8 B;  2OLB A;  2F8D A;  4KCC A;  4E0X A;  4F1V A;  1B3E A;  5JTY A;  1Y1Z A;  3W15 C;  3T96 B;  4FAT A;  1D9V A;  4BDM A;  1B2H A;  3Q28 A;  5EHM A;  1CB6 A;  4NF6 A;  3VVE A;  3Q29 A;  2E1S A;  2HZL A;  2D21 A;  2Y7W A;  3FXR A;  1MY4 A;  3HV1 A;  4H5G A;  3LSW A;  4NF8 A;  3VXB A;  4ZZE A;  1PBP A;  3TTK A;  5I2K A;  2UVI A;  4ELO A;  3TEL A;  5BUU A;  2E0S A;  3U94 A;  3MAM A;  2DS9 A;  3OSQ A;  3KZG A;  5TU0 A;  4JBZ A;  4PFY A;  5I56 B;  2UXA A;  3VLW A;  3IOT A;  4BDQ A;  1SW5 A;  1Y3N A;  1POY 1;  3IB2 A;  4RK9 A;  1UIU A;  2OK2 A;  1SI0 A;  2R9J A;  4HW8 A;  3VFJ A;  3V83 A;  2HFB A;  1N3W A;  1NKX A;  4IO2 A;  1I6A A;  1USY E;  4OZ9 A;  4NWD A;  1JW4 A;  1TFD A;  2UYE A;  2XX8 A;  3K00 A;  1MQI A;  3FVK A;  3IOU A;  3CG1 A;  4R9G A;  3IL1 B;  4YKP A;  2AIX A;  4L17 A;  1TFA A;  4JSD A;  2CZL A;  2I4C A;  4YKJ A;  4FE8 A;  3DP4 A;  1B32 A;  3FJG A;  4PET A;  2O68 A;  4P0I A;  1FW0 A;  2V84 A;  1LCT A;  4ZEF A;  1M5E A;  3C32 A;  1QW0 A;  1WDN A;  1HSE A;  3PUY E;  3I6V A;  4DXB A;  2HAV A;  1Q35 A;  3B6W A;  5CMB A;  3EHT A;  4R72 A;  2DYX A;  4MLV A;  3K6U A;  1N7W A;  1JW1 A;  4HTG A;  5M2V A;  1JW5 A;  3LBS A;  3O9P A;  2HAU A;  1HSL A;  3KN7 A;  4THI A;  5FHO A;  2BJJ X;  3H3G A;  3TQW A;  4BLA A;  1B6H A;  1D3K A;  3H7M A;  2GRV A;  4RPO A;  2Y7P A;  1BLF A;  2F78 A;  1DTG A;  1LFH A;  1FTL A;  3PMX A;  1IEJ A;  4G68 A;  4GL8 A;  1BKA A;  4U21 A;  2HEU A;  1SYI A;  3MVW A;  5AA4 A;  5KDT A;  2H4I A;  2ONS A;  2O1L A;  3C36 A;  2Q9T A;  2O7I A;  2Q8J A;  2XD3 A;  3F11 A;  1R9L A;  1MQJ A;  3DP6 A;  3V89 B;  1Z7M E;  2XXU A;  3HST A;  2ZNU A;  3U1O A;  3IOW A;  4RXL A;  3D4G A;  4FIM A;  2DVC A;  1Y4C A;  4NWC A;  4UA8 A;  3LSX A;  4KCD A;  2QMW A;  2DXR A;  1MY2 A;  4FEC A;  2A5T B;  3KN8 A;  3H6U A;  1JVX A;  4GFR A;  4MLQ A;  4GD5 A;  3K6W A;  5AA2 B;  4PP0 A;  4H0W A;  3SEX A;  1B52 A;  4LA9 A;  1MM6 A;  2XXX A;  2Y84 A;  3TFL A;  3L6G A;  3TEP A;  2YLN A;  4OTE A;  2H98 A;  5H8S A;  1J1N A;  1TT1 A;  1MXU A;  2V25 A;  2ZMB A;  2VP1 A;  3OSR A;  3OO9 A;  3G3I A;  3RN8 A;  3RGY A;  4JWO A;  5KZT A;  1MXW A;  4F3B A;  2D3I A;  3K02 A;  4U4S A;  4R6Y A;  3AXF A;  2V93 A;  2PMS A;  1RYX A;  3CG3 A;  4NE4 A;  1JNF A;  3ILU B;  2B3F A;  4RPN A;  2R6G E;  3MP6 A;  1QUK A;  3CR9 A;  1NFT A;  3UA8 A;  5IAI A;  2DE2 A;  4NF4 B;  1DPE A;  4U22 A;  3VLU A;  4DZ1 A;  1MH3 A;  4QF9 A;  1NH8 A;  1B7Z A;  5EHS A;  4ELQ A;  5K2X A;  1ATG A;  4K3F A;  4FJP A;  4KR5 A;  1SD3 A;  4EQ9 A;  4G2Z A;  4YKK A;  5CI5 A;  1FQC A;  5H8Q B;  2XXI A;  2GHA A;  3PUX E;  2XXW A;  3N6T A;  4FOR A;  5ELV A;  4YZZ A;  3ZKK A;  1VR5 A;  3CVG A;  4U23 A;  5ITO A;  2DWJ A;  4MF3 A;  4F18 A;  3U92 A;  3H03 A;  1A99 A;  3I3V A;  1BP5 A;  3IO4 A;  1H3D A;  3FAT A;  4NTL A;  4X1B A;  3PV0 E;  1OVT A;  2O69 A;  1B3L A;  1MDP 1;  2V3Q A;  4QFP A;  2F97 A;  4C1U A;  4F2Q A;  2CMO A;  1P1O A;  3MP8 A;  4LVQ A;  2I4B A;  5H8Q A;  3CI8 A;  2VHA A;  1MRP A;  4QSE A;  4XKN A;  4ESX A;  4P0G A;  1MPD A;  3T9H B;  2HQ0 A;  5DYH A;  3JYR A;  4OYV A;  1IXH A;  2DXY A;  3IR1 A;  2X7Q A;  3VV5 A;  3CFL A;  3T9V A;  4EQB A;  4Q8R A;  3FV2 A;  4DXU A;  4I62 A;  4EUO A;  3RNN A;  4KFQ A;  5B7D A;  1B1H A;  3PPN A;  3QIM A;  4NED A;  4IB2 A;  1L5T A;  3G3K A;  3MVY A;  2H9B A;  1NNP A;  3QSL A;  1PEB A;  4AQ4 A;  3K1P A;  5TPA B;  1OLA A;  3M3K A;  1B9J A;  4BDR A;  2FYI A;  1XVY A;  4F1U A;  4QFO A;  5L9S A;  4ZEI A;  1O63 A;  2H25 A;  4LP2 B;  1DMB A;  1QUJ A;  1LBB A;  2OBG A;  3OO6 A;  4GIZ A;  3TOD A;  3RPW A;  3TZA A;  3CSB A;  4LAT A;  4Q30 B;  1N04 A;  2O6A A;  1P1U A;  3E13 X;  5HBC A;  1I6Q A;  4F29 A;  2RIN A;  1FQF A;  3MVZ A;  3CFX A;  3A3U A;  3O97 A;  2REG A;  4X48 A;  5K2Y A;  1YPN A;  3S9L C;  1LBC A;  5FTH A;  4IO4 A;  1ZU0 A;  3O29 A;  5AA3 A;  2OWS A;  1MQG A;  4G8H A;  1VFE A;  3EPE A;  1UTH B;  3PU5 A;  4R9F A;  5L9O A;  4FED A;  4R74 A;  4IO3 A;  4UAC A;  5ITP A;  4O3A A;  2ZYM A;  5DT6 A;  1OQH A;  3SES A;  3TTL A;  4DXC A;  4EF2 A;  1AOV A;  1DPP A;  2PVU A;  3MJN A;  3GLB A;  1ZMG A;  2QMX A;  3K2D A;  3MWB A;  4QSD A;  4XKQ A;  5DEX B;  3E4R A;  3PD9 A;  3TKD A;  5AA4 B;  5HM4 B;  3USD A;  4R6K A;  3KSJ A;  3KFM A;  2I58 A;  1O64 A;  2XX9 A;  4I8C A;  1NMU A;  3SEU A;  4ISU A;  1NNT A;  3BBR A;  3HCQ A;  4X1D A;  3T66 A;  5ICT A;  5KCJ A;  1B0H A;  4HS7 A;  1P1Q A;  3LR1 A;  2PX1 A;  4OHN A;  3TYH A;  4C0R A;  1M5D A;  3C35 A;  2IA4 A;  4RK2 A;  4GXA A;  4XTC Q;  1O7T A;  3RUM A;  4EDP A;  4U1Z A;  4WKM A;  1TXF A;  3THI A;  3N6U A;  4OFL A;  1F9B A;  3I5O A;  4JWX A;  4PFU A;  4IY5 A;  4FEB A;  2ZNT A;  3O6H A;  1URG A;  3K1M A;  3KEI A;  4PE5 B;  3QAX A;  4GLI A;  3VVF A;  5J1D A;  3VXC A;  1R1N A;  3U72 A;  3E9X A;  3HO7 A;  3FJ7 A;  1B3G A;  3VLV A;  5B70 A;  5CBS A;  4MH5 A;  3MVX A;  5F1Q A;  2RF1 A;  2XD2 A;  2UYF A;  4KYD A;  4YAH X;  2DQV A;  1JVY A;  1B40 A;  3OEK A;  4TOZ A;  5IKB A;  1ANF A;  1PB7 A;  1US5 A;  1IUD A;  2UVJ A;  2VOZ A;  3HHF A;  4NF4 A;  1AMF A;  2GFE A;  3N5L A;  4DE8 A;  1RKM A;  4YU0 A;  1EZO A;  2XXR A;  4NF5 A;  3PGF A;  3SER A;  2AL5 A;  2DE3 A;  5I2K B;  1NNF A;  4R2B A;  2I0B A;  3SDF A;  1T0K A;  5I56 A;  1B0L A;  4G77 A;  4JSO A;  3DLN A;  4ND9 A;  4XXU A;  2H5Y A;  1MXV A;  2ONK E;  3B7D A;  3H6W A;  1FTJ A;  3ILT B;  3MP1 A;  5CRY A;  5F7V A;  2Z8F A;  5H8F B;  5CC2 A;  2KLF A;  1UTB B;  4OEU A;  1MY3 A;  4LZ7 A;  3S9E A;  3GXA A;  3S9N C;  3OO7 A;  4EF1 A;  1A40 A;  4ECF A;  1QJM A;  3OEM A;  2Y7I A;  4PFW A;  3S9M C;  1NL5 A;  1JEV A;  3RTF B;  1SW2 A;  2M8C A;  4H1X A;  2DVZ A;  3LSF B;  4F1Y A;  3FGS A;  3IJO B;  3MW0 A;  1P1N A;  3FVN A;  2XXQ A;  3SEY A;  1MXX A;  2I49 A;  4U2R A;  4ZS9 A;  4YB6 A;  4OMB A;  3G3H A;  3PD8 A;  4YMA A;  3W9W A;  1P1W A;  3RT6 B;  1HSJ A;  1OQG A;  5DVJ A;  4DLD A;  3PPQ A;  1M5C A;  3SEV A;  4ELP A;  4IGT A;  4BDL A;  1B51 A;  4KD5 A;  3BFT A;  5CMC A;  3MPK A;  1YTV A;  3OO8 A;  4LON B;  4XKR A;  4ZED A;  5JK4 A;  4GXS B;  1LAX A;  2G29 A;  3O66 A;  4GQO A;  2XXT A;  4LQ2 A;  3M3L A;  4KPT A;  4HCW A;  4ZEB A;  4H8J A;  3TCF A;  1XVX A;  1PC3 A;  4EQ7 A;  4R2F A;  3FIR A;  1URD A;  2DOJ A;  4RA1 A;  2Z22 A;  2ONR A;  3B6Q A;  4GWO A;  1N84 A;  1UQW A;  1TWY A;  3TMG A;  1IIT A;  1OLC A;  1YCJ A;  4GF8 A;  1B7U A;  4OEN A;  3KN3 A;  4RNS A;  4F3P A;  1USY H;  1OMP A;  2PT2 A;  1B7H A;  2VD2 A;  3KGC A;  2VGQ A;  3SEW A;  2QRY A;  2OWT A;  4WED A;  2F6P A;  3R7X A;  5H8F A;  2DE4 A;  3G3G A;  1ZBM A;  1Q1K A;  1BIY A;  3IAZ A;  4F19 A;  4NMY A;  2QL3 A;  2QS1 A;  2Z8E A;  4ZDM A;  5JEI A;  2I48 A;  2YJP A;  3UIF A;  3H6V A;  3MZ9 A;  1JQF A;  1VSO A;  1S9T A;  3GBA A;  2F6G A;  1DSN A;  2DWH A;  3T9U A;  1LGB C;  4ZEC A;  2O51 A;  4G8M A;  1B5J A;  1Y4T A;  1A54 A;  1POT A;  2HCA A;  5H8H B;  4PFT A;  3OEN A;  4LUB A;  1LAF E;  3OD7 A;  1R6Z A;  4F3G A;  5A5X B;  1LAG E;  1AIV A;  2UVH A;  5CMM A;  4YB7 A;  5KCJ B;  2O84 X;  2F34 A;  1DTZ A;  1QUL A;  2XHD A;  3O6G A;  5ISU A;  1VE4 A;  3FVG A;  3K6X A;  1MPC A;  2RC8 A;  4X9T A;  1B3F A;  4JWY A;  4OFJ A;  1SW1 A;  3SKP A;  2F7B A;  3DEL B;  3QK6 A;  4QHQ A;  3JV9 A;  2RCB A;  4H65 A;  3FXQ A;  4F2O A;  1NNK A;  3JZJ A;  4OQO A;  2Q88 A;  1IXI A;  1N76 A;  3TQL A;  4JB7 A;  1B1X A;  3FVO A;  4R6H A;  3FAS A;  2QSX A;  2ALU A;  1SDX A;  1UTH A;  1GGG A;  4AB6 A;  3OOA A;  1VFD A;  2HZK A;  3PPR A;  4KYS A;  3EQ1 A;  1N3X A;  1XC1 A;  4G68 C;  4G4P A;  2RC7 A;  3HPI A;  3TCH A;  3UK4 A;  4F22 A;  4QFL A;  1D4N A;  2PBW A;  5CBR A;  5I2N B;  5I84 A;  5LOM A;  2ZNS A;  1MS7 A;  3DP8 A;  1A8E A;  3KG2 A;  1B46 A;  2F36 A;  4U4X A;  3O2A A;  1XT8 A;  1I69 A;  4BDO A;  1JEU A;  4QFN A;  4RYA A;  2ZXT A;  1KWH A;  4NF5 B;  1MQD A;  1Y1M A;  2B65 A;  2QS2 A;  1LB9 A;  1LB8 A;  3HHG A;  3L6H A;  2Q89 A;  3ODB A;  3PMV A;  4TQU Q;  5I58 B;  4RY1 A;  3O28 A;  3KJ7 A;  2Y7R A;  1A8F A;  2QPQ A;  3LUY A;  1H43 A;  3RQT A;  2UVG A;  2ZYK A;  2I6E A;  3B6T A;  4JDF A;  4O3C A;  3W9V A;  2ZYN A;  3TTR A;  3C9H A;  1MM7 A;  1GVC A;  1FTM A;  4QSC A;  4GRK A;  3MBP A;  1IXC A;  4YIC A;  5DTB A;  4OEV A;  2D5W A;  1Z7N E;  2XXV A;  3KSX A;  3TAJ A;  2I0C A;  2HXW A;  2THI A;  4H67 A;  4ELR A;  3LSL A;  3G3J A;  3MZB A;  1Y3Q A;  3R26 A;  4P11 A;  3ZS6 A;  5I57 A;  2Z23 A;  3MQ9 A;  4QRZ A;  4POX A;  5HPQ A;  1FCK A;  5AA2 A;  1RYO A;  1SBP A;  1S50 A;  1D9Y A;  3C34 A;  4OXV A;  2GHB A;  2X7P A;  3CRB A;  1A55 A;  5L8D A;  3SET A;  3H6T A;  3PMW A;  4IO5 A;  4M1V A;  1H44 A;  3CIJ A;  5AE4 A;  3TPA A;  3EHU A;  5EYF A;  4N13 A;  2DWI A;  2OJT A;  3T93 B;  3N94 A;  3R6U A;  4I1D A;  2NVU B;  4EXK A;  3CSG A;  5I57 B;  5JTY B;  4ESW A;  3PPO A;  2G93 A;  2I3V A;  4H8I A;  4GOT A;  1LLS A;  2R71 A;  4H6D A;  4YKI A;  3QYT A;  4F31 B;  2GH9 A;  4TLL B;  4DCY A;  1WVJ A;  4IY6 A;  3IJX B;  2ESN A;  4QFK A;  1LFG A;  4WEP A;  4F39 A;  2F35 A;  2RC9 A;  3OEL A;  3RLF E;  1H45 A;  2W7Y A;  1SVX B;  3A09 A;  5BWJ A;  5I59 A;  2X26 A;  4H5F A;  1XOC A;  2XXP A;  5DEX A;  5I58 A;  4N07 A;  2AL4 A;  1MH4 A;  4E0W A;  1DOT A;  2Z8D A;  3IOV A;  3RY3 A;  1ZTY A;  2QS3 A;  2P0S A;  5FHN A;  1N7X A;  2DWA A;  2RKM A;  1SYH A;  1Y9U A;  3LC8 A;  3MUQ A;  1ZIU A;  4ZEK A;  3UP9 A;  1QKB A;  3IB1 A;  5H8N B;  1M5B A;  1AL3 A;  3C33 A;  3FV1 A;  5DVF A;  3C31 A;  1SI1 A;  3S2V A;  1ZLQ A;  1GR2 A;  4PQJ A;  3TUS A;  3FXU A;  4Q0C A;  3EF7 A;  3V8X B;  1FTK A;  2PT1 A;  1XHY A;  2QJE A;  3TDJ A;  4AB5 A;  3FD3 A;  3QUF A;  3T9X B;  4YMB A;  3K01 A;  1QKA A;  3M8U A;  2F7A A;  3PPP A;  1LFI A;  3KOT A;  3PUZ E;  3QUJ A;  4JXI A;  1PBQ A;  2XX7 A;  3C4M A;  3O6I A;  3UGW A;  1URS A;  4DIG A;  3IO6 A;  1M5F A;  4LQ5 A;  4Z7E A;  1LST A;  2I3W A;  1AH5 A;  1IQ7 A;  3OMB A;  1FTO A;  2YPN A;  1LAH E;  4O3B A;  4RJZ A;  2FNC A;  2P2A A;  1WOD A;  1MY0 A;  4DCX A;  1GV8 A;  4OWD A;  2DP8 A;  1Y20 A; 
#chains in the Genus database with same CATH topology
 3FZV A;  2P3V A;  1IXG A;  3K0V A;  1FRP A;  1JET A;  1IIW A;  4GL0 A;  2LAO A;  5TP9 B;  3G7W A;  5A5L A;  3IX1 A;  3TCG A;  5EQ8 A;  1UIV A;  3KBR A;  4N15 A;  4F3S A;  3BKI B;  2DSF A;  2ABH A;  3FJM A;  3Q25 A;  5ESY A;  4GWX A;  4OET A;  2P1S A;  3M3F A;  4P47 A;  4C1T A;  3IK6 B;  3DM0 A;  5I2N A;  4XIG Q;  3V5A A;  1B58 A;  5A5X A;  2WX9 A;  3RT8 A;  4OER A;  3T22 A;  1NH7 A;  5ICQ A;  4WXJ A;  2B3B A;  1EU8 A;  3OXN A;  3BFU A;  2WKY A;  1MXY A;  3FBP A;  3VVD A;  2Y7K A;  2NUV A;  2F7C A;  3HN0 A;  2AYS A;  4G68 B;  1LCF A;  3PUV E;  1OVB A;  1MPB A;  5AA1 A;  3T96 B;  4BDM A;  3NOH A;  2HZL A;  1MY4 A;  3LSW A;  4NF8 A;  4ZZE A;  1PBP A;  3TEL A;  3U94 A;  3KZG A;  2UXA A;  3VLW A;  1Y3N A;  1POY 1;  3VFJ A;  4N81 A;  1N3W A;  5EQ9 A;  1TFD A;  1MQI A;  3IL1 B;  4YKP A;  4YKJ A;  3FXB A;  1B32 A;  3FJG A;  4PET A;  1FW0 A;  2V84 A;  4P8B A;  1QW0 A;  5CMB A;  4R72 A;  4GX4 A;  3K6U A;  4HTG A;  3MST A;  3KN7 A;  3H3G A;  3TQW A;  1B6H A;  3PMX A;  4NN3 A;  2HEU A;  4N6K A;  2O1L A;  3F11 A;  1MQJ A;  3U1O A;  4NWC A;  4KCD A;  1JVX A;  4PP0 A;  4H0W A;  1B52 A;  4LA9 A;  1MM6 A;  2XXX A;  2YLN A;  1J1N A;  2ZMB A;  4JVD A;  5KZT A;  3AXF A;  3CG3 A;  4N8G A;  3UA8 A;  2CEX A;  4QF9 A;  5EHS A;  4ELQ A;  1ATG A;  4K3F A;  4EQ9 A;  1SD3 A;  2XXW A;  1VR5 A;  3CVG A;  3T1B A;  3H03 A;  4N4U A;  2O69 A;  2F97 A;  1NUZ A;  4P0G A;  3T9H B;  1FPJ A;  1IXH A;  3T9V A;  4Q8R A;  4NED A;  3A29 A;  3MVY A;  4AQ4 A;  5TPA B;  1OLA A;  4NG7 A;  2OBG A;  3CSB A;  2O6A A;  2QFL A;  1I6Q A;  4H45 A;  2RIN A;  3MVZ A;  4F29 A;  3CFX A;  3S9L C;  1YPN A;  4G8H A;  3EPE A;  3PU5 A;  4FED A;  4UAC A;  4O3A A;  1OQH A;  2KR0 A;  4DXC A;  5ET6 A;  3GLB A;  2Y5L A;  3PD9 A;  3USD A;  1NMU A;  5KCJ A;  1P1Q A;  4O7M A;  1M5D A;  4RK2 A;  1O7T A;  3RUM A;  4WKM A;  1TXF A;  4PGN A;  3I5O A;  3VVF A;  3VXC A;  4I40 A;  3E9X A;  5CBS A;  2RF1 A;  2XD2 A;  2QVU A;  3OEK A;  1PB7 A;  1US5 A;  2UVJ A;  4YU0 A;  4NF5 A;  3PGF A;  5I2K B;  1NNF A;  2I0B A;  3BIG A;  5I56 A;  4G77 A;  4XXU A;  1MXV A;  1FTJ A;  5CC2 A;  4OEU A;  4P9K A;  4EF1 A;  1A40 A;  1NV3 A;  2Y7I A;  1JEV A;  4O7I A;  3RTF B;  4PC9 A;  4ZS9 A;  3PD8 A;  3RT6 B;  1M5C A;  4ELP A;  4BDL A;  1B51 A;  3KC0 A;  3BFT A;  3MPK A;  4N8Y A;  2G29 A;  4ZEB A;  1XVX A;  1PC3 A;  4RA1 A;  1URD A;  4PCD A;  2QVV A;  1UQW A;  1TWY A;  2ZZV A;  1B7U A;  2PT2 A;  2VD2 A;  2VGQ A;  2DE4 A;  4MCO A;  1ZBM A;  3IAZ A;  2Z8E A;  2F3D A;  1VSO A;  2O51 A;  2F3B A;  1Y4T A;  1A54 A;  5ET5 A;  1R6Z A;  1LBZ A;  5A5X B;  5IZZ A;  1VDW A;  4NGU A;  1QUL A;  3K6X A;  4X9T A;  1B3F A;  1SW1 A;  3DEL B;  2RCB A;  4H65 A;  3TQL A;  4JB7 A;  1B1X A;  4R6H A;  2ALU A;  1GGG A;  1NV4 A;  3EQ1 A;  5CBR A;  5LOM A;  4U4X A;  1XT8 A;  3SZP A;  4BDO A;  2ZXT A;  1KWH A;  2QS2 A;  3PMV A;  1LB9 A;  1YZ0 A;  3ODB A;  5I58 B;  3O28 A;  4P1E A;  3RQT A;  2ZYK A;  3B6T A;  1IMC A;  1MM7 A;  4YIC A;  2HXW A;  1Y3Q A;  5I57 A;  1S50 A;  3C34 A;  1LBW A;  1H44 A;  3EHU A;  3T93 B;  2NVU B;  4H6D A;  2R71 A;  4F31 B;  2GH9 A;  4MHF A;  4NAP A;  1WVJ A;  3IJX B;  2ESN A;  4PDH A;  4WEP A;  4F39 A;  1K9Y A;  3LUZ A;  4OA4 A;  5DEX A;  5I58 A;  4E0W A;  2Z8D A;  3RY3 A;  1N7X A;  4ZEK A;  3MUQ A;  5H8N B;  3FV1 A;  1ZLQ A;  4PQJ A;  4MMP A;  3FXU A;  2P3N A;  1Q9D A;  2PFZ A;  3FD3 A;  3T9X B;  4YMB A;  1FPD A;  4JXI A;  2XX7 A;  3C4M A;  3O6I A;  3UGW A;  1URS A;  4O8M A;  1M5F A;  1NUY A;  2Y5K A;  1AH5 A;  1FTO A;  1LAH E;  2P2A A;  1WOD A;  1MY0 A;  1Y20 A;  1MXZ A;  3K4U A;  3A3C A;  4ONY A;  1FQE A;  1MDQ A;  4IO6 A;  2VPO A;  1MY1 A;  4R73 A;  2RCA A;  4M4G A;  4Q5T A;  3WAF A;  4IGR A;  3K6V A;  4JVI A;  5DVI A;  3U8Q A;  1N0T A;  5H8N A;  2OCU A;  3UN6 A;  1ZJL A;  4R75 A;  2PYY A;  4KQP A;  3MPL A;  1NV6 A;  1A7L A;  3TTN A;  1QVS A;  4FAJ A;  5TPA A;  2VD3 A;  4EXL A;  1MQH A;  3GZG A;  3MC2 A;  4I9D A;  4PTK A;  1YAE A;  4OES A;  5I59 B;  3N26 A;  1MG1 A;  1II5 A;  5DW8 A;  2Q2C A;  4LZ8 A;  4QXD A;  3D4C A;  1B5I A;  4HCY A;  4KHZ E;  4OFO A;  4LZ5 A;  3EN3 A;  2XXH A;  2XWI A;  3ONM A;  2NOO A;  1OIB A;  3QXM A;  3KJT A;  2Q2A A;  3K1N A;  5J16 A;  3WAE A;  1NV2 A;  2F5X A;  4H46 A;  3ZKL A;  3KOS A;  2V3T A;  3TTM A;  4P56 A;  1SQY A;  1PDA A;  3S4U A;  2WEF A;  4E0X A;  2F8D A;  1FPE A;  1B3E A;  1Y1Z A;  3W15 C;  1D9V A;  1CNQ A;  3LV0 A;  5EHM A;  1CB6 A;  4NF6 A;  2Y7W A;  3FXR A;  4H5G A;  3TTK A;  4ELO A;  3MAM A;  3OSQ A;  5I56 B;  1UIU A;  2OK2 A;  1SI0 A;  4HW8 A;  3V83 A;  3K00 A;  2R8T A;  3CG1 A;  1TFA A;  4JSD A;  1NI9 A;  5I5P A;  4P0I A;  4GWS A;  1LCT A;  4ZEF A;  1HSE A;  2HAV A;  1Q35 A;  3EHT A;  2DYX A;  1JW5 A;  3LBS A;  4BLA A;  3H7M A;  1BLF A;  2BJI A;  4G68 A;  4GL8 A;  4U21 A;  1SYI A;  1JP4 A;  1FJ9 A;  3DP6 A;  2XXU A;  3HST A;  1QGX A;  3T0J A;  3IOW A;  3D4G A;  1Y4C A;  3KN8 A;  3K6W A;  5AA2 B;  2Y84 A;  3L6G A;  3E79 A;  1TT1 A;  3OO9 A;  4F3B A;  4NE4 A;  2PMS A;  1FJ6 A;  4RPN A;  4U22 A;  4DZ1 A;  1MH3 A;  2DDK A;  1NH8 A;  5K2X A;  4KR5 A;  4YKK A;  1LBY A;  5H8Q B;  3N6T A;  5ELV A;  4FOR A;  4U23 A;  5ITO A;  4MF3 A;  3U92 A;  1A99 A;  3CHG A;  3I3V A;  1BP5 A;  3IO4 A;  4X1B A;  1OVT A;  4QFP A;  2CMO A;  1P1O A;  3MP8 A;  3CI8 A;  2VHA A;  4QSE A;  4XKN A;  4ESX A;  2HQ0 A;  4DXU A;  4EUO A;  5B7D A;  4KFQ A;  4IB2 A;  1DCU A;  4HE2 A;  3M3K A;  1B9J A;  5L9S A;  2FYI A;  1XVY A;  4F1U A;  4ZEI A;  4XEQ A;  1O63 A;  3TZA A;  1LBB A;  3TOD A;  4GWU A;  4LAT A;  4Q30 B;  3E13 X;  5HBC A;  3A3U A;  5FTH A;  4IO4 A;  3O29 A;  5AA3 A;  1VFE A;  5ITP A;  5DT6 A;  4EF2 A;  5DEX B;  4QSD A;  4R6K A;  3KSJ A;  4I8C A;  2I58 A;  3SEU A;  2XX9 A;  3BBR A;  4X1D A;  5ICT A;  3T66 A;  1XI6 A;  3LR1 A;  2PX1 A;  3THI A;  4PFI A;  3O6H A;  1NV5 A;  3QAX A;  3HO7 A;  3VLV A;  1B3G A;  5B70 A;  4MH5 A;  2DQV A;  1JVY A;  4TOZ A;  4NF4 A;  1RKM A;  3SER A;  2AL5 A;  2DE3 A;  2VT5 A;  4R2B A;  3BIH A;  1T0K A;  2QVR A;  3DLN A;  5CRY A;  2H5Y A;  3MP1 A;  3ILT B;  4LZ7 A;  3S9E A;  3OEM A;  1FBC A;  4PFW A;  1NL5 A;  5FBP A;  2XWV A;  1SW2 A;  2M8C A;  2DVZ A;  5EQA A;  4GWY A;  4O94 A;  3SEY A;  3W9W A;  1HSJ A;  4DLD A;  3SEV A;  4KD5 A;  5CMC A;  4XF5 A;  1LAX A;  3M3L A;  4KPT A;  1NV7 A;  4EQ7 A;  2DOJ A;  2Z22 A;  1N84 A;  1IIT A;  1OLC A;  4GF8 A;  3KN3 A;  3SEW A;  2F6P A;  3G3G A;  5JEI A;  1BIY A;  4MX6 A;  4HE0 A;  2I48 A;  2YJP A;  3UIF A;  3MZ9 A;  1S9T A;  3GBA A;  4ZEC A;  1LGB C;  4I3Y A;  5H8H B;  1POT A;  4F3G A;  1LAG E;  1AIV A;  2UVH A;  2ZZW A;  4YB7 A;  5KCJ B;  2O84 X;  5ISU A;  4PBQ A;  3FVG A;  1FPB A;  2RC8 A;  3IFA A;  3SKP A;  3JV9 A;  3FXQ A;  4F2O A;  3JZJ A;  1IXI A;  4PFR A;  2CZI A;  3FAS A;  4AB6 A;  4N6D A;  2HZK A;  3PPR A;  4MNP A;  4KYS A;  1XC1 A;  1N3X A;  2Q8M A;  4G4P A;  5I84 A;  4QFL A;  1D4N A;  2PBW A;  3DP8 A;  1MS7 A;  1A8E A;  2F36 A;  2HPG A;  2FIX A;  1I69 A;  4PAF A;  1JEU A;  1MQD A;  1Y1M A;  4NHB A;  2FHY A;  1IME A;  2GQ1 A;  4RY1 A;  4AS4 A;  3W9V A;  1FTM A;  4GRK A;  4NF0 A;  4H67 A;  4QRZ A;  4POX A;  2XXK A;  2X7P A;  1A55 A;  4IO5 A;  4M1V A;  1FBD A;  3CIJ A;  5EYF A;  4N13 A;  2DWI A;  3R6U A;  4I1D A;  4EXK A;  1YYZ A;  3CSG A;  5I57 B;  1LFG A;  3QMF A;  3KC1 A;  2F35 A;  2RC9 A;  3RLF E;  5BWJ A;  1SVX B;  4H5F A;  2AL4 A;  1ZTY A;  2P0S A;  5FHN A;  1FPI A;  2DWA A;  1FPG A;  2RKM A;  2WBB A;  1M5B A;  4NX1 A;  1SI1 A;  3S2V A;  1GR2 A;  3TUS A;  1FTK A;  2PT1 A;  4AB5 A;  1IMB A;  3K01 A;  3QUJ A;  2WYK A;  1PBQ A;  5LDZ A;  3IO6 A;  2I3W A;  1IQ7 A;  3OMB A;  4O3B A;  2FNC A;  5AA2 D;  5T3J A;  3VDF A;  1P99 A;  3EHS A;  4GVO A;  5I3S A;  4XKP A;  4NF6 B;  5CMK A;  1US4 A;  1UTB A;  4Z0I A;  2XWO A;  1GTK A;  2FBP A;  2A5T A;  3RYD A;  3ECR A;  4PE3 A;  3ZSF A;  4ZE9 A;  1IZ1 A;  4KYE A;  2VPN A;  3P7I A;  3G3F A;  1XS5 A;  4IO7 A;  4YB5 A;  2XXY A;  2B4L A;  1CE2 A;  3Q27 A;  1PB9 A;  2O7U A;  1QUI A;  3PUW E;  2MKZ A;  3PTY A;  1FBH A;  1FPK A;  2FA7 A;  4PAI A;  1I6B A;  5L9M A;  4ZE8 A;  4TLM B;  2XA5 A;  3MZ1 A;  1R9Q A;  3IB0 A;  1B4Z A;  5CM6 A;  2ZYO A;  4HXV A;  1ELJ A;  2V3U A;  1RDY A;  4MBP A;  4DDD A;  3H06 B;  4KCC A;  1LBX A;  4F1V A;  5JTY A;  3VVE A;  2E1S A;  2D21 A;  1FSA A;  2DS9 A;  5TU0 A;  4PFY A;  5IZ3 B;  3IOT A;  2Q74 A;  3IB2 A;  3E78 A;  2HFB A;  1NV1 A;  2CZK A;  4NWD A;  2UYE A;  2XX8 A;  3FVK A;  2CZL A;  2I4C A;  4FE8 A;  2O68 A;  1M5E A;  2PFY A;  3C32 A;  3PUY E;  3I6V A;  4DXB A;  1RDX A;  4MLV A;  4MAG A;  4THI A;  2BJJ X;  1D3K A;  2GRV A;  2F78 A;  2H4I A;  3C36 A;  1R9L A;  3V89 B;  1Z7M E;  2ZNU A;  2CZH A;  4RXL A;  4FIM A;  2DVC A;  4PBH A;  4UA8 A;  2DXR A;  1MY2 A;  5ET8 A;  2A5T B;  4OAN A;  3H6U A;  4MLQ A;  2FVZ A;  4MNC A;  1EYI A;  1G0H A;  2H98 A;  5H8S A;  1MXU A;  1K9Z A;  3RN8 A;  1MXW A;  3RPL A;  4U4S A;  1NV0 A;  2V93 A;  1JNF A;  3ILU B;  1LEV A;  3MP6 A;  1QUK A;  3CR9 A;  2DE2 A;  4NF4 B;  2JJK A;  1B7Z A;  3EKI A;  4FJP A;  3ISP A;  4G2Z A;  3PUX E;  4YZZ A;  1H3D A;  4C1U A;  4LVQ A;  5H8Q A;  1MRP A;  4KXP A;  1MPD A;  2OWZ A;  3VV5 A;  3IR1 A;  2PCR A;  3G3K A;  1NNP A;  1PEB A;  4BDR A;  4LP2 B;  1DMB A;  1QUJ A;  4MEV A;  5I7I A;  3RPW A;  1N04 A;  1FQF A;  4X48 A;  4MIJ A;  1DK4 A;  4IO3 A;  2ZYM A;  3SES A;  3TTL A;  1AOV A;  1DPP A;  2PVU A;  4XKQ A;  3K2D A;  2QMX A;  3MWB A;  4C0R A;  5AA4 B;  5HM4 B;  3TKD A;  5KDT B;  3KFM A;  1NNT A;  1B0H A;  4HS7 A;  4GXA A;  4PF6 A;  4XTC Q;  4EDP A;  4U1Z A;  4OFL A;  1F9B A;  3IFC A;  4JWX A;  4FEB A;  3K1M A;  3KEI A;  3FJ7 A;  3U65 A;  3MVX A;  5F1Q A;  4MNI A;  5IKB A;  1ANF A;  1IUD A;  3HHF A;  1AMF A;  2GFE A;  1EZO A;  4JVC A;  1B0L A;  4ND9 A;  3H6W A;  2KLF A;  1UTB B;  1MY3 A;  3OO7 A;  4ECF A;  1QJM A;  2L5V A;  5EYH A;  4GBW A;  3FGS A;  3IJO B;  5IGA A;  2KQZ A;  3FVN A;  2XXQ A;  4P1L A;  1MXX A;  4U2R A;  4OMB A;  3G3H A;  4PGP A;  4YMA A;  1P1W A;  2WYP A;  4IGT A;  1AWB A;  1YTV A;  3OO8 A;  4LON B;  4GXS B;  4LQ2 A;  2XXT A;  3KBZ A;  4H8J A;  3TCF A;  4R2F A;  3FIR A;  3B6Q A;  4GWO A;  4OVS A;  1FTA A;  4OEN A;  4RNS A;  4F3P A;  3KGC A;  2QRY A;  3R7X A;  4F19 A;  1Q1K A;  4NMY A;  4ZDM A;  3H6V A;  1JQF A;  1DSN A;  2DWH A;  4PDD A;  1B5J A;  4LUB A;  1LAF E;  5CMM A;  5IZ1 A;  1VE4 A;  1MPC A;  4JWY A;  4OFJ A;  4QHQ A;  3QK6 A;  4DI3 D;  1NNK A;  4OQO A;  1KA0 A;  1IMD A;  3OOA A;  1FBP A;  4XFE A;  3TCH A;  3B8B A;  3KG2 A;  3O2A A;  4GFR A;  2B65 A;  3HHG A;  3L6H A;  1LB8 A;  5BUU A;  3KJ7 A;  2Y7R A;  3LUY A;  4OVT A;  4O3C A;  2B4M A;  4OEV A;  2D5W A;  1Z7N E;  2XXV A;  3KSX A;  3TAJ A;  2THI A;  3LSL A;  3G3J A;  3MZB A;  4P11 A;  2Z23 A;  5AA2 A;  1RYO A;  4OXV A;  1D9Y A;  2GHB A;  1EYK A;  3H6T A;  5AE4 A;  4H8I A;  2G93 A;  2I3V A;  1LLS A;  4YKI A;  3QYT A;  4DCY A;  3OEL A;  1H45 A;  1SPI A;  2X26 A;  1XOC A;  4N07 A;  1MH4 A;  1DOT A;  5L9O A;  3LC8 A;  1Y9U A;  3UP9 A;  1ZIU A;  1QKB A;  3IB1 A;  1KZ8 A;  3V8X B;  3TDJ A;  3QUF A;  3M8U A;  3PUZ E;  1LFI A;  3KOT A;  1D9Q A;  4DIG A;  1KA1 A;  4Z7E A;  1LST A;  2YPN A;  4DCX A;  4X04 A;  3GBB A;  1LBV A;  2FIE A;  1H76 A;  5FTI A;  1INP A;  1B4H A;  3RTW B;  5EYG A;  3Q26 A;  5F24 A;  2H99 A;  4AS5 A;  4ZZA A;  2QS4 A;  3CFZ A;  4OVJ A;  2ANJ A;  1SW4 A;  1S7Y A;  3FUZ A;  1FQD A;  4PFB A;  4OVR A;  4FAT A;  1PB8 A;  4N6P A;  1EZ9 A;  4G8N A;  5TP9 A;  2A5S A;  2OZZ A;  3UOR A;  4MFI A;  5FHM A;  4PF8 A;  4BDN A;  4FBP A;  2NXO A;  2O1M A;  2IEE A;  4PAK A;  1FQB A;  1Y3P A;  2REJ A;  1EZP A;  4POW A;  3IOR A;  4U1O A;  2WBD A;  3E3K A;  1FQA A;  1ZKB A;  1EH3 A;  3H4Z A;  5IM2 A;  4GWW A;  4KI0 E;  1B5H A;  5H8H A;  1BTJ A;  3VE1 B;  1B05 A;  3U93 A;  1B3H A;  2NWJ A;  4NF8 B;  2OLB A;  4IR8 A;  1FBG A;  1B2H A;  3Q28 A;  3Q29 A;  3HV1 A;  3VXB A;  1G0I A;  5I2K A;  2UVI A;  2E0S A;  3S9M C;  4JBZ A;  3HFU A;  4BDQ A;  1SW5 A;  4RK9 A;  2R9J A;  4HE1 A;  1NKX A;  4IO2 A;  1I6A A;  1USY E;  4OZ9 A;  1JW4 A;  3IOU A;  4R9G A;  2AIX A;  4L17 A;  3DP4 A;  1WDN A;  3B6W A;  4UAB A;  1N7W A;  1JW1 A;  5M2V A;  3O9P A;  2HAU A;  1HSL A;  5FHO A;  4RPO A;  2Y7P A;  1LFH A;  1DTG A;  1FTL A;  1IEJ A;  1BKA A;  3MVW A;  5AA4 A;  5KDT A;  2ONS A;  2Q9T A;  2O7I A;  2Q8J A;  2XD3 A;  3B50 A;  3LSX A;  2QMW A;  4FEC A;  4GD5 A;  3SEX A;  3TFL A;  3TEP A;  4OTE A;  2V25 A;  2VP1 A;  3OSR A;  3G3I A;  3RGY A;  4JWO A;  2D3I A;  1DBZ A;  3K02 A;  4R6Y A;  1RYX A;  1IMA A;  5IZ3 A;  1BK4 A;  2B3F A;  2R6G E;  1NFT A;  5IAI A;  1DPE A;  3VLU A;  5CI5 A;  1FQC A;  2XXI A;  2GHA A;  3ZKK A;  2DWJ A;  4F18 A;  3FAT A;  4NTL A;  1FPF A;  3PV0 E;  2V3Q A;  1B3L A;  1MDP 1;  4G61 A;  4F2Q A;  3MYU A;  2I4B A;  2XWK A;  4N17 A;  5DYH A;  3JYR A;  4OYV A;  2DXY A;  2X7Q A;  3CFL A;  4EQB A;  3FV2 A;  4I62 A;  3RNN A;  1B1H A;  3PPN A;  1FBF A;  3QIM A;  1L5T A;  2H9B A;  3QSL A;  3K1P A;  4QFO A;  2H25 A;  3OO6 A;  4GIZ A;  1P1U A;  3O97 A;  2REG A;  5K2Y A;  1LBC A;  1ZU0 A;  2OWS A;  1MQG A;  1UTH B;  4R9F A;  4R74 A;  4GWZ A;  2OX3 A;  2ZZX A;  3MJN A;  1ZMG A;  3E4R A;  1O64 A;  4QBA A;  4ISU A;  3HCQ A;  3TYH A;  4OHN A;  3C35 A;  2IA4 A;  4P3L A;  3D1R A;  3N6U A;  1YXI A;  3ROJ A;  4PFU A;  4IY5 A;  2ZNT A;  5J1D A;  1URG A;  4PE5 B;  4GLI A;  1R1N A;  3U72 A;  2UYF A;  4KYD A;  4YAH X;  1B40 A;  2VOZ A;  4DE8 A;  3N5L A;  2XXR A;  3SDF A;  4JSO A;  2ONK E;  3B7D A;  5F7V A;  5H8F B;  2Z8F A;  3GXA A;  3S9N C;  1FPL A;  4GX6 A;  4H1X A;  3LSF B;  4F1Y A;  3MW0 A;  1P1N A;  2I49 A;  4YB6 A;  1OQG A;  5DVJ A;  3PPQ A;  4XKR A;  5ET7 A;  4ZED A;  5JK4 A;  1IMF A;  3O66 A;  4GQO A;  4HCW A;  4GX3 A;  2ONR A;  3TMG A;  1YCJ A;  1USY H;  1OMP A;  1B7H A;  5LTC A;  4WED A;  2OWT A;  5H8F A;  2HXR A;  2QL3 A;  2QS1 A;  2V4C A;  2F6G A;  3T9U A;  4G8M A;  4MJO A;  2HCA A;  4PFT A;  3OEN A;  3OD7 A;  4OVQ A;  2F34 A;  1DTZ A;  2XHD A;  3O6G A;  1RDZ A;  3RPL B;  2F7B A;  2Q88 A;  1N76 A;  4X8R A;  3FVO A;  3GYY A;  2QSX A;  1SDX A;  1UTH A;  1VFD A;  1FBE A;  4G68 C;  1NUX A;  2RC7 A;  3HPI A;  3UK4 A;  4F22 A;  5I2N B;  2ZNS A;  1B46 A;  4DI4 B;  4RYA A;  4QFN A;  4NF5 B;  4TQU Q;  4N91 A;  2Q89 A;  1A8F A;  2QPQ A;  1H43 A;  2UVG A;  2I6E A;  4JDF A;  2ZYN A;  3TTR A;  3C9H A;  1GVC A;  4QSC A;  2CEY A;  3MBP A;  1IXC A;  4I3E A;  5DTB A;  2I0C A;  4ELR A;  3R26 A;  3ZS6 A;  3MQ9 A;  5HPQ A;  1FCK A;  1SBP A;  3CRB A;  5L8D A;  3SET A;  3PMW A;  3TPA A;  2OJT A;  3N94 A;  5JTY B;  4ESW A;  3PPO A;  4GOT A;  4TLL B;  4IY6 A;  4QFK A;  2W7Y A;  3A09 A;  4NQ8 A;  5I59 A;  2XXP A;  5EQ7 A;  3IOV A;  2QS3 A;  1SYH A;  4LN5 A;  4GBV A;  1AL3 A;  3C33 A;  5DVF A;  3C31 A;  1EYJ A;  4Q0C A;  1NUW A;  3EF7 A;  1XHY A;  2HHM A;  2QJE A;  4OVP A;  1QKA A;  3PPP A;  2F7A A;  4LQ5 A;  4RJZ A;  1GV8 A;  4OWD A;  2DP8 A; 
#chains in the Genus database with same CATH homology
 1MXZ A;  3FZV A;  3K4U A;  3GBB A;  3A3C A;  4ONY A;  1IXG A;  5AA2 D;  1FQE A;  1MDQ A;  3K0V A;  4IO6 A;  1H76 A;  3VDF A;  1MY1 A;  1P99 A;  4R73 A;  2RCA A;  4M4G A;  4Q5T A;  5FTI A;  3WAF A;  1JET A;  4IGR A;  3EHS A;  3K6V A;  4GVO A;  1B4H A;  3RTW B;  5DVI A;  3Q26 A;  3U8Q A;  4XKP A;  1N0T A;  2H99 A;  4NF6 B;  1IIW A;  5CMK A;  5H8N A;  1US4 A;  2OCU A;  4GL0 A;  4ZZA A;  1UTB A;  1ZJL A;  4Z0I A;  4R75 A;  3UN6 A;  2QS4 A;  3CFZ A;  2LAO A;  2PYY A;  1GTK A;  4OVJ A;  2ANJ A;  4KQP A;  5TP9 B;  3G7W A;  3MPL A;  2A5T A;  1SW4 A;  5KDT B;  1S7Y A;  3FUZ A;  1A7L A;  3TTN A;  1QVS A;  3IX1 A;  3TCG A;  3ECR A;  1FQD A;  4FAJ A;  3ZSF A;  1UIV A;  5TPA A;  2VD3 A;  3KBR A;  4EXL A;  4ZE9 A;  1MQH A;  3GZG A;  3MC2 A;  3BKI B;  4I9D A;  2DSF A;  1IZ1 A;  1YAE A;  2ABH A;  3FJM A;  3Q25 A;  1PB8 A;  4KYE A;  1EZ9 A;  4G8N A;  4N6P A;  4F3S A;  4OES A;  4OET A;  5I59 B;  3N26 A;  1MG1 A;  5TP9 A;  2P1S A;  2A5S A;  1II5 A;  2OZZ A;  3M3F A;  4MFI A;  3P7I A;  3UOR A;  3G3F A;  3IK6 B;  4C1T A;  5FHM A;  3DM0 A;  1XS5 A;  4IO7 A;  5I2N A;  4YB5 A;  4BDN A;  2Q2C A;  2XXY A;  4LZ8 A;  1CE2 A;  4XIG Q;  2NXO A;  1B58 A;  3V5A A;  3Q27 A;  5A5X A;  2O1M A;  1PB9 A;  2IEE A;  1FQB A;  1Y3P A;  2O7U A;  1NH7 A;  4OER A;  3RT8 A;  4WXJ A;  3T22 A;  5ICQ A;  1QUI A;  3D4C A;  3PUW E;  1B5I A;  4HCY A;  2REJ A;  4KHZ E;  2B3B A;  1EU8 A;  4OFO A;  3OXN A;  1EZP A;  3BFU A;  4LZ5 A;  3EN3 A;  4POW A;  2WKY A;  2XXH A;  1MXY A;  3ONM A;  3IOR A;  2NOO A;  1OIB A;  4U1O A;  3VVD A;  2Y7K A;  2NUV A;  2FA7 A;  2F7C A;  3E3K A;  3HN0 A;  3QXM A;  1I6B A;  5L9M A;  4ZE8 A;  3KJT A;  1FQA A;  2Q2A A;  1ZKB A;  2AYS A;  3K1N A;  3WAE A;  4TLM B;  4G68 B;  1EH3 A;  1LCF A;  3MZ1 A;  3PUV E;  2F5X A;  1R9Q A;  3H4Z A;  3IB0 A;  3ZKL A;  1B4Z A;  1OVB A;  3KOS A;  4KI0 E;  1B5H A;  2V3T A;  5H8H A;  2ZYO A;  5CM6 A;  3TTM A;  1ELJ A;  2V3U A;  1MPB A;  4MBP A;  1BTJ A;  1SQY A;  3VE1 B;  1B05 A;  3U93 A;  5AA1 A;  1PDA A;  4DDD A;  3S4U A;  1B3H A;  2NWJ A;  3H06 B;  4NF8 B;  2OLB A;  2F8D A;  4KCC A;  4E0X A;  4F1V A;  1B3E A;  5JTY A;  1Y1Z A;  3W15 C;  3T96 B;  4FAT A;  1D9V A;  4BDM A;  1B2H A;  3Q28 A;  5EHM A;  1CB6 A;  4NF6 A;  3VVE A;  3Q29 A;  2E1S A;  2HZL A;  2D21 A;  2Y7W A;  3FXR A;  1MY4 A;  3HV1 A;  4H5G A;  3LSW A;  4NF8 A;  3VXB A;  4ZZE A;  1PBP A;  3TTK A;  5I2K A;  2UVI A;  4ELO A;  3TEL A;  5BUU A;  2E0S A;  3U94 A;  3MAM A;  2DS9 A;  3OSQ A;  3KZG A;  5TU0 A;  4JBZ A;  4PFY A;  5I56 B;  2UXA A;  3VLW A;  3IOT A;  4BDQ A;  1SW5 A;  1Y3N A;  1POY 1;  3IB2 A;  4RK9 A;  1UIU A;  2OK2 A;  1SI0 A;  2R9J A;  4HW8 A;  3VFJ A;  3V83 A;  2HFB A;  1N3W A;  1NKX A;  4IO2 A;  1I6A A;  1USY E;  4OZ9 A;  4NWD A;  1JW4 A;  1TFD A;  2UYE A;  2XX8 A;  3K00 A;  1MQI A;  3FVK A;  3IOU A;  3CG1 A;  4R9G A;  3IL1 B;  4YKP A;  2AIX A;  4L17 A;  1TFA A;  4JSD A;  2CZL A;  2I4C A;  4YKJ A;  4FE8 A;  3DP4 A;  1B32 A;  3FJG A;  4PET A;  2O68 A;  4P0I A;  1FW0 A;  2V84 A;  1LCT A;  4ZEF A;  1M5E A;  3C32 A;  1QW0 A;  1WDN A;  1HSE A;  3PUY E;  3I6V A;  4DXB A;  2HAV A;  1Q35 A;  3B6W A;  5CMB A;  3EHT A;  4R72 A;  2DYX A;  4MLV A;  3K6U A;  1N7W A;  1JW1 A;  4HTG A;  5M2V A;  1JW5 A;  3LBS A;  3O9P A;  2HAU A;  1HSL A;  3KN7 A;  4THI A;  5FHO A;  2BJJ X;  3H3G A;  3TQW A;  4BLA A;  1B6H A;  1D3K A;  3H7M A;  2GRV A;  4RPO A;  2Y7P A;  1BLF A;  2F78 A;  1DTG A;  1LFH A;  1FTL A;  3PMX A;  1IEJ A;  4G68 A;  4GL8 A;  1BKA A;  4U21 A;  2HEU A;  1SYI A;  3MVW A;  5AA4 A;  5KDT A;  2H4I A;  2ONS A;  2O1L A;  3C36 A;  2Q9T A;  2O7I A;  2Q8J A;  2XD3 A;  3F11 A;  1R9L A;  1MQJ A;  3DP6 A;  3V89 B;  1Z7M E;  2XXU A;  3HST A;  2ZNU A;  3U1O A;  3IOW A;  4RXL A;  3D4G A;  4FIM A;  2DVC A;  1Y4C A;  4NWC A;  4UA8 A;  3LSX A;  4KCD A;  2QMW A;  2DXR A;  1MY2 A;  4FEC A;  2A5T B;  3KN8 A;  3H6U A;  1JVX A;  4GFR A;  4MLQ A;  4GD5 A;  3K6W A;  5AA2 B;  4PP0 A;  4H0W A;  3SEX A;  1B52 A;  4LA9 A;  1MM6 A;  2XXX A;  2Y84 A;  3TFL A;  3L6G A;  3TEP A;  2YLN A;  4OTE A;  2H98 A;  5H8S A;  1J1N A;  1TT1 A;  1MXU A;  2V25 A;  2ZMB A;  2VP1 A;  3OSR A;  3OO9 A;  3G3I A;  3RN8 A;  3RGY A;  4JWO A;  5KZT A;  1MXW A;  4F3B A;  2D3I A;  3K02 A;  4U4S A;  4R6Y A;  3AXF A;  2V93 A;  2PMS A;  1RYX A;  3CG3 A;  4NE4 A;  1JNF A;  3ILU B;  2B3F A;  4RPN A;  2R6G E;  3MP6 A;  1QUK A;  3CR9 A;  1NFT A;  3UA8 A;  5IAI A;  2DE2 A;  4NF4 B;  1DPE A;  4U22 A;  3VLU A;  4DZ1 A;  1MH3 A;  4QF9 A;  1NH8 A;  1B7Z A;  5EHS A;  4ELQ A;  5K2X A;  1ATG A;  4K3F A;  4FJP A;  4KR5 A;  1SD3 A;  4EQ9 A;  4G2Z A;  4YKK A;  5CI5 A;  1FQC A;  5H8Q B;  2XXI A;  2GHA A;  3PUX E;  2XXW A;  3N6T A;  4FOR A;  5ELV A;  4YZZ A;  3ZKK A;  1VR5 A;  3CVG A;  4U23 A;  5ITO A;  2DWJ A;  4MF3 A;  4F18 A;  3U92 A;  3H03 A;  1A99 A;  3I3V A;  1BP5 A;  3IO4 A;  1H3D A;  3FAT A;  4NTL A;  4X1B A;  3PV0 E;  1OVT A;  2O69 A;  1B3L A;  1MDP 1;  2V3Q A;  4QFP A;  2F97 A;  4C1U A;  4F2Q A;  2CMO A;  1P1O A;  3MP8 A;  4LVQ A;  2I4B A;  5H8Q A;  3CI8 A;  2VHA A;  1MRP A;  4QSE A;  4XKN A;  4ESX A;  4P0G A;  1MPD A;  3T9H B;  2HQ0 A;  5DYH A;  3JYR A;  4OYV A;  1IXH A;  2DXY A;  3IR1 A;  2X7Q A;  3VV5 A;  3CFL A;  3T9V A;  4EQB A;  4Q8R A;  3FV2 A;  4DXU A;  4I62 A;  4EUO A;  3RNN A;  4KFQ A;  5B7D A;  1B1H A;  3PPN A;  3QIM A;  4NED A;  4IB2 A;  1L5T A;  3G3K A;  3MVY A;  2H9B A;  1NNP A;  3QSL A;  1PEB A;  4AQ4 A;  3K1P A;  5TPA B;  1OLA A;  3M3K A;  1B9J A;  4BDR A;  2FYI A;  1XVY A;  4F1U A;  4QFO A;  5L9S A;  4ZEI A;  1O63 A;  2H25 A;  4LP2 B;  1DMB A;  1QUJ A;  1LBB A;  2OBG A;  3OO6 A;  4GIZ A;  3TOD A;  3RPW A;  3TZA A;  3CSB A;  4LAT A;  4Q30 B;  1N04 A;  2O6A A;  1P1U A;  3E13 X;  5HBC A;  1I6Q A;  4F29 A;  2RIN A;  1FQF A;  3MVZ A;  3CFX A;  3A3U A;  3O97 A;  2REG A;  4X48 A;  5K2Y A;  1YPN A;  3S9L C;  1LBC A;  5FTH A;  4IO4 A;  1ZU0 A;  3O29 A;  5AA3 A;  2OWS A;  1MQG A;  4G8H A;  1VFE A;  3EPE A;  1UTH B;  3PU5 A;  4R9F A;  5L9O A;  4FED A;  4R74 A;  4IO3 A;  4UAC A;  5ITP A;  4O3A A;  2ZYM A;  5DT6 A;  1OQH A;  3SES A;  3TTL A;  4DXC A;  4EF2 A;  1AOV A;  1DPP A;  2PVU A;  3MJN A;  3GLB A;  1ZMG A;  2QMX A;  3K2D A;  3MWB A;  4QSD A;  4XKQ A;  5DEX B;  3E4R A;  3PD9 A;  3TKD A;  5AA4 B;  5HM4 B;  3USD A;  4R6K A;  3KSJ A;  3KFM A;  2I58 A;  1O64 A;  2XX9 A;  4I8C A;  1NMU A;  3SEU A;  4ISU A;  1NNT A;  3BBR A;  3HCQ A;  4X1D A;  3T66 A;  5ICT A;  5KCJ A;  1B0H A;  4HS7 A;  1P1Q A;  3LR1 A;  2PX1 A;  4OHN A;  3TYH A;  4C0R A;  1M5D A;  3C35 A;  2IA4 A;  4RK2 A;  4GXA A;  4XTC Q;  1O7T A;  3RUM A;  4EDP A;  4U1Z A;  4WKM A;  1TXF A;  3THI A;  3N6U A;  4OFL A;  1F9B A;  3I5O A;  4JWX A;  4PFU A;  4IY5 A;  4FEB A;  2ZNT A;  3O6H A;  1URG A;  3K1M A;  3KEI A;  4PE5 B;  3QAX A;  4GLI A;  3VVF A;  5J1D A;  3VXC A;  1R1N A;  3U72 A;  3E9X A;  3HO7 A;  3FJ7 A;  1B3G A;  3VLV A;  5B70 A;  5CBS A;  4MH5 A;  3MVX A;  5F1Q A;  2RF1 A;  2XD2 A;  2UYF A;  4KYD A;  4YAH X;  2DQV A;  1JVY A;  1B40 A;  3OEK A;  4TOZ A;  5IKB A;  1ANF A;  1PB7 A;  1US5 A;  1IUD A;  2UVJ A;  2VOZ A;  3HHF A;  4NF4 A;  1AMF A;  2GFE A;  3N5L A;  4DE8 A;  1RKM A;  4YU0 A;  1EZO A;  2XXR A;  4NF5 A;  3PGF A;  3SER A;  2AL5 A;  2DE3 A;  5I2K B;  1NNF A;  4R2B A;  2I0B A;  3SDF A;  1T0K A;  5I56 A;  1B0L A;  4G77 A;  4JSO A;  3DLN A;  4ND9 A;  4XXU A;  2H5Y A;  1MXV A;  2ONK E;  3B7D A;  3H6W A;  1FTJ A;  3ILT B;  3MP1 A;  5CRY A;  5F7V A;  2Z8F A;  5H8F B;  5CC2 A;  2KLF A;  1UTB B;  4OEU A;  1MY3 A;  4LZ7 A;  3S9E A;  3GXA A;  3S9N C;  3OO7 A;  4EF1 A;  1A40 A;  4ECF A;  1QJM A;  3OEM A;  2Y7I A;  4PFW A;  3S9M C;  1NL5 A;  1JEV A;  3RTF B;  1SW2 A;  2M8C A;  4H1X A;  2DVZ A;  3LSF B;  4F1Y A;  3FGS A;  3IJO B;  3MW0 A;  1P1N A;  3FVN A;  2XXQ A;  3SEY A;  1MXX A;  2I49 A;  4U2R A;  4ZS9 A;  4YB6 A;  4OMB A;  3G3H A;  3PD8 A;  4YMA A;  3W9W A;  1P1W A;  3RT6 B;  1HSJ A;  1OQG A;  5DVJ A;  4DLD A;  3PPQ A;  1M5C A;  3SEV A;  4ELP A;  4IGT A;  4BDL A;  1B51 A;  4KD5 A;  3BFT A;  5CMC A;  3MPK A;  1YTV A;  3OO8 A;  4LON B;  4XKR A;  4ZED A;  5JK4 A;  4GXS B;  1LAX A;  2G29 A;  3O66 A;  4GQO A;  2XXT A;  4LQ2 A;  3M3L A;  4KPT A;  4HCW A;  4ZEB A;  4H8J A;  3TCF A;  1XVX A;  1PC3 A;  4EQ7 A;  4R2F A;  3FIR A;  1URD A;  2DOJ A;  4RA1 A;  2Z22 A;  2ONR A;  3B6Q A;  4GWO A;  1N84 A;  1UQW A;  1TWY A;  3TMG A;  1IIT A;  1OLC A;  1YCJ A;  4GF8 A;  1B7U A;  4OEN A;  3KN3 A;  4RNS A;  4F3P A;  1USY H;  1OMP A;  2PT2 A;  1B7H A;  2VD2 A;  3KGC A;  2VGQ A;  3SEW A;  2QRY A;  2OWT A;  4WED A;  2F6P A;  3R7X A;  5H8F A;  2DE4 A;  3G3G A;  1ZBM A;  1Q1K A;  1BIY A;  3IAZ A;  4F19 A;  4NMY A;  2QL3 A;  2QS1 A;  2Z8E A;  4ZDM A;  5JEI A;  2I48 A;  2YJP A;  3UIF A;  3H6V A;  3MZ9 A;  1JQF A;  1VSO A;  1S9T A;  3GBA A;  2F6G A;  1DSN A;  2DWH A;  3T9U A;  1LGB C;  4ZEC A;  2O51 A;  4G8M A;  1B5J A;  1Y4T A;  1A54 A;  1POT A;  2HCA A;  5H8H B;  4PFT A;  3OEN A;  4LUB A;  1LAF E;  3OD7 A;  1R6Z A;  4F3G A;  5A5X B;  1LAG E;  1AIV A;  2UVH A;  5CMM A;  4YB7 A;  5KCJ B;  2O84 X;  2F34 A;  1DTZ A;  1QUL A;  2XHD A;  3O6G A;  5ISU A;  1VE4 A;  3FVG A;  3K6X A;  1MPC A;  2RC8 A;  4X9T A;  1B3F A;  4JWY A;  4OFJ A;  1SW1 A;  3SKP A;  2F7B A;  3DEL B;  3QK6 A;  4QHQ A;  3JV9 A;  2RCB A;  4H65 A;  3FXQ A;  4F2O A;  1NNK A;  3JZJ A;  4OQO A;  2Q88 A;  1IXI A;  1N76 A;  3TQL A;  4JB7 A;  1B1X A;  3FVO A;  4R6H A;  3FAS A;  2QSX A;  2ALU A;  1SDX A;  1UTH A;  1GGG A;  4AB6 A;  3OOA A;  1VFD A;  2HZK A;  3PPR A;  4KYS A;  3EQ1 A;  1N3X A;  1XC1 A;  4G68 C;  4G4P A;  2RC7 A;  3HPI A;  3TCH A;  3UK4 A;  4F22 A;  4QFL A;  1D4N A;  2PBW A;  5CBR A;  5I2N B;  5I84 A;  5LOM A;  2ZNS A;  1MS7 A;  3DP8 A;  1A8E A;  3KG2 A;  1B46 A;  2F36 A;  4U4X A;  3O2A A;  1XT8 A;  1I69 A;  4BDO A;  1JEU A;  4QFN A;  4RYA A;  2ZXT A;  1KWH A;  4NF5 B;  1MQD A;  1Y1M A;  2B65 A;  2QS2 A;  1LB9 A;  1LB8 A;  3HHG A;  3L6H A;  2Q89 A;  3ODB A;  3PMV A;  4TQU Q;  5I58 B;  4RY1 A;  3O28 A;  3KJ7 A;  2Y7R A;  1A8F A;  2QPQ A;  3LUY A;  1H43 A;  3RQT A;  2UVG A;  2ZYK A;  2I6E A;  3B6T A;  4JDF A;  4O3C A;  3W9V A;  2ZYN A;  3TTR A;  3C9H A;  1MM7 A;  1GVC A;  1FTM A;  4QSC A;  4GRK A;  3MBP A;  1IXC A;  4YIC A;  5DTB A;  4OEV A;  2D5W A;  1Z7N E;  2XXV A;  3KSX A;  3TAJ A;  2I0C A;  2HXW A;  2THI A;  4H67 A;  4ELR A;  3LSL A;  3G3J A;  3MZB A;  1Y3Q A;  3R26 A;  4P11 A;  3ZS6 A;  5I57 A;  2Z23 A;  3MQ9 A;  4QRZ A;  4POX A;  5HPQ A;  1FCK A;  5AA2 A;  1RYO A;  1SBP A;  1S50 A;  1D9Y A;  3C34 A;  4OXV A;  2GHB A;  2X7P A;  3CRB A;  1A55 A;  5L8D A;  3SET A;  3H6T A;  3PMW A;  4IO5 A;  4M1V A;  1H44 A;  3CIJ A;  5AE4 A;  3TPA A;  3EHU A;  5EYF A;  4N13 A;  2DWI A;  2OJT A;  3T93 B;  3N94 A;  3R6U A;  4I1D A;  2NVU B;  4EXK A;  3CSG A;  5I57 B;  5JTY B;  4ESW A;  3PPO A;  2G93 A;  2I3V A;  4H8I A;  4GOT A;  1LLS A;  2R71 A;  4H6D A;  4YKI A;  3QYT A;  4F31 B;  2GH9 A;  4TLL B;  4DCY A;  1WVJ A;  4IY6 A;  3IJX B;  2ESN A;  4QFK A;  1LFG A;  4WEP A;  4F39 A;  2F35 A;  2RC9 A;  3OEL A;  3RLF E;  1H45 A;  2W7Y A;  1SVX B;  3A09 A;  5BWJ A;  5I59 A;  2X26 A;  4H5F A;  1XOC A;  2XXP A;  5DEX A;  5I58 A;  4N07 A;  2AL4 A;  1MH4 A;  4E0W A;  1DOT A;  2Z8D A;  3IOV A;  3RY3 A;  1ZTY A;  2QS3 A;  2P0S A;  5FHN A;  1N7X A;  2DWA A;  2RKM A;  1SYH A;  1Y9U A;  3LC8 A;  3MUQ A;  1ZIU A;  4ZEK A;  3UP9 A;  1QKB A;  3IB1 A;  5H8N B;  1M5B A;  1AL3 A;  3C33 A;  3FV1 A;  5DVF A;  3C31 A;  1SI1 A;  3S2V A;  1ZLQ A;  1GR2 A;  4PQJ A;  3TUS A;  3FXU A;  4Q0C A;  3EF7 A;  3V8X B;  1FTK A;  2PT1 A;  1XHY A;  2QJE A;  3TDJ A;  4AB5 A;  3FD3 A;  3QUF A;  3T9X B;  4YMB A;  3K01 A;  1QKA A;  3M8U A;  2F7A A;  3PPP A;  1LFI A;  3KOT A;  3PUZ E;  3QUJ A;  4JXI A;  1PBQ A;  2XX7 A;  3C4M A;  3O6I A;  3UGW A;  1URS A;  4DIG A;  3IO6 A;  1M5F A;  4LQ5 A;  4Z7E A;  1LST A;  2I3W A;  1AH5 A;  1IQ7 A;  3OMB A;  1FTO A;  2YPN A;  1LAH E;  4O3B A;  4RJZ A;  2FNC A;  2P2A A;  1WOD A;  1MY0 A;  4DCX A;  1GV8 A;  4OWD A;  2DP8 A;  1Y20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...