4R9GA

Cpmnbp1 with mannotriose bound
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
401
structure length
394
Chain Sequence
QVVLTLWYPWAGPDGDAVVSLAKEYSKTHPNVQIKAQMVSGAGIAAKFLSAVAAGNPPDLVLYWGQDALPGLADQGAIIPLDDYLKDVDTSKFFEAAYNAMKYKGKIYGLPEMVNVRVLFWNKDLFKQAGLDPNTPPKTIAELDQMAAKLTKTKNGTIEQMGFIPWIGQGVPHVMAGVFGTSLVDSNGNPILSPDKNPQLLNLLKWEVSYSDKYGAMNINKFIAGMSQNSSQANDPFVLGKVAMMISGEWQINANKQYNPKLNFGVGPIPQAPGGKPMPSLMDGNTWMIPKGSKHPQEAMDFIKWTMDPQRIADTADKVYNIAPIVEAAKIQKLNNDPYFKEVLNVAQKGSIYYTPAAKGMLSTETAANNAFQAAQYKKSTPEQALKNAQAEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MBP1
publication title Structural and Biochemical Basis for Mannan Utilization by Caldanaerobius polysaccharolyticus Strain ATCC BAA-17.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
molecule tags Sugar binding protein
total genus 126
structure length 394
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r9gA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r9gA01
1PBPA 1P99A 2HFBA 5H8FA 1AMFA 5ITPA 1JEUA 1FTLA 3TCFA 2OK2A 3M3KA 2G29A 3ONMA 2OWTA 2VGQA 4EQ9A 2ZYNA 4NF5B 2RC7A 5TP9B 3N5LA 1EZOA 2F34A 3OENA 2E0SA 4R74A 3IOUA 3SESA 4IO5A 3PUYE 2XXPA 3SETA 4KPTA 1LAGE 4HCYA 3MWBA 1N04A 5LOMA 1FTMA 1N3XA 4H65A 1RKMA 5KDTB 5I56B 4GXSB 3KBRA 4I62A 1OQHA 4ECFA 3OSRA 1M5FA 4YAHX 5I84A 3UA8A 4F19A 1A55A 4ZDMA 2GRVA 3OO9A 4LVQA 3PMWA 2Z8EA 3OELA 2P0SA 2DE3A 4R6KA 1NL5A 3I5OA 3V8XB 4QFPA 2OCUA 4IO4A 1T0KA 5CRYA 4BDQA 3K2DA 4NF6B 4Q30B 3HPIA 4G68C 3G3IA 1MXVA 3THIA 4U23A 4F39A 1EH3A 1URDA 3K4UA 4LZ8A 2DE2A 1R6ZA 2FNCA 4GRKA 2VD2A 4C0RA 1LAFE 4UACA 4WXJA 1BKAA 5J1DA 4Z0IA 3S9EA 4U22A 5FTHA 5H8SA 4ESXA 2DVCA 1JEVA 2PBWA 4X1BA 1SYIA 3PMVA 1Y4TA 2PYYA 1H3DA 2UVJA 3UN6A 3KJTA 1B3EA 3DLNA 3RT6B 5KDTA 3IO4A 4KCDA 1VR5A 1II5A 5I56A 3SEYA 3IAZA 2NUVA 4BDNA 2NOOA 1BIYA 4U21A 3OO8A 3KEIA 1XHYA 4XKQA 4POXA 1ZLQA 4OFOA 2XD3A 2Y7PA 4OYVA 2QPQA 1O63A 3CSGA 2QJEA 3C33A 4YKIA 3CR9A 1FTJA 1MQDA 3BFUA 3TTKA 1QUIA 1QJMA 5AA2B 5I2NA 1N7WA 4X1DA 1DPEA 4HW8A 4F2OA 5H8HB 3KZGA 4N07A 4QFKA 2UVIA 1M5EA 3OSQA 5L9OA 4YZZA 2ZMBA 3IOVA 2BJJX 3MZ1A 1TWYA 4O3AA 1GVCA 5TU0A 4ZZEA 5JTYB 4G77A 1Y3QA 1MPBA 3L6GA 3QAXA 2H99A 1N0TA 1H44A 4G8MA 2O84X 2REJA 5IAIA 2I3WA 1NNFA 4G8HA 3MVYA 1Z7NE 2I4CA 4PFWA 3E4RA 1SD3A 3VXCA 5EHSA 3TDJA 3WAFA 2THIA 3ZKKA 5HM4B 4IO3A 1ZBMA 3BBRA 3O2AA 2ESNA 1B40A 5AA2A 1LLSA 3G3KA 3TUSA 5H8HA 1GTKA 2XD2A 1TFAA 3K6WA 1US5A 3O29A 1EU8A 2HCAA 4HCWA 1B0HA 2UYFA 4F31B 2H98A 3U8QA 3TQLA 2QSXA 2HAVA 4KYDA 4KCCA 1KWHA 5ITOA 2B65A 3RN8A 4QRZA 1MXUA 2O68A 2DWHA 1XS5A 1BLFA 1MQJA 2IA4A 2OBGA 3Q26A 2F36A 1QW0A 3T22A 4EQ7A 5I59B 1S9TA 1SI0A 3Q28A 1LCFA 3I6VA 2PT1A 4BLAA 3MZBA 5K2XA 1HSJA 4DLDA 1XVXA 4NF8B 4P0IA 1TXFA 1Y1MA 1L5TA 4HS7A 3TELA 2ZNUA 4JSDA 3H6VA 2A5SA 1LAHE 1JW4A 5CMCA 3SEXA 4RYAA 3TTNA 3KSJA 1P1UA 1SVXB 1MH4A 4KR5A 4E0XA 4KYEA 4ISUA 1Y1ZA 4ESWA 1Y3NA 3MQ9A 2PX1A 5DT6A 3G3GA 4EDPA 3K02A 4MH5A 4NMYA 3R7XA 2VHAA 1USYH 2I4BA 5DTBA 4M1VA 1B1XA 5CC2A 1FW0A 2D21A 3MZ9A 3HCQA 1B5IA 2O6AA 1N84A 3VLUA 3IB2A 4OQOA 3FD3A 5I59A 1H43A 1OVBA 3K01A 4RPNA 3G3HA 2DXRA 3IOWA 2QS3A 2V84A 3E13X 1M5DA 1I6AA 4WEDA 4Q8RA 4NF8A 5M2VA 2NVUB 1SQYA 2I0BA 3OO6A 3KJ7A 4X48A 3DP4A 2XXHA 4FATA 2IEEA 3KSXA 4IO7A 3TPAA 1B4HA 1NFTA 2PT2A 1A8EA 5H8QB 2I0CA 1UIUA 3IX1A 1A99A 4ELRA 4MLQA 4LP2B 3RUMA 5F1QA 4NWCA 4JWYA 5I58B 3O97A 3WAEA 3E3KA 2XXVA 3C36A 3IB0A 5AA4B 5DYHA 3MPKA 3MP8A 4EF2A 1I6QA 2X7PA 3K1MA 4ONYA 4LZ7A 3SERA 1IXGA 3L6HA 3VXBA 1PB9A 3MW0A 3KOTA 3H6UA 4JDFA 4PFTA 1TT1A 3LSFB 2CZLA 4C1TA 1MPCA 3IO6A 3ILUB 2Q89A 1ZMGA 3O6GA 3BKIB 2YPNA 5JEIA 3RTWB 1N3WA 3C9HA 1FTOA 4L17A 5H8QA 2W7YA 4ELOA 1ZJLA 2Y7RA 5EHMA 1S7YA 4LUBA 3U93A 4EF1A 3VV5A 5I57B 5DVIA 3HHGA 2PVUA 4FORA 1MXYA 4POWA 3CRBA 3CIJA 5I58A 3FV2A 3DM0A 5AA3A 4TLMB 3UIFA 5AA4A 1IIWA 4U1OA 2DE4A 1NH7A 5AE4A 3U1OA 1MQHA 3TKDA 3S9MC 1RYXA 5H8NA 3H03A 4YICA 2V3UA 3QUFA 4F1YA 2DWAA 3V5AA 4H5GA 3H6TA 4R75A 2XXIA 3VDFA 3RNNA 3HV1A 1QKBA 1IXHA 3PPRA 5DVJA 1B2HA 1B7UA 3MVXA 4YMBA 1XOCA 3A09A 1B7HA 3H6WA 2PMSA 5HBCA 4G8NA 1Y3PA 1AH5A 3H3GA 5I2NB 3CFLA 5I57A 1M5BA 2GHAA 1B32A 2ZYMA 2ZYKA 2X7QA 3PU5A 2XX9A 3O66A 4P11A 2H25A 1PDAA 4IO6A 3FASA 3HN0A 3IB1A 4ZEBA 3T66A 3PUZE 3MAMA 4F2QA 4XIGQ 4N13A 4NTLA 2DQVA 3FVGA 1IQ7A 1B05A 3O6HA 3T96B 1UQWA 3CG3A 1NNKA 4OVJA 3G7WA 5F7VA 1IXCA 3EHSA 3U92A 1ZTYA 1CE2A 4GWOA 2AL5A 2I58A 2XXQA 2DOJA 2ZNSA 1MY2A 3VE1B 3CFXA 2DVZA 4FIMA 4EQBA 1IZ1A 4YU0A 3CG1A 4YKKA 3S4UA 3V89B 4H5FA 5TPAB 4ELPA 1BTJA 3MP6A 2F7BA 1NH8A 3FGSA 2QMWA 4XKRA 5B70A 3FV1A 4JB7A 1S50A 4R2BA 3C34A 1ZIUA 4OMBA 2DWIA 3B7DA 2OLBA 3VLVA 4FEDA 5AA1A 3LR1A 4FECA 4ZEKA 3VVDA 4KQPA 3TTLA 2DS9A 4QHQA 2O51A 3CVGA 1N7XA 3TTRA 3PPPA 4ZEDA 1MY1A 1NNPA 2D3IA 3A3CA 2AIXA 4YMAA 4ZEIA 2KLFA 1MS7A 3T93B 1FQBA 1ZKBA 1Q35A 1P1OA 2I48A 2F97A 1JVXA 4GD5A 2O1MA 4Q5TA 1ATGA 1DOTA 3MJNA 3OEMA 2Q9TA 2Z22A 3N6UA 3B6WA 4GLIA 1YPNA 1B58A 3VVFA 1Y9UA 1UTBB 1VFEA 3EHTA 3JV9A 4ZS9A 1WDNA 4KFQA 5TPAA 2QS1A 3OXNA 3QXMA 1SDXA 3C31A 4G2ZA 3H4ZA 2RC9A 4NF4B 3P7IA 3W9VA 4GF8A 1Z7ME 2HZKA 4DIGA 4OWDA 3T9VA 4PP0A 1B3GA 3CI8A 1SYHA 4O3BA 2R6GE 3LC8A 2HQ0A 3PUXE 1FQFA 3V83A 1P1NA 1EZPA 3IJOB 3D4GA 3OEKA 4ZEFA 3EHUA 3ZSFA 2RCAA 1VE4A 1MY4A 5CM6A 4MBPA 5ICQA 3S9NC 4XKNA 4JXIA 1LBCA 2Q88A 4FJPA 2V25A 1LAXA 3FXQA 4LZ5A 2F7CA 2I6EA 3FIRA 4JWXA 5CMBA 4GXAA 4Q0CA 3LSLA 1Y20A 2O1LA 3LUYA 1ZU0A 3ODBA 3K6VA 4KD5A 1UIVA 4I9DA 3KGCA 3RPWA 4F1UA 4IY5A 3OMBA 1SW5A 3D4CA 1UTBA 2O7UA 3PMXA 3MVWA 5FHMA 2RCBA 4F18A 4RK2A 5IKBA 4OEUA 4F1VA 5ICTA 4PQJA 3VLWA 4NF4A 3KOSA 3UK4A 4AB5A 1NNTA 4OZ9A 2DP8A 3I3VA 4ZZAA 3G3FA 3EN3A 2XXTA 2FA7A 1POY1 3N94A 4ELQA 3K6XA 3KN7A 1FTKA 3G3JA 3MUQA 4QSCA 1MM6A 4QFOA 3FVOA 1SBPA 3C32A 4O3CA 3FJ7A 4GOTA 2VOZA 3GLBA 2I3VA 5ELVA 2QRYA 1D4NA 4H0WA 3LSWA 3TEPA 4R73A 3R26A 4F22A 3SDFA 2DYXA 3QUJA 4G4PA 3MVZA 1FQDA 2XHDA 2LAOA 2NXOA 2YLNA 1A54A 1GR2A 2Q8JA 3GXAA 3T9UA 1FCKA 5DEXA 1NKXA 2DWJA 2XX7A 5CMMA 4X9TA 3RTFB 3IK6B 3MC2A 1R9QA 1DTGA 4YB6A 3O28A 3UP9A 4I1DA 1H45A 4GVOA 1USYE 1PBQA 3KFMA 3AXFA 5FHOA 4MF3A 4U1ZA 4QSDA 4BDLA 1F9BA 4NEDA 2Y84A 4RK9A 2E1SA 3T9XB 4GL8A 4H1XA 4U4XA 4OFJA 4RA1A 1GV8A 3FJGA 4R6YA 2B3BA 4R6HA 1B46A 1A7LA 5H8NB 3PD8A 3FZVA 2Z8FA 2XXYA 4N6PA 1WODA 1B0LA 3Q27A 5CI5A 1J1NA 4DDDA 1A40A 2QS4A 3ZS6A 1CB6A 1GGGA 3U72A 3TODA 4UA8A 3RLFE 3UORA 3O9PA 2O69A 4GQOA 5L9SA 3KN8A 3CFZA 4RNSA 1MG1A 3FXRA 4NWDA 3S9LC 1OIBA 4U2RA 3T9HB 4IGRA 2RINA 3FUZA 3EQ1A 1B51A 1B3LA 4RXLA 4C1UA 1JETA 5A5XB 3PPOA 2F6PA 4R9FA 4FAJA 5AA2D 4AQ4A 4K3FA 3KN3A 4F3BA 3PPQA 1VSOA 4EUOA 3MP1A 3S2VA 3CSBA 4LQ2A 4OXVA 2H9BA 4MLVA 2ZYOA 1N76A 3SEWA 4QSEA 4FEBA 4XTCQ 1Y4CA 3F11A 3ECRA 1TFDA 4U4SA 1QVSA 3PV0E 2GHBA 3U94A 1MRPA 5B7DA 3IORA 1MM7A 4BDRA 4KYSA 2VP1A 1B9JA 4F3SA 2H5YA 2R9JA 2X26A 3PGFA 3K1PA 1MQGA 2ZXTA 1QUKA 1MQIA 1LFIA 5A5XA 4YB5A 2DSFA 1LBBA 4TLLB 4R9GA 4F3GA 5HPQA 1MXXA 4G68B 3FVNA 4YKPA 1QUJA 4HTGA 1SW1A 1AOVA 3DELB 4I8CA 1LGBC 4R72A 2G93A 1MY3A 5BUUA 4KHZE 1O64A 4NF5A 3EF7A 5TP9A 4ZECA 1LFHA 2RC8A 1WVJA 1QULA 4GIZA 2Y7WA 3TTMA 4JBZA 3ILTB 4JSOA 2NWJA 2YJPA 2F35A 4RY1A 1JNFA 3C4MA 5BWJA 4QF9A 2Q2AA 4E0WA 2P1SA 5CBRA 3TMGA 2V3QA 1OQGA 1LCTA 2OWSA 1B5HA 2RKMA 2R71A 3VVEA 5K2YA 3PUVE 5JK4A 1B3FA 3Q29A 4NE4A 2F78A 5KCJB 2WKYA 5FTIA 1URSA 1POTA 2XXWA 4XKPA 4IY6A 4F29A 4KI0E 2REGA 3DP8A 3Q25A 2XXXA 4OETA 2ANJA 4G68A 4NF6A 2V93A 2ONRA 2FYIA 4GL0A 1H76A 1JQFA 3UGWA 4DCXA 1RYOA 1ANFA 3QSLA 1US4A 3FATA 2GH9A 4H8JA 1MY0A 2HXWA 3SKPA 4OENA 2H4IA 2B3FA 1MDP1 1PC3A 2P2AA 3TYHA 4R2FA 1FQEA 4LA9A 2XXRA 1B52A 1MXWA 2F5XA 1B4ZA 2Y7IA 3H7MA 4AB6A 4OEVA 4OERA 4EXKA 4ND9A 4RPOA 2QL3A 3MPLA 4F3PA 4RJZA 4JWOA 5KCJA 3FJMA 2F7AA 1DSNA 1SW2A 5CBSA 4YB7A 1UTHB 3PUWE 2HAUA 2VD3A 3SEVA 1OVTA 3JYRA 4H67A 4LQ5A 3K1NA 2XXUA 1QKAA 1PEBA 1OLAA 5CMKA 2Z8DA 4PFUA 4WKMA 1EZ9A 3IL1B 1D9VA 4OHNA 3GBBA 1YTVA 4GFRA 4LONB 3USDA 4TQUQ 4FE8A 4OFLA 1OMPA 5JTYA 1B5JA 2HZLA 3QIMA 3FXUA 3LSXA 3N26A 4ZE9A 3TCHA 3W15C 2QS2A 3O6IA 5L9MA 1PB8A 1JW5A 4IO2A 5EYFA 1PB7A 4DXCA 3HO7A 3MBPA 3GBAA 5L8DA 4Z7EA 2F6GA 3QK6A 5DEXB 4BDMA 3DP6A 5I2KB 3HSTA 3TAJA 3M3LA 1DMBA 2ABHA 2OZZA 1IEJA 1MXZA 4DE8A 4QFLA 4M4GA 1I6BA 3LBSA 3TFLA 1HSEA 3M3FA 2HEUA 1UTHA 3IOTA 1MDQA 4THIA 2RF1A 4P0GA 1XVYA 5ISUA 2Y7KA 3PPNA 2Q2CA 3OD7A 1SW4A 2QMXA 4XXUA 4TOZA 1P1WA 3TQWA 3K00A 5KZTA 2M8CA 4IB2A 3C35A 1O7TA 1D9YA 2I49A 1FQCA 1A8FA 1B3HA 4DZ1A 3TCGA 4WEPA 2XX8A 1DPPA 3SEUA 2A5TB 3ZKLA 1B7ZA 1BP5A 3R6UA 4H6DA 3IJXB 1FQAA 4PE5B 2V3TA 1LB8A 3RT8A 1Q1KA 3M8UA 4IGTA 3OO7A 4QFNA 1I69A 3RGYA 4OTEA 1URGA 5I2KA 3N6TA 2CMOA 3PD9A 1HSLA 2UYEA 1XT8A 3KG2A 4LATA 1ELJA 1JVYA 3OOAA 1OLCA 3BFTA 1IITA 1R9LA 1LB9A 4PFYA 1LFGA 1JW1A 3VFJA 1VFDA 5H8FB 2ONSA 3E9XA 2ONKE 3K0VA 4YKJA 4BDOA 2ALUA 3A3UA 3RQTA 2AL4A 2D5WA 3TZAA 2UVHA 1MPDA 4OESA 2UXAA 3GZGA 2Z23A 1MH3A 2A5TA 3K6UA 3B6QA 2OJTA 5DVFA 3HHFA 1B1HA 1IXIA 1R1NA 3FVKA 4ZE8A 4DCYA 1M5CA 3W9WA 2O7IA 2DXYA 3JZJA 1B6HA 2UVGA 1XC1A 4DXBA 3EPEA 1AIVA 1IUDA 1LSTA 4H8IA 1SI1A 4MFIA 2F8DA 1D3KA 4EXLA 2AYSA 1YCJA 1P1QA 3IR1A 1AL3A 3H06B 2ZNTA 2GFEA 3QYTA 1YAEA 5FHNA 3B6TA 1NMUA 4PETA 3RY3A 1DTZA 4DXUA
chains in the Genus database with same CATH superfamily
1PBPA 1P99A 2HFBA 5H8FA 1AMFA 5ITPA 1JEUA 1FTLA 3TCFA 1FJ9A 2OK2A 3M3KA 2G29A 2GQ1A 3ONMA 2OWTA 2VGQA 4EQ9A 2ZYNA 4NF5B 4GWZA 2RC7A 4PFIA 4X04A 5TP9B 2XWVA 3N5LA 3LUZA 1EZOA 2F34A 3OENA 2E0SA 4R74A 3IOUA 3SESA 4IO5A 3PUYE 2XXPA 2P3VA 4N6KA 3SETA 4KPTA 5EYGA 1Q9DA 1LAGE 4HCYA 3MWBA 1N04A 5LOMA 1FTMA 1N3XA 4H65A 1RKMA 5KDTB 2HPGA 5I56B 4GXSB 3FXBA 3KBRA 4I62A 1OQHA 4ECFA 3OSRA 1M5FA 4YAHX 5I84A 3UA8A 4F19A 1A55A 4ZDMA 2GRVA 3OO9A 4LVQA 3PMWA 5I3SA 4NF0A 2Z8EA 1EYKA 3OELA 2P0SA 1RDXA 2DE3A 4JVIA 4R6KA 1NL5A 3I5OA 3V8XB 4QFPA 2OCUA 1NV1A 4IO4A 1T0KA 1NUXA 5CRYA 4BDQA 3K2DA 4NF6B 4Q30B 3HPIA 4G68C 2CZIA 1IMEA 3G3IA 1MXVA 3THIA 4U23A 4F39A 1EH3A 1URDA 3K4UA 4LZ8A 2DE2A 1R6ZA 2FNCA 4GRKA 2VD2A 4C0RA 1LAFE 4UACA 3ISPA 4WXJA 4AS5A 1BKAA 5J1DA 4Z0IA 3S9EA 4U22A 5FTHA 1BK4A 5H8SA 4I3YA 4ESXA 2DVCA 1JEVA 1NV2A 2PBWA 4X1BA 1SYIA 3PMVA 5DW8A 1Y4TA 2PYYA 1H3DA 2UVJA 3UN6A 3KJTA 1B3EA 3DLNA 3PTYA 3RT6B 5KDTA 3IO4A 4KCDA 1VR5A 1II5A 4HE2A 1INPA 5I56A 3SEYA 1KZ8A 3IAZA 2NUVA 4BDNA 3RYDA 2NOOA 1BIYA 4U21A 3OO8A 1NV3A 3KEIA 5J16A 1XHYA 4XKQA 4POXA 1ZLQA 4OFOA 2XD3A 2Y7PA 4OYVA 2QPQA 1O63A 3CSGA 2QJEA 3C33A 4YKIA 4OVPA 3CR9A 1FTJA 1MQDA 4PDDA 3BFUA 3TTKA 4MX6A 1QUIA 1QJMA 5AA2B 5I2NA 1N7WA 4X1DA 1DPEA 4HW8A 4F2OA 5H8HB 3KZGA 4N07A 5T3JA 3BIGA 4QFKA 2UVIA 1M5EA 3OSQA 5L9OA 4YZZA 4NGUA 2ZMBA 3IOVA 2BJJX 3MZ1A 1TWYA 4O3AA 1GVCA 5TU0A 4MHFA 4ZZEA 5JTYB 4G77A 2VT5A 2KR0A 1Y3QA 4N8GA 1MPBA 3L6GA 1DK4A 3QAXA 2H99A 1N0TA 1NUWA 1H44A 4G8MA 2O84X 2REJA 5IAIA 2PCRA 2I3WA 1NNFA 1FPJA 2B4LA 4G8HA 4AS4A 3MVYA 2Q8MA 1Z7NE 2I4CA 4PFWA 3E4RA 1SD3A 3VXCA 5EHSA 3ROJA 3TDJA 3WAFA 2THIA 3ZKKA 5HM4B 4IO3A 1ZBMA 3BBRA 3O2AA 2ESNA 1B40A 4GWYA 5AA2A 1LLSA 3G3KA 1LBYA 1FPEA 3TUSA 5H8HA 4NX1A 1GTKA 1QGXA 2XXKA 2XD2A 1TFAA 3K6WA 1LBXA 1US5A 3O29A 1EU8A 2HCAA 5I5PA 4HCWA 1B0HA 2UYFA 4F31B 2H98A 3U8QA 2Y5LA 2QSXA 3TQLA 2HAVA 2MKZA 4KYDA 4KCCA 1KWHA 5ITOA 2B65A 3RN8A 4QRZA 1MXUA 2O68A 2DWHA 1LBWA 1XS5A 1BLFA 1MQJA 2IA4A 2OBGA 3Q26A 1KA0A 2F36A 1QW0A 3T22A 4EQ7A 5I59B 1S9TA 1SI0A 3Q28A 1LCFA 1EYJA 3I6VA 2PT1A 1SPIA 4BLAA 3MZBA 5K2XA 1HSJA 4DLDA 1XVXA 4FBPA 4NF8B 4P0IA 5IM2A 1TXFA 4I3EA 1Y1MA 1L5TA 4HS7A 1RDYA 3TELA 2ZNUA 4JSDA 3H6VA 4DI4B 2A5SA 1LAHE 1JW4A 5CMCA 3SEXA 4RYAA 3TTNA 3KSJA 4LN5A 1P1UA 1SVXB 1MH4A 2XWIA 4GX4A 4NAPA 4KR5A 4E0XA 4KYEA 4ISUA 1Y1ZA 4ESWA 1Y3NA 1FPFA 2PX1A 3MQ9A 5DT6A 3G3GA 2VPOA 4EDPA 3K02A 4MH5A 4NMYA 3R7XA 2VHAA 1USYH 2I4BA 5DTBA 4M1VA 1B1XA 5CC2A 1FW0A 2D21A 3MZ9A 3HCQA 1B5IA 2O6AA 1N84A 3VLUA 2QVUA 4QXDA 4PCDA 3IB2A 4OQOA 3FD3A 5I59A 1H43A 2CZHA 1OVBA 3K01A 4RPNA 3G3HA 2DXRA 3IOWA 2QS3A 2V84A 3E13X 1M5DA 2HXRA 1I6AA 4WEDA 4Q8RA 4NF8A 5M2VA 2NVUB 1FBFA 1SQYA 2I0BA 3OO6A 3KJ7A 4X48A 3RPLB 3DP4A 2XXHA 4FATA 2IEEA 3KSXA 4IO7A 3TPAA 1B4HA 1NFTA 3KBZA 2PT2A 1A8EA 5H8QB 2I0CA 4GWWA 4UABA 1UIUA 3IX1A 1A99A 4ELRA 4MLQA 4LP2B 3RUMA 5F1QA 4NWCA 4PGNA 4JWYA 5I58B 3O97A 3WAEA 2CZKA 3E3KA 2XXVA 3C36A 3IB0A 2XWKA 4N15A 5AA4B 5DYHA 3MPKA 3MP8A 4EF2A 1I6QA 2X7PA 3K1MA 4ONYA 4LZ7A 3SERA 1IXGA 3L6HA 3VXBA 1PB9A 3MW0A 3KOTA 5F24A 3H6UA 4JDFA 4PFTA 4O8MA 1TT1A 3LSFB 2CZLA 4C1TA 4MAGA 1MPCA 3HFUA 3IO6A 3RPLA 3ILUB 2Q89A 1ZMGA 3O6GA 3BKIB 2YPNA 5JEIA 3RTWB 1N3WA 3C9HA 1FTOA 4L17A 4GX3A 5H8QA 2W7YA 4ELOA 1ZJLA 4DI3D 2Y7RA 5EHMA 1S7YA 4LUBA 3U93A 4EF1A 3VV5A 5I57B 5DVIA 3HHGA 2PVUA 4FORA 1MXYA 3NOHA 2P3NA 4POWA 3CRBA 3CIJA 5I58A 3FV2A 4P8BA 3DM0A 5AA3A 4TLMB 3UIFA 1AWBA 5AA4A 1IIWA 4U1OA 5IZZA 2DE4A 1NH7A 5AE4A 3U1OA 1MQHA 3TKDA 1DBZA 4P47A 5ET6A 3S9MC 1RYXA 5H8NA 4MNPA 3H03A 4YICA 2V3UA 3QUFA 4PAIA 4F1YA 2DWAA 3V5AA 4MEVA 4H5GA 3H6TA 4R75A 2XXIA 3VDFA 3RNNA 4MIJA 3HV1A 1QKBA 1IXHA 1LBVA 3PPRA 5DVJA 1B2HA 1B7UA 3MVXA 4YMBA 1XOCA 3A09A 1B7HA 3H6WA 2PMSA 5HBCA 4G8NA 1Y3PA 4P1EA 1AH5A 1FSAA 4PTKA 1K9ZA 3H3GA 5I2NB 4N91A 4JVDA 3CFLA 5I57A 1M5BA 2GHAA 1B32A 2ZYMA 2ZYKA 4N17A 2X7QA 3PU5A 4O94A 2XX9A 3O66A 5ET7A 4P11A 2H25A 4PAKA 1PDAA 4IO6A 4N81A 3FASA 3HN0A 3IB1A 4ZEBA 3T66A 3PUZE 5EQAA 1YXIA 3MAMA 4F2QA 4XIGQ 4N13A 4NTLA 4MNIA 2DQVA 3FVGA 1IQ7A 1B05A 3O6HA 1JP4A 3T96B 1UQWA 3CG3A 1NNKA 4OVJA 4PGPA 3G7WA 5F7VA 1IXCA 3EHSA 2BJIA 3U92A 4MJOA 1ZTYA 3T1BA 1CE2A 4GWOA 2AL5A 2I58A 2XXQA 3E79A 2DOJA 2ZNSA 1MY2A 3VE1B 3CFXA 3D1RA 2DVZA 4FIMA 4EQBA 1IZ1A 2QVRA 3CG1A 4YU0A 4YKKA 3S4UA 3V89B 4H5FA 5TPAB 4ELPA 1BTJA 3MP6A 2F7BA 1NH8A 4P56A 2ZZXA 3FGSA 2QMWA 4XKRA 5B70A 3FV1A 4JB7A 1S50A 4R2BA 3C34A 1ZIUA 4OMBA 2DWIA 3B7DA 2OLBA 3VLVA 4FEDA 5AA1A 3LR1A 4FECA 1FBCA 4ZEKA 3VVDA 2PFYA 4KQPA 3TTLA 2DS9A 4QHQA 1KA1A 2O51A 3CVGA 1N7XA 3TTRA 3PPPA 4ZEDA 1MY1A 1NNPA 2D3IA 5EQ8A 3A3CA 2AIXA 4YMAA 4ZEIA 2KLFA 1MS7A 3T93B 1FQBA 1ZKBA 1Q35A 1P1OA 2I48A 2F97A 1JVXA 4GD5A 2O1MA 4Q5TA 1ATGA 5ET8A 2WBBA 1DOTA 3MJNA 2F3DA 3OEMA 2Q9TA 4XF5A 4H45A 2Z22A 3N6UA 1NI9A 3B6WA 4GLIA 1YPNA 1B58A 3VVFA 1Y9UA 1UTBB 1VFEA 3EHTA 3JV9A 4ZS9A 1WDNA 4KFQA 5TPAA 2QS1A 3OXNA 3QXMA 1SDXA 3C31A 4G2ZA 1FPGA 3H4ZA 2RC9A 3BIHA 4NF4B 3P7IA 3W9VA 4GF8A 1Z7ME 4OA4A 2HZKA 4DIGA 4OWDA 3T9VA 4PP0A 1B3GA 3CI8A 3B8BA 1SYHA 4O3BA 2V4CA 4O7IA 2R6GE 3PUXE 2HQ0A 3LC8A 1FQFA 3V83A 1P1NA 1EZPA 3IJOB 3D4GA 4QBAA 3OEKA 4ZEFA 3EHUA 3ZSFA 2RCAA 1NUYA 1VE4A 1MY4A 5CM6A 4MBPA 5ICQA 3S9NC 2WX9A 4XKNA 4JXIA 1LBCA 2Q88A 4FJPA 2V25A 1LAXA 3FXQA 4LZ5A 2F7CA 2I6EA 3FIRA 4JWXA 5CMBA 4GXAA 4Q0CA 3LSLA 1NUZA 1Y20A 2O1LA 3LUYA 4JVCA 1ZU0A 3ODBA 3K6VA 4KD5A 4PAFA 1UIVA 4I9DA 3KGCA 4KXPA 3RPWA 4F1UA 4IY5A 3OMBA 1SW5A 3D4CA 1UTBA 2O7UA 3PMXA 3MVWA 2F3BA 5FHMA 2RCBA 4F18A 4MNCA 4RK2A 5IKBA 4OEUA 4F1VA 5ICTA 4PQJA 3VLWA 4NF4A 3KOSA 3UK4A 4AB5A 1NNTA 4OZ9A 2DP8A 3I3VA 4ZZAA 3G3FA 3EN3A 2XXTA 1XI6A 2FA7A 1POY1 3N94A 4ELQA 3K6XA 3KN7A 1FTKA 3G3JA 4NHBA 3MUQA 2Q74A 4QSCA 1MM6A 4QFOA 3FVOA 4X8RA 1SBPA 3C32A 4O3CA 3FJ7A 4GOTA 2VOZA 5I7IA 3GLBA 2L5VA 5IZ3B 1YYZA 2I3VA 4GWUA 5ELVA 2QRYA 1D4NA 1FJ6A 4H0WA 4GBWA 3LSWA 4PC9A 3TEPA 4R73A 4H46A 3R26A 4OVQA 4F22A 3SDFA 2DYXA 4HE0A 2KQZA 3QUJA 4G4PA 3MVZA 1FQDA 3A29A 2XHDA 4PBQA 2LAOA 2NXOA 2YLNA 1A54A 4O7MA 2FVZA 1GR2A 2Q8JA 3GXAA 3T9UA 1RDZA 1FCKA 2WYKA 2XA5A 5DEXA 1NKXA 2DWJA 2XX7A 5CMMA 3KC1A 4X9TA 3RTFB 1FRPA 3IK6B 3MC2A 1R9QA 1DTGA 4YB6A 4GWXA 3O28A 3UP9A 4I1DA 1H45A 2CEYA 4GVOA 1USYE 1PBQA 3KFMA 3AXFA 5FHOA 4MF3A 4U1ZA 4QSDA 4BDLA 3T0JA 1F9BA 4NEDA 2Y84A 4RK9A 2E1SA 3T9XB 5LDZA 4GL8A 4H1XA 1FPBA 4U4XA 4OFJA 4GWSA 4RA1A 1GV8A 4NG7A 3FJGA 5IZ3A 4R6YA 2B3BA 4R6HA 1B46A 1A7LA 3SZPA 5H8NB 4XFEA 4XEQA 3PD8A 3FZVA 2Z8FA 2XXYA 4N6PA 1WODA 1B0LA 3Q27A 5CI5A 1J1NA 4DDDA 1A40A 3FBPA 2QS4A 3ZS6A 1CB6A 1GGGA 3U72A 3TODA 1K9YA 4UA8A 3RLFE 3UORA 3O9PA 2O69A 4GQOA 5L9SA 3KN8A 3CFZA 1FBPA 4RNSA 1MG1A 4PF6A 3FXRA 4NWDA 2OWZA 2QFLA 2FIEA 3S9LC 1OIBA 4U2RA 3T9HB 4IGRA 1D9QA 2RINA 3FUZA 1IMFA 3EQ1A 1B51A 1B3LA 4RXLA 4C1UA 1JETA 5A5XB 3PPOA 2F6PA 4R9FA 4FAJA 5AA2D 3IFAA 4GBVA 4AQ4A 4K3FA 3MSTA 3KC0A 3KN3A 4F3BA 3PPQA 1VSOA 4EUOA 3IFCA 3MP1A 3S2VA 3CSBA 4LQ2A 1FTAA 4OXVA 2H9BA 4MLVA 2ZYOA 1N76A 5ET5A 3SEWA 4QSEA 4FEBA 4XTCQ 4P3LA 1Y4CA 2ZZWA 3F11A 3ECRA 1TFDA 4U4SA 1NV4A 1QVSA 3PV0E 2GHBA 3U94A 1MRPA 5B7DA 3IORA 1MM7A 1FBGA 4BDRA 4KYSA 2VP1A 2VPNA 1B9JA 4F3SA 2H5YA 2R9JA 2X26A 1G0IA 3PGFA 3K1PA 1MQGA 2ZXTA 1QUKA 1MQIA 4OVTA 1LFIA 5A5XA 4YB5A 2DSFA 1LBBA 4TLLB 4R9GA 1G0HA 4MCOA 4F3GA 5HPQA 1MXXA 4G68B 3FVNA 4YKPA 1QUJA 4HTGA 1SW1A 1AOVA 3DELB 4I8CA 1LGBC 4R72A 2G93A 1MY3A 1FBDA 5BUUA 4KHZE 1O64A 4NF5A 1FPIA 3EF7A 5TP9A 4ZECA 1LFHA 1VDWA 2RC8A 1WVJA 1QULA 4GIZA 2R8TA 2Y7WA 3TTMA 3GYYA 4JBZA 3ILTB 4JSOA 2ZZVA 2NWJA 2FHYA 2YJPA 2F35A 4RY1A 1JNFA 3C4MA 2WBDA 5BWJA 4QF9A 2Q2AA 4E0WA 2P1SA 5CBRA 3TMGA 2V3QA 1OQGA 1LCTA 2OWSA 1B5HA 2RKMA 4PDHA 2R71A 3VVEA 5K2YA 3PUVE 5JK4A 1B3FA 3Q29A 4NE4A 2F78A 5KCJB 2WKYA 5FTIA 1URSA 1POTA 2XXWA 4XKPA 2PFZA 4IY6A 4F29A 4KI0E 2REGA 4PFBA 4P1LA 3DP8A 5IGAA 3Q25A 2XXXA 4OETA 2ANJA 4G68A 4NF6A 2V93A 2ONRA 2FYIA 1FPKA 4GL0A 1H76A 1JQFA 3UGWA 4DCXA 4GX6A 1RYOA 1ANFA 3QSLA 1US4A 2CEXA 3FATA 2GH9A 4N4UA 4H8JA 1MY0A 2HXWA 4OVRA 4N8YA 3SKPA 4OENA 2H4IA 1CNQA 2B3FA 1MDP1 1PC3A 2P2AA 3TYHA 3EKIA 4MMPA 4R2FA 3MYUA 1FQEA 4LA9A 2XXRA 1B52A 1MXWA 2OX3A 2F5XA 4HXVA 2DDKA 1B4ZA 2Y7IA 3H7MA 3CHGA 4AB6A 4OEVA 4OERA 4EXKA 4ND9A 4RPOA 2QL3A 3MPLA 4F3PA 4RJZA 4JWOA 5KCJA 4IR8A 3FJMA 2F7AA 1DSNA 2QVVA 1SW2A 5CBSA 4YB7A 1UTHB 3PUWE 2HAUA 2VD3A 3SEVA 1OVTA 5EYHA 3JYRA 4G61A 4H67A 4LQ5A 3K1NA 2XXUA 1QKAA 1PEBA 1OLAA 1IMBA 5CMKA 2Z8DA 4PFUA 5EQ9A 4WKMA 1EZ9A 3IL1B 1D9VA 4OHNA 3GBBA 4OANA 1YTVA 4GFRA 4LONB 3USDA 4N6DA 4TQUQ 2FBPA 4FE8A 4OFLA 1OMPA 1IMCA 1NV0A 5JTYA 1B5JA 2HZLA 1FPLA 3QIMA 3FXUA 5FBPA 3LSXA 3N26A 4ZE9A 3TCHA 3W15C 5LTCA 2QS2A 3O6IA 5L9MA 1PB8A 2WEFA 1JW5A 4IO2A 2HHMA 1FBEA 5EYFA 2XWOA 1LBZA 1PB7A 4DXCA 3HO7A 3MBPA 3GBAA 5L8DA 4Z7EA 2F6GA 3QK6A 5DEXB 4BDMA 3DP6A 5I2KB 3HSTA 3TAJA 3M3LA 1DMBA 2ABHA 2OZZA 1IEJA 1MXZA 2Y5KA 4DE8A 4QFLA 4M4GA 1I6BA 3LBSA 3TFLA 1HSEA 3M3FA 2HEUA 1UTHA 1IMDA 3IOTA 1MDQA 4THIA 2RF1A 4P0GA 1XVYA 5ISUA 2Y7KA 3PPNA 2Q2CA 3OD7A 1SW4A 2QMXA 4XXUA 4TOZA 1P1WA 3TQWA 3K00A 5KZTA 1DCUA 2M8CA 4IB2A 3C35A 1O7TA 1D9YA 2I49A 1FQCA 1A8FA 4OVSA 1B3HA 4DZ1A 1YZ0A 3TCGA 4WEPA 2XX8A 4NQ8A 1DPPA 3SEUA 2A5TB 3ZKLA 1B7ZA 1BP5A 3R6UA 4H6DA 3IJXB 1FQAA 4PE5B 2V3TA 1LB8A 4PFRA 3RT8A 1Q1KA 3M8UA 4IGTA 5IZ1A 3OO7A 4QFNA 1I69A 3RGYA 4OTEA 1URGA 2JJKA 1FBHA 5I2KA 3N6TA 2CMOA 3PD9A 1HSLA 4I40A 5A5LA 2UYEA 1XT8A 1NV6A 3KG2A 4LATA 1ELJA 2B4MA 1JVYA 3OOAA 1OLCA 3BFTA 1IITA 1R9LA 1LB9A 1NV5A 1EYIA 4PFYA 1LFGA 1JW1A 3VFJA 1VFDA 5H8FB 2ONSA 3E9XA 2ONKE 3K0VA 4HE1A 3E78A 4YKJA 4BDOA 5ESYA 1FPDA 2ALUA 3A3UA 3RQTA 2AL4A 2D5WA 3TZAA 2UVHA 1MPDA 4OESA 4P9KA 3U65A 2UXAA 3GZGA 2Z23A 4PBHA 1MH3A 2A5TA 3K6UA 3B6QA 2OJTA 5DVFA 3HHFA 1B1HA 1IXIA 1R1NA 1LEVA 3FVKA 4ZE8A 2FIXA 4DCYA 1M5CA 3W9WA 2O7IA 2DXYA 1NV7A 3JZJA 1B6HA 4PE3A 2UVGA 1XC1A 4DXBA 3EPEA 1AIVA 3B50A 2WYPA 1IUDA 4PF8A 1LSTA 4H8IA 1SI1A 1IMAA 4MFIA 2F8DA 1D3KA 4EXLA 2AYSA 4NN3A 3LV0A 1YCJA 1P1QA 3IR1A 1AL3A 3H06B 3QMFA 2ZNTA 2GFEA 3QYTA 1YAEA 5EQ7A 5FHNA 3B6TA 1NMUA 4PETA 3RY3A 1DTZA 4DXUA
chains in the Genus database with same CATH topology
1PBPA 1P99A 2HFBA 5H8FA 1AMFA 5ITPA 1JEUA 1FTLA 3TCFA 2OK2A 3M3KA 2G29A 3ONMA 2OWTA 2VGQA 4EQ9A 2ZYNA 4NF5B 2RC7A 5TP9B 3N5LA 1EZOA 2F34A 3OENA 2E0SA 4R74A 3IOUA 3SESA 4IO5A 3PUYE 2XXPA 3SETA 4KPTA 1LAGE 4HCYA 3MWBA 1N04A 5LOMA 1FTMA 1N3XA 4H65A 1RKMA 5KDTB 5I56B 4GXSB 3KBRA 4I62A 1OQHA 4ECFA 3OSRA 1M5FA 4YAHX 5I84A 3UA8A 4F19A 1A55A 4ZDMA 2GRVA 3OO9A 4LVQA 3PMWA 2Z8EA 3OELA 2P0SA 2DE3A 4R6KA 1NL5A 3I5OA 3V8XB 4QFPA 2OCUA 4IO4A 1T0KA 5CRYA 4BDQA 3K2DA 4NF6B 4Q30B 3HPIA 4G68C 3G3IA 1MXVA 3THIA 4U23A 4F39A 1EH3A 1URDA 3K4UA 4LZ8A 2DE2A 1R6ZA 2FNCA 4GRKA 2VD2A 4C0RA 1LAFE 4UACA 4WXJA 1BKAA 5J1DA 4Z0IA 3S9EA 4U22A 5FTHA 5H8SA 4ESXA 2DVCA 1JEVA 2PBWA 4X1BA 1SYIA 3PMVA 1Y4TA 2PYYA 1H3DA 2UVJA 3UN6A 3KJTA 1B3EA 3DLNA 3RT6B 5KDTA 3IO4A 4KCDA 1VR5A 1II5A 5I56A 3SEYA 3IAZA 2NUVA 4BDNA 2NOOA 1BIYA 4U21A 3OO8A 3KEIA 1XHYA 4XKQA 4POXA 1ZLQA 4OFOA 2XD3A 2Y7PA 4OYVA 2QPQA 1O63A 3CSGA 2QJEA 3C33A 4YKIA 3CR9A 1FTJA 1MQDA 3BFUA 3TTKA 1QUIA 1QJMA 5AA2B 5I2NA 1N7WA 4X1DA 1DPEA 4HW8A 4F2OA 5H8HB 3KZGA 4N07A 4QFKA 2UVIA 1M5EA 3OSQA 5L9OA 4YZZA 2ZMBA 3IOVA 2BJJX 3MZ1A 1TWYA 4O3AA 1GVCA 5TU0A 4ZZEA 5JTYB 4G77A 1Y3QA 1MPBA 3L6GA 3QAXA 2H99A 1N0TA 1H44A 4G8MA 2O84X 2REJA 5IAIA 2I3WA 1NNFA 4G8HA 3MVYA 1Z7NE 2I4CA 4PFWA 3E4RA 1SD3A 3VXCA 5EHSA 3TDJA 3WAFA 2THIA 3ZKKA 5HM4B 4IO3A 1ZBMA 3BBRA 3O2AA 2ESNA 1B40A 5AA2A 1LLSA 3G3KA 3TUSA 5H8HA 1GTKA 2XD2A 1TFAA 3K6WA 1US5A 3O29A 1EU8A 2HCAA 4HCWA 1B0HA 2UYFA 4F31B 2H98A 3U8QA 3TQLA 2QSXA 2HAVA 4KYDA 4KCCA 1KWHA 5ITOA 2B65A 3RN8A 4QRZA 1MXUA 2O68A 2DWHA 1XS5A 1BLFA 1MQJA 2IA4A 2OBGA 3Q26A 2F36A 1QW0A 3T22A 4EQ7A 5I59B 1S9TA 1SI0A 3Q28A 1LCFA 3I6VA 2PT1A 4BLAA 3MZBA 5K2XA 1HSJA 4DLDA 1XVXA 4NF8B 4P0IA 1TXFA 1Y1MA 1L5TA 4HS7A 3TELA 2ZNUA 4JSDA 3H6VA 2A5SA 1LAHE 1JW4A 5CMCA 3SEXA 4RYAA 3TTNA 3KSJA 1P1UA 1SVXB 1MH4A 4KR5A 4E0XA 4KYEA 4ISUA 1Y1ZA 4ESWA 1Y3NA 3MQ9A 2PX1A 5DT6A 3G3GA 4EDPA 3K02A 4MH5A 4NMYA 3R7XA 2VHAA 1USYH 2I4BA 5DTBA 4M1VA 1B1XA 5CC2A 1FW0A 2D21A 3MZ9A 3HCQA 1B5IA 2O6AA 1N84A 3VLUA 3IB2A 4OQOA 3FD3A 5I59A 1H43A 1OVBA 3K01A 4RPNA 3G3HA 2DXRA 3IOWA 2QS3A 2V84A 3E13X 1M5DA 1I6AA 4WEDA 4Q8RA 4NF8A 5M2VA 2NVUB 1SQYA 2I0BA 3OO6A 3KJ7A 4X48A 3DP4A 2XXHA 4FATA 2IEEA 3KSXA 4IO7A 3TPAA 1B4HA 1NFTA 2PT2A 1A8EA 5H8QB 2I0CA 1UIUA 3IX1A 1A99A 4ELRA 4MLQA 4LP2B 3RUMA 5F1QA 4NWCA 4JWYA 5I58B 3O97A 3WAEA 3E3KA 2XXVA 3C36A 3IB0A 5AA4B 5DYHA 3MPKA 3MP8A 4EF2A 1I6QA 2X7PA 3K1MA 4ONYA 4LZ7A 3SERA 1IXGA 3L6HA 3VXBA 1PB9A 3MW0A 3KOTA 3H6UA 4JDFA 4PFTA 1TT1A 3LSFB 2CZLA 4C1TA 1MPCA 3IO6A 3ILUB 2Q89A 1ZMGA 3O6GA 3BKIB 2YPNA 5JEIA 3RTWB 1N3WA 3C9HA 1FTOA 4L17A 5H8QA 2W7YA 4ELOA 1ZJLA 2Y7RA 5EHMA 1S7YA 4LUBA 3U93A 4EF1A 3VV5A 5I57B 5DVIA 3HHGA 2PVUA 4FORA 1MXYA 4POWA 3CRBA 3CIJA 5I58A 3FV2A 3DM0A 5AA3A 4TLMB 3UIFA 5AA4A 1IIWA 4U1OA 2DE4A 1NH7A 5AE4A 3U1OA 1MQHA 3TKDA 3S9MC 1RYXA 5H8NA 3H03A 4YICA 2V3UA 3QUFA 4F1YA 2DWAA 3V5AA 4H5GA 3H6TA 4R75A 2XXIA 3VDFA 3RNNA 3HV1A 1QKBA 1IXHA 3PPRA 5DVJA 1B2HA 1B7UA 3MVXA 4YMBA 1XOCA 3A09A 1B7HA 3H6WA 2PMSA 5HBCA 4G8NA 1Y3PA 1AH5A 3H3GA 5I2NB 3CFLA 5I57A 1M5BA 2GHAA 1B32A 2ZYMA 2ZYKA 2X7QA 3PU5A 2XX9A 3O66A 4P11A 2H25A 1PDAA 4IO6A 3FASA 3HN0A 3IB1A 4ZEBA 3T66A 3PUZE 3MAMA 4F2QA 4XIGQ 4N13A 4NTLA 2DQVA 3FVGA 1IQ7A 1B05A 3O6HA 3T96B 1UQWA 3CG3A 1NNKA 4OVJA 3G7WA 5F7VA 1IXCA 3EHSA 3U92A 1ZTYA 1CE2A 4GWOA 2AL5A 2I58A 2XXQA 2DOJA 2ZNSA 1MY2A 3VE1B 3CFXA 2DVZA 4FIMA 4EQBA 1IZ1A 4YU0A 3CG1A 4YKKA 3S4UA 3V89B 4H5FA 5TPAB 4ELPA 1BTJA 3MP6A 2F7BA 1NH8A 3FGSA 2QMWA 4XKRA 5B70A 3FV1A 4JB7A 1S50A 4R2BA 3C34A 1ZIUA 4OMBA 2DWIA 3B7DA 2OLBA 3VLVA 4FEDA 5AA1A 3LR1A 4FECA 4ZEKA 3VVDA 4KQPA 3TTLA 2DS9A 4QHQA 2O51A 3CVGA 1N7XA 3TTRA 3PPPA 4ZEDA 1MY1A 1NNPA 2D3IA 3A3CA 2AIXA 4YMAA 4ZEIA 2KLFA 1MS7A 3T93B 1FQBA 1ZKBA 1Q35A 1P1OA 2I48A 2F97A 1JVXA 4GD5A 2O1MA 4Q5TA 1ATGA 1DOTA 3MJNA 3OEMA 2Q9TA 2Z22A 3N6UA 3B6WA 4GLIA 1YPNA 1B58A 3VVFA 1Y9UA 1UTBB 1VFEA 3EHTA 3JV9A 4ZS9A 1WDNA 4KFQA 5TPAA 2QS1A 3OXNA 3QXMA 1SDXA 3C31A 4G2ZA 3H4ZA 2RC9A 4NF4B 3P7IA 3W9VA 4GF8A 1Z7ME 2HZKA 4DIGA 4OWDA 3T9VA 4PP0A 1B3GA 3CI8A 1SYHA 4O3BA 2R6GE 3LC8A 2HQ0A 3PUXE 1FQFA 3V83A 1P1NA 1EZPA 3IJOB 3D4GA 3OEKA 4ZEFA 3EHUA 3ZSFA 2RCAA 1VE4A 1MY4A 5CM6A 4MBPA 5ICQA 3S9NC 4XKNA 4JXIA 1LBCA 2Q88A 4FJPA 2V25A 1LAXA 3FXQA 4LZ5A 2F7CA 2I6EA 3FIRA 4JWXA 5CMBA 4GXAA 4Q0CA 3LSLA 1Y20A 2O1LA 3LUYA 1ZU0A 3ODBA 3K6VA 4KD5A 1UIVA 4I9DA 3KGCA 3RPWA 4F1UA 4IY5A 3OMBA 1SW5A 3D4CA 1UTBA 2O7UA 3PMXA 3MVWA 5FHMA 2RCBA 4F18A 4RK2A 5IKBA 4OEUA 4F1VA 5ICTA 4PQJA 3VLWA 4NF4A 3KOSA 3UK4A 4AB5A 1NNTA 4OZ9A 2DP8A 3I3VA 4ZZAA 3G3FA 3EN3A 2XXTA 2FA7A 1POY1 3N94A 4ELQA 3K6XA 3KN7A 1FTKA 3G3JA 3MUQA 4QSCA 1MM6A 4QFOA 3FVOA 1SBPA 3C32A 4O3CA 3FJ7A 4GOTA 2VOZA 3GLBA 2I3VA 5ELVA 2QRYA 1D4NA 4H0WA 3LSWA 3TEPA 4R73A 3R26A 4F22A 3SDFA 2DYXA 3QUJA 4G4PA 3MVZA 1FQDA 2XHDA 2LAOA 2NXOA 2YLNA 1A54A 1GR2A 2Q8JA 3GXAA 3T9UA 1FCKA 5DEXA 1NKXA 2DWJA 2XX7A 5CMMA 4X9TA 3RTFB 3IK6B 3MC2A 1R9QA 1DTGA 4YB6A 3O28A 3UP9A 4I1DA 1H45A 4GVOA 1USYE 1PBQA 3KFMA 3AXFA 5FHOA 4MF3A 4U1ZA 4QSDA 4BDLA 1F9BA 4NEDA 2Y84A 4RK9A 2E1SA 3T9XB 4GL8A 4H1XA 4U4XA 4OFJA 4RA1A 1GV8A 3FJGA 4R6YA 2B3BA 4R6HA 1B46A 1A7LA 5H8NB 3PD8A 3FZVA 2Z8FA 2XXYA 4N6PA 1WODA 1B0LA 3Q27A 5CI5A 1J1NA 4DDDA 1A40A 2QS4A 3ZS6A 1CB6A 1GGGA 3U72A 3TODA 4UA8A 3RLFE 3UORA 3O9PA 2O69A 4GQOA 5L9SA 3KN8A 3CFZA 4RNSA 1MG1A 3FXRA 4NWDA 3S9LC 1OIBA 4U2RA 3T9HB 4IGRA 2RINA 3FUZA 3EQ1A 1B51A 1B3LA 4RXLA 4C1UA 1JETA 5A5XB 3PPOA 2F6PA 4R9FA 4FAJA 5AA2D 4AQ4A 4K3FA 3KN3A 4F3BA 3PPQA 1VSOA 4EUOA 3MP1A 3S2VA 3CSBA 4LQ2A 4OXVA 2H9BA 4MLVA 2ZYOA 1N76A 3SEWA 4QSEA 4FEBA 4XTCQ 1Y4CA 3F11A 3ECRA 1TFDA 4U4SA 1QVSA 3PV0E 2GHBA 3U94A 1MRPA 5B7DA 3IORA 1MM7A 4BDRA 4KYSA 2VP1A 1B9JA 4F3SA 2H5YA 2R9JA 2X26A 3PGFA 3K1PA 1MQGA 2ZXTA 1QUKA 1MQIA 1LFIA 5A5XA 4YB5A 2DSFA 1LBBA 4TLLB 4R9GA 4F3GA 5HPQA 1MXXA 4G68B 3FVNA 4YKPA 1QUJA 4HTGA 1SW1A 1AOVA 3DELB 4I8CA 1LGBC 4R72A 2G93A 1MY3A 5BUUA 4KHZE 1O64A 4NF5A 3EF7A 5TP9A 4ZECA 1LFHA 2RC8A 1WVJA 1QULA 4GIZA 2Y7WA 3TTMA 4JBZA 3ILTB 4JSOA 2NWJA 2YJPA 2F35A 4RY1A 1JNFA 3C4MA 5BWJA 4QF9A 2Q2AA 4E0WA 2P1SA 5CBRA 3TMGA 2V3QA 1OQGA 1LCTA 2OWSA 1B5HA 2RKMA 2R71A 3VVEA 5K2YA 3PUVE 5JK4A 1B3FA 3Q29A 4NE4A 2F78A 5KCJB 2WKYA 5FTIA 1URSA 1POTA 2XXWA 4XKPA 4IY6A 4F29A 4KI0E 2REGA 3DP8A 3Q25A 2XXXA 4OETA 2ANJA 4G68A 4NF6A 2V93A 2ONRA 2FYIA 4GL0A 1H76A 1JQFA 3UGWA 4DCXA 1RYOA 1ANFA 3QSLA 1US4A 3FATA 2GH9A 4H8JA 1MY0A 2HXWA 3SKPA 4OENA 2H4IA 2B3FA 1MDP1 1PC3A 2P2AA 3TYHA 4R2FA 1FQEA 4LA9A 2XXRA 1B52A 1MXWA 2F5XA 1B4ZA 2Y7IA 3H7MA 4AB6A 4OEVA 4OERA 4EXKA 4ND9A 4RPOA 2QL3A 3MPLA 4F3PA 4RJZA 4JWOA 5KCJA 3FJMA 2F7AA 1DSNA 1SW2A 5CBSA 4YB7A 1UTHB 3PUWE 2HAUA 2VD3A 3SEVA 1OVTA 3JYRA 4H67A 4LQ5A 3K1NA 2XXUA 1QKAA 1PEBA 1OLAA 5CMKA 2Z8DA 4PFUA 4WKMA 1EZ9A 3IL1B 1D9VA 4OHNA 3GBBA 1YTVA 4GFRA 4LONB 3USDA 4TQUQ 4FE8A 4OFLA 1OMPA 5JTYA 1B5JA 2HZLA 3QIMA 3FXUA 3LSXA 3N26A 4ZE9A 3TCHA 3W15C 2QS2A 3O6IA 5L9MA 1PB8A 1JW5A 4IO2A 5EYFA 1PB7A 4DXCA 3HO7A 3MBPA 3GBAA 5L8DA 4Z7EA 2F6GA 3QK6A 5DEXB 4BDMA 3DP6A 5I2KB 3HSTA 3TAJA 3M3LA 1DMBA 2ABHA 2OZZA 1IEJA 1MXZA 4DE8A 4QFLA 4M4GA 1I6BA 3LBSA 3TFLA 1HSEA 3M3FA 2HEUA 1UTHA 3IOTA 1MDQA 4THIA 2RF1A 4P0GA 1XVYA 5ISUA 2Y7KA 3PPNA 2Q2CA 3OD7A 1SW4A 2QMXA 4XXUA 4TOZA 1P1WA 3TQWA 3K00A 5KZTA 2M8CA 4IB2A 3C35A 1O7TA 1D9YA 2I49A 1FQCA 1A8FA 1B3HA 4DZ1A 3TCGA 4WEPA 2XX8A 1DPPA 3SEUA 2A5TB 3ZKLA 1B7ZA 1BP5A 3R6UA 4H6DA 3IJXB 1FQAA 4PE5B 2V3TA 1LB8A 3RT8A 1Q1KA 3M8UA 4IGTA 3OO7A 4QFNA 1I69A 3RGYA 4OTEA 1URGA 5I2KA 3N6TA 2CMOA 3PD9A 1HSLA 2UYEA 1XT8A 3KG2A 4LATA 1ELJA 1JVYA 3OOAA 1OLCA 3BFTA 1IITA 1R9LA 1LB9A 4PFYA 1LFGA 1JW1A 3VFJA 1VFDA 5H8FB 2ONSA 3E9XA 2ONKE 3K0VA 4YKJA 4BDOA 2ALUA 3A3UA 3RQTA 2AL4A 2D5WA 3TZAA 2UVHA 1MPDA 4OESA 2UXAA 3GZGA 2Z23A 1MH3A 2A5TA 3K6UA 3B6QA 2OJTA 5DVFA 3HHFA 1B1HA 1IXIA 1R1NA 3FVKA 4ZE8A 4DCYA 1M5CA 3W9WA 2O7IA 2DXYA 3JZJA 1B6HA 2UVGA 1XC1A 4DXBA 3EPEA 1AIVA 1IUDA 1LSTA 4H8IA 1SI1A 4MFIA 2F8DA 1D3KA 4EXLA 2AYSA 1YCJA 1P1QA 3IR1A 1AL3A 3H06B 2ZNTA 2GFEA 3QYTA 1YAEA 5FHNA 3B6TA 1NMUA 4PETA 3RY3A 1DTZA 4DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBP A;  1P99 A;  2HFB A;  5H8F A;  1AMF A;  5ITP A;  1JEU A;  1FTL A;  3TCF A;  2OK2 A;  3M3K A;  2G29 A;  3ONM A;  2OWT A;  2VGQ A;  4EQ9 A;  2ZYN A;  4NF5 B;  2RC7 A;  5TP9 B;  3N5L A;  1EZO A;  2F34 A;  3OEN A;  2E0S A;  4R74 A;  3IOU A;  3SES A;  4IO5 A;  3PUY E;  2XXP A;  3SET A;  4KPT A;  1LAG E;  4HCY A;  3MWB A;  1N04 A;  5LOM A;  1FTM A;  1N3X A;  4H65 A;  1RKM A;  5KDT B;  5I56 B;  4GXS B;  3KBR A;  4I62 A;  1OQH A;  4ECF A;  3OSR A;  1M5F A;  4YAH X;  5I84 A;  3UA8 A;  4F19 A;  1A55 A;  4ZDM A;  2GRV A;  3OO9 A;  4LVQ A;  3PMW A;  2Z8E A;  3OEL A;  2P0S A;  2DE3 A;  4R6K A;  1NL5 A;  3I5O A;  3V8X B;  4QFP A;  2OCU A;  4IO4 A;  1T0K A;  5CRY A;  4BDQ A;  3K2D A;  4NF6 B;  4Q30 B;  3HPI A;  4G68 C;  3G3I A;  1MXV A;  3THI A;  4U23 A;  4F39 A;  1EH3 A;  1URD A;  3K4U A;  4LZ8 A;  2DE2 A;  1R6Z A;  2FNC A;  4GRK A;  2VD2 A;  4C0R A;  1LAF E;  4UAC A;  4WXJ A;  1BKA A;  5J1D A;  4Z0I A;  3S9E A;  4U22 A;  5FTH A;  5H8S A;  4ESX A;  2DVC A;  1JEV A;  2PBW A;  4X1B A;  1SYI A;  3PMV A;  1Y4T A;  2PYY A;  1H3D A;  2UVJ A;  3UN6 A;  3KJT A;  1B3E A;  3DLN A;  3RT6 B;  5KDT A;  3IO4 A;  4KCD A;  1VR5 A;  1II5 A;  5I56 A;  3SEY A;  3IAZ A;  2NUV A;  4BDN A;  2NOO A;  1BIY A;  4U21 A;  3OO8 A;  3KEI A;  1XHY A;  4XKQ A;  4POX A;  1ZLQ A;  4OFO A;  2XD3 A;  2Y7P A;  4OYV A;  2QPQ A;  1O63 A;  3CSG A;  2QJE A;  3C33 A;  4YKI A;  3CR9 A;  1FTJ A;  1MQD A;  3BFU A;  3TTK A;  1QUI A;  1QJM A;  5AA2 B;  5I2N A;  1N7W A;  4X1D A;  1DPE A;  4HW8 A;  4F2O A;  5H8H B;  3KZG A;  4N07 A;  4QFK A;  2UVI A;  1M5E A;  3OSQ A;  5L9O A;  4YZZ A;  2ZMB A;  3IOV A;  2BJJ X;  3MZ1 A;  1TWY A;  4O3A A;  1GVC A;  5TU0 A;  4ZZE A;  5JTY B;  4G77 A;  1Y3Q A;  1MPB A;  3L6G A;  3QAX A;  2H99 A;  1N0T A;  1H44 A;  4G8M A;  2O84 X;  2REJ A;  5IAI A;  2I3W A;  1NNF A;  4G8H A;  3MVY A;  1Z7N E;  2I4C A;  4PFW A;  3E4R A;  1SD3 A;  3VXC A;  5EHS A;  3TDJ A;  3WAF A;  2THI A;  3ZKK A;  5HM4 B;  4IO3 A;  1ZBM A;  3BBR A;  3O2A A;  2ESN A;  1B40 A;  5AA2 A;  1LLS A;  3G3K A;  3TUS A;  5H8H A;  1GTK A;  2XD2 A;  1TFA A;  3K6W A;  1US5 A;  3O29 A;  1EU8 A;  2HCA A;  4HCW A;  1B0H A;  2UYF A;  4F31 B;  2H98 A;  3U8Q A;  3TQL A;  2QSX A;  2HAV A;  4KYD A;  4KCC A;  1KWH A;  5ITO A;  2B65 A;  3RN8 A;  4QRZ A;  1MXU A;  2O68 A;  2DWH A;  1XS5 A;  1BLF A;  1MQJ A;  2IA4 A;  2OBG A;  3Q26 A;  2F36 A;  1QW0 A;  3T22 A;  4EQ7 A;  5I59 B;  1S9T A;  1SI0 A;  3Q28 A;  1LCF A;  3I6V A;  2PT1 A;  4BLA A;  3MZB A;  5K2X A;  1HSJ A;  4DLD A;  1XVX A;  4NF8 B;  4P0I A;  1TXF A;  1Y1M A;  1L5T A;  4HS7 A;  3TEL A;  2ZNU A;  4JSD A;  3H6V A;  2A5S A;  1LAH E;  1JW4 A;  5CMC A;  3SEX A;  4RYA A;  3TTN A;  3KSJ A;  1P1U A;  1SVX B;  1MH4 A;  4KR5 A;  4E0X A;  4KYE A;  4ISU A;  1Y1Z A;  4ESW A;  1Y3N A;  3MQ9 A;  2PX1 A;  5DT6 A;  3G3G A;  4EDP A;  3K02 A;  4MH5 A;  4NMY A;  3R7X A;  2VHA A;  1USY H;  2I4B A;  5DTB A;  4M1V A;  1B1X A;  5CC2 A;  1FW0 A;  2D21 A;  3MZ9 A;  3HCQ A;  1B5I A;  2O6A A;  1N84 A;  3VLU A;  3IB2 A;  4OQO A;  3FD3 A;  5I59 A;  1H43 A;  1OVB A;  3K01 A;  4RPN A;  3G3H A;  2DXR A;  3IOW A;  2QS3 A;  2V84 A;  3E13 X;  1M5D A;  1I6A A;  4WED A;  4Q8R A;  4NF8 A;  5M2V A;  2NVU B;  1SQY A;  2I0B A;  3OO6 A;  3KJ7 A;  4X48 A;  3DP4 A;  2XXH A;  4FAT A;  2IEE A;  3KSX A;  4IO7 A;  3TPA A;  1B4H A;  1NFT A;  2PT2 A;  1A8E A;  5H8Q B;  2I0C A;  1UIU A;  3IX1 A;  1A99 A;  4ELR A;  4MLQ A;  4LP2 B;  3RUM A;  5F1Q A;  4NWC A;  4JWY A;  5I58 B;  3O97 A;  3WAE A;  3E3K A;  2XXV A;  3C36 A;  3IB0 A;  5AA4 B;  5DYH A;  3MPK A;  3MP8 A;  4EF2 A;  1I6Q A;  2X7P A;  3K1M A;  4ONY A;  4LZ7 A;  3SER A;  1IXG A;  3L6H A;  3VXB A;  1PB9 A;  3MW0 A;  3KOT A;  3H6U A;  4JDF A;  4PFT A;  1TT1 A;  3LSF B;  2CZL A;  4C1T A;  1MPC A;  3IO6 A;  3ILU B;  2Q89 A;  1ZMG A;  3O6G A;  3BKI B;  2YPN A;  5JEI A;  3RTW B;  1N3W A;  3C9H A;  1FTO A;  4L17 A;  5H8Q A;  2W7Y A;  4ELO A;  1ZJL A;  2Y7R A;  5EHM A;  1S7Y A;  4LUB A;  3U93 A;  4EF1 A;  3VV5 A;  5I57 B;  5DVI A;  3HHG A;  2PVU A;  4FOR A;  1MXY A;  4POW A;  3CRB A;  3CIJ A;  5I58 A;  3FV2 A;  3DM0 A;  5AA3 A;  4TLM B;  3UIF A;  5AA4 A;  1IIW A;  4U1O A;  2DE4 A;  1NH7 A;  5AE4 A;  3U1O A;  1MQH A;  3TKD A;  3S9M C;  1RYX A;  5H8N A;  3H03 A;  4YIC A;  2V3U A;  3QUF A;  4F1Y A;  2DWA A;  3V5A A;  4H5G A;  3H6T A;  4R75 A;  2XXI A;  3VDF A;  3RNN A;  3HV1 A;  1QKB A;  1IXH A;  3PPR A;  5DVJ A;  1B2H A;  1B7U A;  3MVX A;  4YMB A;  1XOC A;  3A09 A;  1B7H A;  3H6W A;  2PMS A;  5HBC A;  4G8N A;  1Y3P A;  1AH5 A;  3H3G A;  5I2N B;  3CFL A;  5I57 A;  1M5B A;  2GHA A;  1B32 A;  2ZYM A;  2ZYK A;  2X7Q A;  3PU5 A;  2XX9 A;  3O66 A;  4P11 A;  2H25 A;  1PDA A;  4IO6 A;  3FAS A;  3HN0 A;  3IB1 A;  4ZEB A;  3T66 A;  3PUZ E;  3MAM A;  4F2Q A;  4XIG Q;  4N13 A;  4NTL A;  2DQV A;  3FVG A;  1IQ7 A;  1B05 A;  3O6H A;  3T96 B;  1UQW A;  3CG3 A;  1NNK A;  4OVJ A;  3G7W A;  5F7V A;  1IXC A;  3EHS A;  3U92 A;  1ZTY A;  1CE2 A;  4GWO A;  2AL5 A;  2I58 A;  2XXQ A;  2DOJ A;  2ZNS A;  1MY2 A;  3VE1 B;  3CFX A;  2DVZ A;  4FIM A;  4EQB A;  1IZ1 A;  4YU0 A;  3CG1 A;  4YKK A;  3S4U A;  3V89 B;  4H5F A;  5TPA B;  4ELP A;  1BTJ A;  3MP6 A;  2F7B A;  1NH8 A;  3FGS A;  2QMW A;  4XKR A;  5B70 A;  3FV1 A;  4JB7 A;  1S50 A;  4R2B A;  3C34 A;  1ZIU A;  4OMB A;  2DWI A;  3B7D A;  2OLB A;  3VLV A;  4FED A;  5AA1 A;  3LR1 A;  4FEC A;  4ZEK A;  3VVD A;  4KQP A;  3TTL A;  2DS9 A;  4QHQ A;  2O51 A;  3CVG A;  1N7X A;  3TTR A;  3PPP A;  4ZED A;  1MY1 A;  1NNP A;  2D3I A;  3A3C A;  2AIX A;  4YMA A;  4ZEI A;  2KLF A;  1MS7 A;  3T93 B;  1FQB A;  1ZKB A;  1Q35 A;  1P1O A;  2I48 A;  2F97 A;  1JVX A;  4GD5 A;  2O1M A;  4Q5T A;  1ATG A;  1DOT A;  3MJN A;  3OEM A;  2Q9T A;  2Z22 A;  3N6U A;  3B6W A;  4GLI A;  1YPN A;  1B58 A;  3VVF A;  1Y9U A;  1UTB B;  1VFE A;  3EHT A;  3JV9 A;  4ZS9 A;  1WDN A;  4KFQ A;  5TPA A;  2QS1 A;  3OXN A;  3QXM A;  1SDX A;  3C31 A;  4G2Z A;  3H4Z A;  2RC9 A;  4NF4 B;  3P7I A;  3W9V A;  4GF8 A;  1Z7M E;  2HZK A;  4DIG A;  4OWD A;  3T9V A;  4PP0 A;  1B3G A;  3CI8 A;  1SYH A;  4O3B A;  2R6G E;  3LC8 A;  2HQ0 A;  3PUX E;  1FQF A;  3V83 A;  1P1N A;  1EZP A;  3IJO B;  3D4G A;  3OEK A;  4ZEF A;  3EHU A;  3ZSF A;  2RCA A;  1VE4 A;  1MY4 A;  5CM6 A;  4MBP A;  5ICQ A;  3S9N C;  4XKN A;  4JXI A;  1LBC A;  2Q88 A;  4FJP A;  2V25 A;  1LAX A;  3FXQ A;  4LZ5 A;  2F7C A;  2I6E A;  3FIR A;  4JWX A;  5CMB A;  4GXA A;  4Q0C A;  3LSL A;  1Y20 A;  2O1L A;  3LUY A;  1ZU0 A;  3ODB A;  3K6V A;  4KD5 A;  1UIV A;  4I9D A;  3KGC A;  3RPW A;  4F1U A;  4IY5 A;  3OMB A;  1SW5 A;  3D4C A;  1UTB A;  2O7U A;  3PMX A;  3MVW A;  5FHM A;  2RCB A;  4F18 A;  4RK2 A;  5IKB A;  4OEU A;  4F1V A;  5ICT A;  4PQJ A;  3VLW A;  4NF4 A;  3KOS A;  3UK4 A;  4AB5 A;  1NNT A;  4OZ9 A;  2DP8 A;  3I3V A;  4ZZA A;  3G3F A;  3EN3 A;  2XXT A;  2FA7 A;  1POY 1;  3N94 A;  4ELQ A;  3K6X A;  3KN7 A;  1FTK A;  3G3J A;  3MUQ A;  4QSC A;  1MM6 A;  4QFO A;  3FVO A;  1SBP A;  3C32 A;  4O3C A;  3FJ7 A;  4GOT A;  2VOZ A;  3GLB A;  2I3V A;  5ELV A;  2QRY A;  1D4N A;  4H0W A;  3LSW A;  3TEP A;  4R73 A;  3R26 A;  4F22 A;  3SDF A;  2DYX A;  3QUJ A;  4G4P A;  3MVZ A;  1FQD A;  2XHD A;  2LAO A;  2NXO A;  2YLN A;  1A54 A;  1GR2 A;  2Q8J A;  3GXA A;  3T9U A;  1FCK A;  5DEX A;  1NKX A;  2DWJ A;  2XX7 A;  5CMM A;  4X9T A;  3RTF B;  3IK6 B;  3MC2 A;  1R9Q A;  1DTG A;  4YB6 A;  3O28 A;  3UP9 A;  4I1D A;  1H45 A;  4GVO A;  1USY E;  1PBQ A;  3KFM A;  3AXF A;  5FHO A;  4MF3 A;  4U1Z A;  4QSD A;  4BDL A;  1F9B A;  4NED A;  2Y84 A;  4RK9 A;  2E1S A;  3T9X B;  4GL8 A;  4H1X A;  4U4X A;  4OFJ A;  4RA1 A;  1GV8 A;  3FJG A;  4R6Y A;  2B3B A;  4R6H A;  1B46 A;  1A7L A;  5H8N B;  3PD8 A;  3FZV A;  2Z8F A;  2XXY A;  4N6P A;  1WOD A;  1B0L A;  3Q27 A;  5CI5 A;  1J1N A;  4DDD A;  1A40 A;  2QS4 A;  3ZS6 A;  1CB6 A;  1GGG A;  3U72 A;  3TOD A;  4UA8 A;  3RLF E;  3UOR A;  3O9P A;  2O69 A;  4GQO A;  5L9S A;  3KN8 A;  3CFZ A;  4RNS A;  1MG1 A;  3FXR A;  4NWD A;  3S9L C;  1OIB A;  4U2R A;  3T9H B;  4IGR A;  2RIN A;  3FUZ A;  3EQ1 A;  1B51 A;  1B3L A;  4RXL A;  4C1U A;  1JET A;  5A5X B;  3PPO A;  2F6P A;  4R9F A;  4FAJ A;  5AA2 D;  4AQ4 A;  4K3F A;  3KN3 A;  4F3B A;  3PPQ A;  1VSO A;  4EUO A;  3MP1 A;  3S2V A;  3CSB A;  4LQ2 A;  4OXV A;  2H9B A;  4MLV A;  2ZYO A;  1N76 A;  3SEW A;  4QSE A;  4FEB A;  4XTC Q;  1Y4C A;  3F11 A;  3ECR A;  1TFD A;  4U4S A;  1QVS A;  3PV0 E;  2GHB A;  3U94 A;  1MRP A;  5B7D A;  3IOR A;  1MM7 A;  4BDR A;  4KYS A;  2VP1 A;  1B9J A;  4F3S A;  2H5Y A;  2R9J A;  2X26 A;  3PGF A;  3K1P A;  1MQG A;  2ZXT A;  1QUK A;  1MQI A;  1LFI A;  5A5X A;  4YB5 A;  2DSF A;  1LBB A;  4TLL B;  4R9G A;  4F3G A;  5HPQ A;  1MXX A;  4G68 B;  3FVN A;  4YKP A;  1QUJ A;  4HTG A;  1SW1 A;  1AOV A;  3DEL B;  4I8C A;  1LGB C;  4R72 A;  2G93 A;  1MY3 A;  5BUU A;  4KHZ E;  1O64 A;  4NF5 A;  3EF7 A;  5TP9 A;  4ZEC A;  1LFH A;  2RC8 A;  1WVJ A;  1QUL A;  4GIZ A;  2Y7W A;  3TTM A;  4JBZ A;  3ILT B;  4JSO A;  2NWJ A;  2YJP A;  2F35 A;  4RY1 A;  1JNF A;  3C4M A;  5BWJ A;  4QF9 A;  2Q2A A;  4E0W A;  2P1S A;  5CBR A;  3TMG A;  2V3Q A;  1OQG A;  1LCT A;  2OWS A;  1B5H A;  2RKM A;  2R71 A;  3VVE A;  5K2Y A;  3PUV E;  5JK4 A;  1B3F A;  3Q29 A;  4NE4 A;  2F78 A;  5KCJ B;  2WKY A;  5FTI A;  1URS A;  1POT A;  2XXW A;  4XKP A;  4IY6 A;  4F29 A;  4KI0 E;  2REG A;  3DP8 A;  3Q25 A;  2XXX A;  4OET A;  2ANJ A;  4G68 A;  4NF6 A;  2V93 A;  2ONR A;  2FYI A;  4GL0 A;  1H76 A;  1JQF A;  3UGW A;  4DCX A;  1RYO A;  1ANF A;  3QSL A;  1US4 A;  3FAT A;  2GH9 A;  4H8J A;  1MY0 A;  2HXW A;  3SKP A;  4OEN A;  2H4I A;  2B3F A;  1MDP 1;  1PC3 A;  2P2A A;  3TYH A;  4R2F A;  1FQE A;  4LA9 A;  2XXR A;  1B52 A;  1MXW A;  2F5X A;  1B4Z A;  2Y7I A;  3H7M A;  4AB6 A;  4OEV A;  4OER A;  4EXK A;  4ND9 A;  4RPO A;  2QL3 A;  3MPL A;  4F3P A;  4RJZ A;  4JWO A;  5KCJ A;  3FJM A;  2F7A A;  1DSN A;  1SW2 A;  5CBS A;  4YB7 A;  1UTH B;  3PUW E;  2HAU A;  2VD3 A;  3SEV A;  1OVT A;  3JYR A;  4H67 A;  4LQ5 A;  3K1N A;  2XXU A;  1QKA A;  1PEB A;  1OLA A;  5CMK A;  2Z8D A;  4PFU A;  4WKM A;  1EZ9 A;  3IL1 B;  1D9V A;  4OHN A;  3GBB A;  1YTV A;  4GFR A;  4LON B;  3USD A;  4TQU Q;  4FE8 A;  4OFL A;  1OMP A;  5JTY A;  1B5J A;  2HZL A;  3QIM A;  3FXU A;  3LSX A;  3N26 A;  4ZE9 A;  3TCH A;  3W15 C;  2QS2 A;  3O6I A;  5L9M A;  1PB8 A;  1JW5 A;  4IO2 A;  5EYF A;  1PB7 A;  4DXC A;  3HO7 A;  3MBP A;  3GBA A;  5L8D A;  4Z7E A;  2F6G A;  3QK6 A;  5DEX B;  4BDM A;  3DP6 A;  5I2K B;  3HST A;  3TAJ A;  3M3L A;  1DMB A;  2ABH A;  2OZZ A;  1IEJ A;  1MXZ A;  4DE8 A;  4QFL A;  4M4G A;  1I6B A;  3LBS A;  3TFL A;  1HSE A;  3M3F A;  2HEU A;  1UTH A;  3IOT A;  1MDQ A;  4THI A;  2RF1 A;  4P0G A;  1XVY A;  5ISU A;  2Y7K A;  3PPN A;  2Q2C A;  3OD7 A;  1SW4 A;  2QMX A;  4XXU A;  4TOZ A;  1P1W A;  3TQW A;  3K00 A;  5KZT A;  2M8C A;  4IB2 A;  3C35 A;  1O7T A;  1D9Y A;  2I49 A;  1FQC A;  1A8F A;  1B3H A;  4DZ1 A;  3TCG A;  4WEP A;  2XX8 A;  1DPP A;  3SEU A;  2A5T B;  3ZKL A;  1B7Z A;  1BP5 A;  3R6U A;  4H6D A;  3IJX B;  1FQA A;  4PE5 B;  2V3T A;  1LB8 A;  3RT8 A;  1Q1K A;  3M8U A;  4IGT A;  3OO7 A;  4QFN A;  1I69 A;  3RGY A;  4OTE A;  1URG A;  5I2K A;  3N6T A;  2CMO A;  3PD9 A;  1HSL A;  2UYE A;  1XT8 A;  3KG2 A;  4LAT A;  1ELJ A;  1JVY A;  3OOA A;  1OLC A;  3BFT A;  1IIT A;  1R9L A;  1LB9 A;  4PFY A;  1LFG A;  1JW1 A;  3VFJ A;  1VFD A;  5H8F B;  2ONS A;  3E9X A;  2ONK E;  3K0V A;  4YKJ A;  4BDO A;  2ALU A;  3A3U A;  3RQT A;  2AL4 A;  2D5W A;  3TZA A;  2UVH A;  1MPD A;  4OES A;  2UXA A;  3GZG A;  2Z23 A;  1MH3 A;  2A5T A;  3K6U A;  3B6Q A;  2OJT A;  5DVF A;  3HHF A;  1B1H A;  1IXI A;  1R1N A;  3FVK A;  4ZE8 A;  4DCY A;  1M5C A;  3W9W A;  2O7I A;  2DXY A;  3JZJ A;  1B6H A;  2UVG A;  1XC1 A;  4DXB A;  3EPE A;  1AIV A;  1IUD A;  1LST A;  4H8I A;  1SI1 A;  4MFI A;  2F8D A;  1D3K A;  4EXL A;  2AYS A;  1YCJ A;  1P1Q A;  3IR1 A;  1AL3 A;  3H06 B;  2ZNT A;  2GFE A;  3QYT A;  1YAE A;  5FHN A;  3B6T A;  1NMU A;  4PET A;  3RY3 A;  1DTZ A;  4DXU A; 
#chains in the Genus database with same CATH topology
 1PBP A;  1P99 A;  2HFB A;  5H8F A;  1AMF A;  5ITP A;  1JEU A;  1FTL A;  3TCF A;  1FJ9 A;  2OK2 A;  3M3K A;  2G29 A;  2GQ1 A;  3ONM A;  2OWT A;  2VGQ A;  4EQ9 A;  2ZYN A;  4NF5 B;  4GWZ A;  2RC7 A;  4PFI A;  4X04 A;  5TP9 B;  2XWV A;  3N5L A;  3LUZ A;  1EZO A;  2F34 A;  3OEN A;  2E0S A;  4R74 A;  3IOU A;  3SES A;  4IO5 A;  3PUY E;  2XXP A;  2P3V A;  4N6K A;  3SET A;  4KPT A;  5EYG A;  1Q9D A;  1LAG E;  4HCY A;  3MWB A;  1N04 A;  5LOM A;  1FTM A;  1N3X A;  4H65 A;  1RKM A;  5KDT B;  2HPG A;  5I56 B;  4GXS B;  3FXB A;  3KBR A;  4I62 A;  1OQH A;  4ECF A;  3OSR A;  1M5F A;  4YAH X;  5I84 A;  3UA8 A;  4F19 A;  1A55 A;  4ZDM A;  2GRV A;  3OO9 A;  4LVQ A;  3PMW A;  5I3S A;  4NF0 A;  2Z8E A;  1EYK A;  3OEL A;  2P0S A;  1RDX A;  2DE3 A;  4JVI A;  4R6K A;  1NL5 A;  3I5O A;  3V8X B;  4QFP A;  2OCU A;  1NV1 A;  4IO4 A;  1T0K A;  1NUX A;  5CRY A;  4BDQ A;  3K2D A;  4NF6 B;  4Q30 B;  3HPI A;  4G68 C;  2CZI A;  1IME A;  3G3I A;  1MXV A;  3THI A;  4U23 A;  4F39 A;  1EH3 A;  1URD A;  3K4U A;  4LZ8 A;  2DE2 A;  1R6Z A;  2FNC A;  4GRK A;  2VD2 A;  4C0R A;  1LAF E;  4UAC A;  3ISP A;  4WXJ A;  4AS5 A;  1BKA A;  5J1D A;  4Z0I A;  3S9E A;  4U22 A;  5FTH A;  1BK4 A;  5H8S A;  4I3Y A;  4ESX A;  2DVC A;  1JEV A;  1NV2 A;  2PBW A;  4X1B A;  1SYI A;  3PMV A;  5DW8 A;  1Y4T A;  2PYY A;  1H3D A;  2UVJ A;  3UN6 A;  3KJT A;  1B3E A;  3DLN A;  3PTY A;  3RT6 B;  5KDT A;  3IO4 A;  4KCD A;  1VR5 A;  1II5 A;  4HE2 A;  1INP A;  5I56 A;  3SEY A;  1KZ8 A;  3IAZ A;  2NUV A;  4BDN A;  3RYD A;  2NOO A;  1BIY A;  4U21 A;  3OO8 A;  1NV3 A;  3KEI A;  5J16 A;  1XHY A;  4XKQ A;  4POX A;  1ZLQ A;  4OFO A;  2XD3 A;  2Y7P A;  4OYV A;  2QPQ A;  1O63 A;  3CSG A;  2QJE A;  3C33 A;  4YKI A;  4OVP A;  3CR9 A;  1FTJ A;  1MQD A;  4PDD A;  3BFU A;  3TTK A;  4MX6 A;  1QUI A;  1QJM A;  5AA2 B;  5I2N A;  1N7W A;  4X1D A;  1DPE A;  4HW8 A;  4F2O A;  5H8H B;  3KZG A;  4N07 A;  5T3J A;  3BIG A;  4QFK A;  2UVI A;  1M5E A;  3OSQ A;  5L9O A;  4YZZ A;  4NGU A;  2ZMB A;  3IOV A;  2BJJ X;  3MZ1 A;  1TWY A;  4O3A A;  1GVC A;  5TU0 A;  4MHF A;  4ZZE A;  5JTY B;  4G77 A;  2VT5 A;  2KR0 A;  1Y3Q A;  4N8G A;  1MPB A;  3L6G A;  1DK4 A;  3QAX A;  2H99 A;  1N0T A;  1NUW A;  1H44 A;  4G8M A;  2O84 X;  2REJ A;  5IAI A;  2PCR A;  2I3W A;  1NNF A;  1FPJ A;  2B4L A;  4G8H A;  4AS4 A;  3MVY A;  2Q8M A;  1Z7N E;  2I4C A;  4PFW A;  3E4R A;  1SD3 A;  3VXC A;  5EHS A;  3ROJ A;  3TDJ A;  3WAF A;  2THI A;  3ZKK A;  5HM4 B;  4IO3 A;  1ZBM A;  3BBR A;  3O2A A;  2ESN A;  1B40 A;  4GWY A;  5AA2 A;  1LLS A;  3G3K A;  1LBY A;  1FPE A;  3TUS A;  5H8H A;  4NX1 A;  1GTK A;  1QGX A;  2XXK A;  2XD2 A;  1TFA A;  3K6W A;  1LBX A;  1US5 A;  3O29 A;  1EU8 A;  2HCA A;  5I5P A;  4HCW A;  1B0H A;  2UYF A;  4F31 B;  2H98 A;  3U8Q A;  2Y5L A;  2QSX A;  3TQL A;  2HAV A;  2MKZ A;  4KYD A;  4KCC A;  1KWH A;  5ITO A;  2B65 A;  3RN8 A;  4QRZ A;  1MXU A;  2O68 A;  2DWH A;  1LBW A;  1XS5 A;  1BLF A;  1MQJ A;  2IA4 A;  2OBG A;  3Q26 A;  1KA0 A;  2F36 A;  1QW0 A;  3T22 A;  4EQ7 A;  5I59 B;  1S9T A;  1SI0 A;  3Q28 A;  1LCF A;  1EYJ A;  3I6V A;  2PT1 A;  1SPI A;  4BLA A;  3MZB A;  5K2X A;  1HSJ A;  4DLD A;  1XVX A;  4FBP A;  4NF8 B;  4P0I A;  5IM2 A;  1TXF A;  4I3E A;  1Y1M A;  1L5T A;  4HS7 A;  1RDY A;  3TEL A;  2ZNU A;  4JSD A;  3H6V A;  4DI4 B;  2A5S A;  1LAH E;  1JW4 A;  5CMC A;  3SEX A;  4RYA A;  3TTN A;  3KSJ A;  4LN5 A;  1P1U A;  1SVX B;  1MH4 A;  2XWI A;  4GX4 A;  4NAP A;  4KR5 A;  4E0X A;  4KYE A;  4ISU A;  1Y1Z A;  4ESW A;  1Y3N A;  1FPF A;  2PX1 A;  3MQ9 A;  5DT6 A;  3G3G A;  2VPO A;  4EDP A;  3K02 A;  4MH5 A;  4NMY A;  3R7X A;  2VHA A;  1USY H;  2I4B A;  5DTB A;  4M1V A;  1B1X A;  5CC2 A;  1FW0 A;  2D21 A;  3MZ9 A;  3HCQ A;  1B5I A;  2O6A A;  1N84 A;  3VLU A;  2QVU A;  4QXD A;  4PCD A;  3IB2 A;  4OQO A;  3FD3 A;  5I59 A;  1H43 A;  2CZH A;  1OVB A;  3K01 A;  4RPN A;  3G3H A;  2DXR A;  3IOW A;  2QS3 A;  2V84 A;  3E13 X;  1M5D A;  2HXR A;  1I6A A;  4WED A;  4Q8R A;  4NF8 A;  5M2V A;  2NVU B;  1FBF A;  1SQY A;  2I0B A;  3OO6 A;  3KJ7 A;  4X48 A;  3RPL B;  3DP4 A;  2XXH A;  4FAT A;  2IEE A;  3KSX A;  4IO7 A;  3TPA A;  1B4H A;  1NFT A;  3KBZ A;  2PT2 A;  1A8E A;  5H8Q B;  2I0C A;  4GWW A;  4UAB A;  1UIU A;  3IX1 A;  1A99 A;  4ELR A;  4MLQ A;  4LP2 B;  3RUM A;  5F1Q A;  4NWC A;  4PGN A;  4JWY A;  5I58 B;  3O97 A;  3WAE A;  2CZK A;  3E3K A;  2XXV A;  3C36 A;  3IB0 A;  2XWK A;  4N15 A;  5AA4 B;  5DYH A;  3MPK A;  3MP8 A;  4EF2 A;  1I6Q A;  2X7P A;  3K1M A;  4ONY A;  4LZ7 A;  3SER A;  1IXG A;  3L6H A;  3VXB A;  1PB9 A;  3MW0 A;  3KOT A;  5F24 A;  3H6U A;  4JDF A;  4PFT A;  4O8M A;  1TT1 A;  3LSF B;  2CZL A;  4C1T A;  4MAG A;  1MPC A;  3HFU A;  3IO6 A;  3RPL A;  3ILU B;  2Q89 A;  1ZMG A;  3O6G A;  3BKI B;  2YPN A;  5JEI A;  3RTW B;  1N3W A;  3C9H A;  1FTO A;  4L17 A;  4GX3 A;  5H8Q A;  2W7Y A;  4ELO A;  1ZJL A;  4DI3 D;  2Y7R A;  5EHM A;  1S7Y A;  4LUB A;  3U93 A;  4EF1 A;  3VV5 A;  5I57 B;  5DVI A;  3HHG A;  2PVU A;  4FOR A;  1MXY A;  3NOH A;  2P3N A;  4POW A;  3CRB A;  3CIJ A;  5I58 A;  3FV2 A;  4P8B A;  3DM0 A;  5AA3 A;  4TLM B;  3UIF A;  1AWB A;  5AA4 A;  1IIW A;  4U1O A;  5IZZ A;  2DE4 A;  1NH7 A;  5AE4 A;  3U1O A;  1MQH A;  3TKD A;  1DBZ A;  4P47 A;  5ET6 A;  3S9M C;  1RYX A;  5H8N A;  4MNP A;  3H03 A;  4YIC A;  2V3U A;  3QUF A;  4PAI A;  4F1Y A;  2DWA A;  3V5A A;  4MEV A;  4H5G A;  3H6T A;  4R75 A;  2XXI A;  3VDF A;  3RNN A;  4MIJ A;  3HV1 A;  1QKB A;  1IXH A;  1LBV A;  3PPR A;  5DVJ A;  1B2H A;  1B7U A;  3MVX A;  4YMB A;  1XOC A;  3A09 A;  1B7H A;  3H6W A;  2PMS A;  5HBC A;  4G8N A;  1Y3P A;  4P1E A;  1AH5 A;  1FSA A;  4PTK A;  1K9Z A;  3H3G A;  5I2N B;  4N91 A;  4JVD A;  3CFL A;  5I57 A;  1M5B A;  2GHA A;  1B32 A;  2ZYM A;  2ZYK A;  4N17 A;  2X7Q A;  3PU5 A;  4O94 A;  2XX9 A;  3O66 A;  5ET7 A;  4P11 A;  2H25 A;  4PAK A;  1PDA A;  4IO6 A;  4N81 A;  3FAS A;  3HN0 A;  3IB1 A;  4ZEB A;  3T66 A;  3PUZ E;  5EQA A;  1YXI A;  3MAM A;  4F2Q A;  4XIG Q;  4N13 A;  4NTL A;  4MNI A;  2DQV A;  3FVG A;  1IQ7 A;  1B05 A;  3O6H A;  1JP4 A;  3T96 B;  1UQW A;  3CG3 A;  1NNK A;  4OVJ A;  4PGP A;  3G7W A;  5F7V A;  1IXC A;  3EHS A;  2BJI A;  3U92 A;  4MJO A;  1ZTY A;  3T1B A;  1CE2 A;  4GWO A;  2AL5 A;  2I58 A;  2XXQ A;  3E79 A;  2DOJ A;  2ZNS A;  1MY2 A;  3VE1 B;  3CFX A;  3D1R A;  2DVZ A;  4FIM A;  4EQB A;  1IZ1 A;  2QVR A;  3CG1 A;  4YU0 A;  4YKK A;  3S4U A;  3V89 B;  4H5F A;  5TPA B;  4ELP A;  1BTJ A;  3MP6 A;  2F7B A;  1NH8 A;  4P56 A;  2ZZX A;  3FGS A;  2QMW A;  4XKR A;  5B70 A;  3FV1 A;  4JB7 A;  1S50 A;  4R2B A;  3C34 A;  1ZIU A;  4OMB A;  2DWI A;  3B7D A;  2OLB A;  3VLV A;  4FED A;  5AA1 A;  3LR1 A;  4FEC A;  1FBC A;  4ZEK A;  3VVD A;  2PFY A;  4KQP A;  3TTL A;  2DS9 A;  4QHQ A;  1KA1 A;  2O51 A;  3CVG A;  1N7X A;  3TTR A;  3PPP A;  4ZED A;  1MY1 A;  1NNP A;  2D3I A;  5EQ8 A;  3A3C A;  2AIX A;  4YMA A;  4ZEI A;  2KLF A;  1MS7 A;  3T93 B;  1FQB A;  1ZKB A;  1Q35 A;  1P1O A;  2I48 A;  2F97 A;  1JVX A;  4GD5 A;  2O1M A;  4Q5T A;  1ATG A;  5ET8 A;  2WBB A;  1DOT A;  3MJN A;  2F3D A;  3OEM A;  2Q9T A;  4XF5 A;  4H45 A;  2Z22 A;  3N6U A;  1NI9 A;  3B6W A;  4GLI A;  1YPN A;  1B58 A;  3VVF A;  1Y9U A;  1UTB B;  1VFE A;  3EHT A;  3JV9 A;  4ZS9 A;  1WDN A;  4KFQ A;  5TPA A;  2QS1 A;  3OXN A;  3QXM A;  1SDX A;  3C31 A;  4G2Z A;  1FPG A;  3H4Z A;  2RC9 A;  3BIH A;  4NF4 B;  3P7I A;  3W9V A;  4GF8 A;  1Z7M E;  4OA4 A;  2HZK A;  4DIG A;  4OWD A;  3T9V A;  4PP0 A;  1B3G A;  3CI8 A;  3B8B A;  1SYH A;  4O3B A;  2V4C A;  4O7I A;  2R6G E;  3PUX E;  2HQ0 A;  3LC8 A;  1FQF A;  3V83 A;  1P1N A;  1EZP A;  3IJO B;  3D4G A;  4QBA A;  3OEK A;  4ZEF A;  3EHU A;  3ZSF A;  2RCA A;  1NUY A;  1VE4 A;  1MY4 A;  5CM6 A;  4MBP A;  5ICQ A;  3S9N C;  2WX9 A;  4XKN A;  4JXI A;  1LBC A;  2Q88 A;  4FJP A;  2V25 A;  1LAX A;  3FXQ A;  4LZ5 A;  2F7C A;  2I6E A;  3FIR A;  4JWX A;  5CMB A;  4GXA A;  4Q0C A;  3LSL A;  1NUZ A;  1Y20 A;  2O1L A;  3LUY A;  4JVC A;  1ZU0 A;  3ODB A;  3K6V A;  4KD5 A;  4PAF A;  1UIV A;  4I9D A;  3KGC A;  4KXP A;  3RPW A;  4F1U A;  4IY5 A;  3OMB A;  1SW5 A;  3D4C A;  1UTB A;  2O7U A;  3PMX A;  3MVW A;  2F3B A;  5FHM A;  2RCB A;  4F18 A;  4MNC A;  4RK2 A;  5IKB A;  4OEU A;  4F1V A;  5ICT A;  4PQJ A;  3VLW A;  4NF4 A;  3KOS A;  3UK4 A;  4AB5 A;  1NNT A;  4OZ9 A;  2DP8 A;  3I3V A;  4ZZA A;  3G3F A;  3EN3 A;  2XXT A;  1XI6 A;  2FA7 A;  1POY 1;  3N94 A;  4ELQ A;  3K6X A;  3KN7 A;  1FTK A;  3G3J A;  4NHB A;  3MUQ A;  2Q74 A;  4QSC A;  1MM6 A;  4QFO A;  3FVO A;  4X8R A;  1SBP A;  3C32 A;  4O3C A;  3FJ7 A;  4GOT A;  2VOZ A;  5I7I A;  3GLB A;  2L5V A;  5IZ3 B;  1YYZ A;  2I3V A;  4GWU A;  5ELV A;  2QRY A;  1D4N A;  1FJ6 A;  4H0W A;  4GBW A;  3LSW A;  4PC9 A;  3TEP A;  4R73 A;  4H46 A;  3R26 A;  4OVQ A;  4F22 A;  3SDF A;  2DYX A;  4HE0 A;  2KQZ A;  3QUJ A;  4G4P A;  3MVZ A;  1FQD A;  3A29 A;  2XHD A;  4PBQ A;  2LAO A;  2NXO A;  2YLN A;  1A54 A;  4O7M A;  2FVZ A;  1GR2 A;  2Q8J A;  3GXA A;  3T9U A;  1RDZ A;  1FCK A;  2WYK A;  2XA5 A;  5DEX A;  1NKX A;  2DWJ A;  2XX7 A;  5CMM A;  3KC1 A;  4X9T A;  3RTF B;  1FRP A;  3IK6 B;  3MC2 A;  1R9Q A;  1DTG A;  4YB6 A;  4GWX A;  3O28 A;  3UP9 A;  4I1D A;  1H45 A;  2CEY A;  4GVO A;  1USY E;  1PBQ A;  3KFM A;  3AXF A;  5FHO A;  4MF3 A;  4U1Z A;  4QSD A;  4BDL A;  3T0J A;  1F9B A;  4NED A;  2Y84 A;  4RK9 A;  2E1S A;  3T9X B;  5LDZ A;  4GL8 A;  4H1X A;  1FPB A;  4U4X A;  4OFJ A;  4GWS A;  4RA1 A;  1GV8 A;  4NG7 A;  3FJG A;  5IZ3 A;  4R6Y A;  2B3B A;  4R6H A;  1B46 A;  1A7L A;  3SZP A;  5H8N B;  4XFE A;  4XEQ A;  3PD8 A;  3FZV A;  2Z8F A;  2XXY A;  4N6P A;  1WOD A;  1B0L A;  3Q27 A;  5CI5 A;  1J1N A;  4DDD A;  1A40 A;  3FBP A;  2QS4 A;  3ZS6 A;  1CB6 A;  1GGG A;  3U72 A;  3TOD A;  1K9Y A;  4UA8 A;  3RLF E;  3UOR A;  3O9P A;  2O69 A;  4GQO A;  5L9S A;  3KN8 A;  3CFZ A;  1FBP A;  4RNS A;  1MG1 A;  4PF6 A;  3FXR A;  4NWD A;  2OWZ A;  2QFL A;  2FIE A;  3S9L C;  1OIB A;  4U2R A;  3T9H B;  4IGR A;  1D9Q A;  2RIN A;  3FUZ A;  1IMF A;  3EQ1 A;  1B51 A;  1B3L A;  4RXL A;  4C1U A;  1JET A;  5A5X B;  3PPO A;  2F6P A;  4R9F A;  4FAJ A;  5AA2 D;  3IFA A;  4GBV A;  4AQ4 A;  4K3F A;  3MST A;  3KC0 A;  3KN3 A;  4F3B A;  3PPQ A;  1VSO A;  4EUO A;  3IFC A;  3MP1 A;  3S2V A;  3CSB A;  4LQ2 A;  1FTA A;  4OXV A;  2H9B A;  4MLV A;  2ZYO A;  1N76 A;  5ET5 A;  3SEW A;  4QSE A;  4FEB A;  4XTC Q;  4P3L A;  1Y4C A;  2ZZW A;  3F11 A;  3ECR A;  1TFD A;  4U4S A;  1NV4 A;  1QVS A;  3PV0 E;  2GHB A;  3U94 A;  1MRP A;  5B7D A;  3IOR A;  1MM7 A;  1FBG A;  4BDR A;  4KYS A;  2VP1 A;  2VPN A;  1B9J A;  4F3S A;  2H5Y A;  2R9J A;  2X26 A;  1G0I A;  3PGF A;  3K1P A;  1MQG A;  2ZXT A;  1QUK A;  1MQI A;  4OVT A;  1LFI A;  5A5X A;  4YB5 A;  2DSF A;  1LBB A;  4TLL B;  4R9G A;  1G0H A;  4MCO A;  4F3G A;  5HPQ A;  1MXX A;  4G68 B;  3FVN A;  4YKP A;  1QUJ A;  4HTG A;  1SW1 A;  1AOV A;  3DEL B;  4I8C A;  1LGB C;  4R72 A;  2G93 A;  1MY3 A;  1FBD A;  5BUU A;  4KHZ E;  1O64 A;  4NF5 A;  1FPI A;  3EF7 A;  5TP9 A;  4ZEC A;  1LFH A;  1VDW A;  2RC8 A;  1WVJ A;  1QUL A;  4GIZ A;  2R8T A;  2Y7W A;  3TTM A;  3GYY A;  4JBZ A;  3ILT B;  4JSO A;  2ZZV A;  2NWJ A;  2FHY A;  2YJP A;  2F35 A;  4RY1 A;  1JNF A;  3C4M A;  2WBD A;  5BWJ A;  4QF9 A;  2Q2A A;  4E0W A;  2P1S A;  5CBR A;  3TMG A;  2V3Q A;  1OQG A;  1LCT A;  2OWS A;  1B5H A;  2RKM A;  4PDH A;  2R71 A;  3VVE A;  5K2Y A;  3PUV E;  5JK4 A;  1B3F A;  3Q29 A;  4NE4 A;  2F78 A;  5KCJ B;  2WKY A;  5FTI A;  1URS A;  1POT A;  2XXW A;  4XKP A;  2PFZ A;  4IY6 A;  4F29 A;  4KI0 E;  2REG A;  4PFB A;  4P1L A;  3DP8 A;  5IGA A;  3Q25 A;  2XXX A;  4OET A;  2ANJ A;  4G68 A;  4NF6 A;  2V93 A;  2ONR A;  2FYI A;  1FPK A;  4GL0 A;  1H76 A;  1JQF A;  3UGW A;  4DCX A;  4GX6 A;  1RYO A;  1ANF A;  3QSL A;  1US4 A;  2CEX A;  3FAT A;  2GH9 A;  4N4U A;  4H8J A;  1MY0 A;  2HXW A;  4OVR A;  4N8Y A;  3SKP A;  4OEN A;  2H4I A;  1CNQ A;  2B3F A;  1MDP 1;  1PC3 A;  2P2A A;  3TYH A;  3EKI A;  4MMP A;  4R2F A;  3MYU A;  1FQE A;  4LA9 A;  2XXR A;  1B52 A;  1MXW A;  2OX3 A;  2F5X A;  4HXV A;  2DDK A;  1B4Z A;  2Y7I A;  3H7M A;  3CHG A;  4AB6 A;  4OEV A;  4OER A;  4EXK A;  4ND9 A;  4RPO A;  2QL3 A;  3MPL A;  4F3P A;  4RJZ A;  4JWO A;  5KCJ A;  4IR8 A;  3FJM A;  2F7A A;  1DSN A;  2QVV A;  1SW2 A;  5CBS A;  4YB7 A;  1UTH B;  3PUW E;  2HAU A;  2VD3 A;  3SEV A;  1OVT A;  5EYH A;  3JYR A;  4G61 A;  4H67 A;  4LQ5 A;  3K1N A;  2XXU A;  1QKA A;  1PEB A;  1OLA A;  1IMB A;  5CMK A;  2Z8D A;  4PFU A;  5EQ9 A;  4WKM A;  1EZ9 A;  3IL1 B;  1D9V A;  4OHN A;  3GBB A;  4OAN A;  1YTV A;  4GFR A;  4LON B;  3USD A;  4N6D A;  4TQU Q;  2FBP A;  4FE8 A;  4OFL A;  1OMP A;  1IMC A;  1NV0 A;  5JTY A;  1B5J A;  2HZL A;  1FPL A;  3QIM A;  3FXU A;  5FBP A;  3LSX A;  3N26 A;  4ZE9 A;  3TCH A;  3W15 C;  5LTC A;  2QS2 A;  3O6I A;  5L9M A;  1PB8 A;  2WEF A;  1JW5 A;  4IO2 A;  2HHM A;  1FBE A;  5EYF A;  2XWO A;  1LBZ A;  1PB7 A;  4DXC A;  3HO7 A;  3MBP A;  3GBA A;  5L8D A;  4Z7E A;  2F6G A;  3QK6 A;  5DEX B;  4BDM A;  3DP6 A;  5I2K B;  3HST A;  3TAJ A;  3M3L A;  1DMB A;  2ABH A;  2OZZ A;  1IEJ A;  1MXZ A;  2Y5K A;  4DE8 A;  4QFL A;  4M4G A;  1I6B A;  3LBS A;  3TFL A;  1HSE A;  3M3F A;  2HEU A;  1UTH A;  1IMD A;  3IOT A;  1MDQ A;  4THI A;  2RF1 A;  4P0G A;  1XVY A;  5ISU A;  2Y7K A;  3PPN A;  2Q2C A;  3OD7 A;  1SW4 A;  2QMX A;  4XXU A;  4TOZ A;  1P1W A;  3TQW A;  3K00 A;  5KZT A;  1DCU A;  2M8C A;  4IB2 A;  3C35 A;  1O7T A;  1D9Y A;  2I49 A;  1FQC A;  1A8F A;  4OVS A;  1B3H A;  4DZ1 A;  1YZ0 A;  3TCG A;  4WEP A;  2XX8 A;  4NQ8 A;  1DPP A;  3SEU A;  2A5T B;  3ZKL A;  1B7Z A;  1BP5 A;  3R6U A;  4H6D A;  3IJX B;  1FQA A;  4PE5 B;  2V3T A;  1LB8 A;  4PFR A;  3RT8 A;  1Q1K A;  3M8U A;  4IGT A;  5IZ1 A;  3OO7 A;  4QFN A;  1I69 A;  3RGY A;  4OTE A;  1URG A;  2JJK A;  1FBH A;  5I2K A;  3N6T A;  2CMO A;  3PD9 A;  1HSL A;  4I40 A;  5A5L A;  2UYE A;  1XT8 A;  1NV6 A;  3KG2 A;  4LAT A;  1ELJ A;  2B4M A;  1JVY A;  3OOA A;  1OLC A;  3BFT A;  1IIT A;  1R9L A;  1LB9 A;  1NV5 A;  1EYI A;  4PFY A;  1LFG A;  1JW1 A;  3VFJ A;  1VFD A;  5H8F B;  2ONS A;  3E9X A;  2ONK E;  3K0V A;  4HE1 A;  3E78 A;  4YKJ A;  4BDO A;  5ESY A;  1FPD A;  2ALU A;  3A3U A;  3RQT A;  2AL4 A;  2D5W A;  3TZA A;  2UVH A;  1MPD A;  4OES A;  4P9K A;  3U65 A;  2UXA A;  3GZG A;  2Z23 A;  4PBH A;  1MH3 A;  2A5T A;  3K6U A;  3B6Q A;  2OJT A;  5DVF A;  3HHF A;  1B1H A;  1IXI A;  1R1N A;  1LEV A;  3FVK A;  4ZE8 A;  2FIX A;  4DCY A;  1M5C A;  3W9W A;  2O7I A;  2DXY A;  1NV7 A;  3JZJ A;  1B6H A;  4PE3 A;  2UVG A;  1XC1 A;  4DXB A;  3EPE A;  1AIV A;  3B50 A;  2WYP A;  1IUD A;  4PF8 A;  1LST A;  4H8I A;  1SI1 A;  1IMA A;  4MFI A;  2F8D A;  1D3K A;  4EXL A;  2AYS A;  4NN3 A;  3LV0 A;  1YCJ A;  1P1Q A;  3IR1 A;  1AL3 A;  3H06 B;  3QMF A;  2ZNT A;  2GFE A;  3QYT A;  1YAE A;  5EQ7 A;  5FHN A;  3B6T A;  1NMU A;  4PET A;  3RY3 A;  1DTZ A;  4DXU A; 
#chains in the Genus database with same CATH homology
 1PBP A;  1P99 A;  2HFB A;  5H8F A;  1AMF A;  5ITP A;  1JEU A;  1FTL A;  3TCF A;  2OK2 A;  3M3K A;  2G29 A;  3ONM A;  2OWT A;  2VGQ A;  4EQ9 A;  2ZYN A;  4NF5 B;  2RC7 A;  5TP9 B;  3N5L A;  1EZO A;  2F34 A;  3OEN A;  2E0S A;  4R74 A;  3IOU A;  3SES A;  4IO5 A;  3PUY E;  2XXP A;  3SET A;  4KPT A;  1LAG E;  4HCY A;  3MWB A;  1N04 A;  5LOM A;  1FTM A;  1N3X A;  4H65 A;  1RKM A;  5KDT B;  5I56 B;  4GXS B;  3KBR A;  4I62 A;  1OQH A;  4ECF A;  3OSR A;  1M5F A;  4YAH X;  5I84 A;  3UA8 A;  4F19 A;  1A55 A;  4ZDM A;  2GRV A;  3OO9 A;  4LVQ A;  3PMW A;  2Z8E A;  3OEL A;  2P0S A;  2DE3 A;  4R6K A;  1NL5 A;  3I5O A;  3V8X B;  4QFP A;  2OCU A;  4IO4 A;  1T0K A;  5CRY A;  4BDQ A;  3K2D A;  4NF6 B;  4Q30 B;  3HPI A;  4G68 C;  3G3I A;  1MXV A;  3THI A;  4U23 A;  4F39 A;  1EH3 A;  1URD A;  3K4U A;  4LZ8 A;  2DE2 A;  1R6Z A;  2FNC A;  4GRK A;  2VD2 A;  4C0R A;  1LAF E;  4UAC A;  4WXJ A;  1BKA A;  5J1D A;  4Z0I A;  3S9E A;  4U22 A;  5FTH A;  5H8S A;  4ESX A;  2DVC A;  1JEV A;  2PBW A;  4X1B A;  1SYI A;  3PMV A;  1Y4T A;  2PYY A;  1H3D A;  2UVJ A;  3UN6 A;  3KJT A;  1B3E A;  3DLN A;  3RT6 B;  5KDT A;  3IO4 A;  4KCD A;  1VR5 A;  1II5 A;  5I56 A;  3SEY A;  3IAZ A;  2NUV A;  4BDN A;  2NOO A;  1BIY A;  4U21 A;  3OO8 A;  3KEI A;  1XHY A;  4XKQ A;  4POX A;  1ZLQ A;  4OFO A;  2XD3 A;  2Y7P A;  4OYV A;  2QPQ A;  1O63 A;  3CSG A;  2QJE A;  3C33 A;  4YKI A;  3CR9 A;  1FTJ A;  1MQD A;  3BFU A;  3TTK A;  1QUI A;  1QJM A;  5AA2 B;  5I2N A;  1N7W A;  4X1D A;  1DPE A;  4HW8 A;  4F2O A;  5H8H B;  3KZG A;  4N07 A;  4QFK A;  2UVI A;  1M5E A;  3OSQ A;  5L9O A;  4YZZ A;  2ZMB A;  3IOV A;  2BJJ X;  3MZ1 A;  1TWY A;  4O3A A;  1GVC A;  5TU0 A;  4ZZE A;  5JTY B;  4G77 A;  1Y3Q A;  1MPB A;  3L6G A;  3QAX A;  2H99 A;  1N0T A;  1H44 A;  4G8M A;  2O84 X;  2REJ A;  5IAI A;  2I3W A;  1NNF A;  4G8H A;  3MVY A;  1Z7N E;  2I4C A;  4PFW A;  3E4R A;  1SD3 A;  3VXC A;  5EHS A;  3TDJ A;  3WAF A;  2THI A;  3ZKK A;  5HM4 B;  4IO3 A;  1ZBM A;  3BBR A;  3O2A A;  2ESN A;  1B40 A;  5AA2 A;  1LLS A;  3G3K A;  3TUS A;  5H8H A;  1GTK A;  2XD2 A;  1TFA A;  3K6W A;  1US5 A;  3O29 A;  1EU8 A;  2HCA A;  4HCW A;  1B0H A;  2UYF A;  4F31 B;  2H98 A;  3U8Q A;  3TQL A;  2QSX A;  2HAV A;  4KYD A;  4KCC A;  1KWH A;  5ITO A;  2B65 A;  3RN8 A;  4QRZ A;  1MXU A;  2O68 A;  2DWH A;  1XS5 A;  1BLF A;  1MQJ A;  2IA4 A;  2OBG A;  3Q26 A;  2F36 A;  1QW0 A;  3T22 A;  4EQ7 A;  5I59 B;  1S9T A;  1SI0 A;  3Q28 A;  1LCF A;  3I6V A;  2PT1 A;  4BLA A;  3MZB A;  5K2X A;  1HSJ A;  4DLD A;  1XVX A;  4NF8 B;  4P0I A;  1TXF A;  1Y1M A;  1L5T A;  4HS7 A;  3TEL A;  2ZNU A;  4JSD A;  3H6V A;  2A5S A;  1LAH E;  1JW4 A;  5CMC A;  3SEX A;  4RYA A;  3TTN A;  3KSJ A;  1P1U A;  1SVX B;  1MH4 A;  4KR5 A;  4E0X A;  4KYE A;  4ISU A;  1Y1Z A;  4ESW A;  1Y3N A;  3MQ9 A;  2PX1 A;  5DT6 A;  3G3G A;  4EDP A;  3K02 A;  4MH5 A;  4NMY A;  3R7X A;  2VHA A;  1USY H;  2I4B A;  5DTB A;  4M1V A;  1B1X A;  5CC2 A;  1FW0 A;  2D21 A;  3MZ9 A;  3HCQ A;  1B5I A;  2O6A A;  1N84 A;  3VLU A;  3IB2 A;  4OQO A;  3FD3 A;  5I59 A;  1H43 A;  1OVB A;  3K01 A;  4RPN A;  3G3H A;  2DXR A;  3IOW A;  2QS3 A;  2V84 A;  3E13 X;  1M5D A;  1I6A A;  4WED A;  4Q8R A;  4NF8 A;  5M2V A;  2NVU B;  1SQY A;  2I0B A;  3OO6 A;  3KJ7 A;  4X48 A;  3DP4 A;  2XXH A;  4FAT A;  2IEE A;  3KSX A;  4IO7 A;  3TPA A;  1B4H A;  1NFT A;  2PT2 A;  1A8E A;  5H8Q B;  2I0C A;  1UIU A;  3IX1 A;  1A99 A;  4ELR A;  4MLQ A;  4LP2 B;  3RUM A;  5F1Q A;  4NWC A;  4JWY A;  5I58 B;  3O97 A;  3WAE A;  3E3K A;  2XXV A;  3C36 A;  3IB0 A;  5AA4 B;  5DYH A;  3MPK A;  3MP8 A;  4EF2 A;  1I6Q A;  2X7P A;  3K1M A;  4ONY A;  4LZ7 A;  3SER A;  1IXG A;  3L6H A;  3VXB A;  1PB9 A;  3MW0 A;  3KOT A;  3H6U A;  4JDF A;  4PFT A;  1TT1 A;  3LSF B;  2CZL A;  4C1T A;  1MPC A;  3IO6 A;  3ILU B;  2Q89 A;  1ZMG A;  3O6G A;  3BKI B;  2YPN A;  5JEI A;  3RTW B;  1N3W A;  3C9H A;  1FTO A;  4L17 A;  5H8Q A;  2W7Y A;  4ELO A;  1ZJL A;  2Y7R A;  5EHM A;  1S7Y A;  4LUB A;  3U93 A;  4EF1 A;  3VV5 A;  5I57 B;  5DVI A;  3HHG A;  2PVU A;  4FOR A;  1MXY A;  4POW A;  3CRB A;  3CIJ A;  5I58 A;  3FV2 A;  3DM0 A;  5AA3 A;  4TLM B;  3UIF A;  5AA4 A;  1IIW A;  4U1O A;  2DE4 A;  1NH7 A;  5AE4 A;  3U1O A;  1MQH A;  3TKD A;  3S9M C;  1RYX A;  5H8N A;  3H03 A;  4YIC A;  2V3U A;  3QUF A;  4F1Y A;  2DWA A;  3V5A A;  4H5G A;  3H6T A;  4R75 A;  2XXI A;  3VDF A;  3RNN A;  3HV1 A;  1QKB A;  1IXH A;  3PPR A;  5DVJ A;  1B2H A;  1B7U A;  3MVX A;  4YMB A;  1XOC A;  3A09 A;  1B7H A;  3H6W A;  2PMS A;  5HBC A;  4G8N A;  1Y3P A;  1AH5 A;  3H3G A;  5I2N B;  3CFL A;  5I57 A;  1M5B A;  2GHA A;  1B32 A;  2ZYM A;  2ZYK A;  2X7Q A;  3PU5 A;  2XX9 A;  3O66 A;  4P11 A;  2H25 A;  1PDA A;  4IO6 A;  3FAS A;  3HN0 A;  3IB1 A;  4ZEB A;  3T66 A;  3PUZ E;  3MAM A;  4F2Q A;  4XIG Q;  4N13 A;  4NTL A;  2DQV A;  3FVG A;  1IQ7 A;  1B05 A;  3O6H A;  3T96 B;  1UQW A;  3CG3 A;  1NNK A;  4OVJ A;  3G7W A;  5F7V A;  1IXC A;  3EHS A;  3U92 A;  1ZTY A;  1CE2 A;  4GWO A;  2AL5 A;  2I58 A;  2XXQ A;  2DOJ A;  2ZNS A;  1MY2 A;  3VE1 B;  3CFX A;  2DVZ A;  4FIM A;  4EQB A;  1IZ1 A;  4YU0 A;  3CG1 A;  4YKK A;  3S4U A;  3V89 B;  4H5F A;  5TPA B;  4ELP A;  1BTJ A;  3MP6 A;  2F7B A;  1NH8 A;  3FGS A;  2QMW A;  4XKR A;  5B70 A;  3FV1 A;  4JB7 A;  1S50 A;  4R2B A;  3C34 A;  1ZIU A;  4OMB A;  2DWI A;  3B7D A;  2OLB A;  3VLV A;  4FED A;  5AA1 A;  3LR1 A;  4FEC A;  4ZEK A;  3VVD A;  4KQP A;  3TTL A;  2DS9 A;  4QHQ A;  2O51 A;  3CVG A;  1N7X A;  3TTR A;  3PPP A;  4ZED A;  1MY1 A;  1NNP A;  2D3I A;  3A3C A;  2AIX A;  4YMA A;  4ZEI A;  2KLF A;  1MS7 A;  3T93 B;  1FQB A;  1ZKB A;  1Q35 A;  1P1O A;  2I48 A;  2F97 A;  1JVX A;  4GD5 A;  2O1M A;  4Q5T A;  1ATG A;  1DOT A;  3MJN A;  3OEM A;  2Q9T A;  2Z22 A;  3N6U A;  3B6W A;  4GLI A;  1YPN A;  1B58 A;  3VVF A;  1Y9U A;  1UTB B;  1VFE A;  3EHT A;  3JV9 A;  4ZS9 A;  1WDN A;  4KFQ A;  5TPA A;  2QS1 A;  3OXN A;  3QXM A;  1SDX A;  3C31 A;  4G2Z A;  3H4Z A;  2RC9 A;  4NF4 B;  3P7I A;  3W9V A;  4GF8 A;  1Z7M E;  2HZK A;  4DIG A;  4OWD A;  3T9V A;  4PP0 A;  1B3G A;  3CI8 A;  1SYH A;  4O3B A;  2R6G E;  3LC8 A;  2HQ0 A;  3PUX E;  1FQF A;  3V83 A;  1P1N A;  1EZP A;  3IJO B;  3D4G A;  3OEK A;  4ZEF A;  3EHU A;  3ZSF A;  2RCA A;  1VE4 A;  1MY4 A;  5CM6 A;  4MBP A;  5ICQ A;  3S9N C;  4XKN A;  4JXI A;  1LBC A;  2Q88 A;  4FJP A;  2V25 A;  1LAX A;  3FXQ A;  4LZ5 A;  2F7C A;  2I6E A;  3FIR A;  4JWX A;  5CMB A;  4GXA A;  4Q0C A;  3LSL A;  1Y20 A;  2O1L A;  3LUY A;  1ZU0 A;  3ODB A;  3K6V A;  4KD5 A;  1UIV A;  4I9D A;  3KGC A;  3RPW A;  4F1U A;  4IY5 A;  3OMB A;  1SW5 A;  3D4C A;  1UTB A;  2O7U A;  3PMX A;  3MVW A;  5FHM A;  2RCB A;  4F18 A;  4RK2 A;  5IKB A;  4OEU A;  4F1V A;  5ICT A;  4PQJ A;  3VLW A;  4NF4 A;  3KOS A;  3UK4 A;  4AB5 A;  1NNT A;  4OZ9 A;  2DP8 A;  3I3V A;  4ZZA A;  3G3F A;  3EN3 A;  2XXT A;  2FA7 A;  1POY 1;  3N94 A;  4ELQ A;  3K6X A;  3KN7 A;  1FTK A;  3G3J A;  3MUQ A;  4QSC A;  1MM6 A;  4QFO A;  3FVO A;  1SBP A;  3C32 A;  4O3C A;  3FJ7 A;  4GOT A;  2VOZ A;  3GLB A;  2I3V A;  5ELV A;  2QRY A;  1D4N A;  4H0W A;  3LSW A;  3TEP A;  4R73 A;  3R26 A;  4F22 A;  3SDF A;  2DYX A;  3QUJ A;  4G4P A;  3MVZ A;  1FQD A;  2XHD A;  2LAO A;  2NXO A;  2YLN A;  1A54 A;  1GR2 A;  2Q8J A;  3GXA A;  3T9U A;  1FCK A;  5DEX A;  1NKX A;  2DWJ A;  2XX7 A;  5CMM A;  4X9T A;  3RTF B;  3IK6 B;  3MC2 A;  1R9Q A;  1DTG A;  4YB6 A;  3O28 A;  3UP9 A;  4I1D A;  1H45 A;  4GVO A;  1USY E;  1PBQ A;  3KFM A;  3AXF A;  5FHO A;  4MF3 A;  4U1Z A;  4QSD A;  4BDL A;  1F9B A;  4NED A;  2Y84 A;  4RK9 A;  2E1S A;  3T9X B;  4GL8 A;  4H1X A;  4U4X A;  4OFJ A;  4RA1 A;  1GV8 A;  3FJG A;  4R6Y A;  2B3B A;  4R6H A;  1B46 A;  1A7L A;  5H8N B;  3PD8 A;  3FZV A;  2Z8F A;  2XXY A;  4N6P A;  1WOD A;  1B0L A;  3Q27 A;  5CI5 A;  1J1N A;  4DDD A;  1A40 A;  2QS4 A;  3ZS6 A;  1CB6 A;  1GGG A;  3U72 A;  3TOD A;  4UA8 A;  3RLF E;  3UOR A;  3O9P A;  2O69 A;  4GQO A;  5L9S A;  3KN8 A;  3CFZ A;  4RNS A;  1MG1 A;  3FXR A;  4NWD A;  3S9L C;  1OIB A;  4U2R A;  3T9H B;  4IGR A;  2RIN A;  3FUZ A;  3EQ1 A;  1B51 A;  1B3L A;  4RXL A;  4C1U A;  1JET A;  5A5X B;  3PPO A;  2F6P A;  4R9F A;  4FAJ A;  5AA2 D;  4AQ4 A;  4K3F A;  3KN3 A;  4F3B A;  3PPQ A;  1VSO A;  4EUO A;  3MP1 A;  3S2V A;  3CSB A;  4LQ2 A;  4OXV A;  2H9B A;  4MLV A;  2ZYO A;  1N76 A;  3SEW A;  4QSE A;  4FEB A;  4XTC Q;  1Y4C A;  3F11 A;  3ECR A;  1TFD A;  4U4S A;  1QVS A;  3PV0 E;  2GHB A;  3U94 A;  1MRP A;  5B7D A;  3IOR A;  1MM7 A;  4BDR A;  4KYS A;  2VP1 A;  1B9J A;  4F3S A;  2H5Y A;  2R9J A;  2X26 A;  3PGF A;  3K1P A;  1MQG A;  2ZXT A;  1QUK A;  1MQI A;  1LFI A;  5A5X A;  4YB5 A;  2DSF A;  1LBB A;  4TLL B;  4R9G A;  4F3G A;  5HPQ A;  1MXX A;  4G68 B;  3FVN A;  4YKP A;  1QUJ A;  4HTG A;  1SW1 A;  1AOV A;  3DEL B;  4I8C A;  1LGB C;  4R72 A;  2G93 A;  1MY3 A;  5BUU A;  4KHZ E;  1O64 A;  4NF5 A;  3EF7 A;  5TP9 A;  4ZEC A;  1LFH A;  2RC8 A;  1WVJ A;  1QUL A;  4GIZ A;  2Y7W A;  3TTM A;  4JBZ A;  3ILT B;  4JSO A;  2NWJ A;  2YJP A;  2F35 A;  4RY1 A;  1JNF A;  3C4M A;  5BWJ A;  4QF9 A;  2Q2A A;  4E0W A;  2P1S A;  5CBR A;  3TMG A;  2V3Q A;  1OQG A;  1LCT A;  2OWS A;  1B5H A;  2RKM A;  2R71 A;  3VVE A;  5K2Y A;  3PUV E;  5JK4 A;  1B3F A;  3Q29 A;  4NE4 A;  2F78 A;  5KCJ B;  2WKY A;  5FTI A;  1URS A;  1POT A;  2XXW A;  4XKP A;  4IY6 A;  4F29 A;  4KI0 E;  2REG A;  3DP8 A;  3Q25 A;  2XXX A;  4OET A;  2ANJ A;  4G68 A;  4NF6 A;  2V93 A;  2ONR A;  2FYI A;  4GL0 A;  1H76 A;  1JQF A;  3UGW A;  4DCX A;  1RYO A;  1ANF A;  3QSL A;  1US4 A;  3FAT A;  2GH9 A;  4H8J A;  1MY0 A;  2HXW A;  3SKP A;  4OEN A;  2H4I A;  2B3F A;  1MDP 1;  1PC3 A;  2P2A A;  3TYH A;  4R2F A;  1FQE A;  4LA9 A;  2XXR A;  1B52 A;  1MXW A;  2F5X A;  1B4Z A;  2Y7I A;  3H7M A;  4AB6 A;  4OEV A;  4OER A;  4EXK A;  4ND9 A;  4RPO A;  2QL3 A;  3MPL A;  4F3P A;  4RJZ A;  4JWO A;  5KCJ A;  3FJM A;  2F7A A;  1DSN A;  1SW2 A;  5CBS A;  4YB7 A;  1UTH B;  3PUW E;  2HAU A;  2VD3 A;  3SEV A;  1OVT A;  3JYR A;  4H67 A;  4LQ5 A;  3K1N A;  2XXU A;  1QKA A;  1PEB A;  1OLA A;  5CMK A;  2Z8D A;  4PFU A;  4WKM A;  1EZ9 A;  3IL1 B;  1D9V A;  4OHN A;  3GBB A;  1YTV A;  4GFR A;  4LON B;  3USD A;  4TQU Q;  4FE8 A;  4OFL A;  1OMP A;  5JTY A;  1B5J A;  2HZL A;  3QIM A;  3FXU A;  3LSX A;  3N26 A;  4ZE9 A;  3TCH A;  3W15 C;  2QS2 A;  3O6I A;  5L9M A;  1PB8 A;  1JW5 A;  4IO2 A;  5EYF A;  1PB7 A;  4DXC A;  3HO7 A;  3MBP A;  3GBA A;  5L8D A;  4Z7E A;  2F6G A;  3QK6 A;  5DEX B;  4BDM A;  3DP6 A;  5I2K B;  3HST A;  3TAJ A;  3M3L A;  1DMB A;  2ABH A;  2OZZ A;  1IEJ A;  1MXZ A;  4DE8 A;  4QFL A;  4M4G A;  1I6B A;  3LBS A;  3TFL A;  1HSE A;  3M3F A;  2HEU A;  1UTH A;  3IOT A;  1MDQ A;  4THI A;  2RF1 A;  4P0G A;  1XVY A;  5ISU A;  2Y7K A;  3PPN A;  2Q2C A;  3OD7 A;  1SW4 A;  2QMX A;  4XXU A;  4TOZ A;  1P1W A;  3TQW A;  3K00 A;  5KZT A;  2M8C A;  4IB2 A;  3C35 A;  1O7T A;  1D9Y A;  2I49 A;  1FQC A;  1A8F A;  1B3H A;  4DZ1 A;  3TCG A;  4WEP A;  2XX8 A;  1DPP A;  3SEU A;  2A5T B;  3ZKL A;  1B7Z A;  1BP5 A;  3R6U A;  4H6D A;  3IJX B;  1FQA A;  4PE5 B;  2V3T A;  1LB8 A;  3RT8 A;  1Q1K A;  3M8U A;  4IGT A;  3OO7 A;  4QFN A;  1I69 A;  3RGY A;  4OTE A;  1URG A;  5I2K A;  3N6T A;  2CMO A;  3PD9 A;  1HSL A;  2UYE A;  1XT8 A;  3KG2 A;  4LAT A;  1ELJ A;  1JVY A;  3OOA A;  1OLC A;  3BFT A;  1IIT A;  1R9L A;  1LB9 A;  4PFY A;  1LFG A;  1JW1 A;  3VFJ A;  1VFD A;  5H8F B;  2ONS A;  3E9X A;  2ONK E;  3K0V A;  4YKJ A;  4BDO A;  2ALU A;  3A3U A;  3RQT A;  2AL4 A;  2D5W A;  3TZA A;  2UVH A;  1MPD A;  4OES A;  2UXA A;  3GZG A;  2Z23 A;  1MH3 A;  2A5T A;  3K6U A;  3B6Q A;  2OJT A;  5DVF A;  3HHF A;  1B1H A;  1IXI A;  1R1N A;  3FVK A;  4ZE8 A;  4DCY A;  1M5C A;  3W9W A;  2O7I A;  2DXY A;  3JZJ A;  1B6H A;  2UVG A;  1XC1 A;  4DXB A;  3EPE A;  1AIV A;  1IUD A;  1LST A;  4H8I A;  1SI1 A;  4MFI A;  2F8D A;  1D3K A;  4EXL A;  2AYS A;  1YCJ A;  1P1Q A;  3IR1 A;  1AL3 A;  3H06 B;  2ZNT A;  2GFE A;  3QYT A;  1YAE A;  5FHN A;  3B6T A;  1NMU A;  4PET A;  3RY3 A;  1DTZ A;  4DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...