1GGGA

Glutamine binding protein open ligand-free structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
220
structure length
220
Chain Sequence
LVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glutamine-binding protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Binding protein
molecule keywords GLUTAMINE BINDING PROTEIN
total genus 62
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gggA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gggA01
1PB7A 1MXZA 3R26A 5I58A 5L9OA 1WVJA 1B3LA 1NL5A 1N84A 1BP5A 2LAOA 2M8CA 1IXHA 1GTKA 3DP8A 1MXVA 3FXQA 2RF1A 3V89B 2I0CA 3QUJA 4OENA 2XXWA 1FTMA 1B3FA 1FQEA 3TTNA 3PD9A 2OJTA 4U4XA 1JQFA 2PT1A 4KYSA 4YKPA 4FATA 4G8MA 4YAHX 4QFOA 4OFOA 3MZ1A 3MZBA 3D4GA 2AIXA 3FZVA 1FW0A 1GV8A 4ECFA 4Q5TA 3QIMA 1FQFA 2F5XA 1T0KA 1IQ7A 3IORA 1AL3A 1DTZA 1BIYA 2UYFA 4G68B 4U1ZA 3TAJA 4EF1A 5I57A 5L9SA 3G3KA 3G3IA 1N04A 4NWCA 2QRYA 2XHDA 4C0RA 3W9WA 1M5EA 2DE2A 2F6GA 2ANJA 1JETA 2QSXA 3CFLA 3O66A 1MPBA 1LBCA 3M8UA 3KOSA 1LSTA 2XXIA 1B0HA 4NE4A 2RC8A 3WAEA 3I5OA 3K6WA 2F36A 2YJPA 1EZPA 4OZ9A 1H43A 1MY1A 1XVYA 3Q29A 4NF5A 3TUSA 3OO8A 1RYXA 1VFDA 2ABHA 3PUWE 3HO7A 1SYIA 2Q2CA 3FUZA 3LSLA 3K6XA 3MAMA 1AH5A 3C36A 1UTBB 1I69A 2O51A 4I62A 3SERA 3HHGA 1Q35A 1B5IA 1NNFA 2QMWA 3O97A 2Y84A 1FQBA 3OEKA 4DCXA 5CMCA 1SW2A 2A5TA 1GVCA 2Q89A 4EUOA 3PMVA 2F7BA 3OENA 4NEDA 4MF3A 3F11A 3K6VA 4C1UA 1PC3A 1DMBA 1N7WA 2F35A 2I3VA 2OCUA 2QL3A 2UYEA 3M3LA 2NOOA 4IGRA 4RYAA 1BLFA 3USDA 3VVEA 4ESXA 1PBQA 1MXWA 5FHOA 1QUIA 4H5GA 3QSLA 3SEXA 1H45A 2B3FA 1QVSA 1USYH 2THIA 3FATA 3IAZA 3SEWA 3TEPA 1FTLA 3MP6A 3C33A 4YMBA 5DVIA 1YTVA 5ISUA 5AA3A 3OSRA 1Y3NA 3K1MA 3VVFA 4U23A 5I2KA 3E3KA 3VLVA 5HBCA 1FQDA 1N3XA 4F3BA 1LGBC 5TP9A 4IY5A 3ECRA 4YZZA 5JEIA 1H76A 3SKPA 3MWBA 3HPIA 3GZGA 3MBPA 1P1NA 3A3UA 3CG3A 3MW0A 4Q0CA 1TT1A 3MPLA 1EZ9A 2GH9A 4PETA 1Z7ME 1PEBA 4PE5B 2HCAA 4F1VA 4FIMA 4Z0IA 5EHMA 2QPQA 4H65A 2DE3A 4G77A 4R6HA 3A3CA 2H98A 4X48A 3RUMA 4K3FA 1Q1KA 1BTJA 2E0SA 5AA4B 3KGCA 3TELA 2F34A 1XHYA 4WXJA 4P11A 1B40A 2ALUA 3TMGA 3VDFA 2HAVA 3T9XB 3PD8A 1M5FA 5KZTA 1XOCA 4N13A 1B3HA 1NFTA 4F3PA 4JSDA 3TPAA 5H8HA 3IK6B 3OO7A 1B7UA 3DP4A 4ZDMA 4ONYA 3T22A 5KDTA 3K00A 3D4CA 4JXIA 1MDQA 1OLCA 3LSWA 2XXQA 2HQ0A 4F22A 1Y9UA 2DE4A 2H9BA 3FGSA 2VP1A 1URDA 2Z22A 3ZKKA 4YB5A 4YKJA 4FAJA 3TFLA 2DVCA 2O1MA 5KCJA 3N94A 3FV2A 1Y1ZA 3TQWA 4BDLA 3IX1A 1Y4CA 3SETA 3O9PA 5H8SA 3C35A 2RCBA 1YPNA 3G7WA 3IJXB 4MLQA 4YKIA 3VV5A 5CC2A 1A54A 4KR5A 1RKMA 3RY3A 4G8NA 2F78A 4H67A 2P0SA 4R72A 3E9XA 4F1YA 1URGA 1XVXA 1M5DA 5H8QB 3MVZA 4BDOA 3VXCA 3ZS6A 1MG1A 1JVYA 2Y7PA 5H8FB 3GBBA 1MXYA 3PV0E 3U8QA 1II5A 4G4PA 1USYE 1FQAA 4R75A 5AE4A 2GHAA 3H7MA 4YB7A 2DXRA 1ZLQA 1SQYA 3O2AA 4LP2B 4OVJA 3V5AA 3EQ1A 3FXRA 4ZZEA 5J1DA 4KQPA 1MQHA 2UXAA 1LB8A 3K4UA 3C4MA 4LONB 5DVJA 3THIA 5KDTB 3OXNA 5I58B 4ZEKA 4AB5A 3Q28A 1NNKA 5FTIA 2NVUB 1LCFA 4OETA 3PU5A 3UIFA 1SW5A 2I3WA 4F2QA 3CG1A 1A7LA 2ZYNA 3B6TA 4LZ7A 3BBRA 4U4SA 1MXXA 1IITA 2XXRA 3KFMA 3LR1A 3UK4A 4I1DA 3DP6A 4FE8A 5HM4B 1VE4A 3RPWA 1P1WA 2HZKA 4FEDA 1I6AA 1I6QA 1JW1A 2PX1A 3H4ZA 4RXLA 5AA2A 2DSFA 1IXCA 3MPKA 4O3CA 4ZEIA 1O64A 4ZS9A 4F1UA 1HSJA 1QKAA 1UIUA 2F97A 2FYIA 2NUVA 1IIWA 5TPAA 4AB6A 2ESNA 2R9JA 1QUKA 3G3GA 4JBZA 1IEJA 1KWHA 3KOTA 3ODBA 5A5XA 1XT8A 2F8DA 1VSOA 2AL4A 4IO6A 2H4IA 3IO6A 3QXMA 1JEUA 2CMOA 4FECA 3QK6A 1QW0A 5ITOA 3UN6A 2XXUA 1NMUA 4THIA 4DCYA 5LOMA 2XXPA 3PUVE 3OD7A 2ZYOA 4R6YA 1PBPA 3GLBA 3KG2A 3IL1B 4KHZE 1AIVA 5IKBA 1DOTA 2GHBA 1P1UA 3PPRA 2HAUA 3S9MC 4BDRA 1HSEA 4F3GA 3HN0A 2REJA 2I4CA 2V25A 1JW4A 1VR5A 2E1SA 5CMBA 1LFHA 3AXFA 4XXUA 5I59A 2XX7A 3PPQA 4GQOA 1B4HA 1LBBA 3MVYA 1DPEA 1FQCA 1SI1A 4XKNA 3FXUA 4OTEA 3OEMA 3Q25A 3MQ9A 3O29A 3FVOA 1N76A 1B32A 2PMSA 2Z8FA 4OESA 2XX9A 4Q30B 2DOJA 1YCJA 4LA9A 3UGWA 4DXCA 4PFWA 1UTBA 2Z23A 3I3VA 4JB7A 4YMAA 2HFBA 1MM7A 1US5A 2YLNA 4F31B 2OBGA 1B1XA 4ZE8A 5AA4A 5DTBA 4F3SA 4IY6A 4N6PA 4OWDA 4DXBA 4UACA 1FTOA 2B65A 4GFRA 3SEUA 5H8FA 4X1BA 1SBPA 3RTFB 3B6WA 4P0IA 4F39A 5TP9B 4OMBA 4ELOA 3HHFA 1H44A 1I6BA 4R9FA 5L9MA 2F7AA 1EU8A 1UIVA 3MVWA 4RPOA 1A55A 2ZXTA 4TQUQ 4X1DA 5FTHA 5KCJB 3IB1A 5JTYB 2NXOA 2GRVA 2RC9A 3OO9A 2RC7A 2UVIA 1O63A 1IUDA 1GR2A 1UTHA 1JEVA 4FEBA 4FJPA 4IO3A 4PQJA 4RA1A 1A99A 1B51A 4KCDA 3PMXA 1BKAA 1RYOA 2DYXA 4NF4B 1D4NA 4LQ5A 3FJGA 2DS9A 3CI8A 3I6VA 4R2FA 3UP9A 4JSOA 1D3KA 2V3TA 2H25A 2OK2A 4NF8B 3SESA 3LUYA 3CRBA 5CI5A 3CFXA 4OQOA 1N3WA 3UORA 2DVZA 2HXWA 2REGA 3O6HA 1LAHE 2DWJA 1SDXA 2PYYA 2ZNSA 3CVGA 4MLVA 3SDFA 3V8XB 3IR1A 4NF5B 4IGTA 1LAFE 4AQ4A 3TDJA 3K1NA 1R6ZA 2GFEA 4GL8A 2RCAA 1JNFA 4NF4A 3KN7A 3T96B 4OYVA 4DE8A 5H8QA 3E4RA 1HSLA 2DWIA 4G68C 4LATA 5ICQA 1JW5A 5JTYA 1ZU0A 1MQJA 2XXYA 3HV1A 3VVDA 2Q2AA 3A09A 1IXGA 4UA8A 3JV9A 1MY3A 3MJNA 5M2VA 3U72A 1SYHA 3W9VA 1FTJA 5ELVA 1IZ1A 4PFYA 4MFIA 3R7XA 2A5SA 3H6TA 3PUZE 4G68A 5I57B 4TOZA 5F7VA 2QJEA 3FVNA 5A5XB 1H3DA 3QUFA 4GRKA 1MY2A 2G93A 4KD5A 1B9JA 3H6UA 3M3KA 4KCCA 2I6EA 4O3BA 1DPPA 3N6UA 3K6UA 2O1LA 2UVHA 4OERA 4H5FA 4RJZA 3EF7A 3TTRA 4YICA 3VE1B 2A5TB 1CE2A 2DWHA 4LZ5A 5I84A 3RLFE 5CBSA 4R6KA 3TCHA 4LVQA 1B0LA 4XTCQ 1B1HA 1Y1MA 2ONKE 2X7QA 4WEPA 2W7YA 2IEEA 1NKXA 4JWYA 5FHNA 4EQBA 4I8CA 1MPDA 1MM6A 4MBPA 1TXFA 2AL5A 4NTLA 4R73A 1CB6A 1DTGA 1WODA 2O69A 3C9HA 4OEVA 4ZEFA 3TODA 4EDPA 2Q9TA 3CSGA 5DEXB 4ELQA 4F19A 2PBWA 4QFPA 3TQLA 3PPNA 2UVGA 3T9HB 4OEUA 1NH8A 1SW4A 3BFUA 1LLSA 2O7UA 1A8EA 3KSJA 1MXUA 3KN8A 1R9LA 1NNPA 5HPQA 2FA7A 1SD3A 3MP1A 2Q8JA 5CBRA 4POWA 4F2OA 3Q26A 4IB2A 2P2AA 3FIRA 3S2VA 3S9NC 4QHQA 5I2KB 2V3QA 2XX8A 2ZYKA 3BFTA 2PT2A 3IOWA 4NF6B 5FHMA 4F18A 1Y3PA 1MH4A 1VFEA 2VOZA 4MH5A 4R2BA 3TTKA 5H8NB 4H1XA 1S7YA 4BDNA 1B7HA 1ZJLA 4GIZA 1PB9A 2HEUA 4XIGQ 1ZMGA 4PFTA 4GWOA 2V93A 4LZ8A 5DYHA 1US4A 3CIJA 3K01A 4EQ7A 3IO4A 3OSQA 4HW8A 3FV1A 3IOUA 2Y7KA 3K0VA 3W15C 3N26A 4JWOA 2NWJA 3K02A 3LBSA 5H8HB 4DLDA 5AA2B 1Y4TA 2D21A 2Y7WA 3LC8A 4QFLA 3GXAA 3BKIB 2Z8DA 2RKMA 1LFIA 2O68A 3RGYA 1B46A 4Q8RA 1LAXA 1N7XA 1P99A 1PDAA 3JYRA 3KEIA 3V83A 1LCTA 4X9TA 2OWTA 2V84A 4KFQA 3U93A 2Y7IA 1D9VA 3U94A 4RK9A 2XXXA 3G3JA 3G3FA 1B2HA 2XXVA 4KPTA 2QS3A 3T93B 3H6WA 5IAIA 2FNCA 2OLBA 5BWJA 5I2NA 2R71A 4KI0E 3KJ7A 1SVXB 2I48A 3OMBA 3PUXE 1MY0A 2XD3A 1UTHB 3P7IA 4N07A 3TCFA 2RINA 2V3UA 3HSTA 4GF8A 2ZMBA 4JWXA 4YB6A 2DXYA 3PPOA 5B70A 1S50A 4M4GA 2ONSA 1MDP1 1ZBMA 1TWYA 3G3HA 4QFKA 4P0GA 3WAFA 1MRPA 3KN3A 1OQHA 1QJMA 1SW1A 2O7IA 3O28A 4GOTA 3VFJA 3JZJA 3MP8A 3TTMA 3QAXA 3IJOB 1LB9A 2QS4A 4PFUA 5H8NA 1OLAA 3FD3A 4XKRA 1ZKBA 3PGFA 5AA2D 3FVGA 1EZOA 1ZTYA 2HZLA 4YU0A 3C31A 3DELB 2DQVA 2I58A 1Y3QA 3FJMA 2H99A 4H8JA 1L5TA 3CFZA 4EQ9A 1ZIUA 4Z7EA 1XS5A 1B5HA 4GXAA 4ND9A 3N5LA 2F6PA 3EHTA 5CMKA 1URSA 3LSFB 4OFJA 4U21A 4BDMA 4DDDA 4ELPA 1B58A 1GGGA 4F29A 3C32A 5K2YA 2XXHA 3H06B 3K1PA 4G2ZA 2CZLA 3O6GA 4QF9A 1ATGA 2I4BA 3TCGA 3U1OA 1MS7A 3M3FA 1IXIA 4GL0A 2OZZA 1SI0A 2O6AA 1JVXA 4NMYA 3RN8A 3VLWA 4M1VA 3UA8A 4YKKA 1AMFA 3N6TA 4R74A 2ONRA 1MPCA 1OVBA 1POTA 3U92A 2PVUA 4WKMA 3LSXA 5ICTA 4KYEA 1B6HA 3ZSFA 1AOVA 1M5CA 3B6QA 4EF2A 4ZZAA 2X7PA 3ILTB 5DT6A 4PP0A 3SEVA 2DP8A 2XD2A 3H6VA 4EXKA 3S9EA 3KZGA 3DLNA 3E13X 5BUUA 4GVOA 4NWDA 3GBAA 2F7CA 4G8HA 3MVXA 3CR9A 4ISUA 1F9BA 4LQ2A 1QUJA 4QFNA 3VLUA 2XXTA 5L8DA 5EHSA 2AYSA 1UQWA 2VHAA 4HS7A 5I56B 4NF6A 3EPEA 1D9YA 2IA4A 2ZYMA 3OELA 3OOAA 4TLMB 5CRYA 3ZKLA 2YPNA 1ANFA 4BLAA 3KJTA 4U1OA 4RPNA 3S4UA 4DXUA 4XKQA 5I56A 1QKBA 4DZ1A 3ONMA 1EH3A 3S9LC 3IOVA 3DM0A 4H6DA 4ZEDA 2VGQA 3Q27A 4TLLB 4IO5A 1J1NA 5AA1A 1LFGA 3HCQA 4OHNA 1MY4A 1Y20A 1B5JA 3KSXA 3K2DA 1A8FA 5TPAB 5CMMA 3C34A 3MZ9A 2KLFA 1B05A 1NNTA 2I49A 1TFAA 2UVJA 1OIBA 2ZNUA 2BJJX 3R6UA 5B7DA 1B4ZA 3EHUA 3T66A 3PMWA 1ELJA 2QMXA 1XC1A 3RNNA 1B7ZA 3FVKA 3QYTA 4KYDA 4U2RA 4FORA 3L6HA 1R1NA 2QS1A 4HTGA 3PUYE 1B3EA 4QSDA 3RQTA 3RT8A 3TYHA 1P1QA 4NF8A 3KBRA 4OFLA 4H0WA 4I9DA 1O7TA 1MQDA 4JDFA 5ITPA 5CM6A 3ILUB 4QRZA 1N0TA 4E0WA 3H3GA 4IO4A 4XKPA 4H8IA 4C1TA 3SEYA 4RNSA 4R9GA 3TZAA 1R9QA 3PPPA 1POY1 3CSBA 3OO6A 3EHSA 5F1QA 1LAGE 4EXLA 3T9UA 2P1SA 3VXBA 2WKYA 2D3IA 4ELRA 2R6GE 2X26A 4HCWA 3FASA 5K2XA 2OWSA 5EYFA 4RY1A 1B52A 4U22A 1Z7NE 4QSCA 1PB8A 1OQGA 3RTWB 1FTKA 1MQIA 3O6IA 3TKDA 4ESWA 1M5BA 3EN3A 4ZEBA 3IB2A 3MC2A 4IO2A 4POXA 4DIGA 1B3GA 1NH7A 1S9TA 4GXSB 3RT6B 2VD2A 1DSNA 5TU0A 1YAEA 2O84X 2Z8EA 2Q88A 3TTLA 1OVTA 4HCYA 4GD5A 1QULA 4OXVA 2DWAA 5I2NB 2VD3A 4L17A 4WEDA 1FCKA 2G29A 5DEXA 4IO7A 5JK4A 1OMPA 1WDNA 3B7DA 4BDQA 3IB0A 2D5WA 1MQGA 2B3BA 3IOTA 1MH3A 3T9VA 4ZE9A 4GLIA 1A40A 1P1OA 4ZECA 3FJ7A 3L6GA 4QSEA 4RK2A 5DVFA 4O3AA 5I59B 4LUBA 4E0XA 2H5YA 2ZNTA 2I0BA 2Y7RA 3H03A 1TFDA 2QS2A 3MUQA
chains in the Genus database with same CATH superfamily
1FTAA 1IXHA 2RF1A 2I0CA 3QUJA 2OJTA 3BIHA 4U4XA 2PT1A 4YKPA 4OFOA 3MZBA 3FZVA 1GV8A 3IORA 1DTZA 4G68B 5I57A 3G3IA 2F6GA 1JETA 1LBCA 3WAEA 2F36A 2YJPA 4OZ9A 4NF5A 1RYXA 3HO7A 3FUZA 2O51A 1NNFA 2Y84A 1NUZA 4I3EA 4NQ8A 4MF3A 1FBEA 1PC3A 3VVEA 1BLFA 1MXWA 5FHOA 1QUIA 4XF5A 3TEPA 1QVSA 5IZ3A 3MP6A 4YMBA 5DVIA 5I2KA 3E3KA 2XXKA 5TP9A 5JEIA 1P1NA 3A3UA 4Q0CA 1EYKA 1TT1A 3MPLA 2HCAA 4HXVA 4F1VA 5EHMA 4H65A 4G77A 4PFIA 4X48A 1Q1KA 2E0SA 3TELA 1XHYA 1NUXA 3TMGA 2HAVA 3T9XB 4N13A 1B3HA 4JSDA 3OO7A 4ONYA 3T22A 2VP1A 1IMAA 1NV6A 2O1MA 3FV2A 3TQWA 4BDLA 5I5PA 4MLQA 1A54A 3CHGA 4G8NA 4H67A 2P0SA 4R72A 1XVXA 4BDOA 1MG1A 5H8FB 1MXYA 3PV0E 1II5A 5AE4A 2GHAA 2DXRA 1SQYA 3V5AA 4PAKA 3EQ1A 1FPKA 4KQPA 1MQHA 1LB8A 5I58B 4ZEKA 2NVUB 3B6TA 3UK4A 4I1DA 4FE8A 5HM4B 1VE4A 1I6QA 2PX1A 4MIJA 5AA2A 4O3CA 1HSJA 2F97A 1LBYA 2NUVA 4JBZA 4DI3D 1KWHA 3KOTA 3MYUA 2AL4A 4N15A 2H4IA 3IO6A 3QXMA 3UN6A 1QW0A 1KZ8A 5ESYA 4DCYA 2XXPA 3PUVE 3OD7A 2ZYOA 4R6YA 1PBPA 3PPRA 2HAUA 4MX6A 4F3GA 2E1SA 5CMBA 2P3VA 3PPQA 1LBBA 2ZZWA 4OTEA 3OEMA 2Z8FA 2XX9A 1YCJA 2HFBA 1US5A 4ZE8A 4I3YA 4F3SA 4N6PA 4UACA 3SEUA 4GFRA 1IMEA 4MAGA 1I6BA 5FTHA 2ZXTA 2NXOA 2GRVA 2RC7A 1GR2A 1JEVA 4RA1A 1A99A 1B51A 2DYXA 1RYOA 2FIXA 3RYDA 3I6VA 4R2FA 3UP9A 1D3KA 3CRBA 4OQOA 4O8MA 2REGA 3O6HA 1FPJA 3V8XB 3IR1A 2OX3A 2GFEA 4LATA 2HXRA 1ZU0A 5I7IA 1NV2A 1MY3A 2KQZA 3H6TA 3PUZE 4O3BA 3N6UA 3TTRA 5CBSA 4LVQA 4XTCQ 2X7QA 5FHNA 4JWYA 1MM6A 4MBPA 3TQLA 1WODA 1DTGA 4EDPA 4N6KA 4ELQA 2PBWA 4QFPA 1LBXA 2O7UA 4HE2A 3S9NC 2PFZA 4QHQA 5FHMA 3IOWA 3BFTA 4NF6B 1Y3PA 2FIEA 3TTKA 2HEUA 1US4A 4EQ7A 3FV1A 3IOUA 2Y7KA 3N26A 2NWJA 5AA2B 2D21A 4QFLA 2MKZA 3GXAA 3BKIB 2RKMA 4Q8RA 3RGYA 1B46A 1N7XA 4X9TA 2V84A 3U94A 1D9VA 4H46A 2XXVA 4KPTA 5BWJA 2R71A 4KI0E 3KJ7A 2I48A 3OMBA 3PUXE 4JWXA 2DXYA 2FVZA 4M4GA 1MDP1 1TWYA 5LTCA 3O28A 3JZJA 3MP8A 3QAXA 4P1LA 4N4UA 3IJOB 1LB9A 2HZLA 3DELB 2DQVA 3FJMA 2H99A 1XS5A 2F6PA 4U21A 5EQ7A 3C32A 4F29A 2XXHA 3K1PA 4QF9A 1ATGA 2I4BA 3M3FA 3RN8A 4YKKA 2ONRA 5ICTA 4KYEA 1B6HA 3ZSFA 1FBPA 1M5CA 4EXKA 4GVOA 4NWDA 2F7CA 4MNPA 2XXTA 5L8DA 3SZPA 3RPLB 2AYSA 4HS7A 5I56B 1D9YA 2IA4A 3OELA 4TLMB 4BLAA 2YPNA 4RPNA 4DXUA 4DZ1A 3ONMA 3S9LC 5IZ3B 1FRPA 4H6DA 3Q27A 4IO5A 3PTYA 1J1NA 1MY4A 3C34A 3MZ9A 2I49A 3PMWA 2QMXA 2PFYA 3L6HA 1R1NA 3RQTA 4NF8A 5ITPA 5CM6A 1N0TA 4XKPA 3SEYA 3TZAA 3PPPA 1POY1 2WKYA 2X26A 3RPLA 5K2XA 3RTWB 4QSCA 1NUWA 4O7MA 5ET7A 1M5BA 4ZEBA 1B3GA 5ET6A 1OVTA 2DWAA 5I2NB 4WEDA 5JK4A 4BDQA 2D5WA 1FPLA 1MQGA 3IOTA 1A40A 2BJIA 3T1BA 1PB7A 1MXZA 5I58A 2LAOA 3FXQA 2XXWA 2VPNA 4G8MA 4YAHX 4N91A 4QFOA 3MZ1A 2CEXA 1IMBA 1AL3A 2UYFA 3G3KA 1N04A 4C0RA 3W9WA 1M5EA 2XWVA 1MPBA 3KOSA 2XXIA 3K6WA 1XVYA 3Q29A 1VFDA 4U4SA 3PUWE 3LSLA 3MAMA 4I62A 3SERA 3O97A 1LBWA 4EUOA 2F7BA 3OENA 3F11A 1LEVA 3K6VA 4C1UA 2OCUA 1DMBA 1N7WA 2B3FA 3FATA 3C33A 5AA3A 4U23A 5HBCA 1LGBC 1CNQA 4YZZA 4PFRA 3GZGA 2H98A 4K3FA 5AA4B 3T0JA 1XOCA 1NFTA 4F3PA 4N17A 3TPAA 1B7UA 3K00A 2WBDA 4JXIA 1Y9UA 2DE4A 2H9BA 3FGSA 1URDA 2Z22A 4YB5A 1Y1ZA 3IX1A 3C35A 2RCBA 3IJXB 4YKIA 2OWZA 1FJ6A 4F1YA 3ROJA 3MVZA 3GBBA 4G4PA 3H7MA 3O2AA 4OVJA 5DVJA 3THIA 3Q28A 1NNKA 4GWYA 5FTIA 1LCFA 2I3WA 4F2QA 3CG1A 1A7LA 2ZYNA 4LZ7A 4GX3A 4FEDA 1I6AA 1JW1A 1IXCA 3MPKA 2ZZVA 2FYIA 4AB6A 1QUKA 1IEJA 1JEUA 5ITOA 2XXUA 1NMUA 1AIVA 3IL1B 5IKBA 3S9MC 4BDRA 3HN0A 4G61A 2REJA 2I4CA 2V25A 4OVPA 3MVYA 1DPEA 1SI1A 3Q25A 4LA9A 3UGWA 4YMAA 2YLNA 2FBPA 4F31B 5DTBA 4IR8A 1SBPA 3B6WA 1NV3A 4P0IA 4F39A 1FPFA 5L9MA 1UIVA 2RC9A 4P11A 5BUUA 4U22A 4FJPA 4PF8A 4KCDA 1BKAA 4OVRA 1D4NA 4NF0A 4LQ5A 3CI8A 3B8BA 4JSOA 2H25A 1YYZA 4PGNA 3SESA 1DBZA 1N3WA 2HXWA 1LAHE 3SDFA 4PBHA 4NF5B 4IGTA 2RCAA 1JNFA 3T96B 4DE8A 3E4RA 4X8RA 4G68C 1JW5A 3A09A 3W9VA 1NV0A 3KBZA 4TOZA 4MEVA 1B9JA 4KCCA 5ET5A 3USDA 4H5FA 2A5TB 1CE2A 4LZ5A 5I84A 3TCHA 1B0LA 4WEPA 4EQBA 1TXFA 3C9HA 3CSGA 1SW4A 3KSJA 1XI6A 2CZKA 3KN8A 1NNPA 4GX4A 4F2OA 4IB2A 2XX8A 2PT2A 4F18A 4KXPA 2VOZA 1PB9A 4XIGQ 4GWOA 3IO4A 4HW8A 3W15C 5H8HB 2Y7WA 5IGAA 3JYRA 3KEIA 3V83A 1LCTA 2OWTA 1RDXA 4KFQA 2HHMA 2Y7IA 3G3JA 3G3FA 1K9YA 2QS3A 5I2NA 1MY0A 3P7IA 4GWWA 2ZMBA 1S50A 3G3HA 1FBFA 4P0GA 3WAFA 1QJMA 2O7IA 5H8NA 4XKRA 3FD3A 1ZKBA 1ZTYA 1L5TA 1ZIUA 1B5HA 5CMKA 4BDMA 4ELPA 1B58A 4P8BA 4ZECA 4G2ZA 3O6GA 3TCGA 2OZZA 3FBPA 1IMFA 4M1VA 1POTA 1OVBA 2PVUA 4AS4A 4EF2A 4ZZAA 1JP4A 3ILTB 4PP0A 4GX6A 2DP8A 3H6VA 3S9EA 3E13X 2FHYA 3CR9A 4LQ2A 1QUJA 2WYPA 2VHAA 3E78A 5I56A 2ZYMA 2KR0A 4XKQA 1QKBA 1FBHA 2QVRA 4OHNA 3EHUA 3T66A 1ELJA 1FPEA 1XC1A 4PBQA 2QFLA 3FVKA 2QS1A 3RT8A 3PUYE 3KBRA 4OFLA 4JVCA 3ILUB 4PC9A 4RNSA 3CSBA 3T9UA 2P1SA 3VXBA 2R6GE 2VT5A 4HCWA 3FASA 5EYFA 1B52A 5IZZA 1OQGA 1MQIA 3EN3A 3IB2A 4POXA 4DIGA 4GXSB 2O84X 3TTLA 4HCYA 4OXVA 3GYYA 1OMPA 2DDKA 3IB0A 2B3BA 5I59B 2H5YA 4NHBA 2GQ1A 3R26A 1B3LA 1NL5A 1N84A 2VPOA 3DP8A 2WEFA 1JQFA 4KYSA 4P3LA 1FPIA 1BK4A 2AIXA 3D4GA 1FW0A 4Q5TA 2F5XA 1T0KA 1IQ7A 4U1ZA 3TAJA 5ISUA 4NWCA 2DE2A 3OOAA 2QSXA 3O66A 1NV4A 1LSTA 1B0HA 2RC8A 1EZPA 1H43A 4JVIA 1MY1A 2WYKA 2ABHA 1SYIA 2Q2CA 4F22A 3K6XA 3C36A 1UTBB 3HHGA 1B5IA 2QMWA 3OEKA 1SW2A 2Q89A 4NEDA 4IGRA 2I3VA 2QL3A 3M3LA 2UYEA 4RYAA 4ESXA 2QVUA 4H5GA 3SEWA 1USYH 1YTVA 1Y3NA 3K1MA 4F3BA 1H76A 4PETA 1Z7ME 1PEBA 4FIMA 4Z0IA 4R6HA 3A3CA 3ISPA 3KGCA 2F34A 1B40A 3VDFA 1G0IA 3DP4A 5KDTA 1OLCA 3LSWA 2XXQA 2HQ0A 4GWUA 4PF6A 3TFLA 4FAJA 3N94A 5J16A 3SETA 5H8SA 1YPNA 3VV5A 5CC2A 4KR5A 1RKMA 3RY3A 3E9XA 1URGA 1M5DA 3ZS6A 3U8QA 1USYE 1FQAA 4R75A 1IMDA 4YB7A 1INPA 4LP2B 3FXRA 2UXAA 3K4UA 4OETA 3PU5A 3UIFA 1SW5A 2XXRA 3KFMA 3DP6A 1P1WA 2HZKA 3H4ZA 1O64A 1UIUA 3U65A 1IIWA 5TPAA 1FPGA 3ODBA 4GBVA 5A5XA 1XT8A 1VSOA 4O7IA 4FECA 2CMOA 4PDDA 3IFAA 4THIA 3FXBA 3GLBA 3KG2A 4N8YA 3MSTA 1DOTA 2GHBA 4NG7A 1JW4A 3AXFA 1YXIA 5I59A 4PAFA 3FXUA 3O29A 3FVOA 1N76A 1B32A 1NV7A 2PMSA 4OESA 2DOJA 4DXCA 1UTBA 2Z23A 4JB7A 1MM7A 1B1XA 5AA4A 5DW8A 4OWDA 1FTOA 2B65A 5H8FA 4OMBA 2B4MA 4ELOA 3HHFA 4R9FA 4P56A 1EU8A 4RPOA 3MVWA 1A55A 4X1DA 4PE3A 4IO3A 1DCUA 4NF4B 3FJGA 2DS9A 1EYIA 2OK2A 4OVTA 3LUYA 3CFXA 4NX1A 4PCDA 1Q9DA 2DVZA 3LV0A 2PYYA 2ZNSA 3CVGA 4MLVA 3D1RA 1VDWA 4AQ4A 3TDJA 3K1NA 1R6ZA 4NF4A 5H8QA 2JJKA 1LBZA 1MQJA 2XXYA 3HV1A 3VVDA 5ET8A 1IXGA 3JV9A 4GWSA 5M2VA 1SYHA 3NOHA 5ELVA 4PFYA 3R7XA 2A5SA 2F3DA 5F7VA 2QJEA 3FVNA 4X04A 1H3DA 1DK4A 2HPGA 4GRKA 5EQ8A 1MY2A 2G93A 4KD5A 3H6UA 3M3KA 2CEYA 2I6EA 1FBCA 2UVHA 3EF7A 3VE1B 4YICA 2DWHA 4R6KA 1B1HA 4OANA 1MPDA 4R73A 4NTLA 3TODA 1CB6A 2O69A 2Q9TA 5DEXB 3PPNA 1NH8A 3BFUA 1LLSA 1A8EA 5HPQA 3MP1A 2Q8JA 4POWA 3Q26A 4PGPA 3FIRA 2V3QA 2ZYKA 1KA0A 4MH5A 1MH4A 5H8NB 4R2BA 4H1XA 1S7YA 1B7HA 1ZJLA 4GIZA 4PFTA 3LUZA 3OSQA 3LBSA 4DLDA 1LFIA 2O68A 1LAXA 1P99A 1PDAA 2XXXA 1B2HA 3H6WA 5IAIA 2OLBA 1SVXB 4PFBA 2XD3A 2L5VA 3HSTA 3PPOA 1NI9A 5B70A 2ONSA 2R8TA 4QFKA 1MRPA 3KN3A 1OQHA 3B50A 2QS4A 4PFUA 1OLAA 3PGFA 3C31A 3CFZA 4Z7EA 4ND9A 3N5LA 1RDYA 3EHTA 1URSA 4OFJA 1IMCA 1GGGA 5K2YA 3U1OA 1MS7A 1IXIA 4GL0A 5A5LA 4NMYA 4LN5A 1LBVA 3UA8A 4N6DA 1AMFA 4FBPA 3U92A 4WKMA 3B6QA 2X7PA 1G0HA 1SPIA 4NAPA 3SEVA 3GBAA 4G8HA 3MVXA 2WX9A 3VLUA 5EQAA 5EHSA 1UQWA 4NF6A 3EPEA 5EYGA 3ZKLA 3BIGA 1ANFA 3S4UA 1EH3A 3IOVA 3DM0A 4ZEDA 2VGQA 4TLLB 5AA1A 5EQ9A 1LFGA 3HCQA 1Y20A 5IM2A 1B5JA 3KSXA 3K2DA 1A8FA 5CMMA 1B05A 2UVJA 2BJJX 1B4ZA 1AWBA 1B7ZA 4KYDA 4U2RA 4FORA 4HTGA 3TYHA 4H0WA 1O7TA 1MQDA 4QRZA 4E0WA 4R9GA 5F1QA 3OO6A 3EHSA 4ELRA 4O94A 2OWSA 1Z7NE 1PB8A 3TKDA 4JVDA 1NH7A 1S9TA 5TU0A 1YAEA 2XWIA 2Q88A 2Z8EA 2VD3A 4L17A 2G29A 5DEXA 2Y5LA 4PTKA 3T9VA 1MH3A 4H45A 4ZE9A 3L6GA 4MMPA 4QSEA 4LUBA 4E0XA 2Y7RA 3H03A 1TFDA 2QS2A 4DCXA 5L9OA 1WVJA 1BP5A 2M8CA 1GTKA 3V89B 1MXVA 4OENA 1FTMA 1B3FA 1FQEA 3TTNA 3PD9A 4FATA 4ECFA 3QIMA 1FQFA 2CZHA 1BIYA 4EF1A 5L9SA 2QRYA 2XHDA 2ANJA 3CFLA 3M8UA 4NE4A 4OVSA 3I5OA 3TUSA 3OO8A 1AH5A 1I69A 1Q35A 1FQBA 5CMCA 2A5TA 1GVCA 3PMVA 2Q74A 2F35A 2NOOA 1PBQA 1AOVA 3QSLA 3SEXA 1H45A 3IAZA 2THIA 1FTLA 4GWZA 3OSRA 3VVFA 3VLVA 1FQDA 1N3XA 4IY5A 3ECRA 3SKPA 3MWBA 3HPIA 3MBPA 3CG3A 3MW0A 3E79A 1EZ9A 2GH9A 4PE5B 2QPQA 2DE3A 4XFEA 3RUMA 1BTJA 4WXJA 2ALUA 3PD8A 1M5FA 5KZTA 5H8HA 3IK6B 4ZDMA 3KC1A 3D4CA 1MDQA 3A29A 3ZKKA 4YKJA 2DVCA 5KCJA 1RDZA 1Y4CA 3O9PA 3G7WA 2F78A 5H8QB 2Y5KA 3VXCA 1JVYA 2Y7PA 1ZLQA 5J1DA 4ZZEA 4LONB 5I3SA 3C4MA 5KDTB 3OXNA 4AB5A 3BBRA 2P3NA 1MXXA 1IITA 3LR1A 4XEQA 3RPWA 4I40A 4RXLA 2DSFA 4ZEIA 4ZS9A 3IFCA 4F1UA 1QKAA 2ESNA 2R9JA 3G3GA 1NUYA 2F8DA 4IO6A 3EKIA 2CZIA 4PDHA 3QK6A 5LOMA 1YZ0A 2F3BA 4KHZE 4QXDA 1P1UA 2B4LA 1HSEA 1NV5A 1VR5A 4UABA 1LFHA 4XXUA 2XX7A 4GQOA 1B4HA 1FQCA 4XKNA 4P47A 3MQ9A 4Q30B 4PFWA 3I3VA 2OBGA 4MCOA 4IY6A 4DXBA 2WBBA 4X1BA 3RTFB 5TP9B 1H44A 2F7AA 4TQUQ 5KCJB 3IB1A 5JTYB 3OO9A 2UVIA 1O63A 1IUDA 1UTHA 4PQJA 4FEBA 3PMXA 4NGUA 1K9ZA 2V3TA 4NF8B 1FJ9A 5CI5A 3UORA 4GWXA 4N8GA 2DWJA 1SDXA 3QMFA 1LAFE 4GL8A 3KN7A 4OYVA 1HSLA 2DWIA 2XWKA 5ICQA 5JTYA 2Q2AA 4UA8A 3MJNA 3U72A 1FTJA 1IZ1A 4MFIA 4G68A 5I57B 4QBAA 5A5XB 3QUFA 4HE1A 1FBDA 4MHFA 4RJZA 1DPPA 4NN3A 3K6UA 2O1LA 4OERA 4MNIA 3RLFE 2QVVA 2ONKE 1Y1MA 2W7YA 2IEEA 1NKXA 5T3JA 4I8CA 4RY1A 2AL5A 4ZEFA 4OEVA 4F19A 4DI4B 1FPBA 1D9QA 2UVGA 3T9HB 4OEUA 1NV1A 2Q8MA 1MXUA 4P1EA 1R9LA 2FA7A 1SD3A 5CBRA 2P2AA 3S2VA 5I2KB 1VFEA 4BDNA 1ZMGA 4LZ8A 2V93A 5DYHA 3CIJA 3K01A 3K0VA 4JWOA 3K02A 1Y4TA 3LC8A 2Z8DA 5F24A 3U93A 4RK9A 3T93B 5LDZA 2FNCA 2ZZXA 3TCFA 4N07A 1UTHB 2RINA 2V3UA 4GF8A 4YB6A 2XWOA 2PCRA 1ZBMA 4MNCA 1SW1A 4GOTA 3VFJA 3TTMA 1EZOA 5AA2D 3FVGA 5EYHA 4YU0A 4H8JA 2I58A 1Y3QA 4EQ9A 4GXAA 1KA1A 3LSFB 4DDDA 2XA5A 3H06B 2CZLA 1SI0A 2O6AA 1JVXA 3KC0A 3VLWA 3N6TA 4R74A 1MPCA 3LSXA 4MJOA 5DT6A 4GBWA 2XD2A 4HE0A 1FPDA 3DLNA 3KZGA 4ISUA 1F9BA 4QFNA 4N81A 5CRYA 3KJTA 4U1OA 5IZ1A 1EYJA 1QGXA 3HFUA 1FBGA 5TPAB 2KLFA 1NNTA 1TFAA 2ZNUA 1OIBA 3R6UA 5B7DA 4PAIA 3RNNA 3QYTA 4P9KA 4QSDA 1B3EA 1P1QA 4I9DA 4JDFA 3H3GA 4IO4A 4H8IA 4C1TA 1R9QA 4EXLA 1LAGE 2D3IA 4OA4A 5FBPA 1FTKA 3O6IA 4ESWA 3MC2A 4IO2A 3RT6B 2VD2A 1DSNA 4GD5A 1QULA 1FSAA 1FCKA 4IO7A 3B7DA 1WDNA 4GLIA 2V4CA 1P1OA 3FJ7A 5DVFA 4RK2A 4O3AA 2ZNTA 2I0BA 4OVQA 4AS5A 3MUQA
chains in the Genus database with same CATH topology
1PB7A 1MXZA 3R26A 5I58A 5L9OA 1WVJA 1B3LA 1NL5A 1N84A 1BP5A 2LAOA 2M8CA 1IXHA 1GTKA 3DP8A 1MXVA 3FXQA 2RF1A 3V89B 2I0CA 3QUJA 4OENA 2XXWA 1FTMA 1B3FA 1FQEA 3TTNA 3PD9A 2OJTA 4U4XA 1JQFA 2PT1A 4KYSA 4YKPA 4FATA 4G8MA 4YAHX 4QFOA 4OFOA 3MZ1A 3MZBA 3D4GA 2AIXA 3FZVA 1FW0A 1GV8A 4ECFA 4Q5TA 3QIMA 1FQFA 2F5XA 1T0KA 1IQ7A 3IORA 1AL3A 1DTZA 1BIYA 2UYFA 4G68B 4U1ZA 3TAJA 4EF1A 5I57A 5L9SA 3G3KA 3G3IA 1N04A 4NWCA 2QRYA 2XHDA 4C0RA 3W9WA 1M5EA 2DE2A 2F6GA 2ANJA 1JETA 2QSXA 3CFLA 3O66A 1MPBA 1LBCA 3M8UA 3KOSA 1LSTA 2XXIA 1B0HA 4NE4A 2RC8A 3WAEA 3I5OA 3K6WA 2F36A 2YJPA 1EZPA 4OZ9A 1H43A 1MY1A 1XVYA 3Q29A 4NF5A 3TUSA 3OO8A 1RYXA 1VFDA 2ABHA 3PUWE 3HO7A 1SYIA 2Q2CA 3FUZA 3LSLA 3K6XA 3MAMA 1AH5A 3C36A 1UTBB 1I69A 2O51A 4I62A 3SERA 3HHGA 1Q35A 1B5IA 1NNFA 2QMWA 3O97A 2Y84A 1FQBA 3OEKA 4DCXA 5CMCA 1SW2A 2A5TA 1GVCA 2Q89A 4EUOA 3PMVA 2F7BA 3OENA 4NEDA 4MF3A 3F11A 3K6VA 4C1UA 1PC3A 1DMBA 1N7WA 2F35A 2I3VA 2OCUA 2QL3A 2UYEA 3M3LA 2NOOA 4IGRA 4RYAA 1BLFA 3USDA 3VVEA 4ESXA 1PBQA 1MXWA 5FHOA 1QUIA 4H5GA 3QSLA 3SEXA 1H45A 2B3FA 1QVSA 1USYH 2THIA 3FATA 3IAZA 3SEWA 3TEPA 1FTLA 3MP6A 3C33A 4YMBA 5DVIA 1YTVA 5ISUA 5AA3A 3OSRA 1Y3NA 3K1MA 3VVFA 4U23A 5I2KA 3E3KA 3VLVA 5HBCA 1FQDA 1N3XA 4F3BA 1LGBC 5TP9A 4IY5A 3ECRA 4YZZA 5JEIA 1H76A 3SKPA 3MWBA 3HPIA 3GZGA 3MBPA 1P1NA 3A3UA 3CG3A 3MW0A 4Q0CA 1TT1A 3MPLA 1EZ9A 2GH9A 4PETA 1Z7ME 1PEBA 4PE5B 2HCAA 4F1VA 4FIMA 4Z0IA 5EHMA 2QPQA 4H65A 2DE3A 4G77A 4R6HA 3A3CA 2H98A 4X48A 3RUMA 4K3FA 1Q1KA 1BTJA 2E0SA 5AA4B 3KGCA 3TELA 2F34A 1XHYA 4WXJA 4P11A 1B40A 2ALUA 3TMGA 3VDFA 2HAVA 3T9XB 3PD8A 1M5FA 5KZTA 1XOCA 4N13A 1B3HA 1NFTA 4F3PA 4JSDA 3TPAA 5H8HA 3IK6B 3OO7A 1B7UA 3DP4A 4ZDMA 4ONYA 3T22A 5KDTA 3K00A 3D4CA 4JXIA 1MDQA 1OLCA 3LSWA 2XXQA 2HQ0A 4F22A 1Y9UA 2DE4A 2H9BA 3FGSA 2VP1A 1URDA 2Z22A 3ZKKA 4YB5A 4YKJA 4FAJA 3TFLA 2DVCA 2O1MA 5KCJA 3N94A 3FV2A 1Y1ZA 3TQWA 4BDLA 3IX1A 1Y4CA 3SETA 3O9PA 5H8SA 3C35A 2RCBA 1YPNA 3G7WA 3IJXB 4MLQA 4YKIA 3VV5A 5CC2A 1A54A 4KR5A 1RKMA 3RY3A 4G8NA 2F78A 4H67A 2P0SA 4R72A 3E9XA 4F1YA 1URGA 1XVXA 1M5DA 5H8QB 3MVZA 4BDOA 3VXCA 3ZS6A 1MG1A 1JVYA 2Y7PA 5H8FB 3GBBA 1MXYA 3PV0E 3U8QA 1II5A 4G4PA 1USYE 1FQAA 4R75A 5AE4A 2GHAA 3H7MA 4YB7A 2DXRA 1ZLQA 1SQYA 3O2AA 4LP2B 4OVJA 3V5AA 3EQ1A 3FXRA 4ZZEA 5J1DA 4KQPA 1MQHA 2UXAA 1LB8A 3K4UA 3C4MA 4LONB 5DVJA 3THIA 5KDTB 3OXNA 5I58B 4ZEKA 4AB5A 3Q28A 1NNKA 5FTIA 2NVUB 1LCFA 4OETA 3PU5A 3UIFA 1SW5A 2I3WA 4F2QA 3CG1A 1A7LA 2ZYNA 3B6TA 4LZ7A 3BBRA 4U4SA 1MXXA 1IITA 2XXRA 3KFMA 3LR1A 3UK4A 4I1DA 3DP6A 4FE8A 5HM4B 1VE4A 3RPWA 1P1WA 2HZKA 4FEDA 1I6AA 1I6QA 1JW1A 2PX1A 3H4ZA 4RXLA 5AA2A 2DSFA 1IXCA 3MPKA 4O3CA 4ZEIA 1O64A 4ZS9A 4F1UA 1HSJA 1QKAA 1UIUA 2F97A 2FYIA 2NUVA 1IIWA 5TPAA 4AB6A 2ESNA 2R9JA 1QUKA 3G3GA 4JBZA 1IEJA 1KWHA 3KOTA 3ODBA 5A5XA 1XT8A 2F8DA 1VSOA 2AL4A 4IO6A 2H4IA 3IO6A 3QXMA 1JEUA 2CMOA 4FECA 3QK6A 1QW0A 5ITOA 3UN6A 2XXUA 1NMUA 4THIA 4DCYA 5LOMA 2XXPA 3PUVE 3OD7A 2ZYOA 4R6YA 1PBPA 3GLBA 3KG2A 3IL1B 4KHZE 1AIVA 5IKBA 1DOTA 2GHBA 1P1UA 3PPRA 2HAUA 3S9MC 4BDRA 1HSEA 4F3GA 3HN0A 2REJA 2I4CA 2V25A 1JW4A 1VR5A 2E1SA 5CMBA 1LFHA 3AXFA 4XXUA 5I59A 2XX7A 3PPQA 4GQOA 1B4HA 1LBBA 3MVYA 1DPEA 1FQCA 1SI1A 4XKNA 3FXUA 4OTEA 3OEMA 3Q25A 3MQ9A 3O29A 3FVOA 1N76A 1B32A 2PMSA 2Z8FA 4OESA 2XX9A 4Q30B 2DOJA 1YCJA 4LA9A 3UGWA 4DXCA 4PFWA 1UTBA 2Z23A 3I3VA 4JB7A 4YMAA 2HFBA 1MM7A 1US5A 2YLNA 4F31B 2OBGA 1B1XA 4ZE8A 5AA4A 5DTBA 4F3SA 4IY6A 4N6PA 4OWDA 4DXBA 4UACA 1FTOA 2B65A 4GFRA 3SEUA 5H8FA 4X1BA 1SBPA 3RTFB 3B6WA 4P0IA 4F39A 5TP9B 4OMBA 4ELOA 3HHFA 1H44A 1I6BA 4R9FA 5L9MA 2F7AA 1EU8A 1UIVA 3MVWA 4RPOA 1A55A 2ZXTA 4TQUQ 4X1DA 5FTHA 5KCJB 3IB1A 5JTYB 2NXOA 2GRVA 2RC9A 3OO9A 2RC7A 2UVIA 1O63A 1IUDA 1GR2A 1UTHA 1JEVA 4FEBA 4FJPA 4IO3A 4PQJA 4RA1A 1A99A 1B51A 4KCDA 3PMXA 1BKAA 1RYOA 2DYXA 4NF4B 1D4NA 4LQ5A 3FJGA 2DS9A 3CI8A 3I6VA 4R2FA 3UP9A 4JSOA 1D3KA 2V3TA 2H25A 2OK2A 4NF8B 3SESA 3LUYA 3CRBA 5CI5A 3CFXA 4OQOA 1N3WA 3UORA 2DVZA 2HXWA 2REGA 3O6HA 1LAHE 2DWJA 1SDXA 2PYYA 2ZNSA 3CVGA 4MLVA 3SDFA 3V8XB 3IR1A 4NF5B 4IGTA 1LAFE 4AQ4A 3TDJA 3K1NA 1R6ZA 2GFEA 4GL8A 2RCAA 1JNFA 4NF4A 3KN7A 3T96B 4OYVA 4DE8A 5H8QA 3E4RA 1HSLA 2DWIA 4G68C 4LATA 5ICQA 1JW5A 5JTYA 1ZU0A 1MQJA 2XXYA 3HV1A 3VVDA 2Q2AA 3A09A 1IXGA 4UA8A 3JV9A 1MY3A 3MJNA 5M2VA 3U72A 1SYHA 3W9VA 1FTJA 5ELVA 1IZ1A 4PFYA 4MFIA 3R7XA 2A5SA 3H6TA 3PUZE 4G68A 5I57B 4TOZA 5F7VA 2QJEA 3FVNA 5A5XB 1H3DA 3QUFA 4GRKA 1MY2A 2G93A 4KD5A 1B9JA 3H6UA 3M3KA 4KCCA 2I6EA 4O3BA 1DPPA 3N6UA 3K6UA 2O1LA 2UVHA 4OERA 4H5FA 4RJZA 3EF7A 3TTRA 4YICA 3VE1B 2A5TB 1CE2A 2DWHA 4LZ5A 5I84A 3RLFE 5CBSA 4R6KA 3TCHA 4LVQA 1B0LA 4XTCQ 1B1HA 1Y1MA 2ONKE 2X7QA 4WEPA 2W7YA 2IEEA 1NKXA 4JWYA 5FHNA 4EQBA 4I8CA 1MPDA 1MM6A 4MBPA 1TXFA 2AL5A 4NTLA 4R73A 1CB6A 1DTGA 1WODA 2O69A 3C9HA 4OEVA 4ZEFA 3TODA 4EDPA 2Q9TA 3CSGA 5DEXB 4ELQA 4F19A 2PBWA 4QFPA 3TQLA 3PPNA 2UVGA 3T9HB 4OEUA 1NH8A 1SW4A 3BFUA 1LLSA 2O7UA 1A8EA 3KSJA 1MXUA 3KN8A 1R9LA 1NNPA 5HPQA 2FA7A 1SD3A 3MP1A 2Q8JA 5CBRA 4POWA 4F2OA 3Q26A 4IB2A 2P2AA 3FIRA 3S2VA 3S9NC 4QHQA 5I2KB 2V3QA 2XX8A 2ZYKA 3BFTA 2PT2A 3IOWA 4NF6B 5FHMA 4F18A 1Y3PA 1MH4A 1VFEA 2VOZA 4MH5A 4R2BA 3TTKA 5H8NB 4H1XA 1S7YA 4BDNA 1B7HA 1ZJLA 4GIZA 1PB9A 2HEUA 4XIGQ 1ZMGA 4PFTA 4GWOA 2V93A 4LZ8A 5DYHA 1US4A 3CIJA 3K01A 4EQ7A 3IO4A 3OSQA 4HW8A 3FV1A 3IOUA 2Y7KA 3K0VA 3W15C 3N26A 4JWOA 2NWJA 3K02A 3LBSA 5H8HB 4DLDA 5AA2B 1Y4TA 2D21A 2Y7WA 3LC8A 4QFLA 3GXAA 3BKIB 2Z8DA 2RKMA 1LFIA 2O68A 3RGYA 1B46A 4Q8RA 1LAXA 1N7XA 1P99A 1PDAA 3JYRA 3KEIA 3V83A 1LCTA 4X9TA 2OWTA 2V84A 4KFQA 3U93A 2Y7IA 1D9VA 3U94A 4RK9A 2XXXA 3G3JA 3G3FA 1B2HA 2XXVA 4KPTA 2QS3A 3T93B 3H6WA 5IAIA 2FNCA 2OLBA 5BWJA 5I2NA 2R71A 4KI0E 3KJ7A 1SVXB 2I48A 3OMBA 3PUXE 1MY0A 2XD3A 1UTHB 3P7IA 4N07A 3TCFA 2RINA 2V3UA 3HSTA 4GF8A 2ZMBA 4JWXA 4YB6A 2DXYA 3PPOA 5B70A 1S50A 4M4GA 2ONSA 1MDP1 1ZBMA 1TWYA 3G3HA 4QFKA 4P0GA 3WAFA 1MRPA 3KN3A 1OQHA 1QJMA 1SW1A 2O7IA 3O28A 4GOTA 3VFJA 3JZJA 3MP8A 3TTMA 3QAXA 3IJOB 1LB9A 2QS4A 4PFUA 5H8NA 1OLAA 3FD3A 4XKRA 1ZKBA 3PGFA 5AA2D 3FVGA 1EZOA 1ZTYA 2HZLA 4YU0A 3C31A 3DELB 2DQVA 2I58A 1Y3QA 3FJMA 2H99A 4H8JA 1L5TA 3CFZA 4EQ9A 1ZIUA 4Z7EA 1XS5A 1B5HA 4GXAA 4ND9A 3N5LA 2F6PA 3EHTA 5CMKA 1URSA 3LSFB 4OFJA 4U21A 4BDMA 4DDDA 4ELPA 1B58A 1GGGA 4F29A 3C32A 5K2YA 2XXHA 3H06B 3K1PA 4G2ZA 2CZLA 3O6GA 4QF9A 1ATGA 2I4BA 3TCGA 3U1OA 1MS7A 3M3FA 1IXIA 4GL0A 2OZZA 1SI0A 2O6AA 1JVXA 4NMYA 3RN8A 3VLWA 4M1VA 3UA8A 4YKKA 1AMFA 3N6TA 4R74A 2ONRA 1MPCA 1OVBA 1POTA 3U92A 2PVUA 4WKMA 3LSXA 5ICTA 4KYEA 1B6HA 3ZSFA 1AOVA 1M5CA 3B6QA 4EF2A 4ZZAA 2X7PA 3ILTB 5DT6A 4PP0A 3SEVA 2DP8A 2XD2A 3H6VA 4EXKA 3S9EA 3KZGA 3DLNA 3E13X 5BUUA 4GVOA 4NWDA 3GBAA 2F7CA 4G8HA 3MVXA 3CR9A 4ISUA 1F9BA 4LQ2A 1QUJA 4QFNA 3VLUA 2XXTA 5L8DA 5EHSA 2AYSA 1UQWA 2VHAA 4HS7A 5I56B 4NF6A 3EPEA 1D9YA 2IA4A 2ZYMA 3OELA 3OOAA 4TLMB 5CRYA 3ZKLA 2YPNA 1ANFA 4BLAA 3KJTA 4U1OA 4RPNA 3S4UA 4DXUA 4XKQA 5I56A 1QKBA 4DZ1A 3ONMA 1EH3A 3S9LC 3IOVA 3DM0A 4H6DA 4ZEDA 2VGQA 3Q27A 4TLLB 4IO5A 1J1NA 5AA1A 1LFGA 3HCQA 4OHNA 1MY4A 1Y20A 1B5JA 3KSXA 3K2DA 1A8FA 5TPAB 5CMMA 3C34A 3MZ9A 2KLFA 1B05A 1NNTA 2I49A 1TFAA 2UVJA 1OIBA 2ZNUA 2BJJX 3R6UA 5B7DA 1B4ZA 3EHUA 3T66A 3PMWA 1ELJA 2QMXA 1XC1A 3RNNA 1B7ZA 3FVKA 3QYTA 4KYDA 4U2RA 4FORA 3L6HA 1R1NA 2QS1A 4HTGA 3PUYE 1B3EA 4QSDA 3RQTA 3RT8A 3TYHA 1P1QA 4NF8A 3KBRA 4OFLA 4H0WA 4I9DA 1O7TA 1MQDA 4JDFA 5ITPA 5CM6A 3ILUB 4QRZA 1N0TA 4E0WA 3H3GA 4IO4A 4XKPA 4H8IA 4C1TA 3SEYA 4RNSA 4R9GA 3TZAA 1R9QA 3PPPA 1POY1 3CSBA 3OO6A 3EHSA 5F1QA 1LAGE 4EXLA 3T9UA 2P1SA 3VXBA 2WKYA 2D3IA 4ELRA 2R6GE 2X26A 4HCWA 3FASA 5K2XA 2OWSA 5EYFA 4RY1A 1B52A 4U22A 1Z7NE 4QSCA 1PB8A 1OQGA 3RTWB 1FTKA 1MQIA 3O6IA 3TKDA 4ESWA 1M5BA 3EN3A 4ZEBA 3IB2A 3MC2A 4IO2A 4POXA 4DIGA 1B3GA 1NH7A 1S9TA 4GXSB 3RT6B 2VD2A 1DSNA 5TU0A 1YAEA 2O84X 2Z8EA 2Q88A 3TTLA 1OVTA 4HCYA 4GD5A 1QULA 4OXVA 2DWAA 5I2NB 2VD3A 4L17A 4WEDA 1FCKA 2G29A 5DEXA 4IO7A 5JK4A 1OMPA 1WDNA 3B7DA 4BDQA 3IB0A 2D5WA 1MQGA 2B3BA 3IOTA 1MH3A 3T9VA 4ZE9A 4GLIA 1A40A 1P1OA 4ZECA 3FJ7A 3L6GA 4QSEA 4RK2A 5DVFA 4O3AA 5I59B 4LUBA 4E0XA 2H5YA 2ZNTA 2I0BA 2Y7RA 3H03A 1TFDA 2QS2A 3MUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PB7 A;  1MXZ A;  3R26 A;  5I58 A;  5L9O A;  1WVJ A;  1B3L A;  1NL5 A;  1N84 A;  1BP5 A;  2LAO A;  2M8C A;  1IXH A;  1GTK A;  3DP8 A;  1MXV A;  3FXQ A;  2RF1 A;  3V89 B;  2I0C A;  3QUJ A;  4OEN A;  2XXW A;  1FTM A;  1B3F A;  1FQE A;  3TTN A;  3PD9 A;  2OJT A;  4U4X A;  1JQF A;  2PT1 A;  4KYS A;  4YKP A;  4FAT A;  4G8M A;  4YAH X;  4QFO A;  4OFO A;  3MZ1 A;  3MZB A;  3D4G A;  2AIX A;  3FZV A;  1FW0 A;  1GV8 A;  4ECF A;  4Q5T A;  3QIM A;  1FQF A;  2F5X A;  1T0K A;  1IQ7 A;  3IOR A;  1AL3 A;  1DTZ A;  1BIY A;  2UYF A;  4G68 B;  4U1Z A;  3TAJ A;  4EF1 A;  5I57 A;  5L9S A;  3G3K A;  3G3I A;  1N04 A;  4NWC A;  2QRY A;  2XHD A;  4C0R A;  3W9W A;  1M5E A;  2DE2 A;  2F6G A;  2ANJ A;  1JET A;  2QSX A;  3CFL A;  3O66 A;  1MPB A;  1LBC A;  3M8U A;  3KOS A;  1LST A;  2XXI A;  1B0H A;  4NE4 A;  2RC8 A;  3WAE A;  3I5O A;  3K6W A;  2F36 A;  2YJP A;  1EZP A;  4OZ9 A;  1H43 A;  1MY1 A;  1XVY A;  3Q29 A;  4NF5 A;  3TUS A;  3OO8 A;  1RYX A;  1VFD A;  2ABH A;  3PUW E;  3HO7 A;  1SYI A;  2Q2C A;  3FUZ A;  3LSL A;  3K6X A;  3MAM A;  1AH5 A;  3C36 A;  1UTB B;  1I69 A;  2O51 A;  4I62 A;  3SER A;  3HHG A;  1Q35 A;  1B5I A;  1NNF A;  2QMW A;  3O97 A;  2Y84 A;  1FQB A;  3OEK A;  4DCX A;  5CMC A;  1SW2 A;  2A5T A;  1GVC A;  2Q89 A;  4EUO A;  3PMV A;  2F7B A;  3OEN A;  4NED A;  4MF3 A;  3F11 A;  3K6V A;  4C1U A;  1PC3 A;  1DMB A;  1N7W A;  2F35 A;  2I3V A;  2OCU A;  2QL3 A;  2UYE A;  3M3L A;  2NOO A;  4IGR A;  4RYA A;  1BLF A;  3USD A;  3VVE A;  4ESX A;  1PBQ A;  1MXW A;  5FHO A;  1QUI A;  4H5G A;  3QSL A;  3SEX A;  1H45 A;  2B3F A;  1QVS A;  1USY H;  2THI A;  3FAT A;  3IAZ A;  3SEW A;  3TEP A;  1FTL A;  3MP6 A;  3C33 A;  4YMB A;  5DVI A;  1YTV A;  5ISU A;  5AA3 A;  3OSR A;  1Y3N A;  3K1M A;  3VVF A;  4U23 A;  5I2K A;  3E3K A;  3VLV A;  5HBC A;  1FQD A;  1N3X A;  4F3B A;  1LGB C;  5TP9 A;  4IY5 A;  3ECR A;  4YZZ A;  5JEI A;  1H76 A;  3SKP A;  3MWB A;  3HPI A;  3GZG A;  3MBP A;  1P1N A;  3A3U A;  3CG3 A;  3MW0 A;  4Q0C A;  1TT1 A;  3MPL A;  1EZ9 A;  2GH9 A;  4PET A;  1Z7M E;  1PEB A;  4PE5 B;  2HCA A;  4F1V A;  4FIM A;  4Z0I A;  5EHM A;  2QPQ A;  4H65 A;  2DE3 A;  4G77 A;  4R6H A;  3A3C A;  2H98 A;  4X48 A;  3RUM A;  4K3F A;  1Q1K A;  1BTJ A;  2E0S A;  5AA4 B;  3KGC A;  3TEL A;  2F34 A;  1XHY A;  4WXJ A;  4P11 A;  1B40 A;  2ALU A;  3TMG A;  3VDF A;  2HAV A;  3T9X B;  3PD8 A;  1M5F A;  5KZT A;  1XOC A;  4N13 A;  1B3H A;  1NFT A;  4F3P A;  4JSD A;  3TPA A;  5H8H A;  3IK6 B;  3OO7 A;  1B7U A;  3DP4 A;  4ZDM A;  4ONY A;  3T22 A;  5KDT A;  3K00 A;  3D4C A;  4JXI A;  1MDQ A;  1OLC A;  3LSW A;  2XXQ A;  2HQ0 A;  4F22 A;  1Y9U A;  2DE4 A;  2H9B A;  3FGS A;  2VP1 A;  1URD A;  2Z22 A;  3ZKK A;  4YB5 A;  4YKJ A;  4FAJ A;  3TFL A;  2DVC A;  2O1M A;  5KCJ A;  3N94 A;  3FV2 A;  1Y1Z A;  3TQW A;  4BDL A;  3IX1 A;  1Y4C A;  3SET A;  3O9P A;  5H8S A;  3C35 A;  2RCB A;  1YPN A;  3G7W A;  3IJX B;  4MLQ A;  4YKI A;  3VV5 A;  5CC2 A;  1A54 A;  4KR5 A;  1RKM A;  3RY3 A;  4G8N A;  2F78 A;  4H67 A;  2P0S A;  4R72 A;  3E9X A;  4F1Y A;  1URG A;  1XVX A;  1M5D A;  5H8Q B;  3MVZ A;  4BDO A;  3VXC A;  3ZS6 A;  1MG1 A;  1JVY A;  2Y7P A;  5H8F B;  3GBB A;  1MXY A;  3PV0 E;  3U8Q A;  1II5 A;  4G4P A;  1USY E;  1FQA A;  4R75 A;  5AE4 A;  2GHA A;  3H7M A;  4YB7 A;  2DXR A;  1ZLQ A;  1SQY A;  3O2A A;  4LP2 B;  4OVJ A;  3V5A A;  3EQ1 A;  3FXR A;  4ZZE A;  5J1D A;  4KQP A;  1MQH A;  2UXA A;  1LB8 A;  3K4U A;  3C4M A;  4LON B;  5DVJ A;  3THI A;  5KDT B;  3OXN A;  5I58 B;  4ZEK A;  4AB5 A;  3Q28 A;  1NNK A;  5FTI A;  2NVU B;  1LCF A;  4OET A;  3PU5 A;  3UIF A;  1SW5 A;  2I3W A;  4F2Q A;  3CG1 A;  1A7L A;  2ZYN A;  3B6T A;  4LZ7 A;  3BBR A;  4U4S A;  1MXX A;  1IIT A;  2XXR A;  3KFM A;  3LR1 A;  3UK4 A;  4I1D A;  3DP6 A;  4FE8 A;  5HM4 B;  1VE4 A;  3RPW A;  1P1W A;  2HZK A;  4FED A;  1I6A A;  1I6Q A;  1JW1 A;  2PX1 A;  3H4Z A;  4RXL A;  5AA2 A;  2DSF A;  1IXC A;  3MPK A;  4O3C A;  4ZEI A;  1O64 A;  4ZS9 A;  4F1U A;  1HSJ A;  1QKA A;  1UIU A;  2F97 A;  2FYI A;  2NUV A;  1IIW A;  5TPA A;  4AB6 A;  2ESN A;  2R9J A;  1QUK A;  3G3G A;  4JBZ A;  1IEJ A;  1KWH A;  3KOT A;  3ODB A;  5A5X A;  1XT8 A;  2F8D A;  1VSO A;  2AL4 A;  4IO6 A;  2H4I A;  3IO6 A;  3QXM A;  1JEU A;  2CMO A;  4FEC A;  3QK6 A;  1QW0 A;  5ITO A;  3UN6 A;  2XXU A;  1NMU A;  4THI A;  4DCY A;  5LOM A;  2XXP A;  3PUV E;  3OD7 A;  2ZYO A;  4R6Y A;  1PBP A;  3GLB A;  3KG2 A;  3IL1 B;  4KHZ E;  1AIV A;  5IKB A;  1DOT A;  2GHB A;  1P1U A;  3PPR A;  2HAU A;  3S9M C;  4BDR A;  1HSE A;  4F3G A;  3HN0 A;  2REJ A;  2I4C A;  2V25 A;  1JW4 A;  1VR5 A;  2E1S A;  5CMB A;  1LFH A;  3AXF A;  4XXU A;  5I59 A;  2XX7 A;  3PPQ A;  4GQO A;  1B4H A;  1LBB A;  3MVY A;  1DPE A;  1FQC A;  1SI1 A;  4XKN A;  3FXU A;  4OTE A;  3OEM A;  3Q25 A;  3MQ9 A;  3O29 A;  3FVO A;  1N76 A;  1B32 A;  2PMS A;  2Z8F A;  4OES A;  2XX9 A;  4Q30 B;  2DOJ A;  1YCJ A;  4LA9 A;  3UGW A;  4DXC A;  4PFW A;  1UTB A;  2Z23 A;  3I3V A;  4JB7 A;  4YMA A;  2HFB A;  1MM7 A;  1US5 A;  2YLN A;  4F31 B;  2OBG A;  1B1X A;  4ZE8 A;  5AA4 A;  5DTB A;  4F3S A;  4IY6 A;  4N6P A;  4OWD A;  4DXB A;  4UAC A;  1FTO A;  2B65 A;  4GFR A;  3SEU A;  5H8F A;  4X1B A;  1SBP A;  3RTF B;  3B6W A;  4P0I A;  4F39 A;  5TP9 B;  4OMB A;  4ELO A;  3HHF A;  1H44 A;  1I6B A;  4R9F A;  5L9M A;  2F7A A;  1EU8 A;  1UIV A;  3MVW A;  4RPO A;  1A55 A;  2ZXT A;  4TQU Q;  4X1D A;  5FTH A;  5KCJ B;  3IB1 A;  5JTY B;  2NXO A;  2GRV A;  2RC9 A;  3OO9 A;  2RC7 A;  2UVI A;  1O63 A;  1IUD A;  1GR2 A;  1UTH A;  1JEV A;  4FEB A;  4FJP A;  4IO3 A;  4PQJ A;  4RA1 A;  1A99 A;  1B51 A;  4KCD A;  3PMX A;  1BKA A;  1RYO A;  2DYX A;  4NF4 B;  1D4N A;  4LQ5 A;  3FJG A;  2DS9 A;  3CI8 A;  3I6V A;  4R2F A;  3UP9 A;  4JSO A;  1D3K A;  2V3T A;  2H25 A;  2OK2 A;  4NF8 B;  3SES A;  3LUY A;  3CRB A;  5CI5 A;  3CFX A;  4OQO A;  1N3W A;  3UOR A;  2DVZ A;  2HXW A;  2REG A;  3O6H A;  1LAH E;  2DWJ A;  1SDX A;  2PYY A;  2ZNS A;  3CVG A;  4MLV A;  3SDF A;  3V8X B;  3IR1 A;  4NF5 B;  4IGT A;  1LAF E;  4AQ4 A;  3TDJ A;  3K1N A;  1R6Z A;  2GFE A;  4GL8 A;  2RCA A;  1JNF A;  4NF4 A;  3KN7 A;  3T96 B;  4OYV A;  4DE8 A;  5H8Q A;  3E4R A;  1HSL A;  2DWI A;  4G68 C;  4LAT A;  5ICQ A;  1JW5 A;  5JTY A;  1ZU0 A;  1MQJ A;  2XXY A;  3HV1 A;  3VVD A;  2Q2A A;  3A09 A;  1IXG A;  4UA8 A;  3JV9 A;  1MY3 A;  3MJN A;  5M2V A;  3U72 A;  1SYH A;  3W9V A;  1FTJ A;  5ELV A;  1IZ1 A;  4PFY A;  4MFI A;  3R7X A;  2A5S A;  3H6T A;  3PUZ E;  4G68 A;  5I57 B;  4TOZ A;  5F7V A;  2QJE A;  3FVN A;  5A5X B;  1H3D A;  3QUF A;  4GRK A;  1MY2 A;  2G93 A;  4KD5 A;  1B9J A;  3H6U A;  3M3K A;  4KCC A;  2I6E A;  4O3B A;  1DPP A;  3N6U A;  3K6U A;  2O1L A;  2UVH A;  4OER A;  4H5F A;  4RJZ A;  3EF7 A;  3TTR A;  4YIC A;  3VE1 B;  2A5T B;  1CE2 A;  2DWH A;  4LZ5 A;  5I84 A;  3RLF E;  5CBS A;  4R6K A;  3TCH A;  4LVQ A;  1B0L A;  4XTC Q;  1B1H A;  1Y1M A;  2ONK E;  2X7Q A;  4WEP A;  2W7Y A;  2IEE A;  1NKX A;  4JWY A;  5FHN A;  4EQB A;  4I8C A;  1MPD A;  1MM6 A;  4MBP A;  1TXF A;  2AL5 A;  4NTL A;  4R73 A;  1CB6 A;  1DTG A;  1WOD A;  2O69 A;  3C9H A;  4OEV A;  4ZEF A;  3TOD A;  4EDP A;  2Q9T A;  3CSG A;  5DEX B;  4ELQ A;  4F19 A;  2PBW A;  4QFP A;  3TQL A;  3PPN A;  2UVG A;  3T9H B;  4OEU A;  1NH8 A;  1SW4 A;  3BFU A;  1LLS A;  2O7U A;  1A8E A;  3KSJ A;  1MXU A;  3KN8 A;  1R9L A;  1NNP A;  5HPQ A;  2FA7 A;  1SD3 A;  3MP1 A;  2Q8J A;  5CBR A;  4POW A;  4F2O A;  3Q26 A;  4IB2 A;  2P2A A;  3FIR A;  3S2V A;  3S9N C;  4QHQ A;  5I2K B;  2V3Q A;  2XX8 A;  2ZYK A;  3BFT A;  2PT2 A;  3IOW A;  4NF6 B;  5FHM A;  4F18 A;  1Y3P A;  1MH4 A;  1VFE A;  2VOZ A;  4MH5 A;  4R2B A;  3TTK A;  5H8N B;  4H1X A;  1S7Y A;  4BDN A;  1B7H A;  1ZJL A;  4GIZ A;  1PB9 A;  2HEU A;  4XIG Q;  1ZMG A;  4PFT A;  4GWO A;  2V93 A;  4LZ8 A;  5DYH A;  1US4 A;  3CIJ A;  3K01 A;  4EQ7 A;  3IO4 A;  3OSQ A;  4HW8 A;  3FV1 A;  3IOU A;  2Y7K A;  3K0V A;  3W15 C;  3N26 A;  4JWO A;  2NWJ A;  3K02 A;  3LBS A;  5H8H B;  4DLD A;  5AA2 B;  1Y4T A;  2D21 A;  2Y7W A;  3LC8 A;  4QFL A;  3GXA A;  3BKI B;  2Z8D A;  2RKM A;  1LFI A;  2O68 A;  3RGY A;  1B46 A;  4Q8R A;  1LAX A;  1N7X A;  1P99 A;  1PDA A;  3JYR A;  3KEI A;  3V83 A;  1LCT A;  4X9T A;  2OWT A;  2V84 A;  4KFQ A;  3U93 A;  2Y7I A;  1D9V A;  3U94 A;  4RK9 A;  2XXX A;  3G3J A;  3G3F A;  1B2H A;  2XXV A;  4KPT A;  2QS3 A;  3T93 B;  3H6W A;  5IAI A;  2FNC A;  2OLB A;  5BWJ A;  5I2N A;  2R71 A;  4KI0 E;  3KJ7 A;  1SVX B;  2I48 A;  3OMB A;  3PUX E;  1MY0 A;  2XD3 A;  1UTH B;  3P7I A;  4N07 A;  3TCF A;  2RIN A;  2V3U A;  3HST A;  4GF8 A;  2ZMB A;  4JWX A;  4YB6 A;  2DXY A;  3PPO A;  5B70 A;  1S50 A;  4M4G A;  2ONS A;  1MDP 1;  1ZBM A;  1TWY A;  3G3H A;  4QFK A;  4P0G A;  3WAF A;  1MRP A;  3KN3 A;  1OQH A;  1QJM A;  1SW1 A;  2O7I A;  3O28 A;  4GOT A;  3VFJ A;  3JZJ A;  3MP8 A;  3TTM A;  3QAX A;  3IJO B;  1LB9 A;  2QS4 A;  4PFU A;  5H8N A;  1OLA A;  3FD3 A;  4XKR A;  1ZKB A;  3PGF A;  5AA2 D;  3FVG A;  1EZO A;  1ZTY A;  2HZL A;  4YU0 A;  3C31 A;  3DEL B;  2DQV A;  2I58 A;  1Y3Q A;  3FJM A;  2H99 A;  4H8J A;  1L5T A;  3CFZ A;  4EQ9 A;  1ZIU A;  4Z7E A;  1XS5 A;  1B5H A;  4GXA A;  4ND9 A;  3N5L A;  2F6P A;  3EHT A;  5CMK A;  1URS A;  3LSF B;  4OFJ A;  4U21 A;  4BDM A;  4DDD A;  4ELP A;  1B58 A;  1GGG A;  4F29 A;  3C32 A;  5K2Y A;  2XXH A;  3H06 B;  3K1P A;  4G2Z A;  2CZL A;  3O6G A;  4QF9 A;  1ATG A;  2I4B A;  3TCG A;  3U1O A;  1MS7 A;  3M3F A;  1IXI A;  4GL0 A;  2OZZ A;  1SI0 A;  2O6A A;  1JVX A;  4NMY A;  3RN8 A;  3VLW A;  4M1V A;  3UA8 A;  4YKK A;  1AMF A;  3N6T A;  4R74 A;  2ONR A;  1MPC A;  1OVB A;  1POT A;  3U92 A;  2PVU A;  4WKM A;  3LSX A;  5ICT A;  4KYE A;  1B6H A;  3ZSF A;  1AOV A;  1M5C A;  3B6Q A;  4EF2 A;  4ZZA A;  2X7P A;  3ILT B;  5DT6 A;  4PP0 A;  3SEV A;  2DP8 A;  2XD2 A;  3H6V A;  4EXK A;  3S9E A;  3KZG A;  3DLN A;  3E13 X;  5BUU A;  4GVO A;  4NWD A;  3GBA A;  2F7C A;  4G8H A;  3MVX A;  3CR9 A;  4ISU A;  1F9B A;  4LQ2 A;  1QUJ A;  4QFN A;  3VLU A;  2XXT A;  5L8D A;  5EHS A;  2AYS A;  1UQW A;  2VHA A;  4HS7 A;  5I56 B;  4NF6 A;  3EPE A;  1D9Y A;  2IA4 A;  2ZYM A;  3OEL A;  3OOA A;  4TLM B;  5CRY A;  3ZKL A;  2YPN A;  1ANF A;  4BLA A;  3KJT A;  4U1O A;  4RPN A;  3S4U A;  4DXU A;  4XKQ A;  5I56 A;  1QKB A;  4DZ1 A;  3ONM A;  1EH3 A;  3S9L C;  3IOV A;  3DM0 A;  4H6D A;  4ZED A;  2VGQ A;  3Q27 A;  4TLL B;  4IO5 A;  1J1N A;  5AA1 A;  1LFG A;  3HCQ A;  4OHN A;  1MY4 A;  1Y20 A;  1B5J A;  3KSX A;  3K2D A;  1A8F A;  5TPA B;  5CMM A;  3C34 A;  3MZ9 A;  2KLF A;  1B05 A;  1NNT A;  2I49 A;  1TFA A;  2UVJ A;  1OIB A;  2ZNU A;  2BJJ X;  3R6U A;  5B7D A;  1B4Z A;  3EHU A;  3T66 A;  3PMW A;  1ELJ A;  2QMX A;  1XC1 A;  3RNN A;  1B7Z A;  3FVK A;  3QYT A;  4KYD A;  4U2R A;  4FOR A;  3L6H A;  1R1N A;  2QS1 A;  4HTG A;  3PUY E;  1B3E A;  4QSD A;  3RQT A;  3RT8 A;  3TYH A;  1P1Q A;  4NF8 A;  3KBR A;  4OFL A;  4H0W A;  4I9D A;  1O7T A;  1MQD A;  4JDF A;  5ITP A;  5CM6 A;  3ILU B;  4QRZ A;  1N0T A;  4E0W A;  3H3G A;  4IO4 A;  4XKP A;  4H8I A;  4C1T A;  3SEY A;  4RNS A;  4R9G A;  3TZA A;  1R9Q A;  3PPP A;  1POY 1;  3CSB A;  3OO6 A;  3EHS A;  5F1Q A;  1LAG E;  4EXL A;  3T9U A;  2P1S A;  3VXB A;  2WKY A;  2D3I A;  4ELR A;  2R6G E;  2X26 A;  4HCW A;  3FAS A;  5K2X A;  2OWS A;  5EYF A;  4RY1 A;  1B52 A;  4U22 A;  1Z7N E;  4QSC A;  1PB8 A;  1OQG A;  3RTW B;  1FTK A;  1MQI A;  3O6I A;  3TKD A;  4ESW A;  1M5B A;  3EN3 A;  4ZEB A;  3IB2 A;  3MC2 A;  4IO2 A;  4POX A;  4DIG A;  1B3G A;  1NH7 A;  1S9T A;  4GXS B;  3RT6 B;  2VD2 A;  1DSN A;  5TU0 A;  1YAE A;  2O84 X;  2Z8E A;  2Q88 A;  3TTL A;  1OVT A;  4HCY A;  4GD5 A;  1QUL A;  4OXV A;  2DWA A;  5I2N B;  2VD3 A;  4L17 A;  4WED A;  1FCK A;  2G29 A;  5DEX A;  4IO7 A;  5JK4 A;  1OMP A;  1WDN A;  3B7D A;  4BDQ A;  3IB0 A;  2D5W A;  1MQG A;  2B3B A;  3IOT A;  1MH3 A;  3T9V A;  4ZE9 A;  4GLI A;  1A40 A;  1P1O A;  4ZEC A;  3FJ7 A;  3L6G A;  4QSE A;  4RK2 A;  5DVF A;  4O3A A;  5I59 B;  4LUB A;  4E0X A;  2H5Y A;  2ZNT A;  2I0B A;  2Y7R A;  3H03 A;  1TFD A;  2QS2 A;  3MUQ A; 
#chains in the Genus database with same CATH topology
 1FTA A;  1IXH A;  2RF1 A;  2I0C A;  3QUJ A;  2OJT A;  3BIH A;  4U4X A;  2PT1 A;  4YKP A;  4OFO A;  3MZB A;  3FZV A;  1GV8 A;  3IOR A;  1DTZ A;  4G68 B;  5I57 A;  3G3I A;  2F6G A;  1JET A;  1LBC A;  3WAE A;  2F36 A;  2YJP A;  4OZ9 A;  4NF5 A;  1RYX A;  3HO7 A;  3FUZ A;  2O51 A;  1NNF A;  2Y84 A;  1NUZ A;  4I3E A;  4NQ8 A;  4MF3 A;  1FBE A;  1PC3 A;  3VVE A;  1BLF A;  1MXW A;  5FHO A;  1QUI A;  4XF5 A;  3TEP A;  1QVS A;  5IZ3 A;  3MP6 A;  4YMB A;  5DVI A;  5I2K A;  3E3K A;  2XXK A;  5TP9 A;  5JEI A;  1P1N A;  3A3U A;  4Q0C A;  1EYK A;  1TT1 A;  3MPL A;  2HCA A;  4HXV A;  4F1V A;  5EHM A;  4H65 A;  4G77 A;  4PFI A;  4X48 A;  1Q1K A;  2E0S A;  3TEL A;  1XHY A;  1NUX A;  3TMG A;  2HAV A;  3T9X B;  4N13 A;  1B3H A;  4JSD A;  3OO7 A;  4ONY A;  3T22 A;  2VP1 A;  1IMA A;  1NV6 A;  2O1M A;  3FV2 A;  3TQW A;  4BDL A;  5I5P A;  4MLQ A;  1A54 A;  3CHG A;  4G8N A;  4H67 A;  2P0S A;  4R72 A;  1XVX A;  4BDO A;  1MG1 A;  5H8F B;  1MXY A;  3PV0 E;  1II5 A;  5AE4 A;  2GHA A;  2DXR A;  1SQY A;  3V5A A;  4PAK A;  3EQ1 A;  1FPK A;  4KQP A;  1MQH A;  1LB8 A;  5I58 B;  4ZEK A;  2NVU B;  3B6T A;  3UK4 A;  4I1D A;  4FE8 A;  5HM4 B;  1VE4 A;  1I6Q A;  2PX1 A;  4MIJ A;  5AA2 A;  4O3C A;  1HSJ A;  2F97 A;  1LBY A;  2NUV A;  4JBZ A;  4DI3 D;  1KWH A;  3KOT A;  3MYU A;  2AL4 A;  4N15 A;  2H4I A;  3IO6 A;  3QXM A;  3UN6 A;  1QW0 A;  1KZ8 A;  5ESY A;  4DCY A;  2XXP A;  3PUV E;  3OD7 A;  2ZYO A;  4R6Y A;  1PBP A;  3PPR A;  2HAU A;  4MX6 A;  4F3G A;  2E1S A;  5CMB A;  2P3V A;  3PPQ A;  1LBB A;  2ZZW A;  4OTE A;  3OEM A;  2Z8F A;  2XX9 A;  1YCJ A;  2HFB A;  1US5 A;  4ZE8 A;  4I3Y A;  4F3S A;  4N6P A;  4UAC A;  3SEU A;  4GFR A;  1IME A;  4MAG A;  1I6B A;  5FTH A;  2ZXT A;  2NXO A;  2GRV A;  2RC7 A;  1GR2 A;  1JEV A;  4RA1 A;  1A99 A;  1B51 A;  2DYX A;  1RYO A;  2FIX A;  3RYD A;  3I6V A;  4R2F A;  3UP9 A;  1D3K A;  3CRB A;  4OQO A;  4O8M A;  2REG A;  3O6H A;  1FPJ A;  3V8X B;  3IR1 A;  2OX3 A;  2GFE A;  4LAT A;  2HXR A;  1ZU0 A;  5I7I A;  1NV2 A;  1MY3 A;  2KQZ A;  3H6T A;  3PUZ E;  4O3B A;  3N6U A;  3TTR A;  5CBS A;  4LVQ A;  4XTC Q;  2X7Q A;  5FHN A;  4JWY A;  1MM6 A;  4MBP A;  3TQL A;  1WOD A;  1DTG A;  4EDP A;  4N6K A;  4ELQ A;  2PBW A;  4QFP A;  1LBX A;  2O7U A;  4HE2 A;  3S9N C;  2PFZ A;  4QHQ A;  5FHM A;  3IOW A;  3BFT A;  4NF6 B;  1Y3P A;  2FIE A;  3TTK A;  2HEU A;  1US4 A;  4EQ7 A;  3FV1 A;  3IOU A;  2Y7K A;  3N26 A;  2NWJ A;  5AA2 B;  2D21 A;  4QFL A;  2MKZ A;  3GXA A;  3BKI B;  2RKM A;  4Q8R A;  3RGY A;  1B46 A;  1N7X A;  4X9T A;  2V84 A;  3U94 A;  1D9V A;  4H46 A;  2XXV A;  4KPT A;  5BWJ A;  2R71 A;  4KI0 E;  3KJ7 A;  2I48 A;  3OMB A;  3PUX E;  4JWX A;  2DXY A;  2FVZ A;  4M4G A;  1MDP 1;  1TWY A;  5LTC A;  3O28 A;  3JZJ A;  3MP8 A;  3QAX A;  4P1L A;  4N4U A;  3IJO B;  1LB9 A;  2HZL A;  3DEL B;  2DQV A;  3FJM A;  2H99 A;  1XS5 A;  2F6P A;  4U21 A;  5EQ7 A;  3C32 A;  4F29 A;  2XXH A;  3K1P A;  4QF9 A;  1ATG A;  2I4B A;  3M3F A;  3RN8 A;  4YKK A;  2ONR A;  5ICT A;  4KYE A;  1B6H A;  3ZSF A;  1FBP A;  1M5C A;  4EXK A;  4GVO A;  4NWD A;  2F7C A;  4MNP A;  2XXT A;  5L8D A;  3SZP A;  3RPL B;  2AYS A;  4HS7 A;  5I56 B;  1D9Y A;  2IA4 A;  3OEL A;  4TLM B;  4BLA A;  2YPN A;  4RPN A;  4DXU A;  4DZ1 A;  3ONM A;  3S9L C;  5IZ3 B;  1FRP A;  4H6D A;  3Q27 A;  4IO5 A;  3PTY A;  1J1N A;  1MY4 A;  3C34 A;  3MZ9 A;  2I49 A;  3PMW A;  2QMX A;  2PFY A;  3L6H A;  1R1N A;  3RQT A;  4NF8 A;  5ITP A;  5CM6 A;  1N0T A;  4XKP A;  3SEY A;  3TZA A;  3PPP A;  1POY 1;  2WKY A;  2X26 A;  3RPL A;  5K2X A;  3RTW B;  4QSC A;  1NUW A;  4O7M A;  5ET7 A;  1M5B A;  4ZEB A;  1B3G A;  5ET6 A;  1OVT A;  2DWA A;  5I2N B;  4WED A;  5JK4 A;  4BDQ A;  2D5W A;  1FPL A;  1MQG A;  3IOT A;  1A40 A;  2BJI A;  3T1B A;  1PB7 A;  1MXZ A;  5I58 A;  2LAO A;  3FXQ A;  2XXW A;  2VPN A;  4G8M A;  4YAH X;  4N91 A;  4QFO A;  3MZ1 A;  2CEX A;  1IMB A;  1AL3 A;  2UYF A;  3G3K A;  1N04 A;  4C0R A;  3W9W A;  1M5E A;  2XWV A;  1MPB A;  3KOS A;  2XXI A;  3K6W A;  1XVY A;  3Q29 A;  1VFD A;  4U4S A;  3PUW E;  3LSL A;  3MAM A;  4I62 A;  3SER A;  3O97 A;  1LBW A;  4EUO A;  2F7B A;  3OEN A;  3F11 A;  1LEV A;  3K6V A;  4C1U A;  2OCU A;  1DMB A;  1N7W A;  2B3F A;  3FAT A;  3C33 A;  5AA3 A;  4U23 A;  5HBC A;  1LGB C;  1CNQ A;  4YZZ A;  4PFR A;  3GZG A;  2H98 A;  4K3F A;  5AA4 B;  3T0J A;  1XOC A;  1NFT A;  4F3P A;  4N17 A;  3TPA A;  1B7U A;  3K00 A;  2WBD A;  4JXI A;  1Y9U A;  2DE4 A;  2H9B A;  3FGS A;  1URD A;  2Z22 A;  4YB5 A;  1Y1Z A;  3IX1 A;  3C35 A;  2RCB A;  3IJX B;  4YKI A;  2OWZ A;  1FJ6 A;  4F1Y A;  3ROJ A;  3MVZ A;  3GBB A;  4G4P A;  3H7M A;  3O2A A;  4OVJ A;  5DVJ A;  3THI A;  3Q28 A;  1NNK A;  4GWY A;  5FTI A;  1LCF A;  2I3W A;  4F2Q A;  3CG1 A;  1A7L A;  2ZYN A;  4LZ7 A;  4GX3 A;  4FED A;  1I6A A;  1JW1 A;  1IXC A;  3MPK A;  2ZZV A;  2FYI A;  4AB6 A;  1QUK A;  1IEJ A;  1JEU A;  5ITO A;  2XXU A;  1NMU A;  1AIV A;  3IL1 B;  5IKB A;  3S9M C;  4BDR A;  3HN0 A;  4G61 A;  2REJ A;  2I4C A;  2V25 A;  4OVP A;  3MVY A;  1DPE A;  1SI1 A;  3Q25 A;  4LA9 A;  3UGW A;  4YMA A;  2YLN A;  2FBP A;  4F31 B;  5DTB A;  4IR8 A;  1SBP A;  3B6W A;  1NV3 A;  4P0I A;  4F39 A;  1FPF A;  5L9M A;  1UIV A;  2RC9 A;  4P11 A;  5BUU A;  4U22 A;  4FJP A;  4PF8 A;  4KCD A;  1BKA A;  4OVR A;  1D4N A;  4NF0 A;  4LQ5 A;  3CI8 A;  3B8B A;  4JSO A;  2H25 A;  1YYZ A;  4PGN A;  3SES A;  1DBZ A;  1N3W A;  2HXW A;  1LAH E;  3SDF A;  4PBH A;  4NF5 B;  4IGT A;  2RCA A;  1JNF A;  3T96 B;  4DE8 A;  3E4R A;  4X8R A;  4G68 C;  1JW5 A;  3A09 A;  3W9V A;  1NV0 A;  3KBZ A;  4TOZ A;  4MEV A;  1B9J A;  4KCC A;  5ET5 A;  3USD A;  4H5F A;  2A5T B;  1CE2 A;  4LZ5 A;  5I84 A;  3TCH A;  1B0L A;  4WEP A;  4EQB A;  1TXF A;  3C9H A;  3CSG A;  1SW4 A;  3KSJ A;  1XI6 A;  2CZK A;  3KN8 A;  1NNP A;  4GX4 A;  4F2O A;  4IB2 A;  2XX8 A;  2PT2 A;  4F18 A;  4KXP A;  2VOZ A;  1PB9 A;  4XIG Q;  4GWO A;  3IO4 A;  4HW8 A;  3W15 C;  5H8H B;  2Y7W A;  5IGA A;  3JYR A;  3KEI A;  3V83 A;  1LCT A;  2OWT A;  1RDX A;  4KFQ A;  2HHM A;  2Y7I A;  3G3J A;  3G3F A;  1K9Y A;  2QS3 A;  5I2N A;  1MY0 A;  3P7I A;  4GWW A;  2ZMB A;  1S50 A;  3G3H A;  1FBF A;  4P0G A;  3WAF A;  1QJM A;  2O7I A;  5H8N A;  4XKR A;  3FD3 A;  1ZKB A;  1ZTY A;  1L5T A;  1ZIU A;  1B5H A;  5CMK A;  4BDM A;  4ELP A;  1B58 A;  4P8B A;  4ZEC A;  4G2Z A;  3O6G A;  3TCG A;  2OZZ A;  3FBP A;  1IMF A;  4M1V A;  1POT A;  1OVB A;  2PVU A;  4AS4 A;  4EF2 A;  4ZZA A;  1JP4 A;  3ILT B;  4PP0 A;  4GX6 A;  2DP8 A;  3H6V A;  3S9E A;  3E13 X;  2FHY A;  3CR9 A;  4LQ2 A;  1QUJ A;  2WYP A;  2VHA A;  3E78 A;  5I56 A;  2ZYM A;  2KR0 A;  4XKQ A;  1QKB A;  1FBH A;  2QVR A;  4OHN A;  3EHU A;  3T66 A;  1ELJ A;  1FPE A;  1XC1 A;  4PBQ A;  2QFL A;  3FVK A;  2QS1 A;  3RT8 A;  3PUY E;  3KBR A;  4OFL A;  4JVC A;  3ILU B;  4PC9 A;  4RNS A;  3CSB A;  3T9U A;  2P1S A;  3VXB A;  2R6G E;  2VT5 A;  4HCW A;  3FAS A;  5EYF A;  1B52 A;  5IZZ A;  1OQG A;  1MQI A;  3EN3 A;  3IB2 A;  4POX A;  4DIG A;  4GXS B;  2O84 X;  3TTL A;  4HCY A;  4OXV A;  3GYY A;  1OMP A;  2DDK A;  3IB0 A;  2B3B A;  5I59 B;  2H5Y A;  4NHB A;  2GQ1 A;  3R26 A;  1B3L A;  1NL5 A;  1N84 A;  2VPO A;  3DP8 A;  2WEF A;  1JQF A;  4KYS A;  4P3L A;  1FPI A;  1BK4 A;  2AIX A;  3D4G A;  1FW0 A;  4Q5T A;  2F5X A;  1T0K A;  1IQ7 A;  4U1Z A;  3TAJ A;  5ISU A;  4NWC A;  2DE2 A;  3OOA A;  2QSX A;  3O66 A;  1NV4 A;  1LST A;  1B0H A;  2RC8 A;  1EZP A;  1H43 A;  4JVI A;  1MY1 A;  2WYK A;  2ABH A;  1SYI A;  2Q2C A;  4F22 A;  3K6X A;  3C36 A;  1UTB B;  3HHG A;  1B5I A;  2QMW A;  3OEK A;  1SW2 A;  2Q89 A;  4NED A;  4IGR A;  2I3V A;  2QL3 A;  3M3L A;  2UYE A;  4RYA A;  4ESX A;  2QVU A;  4H5G A;  3SEW A;  1USY H;  1YTV A;  1Y3N A;  3K1M A;  4F3B A;  1H76 A;  4PET A;  1Z7M E;  1PEB A;  4FIM A;  4Z0I A;  4R6H A;  3A3C A;  3ISP A;  3KGC A;  2F34 A;  1B40 A;  3VDF A;  1G0I A;  3DP4 A;  5KDT A;  1OLC A;  3LSW A;  2XXQ A;  2HQ0 A;  4GWU A;  4PF6 A;  3TFL A;  4FAJ A;  3N94 A;  5J16 A;  3SET A;  5H8S A;  1YPN A;  3VV5 A;  5CC2 A;  4KR5 A;  1RKM A;  3RY3 A;  3E9X A;  1URG A;  1M5D A;  3ZS6 A;  3U8Q A;  1USY E;  1FQA A;  4R75 A;  1IMD A;  4YB7 A;  1INP A;  4LP2 B;  3FXR A;  2UXA A;  3K4U A;  4OET A;  3PU5 A;  3UIF A;  1SW5 A;  2XXR A;  3KFM A;  3DP6 A;  1P1W A;  2HZK A;  3H4Z A;  1O64 A;  1UIU A;  3U65 A;  1IIW A;  5TPA A;  1FPG A;  3ODB A;  4GBV A;  5A5X A;  1XT8 A;  1VSO A;  4O7I A;  4FEC A;  2CMO A;  4PDD A;  3IFA A;  4THI A;  3FXB A;  3GLB A;  3KG2 A;  4N8Y A;  3MST A;  1DOT A;  2GHB A;  4NG7 A;  1JW4 A;  3AXF A;  1YXI A;  5I59 A;  4PAF A;  3FXU A;  3O29 A;  3FVO A;  1N76 A;  1B32 A;  1NV7 A;  2PMS A;  4OES A;  2DOJ A;  4DXC A;  1UTB A;  2Z23 A;  4JB7 A;  1MM7 A;  1B1X A;  5AA4 A;  5DW8 A;  4OWD A;  1FTO A;  2B65 A;  5H8F A;  4OMB A;  2B4M A;  4ELO A;  3HHF A;  4R9F A;  4P56 A;  1EU8 A;  4RPO A;  3MVW A;  1A55 A;  4X1D A;  4PE3 A;  4IO3 A;  1DCU A;  4NF4 B;  3FJG A;  2DS9 A;  1EYI A;  2OK2 A;  4OVT A;  3LUY A;  3CFX A;  4NX1 A;  4PCD A;  1Q9D A;  2DVZ A;  3LV0 A;  2PYY A;  2ZNS A;  3CVG A;  4MLV A;  3D1R A;  1VDW A;  4AQ4 A;  3TDJ A;  3K1N A;  1R6Z A;  4NF4 A;  5H8Q A;  2JJK A;  1LBZ A;  1MQJ A;  2XXY A;  3HV1 A;  3VVD A;  5ET8 A;  1IXG A;  3JV9 A;  4GWS A;  5M2V A;  1SYH A;  3NOH A;  5ELV A;  4PFY A;  3R7X A;  2A5S A;  2F3D A;  5F7V A;  2QJE A;  3FVN A;  4X04 A;  1H3D A;  1DK4 A;  2HPG A;  4GRK A;  5EQ8 A;  1MY2 A;  2G93 A;  4KD5 A;  3H6U A;  3M3K A;  2CEY A;  2I6E A;  1FBC A;  2UVH A;  3EF7 A;  3VE1 B;  4YIC A;  2DWH A;  4R6K A;  1B1H A;  4OAN A;  1MPD A;  4R73 A;  4NTL A;  3TOD A;  1CB6 A;  2O69 A;  2Q9T A;  5DEX B;  3PPN A;  1NH8 A;  3BFU A;  1LLS A;  1A8E A;  5HPQ A;  3MP1 A;  2Q8J A;  4POW A;  3Q26 A;  4PGP A;  3FIR A;  2V3Q A;  2ZYK A;  1KA0 A;  4MH5 A;  1MH4 A;  5H8N B;  4R2B A;  4H1X A;  1S7Y A;  1B7H A;  1ZJL A;  4GIZ A;  4PFT A;  3LUZ A;  3OSQ A;  3LBS A;  4DLD A;  1LFI A;  2O68 A;  1LAX A;  1P99 A;  1PDA A;  2XXX A;  1B2H A;  3H6W A;  5IAI A;  2OLB A;  1SVX B;  4PFB A;  2XD3 A;  2L5V A;  3HST A;  3PPO A;  1NI9 A;  5B70 A;  2ONS A;  2R8T A;  4QFK A;  1MRP A;  3KN3 A;  1OQH A;  3B50 A;  2QS4 A;  4PFU A;  1OLA A;  3PGF A;  3C31 A;  3CFZ A;  4Z7E A;  4ND9 A;  3N5L A;  1RDY A;  3EHT A;  1URS A;  4OFJ A;  1IMC A;  1GGG A;  5K2Y A;  3U1O A;  1MS7 A;  1IXI A;  4GL0 A;  5A5L A;  4NMY A;  4LN5 A;  1LBV A;  3UA8 A;  4N6D A;  1AMF A;  4FBP A;  3U92 A;  4WKM A;  3B6Q A;  2X7P A;  1G0H A;  1SPI A;  4NAP A;  3SEV A;  3GBA A;  4G8H A;  3MVX A;  2WX9 A;  3VLU A;  5EQA A;  5EHS A;  1UQW A;  4NF6 A;  3EPE A;  5EYG A;  3ZKL A;  3BIG A;  1ANF A;  3S4U A;  1EH3 A;  3IOV A;  3DM0 A;  4ZED A;  2VGQ A;  4TLL B;  5AA1 A;  5EQ9 A;  1LFG A;  3HCQ A;  1Y20 A;  5IM2 A;  1B5J A;  3KSX A;  3K2D A;  1A8F A;  5CMM A;  1B05 A;  2UVJ A;  2BJJ X;  1B4Z A;  1AWB A;  1B7Z A;  4KYD A;  4U2R A;  4FOR A;  4HTG A;  3TYH A;  4H0W A;  1O7T A;  1MQD A;  4QRZ A;  4E0W A;  4R9G A;  5F1Q A;  3OO6 A;  3EHS A;  4ELR A;  4O94 A;  2OWS A;  1Z7N E;  1PB8 A;  3TKD A;  4JVD A;  1NH7 A;  1S9T A;  5TU0 A;  1YAE A;  2XWI A;  2Q88 A;  2Z8E A;  2VD3 A;  4L17 A;  2G29 A;  5DEX A;  2Y5L A;  4PTK A;  3T9V A;  1MH3 A;  4H45 A;  4ZE9 A;  3L6G A;  4MMP A;  4QSE A;  4LUB A;  4E0X A;  2Y7R A;  3H03 A;  1TFD A;  2QS2 A;  4DCX A;  5L9O A;  1WVJ A;  1BP5 A;  2M8C A;  1GTK A;  3V89 B;  1MXV A;  4OEN A;  1FTM A;  1B3F A;  1FQE A;  3TTN A;  3PD9 A;  4FAT A;  4ECF A;  3QIM A;  1FQF A;  2CZH A;  1BIY A;  4EF1 A;  5L9S A;  2QRY A;  2XHD A;  2ANJ A;  3CFL A;  3M8U A;  4NE4 A;  4OVS A;  3I5O A;  3TUS A;  3OO8 A;  1AH5 A;  1I69 A;  1Q35 A;  1FQB A;  5CMC A;  2A5T A;  1GVC A;  3PMV A;  2Q74 A;  2F35 A;  2NOO A;  1PBQ A;  1AOV A;  3QSL A;  3SEX A;  1H45 A;  3IAZ A;  2THI A;  1FTL A;  4GWZ A;  3OSR A;  3VVF A;  3VLV A;  1FQD A;  1N3X A;  4IY5 A;  3ECR A;  3SKP A;  3MWB A;  3HPI A;  3MBP A;  3CG3 A;  3MW0 A;  3E79 A;  1EZ9 A;  2GH9 A;  4PE5 B;  2QPQ A;  2DE3 A;  4XFE A;  3RUM A;  1BTJ A;  4WXJ A;  2ALU A;  3PD8 A;  1M5F A;  5KZT A;  5H8H A;  3IK6 B;  4ZDM A;  3KC1 A;  3D4C A;  1MDQ A;  3A29 A;  3ZKK A;  4YKJ A;  2DVC A;  5KCJ A;  1RDZ A;  1Y4C A;  3O9P A;  3G7W A;  2F78 A;  5H8Q B;  2Y5K A;  3VXC A;  1JVY A;  2Y7P A;  1ZLQ A;  5J1D A;  4ZZE A;  4LON B;  5I3S A;  3C4M A;  5KDT B;  3OXN A;  4AB5 A;  3BBR A;  2P3N A;  1MXX A;  1IIT A;  3LR1 A;  4XEQ A;  3RPW A;  4I40 A;  4RXL A;  2DSF A;  4ZEI A;  4ZS9 A;  3IFC A;  4F1U A;  1QKA A;  2ESN A;  2R9J A;  3G3G A;  1NUY A;  2F8D A;  4IO6 A;  3EKI A;  2CZI A;  4PDH A;  3QK6 A;  5LOM A;  1YZ0 A;  2F3B A;  4KHZ E;  4QXD A;  1P1U A;  2B4L A;  1HSE A;  1NV5 A;  1VR5 A;  4UAB A;  1LFH A;  4XXU A;  2XX7 A;  4GQO A;  1B4H A;  1FQC A;  4XKN A;  4P47 A;  3MQ9 A;  4Q30 B;  4PFW A;  3I3V A;  2OBG A;  4MCO A;  4IY6 A;  4DXB A;  2WBB A;  4X1B A;  3RTF B;  5TP9 B;  1H44 A;  2F7A A;  4TQU Q;  5KCJ B;  3IB1 A;  5JTY B;  3OO9 A;  2UVI A;  1O63 A;  1IUD A;  1UTH A;  4PQJ A;  4FEB A;  3PMX A;  4NGU A;  1K9Z A;  2V3T A;  4NF8 B;  1FJ9 A;  5CI5 A;  3UOR A;  4GWX A;  4N8G A;  2DWJ A;  1SDX A;  3QMF A;  1LAF E;  4GL8 A;  3KN7 A;  4OYV A;  1HSL A;  2DWI A;  2XWK A;  5ICQ A;  5JTY A;  2Q2A A;  4UA8 A;  3MJN A;  3U72 A;  1FTJ A;  1IZ1 A;  4MFI A;  4G68 A;  5I57 B;  4QBA A;  5A5X B;  3QUF A;  4HE1 A;  1FBD A;  4MHF A;  4RJZ A;  1DPP A;  4NN3 A;  3K6U A;  2O1L A;  4OER A;  4MNI A;  3RLF E;  2QVV A;  2ONK E;  1Y1M A;  2W7Y A;  2IEE A;  1NKX A;  5T3J A;  4I8C A;  4RY1 A;  2AL5 A;  4ZEF A;  4OEV A;  4F19 A;  4DI4 B;  1FPB A;  1D9Q A;  2UVG A;  3T9H B;  4OEU A;  1NV1 A;  2Q8M A;  1MXU A;  4P1E A;  1R9L A;  2FA7 A;  1SD3 A;  5CBR A;  2P2A A;  3S2V A;  5I2K B;  1VFE A;  4BDN A;  1ZMG A;  4LZ8 A;  2V93 A;  5DYH A;  3CIJ A;  3K01 A;  3K0V A;  4JWO A;  3K02 A;  1Y4T A;  3LC8 A;  2Z8D A;  5F24 A;  3U93 A;  4RK9 A;  3T93 B;  5LDZ A;  2FNC A;  2ZZX A;  3TCF A;  4N07 A;  1UTH B;  2RIN A;  2V3U A;  4GF8 A;  4YB6 A;  2XWO A;  2PCR A;  1ZBM A;  4MNC A;  1SW1 A;  4GOT A;  3VFJ A;  3TTM A;  1EZO A;  5AA2 D;  3FVG A;  5EYH A;  4YU0 A;  4H8J A;  2I58 A;  1Y3Q A;  4EQ9 A;  4GXA A;  1KA1 A;  3LSF B;  4DDD A;  2XA5 A;  3H06 B;  2CZL A;  1SI0 A;  2O6A A;  1JVX A;  3KC0 A;  3VLW A;  3N6T A;  4R74 A;  1MPC A;  3LSX A;  4MJO A;  5DT6 A;  4GBW A;  2XD2 A;  4HE0 A;  1FPD A;  3DLN A;  3KZG A;  4ISU A;  1F9B A;  4QFN A;  4N81 A;  5CRY A;  3KJT A;  4U1O A;  5IZ1 A;  1EYJ A;  1QGX A;  3HFU A;  1FBG A;  5TPA B;  2KLF A;  1NNT A;  1TFA A;  2ZNU A;  1OIB A;  3R6U A;  5B7D A;  4PAI A;  3RNN A;  3QYT A;  4P9K A;  4QSD A;  1B3E A;  1P1Q A;  4I9D A;  4JDF A;  3H3G A;  4IO4 A;  4H8I A;  4C1T A;  1R9Q A;  4EXL A;  1LAG E;  2D3I A;  4OA4 A;  5FBP A;  1FTK A;  3O6I A;  4ESW A;  3MC2 A;  4IO2 A;  3RT6 B;  2VD2 A;  1DSN A;  4GD5 A;  1QUL A;  1FSA A;  1FCK A;  4IO7 A;  3B7D A;  1WDN A;  4GLI A;  2V4C A;  1P1O A;  3FJ7 A;  5DVF A;  4RK2 A;  4O3A A;  2ZNT A;  2I0B A;  4OVQ A;  4AS5 A;  3MUQ A; 
#chains in the Genus database with same CATH homology
 1PB7 A;  1MXZ A;  3R26 A;  5I58 A;  5L9O A;  1WVJ A;  1B3L A;  1NL5 A;  1N84 A;  1BP5 A;  2LAO A;  2M8C A;  1IXH A;  1GTK A;  3DP8 A;  1MXV A;  3FXQ A;  2RF1 A;  3V89 B;  2I0C A;  3QUJ A;  4OEN A;  2XXW A;  1FTM A;  1B3F A;  1FQE A;  3TTN A;  3PD9 A;  2OJT A;  4U4X A;  1JQF A;  2PT1 A;  4KYS A;  4YKP A;  4FAT A;  4G8M A;  4YAH X;  4QFO A;  4OFO A;  3MZ1 A;  3MZB A;  3D4G A;  2AIX A;  3FZV A;  1FW0 A;  1GV8 A;  4ECF A;  4Q5T A;  3QIM A;  1FQF A;  2F5X A;  1T0K A;  1IQ7 A;  3IOR A;  1AL3 A;  1DTZ A;  1BIY A;  2UYF A;  4G68 B;  4U1Z A;  3TAJ A;  4EF1 A;  5I57 A;  5L9S A;  3G3K A;  3G3I A;  1N04 A;  4NWC A;  2QRY A;  2XHD A;  4C0R A;  3W9W A;  1M5E A;  2DE2 A;  2F6G A;  2ANJ A;  1JET A;  2QSX A;  3CFL A;  3O66 A;  1MPB A;  1LBC A;  3M8U A;  3KOS A;  1LST A;  2XXI A;  1B0H A;  4NE4 A;  2RC8 A;  3WAE A;  3I5O A;  3K6W A;  2F36 A;  2YJP A;  1EZP A;  4OZ9 A;  1H43 A;  1MY1 A;  1XVY A;  3Q29 A;  4NF5 A;  3TUS A;  3OO8 A;  1RYX A;  1VFD A;  2ABH A;  3PUW E;  3HO7 A;  1SYI A;  2Q2C A;  3FUZ A;  3LSL A;  3K6X A;  3MAM A;  1AH5 A;  3C36 A;  1UTB B;  1I69 A;  2O51 A;  4I62 A;  3SER A;  3HHG A;  1Q35 A;  1B5I A;  1NNF A;  2QMW A;  3O97 A;  2Y84 A;  1FQB A;  3OEK A;  4DCX A;  5CMC A;  1SW2 A;  2A5T A;  1GVC A;  2Q89 A;  4EUO A;  3PMV A;  2F7B A;  3OEN A;  4NED A;  4MF3 A;  3F11 A;  3K6V A;  4C1U A;  1PC3 A;  1DMB A;  1N7W A;  2F35 A;  2I3V A;  2OCU A;  2QL3 A;  2UYE A;  3M3L A;  2NOO A;  4IGR A;  4RYA A;  1BLF A;  3USD A;  3VVE A;  4ESX A;  1PBQ A;  1MXW A;  5FHO A;  1QUI A;  4H5G A;  3QSL A;  3SEX A;  1H45 A;  2B3F A;  1QVS A;  1USY H;  2THI A;  3FAT A;  3IAZ A;  3SEW A;  3TEP A;  1FTL A;  3MP6 A;  3C33 A;  4YMB A;  5DVI A;  1YTV A;  5ISU A;  5AA3 A;  3OSR A;  1Y3N A;  3K1M A;  3VVF A;  4U23 A;  5I2K A;  3E3K A;  3VLV A;  5HBC A;  1FQD A;  1N3X A;  4F3B A;  1LGB C;  5TP9 A;  4IY5 A;  3ECR A;  4YZZ A;  5JEI A;  1H76 A;  3SKP A;  3MWB A;  3HPI A;  3GZG A;  3MBP A;  1P1N A;  3A3U A;  3CG3 A;  3MW0 A;  4Q0C A;  1TT1 A;  3MPL A;  1EZ9 A;  2GH9 A;  4PET A;  1Z7M E;  1PEB A;  4PE5 B;  2HCA A;  4F1V A;  4FIM A;  4Z0I A;  5EHM A;  2QPQ A;  4H65 A;  2DE3 A;  4G77 A;  4R6H A;  3A3C A;  2H98 A;  4X48 A;  3RUM A;  4K3F A;  1Q1K A;  1BTJ A;  2E0S A;  5AA4 B;  3KGC A;  3TEL A;  2F34 A;  1XHY A;  4WXJ A;  4P11 A;  1B40 A;  2ALU A;  3TMG A;  3VDF A;  2HAV A;  3T9X B;  3PD8 A;  1M5F A;  5KZT A;  1XOC A;  4N13 A;  1B3H A;  1NFT A;  4F3P A;  4JSD A;  3TPA A;  5H8H A;  3IK6 B;  3OO7 A;  1B7U A;  3DP4 A;  4ZDM A;  4ONY A;  3T22 A;  5KDT A;  3K00 A;  3D4C A;  4JXI A;  1MDQ A;  1OLC A;  3LSW A;  2XXQ A;  2HQ0 A;  4F22 A;  1Y9U A;  2DE4 A;  2H9B A;  3FGS A;  2VP1 A;  1URD A;  2Z22 A;  3ZKK A;  4YB5 A;  4YKJ A;  4FAJ A;  3TFL A;  2DVC A;  2O1M A;  5KCJ A;  3N94 A;  3FV2 A;  1Y1Z A;  3TQW A;  4BDL A;  3IX1 A;  1Y4C A;  3SET A;  3O9P A;  5H8S A;  3C35 A;  2RCB A;  1YPN A;  3G7W A;  3IJX B;  4MLQ A;  4YKI A;  3VV5 A;  5CC2 A;  1A54 A;  4KR5 A;  1RKM A;  3RY3 A;  4G8N A;  2F78 A;  4H67 A;  2P0S A;  4R72 A;  3E9X A;  4F1Y A;  1URG A;  1XVX A;  1M5D A;  5H8Q B;  3MVZ A;  4BDO A;  3VXC A;  3ZS6 A;  1MG1 A;  1JVY A;  2Y7P A;  5H8F B;  3GBB A;  1MXY A;  3PV0 E;  3U8Q A;  1II5 A;  4G4P A;  1USY E;  1FQA A;  4R75 A;  5AE4 A;  2GHA A;  3H7M A;  4YB7 A;  2DXR A;  1ZLQ A;  1SQY A;  3O2A A;  4LP2 B;  4OVJ A;  3V5A A;  3EQ1 A;  3FXR A;  4ZZE A;  5J1D A;  4KQP A;  1MQH A;  2UXA A;  1LB8 A;  3K4U A;  3C4M A;  4LON B;  5DVJ A;  3THI A;  5KDT B;  3OXN A;  5I58 B;  4ZEK A;  4AB5 A;  3Q28 A;  1NNK A;  5FTI A;  2NVU B;  1LCF A;  4OET A;  3PU5 A;  3UIF A;  1SW5 A;  2I3W A;  4F2Q A;  3CG1 A;  1A7L A;  2ZYN A;  3B6T A;  4LZ7 A;  3BBR A;  4U4S A;  1MXX A;  1IIT A;  2XXR A;  3KFM A;  3LR1 A;  3UK4 A;  4I1D A;  3DP6 A;  4FE8 A;  5HM4 B;  1VE4 A;  3RPW A;  1P1W A;  2HZK A;  4FED A;  1I6A A;  1I6Q A;  1JW1 A;  2PX1 A;  3H4Z A;  4RXL A;  5AA2 A;  2DSF A;  1IXC A;  3MPK A;  4O3C A;  4ZEI A;  1O64 A;  4ZS9 A;  4F1U A;  1HSJ A;  1QKA A;  1UIU A;  2F97 A;  2FYI A;  2NUV A;  1IIW A;  5TPA A;  4AB6 A;  2ESN A;  2R9J A;  1QUK A;  3G3G A;  4JBZ A;  1IEJ A;  1KWH A;  3KOT A;  3ODB A;  5A5X A;  1XT8 A;  2F8D A;  1VSO A;  2AL4 A;  4IO6 A;  2H4I A;  3IO6 A;  3QXM A;  1JEU A;  2CMO A;  4FEC A;  3QK6 A;  1QW0 A;  5ITO A;  3UN6 A;  2XXU A;  1NMU A;  4THI A;  4DCY A;  5LOM A;  2XXP A;  3PUV E;  3OD7 A;  2ZYO A;  4R6Y A;  1PBP A;  3GLB A;  3KG2 A;  3IL1 B;  4KHZ E;  1AIV A;  5IKB A;  1DOT A;  2GHB A;  1P1U A;  3PPR A;  2HAU A;  3S9M C;  4BDR A;  1HSE A;  4F3G A;  3HN0 A;  2REJ A;  2I4C A;  2V25 A;  1JW4 A;  1VR5 A;  2E1S A;  5CMB A;  1LFH A;  3AXF A;  4XXU A;  5I59 A;  2XX7 A;  3PPQ A;  4GQO A;  1B4H A;  1LBB A;  3MVY A;  1DPE A;  1FQC A;  1SI1 A;  4XKN A;  3FXU A;  4OTE A;  3OEM A;  3Q25 A;  3MQ9 A;  3O29 A;  3FVO A;  1N76 A;  1B32 A;  2PMS A;  2Z8F A;  4OES A;  2XX9 A;  4Q30 B;  2DOJ A;  1YCJ A;  4LA9 A;  3UGW A;  4DXC A;  4PFW A;  1UTB A;  2Z23 A;  3I3V A;  4JB7 A;  4YMA A;  2HFB A;  1MM7 A;  1US5 A;  2YLN A;  4F31 B;  2OBG A;  1B1X A;  4ZE8 A;  5AA4 A;  5DTB A;  4F3S A;  4IY6 A;  4N6P A;  4OWD A;  4DXB A;  4UAC A;  1FTO A;  2B65 A;  4GFR A;  3SEU A;  5H8F A;  4X1B A;  1SBP A;  3RTF B;  3B6W A;  4P0I A;  4F39 A;  5TP9 B;  4OMB A;  4ELO A;  3HHF A;  1H44 A;  1I6B A;  4R9F A;  5L9M A;  2F7A A;  1EU8 A;  1UIV A;  3MVW A;  4RPO A;  1A55 A;  2ZXT A;  4TQU Q;  4X1D A;  5FTH A;  5KCJ B;  3IB1 A;  5JTY B;  2NXO A;  2GRV A;  2RC9 A;  3OO9 A;  2RC7 A;  2UVI A;  1O63 A;  1IUD A;  1GR2 A;  1UTH A;  1JEV A;  4FEB A;  4FJP A;  4IO3 A;  4PQJ A;  4RA1 A;  1A99 A;  1B51 A;  4KCD A;  3PMX A;  1BKA A;  1RYO A;  2DYX A;  4NF4 B;  1D4N A;  4LQ5 A;  3FJG A;  2DS9 A;  3CI8 A;  3I6V A;  4R2F A;  3UP9 A;  4JSO A;  1D3K A;  2V3T A;  2H25 A;  2OK2 A;  4NF8 B;  3SES A;  3LUY A;  3CRB A;  5CI5 A;  3CFX A;  4OQO A;  1N3W A;  3UOR A;  2DVZ A;  2HXW A;  2REG A;  3O6H A;  1LAH E;  2DWJ A;  1SDX A;  2PYY A;  2ZNS A;  3CVG A;  4MLV A;  3SDF A;  3V8X B;  3IR1 A;  4NF5 B;  4IGT A;  1LAF E;  4AQ4 A;  3TDJ A;  3K1N A;  1R6Z A;  2GFE A;  4GL8 A;  2RCA A;  1JNF A;  4NF4 A;  3KN7 A;  3T96 B;  4OYV A;  4DE8 A;  5H8Q A;  3E4R A;  1HSL A;  2DWI A;  4G68 C;  4LAT A;  5ICQ A;  1JW5 A;  5JTY A;  1ZU0 A;  1MQJ A;  2XXY A;  3HV1 A;  3VVD A;  2Q2A A;  3A09 A;  1IXG A;  4UA8 A;  3JV9 A;  1MY3 A;  3MJN A;  5M2V A;  3U72 A;  1SYH A;  3W9V A;  1FTJ A;  5ELV A;  1IZ1 A;  4PFY A;  4MFI A;  3R7X A;  2A5S A;  3H6T A;  3PUZ E;  4G68 A;  5I57 B;  4TOZ A;  5F7V A;  2QJE A;  3FVN A;  5A5X B;  1H3D A;  3QUF A;  4GRK A;  1MY2 A;  2G93 A;  4KD5 A;  1B9J A;  3H6U A;  3M3K A;  4KCC A;  2I6E A;  4O3B A;  1DPP A;  3N6U A;  3K6U A;  2O1L A;  2UVH A;  4OER A;  4H5F A;  4RJZ A;  3EF7 A;  3TTR A;  4YIC A;  3VE1 B;  2A5T B;  1CE2 A;  2DWH A;  4LZ5 A;  5I84 A;  3RLF E;  5CBS A;  4R6K A;  3TCH A;  4LVQ A;  1B0L A;  4XTC Q;  1B1H A;  1Y1M A;  2ONK E;  2X7Q A;  4WEP A;  2W7Y A;  2IEE A;  1NKX A;  4JWY A;  5FHN A;  4EQB A;  4I8C A;  1MPD A;  1MM6 A;  4MBP A;  1TXF A;  2AL5 A;  4NTL A;  4R73 A;  1CB6 A;  1DTG A;  1WOD A;  2O69 A;  3C9H A;  4OEV A;  4ZEF A;  3TOD A;  4EDP A;  2Q9T A;  3CSG A;  5DEX B;  4ELQ A;  4F19 A;  2PBW A;  4QFP A;  3TQL A;  3PPN A;  2UVG A;  3T9H B;  4OEU A;  1NH8 A;  1SW4 A;  3BFU A;  1LLS A;  2O7U A;  1A8E A;  3KSJ A;  1MXU A;  3KN8 A;  1R9L A;  1NNP A;  5HPQ A;  2FA7 A;  1SD3 A;  3MP1 A;  2Q8J A;  5CBR A;  4POW A;  4F2O A;  3Q26 A;  4IB2 A;  2P2A A;  3FIR A;  3S2V A;  3S9N C;  4QHQ A;  5I2K B;  2V3Q A;  2XX8 A;  2ZYK A;  3BFT A;  2PT2 A;  3IOW A;  4NF6 B;  5FHM A;  4F18 A;  1Y3P A;  1MH4 A;  1VFE A;  2VOZ A;  4MH5 A;  4R2B A;  3TTK A;  5H8N B;  4H1X A;  1S7Y A;  4BDN A;  1B7H A;  1ZJL A;  4GIZ A;  1PB9 A;  2HEU A;  4XIG Q;  1ZMG A;  4PFT A;  4GWO A;  2V93 A;  4LZ8 A;  5DYH A;  1US4 A;  3CIJ A;  3K01 A;  4EQ7 A;  3IO4 A;  3OSQ A;  4HW8 A;  3FV1 A;  3IOU A;  2Y7K A;  3K0V A;  3W15 C;  3N26 A;  4JWO A;  2NWJ A;  3K02 A;  3LBS A;  5H8H B;  4DLD A;  5AA2 B;  1Y4T A;  2D21 A;  2Y7W A;  3LC8 A;  4QFL A;  3GXA A;  3BKI B;  2Z8D A;  2RKM A;  1LFI A;  2O68 A;  3RGY A;  1B46 A;  4Q8R A;  1LAX A;  1N7X A;  1P99 A;  1PDA A;  3JYR A;  3KEI A;  3V83 A;  1LCT A;  4X9T A;  2OWT A;  2V84 A;  4KFQ A;  3U93 A;  2Y7I A;  1D9V A;  3U94 A;  4RK9 A;  2XXX A;  3G3J A;  3G3F A;  1B2H A;  2XXV A;  4KPT A;  2QS3 A;  3T93 B;  3H6W A;  5IAI A;  2FNC A;  2OLB A;  5BWJ A;  5I2N A;  2R71 A;  4KI0 E;  3KJ7 A;  1SVX B;  2I48 A;  3OMB A;  3PUX E;  1MY0 A;  2XD3 A;  1UTH B;  3P7I A;  4N07 A;  3TCF A;  2RIN A;  2V3U A;  3HST A;  4GF8 A;  2ZMB A;  4JWX A;  4YB6 A;  2DXY A;  3PPO A;  5B70 A;  1S50 A;  4M4G A;  2ONS A;  1MDP 1;  1ZBM A;  1TWY A;  3G3H A;  4QFK A;  4P0G A;  3WAF A;  1MRP A;  3KN3 A;  1OQH A;  1QJM A;  1SW1 A;  2O7I A;  3O28 A;  4GOT A;  3VFJ A;  3JZJ A;  3MP8 A;  3TTM A;  3QAX A;  3IJO B;  1LB9 A;  2QS4 A;  4PFU A;  5H8N A;  1OLA A;  3FD3 A;  4XKR A;  1ZKB A;  3PGF A;  5AA2 D;  3FVG A;  1EZO A;  1ZTY A;  2HZL A;  4YU0 A;  3C31 A;  3DEL B;  2DQV A;  2I58 A;  1Y3Q A;  3FJM A;  2H99 A;  4H8J A;  1L5T A;  3CFZ A;  4EQ9 A;  1ZIU A;  4Z7E A;  1XS5 A;  1B5H A;  4GXA A;  4ND9 A;  3N5L A;  2F6P A;  3EHT A;  5CMK A;  1URS A;  3LSF B;  4OFJ A;  4U21 A;  4BDM A;  4DDD A;  4ELP A;  1B58 A;  1GGG A;  4F29 A;  3C32 A;  5K2Y A;  2XXH A;  3H06 B;  3K1P A;  4G2Z A;  2CZL A;  3O6G A;  4QF9 A;  1ATG A;  2I4B A;  3TCG A;  3U1O A;  1MS7 A;  3M3F A;  1IXI A;  4GL0 A;  2OZZ A;  1SI0 A;  2O6A A;  1JVX A;  4NMY A;  3RN8 A;  3VLW A;  4M1V A;  3UA8 A;  4YKK A;  1AMF A;  3N6T A;  4R74 A;  2ONR A;  1MPC A;  1OVB A;  1POT A;  3U92 A;  2PVU A;  4WKM A;  3LSX A;  5ICT A;  4KYE A;  1B6H A;  3ZSF A;  1AOV A;  1M5C A;  3B6Q A;  4EF2 A;  4ZZA A;  2X7P A;  3ILT B;  5DT6 A;  4PP0 A;  3SEV A;  2DP8 A;  2XD2 A;  3H6V A;  4EXK A;  3S9E A;  3KZG A;  3DLN A;  3E13 X;  5BUU A;  4GVO A;  4NWD A;  3GBA A;  2F7C A;  4G8H A;  3MVX A;  3CR9 A;  4ISU A;  1F9B A;  4LQ2 A;  1QUJ A;  4QFN A;  3VLU A;  2XXT A;  5L8D A;  5EHS A;  2AYS A;  1UQW A;  2VHA A;  4HS7 A;  5I56 B;  4NF6 A;  3EPE A;  1D9Y A;  2IA4 A;  2ZYM A;  3OEL A;  3OOA A;  4TLM B;  5CRY A;  3ZKL A;  2YPN A;  1ANF A;  4BLA A;  3KJT A;  4U1O A;  4RPN A;  3S4U A;  4DXU A;  4XKQ A;  5I56 A;  1QKB A;  4DZ1 A;  3ONM A;  1EH3 A;  3S9L C;  3IOV A;  3DM0 A;  4H6D A;  4ZED A;  2VGQ A;  3Q27 A;  4TLL B;  4IO5 A;  1J1N A;  5AA1 A;  1LFG A;  3HCQ A;  4OHN A;  1MY4 A;  1Y20 A;  1B5J A;  3KSX A;  3K2D A;  1A8F A;  5TPA B;  5CMM A;  3C34 A;  3MZ9 A;  2KLF A;  1B05 A;  1NNT A;  2I49 A;  1TFA A;  2UVJ A;  1OIB A;  2ZNU A;  2BJJ X;  3R6U A;  5B7D A;  1B4Z A;  3EHU A;  3T66 A;  3PMW A;  1ELJ A;  2QMX A;  1XC1 A;  3RNN A;  1B7Z A;  3FVK A;  3QYT A;  4KYD A;  4U2R A;  4FOR A;  3L6H A;  1R1N A;  2QS1 A;  4HTG A;  3PUY E;  1B3E A;  4QSD A;  3RQT A;  3RT8 A;  3TYH A;  1P1Q A;  4NF8 A;  3KBR A;  4OFL A;  4H0W A;  4I9D A;  1O7T A;  1MQD A;  4JDF A;  5ITP A;  5CM6 A;  3ILU B;  4QRZ A;  1N0T A;  4E0W A;  3H3G A;  4IO4 A;  4XKP A;  4H8I A;  4C1T A;  3SEY A;  4RNS A;  4R9G A;  3TZA A;  1R9Q A;  3PPP A;  1POY 1;  3CSB A;  3OO6 A;  3EHS A;  5F1Q A;  1LAG E;  4EXL A;  3T9U A;  2P1S A;  3VXB A;  2WKY A;  2D3I A;  4ELR A;  2R6G E;  2X26 A;  4HCW A;  3FAS A;  5K2X A;  2OWS A;  5EYF A;  4RY1 A;  1B52 A;  4U22 A;  1Z7N E;  4QSC A;  1PB8 A;  1OQG A;  3RTW B;  1FTK A;  1MQI A;  3O6I A;  3TKD A;  4ESW A;  1M5B A;  3EN3 A;  4ZEB A;  3IB2 A;  3MC2 A;  4IO2 A;  4POX A;  4DIG A;  1B3G A;  1NH7 A;  1S9T A;  4GXS B;  3RT6 B;  2VD2 A;  1DSN A;  5TU0 A;  1YAE A;  2O84 X;  2Z8E A;  2Q88 A;  3TTL A;  1OVT A;  4HCY A;  4GD5 A;  1QUL A;  4OXV A;  2DWA A;  5I2N B;  2VD3 A;  4L17 A;  4WED A;  1FCK A;  2G29 A;  5DEX A;  4IO7 A;  5JK4 A;  1OMP A;  1WDN A;  3B7D A;  4BDQ A;  3IB0 A;  2D5W A;  1MQG A;  2B3B A;  3IOT A;  1MH3 A;  3T9V A;  4ZE9 A;  4GLI A;  1A40 A;  1P1O A;  4ZEC A;  3FJ7 A;  3L6G A;  4QSE A;  4RK2 A;  5DVF A;  4O3A A;  5I59 B;  4LUB A;  4E0X A;  2H5Y A;  2ZNT A;  2I0B A;  2Y7R A;  3H03 A;  1TFD A;  2QS2 A;  3MUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...