1GGGA

Glutamine binding protein open ligand-free structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
220
structure length
220
Chain Sequence
LVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glutamine-binding protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Binding protein
molecule keywords GLUTAMINE BINDING PROTEIN
total genus 62
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gggA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gggA01
3TTRA 3IORA 1MDQA 3K2DA 1FQEA 2DE4A 1OMPA 2HQ0A 2XXYA 3RT8A 3TCGA 4ZEFA 5B70A 1I6AA 1MQDA 2O51A 2F34A 3HHFA 3BFTA 4PFUA 4DZ1A 3PU5A 4R72A 1OQGA 3MPLA 2F78A 2V84A 2XD2A 3PPRA 1WVJA 2THIA 2XD3A 3FVOA 3FXUA 3OMBA 1NNKA 3G3KA 3RT6B 3VFJA 5KZTA 1DTGA 1RKMA 4F31B 4ELPA 2XXHA 4ZECA 2V3TA 2E0SA 4QFKA 2H9BA 2F7AA 3QUJA 3OO8A 3K1PA 3SKPA 4PFYA 2P1SA 4YB5A 3MPKA 4H8JA 4MBPA 1ATGA 5DVFA 5H8SA 4ND9A 1H44A 3W9VA 1IEJA 4F2OA 2QSXA 1A99A 5AE4A 4HCYA 2O1MA 2O6AA 3PUXE 4KR5A 1P1QA 1RYOA 4NF6A 3SEUA 4F22A 4P0GA 3QXMA 1N3WA 2DQVA 2D5WA 1VR5A 4LZ7A 1GTKA 1LBCA 1Y4CA 5I2NB 3U93A 1YPNA 3RUMA 3DLNA 2DXYA 3BBRA 4JWYA 4KD5A 4RA1A 4WXJA 4YAHX 5I58A 4C0RA 1NKXA 2DE2A 4K3FA 3UGWA 3FVNA 3KG2A 3TDJA 4F39A 3CSGA 4FEDA 1MDP1 1B3LA 1B32A 3H03A 3MW0A 1SW1A 2QRYA 3DELB 3H06B 3O97A 1Y3QA 5H8QA 3WAEA 3SEXA 1B51A 4NF5B 4ZZEA 2I58A 2I3WA 3HSTA 3TCHA 1BTJA 2REJA 4U1ZA 3O6GA 5DEXB 3K01A 2RCBA 4XKNA 3LSWA 3SERA 1JEUA 3OO9A 3PUWE 1MXZA 2OWTA 1LAFE 2VOZA 1LFGA 1OIBA 1URGA 3H6VA 2ZNUA 3K1NA 4GXSB 4HS7A 1QKBA 1TT1A 1B0HA 2Z22A 3KEIA 3RGYA 2ZNTA 2V93A 2FNCA 1Z7ME 2XXRA 3MZ1A 1ZBMA 3QK6A 5ISUA 1HSLA 3C31A 1IXHA 4IO5A 2QJEA 4RYAA 3U1OA 4OQOA 3KN8A 2DWJA 3PD9A 1ZMGA 4R9FA 1PB8A 2HXWA 4BDOA 5I56A 2DE3A 5KDTA 2DS9A 3L6GA 2HZLA 4HW8A 1FQDA 2PT1A 2DYXA 3VVDA 3LUYA 3PGFA 3ZKKA 5JTYB 3G3FA 1P1NA 4G68C 3FJ7A 4DDDA 3OSRA 3MZBA 5FTHA 4QF9A 1JVYA 3IOWA 3RN8A 3KOSA 2F7CA 3HV1A 4OYVA 2RC7A 3T96B 1SDXA 5DTBA 1DPPA 2LAOA 4LZ5A 3HO7A 1I6QA 2DWAA 3EN3A 2XX9A 2A5TA 5H8HB 4E0WA 2ALUA 2VHAA 4BDQA 2XXIA 4YU0A 3TAJA 1Y9UA 5ICQA 4QFNA 1SD3A 1LB8A 2GHAA 3KJ7A 3DM0A 4TLMB 3PMXA 2D21A 1MY3A 3Q27A 1B1HA 4FEBA 3CR9A 3MBPA 4H65A 4E0XA 1B6HA 3TTKA 1MXWA 3LSLA 3KSXA 4I9DA 4IO2A 4OEVA 5HBCA 3TTLA 3N6TA 4FECA 4POXA 1Q1KA 2OCUA 5TPAA 3VE1B 4ZE9A 2Y7KA 3CI8A 1UTBB 1B9JA 3IB0A 4PFWA 4FIMA 4R75A 4XXUA 1D3KA 3PV0E 4OESA 3V89B 4G2ZA 1QUIA 1B58A 1N0TA 2DWIA 1IUDA 3EPEA 4G68A 2H5YA 2V25A 4GD5A 3U72A 2XXQA 5I57A 5K2XA 2X7PA 2H4IA 1PC3A 3GLBA 4F1YA 3S9MC 1B5HA 4YMAA 4DCYA 2XXVA 3K6UA 4F19A 1QJMA 2G93A 3FGSA 4OERA 1EZPA 3O28A 2DP8A 4NE4A 1OLAA 1LCTA 1SI0A 1IXGA 4YKIA 3K0VA 4IO7A 5EYFA 3KFMA 5FHOA 4IO6A 4ZEBA 2OZZA 1IXCA 2HAUA 2Z23A 1A54A 3C32A 4BDNA 3S9NC 1P99A 5L9SA 4R74A 5FTIA 3KN3A 3UORA 1MRPA 2XX7A 2Y7WA 2QS2A 3MC2A 3R26A 5FHMA 1N3XA 3VV5A 4LP2B 1SVXB 3LR1A 4MFIA 3FUZA 1DPEA 4ELOA 2YLNA 3IB2A 1B3GA 4IO4A 4XKRA 3LSXA 3OOAA 3O9PA 4GQOA 1NMUA 1PBPA 3ECRA 1SYHA 3OD7A 1B3FA 3PPPA 1MPDA 1Y20A 4RPOA 4EXLA 5A5XB 2CMOA 5IAIA 2W7YA 3FIRA 1Y4TA 2P2AA 4NF8A 4NF4B 4H5GA 3E13X 4NMYA 1SYIA 5I84A 2Y7IA 3MAMA 1PEBA 1Y3NA 3H6WA 4KI0E 4X9TA 5DT6A 5DVJA 3TTNA 3IX1A 1PBQA 5TU0A 3T9HB 5JTYA 4U21A 1LGBC 2XXUA 2PX1A 4BDMA 2DSFA 1MG1A 1Y1ZA 2HZKA 4Z0IA 3FJGA 3SEVA 3MQ9A 2F8DA 4OFJA 1DSNA 4H67A 3GXAA 3VVEA 1D9YA 2DXRA 3M3FA 3CFLA 1URDA 1SBPA 2FA7A 3KBRA 4G4PA 4X1BA 1T0KA 2A5SA 5AA3A 3TQLA 2B65A 3MVWA 4QFOA 4F1VA 2NOOA 3DP8A 1XVXA 3C9HA 5DVIA 5ELVA 2ONKE 1JW1A 2Q9TA 1NH8A 4H6DA 5DYHA 1US4A 1B40A 3EQ1A 2F36A 4JDFA 4LONB 3SEWA 1QUKA 4X1DA 3HHGA 2H25A 3UIFA 1S9TA 2R71A 4BDRA 5H8QB 1MY4A 4DLDA 4OTEA 3K6VA 3QUFA 4JB7A 4OMBA 2UVJA 4ESXA 1OQHA 2XXXA 1F9BA 4KPTA 3N94A 3JYRA 3CFXA 1JQFA 3H7MA 4RXLA 4YB6A 5I58B 1M5FA 1MXUA 2OWSA 5CMKA 2GRVA 2Z8EA 2ONSA 2QPQA 2Z8DA 1J1NA 2B3FA 2CZLA 4KYSA 1MS7A 3DP4A 3O29A 2GFEA 1SW2A 2UYFA 3SETA 4M4GA 3CSBA 3LC8A 1ZTYA 1P1UA 4JSDA 3I6VA 4O3BA 3TELA 4DXUA 1LFIA 4EDPA 3RNNA 3U92A 1LFHA 3C34A 1B46A 1MQHA 3C35A 3Q29A 4POWA 3CVGA 3RPWA 4C1TA 2O68A 3OXNA 3VXBA 1MY1A 1YTVA 3BKIB 2AL4A 1M5DA 4G68B 3IJXB 1Q35A 5I57B 1JETA 1A8FA 3B6QA 3MVXA 3PPNA 4QFPA 1MY0A 4RPNA 2GHBA 4FJPA 4KHZE 4X48A 1NFTA 2YJPA 4YB7A 3H3GA 3V83A 2QL3A 4ZZAA 1XT8A 3S4UA 4JSOA 4ELRA 4FATA 5H8FB 1LAXA 1TWYA 4GWOA 4IY5A 2I3VA 3VLWA 4DXCA 1MXYA 3A3UA 1DOTA 3U8QA 4R6YA 2REGA 1WDNA 3CRBA 3W9WA 4EQ7A 1OVBA 1BIYA 2Q2AA 2YPNA 3IK6B 3S2VA 3THIA 3TODA 3D4GA 3UN6A 2NUVA 1USYH 2X7QA 1JVXA 1M5EA 5JEIA 1QW0A 3FASA 5KCJA 4N07A 5F7VA 2UYEA 3MP1A 4F29A 1N76A 1A55A 1SW4A 1Z7NE 2VD2A 3B6TA 4LQ2A 2FYIA 2A5TB 4N13A 3VLUA 1O63A 1JW5A 2RINA 5EHSA 1O7TA 1L5TA 2M8CA 1AMFA 3EHSA 2QS4A 4G77A 5ITOA 4U22A 4XKQA 5LOMA 3IL1B 2ABHA 3E4RA 4HCWA 4IB2A 3ZS6A 1I69A 3FATA 5H8NB 4NTLA 3BFUA 1KWHA 1LLSA 4NWCA 3IAZA 4DE8A 3H6TA 4DXBA 1PDAA 2O69A 2PMSA 3F11A 4C1UA 3KZGA 2DVCA 1B5JA 1MPCA 1R6ZA 4UACA 1B1XA 3FXRA 4G8HA 4LQ5A 3MP6A 4F3SA 4FAJA 4IY6A 1M5CA 5A5XA 1UTHA 3EHTA 4F3BA 4H1XA 3KN7A 2VGQA 4U1OA 4I1DA 1SW5A 5AA1A 1MQGA 4BDLA 2ONRA 3MWBA 3Q25A 2BJJX 3IOUA 4ZEKA 1AOVA 3E9XA 2O7UA 4M1VA 4JXIA 1B4HA 5KCJB 1VSOA 1Y1MA 4I8CA 4R73A 3C4MA 4Q8RA 4FORA 4IGRA 2I6EA 4LUBA 4MLQA 4PE5B 2ESNA 1I6BA 1N7WA 2IA4A 3Q28A 1US5A 2DOJA 4O3AA 4ONYA 4H0WA 4QSDA 3W15C 1YCJA 1B5IA 5TPAB 3LSFB 4RNSA 3CG3A 2UVHA 3RTWB 4Q30B 4PQJA 2ZYMA 3TCFA 3A3CA 5BUUA 4JWXA 3H4ZA 1VE4A 4WKMA 5CC2A 1MQJA 3FD3A 2H99A 1H76A 1QULA 4I62A 4OXVA 5EHMA 3O6HA 3AXFA 3JV9A 3MP8A 4H8IA 5CBSA 5I2NA 1IIWA 2F6PA 5M2VA 1LBBA 3UK4A 2DWHA 4GL8A 5AA4A 5H8HA 1UIVA 1PB7A 1FTLA 2Y7PA 2ZYKA 4OEUA 3G3HA 3K00A 3RTFB 5IKBA 1XOCA 1S50A 4ESWA 4GL0A 1UTHB 3CG1A 3QSLA 4OETA 4RK9A 3B6WA 3KSJA 1AL3A 2XXTA 2E1SA 4OVJA 1B4ZA 3QYTA 2HCAA 3PUVE 1ZU0A 3MVYA 4GXAA 3K4UA 4R2FA 3QIMA 5F1QA 4DIGA 4GLIA 5CBRA 2QS1A 5AA2B 2I4BA 3I5OA 3WAFA 4RK2A 1B52A 4AQ4A 1FCKA 1BLFA 1OLCA 3FZVA 3K6WA 3PUYE 4ISUA 4Q5TA 4XTCQ 4YZZA 1TFDA 4U4XA 5CI5A 3SDFA 2ZXTA 5I2KB 2HEUA 2PT2A 3UP9A 2OJTA 4OZ9A 2F6GA 1A7LA 1B2HA 1QVSA 2X26A 4YICA 1IZ1A 5ITPA 1VFDA 3PUZE 4QHQA 2HFBA 3PPQA 4H5FA 2VD3A 3HN0A 1UIUA 3IR1A 4DCXA 3GBBA 2ZYOA 4KFQA 3KJTA 1CB6A 1TFAA 2ZNSA 5CMBA 1NH7A 1LAHE 3TPAA 2I48A 4U23A 1N7XA 2AIXA 3G3IA 2F35A 1USYE 2Y84A 3R7XA 3TFLA 5CMCA 1UQWA 3FJMA 4TLLB 3N6UA 5FHNA 1MQIA 2I4CA 2NWJA 3GBAA 5I2KA 1A40A 3TEPA 3SEYA 2PVUA 3D4CA 4LZ8A 1MY2A 3VVFA 1QUJA 1OVTA 4GFRA 3OO6A 4ZE8A 4O3CA 2ANJA 1Y3PA 4GVOA 3IOVA 4AB6A 1MM7A 1B7ZA 3I3VA 1GVCA 3RY3A 2NXOA 1BKAA 1IXIA 4PETA 2R6GE 1R9LA 4EF2A 4YKKA 3KGCA 1O64A 3M3LA 1M5BA 3RQTA 3M8UA 1FTOA 4R6KA 1ANFA 5TP9B 3CIJA 3DP6A 3T93B 3UA8A 3OO7A 4L17A 4RY1A 3TUSA 4EUOA 3L6HA 3MZ9A 3PPOA 3V5AA 2Q89A 1POY1 3OSQA 1NNPA 5AA4B 3O2AA 4KYEA 3MVZA 4YKPA 1QKAA 1JNFA 1UTBA 1XS5A 1B7UA 1FQAA 1MXVA 2QMXA 4EQ9A 1GV8A 5BWJA 1NNTA 2KLFA 5B7DA 1H45A 4R6HA 3IO4A 1XHYA 4F1UA 3MJNA 4P0IA 4ZDMA 3PMVA 2RC9A 3PMWA 4MLVA 2G29A 4EQBA 2RC8A 2OK2A 2XHDA 2O1LA 3ONMA 1JEVA 4ZEDA 1ZKBA 2QS3A 4JBZA 5L9MA 2NVUB 3O66A 4KCDA 3IB1A 1PB9A 3GZGA 4OFLA 4WEPA 1XVYA 4QSEA 1YAEA 3K02A 3K1MA 4ZEIA 1HSEA 3ODBA 3USDA 1LSTA 1IQ7A 4ELQA 3U94A 1DMBA 1R1NA 5J1DA 3T9UA 2XXWA 3EF7A 2AYSA 5HPQA 1EH3A 1AH5A 3TZAA 2XXPA 1NNFA 3B7DA 2P0SA 4U2RA 2UVGA 1MM6A 1MH3A 2VP1A 4IO3A 5TP9A 3TYHA 4OFOA 1VFEA 1SQYA 2Z8FA 1S7YA 3ILUB 4KQPA 3QAXA 3T66A 5AA2D 5HM4B 5I56B 3ZKLA 5KDTB 3IJOB 1BP5A 2Q88A 2O7IA 4ZS9A 2UVIA 1FTKA 1H43A 2PBWA 1FTJA 1A8EA 3G7WA 4F18A 1FW0A 4NEDA 4PFTA 2ZYNA 3C36A 5AA2A 1CE2A 1MXXA 2QMWA 3OEKA 4MF3A 3R6UA 4NF4A 4NF8B 3MUQA 5K2YA 1HSJA 3TKDA 1IITA 4G8NA 2OLBA 1JW4A 2I0BA 3HPIA 3SESA 2R9JA 3VXCA 3T9VA 5ICTA 5L9OA 1D4NA 4NWDA 2O84X 5DEXA 1B3EA 2DVZA 3H6UA 3EHUA 4GRKA 4LVQA 1NL5A 4F3GA 3S9EA 2UXAA 2F97A 4JWOA 2GH9A 4KCCA 3RLFE 4P11A 4U4SA 4IGTA 1DTZA 4LA9A 1FTMA 1GR2A 2OBGA 3LBSA 1AIVA 3FV1A 3FXQA 3FV2A 4PP0A 1B7HA 4TQUQ 1ZJLA 3VLVA 2B3BA 5I59B 4KYDA 3HCQA 4F2QA 5H8FA 2HAVA 1MH4A 3Q26A 2PYYA 1GGGA 3CFZA 1D9VA 1TXFA 4THIA 1URSA 3ZSFA 2RKMA 1II5A 4AB5A 4ECFA 2RF1A 5JK4A 1FQFA 1EZ9A 3N5LA 4NF6B 1B3HA 1EU8A 2Q8JA 1LCFA 3G3JA 3ILTB 4OENA 4YMBA 2V3UA 1FQCA 1H3DA 3C33A 3V8XB 1ZIUA 2IEEA 4LATA 2RCAA 3TQWA 2D3IA 4OWDA 4OHNA 1ELJA 1LAGE 5CRYA 2F5XA 2V3QA 3OENA 4G8MA 4QFLA 1LB9A 2AL5A 1N04A 1POTA 2I49A 1SI1A 3A09A 4FE8A 4R2BA 3OEMA 3E3KA 3K6XA 4XKPA 4RJZA 5CMMA 1R9QA 2F7BA 2I0CA 2WKYA 3FVGA 4NF5A 2Q2CA 4GF8A 4BLAA 3G3GA 4XIGQ 1P1WA 4EF1A 3M3KA 3OELA 1B0LA 1P1OA 3P7IA 3O6IA 3IO6A 4R9GA 3TTMA 1RYXA 5H8NA 5I59A 1B05A 1WODA 1ZLQA 4Q0CA 3TMGA 4YKJA 4GIZA 3N26A 4WEDA 4F3PA 2H98A 1EZOA 3FVKA 5L8DA 2ZMBA 1N84A 3JZJA 4UA8A 4EXKA 5CM6A 2XX8A 3VDFA 3S9LC 1FQBA 3KOTA 4QSCA 4HTGA 4GOTA 1XC1A 3T22A 3IOTA 3PD8A 1MPBA 4QRZA 4TOZA 4Z7EA 4N6PA 2Y7RA 4MH5A 3T9XB
chains in the Genus database with same CATH superfamily
3TTRA 1MDQA 4P47A 1OMPA 4NX1A 4DZ1A 3PPRA 2THIA 4F31B 4X04A 4QFKA 2H9BA 3QUJA 3K1PA 4PFYA 2P1SA 4YB5A 1ATGA 4F2OA 2O1MA 1N3WA 4LZ7A 1Y4CA 3RUMA 2DXYA 4JWYA 3SZPA 4WXJA 5I58A 2DE2A 4K3FA 3TDJA 1MDP1 4PF8A 5H8QA 4U1ZA 3K01A 2RCBA 3K1NA 4N6PA 3KEIA 2ZNTA 1Z7ME 1LBVA 3ISPA 4IO5A 2QJEA 3U1OA 2DWJA 3T0JA 3L6GA 2DYXA 3FJ7A 3MZBA 1IMCA 4QF9A 4OYVA 3T96B 4LZ5A 3EN3A 2ALUA 4BDQA 4P3LA 1LB8A 2GHAA 3KJ7A 3PMXA 3Q27A 1B6HA 3TTKA 4I9DA 3N6TA 3VE1B 2OCUA 3CI8A 4FIMA 4R75A 3PV0E 4G2ZA 1B58A 2DWIA 4G68A 1IUDA 3U72A 1D9QA 5K2XA 2X7PA 2H4IA 3GLBA 1B5HA 5FBPA 1Q9DA 4F19A 1QJMA 2G93A 3FGSA 4OERA 2DP8A 1QGXA 2OZZA 4AS5A 3UORA 2XX7A 3R26A 1IMBA 3MC2A 5FHMA 2CEYA 1NUWA 3VV5A 1SVXB 1DK4A 3FUZA 1DPEA 2YLNA 4GQOA 3OD7A 3ECRA 3PPPA 4EXLA 5A5XB 3FIRA 2FVZA 3H6WA 3TTNA 2HZKA 4MIJA 4P1LA 3M3FA 4G4PA 2FA7A 1SBPA 1T0KA 2A5SA 3TQLA 2NOOA 4H6DA 3EKIA 1B40A 4JDFA 4LONB 2R71A 4DLDA 3QUFA 4JB7A 4OMBA 2UVJA 4ESXA 4KPTA 3N94A 1JQFA 3H7MA 2OWSA 4OANA 2GRVA 2Z8DA 2B3FA 4KYSA 3O29A 2GFEA 4PC9A 4JSDA 3U92A 3C34A 4NG7A 3RPWA 5I57B 3MVXA 4X48A 4MNIA 1NFTA 1XT8A 4JSOA 1LAXA 2DDKA 2I3VA 1DOTA 1BIYA 3S2VA 3IK6B 3D4GA 2NUVA 1USYH 3BIGA 3FASA 4F29A 1A55A 1SW4A 1Z7NE 4N13A 3VLUA 2RINA 5ITOA 3IL1B 4NTLA 3BFUA 3LV0A 4I3EA 1PDAA 3F11A 1B5JA 1R6ZA 1FPBA 1M5CA 3KN7A 2VGQA 2VT5A 1SW5A 4BDLA 3MWBA 3E9XA 4I8CA 4R73A 4FORA 4LUBA 3Q28A 1I6BA 1US5A 4ONYA 4GWWA 4H0WA 3W15C 4RNSA 3NOHA 2WX9A 3O6HA 3AXFA 4H8IA 5EQ7A 1LBBA 2DWHA 1UIVA 1PB7A 5IKBA 1XOCA 3KSJA 2FBPA 4OVJA 2E1SA 2HCAA 4R2FA 1FPJA 5ESYA 3K6WA 4ISUA 2HEUA 2PT2A 2OJTA 4OZ9A 4QBAA 2X26A 1IZ1A 5ITPA 4H5FA 3HN0A 1UIUA 4DCXA 3GBBA 1IMAA 4KFQA 3KJTA 4PTKA 1TFAA 2I48A 2AIXA 1FBHA 4HE1A 2QVVA 4TLLB 1MQIA 2I4CA 5I2KA 1A40A 2GQ1A 1MY2A 2ANJA 3IOVA 1BKAA 1IXIA 4PETA 2HXRA 3KGCA 3M3LA 1M5BA 3M8UA 3CIJA 4L17A 3V5AA 1FPFA 5AA4B 1FQAA 1MXVA 2KLFA 4MNCA 3MJNA 4P0IA 2JJKA 3PMVA 4EQBA 3ONMA 4JBZA 5L9MA 4KCDA 3IB1A 1EYJA 2KQZA 1HSEA 3ODBA 1IQ7A 1DMBA 1R1NA 3EF7A 5HPQA 4MAGA 4GWZA 4U2RA 1MM6A 4IO3A 4OFOA 3ILUB 3T66A 3QAXA 5HM4B 3T1BA 3ZKLA 1BP5A 2Q88A 2O7IA 5ET6A 1A8EA 4F18A 3C36A 3TKDA 4MX6A 1IITA 5L9OA 3SESA 2R9JA 2O84X 4PGNA 4PDHA 2DVZA 3HFUA 4F3GA 2F97A 2GH9A 3RLFE 4IGTA 1DTZA 4PFRA 3FV2A 1II5A 4ECFA 2RF1A 5JK4A 1EU8A 2Q8JA 3G3JA 3ILTB 4MEVA 1H3DA 2IEEA 3B8BA 4OHNA 2AL5A 2I49A 3OEMA 3U65A 2F7BA 3MYUA 3M3KA 1B0LA 3P7IA 4N15A 1B05A 1WODA 1ZLQA 4Q0CA 3N26A 4WEDA 2H98A 3FVKA 5L8DA 4UA8A 5CM6A 3JZJA 1XC1A 3T22A 4IR8A 3MPLA 4MH5A 3K2DA 2DE4A 3RT8A 3TCGA 5JTYA 1I6AA 3BFTA 4R72A 1OQGA 2F78A 5KZTA 3VFJA 1NI9A 1XI6A 4ELPA 2E0SA 2F7AA 5H8SA 4ND9A 3W9VA 2QSXA 1A99A 2O6AA 3PUXE 4F22A 1RYOA 4P0GA 3QXMA 1VR5A 1KA0A 1GTKA 5I2NB 4KD5A 3CSGA 2PFZA 3H03A 1RDYA 3DELB 1B51A 2I58A 3TCHA 4GWXA 2REJA 3O6GA 4XKNA 3SERA 3PUWE 4HS7A 1OIBA 3H6VA 2ZNUA 1QKBA 1TT1A 3MZ1A 5ISUA 3C31A 3RPLB 3KN8A 1PB8A 2HXWA 5I56A 5KDTA 4PAIA 2HZLA 1FQDA 3VVDA 1P1NA 4G68C 4DDDA 3OSRA 1JVYA 3RN8A 3KOSA 3HV1A 1SDXA 4OVSA 5DW8A 2XX9A 2A5TA 4E0WA 2VHAA 4KXPA 1Y9UA 4QFNA 4PDDA 4TLMB 3CR9A 4E0XA 4IO2A 4OEVA 3KSXA 5TPAA 2Y7KA 1UTBB 4XXUA 4OESA 3V89B 1N0TA 2V25A 2XXQA 5I3SA 4PAKA 3S9MC 4YMAA 1IMDA 1AWBA 2KR0A 1EZPA 3K0VA 4IO7A 5EYFA 5FHOA 2HAUA 4N8GA 2CEXA 3KN3A 4XEQA 1N3XA 3IB2A 4I3YA 4IO4A 3OOAA 3O9PA 1SYHA 2CZIA 2CMOA 4PBQA 2P2AA 4NF4B 4H5GA 1PEBA 1Y3NA 5DVJA 5TU0A 4U21A 2XXUA 2DSFA 1MG1A 3FJGA 3SEVA 2F8DA 1DSNA 3WAFA 3GXAA 1D9YA 1JP4A 2Q9TA 3EQ1A 3FBPA 3SEWA 1QUKA 3HHGA 4MCOA 1YXIA 3JYRA 3CFXA 1M5FA 1MXUA 1VDWA 4OVPA 2ONSA 3DP4A 3SETA 4M4GA 5IGAA 3TELA 1LFIA 2WBBA 3OXNA 3BKIB 4G68B 1A8FA 4FJPA 4KHZE 2QL3A 3S4UA 1FBFA 5H8FB 4IY5A 1MXYA 3A3UA 2REGA 3W9WA 4EQ7A 3TODA 2Q2AA 2YPNA 5JEIA 1M5EA 5KCJA 1NV0A 4N07A 5F7VA 2UYEA 3MP1A 2VD2A 2FYIA 2A5TB 1O63A 3EHSA 2QS4A 4U22A 5LOMA 4IB2A 1LLSA 4NWCA 3H6TA 3KZGA 3RPLA 3FXRA 4LQ5A 4FAJA 5A5XA 1UTHA 3EHTA 1YYZA 4U1OA 2ONRA 2BJJX 5EQ9A 2O7UA 4Q8RA 1NV3A 1B5IA 5TPAB 3CG3A 3TCFA 3A3CA 5BUUA 1G0IA 3H4ZA 4WKMA 1H76A 5EHMA 3MP8A 5CBSA 5I2NA 1IIWA 1DBZA 4GL8A 1FTLA 4OVTA 3CG1A 3QYTA 5IZ1A 3PUVE 3QIMA 4DIGA 1OLCA 3FZVA 1RDZA 4MMPA 3D1RA 2F6GA 1A7LA 1VFDA 3PPQA 4NN3A 1INPA 2ZYOA 4QXDA 1CB6A 1G0HA 3TPAA 2F35A 3TFLA 3FJMA 3TEPA 3GBAA 3SEYA 2PVUA 3D4CA 3QMFA 4LZ8A 4ZE8A 4GVOA 4AB6A 1MM7A 2Y5LA 3RY3A 2R6GE 4YKKA 2B4MA 5F24A 1ANFA 5TP9B 3UA8A 3OO7A 4RY1A 3MZ9A 4XFEA 2Q89A 1POY1 3OSQA 3MVZA 1XS5A 2OX3A 1B7UA 2QMXA 4EQ9A 1GV8A 1NNTA 3IO4A 2RC8A 4N4UA 1ZKBA 4OFLA 2MKZA 1XVYA 4GX6A 5TP9A 4OA4A 4KQPA 2UVIA 1FTJA 2WYPA 4NEDA 4PAFA 4PFTA 5AA2A 1MXXA 2QMWA 3OEKA 4JVCA 1HSJA 4G8NA 1JW4A 2I0BA 5ICTA 3T9VA 2XXKA 1D4NA 5DEXA 1FBPA 3H6UA 1NL5A 3S9EA 2UXAA 4MNPA 4JWOA 4P11A 4U4SA 1FBEA 5EQ8A 1GR2A 2OBGA 3FXQA 4PP0A 2B3BA 5H8FA 2PYYA 4THIA 1D9VA 1URSA 3N5LA 4OENA 1NV5A 4YMBA 3C33A 3TQWA 2RCAA 1LAGE 2V3QA 3OENA 4QFLA 4HE0A 3A09A 4O94A 1NV6A 3E3KA 3K6XA 4RJZA 5CMMA 2WKYA 3G3GA 1P1WA 3OELA 3TTMA 4R9GA 1RYXA 5I59A 4F3PA 1EZOA 2ZMBA 1N84A 2XX8A 3VDFA 3KOTA 4HTGA 2R8TA 3PD8A 1MPBA 1FPDA 2Y7RA 3IR1A 2F3DA 3T9XB 3IORA 1FQEA 1MQDA 4PFUA 4P9KA 2V84A 2XD2A 1WVJA 3OMBA 3FVOA 3FXUA 4GWYA 3G3KA 4N17A 1RKMA 2XXHA 3SKPA 3MPKA 4H8JA 4MBPA 1H44A 1IEJA 4HCYA 4KR5A 4NF6A 3SEUA 1LBCA 2XWVA 3BBRA 4RA1A 1FRPA 3UGWA 1FJ6A 4FEDA 4P1EA 1B3LA 1B32A 3MW0A 1SW1A 3H06B 1Y3QA 3WAEA 1EYKA 4NF5B 4ZZEA 3HSTA 3MSTA 4NF0A 2OWTA 4LATA 1LFHA 3RGYA 2Z22A 2V93A 3QK6A 1ZBMA 1HSLA 3PD9A 4BDOA 2DE3A 2DS9A 4HW8A 3PGFA 5LDZA 5JTYB 1AIVA 2F7CA 5DTBA 1DPPA 2LAOA 2XXIA 4YU0A 1SD3A 3DM0A 2D21A 4FEBA 3LSLA 5HBCA 3TTLA 4POXA 4ZE9A 1Q1KA 4N6DA 1FPIA 1B9JA 4PFWA 4PCDA 3EPEA 5J1DA 1NV1A 2H5YA 4O7MA 4DI3D 1PC3A 4F1YA 2XWIA 4DCYA 2XXVA 3K6UA 3IFCA 2VPOA 4GX4A 1FPEA 4NE4A 1OLAA 1LCTA 5ET8A 4ZEBA 4LN5A 2Z23A 1A54A 3C32A 4OVRA 3S9NC 4R74A 1MRPA 2Y7WA 2QS2A 4PF6A 4ELOA 1B3GA 4XKRA 1NMUA 1PBPA 2OWZA 1MPDA 4N6KA 2W7YA 4NMYA 1Y4TA 3E13X 1SYIA 5I84A 3MAMA 3IX1A 1PBQA 1KA1A 1KZ8A 2PX1A 4BDMA 4DI4B 1Y1ZA 3MQ9A 1NV4A 2DXRA 1URDA 5AA3A 1NV2A 4F1VA 3DP8A 4G61A 1XVXA 5ELVA 4O7IA 1JW1A 1US4A 2F36A 4X1DA 2H25A 3UIFA 4BDRA 2P3NA 4OTEA 3K6VA 2B4LA 4RXLA 5I58B 3A29A 5CMKA 2Z8EA 2QPQA 1J1NA 2CZLA 1SW2A 3CSBA 3LC8A 1P1UA 4EDPA 3RNNA 4PBHA 1B46A 3Q29A 4C1TA 2O68A 3VXBA 1MY1A 1M5DA 3IJXB 1Q35A 1JETA 3B6QA 4QFPA 4BLAA 2GHBA 2YJPA 4FATA 2P3VA 3VLWA 4DXCA 3GYYA 3U8QA 1WDNA 3CRBA 5IZ3B 1OVBA 2Q74A 3UN6A 2X7QA 1JVXA 1QW0A 3E79A 3B6TA 4LQ2A 1O7TA 5EYGA 1AMFA 4G77A 2ABHA 3FATA 1LBZA 2BJIA 3IAZA 4DE8A 5T3JA 4DXBA 2O69A 4H45A 4C1UA 1MPCA 4UACA 4G8HA 3MP6A 2Q8MA 5ET7A 4H1XA 4I1DA 1MQGA 1NUZA 3Q25A 1AOVA 1Y1MA 2WYKA 4MLQA 2ESNA 1N7WA 1FBDA 1YCJA 4PFIA 4UABA 4Q30B 4PQJA 4JWXA 1MQJA 2H99A 4OXVA 4NAPA 5M2VA 2Y7PA 2F3BA 1FBGA 1S50A 4GL0A 1UTHB 3QSLA 4RK9A 1BK4A 2XXTA 5CC2A 1B4ZA 3MVYA 3K4UA 5F1QA 4GLIA 2QS1A 4HXVA 5AA2B 2I4BA 3I5OA 1B52A 4AQ4A 1FCKA 3PUYE 4Q5TA 3LUZA 4XTCQ 1TFDA 3SDFA 5I2KB 3UP9A 4YICA 4JVIA 3CHGA 2XWOA 2VD3A 2ZNSA 3PTYA 4U23A 3G3IA 2PFYA 2Y5KA 5CMCA 1UQWA 3N6UA 2NWJA 3B50A 3VVFA 1QUJA 3OO6A 1B7ZA 2NXOA 4EF2A 1R9LA 1FTOA 3DP6A 3TUSA 3L6HA 2ZZVA 1FSAA 1CNQA 3O2AA 4KYEA 1QKAA 1UTBA 2HHMA 5BWJA 5B7DA 1H45A 4R6HA 4F1UA 4ZDMA 4MLVA 2G29A 4ZEDA 2XHDA 2O1LA 2ZZWA 4QSEA 3K02A 4ZEIA 1LSTA 2XXWA 2AYSA 1AH5A 3TZAA 2XXPA 1NNFA 3B7DA 3TYHA 1MH3A 1VFEA 1SQYA 4FBPA 2Z8FA 1S7YA 1NUXA 5KDTB 4MJOA 5AA2D 4NQ8A 5I56B 1H43A 2PBWA 3G7WA 1FW0A 2ZYNA 1CE2A 4MF3A 4NF4A 3R6UA 3MUQA 1EYIA 2OLBA 3HPIA 4XF5A 1B3EA 4GRKA 4X8RA 5J16A 3LBSA 3FV1A 4TQUQ 4KYDA 4F2QA 2HAVA 3Q26A 1GGGA 3CFZA 2XWKA 2RKMA 1EZ9A 4NF6B 1LCFA 3IFAA 5CRYA 2F5XA 4G8MA 1N04A 1SI1A 4OVQA 4FE8A 4NF5A 1R9QA 3FVGA 2Q2CA 4XIGQ 3ROJA 3O6IA 3IO6A 4GIZA 3KC1A 4EXKA 3S9LC 1FQBA 4QSCA 3IOTA 2XXYA 2HQ0A 1DCUA 4ZEFA 5B70A 2O51A 2F34A 3HHFA 3PU5A 4PGPA 2XD3A 3BIHA 3RT6B 1NNKA 1DTGA 5IM2A 4ZECA 1IMEA 2V3TA 3OO8A 5DVFA 1RDXA 5AE4A 1P1QA 2DQVA 2D5WA 3U93A 1YPNA 3DLNA 4YAHX 3RYDA 1NKXA 4C0RA 3FVNA 3KG2A 2QRYA 3O97A 3SEXA 2I3WA 1BTJA 4O8MA 4N91A 5DEXB 3LSWA 1JEUA 3OO9A 1MXZA 2VOZA 1LAFE 1LFGA 1URGA 4GXSB 1B0HA 2FNCA 2XXRA 5IZZA 1IXHA 4RYAA 5I7IA 4OQOA 1FPGA 1ZMGA 4R9FA 2QVRA 2PT1A 3ZKKA 3LUYA 3G3FA 5FTHA 3IOWA 2RC7A 5LTCA 4GWUA 3HO7A 1I6QA 2DWAA 2CZHA 5H8HB 3TAJA 5ICQA 4N81A 4H65A 1MY3A 1B1HA 3MBPA 1MXWA 4FECA 3IB0A 1D3KA 4MHFA 1QUIA 4P56A 4GD5A 5I57A 2ZZXA 3KC0A 4GWSA 4PFBA 1LBWA 1K9ZA 3O28A 1SI0A 1IXGA 4YKIA 3KFMA 2XA5A 4I40A 4IO6A 1IXCA 4BDNA 1P99A 5L9SA 5FTIA 4LP2B 3LR1A 4MFIA 1FPLA 1YZ0A 3LSXA 4RPOA 1B3FA 1Y20A 5IAIA 4NF8A 2Y7IA 5DT6A 4X9TA 4KI0E 2HPGA 3T9HB 1LGBC 4Z0IA 4OFJA 3VVEA 4H67A 3CFLA 3KBRA 4X1BA 2B65A 3MVWA 4QFOA 5DVIA 3C9HA 2ONKE 1NH8A 5DYHA 4GBVA 1S9TA 5H8QB 1MY4A 1OQHA 2XXXA 3E78A 1F9BA 4YB6A 5EYHA 2FIEA 1MS7A 2UYFA 1ZTYA 3I6VA 1K9YA 4O3BA 4DXUA 4POWA 1MQHA 3C35A 3CVGA 1YTVA 2AL4A 4RPNA 3PPNA 2CZKA 1MY0A 1FTAA 4YB7A 3V83A 3H3GA 4ZZAA 4ELRA 1TWYA 4GWOA 1FPKA 4HE2A 4NHBA 4R6YA 3THIA 1N76A 1FJ9A 1JW5A 2QFLA 5EHSA 1L5TA 2M8CA 4XKQA 3ZS6A 3E4RA 4HCWA 5H8NB 1I69A 4AS4A 5A5LA 1KWHA 2PMSA 2WBDA 2DVCA 2WEFA 1B1XA 4F3SA 4IY6A 4F3BA 5AA1A 3KBZA 3IOUA 4ZEKA 4M1VA 4JXIA 1B4HA 5KCJB 1VSOA 3C4MA 2QVUA 4IGRA 2I6EA 4F39A 4PE5B 2IA4A 4O3AA 4QSDA 2DOJA 5IZ3A 3LSFB 2UVHA 3RTWB 2ZYMA 3FXBA 1VE4A 3FD3A 1QULA 4I62A 3JV9A 3UK4A 2F6PA 5AA4A 5H8HA 4H46A 4OEUA 1FBCA 2ZYKA 3G3HA 3K00A 3RTFB 4OETA 3B6WA 1AL3A 4NGUA 1ZU0A 4GXAA 5CBRA 2VPNA 4RK2A 1BLFA 4YZZA 4GBWA 4U4XA 5CI5A 2ZXTA 1SPIA 1B2HA 1QVSA 2V4CA 3PUZE 4QHQA 2HFBA 5CMBA 1NH7A 2L5VA 1LAHE 1N7XA 1USYE 2Y84A 3R7XA 5FHNA 1IMFA 4GFRA 1OVTA 4PE3A 4O3CA 1Y3PA 3I3VA 1GVCA 1O64A 3RQTA 4R6KA 3T93B 1NV7A 4EUOA 3PPOA 1NNPA 4YKPA 1JNFA 1XHYA 4GX3A 2RC9A 3PMWA 2OK2A 1JEVA 2QS3A 2FIXA 2NVUB 3O66A 1PB9A 3GZGA 4WEPA 1YAEA 3K1MA 4JVDA 3USDA 4ELQA 3U94A 2FHYA 3T9UA 1EH3A 2P0SA 2UVGA 2VP1A 3IJOB 4ZS9A 5EQAA 1FTKA 4P8BA 5K2YA 4NF8B 3VXCA 1LBXA 4NWDA 3EHUA 4LVQA 4KCCA 4LA9A 1FTMA 2PCRA 1B7HA 3VLVA 1ZJLA 5I59B 3HCQA 1MH4A 1LEVA 1TXFA 3ZSFA 4AB5A 1FQFA 1B3HA 2V3UA 1FQCA 3V8XB 1ZIUA 2D3IA 4OWDA 1ELJA 1LB9A 1POTA 4R2BA 5I5PA 4XKPA 1NUYA 2I0CA 4GF8A 4EF1A 1LBYA 1P1OA 5H8NA 3TMGA 4N8YA 4YKJA 4GOTA 5ET5A 4QRZA 4TOZA 4Z7EA 4ESWA
chains in the Genus database with same CATH topology
3TTRA 3IORA 1MDQA 3K2DA 1FQEA 2DE4A 1OMPA 2HQ0A 2XXYA 3RT8A 3TCGA 4ZEFA 5B70A 1I6AA 1MQDA 2O51A 2F34A 3HHFA 3BFTA 4PFUA 4DZ1A 3PU5A 4R72A 1OQGA 3MPLA 2F78A 2V84A 2XD2A 3PPRA 1WVJA 2THIA 2XD3A 3FVOA 3FXUA 3OMBA 1NNKA 3G3KA 3RT6B 3VFJA 5KZTA 1DTGA 1RKMA 4F31B 4ELPA 2XXHA 4ZECA 2V3TA 2E0SA 4QFKA 2H9BA 2F7AA 3QUJA 3OO8A 3K1PA 3SKPA 4PFYA 2P1SA 4YB5A 3MPKA 4H8JA 4MBPA 1ATGA 5DVFA 5H8SA 4ND9A 1H44A 3W9VA 1IEJA 4F2OA 2QSXA 1A99A 5AE4A 4HCYA 2O1MA 2O6AA 3PUXE 4KR5A 1P1QA 1RYOA 4NF6A 3SEUA 4F22A 4P0GA 3QXMA 1N3WA 2DQVA 2D5WA 1VR5A 4LZ7A 1GTKA 1LBCA 1Y4CA 5I2NB 3U93A 1YPNA 3RUMA 3DLNA 2DXYA 3BBRA 4JWYA 4KD5A 4RA1A 4WXJA 4YAHX 5I58A 4C0RA 1NKXA 2DE2A 4K3FA 3UGWA 3FVNA 3KG2A 3TDJA 4F39A 3CSGA 4FEDA 1MDP1 1B3LA 1B32A 3H03A 3MW0A 1SW1A 2QRYA 3DELB 3H06B 3O97A 1Y3QA 5H8QA 3WAEA 3SEXA 1B51A 4NF5B 4ZZEA 2I58A 2I3WA 3HSTA 3TCHA 1BTJA 2REJA 4U1ZA 3O6GA 5DEXB 3K01A 2RCBA 4XKNA 3LSWA 3SERA 1JEUA 3OO9A 3PUWE 1MXZA 2OWTA 1LAFE 2VOZA 1LFGA 1OIBA 1URGA 3H6VA 2ZNUA 3K1NA 4GXSB 4HS7A 1QKBA 1TT1A 1B0HA 2Z22A 3KEIA 3RGYA 2ZNTA 2V93A 2FNCA 1Z7ME 2XXRA 3MZ1A 1ZBMA 3QK6A 5ISUA 1HSLA 3C31A 1IXHA 4IO5A 2QJEA 4RYAA 3U1OA 4OQOA 3KN8A 2DWJA 3PD9A 1ZMGA 4R9FA 1PB8A 2HXWA 4BDOA 5I56A 2DE3A 5KDTA 2DS9A 3L6GA 2HZLA 4HW8A 1FQDA 2PT1A 2DYXA 3VVDA 3LUYA 3PGFA 3ZKKA 5JTYB 3G3FA 1P1NA 4G68C 3FJ7A 4DDDA 3OSRA 3MZBA 5FTHA 4QF9A 1JVYA 3IOWA 3RN8A 3KOSA 2F7CA 3HV1A 4OYVA 2RC7A 3T96B 1SDXA 5DTBA 1DPPA 2LAOA 4LZ5A 3HO7A 1I6QA 2DWAA 3EN3A 2XX9A 2A5TA 5H8HB 4E0WA 2ALUA 2VHAA 4BDQA 2XXIA 4YU0A 3TAJA 1Y9UA 5ICQA 4QFNA 1SD3A 1LB8A 2GHAA 3KJ7A 3DM0A 4TLMB 3PMXA 2D21A 1MY3A 3Q27A 1B1HA 4FEBA 3CR9A 3MBPA 4H65A 4E0XA 1B6HA 3TTKA 1MXWA 3LSLA 3KSXA 4I9DA 4IO2A 4OEVA 5HBCA 3TTLA 3N6TA 4FECA 4POXA 1Q1KA 2OCUA 5TPAA 3VE1B 4ZE9A 2Y7KA 3CI8A 1UTBB 1B9JA 3IB0A 4PFWA 4FIMA 4R75A 4XXUA 1D3KA 3PV0E 4OESA 3V89B 4G2ZA 1QUIA 1B58A 1N0TA 2DWIA 1IUDA 3EPEA 4G68A 2H5YA 2V25A 4GD5A 3U72A 2XXQA 5I57A 5K2XA 2X7PA 2H4IA 1PC3A 3GLBA 4F1YA 3S9MC 1B5HA 4YMAA 4DCYA 2XXVA 3K6UA 4F19A 1QJMA 2G93A 3FGSA 4OERA 1EZPA 3O28A 2DP8A 4NE4A 1OLAA 1LCTA 1SI0A 1IXGA 4YKIA 3K0VA 4IO7A 5EYFA 3KFMA 5FHOA 4IO6A 4ZEBA 2OZZA 1IXCA 2HAUA 2Z23A 1A54A 3C32A 4BDNA 3S9NC 1P99A 5L9SA 4R74A 5FTIA 3KN3A 3UORA 1MRPA 2XX7A 2Y7WA 2QS2A 3MC2A 3R26A 5FHMA 1N3XA 3VV5A 4LP2B 1SVXB 3LR1A 4MFIA 3FUZA 1DPEA 4ELOA 2YLNA 3IB2A 1B3GA 4IO4A 4XKRA 3LSXA 3OOAA 3O9PA 4GQOA 1NMUA 1PBPA 3ECRA 1SYHA 3OD7A 1B3FA 3PPPA 1MPDA 1Y20A 4RPOA 4EXLA 5A5XB 2CMOA 5IAIA 2W7YA 3FIRA 1Y4TA 2P2AA 4NF8A 4NF4B 4H5GA 3E13X 4NMYA 1SYIA 5I84A 2Y7IA 3MAMA 1PEBA 1Y3NA 3H6WA 4KI0E 4X9TA 5DT6A 5DVJA 3TTNA 3IX1A 1PBQA 5TU0A 3T9HB 5JTYA 4U21A 1LGBC 2XXUA 2PX1A 4BDMA 2DSFA 1MG1A 1Y1ZA 2HZKA 4Z0IA 3FJGA 3SEVA 3MQ9A 2F8DA 4OFJA 1DSNA 4H67A 3GXAA 3VVEA 1D9YA 2DXRA 3M3FA 3CFLA 1URDA 1SBPA 2FA7A 3KBRA 4G4PA 4X1BA 1T0KA 2A5SA 5AA3A 3TQLA 2B65A 3MVWA 4QFOA 4F1VA 2NOOA 3DP8A 1XVXA 3C9HA 5DVIA 5ELVA 2ONKE 1JW1A 2Q9TA 1NH8A 4H6DA 5DYHA 1US4A 1B40A 3EQ1A 2F36A 4JDFA 4LONB 3SEWA 1QUKA 4X1DA 3HHGA 2H25A 3UIFA 1S9TA 2R71A 4BDRA 5H8QB 1MY4A 4DLDA 4OTEA 3K6VA 3QUFA 4JB7A 4OMBA 2UVJA 4ESXA 1OQHA 2XXXA 1F9BA 4KPTA 3N94A 3JYRA 3CFXA 1JQFA 3H7MA 4RXLA 4YB6A 5I58B 1M5FA 1MXUA 2OWSA 5CMKA 2GRVA 2Z8EA 2ONSA 2QPQA 2Z8DA 1J1NA 2B3FA 2CZLA 4KYSA 1MS7A 3DP4A 3O29A 2GFEA 1SW2A 2UYFA 3SETA 4M4GA 3CSBA 3LC8A 1ZTYA 1P1UA 4JSDA 3I6VA 4O3BA 3TELA 4DXUA 1LFIA 4EDPA 3RNNA 3U92A 1LFHA 3C34A 1B46A 1MQHA 3C35A 3Q29A 4POWA 3CVGA 3RPWA 4C1TA 2O68A 3OXNA 3VXBA 1MY1A 1YTVA 3BKIB 2AL4A 1M5DA 4G68B 3IJXB 1Q35A 5I57B 1JETA 1A8FA 3B6QA 3MVXA 3PPNA 4QFPA 1MY0A 4RPNA 2GHBA 4FJPA 4KHZE 4X48A 1NFTA 2YJPA 4YB7A 3H3GA 3V83A 2QL3A 4ZZAA 1XT8A 3S4UA 4JSOA 4ELRA 4FATA 5H8FB 1LAXA 1TWYA 4GWOA 4IY5A 2I3VA 3VLWA 4DXCA 1MXYA 3A3UA 1DOTA 3U8QA 4R6YA 2REGA 1WDNA 3CRBA 3W9WA 4EQ7A 1OVBA 1BIYA 2Q2AA 2YPNA 3IK6B 3S2VA 3THIA 3TODA 3D4GA 3UN6A 2NUVA 1USYH 2X7QA 1JVXA 1M5EA 5JEIA 1QW0A 3FASA 5KCJA 4N07A 5F7VA 2UYEA 3MP1A 4F29A 1N76A 1A55A 1SW4A 1Z7NE 2VD2A 3B6TA 4LQ2A 2FYIA 2A5TB 4N13A 3VLUA 1O63A 1JW5A 2RINA 5EHSA 1O7TA 1L5TA 2M8CA 1AMFA 3EHSA 2QS4A 4G77A 5ITOA 4U22A 4XKQA 5LOMA 3IL1B 2ABHA 3E4RA 4HCWA 4IB2A 3ZS6A 1I69A 3FATA 5H8NB 4NTLA 3BFUA 1KWHA 1LLSA 4NWCA 3IAZA 4DE8A 3H6TA 4DXBA 1PDAA 2O69A 2PMSA 3F11A 4C1UA 3KZGA 2DVCA 1B5JA 1MPCA 1R6ZA 4UACA 1B1XA 3FXRA 4G8HA 4LQ5A 3MP6A 4F3SA 4FAJA 4IY6A 1M5CA 5A5XA 1UTHA 3EHTA 4F3BA 4H1XA 3KN7A 2VGQA 4U1OA 4I1DA 1SW5A 5AA1A 1MQGA 4BDLA 2ONRA 3MWBA 3Q25A 2BJJX 3IOUA 4ZEKA 1AOVA 3E9XA 2O7UA 4M1VA 4JXIA 1B4HA 5KCJB 1VSOA 1Y1MA 4I8CA 4R73A 3C4MA 4Q8RA 4FORA 4IGRA 2I6EA 4LUBA 4MLQA 4PE5B 2ESNA 1I6BA 1N7WA 2IA4A 3Q28A 1US5A 2DOJA 4O3AA 4ONYA 4H0WA 4QSDA 3W15C 1YCJA 1B5IA 5TPAB 3LSFB 4RNSA 3CG3A 2UVHA 3RTWB 4Q30B 4PQJA 2ZYMA 3TCFA 3A3CA 5BUUA 4JWXA 3H4ZA 1VE4A 4WKMA 5CC2A 1MQJA 3FD3A 2H99A 1H76A 1QULA 4I62A 4OXVA 5EHMA 3O6HA 3AXFA 3JV9A 3MP8A 4H8IA 5CBSA 5I2NA 1IIWA 2F6PA 5M2VA 1LBBA 3UK4A 2DWHA 4GL8A 5AA4A 5H8HA 1UIVA 1PB7A 1FTLA 2Y7PA 2ZYKA 4OEUA 3G3HA 3K00A 3RTFB 5IKBA 1XOCA 1S50A 4ESWA 4GL0A 1UTHB 3CG1A 3QSLA 4OETA 4RK9A 3B6WA 3KSJA 1AL3A 2XXTA 2E1SA 4OVJA 1B4ZA 3QYTA 2HCAA 3PUVE 1ZU0A 3MVYA 4GXAA 3K4UA 4R2FA 3QIMA 5F1QA 4DIGA 4GLIA 5CBRA 2QS1A 5AA2B 2I4BA 3I5OA 3WAFA 4RK2A 1B52A 4AQ4A 1FCKA 1BLFA 1OLCA 3FZVA 3K6WA 3PUYE 4ISUA 4Q5TA 4XTCQ 4YZZA 1TFDA 4U4XA 5CI5A 3SDFA 2ZXTA 5I2KB 2HEUA 2PT2A 3UP9A 2OJTA 4OZ9A 2F6GA 1A7LA 1B2HA 1QVSA 2X26A 4YICA 1IZ1A 5ITPA 1VFDA 3PUZE 4QHQA 2HFBA 3PPQA 4H5FA 2VD3A 3HN0A 1UIUA 3IR1A 4DCXA 3GBBA 2ZYOA 4KFQA 3KJTA 1CB6A 1TFAA 2ZNSA 5CMBA 1NH7A 1LAHE 3TPAA 2I48A 4U23A 1N7XA 2AIXA 3G3IA 2F35A 1USYE 2Y84A 3R7XA 3TFLA 5CMCA 1UQWA 3FJMA 4TLLB 3N6UA 5FHNA 1MQIA 2I4CA 2NWJA 3GBAA 5I2KA 1A40A 3TEPA 3SEYA 2PVUA 3D4CA 4LZ8A 1MY2A 3VVFA 1QUJA 1OVTA 4GFRA 3OO6A 4ZE8A 4O3CA 2ANJA 1Y3PA 4GVOA 3IOVA 4AB6A 1MM7A 1B7ZA 3I3VA 1GVCA 3RY3A 2NXOA 1BKAA 1IXIA 4PETA 2R6GE 1R9LA 4EF2A 4YKKA 3KGCA 1O64A 3M3LA 1M5BA 3RQTA 3M8UA 1FTOA 4R6KA 1ANFA 5TP9B 3CIJA 3DP6A 3T93B 3UA8A 3OO7A 4L17A 4RY1A 3TUSA 4EUOA 3L6HA 3MZ9A 3PPOA 3V5AA 2Q89A 1POY1 3OSQA 1NNPA 5AA4B 3O2AA 4KYEA 3MVZA 4YKPA 1QKAA 1JNFA 1UTBA 1XS5A 1B7UA 1FQAA 1MXVA 2QMXA 4EQ9A 1GV8A 5BWJA 1NNTA 2KLFA 5B7DA 1H45A 4R6HA 3IO4A 1XHYA 4F1UA 3MJNA 4P0IA 4ZDMA 3PMVA 2RC9A 3PMWA 4MLVA 2G29A 4EQBA 2RC8A 2OK2A 2XHDA 2O1LA 3ONMA 1JEVA 4ZEDA 1ZKBA 2QS3A 4JBZA 5L9MA 2NVUB 3O66A 4KCDA 3IB1A 1PB9A 3GZGA 4OFLA 4WEPA 1XVYA 4QSEA 1YAEA 3K02A 3K1MA 4ZEIA 1HSEA 3ODBA 3USDA 1LSTA 1IQ7A 4ELQA 3U94A 1DMBA 1R1NA 5J1DA 3T9UA 2XXWA 3EF7A 2AYSA 5HPQA 1EH3A 1AH5A 3TZAA 2XXPA 1NNFA 3B7DA 2P0SA 4U2RA 2UVGA 1MM6A 1MH3A 2VP1A 4IO3A 5TP9A 3TYHA 4OFOA 1VFEA 1SQYA 2Z8FA 1S7YA 3ILUB 4KQPA 3QAXA 3T66A 5AA2D 5HM4B 5I56B 3ZKLA 5KDTB 3IJOB 1BP5A 2Q88A 2O7IA 4ZS9A 2UVIA 1FTKA 1H43A 2PBWA 1FTJA 1A8EA 3G7WA 4F18A 1FW0A 4NEDA 4PFTA 2ZYNA 3C36A 5AA2A 1CE2A 1MXXA 2QMWA 3OEKA 4MF3A 3R6UA 4NF4A 4NF8B 3MUQA 5K2YA 1HSJA 3TKDA 1IITA 4G8NA 2OLBA 1JW4A 2I0BA 3HPIA 3SESA 2R9JA 3VXCA 3T9VA 5ICTA 5L9OA 1D4NA 4NWDA 2O84X 5DEXA 1B3EA 2DVZA 3H6UA 3EHUA 4GRKA 4LVQA 1NL5A 4F3GA 3S9EA 2UXAA 2F97A 4JWOA 2GH9A 4KCCA 3RLFE 4P11A 4U4SA 4IGTA 1DTZA 4LA9A 1FTMA 1GR2A 2OBGA 3LBSA 1AIVA 3FV1A 3FXQA 3FV2A 4PP0A 1B7HA 4TQUQ 1ZJLA 3VLVA 2B3BA 5I59B 4KYDA 3HCQA 4F2QA 5H8FA 2HAVA 1MH4A 3Q26A 2PYYA 1GGGA 3CFZA 1D9VA 1TXFA 4THIA 1URSA 3ZSFA 2RKMA 1II5A 4AB5A 4ECFA 2RF1A 5JK4A 1FQFA 1EZ9A 3N5LA 4NF6B 1B3HA 1EU8A 2Q8JA 1LCFA 3G3JA 3ILTB 4OENA 4YMBA 2V3UA 1FQCA 1H3DA 3C33A 3V8XB 1ZIUA 2IEEA 4LATA 2RCAA 3TQWA 2D3IA 4OWDA 4OHNA 1ELJA 1LAGE 5CRYA 2F5XA 2V3QA 3OENA 4G8MA 4QFLA 1LB9A 2AL5A 1N04A 1POTA 2I49A 1SI1A 3A09A 4FE8A 4R2BA 3OEMA 3E3KA 3K6XA 4XKPA 4RJZA 5CMMA 1R9QA 2F7BA 2I0CA 2WKYA 3FVGA 4NF5A 2Q2CA 4GF8A 4BLAA 3G3GA 4XIGQ 1P1WA 4EF1A 3M3KA 3OELA 1B0LA 1P1OA 3P7IA 3O6IA 3IO6A 4R9GA 3TTMA 1RYXA 5H8NA 5I59A 1B05A 1WODA 1ZLQA 4Q0CA 3TMGA 4YKJA 4GIZA 3N26A 4WEDA 4F3PA 2H98A 1EZOA 3FVKA 5L8DA 2ZMBA 1N84A 3JZJA 4UA8A 4EXKA 5CM6A 2XX8A 3VDFA 3S9LC 1FQBA 3KOTA 4QSCA 4HTGA 4GOTA 1XC1A 3T22A 3IOTA 3PD8A 1MPBA 4QRZA 4TOZA 4Z7EA 4N6PA 2Y7RA 4MH5A 3T9XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTR A;  3IOR A;  1MDQ A;  3K2D A;  1FQE A;  2DE4 A;  1OMP A;  2HQ0 A;  2XXY A;  3RT8 A;  3TCG A;  4ZEF A;  5B70 A;  1I6A A;  1MQD A;  2O51 A;  2F34 A;  3HHF A;  3BFT A;  4PFU A;  4DZ1 A;  3PU5 A;  4R72 A;  1OQG A;  3MPL A;  2F78 A;  2V84 A;  2XD2 A;  3PPR A;  1WVJ A;  2THI A;  2XD3 A;  3FVO A;  3FXU A;  3OMB A;  1NNK A;  3G3K A;  3RT6 B;  3VFJ A;  5KZT A;  1DTG A;  1RKM A;  4F31 B;  4ELP A;  2XXH A;  4ZEC A;  2V3T A;  2E0S A;  4QFK A;  2H9B A;  2F7A A;  3QUJ A;  3OO8 A;  3K1P A;  3SKP A;  4PFY A;  2P1S A;  4YB5 A;  3MPK A;  4H8J A;  4MBP A;  1ATG A;  5DVF A;  5H8S A;  4ND9 A;  1H44 A;  3W9V A;  1IEJ A;  4F2O A;  2QSX A;  1A99 A;  5AE4 A;  4HCY A;  2O1M A;  2O6A A;  3PUX E;  4KR5 A;  1P1Q A;  1RYO A;  4NF6 A;  3SEU A;  4F22 A;  4P0G A;  3QXM A;  1N3W A;  2DQV A;  2D5W A;  1VR5 A;  4LZ7 A;  1GTK A;  1LBC A;  1Y4C A;  5I2N B;  3U93 A;  1YPN A;  3RUM A;  3DLN A;  2DXY A;  3BBR A;  4JWY A;  4KD5 A;  4RA1 A;  4WXJ A;  4YAH X;  5I58 A;  4C0R A;  1NKX A;  2DE2 A;  4K3F A;  3UGW A;  3FVN A;  3KG2 A;  3TDJ A;  4F39 A;  3CSG A;  4FED A;  1MDP 1;  1B3L A;  1B32 A;  3H03 A;  3MW0 A;  1SW1 A;  2QRY A;  3DEL B;  3H06 B;  3O97 A;  1Y3Q A;  5H8Q A;  3WAE A;  3SEX A;  1B51 A;  4NF5 B;  4ZZE A;  2I58 A;  2I3W A;  3HST A;  3TCH A;  1BTJ A;  2REJ A;  4U1Z A;  3O6G A;  5DEX B;  3K01 A;  2RCB A;  4XKN A;  3LSW A;  3SER A;  1JEU A;  3OO9 A;  3PUW E;  1MXZ A;  2OWT A;  1LAF E;  2VOZ A;  1LFG A;  1OIB A;  1URG A;  3H6V A;  2ZNU A;  3K1N A;  4GXS B;  4HS7 A;  1QKB A;  1TT1 A;  1B0H A;  2Z22 A;  3KEI A;  3RGY A;  2ZNT A;  2V93 A;  2FNC A;  1Z7M E;  2XXR A;  3MZ1 A;  1ZBM A;  3QK6 A;  5ISU A;  1HSL A;  3C31 A;  1IXH A;  4IO5 A;  2QJE A;  4RYA A;  3U1O A;  4OQO A;  3KN8 A;  2DWJ A;  3PD9 A;  1ZMG A;  4R9F A;  1PB8 A;  2HXW A;  4BDO A;  5I56 A;  2DE3 A;  5KDT A;  2DS9 A;  3L6G A;  2HZL A;  4HW8 A;  1FQD A;  2PT1 A;  2DYX A;  3VVD A;  3LUY A;  3PGF A;  3ZKK A;  5JTY B;  3G3F A;  1P1N A;  4G68 C;  3FJ7 A;  4DDD A;  3OSR A;  3MZB A;  5FTH A;  4QF9 A;  1JVY A;  3IOW A;  3RN8 A;  3KOS A;  2F7C A;  3HV1 A;  4OYV A;  2RC7 A;  3T96 B;  1SDX A;  5DTB A;  1DPP A;  2LAO A;  4LZ5 A;  3HO7 A;  1I6Q A;  2DWA A;  3EN3 A;  2XX9 A;  2A5T A;  5H8H B;  4E0W A;  2ALU A;  2VHA A;  4BDQ A;  2XXI A;  4YU0 A;  3TAJ A;  1Y9U A;  5ICQ A;  4QFN A;  1SD3 A;  1LB8 A;  2GHA A;  3KJ7 A;  3DM0 A;  4TLM B;  3PMX A;  2D21 A;  1MY3 A;  3Q27 A;  1B1H A;  4FEB A;  3CR9 A;  3MBP A;  4H65 A;  4E0X A;  1B6H A;  3TTK A;  1MXW A;  3LSL A;  3KSX A;  4I9D A;  4IO2 A;  4OEV A;  5HBC A;  3TTL A;  3N6T A;  4FEC A;  4POX A;  1Q1K A;  2OCU A;  5TPA A;  3VE1 B;  4ZE9 A;  2Y7K A;  3CI8 A;  1UTB B;  1B9J A;  3IB0 A;  4PFW A;  4FIM A;  4R75 A;  4XXU A;  1D3K A;  3PV0 E;  4OES A;  3V89 B;  4G2Z A;  1QUI A;  1B58 A;  1N0T A;  2DWI A;  1IUD A;  3EPE A;  4G68 A;  2H5Y A;  2V25 A;  4GD5 A;  3U72 A;  2XXQ A;  5I57 A;  5K2X A;  2X7P A;  2H4I A;  1PC3 A;  3GLB A;  4F1Y A;  3S9M C;  1B5H A;  4YMA A;  4DCY A;  2XXV A;  3K6U A;  4F19 A;  1QJM A;  2G93 A;  3FGS A;  4OER A;  1EZP A;  3O28 A;  2DP8 A;  4NE4 A;  1OLA A;  1LCT A;  1SI0 A;  1IXG A;  4YKI A;  3K0V A;  4IO7 A;  5EYF A;  3KFM A;  5FHO A;  4IO6 A;  4ZEB A;  2OZZ A;  1IXC A;  2HAU A;  2Z23 A;  1A54 A;  3C32 A;  4BDN A;  3S9N C;  1P99 A;  5L9S A;  4R74 A;  5FTI A;  3KN3 A;  3UOR A;  1MRP A;  2XX7 A;  2Y7W A;  2QS2 A;  3MC2 A;  3R26 A;  5FHM A;  1N3X A;  3VV5 A;  4LP2 B;  1SVX B;  3LR1 A;  4MFI A;  3FUZ A;  1DPE A;  4ELO A;  2YLN A;  3IB2 A;  1B3G A;  4IO4 A;  4XKR A;  3LSX A;  3OOA A;  3O9P A;  4GQO A;  1NMU A;  1PBP A;  3ECR A;  1SYH A;  3OD7 A;  1B3F A;  3PPP A;  1MPD A;  1Y20 A;  4RPO A;  4EXL A;  5A5X B;  2CMO A;  5IAI A;  2W7Y A;  3FIR A;  1Y4T A;  2P2A A;  4NF8 A;  4NF4 B;  4H5G A;  3E13 X;  4NMY A;  1SYI A;  5I84 A;  2Y7I A;  3MAM A;  1PEB A;  1Y3N A;  3H6W A;  4KI0 E;  4X9T A;  5DT6 A;  5DVJ A;  3TTN A;  3IX1 A;  1PBQ A;  5TU0 A;  3T9H B;  5JTY A;  4U21 A;  1LGB C;  2XXU A;  2PX1 A;  4BDM A;  2DSF A;  1MG1 A;  1Y1Z A;  2HZK A;  4Z0I A;  3FJG A;  3SEV A;  3MQ9 A;  2F8D A;  4OFJ A;  1DSN A;  4H67 A;  3GXA A;  3VVE A;  1D9Y A;  2DXR A;  3M3F A;  3CFL A;  1URD A;  1SBP A;  2FA7 A;  3KBR A;  4G4P A;  4X1B A;  1T0K A;  2A5S A;  5AA3 A;  3TQL A;  2B65 A;  3MVW A;  4QFO A;  4F1V A;  2NOO A;  3DP8 A;  1XVX A;  3C9H A;  5DVI A;  5ELV A;  2ONK E;  1JW1 A;  2Q9T A;  1NH8 A;  4H6D A;  5DYH A;  1US4 A;  1B40 A;  3EQ1 A;  2F36 A;  4JDF A;  4LON B;  3SEW A;  1QUK A;  4X1D A;  3HHG A;  2H25 A;  3UIF A;  1S9T A;  2R71 A;  4BDR A;  5H8Q B;  1MY4 A;  4DLD A;  4OTE A;  3K6V A;  3QUF A;  4JB7 A;  4OMB A;  2UVJ A;  4ESX A;  1OQH A;  2XXX A;  1F9B A;  4KPT A;  3N94 A;  3JYR A;  3CFX A;  1JQF A;  3H7M A;  4RXL A;  4YB6 A;  5I58 B;  1M5F A;  1MXU A;  2OWS A;  5CMK A;  2GRV A;  2Z8E A;  2ONS A;  2QPQ A;  2Z8D A;  1J1N A;  2B3F A;  2CZL A;  4KYS A;  1MS7 A;  3DP4 A;  3O29 A;  2GFE A;  1SW2 A;  2UYF A;  3SET A;  4M4G A;  3CSB A;  3LC8 A;  1ZTY A;  1P1U A;  4JSD A;  3I6V A;  4O3B A;  3TEL A;  4DXU A;  1LFI A;  4EDP A;  3RNN A;  3U92 A;  1LFH A;  3C34 A;  1B46 A;  1MQH A;  3C35 A;  3Q29 A;  4POW A;  3CVG A;  3RPW A;  4C1T A;  2O68 A;  3OXN A;  3VXB A;  1MY1 A;  1YTV A;  3BKI B;  2AL4 A;  1M5D A;  4G68 B;  3IJX B;  1Q35 A;  5I57 B;  1JET A;  1A8F A;  3B6Q A;  3MVX A;  3PPN A;  4QFP A;  1MY0 A;  4RPN A;  2GHB A;  4FJP A;  4KHZ E;  4X48 A;  1NFT A;  2YJP A;  4YB7 A;  3H3G A;  3V83 A;  2QL3 A;  4ZZA A;  1XT8 A;  3S4U A;  4JSO A;  4ELR A;  4FAT A;  5H8F B;  1LAX A;  1TWY A;  4GWO A;  4IY5 A;  2I3V A;  3VLW A;  4DXC A;  1MXY A;  3A3U A;  1DOT A;  3U8Q A;  4R6Y A;  2REG A;  1WDN A;  3CRB A;  3W9W A;  4EQ7 A;  1OVB A;  1BIY A;  2Q2A A;  2YPN A;  3IK6 B;  3S2V A;  3THI A;  3TOD A;  3D4G A;  3UN6 A;  2NUV A;  1USY H;  2X7Q A;  1JVX A;  1M5E A;  5JEI A;  1QW0 A;  3FAS A;  5KCJ A;  4N07 A;  5F7V A;  2UYE A;  3MP1 A;  4F29 A;  1N76 A;  1A55 A;  1SW4 A;  1Z7N E;  2VD2 A;  3B6T A;  4LQ2 A;  2FYI A;  2A5T B;  4N13 A;  3VLU A;  1O63 A;  1JW5 A;  2RIN A;  5EHS A;  1O7T A;  1L5T A;  2M8C A;  1AMF A;  3EHS A;  2QS4 A;  4G77 A;  5ITO A;  4U22 A;  4XKQ A;  5LOM A;  3IL1 B;  2ABH A;  3E4R A;  4HCW A;  4IB2 A;  3ZS6 A;  1I69 A;  3FAT A;  5H8N B;  4NTL A;  3BFU A;  1KWH A;  1LLS A;  4NWC A;  3IAZ A;  4DE8 A;  3H6T A;  4DXB A;  1PDA A;  2O69 A;  2PMS A;  3F11 A;  4C1U A;  3KZG A;  2DVC A;  1B5J A;  1MPC A;  1R6Z A;  4UAC A;  1B1X A;  3FXR A;  4G8H A;  4LQ5 A;  3MP6 A;  4F3S A;  4FAJ A;  4IY6 A;  1M5C A;  5A5X A;  1UTH A;  3EHT A;  4F3B A;  4H1X A;  3KN7 A;  2VGQ A;  4U1O A;  4I1D A;  1SW5 A;  5AA1 A;  1MQG A;  4BDL A;  2ONR A;  3MWB A;  3Q25 A;  2BJJ X;  3IOU A;  4ZEK A;  1AOV A;  3E9X A;  2O7U A;  4M1V A;  4JXI A;  1B4H A;  5KCJ B;  1VSO A;  1Y1M A;  4I8C A;  4R73 A;  3C4M A;  4Q8R A;  4FOR A;  4IGR A;  2I6E A;  4LUB A;  4MLQ A;  4PE5 B;  2ESN A;  1I6B A;  1N7W A;  2IA4 A;  3Q28 A;  1US5 A;  2DOJ A;  4O3A A;  4ONY A;  4H0W A;  4QSD A;  3W15 C;  1YCJ A;  1B5I A;  5TPA B;  3LSF B;  4RNS A;  3CG3 A;  2UVH A;  3RTW B;  4Q30 B;  4PQJ A;  2ZYM A;  3TCF A;  3A3C A;  5BUU A;  4JWX A;  3H4Z A;  1VE4 A;  4WKM A;  5CC2 A;  1MQJ A;  3FD3 A;  2H99 A;  1H76 A;  1QUL A;  4I62 A;  4OXV A;  5EHM A;  3O6H A;  3AXF A;  3JV9 A;  3MP8 A;  4H8I A;  5CBS A;  5I2N A;  1IIW A;  2F6P A;  5M2V A;  1LBB A;  3UK4 A;  2DWH A;  4GL8 A;  5AA4 A;  5H8H A;  1UIV A;  1PB7 A;  1FTL A;  2Y7P A;  2ZYK A;  4OEU A;  3G3H A;  3K00 A;  3RTF B;  5IKB A;  1XOC A;  1S50 A;  4ESW A;  4GL0 A;  1UTH B;  3CG1 A;  3QSL A;  4OET A;  4RK9 A;  3B6W A;  3KSJ A;  1AL3 A;  2XXT A;  2E1S A;  4OVJ A;  1B4Z A;  3QYT A;  2HCA A;  3PUV E;  1ZU0 A;  3MVY A;  4GXA A;  3K4U A;  4R2F A;  3QIM A;  5F1Q A;  4DIG A;  4GLI A;  5CBR A;  2QS1 A;  5AA2 B;  2I4B A;  3I5O A;  3WAF A;  4RK2 A;  1B52 A;  4AQ4 A;  1FCK A;  1BLF A;  1OLC A;  3FZV A;  3K6W A;  3PUY E;  4ISU A;  4Q5T A;  4XTC Q;  4YZZ A;  1TFD A;  4U4X A;  5CI5 A;  3SDF A;  2ZXT A;  5I2K B;  2HEU A;  2PT2 A;  3UP9 A;  2OJT A;  4OZ9 A;  2F6G A;  1A7L A;  1B2H A;  1QVS A;  2X26 A;  4YIC A;  1IZ1 A;  5ITP A;  1VFD A;  3PUZ E;  4QHQ A;  2HFB A;  3PPQ A;  4H5F A;  2VD3 A;  3HN0 A;  1UIU A;  3IR1 A;  4DCX A;  3GBB A;  2ZYO A;  4KFQ A;  3KJT A;  1CB6 A;  1TFA A;  2ZNS A;  5CMB A;  1NH7 A;  1LAH E;  3TPA A;  2I48 A;  4U23 A;  1N7X A;  2AIX A;  3G3I A;  2F35 A;  1USY E;  2Y84 A;  3R7X A;  3TFL A;  5CMC A;  1UQW A;  3FJM A;  4TLL B;  3N6U A;  5FHN A;  1MQI A;  2I4C A;  2NWJ A;  3GBA A;  5I2K A;  1A40 A;  3TEP A;  3SEY A;  2PVU A;  3D4C A;  4LZ8 A;  1MY2 A;  3VVF A;  1QUJ A;  1OVT A;  4GFR A;  3OO6 A;  4ZE8 A;  4O3C A;  2ANJ A;  1Y3P A;  4GVO A;  3IOV A;  4AB6 A;  1MM7 A;  1B7Z A;  3I3V A;  1GVC A;  3RY3 A;  2NXO A;  1BKA A;  1IXI A;  4PET A;  2R6G E;  1R9L A;  4EF2 A;  4YKK A;  3KGC A;  1O64 A;  3M3L A;  1M5B A;  3RQT A;  3M8U A;  1FTO A;  4R6K A;  1ANF A;  5TP9 B;  3CIJ A;  3DP6 A;  3T93 B;  3UA8 A;  3OO7 A;  4L17 A;  4RY1 A;  3TUS A;  4EUO A;  3L6H A;  3MZ9 A;  3PPO A;  3V5A A;  2Q89 A;  1POY 1;  3OSQ A;  1NNP A;  5AA4 B;  3O2A A;  4KYE A;  3MVZ A;  4YKP A;  1QKA A;  1JNF A;  1UTB A;  1XS5 A;  1B7U A;  1FQA A;  1MXV A;  2QMX A;  4EQ9 A;  1GV8 A;  5BWJ A;  1NNT A;  2KLF A;  5B7D A;  1H45 A;  4R6H A;  3IO4 A;  1XHY A;  4F1U A;  3MJN A;  4P0I A;  4ZDM A;  3PMV A;  2RC9 A;  3PMW A;  4MLV A;  2G29 A;  4EQB A;  2RC8 A;  2OK2 A;  2XHD A;  2O1L A;  3ONM A;  1JEV A;  4ZED A;  1ZKB A;  2QS3 A;  4JBZ A;  5L9M A;  2NVU B;  3O66 A;  4KCD A;  3IB1 A;  1PB9 A;  3GZG A;  4OFL A;  4WEP A;  1XVY A;  4QSE A;  1YAE A;  3K02 A;  3K1M A;  4ZEI A;  1HSE A;  3ODB A;  3USD A;  1LST A;  1IQ7 A;  4ELQ A;  3U94 A;  1DMB A;  1R1N A;  5J1D A;  3T9U A;  2XXW A;  3EF7 A;  2AYS A;  5HPQ A;  1EH3 A;  1AH5 A;  3TZA A;  2XXP A;  1NNF A;  3B7D A;  2P0S A;  4U2R A;  2UVG A;  1MM6 A;  1MH3 A;  2VP1 A;  4IO3 A;  5TP9 A;  3TYH A;  4OFO A;  1VFE A;  1SQY A;  2Z8F A;  1S7Y A;  3ILU B;  4KQP A;  3QAX A;  3T66 A;  5AA2 D;  5HM4 B;  5I56 B;  3ZKL A;  5KDT B;  3IJO B;  1BP5 A;  2Q88 A;  2O7I A;  4ZS9 A;  2UVI A;  1FTK A;  1H43 A;  2PBW A;  1FTJ A;  1A8E A;  3G7W A;  4F18 A;  1FW0 A;  4NED A;  4PFT A;  2ZYN A;  3C36 A;  5AA2 A;  1CE2 A;  1MXX A;  2QMW A;  3OEK A;  4MF3 A;  3R6U A;  4NF4 A;  4NF8 B;  3MUQ A;  5K2Y A;  1HSJ A;  3TKD A;  1IIT A;  4G8N A;  2OLB A;  1JW4 A;  2I0B A;  3HPI A;  3SES A;  2R9J A;  3VXC A;  3T9V A;  5ICT A;  5L9O A;  1D4N A;  4NWD A;  2O84 X;  5DEX A;  1B3E A;  2DVZ A;  3H6U A;  3EHU A;  4GRK A;  4LVQ A;  1NL5 A;  4F3G A;  3S9E A;  2UXA A;  2F97 A;  4JWO A;  2GH9 A;  4KCC A;  3RLF E;  4P11 A;  4U4S A;  4IGT A;  1DTZ A;  4LA9 A;  1FTM A;  1GR2 A;  2OBG A;  3LBS A;  1AIV A;  3FV1 A;  3FXQ A;  3FV2 A;  4PP0 A;  1B7H A;  4TQU Q;  1ZJL A;  3VLV A;  2B3B A;  5I59 B;  4KYD A;  3HCQ A;  4F2Q A;  5H8F A;  2HAV A;  1MH4 A;  3Q26 A;  2PYY A;  1GGG A;  3CFZ A;  1D9V A;  1TXF A;  4THI A;  1URS A;  3ZSF A;  2RKM A;  1II5 A;  4AB5 A;  4ECF A;  2RF1 A;  5JK4 A;  1FQF A;  1EZ9 A;  3N5L A;  4NF6 B;  1B3H A;  1EU8 A;  2Q8J A;  1LCF A;  3G3J A;  3ILT B;  4OEN A;  4YMB A;  2V3U A;  1FQC A;  1H3D A;  3C33 A;  3V8X B;  1ZIU A;  2IEE A;  4LAT A;  2RCA A;  3TQW A;  2D3I A;  4OWD A;  4OHN A;  1ELJ A;  1LAG E;  5CRY A;  2F5X A;  2V3Q A;  3OEN A;  4G8M A;  4QFL A;  1LB9 A;  2AL5 A;  1N04 A;  1POT A;  2I49 A;  1SI1 A;  3A09 A;  4FE8 A;  4R2B A;  3OEM A;  3E3K A;  3K6X A;  4XKP A;  4RJZ A;  5CMM A;  1R9Q A;  2F7B A;  2I0C A;  2WKY A;  3FVG A;  4NF5 A;  2Q2C A;  4GF8 A;  4BLA A;  3G3G A;  4XIG Q;  1P1W A;  4EF1 A;  3M3K A;  3OEL A;  1B0L A;  1P1O A;  3P7I A;  3O6I A;  3IO6 A;  4R9G A;  3TTM A;  1RYX A;  5H8N A;  5I59 A;  1B05 A;  1WOD A;  1ZLQ A;  4Q0C A;  3TMG A;  4YKJ A;  4GIZ A;  3N26 A;  4WED A;  4F3P A;  2H98 A;  1EZO A;  3FVK A;  5L8D A;  2ZMB A;  1N84 A;  3JZJ A;  4UA8 A;  4EXK A;  5CM6 A;  2XX8 A;  3VDF A;  3S9L C;  1FQB A;  3KOT A;  4QSC A;  4HTG A;  4GOT A;  1XC1 A;  3T22 A;  3IOT A;  3PD8 A;  1MPB A;  4QRZ A;  4TOZ A;  4Z7E A;  4N6P A;  2Y7R A;  4MH5 A;  3T9X B; 
#chains in the Genus database with same CATH topology
 3TTR A;  1MDQ A;  4P47 A;  1OMP A;  4NX1 A;  4DZ1 A;  3PPR A;  2THI A;  4F31 B;  4X04 A;  4QFK A;  2H9B A;  3QUJ A;  3K1P A;  4PFY A;  2P1S A;  4YB5 A;  1ATG A;  4F2O A;  2O1M A;  1N3W A;  4LZ7 A;  1Y4C A;  3RUM A;  2DXY A;  4JWY A;  3SZP A;  4WXJ A;  5I58 A;  2DE2 A;  4K3F A;  3TDJ A;  1MDP 1;  4PF8 A;  5H8Q A;  4U1Z A;  3K01 A;  2RCB A;  3K1N A;  4N6P A;  3KEI A;  2ZNT A;  1Z7M E;  1LBV A;  3ISP A;  4IO5 A;  2QJE A;  3U1O A;  2DWJ A;  3T0J A;  3L6G A;  2DYX A;  3FJ7 A;  3MZB A;  1IMC A;  4QF9 A;  4OYV A;  3T96 B;  4LZ5 A;  3EN3 A;  2ALU A;  4BDQ A;  4P3L A;  1LB8 A;  2GHA A;  3KJ7 A;  3PMX A;  3Q27 A;  1B6H A;  3TTK A;  4I9D A;  3N6T A;  3VE1 B;  2OCU A;  3CI8 A;  4FIM A;  4R75 A;  3PV0 E;  4G2Z A;  1B58 A;  2DWI A;  4G68 A;  1IUD A;  3U72 A;  1D9Q A;  5K2X A;  2X7P A;  2H4I A;  3GLB A;  1B5H A;  5FBP A;  1Q9D A;  4F19 A;  1QJM A;  2G93 A;  3FGS A;  4OER A;  2DP8 A;  1QGX A;  2OZZ A;  4AS5 A;  3UOR A;  2XX7 A;  3R26 A;  1IMB A;  3MC2 A;  5FHM A;  2CEY A;  1NUW A;  3VV5 A;  1SVX B;  1DK4 A;  3FUZ A;  1DPE A;  2YLN A;  4GQO A;  3OD7 A;  3ECR A;  3PPP A;  4EXL A;  5A5X B;  3FIR A;  2FVZ A;  3H6W A;  3TTN A;  2HZK A;  4MIJ A;  4P1L A;  3M3F A;  4G4P A;  2FA7 A;  1SBP A;  1T0K A;  2A5S A;  3TQL A;  2NOO A;  4H6D A;  3EKI A;  1B40 A;  4JDF A;  4LON B;  2R71 A;  4DLD A;  3QUF A;  4JB7 A;  4OMB A;  2UVJ A;  4ESX A;  4KPT A;  3N94 A;  1JQF A;  3H7M A;  2OWS A;  4OAN A;  2GRV A;  2Z8D A;  2B3F A;  4KYS A;  3O29 A;  2GFE A;  4PC9 A;  4JSD A;  3U92 A;  3C34 A;  4NG7 A;  3RPW A;  5I57 B;  3MVX A;  4X48 A;  4MNI A;  1NFT A;  1XT8 A;  4JSO A;  1LAX A;  2DDK A;  2I3V A;  1DOT A;  1BIY A;  3S2V A;  3IK6 B;  3D4G A;  2NUV A;  1USY H;  3BIG A;  3FAS A;  4F29 A;  1A55 A;  1SW4 A;  1Z7N E;  4N13 A;  3VLU A;  2RIN A;  5ITO A;  3IL1 B;  4NTL A;  3BFU A;  3LV0 A;  4I3E A;  1PDA A;  3F11 A;  1B5J A;  1R6Z A;  1FPB A;  1M5C A;  3KN7 A;  2VGQ A;  2VT5 A;  1SW5 A;  4BDL A;  3MWB A;  3E9X A;  4I8C A;  4R73 A;  4FOR A;  4LUB A;  3Q28 A;  1I6B A;  1US5 A;  4ONY A;  4GWW A;  4H0W A;  3W15 C;  4RNS A;  3NOH A;  2WX9 A;  3O6H A;  3AXF A;  4H8I A;  5EQ7 A;  1LBB A;  2DWH A;  1UIV A;  1PB7 A;  5IKB A;  1XOC A;  3KSJ A;  2FBP A;  4OVJ A;  2E1S A;  2HCA A;  4R2F A;  1FPJ A;  5ESY A;  3K6W A;  4ISU A;  2HEU A;  2PT2 A;  2OJT A;  4OZ9 A;  4QBA A;  2X26 A;  1IZ1 A;  5ITP A;  4H5F A;  3HN0 A;  1UIU A;  4DCX A;  3GBB A;  1IMA A;  4KFQ A;  3KJT A;  4PTK A;  1TFA A;  2I48 A;  2AIX A;  1FBH A;  4HE1 A;  2QVV A;  4TLL B;  1MQI A;  2I4C A;  5I2K A;  1A40 A;  2GQ1 A;  1MY2 A;  2ANJ A;  3IOV A;  1BKA A;  1IXI A;  4PET A;  2HXR A;  3KGC A;  3M3L A;  1M5B A;  3M8U A;  3CIJ A;  4L17 A;  3V5A A;  1FPF A;  5AA4 B;  1FQA A;  1MXV A;  2KLF A;  4MNC A;  3MJN A;  4P0I A;  2JJK A;  3PMV A;  4EQB A;  3ONM A;  4JBZ A;  5L9M A;  4KCD A;  3IB1 A;  1EYJ A;  2KQZ A;  1HSE A;  3ODB A;  1IQ7 A;  1DMB A;  1R1N A;  3EF7 A;  5HPQ A;  4MAG A;  4GWZ A;  4U2R A;  1MM6 A;  4IO3 A;  4OFO A;  3ILU B;  3T66 A;  3QAX A;  5HM4 B;  3T1B A;  3ZKL A;  1BP5 A;  2Q88 A;  2O7I A;  5ET6 A;  1A8E A;  4F18 A;  3C36 A;  3TKD A;  4MX6 A;  1IIT A;  5L9O A;  3SES A;  2R9J A;  2O84 X;  4PGN A;  4PDH A;  2DVZ A;  3HFU A;  4F3G A;  2F97 A;  2GH9 A;  3RLF E;  4IGT A;  1DTZ A;  4PFR A;  3FV2 A;  1II5 A;  4ECF A;  2RF1 A;  5JK4 A;  1EU8 A;  2Q8J A;  3G3J A;  3ILT B;  4MEV A;  1H3D A;  2IEE A;  3B8B A;  4OHN A;  2AL5 A;  2I49 A;  3OEM A;  3U65 A;  2F7B A;  3MYU A;  3M3K A;  1B0L A;  3P7I A;  4N15 A;  1B05 A;  1WOD A;  1ZLQ A;  4Q0C A;  3N26 A;  4WED A;  2H98 A;  3FVK A;  5L8D A;  4UA8 A;  5CM6 A;  3JZJ A;  1XC1 A;  3T22 A;  4IR8 A;  3MPL A;  4MH5 A;  3K2D A;  2DE4 A;  3RT8 A;  3TCG A;  5JTY A;  1I6A A;  3BFT A;  4R72 A;  1OQG A;  2F78 A;  5KZT A;  3VFJ A;  1NI9 A;  1XI6 A;  4ELP A;  2E0S A;  2F7A A;  5H8S A;  4ND9 A;  3W9V A;  2QSX A;  1A99 A;  2O6A A;  3PUX E;  4F22 A;  1RYO A;  4P0G A;  3QXM A;  1VR5 A;  1KA0 A;  1GTK A;  5I2N B;  4KD5 A;  3CSG A;  2PFZ A;  3H03 A;  1RDY A;  3DEL B;  1B51 A;  2I58 A;  3TCH A;  4GWX A;  2REJ A;  3O6G A;  4XKN A;  3SER A;  3PUW E;  4HS7 A;  1OIB A;  3H6V A;  2ZNU A;  1QKB A;  1TT1 A;  3MZ1 A;  5ISU A;  3C31 A;  3RPL B;  3KN8 A;  1PB8 A;  2HXW A;  5I56 A;  5KDT A;  4PAI A;  2HZL A;  1FQD A;  3VVD A;  1P1N A;  4G68 C;  4DDD A;  3OSR A;  1JVY A;  3RN8 A;  3KOS A;  3HV1 A;  1SDX A;  4OVS A;  5DW8 A;  2XX9 A;  2A5T A;  4E0W A;  2VHA A;  4KXP A;  1Y9U A;  4QFN A;  4PDD A;  4TLM B;  3CR9 A;  4E0X A;  4IO2 A;  4OEV A;  3KSX A;  5TPA A;  2Y7K A;  1UTB B;  4XXU A;  4OES A;  3V89 B;  1N0T A;  2V25 A;  2XXQ A;  5I3S A;  4PAK A;  3S9M C;  4YMA A;  1IMD A;  1AWB A;  2KR0 A;  1EZP A;  3K0V A;  4IO7 A;  5EYF A;  5FHO A;  2HAU A;  4N8G A;  2CEX A;  3KN3 A;  4XEQ A;  1N3X A;  3IB2 A;  4I3Y A;  4IO4 A;  3OOA A;  3O9P A;  1SYH A;  2CZI A;  2CMO A;  4PBQ A;  2P2A A;  4NF4 B;  4H5G A;  1PEB A;  1Y3N A;  5DVJ A;  5TU0 A;  4U21 A;  2XXU A;  2DSF A;  1MG1 A;  3FJG A;  3SEV A;  2F8D A;  1DSN A;  3WAF A;  3GXA A;  1D9Y A;  1JP4 A;  2Q9T A;  3EQ1 A;  3FBP A;  3SEW A;  1QUK A;  3HHG A;  4MCO A;  1YXI A;  3JYR A;  3CFX A;  1M5F A;  1MXU A;  1VDW A;  4OVP A;  2ONS A;  3DP4 A;  3SET A;  4M4G A;  5IGA A;  3TEL A;  1LFI A;  2WBB A;  3OXN A;  3BKI B;  4G68 B;  1A8F A;  4FJP A;  4KHZ E;  2QL3 A;  3S4U A;  1FBF A;  5H8F B;  4IY5 A;  1MXY A;  3A3U A;  2REG A;  3W9W A;  4EQ7 A;  3TOD A;  2Q2A A;  2YPN A;  5JEI A;  1M5E A;  5KCJ A;  1NV0 A;  4N07 A;  5F7V A;  2UYE A;  3MP1 A;  2VD2 A;  2FYI A;  2A5T B;  1O63 A;  3EHS A;  2QS4 A;  4U22 A;  5LOM A;  4IB2 A;  1LLS A;  4NWC A;  3H6T A;  3KZG A;  3RPL A;  3FXR A;  4LQ5 A;  4FAJ A;  5A5X A;  1UTH A;  3EHT A;  1YYZ A;  4U1O A;  2ONR A;  2BJJ X;  5EQ9 A;  2O7U A;  4Q8R A;  1NV3 A;  1B5I A;  5TPA B;  3CG3 A;  3TCF A;  3A3C A;  5BUU A;  1G0I A;  3H4Z A;  4WKM A;  1H76 A;  5EHM A;  3MP8 A;  5CBS A;  5I2N A;  1IIW A;  1DBZ A;  4GL8 A;  1FTL A;  4OVT A;  3CG1 A;  3QYT A;  5IZ1 A;  3PUV E;  3QIM A;  4DIG A;  1OLC A;  3FZV A;  1RDZ A;  4MMP A;  3D1R A;  2F6G A;  1A7L A;  1VFD A;  3PPQ A;  4NN3 A;  1INP A;  2ZYO A;  4QXD A;  1CB6 A;  1G0H A;  3TPA A;  2F35 A;  3TFL A;  3FJM A;  3TEP A;  3GBA A;  3SEY A;  2PVU A;  3D4C A;  3QMF A;  4LZ8 A;  4ZE8 A;  4GVO A;  4AB6 A;  1MM7 A;  2Y5L A;  3RY3 A;  2R6G E;  4YKK A;  2B4M A;  5F24 A;  1ANF A;  5TP9 B;  3UA8 A;  3OO7 A;  4RY1 A;  3MZ9 A;  4XFE A;  2Q89 A;  1POY 1;  3OSQ A;  3MVZ A;  1XS5 A;  2OX3 A;  1B7U A;  2QMX A;  4EQ9 A;  1GV8 A;  1NNT A;  3IO4 A;  2RC8 A;  4N4U A;  1ZKB A;  4OFL A;  2MKZ A;  1XVY A;  4GX6 A;  5TP9 A;  4OA4 A;  4KQP A;  2UVI A;  1FTJ A;  2WYP A;  4NED A;  4PAF A;  4PFT A;  5AA2 A;  1MXX A;  2QMW A;  3OEK A;  4JVC A;  1HSJ A;  4G8N A;  1JW4 A;  2I0B A;  5ICT A;  3T9V A;  2XXK A;  1D4N A;  5DEX A;  1FBP A;  3H6U A;  1NL5 A;  3S9E A;  2UXA A;  4MNP A;  4JWO A;  4P11 A;  4U4S A;  1FBE A;  5EQ8 A;  1GR2 A;  2OBG A;  3FXQ A;  4PP0 A;  2B3B A;  5H8F A;  2PYY A;  4THI A;  1D9V A;  1URS A;  3N5L A;  4OEN A;  1NV5 A;  4YMB A;  3C33 A;  3TQW A;  2RCA A;  1LAG E;  2V3Q A;  3OEN A;  4QFL A;  4HE0 A;  3A09 A;  4O94 A;  1NV6 A;  3E3K A;  3K6X A;  4RJZ A;  5CMM A;  2WKY A;  3G3G A;  1P1W A;  3OEL A;  3TTM A;  4R9G A;  1RYX A;  5I59 A;  4F3P A;  1EZO A;  2ZMB A;  1N84 A;  2XX8 A;  3VDF A;  3KOT A;  4HTG A;  2R8T A;  3PD8 A;  1MPB A;  1FPD A;  2Y7R A;  3IR1 A;  2F3D A;  3T9X B;  3IOR A;  1FQE A;  1MQD A;  4PFU A;  4P9K A;  2V84 A;  2XD2 A;  1WVJ A;  3OMB A;  3FVO A;  3FXU A;  4GWY A;  3G3K A;  4N17 A;  1RKM A;  2XXH A;  3SKP A;  3MPK A;  4H8J A;  4MBP A;  1H44 A;  1IEJ A;  4HCY A;  4KR5 A;  4NF6 A;  3SEU A;  1LBC A;  2XWV A;  3BBR A;  4RA1 A;  1FRP A;  3UGW A;  1FJ6 A;  4FED A;  4P1E A;  1B3L A;  1B32 A;  3MW0 A;  1SW1 A;  3H06 B;  1Y3Q A;  3WAE A;  1EYK A;  4NF5 B;  4ZZE A;  3HST A;  3MST A;  4NF0 A;  2OWT A;  4LAT A;  1LFH A;  3RGY A;  2Z22 A;  2V93 A;  3QK6 A;  1ZBM A;  1HSL A;  3PD9 A;  4BDO A;  2DE3 A;  2DS9 A;  4HW8 A;  3PGF A;  5LDZ A;  5JTY B;  1AIV A;  2F7C A;  5DTB A;  1DPP A;  2LAO A;  2XXI A;  4YU0 A;  1SD3 A;  3DM0 A;  2D21 A;  4FEB A;  3LSL A;  5HBC A;  3TTL A;  4POX A;  4ZE9 A;  1Q1K A;  4N6D A;  1FPI A;  1B9J A;  4PFW A;  4PCD A;  3EPE A;  5J1D A;  1NV1 A;  2H5Y A;  4O7M A;  4DI3 D;  1PC3 A;  4F1Y A;  2XWI A;  4DCY A;  2XXV A;  3K6U A;  3IFC A;  2VPO A;  4GX4 A;  1FPE A;  4NE4 A;  1OLA A;  1LCT A;  5ET8 A;  4ZEB A;  4LN5 A;  2Z23 A;  1A54 A;  3C32 A;  4OVR A;  3S9N C;  4R74 A;  1MRP A;  2Y7W A;  2QS2 A;  4PF6 A;  4ELO A;  1B3G A;  4XKR A;  1NMU A;  1PBP A;  2OWZ A;  1MPD A;  4N6K A;  2W7Y A;  4NMY A;  1Y4T A;  3E13 X;  1SYI A;  5I84 A;  3MAM A;  3IX1 A;  1PBQ A;  1KA1 A;  1KZ8 A;  2PX1 A;  4BDM A;  4DI4 B;  1Y1Z A;  3MQ9 A;  1NV4 A;  2DXR A;  1URD A;  5AA3 A;  1NV2 A;  4F1V A;  3DP8 A;  4G61 A;  1XVX A;  5ELV A;  4O7I A;  1JW1 A;  1US4 A;  2F36 A;  4X1D A;  2H25 A;  3UIF A;  4BDR A;  2P3N A;  4OTE A;  3K6V A;  2B4L A;  4RXL A;  5I58 B;  3A29 A;  5CMK A;  2Z8E A;  2QPQ A;  1J1N A;  2CZL A;  1SW2 A;  3CSB A;  3LC8 A;  1P1U A;  4EDP A;  3RNN A;  4PBH A;  1B46 A;  3Q29 A;  4C1T A;  2O68 A;  3VXB A;  1MY1 A;  1M5D A;  3IJX B;  1Q35 A;  1JET A;  3B6Q A;  4QFP A;  4BLA A;  2GHB A;  2YJP A;  4FAT A;  2P3V A;  3VLW A;  4DXC A;  3GYY A;  3U8Q A;  1WDN A;  3CRB A;  5IZ3 B;  1OVB A;  2Q74 A;  3UN6 A;  2X7Q A;  1JVX A;  1QW0 A;  3E79 A;  3B6T A;  4LQ2 A;  1O7T A;  5EYG A;  1AMF A;  4G77 A;  2ABH A;  3FAT A;  1LBZ A;  2BJI A;  3IAZ A;  4DE8 A;  5T3J A;  4DXB A;  2O69 A;  4H45 A;  4C1U A;  1MPC A;  4UAC A;  4G8H A;  3MP6 A;  2Q8M A;  5ET7 A;  4H1X A;  4I1D A;  1MQG A;  1NUZ A;  3Q25 A;  1AOV A;  1Y1M A;  2WYK A;  4MLQ A;  2ESN A;  1N7W A;  1FBD A;  1YCJ A;  4PFI A;  4UAB A;  4Q30 B;  4PQJ A;  4JWX A;  1MQJ A;  2H99 A;  4OXV A;  4NAP A;  5M2V A;  2Y7P A;  2F3B A;  1FBG A;  1S50 A;  4GL0 A;  1UTH B;  3QSL A;  4RK9 A;  1BK4 A;  2XXT A;  5CC2 A;  1B4Z A;  3MVY A;  3K4U A;  5F1Q A;  4GLI A;  2QS1 A;  4HXV A;  5AA2 B;  2I4B A;  3I5O A;  1B52 A;  4AQ4 A;  1FCK A;  3PUY E;  4Q5T A;  3LUZ A;  4XTC Q;  1TFD A;  3SDF A;  5I2K B;  3UP9 A;  4YIC A;  4JVI A;  3CHG A;  2XWO A;  2VD3 A;  2ZNS A;  3PTY A;  4U23 A;  3G3I A;  2PFY A;  2Y5K A;  5CMC A;  1UQW A;  3N6U A;  2NWJ A;  3B50 A;  3VVF A;  1QUJ A;  3OO6 A;  1B7Z A;  2NXO A;  4EF2 A;  1R9L A;  1FTO A;  3DP6 A;  3TUS A;  3L6H A;  2ZZV A;  1FSA A;  1CNQ A;  3O2A A;  4KYE A;  1QKA A;  1UTB A;  2HHM A;  5BWJ A;  5B7D A;  1H45 A;  4R6H A;  4F1U A;  4ZDM A;  4MLV A;  2G29 A;  4ZED A;  2XHD A;  2O1L A;  2ZZW A;  4QSE A;  3K02 A;  4ZEI A;  1LST A;  2XXW A;  2AYS A;  1AH5 A;  3TZA A;  2XXP A;  1NNF A;  3B7D A;  3TYH A;  1MH3 A;  1VFE A;  1SQY A;  4FBP A;  2Z8F A;  1S7Y A;  1NUX A;  5KDT B;  4MJO A;  5AA2 D;  4NQ8 A;  5I56 B;  1H43 A;  2PBW A;  3G7W A;  1FW0 A;  2ZYN A;  1CE2 A;  4MF3 A;  4NF4 A;  3R6U A;  3MUQ A;  1EYI A;  2OLB A;  3HPI A;  4XF5 A;  1B3E A;  4GRK A;  4X8R A;  5J16 A;  3LBS A;  3FV1 A;  4TQU Q;  4KYD A;  4F2Q A;  2HAV A;  3Q26 A;  1GGG A;  3CFZ A;  2XWK A;  2RKM A;  1EZ9 A;  4NF6 B;  1LCF A;  3IFA A;  5CRY A;  2F5X A;  4G8M A;  1N04 A;  1SI1 A;  4OVQ A;  4FE8 A;  4NF5 A;  1R9Q A;  3FVG A;  2Q2C A;  4XIG Q;  3ROJ A;  3O6I A;  3IO6 A;  4GIZ A;  3KC1 A;  4EXK A;  3S9L C;  1FQB A;  4QSC A;  3IOT A;  2XXY A;  2HQ0 A;  1DCU A;  4ZEF A;  5B70 A;  2O51 A;  2F34 A;  3HHF A;  3PU5 A;  4PGP A;  2XD3 A;  3BIH A;  3RT6 B;  1NNK A;  1DTG A;  5IM2 A;  4ZEC A;  1IME A;  2V3T A;  3OO8 A;  5DVF A;  1RDX A;  5AE4 A;  1P1Q A;  2DQV A;  2D5W A;  3U93 A;  1YPN A;  3DLN A;  4YAH X;  3RYD A;  1NKX A;  4C0R A;  3FVN A;  3KG2 A;  2QRY A;  3O97 A;  3SEX A;  2I3W A;  1BTJ A;  4O8M A;  4N91 A;  5DEX B;  3LSW A;  1JEU A;  3OO9 A;  1MXZ A;  2VOZ A;  1LAF E;  1LFG A;  1URG A;  4GXS B;  1B0H A;  2FNC A;  2XXR A;  5IZZ A;  1IXH A;  4RYA A;  5I7I A;  4OQO A;  1FPG A;  1ZMG A;  4R9F A;  2QVR A;  2PT1 A;  3ZKK A;  3LUY A;  3G3F A;  5FTH A;  3IOW A;  2RC7 A;  5LTC A;  4GWU A;  3HO7 A;  1I6Q A;  2DWA A;  2CZH A;  5H8H B;  3TAJ A;  5ICQ A;  4N81 A;  4H65 A;  1MY3 A;  1B1H A;  3MBP A;  1MXW A;  4FEC A;  3IB0 A;  1D3K A;  4MHF A;  1QUI A;  4P56 A;  4GD5 A;  5I57 A;  2ZZX A;  3KC0 A;  4GWS A;  4PFB A;  1LBW A;  1K9Z A;  3O28 A;  1SI0 A;  1IXG A;  4YKI A;  3KFM A;  2XA5 A;  4I40 A;  4IO6 A;  1IXC A;  4BDN A;  1P99 A;  5L9S A;  5FTI A;  4LP2 B;  3LR1 A;  4MFI A;  1FPL A;  1YZ0 A;  3LSX A;  4RPO A;  1B3F A;  1Y20 A;  5IAI A;  4NF8 A;  2Y7I A;  5DT6 A;  4X9T A;  4KI0 E;  2HPG A;  3T9H B;  1LGB C;  4Z0I A;  4OFJ A;  3VVE A;  4H67 A;  3CFL A;  3KBR A;  4X1B A;  2B65 A;  3MVW A;  4QFO A;  5DVI A;  3C9H A;  2ONK E;  1NH8 A;  5DYH A;  4GBV A;  1S9T A;  5H8Q B;  1MY4 A;  1OQH A;  2XXX A;  3E78 A;  1F9B A;  4YB6 A;  5EYH A;  2FIE A;  1MS7 A;  2UYF A;  1ZTY A;  3I6V A;  1K9Y A;  4O3B A;  4DXU A;  4POW A;  1MQH A;  3C35 A;  3CVG A;  1YTV A;  2AL4 A;  4RPN A;  3PPN A;  2CZK A;  1MY0 A;  1FTA A;  4YB7 A;  3V83 A;  3H3G A;  4ZZA A;  4ELR A;  1TWY A;  4GWO A;  1FPK A;  4HE2 A;  4NHB A;  4R6Y A;  3THI A;  1N76 A;  1FJ9 A;  1JW5 A;  2QFL A;  5EHS A;  1L5T A;  2M8C A;  4XKQ A;  3ZS6 A;  3E4R A;  4HCW A;  5H8N B;  1I69 A;  4AS4 A;  5A5L A;  1KWH A;  2PMS A;  2WBD A;  2DVC A;  2WEF A;  1B1X A;  4F3S A;  4IY6 A;  4F3B A;  5AA1 A;  3KBZ A;  3IOU A;  4ZEK A;  4M1V A;  4JXI A;  1B4H A;  5KCJ B;  1VSO A;  3C4M A;  2QVU A;  4IGR A;  2I6E A;  4F39 A;  4PE5 B;  2IA4 A;  4O3A A;  4QSD A;  2DOJ A;  5IZ3 A;  3LSF B;  2UVH A;  3RTW B;  2ZYM A;  3FXB A;  1VE4 A;  3FD3 A;  1QUL A;  4I62 A;  3JV9 A;  3UK4 A;  2F6P A;  5AA4 A;  5H8H A;  4H46 A;  4OEU A;  1FBC A;  2ZYK A;  3G3H A;  3K00 A;  3RTF B;  4OET A;  3B6W A;  1AL3 A;  4NGU A;  1ZU0 A;  4GXA A;  5CBR A;  2VPN A;  4RK2 A;  1BLF A;  4YZZ A;  4GBW A;  4U4X A;  5CI5 A;  2ZXT A;  1SPI A;  1B2H A;  1QVS A;  2V4C A;  3PUZ E;  4QHQ A;  2HFB A;  5CMB A;  1NH7 A;  2L5V A;  1LAH E;  1N7X A;  1USY E;  2Y84 A;  3R7X A;  5FHN A;  1IMF A;  4GFR A;  1OVT A;  4PE3 A;  4O3C A;  1Y3P A;  3I3V A;  1GVC A;  1O64 A;  3RQT A;  4R6K A;  3T93 B;  1NV7 A;  4EUO A;  3PPO A;  1NNP A;  4YKP A;  1JNF A;  1XHY A;  4GX3 A;  2RC9 A;  3PMW A;  2OK2 A;  1JEV A;  2QS3 A;  2FIX A;  2NVU B;  3O66 A;  1PB9 A;  3GZG A;  4WEP A;  1YAE A;  3K1M A;  4JVD A;  3USD A;  4ELQ A;  3U94 A;  2FHY A;  3T9U A;  1EH3 A;  2P0S A;  2UVG A;  2VP1 A;  3IJO B;  4ZS9 A;  5EQA A;  1FTK A;  4P8B A;  5K2Y A;  4NF8 B;  3VXC A;  1LBX A;  4NWD A;  3EHU A;  4LVQ A;  4KCC A;  4LA9 A;  1FTM A;  2PCR A;  1B7H A;  3VLV A;  1ZJL A;  5I59 B;  3HCQ A;  1MH4 A;  1LEV A;  1TXF A;  3ZSF A;  4AB5 A;  1FQF A;  1B3H A;  2V3U A;  1FQC A;  3V8X B;  1ZIU A;  2D3I A;  4OWD A;  1ELJ A;  1LB9 A;  1POT A;  4R2B A;  5I5P A;  4XKP A;  1NUY A;  2I0C A;  4GF8 A;  4EF1 A;  1LBY A;  1P1O A;  5H8N A;  3TMG A;  4N8Y A;  4YKJ A;  4GOT A;  5ET5 A;  4QRZ A;  4TOZ A;  4Z7E A;  4ESW A; 
#chains in the Genus database with same CATH homology
 3TTR A;  3IOR A;  1MDQ A;  3K2D A;  1FQE A;  2DE4 A;  1OMP A;  2HQ0 A;  2XXY A;  3RT8 A;  3TCG A;  4ZEF A;  5B70 A;  1I6A A;  1MQD A;  2O51 A;  2F34 A;  3HHF A;  3BFT A;  4PFU A;  4DZ1 A;  3PU5 A;  4R72 A;  1OQG A;  3MPL A;  2F78 A;  2V84 A;  2XD2 A;  3PPR A;  1WVJ A;  2THI A;  2XD3 A;  3FVO A;  3FXU A;  3OMB A;  1NNK A;  3G3K A;  3RT6 B;  3VFJ A;  5KZT A;  1DTG A;  1RKM A;  4F31 B;  4ELP A;  2XXH A;  4ZEC A;  2V3T A;  2E0S A;  4QFK A;  2H9B A;  2F7A A;  3QUJ A;  3OO8 A;  3K1P A;  3SKP A;  4PFY A;  2P1S A;  4YB5 A;  3MPK A;  4H8J A;  4MBP A;  1ATG A;  5DVF A;  5H8S A;  4ND9 A;  1H44 A;  3W9V A;  1IEJ A;  4F2O A;  2QSX A;  1A99 A;  5AE4 A;  4HCY A;  2O1M A;  2O6A A;  3PUX E;  4KR5 A;  1P1Q A;  1RYO A;  4NF6 A;  3SEU A;  4F22 A;  4P0G A;  3QXM A;  1N3W A;  2DQV A;  2D5W A;  1VR5 A;  4LZ7 A;  1GTK A;  1LBC A;  1Y4C A;  5I2N B;  3U93 A;  1YPN A;  3RUM A;  3DLN A;  2DXY A;  3BBR A;  4JWY A;  4KD5 A;  4RA1 A;  4WXJ A;  4YAH X;  5I58 A;  4C0R A;  1NKX A;  2DE2 A;  4K3F A;  3UGW A;  3FVN A;  3KG2 A;  3TDJ A;  4F39 A;  3CSG A;  4FED A;  1MDP 1;  1B3L A;  1B32 A;  3H03 A;  3MW0 A;  1SW1 A;  2QRY A;  3DEL B;  3H06 B;  3O97 A;  1Y3Q A;  5H8Q A;  3WAE A;  3SEX A;  1B51 A;  4NF5 B;  4ZZE A;  2I58 A;  2I3W A;  3HST A;  3TCH A;  1BTJ A;  2REJ A;  4U1Z A;  3O6G A;  5DEX B;  3K01 A;  2RCB A;  4XKN A;  3LSW A;  3SER A;  1JEU A;  3OO9 A;  3PUW E;  1MXZ A;  2OWT A;  1LAF E;  2VOZ A;  1LFG A;  1OIB A;  1URG A;  3H6V A;  2ZNU A;  3K1N A;  4GXS B;  4HS7 A;  1QKB A;  1TT1 A;  1B0H A;  2Z22 A;  3KEI A;  3RGY A;  2ZNT A;  2V93 A;  2FNC A;  1Z7M E;  2XXR A;  3MZ1 A;  1ZBM A;  3QK6 A;  5ISU A;  1HSL A;  3C31 A;  1IXH A;  4IO5 A;  2QJE A;  4RYA A;  3U1O A;  4OQO A;  3KN8 A;  2DWJ A;  3PD9 A;  1ZMG A;  4R9F A;  1PB8 A;  2HXW A;  4BDO A;  5I56 A;  2DE3 A;  5KDT A;  2DS9 A;  3L6G A;  2HZL A;  4HW8 A;  1FQD A;  2PT1 A;  2DYX A;  3VVD A;  3LUY A;  3PGF A;  3ZKK A;  5JTY B;  3G3F A;  1P1N A;  4G68 C;  3FJ7 A;  4DDD A;  3OSR A;  3MZB A;  5FTH A;  4QF9 A;  1JVY A;  3IOW A;  3RN8 A;  3KOS A;  2F7C A;  3HV1 A;  4OYV A;  2RC7 A;  3T96 B;  1SDX A;  5DTB A;  1DPP A;  2LAO A;  4LZ5 A;  3HO7 A;  1I6Q A;  2DWA A;  3EN3 A;  2XX9 A;  2A5T A;  5H8H B;  4E0W A;  2ALU A;  2VHA A;  4BDQ A;  2XXI A;  4YU0 A;  3TAJ A;  1Y9U A;  5ICQ A;  4QFN A;  1SD3 A;  1LB8 A;  2GHA A;  3KJ7 A;  3DM0 A;  4TLM B;  3PMX A;  2D21 A;  1MY3 A;  3Q27 A;  1B1H A;  4FEB A;  3CR9 A;  3MBP A;  4H65 A;  4E0X A;  1B6H A;  3TTK A;  1MXW A;  3LSL A;  3KSX A;  4I9D A;  4IO2 A;  4OEV A;  5HBC A;  3TTL A;  3N6T A;  4FEC A;  4POX A;  1Q1K A;  2OCU A;  5TPA A;  3VE1 B;  4ZE9 A;  2Y7K A;  3CI8 A;  1UTB B;  1B9J A;  3IB0 A;  4PFW A;  4FIM A;  4R75 A;  4XXU A;  1D3K A;  3PV0 E;  4OES A;  3V89 B;  4G2Z A;  1QUI A;  1B58 A;  1N0T A;  2DWI A;  1IUD A;  3EPE A;  4G68 A;  2H5Y A;  2V25 A;  4GD5 A;  3U72 A;  2XXQ A;  5I57 A;  5K2X A;  2X7P A;  2H4I A;  1PC3 A;  3GLB A;  4F1Y A;  3S9M C;  1B5H A;  4YMA A;  4DCY A;  2XXV A;  3K6U A;  4F19 A;  1QJM A;  2G93 A;  3FGS A;  4OER A;  1EZP A;  3O28 A;  2DP8 A;  4NE4 A;  1OLA A;  1LCT A;  1SI0 A;  1IXG A;  4YKI A;  3K0V A;  4IO7 A;  5EYF A;  3KFM A;  5FHO A;  4IO6 A;  4ZEB A;  2OZZ A;  1IXC A;  2HAU A;  2Z23 A;  1A54 A;  3C32 A;  4BDN A;  3S9N C;  1P99 A;  5L9S A;  4R74 A;  5FTI A;  3KN3 A;  3UOR A;  1MRP A;  2XX7 A;  2Y7W A;  2QS2 A;  3MC2 A;  3R26 A;  5FHM A;  1N3X A;  3VV5 A;  4LP2 B;  1SVX B;  3LR1 A;  4MFI A;  3FUZ A;  1DPE A;  4ELO A;  2YLN A;  3IB2 A;  1B3G A;  4IO4 A;  4XKR A;  3LSX A;  3OOA A;  3O9P A;  4GQO A;  1NMU A;  1PBP A;  3ECR A;  1SYH A;  3OD7 A;  1B3F A;  3PPP A;  1MPD A;  1Y20 A;  4RPO A;  4EXL A;  5A5X B;  2CMO A;  5IAI A;  2W7Y A;  3FIR A;  1Y4T A;  2P2A A;  4NF8 A;  4NF4 B;  4H5G A;  3E13 X;  4NMY A;  1SYI A;  5I84 A;  2Y7I A;  3MAM A;  1PEB A;  1Y3N A;  3H6W A;  4KI0 E;  4X9T A;  5DT6 A;  5DVJ A;  3TTN A;  3IX1 A;  1PBQ A;  5TU0 A;  3T9H B;  5JTY A;  4U21 A;  1LGB C;  2XXU A;  2PX1 A;  4BDM A;  2DSF A;  1MG1 A;  1Y1Z A;  2HZK A;  4Z0I A;  3FJG A;  3SEV A;  3MQ9 A;  2F8D A;  4OFJ A;  1DSN A;  4H67 A;  3GXA A;  3VVE A;  1D9Y A;  2DXR A;  3M3F A;  3CFL A;  1URD A;  1SBP A;  2FA7 A;  3KBR A;  4G4P A;  4X1B A;  1T0K A;  2A5S A;  5AA3 A;  3TQL A;  2B65 A;  3MVW A;  4QFO A;  4F1V A;  2NOO A;  3DP8 A;  1XVX A;  3C9H A;  5DVI A;  5ELV A;  2ONK E;  1JW1 A;  2Q9T A;  1NH8 A;  4H6D A;  5DYH A;  1US4 A;  1B40 A;  3EQ1 A;  2F36 A;  4JDF A;  4LON B;  3SEW A;  1QUK A;  4X1D A;  3HHG A;  2H25 A;  3UIF A;  1S9T A;  2R71 A;  4BDR A;  5H8Q B;  1MY4 A;  4DLD A;  4OTE A;  3K6V A;  3QUF A;  4JB7 A;  4OMB A;  2UVJ A;  4ESX A;  1OQH A;  2XXX A;  1F9B A;  4KPT A;  3N94 A;  3JYR A;  3CFX A;  1JQF A;  3H7M A;  4RXL A;  4YB6 A;  5I58 B;  1M5F A;  1MXU A;  2OWS A;  5CMK A;  2GRV A;  2Z8E A;  2ONS A;  2QPQ A;  2Z8D A;  1J1N A;  2B3F A;  2CZL A;  4KYS A;  1MS7 A;  3DP4 A;  3O29 A;  2GFE A;  1SW2 A;  2UYF A;  3SET A;  4M4G A;  3CSB A;  3LC8 A;  1ZTY A;  1P1U A;  4JSD A;  3I6V A;  4O3B A;  3TEL A;  4DXU A;  1LFI A;  4EDP A;  3RNN A;  3U92 A;  1LFH A;  3C34 A;  1B46 A;  1MQH A;  3C35 A;  3Q29 A;  4POW A;  3CVG A;  3RPW A;  4C1T A;  2O68 A;  3OXN A;  3VXB A;  1MY1 A;  1YTV A;  3BKI B;  2AL4 A;  1M5D A;  4G68 B;  3IJX B;  1Q35 A;  5I57 B;  1JET A;  1A8F A;  3B6Q A;  3MVX A;  3PPN A;  4QFP A;  1MY0 A;  4RPN A;  2GHB A;  4FJP A;  4KHZ E;  4X48 A;  1NFT A;  2YJP A;  4YB7 A;  3H3G A;  3V83 A;  2QL3 A;  4ZZA A;  1XT8 A;  3S4U A;  4JSO A;  4ELR A;  4FAT A;  5H8F B;  1LAX A;  1TWY A;  4GWO A;  4IY5 A;  2I3V A;  3VLW A;  4DXC A;  1MXY A;  3A3U A;  1DOT A;  3U8Q A;  4R6Y A;  2REG A;  1WDN A;  3CRB A;  3W9W A;  4EQ7 A;  1OVB A;  1BIY A;  2Q2A A;  2YPN A;  3IK6 B;  3S2V A;  3THI A;  3TOD A;  3D4G A;  3UN6 A;  2NUV A;  1USY H;  2X7Q A;  1JVX A;  1M5E A;  5JEI A;  1QW0 A;  3FAS A;  5KCJ A;  4N07 A;  5F7V A;  2UYE A;  3MP1 A;  4F29 A;  1N76 A;  1A55 A;  1SW4 A;  1Z7N E;  2VD2 A;  3B6T A;  4LQ2 A;  2FYI A;  2A5T B;  4N13 A;  3VLU A;  1O63 A;  1JW5 A;  2RIN A;  5EHS A;  1O7T A;  1L5T A;  2M8C A;  1AMF A;  3EHS A;  2QS4 A;  4G77 A;  5ITO A;  4U22 A;  4XKQ A;  5LOM A;  3IL1 B;  2ABH A;  3E4R A;  4HCW A;  4IB2 A;  3ZS6 A;  1I69 A;  3FAT A;  5H8N B;  4NTL A;  3BFU A;  1KWH A;  1LLS A;  4NWC A;  3IAZ A;  4DE8 A;  3H6T A;  4DXB A;  1PDA A;  2O69 A;  2PMS A;  3F11 A;  4C1U A;  3KZG A;  2DVC A;  1B5J A;  1MPC A;  1R6Z A;  4UAC A;  1B1X A;  3FXR A;  4G8H A;  4LQ5 A;  3MP6 A;  4F3S A;  4FAJ A;  4IY6 A;  1M5C A;  5A5X A;  1UTH A;  3EHT A;  4F3B A;  4H1X A;  3KN7 A;  2VGQ A;  4U1O A;  4I1D A;  1SW5 A;  5AA1 A;  1MQG A;  4BDL A;  2ONR A;  3MWB A;  3Q25 A;  2BJJ X;  3IOU A;  4ZEK A;  1AOV A;  3E9X A;  2O7U A;  4M1V A;  4JXI A;  1B4H A;  5KCJ B;  1VSO A;  1Y1M A;  4I8C A;  4R73 A;  3C4M A;  4Q8R A;  4FOR A;  4IGR A;  2I6E A;  4LUB A;  4MLQ A;  4PE5 B;  2ESN A;  1I6B A;  1N7W A;  2IA4 A;  3Q28 A;  1US5 A;  2DOJ A;  4O3A A;  4ONY A;  4H0W A;  4QSD A;  3W15 C;  1YCJ A;  1B5I A;  5TPA B;  3LSF B;  4RNS A;  3CG3 A;  2UVH A;  3RTW B;  4Q30 B;  4PQJ A;  2ZYM A;  3TCF A;  3A3C A;  5BUU A;  4JWX A;  3H4Z A;  1VE4 A;  4WKM A;  5CC2 A;  1MQJ A;  3FD3 A;  2H99 A;  1H76 A;  1QUL A;  4I62 A;  4OXV A;  5EHM A;  3O6H A;  3AXF A;  3JV9 A;  3MP8 A;  4H8I A;  5CBS A;  5I2N A;  1IIW A;  2F6P A;  5M2V A;  1LBB A;  3UK4 A;  2DWH A;  4GL8 A;  5AA4 A;  5H8H A;  1UIV A;  1PB7 A;  1FTL A;  2Y7P A;  2ZYK A;  4OEU A;  3G3H A;  3K00 A;  3RTF B;  5IKB A;  1XOC A;  1S50 A;  4ESW A;  4GL0 A;  1UTH B;  3CG1 A;  3QSL A;  4OET A;  4RK9 A;  3B6W A;  3KSJ A;  1AL3 A;  2XXT A;  2E1S A;  4OVJ A;  1B4Z A;  3QYT A;  2HCA A;  3PUV E;  1ZU0 A;  3MVY A;  4GXA A;  3K4U A;  4R2F A;  3QIM A;  5F1Q A;  4DIG A;  4GLI A;  5CBR A;  2QS1 A;  5AA2 B;  2I4B A;  3I5O A;  3WAF A;  4RK2 A;  1B52 A;  4AQ4 A;  1FCK A;  1BLF A;  1OLC A;  3FZV A;  3K6W A;  3PUY E;  4ISU A;  4Q5T A;  4XTC Q;  4YZZ A;  1TFD A;  4U4X A;  5CI5 A;  3SDF A;  2ZXT A;  5I2K B;  2HEU A;  2PT2 A;  3UP9 A;  2OJT A;  4OZ9 A;  2F6G A;  1A7L A;  1B2H A;  1QVS A;  2X26 A;  4YIC A;  1IZ1 A;  5ITP A;  1VFD A;  3PUZ E;  4QHQ A;  2HFB A;  3PPQ A;  4H5F A;  2VD3 A;  3HN0 A;  1UIU A;  3IR1 A;  4DCX A;  3GBB A;  2ZYO A;  4KFQ A;  3KJT A;  1CB6 A;  1TFA A;  2ZNS A;  5CMB A;  1NH7 A;  1LAH E;  3TPA A;  2I48 A;  4U23 A;  1N7X A;  2AIX A;  3G3I A;  2F35 A;  1USY E;  2Y84 A;  3R7X A;  3TFL A;  5CMC A;  1UQW A;  3FJM A;  4TLL B;  3N6U A;  5FHN A;  1MQI A;  2I4C A;  2NWJ A;  3GBA A;  5I2K A;  1A40 A;  3TEP A;  3SEY A;  2PVU A;  3D4C A;  4LZ8 A;  1MY2 A;  3VVF A;  1QUJ A;  1OVT A;  4GFR A;  3OO6 A;  4ZE8 A;  4O3C A;  2ANJ A;  1Y3P A;  4GVO A;  3IOV A;  4AB6 A;  1MM7 A;  1B7Z A;  3I3V A;  1GVC A;  3RY3 A;  2NXO A;  1BKA A;  1IXI A;  4PET A;  2R6G E;  1R9L A;  4EF2 A;  4YKK A;  3KGC A;  1O64 A;  3M3L A;  1M5B A;  3RQT A;  3M8U A;  1FTO A;  4R6K A;  1ANF A;  5TP9 B;  3CIJ A;  3DP6 A;  3T93 B;  3UA8 A;  3OO7 A;  4L17 A;  4RY1 A;  3TUS A;  4EUO A;  3L6H A;  3MZ9 A;  3PPO A;  3V5A A;  2Q89 A;  1POY 1;  3OSQ A;  1NNP A;  5AA4 B;  3O2A A;  4KYE A;  3MVZ A;  4YKP A;  1QKA A;  1JNF A;  1UTB A;  1XS5 A;  1B7U A;  1FQA A;  1MXV A;  2QMX A;  4EQ9 A;  1GV8 A;  5BWJ A;  1NNT A;  2KLF A;  5B7D A;  1H45 A;  4R6H A;  3IO4 A;  1XHY A;  4F1U A;  3MJN A;  4P0I A;  4ZDM A;  3PMV A;  2RC9 A;  3PMW A;  4MLV A;  2G29 A;  4EQB A;  2RC8 A;  2OK2 A;  2XHD A;  2O1L A;  3ONM A;  1JEV A;  4ZED A;  1ZKB A;  2QS3 A;  4JBZ A;  5L9M A;  2NVU B;  3O66 A;  4KCD A;  3IB1 A;  1PB9 A;  3GZG A;  4OFL A;  4WEP A;  1XVY A;  4QSE A;  1YAE A;  3K02 A;  3K1M A;  4ZEI A;  1HSE A;  3ODB A;  3USD A;  1LST A;  1IQ7 A;  4ELQ A;  3U94 A;  1DMB A;  1R1N A;  5J1D A;  3T9U A;  2XXW A;  3EF7 A;  2AYS A;  5HPQ A;  1EH3 A;  1AH5 A;  3TZA A;  2XXP A;  1NNF A;  3B7D A;  2P0S A;  4U2R A;  2UVG A;  1MM6 A;  1MH3 A;  2VP1 A;  4IO3 A;  5TP9 A;  3TYH A;  4OFO A;  1VFE A;  1SQY A;  2Z8F A;  1S7Y A;  3ILU B;  4KQP A;  3QAX A;  3T66 A;  5AA2 D;  5HM4 B;  5I56 B;  3ZKL A;  5KDT B;  3IJO B;  1BP5 A;  2Q88 A;  2O7I A;  4ZS9 A;  2UVI A;  1FTK A;  1H43 A;  2PBW A;  1FTJ A;  1A8E A;  3G7W A;  4F18 A;  1FW0 A;  4NED A;  4PFT A;  2ZYN A;  3C36 A;  5AA2 A;  1CE2 A;  1MXX A;  2QMW A;  3OEK A;  4MF3 A;  3R6U A;  4NF4 A;  4NF8 B;  3MUQ A;  5K2Y A;  1HSJ A;  3TKD A;  1IIT A;  4G8N A;  2OLB A;  1JW4 A;  2I0B A;  3HPI A;  3SES A;  2R9J A;  3VXC A;  3T9V A;  5ICT A;  5L9O A;  1D4N A;  4NWD A;  2O84 X;  5DEX A;  1B3E A;  2DVZ A;  3H6U A;  3EHU A;  4GRK A;  4LVQ A;  1NL5 A;  4F3G A;  3S9E A;  2UXA A;  2F97 A;  4JWO A;  2GH9 A;  4KCC A;  3RLF E;  4P11 A;  4U4S A;  4IGT A;  1DTZ A;  4LA9 A;  1FTM A;  1GR2 A;  2OBG A;  3LBS A;  1AIV A;  3FV1 A;  3FXQ A;  3FV2 A;  4PP0 A;  1B7H A;  4TQU Q;  1ZJL A;  3VLV A;  2B3B A;  5I59 B;  4KYD A;  3HCQ A;  4F2Q A;  5H8F A;  2HAV A;  1MH4 A;  3Q26 A;  2PYY A;  1GGG A;  3CFZ A;  1D9V A;  1TXF A;  4THI A;  1URS A;  3ZSF A;  2RKM A;  1II5 A;  4AB5 A;  4ECF A;  2RF1 A;  5JK4 A;  1FQF A;  1EZ9 A;  3N5L A;  4NF6 B;  1B3H A;  1EU8 A;  2Q8J A;  1LCF A;  3G3J A;  3ILT B;  4OEN A;  4YMB A;  2V3U A;  1FQC A;  1H3D A;  3C33 A;  3V8X B;  1ZIU A;  2IEE A;  4LAT A;  2RCA A;  3TQW A;  2D3I A;  4OWD A;  4OHN A;  1ELJ A;  1LAG E;  5CRY A;  2F5X A;  2V3Q A;  3OEN A;  4G8M A;  4QFL A;  1LB9 A;  2AL5 A;  1N04 A;  1POT A;  2I49 A;  1SI1 A;  3A09 A;  4FE8 A;  4R2B A;  3OEM A;  3E3K A;  3K6X A;  4XKP A;  4RJZ A;  5CMM A;  1R9Q A;  2F7B A;  2I0C A;  2WKY A;  3FVG A;  4NF5 A;  2Q2C A;  4GF8 A;  4BLA A;  3G3G A;  4XIG Q;  1P1W A;  4EF1 A;  3M3K A;  3OEL A;  1B0L A;  1P1O A;  3P7I A;  3O6I A;  3IO6 A;  4R9G A;  3TTM A;  1RYX A;  5H8N A;  5I59 A;  1B05 A;  1WOD A;  1ZLQ A;  4Q0C A;  3TMG A;  4YKJ A;  4GIZ A;  3N26 A;  4WED A;  4F3P A;  2H98 A;  1EZO A;  3FVK A;  5L8D A;  2ZMB A;  1N84 A;  3JZJ A;  4UA8 A;  4EXK A;  5CM6 A;  2XX8 A;  3VDF A;  3S9L C;  1FQB A;  3KOT A;  4QSC A;  4HTG A;  4GOT A;  1XC1 A;  3T22 A;  3IOT A;  3PD8 A;  1MPB A;  4QRZ A;  4TOZ A;  4Z7E A;  4N6P A;  2Y7R A;  4MH5 A;  3T9X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...