1GGGA

Glutamine binding protein open ligand-free structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
220
structure length
220
Chain Sequence
LVVATDTAFVPFEFKQGDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords GLUTAMINE BINDING PROTEIN
publication title The crystal structure of glutamine-binding protein from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gggA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1gggA01
1QUKA 3MJNA 2CMOA 4EQ9A 5DT6A 2ONSA 1YPNA 3RY3A 1SD3A 3E3KA 5DEXA 4H8JA 4F1UA 2I4CA 1EH3A 3PPRA 3T9UA 3N26A 4I1DA 4O3AA 4XXUA 4QFPA 3L6GA 3RPWA 1ZU0A 1L5TA 4QSDA 5I56A 1LFHA 1LBBA 3IO6A 2REJA 3PPPA 1LAHE 4LATA 3TTKA 1B58A 1MS7A 1MQDA 2B65A 4RK2A 2XX9A 2OK2A 5ITOA 3Q28A 1SVXB 3I3VA 1S9TA 5LOMA 1DOTA 4KQPA 1R6ZA 1IXGA 1N84A 5H8FA 5FHNA 3C4MA 1MDQA 3B7DA 5H8NA 2O1LA 3IB1A 4NF6A 1MM6A 2F5XA 4PFUA 2GRVA 1FQFA 2X7QA 3MBPA 1FQCA 4TQUQ 5CBRA 1SW2A 1NNFA 1P1NA 1FQAA 3U1OA 4NWDA 3KG2A 3R6UA 3QUJA 5EYFA 2RC8A 4ESWA 3SERA 2I3VA 4ZEBA 2B3FA 1JNFA 1B3LA 2QS4A 5AA4B 1B9JA 4ZECA 1ZJLA 3EHSA 3VLWA 2UVIA 1ZKBA 4R6HA 4I62A 4X1BA 4Z0IA 3PMXA 3EF7A 1FTJA 4XKPA 2VP1A 4IO6A 4ELPA 3TFLA 4OFJA 4U1ZA 1JEUA 5M2VA 2Z8DA 4HS7A 3KSJA 2QSXA 3G7WA 4H6DA 5J1DA 1FQDA 3UP9A 1LCFA 5EHMA 3PUXE 2G29A 4DCYA 3D4GA 3CVGA 1MXXA 2XXUA 3PMVA 3VLUA 1MY3A 3MPKA 4THIA 3KJTA 3SEYA 3PUZE 3K00A 2F35A 4FEDA 4KD5A 4RA1A 2F78A 3FVKA 4L17A 2HAVA 3LSWA 4NTLA 5AA2D 2DWAA 2XX7A 4IO2A 4NF4B 4BDRA 4IO3A 2RINA 4OZ9A 2ONKE 1SYIA 2XXWA 1NKXA 1MY0A 4PFYA 1D3KA 3VVDA 5A5XB 3K2DA 4DCXA 3CRBA 1BIYA 1LB8A 4EUOA 4EDPA 3UN6A 1AMFA 4N6PA 2AL4A 5H8QB 3H6VA 1JVXA 5ITPA 5KDTB 4U1OA 4P11A 4FAJA 3FV1A 1QUJA 2QRYA 2IEEA 2HXWA 3IB2A 3MVWA 3T9HB 3VVEA 3SETA 3LC8A 4RXLA 4F39A 3W9WA 5TPAB 1Y4TA 3TTMA 4ZS9A 1HSJA 2RC9A 4OYVA 3FZVA 3LUYA 1GTKA 2XD2A 5DTBA 3TTRA 4IY6A 1UIUA 2XXQA 5H8HA 5TP9B 2Q89A 4LZ8A 4PFWA 1NNPA 1MM7A 3FVGA 3JV9A 4IO5A 1QUIA 4YAHX 4DZ1A 1FTKA 4QSCA 2ESNA 4AQ4A 1OLAA 2YLNA 3O6HA 4F1YA 2H25A 1PDAA 2I0BA 2XXYA 2F7BA 2R71A 2F34A 4HW8A 4IO4A 2DP8A 3CR9A 2I49A 3VVFA 3CSGA 5I57B 4HTGA 1M5DA 4X1DA 3DLNA 3U92A 1LLSA 5I2NB 3OOAA 2H4IA 2OZZA 1MXWA 4XKQA 3FJGA 1URSA 1H45A 4I9DA 1XOCA 4TLMB 4YKPA 3IB0A 2VHAA 1TFDA 4ZEFA 2HCAA 4KYDA 1B5JA 3HSTA 4QFKA 2I48A 5I2KB 3B6QA 3HHGA 3K01A 1T0KA 1SQYA 1DMBA 5L8DA 3C9HA 4ZEKA 3CFXA 3L6HA 3OELA 1POY1 4G2ZA 4NF5B 1OVTA 3PUVE 1D9VA 1ZIUA 1RKMA 3MZBA 3LBSA 2F97A 2I4BA 5I58B 2ZNUA 1DPPA 3Q26A 3K1NA 4BDLA 3OD7A 3HPIA 3SEUA 2XX8A 1RYOA 3PU5A 4NEDA 2QS3A 4ISUA 4JXIA 1QJMA 4KR5A 1QVSA 1N0TA 3T96B 4E0WA 2V93A 1O63A 4GRKA 4RYAA 5CBSA 1SI0A 5B7DA 4ONYA 2QMWA 3K6XA 2QMXA 4YB7A 4GOTA 4GL8A 3WAEA 3TPAA 4YKKA 4Z7EA 4BDQA 1Q1KA 2PT2A 3RTWB 1A40A 1HSEA 2DS9A 5JTYA 3KN8A 4G77A 3R26A 2Y7KA 4G8HA 4DDDA 1HSLA 1MY4A 1PEBA 1MQJA 3MPLA 1EU8A 3LR1A 4GLIA 1Y9UA 1O64A 4DE8A 3OEKA 3FVOA 3VV5A 1SYHA 3W9VA 1KWHA 5K2XA 3TAJA 3H03A 3TTLA 1GV8A 2O84X 2QPQA 4ND9A 3Q25A 2UYFA 3IORA 4JWOA 2BJJX 2PMSA 1MDP1 1XT8A 4U21A 2B3BA 3SEWA 4BDMA 1B0HA 2V3UA 3BBRA 2RCBA 3Q29A 5KCJB 3V83A 3U93A 3A3UA 3IJOB 4XKRA 1Y1ZA 2Y7WA 3O6GA 2Y7IA 1MQHA 4ELOA 1PB9A 3UORA 4C0RA 3O97A 3OO9A 1IZ1A 1PBPA 4WEDA 4EQBA 3U94A 2FYIA 3V89B 2GHAA 3VXCA 2UVGA 3H06B 4YICA 4JB7A 3TCFA 4YMBA 3PUYE 4JWXA 5AA2A 3T22A 1ZLQA 4H1XA 2IA4A 4MLQA 5DEXB 3EN3A 4XIGQ 3ONMA 4YB6A 1SDXA 3G3KA 3DP4A 3O9PA 3IJXB 3FXQA 1LSTA 1JQFA 2UXAA 4FE8A 4JDFA 2R9JA 1S50A 4NWCA 5DVFA 1B4HA 2RC7A 4OEUA 2O51A 4RNSA 1DSNA 3OO7A 3IR1A 3K4UA 3K6VA 4H0WA 1NL5A 4NMYA 2OJTA 1UTHA 3TEPA 3TCHA 4OMBA 2Y7RA 4EF2A 1B0LA 2PBWA 5H8FB 5H8NB 4WEPA 2DVCA 2Q2CA 3I6VA 2GFEA 4NF6B 3GBBA 1XS5A 1B3HA 1IITA 4ELRA 4ZZAA 3EHUA 1YTVA 4LA9A 3TCGA 1NMUA 4P0GA 2AL5A 4ZEDA 4F3PA 3GBAA 4H8IA 3FGSA 1P1WA 4OFOA 2OBGA 3TZAA 1TT1A 1F9BA 2WKYA 2H99A 1TXFA 2Q2AA 3UGWA 1Z7ME 3KSXA 3ILTB 2XXHA 1B46A 1JEVA 4OQOA 3FUZA 3IL1B 4R6YA 5L9SA 5CMBA 5AE4A 5FTIA 2REGA 3TMGA 3E9XA 3PD9A 3TELA 4IGTA 2F7AA 4QSEA 4GWOA 4QFOA 2X7PA 3D4CA 4POWA 4YKJA 2THIA 4OTEA 5CMKA 3TTNA 2F8DA 4MBPA 3R7XA 4DLDA 1I6QA 3ILUB 3LSXA 2V25A 5FTHA 1H43A 4DIGA 3SKPA 1TWYA 4IO7A 4F3SA 1IXHA 3GZGA 2HFBA 4RPOA 1USYE 4EXLA 3H6WA 3KOSA 1B5HA 3ZS6A 3CG1A 4P0IA 5JEIA 1O7TA 3RTFB 5DVIA 3FXRA 1MXVA 2QS1A 1IXIA 1MXUA 1I69A 2ABHA 1B32A 3THIA 1LBCA 2QJEA 1OVBA 1FTLA 5IKBA 4GF8A 4JSDA 4KPTA 5L9MA 3C31A 3AXFA 3T66A 4ZEIA 3F11A 4OVJA 3G3JA 4QFLA 3B6TA 5BWJA 2DXRA 4ZE9A 5B70A 3MAMA 4FIMA 2XXVA 2I58A 2H5YA 2OWSA 2OCUA 1AIVA 4GFRA 3MP6A 4LUBA 3VE1B 3QSLA 4BDNA 3OSQA 2V3QA 1BTJA 4GIZA 1Y3NA 3GXAA 5H8HB 4F18A 3RGYA 4U4XA 2RKMA 1URGA 3IK6B 2YJPA 3FASA 2NOOA 1MH4A 4NF8A 1MY1A 1H44A 1ZMGA 1NFTA 4H65A 5ELVA 3KOTA 3QXMA 3S2VA 5CMCA 2RF1A 2DXYA 2O7IA 4MF3A 3UK4A 1SBPA 3FV2A 1Y3PA 1FQEA 4Q5TA 3EPEA 4FORA 4OESA 3PPQA 3C32A 4E0XA 4TOZA 2KLFA 2DOJA 1P99A 4OFLA 1EZPA 1YAEA 4JBZA 4OWDA 4OEVA 3OEMA 4U22A 3IOTA 3G3GA 3FJ7A 2P2AA 3KFMA 3LSFB 2E1SA 4LVQA 4ELQA 2A5TA 3K1PA 1N04A 2ZYNA 1LFGA 3K0VA 4AB5A 1N7WA 3DP8A 3OENA 4N07A 2NXOA 1B05A 1H3DA 4BDOA 2O7UA 4F22A 3IOVA 4LONB 5FHOA 2ZYOA 2ZNTA 2PX1A 1A54A 4OENA 3FIRA 1H76A 4DXUA 1M5EA 4QF9A 1SW4A 2G93A 3S9MC 4U2RA 4NF5A 4EQ7A 2GH9A 4R6KA 1P1QA 4MLVA 3U72A 4ECFA 2F36A 1B3EA 1ATGA 2I0CA 2D5WA 2QL3A 1N3WA 1AOVA 2DE4A 5CI5A 2V3TA 3PGFA 3BFTA 4FECA 2D21A 2Z23A 1II5A 3RLFE 1OMPA 2XHDA 5JTYB 4AB6A 2HAUA 1MH3A 1MXYA 4M4GA 3QIMA 3PD8A 3TYHA 3SEXA 4KCDA 3IAZA 1XVXA 3MQ9A 2O69A 4H5GA 3QAXA 2ZMBA 4GQOA 1I6AA 5EHSA 4LZ5A 4G68B 4LZ7A 4POXA 1N3XA 2DWHA 1PC3A 1M5CA 1RYXA 1DTZA 2XXPA 1J1NA 3O29A 3K1MA 4N13A 2XXRA 5CM6A 3V5AA 1MQIA 4R74A 3MZ9A 3CFZA 3VDFA 3PPNA 3IOWA 1BLFA 3Q27A 5CC2A 4C1TA 3T93B 1IEJA 2ZXTA 3MP8A 2VOZA 2OWTA 1OLCA 3N6TA 1US4A 4OXVA 3MVYA 4UA8A 3VLVA 4IGRA 3SESA 3E4RA 2XXTA 2XXIA 3MZ1A 1Q35A 4F19A 1LAFE 2DYXA 5I59A 3CSBA 1WDNA 3CG3A 4QHQA 1N76A 4YU0A 3E13X 5AA2B 4MFIA 1UTBA 3FJMA 4DXBA 3T9VA 4G68C 1ZTYA 4G8MA 4YMAA 2I6EA 2DQVA 4Q30B 1R1NA 4LP2B 3ODBA 4R9GA 3OMBA 1P1UA 2ALUA 3JZJA 5AA3A 1MPCA 1B52A 2Z22A 5I56B 4RPNA 4Q8RA 4GXSB 3KBRA 1B7UA 1UTHB 4F2OA 5H8SA 3H6TA 1FW0A 5KZTA 4X48A 3SDFA 1MXZA 4YZZA 5DYHA 1IXCA 4XKNA 2XD3A 4RY1A 1LAXA 1Y1MA 1GR2A 1BKAA 4K3FA 3O2AA 5HM4B 3IO4A 4QFNA 1B3GA 1SW1A 1M5FA 1ANFA 1URDA 3U8QA 1WODA 3PPOA 1B7ZA 1PB8A 3C35A 5K2YA 1MPDA 3H4ZA 2VD2A 5FHMA 2M8CA 2HZLA 1NH8A 3TQLA 3O28A 1EZOA 1AH5A 4KFQA 4GVOA 1I6BA 3N94A 1WVJA 2P0SA 1GVCA 5TU0A 3KEIA 3FXUA 2DE2A 3KJ7A 1UQWA 4F2QA 1LB9A 4QRZA 4KI0E 3K6UA 4F31B 3TUSA 4FEBA 3C36A 5AA4A 3RUMA 3OO8A 2FA7A 2O6AA 4MH5A 1NNTA 4R2FA 1JVYA 1QW0A 4KYSA 3CFLA 4IY5A 4O3BA 2VD3A 3KZGA 1A8FA 3P7IA 4R9FA 4TLLB 1IQ7A 2RCAA 2UVHA 5BUUA 2AYSA 3DM0A 4YB5A 3O6IA 4G8NA 3TODA 2UVJA 1LAGE 1FCKA 1R9QA 1QKBA 3VXBA 1LGBC 1XVYA 4PP0A 1QULA 4NF4A 1NH7A 1XC1A 2O1MA 5ISUA 4Q0CA 2Y84A 2DWIA 3TQWA 5A5XA 2FNCA 1TFAA 2R6GE 1LCTA 4LQ5A 2W7YA 4I8CA 2DSFA 5H8QA 1M5BA 3QK6A 3K6WA 5KDTA 3MVXA 4KYEA 4WXJA 2XXXA 3HHFA 3M8UA 4H5FA 1N7XA 2AIXA 3DP6A 2PVUA 4GD5A 1FQBA 2VGQA 2A5SA 2H9BA 1IIWA 1QKAA 4UACA 1CB6A 1CE2A 4GL0A 4LQ2A 3HV1A 4PETA 3V8XB 4NF8B 1JW5A 4OERA 5TPAA 2P1SA 5DVJA 3SEVA 2I3WA 3S9NC 4PE5B 4KCCA 3H7MA 3IX1A 1MRPA 2UYEA 4C1UA 3JYRA 5F1QA 1MG1A 2ZYKA 3M3FA 4F3BA 5HBCA 3A3CA 3A09A 3M3LA 1B40A 4RJZA 4ZZEA 1FTMA 1DPEA 3H6UA 4XTCQ 5TP9A 1POTA 1B51A 3ZKLA 1S7YA 3S4UA 4BLAA 4PQJA 5F7VA 5IAIA 3IOUA 5ICQA 1A99A 4R72A 4H67A 3KN7A 2X26A 3HCQA 2NUVA 2ZNSA 3QYTA 1MY2A 3TKDA 4U4SA 4U23A 2F6GA 3BFUA 1B7HA 3QUFA 3PUWE 1NNKA 1VE4A 3DELB 3W15C 1Y4CA 2A5TB 3FD3A 1Y20A 5I57A 3ZSFA 3KGCA 5I84A 1B5IA 3ECRA 5I2NA 3USDA 3RNNA 1D9YA 4RK9A 4GXAA 3RT8A 2ZYMA 3GLBA 3C33A 2YPNA 5I2KA 3PV0E 1A8EA 1R9LA 1SI1A 3H3GA 3ZKKA 2GHBA 2ANJA 1UIVA 1GGGA 1B1HA 5JK4A 1P1OA 2H98A 1EZ9A 1FTOA 1XHYA 3MUQA 3MVZA 2D3IA 2F7CA 2QS2A 1VR5A 5AA1A 1OQGA 4ZDMA 1ELJA 3G3FA 1VSOA 1VFEA 4NE4A 3LSLA 1PBQA 3MP1A 5I58A 4OHNA 1VFDA 4HCWA 4R75A 4F1VA 3MC2A 1JW1A 3FVNA 3G3HA 3C34A 2O68A 4DXCA 1B4ZA 3PMWA 3KN3A 3MWBA 1OIBA 1USYH 1LFIA 3OXNA 2HQ0A 2E0SA 1US5A 1BP5A 3O66A 5L9OA 3K02A 1SW5A 3FATA 1IUDA 4IB2A 3S9LC 1A7LA 2OLBA 4FATA 3M3KA 4ZE8A 4F29A 1MPBA 1OQHA 1JETA 2Y7PA 2DVZA 1AL3A 3T9XB 3OSRA 2PYYA 1YCJA 3UIFA 1PB7A 3BKIB 2Q8JA 4M1VA 2PT1A 4X9TA 1DTGA 4OETA 4O3CA 3HN0A 3B6WA 3MW0A 1B1XA 4EF1A 2ONRA 1A55A 4YKIA 4G68A 4F3GA 3RT6B 3HO7A 4EXKA 4HCYA 4G4PA 3EHTA 4ESXA 4JSOA 3OO6A 2NWJA 2DE3A 1ZBMA 2V84A 3TDJA 1B3FA 3RN8A 3CI8A 5ICTA 2Q88A 4PFTA 5I59B 2Q9TA 3EQ1A 5KCJA 4JWYA 3CIJA 4FJPA 4R2BA 1UTBB 2DWJA 1D4NA 1B6HA 3VFJA 3G3IA 4R73A 3I5OA 5HPQA 2LAOA 2NVUB 3WAFA 2Z8FA 4KHZE 3N5LA 1JW4A 2HEUA 1Y3QA 1MQGA 3S9EA 2Z8EA 4WKMA 2HZKA 3N6UA 3UA8A 2F6PA 5CMMA 1B2HA 5CRYA 2CZLA 3RQTA 1Z7NE
chains in the Genus database with same CATH superfamily
1QUKA 3MJNA 2CMOA 4EQ9A 2WYPA 5DT6A 2ONSA 1YPNA 5ET6A 3RY3A 1SD3A 3E3KA 5DEXA 2JJKA 4H8JA 4PGNA 4F1UA 4P1LA 2I4CA 1EH3A 3PPRA 3T9UA 3N26A 4I1DA 4O3AA 4XXUA 1DK4A 4QFPA 3L6GA 3RPWA 1ZU0A 1L5TA 4QSDA 2HHMA 5I56A 1LFHA 1LBBA 3IO6A 2REJA 3PPPA 1LAHE 4LATA 3TTKA 1B58A 1MS7A 1MQDA 2B65A 4RK2A 2XX9A 2OK2A 5ITOA 3Q28A 1SVXB 3I3VA 1S9TA 5LOMA 2CZIA 1DOTA 4GX3A 4KQPA 1R6ZA 1IXGA 1N84A 5H8FA 5FHNA 3C4MA 1MDQA 3B7DA 4OVSA 1NV1A 5H8NA 2O1LA 3IB1A 4NF6A 1MM6A 1FSAA 2F5XA 4PFUA 2GRVA 1FQFA 4MCOA 2X7QA 3MBPA 1FQCA 4TQUQ 5CBRA 1SW2A 1NNFA 1P1NA 1FQAA 4NWDA 3U1OA 3KG2A 3R6UA 3QUJA 5EYFA 4PDHA 2RC8A 4ESWA 3SERA 2I3VA 4ZEBA 5IZ1A 2B3FA 1JNFA 1B3LA 2QS4A 5AA4B 1B9JA 4ZECA 3E78A 2HXRA 1ZJLA 5EYGA 3EHSA 3VLWA 4MEVA 2UVIA 1ZKBA 4R6HA 4I62A 4X1BA 4Z0IA 3PMXA 2L5VA 3EF7A 1FTJA 1FTAA 4XKPA 2VP1A 4IO6A 4ELPA 3TFLA 4OFJA 4U1ZA 1JEUA 5M2VA 2Z8DA 4HS7A 3KSJA 2QSXA 3G7WA 4H6DA 5J1DA 1FQDA 3UP9A 1LCFA 1Q9DA 5EHMA 3PUXE 4OVPA 2G29A 4DCYA 3D4GA 3CVGA 1MXXA 2FIXA 2XXUA 3MYUA 3PMVA 1YZ0A 3VLUA 1MY3A 3MPKA 4THIA 3KJTA 1FPIA 3SEYA 3PUZE 1KA0A 3K00A 2F35A 3RPLB 4FEDA 4KD5A 4RA1A 4PTKA 2F78A 3FVKA 4L17A 2HAVA 3LSWA 4NTLA 5AA2D 2DWAA 2XX7A 4PAFA 4IO2A 4NF4B 4BDRA 4IO3A 1NV4A 2RINA 4OZ9A 2ONKE 1SYIA 2XXWA 1NKXA 1MY0A 4PFYA 1D3KA 3VVDA 1FJ9A 5A5XB 3K2DA 4DCXA 3CRBA 1EYJA 1BIYA 1LB8A 4EUOA 4EDPA 3UN6A 1YXIA 1AMFA 4N6PA 2AL4A 5H8QB 3H6VA 1JVXA 5ITPA 5KDTB 4U1OA 4P11A 4FAJA 3FV1A 4X04A 4PBQA 1QUJA 2QRYA 2IEEA 2HXWA 3IB2A 3MVWA 4IR8A 3T9HB 3VVEA 1IMEA 4JVDA 3SETA 3LC8A 2HPGA 4RXLA 5ET8A 4F39A 3W9WA 4KXPA 5TPAB 1Y4TA 3TTMA 4ZS9A 1HSJA 4X8RA 2RC9A 5A5LA 4OYVA 2VT5A 2QVRA 2CEXA 3FZVA 3LUYA 1GTKA 2XD2A 5DTBA 3TTRA 4IY6A 1QGXA 1UIUA 2XXQA 5H8HA 5TP9B 2KQZA 2Q89A 4LN5A 4LZ8A 4PFWA 1NNPA 1MM7A 3FVGA 3JV9A 4IO5A 1QUIA 4YAHX 4DZ1A 1FTKA 4QSCA 2ESNA 4AQ4A 1OLAA 1NUZA 1VDWA 2YLNA 3O6HA 4F1YA 2H25A 3LV0A 1PDAA 2I0BA 2XXYA 2F7BA 2R71A 2F34A 4HW8A 4IO4A 2DP8A 3CR9A 2I49A 3VVFA 3CSGA 5I57B 1LBVA 4HTGA 1M5DA 4X1DA 3DLNA 3U92A 5IZ3B 1LLSA 5I2NB 3OOAA 1JP4A 4P56A 2H4IA 2OZZA 1MXWA 4XKQA 3FJGA 1URSA 1H45A 1FPGA 4I9DA 1XOCA 4TLMB 4YKPA 3IB0A 5EYHA 2VHAA 1TFDA 4ZEFA 2HCAA 4KYDA 1B5JA 4DI3D 3HSTA 4QFKA 2I48A 5I2KB 3B6QA 3HHGA 3K01A 1T0KA 1SQYA 1DMBA 5L8DA 3C9HA 4NN3A 4ZEKA 3CFXA 1INPA 1NV2A 2Y5KA 3L6HA 3KC0A 3OELA 3T0JA 1POY1 4G2ZA 4NF5B 1OVTA 3PUVE 1D9VA 1FBPA 1RKMA 1ZIUA 3MZBA 1NUYA 3LBSA 2F97A 2I4BA 5I58B 2ZNUA 1DPPA 3Q26A 3K1NA 1NI9A 4BDLA 3OD7A 3HPIA 3SEUA 2XX8A 1RYOA 3PU5A 4NEDA 2QS3A 1FPBA 4ISUA 4JXIA 3CHGA 1QJMA 4KR5A 1QVSA 1N0TA 3T96B 3LUZA 2V93A 4E0WA 1O63A 4GRKA 4RYAA 5CBSA 1SI0A 5EQ9A 5B7DA 4ONYA 2QMWA 3K6XA 2QMXA 4YB7A 4PBHA 4GOTA 4GL8A 3WAEA 3TPAA 4YKKA 4Z7EA 4BDQA 1Q1KA 2PT2A 3RTWB 1A40A 1HSEA 2DS9A 5JTYA 3KN8A 4G77A 1K9ZA 3R26A 1FPKA 4N6DA 4HE0A 2Y7KA 4G8HA 4PAKA 4DDDA 1HSLA 1MY4A 1PEBA 1G0HA 1MQJA 3MPLA 1FBDA 1EU8A 3LR1A 4GLIA 1Y9UA 1O64A 4DE8A 3OEKA 3FVOA 3VV5A 1SYHA 3W9VA 1KWHA 5K2XA 3BIGA 3TAJA 3H03A 3TTLA 2F3BA 1GV8A 4MHFA 2O84X 2QPQA 4ND9A 3Q25A 2UYFA 3IORA 4JWOA 2BJJX 2PMSA 1MDP1 1XT8A 4U21A 2B3BA 3SEWA 4BDMA 1B0HA 2V3UA 3BBRA 2RCBA 3Q29A 5KCJB 3V83A 3U93A 3A3UA 3IJOB 4XKRA 1Y1ZA 2Y7WA 3NOHA 3O6GA 2Y7IA 3T1BA 1MQHA 4ELOA 1PB9A 3UORA 2ZZWA 4C0RA 3O97A 1CNQA 3OO9A 4GWXA 1IZ1A 1PBPA 4WEDA 4EQBA 3U94A 2FYIA 3V89B 2GHAA 3VXCA 2UVGA 3H06B 4JB7A 4YICA 3TCFA 4YMBA 3PUYE 4JWXA 5AA2A 3T22A 1ZLQA 4H1XA 2IA4A 4MLQA 5DEXB 3EN3A 4XIGQ 3ONMA 4YB6A 1FPFA 2CZKA 1KA1A 1LBZA 1SDXA 3G3KA 3DP4A 3O9PA 3IJXB 3FXQA 1LSTA 1JQFA 2UXAA 4FE8A 4JDFA 1NV6A 2R9JA 1FBCA 1S50A 4NWCA 5DVFA 1B4HA 2RC7A 4OEUA 2O51A 4O7IA 4RNSA 1KZ8A 1DSNA 3OO7A 3IR1A 3K4UA 2B4MA 5FBPA 3K6VA 4H0WA 1NL5A 4NMYA 3KC1A 1RDZA 2OJTA 1UTHA 3TEPA 3TCHA 4OMBA 2Y7RA 4EF2A 1B0LA 4GWYA 2PBWA 5H8FB 5H8NB 4WEPA 2DVCA 2Q2CA 2P3VA 3I6VA 2GFEA 4NF6B 1DBZA 3GBBA 1XS5A 2DDKA 1B3HA 1IITA 4ELRA 4ZZAA 3EHUA 1YTVA 4LA9A 3TCGA 1NMUA 4HE1A 4P0GA 2AL5A 2VPOA 3FBPA 4ZEDA 4F3PA 3GBAA 4PFIA 4H8IA 3FGSA 1P1WA 4OFOA 1NUXA 2OBGA 4O8MA 3TZAA 1TT1A 1F9BA 2WKYA 2H99A 1TXFA 2Q2AA 2XXKA 1AWBA 3UGWA 1FBEA 4XF5A 1Z7ME 3KSXA 3ILTB 2XXHA 1B46A 1JEVA 4OQOA 3FUZA 2ZZXA 3IL1B 4R6YA 5L9SA 5CMBA 5AE4A 5FTIA 2REGA 4AS5A 3TMGA 3E9XA 4I3YA 3PD9A 3TELA 4O94A 4PE3A 4IGTA 2F7AA 4PF6A 1FBGA 4QSEA 4GWOA 4QFOA 2X7PA 3D4CA 4POWA 4YKJA 5EQ7A 2THIA 4OTEA 5CMKA 3TTNA 1D9QA 5IGAA 2QVVA 2F8DA 4MBPA 3R7XA 4DLDA 1I6QA 3ILUB 3LSXA 2V25A 5FTHA 1H43A 4PFBA 4DIGA 3SKPA 1TWYA 4IO7A 4PC9A 4F3SA 4N81A 1IXHA 3GZGA 2HFBA 4O7MA 4GBWA 4RPOA 1USYE 4EXLA 3H6WA 3KOSA 4MNPA 1B5HA 3ZS6A 3CG1A 4P0IA 1FBHA 5JEIA 1O7TA 3RTFB 5DVIA 3FXRA 1MXVA 2QS1A 1IXIA 1MXUA 3EKIA 1I69A 4MNCA 2QFLA 2ABHA 1B32A 3THIA 1LBCA 2QJEA 1OVBA 1FTLA 5IKBA 1NUWA 4GF8A 2VPNA 3D1RA 3SZPA 4DI4B 4JSDA 4KPTA 2MKZA 2Q74A 5L9MA 3C31A 3AXFA 3T66A 4P9KA 4ZEIA 3F11A 5ET7A 4OVJA 3G3JA 4QFLA 3B6TA 5BWJA 2DXRA 4ZE9A 5B70A 1FPDA 3MAMA 4FIMA 4QXDA 2XXVA 2I58A 2H5YA 2XA5A 2OWSA 2OCUA 1LBYA 1AIVA 4GFRA 4AS4A 3MP6A 4LUBA 4GWSA 3VE1B 3QSLA 2PFZA 3OSQA 4BDNA 2V3QA 1BTJA 4GIZA 1Y3NA 3GXAA 5H8HB 5ESYA 4F18A 3RGYA 4U4XA 3ROJA 3IFCA 2RKMA 4PFRA 1URGA 3IK6B 2YJPA 3FASA 2NOOA 1MH4A 4NF8A 1MY1A 1H44A 1ZMGA 1NFTA 4H65A 5ELVA 3KOTA 3QXMA 3S2VA 5CMCA 2RF1A 2DXYA 2QVUA 2O7IA 4MF3A 1EYIA 3UK4A 1SBPA 4NHBA 4N15A 3FV2A 1Y3PA 1FQEA 4Q5TA 3EPEA 4FORA 3ISPA 2WYKA 4OESA 2P3NA 3PPQA 3C32A 5ET5A 4E0XA 4TOZA 2KLFA 2DOJA 1P99A 4OFLA 1DCUA 1EZPA 1YAEA 4JBZA 4OWDA 4OEVA 3OEMA 4U22A 3IOTA 3G3GA 3FJ7A 2P2AA 3KFMA 3LSFB 2XWIA 2E1SA 1LBXA 4LVQA 4ELQA 1RDYA 2A5TA 4MMPA 3K1PA 1N04A 2ZYNA 1LFGA 3K0VA 2GQ1A 4AB5A 1EYKA 1N7WA 3DP8A 5EQ8A 3OENA 4N07A 2NXOA 1B05A 1H3DA 4BDOA 2O7UA 3BIHA 4F22A 3IOVA 4LONB 5FHOA 2ZYOA 2ZNTA 2PX1A 4JVCA 1A54A 4OENA 3FIRA 4GBVA 1H76A 4DXUA 1M5EA 4QF9A 1SW4A 2G93A 3S9MC 4GWZA 4U2RA 3B50A 4NF5A 4EQ7A 2GH9A 4R6KA 1P1QA 4MLVA 1IMCA 3U72A 4ECFA 2F36A 1B3EA 1ATGA 2I0CA 2D5WA 2QL3A 1N3WA 4HE2A 1AOVA 2DE4A 5CI5A 2V3TA 3PGFA 3BFTA 4FECA 2D21A 2Z23A 1II5A 3RLFE 1OMPA 2XHDA 5JTYB 4H45A 4AB6A 2HAUA 1MH3A 1MXYA 2F3DA 1FJ6A 4M4GA 3QIMA 3PD8A 2OWZA 3TYHA 4N8GA 3SEXA 4NQ8A 4KCDA 3IAZA 1XVXA 3MQ9A 4XFEA 2O69A 4H5GA 3QAXA 2ZMBA 4GQOA 1I6AA 3HFUA 5EHSA 4JVIA 4LZ5A 2OX3A 2WX9A 4G68B 4LZ7A 4POXA 1N3XA 2DWHA 1PC3A 1M5CA 3KBZA 1RYXA 1DTZA 2XXPA 1J1NA 3O29A 3K1MA 4N13A 2R8TA 2XXRA 5CM6A 3V5AA 1MQIA 4OANA 4R74A 3MZ9A 3CFZA 3VDFA 3PPNA 3IOWA 1XI6A 1G0IA 1BLFA 3Q27A 4I3EA 5CC2A 4C1TA 3T93B 1IEJA 2ZXTA 3MP8A 2VOZA 2OWTA 1OLCA 3N6TA 1US4A 4OXVA 3MVYA 4UA8A 3VLVA 3A29A 4IGRA 3SESA 3E4RA 2XXTA 2XXIA 3MZ1A 1Q35A 4F19A 1LAFE 2DYXA 5I59A 3CSBA 1WDNA 1FPEA 3CG3A 4QHQA 1N76A 4YU0A 1FBFA 3E13X 5AA2B 4MFIA 1UTBA 3FJMA 4DXBA 3T9VA 1LBWA 4G68C 1ZTYA 4G8MA 4P47A 4YMAA 2I6EA 2DQVA 4Q30B 2KR0A 1FRPA 1R1NA 4LP2B 3ODBA 4MJOA 4R9GA 3OMBA 1P1UA 2ALUA 3JZJA 5AA3A 1MPCA 1B52A 2FIEA 4NG7A 2Z22A 5I56B 1NV3A 3E79A 4RPNA 4Q8RA 4GXSB 5I7IA 5I5PA 4PCDA 2Y5LA 3KBRA 1B7UA 4FBPA 2V4CA 1UTHB 4F2OA 5H8SA 3H6TA 1FW0A 5KZTA 4X48A 3U65A 3SDFA 1MXZA 4YZZA 4HXVA 5DYHA 4PDDA 1IXCA 4XKNA 2XD3A 4RY1A 4QBAA 3IFAA 1LAXA 1IMAA 1Y1MA 1GR2A 4MX6A 1BKAA 4K3FA 3O2AA 5HM4B 3IO4A 5J16A 4QFNA 1B3GA 1SW1A 1M5FA 1ANFA 1URDA 3U8QA 1WODA 2ZZVA 2WEFA 3PPOA 1B7ZA 5DW8A 1PB8A 3C35A 5K2YA 1MPDA 3H4ZA 2VD2A 1IMDA 5FHMA 2M8CA 2HZLA 1NH8A 3TQLA 3O28A 1EZOA 1AH5A 4KFQA 4GVOA 1I6BA 3PTYA 3N94A 4N91A 1WVJA 2P0SA 5F24A 1GVCA 5TU0A 3KEIA 3FXUA 5LDZA 2DE2A 3MSTA 3KJ7A 1UQWA 4F2QA 1LB9A 4QRZA 4KI0E 3K6UA 4F31B 3TUSA 4FEBA 3C36A 5AA4A 3RUMA 3OO8A 2FA7A 2O6AA 4MH5A 1NNTA 4R2FA 5EQAA 1JVYA 2PCRA 5I3SA 4N4UA 1QW0A 4KYSA 3CFLA 4IY5A 4PGPA 4O3BA 1K9YA 2VD3A 3FXBA 3KZGA 1A8FA 3P7IA 4OVQA 4R9FA 4TLLB 1IQ7A 2RCAA 2UVHA 5BUUA 2XWVA 1NV0A 2CEYA 4PAIA 2AYSA 3DM0A 4YB5A 3O6IA 4G8NA 3TODA 2UVJA 1LAGE 3RPLA 1FCKA 1R9QA 4H46A 1QKBA 3VXBA 4P1EA 1FPLA 1LGBC 1XVYA 4PP0A 1QULA 4NF4A 4OVRA 1NH7A 1XC1A 2O1MA 5ISUA 4Q0CA 2Y84A 2DWIA 3TQWA 5A5XA 2FNCA 1LEVA 1TFAA 2R6GE 1LCTA 4LQ5A 2W7YA 4NAPA 4I8CA 2DSFA 4N6KA 5H8QA 1IMBA 1M5BA 3QK6A 3K6WA 5KDTA 3MVXA 4KYEA 4WXJA 2XXXA 3HHFA 3M8UA 4H5FA 1N7XA 2AIXA 3DP6A 2CZHA 2PVUA 4GD5A 1FQBA 2VGQA 2A5SA 2H9BA 4OVTA 1IIWA 1QKAA 4UACA 1CB6A 1CE2A 4GL0A 4LQ2A 3HV1A 4PETA 3B8BA 3V8XB 4NF8B 1JW5A 4OERA 5TPAA 2P1SA 1FPJA 5DVJA 3SEVA 2I3WA 3S9NC 4PE5B 4KCCA 4N17A 3H7MA 3IX1A 1MRPA 2UYEA 4C1UA 3JYRA 2BJIA 5F1QA 1MG1A 2ZYKA 3M3FA 4F3BA 5HBCA 3A3CA 1IMFA 3A09A 3M3LA 1B40A 4RJZA 4ZZEA 1FTMA 1DPEA 3H6UA 4XTCQ 5TP9A 1POTA 1B51A 3ZKLA 2WBBA 1S7YA 2FVZA 3S4UA 4PQJA 4BLAA 5F7VA 3QMFA 5IAIA 3IOUA 5ICQA 2XWOA 1A99A 4NGUA 4R72A 4H67A 3KN7A 2X26A 3HCQA 2NUVA 2ZNSA 3QYTA 1MY2A 4OA4A 4P8BA 2FHYA 3TKDA 4U4SA 4U23A 2F6GA 3BFUA 1B7HA 3QUFA 3PUWE 1NNKA 1VE4A 3DELB 3W15C 1Y4CA 2A5TB 3FD3A 4UABA 1Y20A 5I57A 3ZSFA 3KGCA 5I84A 1B5IA 5IZ3A 5LTCA 3ECRA 1BK4A 5I2NA 3USDA 3GYYA 3RNNA 1D9YA 4RK9A 4GXAA 3RT8A 2ZYMA 3GLBA 3C33A 2YPNA 5I2KA 3PV0E 1A8EA 1R9LA 1SI1A 3H3GA 3ZKKA 2GHBA 2ANJA 1UIVA 1GGGA 1B1HA 2WBDA 5JK4A 1P1OA 2H98A 1EZ9A 1FTOA 1XHYA 3MUQA 3MVZA 2D3IA 2F7CA 2QS2A 1VR5A 5AA1A 1OQGA 4ZDMA 1ELJA 3G3FA 1VSOA 1VFEA 4NE4A 3LSLA 2B4LA 1PBQA 3MP1A 5I58A 4OHNA 1VFDA 4HCWA 4R75A 4F1VA 3MC2A 1JW1A 1NV7A 3FVNA 3G3HA 4MAGA 3C34A 2O68A 4DXCA 1B4ZA 4NX1A 3PMWA 3KN3A 4P3LA 4MIJA 3MWBA 1OIBA 1LFIA 1USYH 3OXNA 2HQ0A 2E0SA 1US5A 4GWWA 1BP5A 3O66A 5L9OA 1RDXA 3K02A 1SW5A 3FATA 1IUDA 4IB2A 3S9LC 1A7LA 2OLBA 4FATA 1SPIA 3M3KA 4I40A 4ZE8A 4F29A 1MPBA 1OQHA 1JETA 2Y7PA 2DVZA 4GX4A 1AL3A 3T9XB 3OSRA 2PYYA 1YCJA 3UIFA 1PB7A 3BKIB 2Q8JA 4M1VA 2PT1A 4X9TA 1DTGA 4OETA 4O3CA 1YYZA 3HN0A 3B6WA 4GWUA 3MW0A 1B1XA 5IM2A 4EF1A 2ONRA 1A55A 4YKIA 4G68A 4F3GA 3RT6B 3HO7A 4EXKA 4HCYA 4G4PA 3EHTA 4ESXA 4JSOA 3OO6A 2NWJA 2DE3A 1ZBMA 4N8YA 2V84A 4XEQA 3TDJA 1B3FA 3RN8A 3CI8A 4GX6A 5ICTA 2Q88A 4PFTA 5I59B 4G61A 2Q9TA 2PFYA 3EQ1A 5KCJA 5IZZA 3RYDA 4JWYA 3CIJA 4FJPA 2XWKA 4R2BA 1UTBB 2DWJA 4NF0A 1D4NA 2FBPA 1B6HA 3VFJA 3G3IA 4R73A 3I5OA 5HPQA 2LAOA 2NVUB 3WAFA 2Z8FA 4KHZE 3N5LA 1JW4A 2Q8MA 2HEUA 1Y3QA 1MQGA 3S9EA 2Z8EA 4WKMA 4PF8A 2HZKA 3N6UA 1NV5A 3UA8A 2F6PA 5CMMA 4MNIA 1B2HA 5T3JA 5CRYA 2CZLA 3RQTA 1Z7NE
chains in the Genus database with same CATH topology
1QUKA 3MJNA 2CMOA 4EQ9A 5DT6A 2ONSA 1YPNA 3RY3A 1SD3A 3E3KA 5DEXA 4H8JA 4F1UA 2I4CA 1EH3A 3PPRA 3T9UA 3N26A 4I1DA 4O3AA 4XXUA 4QFPA 3L6GA 3RPWA 1ZU0A 1L5TA 4QSDA 5I56A 1LFHA 1LBBA 3IO6A 2REJA 3PPPA 1LAHE 4LATA 3TTKA 1B58A 1MS7A 1MQDA 2B65A 4RK2A 2XX9A 2OK2A 5ITOA 3Q28A 1SVXB 3I3VA 1S9TA 5LOMA 1DOTA 4KQPA 1R6ZA 1IXGA 1N84A 5H8FA 5FHNA 3C4MA 1MDQA 3B7DA 5H8NA 2O1LA 3IB1A 4NF6A 1MM6A 2F5XA 4PFUA 2GRVA 1FQFA 2X7QA 3MBPA 1FQCA 4TQUQ 5CBRA 1SW2A 1NNFA 1P1NA 1FQAA 3U1OA 4NWDA 3KG2A 3R6UA 3QUJA 5EYFA 2RC8A 4ESWA 3SERA 2I3VA 4ZEBA 2B3FA 1JNFA 1B3LA 2QS4A 5AA4B 1B9JA 4ZECA 1ZJLA 3EHSA 3VLWA 2UVIA 1ZKBA 4R6HA 4I62A 4X1BA 4Z0IA 3PMXA 3EF7A 1FTJA 4XKPA 2VP1A 4IO6A 4ELPA 3TFLA 4OFJA 4U1ZA 1JEUA 5M2VA 2Z8DA 4HS7A 3KSJA 2QSXA 3G7WA 4H6DA 5J1DA 1FQDA 3UP9A 1LCFA 5EHMA 3PUXE 2G29A 4DCYA 3D4GA 3CVGA 1MXXA 2XXUA 3PMVA 3VLUA 1MY3A 3MPKA 4THIA 3KJTA 3SEYA 3PUZE 3K00A 2F35A 4FEDA 4KD5A 4RA1A 2F78A 3FVKA 4L17A 2HAVA 3LSWA 4NTLA 5AA2D 2DWAA 2XX7A 4IO2A 4NF4B 4BDRA 4IO3A 2RINA 4OZ9A 2ONKE 1SYIA 2XXWA 1NKXA 1MY0A 4PFYA 1D3KA 3VVDA 5A5XB 3K2DA 4DCXA 3CRBA 1BIYA 1LB8A 4EUOA 4EDPA 3UN6A 1AMFA 4N6PA 2AL4A 5H8QB 3H6VA 1JVXA 5ITPA 5KDTB 4U1OA 4P11A 4FAJA 3FV1A 1QUJA 2QRYA 2IEEA 2HXWA 3IB2A 3MVWA 3T9HB 3VVEA 3SETA 3LC8A 4RXLA 4F39A 3W9WA 5TPAB 1Y4TA 3TTMA 4ZS9A 1HSJA 2RC9A 4OYVA 3FZVA 3LUYA 1GTKA 2XD2A 5DTBA 3TTRA 4IY6A 1UIUA 2XXQA 5H8HA 5TP9B 2Q89A 4LZ8A 4PFWA 1NNPA 1MM7A 3FVGA 3JV9A 4IO5A 1QUIA 4YAHX 4DZ1A 1FTKA 4QSCA 2ESNA 4AQ4A 1OLAA 2YLNA 3O6HA 4F1YA 2H25A 1PDAA 2I0BA 2XXYA 2F7BA 2R71A 2F34A 4HW8A 4IO4A 2DP8A 3CR9A 2I49A 3VVFA 3CSGA 5I57B 4HTGA 1M5DA 4X1DA 3DLNA 3U92A 1LLSA 5I2NB 3OOAA 2H4IA 2OZZA 1MXWA 4XKQA 3FJGA 1URSA 1H45A 4I9DA 1XOCA 4TLMB 4YKPA 3IB0A 2VHAA 1TFDA 4ZEFA 2HCAA 4KYDA 1B5JA 3HSTA 4QFKA 2I48A 5I2KB 3B6QA 3HHGA 3K01A 1T0KA 1SQYA 1DMBA 5L8DA 3C9HA 4ZEKA 3CFXA 3L6HA 3OELA 1POY1 4G2ZA 4NF5B 1OVTA 3PUVE 1D9VA 1ZIUA 1RKMA 3MZBA 3LBSA 2F97A 2I4BA 5I58B 2ZNUA 1DPPA 3Q26A 3K1NA 4BDLA 3OD7A 3HPIA 3SEUA 2XX8A 1RYOA 3PU5A 4NEDA 2QS3A 4ISUA 4JXIA 1QJMA 4KR5A 1QVSA 1N0TA 3T96B 4E0WA 2V93A 1O63A 4GRKA 4RYAA 5CBSA 1SI0A 5B7DA 4ONYA 2QMWA 3K6XA 2QMXA 4YB7A 4GOTA 4GL8A 3WAEA 3TPAA 4YKKA 4Z7EA 4BDQA 1Q1KA 2PT2A 3RTWB 1A40A 1HSEA 2DS9A 5JTYA 3KN8A 4G77A 3R26A 2Y7KA 4G8HA 4DDDA 1HSLA 1MY4A 1PEBA 1MQJA 3MPLA 1EU8A 3LR1A 4GLIA 1Y9UA 1O64A 4DE8A 3OEKA 3FVOA 3VV5A 1SYHA 3W9VA 1KWHA 5K2XA 3TAJA 3H03A 3TTLA 1GV8A 2O84X 2QPQA 4ND9A 3Q25A 2UYFA 3IORA 4JWOA 2BJJX 2PMSA 1MDP1 1XT8A 4U21A 2B3BA 3SEWA 4BDMA 1B0HA 2V3UA 3BBRA 2RCBA 3Q29A 5KCJB 3V83A 3U93A 3A3UA 3IJOB 4XKRA 1Y1ZA 2Y7WA 3O6GA 2Y7IA 1MQHA 4ELOA 1PB9A 3UORA 4C0RA 3O97A 3OO9A 1IZ1A 1PBPA 4WEDA 4EQBA 3U94A 2FYIA 3V89B 2GHAA 3VXCA 2UVGA 3H06B 4YICA 4JB7A 3TCFA 4YMBA 3PUYE 4JWXA 5AA2A 3T22A 1ZLQA 4H1XA 2IA4A 4MLQA 5DEXB 3EN3A 4XIGQ 3ONMA 4YB6A 1SDXA 3G3KA 3DP4A 3O9PA 3IJXB 3FXQA 1LSTA 1JQFA 2UXAA 4FE8A 4JDFA 2R9JA 1S50A 4NWCA 5DVFA 1B4HA 2RC7A 4OEUA 2O51A 4RNSA 1DSNA 3OO7A 3IR1A 3K4UA 3K6VA 4H0WA 1NL5A 4NMYA 2OJTA 1UTHA 3TEPA 3TCHA 4OMBA 2Y7RA 4EF2A 1B0LA 2PBWA 5H8FB 5H8NB 4WEPA 2DVCA 2Q2CA 3I6VA 2GFEA 4NF6B 3GBBA 1XS5A 1B3HA 1IITA 4ELRA 4ZZAA 3EHUA 1YTVA 4LA9A 3TCGA 1NMUA 4P0GA 2AL5A 4ZEDA 4F3PA 3GBAA 4H8IA 3FGSA 1P1WA 4OFOA 2OBGA 3TZAA 1TT1A 1F9BA 2WKYA 2H99A 1TXFA 2Q2AA 3UGWA 1Z7ME 3KSXA 3ILTB 2XXHA 1B46A 1JEVA 4OQOA 3FUZA 3IL1B 4R6YA 5L9SA 5CMBA 5AE4A 5FTIA 2REGA 3TMGA 3E9XA 3PD9A 3TELA 4IGTA 2F7AA 4QSEA 4GWOA 4QFOA 2X7PA 3D4CA 4POWA 4YKJA 2THIA 4OTEA 5CMKA 3TTNA 2F8DA 4MBPA 3R7XA 4DLDA 1I6QA 3ILUB 3LSXA 2V25A 5FTHA 1H43A 4DIGA 3SKPA 1TWYA 4IO7A 4F3SA 1IXHA 3GZGA 2HFBA 4RPOA 1USYE 4EXLA 3H6WA 3KOSA 1B5HA 3ZS6A 3CG1A 4P0IA 5JEIA 1O7TA 3RTFB 5DVIA 3FXRA 1MXVA 2QS1A 1IXIA 1MXUA 1I69A 2ABHA 1B32A 3THIA 1LBCA 2QJEA 1OVBA 1FTLA 5IKBA 4GF8A 4JSDA 4KPTA 5L9MA 3C31A 3AXFA 3T66A 4ZEIA 3F11A 4OVJA 3G3JA 4QFLA 3B6TA 5BWJA 2DXRA 4ZE9A 5B70A 3MAMA 4FIMA 2XXVA 2I58A 2H5YA 2OWSA 2OCUA 1AIVA 4GFRA 3MP6A 4LUBA 3VE1B 3QSLA 4BDNA 3OSQA 2V3QA 1BTJA 4GIZA 1Y3NA 3GXAA 5H8HB 4F18A 3RGYA 4U4XA 2RKMA 1URGA 3IK6B 2YJPA 3FASA 2NOOA 1MH4A 4NF8A 1MY1A 1H44A 1ZMGA 1NFTA 4H65A 5ELVA 3KOTA 3QXMA 3S2VA 5CMCA 2RF1A 2DXYA 2O7IA 4MF3A 3UK4A 1SBPA 3FV2A 1Y3PA 1FQEA 4Q5TA 3EPEA 4FORA 4OESA 3PPQA 3C32A 4E0XA 4TOZA 2KLFA 2DOJA 1P99A 4OFLA 1EZPA 1YAEA 4JBZA 4OWDA 4OEVA 3OEMA 4U22A 3IOTA 3G3GA 3FJ7A 2P2AA 3KFMA 3LSFB 2E1SA 4LVQA 4ELQA 2A5TA 3K1PA 1N04A 2ZYNA 1LFGA 3K0VA 4AB5A 1N7WA 3DP8A 3OENA 4N07A 2NXOA 1B05A 1H3DA 4BDOA 2O7UA 4F22A 3IOVA 4LONB 5FHOA 2ZYOA 2ZNTA 2PX1A 1A54A 4OENA 3FIRA 1H76A 4DXUA 1M5EA 4QF9A 1SW4A 2G93A 3S9MC 4U2RA 4NF5A 4EQ7A 2GH9A 4R6KA 1P1QA 4MLVA 3U72A 4ECFA 2F36A 1B3EA 1ATGA 2I0CA 2D5WA 2QL3A 1N3WA 1AOVA 2DE4A 5CI5A 2V3TA 3PGFA 3BFTA 4FECA 2D21A 2Z23A 1II5A 3RLFE 1OMPA 2XHDA 5JTYB 4AB6A 2HAUA 1MH3A 1MXYA 4M4GA 3QIMA 3PD8A 3TYHA 3SEXA 4KCDA 3IAZA 1XVXA 3MQ9A 2O69A 4H5GA 3QAXA 2ZMBA 4GQOA 1I6AA 5EHSA 4LZ5A 4G68B 4LZ7A 4POXA 1N3XA 2DWHA 1PC3A 1M5CA 1RYXA 1DTZA 2XXPA 1J1NA 3O29A 3K1MA 4N13A 2XXRA 5CM6A 3V5AA 1MQIA 4R74A 3MZ9A 3CFZA 3VDFA 3PPNA 3IOWA 1BLFA 3Q27A 5CC2A 4C1TA 3T93B 1IEJA 2ZXTA 3MP8A 2VOZA 2OWTA 1OLCA 3N6TA 1US4A 4OXVA 3MVYA 4UA8A 3VLVA 4IGRA 3SESA 3E4RA 2XXTA 2XXIA 3MZ1A 1Q35A 4F19A 1LAFE 2DYXA 5I59A 3CSBA 1WDNA 3CG3A 4QHQA 1N76A 4YU0A 3E13X 5AA2B 4MFIA 1UTBA 3FJMA 4DXBA 3T9VA 4G68C 1ZTYA 4G8MA 4YMAA 2I6EA 2DQVA 4Q30B 1R1NA 4LP2B 3ODBA 4R9GA 3OMBA 1P1UA 2ALUA 3JZJA 5AA3A 1MPCA 1B52A 2Z22A 5I56B 4RPNA 4Q8RA 4GXSB 3KBRA 1B7UA 1UTHB 4F2OA 5H8SA 3H6TA 1FW0A 5KZTA 4X48A 3SDFA 1MXZA 4YZZA 5DYHA 1IXCA 4XKNA 2XD3A 4RY1A 1LAXA 1Y1MA 1GR2A 1BKAA 4K3FA 3O2AA 5HM4B 3IO4A 4QFNA 1B3GA 1SW1A 1M5FA 1ANFA 1URDA 3U8QA 1WODA 3PPOA 1B7ZA 1PB8A 3C35A 5K2YA 1MPDA 3H4ZA 2VD2A 5FHMA 2M8CA 2HZLA 1NH8A 3TQLA 3O28A 1EZOA 1AH5A 4KFQA 4GVOA 1I6BA 3N94A 1WVJA 2P0SA 1GVCA 5TU0A 3KEIA 3FXUA 2DE2A 3KJ7A 1UQWA 4F2QA 1LB9A 4QRZA 4KI0E 3K6UA 4F31B 3TUSA 4FEBA 3C36A 5AA4A 3RUMA 3OO8A 2FA7A 2O6AA 4MH5A 1NNTA 4R2FA 1JVYA 1QW0A 4KYSA 3CFLA 4IY5A 4O3BA 2VD3A 3KZGA 1A8FA 3P7IA 4R9FA 4TLLB 1IQ7A 2RCAA 2UVHA 5BUUA 2AYSA 3DM0A 4YB5A 3O6IA 4G8NA 3TODA 2UVJA 1LAGE 1FCKA 1R9QA 1QKBA 3VXBA 1LGBC 1XVYA 4PP0A 1QULA 4NF4A 1NH7A 1XC1A 2O1MA 5ISUA 4Q0CA 2Y84A 2DWIA 3TQWA 5A5XA 2FNCA 1TFAA 2R6GE 1LCTA 4LQ5A 2W7YA 4I8CA 2DSFA 5H8QA 1M5BA 3QK6A 3K6WA 5KDTA 3MVXA 4KYEA 4WXJA 2XXXA 3HHFA 3M8UA 4H5FA 1N7XA 2AIXA 3DP6A 2PVUA 4GD5A 1FQBA 2VGQA 2A5SA 2H9BA 1IIWA 1QKAA 4UACA 1CB6A 1CE2A 4GL0A 4LQ2A 3HV1A 4PETA 3V8XB 4NF8B 1JW5A 4OERA 5TPAA 2P1SA 5DVJA 3SEVA 2I3WA 3S9NC 4PE5B 4KCCA 3H7MA 3IX1A 1MRPA 2UYEA 4C1UA 3JYRA 5F1QA 1MG1A 2ZYKA 3M3FA 4F3BA 5HBCA 3A3CA 3A09A 3M3LA 1B40A 4RJZA 4ZZEA 1FTMA 1DPEA 3H6UA 4XTCQ 5TP9A 1POTA 1B51A 3ZKLA 1S7YA 3S4UA 4BLAA 4PQJA 5F7VA 5IAIA 3IOUA 5ICQA 1A99A 4R72A 4H67A 3KN7A 2X26A 3HCQA 2NUVA 2ZNSA 3QYTA 1MY2A 3TKDA 4U4SA 4U23A 2F6GA 3BFUA 1B7HA 3QUFA 3PUWE 1NNKA 1VE4A 3DELB 3W15C 1Y4CA 2A5TB 3FD3A 1Y20A 5I57A 3ZSFA 3KGCA 5I84A 1B5IA 3ECRA 5I2NA 3USDA 3RNNA 1D9YA 4RK9A 4GXAA 3RT8A 2ZYMA 3GLBA 3C33A 2YPNA 5I2KA 3PV0E 1A8EA 1R9LA 1SI1A 3H3GA 3ZKKA 2GHBA 2ANJA 1UIVA 1GGGA 1B1HA 5JK4A 1P1OA 2H98A 1EZ9A 1FTOA 1XHYA 3MUQA 3MVZA 2D3IA 2F7CA 2QS2A 1VR5A 5AA1A 1OQGA 4ZDMA 1ELJA 3G3FA 1VSOA 1VFEA 4NE4A 3LSLA 1PBQA 3MP1A 5I58A 4OHNA 1VFDA 4HCWA 4R75A 4F1VA 3MC2A 1JW1A 3FVNA 3G3HA 3C34A 2O68A 4DXCA 1B4ZA 3PMWA 3KN3A 3MWBA 1OIBA 1USYH 1LFIA 3OXNA 2HQ0A 2E0SA 1US5A 1BP5A 3O66A 5L9OA 3K02A 1SW5A 3FATA 1IUDA 4IB2A 3S9LC 1A7LA 2OLBA 4FATA 3M3KA 4ZE8A 4F29A 1MPBA 1OQHA 1JETA 2Y7PA 2DVZA 1AL3A 3T9XB 3OSRA 2PYYA 1YCJA 3UIFA 1PB7A 3BKIB 2Q8JA 4M1VA 2PT1A 4X9TA 1DTGA 4OETA 4O3CA 3HN0A 3B6WA 3MW0A 1B1XA 4EF1A 2ONRA 1A55A 4YKIA 4G68A 4F3GA 3RT6B 3HO7A 4EXKA 4HCYA 4G4PA 3EHTA 4ESXA 4JSOA 3OO6A 2NWJA 2DE3A 1ZBMA 2V84A 3TDJA 1B3FA 3RN8A 3CI8A 5ICTA 2Q88A 4PFTA 5I59B 2Q9TA 3EQ1A 5KCJA 4JWYA 3CIJA 4FJPA 4R2BA 1UTBB 2DWJA 1D4NA 1B6HA 3VFJA 3G3IA 4R73A 3I5OA 5HPQA 2LAOA 2NVUB 3WAFA 2Z8FA 4KHZE 3N5LA 1JW4A 2HEUA 1Y3QA 1MQGA 3S9EA 2Z8EA 4WKMA 2HZKA 3N6UA 3UA8A 2F6PA 5CMMA 1B2HA 5CRYA 2CZLA 3RQTA 1Z7NE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUK A;  3MJN A;  2CMO A;  4EQ9 A;  5DT6 A;  2ONS A;  1YPN A;  3RY3 A;  1SD3 A;  3E3K A;  5DEX A;  4H8J A;  4F1U A;  2I4C A;  1EH3 A;  3PPR A;  3T9U A;  3N26 A;  4I1D A;  4O3A A;  4XXU A;  4QFP A;  3L6G A;  3RPW A;  1ZU0 A;  1L5T A;  4QSD A;  5I56 A;  1LFH A;  1LBB A;  3IO6 A;  2REJ A;  3PPP A;  1LAH E;  4LAT A;  3TTK A;  1B58 A;  1MS7 A;  1MQD A;  2B65 A;  4RK2 A;  2XX9 A;  2OK2 A;  5ITO A;  3Q28 A;  1SVX B;  3I3V A;  1S9T A;  5LOM A;  1DOT A;  4KQP A;  1R6Z A;  1IXG A;  1N84 A;  5H8F A;  5FHN A;  3C4M A;  1MDQ A;  3B7D A;  5H8N A;  2O1L A;  3IB1 A;  4NF6 A;  1MM6 A;  2F5X A;  4PFU A;  2GRV A;  1FQF A;  2X7Q A;  3MBP A;  1FQC A;  4TQU Q;  5CBR A;  1SW2 A;  1NNF A;  1P1N A;  1FQA A;  3U1O A;  4NWD A;  3KG2 A;  3R6U A;  3QUJ A;  5EYF A;  2RC8 A;  4ESW A;  3SER A;  2I3V A;  4ZEB A;  2B3F A;  1JNF A;  1B3L A;  2QS4 A;  5AA4 B;  1B9J A;  4ZEC A;  1ZJL A;  3EHS A;  3VLW A;  2UVI A;  1ZKB A;  4R6H A;  4I62 A;  4X1B A;  4Z0I A;  3PMX A;  3EF7 A;  1FTJ A;  4XKP A;  2VP1 A;  4IO6 A;  4ELP A;  3TFL A;  4OFJ A;  4U1Z A;  1JEU A;  5M2V A;  2Z8D A;  4HS7 A;  3KSJ A;  2QSX A;  3G7W A;  4H6D A;  5J1D A;  1FQD A;  3UP9 A;  1LCF A;  5EHM A;  3PUX E;  2G29 A;  4DCY A;  3D4G A;  3CVG A;  1MXX A;  2XXU A;  3PMV A;  3VLU A;  1MY3 A;  3MPK A;  4THI A;  3KJT A;  3SEY A;  3PUZ E;  3K00 A;  2F35 A;  4FED A;  4KD5 A;  4RA1 A;  2F78 A;  3FVK A;  4L17 A;  2HAV A;  3LSW A;  4NTL A;  5AA2 D;  2DWA A;  2XX7 A;  4IO2 A;  4NF4 B;  4BDR A;  4IO3 A;  2RIN A;  4OZ9 A;  2ONK E;  1SYI A;  2XXW A;  1NKX A;  1MY0 A;  4PFY A;  1D3K A;  3VVD A;  5A5X B;  3K2D A;  4DCX A;  3CRB A;  1BIY A;  1LB8 A;  4EUO A;  4EDP A;  3UN6 A;  1AMF A;  4N6P A;  2AL4 A;  5H8Q B;  3H6V A;  1JVX A;  5ITP A;  5KDT B;  4U1O A;  4P11 A;  4FAJ A;  3FV1 A;  1QUJ A;  2QRY A;  2IEE A;  2HXW A;  3IB2 A;  3MVW A;  3T9H B;  3VVE A;  3SET A;  3LC8 A;  4RXL A;  4F39 A;  3W9W A;  5TPA B;  1Y4T A;  3TTM A;  4ZS9 A;  1HSJ A;  2RC9 A;  4OYV A;  3FZV A;  3LUY A;  1GTK A;  2XD2 A;  5DTB A;  3TTR A;  4IY6 A;  1UIU A;  2XXQ A;  5H8H A;  5TP9 B;  2Q89 A;  4LZ8 A;  4PFW A;  1NNP A;  1MM7 A;  3FVG A;  3JV9 A;  4IO5 A;  1QUI A;  4YAH X;  4DZ1 A;  1FTK A;  4QSC A;  2ESN A;  4AQ4 A;  1OLA A;  2YLN A;  3O6H A;  4F1Y A;  2H25 A;  1PDA A;  2I0B A;  2XXY A;  2F7B A;  2R71 A;  2F34 A;  4HW8 A;  4IO4 A;  2DP8 A;  3CR9 A;  2I49 A;  3VVF A;  3CSG A;  5I57 B;  4HTG A;  1M5D A;  4X1D A;  3DLN A;  3U92 A;  1LLS A;  5I2N B;  3OOA A;  2H4I A;  2OZZ A;  1MXW A;  4XKQ A;  3FJG A;  1URS A;  1H45 A;  4I9D A;  1XOC A;  4TLM B;  4YKP A;  3IB0 A;  2VHA A;  1TFD A;  4ZEF A;  2HCA A;  4KYD A;  1B5J A;  3HST A;  4QFK A;  2I48 A;  5I2K B;  3B6Q A;  3HHG A;  3K01 A;  1T0K A;  1SQY A;  1DMB A;  5L8D A;  3C9H A;  4ZEK A;  3CFX A;  3L6H A;  3OEL A;  1POY 1;  4G2Z A;  4NF5 B;  1OVT A;  3PUV E;  1D9V A;  1ZIU A;  1RKM A;  3MZB A;  3LBS A;  2F97 A;  2I4B A;  5I58 B;  2ZNU A;  1DPP A;  3Q26 A;  3K1N A;  4BDL A;  3OD7 A;  3HPI A;  3SEU A;  2XX8 A;  1RYO A;  3PU5 A;  4NED A;  2QS3 A;  4ISU A;  4JXI A;  1QJM A;  4KR5 A;  1QVS A;  1N0T A;  3T96 B;  4E0W A;  2V93 A;  1O63 A;  4GRK A;  4RYA A;  5CBS A;  1SI0 A;  5B7D A;  4ONY A;  2QMW A;  3K6X A;  2QMX A;  4YB7 A;  4GOT A;  4GL8 A;  3WAE A;  3TPA A;  4YKK A;  4Z7E A;  4BDQ A;  1Q1K A;  2PT2 A;  3RTW B;  1A40 A;  1HSE A;  2DS9 A;  5JTY A;  3KN8 A;  4G77 A;  3R26 A;  2Y7K A;  4G8H A;  4DDD A;  1HSL A;  1MY4 A;  1PEB A;  1MQJ A;  3MPL A;  1EU8 A;  3LR1 A;  4GLI A;  1Y9U A;  1O64 A;  4DE8 A;  3OEK A;  3FVO A;  3VV5 A;  1SYH A;  3W9V A;  1KWH A;  5K2X A;  3TAJ A;  3H03 A;  3TTL A;  1GV8 A;  2O84 X;  2QPQ A;  4ND9 A;  3Q25 A;  2UYF A;  3IOR A;  4JWO A;  2BJJ X;  2PMS A;  1MDP 1;  1XT8 A;  4U21 A;  2B3B A;  3SEW A;  4BDM A;  1B0H A;  2V3U A;  3BBR A;  2RCB A;  3Q29 A;  5KCJ B;  3V83 A;  3U93 A;  3A3U A;  3IJO B;  4XKR A;  1Y1Z A;  2Y7W A;  3O6G A;  2Y7I A;  1MQH A;  4ELO A;  1PB9 A;  3UOR A;  4C0R A;  3O97 A;  3OO9 A;  1IZ1 A;  1PBP A;  4WED A;  4EQB A;  3U94 A;  2FYI A;  3V89 B;  2GHA A;  3VXC A;  2UVG A;  3H06 B;  4YIC A;  4JB7 A;  3TCF A;  4YMB A;  3PUY E;  4JWX A;  5AA2 A;  3T22 A;  1ZLQ A;  4H1X A;  2IA4 A;  4MLQ A;  5DEX B;  3EN3 A;  4XIG Q;  3ONM A;  4YB6 A;  1SDX A;  3G3K A;  3DP4 A;  3O9P A;  3IJX B;  3FXQ A;  1LST A;  1JQF A;  2UXA A;  4FE8 A;  4JDF A;  2R9J A;  1S50 A;  4NWC A;  5DVF A;  1B4H A;  2RC7 A;  4OEU A;  2O51 A;  4RNS A;  1DSN A;  3OO7 A;  3IR1 A;  3K4U A;  3K6V A;  4H0W A;  1NL5 A;  4NMY A;  2OJT A;  1UTH A;  3TEP A;  3TCH A;  4OMB A;  2Y7R A;  4EF2 A;  1B0L A;  2PBW A;  5H8F B;  5H8N B;  4WEP A;  2DVC A;  2Q2C A;  3I6V A;  2GFE A;  4NF6 B;  3GBB A;  1XS5 A;  1B3H A;  1IIT A;  4ELR A;  4ZZA A;  3EHU A;  1YTV A;  4LA9 A;  3TCG A;  1NMU A;  4P0G A;  2AL5 A;  4ZED A;  4F3P A;  3GBA A;  4H8I A;  3FGS A;  1P1W A;  4OFO A;  2OBG A;  3TZA A;  1TT1 A;  1F9B A;  2WKY A;  2H99 A;  1TXF A;  2Q2A A;  3UGW A;  1Z7M E;  3KSX A;  3ILT B;  2XXH A;  1B46 A;  1JEV A;  4OQO A;  3FUZ A;  3IL1 B;  4R6Y A;  5L9S A;  5CMB A;  5AE4 A;  5FTI A;  2REG A;  3TMG A;  3E9X A;  3PD9 A;  3TEL A;  4IGT A;  2F7A A;  4QSE A;  4GWO A;  4QFO A;  2X7P A;  3D4C A;  4POW A;  4YKJ A;  2THI A;  4OTE A;  5CMK A;  3TTN A;  2F8D A;  4MBP A;  3R7X A;  4DLD A;  1I6Q A;  3ILU B;  3LSX A;  2V25 A;  5FTH A;  1H43 A;  4DIG A;  3SKP A;  1TWY A;  4IO7 A;  4F3S A;  1IXH A;  3GZG A;  2HFB A;  4RPO A;  1USY E;  4EXL A;  3H6W A;  3KOS A;  1B5H A;  3ZS6 A;  3CG1 A;  4P0I A;  5JEI A;  1O7T A;  3RTF B;  5DVI A;  3FXR A;  1MXV A;  2QS1 A;  1IXI A;  1MXU A;  1I69 A;  2ABH A;  1B32 A;  3THI A;  1LBC A;  2QJE A;  1OVB A;  1FTL A;  5IKB A;  4GF8 A;  4JSD A;  4KPT A;  5L9M A;  3C31 A;  3AXF A;  3T66 A;  4ZEI A;  3F11 A;  4OVJ A;  3G3J A;  4QFL A;  3B6T A;  5BWJ A;  2DXR A;  4ZE9 A;  5B70 A;  3MAM A;  4FIM A;  2XXV A;  2I58 A;  2H5Y A;  2OWS A;  2OCU A;  1AIV A;  4GFR A;  3MP6 A;  4LUB A;  3VE1 B;  3QSL A;  4BDN A;  3OSQ A;  2V3Q A;  1BTJ A;  4GIZ A;  1Y3N A;  3GXA A;  5H8H B;  4F18 A;  3RGY A;  4U4X A;  2RKM A;  1URG A;  3IK6 B;  2YJP A;  3FAS A;  2NOO A;  1MH4 A;  4NF8 A;  1MY1 A;  1H44 A;  1ZMG A;  1NFT A;  4H65 A;  5ELV A;  3KOT A;  3QXM A;  3S2V A;  5CMC A;  2RF1 A;  2DXY A;  2O7I A;  4MF3 A;  3UK4 A;  1SBP A;  3FV2 A;  1Y3P A;  1FQE A;  4Q5T A;  3EPE A;  4FOR A;  4OES A;  3PPQ A;  3C32 A;  4E0X A;  4TOZ A;  2KLF A;  2DOJ A;  1P99 A;  4OFL A;  1EZP A;  1YAE A;  4JBZ A;  4OWD A;  4OEV A;  3OEM A;  4U22 A;  3IOT A;  3G3G A;  3FJ7 A;  2P2A A;  3KFM A;  3LSF B;  2E1S A;  4LVQ A;  4ELQ A;  2A5T A;  3K1P A;  1N04 A;  2ZYN A;  1LFG A;  3K0V A;  4AB5 A;  1N7W A;  3DP8 A;  3OEN A;  4N07 A;  2NXO A;  1B05 A;  1H3D A;  4BDO A;  2O7U A;  4F22 A;  3IOV A;  4LON B;  5FHO A;  2ZYO A;  2ZNT A;  2PX1 A;  1A54 A;  4OEN A;  3FIR A;  1H76 A;  4DXU A;  1M5E A;  4QF9 A;  1SW4 A;  2G93 A;  3S9M C;  4U2R A;  4NF5 A;  4EQ7 A;  2GH9 A;  4R6K A;  1P1Q A;  4MLV A;  3U72 A;  4ECF A;  2F36 A;  1B3E A;  1ATG A;  2I0C A;  2D5W A;  2QL3 A;  1N3W A;  1AOV A;  2DE4 A;  5CI5 A;  2V3T A;  3PGF A;  3BFT A;  4FEC A;  2D21 A;  2Z23 A;  1II5 A;  3RLF E;  1OMP A;  2XHD A;  5JTY B;  4AB6 A;  2HAU A;  1MH3 A;  1MXY A;  4M4G A;  3QIM A;  3PD8 A;  3TYH A;  3SEX A;  4KCD A;  3IAZ A;  1XVX A;  3MQ9 A;  2O69 A;  4H5G A;  3QAX A;  2ZMB A;  4GQO A;  1I6A A;  5EHS A;  4LZ5 A;  4G68 B;  4LZ7 A;  4POX A;  1N3X A;  2DWH A;  1PC3 A;  1M5C A;  1RYX A;  1DTZ A;  2XXP A;  1J1N A;  3O29 A;  3K1M A;  4N13 A;  2XXR A;  5CM6 A;  3V5A A;  1MQI A;  4R74 A;  3MZ9 A;  3CFZ A;  3VDF A;  3PPN A;  3IOW A;  1BLF A;  3Q27 A;  5CC2 A;  4C1T A;  3T93 B;  1IEJ A;  2ZXT A;  3MP8 A;  2VOZ A;  2OWT A;  1OLC A;  3N6T A;  1US4 A;  4OXV A;  3MVY A;  4UA8 A;  3VLV A;  4IGR A;  3SES A;  3E4R A;  2XXT A;  2XXI A;  3MZ1 A;  1Q35 A;  4F19 A;  1LAF E;  2DYX A;  5I59 A;  3CSB A;  1WDN A;  3CG3 A;  4QHQ A;  1N76 A;  4YU0 A;  3E13 X;  5AA2 B;  4MFI A;  1UTB A;  3FJM A;  4DXB A;  3T9V A;  4G68 C;  1ZTY A;  4G8M A;  4YMA A;  2I6E A;  2DQV A;  4Q30 B;  1R1N A;  4LP2 B;  3ODB A;  4R9G A;  3OMB A;  1P1U A;  2ALU A;  3JZJ A;  5AA3 A;  1MPC A;  1B52 A;  2Z22 A;  5I56 B;  4RPN A;  4Q8R A;  4GXS B;  3KBR A;  1B7U A;  1UTH B;  4F2O A;  5H8S A;  3H6T A;  1FW0 A;  5KZT A;  4X48 A;  3SDF A;  1MXZ A;  4YZZ A;  5DYH A;  1IXC A;  4XKN A;  2XD3 A;  4RY1 A;  1LAX A;  1Y1M A;  1GR2 A;  1BKA A;  4K3F A;  3O2A A;  5HM4 B;  3IO4 A;  4QFN A;  1B3G A;  1SW1 A;  1M5F A;  1ANF A;  1URD A;  3U8Q A;  1WOD A;  3PPO A;  1B7Z A;  1PB8 A;  3C35 A;  5K2Y A;  1MPD A;  3H4Z A;  2VD2 A;  5FHM A;  2M8C A;  2HZL A;  1NH8 A;  3TQL A;  3O28 A;  1EZO A;  1AH5 A;  4KFQ A;  4GVO A;  1I6B A;  3N94 A;  1WVJ A;  2P0S A;  1GVC A;  5TU0 A;  3KEI A;  3FXU A;  2DE2 A;  3KJ7 A;  1UQW A;  4F2Q A;  1LB9 A;  4QRZ A;  4KI0 E;  3K6U A;  4F31 B;  3TUS A;  4FEB A;  3C36 A;  5AA4 A;  3RUM A;  3OO8 A;  2FA7 A;  2O6A A;  4MH5 A;  1NNT A;  4R2F A;  1JVY A;  1QW0 A;  4KYS A;  3CFL A;  4IY5 A;  4O3B A;  2VD3 A;  3KZG A;  1A8F A;  3P7I A;  4R9F A;  4TLL B;  1IQ7 A;  2RCA A;  2UVH A;  5BUU A;  2AYS A;  3DM0 A;  4YB5 A;  3O6I A;  4G8N A;  3TOD A;  2UVJ A;  1LAG E;  1FCK A;  1R9Q A;  1QKB A;  3VXB A;  1LGB C;  1XVY A;  4PP0 A;  1QUL A;  4NF4 A;  1NH7 A;  1XC1 A;  2O1M A;  5ISU A;  4Q0C A;  2Y84 A;  2DWI A;  3TQW A;  5A5X A;  2FNC A;  1TFA A;  2R6G E;  1LCT A;  4LQ5 A;  2W7Y A;  4I8C A;  2DSF A;  5H8Q A;  1M5B A;  3QK6 A;  3K6W A;  5KDT A;  3MVX A;  4KYE A;  4WXJ A;  2XXX A;  3HHF A;  3M8U A;  4H5F A;  1N7X A;  2AIX A;  3DP6 A;  2PVU A;  4GD5 A;  1FQB A;  2VGQ A;  2A5S A;  2H9B A;  1IIW A;  1QKA A;  4UAC A;  1CB6 A;  1CE2 A;  4GL0 A;  4LQ2 A;  3HV1 A;  4PET A;  3V8X B;  4NF8 B;  1JW5 A;  4OER A;  5TPA A;  2P1S A;  5DVJ A;  3SEV A;  2I3W A;  3S9N C;  4PE5 B;  4KCC A;  3H7M A;  3IX1 A;  1MRP A;  2UYE A;  4C1U A;  3JYR A;  5F1Q A;  1MG1 A;  2ZYK A;  3M3F A;  4F3B A;  5HBC A;  3A3C A;  3A09 A;  3M3L A;  1B40 A;  4RJZ A;  4ZZE A;  1FTM A;  1DPE A;  3H6U A;  4XTC Q;  5TP9 A;  1POT A;  1B51 A;  3ZKL A;  1S7Y A;  3S4U A;  4BLA A;  4PQJ A;  5F7V A;  5IAI A;  3IOU A;  5ICQ A;  1A99 A;  4R72 A;  4H67 A;  3KN7 A;  2X26 A;  3HCQ A;  2NUV A;  2ZNS A;  3QYT A;  1MY2 A;  3TKD A;  4U4S A;  4U23 A;  2F6G A;  3BFU A;  1B7H A;  3QUF A;  3PUW E;  1NNK A;  1VE4 A;  3DEL B;  3W15 C;  1Y4C A;  2A5T B;  3FD3 A;  1Y20 A;  5I57 A;  3ZSF A;  3KGC A;  5I84 A;  1B5I A;  3ECR A;  5I2N A;  3USD A;  3RNN A;  1D9Y A;  4RK9 A;  4GXA A;  3RT8 A;  2ZYM A;  3GLB A;  3C33 A;  2YPN A;  5I2K A;  3PV0 E;  1A8E A;  1R9L A;  1SI1 A;  3H3G A;  3ZKK A;  2GHB A;  2ANJ A;  1UIV A;  1GGG A;  1B1H A;  5JK4 A;  1P1O A;  2H98 A;  1EZ9 A;  1FTO A;  1XHY A;  3MUQ A;  3MVZ A;  2D3I A;  2F7C A;  2QS2 A;  1VR5 A;  5AA1 A;  1OQG A;  4ZDM A;  1ELJ A;  3G3F A;  1VSO A;  1VFE A;  4NE4 A;  3LSL A;  1PBQ A;  3MP1 A;  5I58 A;  4OHN A;  1VFD A;  4HCW A;  4R75 A;  4F1V A;  3MC2 A;  1JW1 A;  3FVN A;  3G3H A;  3C34 A;  2O68 A;  4DXC A;  1B4Z A;  3PMW A;  3KN3 A;  3MWB A;  1OIB A;  1USY H;  1LFI A;  3OXN A;  2HQ0 A;  2E0S A;  1US5 A;  1BP5 A;  3O66 A;  5L9O A;  3K02 A;  1SW5 A;  3FAT A;  1IUD A;  4IB2 A;  3S9L C;  1A7L A;  2OLB A;  4FAT A;  3M3K A;  4ZE8 A;  4F29 A;  1MPB A;  1OQH A;  1JET A;  2Y7P A;  2DVZ A;  1AL3 A;  3T9X B;  3OSR A;  2PYY A;  1YCJ A;  3UIF A;  1PB7 A;  3BKI B;  2Q8J A;  4M1V A;  2PT1 A;  4X9T A;  1DTG A;  4OET A;  4O3C A;  3HN0 A;  3B6W A;  3MW0 A;  1B1X A;  4EF1 A;  2ONR A;  1A55 A;  4YKI A;  4G68 A;  4F3G A;  3RT6 B;  3HO7 A;  4EXK A;  4HCY A;  4G4P A;  3EHT A;  4ESX A;  4JSO A;  3OO6 A;  2NWJ A;  2DE3 A;  1ZBM A;  2V84 A;  3TDJ A;  1B3F A;  3RN8 A;  3CI8 A;  5ICT A;  2Q88 A;  4PFT A;  5I59 B;  2Q9T A;  3EQ1 A;  5KCJ A;  4JWY A;  3CIJ A;  4FJP A;  4R2B A;  1UTB B;  2DWJ A;  1D4N A;  1B6H A;  3VFJ A;  3G3I A;  4R73 A;  3I5O A;  5HPQ A;  2LAO A;  2NVU B;  3WAF A;  2Z8F A;  4KHZ E;  3N5L A;  1JW4 A;  2HEU A;  1Y3Q A;  1MQG A;  3S9E A;  2Z8E A;  4WKM A;  2HZK A;  3N6U A;  3UA8 A;  2F6P A;  5CMM A;  1B2H A;  5CRY A;  2CZL A;  3RQT A;  1Z7N E; 
#chains in the Genus database with same CATH topology
 1QUK A;  3MJN A;  2CMO A;  4EQ9 A;  2WYP A;  5DT6 A;  2ONS A;  1YPN A;  5ET6 A;  3RY3 A;  1SD3 A;  3E3K A;  5DEX A;  2JJK A;  4H8J A;  4PGN A;  4F1U A;  4P1L A;  2I4C A;  1EH3 A;  3PPR A;  3T9U A;  3N26 A;  4I1D A;  4O3A A;  4XXU A;  1DK4 A;  4QFP A;  3L6G A;  3RPW A;  1ZU0 A;  1L5T A;  4QSD A;  2HHM A;  5I56 A;  1LFH A;  1LBB A;  3IO6 A;  2REJ A;  3PPP A;  1LAH E;  4LAT A;  3TTK A;  1B58 A;  1MS7 A;  1MQD A;  2B65 A;  4RK2 A;  2XX9 A;  2OK2 A;  5ITO A;  3Q28 A;  1SVX B;  3I3V A;  1S9T A;  5LOM A;  2CZI A;  1DOT A;  4GX3 A;  4KQP A;  1R6Z A;  1IXG A;  1N84 A;  5H8F A;  5FHN A;  3C4M A;  1MDQ A;  3B7D A;  4OVS A;  1NV1 A;  5H8N A;  2O1L A;  3IB1 A;  4NF6 A;  1MM6 A;  1FSA A;  2F5X A;  4PFU A;  2GRV A;  1FQF A;  4MCO A;  2X7Q A;  3MBP A;  1FQC A;  4TQU Q;  5CBR A;  1SW2 A;  1NNF A;  1P1N A;  1FQA A;  4NWD A;  3U1O A;  3KG2 A;  3R6U A;  3QUJ A;  5EYF A;  4PDH A;  2RC8 A;  4ESW A;  3SER A;  2I3V A;  4ZEB A;  5IZ1 A;  2B3F A;  1JNF A;  1B3L A;  2QS4 A;  5AA4 B;  1B9J A;  4ZEC A;  3E78 A;  2HXR A;  1ZJL A;  5EYG A;  3EHS A;  3VLW A;  4MEV A;  2UVI A;  1ZKB A;  4R6H A;  4I62 A;  4X1B A;  4Z0I A;  3PMX A;  2L5V A;  3EF7 A;  1FTJ A;  1FTA A;  4XKP A;  2VP1 A;  4IO6 A;  4ELP A;  3TFL A;  4OFJ A;  4U1Z A;  1JEU A;  5M2V A;  2Z8D A;  4HS7 A;  3KSJ A;  2QSX A;  3G7W A;  4H6D A;  5J1D A;  1FQD A;  3UP9 A;  1LCF A;  1Q9D A;  5EHM A;  3PUX E;  4OVP A;  2G29 A;  4DCY A;  3D4G A;  3CVG A;  1MXX A;  2FIX A;  2XXU A;  3MYU A;  3PMV A;  1YZ0 A;  3VLU A;  1MY3 A;  3MPK A;  4THI A;  3KJT A;  1FPI A;  3SEY A;  3PUZ E;  1KA0 A;  3K00 A;  2F35 A;  3RPL B;  4FED A;  4KD5 A;  4RA1 A;  4PTK A;  2F78 A;  3FVK A;  4L17 A;  2HAV A;  3LSW A;  4NTL A;  5AA2 D;  2DWA A;  2XX7 A;  4PAF A;  4IO2 A;  4NF4 B;  4BDR A;  4IO3 A;  1NV4 A;  2RIN A;  4OZ9 A;  2ONK E;  1SYI A;  2XXW A;  1NKX A;  1MY0 A;  4PFY A;  1D3K A;  3VVD A;  1FJ9 A;  5A5X B;  3K2D A;  4DCX A;  3CRB A;  1EYJ A;  1BIY A;  1LB8 A;  4EUO A;  4EDP A;  3UN6 A;  1YXI A;  1AMF A;  4N6P A;  2AL4 A;  5H8Q B;  3H6V A;  1JVX A;  5ITP A;  5KDT B;  4U1O A;  4P11 A;  4FAJ A;  3FV1 A;  4X04 A;  4PBQ A;  1QUJ A;  2QRY A;  2IEE A;  2HXW A;  3IB2 A;  3MVW A;  4IR8 A;  3T9H B;  3VVE A;  1IME A;  4JVD A;  3SET A;  3LC8 A;  2HPG A;  4RXL A;  5ET8 A;  4F39 A;  3W9W A;  4KXP A;  5TPA B;  1Y4T A;  3TTM A;  4ZS9 A;  1HSJ A;  4X8R A;  2RC9 A;  5A5L A;  4OYV A;  2VT5 A;  2QVR A;  2CEX A;  3FZV A;  3LUY A;  1GTK A;  2XD2 A;  5DTB A;  3TTR A;  4IY6 A;  1QGX A;  1UIU A;  2XXQ A;  5H8H A;  5TP9 B;  2KQZ A;  2Q89 A;  4LN5 A;  4LZ8 A;  4PFW A;  1NNP A;  1MM7 A;  3FVG A;  3JV9 A;  4IO5 A;  1QUI A;  4YAH X;  4DZ1 A;  1FTK A;  4QSC A;  2ESN A;  4AQ4 A;  1OLA A;  1NUZ A;  1VDW A;  2YLN A;  3O6H A;  4F1Y A;  2H25 A;  3LV0 A;  1PDA A;  2I0B A;  2XXY A;  2F7B A;  2R71 A;  2F34 A;  4HW8 A;  4IO4 A;  2DP8 A;  3CR9 A;  2I49 A;  3VVF A;  3CSG A;  5I57 B;  1LBV A;  4HTG A;  1M5D A;  4X1D A;  3DLN A;  3U92 A;  5IZ3 B;  1LLS A;  5I2N B;  3OOA A;  1JP4 A;  4P56 A;  2H4I A;  2OZZ A;  1MXW A;  4XKQ A;  3FJG A;  1URS A;  1H45 A;  1FPG A;  4I9D A;  1XOC A;  4TLM B;  4YKP A;  3IB0 A;  5EYH A;  2VHA A;  1TFD A;  4ZEF A;  2HCA A;  4KYD A;  1B5J A;  4DI3 D;  3HST A;  4QFK A;  2I48 A;  5I2K B;  3B6Q A;  3HHG A;  3K01 A;  1T0K A;  1SQY A;  1DMB A;  5L8D A;  3C9H A;  4NN3 A;  4ZEK A;  3CFX A;  1INP A;  1NV2 A;  2Y5K A;  3L6H A;  3KC0 A;  3OEL A;  3T0J A;  1POY 1;  4G2Z A;  4NF5 B;  1OVT A;  3PUV E;  1D9V A;  1FBP A;  1RKM A;  1ZIU A;  3MZB A;  1NUY A;  3LBS A;  2F97 A;  2I4B A;  5I58 B;  2ZNU A;  1DPP A;  3Q26 A;  3K1N A;  1NI9 A;  4BDL A;  3OD7 A;  3HPI A;  3SEU A;  2XX8 A;  1RYO A;  3PU5 A;  4NED A;  2QS3 A;  1FPB A;  4ISU A;  4JXI A;  3CHG A;  1QJM A;  4KR5 A;  1QVS A;  1N0T A;  3T96 B;  3LUZ A;  2V93 A;  4E0W A;  1O63 A;  4GRK A;  4RYA A;  5CBS A;  1SI0 A;  5EQ9 A;  5B7D A;  4ONY A;  2QMW A;  3K6X A;  2QMX A;  4YB7 A;  4PBH A;  4GOT A;  4GL8 A;  3WAE A;  3TPA A;  4YKK A;  4Z7E A;  4BDQ A;  1Q1K A;  2PT2 A;  3RTW B;  1A40 A;  1HSE A;  2DS9 A;  5JTY A;  3KN8 A;  4G77 A;  1K9Z A;  3R26 A;  1FPK A;  4N6D A;  4HE0 A;  2Y7K A;  4G8H A;  4PAK A;  4DDD A;  1HSL A;  1MY4 A;  1PEB A;  1G0H A;  1MQJ A;  3MPL A;  1FBD A;  1EU8 A;  3LR1 A;  4GLI A;  1Y9U A;  1O64 A;  4DE8 A;  3OEK A;  3FVO A;  3VV5 A;  1SYH A;  3W9V A;  1KWH A;  5K2X A;  3BIG A;  3TAJ A;  3H03 A;  3TTL A;  2F3B A;  1GV8 A;  4MHF A;  2O84 X;  2QPQ A;  4ND9 A;  3Q25 A;  2UYF A;  3IOR A;  4JWO A;  2BJJ X;  2PMS A;  1MDP 1;  1XT8 A;  4U21 A;  2B3B A;  3SEW A;  4BDM A;  1B0H A;  2V3U A;  3BBR A;  2RCB A;  3Q29 A;  5KCJ B;  3V83 A;  3U93 A;  3A3U A;  3IJO B;  4XKR A;  1Y1Z A;  2Y7W A;  3NOH A;  3O6G A;  2Y7I A;  3T1B A;  1MQH A;  4ELO A;  1PB9 A;  3UOR A;  2ZZW A;  4C0R A;  3O97 A;  1CNQ A;  3OO9 A;  4GWX A;  1IZ1 A;  1PBP A;  4WED A;  4EQB A;  3U94 A;  2FYI A;  3V89 B;  2GHA A;  3VXC A;  2UVG A;  3H06 B;  4JB7 A;  4YIC A;  3TCF A;  4YMB A;  3PUY E;  4JWX A;  5AA2 A;  3T22 A;  1ZLQ A;  4H1X A;  2IA4 A;  4MLQ A;  5DEX B;  3EN3 A;  4XIG Q;  3ONM A;  4YB6 A;  1FPF A;  2CZK A;  1KA1 A;  1LBZ A;  1SDX A;  3G3K A;  3DP4 A;  3O9P A;  3IJX B;  3FXQ A;  1LST A;  1JQF A;  2UXA A;  4FE8 A;  4JDF A;  1NV6 A;  2R9J A;  1FBC A;  1S50 A;  4NWC A;  5DVF A;  1B4H A;  2RC7 A;  4OEU A;  2O51 A;  4O7I A;  4RNS A;  1KZ8 A;  1DSN A;  3OO7 A;  3IR1 A;  3K4U A;  2B4M A;  5FBP A;  3K6V A;  4H0W A;  1NL5 A;  4NMY A;  3KC1 A;  1RDZ A;  2OJT A;  1UTH A;  3TEP A;  3TCH A;  4OMB A;  2Y7R A;  4EF2 A;  1B0L A;  4GWY A;  2PBW A;  5H8F B;  5H8N B;  4WEP A;  2DVC A;  2Q2C A;  2P3V A;  3I6V A;  2GFE A;  4NF6 B;  1DBZ A;  3GBB A;  1XS5 A;  2DDK A;  1B3H A;  1IIT A;  4ELR A;  4ZZA A;  3EHU A;  1YTV A;  4LA9 A;  3TCG A;  1NMU A;  4HE1 A;  4P0G A;  2AL5 A;  2VPO A;  3FBP A;  4ZED A;  4F3P A;  3GBA A;  4PFI A;  4H8I A;  3FGS A;  1P1W A;  4OFO A;  1NUX A;  2OBG A;  4O8M A;  3TZA A;  1TT1 A;  1F9B A;  2WKY A;  2H99 A;  1TXF A;  2Q2A A;  2XXK A;  1AWB A;  3UGW A;  1FBE A;  4XF5 A;  1Z7M E;  3KSX A;  3ILT B;  2XXH A;  1B46 A;  1JEV A;  4OQO A;  3FUZ A;  2ZZX A;  3IL1 B;  4R6Y A;  5L9S A;  5CMB A;  5AE4 A;  5FTI A;  2REG A;  4AS5 A;  3TMG A;  3E9X A;  4I3Y A;  3PD9 A;  3TEL A;  4O94 A;  4PE3 A;  4IGT A;  2F7A A;  4PF6 A;  1FBG A;  4QSE A;  4GWO A;  4QFO A;  2X7P A;  3D4C A;  4POW A;  4YKJ A;  5EQ7 A;  2THI A;  4OTE A;  5CMK A;  3TTN A;  1D9Q A;  5IGA A;  2QVV A;  2F8D A;  4MBP A;  3R7X A;  4DLD A;  1I6Q A;  3ILU B;  3LSX A;  2V25 A;  5FTH A;  1H43 A;  4PFB A;  4DIG A;  3SKP A;  1TWY A;  4IO7 A;  4PC9 A;  4F3S A;  4N81 A;  1IXH A;  3GZG A;  2HFB A;  4O7M A;  4GBW A;  4RPO A;  1USY E;  4EXL A;  3H6W A;  3KOS A;  4MNP A;  1B5H A;  3ZS6 A;  3CG1 A;  4P0I A;  1FBH A;  5JEI A;  1O7T A;  3RTF B;  5DVI A;  3FXR A;  1MXV A;  2QS1 A;  1IXI A;  1MXU A;  3EKI A;  1I69 A;  4MNC A;  2QFL A;  2ABH A;  1B32 A;  3THI A;  1LBC A;  2QJE A;  1OVB A;  1FTL A;  5IKB A;  1NUW A;  4GF8 A;  2VPN A;  3D1R A;  3SZP A;  4DI4 B;  4JSD A;  4KPT A;  2MKZ A;  2Q74 A;  5L9M A;  3C31 A;  3AXF A;  3T66 A;  4P9K A;  4ZEI A;  3F11 A;  5ET7 A;  4OVJ A;  3G3J A;  4QFL A;  3B6T A;  5BWJ A;  2DXR A;  4ZE9 A;  5B70 A;  1FPD A;  3MAM A;  4FIM A;  4QXD A;  2XXV A;  2I58 A;  2H5Y A;  2XA5 A;  2OWS A;  2OCU A;  1LBY A;  1AIV A;  4GFR A;  4AS4 A;  3MP6 A;  4LUB A;  4GWS A;  3VE1 B;  3QSL A;  2PFZ A;  3OSQ A;  4BDN A;  2V3Q A;  1BTJ A;  4GIZ A;  1Y3N A;  3GXA A;  5H8H B;  5ESY A;  4F18 A;  3RGY A;  4U4X A;  3ROJ A;  3IFC A;  2RKM A;  4PFR A;  1URG A;  3IK6 B;  2YJP A;  3FAS A;  2NOO A;  1MH4 A;  4NF8 A;  1MY1 A;  1H44 A;  1ZMG A;  1NFT A;  4H65 A;  5ELV A;  3KOT A;  3QXM A;  3S2V A;  5CMC A;  2RF1 A;  2DXY A;  2QVU A;  2O7I A;  4MF3 A;  1EYI A;  3UK4 A;  1SBP A;  4NHB A;  4N15 A;  3FV2 A;  1Y3P A;  1FQE A;  4Q5T A;  3EPE A;  4FOR A;  3ISP A;  2WYK A;  4OES A;  2P3N A;  3PPQ A;  3C32 A;  5ET5 A;  4E0X A;  4TOZ A;  2KLF A;  2DOJ A;  1P99 A;  4OFL A;  1DCU A;  1EZP A;  1YAE A;  4JBZ A;  4OWD A;  4OEV A;  3OEM A;  4U22 A;  3IOT A;  3G3G A;  3FJ7 A;  2P2A A;  3KFM A;  3LSF B;  2XWI A;  2E1S A;  1LBX A;  4LVQ A;  4ELQ A;  1RDY A;  2A5T A;  4MMP A;  3K1P A;  1N04 A;  2ZYN A;  1LFG A;  3K0V A;  2GQ1 A;  4AB5 A;  1EYK A;  1N7W A;  3DP8 A;  5EQ8 A;  3OEN A;  4N07 A;  2NXO A;  1B05 A;  1H3D A;  4BDO A;  2O7U A;  3BIH A;  4F22 A;  3IOV A;  4LON B;  5FHO A;  2ZYO A;  2ZNT A;  2PX1 A;  4JVC A;  1A54 A;  4OEN A;  3FIR A;  4GBV A;  1H76 A;  4DXU A;  1M5E A;  4QF9 A;  1SW4 A;  2G93 A;  3S9M C;  4GWZ A;  4U2R A;  3B50 A;  4NF5 A;  4EQ7 A;  2GH9 A;  4R6K A;  1P1Q A;  4MLV A;  1IMC A;  3U72 A;  4ECF A;  2F36 A;  1B3E A;  1ATG A;  2I0C A;  2D5W A;  2QL3 A;  1N3W A;  4HE2 A;  1AOV A;  2DE4 A;  5CI5 A;  2V3T A;  3PGF A;  3BFT A;  4FEC A;  2D21 A;  2Z23 A;  1II5 A;  3RLF E;  1OMP A;  2XHD A;  5JTY B;  4H45 A;  4AB6 A;  2HAU A;  1MH3 A;  1MXY A;  2F3D A;  1FJ6 A;  4M4G A;  3QIM A;  3PD8 A;  2OWZ A;  3TYH A;  4N8G A;  3SEX A;  4NQ8 A;  4KCD A;  3IAZ A;  1XVX A;  3MQ9 A;  4XFE A;  2O69 A;  4H5G A;  3QAX A;  2ZMB A;  4GQO A;  1I6A A;  3HFU A;  5EHS A;  4JVI A;  4LZ5 A;  2OX3 A;  2WX9 A;  4G68 B;  4LZ7 A;  4POX A;  1N3X A;  2DWH A;  1PC3 A;  1M5C A;  3KBZ A;  1RYX A;  1DTZ A;  2XXP A;  1J1N A;  3O29 A;  3K1M A;  4N13 A;  2R8T A;  2XXR A;  5CM6 A;  3V5A A;  1MQI A;  4OAN A;  4R74 A;  3MZ9 A;  3CFZ A;  3VDF A;  3PPN A;  3IOW A;  1XI6 A;  1G0I A;  1BLF A;  3Q27 A;  4I3E A;  5CC2 A;  4C1T A;  3T93 B;  1IEJ A;  2ZXT A;  3MP8 A;  2VOZ A;  2OWT A;  1OLC A;  3N6T A;  1US4 A;  4OXV A;  3MVY A;  4UA8 A;  3VLV A;  3A29 A;  4IGR A;  3SES A;  3E4R A;  2XXT A;  2XXI A;  3MZ1 A;  1Q35 A;  4F19 A;  1LAF E;  2DYX A;  5I59 A;  3CSB A;  1WDN A;  1FPE A;  3CG3 A;  4QHQ A;  1N76 A;  4YU0 A;  1FBF A;  3E13 X;  5AA2 B;  4MFI A;  1UTB A;  3FJM A;  4DXB A;  3T9V A;  1LBW A;  4G68 C;  1ZTY A;  4G8M A;  4P47 A;  4YMA A;  2I6E A;  2DQV A;  4Q30 B;  2KR0 A;  1FRP A;  1R1N A;  4LP2 B;  3ODB A;  4MJO A;  4R9G A;  3OMB A;  1P1U A;  2ALU A;  3JZJ A;  5AA3 A;  1MPC A;  1B52 A;  2FIE A;  4NG7 A;  2Z22 A;  5I56 B;  1NV3 A;  3E79 A;  4RPN A;  4Q8R A;  4GXS B;  5I7I A;  5I5P A;  4PCD A;  2Y5L A;  3KBR A;  1B7U A;  4FBP A;  2V4C A;  1UTH B;  4F2O A;  5H8S A;  3H6T A;  1FW0 A;  5KZT A;  4X48 A;  3U65 A;  3SDF A;  1MXZ A;  4YZZ A;  4HXV A;  5DYH A;  4PDD A;  1IXC A;  4XKN A;  2XD3 A;  4RY1 A;  4QBA A;  3IFA A;  1LAX A;  1IMA A;  1Y1M A;  1GR2 A;  4MX6 A;  1BKA A;  4K3F A;  3O2A A;  5HM4 B;  3IO4 A;  5J16 A;  4QFN A;  1B3G A;  1SW1 A;  1M5F A;  1ANF A;  1URD A;  3U8Q A;  1WOD A;  2ZZV A;  2WEF A;  3PPO A;  1B7Z A;  5DW8 A;  1PB8 A;  3C35 A;  5K2Y A;  1MPD A;  3H4Z A;  2VD2 A;  1IMD A;  5FHM A;  2M8C A;  2HZL A;  1NH8 A;  3TQL A;  3O28 A;  1EZO A;  1AH5 A;  4KFQ A;  4GVO A;  1I6B A;  3PTY A;  3N94 A;  4N91 A;  1WVJ A;  2P0S A;  5F24 A;  1GVC A;  5TU0 A;  3KEI A;  3FXU A;  5LDZ A;  2DE2 A;  3MST A;  3KJ7 A;  1UQW A;  4F2Q A;  1LB9 A;  4QRZ A;  4KI0 E;  3K6U A;  4F31 B;  3TUS A;  4FEB A;  3C36 A;  5AA4 A;  3RUM A;  3OO8 A;  2FA7 A;  2O6A A;  4MH5 A;  1NNT A;  4R2F A;  5EQA A;  1JVY A;  2PCR A;  5I3S A;  4N4U A;  1QW0 A;  4KYS A;  3CFL A;  4IY5 A;  4PGP A;  4O3B A;  1K9Y A;  2VD3 A;  3FXB A;  3KZG A;  1A8F A;  3P7I A;  4OVQ A;  4R9F A;  4TLL B;  1IQ7 A;  2RCA A;  2UVH A;  5BUU A;  2XWV A;  1NV0 A;  2CEY A;  4PAI A;  2AYS A;  3DM0 A;  4YB5 A;  3O6I A;  4G8N A;  3TOD A;  2UVJ A;  1LAG E;  3RPL A;  1FCK A;  1R9Q A;  4H46 A;  1QKB A;  3VXB A;  4P1E A;  1FPL A;  1LGB C;  1XVY A;  4PP0 A;  1QUL A;  4NF4 A;  4OVR A;  1NH7 A;  1XC1 A;  2O1M A;  5ISU A;  4Q0C A;  2Y84 A;  2DWI A;  3TQW A;  5A5X A;  2FNC A;  1LEV A;  1TFA A;  2R6G E;  1LCT A;  4LQ5 A;  2W7Y A;  4NAP A;  4I8C A;  2DSF A;  4N6K A;  5H8Q A;  1IMB A;  1M5B A;  3QK6 A;  3K6W A;  5KDT A;  3MVX A;  4KYE A;  4WXJ A;  2XXX A;  3HHF A;  3M8U A;  4H5F A;  1N7X A;  2AIX A;  3DP6 A;  2CZH A;  2PVU A;  4GD5 A;  1FQB A;  2VGQ A;  2A5S A;  2H9B A;  4OVT A;  1IIW A;  1QKA A;  4UAC A;  1CB6 A;  1CE2 A;  4GL0 A;  4LQ2 A;  3HV1 A;  4PET A;  3B8B A;  3V8X B;  4NF8 B;  1JW5 A;  4OER A;  5TPA A;  2P1S A;  1FPJ A;  5DVJ A;  3SEV A;  2I3W A;  3S9N C;  4PE5 B;  4KCC A;  4N17 A;  3H7M A;  3IX1 A;  1MRP A;  2UYE A;  4C1U A;  3JYR A;  2BJI A;  5F1Q A;  1MG1 A;  2ZYK A;  3M3F A;  4F3B A;  5HBC A;  3A3C A;  1IMF A;  3A09 A;  3M3L A;  1B40 A;  4RJZ A;  4ZZE A;  1FTM A;  1DPE A;  3H6U A;  4XTC Q;  5TP9 A;  1POT A;  1B51 A;  3ZKL A;  2WBB A;  1S7Y A;  2FVZ A;  3S4U A;  4PQJ A;  4BLA A;  5F7V A;  3QMF A;  5IAI A;  3IOU A;  5ICQ A;  2XWO A;  1A99 A;  4NGU A;  4R72 A;  4H67 A;  3KN7 A;  2X26 A;  3HCQ A;  2NUV A;  2ZNS A;  3QYT A;  1MY2 A;  4OA4 A;  4P8B A;  2FHY A;  3TKD A;  4U4S A;  4U23 A;  2F6G A;  3BFU A;  1B7H A;  3QUF A;  3PUW E;  1NNK A;  1VE4 A;  3DEL B;  3W15 C;  1Y4C A;  2A5T B;  3FD3 A;  4UAB A;  1Y20 A;  5I57 A;  3ZSF A;  3KGC A;  5I84 A;  1B5I A;  5IZ3 A;  5LTC A;  3ECR A;  1BK4 A;  5I2N A;  3USD A;  3GYY A;  3RNN A;  1D9Y A;  4RK9 A;  4GXA A;  3RT8 A;  2ZYM A;  3GLB A;  3C33 A;  2YPN A;  5I2K A;  3PV0 E;  1A8E A;  1R9L A;  1SI1 A;  3H3G A;  3ZKK A;  2GHB A;  2ANJ A;  1UIV A;  1GGG A;  1B1H A;  2WBD A;  5JK4 A;  1P1O A;  2H98 A;  1EZ9 A;  1FTO A;  1XHY A;  3MUQ A;  3MVZ A;  2D3I A;  2F7C A;  2QS2 A;  1VR5 A;  5AA1 A;  1OQG A;  4ZDM A;  1ELJ A;  3G3F A;  1VSO A;  1VFE A;  4NE4 A;  3LSL A;  2B4L A;  1PBQ A;  3MP1 A;  5I58 A;  4OHN A;  1VFD A;  4HCW A;  4R75 A;  4F1V A;  3MC2 A;  1JW1 A;  1NV7 A;  3FVN A;  3G3H A;  4MAG A;  3C34 A;  2O68 A;  4DXC A;  1B4Z A;  4NX1 A;  3PMW A;  3KN3 A;  4P3L A;  4MIJ A;  3MWB A;  1OIB A;  1LFI A;  1USY H;  3OXN A;  2HQ0 A;  2E0S A;  1US5 A;  4GWW A;  1BP5 A;  3O66 A;  5L9O A;  1RDX A;  3K02 A;  1SW5 A;  3FAT A;  1IUD A;  4IB2 A;  3S9L C;  1A7L A;  2OLB A;  4FAT A;  1SPI A;  3M3K A;  4I40 A;  4ZE8 A;  4F29 A;  1MPB A;  1OQH A;  1JET A;  2Y7P A;  2DVZ A;  4GX4 A;  1AL3 A;  3T9X B;  3OSR A;  2PYY A;  1YCJ A;  3UIF A;  1PB7 A;  3BKI B;  2Q8J A;  4M1V A;  2PT1 A;  4X9T A;  1DTG A;  4OET A;  4O3C A;  1YYZ A;  3HN0 A;  3B6W A;  4GWU A;  3MW0 A;  1B1X A;  5IM2 A;  4EF1 A;  2ONR A;  1A55 A;  4YKI A;  4G68 A;  4F3G A;  3RT6 B;  3HO7 A;  4EXK A;  4HCY A;  4G4P A;  3EHT A;  4ESX A;  4JSO A;  3OO6 A;  2NWJ A;  2DE3 A;  1ZBM A;  4N8Y A;  2V84 A;  4XEQ A;  3TDJ A;  1B3F A;  3RN8 A;  3CI8 A;  4GX6 A;  5ICT A;  2Q88 A;  4PFT A;  5I59 B;  4G61 A;  2Q9T A;  2PFY A;  3EQ1 A;  5KCJ A;  5IZZ A;  3RYD A;  4JWY A;  3CIJ A;  4FJP A;  2XWK A;  4R2B A;  1UTB B;  2DWJ A;  4NF0 A;  1D4N A;  2FBP A;  1B6H A;  3VFJ A;  3G3I A;  4R73 A;  3I5O A;  5HPQ A;  2LAO A;  2NVU B;  3WAF A;  2Z8F A;  4KHZ E;  3N5L A;  1JW4 A;  2Q8M A;  2HEU A;  1Y3Q A;  1MQG A;  3S9E A;  2Z8E A;  4WKM A;  4PF8 A;  2HZK A;  3N6U A;  1NV5 A;  3UA8 A;  2F6P A;  5CMM A;  4MNI A;  1B2H A;  5T3J A;  5CRY A;  2CZL A;  3RQT A;  1Z7N E; 
#chains in the Genus database with same CATH homology
 1QUK A;  3MJN A;  2CMO A;  4EQ9 A;  5DT6 A;  2ONS A;  1YPN A;  3RY3 A;  1SD3 A;  3E3K A;  5DEX A;  4H8J A;  4F1U A;  2I4C A;  1EH3 A;  3PPR A;  3T9U A;  3N26 A;  4I1D A;  4O3A A;  4XXU A;  4QFP A;  3L6G A;  3RPW A;  1ZU0 A;  1L5T A;  4QSD A;  5I56 A;  1LFH A;  1LBB A;  3IO6 A;  2REJ A;  3PPP A;  1LAH E;  4LAT A;  3TTK A;  1B58 A;  1MS7 A;  1MQD A;  2B65 A;  4RK2 A;  2XX9 A;  2OK2 A;  5ITO A;  3Q28 A;  1SVX B;  3I3V A;  1S9T A;  5LOM A;  1DOT A;  4KQP A;  1R6Z A;  1IXG A;  1N84 A;  5H8F A;  5FHN A;  3C4M A;  1MDQ A;  3B7D A;  5H8N A;  2O1L A;  3IB1 A;  4NF6 A;  1MM6 A;  2F5X A;  4PFU A;  2GRV A;  1FQF A;  2X7Q A;  3MBP A;  1FQC A;  4TQU Q;  5CBR A;  1SW2 A;  1NNF A;  1P1N A;  1FQA A;  3U1O A;  4NWD A;  3KG2 A;  3R6U A;  3QUJ A;  5EYF A;  2RC8 A;  4ESW A;  3SER A;  2I3V A;  4ZEB A;  2B3F A;  1JNF A;  1B3L A;  2QS4 A;  5AA4 B;  1B9J A;  4ZEC A;  1ZJL A;  3EHS A;  3VLW A;  2UVI A;  1ZKB A;  4R6H A;  4I62 A;  4X1B A;  4Z0I A;  3PMX A;  3EF7 A;  1FTJ A;  4XKP A;  2VP1 A;  4IO6 A;  4ELP A;  3TFL A;  4OFJ A;  4U1Z A;  1JEU A;  5M2V A;  2Z8D A;  4HS7 A;  3KSJ A;  2QSX A;  3G7W A;  4H6D A;  5J1D A;  1FQD A;  3UP9 A;  1LCF A;  5EHM A;  3PUX E;  2G29 A;  4DCY A;  3D4G A;  3CVG A;  1MXX A;  2XXU A;  3PMV A;  3VLU A;  1MY3 A;  3MPK A;  4THI A;  3KJT A;  3SEY A;  3PUZ E;  3K00 A;  2F35 A;  4FED A;  4KD5 A;  4RA1 A;  2F78 A;  3FVK A;  4L17 A;  2HAV A;  3LSW A;  4NTL A;  5AA2 D;  2DWA A;  2XX7 A;  4IO2 A;  4NF4 B;  4BDR A;  4IO3 A;  2RIN A;  4OZ9 A;  2ONK E;  1SYI A;  2XXW A;  1NKX A;  1MY0 A;  4PFY A;  1D3K A;  3VVD A;  5A5X B;  3K2D A;  4DCX A;  3CRB A;  1BIY A;  1LB8 A;  4EUO A;  4EDP A;  3UN6 A;  1AMF A;  4N6P A;  2AL4 A;  5H8Q B;  3H6V A;  1JVX A;  5ITP A;  5KDT B;  4U1O A;  4P11 A;  4FAJ A;  3FV1 A;  1QUJ A;  2QRY A;  2IEE A;  2HXW A;  3IB2 A;  3MVW A;  3T9H B;  3VVE A;  3SET A;  3LC8 A;  4RXL A;  4F39 A;  3W9W A;  5TPA B;  1Y4T A;  3TTM A;  4ZS9 A;  1HSJ A;  2RC9 A;  4OYV A;  3FZV A;  3LUY A;  1GTK A;  2XD2 A;  5DTB A;  3TTR A;  4IY6 A;  1UIU A;  2XXQ A;  5H8H A;  5TP9 B;  2Q89 A;  4LZ8 A;  4PFW A;  1NNP A;  1MM7 A;  3FVG A;  3JV9 A;  4IO5 A;  1QUI A;  4YAH X;  4DZ1 A;  1FTK A;  4QSC A;  2ESN A;  4AQ4 A;  1OLA A;  2YLN A;  3O6H A;  4F1Y A;  2H25 A;  1PDA A;  2I0B A;  2XXY A;  2F7B A;  2R71 A;  2F34 A;  4HW8 A;  4IO4 A;  2DP8 A;  3CR9 A;  2I49 A;  3VVF A;  3CSG A;  5I57 B;  4HTG A;  1M5D A;  4X1D A;  3DLN A;  3U92 A;  1LLS A;  5I2N B;  3OOA A;  2H4I A;  2OZZ A;  1MXW A;  4XKQ A;  3FJG A;  1URS A;  1H45 A;  4I9D A;  1XOC A;  4TLM B;  4YKP A;  3IB0 A;  2VHA A;  1TFD A;  4ZEF A;  2HCA A;  4KYD A;  1B5J A;  3HST A;  4QFK A;  2I48 A;  5I2K B;  3B6Q A;  3HHG A;  3K01 A;  1T0K A;  1SQY A;  1DMB A;  5L8D A;  3C9H A;  4ZEK A;  3CFX A;  3L6H A;  3OEL A;  1POY 1;  4G2Z A;  4NF5 B;  1OVT A;  3PUV E;  1D9V A;  1ZIU A;  1RKM A;  3MZB A;  3LBS A;  2F97 A;  2I4B A;  5I58 B;  2ZNU A;  1DPP A;  3Q26 A;  3K1N A;  4BDL A;  3OD7 A;  3HPI A;  3SEU A;  2XX8 A;  1RYO A;  3PU5 A;  4NED A;  2QS3 A;  4ISU A;  4JXI A;  1QJM A;  4KR5 A;  1QVS A;  1N0T A;  3T96 B;  4E0W A;  2V93 A;  1O63 A;  4GRK A;  4RYA A;  5CBS A;  1SI0 A;  5B7D A;  4ONY A;  2QMW A;  3K6X A;  2QMX A;  4YB7 A;  4GOT A;  4GL8 A;  3WAE A;  3TPA A;  4YKK A;  4Z7E A;  4BDQ A;  1Q1K A;  2PT2 A;  3RTW B;  1A40 A;  1HSE A;  2DS9 A;  5JTY A;  3KN8 A;  4G77 A;  3R26 A;  2Y7K A;  4G8H A;  4DDD A;  1HSL A;  1MY4 A;  1PEB A;  1MQJ A;  3MPL A;  1EU8 A;  3LR1 A;  4GLI A;  1Y9U A;  1O64 A;  4DE8 A;  3OEK A;  3FVO A;  3VV5 A;  1SYH A;  3W9V A;  1KWH A;  5K2X A;  3TAJ A;  3H03 A;  3TTL A;  1GV8 A;  2O84 X;  2QPQ A;  4ND9 A;  3Q25 A;  2UYF A;  3IOR A;  4JWO A;  2BJJ X;  2PMS A;  1MDP 1;  1XT8 A;  4U21 A;  2B3B A;  3SEW A;  4BDM A;  1B0H A;  2V3U A;  3BBR A;  2RCB A;  3Q29 A;  5KCJ B;  3V83 A;  3U93 A;  3A3U A;  3IJO B;  4XKR A;  1Y1Z A;  2Y7W A;  3O6G A;  2Y7I A;  1MQH A;  4ELO A;  1PB9 A;  3UOR A;  4C0R A;  3O97 A;  3OO9 A;  1IZ1 A;  1PBP A;  4WED A;  4EQB A;  3U94 A;  2FYI A;  3V89 B;  2GHA A;  3VXC A;  2UVG A;  3H06 B;  4YIC A;  4JB7 A;  3TCF A;  4YMB A;  3PUY E;  4JWX A;  5AA2 A;  3T22 A;  1ZLQ A;  4H1X A;  2IA4 A;  4MLQ A;  5DEX B;  3EN3 A;  4XIG Q;  3ONM A;  4YB6 A;  1SDX A;  3G3K A;  3DP4 A;  3O9P A;  3IJX B;  3FXQ A;  1LST A;  1JQF A;  2UXA A;  4FE8 A;  4JDF A;  2R9J A;  1S50 A;  4NWC A;  5DVF A;  1B4H A;  2RC7 A;  4OEU A;  2O51 A;  4RNS A;  1DSN A;  3OO7 A;  3IR1 A;  3K4U A;  3K6V A;  4H0W A;  1NL5 A;  4NMY A;  2OJT A;  1UTH A;  3TEP A;  3TCH A;  4OMB A;  2Y7R A;  4EF2 A;  1B0L A;  2PBW A;  5H8F B;  5H8N B;  4WEP A;  2DVC A;  2Q2C A;  3I6V A;  2GFE A;  4NF6 B;  3GBB A;  1XS5 A;  1B3H A;  1IIT A;  4ELR A;  4ZZA A;  3EHU A;  1YTV A;  4LA9 A;  3TCG A;  1NMU A;  4P0G A;  2AL5 A;  4ZED A;  4F3P A;  3GBA A;  4H8I A;  3FGS A;  1P1W A;  4OFO A;  2OBG A;  3TZA A;  1TT1 A;  1F9B A;  2WKY A;  2H99 A;  1TXF A;  2Q2A A;  3UGW A;  1Z7M E;  3KSX A;  3ILT B;  2XXH A;  1B46 A;  1JEV A;  4OQO A;  3FUZ A;  3IL1 B;  4R6Y A;  5L9S A;  5CMB A;  5AE4 A;  5FTI A;  2REG A;  3TMG A;  3E9X A;  3PD9 A;  3TEL A;  4IGT A;  2F7A A;  4QSE A;  4GWO A;  4QFO A;  2X7P A;  3D4C A;  4POW A;  4YKJ A;  2THI A;  4OTE A;  5CMK A;  3TTN A;  2F8D A;  4MBP A;  3R7X A;  4DLD A;  1I6Q A;  3ILU B;  3LSX A;  2V25 A;  5FTH A;  1H43 A;  4DIG A;  3SKP A;  1TWY A;  4IO7 A;  4F3S A;  1IXH A;  3GZG A;  2HFB A;  4RPO A;  1USY E;  4EXL A;  3H6W A;  3KOS A;  1B5H A;  3ZS6 A;  3CG1 A;  4P0I A;  5JEI A;  1O7T A;  3RTF B;  5DVI A;  3FXR A;  1MXV A;  2QS1 A;  1IXI A;  1MXU A;  1I69 A;  2ABH A;  1B32 A;  3THI A;  1LBC A;  2QJE A;  1OVB A;  1FTL A;  5IKB A;  4GF8 A;  4JSD A;  4KPT A;  5L9M A;  3C31 A;  3AXF A;  3T66 A;  4ZEI A;  3F11 A;  4OVJ A;  3G3J A;  4QFL A;  3B6T A;  5BWJ A;  2DXR A;  4ZE9 A;  5B70 A;  3MAM A;  4FIM A;  2XXV A;  2I58 A;  2H5Y A;  2OWS A;  2OCU A;  1AIV A;  4GFR A;  3MP6 A;  4LUB A;  3VE1 B;  3QSL A;  4BDN A;  3OSQ A;  2V3Q A;  1BTJ A;  4GIZ A;  1Y3N A;  3GXA A;  5H8H B;  4F18 A;  3RGY A;  4U4X A;  2RKM A;  1URG A;  3IK6 B;  2YJP A;  3FAS A;  2NOO A;  1MH4 A;  4NF8 A;  1MY1 A;  1H44 A;  1ZMG A;  1NFT A;  4H65 A;  5ELV A;  3KOT A;  3QXM A;  3S2V A;  5CMC A;  2RF1 A;  2DXY A;  2O7I A;  4MF3 A;  3UK4 A;  1SBP A;  3FV2 A;  1Y3P A;  1FQE A;  4Q5T A;  3EPE A;  4FOR A;  4OES A;  3PPQ A;  3C32 A;  4E0X A;  4TOZ A;  2KLF A;  2DOJ A;  1P99 A;  4OFL A;  1EZP A;  1YAE A;  4JBZ A;  4OWD A;  4OEV A;  3OEM A;  4U22 A;  3IOT A;  3G3G A;  3FJ7 A;  2P2A A;  3KFM A;  3LSF B;  2E1S A;  4LVQ A;  4ELQ A;  2A5T A;  3K1P A;  1N04 A;  2ZYN A;  1LFG A;  3K0V A;  4AB5 A;  1N7W A;  3DP8 A;  3OEN A;  4N07 A;  2NXO A;  1B05 A;  1H3D A;  4BDO A;  2O7U A;  4F22 A;  3IOV A;  4LON B;  5FHO A;  2ZYO A;  2ZNT A;  2PX1 A;  1A54 A;  4OEN A;  3FIR A;  1H76 A;  4DXU A;  1M5E A;  4QF9 A;  1SW4 A;  2G93 A;  3S9M C;  4U2R A;  4NF5 A;  4EQ7 A;  2GH9 A;  4R6K A;  1P1Q A;  4MLV A;  3U72 A;  4ECF A;  2F36 A;  1B3E A;  1ATG A;  2I0C A;  2D5W A;  2QL3 A;  1N3W A;  1AOV A;  2DE4 A;  5CI5 A;  2V3T A;  3PGF A;  3BFT A;  4FEC A;  2D21 A;  2Z23 A;  1II5 A;  3RLF E;  1OMP A;  2XHD A;  5JTY B;  4AB6 A;  2HAU A;  1MH3 A;  1MXY A;  4M4G A;  3QIM A;  3PD8 A;  3TYH A;  3SEX A;  4KCD A;  3IAZ A;  1XVX A;  3MQ9 A;  2O69 A;  4H5G A;  3QAX A;  2ZMB A;  4GQO A;  1I6A A;  5EHS A;  4LZ5 A;  4G68 B;  4LZ7 A;  4POX A;  1N3X A;  2DWH A;  1PC3 A;  1M5C A;  1RYX A;  1DTZ A;  2XXP A;  1J1N A;  3O29 A;  3K1M A;  4N13 A;  2XXR A;  5CM6 A;  3V5A A;  1MQI A;  4R74 A;  3MZ9 A;  3CFZ A;  3VDF A;  3PPN A;  3IOW A;  1BLF A;  3Q27 A;  5CC2 A;  4C1T A;  3T93 B;  1IEJ A;  2ZXT A;  3MP8 A;  2VOZ A;  2OWT A;  1OLC A;  3N6T A;  1US4 A;  4OXV A;  3MVY A;  4UA8 A;  3VLV A;  4IGR A;  3SES A;  3E4R A;  2XXT A;  2XXI A;  3MZ1 A;  1Q35 A;  4F19 A;  1LAF E;  2DYX A;  5I59 A;  3CSB A;  1WDN A;  3CG3 A;  4QHQ A;  1N76 A;  4YU0 A;  3E13 X;  5AA2 B;  4MFI A;  1UTB A;  3FJM A;  4DXB A;  3T9V A;  4G68 C;  1ZTY A;  4G8M A;  4YMA A;  2I6E A;  2DQV A;  4Q30 B;  1R1N A;  4LP2 B;  3ODB A;  4R9G A;  3OMB A;  1P1U A;  2ALU A;  3JZJ A;  5AA3 A;  1MPC A;  1B52 A;  2Z22 A;  5I56 B;  4RPN A;  4Q8R A;  4GXS B;  3KBR A;  1B7U A;  1UTH B;  4F2O A;  5H8S A;  3H6T A;  1FW0 A;  5KZT A;  4X48 A;  3SDF A;  1MXZ A;  4YZZ A;  5DYH A;  1IXC A;  4XKN A;  2XD3 A;  4RY1 A;  1LAX A;  1Y1M A;  1GR2 A;  1BKA A;  4K3F A;  3O2A A;  5HM4 B;  3IO4 A;  4QFN A;  1B3G A;  1SW1 A;  1M5F A;  1ANF A;  1URD A;  3U8Q A;  1WOD A;  3PPO A;  1B7Z A;  1PB8 A;  3C35 A;  5K2Y A;  1MPD A;  3H4Z A;  2VD2 A;  5FHM A;  2M8C A;  2HZL A;  1NH8 A;  3TQL A;  3O28 A;  1EZO A;  1AH5 A;  4KFQ A;  4GVO A;  1I6B A;  3N94 A;  1WVJ A;  2P0S A;  1GVC A;  5TU0 A;  3KEI A;  3FXU A;  2DE2 A;  3KJ7 A;  1UQW A;  4F2Q A;  1LB9 A;  4QRZ A;  4KI0 E;  3K6U A;  4F31 B;  3TUS A;  4FEB A;  3C36 A;  5AA4 A;  3RUM A;  3OO8 A;  2FA7 A;  2O6A A;  4MH5 A;  1NNT A;  4R2F A;  1JVY A;  1QW0 A;  4KYS A;  3CFL A;  4IY5 A;  4O3B A;  2VD3 A;  3KZG A;  1A8F A;  3P7I A;  4R9F A;  4TLL B;  1IQ7 A;  2RCA A;  2UVH A;  5BUU A;  2AYS A;  3DM0 A;  4YB5 A;  3O6I A;  4G8N A;  3TOD A;  2UVJ A;  1LAG E;  1FCK A;  1R9Q A;  1QKB A;  3VXB A;  1LGB C;  1XVY A;  4PP0 A;  1QUL A;  4NF4 A;  1NH7 A;  1XC1 A;  2O1M A;  5ISU A;  4Q0C A;  2Y84 A;  2DWI A;  3TQW A;  5A5X A;  2FNC A;  1TFA A;  2R6G E;  1LCT A;  4LQ5 A;  2W7Y A;  4I8C A;  2DSF A;  5H8Q A;  1M5B A;  3QK6 A;  3K6W A;  5KDT A;  3MVX A;  4KYE A;  4WXJ A;  2XXX A;  3HHF A;  3M8U A;  4H5F A;  1N7X A;  2AIX A;  3DP6 A;  2PVU A;  4GD5 A;  1FQB A;  2VGQ A;  2A5S A;  2H9B A;  1IIW A;  1QKA A;  4UAC A;  1CB6 A;  1CE2 A;  4GL0 A;  4LQ2 A;  3HV1 A;  4PET A;  3V8X B;  4NF8 B;  1JW5 A;  4OER A;  5TPA A;  2P1S A;  5DVJ A;  3SEV A;  2I3W A;  3S9N C;  4PE5 B;  4KCC A;  3H7M A;  3IX1 A;  1MRP A;  2UYE A;  4C1U A;  3JYR A;  5F1Q A;  1MG1 A;  2ZYK A;  3M3F A;  4F3B A;  5HBC A;  3A3C A;  3A09 A;  3M3L A;  1B40 A;  4RJZ A;  4ZZE A;  1FTM A;  1DPE A;  3H6U A;  4XTC Q;  5TP9 A;  1POT A;  1B51 A;  3ZKL A;  1S7Y A;  3S4U A;  4BLA A;  4PQJ A;  5F7V A;  5IAI A;  3IOU A;  5ICQ A;  1A99 A;  4R72 A;  4H67 A;  3KN7 A;  2X26 A;  3HCQ A;  2NUV A;  2ZNS A;  3QYT A;  1MY2 A;  3TKD A;  4U4S A;  4U23 A;  2F6G A;  3BFU A;  1B7H A;  3QUF A;  3PUW E;  1NNK A;  1VE4 A;  3DEL B;  3W15 C;  1Y4C A;  2A5T B;  3FD3 A;  1Y20 A;  5I57 A;  3ZSF A;  3KGC A;  5I84 A;  1B5I A;  3ECR A;  5I2N A;  3USD A;  3RNN A;  1D9Y A;  4RK9 A;  4GXA A;  3RT8 A;  2ZYM A;  3GLB A;  3C33 A;  2YPN A;  5I2K A;  3PV0 E;  1A8E A;  1R9L A;  1SI1 A;  3H3G A;  3ZKK A;  2GHB A;  2ANJ A;  1UIV A;  1GGG A;  1B1H A;  5JK4 A;  1P1O A;  2H98 A;  1EZ9 A;  1FTO A;  1XHY A;  3MUQ A;  3MVZ A;  2D3I A;  2F7C A;  2QS2 A;  1VR5 A;  5AA1 A;  1OQG A;  4ZDM A;  1ELJ A;  3G3F A;  1VSO A;  1VFE A;  4NE4 A;  3LSL A;  1PBQ A;  3MP1 A;  5I58 A;  4OHN A;  1VFD A;  4HCW A;  4R75 A;  4F1V A;  3MC2 A;  1JW1 A;  3FVN A;  3G3H A;  3C34 A;  2O68 A;  4DXC A;  1B4Z A;  3PMW A;  3KN3 A;  3MWB A;  1OIB A;  1USY H;  1LFI A;  3OXN A;  2HQ0 A;  2E0S A;  1US5 A;  1BP5 A;  3O66 A;  5L9O A;  3K02 A;  1SW5 A;  3FAT A;  1IUD A;  4IB2 A;  3S9L C;  1A7L A;  2OLB A;  4FAT A;  3M3K A;  4ZE8 A;  4F29 A;  1MPB A;  1OQH A;  1JET A;  2Y7P A;  2DVZ A;  1AL3 A;  3T9X B;  3OSR A;  2PYY A;  1YCJ A;  3UIF A;  1PB7 A;  3BKI B;  2Q8J A;  4M1V A;  2PT1 A;  4X9T A;  1DTG A;  4OET A;  4O3C A;  3HN0 A;  3B6W A;  3MW0 A;  1B1X A;  4EF1 A;  2ONR A;  1A55 A;  4YKI A;  4G68 A;  4F3G A;  3RT6 B;  3HO7 A;  4EXK A;  4HCY A;  4G4P A;  3EHT A;  4ESX A;  4JSO A;  3OO6 A;  2NWJ A;  2DE3 A;  1ZBM A;  2V84 A;  3TDJ A;  1B3F A;  3RN8 A;  3CI8 A;  5ICT A;  2Q88 A;  4PFT A;  5I59 B;  2Q9T A;  3EQ1 A;  5KCJ A;  4JWY A;  3CIJ A;  4FJP A;  4R2B A;  1UTB B;  2DWJ A;  1D4N A;  1B6H A;  3VFJ A;  3G3I A;  4R73 A;  3I5O A;  5HPQ A;  2LAO A;  2NVU B;  3WAF A;  2Z8F A;  4KHZ E;  3N5L A;  1JW4 A;  2HEU A;  1Y3Q A;  1MQG A;  3S9E A;  2Z8E A;  4WKM A;  2HZK A;  3N6U A;  3UA8 A;  2F6P A;  5CMM A;  1B2H A;  5CRY A;  2CZL A;  3RQT A;  1Z7N E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...