1QVSA

Crystal structure of haemophilus influenzae h9a mutant holo ferric ion-binding protein a
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
DITVYNGQAKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-utilization periplasmic protein
publication title Presence of ferric hydroxide clusters in mutants of Haemophilus influenzae ferric ion-binding protein A
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
total genus 111
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qvsA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qvsA01
1GTKA 1H76A 3K2DA 3MAMA 3O28A 2HXWA 1Q35A 4Q0CA 2IEEA 3OMBA 4G8NA 2AL5A 1B7UA 2O69A 3LBSA 1B5HA 2DQVA 1MPDA 1QVSA 5H8FB 4LQ5A 2RC7A 1NNKA 1DSNA 3IR1A 2AYSA 3ODBA 4FECA 4ZEBA 3OOAA 3FJMA 5EHMA 1IZ1A 2P1SA 2A5SA 1B40A 3CG1A 1M5DA 4ZEIA 2Y7PA 3MUQA 4KCDA 2XXVA 2ZMBA 5KCJB 2H98A 5FHOA 4U23A 3PU5A 1QUIA 1UQWA 3T9VA 1LLSA 3M3LA 1OMPA 2ESNA 5I2NA 4YKPA 2B3FA 1QUJA 2RKMA 3MVYA 3CSGA 3K01A 2PMSA 3RTFB 4OFLA 3SESA 4RK9A 3SEUA 4QFNA 2QL3A 1MXVA 1OIBA 5L8DA 2VP1A 3ZKLA 3OO6A 4DCXA 4JWXA 3FVOA 4R72A 2I58A 3KSJA 3B7DA 1LBBA 3A3UA 3VDFA 1H44A 5B70A 1MS7A 1XOCA 4RY1A 3OELA 3DM0A 1SYHA 4F39A 3IAZA 2R9JA 2ZNSA 4U1OA 1FTKA 4F3PA 3N6UA 1B0HA 5B7DA 2REJA 4EQ7A 1N0TA 1ZU0A 3MJNA 4GD5A 1BTJA 3IOTA 3TDJA 1QJMA 2FYIA 1XC1A 1HSLA 3KSXA 4UA8A 1OQHA 5JEIA 4KI0E 2DXYA 3T96B 2O1LA 4H6DA 4IO6A 2FNCA 4G8MA 2DE4A 4NF8B 2GHAA 3VFJA 1N7XA 3DP4A 3UP9A 1MY1A 3G7WA 3Q27A 4QF9A 1R9LA 3O6IA 4OEUA 5I57A 5A5XA 3JV9A 2NWJA 1MG1A 4TQUQ 3MQ9A 4BDQA 1B5JA 3USDA 5AE4A 3TQLA 3MVXA 3IB2A 4KR5A 4EQ9A 3SEVA 1NNTA 5ITPA 5I84A 2XX9A 3S4UA 3TFLA 1A54A 3PUYE 4LUBA 2F97A 5TU0A 2A5TA 3GZGA 3K1MA 1VR5A 1B9JA 1JW5A 3T9HB 3ILUB 4MLQA 4R9FA 5H8HB 3G3FA 2UVHA 4LQ2A 4G77A 5KDTA 3OO7A 5H8NA 2O7UA 1IXIA 1OLCA 2I3WA 2ZYOA 3PPOA 3O9PA 4GWOA 3UORA 4RK2A 3FXQA 4R9GA 1XVXA 2PVUA 3TQWA 4C1TA 1I6AA 3FATA 1PB9A 4OMBA 1EU8A 4PETA 5TPAA 2O7IA 3UIFA 1MY0A 2XX8A 1B3HA 2OJTA 4OWDA 4LVQA 1OVBA 1Q1KA 1USYE 2AIXA 3HN0A 1Y4CA 1N76A 4FIMA 2O84X 1PB8A 3HPIA 3CI8A 1MM7A 4ESWA 5I2KA 3EF7A 1SD3A 4EQBA 4KYDA 3UK4A 1MY2A 2BJJX 4ELQA 2FA7A 4OERA 4IGTA 5ICQA 3PV0E 4GL0A 2ZYNA 5LOMA 3TCHA 2Z8DA 4EUOA 3MP6A 1SI0A 5H8QA 4XKNA 3L6GA 3G3JA 1MH4A 1DPEA 2QMWA 3PD9A 4IO5A 1B3GA 4JXIA 3WAFA 3BKIB 2Q88A 4GRKA 4PP0A 3U72A 2O68A 3S2VA 5F7VA 3MW0A 2ONKE 1VFDA 2RC8A 4QSCA 1TFDA 2QS4A 4Q30B 2DS9A 4Z7EA 4FEBA 1J1NA 3PMXA 3HHFA 4QHQA 3RQTA 5FTHA 3KJ7A 1LCFA 3QUJA 1TFAA 3SDFA 5DEXA 4FE8A 4DXBA 3JYRA 4NF6B 4EDPA 5AA2D 3G3HA 4NF4A 5AA4B 3PUWE 4QSDA 4X9TA 1BP5A 1QKBA 2KLFA 1PDAA 2PBWA 3W15C 3H06B 1O7TA 4DE8A 3H6VA 3VVFA 3TKDA 2ZYMA 4ZDMA 4XKQA 1Z7NE 1ZIUA 3TTNA 4KFQA 1FTMA 2Z22A 2Q2AA 2ZNUA 4OQOA 5F1QA 4DIGA 4X48A 3VLUA 5DVJA 3SKPA 4KD5A 1UTBB 1RYOA 4RA1A 4I9DA 1RYXA 1URDA 4RXLA 2XXRA 5FTIA 2YLNA 2LAOA 3LC8A 1B1HA 1FTOA 3FXRA 3HV1A 3CIJA 1XHYA 1Y3PA 4KQPA 1XT8A 2Y7IA 5BUUA 2CZLA 3H7MA 3PPRA 2Z8FA 4FORA 4YAHX 2O1MA 5I59B 3CFLA 3H6TA 4R2FA 2GHBA 1MRPA 4ECFA 1ZKBA 3DLNA 4YU0A 1QKAA 4NF5A 1MY3A 3QYTA 5HBCA 2OWSA 3MZ1A 4LATA 4H8IA 1FTLA 4G68A 4TLMB 4G68C 1JEVA 1ZBMA 1ZLQA 1MXXA 2F34A 4FATA 1EZOA 4LA9A 3PD8A 4OESA 3I3VA 1LAGE 3HSTA 2DVCA 4ISUA 5DTBA 3V83A 1Y1ZA 2VD3A 3C36A 1WVJA 3UN6A 3DP6A 2DE2A 1M5FA 4OENA 1UTHB 3EQ1A 1B4HA 3BBRA 2HQ0A 5AA3A 2UVGA 4RPNA 5CI5A 1M5CA 4I8CA 1POTA 4NWCA 2NVUB 3JZJA 4OFOA 1NNFA 2H5YA 4GIZA 3IOUA 5JTYA 3E13X 3EPEA 1B05A 1AL3A 2WKYA 4RNSA 1B3FA 1IITA 4JDFA 1B58A 3UGWA 3RNNA 3Q29A 2XXXA 3PUVE 2Y7WA 1GVCA 3RGYA 1O63A 4IY6A 4I1DA 2E0SA 4RYAA 2I0CA 4NF8A 4OETA 1P1OA 2F8DA 1II5A 1BKAA 3IJXB 3EHUA 4DXUA 2QPQA 2Z8EA 1IQ7A 4P0IA 4ZE8A 3H4ZA 1IIWA 1FQBA 1S7YA 4KYSA 1LAHE 3Q26A 4ZEFA 4QSEA 3GLBA 1EZPA 3S9EA 4N07A 4PQJA 5L9OA 5EYFA 2HAUA 2Z23A 3EHSA 4OYVA 1MH3A 2Q9TA 4IGRA 5TP9B 3TEPA 4GLIA 2X26A 1XVYA 4NEDA 1POY1 2OZZA 3KOSA 2HAVA 5M2VA 3W9VA 1A8FA 4R74A 4ELOA 3ECRA 3WAEA 3OEMA 2AL4A 2UYEA 3ZKKA 4U1ZA 3IO6A 1MM6A 3KEIA 4AB6A 4F2OA 1SBPA 1A40A 4F31B 3LSXA 1D4NA 3QK6A 5CMKA 4PFWA 3KOTA 1S9TA 4BDOA 2V93A 3MZ9A 3MC2A 3PPNA 5DYHA 4F3GA 1DPPA 5AA2B 4YMAA 1ANFA 2XX7A 1DOTA 4LONB 3GBAA 3D4GA 3S9LC 3H3GA 4G2ZA 4EXKA 1NMUA 2QS2A 3PUXE 1O64A 5FHNA 4IO4A 4N13A 1FQFA 1MDP1 1N84A 3SEYA 3U8QA 3P7IA 2XXWA 4PE5B 5JK4A 1AMFA 4IO3A 3E4RA 3DP8A 5ICTA 1UIVA 1AH5A 2OK2A 4H1XA 3ILTB 3FGSA 3L6HA 4HTGA 1IUDA 1R9QA 3W9WA 2XHDA 2RC9A 1N04A 1R6ZA 2P2AA 5HM4B 2DWIA 3U1OA 3MVWA 1JQFA 3G3KA 4XTCQ 5CRYA 2DE3A 2G29A 3SETA 3V8XB 5CMMA 1JNFA 4F22A 4ZEDA 4FEDA 2ZXTA 2Q2CA 5I2NB 4LP2B 1EH3A 4F3SA 3TMGA 4K3FA 5CMCA 1VSOA 3EN3A 1LFIA 1SDXA 4DCYA 3TTLA 3IOWA 1H43A 2XD3A 4EXLA 4XXUA 3K1NA 1A8EA 3U93A 3T93B 2QJEA 1FQEA 4C1UA 4ELRA 1ZMGA 4QFLA 4BDRA 1QW0A 1MY4A 2ANJA 3KFMA 3HCQA 4PFTA 2DYXA 4WEPA 1B3EA 3QIMA 1US5A 1LGBC 2Q89A 1FQCA 3K6VA 2O51A 3K6WA 2YJPA 3FVGA 4JWOA 5CM6A 1P99A 3IJOB 5HPQA 2DSFA 1B3LA 4BLAA 1H3DA 2I49A 4O3AA 4OZ9A 3ONMA 1XS5A 2NOOA 2X7QA 1HSEA 1LAXA 3TCFA 1US4A 2UVIA 2GFEA 4NE4A 1TXFA 4POXA 3FVKA 5I56A 2REGA 4NWDA 2B3BA 1B52A 3CR9A 3HHGA 4YB5A 1T0KA 5I57B 5A5XB 1CE2A 4GOTA 3T66A 3N5LA 1RKMA 1P1QA 3EHTA 2PX1A 3V5AA 3O29A 4BDNA 4Z0IA 2E1SA 1LAFE 4MFIA 1M5BA 4F1YA 3VXBA 4LZ7A 5I58A 2QSXA 1OLAA 2V3UA 4POWA 3MPLA 2A5TB 1FQAA 3IB0A 4QFKA 3AXFA 3N94A 2H4IA 4M4GA 1KWHA 4GQOA 3TAJA 5KDTB 5H8NB 3C31A 1I6QA 4AB5A 3A09A 3Q25A 4WXJA 5IAIA 4G8HA 3VVDA 2DOJA 4F19A 4L17A 1TWYA 3KGCA 3O2AA 4IO2A 3CSBA 3K0VA 1NFTA 5TPAB 2DWAA 5DT6A 3MP1A 3S9MC 3TELA 3FD3A 2F6GA 1LFHA 1B5IA 1N3WA 2UYFA 4X1BA 4GL8A 2H25A 4YZZA 3PGFA 3IOVA 4ONYA 1MDQA 4RJZA 2RCBA 2F36A 1Y3QA 1SVXB 1YTVA 5I2KB 1PB7A 1S50A 4ZS9A 2HEUA 3LUYA 3G3IA 3MZBA 5AA1A 3A3CA 3FVNA 3R7XA 3TCGA 3CFZA 5H8FA 5H8QB 3O97A 3R6UA 4YKJA 3IL1B 1H45A 2OBGA 3IO4A 2HFBA 1B4ZA 1D9YA 1AOVA 1I6BA 1ELJA 1MXYA 1DTGA 2V25A 1MQGA 1A55A 4P11A 1B0LA 5KCJA 3PPQA 3H6WA 2VD2A 5ELVA 5CBSA 4IO7A 1SW5A 3IK6B 1MXWA 3GXAA 3H03A 1B1XA 3MVZA 3C32A 4R6YA 2PT1A 1MQDA 2XXQA 3RLFE 2YPNA 1MPCA 2F5XA 4NMYA 5DEXB 4F1UA 1VE4A 2M8CA 2XXPA 3LSFB 3QUFA 4NF4B 1SW2A 1JETA 4OFJA 2HZLA 3VXCA 3C33A 1MXZA 4FAJA 4HS7A 2G93A 2RINA 2VHAA 4ZECA 3T9UA 3IB1A 1P1WA 1JW4A 2XD2A 3QAXA 3CG3A 1SYIA 3PMVA 1PBQA 5EHSA 1GV8A 2OWTA 2ONSA 2ZNTA 3CRBA 3T9XB 3RN8A 5K2YA 1SW1A 4F18A 5CBRA 2H9BA 3LSWA 4DLDA 1NNPA 1EZ9A 3RY3A 3RTWB 4ELPA 4QFPA 3V89B 1B46A 1IXHA 1MQJA 4Q5TA 1MQHA 3N26A 1NH8A 1R1NA 4WEDA 3KN3A 3O66A 3M3FA 3C34A 2DWJA 2O6AA 3B6QA 3S9NC 1JVXA 4NTLA 2XXIA 3TTKA 5IKBA 3FUZA 4MBPA 4NF5B 2DWHA 3PUZE 4UACA 2X7PA 3K6XA 4O3BA 4G68B 2UVJA 2D21A 2R71A 3TTMA 4RPOA 3FXUA 4F3BA 2D3IA 4JB7A 1D3KA 3MWBA 5H8HA 1B7ZA 2PT2A 3K6UA 3LR1A 1I69A 3RPWA 2DXRA 4HCYA 2DVZA 4XKRA 2I0BA 1IXGA 1ZJLA 2HZKA 1PEBA 4GXAA 1JVYA 4PFYA 4MLVA 4DZ1A 4GFRA 2V3TA 4YB6A 4C0RA 4F2QA 3SEXA 1BLFA 4R2BA 4IY5A 4N6PA 1GGGA 2GRVA 3TUSA 4KHZE 5JTYB 1DMBA 1SW4A 1B7HA 3VE1B 2Q8JA 3HO7A 4YICA 4QFOA 1UIUA 3K1PA 1CB6A 4X1DA 2IA4A 1Y1MA 3C4MA 4MH5A 3E9XA 5ISUA 4ESXA 4BDMA 2F7BA 3K00A 4H5GA 1PBPA 2UXAA 1HSJA 4R6KA 1LCTA 1GR2A 4GF8A 4GVOA 1OQGA 4JSDA 4R75A 3Q28A 4BDLA 3OO8A 3VVEA 3OEKA 4U4XA 3TPAA 4KCCA 3ZS6A 3K02A 3OENA 3RT8A 1BIYA 5ITOA 3TYHA 2B65A 1MXUA 3K4UA 2OLBA 4ZE9A 1JEUA 1NKXA 2F35A 4U21A 1PC3A 1MPBA 4HCWA 4Q8RA 3IX1A 5KZTA 3M3KA 4DDDA 2ZYKA 1USYH 4E0XA 2XXUA 5J1DA 3VLWA 3KN7A 1JW1A 3FJ7A 3RUMA 4NF6A 2H99A 4H8JA 5AA4A 4F29A 1ATGA 4R73A 4TOZA 4G4PA 2Y7RA 3G3GA 3GBBA 3LSLA 3TTRA 4H5FA 3O6GA 3M8UA 4H65A 3UA8A 2XXTA 1FW0A 4YB7A 1FTJA 2NXOA 4GXSB 3C35A 4R6HA 1UTBA 4TLLB 4JWYA 4P0GA 4ZZEA 2Y7KA 3U94A 4THIA 3PPPA 1A99A 2QS1A 3N6TA 1NH7A 2VOZA 3CFXA 1P1NA 3OO9A 3KG2A 1LB8A 5DVFA 5I59A 1A7LA 2RCAA 2W7YA 3QXMA 3KJTA 3ZSFA 2V84A 3CVGA 4ZEKA 4ZZAA 1IEJA 4YKIA 3SERA 4EF1A 4EF2A 1LFGA 2DP8A 4LZ8A 1B51A 4JSOA 3T22A 1Z7ME 5K2XA 1SI1A 2ONRA 3QSLA 2R6GE 2THIA 1LBCA 3B6TA 5FHMA 2Y84A 4IB2A 1DTZA 3VV5A 2NUVA 2ABHA 2QRYA 3TODA 4QRZA 3DELB 4U22A 4U4SA 3PMWA 3RT6B 1Y4TA 3R26A 4M1VA 4XKPA 1WODA 2XXHA 3KN8A 1SQYA 2I4BA 4YMBA 4I62A 1P1UA 2HCAA 4OXVA 3MPKA 3O6HA 1M5EA 2I48A 3KZGA 1UTHA 2QMXA 1FCKA 4DXCA 1Y20A 4OVJA 4KPTA 1L5TA 5BWJA 1IXCA 4H0WA 1MQIA 1YAEA 4KYEA 3H6UA 2QS3A 3THIA 3D4CA 4F1VA 1QUKA 2F78A 1NL5A 4O3CA 2V3QA 2VGQA 1YPNA 1F9BA 1TT1A 1Y3NA 4OHNA 1N3XA 3BFTA 3OSQA 3IORA 4E0WA 3U92A 3I6VA 2XXYA 4ND9A 2F6PA 4WKMA 2D5WA 2F7CA 5I56B 2P0SA 3FV2A 1ZTYA 1WDNA 3B6WA 4OTEA 5CC2A 3MBPA 1B32A 1B2HA 3BFUA 2OCUA 3TZAA 4OEVA 1AIVA 1QULA 3I5OA 4XIGQ 3C9HA 3FV1A 3FASA 5I58B 5H8SA 2RF1A 3E3KA 5CMBA 3VLVA 1OVTA 1YCJA 4AQ4A 2I3VA 5DVIA 3SEWA 4HW8A 3FZVA 5TP9A 1Y9UA 2I4CA 4MF3A 1URGA 3MP8A 4U2RA 4FJPA 3KBRA 4YKKA 2PYYA 4PFUA 3OXNA 3FIRA 1N7WA 1B6HA 4JBZA 2I6EA 3OSRA 3OD7A 2ALUA 3F11A 1FQDA 1D9VA 5AA2A 5L9MA 1URSA 1LSTA 1VFEA 4H67A 5L9SA 4LZ5A 2F7AA 2GH9A 3FJGA 2CMOA 1LB9A
chains in the Genus database with same CATH superfamily
1Q9DA 1GTKA 1H76A 3K2DA 3MAMA 3O28A 2HXWA 1Q35A 4Q0CA 4PFRA 2IEEA 3OMBA 4G8NA 2AL5A 1B7UA 2O69A 3LBSA 1B5HA 2DQVA 1MPDA 1QVSA 5H8FB 4LQ5A 2RC7A 1NNKA 3KC0A 3KBZA 1DSNA 3IR1A 4NQ8A 2AYSA 4MJOA 3ODBA 4FECA 4ZEBA 3OOAA 3FJMA 5EHMA 1IZ1A 2P1SA 5ET6A 2A5SA 1B40A 1NV0A 2KR0A 3CG1A 1M5DA 4ZEIA 2Y7PA 3MUQA 4KCDA 2XXVA 2ZMBA 5KCJB 2H98A 5FHOA 4U23A 3PU5A 1QUIA 1UQWA 2FIEA 3T9VA 1LLSA 3M3LA 1OMPA 4N4UA 2ESNA 5I2NA 2XXKA 4YKPA 2B3FA 1QUJA 2RKMA 3MVYA 3CSGA 3K01A 2PMSA 3RTFB 4OFLA 3SESA 4RK9A 3SEUA 4QFNA 2QL3A 1MXVA 1OIBA 5L8DA 2VP1A 4GX6A 3ZKLA 3OO6A 4DCXA 4JWXA 3FVOA 4R72A 2I58A 3KSJA 3B7DA 1LBBA 3A3UA 3VDFA 1H44A 5B70A 1MS7A 1XOCA 4RY1A 3OELA 3DM0A 1SYHA 4F39A 2JJKA 3IAZA 2R9JA 2ZNSA 4U1OA 1FTKA 4F3PA 4OVQA 3N6UA 1B0HA 4MNPA 4PDHA 5B7DA 1YXIA 4GWUA 2REJA 4EQ7A 1N0TA 1ZU0A 3MJNA 4GD5A 1BTJA 3IOTA 3TDJA 1QJMA 5LDZA 5IZ1A 2FYIA 1XC1A 1HSLA 3KSXA 4G61A 4UA8A 1OQHA 5JEIA 4KI0E 2DXYA 3T96B 1FPIA 2O1LA 4H6DA 4IO6A 1SPIA 2FNCA 4PGNA 4G8MA 4PAFA 2DE4A 4NF8B 2GHAA 2Q74A 4HE2A 3VFJA 1N7XA 3DP4A 3UP9A 1MY1A 3G7WA 3Q27A 3U65A 4QF9A 1R9LA 3O6IA 4OEUA 5I57A 5A5XA 3JV9A 2NWJA 1MG1A 4TQUQ 3E78A 3MQ9A 4BDQA 1INPA 1FJ9A 1B5JA 2CZIA 3USDA 5AE4A 3TQLA 3MVXA 3IB2A 4KR5A 4EQ9A 3SEVA 1NNTA 5ITPA 5I84A 2XX9A 3S4UA 3TFLA 4NN3A 1A54A 3PUYE 4LUBA 2F97A 5TU0A 2A5TA 3GZGA 3K1MA 4O7IA 1VR5A 1B9JA 1JW5A 3T9HB 4GX4A 3ILUB 2WEFA 4MLQA 4R9FA 5H8HB 3G3FA 4OVPA 2UVHA 4LQ2A 4G77A 5KDTA 3OO7A 1FBPA 5H8NA 2O7UA 1IXIA 1OLCA 2I3WA 2ZYOA 3PPOA 3O9PA 4GWOA 3UORA 4RK2A 3FXQA 4R9GA 1XVXA 2PVUA 4PBQA 3TQWA 3T0JA 4C1TA 5FBPA 4NF0A 1I6AA 1FBFA 3FATA 1PB9A 4OMBA 1EU8A 4PETA 5TPAA 1G0HA 2O7IA 3UIFA 4PE3A 4GBVA 1MY0A 2ZZVA 4NHBA 2XX8A 1B3HA 2OJTA 4OWDA 4LVQA 1OVBA 1Q1KA 1USYE 2AIXA 2PCRA 3HN0A 1Y4CA 1N76A 1FBCA 4FIMA 2O84X 1FBDA 3E79A 1PB8A 3HPIA 4HE1A 2PFZA 3CI8A 1MM7A 4ESWA 5I2KA 3EF7A 1SD3A 4EQBA 4KYDA 3UK4A 1MY2A 2BJJX 1IMEA 4ELQA 2FA7A 4OERA 4IGTA 5ICQA 4MMPA 3PV0E 4GL0A 2ZYNA 5LOMA 3TCHA 2Z8DA 4EUOA 4PAKA 3MP6A 3RYDA 1SI0A 5H8QA 4XKNA 2CZHA 3D1RA 4OVRA 4P8BA 3L6GA 3G3JA 1MH4A 1DPEA 2QMWA 3PD9A 2Y5LA 4JVDA 4IO5A 1B3GA 4JXIA 3WAFA 5DW8A 3BKIB 2Q88A 4GRKA 4PP0A 3U72A 2O68A 3S2VA 5F7VA 3MW0A 2ONKE 1VFDA 2RC8A 4GX3A 4QSCA 1TFDA 2QS4A 4Q30B 2DS9A 1NUYA 4Z7EA 4H45A 4FEBA 1FBEA 3MSTA 1J1NA 3PMXA 3HHFA 4QHQA 3RQTA 1FBHA 5FTHA 3KJ7A 1LCFA 3QUJA 1TFAA 3SDFA 5DEXA 4FE8A 4DXBA 3JYRA 4NF6B 4EDPA 5AA2D 3G3HA 4NF4A 5AA4B 3PUWE 4QSDA 4X9TA 1BP5A 4PBHA 1QKBA 2KLFA 1PDAA 2PBWA 3LV0A 4H46A 3W15C 3H06B 1O7TA 4NG7A 4DE8A 3H6VA 4NAPA 3VVFA 3TKDA 2ZYMA 4ZDMA 4XKQA 1Z7NE 3IFCA 1ZIUA 3TTNA 4KFQA 1NUZA 1FTMA 2Z22A 2Q2AA 2ZNUA 4OQOA 5F1QA 4MNCA 4DIGA 4X48A 5DVJA 3VLUA 3SKPA 4KD5A 1UTBB 1RYOA 4RA1A 4I9DA 1RYXA 1URDA 4RXLA 4MHFA 2XXRA 5FTIA 4P1EA 2YLNA 2LAOA 1LBWA 3LC8A 1B1HA 1FTOA 3FXRA 3HV1A 3CIJA 1XHYA 1Y3PA 4KQPA 1XT8A 2Y7IA 5BUUA 2CZLA 3H7MA 3PPRA 2B4LA 2Z8FA 3B50A 4P3LA 5IZZA 4FORA 4YAHX 4O94A 2O1MA 5I59B 3CFLA 1DK4A 3H6TA 3CHGA 2BJIA 1NV3A 4OA4A 4R2FA 2GHBA 1MRPA 4ECFA 1ZKBA 1NV4A 3DLNA 1K9YA 4YU0A 1LBYA 1QKAA 4NF5A 1MY3A 3QYTA 5HBCA 2OWSA 3MZ1A 4LATA 4OVTA 2QVRA 4H8IA 1FTLA 4G68A 4PF6A 4TLMB 4G68C 1JEVA 1ZBMA 1ZLQA 1MXXA 2F34A 4FATA 1EZOA 4LA9A 3PD8A 4OESA 2VT5A 3I3VA 1LAGE 3HSTA 2DVCA 4ISUA 2XWIA 5DTBA 3V83A 1Y1ZA 2VD3A 3C36A 1WVJA 4NX1A 4AS4A 3UN6A 3DP6A 2DE2A 1M5FA 4OENA 1UTHB 3EQ1A 1B4HA 3BBRA 2HQ0A 5AA3A 2UVGA 4RPNA 1FPFA 5CI5A 1M5CA 4I8CA 1POTA 2F3DA 4NWCA 5IGAA 2NVUB 4QBAA 3JZJA 4OFOA 4PFIA 3BIHA 1NNFA 2H5YA 4GIZA 3IOUA 5JTYA 3E13X 4AS5A 3EPEA 4MIJA 1B05A 1AL3A 2WKYA 3PTYA 4RNSA 1B3FA 4GWSA 1IITA 4JDFA 1B58A 3UGWA 3RNNA 3Q29A 2XXXA 3PUVE 2Y7WA 1GVCA 3RGYA 1O63A 5EQ9A 4IY6A 4I1DA 2E0SA 4RYAA 2I0CA 5J16A 4NF8A 4OETA 1P1OA 2F8DA 1II5A 1BKAA 3IJXB 3EHUA 4DXUA 2QPQA 2Z8EA 1IQ7A 4P0IA 4ZE8A 3H4ZA 1IIWA 1FQBA 2OX3A 1NV7A 1S7YA 4KYSA 1LAHE 3Q26A 4ZEFA 4QSEA 1AWBA 3GLBA 4GBWA 1EZPA 3S9EA 4N07A 4PQJA 5L9OA 5EYFA 2HAUA 5IM2A 2Z23A 4N6KA 3EHSA 1IMAA 4OYVA 1MH3A 2Q9TA 4IGRA 5TP9B 3TEPA 4GLIA 2X26A 1XVYA 4NEDA 1POY1 2OZZA 3KOSA 2HAVA 5M2VA 2DDKA 3W9VA 1A8FA 4R74A 4ELOA 3ECRA 3WAEA 3OEMA 2AL4A 2UYEA 3ZKKA 4U1ZA 4O8MA 3IO6A 1MM6A 3KEIA 4AB6A 4F2OA 4P56A 1SBPA 1A40A 4F31B 5IZ3B 4UABA 3LSXA 1D4NA 3QK6A 5CMKA 4PFWA 3KOTA 1S9TA 4P47A 4BDOA 2V93A 3MZ9A 3MC2A 3PPNA 5DYHA 4F3GA 1DPPA 5AA2B 4YMAA 2QFLA 1ANFA 2XWKA 1DOTA 2XX7A 4LONB 3GBAA 1EYJA 3D4GA 3S9LC 3H3GA 4G2ZA 4EXKA 1NMUA 2QS2A 3PUXE 1O64A 5FHNA 4IO4A 4MAGA 4N13A 1FQFA 1MDP1 2WYKA 1N84A 3SEYA 3U8QA 3P7IA 2XXWA 4PE5B 2PFYA 5JK4A 1AMFA 4IO3A 3E4RA 3DP8A 5ICTA 1UIVA 1AH5A 2OK2A 4H1XA 3ILTB 1YZ0A 3FGSA 3L6HA 4HTGA 1IUDA 1R9QA 4PCDA 3W9WA 2ZZWA 2WX9A 2XHDA 2RC9A 2HXRA 1N04A 1R6ZA 2P2AA 1D9QA 5HM4B 2DWIA 3U1OA 3MVWA 1JQFA 3G3KA 4XTCQ 5CRYA 2DE3A 2G29A 3SETA 3V8XB 5CMMA 1JNFA 4F22A 4ZEDA 4FEDA 1QGXA 2ZXTA 4XFEA 2Q2CA 4I3YA 1BK4A 5I2NB 4LP2B 1EH3A 3NOHA 4F3SA 3TMGA 4K3FA 5CMCA 1VSOA 3EN3A 1LFIA 1SDXA 3HFUA 4DCYA 3TTLA 3IOWA 1H43A 2XD3A 4EXLA 3K1NA 4XXUA 4X8RA 1A8EA 3U93A 3T93B 2QJEA 1FQEA 4C1UA 4ELRA 1ZMGA 4QFLA 4BDRA 4FBPA 1QW0A 2L5VA 1MY4A 1RDYA 2ANJA 3KFMA 3HCQA 1EYKA 4PFTA 4DI3D 2DYXA 4WEPA 1B3EA 3QIMA 1FPKA 1US5A 1LGBC 2Q89A 1FQCA 3K6VA 3FXBA 2O51A 4N17A 3K6WA 2YJPA 3FVGA 4N8GA 4JWOA 1FPEA 1NV2A 5CM6A 4NGUA 1P99A 3IJOB 5HPQA 2DSFA 1B3LA 5I3SA 4BLAA 1H3DA 2I49A 4O3AA 4OZ9A 2XWOA 3ONMA 1XS5A 2NOOA 2X7QA 1HSEA 1LAXA 3TCFA 1US4A 2UVIA 2GFEA 4NE4A 1TXFA 2FHYA 2V4CA 4POXA 3FVKA 5I56A 2REGA 4MX6A 4NWDA 2HHMA 2B3BA 1B52A 3CR9A 3HHGA 4YB5A 1T0KA 5I57B 5A5XB 1CE2A 4GOTA 3T66A 3N5LA 1RKMA 1P1QA 3EHTA 2PX1A 3V5AA 3O29A 4BDNA 5EYGA 3RPLA 4Z0IA 2E1SA 1LAFE 4MFIA 1M5BA 4F1YA 3VXBA 4LZ7A 2F3BA 5I58A 2QSXA 1OLAA 2V3UA 4POWA 3MPLA 2WBDA 2A5TB 1FQAA 3IB0A 1LBXA 4QFKA 3AXFA 3N94A 2H4IA 4M4GA 1KWHA 4GQOA 3TAJA 3B8BA 5KDTB 5H8NB 3C31A 1I6QA 4AB5A 3A09A 3Q25A 4WXJA 4HE0A 5IAIA 4G8HA 3VVDA 2DOJA 4I40A 4F19A 5I7IA 4L17A 1TWYA 3KGCA 3O2AA 4IO2A 2Q8MA 3CSBA 3K0VA 4N91A 1NFTA 5TPAB 2DWAA 5DT6A 3MP1A 3S9MC 3TELA 3FD3A 2F6GA 1LFHA 1B5IA 1N3WA 2UYFA 4X1BA 4GL8A 2H25A 4YZZA 3PGFA 3IOVA 4ONYA 1MDQA 4RJZA 2RCBA 2VPNA 2F36A 1Y3QA 1SVXB 1YTVA 5I2KB 1PB7A 1S50A 4ZS9A 2HEUA 3LUYA 3G3IA 3MZBA 5AA1A 3ISPA 3A3CA 3FVNA 3R7XA 3TCGA 3CFZA 5H8FA 5H8QB 3O97A 3R6UA 4YKJA 3IL1B 1H45A 2OBGA 3IO4A 2HFBA 4P9KA 1B4ZA 1D9YA 1AOVA 1I6BA 1ELJA 1MXYA 1DTGA 2V25A 1MQGA 1A55A 1FJ6A 3IFAA 4P11A 1B0LA 5KCJA 3EKIA 3PPQA 3MYUA 3H6WA 4PDDA 2VD2A 5ELVA 5CBSA 4IO7A 1SW5A 3IK6B 1MXWA 3GXAA 3H03A 1B1XA 3MVZA 3C32A 4R6YA 2PT1A 1MQDA 2XXQA 3RLFE 2YPNA 4PGPA 1MPCA 2F5XA 4NMYA 5DEXB 5ET8A 4F1UA 1VE4A 1FPJA 2M8CA 2XXPA 3LSFB 3QUFA 4NF4B 4GWYA 1SW2A 1JETA 4OFJA 2HZLA 3VXCA 3C33A 5T3JA 1MXZA 1JP4A 4FAJA 4GWZA 4HS7A 2G93A 2RINA 2VHAA 4ZECA 3T9UA 3IB1A 1P1WA 1JW4A 5EQ8A 2XD2A 3QAXA 2ZZXA 3SZPA 2Y5KA 3CG3A 1SYIA 3PMVA 1PBQA 5EHSA 1GV8A 2OWTA 5I5PA 2ONSA 2ZNTA 3CRBA 3T9XB 3RN8A 5K2YA 1SW1A 1LBZA 4F18A 1G0IA 5CBRA 2H9BA 3LSWA 3T1BA 4DLDA 1NNPA 1EZ9A 2KQZA 3RY3A 2FVZA 3RTWB 4GWWA 4ELPA 4QFPA 3V89B 1B46A 1IXHA 1MQJA 4Q5TA 1MQHA 3N26A 1NH8A 1R1NA 4PC9A 4WEDA 3KN3A 3O66A 3M3FA 4JVIA 1CNQA 3C34A 2DWJA 2O6AA 1IMDA 3B6QA 3S9NC 1JVXA 4NTLA 4XF5A 2XXIA 3TTKA 5IKBA 3FUZA 4MBPA 4NF5B 3BIGA 1NUWA 2DWHA 3PUZE 4UACA 2X7PA 3K6XA 4O3BA 4G68B 2UVJA 2D21A 4HXVA 2R71A 1LBVA 4KXPA 3TTMA 4RPOA 4I3EA 3FXUA 1NV6A 4F3BA 2D3IA 4JB7A 4N81A 1D3KA 3MWBA 2P3NA 1LEVA 1B7ZA 5H8HA 2CZKA 2PT2A 3K6UA 3LR1A 1K9ZA 1I69A 3RPWA 2DXRA 4HCYA 2DVZA 3KC1A 4XKRA 2I0BA 4MEVA 1IXGA 1ZJLA 2HZKA 1PEBA 4GXAA 1JVYA 4PFYA 4MLVA 4DZ1A 4GFRA 2V3TA 4YB6A 4C0RA 4F2QA 3SEXA 1BLFA 4R2BA 4IY5A 4N6PA 5EQAA 1GGGA 2GRVA 4N8YA 3TUSA 4KHZE 5JTYB 2P3VA 1DMBA 1SW4A 1B7HA 3VE1B 2Q8JA 3HO7A 4YICA 4QFOA 1IMBA 1UIUA 3K1PA 1CB6A 4X1DA 2IA4A 1Y1MA 3C4MA 4PTKA 4GWXA 4MH5A 1NI9A 3E9XA 5ISUA 4ESXA 4BDMA 1FPGA 2F7BA 3K00A 4H5GA 1PBPA 2UXAA 5F24A 1HSJA 4R6KA 1LCTA 4QXDA 1GR2A 4GF8A 4GVOA 1OQGA 3GYYA 4JSDA 4R75A 4X04A 3Q28A 4BDLA 3OO8A 3VVEA 3OEKA 2HPGA 4U4XA 3TPAA 4MNIA 1RDXA 4KCCA 3ZS6A 3K02A 1XI6A 3OENA 3RT8A 1BIYA 5ITOA 3LUZA 2FIXA 3TYHA 2B65A 1MXUA 3K4UA 2OLBA 4ZE9A 1JEUA 1NKXA 2F35A 4U21A 4P1LA 1PC3A 2GQ1A 1MPBA 4HCWA 4Q8RA 1NUXA 3IX1A 5KZTA 3M3KA 4DDDA 2ZYKA 1USYH 4E0XA 2XXUA 5J1DA 4OANA 3VLWA 3KN7A 1JW1A 1YYZA 3FJ7A 4PF8A 2WBBA 4NF6A 3RUMA 2H99A 4H8JA 2CEXA 1FSAA 5AA4A 4MCOA 4F29A 1ATGA 4R73A 4TOZA 4G4PA 2Y7RA 3G3GA 3GBBA 3LSLA 5LTCA 3TTRA 4H5FA 3O6GA 3M8UA 4H65A 3UA8A 2XXTA 1FW0A 1VDWA 4YB7A 4N15A 1FTJA 2NXOA 4GXSB 3C35A 2CEYA 4R6HA 1UTBA 4TLLB 3ROJA 4JWYA 4P0GA 2WYPA 4ZZEA 2Y7KA 3U94A 4THIA 3PPPA 1A99A 2QS1A 3N6TA 1NH7A 2QVVA 2VOZA 3CFXA 1P1NA 3OO9A 3KG2A 1LB8A 5DVFA 5I59A 1A7LA 2RCAA 5EQ7A 1KZ8A 4OVSA 2W7YA 3QXMA 3KJTA 3ZSFA 2V84A 3CVGA 4XEQA 4ZEKA 4ZZAA 1IEJA 4YKIA 3SERA 4EF1A 4EF2A 1LFGA 2DP8A 4LZ8A 1B51A 4JSOA 3T22A 1Z7ME 5K2XA 1SI1A 2ONRA 4JVCA 5ET7A 2B4MA 3QSLA 2R6GE 2THIA 1LBCA 3B6TA 5FHMA 2Y84A 1NV5A 2XWVA 4IB2A 1DTZA 3VV5A 2NUVA 2ABHA 2QRYA 3TODA 4O7MA 4QRZA 3DELB 4U22A 4U4SA 3PMWA 1FPDA 3RT6B 1Y4TA 3R26A 4M1VA 4XKPA 1WODA 2XXHA 3KN8A 1SQYA 2I4BA 4YMBA 4I62A 1P1UA 1DBZA 2HCAA 4OXVA 3MPKA 3O6HA 4PAIA 1M5EA 2I48A 3KZGA 1UTHA 5EYHA 2QMXA 1FRPA 1FCKA 4DXCA 1Y20A 4OVJA 4KPTA 1L5TA 5BWJA 4IR8A 1IXCA 4H0WA 1MQIA 1YAEA 4KYEA 3H6UA 2QS3A 3THIA 1FBGA 3D4CA 4F1VA 2VPOA 1QUKA 2F78A 2R8TA 3QMFA 1NL5A 4O3CA 1KA0A 2V3QA 3FBPA 2MKZA 2VGQA 1F9BA 1YPNA 1TT1A 1Y3NA 5ESYA 4OHNA 1N3XA 3BFTA 3OSQA 3IORA 4E0WA 1FPLA 3U92A 3I6VA 2XXYA 4ND9A 2F6PA 4WKMA 2D5WA 1FTAA 2F7CA 5I56B 2P0SA 3FV2A 1ZTYA 1WDNA 3B6WA 1IMFA 4OTEA 5CC2A 1DCUA 3MBPA 1B32A 1B2HA 1KA1A 3BFUA 2OCUA 3TZAA 4OEVA 1AIVA 2OWZA 3RPLB 1QULA 3I5OA 4XIGQ 5A5LA 3C9HA 3FV1A 4DI4B 3FASA 5I58B 5H8SA 2RF1A 3E3KA 2XA5A 5CMBA 3VLVA 2QVUA 5ET5A 1OVTA 1YCJA 4AQ4A 2I3VA 5DVIA 3SEWA 4HW8A 4LN5A 1EYIA 3FZVA 5TP9A 1Y9UA 2I4CA 4MF3A 1URGA 3MP8A 4U2RA 2FBPA 4FJPA 3KBRA 4YKKA 1RDZA 2PYYA 4PFUA 3OXNA 3FIRA 1N7WA 1B6HA 1IMCA 4JBZA 2I6EA 5IZ3A 3OSRA 4N6DA 3OD7A 2ALUA 3F11A 1FPBA 1FQDA 3A29A 1D9VA 5L9MA 5AA2A 1URSA 1LSTA 1VFEA 4H67A 5L9SA 4LZ5A 2F7AA 2GH9A 1NV1A 3FJGA 2CMOA 1LB9A 4PFBA
chains in the Genus database with same CATH topology
1GTKA 1H76A 3K2DA 3MAMA 3O28A 2HXWA 1Q35A 4Q0CA 2IEEA 3OMBA 4G8NA 2AL5A 1B7UA 2O69A 3LBSA 1B5HA 2DQVA 1MPDA 1QVSA 5H8FB 4LQ5A 2RC7A 1NNKA 1DSNA 3IR1A 2AYSA 3ODBA 4FECA 4ZEBA 3OOAA 3FJMA 5EHMA 1IZ1A 2P1SA 2A5SA 1B40A 3CG1A 1M5DA 4ZEIA 2Y7PA 3MUQA 4KCDA 2XXVA 2ZMBA 5KCJB 2H98A 5FHOA 4U23A 3PU5A 1QUIA 1UQWA 3T9VA 1LLSA 3M3LA 1OMPA 2ESNA 5I2NA 4YKPA 2B3FA 1QUJA 2RKMA 3MVYA 3CSGA 3K01A 2PMSA 3RTFB 4OFLA 3SESA 4RK9A 3SEUA 4QFNA 2QL3A 1MXVA 1OIBA 5L8DA 2VP1A 3ZKLA 3OO6A 4DCXA 4JWXA 3FVOA 4R72A 2I58A 3KSJA 3B7DA 1LBBA 3A3UA 3VDFA 1H44A 5B70A 1MS7A 1XOCA 4RY1A 3OELA 3DM0A 1SYHA 4F39A 3IAZA 2R9JA 2ZNSA 4U1OA 1FTKA 4F3PA 3N6UA 1B0HA 5B7DA 2REJA 4EQ7A 1N0TA 1ZU0A 3MJNA 4GD5A 1BTJA 3IOTA 3TDJA 1QJMA 2FYIA 1XC1A 1HSLA 3KSXA 4UA8A 1OQHA 5JEIA 4KI0E 2DXYA 3T96B 2O1LA 4H6DA 4IO6A 2FNCA 4G8MA 2DE4A 4NF8B 2GHAA 3VFJA 1N7XA 3DP4A 3UP9A 1MY1A 3G7WA 3Q27A 4QF9A 1R9LA 3O6IA 4OEUA 5I57A 5A5XA 3JV9A 2NWJA 1MG1A 4TQUQ 3MQ9A 4BDQA 1B5JA 3USDA 5AE4A 3TQLA 3MVXA 3IB2A 4KR5A 4EQ9A 3SEVA 1NNTA 5ITPA 5I84A 2XX9A 3S4UA 3TFLA 1A54A 3PUYE 4LUBA 2F97A 5TU0A 2A5TA 3GZGA 3K1MA 1VR5A 1B9JA 1JW5A 3T9HB 3ILUB 4MLQA 4R9FA 5H8HB 3G3FA 2UVHA 4LQ2A 4G77A 5KDTA 3OO7A 5H8NA 2O7UA 1IXIA 1OLCA 2I3WA 2ZYOA 3PPOA 3O9PA 4GWOA 3UORA 4RK2A 3FXQA 4R9GA 1XVXA 2PVUA 3TQWA 4C1TA 1I6AA 3FATA 1PB9A 4OMBA 1EU8A 4PETA 5TPAA 2O7IA 3UIFA 1MY0A 2XX8A 1B3HA 2OJTA 4OWDA 4LVQA 1OVBA 1Q1KA 1USYE 2AIXA 3HN0A 1Y4CA 1N76A 4FIMA 2O84X 1PB8A 3HPIA 3CI8A 1MM7A 4ESWA 5I2KA 3EF7A 1SD3A 4EQBA 4KYDA 3UK4A 1MY2A 2BJJX 4ELQA 2FA7A 4OERA 4IGTA 5ICQA 3PV0E 4GL0A 2ZYNA 5LOMA 3TCHA 2Z8DA 4EUOA 3MP6A 1SI0A 5H8QA 4XKNA 3L6GA 3G3JA 1MH4A 1DPEA 2QMWA 3PD9A 4IO5A 1B3GA 4JXIA 3WAFA 3BKIB 2Q88A 4GRKA 4PP0A 3U72A 2O68A 3S2VA 5F7VA 3MW0A 2ONKE 1VFDA 2RC8A 4QSCA 1TFDA 2QS4A 4Q30B 2DS9A 4Z7EA 4FEBA 1J1NA 3PMXA 3HHFA 4QHQA 3RQTA 5FTHA 3KJ7A 1LCFA 3QUJA 1TFAA 3SDFA 5DEXA 4FE8A 4DXBA 3JYRA 4NF6B 4EDPA 5AA2D 3G3HA 4NF4A 5AA4B 3PUWE 4QSDA 4X9TA 1BP5A 1QKBA 2KLFA 1PDAA 2PBWA 3W15C 3H06B 1O7TA 4DE8A 3H6VA 3VVFA 3TKDA 2ZYMA 4ZDMA 4XKQA 1Z7NE 1ZIUA 3TTNA 4KFQA 1FTMA 2Z22A 2Q2AA 2ZNUA 4OQOA 5F1QA 4DIGA 4X48A 3VLUA 5DVJA 3SKPA 4KD5A 1UTBB 1RYOA 4RA1A 4I9DA 1RYXA 1URDA 4RXLA 2XXRA 5FTIA 2YLNA 2LAOA 3LC8A 1B1HA 1FTOA 3FXRA 3HV1A 3CIJA 1XHYA 1Y3PA 4KQPA 1XT8A 2Y7IA 5BUUA 2CZLA 3H7MA 3PPRA 2Z8FA 4FORA 4YAHX 2O1MA 5I59B 3CFLA 3H6TA 4R2FA 2GHBA 1MRPA 4ECFA 1ZKBA 3DLNA 4YU0A 1QKAA 4NF5A 1MY3A 3QYTA 5HBCA 2OWSA 3MZ1A 4LATA 4H8IA 1FTLA 4G68A 4TLMB 4G68C 1JEVA 1ZBMA 1ZLQA 1MXXA 2F34A 4FATA 1EZOA 4LA9A 3PD8A 4OESA 3I3VA 1LAGE 3HSTA 2DVCA 4ISUA 5DTBA 3V83A 1Y1ZA 2VD3A 3C36A 1WVJA 3UN6A 3DP6A 2DE2A 1M5FA 4OENA 1UTHB 3EQ1A 1B4HA 3BBRA 2HQ0A 5AA3A 2UVGA 4RPNA 5CI5A 1M5CA 4I8CA 1POTA 4NWCA 2NVUB 3JZJA 4OFOA 1NNFA 2H5YA 4GIZA 3IOUA 5JTYA 3E13X 3EPEA 1B05A 1AL3A 2WKYA 4RNSA 1B3FA 1IITA 4JDFA 1B58A 3UGWA 3RNNA 3Q29A 2XXXA 3PUVE 2Y7WA 1GVCA 3RGYA 1O63A 4IY6A 4I1DA 2E0SA 4RYAA 2I0CA 4NF8A 4OETA 1P1OA 2F8DA 1II5A 1BKAA 3IJXB 3EHUA 4DXUA 2QPQA 2Z8EA 1IQ7A 4P0IA 4ZE8A 3H4ZA 1IIWA 1FQBA 1S7YA 4KYSA 1LAHE 3Q26A 4ZEFA 4QSEA 3GLBA 1EZPA 3S9EA 4N07A 4PQJA 5L9OA 5EYFA 2HAUA 2Z23A 3EHSA 4OYVA 1MH3A 2Q9TA 4IGRA 5TP9B 3TEPA 4GLIA 2X26A 1XVYA 4NEDA 1POY1 2OZZA 3KOSA 2HAVA 5M2VA 3W9VA 1A8FA 4R74A 4ELOA 3ECRA 3WAEA 3OEMA 2AL4A 2UYEA 3ZKKA 4U1ZA 3IO6A 1MM6A 3KEIA 4AB6A 4F2OA 1SBPA 1A40A 4F31B 3LSXA 1D4NA 3QK6A 5CMKA 4PFWA 3KOTA 1S9TA 4BDOA 2V93A 3MZ9A 3MC2A 3PPNA 5DYHA 4F3GA 1DPPA 5AA2B 4YMAA 1ANFA 2XX7A 1DOTA 4LONB 3GBAA 3D4GA 3S9LC 3H3GA 4G2ZA 4EXKA 1NMUA 2QS2A 3PUXE 1O64A 5FHNA 4IO4A 4N13A 1FQFA 1MDP1 1N84A 3SEYA 3U8QA 3P7IA 2XXWA 4PE5B 5JK4A 1AMFA 4IO3A 3E4RA 3DP8A 5ICTA 1UIVA 1AH5A 2OK2A 4H1XA 3ILTB 3FGSA 3L6HA 4HTGA 1IUDA 1R9QA 3W9WA 2XHDA 2RC9A 1N04A 1R6ZA 2P2AA 5HM4B 2DWIA 3U1OA 3MVWA 1JQFA 3G3KA 4XTCQ 5CRYA 2DE3A 2G29A 3SETA 3V8XB 5CMMA 1JNFA 4F22A 4ZEDA 4FEDA 2ZXTA 2Q2CA 5I2NB 4LP2B 1EH3A 4F3SA 3TMGA 4K3FA 5CMCA 1VSOA 3EN3A 1LFIA 1SDXA 4DCYA 3TTLA 3IOWA 1H43A 2XD3A 4EXLA 4XXUA 3K1NA 1A8EA 3U93A 3T93B 2QJEA 1FQEA 4C1UA 4ELRA 1ZMGA 4QFLA 4BDRA 1QW0A 1MY4A 2ANJA 3KFMA 3HCQA 4PFTA 2DYXA 4WEPA 1B3EA 3QIMA 1US5A 1LGBC 2Q89A 1FQCA 3K6VA 2O51A 3K6WA 2YJPA 3FVGA 4JWOA 5CM6A 1P99A 3IJOB 5HPQA 2DSFA 1B3LA 4BLAA 1H3DA 2I49A 4O3AA 4OZ9A 3ONMA 1XS5A 2NOOA 2X7QA 1HSEA 1LAXA 3TCFA 1US4A 2UVIA 2GFEA 4NE4A 1TXFA 4POXA 3FVKA 5I56A 2REGA 4NWDA 2B3BA 1B52A 3CR9A 3HHGA 4YB5A 1T0KA 5I57B 5A5XB 1CE2A 4GOTA 3T66A 3N5LA 1RKMA 1P1QA 3EHTA 2PX1A 3V5AA 3O29A 4BDNA 4Z0IA 2E1SA 1LAFE 4MFIA 1M5BA 4F1YA 3VXBA 4LZ7A 5I58A 2QSXA 1OLAA 2V3UA 4POWA 3MPLA 2A5TB 1FQAA 3IB0A 4QFKA 3AXFA 3N94A 2H4IA 4M4GA 1KWHA 4GQOA 3TAJA 5KDTB 5H8NB 3C31A 1I6QA 4AB5A 3A09A 3Q25A 4WXJA 5IAIA 4G8HA 3VVDA 2DOJA 4F19A 4L17A 1TWYA 3KGCA 3O2AA 4IO2A 3CSBA 3K0VA 1NFTA 5TPAB 2DWAA 5DT6A 3MP1A 3S9MC 3TELA 3FD3A 2F6GA 1LFHA 1B5IA 1N3WA 2UYFA 4X1BA 4GL8A 2H25A 4YZZA 3PGFA 3IOVA 4ONYA 1MDQA 4RJZA 2RCBA 2F36A 1Y3QA 1SVXB 1YTVA 5I2KB 1PB7A 1S50A 4ZS9A 2HEUA 3LUYA 3G3IA 3MZBA 5AA1A 3A3CA 3FVNA 3R7XA 3TCGA 3CFZA 5H8FA 5H8QB 3O97A 3R6UA 4YKJA 3IL1B 1H45A 2OBGA 3IO4A 2HFBA 1B4ZA 1D9YA 1AOVA 1I6BA 1ELJA 1MXYA 1DTGA 2V25A 1MQGA 1A55A 4P11A 1B0LA 5KCJA 3PPQA 3H6WA 2VD2A 5ELVA 5CBSA 4IO7A 1SW5A 3IK6B 1MXWA 3GXAA 3H03A 1B1XA 3MVZA 3C32A 4R6YA 2PT1A 1MQDA 2XXQA 3RLFE 2YPNA 1MPCA 2F5XA 4NMYA 5DEXB 4F1UA 1VE4A 2M8CA 2XXPA 3LSFB 3QUFA 4NF4B 1SW2A 1JETA 4OFJA 2HZLA 3VXCA 3C33A 1MXZA 4FAJA 4HS7A 2G93A 2RINA 2VHAA 4ZECA 3T9UA 3IB1A 1P1WA 1JW4A 2XD2A 3QAXA 3CG3A 1SYIA 3PMVA 1PBQA 5EHSA 1GV8A 2OWTA 2ONSA 2ZNTA 3CRBA 3T9XB 3RN8A 5K2YA 1SW1A 4F18A 5CBRA 2H9BA 3LSWA 4DLDA 1NNPA 1EZ9A 3RY3A 3RTWB 4ELPA 4QFPA 3V89B 1B46A 1IXHA 1MQJA 4Q5TA 1MQHA 3N26A 1NH8A 1R1NA 4WEDA 3KN3A 3O66A 3M3FA 3C34A 2DWJA 2O6AA 3B6QA 3S9NC 1JVXA 4NTLA 2XXIA 3TTKA 5IKBA 3FUZA 4MBPA 4NF5B 2DWHA 3PUZE 4UACA 2X7PA 3K6XA 4O3BA 4G68B 2UVJA 2D21A 2R71A 3TTMA 4RPOA 3FXUA 4F3BA 2D3IA 4JB7A 1D3KA 3MWBA 5H8HA 1B7ZA 2PT2A 3K6UA 3LR1A 1I69A 3RPWA 2DXRA 4HCYA 2DVZA 4XKRA 2I0BA 1IXGA 1ZJLA 2HZKA 1PEBA 4GXAA 1JVYA 4PFYA 4MLVA 4DZ1A 4GFRA 2V3TA 4YB6A 4C0RA 4F2QA 3SEXA 1BLFA 4R2BA 4IY5A 4N6PA 1GGGA 2GRVA 3TUSA 4KHZE 5JTYB 1DMBA 1SW4A 1B7HA 3VE1B 2Q8JA 3HO7A 4YICA 4QFOA 1UIUA 3K1PA 1CB6A 4X1DA 2IA4A 1Y1MA 3C4MA 4MH5A 3E9XA 5ISUA 4ESXA 4BDMA 2F7BA 3K00A 4H5GA 1PBPA 2UXAA 1HSJA 4R6KA 1LCTA 1GR2A 4GF8A 4GVOA 1OQGA 4JSDA 4R75A 3Q28A 4BDLA 3OO8A 3VVEA 3OEKA 4U4XA 3TPAA 4KCCA 3ZS6A 3K02A 3OENA 3RT8A 1BIYA 5ITOA 3TYHA 2B65A 1MXUA 3K4UA 2OLBA 4ZE9A 1JEUA 1NKXA 2F35A 4U21A 1PC3A 1MPBA 4HCWA 4Q8RA 3IX1A 5KZTA 3M3KA 4DDDA 2ZYKA 1USYH 4E0XA 2XXUA 5J1DA 3VLWA 3KN7A 1JW1A 3FJ7A 3RUMA 4NF6A 2H99A 4H8JA 5AA4A 4F29A 1ATGA 4R73A 4TOZA 4G4PA 2Y7RA 3G3GA 3GBBA 3LSLA 3TTRA 4H5FA 3O6GA 3M8UA 4H65A 3UA8A 2XXTA 1FW0A 4YB7A 1FTJA 2NXOA 4GXSB 3C35A 4R6HA 1UTBA 4TLLB 4JWYA 4P0GA 4ZZEA 2Y7KA 3U94A 4THIA 3PPPA 1A99A 2QS1A 3N6TA 1NH7A 2VOZA 3CFXA 1P1NA 3OO9A 3KG2A 1LB8A 5DVFA 5I59A 1A7LA 2RCAA 2W7YA 3QXMA 3KJTA 3ZSFA 2V84A 3CVGA 4ZEKA 4ZZAA 1IEJA 4YKIA 3SERA 4EF1A 4EF2A 1LFGA 2DP8A 4LZ8A 1B51A 4JSOA 3T22A 1Z7ME 5K2XA 1SI1A 2ONRA 3QSLA 2R6GE 2THIA 1LBCA 3B6TA 5FHMA 2Y84A 4IB2A 1DTZA 3VV5A 2NUVA 2ABHA 2QRYA 3TODA 4QRZA 3DELB 4U22A 4U4SA 3PMWA 3RT6B 1Y4TA 3R26A 4M1VA 4XKPA 1WODA 2XXHA 3KN8A 1SQYA 2I4BA 4YMBA 4I62A 1P1UA 2HCAA 4OXVA 3MPKA 3O6HA 1M5EA 2I48A 3KZGA 1UTHA 2QMXA 1FCKA 4DXCA 1Y20A 4OVJA 4KPTA 1L5TA 5BWJA 1IXCA 4H0WA 1MQIA 1YAEA 4KYEA 3H6UA 2QS3A 3THIA 3D4CA 4F1VA 1QUKA 2F78A 1NL5A 4O3CA 2V3QA 2VGQA 1YPNA 1F9BA 1TT1A 1Y3NA 4OHNA 1N3XA 3BFTA 3OSQA 3IORA 4E0WA 3U92A 3I6VA 2XXYA 4ND9A 2F6PA 4WKMA 2D5WA 2F7CA 5I56B 2P0SA 3FV2A 1ZTYA 1WDNA 3B6WA 4OTEA 5CC2A 3MBPA 1B32A 1B2HA 3BFUA 2OCUA 3TZAA 4OEVA 1AIVA 1QULA 3I5OA 4XIGQ 3C9HA 3FV1A 3FASA 5I58B 5H8SA 2RF1A 3E3KA 5CMBA 3VLVA 1OVTA 1YCJA 4AQ4A 2I3VA 5DVIA 3SEWA 4HW8A 3FZVA 5TP9A 1Y9UA 2I4CA 4MF3A 1URGA 3MP8A 4U2RA 4FJPA 3KBRA 4YKKA 2PYYA 4PFUA 3OXNA 3FIRA 1N7WA 1B6HA 4JBZA 2I6EA 3OSRA 3OD7A 2ALUA 3F11A 1FQDA 1D9VA 5AA2A 5L9MA 1URSA 1LSTA 1VFEA 4H67A 5L9SA 4LZ5A 2F7AA 2GH9A 3FJGA 2CMOA 1LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTK A;  1H76 A;  3K2D A;  3MAM A;  3O28 A;  2HXW A;  1Q35 A;  4Q0C A;  2IEE A;  3OMB A;  4G8N A;  2AL5 A;  1B7U A;  2O69 A;  3LBS A;  1B5H A;  2DQV A;  1MPD A;  1QVS A;  5H8F B;  4LQ5 A;  2RC7 A;  1NNK A;  1DSN A;  3IR1 A;  2AYS A;  3ODB A;  4FEC A;  4ZEB A;  3OOA A;  3FJM A;  5EHM A;  1IZ1 A;  2P1S A;  2A5S A;  1B40 A;  3CG1 A;  1M5D A;  4ZEI A;  2Y7P A;  3MUQ A;  4KCD A;  2XXV A;  2ZMB A;  5KCJ B;  2H98 A;  5FHO A;  4U23 A;  3PU5 A;  1QUI A;  1UQW A;  3T9V A;  1LLS A;  3M3L A;  1OMP A;  2ESN A;  5I2N A;  4YKP A;  2B3F A;  1QUJ A;  2RKM A;  3MVY A;  3CSG A;  3K01 A;  2PMS A;  3RTF B;  4OFL A;  3SES A;  4RK9 A;  3SEU A;  4QFN A;  2QL3 A;  1MXV A;  1OIB A;  5L8D A;  2VP1 A;  3ZKL A;  3OO6 A;  4DCX A;  4JWX A;  3FVO A;  4R72 A;  2I58 A;  3KSJ A;  3B7D A;  1LBB A;  3A3U A;  3VDF A;  1H44 A;  5B70 A;  1MS7 A;  1XOC A;  4RY1 A;  3OEL A;  3DM0 A;  1SYH A;  4F39 A;  3IAZ A;  2R9J A;  2ZNS A;  4U1O A;  1FTK A;  4F3P A;  3N6U A;  1B0H A;  5B7D A;  2REJ A;  4EQ7 A;  1N0T A;  1ZU0 A;  3MJN A;  4GD5 A;  1BTJ A;  3IOT A;  3TDJ A;  1QJM A;  2FYI A;  1XC1 A;  1HSL A;  3KSX A;  4UA8 A;  1OQH A;  5JEI A;  4KI0 E;  2DXY A;  3T96 B;  2O1L A;  4H6D A;  4IO6 A;  2FNC A;  4G8M A;  2DE4 A;  4NF8 B;  2GHA A;  3VFJ A;  1N7X A;  3DP4 A;  3UP9 A;  1MY1 A;  3G7W A;  3Q27 A;  4QF9 A;  1R9L A;  3O6I A;  4OEU A;  5I57 A;  5A5X A;  3JV9 A;  2NWJ A;  1MG1 A;  4TQU Q;  3MQ9 A;  4BDQ A;  1B5J A;  3USD A;  5AE4 A;  3TQL A;  3MVX A;  3IB2 A;  4KR5 A;  4EQ9 A;  3SEV A;  1NNT A;  5ITP A;  5I84 A;  2XX9 A;  3S4U A;  3TFL A;  1A54 A;  3PUY E;  4LUB A;  2F97 A;  5TU0 A;  2A5T A;  3GZG A;  3K1M A;  1VR5 A;  1B9J A;  1JW5 A;  3T9H B;  3ILU B;  4MLQ A;  4R9F A;  5H8H B;  3G3F A;  2UVH A;  4LQ2 A;  4G77 A;  5KDT A;  3OO7 A;  5H8N A;  2O7U A;  1IXI A;  1OLC A;  2I3W A;  2ZYO A;  3PPO A;  3O9P A;  4GWO A;  3UOR A;  4RK2 A;  3FXQ A;  4R9G A;  1XVX A;  2PVU A;  3TQW A;  4C1T A;  1I6A A;  3FAT A;  1PB9 A;  4OMB A;  1EU8 A;  4PET A;  5TPA A;  2O7I A;  3UIF A;  1MY0 A;  2XX8 A;  1B3H A;  2OJT A;  4OWD A;  4LVQ A;  1OVB A;  1Q1K A;  1USY E;  2AIX A;  3HN0 A;  1Y4C A;  1N76 A;  4FIM A;  2O84 X;  1PB8 A;  3HPI A;  3CI8 A;  1MM7 A;  4ESW A;  5I2K A;  3EF7 A;  1SD3 A;  4EQB A;  4KYD A;  3UK4 A;  1MY2 A;  2BJJ X;  4ELQ A;  2FA7 A;  4OER A;  4IGT A;  5ICQ A;  3PV0 E;  4GL0 A;  2ZYN A;  5LOM A;  3TCH A;  2Z8D A;  4EUO A;  3MP6 A;  1SI0 A;  5H8Q A;  4XKN A;  3L6G A;  3G3J A;  1MH4 A;  1DPE A;  2QMW A;  3PD9 A;  4IO5 A;  1B3G A;  4JXI A;  3WAF A;  3BKI B;  2Q88 A;  4GRK A;  4PP0 A;  3U72 A;  2O68 A;  3S2V A;  5F7V A;  3MW0 A;  2ONK E;  1VFD A;  2RC8 A;  4QSC A;  1TFD A;  2QS4 A;  4Q30 B;  2DS9 A;  4Z7E A;  4FEB A;  1J1N A;  3PMX A;  3HHF A;  4QHQ A;  3RQT A;  5FTH A;  3KJ7 A;  1LCF A;  3QUJ A;  1TFA A;  3SDF A;  5DEX A;  4FE8 A;  4DXB A;  3JYR A;  4NF6 B;  4EDP A;  5AA2 D;  3G3H A;  4NF4 A;  5AA4 B;  3PUW E;  4QSD A;  4X9T A;  1BP5 A;  1QKB A;  2KLF A;  1PDA A;  2PBW A;  3W15 C;  3H06 B;  1O7T A;  4DE8 A;  3H6V A;  3VVF A;  3TKD A;  2ZYM A;  4ZDM A;  4XKQ A;  1Z7N E;  1ZIU A;  3TTN A;  4KFQ A;  1FTM A;  2Z22 A;  2Q2A A;  2ZNU A;  4OQO A;  5F1Q A;  4DIG A;  4X48 A;  3VLU A;  5DVJ A;  3SKP A;  4KD5 A;  1UTB B;  1RYO A;  4RA1 A;  4I9D A;  1RYX A;  1URD A;  4RXL A;  2XXR A;  5FTI A;  2YLN A;  2LAO A;  3LC8 A;  1B1H A;  1FTO A;  3FXR A;  3HV1 A;  3CIJ A;  1XHY A;  1Y3P A;  4KQP A;  1XT8 A;  2Y7I A;  5BUU A;  2CZL A;  3H7M A;  3PPR A;  2Z8F A;  4FOR A;  4YAH X;  2O1M A;  5I59 B;  3CFL A;  3H6T A;  4R2F A;  2GHB A;  1MRP A;  4ECF A;  1ZKB A;  3DLN A;  4YU0 A;  1QKA A;  4NF5 A;  1MY3 A;  3QYT A;  5HBC A;  2OWS A;  3MZ1 A;  4LAT A;  4H8I A;  1FTL A;  4G68 A;  4TLM B;  4G68 C;  1JEV A;  1ZBM A;  1ZLQ A;  1MXX A;  2F34 A;  4FAT A;  1EZO A;  4LA9 A;  3PD8 A;  4OES A;  3I3V A;  1LAG E;  3HST A;  2DVC A;  4ISU A;  5DTB A;  3V83 A;  1Y1Z A;  2VD3 A;  3C36 A;  1WVJ A;  3UN6 A;  3DP6 A;  2DE2 A;  1M5F A;  4OEN A;  1UTH B;  3EQ1 A;  1B4H A;  3BBR A;  2HQ0 A;  5AA3 A;  2UVG A;  4RPN A;  5CI5 A;  1M5C A;  4I8C A;  1POT A;  4NWC A;  2NVU B;  3JZJ A;  4OFO A;  1NNF A;  2H5Y A;  4GIZ A;  3IOU A;  5JTY A;  3E13 X;  3EPE A;  1B05 A;  1AL3 A;  2WKY A;  4RNS A;  1B3F A;  1IIT A;  4JDF A;  1B58 A;  3UGW A;  3RNN A;  3Q29 A;  2XXX A;  3PUV E;  2Y7W A;  1GVC A;  3RGY A;  1O63 A;  4IY6 A;  4I1D A;  2E0S A;  4RYA A;  2I0C A;  4NF8 A;  4OET A;  1P1O A;  2F8D A;  1II5 A;  1BKA A;  3IJX B;  3EHU A;  4DXU A;  2QPQ A;  2Z8E A;  1IQ7 A;  4P0I A;  4ZE8 A;  3H4Z A;  1IIW A;  1FQB A;  1S7Y A;  4KYS A;  1LAH E;  3Q26 A;  4ZEF A;  4QSE A;  3GLB A;  1EZP A;  3S9E A;  4N07 A;  4PQJ A;  5L9O A;  5EYF A;  2HAU A;  2Z23 A;  3EHS A;  4OYV A;  1MH3 A;  2Q9T A;  4IGR A;  5TP9 B;  3TEP A;  4GLI A;  2X26 A;  1XVY A;  4NED A;  1POY 1;  2OZZ A;  3KOS A;  2HAV A;  5M2V A;  3W9V A;  1A8F A;  4R74 A;  4ELO A;  3ECR A;  3WAE A;  3OEM A;  2AL4 A;  2UYE A;  3ZKK A;  4U1Z A;  3IO6 A;  1MM6 A;  3KEI A;  4AB6 A;  4F2O A;  1SBP A;  1A40 A;  4F31 B;  3LSX A;  1D4N A;  3QK6 A;  5CMK A;  4PFW A;  3KOT A;  1S9T A;  4BDO A;  2V93 A;  3MZ9 A;  3MC2 A;  3PPN A;  5DYH A;  4F3G A;  1DPP A;  5AA2 B;  4YMA A;  1ANF A;  2XX7 A;  1DOT A;  4LON B;  3GBA A;  3D4G A;  3S9L C;  3H3G A;  4G2Z A;  4EXK A;  1NMU A;  2QS2 A;  3PUX E;  1O64 A;  5FHN A;  4IO4 A;  4N13 A;  1FQF A;  1MDP 1;  1N84 A;  3SEY A;  3U8Q A;  3P7I A;  2XXW A;  4PE5 B;  5JK4 A;  1AMF A;  4IO3 A;  3E4R A;  3DP8 A;  5ICT A;  1UIV A;  1AH5 A;  2OK2 A;  4H1X A;  3ILT B;  3FGS A;  3L6H A;  4HTG A;  1IUD A;  1R9Q A;  3W9W A;  2XHD A;  2RC9 A;  1N04 A;  1R6Z A;  2P2A A;  5HM4 B;  2DWI A;  3U1O A;  3MVW A;  1JQF A;  3G3K A;  4XTC Q;  5CRY A;  2DE3 A;  2G29 A;  3SET A;  3V8X B;  5CMM A;  1JNF A;  4F22 A;  4ZED A;  4FED A;  2ZXT A;  2Q2C A;  5I2N B;  4LP2 B;  1EH3 A;  4F3S A;  3TMG A;  4K3F A;  5CMC A;  1VSO A;  3EN3 A;  1LFI A;  1SDX A;  4DCY A;  3TTL A;  3IOW A;  1H43 A;  2XD3 A;  4EXL A;  4XXU A;  3K1N A;  1A8E A;  3U93 A;  3T93 B;  2QJE A;  1FQE A;  4C1U A;  4ELR A;  1ZMG A;  4QFL A;  4BDR A;  1QW0 A;  1MY4 A;  2ANJ A;  3KFM A;  3HCQ A;  4PFT A;  2DYX A;  4WEP A;  1B3E A;  3QIM A;  1US5 A;  1LGB C;  2Q89 A;  1FQC A;  3K6V A;  2O51 A;  3K6W A;  2YJP A;  3FVG A;  4JWO A;  5CM6 A;  1P99 A;  3IJO B;  5HPQ A;  2DSF A;  1B3L A;  4BLA A;  1H3D A;  2I49 A;  4O3A A;  4OZ9 A;  3ONM A;  1XS5 A;  2NOO A;  2X7Q A;  1HSE A;  1LAX A;  3TCF A;  1US4 A;  2UVI A;  2GFE A;  4NE4 A;  1TXF A;  4POX A;  3FVK A;  5I56 A;  2REG A;  4NWD A;  2B3B A;  1B52 A;  3CR9 A;  3HHG A;  4YB5 A;  1T0K A;  5I57 B;  5A5X B;  1CE2 A;  4GOT A;  3T66 A;  3N5L A;  1RKM A;  1P1Q A;  3EHT A;  2PX1 A;  3V5A A;  3O29 A;  4BDN A;  4Z0I A;  2E1S A;  1LAF E;  4MFI A;  1M5B A;  4F1Y A;  3VXB A;  4LZ7 A;  5I58 A;  2QSX A;  1OLA A;  2V3U A;  4POW A;  3MPL A;  2A5T B;  1FQA A;  3IB0 A;  4QFK A;  3AXF A;  3N94 A;  2H4I A;  4M4G A;  1KWH A;  4GQO A;  3TAJ A;  5KDT B;  5H8N B;  3C31 A;  1I6Q A;  4AB5 A;  3A09 A;  3Q25 A;  4WXJ A;  5IAI A;  4G8H A;  3VVD A;  2DOJ A;  4F19 A;  4L17 A;  1TWY A;  3KGC A;  3O2A A;  4IO2 A;  3CSB A;  3K0V A;  1NFT A;  5TPA B;  2DWA A;  5DT6 A;  3MP1 A;  3S9M C;  3TEL A;  3FD3 A;  2F6G A;  1LFH A;  1B5I A;  1N3W A;  2UYF A;  4X1B A;  4GL8 A;  2H25 A;  4YZZ A;  3PGF A;  3IOV A;  4ONY A;  1MDQ A;  4RJZ A;  2RCB A;  2F36 A;  1Y3Q A;  1SVX B;  1YTV A;  5I2K B;  1PB7 A;  1S50 A;  4ZS9 A;  2HEU A;  3LUY A;  3G3I A;  3MZB A;  5AA1 A;  3A3C A;  3FVN A;  3R7X A;  3TCG A;  3CFZ A;  5H8F A;  5H8Q B;  3O97 A;  3R6U A;  4YKJ A;  3IL1 B;  1H45 A;  2OBG A;  3IO4 A;  2HFB A;  1B4Z A;  1D9Y A;  1AOV A;  1I6B A;  1ELJ A;  1MXY A;  1DTG A;  2V25 A;  1MQG A;  1A55 A;  4P11 A;  1B0L A;  5KCJ A;  3PPQ A;  3H6W A;  2VD2 A;  5ELV A;  5CBS A;  4IO7 A;  1SW5 A;  3IK6 B;  1MXW A;  3GXA A;  3H03 A;  1B1X A;  3MVZ A;  3C32 A;  4R6Y A;  2PT1 A;  1MQD A;  2XXQ A;  3RLF E;  2YPN A;  1MPC A;  2F5X A;  4NMY A;  5DEX B;  4F1U A;  1VE4 A;  2M8C A;  2XXP A;  3LSF B;  3QUF A;  4NF4 B;  1SW2 A;  1JET A;  4OFJ A;  2HZL A;  3VXC A;  3C33 A;  1MXZ A;  4FAJ A;  4HS7 A;  2G93 A;  2RIN A;  2VHA A;  4ZEC A;  3T9U A;  3IB1 A;  1P1W A;  1JW4 A;  2XD2 A;  3QAX A;  3CG3 A;  1SYI A;  3PMV A;  1PBQ A;  5EHS A;  1GV8 A;  2OWT A;  2ONS A;  2ZNT A;  3CRB A;  3T9X B;  3RN8 A;  5K2Y A;  1SW1 A;  4F18 A;  5CBR A;  2H9B A;  3LSW A;  4DLD A;  1NNP A;  1EZ9 A;  3RY3 A;  3RTW B;  4ELP A;  4QFP A;  3V89 B;  1B46 A;  1IXH A;  1MQJ A;  4Q5T A;  1MQH A;  3N26 A;  1NH8 A;  1R1N A;  4WED A;  3KN3 A;  3O66 A;  3M3F A;  3C34 A;  2DWJ A;  2O6A A;  3B6Q A;  3S9N C;  1JVX A;  4NTL A;  2XXI A;  3TTK A;  5IKB A;  3FUZ A;  4MBP A;  4NF5 B;  2DWH A;  3PUZ E;  4UAC A;  2X7P A;  3K6X A;  4O3B A;  4G68 B;  2UVJ A;  2D21 A;  2R71 A;  3TTM A;  4RPO A;  3FXU A;  4F3B A;  2D3I A;  4JB7 A;  1D3K A;  3MWB A;  5H8H A;  1B7Z A;  2PT2 A;  3K6U A;  3LR1 A;  1I69 A;  3RPW A;  2DXR A;  4HCY A;  2DVZ A;  4XKR A;  2I0B A;  1IXG A;  1ZJL A;  2HZK A;  1PEB A;  4GXA A;  1JVY A;  4PFY A;  4MLV A;  4DZ1 A;  4GFR A;  2V3T A;  4YB6 A;  4C0R A;  4F2Q A;  3SEX A;  1BLF A;  4R2B A;  4IY5 A;  4N6P A;  1GGG A;  2GRV A;  3TUS A;  4KHZ E;  5JTY B;  1DMB A;  1SW4 A;  1B7H A;  3VE1 B;  2Q8J A;  3HO7 A;  4YIC A;  4QFO A;  1UIU A;  3K1P A;  1CB6 A;  4X1D A;  2IA4 A;  1Y1M A;  3C4M A;  4MH5 A;  3E9X A;  5ISU A;  4ESX A;  4BDM A;  2F7B A;  3K00 A;  4H5G A;  1PBP A;  2UXA A;  1HSJ A;  4R6K A;  1LCT A;  1GR2 A;  4GF8 A;  4GVO A;  1OQG A;  4JSD A;  4R75 A;  3Q28 A;  4BDL A;  3OO8 A;  3VVE A;  3OEK A;  4U4X A;  3TPA A;  4KCC A;  3ZS6 A;  3K02 A;  3OEN A;  3RT8 A;  1BIY A;  5ITO A;  3TYH A;  2B65 A;  1MXU A;  3K4U A;  2OLB A;  4ZE9 A;  1JEU A;  1NKX A;  2F35 A;  4U21 A;  1PC3 A;  1MPB A;  4HCW A;  4Q8R A;  3IX1 A;  5KZT A;  3M3K A;  4DDD A;  2ZYK A;  1USY H;  4E0X A;  2XXU A;  5J1D A;  3VLW A;  3KN7 A;  1JW1 A;  3FJ7 A;  3RUM A;  4NF6 A;  2H99 A;  4H8J A;  5AA4 A;  4F29 A;  1ATG A;  4R73 A;  4TOZ A;  4G4P A;  2Y7R A;  3G3G A;  3GBB A;  3LSL A;  3TTR A;  4H5F A;  3O6G A;  3M8U A;  4H65 A;  3UA8 A;  2XXT A;  1FW0 A;  4YB7 A;  1FTJ A;  2NXO A;  4GXS B;  3C35 A;  4R6H A;  1UTB A;  4TLL B;  4JWY A;  4P0G A;  4ZZE A;  2Y7K A;  3U94 A;  4THI A;  3PPP A;  1A99 A;  2QS1 A;  3N6T A;  1NH7 A;  2VOZ A;  3CFX A;  1P1N A;  3OO9 A;  3KG2 A;  1LB8 A;  5DVF A;  5I59 A;  1A7L A;  2RCA A;  2W7Y A;  3QXM A;  3KJT A;  3ZSF A;  2V84 A;  3CVG A;  4ZEK A;  4ZZA A;  1IEJ A;  4YKI A;  3SER A;  4EF1 A;  4EF2 A;  1LFG A;  2DP8 A;  4LZ8 A;  1B51 A;  4JSO A;  3T22 A;  1Z7M E;  5K2X A;  1SI1 A;  2ONR A;  3QSL A;  2R6G E;  2THI A;  1LBC A;  3B6T A;  5FHM A;  2Y84 A;  4IB2 A;  1DTZ A;  3VV5 A;  2NUV A;  2ABH A;  2QRY A;  3TOD A;  4QRZ A;  3DEL B;  4U22 A;  4U4S A;  3PMW A;  3RT6 B;  1Y4T A;  3R26 A;  4M1V A;  4XKP A;  1WOD A;  2XXH A;  3KN8 A;  1SQY A;  2I4B A;  4YMB A;  4I62 A;  1P1U A;  2HCA A;  4OXV A;  3MPK A;  3O6H A;  1M5E A;  2I48 A;  3KZG A;  1UTH A;  2QMX A;  1FCK A;  4DXC A;  1Y20 A;  4OVJ A;  4KPT A;  1L5T A;  5BWJ A;  1IXC A;  4H0W A;  1MQI A;  1YAE A;  4KYE A;  3H6U A;  2QS3 A;  3THI A;  3D4C A;  4F1V A;  1QUK A;  2F78 A;  1NL5 A;  4O3C A;  2V3Q A;  2VGQ A;  1YPN A;  1F9B A;  1TT1 A;  1Y3N A;  4OHN A;  1N3X A;  3BFT A;  3OSQ A;  3IOR A;  4E0W A;  3U92 A;  3I6V A;  2XXY A;  4ND9 A;  2F6P A;  4WKM A;  2D5W A;  2F7C A;  5I56 B;  2P0S A;  3FV2 A;  1ZTY A;  1WDN A;  3B6W A;  4OTE A;  5CC2 A;  3MBP A;  1B32 A;  1B2H A;  3BFU A;  2OCU A;  3TZA A;  4OEV A;  1AIV A;  1QUL A;  3I5O A;  4XIG Q;  3C9H A;  3FV1 A;  3FAS A;  5I58 B;  5H8S A;  2RF1 A;  3E3K A;  5CMB A;  3VLV A;  1OVT A;  1YCJ A;  4AQ4 A;  2I3V A;  5DVI A;  3SEW A;  4HW8 A;  3FZV A;  5TP9 A;  1Y9U A;  2I4C A;  4MF3 A;  1URG A;  3MP8 A;  4U2R A;  4FJP A;  3KBR A;  4YKK A;  2PYY A;  4PFU A;  3OXN A;  3FIR A;  1N7W A;  1B6H A;  4JBZ A;  2I6E A;  3OSR A;  3OD7 A;  2ALU A;  3F11 A;  1FQD A;  1D9V A;  5AA2 A;  5L9M A;  1URS A;  1LST A;  1VFE A;  4H67 A;  5L9S A;  4LZ5 A;  2F7A A;  2GH9 A;  3FJG A;  2CMO A;  1LB9 A; 
#chains in the Genus database with same CATH topology
 1Q9D A;  1GTK A;  1H76 A;  3K2D A;  3MAM A;  3O28 A;  2HXW A;  1Q35 A;  4Q0C A;  4PFR A;  2IEE A;  3OMB A;  4G8N A;  2AL5 A;  1B7U A;  2O69 A;  3LBS A;  1B5H A;  2DQV A;  1MPD A;  1QVS A;  5H8F B;  4LQ5 A;  2RC7 A;  1NNK A;  3KC0 A;  3KBZ A;  1DSN A;  3IR1 A;  4NQ8 A;  2AYS A;  4MJO A;  3ODB A;  4FEC A;  4ZEB A;  3OOA A;  3FJM A;  5EHM A;  1IZ1 A;  2P1S A;  5ET6 A;  2A5S A;  1B40 A;  1NV0 A;  2KR0 A;  3CG1 A;  1M5D A;  4ZEI A;  2Y7P A;  3MUQ A;  4KCD A;  2XXV A;  2ZMB A;  5KCJ B;  2H98 A;  5FHO A;  4U23 A;  3PU5 A;  1QUI A;  1UQW A;  2FIE A;  3T9V A;  1LLS A;  3M3L A;  1OMP A;  4N4U A;  2ESN A;  5I2N A;  2XXK A;  4YKP A;  2B3F A;  1QUJ A;  2RKM A;  3MVY A;  3CSG A;  3K01 A;  2PMS A;  3RTF B;  4OFL A;  3SES A;  4RK9 A;  3SEU A;  4QFN A;  2QL3 A;  1MXV A;  1OIB A;  5L8D A;  2VP1 A;  4GX6 A;  3ZKL A;  3OO6 A;  4DCX A;  4JWX A;  3FVO A;  4R72 A;  2I58 A;  3KSJ A;  3B7D A;  1LBB A;  3A3U A;  3VDF A;  1H44 A;  5B70 A;  1MS7 A;  1XOC A;  4RY1 A;  3OEL A;  3DM0 A;  1SYH A;  4F39 A;  2JJK A;  3IAZ A;  2R9J A;  2ZNS A;  4U1O A;  1FTK A;  4F3P A;  4OVQ A;  3N6U A;  1B0H A;  4MNP A;  4PDH A;  5B7D A;  1YXI A;  4GWU A;  2REJ A;  4EQ7 A;  1N0T A;  1ZU0 A;  3MJN A;  4GD5 A;  1BTJ A;  3IOT A;  3TDJ A;  1QJM A;  5LDZ A;  5IZ1 A;  2FYI A;  1XC1 A;  1HSL A;  3KSX A;  4G61 A;  4UA8 A;  1OQH A;  5JEI A;  4KI0 E;  2DXY A;  3T96 B;  1FPI A;  2O1L A;  4H6D A;  4IO6 A;  1SPI A;  2FNC A;  4PGN A;  4G8M A;  4PAF A;  2DE4 A;  4NF8 B;  2GHA A;  2Q74 A;  4HE2 A;  3VFJ A;  1N7X A;  3DP4 A;  3UP9 A;  1MY1 A;  3G7W A;  3Q27 A;  3U65 A;  4QF9 A;  1R9L A;  3O6I A;  4OEU A;  5I57 A;  5A5X A;  3JV9 A;  2NWJ A;  1MG1 A;  4TQU Q;  3E78 A;  3MQ9 A;  4BDQ A;  1INP A;  1FJ9 A;  1B5J A;  2CZI A;  3USD A;  5AE4 A;  3TQL A;  3MVX A;  3IB2 A;  4KR5 A;  4EQ9 A;  3SEV A;  1NNT A;  5ITP A;  5I84 A;  2XX9 A;  3S4U A;  3TFL A;  4NN3 A;  1A54 A;  3PUY E;  4LUB A;  2F97 A;  5TU0 A;  2A5T A;  3GZG A;  3K1M A;  4O7I A;  1VR5 A;  1B9J A;  1JW5 A;  3T9H B;  4GX4 A;  3ILU B;  2WEF A;  4MLQ A;  4R9F A;  5H8H B;  3G3F A;  4OVP A;  2UVH A;  4LQ2 A;  4G77 A;  5KDT A;  3OO7 A;  1FBP A;  5H8N A;  2O7U A;  1IXI A;  1OLC A;  2I3W A;  2ZYO A;  3PPO A;  3O9P A;  4GWO A;  3UOR A;  4RK2 A;  3FXQ A;  4R9G A;  1XVX A;  2PVU A;  4PBQ A;  3TQW A;  3T0J A;  4C1T A;  5FBP A;  4NF0 A;  1I6A A;  1FBF A;  3FAT A;  1PB9 A;  4OMB A;  1EU8 A;  4PET A;  5TPA A;  1G0H A;  2O7I A;  3UIF A;  4PE3 A;  4GBV A;  1MY0 A;  2ZZV A;  4NHB A;  2XX8 A;  1B3H A;  2OJT A;  4OWD A;  4LVQ A;  1OVB A;  1Q1K A;  1USY E;  2AIX A;  2PCR A;  3HN0 A;  1Y4C A;  1N76 A;  1FBC A;  4FIM A;  2O84 X;  1FBD A;  3E79 A;  1PB8 A;  3HPI A;  4HE1 A;  2PFZ A;  3CI8 A;  1MM7 A;  4ESW A;  5I2K A;  3EF7 A;  1SD3 A;  4EQB A;  4KYD A;  3UK4 A;  1MY2 A;  2BJJ X;  1IME A;  4ELQ A;  2FA7 A;  4OER A;  4IGT A;  5ICQ A;  4MMP A;  3PV0 E;  4GL0 A;  2ZYN A;  5LOM A;  3TCH A;  2Z8D A;  4EUO A;  4PAK A;  3MP6 A;  3RYD A;  1SI0 A;  5H8Q A;  4XKN A;  2CZH A;  3D1R A;  4OVR A;  4P8B A;  3L6G A;  3G3J A;  1MH4 A;  1DPE A;  2QMW A;  3PD9 A;  2Y5L A;  4JVD A;  4IO5 A;  1B3G A;  4JXI A;  3WAF A;  5DW8 A;  3BKI B;  2Q88 A;  4GRK A;  4PP0 A;  3U72 A;  2O68 A;  3S2V A;  5F7V A;  3MW0 A;  2ONK E;  1VFD A;  2RC8 A;  4GX3 A;  4QSC A;  1TFD A;  2QS4 A;  4Q30 B;  2DS9 A;  1NUY A;  4Z7E A;  4H45 A;  4FEB A;  1FBE A;  3MST A;  1J1N A;  3PMX A;  3HHF A;  4QHQ A;  3RQT A;  1FBH A;  5FTH A;  3KJ7 A;  1LCF A;  3QUJ A;  1TFA A;  3SDF A;  5DEX A;  4FE8 A;  4DXB A;  3JYR A;  4NF6 B;  4EDP A;  5AA2 D;  3G3H A;  4NF4 A;  5AA4 B;  3PUW E;  4QSD A;  4X9T A;  1BP5 A;  4PBH A;  1QKB A;  2KLF A;  1PDA A;  2PBW A;  3LV0 A;  4H46 A;  3W15 C;  3H06 B;  1O7T A;  4NG7 A;  4DE8 A;  3H6V A;  4NAP A;  3VVF A;  3TKD A;  2ZYM A;  4ZDM A;  4XKQ A;  1Z7N E;  3IFC A;  1ZIU A;  3TTN A;  4KFQ A;  1NUZ A;  1FTM A;  2Z22 A;  2Q2A A;  2ZNU A;  4OQO A;  5F1Q A;  4MNC A;  4DIG A;  4X48 A;  5DVJ A;  3VLU A;  3SKP A;  4KD5 A;  1UTB B;  1RYO A;  4RA1 A;  4I9D A;  1RYX A;  1URD A;  4RXL A;  4MHF A;  2XXR A;  5FTI A;  4P1E A;  2YLN A;  2LAO A;  1LBW A;  3LC8 A;  1B1H A;  1FTO A;  3FXR A;  3HV1 A;  3CIJ A;  1XHY A;  1Y3P A;  4KQP A;  1XT8 A;  2Y7I A;  5BUU A;  2CZL A;  3H7M A;  3PPR A;  2B4L A;  2Z8F A;  3B50 A;  4P3L A;  5IZZ A;  4FOR A;  4YAH X;  4O94 A;  2O1M A;  5I59 B;  3CFL A;  1DK4 A;  3H6T A;  3CHG A;  2BJI A;  1NV3 A;  4OA4 A;  4R2F A;  2GHB A;  1MRP A;  4ECF A;  1ZKB A;  1NV4 A;  3DLN A;  1K9Y A;  4YU0 A;  1LBY A;  1QKA A;  4NF5 A;  1MY3 A;  3QYT A;  5HBC A;  2OWS A;  3MZ1 A;  4LAT A;  4OVT A;  2QVR A;  4H8I A;  1FTL A;  4G68 A;  4PF6 A;  4TLM B;  4G68 C;  1JEV A;  1ZBM A;  1ZLQ A;  1MXX A;  2F34 A;  4FAT A;  1EZO A;  4LA9 A;  3PD8 A;  4OES A;  2VT5 A;  3I3V A;  1LAG E;  3HST A;  2DVC A;  4ISU A;  2XWI A;  5DTB A;  3V83 A;  1Y1Z A;  2VD3 A;  3C36 A;  1WVJ A;  4NX1 A;  4AS4 A;  3UN6 A;  3DP6 A;  2DE2 A;  1M5F A;  4OEN A;  1UTH B;  3EQ1 A;  1B4H A;  3BBR A;  2HQ0 A;  5AA3 A;  2UVG A;  4RPN A;  1FPF A;  5CI5 A;  1M5C A;  4I8C A;  1POT A;  2F3D A;  4NWC A;  5IGA A;  2NVU B;  4QBA A;  3JZJ A;  4OFO A;  4PFI A;  3BIH A;  1NNF A;  2H5Y A;  4GIZ A;  3IOU A;  5JTY A;  3E13 X;  4AS5 A;  3EPE A;  4MIJ A;  1B05 A;  1AL3 A;  2WKY A;  3PTY A;  4RNS A;  1B3F A;  4GWS A;  1IIT A;  4JDF A;  1B58 A;  3UGW A;  3RNN A;  3Q29 A;  2XXX A;  3PUV E;  2Y7W A;  1GVC A;  3RGY A;  1O63 A;  5EQ9 A;  4IY6 A;  4I1D A;  2E0S A;  4RYA A;  2I0C A;  5J16 A;  4NF8 A;  4OET A;  1P1O A;  2F8D A;  1II5 A;  1BKA A;  3IJX B;  3EHU A;  4DXU A;  2QPQ A;  2Z8E A;  1IQ7 A;  4P0I A;  4ZE8 A;  3H4Z A;  1IIW A;  1FQB A;  2OX3 A;  1NV7 A;  1S7Y A;  4KYS A;  1LAH E;  3Q26 A;  4ZEF A;  4QSE A;  1AWB A;  3GLB A;  4GBW A;  1EZP A;  3S9E A;  4N07 A;  4PQJ A;  5L9O A;  5EYF A;  2HAU A;  5IM2 A;  2Z23 A;  4N6K A;  3EHS A;  1IMA A;  4OYV A;  1MH3 A;  2Q9T A;  4IGR A;  5TP9 B;  3TEP A;  4GLI A;  2X26 A;  1XVY A;  4NED A;  1POY 1;  2OZZ A;  3KOS A;  2HAV A;  5M2V A;  2DDK A;  3W9V A;  1A8F A;  4R74 A;  4ELO A;  3ECR A;  3WAE A;  3OEM A;  2AL4 A;  2UYE A;  3ZKK A;  4U1Z A;  4O8M A;  3IO6 A;  1MM6 A;  3KEI A;  4AB6 A;  4F2O A;  4P56 A;  1SBP A;  1A40 A;  4F31 B;  5IZ3 B;  4UAB A;  3LSX A;  1D4N A;  3QK6 A;  5CMK A;  4PFW A;  3KOT A;  1S9T A;  4P47 A;  4BDO A;  2V93 A;  3MZ9 A;  3MC2 A;  3PPN A;  5DYH A;  4F3G A;  1DPP A;  5AA2 B;  4YMA A;  2QFL A;  1ANF A;  2XWK A;  1DOT A;  2XX7 A;  4LON B;  3GBA A;  1EYJ A;  3D4G A;  3S9L C;  3H3G A;  4G2Z A;  4EXK A;  1NMU A;  2QS2 A;  3PUX E;  1O64 A;  5FHN A;  4IO4 A;  4MAG A;  4N13 A;  1FQF A;  1MDP 1;  2WYK A;  1N84 A;  3SEY A;  3U8Q A;  3P7I A;  2XXW A;  4PE5 B;  2PFY A;  5JK4 A;  1AMF A;  4IO3 A;  3E4R A;  3DP8 A;  5ICT A;  1UIV A;  1AH5 A;  2OK2 A;  4H1X A;  3ILT B;  1YZ0 A;  3FGS A;  3L6H A;  4HTG A;  1IUD A;  1R9Q A;  4PCD A;  3W9W A;  2ZZW A;  2WX9 A;  2XHD A;  2RC9 A;  2HXR A;  1N04 A;  1R6Z A;  2P2A A;  1D9Q A;  5HM4 B;  2DWI A;  3U1O A;  3MVW A;  1JQF A;  3G3K A;  4XTC Q;  5CRY A;  2DE3 A;  2G29 A;  3SET A;  3V8X B;  5CMM A;  1JNF A;  4F22 A;  4ZED A;  4FED A;  1QGX A;  2ZXT A;  4XFE A;  2Q2C A;  4I3Y A;  1BK4 A;  5I2N B;  4LP2 B;  1EH3 A;  3NOH A;  4F3S A;  3TMG A;  4K3F A;  5CMC A;  1VSO A;  3EN3 A;  1LFI A;  1SDX A;  3HFU A;  4DCY A;  3TTL A;  3IOW A;  1H43 A;  2XD3 A;  4EXL A;  3K1N A;  4XXU A;  4X8R A;  1A8E A;  3U93 A;  3T93 B;  2QJE A;  1FQE A;  4C1U A;  4ELR A;  1ZMG A;  4QFL A;  4BDR A;  4FBP A;  1QW0 A;  2L5V A;  1MY4 A;  1RDY A;  2ANJ A;  3KFM A;  3HCQ A;  1EYK A;  4PFT A;  4DI3 D;  2DYX A;  4WEP A;  1B3E A;  3QIM A;  1FPK A;  1US5 A;  1LGB C;  2Q89 A;  1FQC A;  3K6V A;  3FXB A;  2O51 A;  4N17 A;  3K6W A;  2YJP A;  3FVG A;  4N8G A;  4JWO A;  1FPE A;  1NV2 A;  5CM6 A;  4NGU A;  1P99 A;  3IJO B;  5HPQ A;  2DSF A;  1B3L A;  5I3S A;  4BLA A;  1H3D A;  2I49 A;  4O3A A;  4OZ9 A;  2XWO A;  3ONM A;  1XS5 A;  2NOO A;  2X7Q A;  1HSE A;  1LAX A;  3TCF A;  1US4 A;  2UVI A;  2GFE A;  4NE4 A;  1TXF A;  2FHY A;  2V4C A;  4POX A;  3FVK A;  5I56 A;  2REG A;  4MX6 A;  4NWD A;  2HHM A;  2B3B A;  1B52 A;  3CR9 A;  3HHG A;  4YB5 A;  1T0K A;  5I57 B;  5A5X B;  1CE2 A;  4GOT A;  3T66 A;  3N5L A;  1RKM A;  1P1Q A;  3EHT A;  2PX1 A;  3V5A A;  3O29 A;  4BDN A;  5EYG A;  3RPL A;  4Z0I A;  2E1S A;  1LAF E;  4MFI A;  1M5B A;  4F1Y A;  3VXB A;  4LZ7 A;  2F3B A;  5I58 A;  2QSX A;  1OLA A;  2V3U A;  4POW A;  3MPL A;  2WBD A;  2A5T B;  1FQA A;  3IB0 A;  1LBX A;  4QFK A;  3AXF A;  3N94 A;  2H4I A;  4M4G A;  1KWH A;  4GQO A;  3TAJ A;  3B8B A;  5KDT B;  5H8N B;  3C31 A;  1I6Q A;  4AB5 A;  3A09 A;  3Q25 A;  4WXJ A;  4HE0 A;  5IAI A;  4G8H A;  3VVD A;  2DOJ A;  4I40 A;  4F19 A;  5I7I A;  4L17 A;  1TWY A;  3KGC A;  3O2A A;  4IO2 A;  2Q8M A;  3CSB A;  3K0V A;  4N91 A;  1NFT A;  5TPA B;  2DWA A;  5DT6 A;  3MP1 A;  3S9M C;  3TEL A;  3FD3 A;  2F6G A;  1LFH A;  1B5I A;  1N3W A;  2UYF A;  4X1B A;  4GL8 A;  2H25 A;  4YZZ A;  3PGF A;  3IOV A;  4ONY A;  1MDQ A;  4RJZ A;  2RCB A;  2VPN A;  2F36 A;  1Y3Q A;  1SVX B;  1YTV A;  5I2K B;  1PB7 A;  1S50 A;  4ZS9 A;  2HEU A;  3LUY A;  3G3I A;  3MZB A;  5AA1 A;  3ISP A;  3A3C A;  3FVN A;  3R7X A;  3TCG A;  3CFZ A;  5H8F A;  5H8Q B;  3O97 A;  3R6U A;  4YKJ A;  3IL1 B;  1H45 A;  2OBG A;  3IO4 A;  2HFB A;  4P9K A;  1B4Z A;  1D9Y A;  1AOV A;  1I6B A;  1ELJ A;  1MXY A;  1DTG A;  2V25 A;  1MQG A;  1A55 A;  1FJ6 A;  3IFA A;  4P11 A;  1B0L A;  5KCJ A;  3EKI A;  3PPQ A;  3MYU A;  3H6W A;  4PDD A;  2VD2 A;  5ELV A;  5CBS A;  4IO7 A;  1SW5 A;  3IK6 B;  1MXW A;  3GXA A;  3H03 A;  1B1X A;  3MVZ A;  3C32 A;  4R6Y A;  2PT1 A;  1MQD A;  2XXQ A;  3RLF E;  2YPN A;  4PGP A;  1MPC A;  2F5X A;  4NMY A;  5DEX B;  5ET8 A;  4F1U A;  1VE4 A;  1FPJ A;  2M8C A;  2XXP A;  3LSF B;  3QUF A;  4NF4 B;  4GWY A;  1SW2 A;  1JET A;  4OFJ A;  2HZL A;  3VXC A;  3C33 A;  5T3J A;  1MXZ A;  1JP4 A;  4FAJ A;  4GWZ A;  4HS7 A;  2G93 A;  2RIN A;  2VHA A;  4ZEC A;  3T9U A;  3IB1 A;  1P1W A;  1JW4 A;  5EQ8 A;  2XD2 A;  3QAX A;  2ZZX A;  3SZP A;  2Y5K A;  3CG3 A;  1SYI A;  3PMV A;  1PBQ A;  5EHS A;  1GV8 A;  2OWT A;  5I5P A;  2ONS A;  2ZNT A;  3CRB A;  3T9X B;  3RN8 A;  5K2Y A;  1SW1 A;  1LBZ A;  4F18 A;  1G0I A;  5CBR A;  2H9B A;  3LSW A;  3T1B A;  4DLD A;  1NNP A;  1EZ9 A;  2KQZ A;  3RY3 A;  2FVZ A;  3RTW B;  4GWW A;  4ELP A;  4QFP A;  3V89 B;  1B46 A;  1IXH A;  1MQJ A;  4Q5T A;  1MQH A;  3N26 A;  1NH8 A;  1R1N A;  4PC9 A;  4WED A;  3KN3 A;  3O66 A;  3M3F A;  4JVI A;  1CNQ A;  3C34 A;  2DWJ A;  2O6A A;  1IMD A;  3B6Q A;  3S9N C;  1JVX A;  4NTL A;  4XF5 A;  2XXI A;  3TTK A;  5IKB A;  3FUZ A;  4MBP A;  4NF5 B;  3BIG A;  1NUW A;  2DWH A;  3PUZ E;  4UAC A;  2X7P A;  3K6X A;  4O3B A;  4G68 B;  2UVJ A;  2D21 A;  4HXV A;  2R71 A;  1LBV A;  4KXP A;  3TTM A;  4RPO A;  4I3E A;  3FXU A;  1NV6 A;  4F3B A;  2D3I A;  4JB7 A;  4N81 A;  1D3K A;  3MWB A;  2P3N A;  1LEV A;  1B7Z A;  5H8H A;  2CZK A;  2PT2 A;  3K6U A;  3LR1 A;  1K9Z A;  1I69 A;  3RPW A;  2DXR A;  4HCY A;  2DVZ A;  3KC1 A;  4XKR A;  2I0B A;  4MEV A;  1IXG A;  1ZJL A;  2HZK A;  1PEB A;  4GXA A;  1JVY A;  4PFY A;  4MLV A;  4DZ1 A;  4GFR A;  2V3T A;  4YB6 A;  4C0R A;  4F2Q A;  3SEX A;  1BLF A;  4R2B A;  4IY5 A;  4N6P A;  5EQA A;  1GGG A;  2GRV A;  4N8Y A;  3TUS A;  4KHZ E;  5JTY B;  2P3V A;  1DMB A;  1SW4 A;  1B7H A;  3VE1 B;  2Q8J A;  3HO7 A;  4YIC A;  4QFO A;  1IMB A;  1UIU A;  3K1P A;  1CB6 A;  4X1D A;  2IA4 A;  1Y1M A;  3C4M A;  4PTK A;  4GWX A;  4MH5 A;  1NI9 A;  3E9X A;  5ISU A;  4ESX A;  4BDM A;  1FPG A;  2F7B A;  3K00 A;  4H5G A;  1PBP A;  2UXA A;  5F24 A;  1HSJ A;  4R6K A;  1LCT A;  4QXD A;  1GR2 A;  4GF8 A;  4GVO A;  1OQG A;  3GYY A;  4JSD A;  4R75 A;  4X04 A;  3Q28 A;  4BDL A;  3OO8 A;  3VVE A;  3OEK A;  2HPG A;  4U4X A;  3TPA A;  4MNI A;  1RDX A;  4KCC A;  3ZS6 A;  3K02 A;  1XI6 A;  3OEN A;  3RT8 A;  1BIY A;  5ITO A;  3LUZ A;  2FIX A;  3TYH A;  2B65 A;  1MXU A;  3K4U A;  2OLB A;  4ZE9 A;  1JEU A;  1NKX A;  2F35 A;  4U21 A;  4P1L A;  1PC3 A;  2GQ1 A;  1MPB A;  4HCW A;  4Q8R A;  1NUX A;  3IX1 A;  5KZT A;  3M3K A;  4DDD A;  2ZYK A;  1USY H;  4E0X A;  2XXU A;  5J1D A;  4OAN A;  3VLW A;  3KN7 A;  1JW1 A;  1YYZ A;  3FJ7 A;  4PF8 A;  2WBB A;  4NF6 A;  3RUM A;  2H99 A;  4H8J A;  2CEX A;  1FSA A;  5AA4 A;  4MCO A;  4F29 A;  1ATG A;  4R73 A;  4TOZ A;  4G4P A;  2Y7R A;  3G3G A;  3GBB A;  3LSL A;  5LTC A;  3TTR A;  4H5F A;  3O6G A;  3M8U A;  4H65 A;  3UA8 A;  2XXT A;  1FW0 A;  1VDW A;  4YB7 A;  4N15 A;  1FTJ A;  2NXO A;  4GXS B;  3C35 A;  2CEY A;  4R6H A;  1UTB A;  4TLL B;  3ROJ A;  4JWY A;  4P0G A;  2WYP A;  4ZZE A;  2Y7K A;  3U94 A;  4THI A;  3PPP A;  1A99 A;  2QS1 A;  3N6T A;  1NH7 A;  2QVV A;  2VOZ A;  3CFX A;  1P1N A;  3OO9 A;  3KG2 A;  1LB8 A;  5DVF A;  5I59 A;  1A7L A;  2RCA A;  5EQ7 A;  1KZ8 A;  4OVS A;  2W7Y A;  3QXM A;  3KJT A;  3ZSF A;  2V84 A;  3CVG A;  4XEQ A;  4ZEK A;  4ZZA A;  1IEJ A;  4YKI A;  3SER A;  4EF1 A;  4EF2 A;  1LFG A;  2DP8 A;  4LZ8 A;  1B51 A;  4JSO A;  3T22 A;  1Z7M E;  5K2X A;  1SI1 A;  2ONR A;  4JVC A;  5ET7 A;  2B4M A;  3QSL A;  2R6G E;  2THI A;  1LBC A;  3B6T A;  5FHM A;  2Y84 A;  1NV5 A;  2XWV A;  4IB2 A;  1DTZ A;  3VV5 A;  2NUV A;  2ABH A;  2QRY A;  3TOD A;  4O7M A;  4QRZ A;  3DEL B;  4U22 A;  4U4S A;  3PMW A;  1FPD A;  3RT6 B;  1Y4T A;  3R26 A;  4M1V A;  4XKP A;  1WOD A;  2XXH A;  3KN8 A;  1SQY A;  2I4B A;  4YMB A;  4I62 A;  1P1U A;  1DBZ A;  2HCA A;  4OXV A;  3MPK A;  3O6H A;  4PAI A;  1M5E A;  2I48 A;  3KZG A;  1UTH A;  5EYH A;  2QMX A;  1FRP A;  1FCK A;  4DXC A;  1Y20 A;  4OVJ A;  4KPT A;  1L5T A;  5BWJ A;  4IR8 A;  1IXC A;  4H0W A;  1MQI A;  1YAE A;  4KYE A;  3H6U A;  2QS3 A;  3THI A;  1FBG A;  3D4C A;  4F1V A;  2VPO A;  1QUK A;  2F78 A;  2R8T A;  3QMF A;  1NL5 A;  4O3C A;  1KA0 A;  2V3Q A;  3FBP A;  2MKZ A;  2VGQ A;  1F9B A;  1YPN A;  1TT1 A;  1Y3N A;  5ESY A;  4OHN A;  1N3X A;  3BFT A;  3OSQ A;  3IOR A;  4E0W A;  1FPL A;  3U92 A;  3I6V A;  2XXY A;  4ND9 A;  2F6P A;  4WKM A;  2D5W A;  1FTA A;  2F7C A;  5I56 B;  2P0S A;  3FV2 A;  1ZTY A;  1WDN A;  3B6W A;  1IMF A;  4OTE A;  5CC2 A;  1DCU A;  3MBP A;  1B32 A;  1B2H A;  1KA1 A;  3BFU A;  2OCU A;  3TZA A;  4OEV A;  1AIV A;  2OWZ A;  3RPL B;  1QUL A;  3I5O A;  4XIG Q;  5A5L A;  3C9H A;  3FV1 A;  4DI4 B;  3FAS A;  5I58 B;  5H8S A;  2RF1 A;  3E3K A;  2XA5 A;  5CMB A;  3VLV A;  2QVU A;  5ET5 A;  1OVT A;  1YCJ A;  4AQ4 A;  2I3V A;  5DVI A;  3SEW A;  4HW8 A;  4LN5 A;  1EYI A;  3FZV A;  5TP9 A;  1Y9U A;  2I4C A;  4MF3 A;  1URG A;  3MP8 A;  4U2R A;  2FBP A;  4FJP A;  3KBR A;  4YKK A;  1RDZ A;  2PYY A;  4PFU A;  3OXN A;  3FIR A;  1N7W A;  1B6H A;  1IMC A;  4JBZ A;  2I6E A;  5IZ3 A;  3OSR A;  4N6D A;  3OD7 A;  2ALU A;  3F11 A;  1FPB A;  1FQD A;  3A29 A;  1D9V A;  5L9M A;  5AA2 A;  1URS A;  1LST A;  1VFE A;  4H67 A;  5L9S A;  4LZ5 A;  2F7A A;  2GH9 A;  1NV1 A;  3FJG A;  2CMO A;  1LB9 A;  4PFB A; 
#chains in the Genus database with same CATH homology
 1GTK A;  1H76 A;  3K2D A;  3MAM A;  3O28 A;  2HXW A;  1Q35 A;  4Q0C A;  2IEE A;  3OMB A;  4G8N A;  2AL5 A;  1B7U A;  2O69 A;  3LBS A;  1B5H A;  2DQV A;  1MPD A;  1QVS A;  5H8F B;  4LQ5 A;  2RC7 A;  1NNK A;  1DSN A;  3IR1 A;  2AYS A;  3ODB A;  4FEC A;  4ZEB A;  3OOA A;  3FJM A;  5EHM A;  1IZ1 A;  2P1S A;  2A5S A;  1B40 A;  3CG1 A;  1M5D A;  4ZEI A;  2Y7P A;  3MUQ A;  4KCD A;  2XXV A;  2ZMB A;  5KCJ B;  2H98 A;  5FHO A;  4U23 A;  3PU5 A;  1QUI A;  1UQW A;  3T9V A;  1LLS A;  3M3L A;  1OMP A;  2ESN A;  5I2N A;  4YKP A;  2B3F A;  1QUJ A;  2RKM A;  3MVY A;  3CSG A;  3K01 A;  2PMS A;  3RTF B;  4OFL A;  3SES A;  4RK9 A;  3SEU A;  4QFN A;  2QL3 A;  1MXV A;  1OIB A;  5L8D A;  2VP1 A;  3ZKL A;  3OO6 A;  4DCX A;  4JWX A;  3FVO A;  4R72 A;  2I58 A;  3KSJ A;  3B7D A;  1LBB A;  3A3U A;  3VDF A;  1H44 A;  5B70 A;  1MS7 A;  1XOC A;  4RY1 A;  3OEL A;  3DM0 A;  1SYH A;  4F39 A;  3IAZ A;  2R9J A;  2ZNS A;  4U1O A;  1FTK A;  4F3P A;  3N6U A;  1B0H A;  5B7D A;  2REJ A;  4EQ7 A;  1N0T A;  1ZU0 A;  3MJN A;  4GD5 A;  1BTJ A;  3IOT A;  3TDJ A;  1QJM A;  2FYI A;  1XC1 A;  1HSL A;  3KSX A;  4UA8 A;  1OQH A;  5JEI A;  4KI0 E;  2DXY A;  3T96 B;  2O1L A;  4H6D A;  4IO6 A;  2FNC A;  4G8M A;  2DE4 A;  4NF8 B;  2GHA A;  3VFJ A;  1N7X A;  3DP4 A;  3UP9 A;  1MY1 A;  3G7W A;  3Q27 A;  4QF9 A;  1R9L A;  3O6I A;  4OEU A;  5I57 A;  5A5X A;  3JV9 A;  2NWJ A;  1MG1 A;  4TQU Q;  3MQ9 A;  4BDQ A;  1B5J A;  3USD A;  5AE4 A;  3TQL A;  3MVX A;  3IB2 A;  4KR5 A;  4EQ9 A;  3SEV A;  1NNT A;  5ITP A;  5I84 A;  2XX9 A;  3S4U A;  3TFL A;  1A54 A;  3PUY E;  4LUB A;  2F97 A;  5TU0 A;  2A5T A;  3GZG A;  3K1M A;  1VR5 A;  1B9J A;  1JW5 A;  3T9H B;  3ILU B;  4MLQ A;  4R9F A;  5H8H B;  3G3F A;  2UVH A;  4LQ2 A;  4G77 A;  5KDT A;  3OO7 A;  5H8N A;  2O7U A;  1IXI A;  1OLC A;  2I3W A;  2ZYO A;  3PPO A;  3O9P A;  4GWO A;  3UOR A;  4RK2 A;  3FXQ A;  4R9G A;  1XVX A;  2PVU A;  3TQW A;  4C1T A;  1I6A A;  3FAT A;  1PB9 A;  4OMB A;  1EU8 A;  4PET A;  5TPA A;  2O7I A;  3UIF A;  1MY0 A;  2XX8 A;  1B3H A;  2OJT A;  4OWD A;  4LVQ A;  1OVB A;  1Q1K A;  1USY E;  2AIX A;  3HN0 A;  1Y4C A;  1N76 A;  4FIM A;  2O84 X;  1PB8 A;  3HPI A;  3CI8 A;  1MM7 A;  4ESW A;  5I2K A;  3EF7 A;  1SD3 A;  4EQB A;  4KYD A;  3UK4 A;  1MY2 A;  2BJJ X;  4ELQ A;  2FA7 A;  4OER A;  4IGT A;  5ICQ A;  3PV0 E;  4GL0 A;  2ZYN A;  5LOM A;  3TCH A;  2Z8D A;  4EUO A;  3MP6 A;  1SI0 A;  5H8Q A;  4XKN A;  3L6G A;  3G3J A;  1MH4 A;  1DPE A;  2QMW A;  3PD9 A;  4IO5 A;  1B3G A;  4JXI A;  3WAF A;  3BKI B;  2Q88 A;  4GRK A;  4PP0 A;  3U72 A;  2O68 A;  3S2V A;  5F7V A;  3MW0 A;  2ONK E;  1VFD A;  2RC8 A;  4QSC A;  1TFD A;  2QS4 A;  4Q30 B;  2DS9 A;  4Z7E A;  4FEB A;  1J1N A;  3PMX A;  3HHF A;  4QHQ A;  3RQT A;  5FTH A;  3KJ7 A;  1LCF A;  3QUJ A;  1TFA A;  3SDF A;  5DEX A;  4FE8 A;  4DXB A;  3JYR A;  4NF6 B;  4EDP A;  5AA2 D;  3G3H A;  4NF4 A;  5AA4 B;  3PUW E;  4QSD A;  4X9T A;  1BP5 A;  1QKB A;  2KLF A;  1PDA A;  2PBW A;  3W15 C;  3H06 B;  1O7T A;  4DE8 A;  3H6V A;  3VVF A;  3TKD A;  2ZYM A;  4ZDM A;  4XKQ A;  1Z7N E;  1ZIU A;  3TTN A;  4KFQ A;  1FTM A;  2Z22 A;  2Q2A A;  2ZNU A;  4OQO A;  5F1Q A;  4DIG A;  4X48 A;  3VLU A;  5DVJ A;  3SKP A;  4KD5 A;  1UTB B;  1RYO A;  4RA1 A;  4I9D A;  1RYX A;  1URD A;  4RXL A;  2XXR A;  5FTI A;  2YLN A;  2LAO A;  3LC8 A;  1B1H A;  1FTO A;  3FXR A;  3HV1 A;  3CIJ A;  1XHY A;  1Y3P A;  4KQP A;  1XT8 A;  2Y7I A;  5BUU A;  2CZL A;  3H7M A;  3PPR A;  2Z8F A;  4FOR A;  4YAH X;  2O1M A;  5I59 B;  3CFL A;  3H6T A;  4R2F A;  2GHB A;  1MRP A;  4ECF A;  1ZKB A;  3DLN A;  4YU0 A;  1QKA A;  4NF5 A;  1MY3 A;  3QYT A;  5HBC A;  2OWS A;  3MZ1 A;  4LAT A;  4H8I A;  1FTL A;  4G68 A;  4TLM B;  4G68 C;  1JEV A;  1ZBM A;  1ZLQ A;  1MXX A;  2F34 A;  4FAT A;  1EZO A;  4LA9 A;  3PD8 A;  4OES A;  3I3V A;  1LAG E;  3HST A;  2DVC A;  4ISU A;  5DTB A;  3V83 A;  1Y1Z A;  2VD3 A;  3C36 A;  1WVJ A;  3UN6 A;  3DP6 A;  2DE2 A;  1M5F A;  4OEN A;  1UTH B;  3EQ1 A;  1B4H A;  3BBR A;  2HQ0 A;  5AA3 A;  2UVG A;  4RPN A;  5CI5 A;  1M5C A;  4I8C A;  1POT A;  4NWC A;  2NVU B;  3JZJ A;  4OFO A;  1NNF A;  2H5Y A;  4GIZ A;  3IOU A;  5JTY A;  3E13 X;  3EPE A;  1B05 A;  1AL3 A;  2WKY A;  4RNS A;  1B3F A;  1IIT A;  4JDF A;  1B58 A;  3UGW A;  3RNN A;  3Q29 A;  2XXX A;  3PUV E;  2Y7W A;  1GVC A;  3RGY A;  1O63 A;  4IY6 A;  4I1D A;  2E0S A;  4RYA A;  2I0C A;  4NF8 A;  4OET A;  1P1O A;  2F8D A;  1II5 A;  1BKA A;  3IJX B;  3EHU A;  4DXU A;  2QPQ A;  2Z8E A;  1IQ7 A;  4P0I A;  4ZE8 A;  3H4Z A;  1IIW A;  1FQB A;  1S7Y A;  4KYS A;  1LAH E;  3Q26 A;  4ZEF A;  4QSE A;  3GLB A;  1EZP A;  3S9E A;  4N07 A;  4PQJ A;  5L9O A;  5EYF A;  2HAU A;  2Z23 A;  3EHS A;  4OYV A;  1MH3 A;  2Q9T A;  4IGR A;  5TP9 B;  3TEP A;  4GLI A;  2X26 A;  1XVY A;  4NED A;  1POY 1;  2OZZ A;  3KOS A;  2HAV A;  5M2V A;  3W9V A;  1A8F A;  4R74 A;  4ELO A;  3ECR A;  3WAE A;  3OEM A;  2AL4 A;  2UYE A;  3ZKK A;  4U1Z A;  3IO6 A;  1MM6 A;  3KEI A;  4AB6 A;  4F2O A;  1SBP A;  1A40 A;  4F31 B;  3LSX A;  1D4N A;  3QK6 A;  5CMK A;  4PFW A;  3KOT A;  1S9T A;  4BDO A;  2V93 A;  3MZ9 A;  3MC2 A;  3PPN A;  5DYH A;  4F3G A;  1DPP A;  5AA2 B;  4YMA A;  1ANF A;  2XX7 A;  1DOT A;  4LON B;  3GBA A;  3D4G A;  3S9L C;  3H3G A;  4G2Z A;  4EXK A;  1NMU A;  2QS2 A;  3PUX E;  1O64 A;  5FHN A;  4IO4 A;  4N13 A;  1FQF A;  1MDP 1;  1N84 A;  3SEY A;  3U8Q A;  3P7I A;  2XXW A;  4PE5 B;  5JK4 A;  1AMF A;  4IO3 A;  3E4R A;  3DP8 A;  5ICT A;  1UIV A;  1AH5 A;  2OK2 A;  4H1X A;  3ILT B;  3FGS A;  3L6H A;  4HTG A;  1IUD A;  1R9Q A;  3W9W A;  2XHD A;  2RC9 A;  1N04 A;  1R6Z A;  2P2A A;  5HM4 B;  2DWI A;  3U1O A;  3MVW A;  1JQF A;  3G3K A;  4XTC Q;  5CRY A;  2DE3 A;  2G29 A;  3SET A;  3V8X B;  5CMM A;  1JNF A;  4F22 A;  4ZED A;  4FED A;  2ZXT A;  2Q2C A;  5I2N B;  4LP2 B;  1EH3 A;  4F3S A;  3TMG A;  4K3F A;  5CMC A;  1VSO A;  3EN3 A;  1LFI A;  1SDX A;  4DCY A;  3TTL A;  3IOW A;  1H43 A;  2XD3 A;  4EXL A;  4XXU A;  3K1N A;  1A8E A;  3U93 A;  3T93 B;  2QJE A;  1FQE A;  4C1U A;  4ELR A;  1ZMG A;  4QFL A;  4BDR A;  1QW0 A;  1MY4 A;  2ANJ A;  3KFM A;  3HCQ A;  4PFT A;  2DYX A;  4WEP A;  1B3E A;  3QIM A;  1US5 A;  1LGB C;  2Q89 A;  1FQC A;  3K6V A;  2O51 A;  3K6W A;  2YJP A;  3FVG A;  4JWO A;  5CM6 A;  1P99 A;  3IJO B;  5HPQ A;  2DSF A;  1B3L A;  4BLA A;  1H3D A;  2I49 A;  4O3A A;  4OZ9 A;  3ONM A;  1XS5 A;  2NOO A;  2X7Q A;  1HSE A;  1LAX A;  3TCF A;  1US4 A;  2UVI A;  2GFE A;  4NE4 A;  1TXF A;  4POX A;  3FVK A;  5I56 A;  2REG A;  4NWD A;  2B3B A;  1B52 A;  3CR9 A;  3HHG A;  4YB5 A;  1T0K A;  5I57 B;  5A5X B;  1CE2 A;  4GOT A;  3T66 A;  3N5L A;  1RKM A;  1P1Q A;  3EHT A;  2PX1 A;  3V5A A;  3O29 A;  4BDN A;  4Z0I A;  2E1S A;  1LAF E;  4MFI A;  1M5B A;  4F1Y A;  3VXB A;  4LZ7 A;  5I58 A;  2QSX A;  1OLA A;  2V3U A;  4POW A;  3MPL A;  2A5T B;  1FQA A;  3IB0 A;  4QFK A;  3AXF A;  3N94 A;  2H4I A;  4M4G A;  1KWH A;  4GQO A;  3TAJ A;  5KDT B;  5H8N B;  3C31 A;  1I6Q A;  4AB5 A;  3A09 A;  3Q25 A;  4WXJ A;  5IAI A;  4G8H A;  3VVD A;  2DOJ A;  4F19 A;  4L17 A;  1TWY A;  3KGC A;  3O2A A;  4IO2 A;  3CSB A;  3K0V A;  1NFT A;  5TPA B;  2DWA A;  5DT6 A;  3MP1 A;  3S9M C;  3TEL A;  3FD3 A;  2F6G A;  1LFH A;  1B5I A;  1N3W A;  2UYF A;  4X1B A;  4GL8 A;  2H25 A;  4YZZ A;  3PGF A;  3IOV A;  4ONY A;  1MDQ A;  4RJZ A;  2RCB A;  2F36 A;  1Y3Q A;  1SVX B;  1YTV A;  5I2K B;  1PB7 A;  1S50 A;  4ZS9 A;  2HEU A;  3LUY A;  3G3I A;  3MZB A;  5AA1 A;  3A3C A;  3FVN A;  3R7X A;  3TCG A;  3CFZ A;  5H8F A;  5H8Q B;  3O97 A;  3R6U A;  4YKJ A;  3IL1 B;  1H45 A;  2OBG A;  3IO4 A;  2HFB A;  1B4Z A;  1D9Y A;  1AOV A;  1I6B A;  1ELJ A;  1MXY A;  1DTG A;  2V25 A;  1MQG A;  1A55 A;  4P11 A;  1B0L A;  5KCJ A;  3PPQ A;  3H6W A;  2VD2 A;  5ELV A;  5CBS A;  4IO7 A;  1SW5 A;  3IK6 B;  1MXW A;  3GXA A;  3H03 A;  1B1X A;  3MVZ A;  3C32 A;  4R6Y A;  2PT1 A;  1MQD A;  2XXQ A;  3RLF E;  2YPN A;  1MPC A;  2F5X A;  4NMY A;  5DEX B;  4F1U A;  1VE4 A;  2M8C A;  2XXP A;  3LSF B;  3QUF A;  4NF4 B;  1SW2 A;  1JET A;  4OFJ A;  2HZL A;  3VXC A;  3C33 A;  1MXZ A;  4FAJ A;  4HS7 A;  2G93 A;  2RIN A;  2VHA A;  4ZEC A;  3T9U A;  3IB1 A;  1P1W A;  1JW4 A;  2XD2 A;  3QAX A;  3CG3 A;  1SYI A;  3PMV A;  1PBQ A;  5EHS A;  1GV8 A;  2OWT A;  2ONS A;  2ZNT A;  3CRB A;  3T9X B;  3RN8 A;  5K2Y A;  1SW1 A;  4F18 A;  5CBR A;  2H9B A;  3LSW A;  4DLD A;  1NNP A;  1EZ9 A;  3RY3 A;  3RTW B;  4ELP A;  4QFP A;  3V89 B;  1B46 A;  1IXH A;  1MQJ A;  4Q5T A;  1MQH A;  3N26 A;  1NH8 A;  1R1N A;  4WED A;  3KN3 A;  3O66 A;  3M3F A;  3C34 A;  2DWJ A;  2O6A A;  3B6Q A;  3S9N C;  1JVX A;  4NTL A;  2XXI A;  3TTK A;  5IKB A;  3FUZ A;  4MBP A;  4NF5 B;  2DWH A;  3PUZ E;  4UAC A;  2X7P A;  3K6X A;  4O3B A;  4G68 B;  2UVJ A;  2D21 A;  2R71 A;  3TTM A;  4RPO A;  3FXU A;  4F3B A;  2D3I A;  4JB7 A;  1D3K A;  3MWB A;  5H8H A;  1B7Z A;  2PT2 A;  3K6U A;  3LR1 A;  1I69 A;  3RPW A;  2DXR A;  4HCY A;  2DVZ A;  4XKR A;  2I0B A;  1IXG A;  1ZJL A;  2HZK A;  1PEB A;  4GXA A;  1JVY A;  4PFY A;  4MLV A;  4DZ1 A;  4GFR A;  2V3T A;  4YB6 A;  4C0R A;  4F2Q A;  3SEX A;  1BLF A;  4R2B A;  4IY5 A;  4N6P A;  1GGG A;  2GRV A;  3TUS A;  4KHZ E;  5JTY B;  1DMB A;  1SW4 A;  1B7H A;  3VE1 B;  2Q8J A;  3HO7 A;  4YIC A;  4QFO A;  1UIU A;  3K1P A;  1CB6 A;  4X1D A;  2IA4 A;  1Y1M A;  3C4M A;  4MH5 A;  3E9X A;  5ISU A;  4ESX A;  4BDM A;  2F7B A;  3K00 A;  4H5G A;  1PBP A;  2UXA A;  1HSJ A;  4R6K A;  1LCT A;  1GR2 A;  4GF8 A;  4GVO A;  1OQG A;  4JSD A;  4R75 A;  3Q28 A;  4BDL A;  3OO8 A;  3VVE A;  3OEK A;  4U4X A;  3TPA A;  4KCC A;  3ZS6 A;  3K02 A;  3OEN A;  3RT8 A;  1BIY A;  5ITO A;  3TYH A;  2B65 A;  1MXU A;  3K4U A;  2OLB A;  4ZE9 A;  1JEU A;  1NKX A;  2F35 A;  4U21 A;  1PC3 A;  1MPB A;  4HCW A;  4Q8R A;  3IX1 A;  5KZT A;  3M3K A;  4DDD A;  2ZYK A;  1USY H;  4E0X A;  2XXU A;  5J1D A;  3VLW A;  3KN7 A;  1JW1 A;  3FJ7 A;  3RUM A;  4NF6 A;  2H99 A;  4H8J A;  5AA4 A;  4F29 A;  1ATG A;  4R73 A;  4TOZ A;  4G4P A;  2Y7R A;  3G3G A;  3GBB A;  3LSL A;  3TTR A;  4H5F A;  3O6G A;  3M8U A;  4H65 A;  3UA8 A;  2XXT A;  1FW0 A;  4YB7 A;  1FTJ A;  2NXO A;  4GXS B;  3C35 A;  4R6H A;  1UTB A;  4TLL B;  4JWY A;  4P0G A;  4ZZE A;  2Y7K A;  3U94 A;  4THI A;  3PPP A;  1A99 A;  2QS1 A;  3N6T A;  1NH7 A;  2VOZ A;  3CFX A;  1P1N A;  3OO9 A;  3KG2 A;  1LB8 A;  5DVF A;  5I59 A;  1A7L A;  2RCA A;  2W7Y A;  3QXM A;  3KJT A;  3ZSF A;  2V84 A;  3CVG A;  4ZEK A;  4ZZA A;  1IEJ A;  4YKI A;  3SER A;  4EF1 A;  4EF2 A;  1LFG A;  2DP8 A;  4LZ8 A;  1B51 A;  4JSO A;  3T22 A;  1Z7M E;  5K2X A;  1SI1 A;  2ONR A;  3QSL A;  2R6G E;  2THI A;  1LBC A;  3B6T A;  5FHM A;  2Y84 A;  4IB2 A;  1DTZ A;  3VV5 A;  2NUV A;  2ABH A;  2QRY A;  3TOD A;  4QRZ A;  3DEL B;  4U22 A;  4U4S A;  3PMW A;  3RT6 B;  1Y4T A;  3R26 A;  4M1V A;  4XKP A;  1WOD A;  2XXH A;  3KN8 A;  1SQY A;  2I4B A;  4YMB A;  4I62 A;  1P1U A;  2HCA A;  4OXV A;  3MPK A;  3O6H A;  1M5E A;  2I48 A;  3KZG A;  1UTH A;  2QMX A;  1FCK A;  4DXC A;  1Y20 A;  4OVJ A;  4KPT A;  1L5T A;  5BWJ A;  1IXC A;  4H0W A;  1MQI A;  1YAE A;  4KYE A;  3H6U A;  2QS3 A;  3THI A;  3D4C A;  4F1V A;  1QUK A;  2F78 A;  1NL5 A;  4O3C A;  2V3Q A;  2VGQ A;  1YPN A;  1F9B A;  1TT1 A;  1Y3N A;  4OHN A;  1N3X A;  3BFT A;  3OSQ A;  3IOR A;  4E0W A;  3U92 A;  3I6V A;  2XXY A;  4ND9 A;  2F6P A;  4WKM A;  2D5W A;  2F7C A;  5I56 B;  2P0S A;  3FV2 A;  1ZTY A;  1WDN A;  3B6W A;  4OTE A;  5CC2 A;  3MBP A;  1B32 A;  1B2H A;  3BFU A;  2OCU A;  3TZA A;  4OEV A;  1AIV A;  1QUL A;  3I5O A;  4XIG Q;  3C9H A;  3FV1 A;  3FAS A;  5I58 B;  5H8S A;  2RF1 A;  3E3K A;  5CMB A;  3VLV A;  1OVT A;  1YCJ A;  4AQ4 A;  2I3V A;  5DVI A;  3SEW A;  4HW8 A;  3FZV A;  5TP9 A;  1Y9U A;  2I4C A;  4MF3 A;  1URG A;  3MP8 A;  4U2R A;  4FJP A;  3KBR A;  4YKK A;  2PYY A;  4PFU A;  3OXN A;  3FIR A;  1N7W A;  1B6H A;  4JBZ A;  2I6E A;  3OSR A;  3OD7 A;  2ALU A;  3F11 A;  1FQD A;  1D9V A;  5AA2 A;  5L9M A;  1URS A;  1LST A;  1VFE A;  4H67 A;  5L9S A;  4LZ5 A;  2F7A A;  2GH9 A;  3FJG A;  2CMO A;  1LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...