3FJMA

Crystal structure of phosphate bound peb3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords Major antigenic peptide PEB3
total genus 83
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjmA02
1CB6A 3O6IA 2X26A 4RY1A 1MY4A 3K6UA 2XXIA 4KD5A 4KCCA 1M5BA 1R6ZA 3EQ1A 1D4NA 3H3GA 4NF4A 5A5XB 2B3BA 2Y84A 2Z23A 3RGYA 2VD3A 1B5IA 3C32A 4G68B 3FXUA 4PP0A 1B2HA 5DVFA 5DVJA 3O66A 3S2VA 4OTEA 3RPWA 4YB7A 2O7IA 2DXYA 3B7DA 1MQJA 2UVJA 3OELA 4JBZA 4YKJA 4BDOA 4PETA 4LZ5A 4LATA 1N76A 3WAFA 4DE8A 1FTMA 4HCYA 4LP2B 3SKPA 3FD3A 4QHQA 1POY1 4GLIA 2PX1A 4MBPA 1MDQA 1MXZA 1TWYA 5H8HB 3ZKKA 2RINA 3FASA 3MP1A 3MWBA 3ILTB 3MAMA 1US5A 1MH4A 1MQHA 3MVWA 3MPLA 2ONSA 4YZZA 4ECFA 2F5XA 5DTBA 3S9LC 3I5OA 2HAVA 1FTLA 1BTJA 4TQUQ 2DQVA 3FGSA 4QFPA 2OJTA 4N13A 3IOUA 1FQEA 5B7DA 1N3XA 4NF6B 1Z7NE 1ZBMA 3S9EA 4OYVA 1B7ZA 1LFHA 2A5SA 3HCQA 2DWHA 1OVBA 3KSJA 3OO7A 2H5YA 5H8NA 3T96B 4C1TA 2FNCA 4YB6A 5M2VA 1ANFA 3EHUA 1Y1ZA 1NNPA 2Y7RA 2XXTA 3TQWA 1SDXA 4RPNA 4BDLA 4DXBA 2GRVA 1MXVA 3O97A 4NWDA 5L9SA 2P2AA 3OOAA 1AMFA 2ZYNA 2XX9A 1WDNA 3M3FA 1B40A 2HZLA 3MQ9A 3PD8A 4FJPA 1MXUA 1P1WA 1UIUA 4G8NA 4F3SA 3UIFA 4RXLA 4HTGA 2Y7WA 1EZOA 1YAEA 1NNTA 3T9HB 3C33A 5I2KB 4OFJA 4YU0A 3H03A 2XHDA 3R6UA 3RUMA 2OLBA 3E13X 3FVGA 4KYEA 5CMKA 1GGGA 4NF8A 5EYFA 2DYXA 3MUQA 2HAUA 4ZEKA 2ZNUA 3CVGA 5I59B 1JW1A 2O84X 1YTVA 3RN8A 4YKPA 2G29A 3FV2A 4KHZE 4OWDA 4U23A 2P0SA 4ZE9A 1R1NA 4JDFA 4KR5A 4EDPA 1NFTA 3N6UA 1OLCA 3IX1A 3M3KA 3EF7A 1N84A 3JV9A 4G4PA 2G93A 2QL3A 4K3FA 1B6HA 4P0GA 4HW8A 3DP6A 1ZU0A 2PMSA 4N6PA 4ZEBA 3KGCA 5I57A 1BKAA 2BJJX 2DSFA 3C36A 5K2YA 1LFGA 3SEUA 1IXCA 3MJNA 1S7YA 4JSDA 5KDTA 2DE3A 4R74A 2ZMBA 3A3CA 5TPAA 4NF4B 2QRYA 3QYTA 3SEWA 5A5XA 2OBGA 2REGA 2DXRA 4H1XA 2O6AA 3TZAA 1EZPA 1O64A 3TCFA 4F2QA 5I2NB 1Z7ME 5ICQA 1M5CA 1J1NA 2ANJA 2HXWA 2PVUA 3G3GA 4UACA 4IO2A 1B0LA 2F6PA 3TTLA 5IKBA 3MW0A 4YMAA 1FQDA 4U22A 2XXUA 3S4UA 4DXUA 1Y20A 3FZVA 1XC1A 1MQDA 4QFNA 5JTYB 1B5JA 3N94A 4O3BA 1PB8A 4JWYA 2Q89A 1NL5A 1RKMA 1LBCA 3MVZA 4FE8A 1SI1A 3FIRA 4P0IA 3LUYA 1JVXA 2Q8JA 5KCJB 2B3FA 1SW5A 4WEPA 4IO4A 1BLFA 1L5TA 4FORA 5HM4B 2XX8A 3JYRA 4F22A 4IO6A 4ZEDA 2ZXTA 4F31B 2GH9A 3KJTA 3TODA 1CE2A 4ZE8A 1B52A 1DTGA 3IR1A 3FVKA 1QW0A 3N26A 4THIA 3UN6A 2B65A 3TPAA 1D9VA 2RCAA 4ZZEA 4GL0A 3R7XA 3BFUA 4QFOA 2V25A 3C4MA 1QULA 3MVXA 5DEXB 3GXAA 5ELVA 1ELJA 4DCYA 1UTBA 4F1YA 1MY1A 4OESA 4OZ9A 1GTKA 4DLDA 2H9BA 1XT8A 2F35A 3TTNA 1SW4A 2DWAA 2NUVA 3B6WA 5HBCA 1LAGE 1US4A 1IUDA 1B5HA 5FTIA 1IXGA 2GHAA 2OCUA 4R6YA 1SW1A 4FATA 4ZEIA 1DSNA 3PUYE 4HCWA 1VSOA 2HFBA 2ONKE 4XKQA 4XTCQ 4EQ7A 5ICTA 4Z0IA 1MXYA 3RNNA 1A54A 3KOTA 1XVYA 5CMMA 3T93B 4KI0E 4U21A 1KWHA 3RQTA 4NMYA 4XIGQ 4PE5B 3VVFA 4UA8A 4OERA 1B51A 1MY2A 1II5A 2QS1A 3ILUB 4JXIA 5TPAB 1B1HA 3M8UA 4GF8A 4R2FA 3QSLA 1SD3A 2RKMA 2UVHA 3B6TA 4RPOA 2DWIA 1IXHA 2ALUA 4U4SA 5I2NA 5IAIA 2Z8FA 2H98A 1LGBC 2XXRA 1FQBA 3EHTA 1OLAA 3KJ7A 3TQLA 4WKMA 5EHMA 2Q2CA 1OQHA 2UYFA 2V3UA 4ESXA 4JWOA 5ITOA 2DOJA 3PUVE 1JNFA 1GR2A 4FIMA 4TLLB 2HCAA 2QS3A 1FCKA 1R9LA 1R9QA 3MPKA 5CRYA 1Q35A 2QS4A 1B58A 3DM0A 4H6DA 1D3KA 2M8CA 4L17A 2VP1A 3K02A 4NF5B 2KLFA 3R26A 1A7LA 3O6GA 1ZIUA 3LSLA 4PFTA 2R6GE 1LBBA 4QSEA 4I9DA 1TFDA 3VLWA 1QVSA 1USYE 2DWJA 2F7AA 2A5TA 4G68C 5I58B 5I56A 1LSTA 4OMBA 3HV1A 1URDA 2D21A 1ZMGA 4LONB 1I6AA 2QJEA 3HPIA 4NTLA 5CBSA 5JEIA 4BDRA 1MQIA 4OXVA 1LAXA 2D5WA 4FECA 3VLUA 1ZKBA 2VD2A 5TU0A 2F36A 1A8FA 2R9JA 2Z8EA 4EQ9A 1S9TA 3OO8A 1ZTYA 1B46A 4OFLA 4LVQA 1VFEA 3BKIB 4U1OA 3BFTA 1SW2A 3KN8A 3PUZE 4RK2A 5KCJA 2Y7IA 3PPOA 3S9MC 4MLVA 4O3CA 4DZ1A 5TP9A 3QUJA 3G7WA 4E0XA 5KZTA 1JEVA 4AB5A 2HZKA 2LAOA 1B7UA 3CIJA 3OD7A 1B3HA 2XXPA 2I49A 4QF9A 5CM6A 5H8NB 2Q9TA 3K00A 4EUOA 2V93A 1EZ9A 3K1NA 1HSLA 1LB9A 2XX7A 4QFLA 1PBQA 4F19A 3PGFA 1AOVA 4OQOA 3IOVA 5CMCA 3FJGA 1M5EA 1XHYA 2REJA 3TCHA 3LC8A 3LSFB 4MFIA 5B70A 2CMOA 4YB5A 3MZ1A 3HHGA 1B3LA 4ND9A 3D4GA 4Q0CA 1P1UA 3IK6B 2Y7KA 3KN3A 1EU8A 1LB8A 3LBSA 3U8QA 4EQBA 1FTOA 1SQYA 4GVOA 3FXRA 3OEKA 4KYDA 2H99A 2DS9A 3IORA 1MRPA 1UIVA 4POXA 3KFMA 3CSGA 3EHSA 4IGRA 2O69A 2P1SA 1OVTA 2OWSA 5L9OA 1LCTA 1LLSA 1I69A 1N7XA 5AE4A 1DTZA 2AIXA 3IB1A 1P99A 3KSXA 4ONYA 1H76A 3PV0E 3Q26A 3IOTA 4RNSA 1XOCA 3TEPA 3OO9A 3CFXA 4GXSB 4P11A 3H6WA 4Q5TA 1OIBA 4I8CA 5DVIA 2I4CA 3EN3A 3OSRA 3FV1A 3VFJA 3IOWA 3ZSFA 5I58A 2XXVA 3IAZA 3H6UA 1LFIA 4NEDA 4NF8B 1N0TA 2HEUA 3MC2A 5F1QA 5AA4B 1ZLQA 1MM6A 1LAFE 2OK2A 3FUZA 1PDAA 2I6EA 4YKKA 1FTJA 5J1DA 3KEIA 4JWXA 2XD2A 3GZGA 3PPQA 4AQ4A 3H06B 2I0CA 4H0WA 2UYEA 3FJ7A 3TDJA 3RTFB 1Y3QA 5JK4A 1S50A 1JQFA 4FEDA 3OEMA 1F9BA 4G77A 1FQCA 4M1VA 4N07A 4ELOA 3IJOB 5LOMA 3H4ZA 1P1OA 3O6HA 3THIA 1HSEA 1JVYA 1B0HA 3CSBA 3K01A 2A5TB 3K4UA 3GBAA 3Q29A 4TLMB 1B32A 1FQAA 5FHOA 3SEVA 1I6QA 4X9TA 4ZDMA 3CR9A 3T22A 1B7HA 4F29A 3LR1A 4LUBA 4XKRA 2OZZA 2IA4A 4ISUA 2QMWA 3C35A 3PPNA 4EF1A 4F2OA 3BBRA 4U4XA 2QS2A 1B4ZA 4GL8A 1MM7A 3USDA 1IITA 1NNFA 2ESNA 2F97A 1O7TA 1Y3NA 2XD3A 1FW0A 1ATGA 1Y3PA 3P7IA 5H8QB 4LQ5A 1DPPA 1JW5A 3W9VA 1JW4A 5TP9B 3O2AA 4IGTA 3TCGA 3E9XA 4H65A 3U94A 4GOTA 2RC9A 2X7PA 2YJPA 2H4IA 2Y7PA 4XXUA 2NWJA 3UK4A 3UP9A 3KBRA 3ZKLA 2AYSA 4BLAA 1AIVA 2RC8A 5AA1A 2ZYMA 3E3KA 4U1ZA 3H7MA 4LA9A 3SETA 2RCBA 2ZYKA 2ABHA 1N04A 1Y4TA 4OEUA 5L8DA 2O1MA 5AA3A 2VHAA 1PEBA 3H6TA 3TUSA 4QRZA 4PQJA 2FA7A 5CC2A 1O63A 2DP8A 3DLNA 1XVXA 3PMWA 2ZNTA 4LZ8A 4GFRA 1MG1A 3PUXE 5DEXA 5FHMA 4U2RA 3UA8A 1D9YA 3H6VA 4GQOA 2PYYA 4KYSA 3MP8A 1QUJA 3TTMA 3VXBA 1UTBB 4BDNA 4Z7EA 3L6HA 2V3TA 3C9HA 4G68A 3TTKA 3ZS6A 2I0BA 1H44A 4GRKA 4IO7A 1N7WA 4G8MA 3U92A 3IO6A 1T0KA 4H8IA 3PD9A 1WODA 4F3PA 4F18A 2H25A 1B3EA 3L6GA 5H8FB 4C1UA 2F78A 4ELQA 2PT2A 2D3IA 4PFYA 3MZ9A 3FVOA 4H67A 5AA2A 4R75A 4POWA 1A99A 4PFUA 1Y9UA 5BUUA 4O3AA 4ZS9A 1M5DA 1HSJA 1H43A 1MS7A 3I3VA 3CG3A 4JB7A 1IXIA 3O9PA 3QIMA 5HPQA 4GXAA 1AH5A 5I56B 1POTA 1H3DA 2VGQA 4FEBA 3VVEA 4KFQA 1NKXA 2PT1A 1Q1KA 3SESA 3DELB 3A3UA 3Q27A 1DOTA 1VR5A 2XXWA 3PMVA 3FJMA 5H8QA 1B9JA 1XS5A 5CMBA 5I84A 1TT1A 2CZLA 2O7UA 1SYIA 3IO4A 3IB2A 3K6WA 5CBRA 1MPDA 2O51A 3IJXB 4X1DA 1B3GA 3U93A 1IQ7A 4BDMA 2DVZA 3WAEA 3DP8A 4ESWA 2RC7A 4KCDA 4IY5A 5L9MA 3TMGA 3VE1B 4QSCA 3PPPA 1MDP1 1SI0A 1URSA 3VLVA 1QKAA 3C31A 1WVJA 1H45A 3K6VA 3K2DA 3OSQA 4R6KA 2UXAA 3U1OA 1BIYA 3HN0A 1ZJLA 1URGA 3KZGA 4OEVA 4GIZA 3G3JA 3VVDA 1MY3A 4YKIA 3EPEA 2WKYA 3TFLA 3TELA 1LCFA 2PBWA 2I3VA 3N5LA 3G3KA 3N6TA 3UORA 3TTRA 4XKPA 2NVUB 1AL3A 3HO7A 1MH3A 4OENA 1B3FA 1VE4A 1A55A 1LAHE 3A09A 1JETA 4RA1A 3MZBA 4WXJA 3KOSA 1YPNA 3O29A 5H8SA 5K2XA 4RK9A 3SEXA 3V89B 1JEUA 2O68A 4GD5A 4EXLA 3SERA 4F3BA 3RTWB 3ONMA 3B6QA 2AL5A 3Q25A 1EH3A 4KQPA 4M4GA 1QUIA 4HS7A 3JZJA 2FYIA 3RT8A 5I57B 2XXYA 2W7YA 3OO6A 3CFZA 4H8JA 5I2KA 3QK6A 3W9WA 1NMUA 3I6VA 5CI5A 5DT6A 4BDQA 2Q2AA 2UVIA 1PB9A 5KDTB 1QKBA 3U72A 1NNKA 4IO3A 4Q30B 3DP4A 4ZEFA 2NXOA 2XXHA 3Q28A 5AA4A 3IL1B 4R9FA 3PPRA 3V8XB 1A40A 4F39A 3SDFA 3TYHA 1IZ1A 2DE4A 4ELRA 3F11A 1SVXB 2ZNSA 3PUWE 4F3GA 1MXWA 2IEEA 3FXQA 3PU5A 4WEDA 1FTKA 1M5FA 1UTHA 5JTYA 3CRBA 2ZYOA 5DYHA 1NH7A 1PC3A 2I3WA 1SYHA 1BP5A 1DPEA 2Q88A 3CG1A 4I1DA 1RYXA 4I62A 4MF3A 4R2BA 3W15C 1NH8A 1MY0A 2DVCA 1GVCA 5FHNA 3G3IA 5AA2D 1QJMA 4F1VA 1PB7A 4MH5A 3SEYA 3GLBA 3V83A 1TFAA 2V3QA 1RYOA 3T9VA 4EF2A 4NE4A 4OVJA 2I4BA 2UVGA 3QAXA 4FAJA 4IO5A 2VOZA 1USYH 1B05A 5H8HA 2YLNA 1QUKA 1SBPA 4AB6A 1UQWA 3VV5A 4QFKA 2ONRA 3OENA 5FTHA 3T9UA 3T9XB 3TKDA 4LQ2A 4F1UA 2NOOA 4JSOA 2F6GA 1MPBA 1OQGA 1IIWA 1B1XA 2HQ0A 2Z22A 3E4RA 3FATA 3FVNA 3M3LA 3QXMA 2F7BA 4KPTA 2QMXA 4H5GA 2QSXA 4TOZA 3VDFA 3CI8A 4ZECA 4Q8RA 4LZ7A 3ECRA 3G3HA 4RYAA 1FQFA 1PBPA 4G2ZA 2GHBA 4NWCA 4ZZAA 3LSXA 4EXKA 3PMXA 2X7QA 4YICA 3AXFA 2GFEA 1P1QA 4YMBA 4X48A 3HHFA 4C0RA 1MPCA 2QPQA 4IY6A 4X1BA 5ITPA 3RT6B 4RJZA 4DDDA 4R6HA 4DCXA 2I58A 4MLQA 4H5FA 2V84A 4OFOA 4QSDA 4R72A 4DIGA 3K1PA 2XXXA 4GWOA 3LSWA 1OMPA 1A8EA 1DMBA 4R9GA 3VXCA 3UGWA 3MBPA 2OWTA 3QUFA 3RLFE 1Y4CA 5ISUA 1I6BA 4R73A 4NF6A 4OETA 2E0SA 3OXNA 4ELPA 3HSTA 3KN7A 3OMBA 5F7VA 3CFLA 1GV8A 2E1SA 3K0VA 3ODBA 4IB2A 3MP6A 3GBBA 2R71A 3O28A 4XKNA 5EHSA 5BWJA 1MQGA 3G3FA 1IEJA 5I59A 3S9NC 1MXXA 1N3WA 1P1NA 3IB0A 2Z8DA 2XXQA 1VFDA 1UTHB 3V5AA 2F34A 4PFWA 2DE2A 1B4HA 3TAJA 1YCJA 4DXCA 1Y1MA 2O1LA 4OHNA 2I48A 2THIA 3K1MA 4E0WA 4G8HA 3D4CA 4NF5A 1TXFA 2F7CA 3MVYA 3KG2A 2YPNA 4YAHX 3RY3A 2RF1A 5H8FA 2AL4A 2F8DA 3C34A 3K6XA 5AA2B 3T66A
chains in the Genus database with same CATH superfamily
1CB6A 3O6IA 4O8MA 1MY4A 1R6ZA 3EQ1A 5A5XB 5IGAA 3RGYA 3C32A 3FXUA 3O66A 3RPWA 2O7IA 2GQ1A 2DXYA 4JBZA 4PETA 4DE8A 5EYGA 2FBPA 3FD3A 1POY1 2PX1A 1TWYA 5IZZA 3FASA 5I3SA 1MH4A 1RDYA 3MPLA 3S9LC 3I5OA 1FTLA 1BTJA 4QFPA 2OJTA 1NV2A 1ZBMA 1B7ZA 2DWHA 1OVBA 3OO7A 4C1TA 5M2VA 1Y1ZA 4DXBA 1SDXA 2V4CA 4NWDA 1AMFA 3SEXA 3MQ9A 2HZLA 1P1WA 4O94A 2OWZA 3UIFA 4HTGA 1EZOA 1NNTA 4OFJA 4P3LA 3FVGA 4KYEA 4N6DA 5EYFA 3MUQA 4X04A 2HAUA 2ZNUA 3LUZA 1YTVA 4U23A 4ZE9A 1OLCA 3M3KA 1N84A 1B6HA 4HW8A 1ZU0A 3KGCA 1BKAA 2DSFA 3C36A 3SEUA 3MJNA 1S7YA 4JSDA 2PFZA 3A3CA 2OBGA 2REGA 1EZPA 3TCFA 3MSTA 2ANJA 4UACA 2F6PA 1XC1A 1MQDA 4O3BA 2WEFA 4FE8A 2B3FA 4OVTA 5HM4B 1YZ0A 4ZEDA 1KZ8A 2GH9A 3KJTA 1CE2A 4ZE8A 3FVKA 3UN6A 4THIA 2B65A 3TPAA 4GL0A 4QFOA 2V25A 1QULA 5DEXB 2FIXA 2QVRA 2FVZA 1XT8A 2F35A 1LAGE 1IXGA 2OCUA 1SW1A 3MYUA 4ZEIA 1YXIA 4XKQA 4XTCQ 5ICTA 1FPKA 1XVYA 3T93B 4U21A 1II5A 3ILUB 2ZZXA 4QBAA 1B1HA 3M8UA 3B6TA 5I2NA 1LGBC 5EHMA 5LDZA 1Q35A 3DM0A 3WAFA 4NF5B 1AWBA 3O6GA 3LSLA 4G61A 5I58B 2D21A 1ZMGA 2QJEA 4NTLA 5CBSA 5JEIA 4OXVA 4OVPA 2D5WA 4FECA 2VD2A 5TU0A 2B4LA 1ZTYA 4LVQA 4PGPA 3BFTA 2Y7IA 3PPOA 4O3CA 4AB5A 3CIJA 5CM6A 1B3HA 2XXPA 2P3NA 2V93A 3K1NA 2XWKA 2PCRA 3FJGA 2REJA 5B70A 3D4GA 4PFBA 1EYKA 1LB8A 3LBSA 3U8QA 1FTOA 4GVOA 1UIVA 4IGRA 2O69A 2P1SA 1OVTA 2OWSA 5AE4A 3IOTA 3TEPA 3CFXA 4P11A 4BDMA 4I8CA 2I4CA 3EN3A 5I58A 5J16A 4NF8B 3ROJA 2OK2A 4YKKA 5J1DA 2I6EA 3KEIA 4AQ4A 3H06B 1Y3QA 5LOMA 1JVYA 3GBAA 1FQAA 4ZDMA 3T22A 4F29A 3LR1A 4LUBA 4XKRA 1IMEA 4ISUA 4GWYA 1FPFA 1MM7A 5CMKA 2XD3A 1FW0A 1ATGA 1Y3PA 2ZZVA 4LQ5A 1JW5A 3W9VA 3O2AA 2RC9A 2Y7PA 4P9KA 2AYSA 2HPGA 2ZYMA 3H7MA 4LA9A 4OA4A 2ZYKA 1N04A 2VHAA 3TUSA 4QRZA 2FA7A 1XVXA 4GFRA 3PUXE 4PFIA 4GQOA 3VXBA 2PYYA 3TTMA 3MP8A 4BDNA 1UTBB 3L6HA 1RDXA 3C9HA 3ZS6A 4GX3A 3U92A 1T0KA 2XWVA 4F18A 5FBPA 2D3IA 5AA2A 4POWA 1M5DA 3CG3A 4GXAA 1POTA 3VVEA 1K9ZA 3PMVA 5I84A 2O7UA 5CBRA 3IO4A 3IB2A 3IFCA 1IQ7A 2KR0A 5L9MA 4IY5A 4QSCA 4I40A 2QVVA 2XXKA 3K2DA 1BIYA 1URGA 4OEVA 3G3JA 5EQ7A 1MY3A 3TELA 3EPEA 3N5LA 3HO7A 4WXJA 4RA1A 3MZBA 3O29A 5K2XA 3V89B 3HFUA 4EXLA 3RT8A 3JZJA 4H8JA 2W7YA 4PFRA 5DT6A 3QMFA 3U72A 4Q30B 3DP4A 2Y5KA 3IL1B 1IZ1A 3PU5A 1M5FA 1UTHA 5JTYA 5DYHA 3CG1A 2I3WA 4I1DA 1RYXA 4GBVA 3BIGA 3SEYA 3GLBA 2V3QA 1RYOA 4IO5A 1B05A 1QUKA 4AB6A 4Q8RA 3OENA 3T9UA 5B7DA 1LBXA 4N8GA 4KPTA 4NN3A 4ZECA 4LZ7A 2QFLA 1FQFA 4ZZAA 2HXRA 3LSXA 2X7QA 1P1QA 4DDDA 4RJZA 4MLQA 4OFOA 4QSDA 2XXXA 1OMPA 4R9GA 2OWTA 3RLFE 1Y4CA 1I6BA 3OMBA 4MMPA 3CFLA 2E1SA 4IB2A 3GBBA 5BWJA 5EHSA 5I59A 2L5VA 1N3WA 3V5AA 2F34A 2DE2A 4E0WA 4YAHX 3MVYA 4HE1A 2RF1A 2R8TA 4DI3D 4RY1A 4KD5A 4KCCA 1FRPA 1LEVA 1FPIA 2B3BA 2Y84A 2Z23A 2VD3A 1B5IA 5A5LA 2CZHA 4LATA 2PFYA 4MNPA 4LP2B 3SKPA 4GLIA 1MDQA 3ZKKA 3MP1A 3MWBA 3ILTB 3MAMA 1US5A 2ONSA 1Q9DA 4GWSA 3FGSA 1N3XA 3PTYA 4NF6B 4OYVA 1INPA 3HCQA 3KSJA 2H5YA 5H8NA 2FNCA 1ANFA 3EHUA 3TQWA 2XXTA 4BDLA 2GRVA 1MXVA 3OOAA 3PD8A 5ISUA 4G8NA 4F3SA 1EYIA 2Y7WA 1YAEA 4PBQA 3R6UA 3RUMA 4NF8A 4ZEKA 2DYXA 2O84X 3RN8A 4YKPA 2G29A 3FV2A 4KHZE 4H45A 2P0SA 2WYPA 4KR5A 4N6KA 3JV9A 4P0GA 4K3FA 3DP6A 2PMSA 3U65A 4N81A 1IXCA 5KDTA 2ZMBA 3SEWA 4NF4B 2QRYA 4HE0A 4H1XA 2O6AA 1Z7ME 1M5CA 3G3GA 3TTLA 4GWZA 2XXUA 5JTYB 4QFNA 1B5JA 5IZ3A 4JWYA 4HXVA 1LBCA 3MVZA 3FIRA 3LUYA 1JVXA 4WEPA 4NGUA 1QGXA 1BLFA 4PDHA 3JYRA 4IO6A 4F31B 4MHFA 3IR1A 3T1BA 4H46A 3BFUA 3C4MA 3GXAA 1GTKA 1SW4A 2DWAA 2NUVA 3B6WA 1NV5A 1US4A 1IUDA 2GHAA 4R6YA 2HFBA 4Z0IA 3KOTA 5CMMA 3RQTA 4NMYA 1B51A 1MY2A 5TPAB 2QS1A 4R2FA 3QSLA 2RKMA 1FJ9A 2DWIA 1IXHA 4U4SA 5IAIA 5I7IA 2XXRA 3TQLA 1FPJA 5EQ8A 2UYFA 4JWOA 2DOJA 2HCAA 3MPKA 1FCKA 5CRYA 2QS4A 2VP1A 5IKBA 4PFTA 1QVSA 2F7AA 1URDA 2VPOA 1I6AA 4MNIA 1DBZA 1MQIA 2XWIA 2Z8EA 1VFEA 1IMFA 4N8YA 3PUZE 4RK2A 5KCJA 4MLVA 1YYZA 3G7WA 3KC0A 2HZKA 2LAOA 1B7UA 4QF9A 4MCOA 5H8NB 1LB9A 2XX7A 4QFLA 4F19A 1AOVA 5CMCA 3LC8A 3LSFB 4MFIA 1IMBA 4ND9A 4Q0CA 1EU8A 1G0IA 3FXRA 3OEKA 4POXA 2H99A 1MRPA 3KFMA 1K9YA 3CSGA 3EHSA 3SZPA 3RYDA 1LLSA 1N7XA 3IB1A 1P99A 1H76A 3Q26A 1XOCA 3OO9A 4GXSB 4Q5TA 3VFJA 2HEUA 3MC2A 1FTJA 3PPQA 2UYEA 3FJ7A 5JK4A 4G77A 4N07A 4PBHA 3THIA 3K01A 2A5TB 3Q29A 1B32A 2OZZA 5T3JA 3C35A 4N4UA 4EF1A 4F2OA 4GL8A 4LN5A 2F97A 2ESNA 4F3PA 3P7IA 1Y3NA 5H8QB 1JW4A 3E9XA 4H65A 2X7PA 2YJPA 3UP9A 3KBRA 4BLAA 1AIVA 2RC8A 1NUZA 3E3KA 3ISPA 3SETA 2RCBA 2ABHA 5L8DA 3H6TA 4PDDA 1G0HA 4PE3A 1O63A 3DLNA 4LZ8A 1MG1A 5DEXA 3UA8A 1D9YA 3H6VA 1NV1A 1NV3A 2V3TA 2I0BA 4GRKA 3PD9A 5H8FB 1NV7A 2PT2A 1BK4A 4R75A 4PFUA 1Y9UA 5BUUA 4O3AA 1MS7A 1H43A 4JB7A 5HPQA 1IXIA 4NF0A 4O7MA 1H3DA 2XXWA 3FJMA 3T0JA 5CMBA 1TT1A 2CZLA 1MPDA 3IJXB 4X1DA 3U93A 2DVZA 2RC7A 4GWXA 1MDP1 1QKAA 2XWOA 3C31A 1WVJA 3K6VA 3U1OA 2UXAA 5ET7A 3HN0A 5DW8A 4YKIA 3TFLA 3G3KA 3UORA 2NVUB 4OENA 1B3FA 1VE4A 1JETA 3KOSA 1YPNA 4RK9A 1EH3A 4HS7A 3OO6A 3B8BA 3I6VA 2UVIA 5KDTB 4IO3A 2NXOA 2XXHA 3D1RA 5AA4A 3PPRA 3V8XB 3TYHA 4ELRA 3PUWE 4F3GA 1FTKA 1PC3A 4DLDA 2Q88A 1DPEA 4I62A 3W15C 1NH8A 5FHNA 1JP4A 1TFAA 4EF2A 4FAJA 2YLNA 1SBPA 4QFKA 5FTHA 4F1UA 4GBWA 3T9XB 2NOOA 4P1LA 2F6GA 2HQ0A 3E4RA 3M3LA 3BIHA 2CZKA 2QMXA 4KXPA 2QSXA 4TOZA 3VDFA 3CI8A 3ECRA 3G3HA 4P8BA 1PBPA 2GHBA 4NWCA 3PMXA 4PAKA 5ITPA 2I58A 3LV0A 4DIGA 4R72A 3K1PA 4GWOA 1NUXA 1A8EA 3VXCA 3UGWA 4NG7A 3QUFA 5I5PA 4R73A 4OETA 3OXNA 3KN7A 3S9NC 1GV8A 3K0VA 2R71A 1MQGA 1MXXA 1P1NA 2XXQA 4PFWA 1B4HA 3TAJA 4DXCA 1FBCA 4OHNA 2THIA 2F7CA 5H8FA 3RY3A 2P3VA 2KQZA 2F8DA 5AA2B 3T66A 2XXIA 1M5BA 4NF4A 1D4NA 4UABA 5DVJA 1B2HA 4OTEA 1MQJA 4BDOA 4LZ5A 1N76A 4QHQA 1MXZA 1RDZA 1MQHA 4YZZA 5DTBA 2HAVA 2FHYA 2DQVA 5EQAA 3IOUA 5F24A 1DK4A 1LFHA 2A5SA 4N15A 3T96B 2Y7RA 4FBPA 3O97A 2P2AA 5L9SA 1B40A 4FJPA 2VPNA 1UIUA 3T9HB 3C33A 5I2KB 4YU0A 3H03A 2OLBA 3E13X 3CVGA 5I59B 1JW1A 2HHMA 3N6UA 3IX1A 2QL3A 4DI4B 4N6PA 4ZEBA 1LFGA 5TPAA 4R74A 2DXRA 4NX1A 3TZAA 4O7IA 5ICQA 1J1NA 1NV4A 2PVUA 4IO2A 1B0LA 4EQ7A 3N94A 1PB8A 2Q8JA 1SI1A 4P0IA 5KCJB 4MEVA 2XX8A 4F22A 1DTGA 1B52A 1QW0A 3N26A 1D9VA 2RCAA 3R7XA 2WYKA 2DDKA 3MVXA 5ELVA 5EQ9A 4N91A 1FPEA 1UTBA 4F1YA 1MY1A 4OESA 4OZ9A 2H9BA 3TTNA 4PC9A 2JJKA 1B5HA 4FATA 1DSNA 2Y5LA 4HCWA 1VSOA 2ONKE 3RNNA 4KI0E 1FBDA 4XIGQ 4AS5A 4PE5B 1D9QA 4UA8A 3VVFA 5EYHA 1SD3A 2UVHA 4ESXA 4WKMA 1JNFA 2QS3A 4MNCA 1B58A 4H6DA 3R26A 1ZIUA 3VLWA 1LBBA 4I9DA 1TFDA 1USYE 4G68C 4OMBA 4LONB 1NUWA 3HPIA 1LAXA 2BJIA 2F36A 1A8FA 4EQ9A 1S9TA 3KN8A 3S9MC 4DZ1A 5TP9A 3QUJA 3OD7A 4EUOA 1EZ9A 3IOVA 1XHYA 3TCHA 3A29A 4YB5A 3MZ1A 3HHGA 1FTAA 2Y7KA 3KN3A 1SQYA 3NOHA 2AIXA 3KSXA 4AS4A 3PV0E 4RNSA 3H6WA 1OIBA 4OVSA 1FBFA 3OSRA 2XXVA 5AA4B 5F1QA 1LAFE 2XD2A 3GZGA 4H0WA 1S50A 4M1VA 4ELOA 3H4ZA 1P1OA 3O6HA 1B0HA 3CSBA 2Q74A 4X9TA 1B7HA 2QMWA 5IZ1A 3PPNA 3BBRA 4U4XA 3USDA 4JVDA 1O7TA 5TP9B 3U94A 1NUYA 4GOTA 4PF8A 2NWJA 3UK4A 2XA5A 5AA1A 4U1ZA 1Y4TA 4OEUA 1FBEA 1PEBA 4PQJA 2QVUA 5CC2A 2DP8A 4PCDA 5FHMA 4U2RA 1QUJA 4Z7EA 1H44A 4IO7A 2CEXA 4G8MA 4H8IA 1B3EA 3L6GA 2F78A 4PFYA 4H67A 4I3YA 1A99A 3RPLA 3I3VA 5I56B 2PT1A 1Q1KA 3DELB 3Q27A 4MX6A 1DOTA 1XS5A 2OX3A 1SYIA 2O51A 1B3GA 4JVIA 3TMGA 2WBDA 3PPPA 1SI0A 1URSA 3KC1A 1FPLA 4PGNA 4GIZA 2WKYA 3TTRA 4XKPA 1AL3A 1MH3A 1FSAA 4GWUA 3A09A 4XF5A 2MKZA 5H8SA 4GD5A 4F3BA 3RTWB 3ONMA 3IFAA 4M4GA 4KQPA 3FXBA 3QK6A 3W9WA 5CI5A 4BDQA 1PB9A 1QKBA 1FPDA 1NNKA 4ZEFA 3F11A 1LBWA 1SVXB 1MXWA 2IEEA 4WEDA 2ZYOA 1SYHA 1BP5A 4MF3A 5ET5A 1MY0A 5AA2D 1QJMA 4F1VA 3T9VA 4MJOA 4NE4A 4OVJA 2I4BA 3QAXA 1USYH 5H8HA 3TKDA 4JSOA 1MPBA 3QXMA 3FATA 2F7BA 4MAGA 4RYAA 4G2ZA 2CEYA 4EXKA 3AXFA 2GFEA 4YMBA 4X48A 3HHFA 4C0RA 1MPCA 2QPQA 4X1BA 3RT6B 4R6HA 4H5FA 2V84A 3MBPA 4JVCA 4NF6A 4ELPA 5F7VA 3ODBA 4XKNA 3MP6A 3G3FA 1IEJA 1VFDA 1UTHB 1YCJA 1KA1A 2O1LA 3K1MA 3D4CA 4NF5A 2YPNA 2CZIA 2X26A 3K6UA 3H3GA 3CHGA 4PP0A 4G68B 3S2VA 5DVFA 4YB7A 3B7DA 4YKJA 2UVJA 3OELA 1FTMA 4HCYA 4MBPA 5H8HB 2RINA 4GX4A 3MVWA 4ECFA 2F5XA 4TQUQ 4N13A 1FQEA 5ET6A 1Z7NE 3S9EA 4OVRA 4YB6A 1NNPA 3FBPA 4RPNA 2ZYNA 2XX9A 1WDNA 3M3FA 4PTKA 4NQ8A 1MXUA 4N17A 5LTCA 1LBYA 2XHDA 1GGGA 2F3BA 4OWDA 1R1NA 4JDFA 4EDPA 1NFTA 3EF7A 4G4PA 2G93A 5I57A 2BJJX 5K2YA 2DE3A 5A5XA 3QYTA 1O64A 4F2QA 5I2NB 2HXWA 2FIEA 3MW0A 4YMAA 1FQDA 4U22A 3S4UA 4DXUA 1Y20A 3FZVA 2Q89A 1NL5A 1RKMA 4PAIA 1SW5A 4IO4A 1L5TA 4FORA 2ZXTA 3TODA 2VT5A 4ZZEA 1ELJA 4DCYA 5HBCA 5FTIA 2ZZWA 3PUYE 1MXYA 1A54A 1KWHA 4P56A 4OERA 1NV6A 3RPLB 4JXIA 4GF8A 3GYYA 4RPOA 2ALUA 2Z8FA 1FBGA 2H98A 1FQBA 3EHTA 1OLAA 3KJ7A 2Q2CA 1OQHA 2V3UA 5ITOA 3PUVE 5IZ3B 1GR2A 4FIMA 4TLLB 1R9LA 1R9QA 4L17A 4RXLA 1D3KA 2M8CA 3K02A 2KLFA 1A7LA 4QSEA 2R6GE 2DWJA 4OANA 5I56A 2A5TA 1LSTA 3HV1A 4BDRA 3VLUA 1ZKBA 4NAPA 4MIJA 2R9JA 3OO8A 1B46A 4OFLA 4U1OA 3BKIB 1SW2A 5KZTA 2Q8MA 4E0XA 1JEVA 2I49A 2Q9TA 3K00A 1HSLA 1PBQA 3PGFA 2F3DA 4OQOA 1M5EA 1FBPA 2CMOA 1DCUA 1B3LA 1P1UA 3IK6B 4EQBA 4KYDA 2DS9A 3IORA 4I3EA 5L9OA 1LCTA 1I69A 1DTZA 4ONYA 5DVIA 3FV1A 4X8RA 3IOWA 3ZSFA 3IAZA 3H6UA 1LFIA 4NEDA 1N0TA 1ZLQA 1MM6A 3FUZA 5IM2A 1PDAA 4JWXA 2I0CA 3TDJA 3RTFB 4NHBA 1JQFA 4FEDA 3OEMA 1F9BA 1FQCA 3IJOB 1HSEA 3K4UA 4TLMB 1FPGA 3KBZA 5FHOA 3SEVA 1I6QA 3CR9A 2IA4A 2QS2A 1B4ZA 1FBHA 1IITA 1NNFA 1IMDA 1DPPA 4IGTA 3TCGA 2H4IA 4XXUA 3ZKLA 4P1EA 1VDWA 2O1MA 5AA3A 4XEQA 3EKIA 3PMWA 2ZNTA 4PAFA 4QXDA 4KYSA 4G68A 3TTKA 1N7WA 3IO6A 4PF6A 1WODA 2H25A 4C1UA 4ELQA 1NV0A 3MZ9A 3FVOA 1KA0A 4ZS9A 1HSJA 3QIMA 3O9PA 1AH5A 4P47A 4FEBA 2VGQA 5ESYA 4KFQA 1NKXA 3SESA 1IMAA 3A3UA 1VR5A 5H8QA 1B9JA 3K6WA 3WAEA 3DP8A 4ESWA 1CNQA 4KCDA 3VE1B 1LBZA 3VLVA 1H45A 4R6KA 3OSQA 1ZJLA 3KZGA 3VVDA 1LCFA 2PBWA 2I3VA 3N6TA 1A55A 1LAHE 1JEUA 2O68A 3SERA 3B6QA 2AL5A 3Q25A 1QUIA 4IR8A 5I57B 2FYIA 2XXYA 5I2KA 3CFZA 1NMUA 2Q2AA 3Q28A 3B50A 4R9FA 1A40A 4F39A 3SDFA 2DE4A 1FPBA 2ZNSA 1XI6A 3FXQA 3CRBA 1NH7A 4R2BA 2B4MA 2DVCA 1GVCA 3G3IA 4XFEA 3V83A 1PB7A 4MH5A 2WBBA 4GX6A 2UVGA 2VOZA 1IMCA 1UQWA 3VV5A 2ONRA 4LQ2A 1OQGA 2Z22A 5ET8A 1IIWA 1B1XA 3FVNA 4H5GA 3E79A 4YICA 4IY6A 4DCXA 1LBVA 1FJ6A 3LSWA 1DMBA 2E0SA 3HSTA 2WX9A 4OVQA 3O28A 4HE2A 1EYJA 1NI9A 3IB0A 2Z8DA 1SPIA 1Y1MA 2I48A 3E78A 4G8HA 1TXFA 3KG2A 2AL4A 3C34A 3K6XA 4GWWA
chains in the Genus database with same CATH topology
1CB6A 3O6IA 2X26A 4RY1A 1MY4A 3K6UA 2XXIA 4KD5A 4KCCA 1M5BA 1R6ZA 3EQ1A 1D4NA 3H3GA 4NF4A 5A5XB 2B3BA 2Y84A 2Z23A 3RGYA 2VD3A 1B5IA 3C32A 4G68B 3FXUA 4PP0A 1B2HA 5DVFA 5DVJA 3O66A 3S2VA 4OTEA 3RPWA 4YB7A 2O7IA 2DXYA 3B7DA 1MQJA 2UVJA 3OELA 4JBZA 4YKJA 4BDOA 4PETA 4LZ5A 4LATA 1N76A 3WAFA 4DE8A 1FTMA 4HCYA 4LP2B 3SKPA 3FD3A 4QHQA 1POY1 4GLIA 2PX1A 4MBPA 1MDQA 1MXZA 1TWYA 5H8HB 3ZKKA 2RINA 3FASA 3MP1A 3MWBA 3ILTB 3MAMA 1US5A 1MH4A 1MQHA 3MVWA 3MPLA 2ONSA 4YZZA 4ECFA 2F5XA 5DTBA 3S9LC 3I5OA 2HAVA 1FTLA 1BTJA 4TQUQ 2DQVA 3FGSA 4QFPA 2OJTA 4N13A 3IOUA 1FQEA 5B7DA 1N3XA 4NF6B 1Z7NE 1ZBMA 3S9EA 4OYVA 1B7ZA 1LFHA 2A5SA 3HCQA 2DWHA 1OVBA 3KSJA 3OO7A 2H5YA 5H8NA 3T96B 4C1TA 2FNCA 4YB6A 5M2VA 1ANFA 3EHUA 1Y1ZA 1NNPA 2Y7RA 2XXTA 3TQWA 1SDXA 4RPNA 4BDLA 4DXBA 2GRVA 1MXVA 3O97A 4NWDA 5L9SA 2P2AA 3OOAA 1AMFA 2ZYNA 2XX9A 1WDNA 3M3FA 1B40A 2HZLA 3MQ9A 3PD8A 4FJPA 1MXUA 1P1WA 1UIUA 4G8NA 4F3SA 3UIFA 4RXLA 4HTGA 2Y7WA 1EZOA 1YAEA 1NNTA 3T9HB 3C33A 5I2KB 4OFJA 4YU0A 3H03A 2XHDA 3R6UA 3RUMA 2OLBA 3E13X 3FVGA 4KYEA 5CMKA 1GGGA 4NF8A 5EYFA 2DYXA 3MUQA 2HAUA 4ZEKA 2ZNUA 3CVGA 5I59B 1JW1A 2O84X 1YTVA 3RN8A 4YKPA 2G29A 3FV2A 4KHZE 4OWDA 4U23A 2P0SA 4ZE9A 1R1NA 4JDFA 4KR5A 4EDPA 1NFTA 3N6UA 1OLCA 3IX1A 3M3KA 3EF7A 1N84A 3JV9A 4G4PA 2G93A 2QL3A 4K3FA 1B6HA 4P0GA 4HW8A 3DP6A 1ZU0A 2PMSA 4N6PA 4ZEBA 3KGCA 5I57A 1BKAA 2BJJX 2DSFA 3C36A 5K2YA 1LFGA 3SEUA 1IXCA 3MJNA 1S7YA 4JSDA 5KDTA 2DE3A 4R74A 2ZMBA 3A3CA 5TPAA 4NF4B 2QRYA 3QYTA 3SEWA 5A5XA 2OBGA 2REGA 2DXRA 4H1XA 2O6AA 3TZAA 1EZPA 1O64A 3TCFA 4F2QA 5I2NB 1Z7ME 5ICQA 1M5CA 1J1NA 2ANJA 2HXWA 2PVUA 3G3GA 4UACA 4IO2A 1B0LA 2F6PA 3TTLA 5IKBA 3MW0A 4YMAA 1FQDA 4U22A 2XXUA 3S4UA 4DXUA 1Y20A 3FZVA 1XC1A 1MQDA 4QFNA 5JTYB 1B5JA 3N94A 4O3BA 1PB8A 4JWYA 2Q89A 1NL5A 1RKMA 1LBCA 3MVZA 4FE8A 1SI1A 3FIRA 4P0IA 3LUYA 1JVXA 2Q8JA 5KCJB 2B3FA 1SW5A 4WEPA 4IO4A 1BLFA 1L5TA 4FORA 5HM4B 2XX8A 3JYRA 4F22A 4IO6A 4ZEDA 2ZXTA 4F31B 2GH9A 3KJTA 3TODA 1CE2A 4ZE8A 1B52A 1DTGA 3IR1A 3FVKA 1QW0A 3N26A 4THIA 3UN6A 2B65A 3TPAA 1D9VA 2RCAA 4ZZEA 4GL0A 3R7XA 3BFUA 4QFOA 2V25A 3C4MA 1QULA 3MVXA 5DEXB 3GXAA 5ELVA 1ELJA 4DCYA 1UTBA 4F1YA 1MY1A 4OESA 4OZ9A 1GTKA 4DLDA 2H9BA 1XT8A 2F35A 3TTNA 1SW4A 2DWAA 2NUVA 3B6WA 5HBCA 1LAGE 1US4A 1IUDA 1B5HA 5FTIA 1IXGA 2GHAA 2OCUA 4R6YA 1SW1A 4FATA 4ZEIA 1DSNA 3PUYE 4HCWA 1VSOA 2HFBA 2ONKE 4XKQA 4XTCQ 4EQ7A 5ICTA 4Z0IA 1MXYA 3RNNA 1A54A 3KOTA 1XVYA 5CMMA 3T93B 4KI0E 4U21A 1KWHA 3RQTA 4NMYA 4XIGQ 4PE5B 3VVFA 4UA8A 4OERA 1B51A 1MY2A 1II5A 2QS1A 3ILUB 4JXIA 5TPAB 1B1HA 3M8UA 4GF8A 4R2FA 3QSLA 1SD3A 2RKMA 2UVHA 3B6TA 4RPOA 2DWIA 1IXHA 2ALUA 4U4SA 5I2NA 5IAIA 2Z8FA 2H98A 1LGBC 2XXRA 1FQBA 3EHTA 1OLAA 3KJ7A 3TQLA 4WKMA 5EHMA 2Q2CA 1OQHA 2UYFA 2V3UA 4ESXA 4JWOA 5ITOA 2DOJA 3PUVE 1JNFA 1GR2A 4FIMA 4TLLB 2HCAA 2QS3A 1FCKA 1R9LA 1R9QA 3MPKA 5CRYA 1Q35A 2QS4A 1B58A 3DM0A 4H6DA 1D3KA 2M8CA 4L17A 2VP1A 3K02A 4NF5B 2KLFA 3R26A 1A7LA 3O6GA 1ZIUA 3LSLA 4PFTA 2R6GE 1LBBA 4QSEA 4I9DA 1TFDA 3VLWA 1QVSA 1USYE 2DWJA 2F7AA 2A5TA 4G68C 5I58B 5I56A 1LSTA 4OMBA 3HV1A 1URDA 2D21A 1ZMGA 4LONB 1I6AA 2QJEA 3HPIA 4NTLA 5CBSA 5JEIA 4BDRA 1MQIA 4OXVA 1LAXA 2D5WA 4FECA 3VLUA 1ZKBA 2VD2A 5TU0A 2F36A 1A8FA 2R9JA 2Z8EA 4EQ9A 1S9TA 3OO8A 1ZTYA 1B46A 4OFLA 4LVQA 1VFEA 3BKIB 4U1OA 3BFTA 1SW2A 3KN8A 3PUZE 4RK2A 5KCJA 2Y7IA 3PPOA 3S9MC 4MLVA 4O3CA 4DZ1A 5TP9A 3QUJA 3G7WA 4E0XA 5KZTA 1JEVA 4AB5A 2HZKA 2LAOA 1B7UA 3CIJA 3OD7A 1B3HA 2XXPA 2I49A 4QF9A 5CM6A 5H8NB 2Q9TA 3K00A 4EUOA 2V93A 1EZ9A 3K1NA 1HSLA 1LB9A 2XX7A 4QFLA 1PBQA 4F19A 3PGFA 1AOVA 4OQOA 3IOVA 5CMCA 3FJGA 1M5EA 1XHYA 2REJA 3TCHA 3LC8A 3LSFB 4MFIA 5B70A 2CMOA 4YB5A 3MZ1A 3HHGA 1B3LA 4ND9A 3D4GA 4Q0CA 1P1UA 3IK6B 2Y7KA 3KN3A 1EU8A 1LB8A 3LBSA 3U8QA 4EQBA 1FTOA 1SQYA 4GVOA 3FXRA 3OEKA 4KYDA 2H99A 2DS9A 3IORA 1MRPA 1UIVA 4POXA 3KFMA 3CSGA 3EHSA 4IGRA 2O69A 2P1SA 1OVTA 2OWSA 5L9OA 1LCTA 1LLSA 1I69A 1N7XA 5AE4A 1DTZA 2AIXA 3IB1A 1P99A 3KSXA 4ONYA 1H76A 3PV0E 3Q26A 3IOTA 4RNSA 1XOCA 3TEPA 3OO9A 3CFXA 4GXSB 4P11A 3H6WA 4Q5TA 1OIBA 4I8CA 5DVIA 2I4CA 3EN3A 3OSRA 3FV1A 3VFJA 3IOWA 3ZSFA 5I58A 2XXVA 3IAZA 3H6UA 1LFIA 4NEDA 4NF8B 1N0TA 2HEUA 3MC2A 5F1QA 5AA4B 1ZLQA 1MM6A 1LAFE 2OK2A 3FUZA 1PDAA 2I6EA 4YKKA 1FTJA 5J1DA 3KEIA 4JWXA 2XD2A 3GZGA 3PPQA 4AQ4A 3H06B 2I0CA 4H0WA 2UYEA 3FJ7A 3TDJA 3RTFB 1Y3QA 5JK4A 1S50A 1JQFA 4FEDA 3OEMA 1F9BA 4G77A 1FQCA 4M1VA 4N07A 4ELOA 3IJOB 5LOMA 3H4ZA 1P1OA 3O6HA 3THIA 1HSEA 1JVYA 1B0HA 3CSBA 3K01A 2A5TB 3K4UA 3GBAA 3Q29A 4TLMB 1B32A 1FQAA 5FHOA 3SEVA 1I6QA 4X9TA 4ZDMA 3CR9A 3T22A 1B7HA 4F29A 3LR1A 4LUBA 4XKRA 2OZZA 2IA4A 4ISUA 2QMWA 3C35A 3PPNA 4EF1A 4F2OA 3BBRA 4U4XA 2QS2A 1B4ZA 4GL8A 1MM7A 3USDA 1IITA 1NNFA 2ESNA 2F97A 1O7TA 1Y3NA 2XD3A 1FW0A 1ATGA 1Y3PA 3P7IA 5H8QB 4LQ5A 1DPPA 1JW5A 3W9VA 1JW4A 5TP9B 3O2AA 4IGTA 3TCGA 3E9XA 4H65A 3U94A 4GOTA 2RC9A 2X7PA 2YJPA 2H4IA 2Y7PA 4XXUA 2NWJA 3UK4A 3UP9A 3KBRA 3ZKLA 2AYSA 4BLAA 1AIVA 2RC8A 5AA1A 2ZYMA 3E3KA 4U1ZA 3H7MA 4LA9A 3SETA 2RCBA 2ZYKA 2ABHA 1N04A 1Y4TA 4OEUA 5L8DA 2O1MA 5AA3A 2VHAA 1PEBA 3H6TA 3TUSA 4QRZA 4PQJA 2FA7A 5CC2A 1O63A 2DP8A 3DLNA 1XVXA 3PMWA 2ZNTA 4LZ8A 4GFRA 1MG1A 3PUXE 5DEXA 5FHMA 4U2RA 3UA8A 1D9YA 3H6VA 4GQOA 2PYYA 4KYSA 3MP8A 1QUJA 3TTMA 3VXBA 1UTBB 4BDNA 4Z7EA 3L6HA 2V3TA 3C9HA 4G68A 3TTKA 3ZS6A 2I0BA 1H44A 4GRKA 4IO7A 1N7WA 4G8MA 3U92A 3IO6A 1T0KA 4H8IA 3PD9A 1WODA 4F3PA 4F18A 2H25A 1B3EA 3L6GA 5H8FB 4C1UA 2F78A 4ELQA 2PT2A 2D3IA 4PFYA 3MZ9A 3FVOA 4H67A 5AA2A 4R75A 4POWA 1A99A 4PFUA 1Y9UA 5BUUA 4O3AA 4ZS9A 1M5DA 1HSJA 1H43A 1MS7A 3I3VA 3CG3A 4JB7A 1IXIA 3O9PA 3QIMA 5HPQA 4GXAA 1AH5A 5I56B 1POTA 1H3DA 2VGQA 4FEBA 3VVEA 4KFQA 1NKXA 2PT1A 1Q1KA 3SESA 3DELB 3A3UA 3Q27A 1DOTA 1VR5A 2XXWA 3PMVA 3FJMA 5H8QA 1B9JA 1XS5A 5CMBA 5I84A 1TT1A 2CZLA 2O7UA 1SYIA 3IO4A 3IB2A 3K6WA 5CBRA 1MPDA 2O51A 3IJXB 4X1DA 1B3GA 3U93A 1IQ7A 4BDMA 2DVZA 3WAEA 3DP8A 4ESWA 2RC7A 4KCDA 4IY5A 5L9MA 3TMGA 3VE1B 4QSCA 3PPPA 1MDP1 1SI0A 1URSA 3VLVA 1QKAA 3C31A 1WVJA 1H45A 3K6VA 3K2DA 3OSQA 4R6KA 2UXAA 3U1OA 1BIYA 3HN0A 1ZJLA 1URGA 3KZGA 4OEVA 4GIZA 3G3JA 3VVDA 1MY3A 4YKIA 3EPEA 2WKYA 3TFLA 3TELA 1LCFA 2PBWA 2I3VA 3N5LA 3G3KA 3N6TA 3UORA 3TTRA 4XKPA 2NVUB 1AL3A 3HO7A 1MH3A 4OENA 1B3FA 1VE4A 1A55A 1LAHE 3A09A 1JETA 4RA1A 3MZBA 4WXJA 3KOSA 1YPNA 3O29A 5H8SA 5K2XA 4RK9A 3SEXA 3V89B 1JEUA 2O68A 4GD5A 4EXLA 3SERA 4F3BA 3RTWB 3ONMA 3B6QA 2AL5A 3Q25A 1EH3A 4KQPA 4M4GA 1QUIA 4HS7A 3JZJA 2FYIA 3RT8A 5I57B 2XXYA 2W7YA 3OO6A 3CFZA 4H8JA 5I2KA 3QK6A 3W9WA 1NMUA 3I6VA 5CI5A 5DT6A 4BDQA 2Q2AA 2UVIA 1PB9A 5KDTB 1QKBA 3U72A 1NNKA 4IO3A 4Q30B 3DP4A 4ZEFA 2NXOA 2XXHA 3Q28A 5AA4A 3IL1B 4R9FA 3PPRA 3V8XB 1A40A 4F39A 3SDFA 3TYHA 1IZ1A 2DE4A 4ELRA 3F11A 1SVXB 2ZNSA 3PUWE 4F3GA 1MXWA 2IEEA 3FXQA 3PU5A 4WEDA 1FTKA 1M5FA 1UTHA 5JTYA 3CRBA 2ZYOA 5DYHA 1NH7A 1PC3A 2I3WA 1SYHA 1BP5A 1DPEA 2Q88A 3CG1A 4I1DA 1RYXA 4I62A 4MF3A 4R2BA 3W15C 1NH8A 1MY0A 2DVCA 1GVCA 5FHNA 3G3IA 5AA2D 1QJMA 4F1VA 1PB7A 4MH5A 3SEYA 3GLBA 3V83A 1TFAA 2V3QA 1RYOA 3T9VA 4EF2A 4NE4A 4OVJA 2I4BA 2UVGA 3QAXA 4FAJA 4IO5A 2VOZA 1USYH 1B05A 5H8HA 2YLNA 1QUKA 1SBPA 4AB6A 1UQWA 3VV5A 4QFKA 2ONRA 3OENA 5FTHA 3T9UA 3T9XB 3TKDA 4LQ2A 4F1UA 2NOOA 4JSOA 2F6GA 1MPBA 1OQGA 1IIWA 1B1XA 2HQ0A 2Z22A 3E4RA 3FATA 3FVNA 3M3LA 3QXMA 2F7BA 4KPTA 2QMXA 4H5GA 2QSXA 4TOZA 3VDFA 3CI8A 4ZECA 4Q8RA 4LZ7A 3ECRA 3G3HA 4RYAA 1FQFA 1PBPA 4G2ZA 2GHBA 4NWCA 4ZZAA 3LSXA 4EXKA 3PMXA 2X7QA 4YICA 3AXFA 2GFEA 1P1QA 4YMBA 4X48A 3HHFA 4C0RA 1MPCA 2QPQA 4IY6A 4X1BA 5ITPA 3RT6B 4RJZA 4DDDA 4R6HA 4DCXA 2I58A 4MLQA 4H5FA 2V84A 4OFOA 4QSDA 4R72A 4DIGA 3K1PA 2XXXA 4GWOA 3LSWA 1OMPA 1A8EA 1DMBA 4R9GA 3VXCA 3UGWA 3MBPA 2OWTA 3QUFA 3RLFE 1Y4CA 5ISUA 1I6BA 4R73A 4NF6A 4OETA 2E0SA 3OXNA 4ELPA 3HSTA 3KN7A 3OMBA 5F7VA 3CFLA 1GV8A 2E1SA 3K0VA 3ODBA 4IB2A 3MP6A 3GBBA 2R71A 3O28A 4XKNA 5EHSA 5BWJA 1MQGA 3G3FA 1IEJA 5I59A 3S9NC 1MXXA 1N3WA 1P1NA 3IB0A 2Z8DA 2XXQA 1VFDA 1UTHB 3V5AA 2F34A 4PFWA 2DE2A 1B4HA 3TAJA 1YCJA 4DXCA 1Y1MA 2O1LA 4OHNA 2I48A 2THIA 3K1MA 4E0WA 4G8HA 3D4CA 4NF5A 1TXFA 2F7CA 3MVYA 3KG2A 2YPNA 4YAHX 3RY3A 2RF1A 5H8FA 2AL4A 2F8DA 3C34A 3K6XA 5AA2B 3T66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB6 A;  3O6I A;  2X26 A;  4RY1 A;  1MY4 A;  3K6U A;  2XXI A;  4KD5 A;  4KCC A;  1M5B A;  1R6Z A;  3EQ1 A;  1D4N A;  3H3G A;  4NF4 A;  5A5X B;  2B3B A;  2Y84 A;  2Z23 A;  3RGY A;  2VD3 A;  1B5I A;  3C32 A;  4G68 B;  3FXU A;  4PP0 A;  1B2H A;  5DVF A;  5DVJ A;  3O66 A;  3S2V A;  4OTE A;  3RPW A;  4YB7 A;  2O7I A;  2DXY A;  3B7D A;  1MQJ A;  2UVJ A;  3OEL A;  4JBZ A;  4YKJ A;  4BDO A;  4PET A;  4LZ5 A;  4LAT A;  1N76 A;  3WAF A;  4DE8 A;  1FTM A;  4HCY A;  4LP2 B;  3SKP A;  3FD3 A;  4QHQ A;  1POY 1;  4GLI A;  2PX1 A;  4MBP A;  1MDQ A;  1MXZ A;  1TWY A;  5H8H B;  3ZKK A;  2RIN A;  3FAS A;  3MP1 A;  3MWB A;  3ILT B;  3MAM A;  1US5 A;  1MH4 A;  1MQH A;  3MVW A;  3MPL A;  2ONS A;  4YZZ A;  4ECF A;  2F5X A;  5DTB A;  3S9L C;  3I5O A;  2HAV A;  1FTL A;  1BTJ A;  4TQU Q;  2DQV A;  3FGS A;  4QFP A;  2OJT A;  4N13 A;  3IOU A;  1FQE A;  5B7D A;  1N3X A;  4NF6 B;  1Z7N E;  1ZBM A;  3S9E A;  4OYV A;  1B7Z A;  1LFH A;  2A5S A;  3HCQ A;  2DWH A;  1OVB A;  3KSJ A;  3OO7 A;  2H5Y A;  5H8N A;  3T96 B;  4C1T A;  2FNC A;  4YB6 A;  5M2V A;  1ANF A;  3EHU A;  1Y1Z A;  1NNP A;  2Y7R A;  2XXT A;  3TQW A;  1SDX A;  4RPN A;  4BDL A;  4DXB A;  2GRV A;  1MXV A;  3O97 A;  4NWD A;  5L9S A;  2P2A A;  3OOA A;  1AMF A;  2ZYN A;  2XX9 A;  1WDN A;  3M3F A;  1B40 A;  2HZL A;  3MQ9 A;  3PD8 A;  4FJP A;  1MXU A;  1P1W A;  1UIU A;  4G8N A;  4F3S A;  3UIF A;  4RXL A;  4HTG A;  2Y7W A;  1EZO A;  1YAE A;  1NNT A;  3T9H B;  3C33 A;  5I2K B;  4OFJ A;  4YU0 A;  3H03 A;  2XHD A;  3R6U A;  3RUM A;  2OLB A;  3E13 X;  3FVG A;  4KYE A;  5CMK A;  1GGG A;  4NF8 A;  5EYF A;  2DYX A;  3MUQ A;  2HAU A;  4ZEK A;  2ZNU A;  3CVG A;  5I59 B;  1JW1 A;  2O84 X;  1YTV A;  3RN8 A;  4YKP A;  2G29 A;  3FV2 A;  4KHZ E;  4OWD A;  4U23 A;  2P0S A;  4ZE9 A;  1R1N A;  4JDF A;  4KR5 A;  4EDP A;  1NFT A;  3N6U A;  1OLC A;  3IX1 A;  3M3K A;  3EF7 A;  1N84 A;  3JV9 A;  4G4P A;  2G93 A;  2QL3 A;  4K3F A;  1B6H A;  4P0G A;  4HW8 A;  3DP6 A;  1ZU0 A;  2PMS A;  4N6P A;  4ZEB A;  3KGC A;  5I57 A;  1BKA A;  2BJJ X;  2DSF A;  3C36 A;  5K2Y A;  1LFG A;  3SEU A;  1IXC A;  3MJN A;  1S7Y A;  4JSD A;  5KDT A;  2DE3 A;  4R74 A;  2ZMB A;  3A3C A;  5TPA A;  4NF4 B;  2QRY A;  3QYT A;  3SEW A;  5A5X A;  2OBG A;  2REG A;  2DXR A;  4H1X A;  2O6A A;  3TZA A;  1EZP A;  1O64 A;  3TCF A;  4F2Q A;  5I2N B;  1Z7M E;  5ICQ A;  1M5C A;  1J1N A;  2ANJ A;  2HXW A;  2PVU A;  3G3G A;  4UAC A;  4IO2 A;  1B0L A;  2F6P A;  3TTL A;  5IKB A;  3MW0 A;  4YMA A;  1FQD A;  4U22 A;  2XXU A;  3S4U A;  4DXU A;  1Y20 A;  3FZV A;  1XC1 A;  1MQD A;  4QFN A;  5JTY B;  1B5J A;  3N94 A;  4O3B A;  1PB8 A;  4JWY A;  2Q89 A;  1NL5 A;  1RKM A;  1LBC A;  3MVZ A;  4FE8 A;  1SI1 A;  3FIR A;  4P0I A;  3LUY A;  1JVX A;  2Q8J A;  5KCJ B;  2B3F A;  1SW5 A;  4WEP A;  4IO4 A;  1BLF A;  1L5T A;  4FOR A;  5HM4 B;  2XX8 A;  3JYR A;  4F22 A;  4IO6 A;  4ZED A;  2ZXT A;  4F31 B;  2GH9 A;  3KJT A;  3TOD A;  1CE2 A;  4ZE8 A;  1B52 A;  1DTG A;  3IR1 A;  3FVK A;  1QW0 A;  3N26 A;  4THI A;  3UN6 A;  2B65 A;  3TPA A;  1D9V A;  2RCA A;  4ZZE A;  4GL0 A;  3R7X A;  3BFU A;  4QFO A;  2V25 A;  3C4M A;  1QUL A;  3MVX A;  5DEX B;  3GXA A;  5ELV A;  1ELJ A;  4DCY A;  1UTB A;  4F1Y A;  1MY1 A;  4OES A;  4OZ9 A;  1GTK A;  4DLD A;  2H9B A;  1XT8 A;  2F35 A;  3TTN A;  1SW4 A;  2DWA A;  2NUV A;  3B6W A;  5HBC A;  1LAG E;  1US4 A;  1IUD A;  1B5H A;  5FTI A;  1IXG A;  2GHA A;  2OCU A;  4R6Y A;  1SW1 A;  4FAT A;  4ZEI A;  1DSN A;  3PUY E;  4HCW A;  1VSO A;  2HFB A;  2ONK E;  4XKQ A;  4XTC Q;  4EQ7 A;  5ICT A;  4Z0I A;  1MXY A;  3RNN A;  1A54 A;  3KOT A;  1XVY A;  5CMM A;  3T93 B;  4KI0 E;  4U21 A;  1KWH A;  3RQT A;  4NMY A;  4XIG Q;  4PE5 B;  3VVF A;  4UA8 A;  4OER A;  1B51 A;  1MY2 A;  1II5 A;  2QS1 A;  3ILU B;  4JXI A;  5TPA B;  1B1H A;  3M8U A;  4GF8 A;  4R2F A;  3QSL A;  1SD3 A;  2RKM A;  2UVH A;  3B6T A;  4RPO A;  2DWI A;  1IXH A;  2ALU A;  4U4S A;  5I2N A;  5IAI A;  2Z8F A;  2H98 A;  1LGB C;  2XXR A;  1FQB A;  3EHT A;  1OLA A;  3KJ7 A;  3TQL A;  4WKM A;  5EHM A;  2Q2C A;  1OQH A;  2UYF A;  2V3U A;  4ESX A;  4JWO A;  5ITO A;  2DOJ A;  3PUV E;  1JNF A;  1GR2 A;  4FIM A;  4TLL B;  2HCA A;  2QS3 A;  1FCK A;  1R9L A;  1R9Q A;  3MPK A;  5CRY A;  1Q35 A;  2QS4 A;  1B58 A;  3DM0 A;  4H6D A;  1D3K A;  2M8C A;  4L17 A;  2VP1 A;  3K02 A;  4NF5 B;  2KLF A;  3R26 A;  1A7L A;  3O6G A;  1ZIU A;  3LSL A;  4PFT A;  2R6G E;  1LBB A;  4QSE A;  4I9D A;  1TFD A;  3VLW A;  1QVS A;  1USY E;  2DWJ A;  2F7A A;  2A5T A;  4G68 C;  5I58 B;  5I56 A;  1LST A;  4OMB A;  3HV1 A;  1URD A;  2D21 A;  1ZMG A;  4LON B;  1I6A A;  2QJE A;  3HPI A;  4NTL A;  5CBS A;  5JEI A;  4BDR A;  1MQI A;  4OXV A;  1LAX A;  2D5W A;  4FEC A;  3VLU A;  1ZKB A;  2VD2 A;  5TU0 A;  2F36 A;  1A8F A;  2R9J A;  2Z8E A;  4EQ9 A;  1S9T A;  3OO8 A;  1ZTY A;  1B46 A;  4OFL A;  4LVQ A;  1VFE A;  3BKI B;  4U1O A;  3BFT A;  1SW2 A;  3KN8 A;  3PUZ E;  4RK2 A;  5KCJ A;  2Y7I A;  3PPO A;  3S9M C;  4MLV A;  4O3C A;  4DZ1 A;  5TP9 A;  3QUJ A;  3G7W A;  4E0X A;  5KZT A;  1JEV A;  4AB5 A;  2HZK A;  2LAO A;  1B7U A;  3CIJ A;  3OD7 A;  1B3H A;  2XXP A;  2I49 A;  4QF9 A;  5CM6 A;  5H8N B;  2Q9T A;  3K00 A;  4EUO A;  2V93 A;  1EZ9 A;  3K1N A;  1HSL A;  1LB9 A;  2XX7 A;  4QFL A;  1PBQ A;  4F19 A;  3PGF A;  1AOV A;  4OQO A;  3IOV A;  5CMC A;  3FJG A;  1M5E A;  1XHY A;  2REJ A;  3TCH A;  3LC8 A;  3LSF B;  4MFI A;  5B70 A;  2CMO A;  4YB5 A;  3MZ1 A;  3HHG A;  1B3L A;  4ND9 A;  3D4G A;  4Q0C A;  1P1U A;  3IK6 B;  2Y7K A;  3KN3 A;  1EU8 A;  1LB8 A;  3LBS A;  3U8Q A;  4EQB A;  1FTO A;  1SQY A;  4GVO A;  3FXR A;  3OEK A;  4KYD A;  2H99 A;  2DS9 A;  3IOR A;  1MRP A;  1UIV A;  4POX A;  3KFM A;  3CSG A;  3EHS A;  4IGR A;  2O69 A;  2P1S A;  1OVT A;  2OWS A;  5L9O A;  1LCT A;  1LLS A;  1I69 A;  1N7X A;  5AE4 A;  1DTZ A;  2AIX A;  3IB1 A;  1P99 A;  3KSX A;  4ONY A;  1H76 A;  3PV0 E;  3Q26 A;  3IOT A;  4RNS A;  1XOC A;  3TEP A;  3OO9 A;  3CFX A;  4GXS B;  4P11 A;  3H6W A;  4Q5T A;  1OIB A;  4I8C A;  5DVI A;  2I4C A;  3EN3 A;  3OSR A;  3FV1 A;  3VFJ A;  3IOW A;  3ZSF A;  5I58 A;  2XXV A;  3IAZ A;  3H6U A;  1LFI A;  4NED A;  4NF8 B;  1N0T A;  2HEU A;  3MC2 A;  5F1Q A;  5AA4 B;  1ZLQ A;  1MM6 A;  1LAF E;  2OK2 A;  3FUZ A;  1PDA A;  2I6E A;  4YKK A;  1FTJ A;  5J1D A;  3KEI A;  4JWX A;  2XD2 A;  3GZG A;  3PPQ A;  4AQ4 A;  3H06 B;  2I0C A;  4H0W A;  2UYE A;  3FJ7 A;  3TDJ A;  3RTF B;  1Y3Q A;  5JK4 A;  1S50 A;  1JQF A;  4FED A;  3OEM A;  1F9B A;  4G77 A;  1FQC A;  4M1V A;  4N07 A;  4ELO A;  3IJO B;  5LOM A;  3H4Z A;  1P1O A;  3O6H A;  3THI A;  1HSE A;  1JVY A;  1B0H A;  3CSB A;  3K01 A;  2A5T B;  3K4U A;  3GBA A;  3Q29 A;  4TLM B;  1B32 A;  1FQA A;  5FHO A;  3SEV A;  1I6Q A;  4X9T A;  4ZDM A;  3CR9 A;  3T22 A;  1B7H A;  4F29 A;  3LR1 A;  4LUB A;  4XKR A;  2OZZ A;  2IA4 A;  4ISU A;  2QMW A;  3C35 A;  3PPN A;  4EF1 A;  4F2O A;  3BBR A;  4U4X A;  2QS2 A;  1B4Z A;  4GL8 A;  1MM7 A;  3USD A;  1IIT A;  1NNF A;  2ESN A;  2F97 A;  1O7T A;  1Y3N A;  2XD3 A;  1FW0 A;  1ATG A;  1Y3P A;  3P7I A;  5H8Q B;  4LQ5 A;  1DPP A;  1JW5 A;  3W9V A;  1JW4 A;  5TP9 B;  3O2A A;  4IGT A;  3TCG A;  3E9X A;  4H65 A;  3U94 A;  4GOT A;  2RC9 A;  2X7P A;  2YJP A;  2H4I A;  2Y7P A;  4XXU A;  2NWJ A;  3UK4 A;  3UP9 A;  3KBR A;  3ZKL A;  2AYS A;  4BLA A;  1AIV A;  2RC8 A;  5AA1 A;  2ZYM A;  3E3K A;  4U1Z A;  3H7M A;  4LA9 A;  3SET A;  2RCB A;  2ZYK A;  2ABH A;  1N04 A;  1Y4T A;  4OEU A;  5L8D A;  2O1M A;  5AA3 A;  2VHA A;  1PEB A;  3H6T A;  3TUS A;  4QRZ A;  4PQJ A;  2FA7 A;  5CC2 A;  1O63 A;  2DP8 A;  3DLN A;  1XVX A;  3PMW A;  2ZNT A;  4LZ8 A;  4GFR A;  1MG1 A;  3PUX E;  5DEX A;  5FHM A;  4U2R A;  3UA8 A;  1D9Y A;  3H6V A;  4GQO A;  2PYY A;  4KYS A;  3MP8 A;  1QUJ A;  3TTM A;  3VXB A;  1UTB B;  4BDN A;  4Z7E A;  3L6H A;  2V3T A;  3C9H A;  4G68 A;  3TTK A;  3ZS6 A;  2I0B A;  1H44 A;  4GRK A;  4IO7 A;  1N7W A;  4G8M A;  3U92 A;  3IO6 A;  1T0K A;  4H8I A;  3PD9 A;  1WOD A;  4F3P A;  4F18 A;  2H25 A;  1B3E A;  3L6G A;  5H8F B;  4C1U A;  2F78 A;  4ELQ A;  2PT2 A;  2D3I A;  4PFY A;  3MZ9 A;  3FVO A;  4H67 A;  5AA2 A;  4R75 A;  4POW A;  1A99 A;  4PFU A;  1Y9U A;  5BUU A;  4O3A A;  4ZS9 A;  1M5D A;  1HSJ A;  1H43 A;  1MS7 A;  3I3V A;  3CG3 A;  4JB7 A;  1IXI A;  3O9P A;  3QIM A;  5HPQ A;  4GXA A;  1AH5 A;  5I56 B;  1POT A;  1H3D A;  2VGQ A;  4FEB A;  3VVE A;  4KFQ A;  1NKX A;  2PT1 A;  1Q1K A;  3SES A;  3DEL B;  3A3U A;  3Q27 A;  1DOT A;  1VR5 A;  2XXW A;  3PMV A;  3FJM A;  5H8Q A;  1B9J A;  1XS5 A;  5CMB A;  5I84 A;  1TT1 A;  2CZL A;  2O7U A;  1SYI A;  3IO4 A;  3IB2 A;  3K6W A;  5CBR A;  1MPD A;  2O51 A;  3IJX B;  4X1D A;  1B3G A;  3U93 A;  1IQ7 A;  4BDM A;  2DVZ A;  3WAE A;  3DP8 A;  4ESW A;  2RC7 A;  4KCD A;  4IY5 A;  5L9M A;  3TMG A;  3VE1 B;  4QSC A;  3PPP A;  1MDP 1;  1SI0 A;  1URS A;  3VLV A;  1QKA A;  3C31 A;  1WVJ A;  1H45 A;  3K6V A;  3K2D A;  3OSQ A;  4R6K A;  2UXA A;  3U1O A;  1BIY A;  3HN0 A;  1ZJL A;  1URG A;  3KZG A;  4OEV A;  4GIZ A;  3G3J A;  3VVD A;  1MY3 A;  4YKI A;  3EPE A;  2WKY A;  3TFL A;  3TEL A;  1LCF A;  2PBW A;  2I3V A;  3N5L A;  3G3K A;  3N6T A;  3UOR A;  3TTR A;  4XKP A;  2NVU B;  1AL3 A;  3HO7 A;  1MH3 A;  4OEN A;  1B3F A;  1VE4 A;  1A55 A;  1LAH E;  3A09 A;  1JET A;  4RA1 A;  3MZB A;  4WXJ A;  3KOS A;  1YPN A;  3O29 A;  5H8S A;  5K2X A;  4RK9 A;  3SEX A;  3V89 B;  1JEU A;  2O68 A;  4GD5 A;  4EXL A;  3SER A;  4F3B A;  3RTW B;  3ONM A;  3B6Q A;  2AL5 A;  3Q25 A;  1EH3 A;  4KQP A;  4M4G A;  1QUI A;  4HS7 A;  3JZJ A;  2FYI A;  3RT8 A;  5I57 B;  2XXY A;  2W7Y A;  3OO6 A;  3CFZ A;  4H8J A;  5I2K A;  3QK6 A;  3W9W A;  1NMU A;  3I6V A;  5CI5 A;  5DT6 A;  4BDQ A;  2Q2A A;  2UVI A;  1PB9 A;  5KDT B;  1QKB A;  3U72 A;  1NNK A;  4IO3 A;  4Q30 B;  3DP4 A;  4ZEF A;  2NXO A;  2XXH A;  3Q28 A;  5AA4 A;  3IL1 B;  4R9F A;  3PPR A;  3V8X B;  1A40 A;  4F39 A;  3SDF A;  3TYH A;  1IZ1 A;  2DE4 A;  4ELR A;  3F11 A;  1SVX B;  2ZNS A;  3PUW E;  4F3G A;  1MXW A;  2IEE A;  3FXQ A;  3PU5 A;  4WED A;  1FTK A;  1M5F A;  1UTH A;  5JTY A;  3CRB A;  2ZYO A;  5DYH A;  1NH7 A;  1PC3 A;  2I3W A;  1SYH A;  1BP5 A;  1DPE A;  2Q88 A;  3CG1 A;  4I1D A;  1RYX A;  4I62 A;  4MF3 A;  4R2B A;  3W15 C;  1NH8 A;  1MY0 A;  2DVC A;  1GVC A;  5FHN A;  3G3I A;  5AA2 D;  1QJM A;  4F1V A;  1PB7 A;  4MH5 A;  3SEY A;  3GLB A;  3V83 A;  1TFA A;  2V3Q A;  1RYO A;  3T9V A;  4EF2 A;  4NE4 A;  4OVJ A;  2I4B A;  2UVG A;  3QAX A;  4FAJ A;  4IO5 A;  2VOZ A;  1USY H;  1B05 A;  5H8H A;  2YLN A;  1QUK A;  1SBP A;  4AB6 A;  1UQW A;  3VV5 A;  4QFK A;  2ONR A;  3OEN A;  5FTH A;  3T9U A;  3T9X B;  3TKD A;  4LQ2 A;  4F1U A;  2NOO A;  4JSO A;  2F6G A;  1MPB A;  1OQG A;  1IIW A;  1B1X A;  2HQ0 A;  2Z22 A;  3E4R A;  3FAT A;  3FVN A;  3M3L A;  3QXM A;  2F7B A;  4KPT A;  2QMX A;  4H5G A;  2QSX A;  4TOZ A;  3VDF A;  3CI8 A;  4ZEC A;  4Q8R A;  4LZ7 A;  3ECR A;  3G3H A;  4RYA A;  1FQF A;  1PBP A;  4G2Z A;  2GHB A;  4NWC A;  4ZZA A;  3LSX A;  4EXK A;  3PMX A;  2X7Q A;  4YIC A;  3AXF A;  2GFE A;  1P1Q A;  4YMB A;  4X48 A;  3HHF A;  4C0R A;  1MPC A;  2QPQ A;  4IY6 A;  4X1B A;  5ITP A;  3RT6 B;  4RJZ A;  4DDD A;  4R6H A;  4DCX A;  2I58 A;  4MLQ A;  4H5F A;  2V84 A;  4OFO A;  4QSD A;  4R72 A;  4DIG A;  3K1P A;  2XXX A;  4GWO A;  3LSW A;  1OMP A;  1A8E A;  1DMB A;  4R9G A;  3VXC A;  3UGW A;  3MBP A;  2OWT A;  3QUF A;  3RLF E;  1Y4C A;  5ISU A;  1I6B A;  4R73 A;  4NF6 A;  4OET A;  2E0S A;  3OXN A;  4ELP A;  3HST A;  3KN7 A;  3OMB A;  5F7V A;  3CFL A;  1GV8 A;  2E1S A;  3K0V A;  3ODB A;  4IB2 A;  3MP6 A;  3GBB A;  2R71 A;  3O28 A;  4XKN A;  5EHS A;  5BWJ A;  1MQG A;  3G3F A;  1IEJ A;  5I59 A;  3S9N C;  1MXX A;  1N3W A;  1P1N A;  3IB0 A;  2Z8D A;  2XXQ A;  1VFD A;  1UTH B;  3V5A A;  2F34 A;  4PFW A;  2DE2 A;  1B4H A;  3TAJ A;  1YCJ A;  4DXC A;  1Y1M A;  2O1L A;  4OHN A;  2I48 A;  2THI A;  3K1M A;  4E0W A;  4G8H A;  3D4C A;  4NF5 A;  1TXF A;  2F7C A;  3MVY A;  3KG2 A;  2YPN A;  4YAH X;  3RY3 A;  2RF1 A;  5H8F A;  2AL4 A;  2F8D A;  3C34 A;  3K6X A;  5AA2 B;  3T66 A; 
#chains in the Genus database with same CATH topology
 1CB6 A;  3O6I A;  4O8M A;  1MY4 A;  1R6Z A;  3EQ1 A;  5A5X B;  5IGA A;  3RGY A;  3C32 A;  3FXU A;  3O66 A;  3RPW A;  2O7I A;  2GQ1 A;  2DXY A;  4JBZ A;  4PET A;  4DE8 A;  5EYG A;  2FBP A;  3FD3 A;  1POY 1;  2PX1 A;  1TWY A;  5IZZ A;  3FAS A;  5I3S A;  1MH4 A;  1RDY A;  3MPL A;  3S9L C;  3I5O A;  1FTL A;  1BTJ A;  4QFP A;  2OJT A;  1NV2 A;  1ZBM A;  1B7Z A;  2DWH A;  1OVB A;  3OO7 A;  4C1T A;  5M2V A;  1Y1Z A;  4DXB A;  1SDX A;  2V4C A;  4NWD A;  1AMF A;  3SEX A;  3MQ9 A;  2HZL A;  1P1W A;  4O94 A;  2OWZ A;  3UIF A;  4HTG A;  1EZO A;  1NNT A;  4OFJ A;  4P3L A;  3FVG A;  4KYE A;  4N6D A;  5EYF A;  3MUQ A;  4X04 A;  2HAU A;  2ZNU A;  3LUZ A;  1YTV A;  4U23 A;  4ZE9 A;  1OLC A;  3M3K A;  1N84 A;  1B6H A;  4HW8 A;  1ZU0 A;  3KGC A;  1BKA A;  2DSF A;  3C36 A;  3SEU A;  3MJN A;  1S7Y A;  4JSD A;  2PFZ A;  3A3C A;  2OBG A;  2REG A;  1EZP A;  3TCF A;  3MST A;  2ANJ A;  4UAC A;  2F6P A;  1XC1 A;  1MQD A;  4O3B A;  2WEF A;  4FE8 A;  2B3F A;  4OVT A;  5HM4 B;  1YZ0 A;  4ZED A;  1KZ8 A;  2GH9 A;  3KJT A;  1CE2 A;  4ZE8 A;  3FVK A;  3UN6 A;  4THI A;  2B65 A;  3TPA A;  4GL0 A;  4QFO A;  2V25 A;  1QUL A;  5DEX B;  2FIX A;  2QVR A;  2FVZ A;  1XT8 A;  2F35 A;  1LAG E;  1IXG A;  2OCU A;  1SW1 A;  3MYU A;  4ZEI A;  1YXI A;  4XKQ A;  4XTC Q;  5ICT A;  1FPK A;  1XVY A;  3T93 B;  4U21 A;  1II5 A;  3ILU B;  2ZZX A;  4QBA A;  1B1H A;  3M8U A;  3B6T A;  5I2N A;  1LGB C;  5EHM A;  5LDZ A;  1Q35 A;  3DM0 A;  3WAF A;  4NF5 B;  1AWB A;  3O6G A;  3LSL A;  4G61 A;  5I58 B;  2D21 A;  1ZMG A;  2QJE A;  4NTL A;  5CBS A;  5JEI A;  4OXV A;  4OVP A;  2D5W A;  4FEC A;  2VD2 A;  5TU0 A;  2B4L A;  1ZTY A;  4LVQ A;  4PGP A;  3BFT A;  2Y7I A;  3PPO A;  4O3C A;  4AB5 A;  3CIJ A;  5CM6 A;  1B3H A;  2XXP A;  2P3N A;  2V93 A;  3K1N A;  2XWK A;  2PCR A;  3FJG A;  2REJ A;  5B70 A;  3D4G A;  4PFB A;  1EYK A;  1LB8 A;  3LBS A;  3U8Q A;  1FTO A;  4GVO A;  1UIV A;  4IGR A;  2O69 A;  2P1S A;  1OVT A;  2OWS A;  5AE4 A;  3IOT A;  3TEP A;  3CFX A;  4P11 A;  4BDM A;  4I8C A;  2I4C A;  3EN3 A;  5I58 A;  5J16 A;  4NF8 B;  3ROJ A;  2OK2 A;  4YKK A;  5J1D A;  2I6E A;  3KEI A;  4AQ4 A;  3H06 B;  1Y3Q A;  5LOM A;  1JVY A;  3GBA A;  1FQA A;  4ZDM A;  3T22 A;  4F29 A;  3LR1 A;  4LUB A;  4XKR A;  1IME A;  4ISU A;  4GWY A;  1FPF A;  1MM7 A;  5CMK A;  2XD3 A;  1FW0 A;  1ATG A;  1Y3P A;  2ZZV A;  4LQ5 A;  1JW5 A;  3W9V A;  3O2A A;  2RC9 A;  2Y7P A;  4P9K A;  2AYS A;  2HPG A;  2ZYM A;  3H7M A;  4LA9 A;  4OA4 A;  2ZYK A;  1N04 A;  2VHA A;  3TUS A;  4QRZ A;  2FA7 A;  1XVX A;  4GFR A;  3PUX E;  4PFI A;  4GQO A;  3VXB A;  2PYY A;  3TTM A;  3MP8 A;  4BDN A;  1UTB B;  3L6H A;  1RDX A;  3C9H A;  3ZS6 A;  4GX3 A;  3U92 A;  1T0K A;  2XWV A;  4F18 A;  5FBP A;  2D3I A;  5AA2 A;  4POW A;  1M5D A;  3CG3 A;  4GXA A;  1POT A;  3VVE A;  1K9Z A;  3PMV A;  5I84 A;  2O7U A;  5CBR A;  3IO4 A;  3IB2 A;  3IFC A;  1IQ7 A;  2KR0 A;  5L9M A;  4IY5 A;  4QSC A;  4I40 A;  2QVV A;  2XXK A;  3K2D A;  1BIY A;  1URG A;  4OEV A;  3G3J A;  5EQ7 A;  1MY3 A;  3TEL A;  3EPE A;  3N5L A;  3HO7 A;  4WXJ A;  4RA1 A;  3MZB A;  3O29 A;  5K2X A;  3V89 B;  3HFU A;  4EXL A;  3RT8 A;  3JZJ A;  4H8J A;  2W7Y A;  4PFR A;  5DT6 A;  3QMF A;  3U72 A;  4Q30 B;  3DP4 A;  2Y5K A;  3IL1 B;  1IZ1 A;  3PU5 A;  1M5F A;  1UTH A;  5JTY A;  5DYH A;  3CG1 A;  2I3W A;  4I1D A;  1RYX A;  4GBV A;  3BIG A;  3SEY A;  3GLB A;  2V3Q A;  1RYO A;  4IO5 A;  1B05 A;  1QUK A;  4AB6 A;  4Q8R A;  3OEN A;  3T9U A;  5B7D A;  1LBX A;  4N8G A;  4KPT A;  4NN3 A;  4ZEC A;  4LZ7 A;  2QFL A;  1FQF A;  4ZZA A;  2HXR A;  3LSX A;  2X7Q A;  1P1Q A;  4DDD A;  4RJZ A;  4MLQ A;  4OFO A;  4QSD A;  2XXX A;  1OMP A;  4R9G A;  2OWT A;  3RLF E;  1Y4C A;  1I6B A;  3OMB A;  4MMP A;  3CFL A;  2E1S A;  4IB2 A;  3GBB A;  5BWJ A;  5EHS A;  5I59 A;  2L5V A;  1N3W A;  3V5A A;  2F34 A;  2DE2 A;  4E0W A;  4YAH X;  3MVY A;  4HE1 A;  2RF1 A;  2R8T A;  4DI3 D;  4RY1 A;  4KD5 A;  4KCC A;  1FRP A;  1LEV A;  1FPI A;  2B3B A;  2Y84 A;  2Z23 A;  2VD3 A;  1B5I A;  5A5L A;  2CZH A;  4LAT A;  2PFY A;  4MNP A;  4LP2 B;  3SKP A;  4GLI A;  1MDQ A;  3ZKK A;  3MP1 A;  3MWB A;  3ILT B;  3MAM A;  1US5 A;  2ONS A;  1Q9D A;  4GWS A;  3FGS A;  1N3X A;  3PTY A;  4NF6 B;  4OYV A;  1INP A;  3HCQ A;  3KSJ A;  2H5Y A;  5H8N A;  2FNC A;  1ANF A;  3EHU A;  3TQW A;  2XXT A;  4BDL A;  2GRV A;  1MXV A;  3OOA A;  3PD8 A;  5ISU A;  4G8N A;  4F3S A;  1EYI A;  2Y7W A;  1YAE A;  4PBQ A;  3R6U A;  3RUM A;  4NF8 A;  4ZEK A;  2DYX A;  2O84 X;  3RN8 A;  4YKP A;  2G29 A;  3FV2 A;  4KHZ E;  4H45 A;  2P0S A;  2WYP A;  4KR5 A;  4N6K A;  3JV9 A;  4P0G A;  4K3F A;  3DP6 A;  2PMS A;  3U65 A;  4N81 A;  1IXC A;  5KDT A;  2ZMB A;  3SEW A;  4NF4 B;  2QRY A;  4HE0 A;  4H1X A;  2O6A A;  1Z7M E;  1M5C A;  3G3G A;  3TTL A;  4GWZ A;  2XXU A;  5JTY B;  4QFN A;  1B5J A;  5IZ3 A;  4JWY A;  4HXV A;  1LBC A;  3MVZ A;  3FIR A;  3LUY A;  1JVX A;  4WEP A;  4NGU A;  1QGX A;  1BLF A;  4PDH A;  3JYR A;  4IO6 A;  4F31 B;  4MHF A;  3IR1 A;  3T1B A;  4H46 A;  3BFU A;  3C4M A;  3GXA A;  1GTK A;  1SW4 A;  2DWA A;  2NUV A;  3B6W A;  1NV5 A;  1US4 A;  1IUD A;  2GHA A;  4R6Y A;  2HFB A;  4Z0I A;  3KOT A;  5CMM A;  3RQT A;  4NMY A;  1B51 A;  1MY2 A;  5TPA B;  2QS1 A;  4R2F A;  3QSL A;  2RKM A;  1FJ9 A;  2DWI A;  1IXH A;  4U4S A;  5IAI A;  5I7I A;  2XXR A;  3TQL A;  1FPJ A;  5EQ8 A;  2UYF A;  4JWO A;  2DOJ A;  2HCA A;  3MPK A;  1FCK A;  5CRY A;  2QS4 A;  2VP1 A;  5IKB A;  4PFT A;  1QVS A;  2F7A A;  1URD A;  2VPO A;  1I6A A;  4MNI A;  1DBZ A;  1MQI A;  2XWI A;  2Z8E A;  1VFE A;  1IMF A;  4N8Y A;  3PUZ E;  4RK2 A;  5KCJ A;  4MLV A;  1YYZ A;  3G7W A;  3KC0 A;  2HZK A;  2LAO A;  1B7U A;  4QF9 A;  4MCO A;  5H8N B;  1LB9 A;  2XX7 A;  4QFL A;  4F19 A;  1AOV A;  5CMC A;  3LC8 A;  3LSF B;  4MFI A;  1IMB A;  4ND9 A;  4Q0C A;  1EU8 A;  1G0I A;  3FXR A;  3OEK A;  4POX A;  2H99 A;  1MRP A;  3KFM A;  1K9Y A;  3CSG A;  3EHS A;  3SZP A;  3RYD A;  1LLS A;  1N7X A;  3IB1 A;  1P99 A;  1H76 A;  3Q26 A;  1XOC A;  3OO9 A;  4GXS B;  4Q5T A;  3VFJ A;  2HEU A;  3MC2 A;  1FTJ A;  3PPQ A;  2UYE A;  3FJ7 A;  5JK4 A;  4G77 A;  4N07 A;  4PBH A;  3THI A;  3K01 A;  2A5T B;  3Q29 A;  1B32 A;  2OZZ A;  5T3J A;  3C35 A;  4N4U A;  4EF1 A;  4F2O A;  4GL8 A;  4LN5 A;  2F97 A;  2ESN A;  4F3P A;  3P7I A;  1Y3N A;  5H8Q B;  1JW4 A;  3E9X A;  4H65 A;  2X7P A;  2YJP A;  3UP9 A;  3KBR A;  4BLA A;  1AIV A;  2RC8 A;  1NUZ A;  3E3K A;  3ISP A;  3SET A;  2RCB A;  2ABH A;  5L8D A;  3H6T A;  4PDD A;  1G0H A;  4PE3 A;  1O63 A;  3DLN A;  4LZ8 A;  1MG1 A;  5DEX A;  3UA8 A;  1D9Y A;  3H6V A;  1NV1 A;  1NV3 A;  2V3T A;  2I0B A;  4GRK A;  3PD9 A;  5H8F B;  1NV7 A;  2PT2 A;  1BK4 A;  4R75 A;  4PFU A;  1Y9U A;  5BUU A;  4O3A A;  1MS7 A;  1H43 A;  4JB7 A;  5HPQ A;  1IXI A;  4NF0 A;  4O7M A;  1H3D A;  2XXW A;  3FJM A;  3T0J A;  5CMB A;  1TT1 A;  2CZL A;  1MPD A;  3IJX B;  4X1D A;  3U93 A;  2DVZ A;  2RC7 A;  4GWX A;  1MDP 1;  1QKA A;  2XWO A;  3C31 A;  1WVJ A;  3K6V A;  3U1O A;  2UXA A;  5ET7 A;  3HN0 A;  5DW8 A;  4YKI A;  3TFL A;  3G3K A;  3UOR A;  2NVU B;  4OEN A;  1B3F A;  1VE4 A;  1JET A;  3KOS A;  1YPN A;  4RK9 A;  1EH3 A;  4HS7 A;  3OO6 A;  3B8B A;  3I6V A;  2UVI A;  5KDT B;  4IO3 A;  2NXO A;  2XXH A;  3D1R A;  5AA4 A;  3PPR A;  3V8X B;  3TYH A;  4ELR A;  3PUW E;  4F3G A;  1FTK A;  1PC3 A;  4DLD A;  2Q88 A;  1DPE A;  4I62 A;  3W15 C;  1NH8 A;  5FHN A;  1JP4 A;  1TFA A;  4EF2 A;  4FAJ A;  2YLN A;  1SBP A;  4QFK A;  5FTH A;  4F1U A;  4GBW A;  3T9X B;  2NOO A;  4P1L A;  2F6G A;  2HQ0 A;  3E4R A;  3M3L A;  3BIH A;  2CZK A;  2QMX A;  4KXP A;  2QSX A;  4TOZ A;  3VDF A;  3CI8 A;  3ECR A;  3G3H A;  4P8B A;  1PBP A;  2GHB A;  4NWC A;  3PMX A;  4PAK A;  5ITP A;  2I58 A;  3LV0 A;  4DIG A;  4R72 A;  3K1P A;  4GWO A;  1NUX A;  1A8E A;  3VXC A;  3UGW A;  4NG7 A;  3QUF A;  5I5P A;  4R73 A;  4OET A;  3OXN A;  3KN7 A;  3S9N C;  1GV8 A;  3K0V A;  2R71 A;  1MQG A;  1MXX A;  1P1N A;  2XXQ A;  4PFW A;  1B4H A;  3TAJ A;  4DXC A;  1FBC A;  4OHN A;  2THI A;  2F7C A;  5H8F A;  3RY3 A;  2P3V A;  2KQZ A;  2F8D A;  5AA2 B;  3T66 A;  2XXI A;  1M5B A;  4NF4 A;  1D4N A;  4UAB A;  5DVJ A;  1B2H A;  4OTE A;  1MQJ A;  4BDO A;  4LZ5 A;  1N76 A;  4QHQ A;  1MXZ A;  1RDZ A;  1MQH A;  4YZZ A;  5DTB A;  2HAV A;  2FHY A;  2DQV A;  5EQA A;  3IOU A;  5F24 A;  1DK4 A;  1LFH A;  2A5S A;  4N15 A;  3T96 B;  2Y7R A;  4FBP A;  3O97 A;  2P2A A;  5L9S A;  1B40 A;  4FJP A;  2VPN A;  1UIU A;  3T9H B;  3C33 A;  5I2K B;  4YU0 A;  3H03 A;  2OLB A;  3E13 X;  3CVG A;  5I59 B;  1JW1 A;  2HHM A;  3N6U A;  3IX1 A;  2QL3 A;  4DI4 B;  4N6P A;  4ZEB A;  1LFG A;  5TPA A;  4R74 A;  2DXR A;  4NX1 A;  3TZA A;  4O7I A;  5ICQ A;  1J1N A;  1NV4 A;  2PVU A;  4IO2 A;  1B0L A;  4EQ7 A;  3N94 A;  1PB8 A;  2Q8J A;  1SI1 A;  4P0I A;  5KCJ B;  4MEV A;  2XX8 A;  4F22 A;  1DTG A;  1B52 A;  1QW0 A;  3N26 A;  1D9V A;  2RCA A;  3R7X A;  2WYK A;  2DDK A;  3MVX A;  5ELV A;  5EQ9 A;  4N91 A;  1FPE A;  1UTB A;  4F1Y A;  1MY1 A;  4OES A;  4OZ9 A;  2H9B A;  3TTN A;  4PC9 A;  2JJK A;  1B5H A;  4FAT A;  1DSN A;  2Y5L A;  4HCW A;  1VSO A;  2ONK E;  3RNN A;  4KI0 E;  1FBD A;  4XIG Q;  4AS5 A;  4PE5 B;  1D9Q A;  4UA8 A;  3VVF A;  5EYH A;  1SD3 A;  2UVH A;  4ESX A;  4WKM A;  1JNF A;  2QS3 A;  4MNC A;  1B58 A;  4H6D A;  3R26 A;  1ZIU A;  3VLW A;  1LBB A;  4I9D A;  1TFD A;  1USY E;  4G68 C;  4OMB A;  4LON B;  1NUW A;  3HPI A;  1LAX A;  2BJI A;  2F36 A;  1A8F A;  4EQ9 A;  1S9T A;  3KN8 A;  3S9M C;  4DZ1 A;  5TP9 A;  3QUJ A;  3OD7 A;  4EUO A;  1EZ9 A;  3IOV A;  1XHY A;  3TCH A;  3A29 A;  4YB5 A;  3MZ1 A;  3HHG A;  1FTA A;  2Y7K A;  3KN3 A;  1SQY A;  3NOH A;  2AIX A;  3KSX A;  4AS4 A;  3PV0 E;  4RNS A;  3H6W A;  1OIB A;  4OVS A;  1FBF A;  3OSR A;  2XXV A;  5AA4 B;  5F1Q A;  1LAF E;  2XD2 A;  3GZG A;  4H0W A;  1S50 A;  4M1V A;  4ELO A;  3H4Z A;  1P1O A;  3O6H A;  1B0H A;  3CSB A;  2Q74 A;  4X9T A;  1B7H A;  2QMW A;  5IZ1 A;  3PPN A;  3BBR A;  4U4X A;  3USD A;  4JVD A;  1O7T A;  5TP9 B;  3U94 A;  1NUY A;  4GOT A;  4PF8 A;  2NWJ A;  3UK4 A;  2XA5 A;  5AA1 A;  4U1Z A;  1Y4T A;  4OEU A;  1FBE A;  1PEB A;  4PQJ A;  2QVU A;  5CC2 A;  2DP8 A;  4PCD A;  5FHM A;  4U2R A;  1QUJ A;  4Z7E A;  1H44 A;  4IO7 A;  2CEX A;  4G8M A;  4H8I A;  1B3E A;  3L6G A;  2F78 A;  4PFY A;  4H67 A;  4I3Y A;  1A99 A;  3RPL A;  3I3V A;  5I56 B;  2PT1 A;  1Q1K A;  3DEL B;  3Q27 A;  4MX6 A;  1DOT A;  1XS5 A;  2OX3 A;  1SYI A;  2O51 A;  1B3G A;  4JVI A;  3TMG A;  2WBD A;  3PPP A;  1SI0 A;  1URS A;  3KC1 A;  1FPL A;  4PGN A;  4GIZ A;  2WKY A;  3TTR A;  4XKP A;  1AL3 A;  1MH3 A;  1FSA A;  4GWU A;  3A09 A;  4XF5 A;  2MKZ A;  5H8S A;  4GD5 A;  4F3B A;  3RTW B;  3ONM A;  3IFA A;  4M4G A;  4KQP A;  3FXB A;  3QK6 A;  3W9W A;  5CI5 A;  4BDQ A;  1PB9 A;  1QKB A;  1FPD A;  1NNK A;  4ZEF A;  3F11 A;  1LBW A;  1SVX B;  1MXW A;  2IEE A;  4WED A;  2ZYO A;  1SYH A;  1BP5 A;  4MF3 A;  5ET5 A;  1MY0 A;  5AA2 D;  1QJM A;  4F1V A;  3T9V A;  4MJO A;  4NE4 A;  4OVJ A;  2I4B A;  3QAX A;  1USY H;  5H8H A;  3TKD A;  4JSO A;  1MPB A;  3QXM A;  3FAT A;  2F7B A;  4MAG A;  4RYA A;  4G2Z A;  2CEY A;  4EXK A;  3AXF A;  2GFE A;  4YMB A;  4X48 A;  3HHF A;  4C0R A;  1MPC A;  2QPQ A;  4X1B A;  3RT6 B;  4R6H A;  4H5F A;  2V84 A;  3MBP A;  4JVC A;  4NF6 A;  4ELP A;  5F7V A;  3ODB A;  4XKN A;  3MP6 A;  3G3F A;  1IEJ A;  1VFD A;  1UTH B;  1YCJ A;  1KA1 A;  2O1L A;  3K1M A;  3D4C A;  4NF5 A;  2YPN A;  2CZI A;  2X26 A;  3K6U A;  3H3G A;  3CHG A;  4PP0 A;  4G68 B;  3S2V A;  5DVF A;  4YB7 A;  3B7D A;  4YKJ A;  2UVJ A;  3OEL A;  1FTM A;  4HCY A;  4MBP A;  5H8H B;  2RIN A;  4GX4 A;  3MVW A;  4ECF A;  2F5X A;  4TQU Q;  4N13 A;  1FQE A;  5ET6 A;  1Z7N E;  3S9E A;  4OVR A;  4YB6 A;  1NNP A;  3FBP A;  4RPN A;  2ZYN A;  2XX9 A;  1WDN A;  3M3F A;  4PTK A;  4NQ8 A;  1MXU A;  4N17 A;  5LTC A;  1LBY A;  2XHD A;  1GGG A;  2F3B A;  4OWD A;  1R1N A;  4JDF A;  4EDP A;  1NFT A;  3EF7 A;  4G4P A;  2G93 A;  5I57 A;  2BJJ X;  5K2Y A;  2DE3 A;  5A5X A;  3QYT A;  1O64 A;  4F2Q A;  5I2N B;  2HXW A;  2FIE A;  3MW0 A;  4YMA A;  1FQD A;  4U22 A;  3S4U A;  4DXU A;  1Y20 A;  3FZV A;  2Q89 A;  1NL5 A;  1RKM A;  4PAI A;  1SW5 A;  4IO4 A;  1L5T A;  4FOR A;  2ZXT A;  3TOD A;  2VT5 A;  4ZZE A;  1ELJ A;  4DCY A;  5HBC A;  5FTI A;  2ZZW A;  3PUY E;  1MXY A;  1A54 A;  1KWH A;  4P56 A;  4OER A;  1NV6 A;  3RPL B;  4JXI A;  4GF8 A;  3GYY A;  4RPO A;  2ALU A;  2Z8F A;  1FBG A;  2H98 A;  1FQB A;  3EHT A;  1OLA A;  3KJ7 A;  2Q2C A;  1OQH A;  2V3U A;  5ITO A;  3PUV E;  5IZ3 B;  1GR2 A;  4FIM A;  4TLL B;  1R9L A;  1R9Q A;  4L17 A;  4RXL A;  1D3K A;  2M8C A;  3K02 A;  2KLF A;  1A7L A;  4QSE A;  2R6G E;  2DWJ A;  4OAN A;  5I56 A;  2A5T A;  1LST A;  3HV1 A;  4BDR A;  3VLU A;  1ZKB A;  4NAP A;  4MIJ A;  2R9J A;  3OO8 A;  1B46 A;  4OFL A;  4U1O A;  3BKI B;  1SW2 A;  5KZT A;  2Q8M A;  4E0X A;  1JEV A;  2I49 A;  2Q9T A;  3K00 A;  1HSL A;  1PBQ A;  3PGF A;  2F3D A;  4OQO A;  1M5E A;  1FBP A;  2CMO A;  1DCU A;  1B3L A;  1P1U A;  3IK6 B;  4EQB A;  4KYD A;  2DS9 A;  3IOR A;  4I3E A;  5L9O A;  1LCT A;  1I69 A;  1DTZ A;  4ONY A;  5DVI A;  3FV1 A;  4X8R A;  3IOW A;  3ZSF A;  3IAZ A;  3H6U A;  1LFI A;  4NED A;  1N0T A;  1ZLQ A;  1MM6 A;  3FUZ A;  5IM2 A;  1PDA A;  4JWX A;  2I0C A;  3TDJ A;  3RTF B;  4NHB A;  1JQF A;  4FED A;  3OEM A;  1F9B A;  1FQC A;  3IJO B;  1HSE A;  3K4U A;  4TLM B;  1FPG A;  3KBZ A;  5FHO A;  3SEV A;  1I6Q A;  3CR9 A;  2IA4 A;  2QS2 A;  1B4Z A;  1FBH A;  1IIT A;  1NNF A;  1IMD A;  1DPP A;  4IGT A;  3TCG A;  2H4I A;  4XXU A;  3ZKL A;  4P1E A;  1VDW A;  2O1M A;  5AA3 A;  4XEQ A;  3EKI A;  3PMW A;  2ZNT A;  4PAF A;  4QXD A;  4KYS A;  4G68 A;  3TTK A;  1N7W A;  3IO6 A;  4PF6 A;  1WOD A;  2H25 A;  4C1U A;  4ELQ A;  1NV0 A;  3MZ9 A;  3FVO A;  1KA0 A;  4ZS9 A;  1HSJ A;  3QIM A;  3O9P A;  1AH5 A;  4P47 A;  4FEB A;  2VGQ A;  5ESY A;  4KFQ A;  1NKX A;  3SES A;  1IMA A;  3A3U A;  1VR5 A;  5H8Q A;  1B9J A;  3K6W A;  3WAE A;  3DP8 A;  4ESW A;  1CNQ A;  4KCD A;  3VE1 B;  1LBZ A;  3VLV A;  1H45 A;  4R6K A;  3OSQ A;  1ZJL A;  3KZG A;  3VVD A;  1LCF A;  2PBW A;  2I3V A;  3N6T A;  1A55 A;  1LAH E;  1JEU A;  2O68 A;  3SER A;  3B6Q A;  2AL5 A;  3Q25 A;  1QUI A;  4IR8 A;  5I57 B;  2FYI A;  2XXY A;  5I2K A;  3CFZ A;  1NMU A;  2Q2A A;  3Q28 A;  3B50 A;  4R9F A;  1A40 A;  4F39 A;  3SDF A;  2DE4 A;  1FPB A;  2ZNS A;  1XI6 A;  3FXQ A;  3CRB A;  1NH7 A;  4R2B A;  2B4M A;  2DVC A;  1GVC A;  3G3I A;  4XFE A;  3V83 A;  1PB7 A;  4MH5 A;  2WBB A;  4GX6 A;  2UVG A;  2VOZ A;  1IMC A;  1UQW A;  3VV5 A;  2ONR A;  4LQ2 A;  1OQG A;  2Z22 A;  5ET8 A;  1IIW A;  1B1X A;  3FVN A;  4H5G A;  3E79 A;  4YIC A;  4IY6 A;  4DCX A;  1LBV A;  1FJ6 A;  3LSW A;  1DMB A;  2E0S A;  3HST A;  2WX9 A;  4OVQ A;  3O28 A;  4HE2 A;  1EYJ A;  1NI9 A;  3IB0 A;  2Z8D A;  1SPI A;  1Y1M A;  2I48 A;  3E78 A;  4G8H A;  1TXF A;  3KG2 A;  2AL4 A;  3C34 A;  3K6X A;  4GWW A; 
#chains in the Genus database with same CATH homology
 1CB6 A;  3O6I A;  2X26 A;  4RY1 A;  1MY4 A;  3K6U A;  2XXI A;  4KD5 A;  4KCC A;  1M5B A;  1R6Z A;  3EQ1 A;  1D4N A;  3H3G A;  4NF4 A;  5A5X B;  2B3B A;  2Y84 A;  2Z23 A;  3RGY A;  2VD3 A;  1B5I A;  3C32 A;  4G68 B;  3FXU A;  4PP0 A;  1B2H A;  5DVF A;  5DVJ A;  3O66 A;  3S2V A;  4OTE A;  3RPW A;  4YB7 A;  2O7I A;  2DXY A;  3B7D A;  1MQJ A;  2UVJ A;  3OEL A;  4JBZ A;  4YKJ A;  4BDO A;  4PET A;  4LZ5 A;  4LAT A;  1N76 A;  3WAF A;  4DE8 A;  1FTM A;  4HCY A;  4LP2 B;  3SKP A;  3FD3 A;  4QHQ A;  1POY 1;  4GLI A;  2PX1 A;  4MBP A;  1MDQ A;  1MXZ A;  1TWY A;  5H8H B;  3ZKK A;  2RIN A;  3FAS A;  3MP1 A;  3MWB A;  3ILT B;  3MAM A;  1US5 A;  1MH4 A;  1MQH A;  3MVW A;  3MPL A;  2ONS A;  4YZZ A;  4ECF A;  2F5X A;  5DTB A;  3S9L C;  3I5O A;  2HAV A;  1FTL A;  1BTJ A;  4TQU Q;  2DQV A;  3FGS A;  4QFP A;  2OJT A;  4N13 A;  3IOU A;  1FQE A;  5B7D A;  1N3X A;  4NF6 B;  1Z7N E;  1ZBM A;  3S9E A;  4OYV A;  1B7Z A;  1LFH A;  2A5S A;  3HCQ A;  2DWH A;  1OVB A;  3KSJ A;  3OO7 A;  2H5Y A;  5H8N A;  3T96 B;  4C1T A;  2FNC A;  4YB6 A;  5M2V A;  1ANF A;  3EHU A;  1Y1Z A;  1NNP A;  2Y7R A;  2XXT A;  3TQW A;  1SDX A;  4RPN A;  4BDL A;  4DXB A;  2GRV A;  1MXV A;  3O97 A;  4NWD A;  5L9S A;  2P2A A;  3OOA A;  1AMF A;  2ZYN A;  2XX9 A;  1WDN A;  3M3F A;  1B40 A;  2HZL A;  3MQ9 A;  3PD8 A;  4FJP A;  1MXU A;  1P1W A;  1UIU A;  4G8N A;  4F3S A;  3UIF A;  4RXL A;  4HTG A;  2Y7W A;  1EZO A;  1YAE A;  1NNT A;  3T9H B;  3C33 A;  5I2K B;  4OFJ A;  4YU0 A;  3H03 A;  2XHD A;  3R6U A;  3RUM A;  2OLB A;  3E13 X;  3FVG A;  4KYE A;  5CMK A;  1GGG A;  4NF8 A;  5EYF A;  2DYX A;  3MUQ A;  2HAU A;  4ZEK A;  2ZNU A;  3CVG A;  5I59 B;  1JW1 A;  2O84 X;  1YTV A;  3RN8 A;  4YKP A;  2G29 A;  3FV2 A;  4KHZ E;  4OWD A;  4U23 A;  2P0S A;  4ZE9 A;  1R1N A;  4JDF A;  4KR5 A;  4EDP A;  1NFT A;  3N6U A;  1OLC A;  3IX1 A;  3M3K A;  3EF7 A;  1N84 A;  3JV9 A;  4G4P A;  2G93 A;  2QL3 A;  4K3F A;  1B6H A;  4P0G A;  4HW8 A;  3DP6 A;  1ZU0 A;  2PMS A;  4N6P A;  4ZEB A;  3KGC A;  5I57 A;  1BKA A;  2BJJ X;  2DSF A;  3C36 A;  5K2Y A;  1LFG A;  3SEU A;  1IXC A;  3MJN A;  1S7Y A;  4JSD A;  5KDT A;  2DE3 A;  4R74 A;  2ZMB A;  3A3C A;  5TPA A;  4NF4 B;  2QRY A;  3QYT A;  3SEW A;  5A5X A;  2OBG A;  2REG A;  2DXR A;  4H1X A;  2O6A A;  3TZA A;  1EZP A;  1O64 A;  3TCF A;  4F2Q A;  5I2N B;  1Z7M E;  5ICQ A;  1M5C A;  1J1N A;  2ANJ A;  2HXW A;  2PVU A;  3G3G A;  4UAC A;  4IO2 A;  1B0L A;  2F6P A;  3TTL A;  5IKB A;  3MW0 A;  4YMA A;  1FQD A;  4U22 A;  2XXU A;  3S4U A;  4DXU A;  1Y20 A;  3FZV A;  1XC1 A;  1MQD A;  4QFN A;  5JTY B;  1B5J A;  3N94 A;  4O3B A;  1PB8 A;  4JWY A;  2Q89 A;  1NL5 A;  1RKM A;  1LBC A;  3MVZ A;  4FE8 A;  1SI1 A;  3FIR A;  4P0I A;  3LUY A;  1JVX A;  2Q8J A;  5KCJ B;  2B3F A;  1SW5 A;  4WEP A;  4IO4 A;  1BLF A;  1L5T A;  4FOR A;  5HM4 B;  2XX8 A;  3JYR A;  4F22 A;  4IO6 A;  4ZED A;  2ZXT A;  4F31 B;  2GH9 A;  3KJT A;  3TOD A;  1CE2 A;  4ZE8 A;  1B52 A;  1DTG A;  3IR1 A;  3FVK A;  1QW0 A;  3N26 A;  4THI A;  3UN6 A;  2B65 A;  3TPA A;  1D9V A;  2RCA A;  4ZZE A;  4GL0 A;  3R7X A;  3BFU A;  4QFO A;  2V25 A;  3C4M A;  1QUL A;  3MVX A;  5DEX B;  3GXA A;  5ELV A;  1ELJ A;  4DCY A;  1UTB A;  4F1Y A;  1MY1 A;  4OES A;  4OZ9 A;  1GTK A;  4DLD A;  2H9B A;  1XT8 A;  2F35 A;  3TTN A;  1SW4 A;  2DWA A;  2NUV A;  3B6W A;  5HBC A;  1LAG E;  1US4 A;  1IUD A;  1B5H A;  5FTI A;  1IXG A;  2GHA A;  2OCU A;  4R6Y A;  1SW1 A;  4FAT A;  4ZEI A;  1DSN A;  3PUY E;  4HCW A;  1VSO A;  2HFB A;  2ONK E;  4XKQ A;  4XTC Q;  4EQ7 A;  5ICT A;  4Z0I A;  1MXY A;  3RNN A;  1A54 A;  3KOT A;  1XVY A;  5CMM A;  3T93 B;  4KI0 E;  4U21 A;  1KWH A;  3RQT A;  4NMY A;  4XIG Q;  4PE5 B;  3VVF A;  4UA8 A;  4OER A;  1B51 A;  1MY2 A;  1II5 A;  2QS1 A;  3ILU B;  4JXI A;  5TPA B;  1B1H A;  3M8U A;  4GF8 A;  4R2F A;  3QSL A;  1SD3 A;  2RKM A;  2UVH A;  3B6T A;  4RPO A;  2DWI A;  1IXH A;  2ALU A;  4U4S A;  5I2N A;  5IAI A;  2Z8F A;  2H98 A;  1LGB C;  2XXR A;  1FQB A;  3EHT A;  1OLA A;  3KJ7 A;  3TQL A;  4WKM A;  5EHM A;  2Q2C A;  1OQH A;  2UYF A;  2V3U A;  4ESX A;  4JWO A;  5ITO A;  2DOJ A;  3PUV E;  1JNF A;  1GR2 A;  4FIM A;  4TLL B;  2HCA A;  2QS3 A;  1FCK A;  1R9L A;  1R9Q A;  3MPK A;  5CRY A;  1Q35 A;  2QS4 A;  1B58 A;  3DM0 A;  4H6D A;  1D3K A;  2M8C A;  4L17 A;  2VP1 A;  3K02 A;  4NF5 B;  2KLF A;  3R26 A;  1A7L A;  3O6G A;  1ZIU A;  3LSL A;  4PFT A;  2R6G E;  1LBB A;  4QSE A;  4I9D A;  1TFD A;  3VLW A;  1QVS A;  1USY E;  2DWJ A;  2F7A A;  2A5T A;  4G68 C;  5I58 B;  5I56 A;  1LST A;  4OMB A;  3HV1 A;  1URD A;  2D21 A;  1ZMG A;  4LON B;  1I6A A;  2QJE A;  3HPI A;  4NTL A;  5CBS A;  5JEI A;  4BDR A;  1MQI A;  4OXV A;  1LAX A;  2D5W A;  4FEC A;  3VLU A;  1ZKB A;  2VD2 A;  5TU0 A;  2F36 A;  1A8F A;  2R9J A;  2Z8E A;  4EQ9 A;  1S9T A;  3OO8 A;  1ZTY A;  1B46 A;  4OFL A;  4LVQ A;  1VFE A;  3BKI B;  4U1O A;  3BFT A;  1SW2 A;  3KN8 A;  3PUZ E;  4RK2 A;  5KCJ A;  2Y7I A;  3PPO A;  3S9M C;  4MLV A;  4O3C A;  4DZ1 A;  5TP9 A;  3QUJ A;  3G7W A;  4E0X A;  5KZT A;  1JEV A;  4AB5 A;  2HZK A;  2LAO A;  1B7U A;  3CIJ A;  3OD7 A;  1B3H A;  2XXP A;  2I49 A;  4QF9 A;  5CM6 A;  5H8N B;  2Q9T A;  3K00 A;  4EUO A;  2V93 A;  1EZ9 A;  3K1N A;  1HSL A;  1LB9 A;  2XX7 A;  4QFL A;  1PBQ A;  4F19 A;  3PGF A;  1AOV A;  4OQO A;  3IOV A;  5CMC A;  3FJG A;  1M5E A;  1XHY A;  2REJ A;  3TCH A;  3LC8 A;  3LSF B;  4MFI A;  5B70 A;  2CMO A;  4YB5 A;  3MZ1 A;  3HHG A;  1B3L A;  4ND9 A;  3D4G A;  4Q0C A;  1P1U A;  3IK6 B;  2Y7K A;  3KN3 A;  1EU8 A;  1LB8 A;  3LBS A;  3U8Q A;  4EQB A;  1FTO A;  1SQY A;  4GVO A;  3FXR A;  3OEK A;  4KYD A;  2H99 A;  2DS9 A;  3IOR A;  1MRP A;  1UIV A;  4POX A;  3KFM A;  3CSG A;  3EHS A;  4IGR A;  2O69 A;  2P1S A;  1OVT A;  2OWS A;  5L9O A;  1LCT A;  1LLS A;  1I69 A;  1N7X A;  5AE4 A;  1DTZ A;  2AIX A;  3IB1 A;  1P99 A;  3KSX A;  4ONY A;  1H76 A;  3PV0 E;  3Q26 A;  3IOT A;  4RNS A;  1XOC A;  3TEP A;  3OO9 A;  3CFX A;  4GXS B;  4P11 A;  3H6W A;  4Q5T A;  1OIB A;  4I8C A;  5DVI A;  2I4C A;  3EN3 A;  3OSR A;  3FV1 A;  3VFJ A;  3IOW A;  3ZSF A;  5I58 A;  2XXV A;  3IAZ A;  3H6U A;  1LFI A;  4NED A;  4NF8 B;  1N0T A;  2HEU A;  3MC2 A;  5F1Q A;  5AA4 B;  1ZLQ A;  1MM6 A;  1LAF E;  2OK2 A;  3FUZ A;  1PDA A;  2I6E A;  4YKK A;  1FTJ A;  5J1D A;  3KEI A;  4JWX A;  2XD2 A;  3GZG A;  3PPQ A;  4AQ4 A;  3H06 B;  2I0C A;  4H0W A;  2UYE A;  3FJ7 A;  3TDJ A;  3RTF B;  1Y3Q A;  5JK4 A;  1S50 A;  1JQF A;  4FED A;  3OEM A;  1F9B A;  4G77 A;  1FQC A;  4M1V A;  4N07 A;  4ELO A;  3IJO B;  5LOM A;  3H4Z A;  1P1O A;  3O6H A;  3THI A;  1HSE A;  1JVY A;  1B0H A;  3CSB A;  3K01 A;  2A5T B;  3K4U A;  3GBA A;  3Q29 A;  4TLM B;  1B32 A;  1FQA A;  5FHO A;  3SEV A;  1I6Q A;  4X9T A;  4ZDM A;  3CR9 A;  3T22 A;  1B7H A;  4F29 A;  3LR1 A;  4LUB A;  4XKR A;  2OZZ A;  2IA4 A;  4ISU A;  2QMW A;  3C35 A;  3PPN A;  4EF1 A;  4F2O A;  3BBR A;  4U4X A;  2QS2 A;  1B4Z A;  4GL8 A;  1MM7 A;  3USD A;  1IIT A;  1NNF A;  2ESN A;  2F97 A;  1O7T A;  1Y3N A;  2XD3 A;  1FW0 A;  1ATG A;  1Y3P A;  3P7I A;  5H8Q B;  4LQ5 A;  1DPP A;  1JW5 A;  3W9V A;  1JW4 A;  5TP9 B;  3O2A A;  4IGT A;  3TCG A;  3E9X A;  4H65 A;  3U94 A;  4GOT A;  2RC9 A;  2X7P A;  2YJP A;  2H4I A;  2Y7P A;  4XXU A;  2NWJ A;  3UK4 A;  3UP9 A;  3KBR A;  3ZKL A;  2AYS A;  4BLA A;  1AIV A;  2RC8 A;  5AA1 A;  2ZYM A;  3E3K A;  4U1Z A;  3H7M A;  4LA9 A;  3SET A;  2RCB A;  2ZYK A;  2ABH A;  1N04 A;  1Y4T A;  4OEU A;  5L8D A;  2O1M A;  5AA3 A;  2VHA A;  1PEB A;  3H6T A;  3TUS A;  4QRZ A;  4PQJ A;  2FA7 A;  5CC2 A;  1O63 A;  2DP8 A;  3DLN A;  1XVX A;  3PMW A;  2ZNT A;  4LZ8 A;  4GFR A;  1MG1 A;  3PUX E;  5DEX A;  5FHM A;  4U2R A;  3UA8 A;  1D9Y A;  3H6V A;  4GQO A;  2PYY A;  4KYS A;  3MP8 A;  1QUJ A;  3TTM A;  3VXB A;  1UTB B;  4BDN A;  4Z7E A;  3L6H A;  2V3T A;  3C9H A;  4G68 A;  3TTK A;  3ZS6 A;  2I0B A;  1H44 A;  4GRK A;  4IO7 A;  1N7W A;  4G8M A;  3U92 A;  3IO6 A;  1T0K A;  4H8I A;  3PD9 A;  1WOD A;  4F3P A;  4F18 A;  2H25 A;  1B3E A;  3L6G A;  5H8F B;  4C1U A;  2F78 A;  4ELQ A;  2PT2 A;  2D3I A;  4PFY A;  3MZ9 A;  3FVO A;  4H67 A;  5AA2 A;  4R75 A;  4POW A;  1A99 A;  4PFU A;  1Y9U A;  5BUU A;  4O3A A;  4ZS9 A;  1M5D A;  1HSJ A;  1H43 A;  1MS7 A;  3I3V A;  3CG3 A;  4JB7 A;  1IXI A;  3O9P A;  3QIM A;  5HPQ A;  4GXA A;  1AH5 A;  5I56 B;  1POT A;  1H3D A;  2VGQ A;  4FEB A;  3VVE A;  4KFQ A;  1NKX A;  2PT1 A;  1Q1K A;  3SES A;  3DEL B;  3A3U A;  3Q27 A;  1DOT A;  1VR5 A;  2XXW A;  3PMV A;  3FJM A;  5H8Q A;  1B9J A;  1XS5 A;  5CMB A;  5I84 A;  1TT1 A;  2CZL A;  2O7U A;  1SYI A;  3IO4 A;  3IB2 A;  3K6W A;  5CBR A;  1MPD A;  2O51 A;  3IJX B;  4X1D A;  1B3G A;  3U93 A;  1IQ7 A;  4BDM A;  2DVZ A;  3WAE A;  3DP8 A;  4ESW A;  2RC7 A;  4KCD A;  4IY5 A;  5L9M A;  3TMG A;  3VE1 B;  4QSC A;  3PPP A;  1MDP 1;  1SI0 A;  1URS A;  3VLV A;  1QKA A;  3C31 A;  1WVJ A;  1H45 A;  3K6V A;  3K2D A;  3OSQ A;  4R6K A;  2UXA A;  3U1O A;  1BIY A;  3HN0 A;  1ZJL A;  1URG A;  3KZG A;  4OEV A;  4GIZ A;  3G3J A;  3VVD A;  1MY3 A;  4YKI A;  3EPE A;  2WKY A;  3TFL A;  3TEL A;  1LCF A;  2PBW A;  2I3V A;  3N5L A;  3G3K A;  3N6T A;  3UOR A;  3TTR A;  4XKP A;  2NVU B;  1AL3 A;  3HO7 A;  1MH3 A;  4OEN A;  1B3F A;  1VE4 A;  1A55 A;  1LAH E;  3A09 A;  1JET A;  4RA1 A;  3MZB A;  4WXJ A;  3KOS A;  1YPN A;  3O29 A;  5H8S A;  5K2X A;  4RK9 A;  3SEX A;  3V89 B;  1JEU A;  2O68 A;  4GD5 A;  4EXL A;  3SER A;  4F3B A;  3RTW B;  3ONM A;  3B6Q A;  2AL5 A;  3Q25 A;  1EH3 A;  4KQP A;  4M4G A;  1QUI A;  4HS7 A;  3JZJ A;  2FYI A;  3RT8 A;  5I57 B;  2XXY A;  2W7Y A;  3OO6 A;  3CFZ A;  4H8J A;  5I2K A;  3QK6 A;  3W9W A;  1NMU A;  3I6V A;  5CI5 A;  5DT6 A;  4BDQ A;  2Q2A A;  2UVI A;  1PB9 A;  5KDT B;  1QKB A;  3U72 A;  1NNK A;  4IO3 A;  4Q30 B;  3DP4 A;  4ZEF A;  2NXO A;  2XXH A;  3Q28 A;  5AA4 A;  3IL1 B;  4R9F A;  3PPR A;  3V8X B;  1A40 A;  4F39 A;  3SDF A;  3TYH A;  1IZ1 A;  2DE4 A;  4ELR A;  3F11 A;  1SVX B;  2ZNS A;  3PUW E;  4F3G A;  1MXW A;  2IEE A;  3FXQ A;  3PU5 A;  4WED A;  1FTK A;  1M5F A;  1UTH A;  5JTY A;  3CRB A;  2ZYO A;  5DYH A;  1NH7 A;  1PC3 A;  2I3W A;  1SYH A;  1BP5 A;  1DPE A;  2Q88 A;  3CG1 A;  4I1D A;  1RYX A;  4I62 A;  4MF3 A;  4R2B A;  3W15 C;  1NH8 A;  1MY0 A;  2DVC A;  1GVC A;  5FHN A;  3G3I A;  5AA2 D;  1QJM A;  4F1V A;  1PB7 A;  4MH5 A;  3SEY A;  3GLB A;  3V83 A;  1TFA A;  2V3Q A;  1RYO A;  3T9V A;  4EF2 A;  4NE4 A;  4OVJ A;  2I4B A;  2UVG A;  3QAX A;  4FAJ A;  4IO5 A;  2VOZ A;  1USY H;  1B05 A;  5H8H A;  2YLN A;  1QUK A;  1SBP A;  4AB6 A;  1UQW A;  3VV5 A;  4QFK A;  2ONR A;  3OEN A;  5FTH A;  3T9U A;  3T9X B;  3TKD A;  4LQ2 A;  4F1U A;  2NOO A;  4JSO A;  2F6G A;  1MPB A;  1OQG A;  1IIW A;  1B1X A;  2HQ0 A;  2Z22 A;  3E4R A;  3FAT A;  3FVN A;  3M3L A;  3QXM A;  2F7B A;  4KPT A;  2QMX A;  4H5G A;  2QSX A;  4TOZ A;  3VDF A;  3CI8 A;  4ZEC A;  4Q8R A;  4LZ7 A;  3ECR A;  3G3H A;  4RYA A;  1FQF A;  1PBP A;  4G2Z A;  2GHB A;  4NWC A;  4ZZA A;  3LSX A;  4EXK A;  3PMX A;  2X7Q A;  4YIC A;  3AXF A;  2GFE A;  1P1Q A;  4YMB A;  4X48 A;  3HHF A;  4C0R A;  1MPC A;  2QPQ A;  4IY6 A;  4X1B A;  5ITP A;  3RT6 B;  4RJZ A;  4DDD A;  4R6H A;  4DCX A;  2I58 A;  4MLQ A;  4H5F A;  2V84 A;  4OFO A;  4QSD A;  4R72 A;  4DIG A;  3K1P A;  2XXX A;  4GWO A;  3LSW A;  1OMP A;  1A8E A;  1DMB A;  4R9G A;  3VXC A;  3UGW A;  3MBP A;  2OWT A;  3QUF A;  3RLF E;  1Y4C A;  5ISU A;  1I6B A;  4R73 A;  4NF6 A;  4OET A;  2E0S A;  3OXN A;  4ELP A;  3HST A;  3KN7 A;  3OMB A;  5F7V A;  3CFL A;  1GV8 A;  2E1S A;  3K0V A;  3ODB A;  4IB2 A;  3MP6 A;  3GBB A;  2R71 A;  3O28 A;  4XKN A;  5EHS A;  5BWJ A;  1MQG A;  3G3F A;  1IEJ A;  5I59 A;  3S9N C;  1MXX A;  1N3W A;  1P1N A;  3IB0 A;  2Z8D A;  2XXQ A;  1VFD A;  1UTH B;  3V5A A;  2F34 A;  4PFW A;  2DE2 A;  1B4H A;  3TAJ A;  1YCJ A;  4DXC A;  1Y1M A;  2O1L A;  4OHN A;  2I48 A;  2THI A;  3K1M A;  4E0W A;  4G8H A;  3D4C A;  4NF5 A;  1TXF A;  2F7C A;  3MVY A;  3KG2 A;  2YPN A;  4YAH X;  3RY3 A;  2RF1 A;  5H8F A;  2AL4 A;  2F8D A;  3C34 A;  3K6X A;  5AA2 B;  3T66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...