3FJMA

Crystal structure of phosphate bound peb3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords Major antigenic peptide PEB3
total genus 83
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjmA02
2O7IA 4GXSB 1B3LA 1EU8A 4GL8A 4WEDA 3IB0A 3ILTB 5B70A 4QHQA 4PETA 2I3VA 4YICA 4H5FA 3FXRA 5H8SA 3O28A 2QJEA 5TPAA 3N26A 1A54A 1H76A 1MQDA 2Z22A 3CSBA 2F6PA 3SEXA 3K6UA 2I58A 3CR9A 1IUDA 5EHMA 1BP5A 3C32A 1BKAA 1LAGE 2HAVA 3OELA 4LZ8A 1OQGA 1QKAA 1PC3A 3V5AA 2F78A 2QRYA 3PUYE 4FJPA 3WAEA 1USYE 3KZGA 1PDAA 3PU5A 1Y9UA 1DPEA 4JB7A 3SETA 1ZMGA 4Q0CA 5I57A 2Y84A 4R2BA 4PQJA 3RN8A 2ONRA 2I3WA 1LFGA 5I2NB 3R6UA 1JQFA 1M5EA 2DXYA 1P1UA 2P2AA 3ILUB 3U94A 4F19A 3B6TA 1B32A 1F9BA 1US5A 2O7UA 4MFIA 3LR1A 2DWHA 4OESA 3S2VA 1MXYA 4DCYA 2FYIA 4U23A 1B0HA 3FZVA 4ELQA 1B4ZA 2RC9A 4MF3A 3C36A 4KQPA 5I2KB 1MH4A 5FHOA 1P1NA 4I1DA 4NWCA 4OENA 4TOZA 5FTIA 2REGA 3ZSFA 4OWDA 3I3VA 4IO5A 5CBSA 4LONB 3W15C 3RGYA 3H6TA 3K6XA 5KCJA 4WKMA 4MLQA 3TMGA 1ZIUA 1I6BA 2ZMBA 1ZU0A 2VHAA 3M3LA 3MBPA 4LATA 1TT1A 1FTKA 3KJTA 2OCUA 3G3FA 4F3SA 1GGGA 1OLCA 3G3GA 1TFAA 5B7DA 1XHYA 3MP8A 2QS2A 3M8UA 3QUFA 3K6VA 1ZTYA 1BLFA 2H25A 5A5XA 1B40A 4LQ2A 4ELRA 2AL5A 1NNPA 3OEMA 4IO2A 2O1MA 4OMBA 3S9NC 3E3KA 4G4PA 3IJOB 4DDDA 4MH5A 3K0VA 2V3QA 3C34A 1M5FA 3H06B 3ECRA 1P99A 2ZYMA 3KN3A 3MVZA 4HS7A 2F36A 3FGSA 4F22A 3ZKKA 3B6QA 4NF4B 3K1NA 4ZZEA 2B3BA 1NH8A 4KPTA 4G68C 4H65A 1B51A 1MY2A 1I6QA 2RKMA 4HW8A 2F6GA 3DELB 1B1XA 2ALUA 2XXQA 2HZKA 4U1ZA 3RQTA 2XXHA 1B5JA 1UQWA 3PUZE 2H5YA 3Q28A 4R2FA 2RF1A 1QKBA 4BDLA 2XX7A 1P1OA 1FW0A 1N76A 5L9MA 3TFLA 5KZTA 4X1DA 4YB5A 3E9XA 1PBQA 1SW4A 4NF5B 5CMMA 1PB9A 2F35A 1I69A 1N3XA 3Q25A 1OIBA 1Y3PA 3FVKA 3SKPA 2X7QA 4JBZA 4NE4A 3MW0A 3LSFB 4H6DA 1SBPA 4EQBA 3VVEA 4KYSA 1Z7NE 3BFTA 3FJGA 1LAXA 4MBPA 3TQWA 1OVTA 3KN8A 3VLVA 5HPQA 1O7TA 2ZNTA 4OYVA 4GRKA 3KEIA 5I84A 5JTYA 2Q89A 4QFKA 5H8HB 2Y7IA 3FXQA 2YPNA 3LSXA 5K2XA 4HCYA 5LOMA 5I58A 3MUQA 4C1UA 1D9YA 1LFHA 4GF8A 5TU0A 1FQFA 2UVJA 5TP9A 3O66A 1ZKBA 1LCFA 3CG1A 4O3BA 5I59B 1N04A 1S7YA 2IA4A 4EUOA 1SW2A 3VDFA 1B9JA 1B1HA 4DXBA 4ESXA 3KJ7A 4ELPA 2Q9TA 4LA9A 4IO7A 2GHAA 3EHUA 3IORA 1B4HA 1UTBA 1VE4A 2G29A 1PB8A 3DP4A 1XVYA 4YKIA 2CMOA 4PFUA 3UORA 1RYOA 3K6WA 4ND9A 3BKIB 4YB6A 1MY0A 3S9LC 1NNTA 2I6EA 2G93A 4YAHX 4XIGQ 2RINA 4JSDA 3CRBA 3JV9A 1M5CA 3H03A 3OOAA 4YMBA 2FA7A 2QL3A 1OVBA 5H8FA 3EF7A 4GL0A 4UA8A 1OQHA 4NWDA 4PFWA 3L6HA 3TTMA 4XXUA 1DPPA 2IEEA 3IAZA 3I6VA 4YB7A 2ZYNA 3T96B 2CZLA 4KYDA 4LVQA 2Y7KA 5CRYA 4NF8B 3T66A 4EF1A 2Y7RA 3VXBA 3RTFB 3TCHA 1B58A 1SVXB 1TXFA 2Z8FA 3V89B 2XXTA 2M8CA 3A3CA 4F39A 1R9LA 4R6HA 1VFEA 5F1QA 1SYIA 1A55A 1Z7ME 2ONKE 3OSQA 4P0GA 4DXCA 1L5TA 4HCWA 3UGWA 5ITPA 3O97A 1XVXA 1GVCA 3VVDA 4ISUA 1EH3A 1LBCA 3OXNA 5EYFA 2OWSA 3CIJA 4QF9A 2YJPA 1IXHA 4KHZE 2V3TA 2XD3A 3FXUA 3OO6A 2OBGA 4LUBA 3O6GA 3H7MA 3PMWA 3FIRA 3SEUA 1B0LA 2NUVA 3BFUA 1MY4A 3KFMA 4QSDA 5CMCA 2H98A 4ZE8A 4QFNA 1Q1KA 1D4NA 1SD3A 2R71A 4Q8RA 1CB6A 2DXRA 2F8DA 4OEUA 3DM0A 3OD7A 2ZYKA 4U4XA 4Z0IA 2Q2AA 1A8EA 1B7ZA 4F29A 4F3PA 3PD9A 4H1XA 4RNSA 3JYRA 1QULA 2DE4A 4KI0E 3OEKA 5K2YA 5CMKA 3TUSA 2VD3A 4I62A 4ZEFA 3KOSA 4OFLA 2DQVA 4F1UA 3HN0A 1O64A 4G2ZA 3FVNA 4HTGA 4FIMA 4NF4A 1MDP1 3UN6A 2HEUA 3DP8A 3OO7A 4EDPA 2UYEA 1MPDA 3KBRA 5DVJA 4GLIA 4R74A 3U93A 4POXA 3VE1B 3OO9A 4FATA 2XXYA 3IJXB 4ESWA 3UA8A 2P1SA 4GIZA 4R73A 3WAFA 4PP0A 4I8CA 2DVCA 3OSRA 4RY1A 2RCBA 4QSCA 1HSLA 1MQIA 1B3FA 1B5IA 2PBWA 3CFZA 4NMYA 3MPLA 4IO4A 2H99A 3IOTA 4TQUQ 3TAJA 3TYHA 2OWTA 5F7VA 4EQ7A 4AB6A 1US4A 1IXGA 5FTHA 4WXJA 2Q8JA 5H8QA 5HBCA 5J1DA 3SESA 4LZ7A 1LSTA 3GBBA 3IOVA 3L6GA 3N6TA 4DIGA 4ECFA 1EZOA 5BWJA 3O2AA 1N3WA 1RKMA 1FQCA 1ZLQA 5H8NB 2F7AA 4ZECA 2DS9A 1PB7A 1SQYA 1GR2A 4EXKA 4FE8A 1MPBA 1QVSA 3EN3A 1NKXA 4H8IA 1II5A 3IR1A 3O6HA 2OK2A 2A5SA 2LAOA 1IEJA 2UXAA 2XHDA 5ELVA 4RK2A 2QMXA 3T93B 3MP1A 2PYYA 4Z7EA 3TQLA 2ONSA 1MXUA 1LB8A 2H9BA 2KLFA 3N6UA 5DYHA 2Y7WA 5FHMA 5KDTA 1FTOA 3C9HA 3IB1A 3MZ1A 5M2VA 5H8HA 3IOWA 3UK4A 2I0BA 3H4ZA 4N6PA 1AH5A 4QFLA 3KOTA 4Q30B 3Q29A 2NWJA 4DE8A 5I58B 1T0KA 2PT1A 1Y20A 5I56B 5AA3A 4UACA 4G77A 2W7YA 3PPQA 4TLLB 3B7DA 3USDA 5L9SA 2VP1A 4XKPA 1QJMA 2Z8EA 1AL3A 3O29A 3PPOA 4AQ4A 4MLVA 2XXIA 3I5OA 3T9XB 1XC1A 3IOUA 4F3BA 1LCTA 1URSA 3B6WA 1B3HA 3HV1A 1HSEA 2VGQA 2I4BA 4OHNA 4XKRA 3QAXA 4ZE9A 3FV2A 1NMUA 2ESNA 3TPAA 2A5TB 1WDNA 2XXXA 4PFYA 3E13X 1YPNA 4P0IA 1SI0A 3SEYA 4QRZA 3K01A 3VV5A 4E0WA 1TWYA 1ZJLA 4TLMB 2HZLA 3FJ7A 3V83A 1LFIA 3OMBA 3LSWA 1URGA 1OMPA 5ICTA 4G68A 2OLBA 1QUIA 3FATA 3KN7A 1P1QA 1B05A 1MDQA 4M4GA 2DOJA 3CVGA 1NNFA 4YZZA 4AB5A 1GTKA 2QMWA 3TTRA 3SEWA 2Q88A 4IY5A 3G3KA 2UVHA 1Y3NA 3O9PA 1B3GA 1NH7A 3D4GA 4OFJA 5DEXA 3T9HB 4RK9A 1LAHE 1LAFE 3BBRA 4NF6A 2D21A 3K02A 5DT6A 2ZYOA 3EQ1A 3QSLA 1IXIA 3PMVA 3PPPA 2V25A 4Q5TA 4K3FA 3THIA 3K00A 2XXRA 1B46A 4YKPA 2D3IA 1JEVA 2E0SA 2UVGA 3G3IA 3T9UA 3TKDA 1FTMA 1MXVA 2HCAA 2O68A 3U8QA 2VOZA 4KCDA 3FV1A 3VVFA 5CM6A 3S9EA 3A3UA 2DE3A 3PUXE 2A5TA 4IB2A 4LQ5A 5DVIA 1BIYA 4KR5A 2VD2A 1O63A 1Q35A 3CFLA 4NF5A 2NXOA 1MXZA 2DWAA 2UYFA 1EZPA 3MC2A 3DP6A 3PGFA 1USYH 4DZ1A 4YMAA 4R9GA 4OVJA 1JVXA 2DE2A 3QK6A 1B5HA 5DTBA 3ZS6A 2YLNA 4GD5A 4R72A 3GBAA 2QS3A 3IO4A 3G3HA 1A99A 3EHSA 4DXUA 4OQOA 2ZNUA 4QSEA 2DP8A 2D5WA 2AIXA 1FTJA 1LBBA 2QS4A 3OENA 1H43A 5CI5A 2UVIA 3E4RA 2B65A 5JTYB 5L9OA 3FVGA 1MRPA 1XT8A 3TTKA 3R7XA 3HCQA 5DVFA 2XX9A 1FQDA 1JW4A 1UIVA 1VSOA 1ATGA 3FUZA 2DVZA 1YCJA 1WVJA 1H45A 1SDXA 1SI1A 2O51A 3T22A 3HO7A 4BDOA 5AA4B 1IZ1A 5IKBA 3SDFA 1IQ7A 4G8HA 4YKJA 1N84A 1H44A 1B6HA 4YKKA 3P7IA 4QFPA 1UTBB 3TZAA 3LC8A 4JDFA 3M3KA 2GRVA 2OZZA 3C31A 3PPNA 1SW5A 1Y1MA 1POTA 1FTLA 2BJJX 2PVUA 4KYEA 1D3KA 3MQ9A 3IK6B 4JWYA 4U22A 1B3EA 3KGCA 3MVXA 3W9VA 2V3UA 3H3GA 3N94A 4IGRA 1EZ9A 2F7BA 3EPEA 4F18A 5HM4B 3U1OA 1MPCA 3OO8A 1DTGA 1JW1A 1LGBC 3K2DA 5H8FB 1QUJA 1DTZA 1PBPA 2Y7PA 3LBSA 2GHBA 3QXMA 2V93A 4IO6A 3SEVA 5AE4A 1JVYA 3TTLA 4H8JA 3DLNA 1B2HA 4GQOA 2THIA 2PT2A 4H0WA 3H6UA 3KSJA 2ZNSA 5KDTB 3ZKLA 1AIVA 5H8NA 2X7PA 2RCAA 3FVOA 5ITOA 3SERA 4NF8A 2B3FA 4LP2B 3FJMA 1AMFA 1M5BA 4KCCA 1B7UA 4POWA 2XD2A 4NEDA 4XKNA 2R9JA 5JEIA 3UP9A 2I49A 1URDA 4N13A 3HSTA 3UIFA 2F7CA 3M3FA 4GWOA 4OZ9A 4O3AA 1MM6A 3K1PA 4O3CA 2Q2CA 4RPNA 4THIA 4ZDMA 5AA2A 1IXCA 1MY3A 3LUYA 1IITA 4F31B 3AXFA 4L17A 1JEUA 3RY3A 4EXLA 1R1NA 1NL5A 3K1MA 2DYXA 3RT8A 5BUUA 2XXVA 3HHGA 4H67A 1J1NA 5FHNA 5I56A 3S4UA 4BLAA 1WODA 3PD8A 1QUKA 1ANFA 2I4CA 3KG2A 2F97A 1Y1ZA 4FEBA 3S9MC 3CFXA 3MP6A 1CE2A 4X48A 4JWXA 3IX1A 3RUMA 3U92A 1VFDA 3F11A 3RTWB 1QW0A 5AA2D 2XXUA 3H6WA 1MS7A 3TTNA 5I2NA 1A7LA 2I48A 2RC7A 3FD3A 1S50A 2XXWA 4KFQA 2OJTA 4OFOA 3KSXA 3RT6B 5ISUA 4FAJA 3IL1B 1POY1 4G8MA 5TP9B 1SYHA 3O6IA 1FQBA 4G68B 1JNFA 3VXCA 3CSGA 1BTJA 1NFTA 4FORA 4OTEA 1FCKA 2DWIA 1UTHA 3PPRA 4OXVA 1YAEA 4RJZA 4U4SA 4YU0A 5CC2A 1MQJA 4RYAA 5I57B 4XKQA 5AA2B 2Z8DA 3T9VA 1NNKA 2HXWA 1XOCA 2XX8A 2X26A 2DWJA 4GXAA 1MY1A 2PX1A 1RYXA 3RNNA 5KCJB 1AOVA 3TDJA 3G3JA 3QUJA 2FNCA 4IY6A 4FEDA 4BDRA 1B7HA 1R9QA 3MWBA 3TCGA 3CG3A 2GH9A 2H4IA 3GXAA 3V8XB 4F2QA 4H5GA 2HFBA 4IO3A 4ZEKA 5ICQA 5H8QB 2QS1A 1N7XA 3TELA 3H6VA 1MXXA 4EQ9A 1DSNA 2NVUB 2AYSA 1ELJA 4JSOA 1FQAA 3MAMA 3MPKA 4ELOA 3C35A 1A8FA 3LSLA 4ZEBA 4ZEIA 3MVYA 4GVOA 1MH3A 1SW1A 4F1YA 1MM7A 3GZGA 1R6ZA 1ZBMA 4BDMA 3MVWA 2HQ0A 1M5DA 4OETA 1GV8A 1Y4TA 2F5XA 3N5LA 1H3DA 4P11A 2REJA 2F34A 2QSXA 3D4CA 1I6AA 4OERA 3CI8A 1FQEA 1JW5A 1Y3QA 1IIWA 2QPQA 3IO6A 3R26A 1MXWA 1XS5A 4PE5B 4RXLA 1UTHB 3MZ9A 1UIUA 1TFDA 3GLBA 2ANJA 5A5XB 4C1TA 3QYTA 5CBRA 3HPIA 3JZJA 4G8NA 1D9VA 4F3GA 1HSJA 2ZXTA 3G7WA 3K4UA 1OLAA 3HHFA 4DCXA 2E1SA 4JWOA 1VR5A 4F2OA 4IGTA 4KD5A 5CMBA 3RPWA 3PMXA 1N7WA 4GOTA 5EHSA 4ZZAA 4EF2A 2P0SA 3QIMA 4JXIA 4X1BA 3TODA 3PUVE 3VLUA 1B52A 2O69A 3C33A 4NTLA 4ONYA 2DSFA 4RPOA 4C0RA 4F1VA 1P1WA 2ABHA 1JETA 4R9FA 4X9TA 1MQHA 4DLDA 1Y4CA 3U72A 1LB9A 5TPAB 4ZEDA 3FASA 3ODBA 4GFRA 3ONMA 1S9TA 4OEVA 4WEPA 2I0CA 2V84A 4PFTA 1MG1A 2HAUA 4R75A 4R6KA 2PMSA 5L8DA 4N07A 3TCFA 4U21A 3PV0E 4BDNA 5JK4A 3MJNA 2R6GE 2O84X 1DMBA 3TEPA 5AA1A 1DOTA 3A09A 2RC8A 1MQGA 2NOOA 2WKYA 3EHTA 4LZ5A 3VLWA 5I59A 5IAIA 3Q26A 3MZBA 3Q27A 2GFEA 4XTCQ 3W9WA 4E0XA 2AL4A 2O1LA 4M1VA 3VFJA 4QFOA 4U2RA 3PUWE 4FECA 4RA1A 1KWHA 4I9DA 1LLSA 5DEXB 4U1OA 1YTVA 1A40A 4ZS9A 3RLFE 4BDQA 4R6YA 3C4MA 2O6AA 2XXPA 4NF6B 5AA4A 1N0TA 1PEBA 3IB2A 5I2KA 2Z23A
chains in the Genus database with same CATH superfamily
4GXSB 5H8SA 5TPAA 2QJEA 3V5AA 1USYE 3KZGA 5F24A 4JB7A 3SETA 4Q0CA 3RN8A 5I2NB 4N17A 1JQFA 2DXYA 3ILUB 4OA4A 4PDDA 4GWUA 3QMFA 1FTAA 3LR1A 4OESA 4DCYA 4MCOA 1B0HA 5I2KB 3C36A 4I1DA 3ZSFA 4FBPA 4OWDA 3I3VA 5CBSA 3W15C 4WKMA 3TMGA 1ZIUA 2ZMBA 1ZU0A 1GGGA 1TFAA 4O7MA 1XHYA 5J16A 4ELRA 1NNPA 3E3KA 4G4PA 3ECRA 4F22A 1NH8A 4G68C 1B51A 1MY2A 3DELB 4U1ZA 3PUZE 4R2FA 1QKBA 3TFLA 5KZTA 4X1DA 3E9XA 1RDYA 1N3XA 3Q25A 3SKPA 4H6DA 1SBPA 4KYSA 3KN8A 5HPQA 4LN5A 2Q89A 4QFKA 4MNCA 4UABA 5LOMA 4C1UA 5EQ7A 3CG1A 1B9JA 3KBZA 4DXBA 4ESXA 3KJ7A 4MAGA 2Q9TA 2GHAA 4PFUA 1RYOA 4ND9A 2I6EA 3H03A 2FA7A 4NWDA 3L6HA 1Q9DA 5EYHA 1FBDA 3T96B 4JVDA 4PDHA 3T66A 1SVXB 2XXTA 1SYIA 3OSQA 1L5TA 4PGNA 5ITPA 1GVCA 2XXKA 2OWSA 4QF9A 4KHZE 2V3TA 3FXUA 2OBGA 3H7MA 3SEUA 1B0LA 2NUVA 5CMCA 4QFNA 2F8DA 1IMEA 2ZYKA 4U4XA 4Z0IA 1A8EA 1B7ZA 4F29A 4KI0E 3OEKA 5K2YA 2HEUA 3OO7A 2UYEA 4MIJA 3KBRA 3U93A 4GLIA 4R74A 3VE1B 4POXA 3IJXB 4RY1A 1HSLA 3CFZA 4N8GA 3MPLA 5EYGA 3TAJA 4OVTA 3TYHA 5F7VA 1DCUA 1US4A 3B50A 5H8QA 4LZ7A 1FQCA 4ZECA 4N6DA 4GX4A 3T93B 2A5SA 5IZZA 3MP1A 1LB8A 2H9BA 2KLFA 2Y7WA 5M2VA 5H8HA 2WEFA 3H4ZA 3KOTA 5I58B 1Y20A 5AA3A 1IMCA 3PPQA 3USDA 5L9SA 2VP1A 4MLVA 2XXIA 3T9XB 3B6WA 3FV2A 2XXXA 4PFYA 4P0IA 1SI0A 4QRZA 1LFIA 1FPJA 3KN7A 4YZZA 4HE1A 1Y3NA 3D4GA 1LAFE 3K02A 2ZYOA 3EQ1A 4NX1A 4QXDA 2XXRA 1B46A 1JEVA 1K9ZA 3U8QA 3FV1A 2DE3A 1BIYA 1O63A 1LBXA 1USYH 2DE2A 5DTBA 4R72A 4OQOA 2AIXA 5AA2D 5JTYB 1FBEA 2B65A 3E4RA 4P3LA 3R7XA 5DVFA 2XX9A 1FQDA 1UIVA 1ATGA 3FUZA 1FBPA 5AA4B 1N84A 4JDFA 2OZZA 1SW5A 2QVRA 1FTLA 2FBPA 1NV7A 5ET5A 3W9VA 3N94A 1KZ8A 2F7BA 1LBVA 1LGBC 1QUJA 1DTZA 2HHMA 1PBPA 3SEVA 2GHBA 4IO6A 2V93A 1JVYA 3ZKLA 1AIVA 4N91A 3FVOA 5ITOA 1FSAA 1AMFA 4XKNA 2XD2A 4NEDA 5JEIA 2I49A 3HSTA 5AA2A 3AXFA 1NL5A 2DYXA 3ISPA 4IR8A 1NI9A 5FHNA 1FJ9A 5IGAA 1ANFA 2F97A 2HXRA 2B4MA 4X48A 3IX1A 3U92A 2XXUA 2RC7A 3E78A 5ISUA 2WBBA 1SYHA 1FQBA 3CSGA 1NFTA 4OXVA 4U4SA 5CC2A 1YXIA 2Z8DA 1NNKA 2HXWA 2DWJA 1MY1A 3TDJA 3G3JA 3QUJA 4BDRA 2GH9A 3GXAA 5ICQA 3V8XB 4H5GA 2QS1A 1N7XA 2AYSA 1FQAA 4ELOA 2F3DA 4ZEBA 2R8TA 4ZEIA 4GVOA 4F1YA 1SW1A 1ZBMA 1GV8A 2HQ0A 2XWOA 3NOHA 2REJA 2QSXA 2QPQA 1UIUA 3GLBA 3SZPA 3JZJA 4G8NA 4GWSA 4P1LA 2F3BA 2FVZA 3G7WA 2E1SA 4F2OA 4IGTA 3T0JA 3RPWA 3PMXA 4XFEA 4JXIA 3QIMA 4NTLA 4F1VA 4C0RA 4DLDA 3U72A 3FASA 3ODBA 1S9TA 4WEPA 2I0CA 2V84A 3TCFA 4N07A 4BDNA 3BIGA 5JK4A 1DOTA 1SPIA 2NOOA 5IAIA 3MZBA 3Q27A 4XTCQ 3E79A 4RA1A 5I3SA 3RLFE 4BDQA 4ZS9A 5ESYA 3C4MA 4NF6B 1N0TA 1PEBA 5LDZA 2Z23A 5B70A 4GL8A 4WEDA 3IB0A 2I3VA 4YICA 3N26A 1A54A 3KC1A 3CR9A 5EHMA 2GQ1A 3C32A 3OELA 1BKAA 1LAGE 2MKZA 1OQGA 3WAEA 4NQ8A 3RPLA 4P56A 1M5EA 4NGUA 1NUZA 1B32A 2O7UA 4N15A 1NV3A 1MXYA 4KQPA 1LBWA 2REGA 4LONB 3K6XA 4MLQA 2VHAA 4PAKA 2OCUA 3G3FA 1OLCA 1ZTYA 1BLFA 1B40A 3OEMA 2O1MA 4DDDA 3H06B 3PTYA 3B6QA 4ZZEA 2B3BA 4P1EA 2ALUA 2HZKA 2XXHA 4BDLA 1N76A 1PBQA 4DI3D 1NV5A 1PB9A 1Y3PA 2X7QA 4JBZA 3EKIA 2V4CA 3VVEA 1Z7NE 3VLVA 1O7TA 4OYVA 5H8HB 3LSXA 5I58A 1D9YA 1LCFA 5I59B 3EHUA 1UTBA 2CMOA 3U65A 1KA0A 3S9LC 1NNTA 4YAHX 4XIGQ 2RINA 3JV9A 4GL0A 3TTMA 2IEEA 3IAZA 4KYDA 5CRYA 2Y7KA 4NF8B 4EF1A 3RTFB 1B58A 1TXFA 4I3YA 4N8YA 4R6HA 2ONKE 4MNIA 4DI4B 3O97A 1XVXA 4ISUA 5EYFA 3CIJA 1IXHA 2XD3A 3OO6A 3O6GA 3PMWA 4I40A 3BFUA 2H98A 4ZE8A 1Q1KA 1SD3A 1CB6A 2DXRA 4OEUA 3DM0A 1IMBA 2Q2AA 1RDXA 4H1XA 4RNSA 1QULA 2VD3A 4I62A 4ZEFA 1FPKA 3KOSA 4GWYA 3HN0A 3FVNA 1MDP1 4GBWA 4FATA 3OO9A 2P1SA 4PCDA 4PP0A 1B5IA 2PBWA 4NMYA 4IO4A 2OWTA 1IXGA 5HBCA 2ZZXA 3SESA 4GWWA 1LSTA 4ECFA 3IOVA 1ZLQA 4O8MA 5H8NB 3HFUA 1MPBA 2DDKA 1QVSA 3EN3A 3O6HA 2OK2A 2LAOA 4MNPA 1MXUA 3MZ1A 2I0BA 1AH5A 4G77A 4TLLB 4N6KA 1QJMA 3O29A 3IOUA 1B3HA 2VGQA 2I4BA 4XKRA 3VV5A 1ZJLA 4TLMB 3FJ7A 1FPIA 3V83A 3LSWA 3LUZA 2OLBA 1QUIA 3FATA 1P1QA 3CVGA 1NV2A 2UVHA 1NH7A 4RK9A 3BBRA 1IMAA 4OVRA 2XWVA 1IXIA 3K00A 4YKPA 2D3IA 2UVGA 2O68A 5CM6A 4IB2A 5DVIA 4KR5A 2VD2A 3CFLA 1EZPA 1MXZA 3MC2A 3DP6A 4YMAA 4R9GA 3QK6A 1B5HA 4GD5A 4QSEA 2DP8A 2D5WA 1LBBA 3U94A 2QS4A 3OENA 1H43A 3FVGA 1XT8A 2XA5A 3HCQA 4JVCA 1WVJA 1SDXA 2O51A 3HO7A 4BDOA 4HE2A 1B6HA 1UTBB 4QBAA 4KYEA 4X9TA 4U22A 3T9VA 1B3EA 4P47A 4IGRA 5HM4B 1IMDA 1JW1A 3K2DA 3LBSA 3DLNA 1B2HA 2THIA 2ZNSA 5H8NA 3SERA 2B3FA 4POWA 2R9JA 4OANA 3UP9A 3UIFA 2QFLA 2F7CA 4OZ9A 1NV1A 1MM6A 4O3CA 4O3AA 1IXCA 1JEUA 4EXLA 4H67A 5I56A 3PD8A 4PFIA 4NN3A 4MMPA 3CFXA 3MP6A 3S9MC 4JWXA 2PCRA 3RUMA 2VT5A 3F11A 1MS7A 3TTNA 2I48A 1S50A 2XXWA 4HE0A 2OJTA 1POY1 4G61A 5TP9B 3PPRA 2DWIA 1MQJA 4XKQA 3GYYA 2X26A 2PX1A 1RYXA 4IY6A 4FEDA 1B7HA 2H4IA 4F2QA 2HFBA 4ZEKA 5H8QB 3TELA 2WX9A 1ELJA 3C35A 3A29A 3LSLA 3GZGA 2WYPA 1R6ZA 4GWXA 5ET7A 1M5DA 4OETA 3N5LA 1H3DA 3D4CA 4PE5B 1JW5A 3IO6A 3FBPA 4RXLA 1UTHB 3MZ9A 1TFDA 2FHYA 3QYTA 1D9VA 1HSJA 2ZXTA 4DCXA 1VR5A 4KD5A 4PBHA 4GOTA 4EF2A 3TODA 2O69A 4ONYA 2DSFA 4RPOA 2P3VA 1JETA 1MQHA 2QVVA 5TPAB 4AS4A 3ONMA 3IFCA 4OEVA 4R75A 4PFTA 1DK4A 3MJNA 2R6GE 3A09A 2WYKA 2WKYA 5I59A 4LZ5A 5IZ3A 2GFEA 4NHBA 2O1LA 3PUWE 4I9DA 1LLSA 1YTVA 2O6AA 1LEVA 5I2KA 4P8BA 2O7IA 1B3LA 3ILTB 1XI6A 4PETA 3FXRA 1NUYA 2F6PA 3K6UA 1IUDA 4LZ8A 1QKAA 1PC3A 4FJPA 4MX6A 1DPEA 2Y84A 4R2BA 4PQJA 2I3WA 1LFGA 2FIEA 3LV0A 4U23A 3FZVA 4ELQA 1B4ZA 1MH4A 1P1NA 4TOZA 4OENA 5FTIA 4IO5A 3RGYA 5KCJA 1I6BA 2VPNA 3G3GA 5B7DA 4JVIA 3MP8A 2QS2A 3M8UA 2OX3A 4HXVA 2H25A 4X8RA 4IO2A 1EYKA 4OMBA 3S9NC 3IJOB 3K0VA 3KN3A 1M5FA 3MVZA 2ZYMA 4HS7A 4KPTA 4H65A 1I6QA 2RKMA 2F6GA 1B1XA 3RQTA 2XXQA 5CBRA 1B5JA 2H5YA 1K9YA 4YB5A 1SW4A 5CMMA 2F35A 5I5PA 1I69A 3MW0A 4N4UA 4EQBA 3TQWA 1OVTA 3KC0A 4GRKA 3KEIA 3FXQA 2YPNA 5K2XA 1LFHA 4GF8A 3O66A 1ZKBA 4O3BA 1N04A 2IA4A 4EUOA 1SW2A 4IO7A 2G29A 5ET8A 1XVYA 5IZ1A 4YB6A 2G93A 4O94A 4YMBA 1RDZA 5H8FA 3EF7A 1OQHA 1DPPA 5ET6A 4LVQA 3VXBA 2Z8FA 2M8CA 1R9LA 5F1QA 1Z7ME 3UGWA 2CZHA 1EH3A 5LTCA 4LUBA 1FPFA 5EQ8A 1MY4A 3KFMA 1D4NA 2R71A 4F3PA 4XEQA 3PD9A 5CMKA 3JYRA 3TUSA 3RYDA 4F1UA 4HTGA 4FIMA 3UN6A 3DP8A 4H46A 5DVJA 4HW8A 5EQ9A 3UA8A 4R73A 4I8CA 3OSRA 1B3FA 2H99A 3IOTA 4TQUQ 5FTHA 2BJIA 4WXJA 2Q8JA 5J1DA 3GBBA 3N6TA 1EZOA 1FPGA 3O2AA 1N3WA 2F7AA 4PGPA 1SQYA 1GR2A 4EXKA 4FE8A 1QGXA 4H8IA 3IR1A 1G0HA 2UXAA 1IEJA 5ELVA 4RK2A 2QMXA 2PYYA 2ONSA 5DYHA 4GWZA 3N6UA 1FTOA 3IB1A 3UK4A 4DE8A 3Q29A 2PT1A 4PF6A 5I56B 2Z8EA 1AL3A 3PPOA 3I5OA 1XC1A 4F3BA 3HV1A 1HSEA 4OHNA 1NMUA 2ESNA 2A5TB 3E13X 3SEYA 4E0WA 3K01A 1TWYA 4PC9A 3OMBA 2PFYA 4M4GA 4GBVA 3SEWA 4IY5A 3G3KA 3O9PA 4OFJA 3T9HB 1LAHE 3THIA 4Q5TA 2V25A 2XWIA 2E0SA 1FTMA 1MXVA 2HCAA 2VOZA 4KCDA 3VVFA 3A3UA 3PUXE 2JJKA 2DWAA 4DZ1A 3ZS6A 2XWKA 2QS3A 3IO4A 3G3HA 3EHSA 2ZNUA 5CI5A 4MHFA 5L9OA 4NF0A 1VSOA 4PBQA 2DVZA 1YCJA 1H45A 3T22A 5IKBA 3SDFA 4YKJA 4YKKA 3LC8A 1NV0A 3M3KA 3C31A 1Y1MA 2BJJX 1POTA 3MQ9A 3MVXA 2V3UA 4F18A 1EZ9A 1VDWA 3U1OA 2Y7PA 5AE4A 3TTLA 4GQOA 4H0WA 5KDTB 3H6UA 4NF8A 4LP2B 1M5BA 1B7UA 1URDA 4N13A 3M3FA 3K1PA 4RPNA 2Q2CA 4ZDMA 1MY3A 4F31B 4L17A 3RY3A 3K1MA 2XXVA 3HHGA 2P3NA 1J1NA 4BLAA 1QUKA 3KG2A 4FEBA 1Y1ZA 1VFDA 1A7LA 4PAFA 3FD3A 4H45A 4OFOA 3KSXA 4FAJA 3IL1B 4G8MA 3VXCA 1BTJA 4OTEA 4RYAA 5AA2B 2VPOA 1NV6A 3RNNA 5KCJB 1AOVA 2FNCA 3CG3A 4IO3A 1YZ0A 1AWBA 4JSOA 3MPKA 3MAMA 1A8FA 3FXBA 3MVYA 5FBPA 2CZIA 1JP4A 1Y4TA 2F5XA 1T0KA 4UACA 2F34A 4XKPA 4NF4A 1FQEA 1Y3QA 1IIWA 3BIHA 3R26A 1MXWA 4NAPA 4NG7A 2ANJA 4C1TA 4N81A 3HPIA 4F3GA 3HHFA 4JWOA 2PFZA 5CMBA 3VLUA 3MSTA 4X1BA 1B52A 3C33A 2L5VA 3D1RA 4ZEDA 4GFRA 5L8DA 1MG1A 2HAUA 4R6KA 2PMSA 4U21A 1DMBA 3TEPA 5AA1A 2ZZWA 3VLWA 3RPLB 2AL4A 1FBCA 4M1VA 3VFJA 4U2RA 3IFAA 2XXPA 3MYUA 1EYJA 1EU8A 1LBZA 4QHQA 1BK4A 4OVPA 4H5FA 3O28A 1H76A 1MQDA 2Z22A 3CSBA 3SEXA 1KA1A 2I58A 1BP5A 2HAVA 2F78A 2QRYA 3PUYE 1PDAA 3PU5A 1Y9UA 5I7IA 1ZMGA 5I57A 2CEYA 2ONRA 3R6UA 2P2AA 1P1UA 4F19A 3B6TA 1LBYA 1F9BA 4MFIA 1US5A 2CZKA 3S2VA 2DWHA 2FYIA 2RC9A 4MF3A 5FHOA 4NWCA 1NUWA 1FPDA 3H6TA 3MBPA 3M3LA 4LATA 2ZZVA 1TT1A 1FTKA 3KJTA 2WBDA 4F3SA 3QUFA 3K6VA 5A5XA 4LQ2A 2AL5A 4PE3A 4MH5A 2V3QA 3C34A 1P99A 2F36A 3FGSA 3ZKKA 4NF4B 3K1NA 2Q74A 4OVSA 1UQWA 3Q28A 2RF1A 2XX7A 1P1OA 1FW0A 5L9MA 3T1BA 1YYZA 4NF5B 1OIBA 5A5LA 3FVKA 4NE4A 3LSFB 3BFTA 3B8BA 3FJGA 1LAXA 4MBPA 2ZNTA 5I84A 5JTYA 2Y7IA 4HCYA 3MUQA 4X04A 5TU0A 1FQFA 2UVJA 5TP9A 1S7YA 3VDFA 1B1HA 4ELPA 4LA9A 2Y5LA 4YKIA 3IORA 1B4HA 4MEVA 1VE4A 3DP4A 1PB8A 3UORA 3K6WA 3BKIB 1MY0A 4JSDA 3CRBA 1M5CA 5IM2A 3OOAA 2QL3A 1OVBA 4UA8A 4PFWA 4XXUA 3I6VA 4YB7A 2ZYNA 1NV4A 2CZLA 2B4LA 2Y7RA 2HPGA 3TCHA 3V89B 4PF8A 3A3CA 4F39A 1VFEA 4O7IA 1A55A 4DXCA 4P0GA 4HCWA 3VVDA 1LBCA 3OXNA 4QSCA 2YJPA 2Q8MA 3FIRA 4Z7EA 4QSDA 4Q8RA 3OD7A 2DE4A 4OFLA 2DQVA 4G2ZA 1O64A 4EDPA 1MPDA 2XXYA 4ESWA 4GIZA 3WAFA 2DVCA 2RCBA 1MQIA 4P9KA 4EQ7A 4AB6A 2CEXA 3L6GA 4DIGA 5BWJA 1RKMA 2DS9A 1PB7A 1NKXA 1II5A 1IMFA 1CNQA 2XHDA 3TQLA 4I3EA 5FHMA 5KDTA 3C9HA 3IOWA 4N6PA 4QFLA 3CHGA 4PFRA 4Q30B 2NWJA 1FBGA 2W7YA 3B7DA 4AQ4A 1LCTA 1URSA 4ZE9A 3QAXA 3TPAA 1WDNA 1YPNA 2KQZA 4MJOA 2HZLA 1URGA 1OMPA 5ICTA 4G68A 4GX3A 1B05A 1MDQA 2DOJA 4OVQA 1NNFA 4AB5A 4PTKA 1GTKA 2QMWA 3TTRA 2Q88A 1B3GA 5DEXA 3ROJA 4NF6A 2D21A 5DT6A 1G0IA 3QSLA 3PMVA 3PPPA 4K3FA 3T9UA 3TKDA 3G3IA 3S9EA 1FBFA 2A5TA 4LQ5A 4PAIA 1Q35A 4NF5A 2NXOA 2UYFA 3PGFA 4OVJA 1JVXA 2YLNA 3GBAA 1A99A 4DXUA 1FTJA 2QVUA 5BUUA 4AS5A 2UVIA 1MRPA 3TTKA 1D9QA 1JW4A 1SI1A 1IZ1A 2KR0A 1IQ7A 4G8HA 1H44A 3TZAA 3P7IA 4QFPA 4XF5A 2GRVA 3PPNA 2PVUA 2Y5KA 4KXPA 1D3KA 4JWYA 3IK6B 3KGCA 3H3GA 1DBZA 3EPEA 1MPCA 3OO8A 1DTGA 5H8FB 1EYIA 3QXMA 4H8JA 1FJ6A 2PT2A 3KSJA 2X7PA 2RCAA 3FJMA 4KCCA 5DW8A 4GWOA 4THIA 3LUYA 1IITA 1R1NA 3RT8A 3S4UA 1WODA 2I4CA 1CE2A 3RTWB 1QW0A 3H6WA 5I2NA 1FPLA 4KFQA 3RT6B 2FIXA 1FRPA 3O6IA 4G68B 1JNFA 4FORA 1FCKA 1UTHA 4RJZA 4YU0A 1YAEA 5I57B 1XOCA 2XX8A 4GXAA 3MWBA 1R9QA 3TCGA 3H6VA 1MXXA 1FPEA 4EQ9A 1DSNA 2NVUB 1NUXA 1MH3A 1MM7A 4GX6A 4BDMA 3MVWA 4P11A 4OERA 1I6AA 3CI8A 5IZ3B 1XS5A 5A5XB 3K4UA 1OLAA 1N7WA 1FBHA 5EHSA 4ZZAA 2P0SA 1INPA 3PUVE 5AA4A 1P1WA 2ABHA 4R9FA 1Y4CA 1LB9A 1FPBA 5T3JA 5EQAA 3PV0E 2O84X 2RC8A 1MQGA 3EHTA 3Q26A 3W9WA 4E0XA 2OWZA 4QFOA 4FECA 1KWHA 5DEXB 4U1OA 1A40A 4PFBA 4R6YA 3IB2A
chains in the Genus database with same CATH topology
2O7IA 4GXSB 1B3LA 1EU8A 4GL8A 4WEDA 3IB0A 3ILTB 5B70A 4QHQA 4PETA 2I3VA 4YICA 4H5FA 3FXRA 5H8SA 3O28A 2QJEA 5TPAA 3N26A 1A54A 1H76A 1MQDA 2Z22A 3CSBA 2F6PA 3SEXA 3K6UA 2I58A 3CR9A 1IUDA 5EHMA 1BP5A 3C32A 1BKAA 1LAGE 2HAVA 3OELA 4LZ8A 1OQGA 1QKAA 1PC3A 3V5AA 2F78A 2QRYA 3PUYE 4FJPA 3WAEA 1USYE 3KZGA 1PDAA 3PU5A 1Y9UA 1DPEA 4JB7A 3SETA 1ZMGA 4Q0CA 5I57A 2Y84A 4R2BA 4PQJA 3RN8A 2ONRA 2I3WA 1LFGA 5I2NB 3R6UA 1JQFA 1M5EA 2DXYA 1P1UA 2P2AA 3ILUB 3U94A 4F19A 3B6TA 1B32A 1F9BA 1US5A 2O7UA 4MFIA 3LR1A 2DWHA 4OESA 3S2VA 1MXYA 4DCYA 2FYIA 4U23A 1B0HA 3FZVA 4ELQA 1B4ZA 2RC9A 4MF3A 3C36A 4KQPA 5I2KB 1MH4A 5FHOA 1P1NA 4I1DA 4NWCA 4OENA 4TOZA 5FTIA 2REGA 3ZSFA 4OWDA 3I3VA 4IO5A 5CBSA 4LONB 3W15C 3RGYA 3H6TA 3K6XA 5KCJA 4WKMA 4MLQA 3TMGA 1ZIUA 1I6BA 2ZMBA 1ZU0A 2VHAA 3M3LA 3MBPA 4LATA 1TT1A 1FTKA 3KJTA 2OCUA 3G3FA 4F3SA 1GGGA 1OLCA 3G3GA 1TFAA 5B7DA 1XHYA 3MP8A 2QS2A 3M8UA 3QUFA 3K6VA 1ZTYA 1BLFA 2H25A 5A5XA 1B40A 4LQ2A 4ELRA 2AL5A 1NNPA 3OEMA 4IO2A 2O1MA 4OMBA 3S9NC 3E3KA 4G4PA 3IJOB 4DDDA 4MH5A 3K0VA 2V3QA 3C34A 1M5FA 3H06B 3ECRA 1P99A 2ZYMA 3KN3A 3MVZA 4HS7A 2F36A 3FGSA 4F22A 3ZKKA 3B6QA 4NF4B 3K1NA 4ZZEA 2B3BA 1NH8A 4KPTA 4G68C 4H65A 1B51A 1MY2A 1I6QA 2RKMA 4HW8A 2F6GA 3DELB 1B1XA 2ALUA 2XXQA 2HZKA 4U1ZA 3RQTA 2XXHA 1B5JA 1UQWA 3PUZE 2H5YA 3Q28A 4R2FA 2RF1A 1QKBA 4BDLA 2XX7A 1P1OA 1FW0A 1N76A 5L9MA 3TFLA 5KZTA 4X1DA 4YB5A 3E9XA 1PBQA 1SW4A 4NF5B 5CMMA 1PB9A 2F35A 1I69A 1N3XA 3Q25A 1OIBA 1Y3PA 3FVKA 3SKPA 2X7QA 4JBZA 4NE4A 3MW0A 3LSFB 4H6DA 1SBPA 4EQBA 3VVEA 4KYSA 1Z7NE 3BFTA 3FJGA 1LAXA 4MBPA 3TQWA 1OVTA 3KN8A 3VLVA 5HPQA 1O7TA 2ZNTA 4OYVA 4GRKA 3KEIA 5I84A 5JTYA 2Q89A 4QFKA 5H8HB 2Y7IA 3FXQA 2YPNA 3LSXA 5K2XA 4HCYA 5LOMA 5I58A 3MUQA 4C1UA 1D9YA 1LFHA 4GF8A 5TU0A 1FQFA 2UVJA 5TP9A 3O66A 1ZKBA 1LCFA 3CG1A 4O3BA 5I59B 1N04A 1S7YA 2IA4A 4EUOA 1SW2A 3VDFA 1B9JA 1B1HA 4DXBA 4ESXA 3KJ7A 4ELPA 2Q9TA 4LA9A 4IO7A 2GHAA 3EHUA 3IORA 1B4HA 1UTBA 1VE4A 2G29A 1PB8A 3DP4A 1XVYA 4YKIA 2CMOA 4PFUA 3UORA 1RYOA 3K6WA 4ND9A 3BKIB 4YB6A 1MY0A 3S9LC 1NNTA 2I6EA 2G93A 4YAHX 4XIGQ 2RINA 4JSDA 3CRBA 3JV9A 1M5CA 3H03A 3OOAA 4YMBA 2FA7A 2QL3A 1OVBA 5H8FA 3EF7A 4GL0A 4UA8A 1OQHA 4NWDA 4PFWA 3L6HA 3TTMA 4XXUA 1DPPA 2IEEA 3IAZA 3I6VA 4YB7A 2ZYNA 3T96B 2CZLA 4KYDA 4LVQA 2Y7KA 5CRYA 4NF8B 3T66A 4EF1A 2Y7RA 3VXBA 3RTFB 3TCHA 1B58A 1SVXB 1TXFA 2Z8FA 3V89B 2XXTA 2M8CA 3A3CA 4F39A 1R9LA 4R6HA 1VFEA 5F1QA 1SYIA 1A55A 1Z7ME 2ONKE 3OSQA 4P0GA 4DXCA 1L5TA 4HCWA 3UGWA 5ITPA 3O97A 1XVXA 1GVCA 3VVDA 4ISUA 1EH3A 1LBCA 3OXNA 5EYFA 2OWSA 3CIJA 4QF9A 2YJPA 1IXHA 4KHZE 2V3TA 2XD3A 3FXUA 3OO6A 2OBGA 4LUBA 3O6GA 3H7MA 3PMWA 3FIRA 3SEUA 1B0LA 2NUVA 3BFUA 1MY4A 3KFMA 4QSDA 5CMCA 2H98A 4ZE8A 4QFNA 1Q1KA 1D4NA 1SD3A 2R71A 4Q8RA 1CB6A 2DXRA 2F8DA 4OEUA 3DM0A 3OD7A 2ZYKA 4U4XA 4Z0IA 2Q2AA 1A8EA 1B7ZA 4F29A 4F3PA 3PD9A 4H1XA 4RNSA 3JYRA 1QULA 2DE4A 4KI0E 3OEKA 5K2YA 5CMKA 3TUSA 2VD3A 4I62A 4ZEFA 3KOSA 4OFLA 2DQVA 4F1UA 3HN0A 1O64A 4G2ZA 3FVNA 4HTGA 4FIMA 4NF4A 1MDP1 3UN6A 2HEUA 3DP8A 3OO7A 4EDPA 2UYEA 1MPDA 3KBRA 5DVJA 4GLIA 4R74A 3U93A 4POXA 3VE1B 3OO9A 4FATA 2XXYA 3IJXB 4ESWA 3UA8A 2P1SA 4GIZA 4R73A 3WAFA 4PP0A 4I8CA 2DVCA 3OSRA 4RY1A 2RCBA 4QSCA 1HSLA 1MQIA 1B3FA 1B5IA 2PBWA 3CFZA 4NMYA 3MPLA 4IO4A 2H99A 3IOTA 4TQUQ 3TAJA 3TYHA 2OWTA 5F7VA 4EQ7A 4AB6A 1US4A 1IXGA 5FTHA 4WXJA 2Q8JA 5H8QA 5HBCA 5J1DA 3SESA 4LZ7A 1LSTA 3GBBA 3IOVA 3L6GA 3N6TA 4DIGA 4ECFA 1EZOA 5BWJA 3O2AA 1N3WA 1RKMA 1FQCA 1ZLQA 5H8NB 2F7AA 4ZECA 2DS9A 1PB7A 1SQYA 1GR2A 4EXKA 4FE8A 1MPBA 1QVSA 3EN3A 1NKXA 4H8IA 1II5A 3IR1A 3O6HA 2OK2A 2A5SA 2LAOA 1IEJA 2UXAA 2XHDA 5ELVA 4RK2A 2QMXA 3T93B 3MP1A 2PYYA 4Z7EA 3TQLA 2ONSA 1MXUA 1LB8A 2H9BA 2KLFA 3N6UA 5DYHA 2Y7WA 5FHMA 5KDTA 1FTOA 3C9HA 3IB1A 3MZ1A 5M2VA 5H8HA 3IOWA 3UK4A 2I0BA 3H4ZA 4N6PA 1AH5A 4QFLA 3KOTA 4Q30B 3Q29A 2NWJA 4DE8A 5I58B 1T0KA 2PT1A 1Y20A 5I56B 5AA3A 4UACA 4G77A 2W7YA 3PPQA 4TLLB 3B7DA 3USDA 5L9SA 2VP1A 4XKPA 1QJMA 2Z8EA 1AL3A 3O29A 3PPOA 4AQ4A 4MLVA 2XXIA 3I5OA 3T9XB 1XC1A 3IOUA 4F3BA 1LCTA 1URSA 3B6WA 1B3HA 3HV1A 1HSEA 2VGQA 2I4BA 4OHNA 4XKRA 3QAXA 4ZE9A 3FV2A 1NMUA 2ESNA 3TPAA 2A5TB 1WDNA 2XXXA 4PFYA 3E13X 1YPNA 4P0IA 1SI0A 3SEYA 4QRZA 3K01A 3VV5A 4E0WA 1TWYA 1ZJLA 4TLMB 2HZLA 3FJ7A 3V83A 1LFIA 3OMBA 3LSWA 1URGA 1OMPA 5ICTA 4G68A 2OLBA 1QUIA 3FATA 3KN7A 1P1QA 1B05A 1MDQA 4M4GA 2DOJA 3CVGA 1NNFA 4YZZA 4AB5A 1GTKA 2QMWA 3TTRA 3SEWA 2Q88A 4IY5A 3G3KA 2UVHA 1Y3NA 3O9PA 1B3GA 1NH7A 3D4GA 4OFJA 5DEXA 3T9HB 4RK9A 1LAHE 1LAFE 3BBRA 4NF6A 2D21A 3K02A 5DT6A 2ZYOA 3EQ1A 3QSLA 1IXIA 3PMVA 3PPPA 2V25A 4Q5TA 4K3FA 3THIA 3K00A 2XXRA 1B46A 4YKPA 2D3IA 1JEVA 2E0SA 2UVGA 3G3IA 3T9UA 3TKDA 1FTMA 1MXVA 2HCAA 2O68A 3U8QA 2VOZA 4KCDA 3FV1A 3VVFA 5CM6A 3S9EA 3A3UA 2DE3A 3PUXE 2A5TA 4IB2A 4LQ5A 5DVIA 1BIYA 4KR5A 2VD2A 1O63A 1Q35A 3CFLA 4NF5A 2NXOA 1MXZA 2DWAA 2UYFA 1EZPA 3MC2A 3DP6A 3PGFA 1USYH 4DZ1A 4YMAA 4R9GA 4OVJA 1JVXA 2DE2A 3QK6A 1B5HA 5DTBA 3ZS6A 2YLNA 4GD5A 4R72A 3GBAA 2QS3A 3IO4A 3G3HA 1A99A 3EHSA 4DXUA 4OQOA 2ZNUA 4QSEA 2DP8A 2D5WA 2AIXA 1FTJA 1LBBA 2QS4A 3OENA 1H43A 5CI5A 2UVIA 3E4RA 2B65A 5JTYB 5L9OA 3FVGA 1MRPA 1XT8A 3TTKA 3R7XA 3HCQA 5DVFA 2XX9A 1FQDA 1JW4A 1UIVA 1VSOA 1ATGA 3FUZA 2DVZA 1YCJA 1WVJA 1H45A 1SDXA 1SI1A 2O51A 3T22A 3HO7A 4BDOA 5AA4B 1IZ1A 5IKBA 3SDFA 1IQ7A 4G8HA 4YKJA 1N84A 1H44A 1B6HA 4YKKA 3P7IA 4QFPA 1UTBB 3TZAA 3LC8A 4JDFA 3M3KA 2GRVA 2OZZA 3C31A 3PPNA 1SW5A 1Y1MA 1POTA 1FTLA 2BJJX 2PVUA 4KYEA 1D3KA 3MQ9A 3IK6B 4JWYA 4U22A 1B3EA 3KGCA 3MVXA 3W9VA 2V3UA 3H3GA 3N94A 4IGRA 1EZ9A 2F7BA 3EPEA 4F18A 5HM4B 3U1OA 1MPCA 3OO8A 1DTGA 1JW1A 1LGBC 3K2DA 5H8FB 1QUJA 1DTZA 1PBPA 2Y7PA 3LBSA 2GHBA 3QXMA 2V93A 4IO6A 3SEVA 5AE4A 1JVYA 3TTLA 4H8JA 3DLNA 1B2HA 4GQOA 2THIA 2PT2A 4H0WA 3H6UA 3KSJA 2ZNSA 5KDTB 3ZKLA 1AIVA 5H8NA 2X7PA 2RCAA 3FVOA 5ITOA 3SERA 4NF8A 2B3FA 4LP2B 3FJMA 1AMFA 1M5BA 4KCCA 1B7UA 4POWA 2XD2A 4NEDA 4XKNA 2R9JA 5JEIA 3UP9A 2I49A 1URDA 4N13A 3HSTA 3UIFA 2F7CA 3M3FA 4GWOA 4OZ9A 4O3AA 1MM6A 3K1PA 4O3CA 2Q2CA 4RPNA 4THIA 4ZDMA 5AA2A 1IXCA 1MY3A 3LUYA 1IITA 4F31B 3AXFA 4L17A 1JEUA 3RY3A 4EXLA 1R1NA 1NL5A 3K1MA 2DYXA 3RT8A 5BUUA 2XXVA 3HHGA 4H67A 1J1NA 5FHNA 5I56A 3S4UA 4BLAA 1WODA 3PD8A 1QUKA 1ANFA 2I4CA 3KG2A 2F97A 1Y1ZA 4FEBA 3S9MC 3CFXA 3MP6A 1CE2A 4X48A 4JWXA 3IX1A 3RUMA 3U92A 1VFDA 3F11A 3RTWB 1QW0A 5AA2D 2XXUA 3H6WA 1MS7A 3TTNA 5I2NA 1A7LA 2I48A 2RC7A 3FD3A 1S50A 2XXWA 4KFQA 2OJTA 4OFOA 3KSXA 3RT6B 5ISUA 4FAJA 3IL1B 1POY1 4G8MA 5TP9B 1SYHA 3O6IA 1FQBA 4G68B 1JNFA 3VXCA 3CSGA 1BTJA 1NFTA 4FORA 4OTEA 1FCKA 2DWIA 1UTHA 3PPRA 4OXVA 1YAEA 4RJZA 4U4SA 4YU0A 5CC2A 1MQJA 4RYAA 5I57B 4XKQA 5AA2B 2Z8DA 3T9VA 1NNKA 2HXWA 1XOCA 2XX8A 2X26A 2DWJA 4GXAA 1MY1A 2PX1A 1RYXA 3RNNA 5KCJB 1AOVA 3TDJA 3G3JA 3QUJA 2FNCA 4IY6A 4FEDA 4BDRA 1B7HA 1R9QA 3MWBA 3TCGA 3CG3A 2GH9A 2H4IA 3GXAA 3V8XB 4F2QA 4H5GA 2HFBA 4IO3A 4ZEKA 5ICQA 5H8QB 2QS1A 1N7XA 3TELA 3H6VA 1MXXA 4EQ9A 1DSNA 2NVUB 2AYSA 1ELJA 4JSOA 1FQAA 3MAMA 3MPKA 4ELOA 3C35A 1A8FA 3LSLA 4ZEBA 4ZEIA 3MVYA 4GVOA 1MH3A 1SW1A 4F1YA 1MM7A 3GZGA 1R6ZA 1ZBMA 4BDMA 3MVWA 2HQ0A 1M5DA 4OETA 1GV8A 1Y4TA 2F5XA 3N5LA 1H3DA 4P11A 2REJA 2F34A 2QSXA 3D4CA 1I6AA 4OERA 3CI8A 1FQEA 1JW5A 1Y3QA 1IIWA 2QPQA 3IO6A 3R26A 1MXWA 1XS5A 4PE5B 4RXLA 1UTHB 3MZ9A 1UIUA 1TFDA 3GLBA 2ANJA 5A5XB 4C1TA 3QYTA 5CBRA 3HPIA 3JZJA 4G8NA 1D9VA 4F3GA 1HSJA 2ZXTA 3G7WA 3K4UA 1OLAA 3HHFA 4DCXA 2E1SA 4JWOA 1VR5A 4F2OA 4IGTA 4KD5A 5CMBA 3RPWA 3PMXA 1N7WA 4GOTA 5EHSA 4ZZAA 4EF2A 2P0SA 3QIMA 4JXIA 4X1BA 3TODA 3PUVE 3VLUA 1B52A 2O69A 3C33A 4NTLA 4ONYA 2DSFA 4RPOA 4C0RA 4F1VA 1P1WA 2ABHA 1JETA 4R9FA 4X9TA 1MQHA 4DLDA 1Y4CA 3U72A 1LB9A 5TPAB 4ZEDA 3FASA 3ODBA 4GFRA 3ONMA 1S9TA 4OEVA 4WEPA 2I0CA 2V84A 4PFTA 1MG1A 2HAUA 4R75A 4R6KA 2PMSA 5L8DA 4N07A 3TCFA 4U21A 3PV0E 4BDNA 5JK4A 3MJNA 2R6GE 2O84X 1DMBA 3TEPA 5AA1A 1DOTA 3A09A 2RC8A 1MQGA 2NOOA 2WKYA 3EHTA 4LZ5A 3VLWA 5I59A 5IAIA 3Q26A 3MZBA 3Q27A 2GFEA 4XTCQ 3W9WA 4E0XA 2AL4A 2O1LA 4M1VA 3VFJA 4QFOA 4U2RA 3PUWE 4FECA 4RA1A 1KWHA 4I9DA 1LLSA 5DEXB 4U1OA 1YTVA 1A40A 4ZS9A 3RLFE 4BDQA 4R6YA 3C4MA 2O6AA 2XXPA 4NF6B 5AA4A 1N0TA 1PEBA 3IB2A 5I2KA 2Z23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O7I A;  4GXS B;  1B3L A;  1EU8 A;  4GL8 A;  4WED A;  3IB0 A;  3ILT B;  5B70 A;  4QHQ A;  4PET A;  2I3V A;  4YIC A;  4H5F A;  3FXR A;  5H8S A;  3O28 A;  2QJE A;  5TPA A;  3N26 A;  1A54 A;  1H76 A;  1MQD A;  2Z22 A;  3CSB A;  2F6P A;  3SEX A;  3K6U A;  2I58 A;  3CR9 A;  1IUD A;  5EHM A;  1BP5 A;  3C32 A;  1BKA A;  1LAG E;  2HAV A;  3OEL A;  4LZ8 A;  1OQG A;  1QKA A;  1PC3 A;  3V5A A;  2F78 A;  2QRY A;  3PUY E;  4FJP A;  3WAE A;  1USY E;  3KZG A;  1PDA A;  3PU5 A;  1Y9U A;  1DPE A;  4JB7 A;  3SET A;  1ZMG A;  4Q0C A;  5I57 A;  2Y84 A;  4R2B A;  4PQJ A;  3RN8 A;  2ONR A;  2I3W A;  1LFG A;  5I2N B;  3R6U A;  1JQF A;  1M5E A;  2DXY A;  1P1U A;  2P2A A;  3ILU B;  3U94 A;  4F19 A;  3B6T A;  1B32 A;  1F9B A;  1US5 A;  2O7U A;  4MFI A;  3LR1 A;  2DWH A;  4OES A;  3S2V A;  1MXY A;  4DCY A;  2FYI A;  4U23 A;  1B0H A;  3FZV A;  4ELQ A;  1B4Z A;  2RC9 A;  4MF3 A;  3C36 A;  4KQP A;  5I2K B;  1MH4 A;  5FHO A;  1P1N A;  4I1D A;  4NWC A;  4OEN A;  4TOZ A;  5FTI A;  2REG A;  3ZSF A;  4OWD A;  3I3V A;  4IO5 A;  5CBS A;  4LON B;  3W15 C;  3RGY A;  3H6T A;  3K6X A;  5KCJ A;  4WKM A;  4MLQ A;  3TMG A;  1ZIU A;  1I6B A;  2ZMB A;  1ZU0 A;  2VHA A;  3M3L A;  3MBP A;  4LAT A;  1TT1 A;  1FTK A;  3KJT A;  2OCU A;  3G3F A;  4F3S A;  1GGG A;  1OLC A;  3G3G A;  1TFA A;  5B7D A;  1XHY A;  3MP8 A;  2QS2 A;  3M8U A;  3QUF A;  3K6V A;  1ZTY A;  1BLF A;  2H25 A;  5A5X A;  1B40 A;  4LQ2 A;  4ELR A;  2AL5 A;  1NNP A;  3OEM A;  4IO2 A;  2O1M A;  4OMB A;  3S9N C;  3E3K A;  4G4P A;  3IJO B;  4DDD A;  4MH5 A;  3K0V A;  2V3Q A;  3C34 A;  1M5F A;  3H06 B;  3ECR A;  1P99 A;  2ZYM A;  3KN3 A;  3MVZ A;  4HS7 A;  2F36 A;  3FGS A;  4F22 A;  3ZKK A;  3B6Q A;  4NF4 B;  3K1N A;  4ZZE A;  2B3B A;  1NH8 A;  4KPT A;  4G68 C;  4H65 A;  1B51 A;  1MY2 A;  1I6Q A;  2RKM A;  4HW8 A;  2F6G A;  3DEL B;  1B1X A;  2ALU A;  2XXQ A;  2HZK A;  4U1Z A;  3RQT A;  2XXH A;  1B5J A;  1UQW A;  3PUZ E;  2H5Y A;  3Q28 A;  4R2F A;  2RF1 A;  1QKB A;  4BDL A;  2XX7 A;  1P1O A;  1FW0 A;  1N76 A;  5L9M A;  3TFL A;  5KZT A;  4X1D A;  4YB5 A;  3E9X A;  1PBQ A;  1SW4 A;  4NF5 B;  5CMM A;  1PB9 A;  2F35 A;  1I69 A;  1N3X A;  3Q25 A;  1OIB A;  1Y3P A;  3FVK A;  3SKP A;  2X7Q A;  4JBZ A;  4NE4 A;  3MW0 A;  3LSF B;  4H6D A;  1SBP A;  4EQB A;  3VVE A;  4KYS A;  1Z7N E;  3BFT A;  3FJG A;  1LAX A;  4MBP A;  3TQW A;  1OVT A;  3KN8 A;  3VLV A;  5HPQ A;  1O7T A;  2ZNT A;  4OYV A;  4GRK A;  3KEI A;  5I84 A;  5JTY A;  2Q89 A;  4QFK A;  5H8H B;  2Y7I A;  3FXQ A;  2YPN A;  3LSX A;  5K2X A;  4HCY A;  5LOM A;  5I58 A;  3MUQ A;  4C1U A;  1D9Y A;  1LFH A;  4GF8 A;  5TU0 A;  1FQF A;  2UVJ A;  5TP9 A;  3O66 A;  1ZKB A;  1LCF A;  3CG1 A;  4O3B A;  5I59 B;  1N04 A;  1S7Y A;  2IA4 A;  4EUO A;  1SW2 A;  3VDF A;  1B9J A;  1B1H A;  4DXB A;  4ESX A;  3KJ7 A;  4ELP A;  2Q9T A;  4LA9 A;  4IO7 A;  2GHA A;  3EHU A;  3IOR A;  1B4H A;  1UTB A;  1VE4 A;  2G29 A;  1PB8 A;  3DP4 A;  1XVY A;  4YKI A;  2CMO A;  4PFU A;  3UOR A;  1RYO A;  3K6W A;  4ND9 A;  3BKI B;  4YB6 A;  1MY0 A;  3S9L C;  1NNT A;  2I6E A;  2G93 A;  4YAH X;  4XIG Q;  2RIN A;  4JSD A;  3CRB A;  3JV9 A;  1M5C A;  3H03 A;  3OOA A;  4YMB A;  2FA7 A;  2QL3 A;  1OVB A;  5H8F A;  3EF7 A;  4GL0 A;  4UA8 A;  1OQH A;  4NWD A;  4PFW A;  3L6H A;  3TTM A;  4XXU A;  1DPP A;  2IEE A;  3IAZ A;  3I6V A;  4YB7 A;  2ZYN A;  3T96 B;  2CZL A;  4KYD A;  4LVQ A;  2Y7K A;  5CRY A;  4NF8 B;  3T66 A;  4EF1 A;  2Y7R A;  3VXB A;  3RTF B;  3TCH A;  1B58 A;  1SVX B;  1TXF A;  2Z8F A;  3V89 B;  2XXT A;  2M8C A;  3A3C A;  4F39 A;  1R9L A;  4R6H A;  1VFE A;  5F1Q A;  1SYI A;  1A55 A;  1Z7M E;  2ONK E;  3OSQ A;  4P0G A;  4DXC A;  1L5T A;  4HCW A;  3UGW A;  5ITP A;  3O97 A;  1XVX A;  1GVC A;  3VVD A;  4ISU A;  1EH3 A;  1LBC A;  3OXN A;  5EYF A;  2OWS A;  3CIJ A;  4QF9 A;  2YJP A;  1IXH A;  4KHZ E;  2V3T A;  2XD3 A;  3FXU A;  3OO6 A;  2OBG A;  4LUB A;  3O6G A;  3H7M A;  3PMW A;  3FIR A;  3SEU A;  1B0L A;  2NUV A;  3BFU A;  1MY4 A;  3KFM A;  4QSD A;  5CMC A;  2H98 A;  4ZE8 A;  4QFN A;  1Q1K A;  1D4N A;  1SD3 A;  2R71 A;  4Q8R A;  1CB6 A;  2DXR A;  2F8D A;  4OEU A;  3DM0 A;  3OD7 A;  2ZYK A;  4U4X A;  4Z0I A;  2Q2A A;  1A8E A;  1B7Z A;  4F29 A;  4F3P A;  3PD9 A;  4H1X A;  4RNS A;  3JYR A;  1QUL A;  2DE4 A;  4KI0 E;  3OEK A;  5K2Y A;  5CMK A;  3TUS A;  2VD3 A;  4I62 A;  4ZEF A;  3KOS A;  4OFL A;  2DQV A;  4F1U A;  3HN0 A;  1O64 A;  4G2Z A;  3FVN A;  4HTG A;  4FIM A;  4NF4 A;  1MDP 1;  3UN6 A;  2HEU A;  3DP8 A;  3OO7 A;  4EDP A;  2UYE A;  1MPD A;  3KBR A;  5DVJ A;  4GLI A;  4R74 A;  3U93 A;  4POX A;  3VE1 B;  3OO9 A;  4FAT A;  2XXY A;  3IJX B;  4ESW A;  3UA8 A;  2P1S A;  4GIZ A;  4R73 A;  3WAF A;  4PP0 A;  4I8C A;  2DVC A;  3OSR A;  4RY1 A;  2RCB A;  4QSC A;  1HSL A;  1MQI A;  1B3F A;  1B5I A;  2PBW A;  3CFZ A;  4NMY A;  3MPL A;  4IO4 A;  2H99 A;  3IOT A;  4TQU Q;  3TAJ A;  3TYH A;  2OWT A;  5F7V A;  4EQ7 A;  4AB6 A;  1US4 A;  1IXG A;  5FTH A;  4WXJ A;  2Q8J A;  5H8Q A;  5HBC A;  5J1D A;  3SES A;  4LZ7 A;  1LST A;  3GBB A;  3IOV A;  3L6G A;  3N6T A;  4DIG A;  4ECF A;  1EZO A;  5BWJ A;  3O2A A;  1N3W A;  1RKM A;  1FQC A;  1ZLQ A;  5H8N B;  2F7A A;  4ZEC A;  2DS9 A;  1PB7 A;  1SQY A;  1GR2 A;  4EXK A;  4FE8 A;  1MPB A;  1QVS A;  3EN3 A;  1NKX A;  4H8I A;  1II5 A;  3IR1 A;  3O6H A;  2OK2 A;  2A5S A;  2LAO A;  1IEJ A;  2UXA A;  2XHD A;  5ELV A;  4RK2 A;  2QMX A;  3T93 B;  3MP1 A;  2PYY A;  4Z7E A;  3TQL A;  2ONS A;  1MXU A;  1LB8 A;  2H9B A;  2KLF A;  3N6U A;  5DYH A;  2Y7W A;  5FHM A;  5KDT A;  1FTO A;  3C9H A;  3IB1 A;  3MZ1 A;  5M2V A;  5H8H A;  3IOW A;  3UK4 A;  2I0B A;  3H4Z A;  4N6P A;  1AH5 A;  4QFL A;  3KOT A;  4Q30 B;  3Q29 A;  2NWJ A;  4DE8 A;  5I58 B;  1T0K A;  2PT1 A;  1Y20 A;  5I56 B;  5AA3 A;  4UAC A;  4G77 A;  2W7Y A;  3PPQ A;  4TLL B;  3B7D A;  3USD A;  5L9S A;  2VP1 A;  4XKP A;  1QJM A;  2Z8E A;  1AL3 A;  3O29 A;  3PPO A;  4AQ4 A;  4MLV A;  2XXI A;  3I5O A;  3T9X B;  1XC1 A;  3IOU A;  4F3B A;  1LCT A;  1URS A;  3B6W A;  1B3H A;  3HV1 A;  1HSE A;  2VGQ A;  2I4B A;  4OHN A;  4XKR A;  3QAX A;  4ZE9 A;  3FV2 A;  1NMU A;  2ESN A;  3TPA A;  2A5T B;  1WDN A;  2XXX A;  4PFY A;  3E13 X;  1YPN A;  4P0I A;  1SI0 A;  3SEY A;  4QRZ A;  3K01 A;  3VV5 A;  4E0W A;  1TWY A;  1ZJL A;  4TLM B;  2HZL A;  3FJ7 A;  3V83 A;  1LFI A;  3OMB A;  3LSW A;  1URG A;  1OMP A;  5ICT A;  4G68 A;  2OLB A;  1QUI A;  3FAT A;  3KN7 A;  1P1Q A;  1B05 A;  1MDQ A;  4M4G A;  2DOJ A;  3CVG A;  1NNF A;  4YZZ A;  4AB5 A;  1GTK A;  2QMW A;  3TTR A;  3SEW A;  2Q88 A;  4IY5 A;  3G3K A;  2UVH A;  1Y3N A;  3O9P A;  1B3G A;  1NH7 A;  3D4G A;  4OFJ A;  5DEX A;  3T9H B;  4RK9 A;  1LAH E;  1LAF E;  3BBR A;  4NF6 A;  2D21 A;  3K02 A;  5DT6 A;  2ZYO A;  3EQ1 A;  3QSL A;  1IXI A;  3PMV A;  3PPP A;  2V25 A;  4Q5T A;  4K3F A;  3THI A;  3K00 A;  2XXR A;  1B46 A;  4YKP A;  2D3I A;  1JEV A;  2E0S A;  2UVG A;  3G3I A;  3T9U A;  3TKD A;  1FTM A;  1MXV A;  2HCA A;  2O68 A;  3U8Q A;  2VOZ A;  4KCD A;  3FV1 A;  3VVF A;  5CM6 A;  3S9E A;  3A3U A;  2DE3 A;  3PUX E;  2A5T A;  4IB2 A;  4LQ5 A;  5DVI A;  1BIY A;  4KR5 A;  2VD2 A;  1O63 A;  1Q35 A;  3CFL A;  4NF5 A;  2NXO A;  1MXZ A;  2DWA A;  2UYF A;  1EZP A;  3MC2 A;  3DP6 A;  3PGF A;  1USY H;  4DZ1 A;  4YMA A;  4R9G A;  4OVJ A;  1JVX A;  2DE2 A;  3QK6 A;  1B5H A;  5DTB A;  3ZS6 A;  2YLN A;  4GD5 A;  4R72 A;  3GBA A;  2QS3 A;  3IO4 A;  3G3H A;  1A99 A;  3EHS A;  4DXU A;  4OQO A;  2ZNU A;  4QSE A;  2DP8 A;  2D5W A;  2AIX A;  1FTJ A;  1LBB A;  2QS4 A;  3OEN A;  1H43 A;  5CI5 A;  2UVI A;  3E4R A;  2B65 A;  5JTY B;  5L9O A;  3FVG A;  1MRP A;  1XT8 A;  3TTK A;  3R7X A;  3HCQ A;  5DVF A;  2XX9 A;  1FQD A;  1JW4 A;  1UIV A;  1VSO A;  1ATG A;  3FUZ A;  2DVZ A;  1YCJ A;  1WVJ A;  1H45 A;  1SDX A;  1SI1 A;  2O51 A;  3T22 A;  3HO7 A;  4BDO A;  5AA4 B;  1IZ1 A;  5IKB A;  3SDF A;  1IQ7 A;  4G8H A;  4YKJ A;  1N84 A;  1H44 A;  1B6H A;  4YKK A;  3P7I A;  4QFP A;  1UTB B;  3TZA A;  3LC8 A;  4JDF A;  3M3K A;  2GRV A;  2OZZ A;  3C31 A;  3PPN A;  1SW5 A;  1Y1M A;  1POT A;  1FTL A;  2BJJ X;  2PVU A;  4KYE A;  1D3K A;  3MQ9 A;  3IK6 B;  4JWY A;  4U22 A;  1B3E A;  3KGC A;  3MVX A;  3W9V A;  2V3U A;  3H3G A;  3N94 A;  4IGR A;  1EZ9 A;  2F7B A;  3EPE A;  4F18 A;  5HM4 B;  3U1O A;  1MPC A;  3OO8 A;  1DTG A;  1JW1 A;  1LGB C;  3K2D A;  5H8F B;  1QUJ A;  1DTZ A;  1PBP A;  2Y7P A;  3LBS A;  2GHB A;  3QXM A;  2V93 A;  4IO6 A;  3SEV A;  5AE4 A;  1JVY A;  3TTL A;  4H8J A;  3DLN A;  1B2H A;  4GQO A;  2THI A;  2PT2 A;  4H0W A;  3H6U A;  3KSJ A;  2ZNS A;  5KDT B;  3ZKL A;  1AIV A;  5H8N A;  2X7P A;  2RCA A;  3FVO A;  5ITO A;  3SER A;  4NF8 A;  2B3F A;  4LP2 B;  3FJM A;  1AMF A;  1M5B A;  4KCC A;  1B7U A;  4POW A;  2XD2 A;  4NED A;  4XKN A;  2R9J A;  5JEI A;  3UP9 A;  2I49 A;  1URD A;  4N13 A;  3HST A;  3UIF A;  2F7C A;  3M3F A;  4GWO A;  4OZ9 A;  4O3A A;  1MM6 A;  3K1P A;  4O3C A;  2Q2C A;  4RPN A;  4THI A;  4ZDM A;  5AA2 A;  1IXC A;  1MY3 A;  3LUY A;  1IIT A;  4F31 B;  3AXF A;  4L17 A;  1JEU A;  3RY3 A;  4EXL A;  1R1N A;  1NL5 A;  3K1M A;  2DYX A;  3RT8 A;  5BUU A;  2XXV A;  3HHG A;  4H67 A;  1J1N A;  5FHN A;  5I56 A;  3S4U A;  4BLA A;  1WOD A;  3PD8 A;  1QUK A;  1ANF A;  2I4C A;  3KG2 A;  2F97 A;  1Y1Z A;  4FEB A;  3S9M C;  3CFX A;  3MP6 A;  1CE2 A;  4X48 A;  4JWX A;  3IX1 A;  3RUM A;  3U92 A;  1VFD A;  3F11 A;  3RTW B;  1QW0 A;  5AA2 D;  2XXU A;  3H6W A;  1MS7 A;  3TTN A;  5I2N A;  1A7L A;  2I48 A;  2RC7 A;  3FD3 A;  1S50 A;  2XXW A;  4KFQ A;  2OJT A;  4OFO A;  3KSX A;  3RT6 B;  5ISU A;  4FAJ A;  3IL1 B;  1POY 1;  4G8M A;  5TP9 B;  1SYH A;  3O6I A;  1FQB A;  4G68 B;  1JNF A;  3VXC A;  3CSG A;  1BTJ A;  1NFT A;  4FOR A;  4OTE A;  1FCK A;  2DWI A;  1UTH A;  3PPR A;  4OXV A;  1YAE A;  4RJZ A;  4U4S A;  4YU0 A;  5CC2 A;  1MQJ A;  4RYA A;  5I57 B;  4XKQ A;  5AA2 B;  2Z8D A;  3T9V A;  1NNK A;  2HXW A;  1XOC A;  2XX8 A;  2X26 A;  2DWJ A;  4GXA A;  1MY1 A;  2PX1 A;  1RYX A;  3RNN A;  5KCJ B;  1AOV A;  3TDJ A;  3G3J A;  3QUJ A;  2FNC A;  4IY6 A;  4FED A;  4BDR A;  1B7H A;  1R9Q A;  3MWB A;  3TCG A;  3CG3 A;  2GH9 A;  2H4I A;  3GXA A;  3V8X B;  4F2Q A;  4H5G A;  2HFB A;  4IO3 A;  4ZEK A;  5ICQ A;  5H8Q B;  2QS1 A;  1N7X A;  3TEL A;  3H6V A;  1MXX A;  4EQ9 A;  1DSN A;  2NVU B;  2AYS A;  1ELJ A;  4JSO A;  1FQA A;  3MAM A;  3MPK A;  4ELO A;  3C35 A;  1A8F A;  3LSL A;  4ZEB A;  4ZEI A;  3MVY A;  4GVO A;  1MH3 A;  1SW1 A;  4F1Y A;  1MM7 A;  3GZG A;  1R6Z A;  1ZBM A;  4BDM A;  3MVW A;  2HQ0 A;  1M5D A;  4OET A;  1GV8 A;  1Y4T A;  2F5X A;  3N5L A;  1H3D A;  4P11 A;  2REJ A;  2F34 A;  2QSX A;  3D4C A;  1I6A A;  4OER A;  3CI8 A;  1FQE A;  1JW5 A;  1Y3Q A;  1IIW A;  2QPQ A;  3IO6 A;  3R26 A;  1MXW A;  1XS5 A;  4PE5 B;  4RXL A;  1UTH B;  3MZ9 A;  1UIU A;  1TFD A;  3GLB A;  2ANJ A;  5A5X B;  4C1T A;  3QYT A;  5CBR A;  3HPI A;  3JZJ A;  4G8N A;  1D9V A;  4F3G A;  1HSJ A;  2ZXT A;  3G7W A;  3K4U A;  1OLA A;  3HHF A;  4DCX A;  2E1S A;  4JWO A;  1VR5 A;  4F2O A;  4IGT A;  4KD5 A;  5CMB A;  3RPW A;  3PMX A;  1N7W A;  4GOT A;  5EHS A;  4ZZA A;  4EF2 A;  2P0S A;  3QIM A;  4JXI A;  4X1B A;  3TOD A;  3PUV E;  3VLU A;  1B52 A;  2O69 A;  3C33 A;  4NTL A;  4ONY A;  2DSF A;  4RPO A;  4C0R A;  4F1V A;  1P1W A;  2ABH A;  1JET A;  4R9F A;  4X9T A;  1MQH A;  4DLD A;  1Y4C A;  3U72 A;  1LB9 A;  5TPA B;  4ZED A;  3FAS A;  3ODB A;  4GFR A;  3ONM A;  1S9T A;  4OEV A;  4WEP A;  2I0C A;  2V84 A;  4PFT A;  1MG1 A;  2HAU A;  4R75 A;  4R6K A;  2PMS A;  5L8D A;  4N07 A;  3TCF A;  4U21 A;  3PV0 E;  4BDN A;  5JK4 A;  3MJN A;  2R6G E;  2O84 X;  1DMB A;  3TEP A;  5AA1 A;  1DOT A;  3A09 A;  2RC8 A;  1MQG A;  2NOO A;  2WKY A;  3EHT A;  4LZ5 A;  3VLW A;  5I59 A;  5IAI A;  3Q26 A;  3MZB A;  3Q27 A;  2GFE A;  4XTC Q;  3W9W A;  4E0X A;  2AL4 A;  2O1L A;  4M1V A;  3VFJ A;  4QFO A;  4U2R A;  3PUW E;  4FEC A;  4RA1 A;  1KWH A;  4I9D A;  1LLS A;  5DEX B;  4U1O A;  1YTV A;  1A40 A;  4ZS9 A;  3RLF E;  4BDQ A;  4R6Y A;  3C4M A;  2O6A A;  2XXP A;  4NF6 B;  5AA4 A;  1N0T A;  1PEB A;  3IB2 A;  5I2K A;  2Z23 A; 
#chains in the Genus database with same CATH topology
 4GXS B;  5H8S A;  5TPA A;  2QJE A;  3V5A A;  1USY E;  3KZG A;  5F24 A;  4JB7 A;  3SET A;  4Q0C A;  3RN8 A;  5I2N B;  4N17 A;  1JQF A;  2DXY A;  3ILU B;  4OA4 A;  4PDD A;  4GWU A;  3QMF A;  1FTA A;  3LR1 A;  4OES A;  4DCY A;  4MCO A;  1B0H A;  5I2K B;  3C36 A;  4I1D A;  3ZSF A;  4FBP A;  4OWD A;  3I3V A;  5CBS A;  3W15 C;  4WKM A;  3TMG A;  1ZIU A;  2ZMB A;  1ZU0 A;  1GGG A;  1TFA A;  4O7M A;  1XHY A;  5J16 A;  4ELR A;  1NNP A;  3E3K A;  4G4P A;  3ECR A;  4F22 A;  1NH8 A;  4G68 C;  1B51 A;  1MY2 A;  3DEL B;  4U1Z A;  3PUZ E;  4R2F A;  1QKB A;  3TFL A;  5KZT A;  4X1D A;  3E9X A;  1RDY A;  1N3X A;  3Q25 A;  3SKP A;  4H6D A;  1SBP A;  4KYS A;  3KN8 A;  5HPQ A;  4LN5 A;  2Q89 A;  4QFK A;  4MNC A;  4UAB A;  5LOM A;  4C1U A;  5EQ7 A;  3CG1 A;  1B9J A;  3KBZ A;  4DXB A;  4ESX A;  3KJ7 A;  4MAG A;  2Q9T A;  2GHA A;  4PFU A;  1RYO A;  4ND9 A;  2I6E A;  3H03 A;  2FA7 A;  4NWD A;  3L6H A;  1Q9D A;  5EYH A;  1FBD A;  3T96 B;  4JVD A;  4PDH A;  3T66 A;  1SVX B;  2XXT A;  1SYI A;  3OSQ A;  1L5T A;  4PGN A;  5ITP A;  1GVC A;  2XXK A;  2OWS A;  4QF9 A;  4KHZ E;  2V3T A;  3FXU A;  2OBG A;  3H7M A;  3SEU A;  1B0L A;  2NUV A;  5CMC A;  4QFN A;  2F8D A;  1IME A;  2ZYK A;  4U4X A;  4Z0I A;  1A8E A;  1B7Z A;  4F29 A;  4KI0 E;  3OEK A;  5K2Y A;  2HEU A;  3OO7 A;  2UYE A;  4MIJ A;  3KBR A;  3U93 A;  4GLI A;  4R74 A;  3VE1 B;  4POX A;  3IJX B;  4RY1 A;  1HSL A;  3CFZ A;  4N8G A;  3MPL A;  5EYG A;  3TAJ A;  4OVT A;  3TYH A;  5F7V A;  1DCU A;  1US4 A;  3B50 A;  5H8Q A;  4LZ7 A;  1FQC A;  4ZEC A;  4N6D A;  4GX4 A;  3T93 B;  2A5S A;  5IZZ A;  3MP1 A;  1LB8 A;  2H9B A;  2KLF A;  2Y7W A;  5M2V A;  5H8H A;  2WEF A;  3H4Z A;  3KOT A;  5I58 B;  1Y20 A;  5AA3 A;  1IMC A;  3PPQ A;  3USD A;  5L9S A;  2VP1 A;  4MLV A;  2XXI A;  3T9X B;  3B6W A;  3FV2 A;  2XXX A;  4PFY A;  4P0I A;  1SI0 A;  4QRZ A;  1LFI A;  1FPJ A;  3KN7 A;  4YZZ A;  4HE1 A;  1Y3N A;  3D4G A;  1LAF E;  3K02 A;  2ZYO A;  3EQ1 A;  4NX1 A;  4QXD A;  2XXR A;  1B46 A;  1JEV A;  1K9Z A;  3U8Q A;  3FV1 A;  2DE3 A;  1BIY A;  1O63 A;  1LBX A;  1USY H;  2DE2 A;  5DTB A;  4R72 A;  4OQO A;  2AIX A;  5AA2 D;  5JTY B;  1FBE A;  2B65 A;  3E4R A;  4P3L A;  3R7X A;  5DVF A;  2XX9 A;  1FQD A;  1UIV A;  1ATG A;  3FUZ A;  1FBP A;  5AA4 B;  1N84 A;  4JDF A;  2OZZ A;  1SW5 A;  2QVR A;  1FTL A;  2FBP A;  1NV7 A;  5ET5 A;  3W9V A;  3N94 A;  1KZ8 A;  2F7B A;  1LBV A;  1LGB C;  1QUJ A;  1DTZ A;  2HHM A;  1PBP A;  3SEV A;  2GHB A;  4IO6 A;  2V93 A;  1JVY A;  3ZKL A;  1AIV A;  4N91 A;  3FVO A;  5ITO A;  1FSA A;  1AMF A;  4XKN A;  2XD2 A;  4NED A;  5JEI A;  2I49 A;  3HST A;  5AA2 A;  3AXF A;  1NL5 A;  2DYX A;  3ISP A;  4IR8 A;  1NI9 A;  5FHN A;  1FJ9 A;  5IGA A;  1ANF A;  2F97 A;  2HXR A;  2B4M A;  4X48 A;  3IX1 A;  3U92 A;  2XXU A;  2RC7 A;  3E78 A;  5ISU A;  2WBB A;  1SYH A;  1FQB A;  3CSG A;  1NFT A;  4OXV A;  4U4S A;  5CC2 A;  1YXI A;  2Z8D A;  1NNK A;  2HXW A;  2DWJ A;  1MY1 A;  3TDJ A;  3G3J A;  3QUJ A;  4BDR A;  2GH9 A;  3GXA A;  5ICQ A;  3V8X B;  4H5G A;  2QS1 A;  1N7X A;  2AYS A;  1FQA A;  4ELO A;  2F3D A;  4ZEB A;  2R8T A;  4ZEI A;  4GVO A;  4F1Y A;  1SW1 A;  1ZBM A;  1GV8 A;  2HQ0 A;  2XWO A;  3NOH A;  2REJ A;  2QSX A;  2QPQ A;  1UIU A;  3GLB A;  3SZP A;  3JZJ A;  4G8N A;  4GWS A;  4P1L A;  2F3B A;  2FVZ A;  3G7W A;  2E1S A;  4F2O A;  4IGT A;  3T0J A;  3RPW A;  3PMX A;  4XFE A;  4JXI A;  3QIM A;  4NTL A;  4F1V A;  4C0R A;  4DLD A;  3U72 A;  3FAS A;  3ODB A;  1S9T A;  4WEP A;  2I0C A;  2V84 A;  3TCF A;  4N07 A;  4BDN A;  3BIG A;  5JK4 A;  1DOT A;  1SPI A;  2NOO A;  5IAI A;  3MZB A;  3Q27 A;  4XTC Q;  3E79 A;  4RA1 A;  5I3S A;  3RLF E;  4BDQ A;  4ZS9 A;  5ESY A;  3C4M A;  4NF6 B;  1N0T A;  1PEB A;  5LDZ A;  2Z23 A;  5B70 A;  4GL8 A;  4WED A;  3IB0 A;  2I3V A;  4YIC A;  3N26 A;  1A54 A;  3KC1 A;  3CR9 A;  5EHM A;  2GQ1 A;  3C32 A;  3OEL A;  1BKA A;  1LAG E;  2MKZ A;  1OQG A;  3WAE A;  4NQ8 A;  3RPL A;  4P56 A;  1M5E A;  4NGU A;  1NUZ A;  1B32 A;  2O7U A;  4N15 A;  1NV3 A;  1MXY A;  4KQP A;  1LBW A;  2REG A;  4LON B;  3K6X A;  4MLQ A;  2VHA A;  4PAK A;  2OCU A;  3G3F A;  1OLC A;  1ZTY A;  1BLF A;  1B40 A;  3OEM A;  2O1M A;  4DDD A;  3H06 B;  3PTY A;  3B6Q A;  4ZZE A;  2B3B A;  4P1E A;  2ALU A;  2HZK A;  2XXH A;  4BDL A;  1N76 A;  1PBQ A;  4DI3 D;  1NV5 A;  1PB9 A;  1Y3P A;  2X7Q A;  4JBZ A;  3EKI A;  2V4C A;  3VVE A;  1Z7N E;  3VLV A;  1O7T A;  4OYV A;  5H8H B;  3LSX A;  5I58 A;  1D9Y A;  1LCF A;  5I59 B;  3EHU A;  1UTB A;  2CMO A;  3U65 A;  1KA0 A;  3S9L C;  1NNT A;  4YAH X;  4XIG Q;  2RIN A;  3JV9 A;  4GL0 A;  3TTM A;  2IEE A;  3IAZ A;  4KYD A;  5CRY A;  2Y7K A;  4NF8 B;  4EF1 A;  3RTF B;  1B58 A;  1TXF A;  4I3Y A;  4N8Y A;  4R6H A;  2ONK E;  4MNI A;  4DI4 B;  3O97 A;  1XVX A;  4ISU A;  5EYF A;  3CIJ A;  1IXH A;  2XD3 A;  3OO6 A;  3O6G A;  3PMW A;  4I40 A;  3BFU A;  2H98 A;  4ZE8 A;  1Q1K A;  1SD3 A;  1CB6 A;  2DXR A;  4OEU A;  3DM0 A;  1IMB A;  2Q2A A;  1RDX A;  4H1X A;  4RNS A;  1QUL A;  2VD3 A;  4I62 A;  4ZEF A;  1FPK A;  3KOS A;  4GWY A;  3HN0 A;  3FVN A;  1MDP 1;  4GBW A;  4FAT A;  3OO9 A;  2P1S A;  4PCD A;  4PP0 A;  1B5I A;  2PBW A;  4NMY A;  4IO4 A;  2OWT A;  1IXG A;  5HBC A;  2ZZX A;  3SES A;  4GWW A;  1LST A;  4ECF A;  3IOV A;  1ZLQ A;  4O8M A;  5H8N B;  3HFU A;  1MPB A;  2DDK A;  1QVS A;  3EN3 A;  3O6H A;  2OK2 A;  2LAO A;  4MNP A;  1MXU A;  3MZ1 A;  2I0B A;  1AH5 A;  4G77 A;  4TLL B;  4N6K A;  1QJM A;  3O29 A;  3IOU A;  1B3H A;  2VGQ A;  2I4B A;  4XKR A;  3VV5 A;  1ZJL A;  4TLM B;  3FJ7 A;  1FPI A;  3V83 A;  3LSW A;  3LUZ A;  2OLB A;  1QUI A;  3FAT A;  1P1Q A;  3CVG A;  1NV2 A;  2UVH A;  1NH7 A;  4RK9 A;  3BBR A;  1IMA A;  4OVR A;  2XWV A;  1IXI A;  3K00 A;  4YKP A;  2D3I A;  2UVG A;  2O68 A;  5CM6 A;  4IB2 A;  5DVI A;  4KR5 A;  2VD2 A;  3CFL A;  1EZP A;  1MXZ A;  3MC2 A;  3DP6 A;  4YMA A;  4R9G A;  3QK6 A;  1B5H A;  4GD5 A;  4QSE A;  2DP8 A;  2D5W A;  1LBB A;  3U94 A;  2QS4 A;  3OEN A;  1H43 A;  3FVG A;  1XT8 A;  2XA5 A;  3HCQ A;  4JVC A;  1WVJ A;  1SDX A;  2O51 A;  3HO7 A;  4BDO A;  4HE2 A;  1B6H A;  1UTB B;  4QBA A;  4KYE A;  4X9T A;  4U22 A;  3T9V A;  1B3E A;  4P47 A;  4IGR A;  5HM4 B;  1IMD A;  1JW1 A;  3K2D A;  3LBS A;  3DLN A;  1B2H A;  2THI A;  2ZNS A;  5H8N A;  3SER A;  2B3F A;  4POW A;  2R9J A;  4OAN A;  3UP9 A;  3UIF A;  2QFL A;  2F7C A;  4OZ9 A;  1NV1 A;  1MM6 A;  4O3C A;  4O3A A;  1IXC A;  1JEU A;  4EXL A;  4H67 A;  5I56 A;  3PD8 A;  4PFI A;  4NN3 A;  4MMP A;  3CFX A;  3MP6 A;  3S9M C;  4JWX A;  2PCR A;  3RUM A;  2VT5 A;  3F11 A;  1MS7 A;  3TTN A;  2I48 A;  1S50 A;  2XXW A;  4HE0 A;  2OJT A;  1POY 1;  4G61 A;  5TP9 B;  3PPR A;  2DWI A;  1MQJ A;  4XKQ A;  3GYY A;  2X26 A;  2PX1 A;  1RYX A;  4IY6 A;  4FED A;  1B7H A;  2H4I A;  4F2Q A;  2HFB A;  4ZEK A;  5H8Q B;  3TEL A;  2WX9 A;  1ELJ A;  3C35 A;  3A29 A;  3LSL A;  3GZG A;  2WYP A;  1R6Z A;  4GWX A;  5ET7 A;  1M5D A;  4OET A;  3N5L A;  1H3D A;  3D4C A;  4PE5 B;  1JW5 A;  3IO6 A;  3FBP A;  4RXL A;  1UTH B;  3MZ9 A;  1TFD A;  2FHY A;  3QYT A;  1D9V A;  1HSJ A;  2ZXT A;  4DCX A;  1VR5 A;  4KD5 A;  4PBH A;  4GOT A;  4EF2 A;  3TOD A;  2O69 A;  4ONY A;  2DSF A;  4RPO A;  2P3V A;  1JET A;  1MQH A;  2QVV A;  5TPA B;  4AS4 A;  3ONM A;  3IFC A;  4OEV A;  4R75 A;  4PFT A;  1DK4 A;  3MJN A;  2R6G E;  3A09 A;  2WYK A;  2WKY A;  5I59 A;  4LZ5 A;  5IZ3 A;  2GFE A;  4NHB A;  2O1L A;  3PUW E;  4I9D A;  1LLS A;  1YTV A;  2O6A A;  1LEV A;  5I2K A;  4P8B A;  2O7I A;  1B3L A;  3ILT B;  1XI6 A;  4PET A;  3FXR A;  1NUY A;  2F6P A;  3K6U A;  1IUD A;  4LZ8 A;  1QKA A;  1PC3 A;  4FJP A;  4MX6 A;  1DPE A;  2Y84 A;  4R2B A;  4PQJ A;  2I3W A;  1LFG A;  2FIE A;  3LV0 A;  4U23 A;  3FZV A;  4ELQ A;  1B4Z A;  1MH4 A;  1P1N A;  4TOZ A;  4OEN A;  5FTI A;  4IO5 A;  3RGY A;  5KCJ A;  1I6B A;  2VPN A;  3G3G A;  5B7D A;  4JVI A;  3MP8 A;  2QS2 A;  3M8U A;  2OX3 A;  4HXV A;  2H25 A;  4X8R A;  4IO2 A;  1EYK A;  4OMB A;  3S9N C;  3IJO B;  3K0V A;  3KN3 A;  1M5F A;  3MVZ A;  2ZYM A;  4HS7 A;  4KPT A;  4H65 A;  1I6Q A;  2RKM A;  2F6G A;  1B1X A;  3RQT A;  2XXQ A;  5CBR A;  1B5J A;  2H5Y A;  1K9Y A;  4YB5 A;  1SW4 A;  5CMM A;  2F35 A;  5I5P A;  1I69 A;  3MW0 A;  4N4U A;  4EQB A;  3TQW A;  1OVT A;  3KC0 A;  4GRK A;  3KEI A;  3FXQ A;  2YPN A;  5K2X A;  1LFH A;  4GF8 A;  3O66 A;  1ZKB A;  4O3B A;  1N04 A;  2IA4 A;  4EUO A;  1SW2 A;  4IO7 A;  2G29 A;  5ET8 A;  1XVY A;  5IZ1 A;  4YB6 A;  2G93 A;  4O94 A;  4YMB A;  1RDZ A;  5H8F A;  3EF7 A;  1OQH A;  1DPP A;  5ET6 A;  4LVQ A;  3VXB A;  2Z8F A;  2M8C A;  1R9L A;  5F1Q A;  1Z7M E;  3UGW A;  2CZH A;  1EH3 A;  5LTC A;  4LUB A;  1FPF A;  5EQ8 A;  1MY4 A;  3KFM A;  1D4N A;  2R71 A;  4F3P A;  4XEQ A;  3PD9 A;  5CMK A;  3JYR A;  3TUS A;  3RYD A;  4F1U A;  4HTG A;  4FIM A;  3UN6 A;  3DP8 A;  4H46 A;  5DVJ A;  4HW8 A;  5EQ9 A;  3UA8 A;  4R73 A;  4I8C A;  3OSR A;  1B3F A;  2H99 A;  3IOT A;  4TQU Q;  5FTH A;  2BJI A;  4WXJ A;  2Q8J A;  5J1D A;  3GBB A;  3N6T A;  1EZO A;  1FPG A;  3O2A A;  1N3W A;  2F7A A;  4PGP A;  1SQY A;  1GR2 A;  4EXK A;  4FE8 A;  1QGX A;  4H8I A;  3IR1 A;  1G0H A;  2UXA A;  1IEJ A;  5ELV A;  4RK2 A;  2QMX A;  2PYY A;  2ONS A;  5DYH A;  4GWZ A;  3N6U A;  1FTO A;  3IB1 A;  3UK4 A;  4DE8 A;  3Q29 A;  2PT1 A;  4PF6 A;  5I56 B;  2Z8E A;  1AL3 A;  3PPO A;  3I5O A;  1XC1 A;  4F3B A;  3HV1 A;  1HSE A;  4OHN A;  1NMU A;  2ESN A;  2A5T B;  3E13 X;  3SEY A;  4E0W A;  3K01 A;  1TWY A;  4PC9 A;  3OMB A;  2PFY A;  4M4G A;  4GBV A;  3SEW A;  4IY5 A;  3G3K A;  3O9P A;  4OFJ A;  3T9H B;  1LAH E;  3THI A;  4Q5T A;  2V25 A;  2XWI A;  2E0S A;  1FTM A;  1MXV A;  2HCA A;  2VOZ A;  4KCD A;  3VVF A;  3A3U A;  3PUX E;  2JJK A;  2DWA A;  4DZ1 A;  3ZS6 A;  2XWK A;  2QS3 A;  3IO4 A;  3G3H A;  3EHS A;  2ZNU A;  5CI5 A;  4MHF A;  5L9O A;  4NF0 A;  1VSO A;  4PBQ A;  2DVZ A;  1YCJ A;  1H45 A;  3T22 A;  5IKB A;  3SDF A;  4YKJ A;  4YKK A;  3LC8 A;  1NV0 A;  3M3K A;  3C31 A;  1Y1M A;  2BJJ X;  1POT A;  3MQ9 A;  3MVX A;  2V3U A;  4F18 A;  1EZ9 A;  1VDW A;  3U1O A;  2Y7P A;  5AE4 A;  3TTL A;  4GQO A;  4H0W A;  5KDT B;  3H6U A;  4NF8 A;  4LP2 B;  1M5B A;  1B7U A;  1URD A;  4N13 A;  3M3F A;  3K1P A;  4RPN A;  2Q2C A;  4ZDM A;  1MY3 A;  4F31 B;  4L17 A;  3RY3 A;  3K1M A;  2XXV A;  3HHG A;  2P3N A;  1J1N A;  4BLA A;  1QUK A;  3KG2 A;  4FEB A;  1Y1Z A;  1VFD A;  1A7L A;  4PAF A;  3FD3 A;  4H45 A;  4OFO A;  3KSX A;  4FAJ A;  3IL1 B;  4G8M A;  3VXC A;  1BTJ A;  4OTE A;  4RYA A;  5AA2 B;  2VPO A;  1NV6 A;  3RNN A;  5KCJ B;  1AOV A;  2FNC A;  3CG3 A;  4IO3 A;  1YZ0 A;  1AWB A;  4JSO A;  3MPK A;  3MAM A;  1A8F A;  3FXB A;  3MVY A;  5FBP A;  2CZI A;  1JP4 A;  1Y4T A;  2F5X A;  1T0K A;  4UAC A;  2F34 A;  4XKP A;  4NF4 A;  1FQE A;  1Y3Q A;  1IIW A;  3BIH A;  3R26 A;  1MXW A;  4NAP A;  4NG7 A;  2ANJ A;  4C1T A;  4N81 A;  3HPI A;  4F3G A;  3HHF A;  4JWO A;  2PFZ A;  5CMB A;  3VLU A;  3MST A;  4X1B A;  1B52 A;  3C33 A;  2L5V A;  3D1R A;  4ZED A;  4GFR A;  5L8D A;  1MG1 A;  2HAU A;  4R6K A;  2PMS A;  4U21 A;  1DMB A;  3TEP A;  5AA1 A;  2ZZW A;  3VLW A;  3RPL B;  2AL4 A;  1FBC A;  4M1V A;  3VFJ A;  4U2R A;  3IFA A;  2XXP A;  3MYU A;  1EYJ A;  1EU8 A;  1LBZ A;  4QHQ A;  1BK4 A;  4OVP A;  4H5F A;  3O28 A;  1H76 A;  1MQD A;  2Z22 A;  3CSB A;  3SEX A;  1KA1 A;  2I58 A;  1BP5 A;  2HAV A;  2F78 A;  2QRY A;  3PUY E;  1PDA A;  3PU5 A;  1Y9U A;  5I7I A;  1ZMG A;  5I57 A;  2CEY A;  2ONR A;  3R6U A;  2P2A A;  1P1U A;  4F19 A;  3B6T A;  1LBY A;  1F9B A;  4MFI A;  1US5 A;  2CZK A;  3S2V A;  2DWH A;  2FYI A;  2RC9 A;  4MF3 A;  5FHO A;  4NWC A;  1NUW A;  1FPD A;  3H6T A;  3MBP A;  3M3L A;  4LAT A;  2ZZV A;  1TT1 A;  1FTK A;  3KJT A;  2WBD A;  4F3S A;  3QUF A;  3K6V A;  5A5X A;  4LQ2 A;  2AL5 A;  4PE3 A;  4MH5 A;  2V3Q A;  3C34 A;  1P99 A;  2F36 A;  3FGS A;  3ZKK A;  4NF4 B;  3K1N A;  2Q74 A;  4OVS A;  1UQW A;  3Q28 A;  2RF1 A;  2XX7 A;  1P1O A;  1FW0 A;  5L9M A;  3T1B A;  1YYZ A;  4NF5 B;  1OIB A;  5A5L A;  3FVK A;  4NE4 A;  3LSF B;  3BFT A;  3B8B A;  3FJG A;  1LAX A;  4MBP A;  2ZNT A;  5I84 A;  5JTY A;  2Y7I A;  4HCY A;  3MUQ A;  4X04 A;  5TU0 A;  1FQF A;  2UVJ A;  5TP9 A;  1S7Y A;  3VDF A;  1B1H A;  4ELP A;  4LA9 A;  2Y5L A;  4YKI A;  3IOR A;  1B4H A;  4MEV A;  1VE4 A;  3DP4 A;  1PB8 A;  3UOR A;  3K6W A;  3BKI B;  1MY0 A;  4JSD A;  3CRB A;  1M5C A;  5IM2 A;  3OOA A;  2QL3 A;  1OVB A;  4UA8 A;  4PFW A;  4XXU A;  3I6V A;  4YB7 A;  2ZYN A;  1NV4 A;  2CZL A;  2B4L A;  2Y7R A;  2HPG A;  3TCH A;  3V89 B;  4PF8 A;  3A3C A;  4F39 A;  1VFE A;  4O7I A;  1A55 A;  4DXC A;  4P0G A;  4HCW A;  3VVD A;  1LBC A;  3OXN A;  4QSC A;  2YJP A;  2Q8M A;  3FIR A;  4Z7E A;  4QSD A;  4Q8R A;  3OD7 A;  2DE4 A;  4OFL A;  2DQV A;  4G2Z A;  1O64 A;  4EDP A;  1MPD A;  2XXY A;  4ESW A;  4GIZ A;  3WAF A;  2DVC A;  2RCB A;  1MQI A;  4P9K A;  4EQ7 A;  4AB6 A;  2CEX A;  3L6G A;  4DIG A;  5BWJ A;  1RKM A;  2DS9 A;  1PB7 A;  1NKX A;  1II5 A;  1IMF A;  1CNQ A;  2XHD A;  3TQL A;  4I3E A;  5FHM A;  5KDT A;  3C9H A;  3IOW A;  4N6P A;  4QFL A;  3CHG A;  4PFR A;  4Q30 B;  2NWJ A;  1FBG A;  2W7Y A;  3B7D A;  4AQ4 A;  1LCT A;  1URS A;  4ZE9 A;  3QAX A;  3TPA A;  1WDN A;  1YPN A;  2KQZ A;  4MJO A;  2HZL A;  1URG A;  1OMP A;  5ICT A;  4G68 A;  4GX3 A;  1B05 A;  1MDQ A;  2DOJ A;  4OVQ A;  1NNF A;  4AB5 A;  4PTK A;  1GTK A;  2QMW A;  3TTR A;  2Q88 A;  1B3G A;  5DEX A;  3ROJ A;  4NF6 A;  2D21 A;  5DT6 A;  1G0I A;  3QSL A;  3PMV A;  3PPP A;  4K3F A;  3T9U A;  3TKD A;  3G3I A;  3S9E A;  1FBF A;  2A5T A;  4LQ5 A;  4PAI A;  1Q35 A;  4NF5 A;  2NXO A;  2UYF A;  3PGF A;  4OVJ A;  1JVX A;  2YLN A;  3GBA A;  1A99 A;  4DXU A;  1FTJ A;  2QVU A;  5BUU A;  4AS5 A;  2UVI A;  1MRP A;  3TTK A;  1D9Q A;  1JW4 A;  1SI1 A;  1IZ1 A;  2KR0 A;  1IQ7 A;  4G8H A;  1H44 A;  3TZA A;  3P7I A;  4QFP A;  4XF5 A;  2GRV A;  3PPN A;  2PVU A;  2Y5K A;  4KXP A;  1D3K A;  4JWY A;  3IK6 B;  3KGC A;  3H3G A;  1DBZ A;  3EPE A;  1MPC A;  3OO8 A;  1DTG A;  5H8F B;  1EYI A;  3QXM A;  4H8J A;  1FJ6 A;  2PT2 A;  3KSJ A;  2X7P A;  2RCA A;  3FJM A;  4KCC A;  5DW8 A;  4GWO A;  4THI A;  3LUY A;  1IIT A;  1R1N A;  3RT8 A;  3S4U A;  1WOD A;  2I4C A;  1CE2 A;  3RTW B;  1QW0 A;  3H6W A;  5I2N A;  1FPL A;  4KFQ A;  3RT6 B;  2FIX A;  1FRP A;  3O6I A;  4G68 B;  1JNF A;  4FOR A;  1FCK A;  1UTH A;  4RJZ A;  4YU0 A;  1YAE A;  5I57 B;  1XOC A;  2XX8 A;  4GXA A;  3MWB A;  1R9Q A;  3TCG A;  3H6V A;  1MXX A;  1FPE A;  4EQ9 A;  1DSN A;  2NVU B;  1NUX A;  1MH3 A;  1MM7 A;  4GX6 A;  4BDM A;  3MVW A;  4P11 A;  4OER A;  1I6A A;  3CI8 A;  5IZ3 B;  1XS5 A;  5A5X B;  3K4U A;  1OLA A;  1N7W A;  1FBH A;  5EHS A;  4ZZA A;  2P0S A;  1INP A;  3PUV E;  5AA4 A;  1P1W A;  2ABH A;  4R9F A;  1Y4C A;  1LB9 A;  1FPB A;  5T3J A;  5EQA A;  3PV0 E;  2O84 X;  2RC8 A;  1MQG A;  3EHT A;  3Q26 A;  3W9W A;  4E0X A;  2OWZ A;  4QFO A;  4FEC A;  1KWH A;  5DEX B;  4U1O A;  1A40 A;  4PFB A;  4R6Y A;  3IB2 A; 
#chains in the Genus database with same CATH homology
 2O7I A;  4GXS B;  1B3L A;  1EU8 A;  4GL8 A;  4WED A;  3IB0 A;  3ILT B;  5B70 A;  4QHQ A;  4PET A;  2I3V A;  4YIC A;  4H5F A;  3FXR A;  5H8S A;  3O28 A;  2QJE A;  5TPA A;  3N26 A;  1A54 A;  1H76 A;  1MQD A;  2Z22 A;  3CSB A;  2F6P A;  3SEX A;  3K6U A;  2I58 A;  3CR9 A;  1IUD A;  5EHM A;  1BP5 A;  3C32 A;  1BKA A;  1LAG E;  2HAV A;  3OEL A;  4LZ8 A;  1OQG A;  1QKA A;  1PC3 A;  3V5A A;  2F78 A;  2QRY A;  3PUY E;  4FJP A;  3WAE A;  1USY E;  3KZG A;  1PDA A;  3PU5 A;  1Y9U A;  1DPE A;  4JB7 A;  3SET A;  1ZMG A;  4Q0C A;  5I57 A;  2Y84 A;  4R2B A;  4PQJ A;  3RN8 A;  2ONR A;  2I3W A;  1LFG A;  5I2N B;  3R6U A;  1JQF A;  1M5E A;  2DXY A;  1P1U A;  2P2A A;  3ILU B;  3U94 A;  4F19 A;  3B6T A;  1B32 A;  1F9B A;  1US5 A;  2O7U A;  4MFI A;  3LR1 A;  2DWH A;  4OES A;  3S2V A;  1MXY A;  4DCY A;  2FYI A;  4U23 A;  1B0H A;  3FZV A;  4ELQ A;  1B4Z A;  2RC9 A;  4MF3 A;  3C36 A;  4KQP A;  5I2K B;  1MH4 A;  5FHO A;  1P1N A;  4I1D A;  4NWC A;  4OEN A;  4TOZ A;  5FTI A;  2REG A;  3ZSF A;  4OWD A;  3I3V A;  4IO5 A;  5CBS A;  4LON B;  3W15 C;  3RGY A;  3H6T A;  3K6X A;  5KCJ A;  4WKM A;  4MLQ A;  3TMG A;  1ZIU A;  1I6B A;  2ZMB A;  1ZU0 A;  2VHA A;  3M3L A;  3MBP A;  4LAT A;  1TT1 A;  1FTK A;  3KJT A;  2OCU A;  3G3F A;  4F3S A;  1GGG A;  1OLC A;  3G3G A;  1TFA A;  5B7D A;  1XHY A;  3MP8 A;  2QS2 A;  3M8U A;  3QUF A;  3K6V A;  1ZTY A;  1BLF A;  2H25 A;  5A5X A;  1B40 A;  4LQ2 A;  4ELR A;  2AL5 A;  1NNP A;  3OEM A;  4IO2 A;  2O1M A;  4OMB A;  3S9N C;  3E3K A;  4G4P A;  3IJO B;  4DDD A;  4MH5 A;  3K0V A;  2V3Q A;  3C34 A;  1M5F A;  3H06 B;  3ECR A;  1P99 A;  2ZYM A;  3KN3 A;  3MVZ A;  4HS7 A;  2F36 A;  3FGS A;  4F22 A;  3ZKK A;  3B6Q A;  4NF4 B;  3K1N A;  4ZZE A;  2B3B A;  1NH8 A;  4KPT A;  4G68 C;  4H65 A;  1B51 A;  1MY2 A;  1I6Q A;  2RKM A;  4HW8 A;  2F6G A;  3DEL B;  1B1X A;  2ALU A;  2XXQ A;  2HZK A;  4U1Z A;  3RQT A;  2XXH A;  1B5J A;  1UQW A;  3PUZ E;  2H5Y A;  3Q28 A;  4R2F A;  2RF1 A;  1QKB A;  4BDL A;  2XX7 A;  1P1O A;  1FW0 A;  1N76 A;  5L9M A;  3TFL A;  5KZT A;  4X1D A;  4YB5 A;  3E9X A;  1PBQ A;  1SW4 A;  4NF5 B;  5CMM A;  1PB9 A;  2F35 A;  1I69 A;  1N3X A;  3Q25 A;  1OIB A;  1Y3P A;  3FVK A;  3SKP A;  2X7Q A;  4JBZ A;  4NE4 A;  3MW0 A;  3LSF B;  4H6D A;  1SBP A;  4EQB A;  3VVE A;  4KYS A;  1Z7N E;  3BFT A;  3FJG A;  1LAX A;  4MBP A;  3TQW A;  1OVT A;  3KN8 A;  3VLV A;  5HPQ A;  1O7T A;  2ZNT A;  4OYV A;  4GRK A;  3KEI A;  5I84 A;  5JTY A;  2Q89 A;  4QFK A;  5H8H B;  2Y7I A;  3FXQ A;  2YPN A;  3LSX A;  5K2X A;  4HCY A;  5LOM A;  5I58 A;  3MUQ A;  4C1U A;  1D9Y A;  1LFH A;  4GF8 A;  5TU0 A;  1FQF A;  2UVJ A;  5TP9 A;  3O66 A;  1ZKB A;  1LCF A;  3CG1 A;  4O3B A;  5I59 B;  1N04 A;  1S7Y A;  2IA4 A;  4EUO A;  1SW2 A;  3VDF A;  1B9J A;  1B1H A;  4DXB A;  4ESX A;  3KJ7 A;  4ELP A;  2Q9T A;  4LA9 A;  4IO7 A;  2GHA A;  3EHU A;  3IOR A;  1B4H A;  1UTB A;  1VE4 A;  2G29 A;  1PB8 A;  3DP4 A;  1XVY A;  4YKI A;  2CMO A;  4PFU A;  3UOR A;  1RYO A;  3K6W A;  4ND9 A;  3BKI B;  4YB6 A;  1MY0 A;  3S9L C;  1NNT A;  2I6E A;  2G93 A;  4YAH X;  4XIG Q;  2RIN A;  4JSD A;  3CRB A;  3JV9 A;  1M5C A;  3H03 A;  3OOA A;  4YMB A;  2FA7 A;  2QL3 A;  1OVB A;  5H8F A;  3EF7 A;  4GL0 A;  4UA8 A;  1OQH A;  4NWD A;  4PFW A;  3L6H A;  3TTM A;  4XXU A;  1DPP A;  2IEE A;  3IAZ A;  3I6V A;  4YB7 A;  2ZYN A;  3T96 B;  2CZL A;  4KYD A;  4LVQ A;  2Y7K A;  5CRY A;  4NF8 B;  3T66 A;  4EF1 A;  2Y7R A;  3VXB A;  3RTF B;  3TCH A;  1B58 A;  1SVX B;  1TXF A;  2Z8F A;  3V89 B;  2XXT A;  2M8C A;  3A3C A;  4F39 A;  1R9L A;  4R6H A;  1VFE A;  5F1Q A;  1SYI A;  1A55 A;  1Z7M E;  2ONK E;  3OSQ A;  4P0G A;  4DXC A;  1L5T A;  4HCW A;  3UGW A;  5ITP A;  3O97 A;  1XVX A;  1GVC A;  3VVD A;  4ISU A;  1EH3 A;  1LBC A;  3OXN A;  5EYF A;  2OWS A;  3CIJ A;  4QF9 A;  2YJP A;  1IXH A;  4KHZ E;  2V3T A;  2XD3 A;  3FXU A;  3OO6 A;  2OBG A;  4LUB A;  3O6G A;  3H7M A;  3PMW A;  3FIR A;  3SEU A;  1B0L A;  2NUV A;  3BFU A;  1MY4 A;  3KFM A;  4QSD A;  5CMC A;  2H98 A;  4ZE8 A;  4QFN A;  1Q1K A;  1D4N A;  1SD3 A;  2R71 A;  4Q8R A;  1CB6 A;  2DXR A;  2F8D A;  4OEU A;  3DM0 A;  3OD7 A;  2ZYK A;  4U4X A;  4Z0I A;  2Q2A A;  1A8E A;  1B7Z A;  4F29 A;  4F3P A;  3PD9 A;  4H1X A;  4RNS A;  3JYR A;  1QUL A;  2DE4 A;  4KI0 E;  3OEK A;  5K2Y A;  5CMK A;  3TUS A;  2VD3 A;  4I62 A;  4ZEF A;  3KOS A;  4OFL A;  2DQV A;  4F1U A;  3HN0 A;  1O64 A;  4G2Z A;  3FVN A;  4HTG A;  4FIM A;  4NF4 A;  1MDP 1;  3UN6 A;  2HEU A;  3DP8 A;  3OO7 A;  4EDP A;  2UYE A;  1MPD A;  3KBR A;  5DVJ A;  4GLI A;  4R74 A;  3U93 A;  4POX A;  3VE1 B;  3OO9 A;  4FAT A;  2XXY A;  3IJX B;  4ESW A;  3UA8 A;  2P1S A;  4GIZ A;  4R73 A;  3WAF A;  4PP0 A;  4I8C A;  2DVC A;  3OSR A;  4RY1 A;  2RCB A;  4QSC A;  1HSL A;  1MQI A;  1B3F A;  1B5I A;  2PBW A;  3CFZ A;  4NMY A;  3MPL A;  4IO4 A;  2H99 A;  3IOT A;  4TQU Q;  3TAJ A;  3TYH A;  2OWT A;  5F7V A;  4EQ7 A;  4AB6 A;  1US4 A;  1IXG A;  5FTH A;  4WXJ A;  2Q8J A;  5H8Q A;  5HBC A;  5J1D A;  3SES A;  4LZ7 A;  1LST A;  3GBB A;  3IOV A;  3L6G A;  3N6T A;  4DIG A;  4ECF A;  1EZO A;  5BWJ A;  3O2A A;  1N3W A;  1RKM A;  1FQC A;  1ZLQ A;  5H8N B;  2F7A A;  4ZEC A;  2DS9 A;  1PB7 A;  1SQY A;  1GR2 A;  4EXK A;  4FE8 A;  1MPB A;  1QVS A;  3EN3 A;  1NKX A;  4H8I A;  1II5 A;  3IR1 A;  3O6H A;  2OK2 A;  2A5S A;  2LAO A;  1IEJ A;  2UXA A;  2XHD A;  5ELV A;  4RK2 A;  2QMX A;  3T93 B;  3MP1 A;  2PYY A;  4Z7E A;  3TQL A;  2ONS A;  1MXU A;  1LB8 A;  2H9B A;  2KLF A;  3N6U A;  5DYH A;  2Y7W A;  5FHM A;  5KDT A;  1FTO A;  3C9H A;  3IB1 A;  3MZ1 A;  5M2V A;  5H8H A;  3IOW A;  3UK4 A;  2I0B A;  3H4Z A;  4N6P A;  1AH5 A;  4QFL A;  3KOT A;  4Q30 B;  3Q29 A;  2NWJ A;  4DE8 A;  5I58 B;  1T0K A;  2PT1 A;  1Y20 A;  5I56 B;  5AA3 A;  4UAC A;  4G77 A;  2W7Y A;  3PPQ A;  4TLL B;  3B7D A;  3USD A;  5L9S A;  2VP1 A;  4XKP A;  1QJM A;  2Z8E A;  1AL3 A;  3O29 A;  3PPO A;  4AQ4 A;  4MLV A;  2XXI A;  3I5O A;  3T9X B;  1XC1 A;  3IOU A;  4F3B A;  1LCT A;  1URS A;  3B6W A;  1B3H A;  3HV1 A;  1HSE A;  2VGQ A;  2I4B A;  4OHN A;  4XKR A;  3QAX A;  4ZE9 A;  3FV2 A;  1NMU A;  2ESN A;  3TPA A;  2A5T B;  1WDN A;  2XXX A;  4PFY A;  3E13 X;  1YPN A;  4P0I A;  1SI0 A;  3SEY A;  4QRZ A;  3K01 A;  3VV5 A;  4E0W A;  1TWY A;  1ZJL A;  4TLM B;  2HZL A;  3FJ7 A;  3V83 A;  1LFI A;  3OMB A;  3LSW A;  1URG A;  1OMP A;  5ICT A;  4G68 A;  2OLB A;  1QUI A;  3FAT A;  3KN7 A;  1P1Q A;  1B05 A;  1MDQ A;  4M4G A;  2DOJ A;  3CVG A;  1NNF A;  4YZZ A;  4AB5 A;  1GTK A;  2QMW A;  3TTR A;  3SEW A;  2Q88 A;  4IY5 A;  3G3K A;  2UVH A;  1Y3N A;  3O9P A;  1B3G A;  1NH7 A;  3D4G A;  4OFJ A;  5DEX A;  3T9H B;  4RK9 A;  1LAH E;  1LAF E;  3BBR A;  4NF6 A;  2D21 A;  3K02 A;  5DT6 A;  2ZYO A;  3EQ1 A;  3QSL A;  1IXI A;  3PMV A;  3PPP A;  2V25 A;  4Q5T A;  4K3F A;  3THI A;  3K00 A;  2XXR A;  1B46 A;  4YKP A;  2D3I A;  1JEV A;  2E0S A;  2UVG A;  3G3I A;  3T9U A;  3TKD A;  1FTM A;  1MXV A;  2HCA A;  2O68 A;  3U8Q A;  2VOZ A;  4KCD A;  3FV1 A;  3VVF A;  5CM6 A;  3S9E A;  3A3U A;  2DE3 A;  3PUX E;  2A5T A;  4IB2 A;  4LQ5 A;  5DVI A;  1BIY A;  4KR5 A;  2VD2 A;  1O63 A;  1Q35 A;  3CFL A;  4NF5 A;  2NXO A;  1MXZ A;  2DWA A;  2UYF A;  1EZP A;  3MC2 A;  3DP6 A;  3PGF A;  1USY H;  4DZ1 A;  4YMA A;  4R9G A;  4OVJ A;  1JVX A;  2DE2 A;  3QK6 A;  1B5H A;  5DTB A;  3ZS6 A;  2YLN A;  4GD5 A;  4R72 A;  3GBA A;  2QS3 A;  3IO4 A;  3G3H A;  1A99 A;  3EHS A;  4DXU A;  4OQO A;  2ZNU A;  4QSE A;  2DP8 A;  2D5W A;  2AIX A;  1FTJ A;  1LBB A;  2QS4 A;  3OEN A;  1H43 A;  5CI5 A;  2UVI A;  3E4R A;  2B65 A;  5JTY B;  5L9O A;  3FVG A;  1MRP A;  1XT8 A;  3TTK A;  3R7X A;  3HCQ A;  5DVF A;  2XX9 A;  1FQD A;  1JW4 A;  1UIV A;  1VSO A;  1ATG A;  3FUZ A;  2DVZ A;  1YCJ A;  1WVJ A;  1H45 A;  1SDX A;  1SI1 A;  2O51 A;  3T22 A;  3HO7 A;  4BDO A;  5AA4 B;  1IZ1 A;  5IKB A;  3SDF A;  1IQ7 A;  4G8H A;  4YKJ A;  1N84 A;  1H44 A;  1B6H A;  4YKK A;  3P7I A;  4QFP A;  1UTB B;  3TZA A;  3LC8 A;  4JDF A;  3M3K A;  2GRV A;  2OZZ A;  3C31 A;  3PPN A;  1SW5 A;  1Y1M A;  1POT A;  1FTL A;  2BJJ X;  2PVU A;  4KYE A;  1D3K A;  3MQ9 A;  3IK6 B;  4JWY A;  4U22 A;  1B3E A;  3KGC A;  3MVX A;  3W9V A;  2V3U A;  3H3G A;  3N94 A;  4IGR A;  1EZ9 A;  2F7B A;  3EPE A;  4F18 A;  5HM4 B;  3U1O A;  1MPC A;  3OO8 A;  1DTG A;  1JW1 A;  1LGB C;  3K2D A;  5H8F B;  1QUJ A;  1DTZ A;  1PBP A;  2Y7P A;  3LBS A;  2GHB A;  3QXM A;  2V93 A;  4IO6 A;  3SEV A;  5AE4 A;  1JVY A;  3TTL A;  4H8J A;  3DLN A;  1B2H A;  4GQO A;  2THI A;  2PT2 A;  4H0W A;  3H6U A;  3KSJ A;  2ZNS A;  5KDT B;  3ZKL A;  1AIV A;  5H8N A;  2X7P A;  2RCA A;  3FVO A;  5ITO A;  3SER A;  4NF8 A;  2B3F A;  4LP2 B;  3FJM A;  1AMF A;  1M5B A;  4KCC A;  1B7U A;  4POW A;  2XD2 A;  4NED A;  4XKN A;  2R9J A;  5JEI A;  3UP9 A;  2I49 A;  1URD A;  4N13 A;  3HST A;  3UIF A;  2F7C A;  3M3F A;  4GWO A;  4OZ9 A;  4O3A A;  1MM6 A;  3K1P A;  4O3C A;  2Q2C A;  4RPN A;  4THI A;  4ZDM A;  5AA2 A;  1IXC A;  1MY3 A;  3LUY A;  1IIT A;  4F31 B;  3AXF A;  4L17 A;  1JEU A;  3RY3 A;  4EXL A;  1R1N A;  1NL5 A;  3K1M A;  2DYX A;  3RT8 A;  5BUU A;  2XXV A;  3HHG A;  4H67 A;  1J1N A;  5FHN A;  5I56 A;  3S4U A;  4BLA A;  1WOD A;  3PD8 A;  1QUK A;  1ANF A;  2I4C A;  3KG2 A;  2F97 A;  1Y1Z A;  4FEB A;  3S9M C;  3CFX A;  3MP6 A;  1CE2 A;  4X48 A;  4JWX A;  3IX1 A;  3RUM A;  3U92 A;  1VFD A;  3F11 A;  3RTW B;  1QW0 A;  5AA2 D;  2XXU A;  3H6W A;  1MS7 A;  3TTN A;  5I2N A;  1A7L A;  2I48 A;  2RC7 A;  3FD3 A;  1S50 A;  2XXW A;  4KFQ A;  2OJT A;  4OFO A;  3KSX A;  3RT6 B;  5ISU A;  4FAJ A;  3IL1 B;  1POY 1;  4G8M A;  5TP9 B;  1SYH A;  3O6I A;  1FQB A;  4G68 B;  1JNF A;  3VXC A;  3CSG A;  1BTJ A;  1NFT A;  4FOR A;  4OTE A;  1FCK A;  2DWI A;  1UTH A;  3PPR A;  4OXV A;  1YAE A;  4RJZ A;  4U4S A;  4YU0 A;  5CC2 A;  1MQJ A;  4RYA A;  5I57 B;  4XKQ A;  5AA2 B;  2Z8D A;  3T9V A;  1NNK A;  2HXW A;  1XOC A;  2XX8 A;  2X26 A;  2DWJ A;  4GXA A;  1MY1 A;  2PX1 A;  1RYX A;  3RNN A;  5KCJ B;  1AOV A;  3TDJ A;  3G3J A;  3QUJ A;  2FNC A;  4IY6 A;  4FED A;  4BDR A;  1B7H A;  1R9Q A;  3MWB A;  3TCG A;  3CG3 A;  2GH9 A;  2H4I A;  3GXA A;  3V8X B;  4F2Q A;  4H5G A;  2HFB A;  4IO3 A;  4ZEK A;  5ICQ A;  5H8Q B;  2QS1 A;  1N7X A;  3TEL A;  3H6V A;  1MXX A;  4EQ9 A;  1DSN A;  2NVU B;  2AYS A;  1ELJ A;  4JSO A;  1FQA A;  3MAM A;  3MPK A;  4ELO A;  3C35 A;  1A8F A;  3LSL A;  4ZEB A;  4ZEI A;  3MVY A;  4GVO A;  1MH3 A;  1SW1 A;  4F1Y A;  1MM7 A;  3GZG A;  1R6Z A;  1ZBM A;  4BDM A;  3MVW A;  2HQ0 A;  1M5D A;  4OET A;  1GV8 A;  1Y4T A;  2F5X A;  3N5L A;  1H3D A;  4P11 A;  2REJ A;  2F34 A;  2QSX A;  3D4C A;  1I6A A;  4OER A;  3CI8 A;  1FQE A;  1JW5 A;  1Y3Q A;  1IIW A;  2QPQ A;  3IO6 A;  3R26 A;  1MXW A;  1XS5 A;  4PE5 B;  4RXL A;  1UTH B;  3MZ9 A;  1UIU A;  1TFD A;  3GLB A;  2ANJ A;  5A5X B;  4C1T A;  3QYT A;  5CBR A;  3HPI A;  3JZJ A;  4G8N A;  1D9V A;  4F3G A;  1HSJ A;  2ZXT A;  3G7W A;  3K4U A;  1OLA A;  3HHF A;  4DCX A;  2E1S A;  4JWO A;  1VR5 A;  4F2O A;  4IGT A;  4KD5 A;  5CMB A;  3RPW A;  3PMX A;  1N7W A;  4GOT A;  5EHS A;  4ZZA A;  4EF2 A;  2P0S A;  3QIM A;  4JXI A;  4X1B A;  3TOD A;  3PUV E;  3VLU A;  1B52 A;  2O69 A;  3C33 A;  4NTL A;  4ONY A;  2DSF A;  4RPO A;  4C0R A;  4F1V A;  1P1W A;  2ABH A;  1JET A;  4R9F A;  4X9T A;  1MQH A;  4DLD A;  1Y4C A;  3U72 A;  1LB9 A;  5TPA B;  4ZED A;  3FAS A;  3ODB A;  4GFR A;  3ONM A;  1S9T A;  4OEV A;  4WEP A;  2I0C A;  2V84 A;  4PFT A;  1MG1 A;  2HAU A;  4R75 A;  4R6K A;  2PMS A;  5L8D A;  4N07 A;  3TCF A;  4U21 A;  3PV0 E;  4BDN A;  5JK4 A;  3MJN A;  2R6G E;  2O84 X;  1DMB A;  3TEP A;  5AA1 A;  1DOT A;  3A09 A;  2RC8 A;  1MQG A;  2NOO A;  2WKY A;  3EHT A;  4LZ5 A;  3VLW A;  5I59 A;  5IAI A;  3Q26 A;  3MZB A;  3Q27 A;  2GFE A;  4XTC Q;  3W9W A;  4E0X A;  2AL4 A;  2O1L A;  4M1V A;  3VFJ A;  4QFO A;  4U2R A;  3PUW E;  4FEC A;  4RA1 A;  1KWH A;  4I9D A;  1LLS A;  5DEX B;  4U1O A;  1YTV A;  1A40 A;  4ZS9 A;  3RLF E;  4BDQ A;  4R6Y A;  3C4M A;  2O6A A;  2XXP A;  4NF6 B;  5AA4 A;  1N0T A;  1PEB A;  3IB2 A;  5I2K A;  2Z23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...