3FJMA

Crystal structure of phosphate bound peb3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
231
structure length
231
Chain Sequence
DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Major antigenic peptide PEB3
publication title Specificity of Campylobacter jejuni adhesin PEB3 for phosphates and structural differences among its ligand complexes.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 83
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fjmA02
2Z8DA 1SD3A 3VLUA 3FATA 4GIZA 4PQJA 4FEDA 4ZE9A 1D4NA 1LAXA 4QFPA 4OMBA 2DOJA 4JWXA 5HM4B 4IO4A 3Q28A 2FNCA 2F7CA 3OMBA 4ZE8A 1UTHA 1Y3QA 1UTHB 1H43A 1MXWA 3HHGA 3Q25A 3T96B 2DWAA 2I3VA 3HV1A 3LBSA 4NF8B 2ZNSA 3ZKKA 1SVXB 1Y1ZA 2X26A 1GGGA 3JZJA 4F19A 3IX1A 1FW0A 2HEUA 1WODA 3OEKA 5CMKA 4QSEA 2P1SA 4P11A 4UACA 1PB8A 3MZ1A 5B70A 1HSEA 2H98A 3I6VA 4R9FA 4ND9A 4UA8A 1URDA 4MBPA 1LAFE 1PEBA 2XX9A 2GH9A 3MP1A 3PPQA 2QS1A 4G8HA 2HFBA 3RY3A 1PBPA 1VR5A 4OWDA 4EDPA 4M4GA 5AA4A 1YTVA 5AA4B 4ZECA 3TAJA 2QS2A 1GTKA 1B7HA 2HAVA 2I4BA 2PT2A 3SESA 2XD2A 3R6UA 1XC1A 1Q35A 2OK2A 2VOZA 4F29A 5ELVA 1N3XA 3TZAA 3OSRA 4R74A 3U94A 1QW0A 3IO6A 3E3KA 2Q88A 3K1MA 4ECFA 2FA7A 3D4GA 3JV9A 4DXCA 5CMCA 4JB7A 3DP6A 3K6XA 3A09A 3VXCA 1B0LA 5F1QA 4PP0A 5I84A 1ZLQA 2QS3A 5L9SA 1LGBC 4PETA 3T9HB 4RNSA 1FQFA 2PVUA 2Q89A 3SKPA 3CR9A 3FZVA 1OVTA 3KJTA 4R73A 3FGSA 4IO6A 3KN7A 1TT1A 2IA4A 3DP8A 1S9TA 2OZZA 1FQBA 1LCTA 1B2HA 2PX1A 2PT1A 2XD3A 4LZ7A 2IEEA 1SW1A 4KFQA 2AIXA 4DLDA 4RK2A 3KSJA 1VFEA 3RQTA 5AA3A 3CFXA 2REGA 3K0VA 4MLVA 4G8NA 1JW5A 4TOZA 3RGYA 3MZ9A 4WEPA 1JETA 4YB5A 3V83A 2REJA 4POXA 4ZEDA 3TFLA 4JSOA 1MQJA 1QUKA 2ZNTA 2DYXA 4YB6A 3IJOB 5A5XB 1MQHA 1JNFA 3DM0A 3G3HA 3U1OA 1QKAA 4HTGA 4N13A 1B3GA 1POY1 4KCCA 1QUJA 3IAZA 1H44A 3IOWA 3HSTA 1B1XA 3TPAA 3PPRA 3IB1A 4G8MA 3FXRA 3OELA 4DIGA 3JYRA 4F3BA 1NH8A 2WKYA 3C32A 4L17A 3FXQA 2D3IA 3N6TA 4XIGQ 3U93A 1CE2A 4O3CA 4EQBA 1MY1A 3H03A 3OEMA 3RLFE 1LAGE 1ZU0A 1NNKA 4OZ9A 4QF9A 4QSDA 4O3BA 3TUSA 3K6VA 2CZLA 5K2YA 4QHQA 1UTBA 4JWOA 1D3KA 1URSA 1SYHA 3L6GA 3LR1A 5KZTA 2XXQA 1B4ZA 1OLCA 1BKAA 1JEVA 2XXRA 3IORA 3HO7A 4EXKA 1ATGA 1UQWA 1O7TA 3TQWA 3FUZA 5ISUA 3MVYA 3Q26A 4G4PA 1DPPA 4IO3A 3VDFA 4DZ1A 1ZJLA 1JW4A 4PFUA 1B3LA 4LVQA 1FTJA 2Q8JA 1FTKA 2UXAA 1NNTA 4BLAA 3ONMA 3IJXB 1MXXA 3SERA 5JEIA 4IB2A 5H8HA 3I3VA 2ZYNA 3ZKLA 5H8SA 1I6AA 3S9NC 5DEXA 5DEXB 2I58A 3PUXE 3S4UA 2OCUA 3EHUA 2CMOA 4WXJA 3IB2A 3TELA 4C1TA 3TEPA 2NUVA 4KYSA 3TTLA 1OMPA 3IOVA 2R71A 3FV2A 4C0RA 4ZS9A 2ZYOA 3FASA 3PUZE 4FIMA 4I8CA 2DWHA 2Q2AA 1MPBA 1MPCA 3CSBA 4TLLB 1JQFA 5LOMA 4F1VA 2I48A 1IITA 3W9VA 3DP4A 3F11A 1NH7A 1XHYA 2E0SA 4LUBA 4POWA 5TU0A 4JSDA 4R6KA 1HSLA 3MZBA 2R9JA 2UYEA 4H8IA 3S9MC 1TWYA 4OHNA 3K4UA 2PBWA 4IY6A 5AA2A 3MPKA 4OVJA 3FIRA 4ZZEA 4DXUA 2DE3A 2B65A 2I3WA 2HAUA 3SEWA 1I6QA 4ZDMA 3UIFA 3A3CA 4X1DA 5K2XA 4XKQA 1MY0A 3MP6A 3C9HA 4BDOA 4ZZAA 1B32A 1M5CA 2Y7RA 3OO8A 3O9PA 4YMBA 1JVXA 4QFLA 4KCDA 1RYOA 4U22A 4AQ4A 3B6TA 3M3KA 3SEUA 3H7MA 3T93B 3K01A 1FCKA 4Z0IA 1XVXA 1P1UA 4LP2B 5I59A 5KDTA 3MQ9A 5I59B 5KDTB 1D9YA 1EH3A 3O2AA 3KG2A 3O29A 5EYFA 2DQVA 4GLIA 4XTCQ 4FECA 2O68A 4F2OA 4NF5A 3VV5A 4NF5B 2ABHA 4F31B 1JEUA 4MF3A 1H3DA 3TKDA 2I49A 2YPNA 4M1VA 1AOVA 3LSWA 3L6HA 4EQ7A 3PD9A 4FE8A 2HXWA 5HPQA 5DYHA 5J1DA 4DE8A 1TFAA 2HQ0A 2V3UA 4NF8A 3OOAA 2DVCA 1MDQA 4FJPA 3G3KA 4DXBA 1XOCA 5I2NA 2XXPA 2ONKE 3RT8A 2O7UA 5I2NB 1B51A 4ONYA 4LQ5A 1IZ1A 1WDNA 3VVEA 4NF6A 4QFKA 5JTYA 1NL5A 4NF6B 5JTYB 4F3GA 3K2DA 1Y3NA 2Y7PA 5EHMA 2QMWA 3FXUA 4XKNA 4NF4A 4GFRA 1IXGA 1F9BA 3KZGA 4NF4B 1BP5A 4RPNA 1ZMGA 1A99A 3KEIA 1Y20A 3TMGA 1N0TA 3K6UA 4G68C 3BKIB 3V8XB 2OBGA 1VSOA 5HBCA 3O97A 3G7WA 3H6UA 2V3TA 3HN0A 1HSJA 1Z7ME 2F34A 2I6EA 2H9BA 1OLAA 3K1NA 1MM7A 3R7XA 4G68B 2ESNA 5DT6A 4F1YA 4QRZA 3C33A 4GQOA 2NOOA 3GZGA 1SW4A 4QFOA 1H45A 1OIBA 1A8EA 3KBRA 3IR1A 1ZIUA 3U8QA 3H6WA 3VFJA 1B9JA 1SW2A 1O64A 5I58A 2F5XA 5I58B 3QSLA 2YJPA 2F6PA 2F7AA 4F2QA 1YCJA 3KN8A 3EF7A 1RKMA 4X9TA 3CVGA 4R75A 1JW1A 1M5FA 3MPLA 1LCFA 4GL0A 4LONB 1MDP1 4N07A 1I6BA 5B7DA 3ZSFA 4F39A 3VVFA 3PPPA 4FORA 1EZOA 2V3QA 1ANFA 1URGA 3I5OA 1UIUA 4KPTA 1R9LA 4KQPA 4Q0CA 3CFZA 2XXYA 2I0BA 4ELRA 1PBQA 3PUYE 2XX7A 2D5WA 3SETA 4ZEIA 2NWJA 1B3FA 4R72A 1XS5A 4BDQA 4C1UA 2D21A 5A5XA 2OWTA 3SEVA 2ZNUA 3HPIA 5I56B 1B5HA 5CMMA 3PD8A 3RN8A 2A5SA 2H99A 1B6HA 1B7ZA 2B3BA 4P0IA 2DS9A 3K6WA 1FTMA 1NMUA 3B7DA 4ZEBA 3MW0A 4P0GA 3D4CA 1S50A 1US4A 3C31A 1B4HA 4OXVA 1POTA 1D9VA 2F6GA 3C4MA 1FQDA 3TDJA 4DCYA 4JXIA 4H8JA 4Q30B 1B05A 1MXUA 2HZKA 2THIA 3RNNA 4Q5TA 1IXCA 2XXHA 1IQ7A 4G77A 3TODA 3EPEA 4EUOA 1PDAA 3CG1A 2PMSA 2GFEA 4OFJA 3K00A 4IGRA 4YAHX 5KCJB 3PPOA 3B6WA 2DVZA 2F97A 1M5EA 3MP8A 1LFGA 4ELPA 1LFIA 3LSXA 4H5GA 3VLWA 3C35A 1SYIA 1RYXA 2XXUA 3PU5A 5ITPA 2ANJA 2UVJA 2V25A 2AL4A 3SEXA 2XXXA 1SW5A 1ELJA 2ZMBA 5F7VA 5AA2D 1SQYA 3PPNA 2DXYA 3IB0A 3KOTA 1EZ9A 1IEJA 3TCHA 5AE4A 2P2AA 3MJNA 3TTRA 3A3UA 1FQAA 3CRBA 3PMWA 4YB7A 4GOTA 4ELQA 3S9EA 4I1DA 4RK9A 4XXUA 1QJMA 3TTKA 3VE1B 4NTLA 3IOUA 2VD2A 2ALUA 1R9QA 1Y1MA 3G3FA 1NFTA 1MM6A 2XXTA 4OYVA 1GR2A 3LUYA 1GV8A 1Y4CA 4X1BA 3TTMA 1A7LA 3R26A 2OWSA 2QS4A 3G3JA 1J1NA 5H8NA 3IK6B 3G3IA 5H8NB 4JWYA 1R6ZA 2ONRA 3UA8A 2OJTA 4BDMA 3EHTA 5TP9A 5TP9B 4OERA 3W15C 4RJZA 1UIVA 3H6TA 4IY5A 4OENA 2XHDA 4LQ2A 2NVUB 3RTWB 1M5DA 1EZPA 1LB9A 1A40A 2UVIA 3KSXA 4EQ9A 2HCAA 1TXFA 3CIJA 3QYTA 3E9XA 5CC2A 1N3WA 4Q8RA 4Z7EA 5FHOA 2Z22A 2DE2A 3GXAA 4WEDA 1SI0A 2XXIA 3BBRA 4H65A 5ICTA 2Z23A 1B5JA 1QKBA 3P7IA 3VVDA 4AB6A 3UN6A 2DWJA 1ZTYA 1IXIA 1MRPA 1R1NA 1IIWA 1BLFA 3E4RA 3PUWE 4ZEKA 4U21A 3T9VA 1ZBMA 4THIA 2O1LA 1A55A 5JK4A 3H06B 3TCGA 3PMVA 1DSNA 4YKPA 3KOSA 1N7XA 1AIVA 5IAIA 3FV1A 4NEDA 1PB9A 4GWOA 3V5AA 5CRYA 3KFMA 3MVXA 4KR5A 3DLNA 4R2FA 2Q2CA 4DCXA 3U92A 3OENA 3N6UA 1LBCA 4EF2A 5L9MA 4H67A 2R6GE 3SDFA 4G2ZA 4OTEA 2UYFA 2GHBA 2QPQA 3H6VA 4R2BA 4MLQA 3V89B 2V93A 2F35A 2Y7IA 4LA9A 2O6AA 1Z7NE 1NNFA 1O63A 2DXRA 3O6GA 4LZ8A 3KN3A 2H4IA 2UVGA 5L8DA 1XVYA 5ICQA 4N6PA 3OD7A 1MQIA 2E1SA 3W9WA 4BDRA 4YICA 1II5A 4EF1A 3OSQA 2H5YA 2RC8A 4YU0A 2X7QA 1AMFA 3UP9A 4PFWA 2HZLA 2QMXA 3RT6B 3MC2A 3GBAA 1B1HA 4F3PA 2RF1A 2YLNA 5I57A 5I57B 4MH5A 2F78A 1MXVA 1DMBA 3PMXA 1GVCA 2ONSA 3U72A 3QUFA 3MUQA 3S2VA 1MS7A 1M5BA 1FTOA 1B52A 1ZKBA 2QL3A 1MG1A 3ODBA 1US5A 3FD3A 5DVIA 1T0KA 2QSXA 4F18A 3UK4A 1XT8A 4RY1A 5BWJA 1AL3A 2Y7KA 4G68A 3FVNA 1Y4TA 1S7YA 2A5TA 3G3GA 2A5TB 4HCYA 3EN3A 3MVWA 1VFDA 3H4ZA 3M3FA 5FTIA 1B46A 4AB5A 2O1MA 2O51A 3K1PA 3T22A 4GRKA 5H8FA 5H8FB 2AYSA 4MFIA 2F7BA 2M8CA 3ILTB 4PFTA 4DDDA 4WKMA 1OQHA 1AH5A 4ESWA 3HHFA 4RA1A 4JDFA 2RCAA 2BJJX 3PGFA 1P1OA 2I0CA 2LAOA 3B6QA 5DVJA 5H8QA 3N26A 5H8QB 4RXLA 1JVYA 3M8UA 4NWDA 3O6IA 1TFDA 4HS7A 1MY2A 2O84X 4GXAA 3GLBA 4YKJA 1BTJA 2Y84A 1LBBA 1QUIA 3RTFB 1MQDA 3DELB 3WAEA 5EHSA 2O69A 1A54A 2DSFA 4FEBA 1KWHA 3QAXA 4BDLA 4IGTA 3LC8A 3VLVA 4IO7A 3C34A 3MAMA 3FJMA 4F3SA 4BDNA 3UORA 2X7PA 3AXFA 3K02A 3PV0E 4EXLA 1WVJA 2QRYA 4OFLA 4HCWA 1LAHE 2O7IA 1L5TA 3Q29A 4GD5A 1H76A 1N76A 1P99A 1NKXA 4OEVA 2AL5A 4QFNA 1PC3A 4U4XA 5I56A 3ILUB 4IO5A 4U23A 3EHSA 4KHZE 1B40A 1MXYA 1OQGA 3S9LC 4OEUA 5FHNA 3N5LA 3H3GA 1YAEA 4NMYA 2RKMA 2NXOA 1P1QA 4PFYA 5TPAA 1MY4A 5CM6A 2RINA 1DOTA 5TPAB 2VGQA 2G29A 4JBZA 1BIYA 5IKBA 2VD3A 1LLSA 4ISUA 1N84A 1IXHA 4KD5A 4O3AA 4NE4A 4RYAA 4K3FA 4KYEA 3FJGA 3GBBA 1MPDA 3QIMA 4NWCA 5FHMA 3LSLA 2RC9A 3OXNA 3QXMA 4QSCA 5AA1A 1PB7A 4FATA 1QULA 4E0XA 2RC7A 1OVBA 1EU8A 5CI5A 1USYE 4RPOA 3OO7A 2GRVA 5KCJA 3T9UA 2VHAA 3M3LA 4IO2A 3O6HA 3FVGA 1DTZA 2DP8A 4KYDA 2W7YA 4TQUQ 4ZEFA 4YKIA 5CBRA 4ELOA 2DWIA 4H6DA 1MH3A 3TQLA 1LFHA 1MH4A 2XXWA 1SI1A 3THIA 1MQGA 3RUMA 1Y3PA 4GVOA 4X48A 4U2RA 4U1OA 4H1XA 1N04A 1UTBB 1I69A 3CG3A 2FYIA 5L9OA 3OO9A 4YMAA 4GF8A 2F8DA 3TYHA 3FVKA 1IUDA 3PUVE 4GL8A 3ECRA 2V84A 4PE5B 2Z8EA 3O66A 1QVSA 1Q1KA 2XX8A 3O28A 4R9GA 4FAJA 1Y9UA 3BFUA 3E13X 3BFTA 4XKPA 3N94A 1CB6A 1LB8A 3OO6A 3TCFA 2ZYMA 4HW8A 3KGCA 1FTLA 2ZYKA 3KJ7A 4H0WA 3VXBA 2F36A 3EQ1A 1A8FA 4F1UA 2GHAA 4ESXA 4H5FA 5H8HB 3TTNA 3RPWA 3FJ7A 3HCQA 2QJEA 4TLMB 5BUUA 4KI0E 3MBPA 1DPEA 4OETA 1P1WA 5FTHA 1LSTA 5M2VA 4OFOA 3SEYA 1USYH 1B0HA 4YZZA 1P1NA 2OLBA 4R6YA 1FQCA 3Q27A 1SBPA 2Y7WA 3QUJA 1B3EA 1MY3A 1MXZA 1DTGA 5DTBA 2G93A 3IL1B 2XXVA 2I4CA 2P0SA 2RCBA 2VP1A 4OESA 1B7UA 5CMBA 4I62A 3ZS6A 4GXSB 2UVHA 4F22A 1NNPA 1SDXA 3UGWA 1VE4A 1B58A 1YPNA 1B5IA 5I2KA 2DE4A 1B3HA 5I2KB 4XKRA 2ZXTA 2Q9TA 3T66A 3IO4A 5AA2B 4OQOA 4LATA 2PYYA 2Z8FA 3FVOA 1FQEA 5CBSA 4R6HA 4YKKA 3CSGA 3T9XB 4E0WA 3MVZA 3CI8A 3WAFA 2H25A 2B3FA 3MWBA 1N7WA 5ITOA 4U1ZA 3CFLA 5DVFA 3IOTA 4LZ5A 3C36A 4I9DA 3USDA 3LSFB 2KLFA 3QK6A 4U4SA
chains in the Genus database with same CATH superfamily
2Z8DA 1SD3A 3VLUA 3FATA 4GIZA 4PQJA 4FEDA 4ZE9A 1D4NA 1LAXA 5I5PA 5FBPA 4QFPA 4OMBA 2DOJA 4JWXA 3ISPA 5HM4B 4N81A 4IO4A 3Q28A 2HXRA 2FNCA 2F7CA 2B4MA 4NX1A 2F3BA 3OMBA 4ZE8A 1UTHA 2JJKA 1Y3QA 1UTHB 1H43A 1NV1A 1MXWA 3HHGA 3Q25A 2BJIA 3T96B 2DWAA 2I3VA 3HV1A 3LBSA 4NF8B 2ZNSA 3ZKKA 1SVXB 4HE2A 1Y1ZA 2X26A 1GGGA 2Y5KA 1NUYA 3JZJA 4F19A 3IX1A 1FW0A 4O8MA 2HEUA 1WODA 3OEKA 5CMKA 4QSEA 2P1SA 4P11A 4UACA 1PB8A 3MZ1A 4QBAA 5B70A 1HSEA 2H98A 3I6VA 1CNQA 4R9FA 4ND9A 1FPDA 4UA8A 1URDA 4MBPA 1LAFE 1PEBA 2XX9A 2GH9A 3MP1A 3PPQA 2QS1A 4G8HA 1EYKA 2HFBA 3RY3A 1PBPA 1VR5A 4OWDA 4EDPA 4M4GA 5AA4A 1YTVA 5AA4B 4ZECA 1SPIA 3TAJA 2QS2A 1GTKA 1B7HA 2HAVA 1Q9DA 2I4BA 2PT2A 3SESA 1RDYA 2XD2A 4PDHA 2XWIA 3R6UA 1XC1A 1Q35A 2OK2A 2VOZA 4F29A 5ELVA 1N3XA 3TZAA 3OSRA 4R74A 2WX9A 3U94A 1QW0A 3IO6A 3E3KA 4OANA 2Q88A 3K1MA 3KBZA 5ET5A 2P3VA 4ECFA 4JVDA 2FA7A 3D4GA 3JV9A 4DXCA 4H45A 5CMCA 4JB7A 3DP6A 5IZ3A 3K6XA 3A09A 5IZ3B 3VXCA 1B0LA 5F1QA 4PP0A 5I84A 1BK4A 1ZLQA 2QS3A 5L9SA 1LGBC 4PETA 3T9HB 4RNSA 1FQFA 4P1LA 2PVUA 2Q89A 2Y5LA 3SKPA 3CR9A 3FZVA 1OVTA 3KJTA 4R73A 3FGSA 4GX3A 1DBZA 4IO6A 3KN7A 1TT1A 2IA4A 4O7IA 3DP8A 1S9TA 2OZZA 1FQBA 1LCTA 1B2HA 2PX1A 2PT1A 2XD3A 3FBPA 4LZ7A 2IEEA 1SW1A 4KFQA 2AIXA 5F24A 1FJ9A 4GWWA 4GBWA 4DLDA 4RK2A 3KSJA 1VFEA 4AS5A 3RQTA 5AA3A 3CFXA 2REGA 3K0VA 4MLVA 4G8NA 1JW5A 4TOZA 3RGYA 3MZ9A 1FPEA 4WEPA 4PFRA 1JETA 4YB5A 3V83A 2REJA 4POXA 4ZEDA 3TFLA 4JSOA 1MQJA 2QVUA 1QUKA 2ZNTA 2DYXA 4YB6A 3IJOB 5A5XB 1MQHA 1JNFA 3EKIA 3DM0A 2KQZA 4N6KA 3G3HA 3U1OA 1QKAA 4HTGA 4N13A 4XF5A 1B3GA 1FPFA 1POY1 5IM2A 4KCCA 1FBPA 1FBCA 1QUJA 3IAZA 1H44A 1K9ZA 3IOWA 3HSTA 1B1XA 5ET6A 3TPAA 3PPRA 3IB1A 4G8MA 3FXRA 3OELA 4DIGA 2KR0A 3JYRA 4F3BA 1NH8A 2WKYA 4NAPA 3C32A 1FBFA 4L17A 3FXQA 2D3IA 3N6TA 4XIGQ 3U93A 2ZZVA 1CE2A 4O3CA 4EQBA 1MY1A 3H03A 3OEMA 3RLFE 4PAKA 1LAGE 1ZU0A 1NNKA 4OZ9A 4QF9A 4QSDA 4O3BA 3TUSA 3K6VA 2CZLA 5K2YA 4QHQA 1UTBA 1FPGA 4JWOA 1D3KA 1URSA 4NHBA 5I3SA 1SYHA 4PAFA 3L6GA 3LR1A 5KZTA 2XXQA 2Q74A 1B4ZA 1OLCA 1BKAA 1JEVA 4PAIA 2XXRA 3IORA 3HO7A 4EXKA 1ATGA 1UQWA 1O7TA 1FPLA 3TQWA 3FUZA 3MSTA 1FBHA 3IFAA 5ISUA 3MVYA 3Q26A 4G4PA 1DPPA 4IO3A 3VDFA 2L5VA 4DZ1A 1ZJLA 1JW4A 4PFUA 1B3LA 2FBPA 4LVQA 1FTJA 2Q8JA 1FTKA 2UXAA 1NNTA 4PC9A 4BLAA 3ONMA 3IJXB 2WBDA 1NV0A 1MXXA 3SERA 5JEIA 4IB2A 5H8HA 3I3VA 2ZYNA 3ZKLA 5H8SA 2HHMA 1I6AA 3S9NC 5DEXA 5DEXB 2I58A 3PUXE 3S4UA 2OCUA 3EHUA 2CMOA 4WXJA 1IMAA 3IB2A 3TELA 4C1TA 3TEPA 2NUVA 4PF6A 4MMPA 4KYSA 3TTLA 1OMPA 3IOVA 2R71A 4P3LA 3FV2A 4C0RA 4N17A 2ZYOA 3FASA 4ZS9A 3U65A 3PUZE 4FIMA 4I8CA 2DWHA 2Q2AA 1MPBA 1MPCA 3CSBA 4TLLB 1JQFA 2ZZWA 5LOMA 4MEVA 4PGNA 4F1VA 2I48A 1IITA 2OX3A 3W9VA 3DP4A 3GYYA 2PFZA 1NV2A 3F11A 1NH7A 1XHYA 2E0SA 4LUBA 4POWA 4NQ8A 5TU0A 4JSDA 4R6KA 1HSLA 3MZBA 2R9JA 2UYEA 4H8IA 3S9MC 1TWYA 4OHNA 3K4UA 2PBWA 4IY6A 5AA2A 3MPKA 4OVJA 3FIRA 4ZZEA 5EQAA 4DXUA 2DE3A 2B65A 4JVCA 2I3WA 2HAUA 3SEWA 1I6QA 4ZDMA 3UIFA 3A3CA 4X1DA 5K2XA 4XKQA 4AS4A 1MY0A 4QXDA 2V4CA 3MP6A 3C9HA 4XEQA 4BDOA 4ZZAA 4N15A 5A5LA 1B32A 1M5CA 2Y7RA 3OO8A 3O9PA 4YMBA 1FBDA 1JVXA 4MNPA 4QFLA 3T0JA 4KCDA 1RYOA 4U22A 4AQ4A 3B6TA 3M3KA 3BIGA 3SEUA 3H7MA 4N8GA 3T93B 3K01A 1FCKA 4Z0IA 1XVXA 1P1UA 4LP2B 5I59A 5KDTA 5EQ8A 3MQ9A 5I59B 5KDTB 1D9YA 4PTKA 1EH3A 3O2AA 3KG2A 3O29A 5EYFA 1XI6A 2DQVA 4MAGA 1NV3A 4GLIA 4XTCQ 4FECA 2O68A 4F2OA 4NF5A 3VV5A 4NF5B 2ABHA 4F31B 1JEUA 4MF3A 3RYDA 1H3DA 3TKDA 2I49A 2YPNA 4M1VA 1LBXA 1AOVA 3LSWA 3L6HA 4EQ7A 3PD9A 4FE8A 2HXWA 5HPQA 5DYHA 4O7MA 5J1DA 4DE8A 1KA0A 1TFAA 2HQ0A 2FVZA 4MX6A 2V3UA 4NF8A 3OOAA 2DVCA 1MDQA 5ET8A 4FJPA 3G3KA 4DXBA 1XOCA 5I2NA 4P56A 2XXPA 2ONKE 3RT8A 2O7UA 5I2NB 1B51A 4ONYA 4LQ5A 1IZ1A 1WDNA 3VVEA 4NF6A 4QFKA 5JTYA 1NL5A 4NF6B 5JTYB 4F3GA 3K2DA 1Y3NA 2Y7PA 4NGUA 5EHMA 2QMWA 3FXUA 3E78A 4XKNA 4NF4A 4GFRA 1IXGA 1F9BA 3KZGA 4NF4B 1BP5A 4RPNA 1ZMGA 1A99A 3KEIA 1Y20A 3TMGA 1N0TA 3K6UA 4G68C 3BKIB 3V8XB 2OBGA 4PF8A 1VSOA 5HBCA 3O97A 3G7WA 3H6UA 4N6DA 4I3YA 2V3TA 3HN0A 1HSJA 1Z7ME 2F34A 2I6EA 2H9BA 2XWKA 1OLAA 3K1NA 1MM7A 3R7XA 4G68B 2ESNA 5DT6A 4F1YA 4QRZA 3C33A 4GQOA 2NOOA 3GZGA 1SW4A 4QFOA 1H45A 1OIBA 1A8EA 1DCUA 3KBRA 3IR1A 4P9KA 2CEYA 1ZIUA 3U8QA 3H6WA 3VFJA 1B9JA 1SW2A 1O64A 3ROJA 1EYJA 5I58A 2F5XA 5I58B 3QSLA 1LBWA 2YJPA 2F6PA 4G61A 2B4LA 2F7AA 4F2QA 1YCJA 2FIXA 3KN8A 3EF7A 1RKMA 4X9TA 3CVGA 4FBPA 4R75A 1JW1A 1M5FA 3MPLA 1LCFA 4GL0A 4LONB 1MDP1 4N07A 4PBHA 1I6BA 4N8YA 5B7DA 3ZSFA 4F39A 3VVFA 3PPPA 2DDKA 2Q8MA 4FORA 1EZOA 2V3QA 1ANFA 1URGA 3I5OA 1UIUA 4KPTA 2FIEA 1R9LA 4KQPA 4Q0CA 3CFZA 2XXYA 1JP4A 2I0BA 4ELRA 1PBQA 4LN5A 3PUYE 2XX7A 2D5WA 2WYPA 3SETA 4ZEIA 2NWJA 1B3FA 4R72A 1XS5A 4BDQA 4C1UA 2D21A 1G0HA 5A5XA 2OWTA 3SEVA 2ZNUA 3HPIA 4I3EA 5I56B 1B5HA 2R8TA 5CMMA 3PD8A 1NV5A 3RN8A 2A5SA 2H99A 1B6HA 1B7ZA 2B3BA 4P0IA 3LV0A 2DS9A 3K6WA 1FTMA 1NMUA 3B7DA 4ZEBA 1FPKA 2QFLA 3MW0A 4P0GA 3D4CA 1NV6A 1FPIA 1S50A 3SZPA 1US4A 3C31A 1B4HA 3RPLB 4OXVA 1INPA 1POTA 1D9VA 2F6GA 3C4MA 1FQDA 3TDJA 4DCYA 2XXKA 4MNIA 4JXIA 4H8JA 4Q30B 2QVVA 1B05A 1MXUA 2HZKA 4GWYA 2THIA 3RNNA 4Q5TA 1IXCA 2XXHA 1LBYA 1IQ7A 4G77A 3TODA 3EPEA 2WEFA 4EUOA 1PDAA 4PFIA 3CG1A 2PMSA 2GFEA 4OFJA 3K00A 4IGRA 4GX4A 4YAHX 5KCJB 3PPOA 3B6WA 2DVZA 4HE1A 3CHGA 2F97A 1M5EA 5ESYA 4O94A 3MP8A 1LFGA 4OA4A 4HXVA 4ELPA 1LFIA 1IMDA 3LSXA 4H5GA 3VLWA 3C35A 1SYIA 1RYXA 2XXUA 1IMFA 3PU5A 5ITPA 2ANJA 2UVJA 2V25A 2AL4A 3SEXA 2XXXA 1SW5A 1ELJA 2ZMBA 5F7VA 5AA2D 4MIJA 4UABA 1SQYA 3PPNA 2DXYA 3IB0A 5LDZA 3KOTA 1EZ9A 1IEJA 3TCHA 5AE4A 2P2AA 3MJNA 3TTRA 3A3UA 1FQAA 3CRBA 1QGXA 3PMWA 4YB7A 4GOTA 4ELQA 3S9EA 4I1DA 4RK9A 4XXUA 1QJMA 3TTKA 4IR8A 4GX6A 1LBZA 3VE1B 4NTLA 3IOUA 2VD2A 2ALUA 1R9QA 1Y1MA 3G3FA 1NFTA 2QVRA 3KC0A 1FJ6A 1MM6A 2XXTA 4OVPA 4OYVA 2F3DA 1GR2A 3LUYA 1GV8A 1Y4CA 4X1BA 3TTMA 1A7LA 1NUXA 1LBVA 3R26A 2OWSA 2QS4A 3A29A 3G3JA 1J1NA 5H8NA 3IK6B 3G3IA 5H8NB 4JWYA 1R6ZA 2ONRA 3UA8A 2OJTA 4BDMA 3EHTA 4PFBA 5TP9A 5TP9B 4OERA 3W15C 4RJZA 1UIVA 3H6TA 4IY5A 4OENA 1YYZA 2XHDA 4LQ2A 2NVUB 3RTWB 1M5DA 3QMFA 1EZPA 1LB9A 1A40A 2UVIA 3KSXA 4EQ9A 2HCAA 2XWVA 1TXFA 1NI9A 3CIJA 3QYTA 3E9XA 5CC2A 1N3WA 4Q8RA 4Z7EA 5FHOA 2Z22A 2DE2A 3GXAA 4WEDA 1SI0A 2XXIA 3BBRA 4H65A 3HFUA 5ICTA 2Z23A 1B5JA 1QKBA 3P7IA 3VVDA 3B50A 4AB6A 3UN6A 2DWJA 1ZTYA 1IXIA 1MRPA 1R1NA 1IIWA 2OWZA 1BLFA 4XFEA 4OVQA 3E4RA 4MHFA 3PUWE 4ZEKA 4U21A 3T9VA 1ZBMA 4THIA 2O1LA 1A55A 5JK4A 3H06B 3TCGA 3PMVA 2VT5A 1DSNA 4PCDA 4YKPA 3KOSA 1N7XA 1AIVA 5IAIA 3FV1A 3LUZA 4NEDA 1PB9A 4GWOA 3V5AA 5CRYA 4GWXA 3KFMA 3MVXA 5EYHA 4KR5A 3DLNA 4R2FA 2Q2CA 4DCXA 3U92A 3OENA 3N6UA 1LBCA 4EF2A 5LTCA 5L9MA 4H67A 2R6GE 3SDFA 4G2ZA 4OTEA 2UYFA 2GHBA 2QPQA 3H6VA 4R2BA 4MLQA 3V89B 5EYGA 2V93A 5DW8A 2F35A 2Y7IA 1AWBA 4LA9A 1NV7A 2ZZXA 2XWOA 2O6AA 1Z7NE 5T3JA 1NNFA 4MNCA 1O63A 2DXRA 2PCRA 3O6GA 4LZ8A 1KA1A 3KN3A 2H4IA 2UVGA 2VPNA 1XVYA 5L8DA 5ICQA 2VPOA 4N6PA 3OD7A 4MJOA 1MQIA 2E1SA 1IMEA 3W9WA 4BDRA 4YICA 1II5A 4EF1A 4GBVA 3OSQA 2H5YA 4GWUA 2RC8A 4YU0A 2X7QA 1AMFA 3UP9A 4PFWA 2HZLA 5EQ9A 2QMXA 4NG7A 3RT6B 3MC2A 3GBAA 1B1HA 1EYIA 5IZZA 4F3PA 2RF1A 2YLNA 5I57A 3PTYA 5I57B 4MH5A 2F78A 1MXVA 1DMBA 3PMXA 1GVCA 2ONSA 3U72A 3QUFA 3MUQA 3S2VA 1MS7A 1M5BA 5ET7A 5EQ7A 1FTOA 1B52A 1ZKBA 2QL3A 1MG1A 3ODBA 1US5A 3FD3A 5DVIA 1T0KA 2QSXA 4X8RA 4NF0A 4DI4B 4F18A 3UK4A 4P47A 1XT8A 4RY1A 5BWJA 1AL3A 2Y7KA 4G68A 3FVNA 1Y4TA 1RDXA 1S7YA 3D1RA 2A5TA 3G3GA 2A5TB 4HCYA 3EN3A 3MVWA 1VFDA 3H4ZA 3M3FA 5FTIA 1B46A 1RDZA 4AB5A 2O1MA 2O51A 3K1PA 3T22A 4GRKA 5H8FA 5H8FB 1D9QA 2WBBA 2AYSA 4MFIA 2F7BA 2M8CA 3ILTB 4PFTA 3MYUA 4DDDA 2P3NA 4WKMA 1OQHA 1AH5A 4ESWA 3HHFA 5IZ1A 4RA1A 4JDFA 2RCAA 2BJJX 3PGFA 1P1OA 2I0CA 2LAOA 3B6QA 5DVJA 5H8QA 4OVRA 3N26A 5H8QB 4RXLA 1JVYA 3M8UA 4NWDA 3O6IA 1TFDA 4HS7A 1MY2A 2O84X 4GXAA 3GLBA 4YKJA 1BTJA 2Y84A 4OVSA 1LBBA 1QUIA 3RTFB 1MQDA 3DELB 3WAEA 5EHSA 1KZ8A 2O69A 1A54A 2DSFA 4P8BA 4FEBA 1KWHA 3QAXA 4BDLA 1NV4A 4IGTA 3LC8A 3VLVA 4IO7A 1K9YA 2PFYA 3C34A 3MAMA 3FJMA 4F3SA 1G0IA 2CZIA 4BDNA 3UORA 2X7PA 3AXFA 3K02A 3PV0E 4EXLA 1WVJA 2QRYA 4OFLA 4HCWA 1LAHE 2O7IA 1YXIA 1L5TA 3Q29A 4GD5A 1H76A 1N76A 1P99A 5I7IA 1NKXA 4OEVA 2AL5A 4QFNA 1PC3A 4U4XA 5I56A 3ILUB 4IO5A 4U23A 3EHSA 4KHZE 1B40A 1MXYA 1OQGA 3S9LC 2CEXA 4OEUA 5FHNA 3N5LA 4DI3D 3H3GA 1YAEA 4NMYA 2RKMA 2NXOA 1P1QA 4PFYA 5TPAA 1MY4A 5CM6A 2RINA 1DOTA 5TPAB 2VGQA 3NOHA 5IGAA 2G29A 4JBZA 1BIYA 5IKBA 2VD3A 1FPBA 1LLSA 4ISUA 2GQ1A 1N84A 3RPLA 1IXHA 4KD5A 4O3AA 4N4UA 4NE4A 4RYAA 4K3FA 4KYEA 3FJGA 3GBBA 1MPDA 3QIMA 4NWCA 5FHMA 3LSLA 2RC9A 3OXNA 3QXMA 4QSCA 5AA1A 1PB7A 4FATA 1QULA 4E0XA 2RC7A 3B8BA 1OVBA 1EU8A 5CI5A 1USYE 4RPOA 3OO7A 2GRVA 5KCJA 2WYKA 4PDDA 3T9UA 2VHAA 4GWSA 3M3LA 4PBQA 4IO2A 4NN3A 3O6HA 3FVGA 1DTZA 2DP8A 4KYDA 2W7YA 4TQUQ 3E79A 1DK4A 4ZEFA 4YKIA 5CBRA 4ELOA 2DWIA 2CZKA 4H6DA 4KXPA 1MH3A 3TQLA 1LFHA 1MH4A 2XXWA 3IFCA 1SI1A 3THIA 1MQGA 3RUMA 1FPJA 1Y3PA 4GVOA 4X48A 4U2RA 4U1OA 2MKZA 4H1XA 1N04A 1FTAA 1UTBB 1I69A 3CG3A 2FYIA 2XA5A 5L9OA 3OO9A 4YMAA 4GF8A 2F8DA 3TYHA 3FVKA 1IUDA 3PUVE 4GL8A 3ECRA 2V84A 4PE5B 2Z8EA 3O66A 1QVSA 1NUWA 1Q1KA 2XX8A 3O28A 1LEVA 4R9GA 4FAJA 1Y9UA 3BIHA 3BFUA 3E13X 3BFTA 1VDWA 4XKPA 4H46A 4OVTA 3N94A 1CB6A 1FSAA 1LB8A 3OO6A 1FBEA 3TCFA 2ZYMA 4HW8A 3KC1A 3KGCA 1FTLA 2ZYKA 4N91A 3KJ7A 4H0WA 3VXBA 2F36A 3EQ1A 1A8FA 4F1UA 2GHAA 4H5FA 5H8HB 3TTNA 4ESXA 3RPWA 3FJ7A 3HCQA 2QJEA 4TLMB 5BUUA 4KI0E 3MBPA 1DPEA 4OETA 1P1WA 4I40A 5FTHA 1LSTA 5M2VA 4OFOA 3SEYA 1USYH 1B0HA 4YZZA 1P1NA 2OLBA 2HPGA 4HE0A 4R6YA 1FQCA 3Q27A 4PGPA 4JVIA 1SBPA 2Y7WA 3QUJA 1B3EA 1MY3A 1MXZA 1DTGA 1FRPA 2G93A 3IL1B 5DTBA 1IMCA 4P1EA 2XXVA 2I4CA 2P0SA 2RCBA 2VP1A 4X04A 5J16A 4OESA 1B7UA 5CMBA 4I62A 3ZS6A 4GXSB 2UVHA 1FBGA 4F22A 1NNPA 1SDXA 3UGWA 1VE4A 1B58A 1YPNA 1B5IA 5I2KA 2DE4A 1B3HA 5I2KB 4XKRA 2ZXTA 4GWZA 2Q9TA 1IMBA 3T66A 3IO4A 5AA2B 4OQOA 4LATA 1YZ0A 2PYYA 2Z8FA 3FVOA 1FQEA 1NUZA 5CBSA 4R6HA 2FHYA 4YKKA 3CSGA 3T9XB 4MCOA 3T1BA 4E0WA 2CZHA 4PE3A 3MVZA 3CI8A 3WAFA 2H25A 2B3FA 3MWBA 1N7WA 5ITOA 4U1ZA 3CFLA 3FXBA 5DVFA 3IOTA 4LZ5A 3C36A 4I9DA 3USDA 3LSFB 2KLFA 3QK6A 4U4SA
chains in the Genus database with same CATH topology
2Z8DA 1SD3A 3VLUA 3FATA 4GIZA 4PQJA 4FEDA 4ZE9A 1D4NA 1LAXA 4QFPA 4OMBA 2DOJA 4JWXA 5HM4B 4IO4A 3Q28A 2FNCA 2F7CA 3OMBA 4ZE8A 1UTHA 1Y3QA 1UTHB 1H43A 1MXWA 3HHGA 3Q25A 3T96B 2DWAA 2I3VA 3HV1A 3LBSA 4NF8B 2ZNSA 3ZKKA 1SVXB 1Y1ZA 2X26A 1GGGA 3JZJA 4F19A 3IX1A 1FW0A 2HEUA 1WODA 3OEKA 5CMKA 4QSEA 2P1SA 4P11A 4UACA 1PB8A 3MZ1A 5B70A 1HSEA 2H98A 3I6VA 4R9FA 4ND9A 4UA8A 1URDA 4MBPA 1LAFE 1PEBA 2XX9A 2GH9A 3MP1A 3PPQA 2QS1A 4G8HA 2HFBA 3RY3A 1PBPA 1VR5A 4OWDA 4EDPA 4M4GA 5AA4A 1YTVA 5AA4B 4ZECA 3TAJA 2QS2A 1GTKA 1B7HA 2HAVA 2I4BA 2PT2A 3SESA 2XD2A 3R6UA 1XC1A 1Q35A 2OK2A 2VOZA 4F29A 5ELVA 1N3XA 3TZAA 3OSRA 4R74A 3U94A 1QW0A 3IO6A 3E3KA 2Q88A 3K1MA 4ECFA 2FA7A 3D4GA 3JV9A 4DXCA 5CMCA 4JB7A 3DP6A 3K6XA 3A09A 3VXCA 1B0LA 5F1QA 4PP0A 5I84A 1ZLQA 2QS3A 5L9SA 1LGBC 4PETA 3T9HB 4RNSA 1FQFA 2PVUA 2Q89A 3SKPA 3CR9A 3FZVA 1OVTA 3KJTA 4R73A 3FGSA 4IO6A 3KN7A 1TT1A 2IA4A 3DP8A 1S9TA 2OZZA 1FQBA 1LCTA 1B2HA 2PX1A 2PT1A 2XD3A 4LZ7A 2IEEA 1SW1A 4KFQA 2AIXA 4DLDA 4RK2A 3KSJA 1VFEA 3RQTA 5AA3A 3CFXA 2REGA 3K0VA 4MLVA 4G8NA 1JW5A 4TOZA 3RGYA 3MZ9A 4WEPA 1JETA 4YB5A 3V83A 2REJA 4POXA 4ZEDA 3TFLA 4JSOA 1MQJA 1QUKA 2ZNTA 2DYXA 4YB6A 3IJOB 5A5XB 1MQHA 1JNFA 3DM0A 3G3HA 3U1OA 1QKAA 4HTGA 4N13A 1B3GA 1POY1 4KCCA 1QUJA 3IAZA 1H44A 3IOWA 3HSTA 1B1XA 3TPAA 3PPRA 3IB1A 4G8MA 3FXRA 3OELA 4DIGA 3JYRA 4F3BA 1NH8A 2WKYA 3C32A 4L17A 3FXQA 2D3IA 3N6TA 4XIGQ 3U93A 1CE2A 4O3CA 4EQBA 1MY1A 3H03A 3OEMA 3RLFE 1LAGE 1ZU0A 1NNKA 4OZ9A 4QF9A 4QSDA 4O3BA 3TUSA 3K6VA 2CZLA 5K2YA 4QHQA 1UTBA 4JWOA 1D3KA 1URSA 1SYHA 3L6GA 3LR1A 5KZTA 2XXQA 1B4ZA 1OLCA 1BKAA 1JEVA 2XXRA 3IORA 3HO7A 4EXKA 1ATGA 1UQWA 1O7TA 3TQWA 3FUZA 5ISUA 3MVYA 3Q26A 4G4PA 1DPPA 4IO3A 3VDFA 4DZ1A 1ZJLA 1JW4A 4PFUA 1B3LA 4LVQA 1FTJA 2Q8JA 1FTKA 2UXAA 1NNTA 4BLAA 3ONMA 3IJXB 1MXXA 3SERA 5JEIA 4IB2A 5H8HA 3I3VA 2ZYNA 3ZKLA 5H8SA 1I6AA 3S9NC 5DEXA 5DEXB 2I58A 3PUXE 3S4UA 2OCUA 3EHUA 2CMOA 4WXJA 3IB2A 3TELA 4C1TA 3TEPA 2NUVA 4KYSA 3TTLA 1OMPA 3IOVA 2R71A 3FV2A 4C0RA 4ZS9A 2ZYOA 3FASA 3PUZE 4FIMA 4I8CA 2DWHA 2Q2AA 1MPBA 1MPCA 3CSBA 4TLLB 1JQFA 5LOMA 4F1VA 2I48A 1IITA 3W9VA 3DP4A 3F11A 1NH7A 1XHYA 2E0SA 4LUBA 4POWA 5TU0A 4JSDA 4R6KA 1HSLA 3MZBA 2R9JA 2UYEA 4H8IA 3S9MC 1TWYA 4OHNA 3K4UA 2PBWA 4IY6A 5AA2A 3MPKA 4OVJA 3FIRA 4ZZEA 4DXUA 2DE3A 2B65A 2I3WA 2HAUA 3SEWA 1I6QA 4ZDMA 3UIFA 3A3CA 4X1DA 5K2XA 4XKQA 1MY0A 3MP6A 3C9HA 4BDOA 4ZZAA 1B32A 1M5CA 2Y7RA 3OO8A 3O9PA 4YMBA 1JVXA 4QFLA 4KCDA 1RYOA 4U22A 4AQ4A 3B6TA 3M3KA 3SEUA 3H7MA 3T93B 3K01A 1FCKA 4Z0IA 1XVXA 1P1UA 4LP2B 5I59A 5KDTA 3MQ9A 5I59B 5KDTB 1D9YA 1EH3A 3O2AA 3KG2A 3O29A 5EYFA 2DQVA 4GLIA 4XTCQ 4FECA 2O68A 4F2OA 4NF5A 3VV5A 4NF5B 2ABHA 4F31B 1JEUA 4MF3A 1H3DA 3TKDA 2I49A 2YPNA 4M1VA 1AOVA 3LSWA 3L6HA 4EQ7A 3PD9A 4FE8A 2HXWA 5HPQA 5DYHA 5J1DA 4DE8A 1TFAA 2HQ0A 2V3UA 4NF8A 3OOAA 2DVCA 1MDQA 4FJPA 3G3KA 4DXBA 1XOCA 5I2NA 2XXPA 2ONKE 3RT8A 2O7UA 5I2NB 1B51A 4ONYA 4LQ5A 1IZ1A 1WDNA 3VVEA 4NF6A 4QFKA 5JTYA 1NL5A 4NF6B 5JTYB 4F3GA 3K2DA 1Y3NA 2Y7PA 5EHMA 2QMWA 3FXUA 4XKNA 4NF4A 4GFRA 1IXGA 1F9BA 3KZGA 4NF4B 1BP5A 4RPNA 1ZMGA 1A99A 3KEIA 1Y20A 3TMGA 1N0TA 3K6UA 4G68C 3BKIB 3V8XB 2OBGA 1VSOA 5HBCA 3O97A 3G7WA 3H6UA 2V3TA 3HN0A 1HSJA 1Z7ME 2F34A 2I6EA 2H9BA 1OLAA 3K1NA 1MM7A 3R7XA 4G68B 2ESNA 5DT6A 4F1YA 4QRZA 3C33A 4GQOA 2NOOA 3GZGA 1SW4A 4QFOA 1H45A 1OIBA 1A8EA 3KBRA 3IR1A 1ZIUA 3U8QA 3H6WA 3VFJA 1B9JA 1SW2A 1O64A 5I58A 2F5XA 5I58B 3QSLA 2YJPA 2F6PA 2F7AA 4F2QA 1YCJA 3KN8A 3EF7A 1RKMA 4X9TA 3CVGA 4R75A 1JW1A 1M5FA 3MPLA 1LCFA 4GL0A 4LONB 1MDP1 4N07A 1I6BA 5B7DA 3ZSFA 4F39A 3VVFA 3PPPA 4FORA 1EZOA 2V3QA 1ANFA 1URGA 3I5OA 1UIUA 4KPTA 1R9LA 4KQPA 4Q0CA 3CFZA 2XXYA 2I0BA 4ELRA 1PBQA 3PUYE 2XX7A 2D5WA 3SETA 4ZEIA 2NWJA 1B3FA 4R72A 1XS5A 4BDQA 4C1UA 2D21A 5A5XA 2OWTA 3SEVA 2ZNUA 3HPIA 5I56B 1B5HA 5CMMA 3PD8A 3RN8A 2A5SA 2H99A 1B6HA 1B7ZA 2B3BA 4P0IA 2DS9A 3K6WA 1FTMA 1NMUA 3B7DA 4ZEBA 3MW0A 4P0GA 3D4CA 1S50A 1US4A 3C31A 1B4HA 4OXVA 1POTA 1D9VA 2F6GA 3C4MA 1FQDA 3TDJA 4DCYA 4JXIA 4H8JA 4Q30B 1B05A 1MXUA 2HZKA 2THIA 3RNNA 4Q5TA 1IXCA 2XXHA 1IQ7A 4G77A 3TODA 3EPEA 4EUOA 1PDAA 3CG1A 2PMSA 2GFEA 4OFJA 3K00A 4IGRA 4YAHX 5KCJB 3PPOA 3B6WA 2DVZA 2F97A 1M5EA 3MP8A 1LFGA 4ELPA 1LFIA 3LSXA 4H5GA 3VLWA 3C35A 1SYIA 1RYXA 2XXUA 3PU5A 5ITPA 2ANJA 2UVJA 2V25A 2AL4A 3SEXA 2XXXA 1SW5A 1ELJA 2ZMBA 5F7VA 5AA2D 1SQYA 3PPNA 2DXYA 3IB0A 3KOTA 1EZ9A 1IEJA 3TCHA 5AE4A 2P2AA 3MJNA 3TTRA 3A3UA 1FQAA 3CRBA 3PMWA 4YB7A 4GOTA 4ELQA 3S9EA 4I1DA 4RK9A 4XXUA 1QJMA 3TTKA 3VE1B 4NTLA 3IOUA 2VD2A 2ALUA 1R9QA 1Y1MA 3G3FA 1NFTA 1MM6A 2XXTA 4OYVA 1GR2A 3LUYA 1GV8A 1Y4CA 4X1BA 3TTMA 1A7LA 3R26A 2OWSA 2QS4A 3G3JA 1J1NA 5H8NA 3IK6B 3G3IA 5H8NB 4JWYA 1R6ZA 2ONRA 3UA8A 2OJTA 4BDMA 3EHTA 5TP9A 5TP9B 4OERA 3W15C 4RJZA 1UIVA 3H6TA 4IY5A 4OENA 2XHDA 4LQ2A 2NVUB 3RTWB 1M5DA 1EZPA 1LB9A 1A40A 2UVIA 3KSXA 4EQ9A 2HCAA 1TXFA 3CIJA 3QYTA 3E9XA 5CC2A 1N3WA 4Q8RA 4Z7EA 5FHOA 2Z22A 2DE2A 3GXAA 4WEDA 1SI0A 2XXIA 3BBRA 4H65A 5ICTA 2Z23A 1B5JA 1QKBA 3P7IA 3VVDA 4AB6A 3UN6A 2DWJA 1ZTYA 1IXIA 1MRPA 1R1NA 1IIWA 1BLFA 3E4RA 3PUWE 4ZEKA 4U21A 3T9VA 1ZBMA 4THIA 2O1LA 1A55A 5JK4A 3H06B 3TCGA 3PMVA 1DSNA 4YKPA 3KOSA 1N7XA 1AIVA 5IAIA 3FV1A 4NEDA 1PB9A 4GWOA 3V5AA 5CRYA 3KFMA 3MVXA 4KR5A 3DLNA 4R2FA 2Q2CA 4DCXA 3U92A 3OENA 3N6UA 1LBCA 4EF2A 5L9MA 4H67A 2R6GE 3SDFA 4G2ZA 4OTEA 2UYFA 2GHBA 2QPQA 3H6VA 4R2BA 4MLQA 3V89B 2V93A 2F35A 2Y7IA 4LA9A 2O6AA 1Z7NE 1NNFA 1O63A 2DXRA 3O6GA 4LZ8A 3KN3A 2H4IA 2UVGA 5L8DA 1XVYA 5ICQA 4N6PA 3OD7A 1MQIA 2E1SA 3W9WA 4BDRA 4YICA 1II5A 4EF1A 3OSQA 2H5YA 2RC8A 4YU0A 2X7QA 1AMFA 3UP9A 4PFWA 2HZLA 2QMXA 3RT6B 3MC2A 3GBAA 1B1HA 4F3PA 2RF1A 2YLNA 5I57A 5I57B 4MH5A 2F78A 1MXVA 1DMBA 3PMXA 1GVCA 2ONSA 3U72A 3QUFA 3MUQA 3S2VA 1MS7A 1M5BA 1FTOA 1B52A 1ZKBA 2QL3A 1MG1A 3ODBA 1US5A 3FD3A 5DVIA 1T0KA 2QSXA 4F18A 3UK4A 1XT8A 4RY1A 5BWJA 1AL3A 2Y7KA 4G68A 3FVNA 1Y4TA 1S7YA 2A5TA 3G3GA 2A5TB 4HCYA 3EN3A 3MVWA 1VFDA 3H4ZA 3M3FA 5FTIA 1B46A 4AB5A 2O1MA 2O51A 3K1PA 3T22A 4GRKA 5H8FA 5H8FB 2AYSA 4MFIA 2F7BA 2M8CA 3ILTB 4PFTA 4DDDA 4WKMA 1OQHA 1AH5A 4ESWA 3HHFA 4RA1A 4JDFA 2RCAA 2BJJX 3PGFA 1P1OA 2I0CA 2LAOA 3B6QA 5DVJA 5H8QA 3N26A 5H8QB 4RXLA 1JVYA 3M8UA 4NWDA 3O6IA 1TFDA 4HS7A 1MY2A 2O84X 4GXAA 3GLBA 4YKJA 1BTJA 2Y84A 1LBBA 1QUIA 3RTFB 1MQDA 3DELB 3WAEA 5EHSA 2O69A 1A54A 2DSFA 4FEBA 1KWHA 3QAXA 4BDLA 4IGTA 3LC8A 3VLVA 4IO7A 3C34A 3MAMA 3FJMA 4F3SA 4BDNA 3UORA 2X7PA 3AXFA 3K02A 3PV0E 4EXLA 1WVJA 2QRYA 4OFLA 4HCWA 1LAHE 2O7IA 1L5TA 3Q29A 4GD5A 1H76A 1N76A 1P99A 1NKXA 4OEVA 2AL5A 4QFNA 1PC3A 4U4XA 5I56A 3ILUB 4IO5A 4U23A 3EHSA 4KHZE 1B40A 1MXYA 1OQGA 3S9LC 4OEUA 5FHNA 3N5LA 3H3GA 1YAEA 4NMYA 2RKMA 2NXOA 1P1QA 4PFYA 5TPAA 1MY4A 5CM6A 2RINA 1DOTA 5TPAB 2VGQA 2G29A 4JBZA 1BIYA 5IKBA 2VD3A 1LLSA 4ISUA 1N84A 1IXHA 4KD5A 4O3AA 4NE4A 4RYAA 4K3FA 4KYEA 3FJGA 3GBBA 1MPDA 3QIMA 4NWCA 5FHMA 3LSLA 2RC9A 3OXNA 3QXMA 4QSCA 5AA1A 1PB7A 4FATA 1QULA 4E0XA 2RC7A 1OVBA 1EU8A 5CI5A 1USYE 4RPOA 3OO7A 2GRVA 5KCJA 3T9UA 2VHAA 3M3LA 4IO2A 3O6HA 3FVGA 1DTZA 2DP8A 4KYDA 2W7YA 4TQUQ 4ZEFA 4YKIA 5CBRA 4ELOA 2DWIA 4H6DA 1MH3A 3TQLA 1LFHA 1MH4A 2XXWA 1SI1A 3THIA 1MQGA 3RUMA 1Y3PA 4GVOA 4X48A 4U2RA 4U1OA 4H1XA 1N04A 1UTBB 1I69A 3CG3A 2FYIA 5L9OA 3OO9A 4YMAA 4GF8A 2F8DA 3TYHA 3FVKA 1IUDA 3PUVE 4GL8A 3ECRA 2V84A 4PE5B 2Z8EA 3O66A 1QVSA 1Q1KA 2XX8A 3O28A 4R9GA 4FAJA 1Y9UA 3BFUA 3E13X 3BFTA 4XKPA 3N94A 1CB6A 1LB8A 3OO6A 3TCFA 2ZYMA 4HW8A 3KGCA 1FTLA 2ZYKA 3KJ7A 4H0WA 3VXBA 2F36A 3EQ1A 1A8FA 4F1UA 2GHAA 4ESXA 4H5FA 5H8HB 3TTNA 3RPWA 3FJ7A 3HCQA 2QJEA 4TLMB 5BUUA 4KI0E 3MBPA 1DPEA 4OETA 1P1WA 5FTHA 1LSTA 5M2VA 4OFOA 3SEYA 1USYH 1B0HA 4YZZA 1P1NA 2OLBA 4R6YA 1FQCA 3Q27A 1SBPA 2Y7WA 3QUJA 1B3EA 1MY3A 1MXZA 1DTGA 5DTBA 2G93A 3IL1B 2XXVA 2I4CA 2P0SA 2RCBA 2VP1A 4OESA 1B7UA 5CMBA 4I62A 3ZS6A 4GXSB 2UVHA 4F22A 1NNPA 1SDXA 3UGWA 1VE4A 1B58A 1YPNA 1B5IA 5I2KA 2DE4A 1B3HA 5I2KB 4XKRA 2ZXTA 2Q9TA 3T66A 3IO4A 5AA2B 4OQOA 4LATA 2PYYA 2Z8FA 3FVOA 1FQEA 5CBSA 4R6HA 4YKKA 3CSGA 3T9XB 4E0WA 3MVZA 3CI8A 3WAFA 2H25A 2B3FA 3MWBA 1N7WA 5ITOA 4U1ZA 3CFLA 5DVFA 3IOTA 4LZ5A 3C36A 4I9DA 3USDA 3LSFB 2KLFA 3QK6A 4U4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8D A;  1SD3 A;  3VLU A;  3FAT A;  4GIZ A;  4PQJ A;  4FED A;  4ZE9 A;  1D4N A;  1LAX A;  4QFP A;  4OMB A;  2DOJ A;  4JWX A;  5HM4 B;  4IO4 A;  3Q28 A;  2FNC A;  2F7C A;  3OMB A;  4ZE8 A;  1UTH A;  1Y3Q A;  1UTH B;  1H43 A;  1MXW A;  3HHG A;  3Q25 A;  3T96 B;  2DWA A;  2I3V A;  3HV1 A;  3LBS A;  4NF8 B;  2ZNS A;  3ZKK A;  1SVX B;  1Y1Z A;  2X26 A;  1GGG A;  3JZJ A;  4F19 A;  3IX1 A;  1FW0 A;  2HEU A;  1WOD A;  3OEK A;  5CMK A;  4QSE A;  2P1S A;  4P11 A;  4UAC A;  1PB8 A;  3MZ1 A;  5B70 A;  1HSE A;  2H98 A;  3I6V A;  4R9F A;  4ND9 A;  4UA8 A;  1URD A;  4MBP A;  1LAF E;  1PEB A;  2XX9 A;  2GH9 A;  3MP1 A;  3PPQ A;  2QS1 A;  4G8H A;  2HFB A;  3RY3 A;  1PBP A;  1VR5 A;  4OWD A;  4EDP A;  4M4G A;  5AA4 A;  1YTV A;  5AA4 B;  4ZEC A;  3TAJ A;  2QS2 A;  1GTK A;  1B7H A;  2HAV A;  2I4B A;  2PT2 A;  3SES A;  2XD2 A;  3R6U A;  1XC1 A;  1Q35 A;  2OK2 A;  2VOZ A;  4F29 A;  5ELV A;  1N3X A;  3TZA A;  3OSR A;  4R74 A;  3U94 A;  1QW0 A;  3IO6 A;  3E3K A;  2Q88 A;  3K1M A;  4ECF A;  2FA7 A;  3D4G A;  3JV9 A;  4DXC A;  5CMC A;  4JB7 A;  3DP6 A;  3K6X A;  3A09 A;  3VXC A;  1B0L A;  5F1Q A;  4PP0 A;  5I84 A;  1ZLQ A;  2QS3 A;  5L9S A;  1LGB C;  4PET A;  3T9H B;  4RNS A;  1FQF A;  2PVU A;  2Q89 A;  3SKP A;  3CR9 A;  3FZV A;  1OVT A;  3KJT A;  4R73 A;  3FGS A;  4IO6 A;  3KN7 A;  1TT1 A;  2IA4 A;  3DP8 A;  1S9T A;  2OZZ A;  1FQB A;  1LCT A;  1B2H A;  2PX1 A;  2PT1 A;  2XD3 A;  4LZ7 A;  2IEE A;  1SW1 A;  4KFQ A;  2AIX A;  4DLD A;  4RK2 A;  3KSJ A;  1VFE A;  3RQT A;  5AA3 A;  3CFX A;  2REG A;  3K0V A;  4MLV A;  4G8N A;  1JW5 A;  4TOZ A;  3RGY A;  3MZ9 A;  4WEP A;  1JET A;  4YB5 A;  3V83 A;  2REJ A;  4POX A;  4ZED A;  3TFL A;  4JSO A;  1MQJ A;  1QUK A;  2ZNT A;  2DYX A;  4YB6 A;  3IJO B;  5A5X B;  1MQH A;  1JNF A;  3DM0 A;  3G3H A;  3U1O A;  1QKA A;  4HTG A;  4N13 A;  1B3G A;  1POY 1;  4KCC A;  1QUJ A;  3IAZ A;  1H44 A;  3IOW A;  3HST A;  1B1X A;  3TPA A;  3PPR A;  3IB1 A;  4G8M A;  3FXR A;  3OEL A;  4DIG A;  3JYR A;  4F3B A;  1NH8 A;  2WKY A;  3C32 A;  4L17 A;  3FXQ A;  2D3I A;  3N6T A;  4XIG Q;  3U93 A;  1CE2 A;  4O3C A;  4EQB A;  1MY1 A;  3H03 A;  3OEM A;  3RLF E;  1LAG E;  1ZU0 A;  1NNK A;  4OZ9 A;  4QF9 A;  4QSD A;  4O3B A;  3TUS A;  3K6V A;  2CZL A;  5K2Y A;  4QHQ A;  1UTB A;  4JWO A;  1D3K A;  1URS A;  1SYH A;  3L6G A;  3LR1 A;  5KZT A;  2XXQ A;  1B4Z A;  1OLC A;  1BKA A;  1JEV A;  2XXR A;  3IOR A;  3HO7 A;  4EXK A;  1ATG A;  1UQW A;  1O7T A;  3TQW A;  3FUZ A;  5ISU A;  3MVY A;  3Q26 A;  4G4P A;  1DPP A;  4IO3 A;  3VDF A;  4DZ1 A;  1ZJL A;  1JW4 A;  4PFU A;  1B3L A;  4LVQ A;  1FTJ A;  2Q8J A;  1FTK A;  2UXA A;  1NNT A;  4BLA A;  3ONM A;  3IJX B;  1MXX A;  3SER A;  5JEI A;  4IB2 A;  5H8H A;  3I3V A;  2ZYN A;  3ZKL A;  5H8S A;  1I6A A;  3S9N C;  5DEX A;  5DEX B;  2I58 A;  3PUX E;  3S4U A;  2OCU A;  3EHU A;  2CMO A;  4WXJ A;  3IB2 A;  3TEL A;  4C1T A;  3TEP A;  2NUV A;  4KYS A;  3TTL A;  1OMP A;  3IOV A;  2R71 A;  3FV2 A;  4C0R A;  4ZS9 A;  2ZYO A;  3FAS A;  3PUZ E;  4FIM A;  4I8C A;  2DWH A;  2Q2A A;  1MPB A;  1MPC A;  3CSB A;  4TLL B;  1JQF A;  5LOM A;  4F1V A;  2I48 A;  1IIT A;  3W9V A;  3DP4 A;  3F11 A;  1NH7 A;  1XHY A;  2E0S A;  4LUB A;  4POW A;  5TU0 A;  4JSD A;  4R6K A;  1HSL A;  3MZB A;  2R9J A;  2UYE A;  4H8I A;  3S9M C;  1TWY A;  4OHN A;  3K4U A;  2PBW A;  4IY6 A;  5AA2 A;  3MPK A;  4OVJ A;  3FIR A;  4ZZE A;  4DXU A;  2DE3 A;  2B65 A;  2I3W A;  2HAU A;  3SEW A;  1I6Q A;  4ZDM A;  3UIF A;  3A3C A;  4X1D A;  5K2X A;  4XKQ A;  1MY0 A;  3MP6 A;  3C9H A;  4BDO A;  4ZZA A;  1B32 A;  1M5C A;  2Y7R A;  3OO8 A;  3O9P A;  4YMB A;  1JVX A;  4QFL A;  4KCD A;  1RYO A;  4U22 A;  4AQ4 A;  3B6T A;  3M3K A;  3SEU A;  3H7M A;  3T93 B;  3K01 A;  1FCK A;  4Z0I A;  1XVX A;  1P1U A;  4LP2 B;  5I59 A;  5KDT A;  3MQ9 A;  5I59 B;  5KDT B;  1D9Y A;  1EH3 A;  3O2A A;  3KG2 A;  3O29 A;  5EYF A;  2DQV A;  4GLI A;  4XTC Q;  4FEC A;  2O68 A;  4F2O A;  4NF5 A;  3VV5 A;  4NF5 B;  2ABH A;  4F31 B;  1JEU A;  4MF3 A;  1H3D A;  3TKD A;  2I49 A;  2YPN A;  4M1V A;  1AOV A;  3LSW A;  3L6H A;  4EQ7 A;  3PD9 A;  4FE8 A;  2HXW A;  5HPQ A;  5DYH A;  5J1D A;  4DE8 A;  1TFA A;  2HQ0 A;  2V3U A;  4NF8 A;  3OOA A;  2DVC A;  1MDQ A;  4FJP A;  3G3K A;  4DXB A;  1XOC A;  5I2N A;  2XXP A;  2ONK E;  3RT8 A;  2O7U A;  5I2N B;  1B51 A;  4ONY A;  4LQ5 A;  1IZ1 A;  1WDN A;  3VVE A;  4NF6 A;  4QFK A;  5JTY A;  1NL5 A;  4NF6 B;  5JTY B;  4F3G A;  3K2D A;  1Y3N A;  2Y7P A;  5EHM A;  2QMW A;  3FXU A;  4XKN A;  4NF4 A;  4GFR A;  1IXG A;  1F9B A;  3KZG A;  4NF4 B;  1BP5 A;  4RPN A;  1ZMG A;  1A99 A;  3KEI A;  1Y20 A;  3TMG A;  1N0T A;  3K6U A;  4G68 C;  3BKI B;  3V8X B;  2OBG A;  1VSO A;  5HBC A;  3O97 A;  3G7W A;  3H6U A;  2V3T A;  3HN0 A;  1HSJ A;  1Z7M E;  2F34 A;  2I6E A;  2H9B A;  1OLA A;  3K1N A;  1MM7 A;  3R7X A;  4G68 B;  2ESN A;  5DT6 A;  4F1Y A;  4QRZ A;  3C33 A;  4GQO A;  2NOO A;  3GZG A;  1SW4 A;  4QFO A;  1H45 A;  1OIB A;  1A8E A;  3KBR A;  3IR1 A;  1ZIU A;  3U8Q A;  3H6W A;  3VFJ A;  1B9J A;  1SW2 A;  1O64 A;  5I58 A;  2F5X A;  5I58 B;  3QSL A;  2YJP A;  2F6P A;  2F7A A;  4F2Q A;  1YCJ A;  3KN8 A;  3EF7 A;  1RKM A;  4X9T A;  3CVG A;  4R75 A;  1JW1 A;  1M5F A;  3MPL A;  1LCF A;  4GL0 A;  4LON B;  1MDP 1;  4N07 A;  1I6B A;  5B7D A;  3ZSF A;  4F39 A;  3VVF A;  3PPP A;  4FOR A;  1EZO A;  2V3Q A;  1ANF A;  1URG A;  3I5O A;  1UIU A;  4KPT A;  1R9L A;  4KQP A;  4Q0C A;  3CFZ A;  2XXY A;  2I0B A;  4ELR A;  1PBQ A;  3PUY E;  2XX7 A;  2D5W A;  3SET A;  4ZEI A;  2NWJ A;  1B3F A;  4R72 A;  1XS5 A;  4BDQ A;  4C1U A;  2D21 A;  5A5X A;  2OWT A;  3SEV A;  2ZNU A;  3HPI A;  5I56 B;  1B5H A;  5CMM A;  3PD8 A;  3RN8 A;  2A5S A;  2H99 A;  1B6H A;  1B7Z A;  2B3B A;  4P0I A;  2DS9 A;  3K6W A;  1FTM A;  1NMU A;  3B7D A;  4ZEB A;  3MW0 A;  4P0G A;  3D4C A;  1S50 A;  1US4 A;  3C31 A;  1B4H A;  4OXV A;  1POT A;  1D9V A;  2F6G A;  3C4M A;  1FQD A;  3TDJ A;  4DCY A;  4JXI A;  4H8J A;  4Q30 B;  1B05 A;  1MXU A;  2HZK A;  2THI A;  3RNN A;  4Q5T A;  1IXC A;  2XXH A;  1IQ7 A;  4G77 A;  3TOD A;  3EPE A;  4EUO A;  1PDA A;  3CG1 A;  2PMS A;  2GFE A;  4OFJ A;  3K00 A;  4IGR A;  4YAH X;  5KCJ B;  3PPO A;  3B6W A;  2DVZ A;  2F97 A;  1M5E A;  3MP8 A;  1LFG A;  4ELP A;  1LFI A;  3LSX A;  4H5G A;  3VLW A;  3C35 A;  1SYI A;  1RYX A;  2XXU A;  3PU5 A;  5ITP A;  2ANJ A;  2UVJ A;  2V25 A;  2AL4 A;  3SEX A;  2XXX A;  1SW5 A;  1ELJ A;  2ZMB A;  5F7V A;  5AA2 D;  1SQY A;  3PPN A;  2DXY A;  3IB0 A;  3KOT A;  1EZ9 A;  1IEJ A;  3TCH A;  5AE4 A;  2P2A A;  3MJN A;  3TTR A;  3A3U A;  1FQA A;  3CRB A;  3PMW A;  4YB7 A;  4GOT A;  4ELQ A;  3S9E A;  4I1D A;  4RK9 A;  4XXU A;  1QJM A;  3TTK A;  3VE1 B;  4NTL A;  3IOU A;  2VD2 A;  2ALU A;  1R9Q A;  1Y1M A;  3G3F A;  1NFT A;  1MM6 A;  2XXT A;  4OYV A;  1GR2 A;  3LUY A;  1GV8 A;  1Y4C A;  4X1B A;  3TTM A;  1A7L A;  3R26 A;  2OWS A;  2QS4 A;  3G3J A;  1J1N A;  5H8N A;  3IK6 B;  3G3I A;  5H8N B;  4JWY A;  1R6Z A;  2ONR A;  3UA8 A;  2OJT A;  4BDM A;  3EHT A;  5TP9 A;  5TP9 B;  4OER A;  3W15 C;  4RJZ A;  1UIV A;  3H6T A;  4IY5 A;  4OEN A;  2XHD A;  4LQ2 A;  2NVU B;  3RTW B;  1M5D A;  1EZP A;  1LB9 A;  1A40 A;  2UVI A;  3KSX A;  4EQ9 A;  2HCA A;  1TXF A;  3CIJ A;  3QYT A;  3E9X A;  5CC2 A;  1N3W A;  4Q8R A;  4Z7E A;  5FHO A;  2Z22 A;  2DE2 A;  3GXA A;  4WED A;  1SI0 A;  2XXI A;  3BBR A;  4H65 A;  5ICT A;  2Z23 A;  1B5J A;  1QKB A;  3P7I A;  3VVD A;  4AB6 A;  3UN6 A;  2DWJ A;  1ZTY A;  1IXI A;  1MRP A;  1R1N A;  1IIW A;  1BLF A;  3E4R A;  3PUW E;  4ZEK A;  4U21 A;  3T9V A;  1ZBM A;  4THI A;  2O1L A;  1A55 A;  5JK4 A;  3H06 B;  3TCG A;  3PMV A;  1DSN A;  4YKP A;  3KOS A;  1N7X A;  1AIV A;  5IAI A;  3FV1 A;  4NED A;  1PB9 A;  4GWO A;  3V5A A;  5CRY A;  3KFM A;  3MVX A;  4KR5 A;  3DLN A;  4R2F A;  2Q2C A;  4DCX A;  3U92 A;  3OEN A;  3N6U A;  1LBC A;  4EF2 A;  5L9M A;  4H67 A;  2R6G E;  3SDF A;  4G2Z A;  4OTE A;  2UYF A;  2GHB A;  2QPQ A;  3H6V A;  4R2B A;  4MLQ A;  3V89 B;  2V93 A;  2F35 A;  2Y7I A;  4LA9 A;  2O6A A;  1Z7N E;  1NNF A;  1O63 A;  2DXR A;  3O6G A;  4LZ8 A;  3KN3 A;  2H4I A;  2UVG A;  5L8D A;  1XVY A;  5ICQ A;  4N6P A;  3OD7 A;  1MQI A;  2E1S A;  3W9W A;  4BDR A;  4YIC A;  1II5 A;  4EF1 A;  3OSQ A;  2H5Y A;  2RC8 A;  4YU0 A;  2X7Q A;  1AMF A;  3UP9 A;  4PFW A;  2HZL A;  2QMX A;  3RT6 B;  3MC2 A;  3GBA A;  1B1H A;  4F3P A;  2RF1 A;  2YLN A;  5I57 A;  5I57 B;  4MH5 A;  2F78 A;  1MXV A;  1DMB A;  3PMX A;  1GVC A;  2ONS A;  3U72 A;  3QUF A;  3MUQ A;  3S2V A;  1MS7 A;  1M5B A;  1FTO A;  1B52 A;  1ZKB A;  2QL3 A;  1MG1 A;  3ODB A;  1US5 A;  3FD3 A;  5DVI A;  1T0K A;  2QSX A;  4F18 A;  3UK4 A;  1XT8 A;  4RY1 A;  5BWJ A;  1AL3 A;  2Y7K A;  4G68 A;  3FVN A;  1Y4T A;  1S7Y A;  2A5T A;  3G3G A;  2A5T B;  4HCY A;  3EN3 A;  3MVW A;  1VFD A;  3H4Z A;  3M3F A;  5FTI A;  1B46 A;  4AB5 A;  2O1M A;  2O51 A;  3K1P A;  3T22 A;  4GRK A;  5H8F A;  5H8F B;  2AYS A;  4MFI A;  2F7B A;  2M8C A;  3ILT B;  4PFT A;  4DDD A;  4WKM A;  1OQH A;  1AH5 A;  4ESW A;  3HHF A;  4RA1 A;  4JDF A;  2RCA A;  2BJJ X;  3PGF A;  1P1O A;  2I0C A;  2LAO A;  3B6Q A;  5DVJ A;  5H8Q A;  3N26 A;  5H8Q B;  4RXL A;  1JVY A;  3M8U A;  4NWD A;  3O6I A;  1TFD A;  4HS7 A;  1MY2 A;  2O84 X;  4GXA A;  3GLB A;  4YKJ A;  1BTJ A;  2Y84 A;  1LBB A;  1QUI A;  3RTF B;  1MQD A;  3DEL B;  3WAE A;  5EHS A;  2O69 A;  1A54 A;  2DSF A;  4FEB A;  1KWH A;  3QAX A;  4BDL A;  4IGT A;  3LC8 A;  3VLV A;  4IO7 A;  3C34 A;  3MAM A;  3FJM A;  4F3S A;  4BDN A;  3UOR A;  2X7P A;  3AXF A;  3K02 A;  3PV0 E;  4EXL A;  1WVJ A;  2QRY A;  4OFL A;  4HCW A;  1LAH E;  2O7I A;  1L5T A;  3Q29 A;  4GD5 A;  1H76 A;  1N76 A;  1P99 A;  1NKX A;  4OEV A;  2AL5 A;  4QFN A;  1PC3 A;  4U4X A;  5I56 A;  3ILU B;  4IO5 A;  4U23 A;  3EHS A;  4KHZ E;  1B40 A;  1MXY A;  1OQG A;  3S9L C;  4OEU A;  5FHN A;  3N5L A;  3H3G A;  1YAE A;  4NMY A;  2RKM A;  2NXO A;  1P1Q A;  4PFY A;  5TPA A;  1MY4 A;  5CM6 A;  2RIN A;  1DOT A;  5TPA B;  2VGQ A;  2G29 A;  4JBZ A;  1BIY A;  5IKB A;  2VD3 A;  1LLS A;  4ISU A;  1N84 A;  1IXH A;  4KD5 A;  4O3A A;  4NE4 A;  4RYA A;  4K3F A;  4KYE A;  3FJG A;  3GBB A;  1MPD A;  3QIM A;  4NWC A;  5FHM A;  3LSL A;  2RC9 A;  3OXN A;  3QXM A;  4QSC A;  5AA1 A;  1PB7 A;  4FAT A;  1QUL A;  4E0X A;  2RC7 A;  1OVB A;  1EU8 A;  5CI5 A;  1USY E;  4RPO A;  3OO7 A;  2GRV A;  5KCJ A;  3T9U A;  2VHA A;  3M3L A;  4IO2 A;  3O6H A;  3FVG A;  1DTZ A;  2DP8 A;  4KYD A;  2W7Y A;  4TQU Q;  4ZEF A;  4YKI A;  5CBR A;  4ELO A;  2DWI A;  4H6D A;  1MH3 A;  3TQL A;  1LFH A;  1MH4 A;  2XXW A;  1SI1 A;  3THI A;  1MQG A;  3RUM A;  1Y3P A;  4GVO A;  4X48 A;  4U2R A;  4U1O A;  4H1X A;  1N04 A;  1UTB B;  1I69 A;  3CG3 A;  2FYI A;  5L9O A;  3OO9 A;  4YMA A;  4GF8 A;  2F8D A;  3TYH A;  3FVK A;  1IUD A;  3PUV E;  4GL8 A;  3ECR A;  2V84 A;  4PE5 B;  2Z8E A;  3O66 A;  1QVS A;  1Q1K A;  2XX8 A;  3O28 A;  4R9G A;  4FAJ A;  1Y9U A;  3BFU A;  3E13 X;  3BFT A;  4XKP A;  3N94 A;  1CB6 A;  1LB8 A;  3OO6 A;  3TCF A;  2ZYM A;  4HW8 A;  3KGC A;  1FTL A;  2ZYK A;  3KJ7 A;  4H0W A;  3VXB A;  2F36 A;  3EQ1 A;  1A8F A;  4F1U A;  2GHA A;  4ESX A;  4H5F A;  5H8H B;  3TTN A;  3RPW A;  3FJ7 A;  3HCQ A;  2QJE A;  4TLM B;  5BUU A;  4KI0 E;  3MBP A;  1DPE A;  4OET A;  1P1W A;  5FTH A;  1LST A;  5M2V A;  4OFO A;  3SEY A;  1USY H;  1B0H A;  4YZZ A;  1P1N A;  2OLB A;  4R6Y A;  1FQC A;  3Q27 A;  1SBP A;  2Y7W A;  3QUJ A;  1B3E A;  1MY3 A;  1MXZ A;  1DTG A;  5DTB A;  2G93 A;  3IL1 B;  2XXV A;  2I4C A;  2P0S A;  2RCB A;  2VP1 A;  4OES A;  1B7U A;  5CMB A;  4I62 A;  3ZS6 A;  4GXS B;  2UVH A;  4F22 A;  1NNP A;  1SDX A;  3UGW A;  1VE4 A;  1B58 A;  1YPN A;  1B5I A;  5I2K A;  2DE4 A;  1B3H A;  5I2K B;  4XKR A;  2ZXT A;  2Q9T A;  3T66 A;  3IO4 A;  5AA2 B;  4OQO A;  4LAT A;  2PYY A;  2Z8F A;  3FVO A;  1FQE A;  5CBS A;  4R6H A;  4YKK A;  3CSG A;  3T9X B;  4E0W A;  3MVZ A;  3CI8 A;  3WAF A;  2H25 A;  2B3F A;  3MWB A;  1N7W A;  5ITO A;  4U1Z A;  3CFL A;  5DVF A;  3IOT A;  4LZ5 A;  3C36 A;  4I9D A;  3USD A;  3LSF B;  2KLF A;  3QK6 A;  4U4S A; 
#chains in the Genus database with same CATH topology
 2Z8D A;  1SD3 A;  3VLU A;  3FAT A;  4GIZ A;  4PQJ A;  4FED A;  4ZE9 A;  1D4N A;  1LAX A;  5I5P A;  5FBP A;  4QFP A;  4OMB A;  2DOJ A;  4JWX A;  3ISP A;  5HM4 B;  4N81 A;  4IO4 A;  3Q28 A;  2HXR A;  2FNC A;  2F7C A;  2B4M A;  4NX1 A;  2F3B A;  3OMB A;  4ZE8 A;  1UTH A;  2JJK A;  1Y3Q A;  1UTH B;  1H43 A;  1NV1 A;  1MXW A;  3HHG A;  3Q25 A;  2BJI A;  3T96 B;  2DWA A;  2I3V A;  3HV1 A;  3LBS A;  4NF8 B;  2ZNS A;  3ZKK A;  1SVX B;  4HE2 A;  1Y1Z A;  2X26 A;  1GGG A;  2Y5K A;  1NUY A;  3JZJ A;  4F19 A;  3IX1 A;  1FW0 A;  4O8M A;  2HEU A;  1WOD A;  3OEK A;  5CMK A;  4QSE A;  2P1S A;  4P11 A;  4UAC A;  1PB8 A;  3MZ1 A;  4QBA A;  5B70 A;  1HSE A;  2H98 A;  3I6V A;  1CNQ A;  4R9F A;  4ND9 A;  1FPD A;  4UA8 A;  1URD A;  4MBP A;  1LAF E;  1PEB A;  2XX9 A;  2GH9 A;  3MP1 A;  3PPQ A;  2QS1 A;  4G8H A;  1EYK A;  2HFB A;  3RY3 A;  1PBP A;  1VR5 A;  4OWD A;  4EDP A;  4M4G A;  5AA4 A;  1YTV A;  5AA4 B;  4ZEC A;  1SPI A;  3TAJ A;  2QS2 A;  1GTK A;  1B7H A;  2HAV A;  1Q9D A;  2I4B A;  2PT2 A;  3SES A;  1RDY A;  2XD2 A;  4PDH A;  2XWI A;  3R6U A;  1XC1 A;  1Q35 A;  2OK2 A;  2VOZ A;  4F29 A;  5ELV A;  1N3X A;  3TZA A;  3OSR A;  4R74 A;  2WX9 A;  3U94 A;  1QW0 A;  3IO6 A;  3E3K A;  4OAN A;  2Q88 A;  3K1M A;  3KBZ A;  5ET5 A;  2P3V A;  4ECF A;  4JVD A;  2FA7 A;  3D4G A;  3JV9 A;  4DXC A;  4H45 A;  5CMC A;  4JB7 A;  3DP6 A;  5IZ3 A;  3K6X A;  3A09 A;  5IZ3 B;  3VXC A;  1B0L A;  5F1Q A;  4PP0 A;  5I84 A;  1BK4 A;  1ZLQ A;  2QS3 A;  5L9S A;  1LGB C;  4PET A;  3T9H B;  4RNS A;  1FQF A;  4P1L A;  2PVU A;  2Q89 A;  2Y5L A;  3SKP A;  3CR9 A;  3FZV A;  1OVT A;  3KJT A;  4R73 A;  3FGS A;  4GX3 A;  1DBZ A;  4IO6 A;  3KN7 A;  1TT1 A;  2IA4 A;  4O7I A;  3DP8 A;  1S9T A;  2OZZ A;  1FQB A;  1LCT A;  1B2H A;  2PX1 A;  2PT1 A;  2XD3 A;  3FBP A;  4LZ7 A;  2IEE A;  1SW1 A;  4KFQ A;  2AIX A;  5F24 A;  1FJ9 A;  4GWW A;  4GBW A;  4DLD A;  4RK2 A;  3KSJ A;  1VFE A;  4AS5 A;  3RQT A;  5AA3 A;  3CFX A;  2REG A;  3K0V A;  4MLV A;  4G8N A;  1JW5 A;  4TOZ A;  3RGY A;  3MZ9 A;  1FPE A;  4WEP A;  4PFR A;  1JET A;  4YB5 A;  3V83 A;  2REJ A;  4POX A;  4ZED A;  3TFL A;  4JSO A;  1MQJ A;  2QVU A;  1QUK A;  2ZNT A;  2DYX A;  4YB6 A;  3IJO B;  5A5X B;  1MQH A;  1JNF A;  3EKI A;  3DM0 A;  2KQZ A;  4N6K A;  3G3H A;  3U1O A;  1QKA A;  4HTG A;  4N13 A;  4XF5 A;  1B3G A;  1FPF A;  1POY 1;  5IM2 A;  4KCC A;  1FBP A;  1FBC A;  1QUJ A;  3IAZ A;  1H44 A;  1K9Z A;  3IOW A;  3HST A;  1B1X A;  5ET6 A;  3TPA A;  3PPR A;  3IB1 A;  4G8M A;  3FXR A;  3OEL A;  4DIG A;  2KR0 A;  3JYR A;  4F3B A;  1NH8 A;  2WKY A;  4NAP A;  3C32 A;  1FBF A;  4L17 A;  3FXQ A;  2D3I A;  3N6T A;  4XIG Q;  3U93 A;  2ZZV A;  1CE2 A;  4O3C A;  4EQB A;  1MY1 A;  3H03 A;  3OEM A;  3RLF E;  4PAK A;  1LAG E;  1ZU0 A;  1NNK A;  4OZ9 A;  4QF9 A;  4QSD A;  4O3B A;  3TUS A;  3K6V A;  2CZL A;  5K2Y A;  4QHQ A;  1UTB A;  1FPG A;  4JWO A;  1D3K A;  1URS A;  4NHB A;  5I3S A;  1SYH A;  4PAF A;  3L6G A;  3LR1 A;  5KZT A;  2XXQ A;  2Q74 A;  1B4Z A;  1OLC A;  1BKA A;  1JEV A;  4PAI A;  2XXR A;  3IOR A;  3HO7 A;  4EXK A;  1ATG A;  1UQW A;  1O7T A;  1FPL A;  3TQW A;  3FUZ A;  3MST A;  1FBH A;  3IFA A;  5ISU A;  3MVY A;  3Q26 A;  4G4P A;  1DPP A;  4IO3 A;  3VDF A;  2L5V A;  4DZ1 A;  1ZJL A;  1JW4 A;  4PFU A;  1B3L A;  2FBP A;  4LVQ A;  1FTJ A;  2Q8J A;  1FTK A;  2UXA A;  1NNT A;  4PC9 A;  4BLA A;  3ONM A;  3IJX B;  2WBD A;  1NV0 A;  1MXX A;  3SER A;  5JEI A;  4IB2 A;  5H8H A;  3I3V A;  2ZYN A;  3ZKL A;  5H8S A;  2HHM A;  1I6A A;  3S9N C;  5DEX A;  5DEX B;  2I58 A;  3PUX E;  3S4U A;  2OCU A;  3EHU A;  2CMO A;  4WXJ A;  1IMA A;  3IB2 A;  3TEL A;  4C1T A;  3TEP A;  2NUV A;  4PF6 A;  4MMP A;  4KYS A;  3TTL A;  1OMP A;  3IOV A;  2R71 A;  4P3L A;  3FV2 A;  4C0R A;  4N17 A;  2ZYO A;  3FAS A;  4ZS9 A;  3U65 A;  3PUZ E;  4FIM A;  4I8C A;  2DWH A;  2Q2A A;  1MPB A;  1MPC A;  3CSB A;  4TLL B;  1JQF A;  2ZZW A;  5LOM A;  4MEV A;  4PGN A;  4F1V A;  2I48 A;  1IIT A;  2OX3 A;  3W9V A;  3DP4 A;  3GYY A;  2PFZ A;  1NV2 A;  3F11 A;  1NH7 A;  1XHY A;  2E0S A;  4LUB A;  4POW A;  4NQ8 A;  5TU0 A;  4JSD A;  4R6K A;  1HSL A;  3MZB A;  2R9J A;  2UYE A;  4H8I A;  3S9M C;  1TWY A;  4OHN A;  3K4U A;  2PBW A;  4IY6 A;  5AA2 A;  3MPK A;  4OVJ A;  3FIR A;  4ZZE A;  5EQA A;  4DXU A;  2DE3 A;  2B65 A;  4JVC A;  2I3W A;  2HAU A;  3SEW A;  1I6Q A;  4ZDM A;  3UIF A;  3A3C A;  4X1D A;  5K2X A;  4XKQ A;  4AS4 A;  1MY0 A;  4QXD A;  2V4C A;  3MP6 A;  3C9H A;  4XEQ A;  4BDO A;  4ZZA A;  4N15 A;  5A5L A;  1B32 A;  1M5C A;  2Y7R A;  3OO8 A;  3O9P A;  4YMB A;  1FBD A;  1JVX A;  4MNP A;  4QFL A;  3T0J A;  4KCD A;  1RYO A;  4U22 A;  4AQ4 A;  3B6T A;  3M3K A;  3BIG A;  3SEU A;  3H7M A;  4N8G A;  3T93 B;  3K01 A;  1FCK A;  4Z0I A;  1XVX A;  1P1U A;  4LP2 B;  5I59 A;  5KDT A;  5EQ8 A;  3MQ9 A;  5I59 B;  5KDT B;  1D9Y A;  4PTK A;  1EH3 A;  3O2A A;  3KG2 A;  3O29 A;  5EYF A;  1XI6 A;  2DQV A;  4MAG A;  1NV3 A;  4GLI A;  4XTC Q;  4FEC A;  2O68 A;  4F2O A;  4NF5 A;  3VV5 A;  4NF5 B;  2ABH A;  4F31 B;  1JEU A;  4MF3 A;  3RYD A;  1H3D A;  3TKD A;  2I49 A;  2YPN A;  4M1V A;  1LBX A;  1AOV A;  3LSW A;  3L6H A;  4EQ7 A;  3PD9 A;  4FE8 A;  2HXW A;  5HPQ A;  5DYH A;  4O7M A;  5J1D A;  4DE8 A;  1KA0 A;  1TFA A;  2HQ0 A;  2FVZ A;  4MX6 A;  2V3U A;  4NF8 A;  3OOA A;  2DVC A;  1MDQ A;  5ET8 A;  4FJP A;  3G3K A;  4DXB A;  1XOC A;  5I2N A;  4P56 A;  2XXP A;  2ONK E;  3RT8 A;  2O7U A;  5I2N B;  1B51 A;  4ONY A;  4LQ5 A;  1IZ1 A;  1WDN A;  3VVE A;  4NF6 A;  4QFK A;  5JTY A;  1NL5 A;  4NF6 B;  5JTY B;  4F3G A;  3K2D A;  1Y3N A;  2Y7P A;  4NGU A;  5EHM A;  2QMW A;  3FXU A;  3E78 A;  4XKN A;  4NF4 A;  4GFR A;  1IXG A;  1F9B A;  3KZG A;  4NF4 B;  1BP5 A;  4RPN A;  1ZMG A;  1A99 A;  3KEI A;  1Y20 A;  3TMG A;  1N0T A;  3K6U A;  4G68 C;  3BKI B;  3V8X B;  2OBG A;  4PF8 A;  1VSO A;  5HBC A;  3O97 A;  3G7W A;  3H6U A;  4N6D A;  4I3Y A;  2V3T A;  3HN0 A;  1HSJ A;  1Z7M E;  2F34 A;  2I6E A;  2H9B A;  2XWK A;  1OLA A;  3K1N A;  1MM7 A;  3R7X A;  4G68 B;  2ESN A;  5DT6 A;  4F1Y A;  4QRZ A;  3C33 A;  4GQO A;  2NOO A;  3GZG A;  1SW4 A;  4QFO A;  1H45 A;  1OIB A;  1A8E A;  1DCU A;  3KBR A;  3IR1 A;  4P9K A;  2CEY A;  1ZIU A;  3U8Q A;  3H6W A;  3VFJ A;  1B9J A;  1SW2 A;  1O64 A;  3ROJ A;  1EYJ A;  5I58 A;  2F5X A;  5I58 B;  3QSL A;  1LBW A;  2YJP A;  2F6P A;  4G61 A;  2B4L A;  2F7A A;  4F2Q A;  1YCJ A;  2FIX A;  3KN8 A;  3EF7 A;  1RKM A;  4X9T A;  3CVG A;  4FBP A;  4R75 A;  1JW1 A;  1M5F A;  3MPL A;  1LCF A;  4GL0 A;  4LON B;  1MDP 1;  4N07 A;  4PBH A;  1I6B A;  4N8Y A;  5B7D A;  3ZSF A;  4F39 A;  3VVF A;  3PPP A;  2DDK A;  2Q8M A;  4FOR A;  1EZO A;  2V3Q A;  1ANF A;  1URG A;  3I5O A;  1UIU A;  4KPT A;  2FIE A;  1R9L A;  4KQP A;  4Q0C A;  3CFZ A;  2XXY A;  1JP4 A;  2I0B A;  4ELR A;  1PBQ A;  4LN5 A;  3PUY E;  2XX7 A;  2D5W A;  2WYP A;  3SET A;  4ZEI A;  2NWJ A;  1B3F A;  4R72 A;  1XS5 A;  4BDQ A;  4C1U A;  2D21 A;  1G0H A;  5A5X A;  2OWT A;  3SEV A;  2ZNU A;  3HPI A;  4I3E A;  5I56 B;  1B5H A;  2R8T A;  5CMM A;  3PD8 A;  1NV5 A;  3RN8 A;  2A5S A;  2H99 A;  1B6H A;  1B7Z A;  2B3B A;  4P0I A;  3LV0 A;  2DS9 A;  3K6W A;  1FTM A;  1NMU A;  3B7D A;  4ZEB A;  1FPK A;  2QFL A;  3MW0 A;  4P0G A;  3D4C A;  1NV6 A;  1FPI A;  1S50 A;  3SZP A;  1US4 A;  3C31 A;  1B4H A;  3RPL B;  4OXV A;  1INP A;  1POT A;  1D9V A;  2F6G A;  3C4M A;  1FQD A;  3TDJ A;  4DCY A;  2XXK A;  4MNI A;  4JXI A;  4H8J A;  4Q30 B;  2QVV A;  1B05 A;  1MXU A;  2HZK A;  4GWY A;  2THI A;  3RNN A;  4Q5T A;  1IXC A;  2XXH A;  1LBY A;  1IQ7 A;  4G77 A;  3TOD A;  3EPE A;  2WEF A;  4EUO A;  1PDA A;  4PFI A;  3CG1 A;  2PMS A;  2GFE A;  4OFJ A;  3K00 A;  4IGR A;  4GX4 A;  4YAH X;  5KCJ B;  3PPO A;  3B6W A;  2DVZ A;  4HE1 A;  3CHG A;  2F97 A;  1M5E A;  5ESY A;  4O94 A;  3MP8 A;  1LFG A;  4OA4 A;  4HXV A;  4ELP A;  1LFI A;  1IMD A;  3LSX A;  4H5G A;  3VLW A;  3C35 A;  1SYI A;  1RYX A;  2XXU A;  1IMF A;  3PU5 A;  5ITP A;  2ANJ A;  2UVJ A;  2V25 A;  2AL4 A;  3SEX A;  2XXX A;  1SW5 A;  1ELJ A;  2ZMB A;  5F7V A;  5AA2 D;  4MIJ A;  4UAB A;  1SQY A;  3PPN A;  2DXY A;  3IB0 A;  5LDZ A;  3KOT A;  1EZ9 A;  1IEJ A;  3TCH A;  5AE4 A;  2P2A A;  3MJN A;  3TTR A;  3A3U A;  1FQA A;  3CRB A;  1QGX A;  3PMW A;  4YB7 A;  4GOT A;  4ELQ A;  3S9E A;  4I1D A;  4RK9 A;  4XXU A;  1QJM A;  3TTK A;  4IR8 A;  4GX6 A;  1LBZ A;  3VE1 B;  4NTL A;  3IOU A;  2VD2 A;  2ALU A;  1R9Q A;  1Y1M A;  3G3F A;  1NFT A;  2QVR A;  3KC0 A;  1FJ6 A;  1MM6 A;  2XXT A;  4OVP A;  4OYV A;  2F3D A;  1GR2 A;  3LUY A;  1GV8 A;  1Y4C A;  4X1B A;  3TTM A;  1A7L A;  1NUX A;  1LBV A;  3R26 A;  2OWS A;  2QS4 A;  3A29 A;  3G3J A;  1J1N A;  5H8N A;  3IK6 B;  3G3I A;  5H8N B;  4JWY A;  1R6Z A;  2ONR A;  3UA8 A;  2OJT A;  4BDM A;  3EHT A;  4PFB A;  5TP9 A;  5TP9 B;  4OER A;  3W15 C;  4RJZ A;  1UIV A;  3H6T A;  4IY5 A;  4OEN A;  1YYZ A;  2XHD A;  4LQ2 A;  2NVU B;  3RTW B;  1M5D A;  3QMF A;  1EZP A;  1LB9 A;  1A40 A;  2UVI A;  3KSX A;  4EQ9 A;  2HCA A;  2XWV A;  1TXF A;  1NI9 A;  3CIJ A;  3QYT A;  3E9X A;  5CC2 A;  1N3W A;  4Q8R A;  4Z7E A;  5FHO A;  2Z22 A;  2DE2 A;  3GXA A;  4WED A;  1SI0 A;  2XXI A;  3BBR A;  4H65 A;  3HFU A;  5ICT A;  2Z23 A;  1B5J A;  1QKB A;  3P7I A;  3VVD A;  3B50 A;  4AB6 A;  3UN6 A;  2DWJ A;  1ZTY A;  1IXI A;  1MRP A;  1R1N A;  1IIW A;  2OWZ A;  1BLF A;  4XFE A;  4OVQ A;  3E4R A;  4MHF A;  3PUW E;  4ZEK A;  4U21 A;  3T9V A;  1ZBM A;  4THI A;  2O1L A;  1A55 A;  5JK4 A;  3H06 B;  3TCG A;  3PMV A;  2VT5 A;  1DSN A;  4PCD A;  4YKP A;  3KOS A;  1N7X A;  1AIV A;  5IAI A;  3FV1 A;  3LUZ A;  4NED A;  1PB9 A;  4GWO A;  3V5A A;  5CRY A;  4GWX A;  3KFM A;  3MVX A;  5EYH A;  4KR5 A;  3DLN A;  4R2F A;  2Q2C A;  4DCX A;  3U92 A;  3OEN A;  3N6U A;  1LBC A;  4EF2 A;  5LTC A;  5L9M A;  4H67 A;  2R6G E;  3SDF A;  4G2Z A;  4OTE A;  2UYF A;  2GHB A;  2QPQ A;  3H6V A;  4R2B A;  4MLQ A;  3V89 B;  5EYG A;  2V93 A;  5DW8 A;  2F35 A;  2Y7I A;  1AWB A;  4LA9 A;  1NV7 A;  2ZZX A;  2XWO A;  2O6A A;  1Z7N E;  5T3J A;  1NNF A;  4MNC A;  1O63 A;  2DXR A;  2PCR A;  3O6G A;  4LZ8 A;  1KA1 A;  3KN3 A;  2H4I A;  2UVG A;  2VPN A;  1XVY A;  5L8D A;  5ICQ A;  2VPO A;  4N6P A;  3OD7 A;  4MJO A;  1MQI A;  2E1S A;  1IME A;  3W9W A;  4BDR A;  4YIC A;  1II5 A;  4EF1 A;  4GBV A;  3OSQ A;  2H5Y A;  4GWU A;  2RC8 A;  4YU0 A;  2X7Q A;  1AMF A;  3UP9 A;  4PFW A;  2HZL A;  5EQ9 A;  2QMX A;  4NG7 A;  3RT6 B;  3MC2 A;  3GBA A;  1B1H A;  1EYI A;  5IZZ A;  4F3P A;  2RF1 A;  2YLN A;  5I57 A;  3PTY A;  5I57 B;  4MH5 A;  2F78 A;  1MXV A;  1DMB A;  3PMX A;  1GVC A;  2ONS A;  3U72 A;  3QUF A;  3MUQ A;  3S2V A;  1MS7 A;  1M5B A;  5ET7 A;  5EQ7 A;  1FTO A;  1B52 A;  1ZKB A;  2QL3 A;  1MG1 A;  3ODB A;  1US5 A;  3FD3 A;  5DVI A;  1T0K A;  2QSX A;  4X8R A;  4NF0 A;  4DI4 B;  4F18 A;  3UK4 A;  4P47 A;  1XT8 A;  4RY1 A;  5BWJ A;  1AL3 A;  2Y7K A;  4G68 A;  3FVN A;  1Y4T A;  1RDX A;  1S7Y A;  3D1R A;  2A5T A;  3G3G A;  2A5T B;  4HCY A;  3EN3 A;  3MVW A;  1VFD A;  3H4Z A;  3M3F A;  5FTI A;  1B46 A;  1RDZ A;  4AB5 A;  2O1M A;  2O51 A;  3K1P A;  3T22 A;  4GRK A;  5H8F A;  5H8F B;  1D9Q A;  2WBB A;  2AYS A;  4MFI A;  2F7B A;  2M8C A;  3ILT B;  4PFT A;  3MYU A;  4DDD A;  2P3N A;  4WKM A;  1OQH A;  1AH5 A;  4ESW A;  3HHF A;  5IZ1 A;  4RA1 A;  4JDF A;  2RCA A;  2BJJ X;  3PGF A;  1P1O A;  2I0C A;  2LAO A;  3B6Q A;  5DVJ A;  5H8Q A;  4OVR A;  3N26 A;  5H8Q B;  4RXL A;  1JVY A;  3M8U A;  4NWD A;  3O6I A;  1TFD A;  4HS7 A;  1MY2 A;  2O84 X;  4GXA A;  3GLB A;  4YKJ A;  1BTJ A;  2Y84 A;  4OVS A;  1LBB A;  1QUI A;  3RTF B;  1MQD A;  3DEL B;  3WAE A;  5EHS A;  1KZ8 A;  2O69 A;  1A54 A;  2DSF A;  4P8B A;  4FEB A;  1KWH A;  3QAX A;  4BDL A;  1NV4 A;  4IGT A;  3LC8 A;  3VLV A;  4IO7 A;  1K9Y A;  2PFY A;  3C34 A;  3MAM A;  3FJM A;  4F3S A;  1G0I A;  2CZI A;  4BDN A;  3UOR A;  2X7P A;  3AXF A;  3K02 A;  3PV0 E;  4EXL A;  1WVJ A;  2QRY A;  4OFL A;  4HCW A;  1LAH E;  2O7I A;  1YXI A;  1L5T A;  3Q29 A;  4GD5 A;  1H76 A;  1N76 A;  1P99 A;  5I7I A;  1NKX A;  4OEV A;  2AL5 A;  4QFN A;  1PC3 A;  4U4X A;  5I56 A;  3ILU B;  4IO5 A;  4U23 A;  3EHS A;  4KHZ E;  1B40 A;  1MXY A;  1OQG A;  3S9L C;  2CEX A;  4OEU A;  5FHN A;  3N5L A;  4DI3 D;  3H3G A;  1YAE A;  4NMY A;  2RKM A;  2NXO A;  1P1Q A;  4PFY A;  5TPA A;  1MY4 A;  5CM6 A;  2RIN A;  1DOT A;  5TPA B;  2VGQ A;  3NOH A;  5IGA A;  2G29 A;  4JBZ A;  1BIY A;  5IKB A;  2VD3 A;  1FPB A;  1LLS A;  4ISU A;  2GQ1 A;  1N84 A;  3RPL A;  1IXH A;  4KD5 A;  4O3A A;  4N4U A;  4NE4 A;  4RYA A;  4K3F A;  4KYE A;  3FJG A;  3GBB A;  1MPD A;  3QIM A;  4NWC A;  5FHM A;  3LSL A;  2RC9 A;  3OXN A;  3QXM A;  4QSC A;  5AA1 A;  1PB7 A;  4FAT A;  1QUL A;  4E0X A;  2RC7 A;  3B8B A;  1OVB A;  1EU8 A;  5CI5 A;  1USY E;  4RPO A;  3OO7 A;  2GRV A;  5KCJ A;  2WYK A;  4PDD A;  3T9U A;  2VHA A;  4GWS A;  3M3L A;  4PBQ A;  4IO2 A;  4NN3 A;  3O6H A;  3FVG A;  1DTZ A;  2DP8 A;  4KYD A;  2W7Y A;  4TQU Q;  3E79 A;  1DK4 A;  4ZEF A;  4YKI A;  5CBR A;  4ELO A;  2DWI A;  2CZK A;  4H6D A;  4KXP A;  1MH3 A;  3TQL A;  1LFH A;  1MH4 A;  2XXW A;  3IFC A;  1SI1 A;  3THI A;  1MQG A;  3RUM A;  1FPJ A;  1Y3P A;  4GVO A;  4X48 A;  4U2R A;  4U1O A;  2MKZ A;  4H1X A;  1N04 A;  1FTA A;  1UTB B;  1I69 A;  3CG3 A;  2FYI A;  2XA5 A;  5L9O A;  3OO9 A;  4YMA A;  4GF8 A;  2F8D A;  3TYH A;  3FVK A;  1IUD A;  3PUV E;  4GL8 A;  3ECR A;  2V84 A;  4PE5 B;  2Z8E A;  3O66 A;  1QVS A;  1NUW A;  1Q1K A;  2XX8 A;  3O28 A;  1LEV A;  4R9G A;  4FAJ A;  1Y9U A;  3BIH A;  3BFU A;  3E13 X;  3BFT A;  1VDW A;  4XKP A;  4H46 A;  4OVT A;  3N94 A;  1CB6 A;  1FSA A;  1LB8 A;  3OO6 A;  1FBE A;  3TCF A;  2ZYM A;  4HW8 A;  3KC1 A;  3KGC A;  1FTL A;  2ZYK A;  4N91 A;  3KJ7 A;  4H0W A;  3VXB A;  2F36 A;  3EQ1 A;  1A8F A;  4F1U A;  2GHA A;  4H5F A;  5H8H B;  3TTN A;  4ESX A;  3RPW A;  3FJ7 A;  3HCQ A;  2QJE A;  4TLM B;  5BUU A;  4KI0 E;  3MBP A;  1DPE A;  4OET A;  1P1W A;  4I40 A;  5FTH A;  1LST A;  5M2V A;  4OFO A;  3SEY A;  1USY H;  1B0H A;  4YZZ A;  1P1N A;  2OLB A;  2HPG A;  4HE0 A;  4R6Y A;  1FQC A;  3Q27 A;  4PGP A;  4JVI A;  1SBP A;  2Y7W A;  3QUJ A;  1B3E A;  1MY3 A;  1MXZ A;  1DTG A;  1FRP A;  2G93 A;  3IL1 B;  5DTB A;  1IMC A;  4P1E A;  2XXV A;  2I4C A;  2P0S A;  2RCB A;  2VP1 A;  4X04 A;  5J16 A;  4OES A;  1B7U A;  5CMB A;  4I62 A;  3ZS6 A;  4GXS B;  2UVH A;  1FBG A;  4F22 A;  1NNP A;  1SDX A;  3UGW A;  1VE4 A;  1B58 A;  1YPN A;  1B5I A;  5I2K A;  2DE4 A;  1B3H A;  5I2K B;  4XKR A;  2ZXT A;  4GWZ A;  2Q9T A;  1IMB A;  3T66 A;  3IO4 A;  5AA2 B;  4OQO A;  4LAT A;  1YZ0 A;  2PYY A;  2Z8F A;  3FVO A;  1FQE A;  1NUZ A;  5CBS A;  4R6H A;  2FHY A;  4YKK A;  3CSG A;  3T9X B;  4MCO A;  3T1B A;  4E0W A;  2CZH A;  4PE3 A;  3MVZ A;  3CI8 A;  3WAF A;  2H25 A;  2B3F A;  3MWB A;  1N7W A;  5ITO A;  4U1Z A;  3CFL A;  3FXB A;  5DVF A;  3IOT A;  4LZ5 A;  3C36 A;  4I9D A;  3USD A;  3LSF B;  2KLF A;  3QK6 A;  4U4S A; 
#chains in the Genus database with same CATH homology
 2Z8D A;  1SD3 A;  3VLU A;  3FAT A;  4GIZ A;  4PQJ A;  4FED A;  4ZE9 A;  1D4N A;  1LAX A;  4QFP A;  4OMB A;  2DOJ A;  4JWX A;  5HM4 B;  4IO4 A;  3Q28 A;  2FNC A;  2F7C A;  3OMB A;  4ZE8 A;  1UTH A;  1Y3Q A;  1UTH B;  1H43 A;  1MXW A;  3HHG A;  3Q25 A;  3T96 B;  2DWA A;  2I3V A;  3HV1 A;  3LBS A;  4NF8 B;  2ZNS A;  3ZKK A;  1SVX B;  1Y1Z A;  2X26 A;  1GGG A;  3JZJ A;  4F19 A;  3IX1 A;  1FW0 A;  2HEU A;  1WOD A;  3OEK A;  5CMK A;  4QSE A;  2P1S A;  4P11 A;  4UAC A;  1PB8 A;  3MZ1 A;  5B70 A;  1HSE A;  2H98 A;  3I6V A;  4R9F A;  4ND9 A;  4UA8 A;  1URD A;  4MBP A;  1LAF E;  1PEB A;  2XX9 A;  2GH9 A;  3MP1 A;  3PPQ A;  2QS1 A;  4G8H A;  2HFB A;  3RY3 A;  1PBP A;  1VR5 A;  4OWD A;  4EDP A;  4M4G A;  5AA4 A;  1YTV A;  5AA4 B;  4ZEC A;  3TAJ A;  2QS2 A;  1GTK A;  1B7H A;  2HAV A;  2I4B A;  2PT2 A;  3SES A;  2XD2 A;  3R6U A;  1XC1 A;  1Q35 A;  2OK2 A;  2VOZ A;  4F29 A;  5ELV A;  1N3X A;  3TZA A;  3OSR A;  4R74 A;  3U94 A;  1QW0 A;  3IO6 A;  3E3K A;  2Q88 A;  3K1M A;  4ECF A;  2FA7 A;  3D4G A;  3JV9 A;  4DXC A;  5CMC A;  4JB7 A;  3DP6 A;  3K6X A;  3A09 A;  3VXC A;  1B0L A;  5F1Q A;  4PP0 A;  5I84 A;  1ZLQ A;  2QS3 A;  5L9S A;  1LGB C;  4PET A;  3T9H B;  4RNS A;  1FQF A;  2PVU A;  2Q89 A;  3SKP A;  3CR9 A;  3FZV A;  1OVT A;  3KJT A;  4R73 A;  3FGS A;  4IO6 A;  3KN7 A;  1TT1 A;  2IA4 A;  3DP8 A;  1S9T A;  2OZZ A;  1FQB A;  1LCT A;  1B2H A;  2PX1 A;  2PT1 A;  2XD3 A;  4LZ7 A;  2IEE A;  1SW1 A;  4KFQ A;  2AIX A;  4DLD A;  4RK2 A;  3KSJ A;  1VFE A;  3RQT A;  5AA3 A;  3CFX A;  2REG A;  3K0V A;  4MLV A;  4G8N A;  1JW5 A;  4TOZ A;  3RGY A;  3MZ9 A;  4WEP A;  1JET A;  4YB5 A;  3V83 A;  2REJ A;  4POX A;  4ZED A;  3TFL A;  4JSO A;  1MQJ A;  1QUK A;  2ZNT A;  2DYX A;  4YB6 A;  3IJO B;  5A5X B;  1MQH A;  1JNF A;  3DM0 A;  3G3H A;  3U1O A;  1QKA A;  4HTG A;  4N13 A;  1B3G A;  1POY 1;  4KCC A;  1QUJ A;  3IAZ A;  1H44 A;  3IOW A;  3HST A;  1B1X A;  3TPA A;  3PPR A;  3IB1 A;  4G8M A;  3FXR A;  3OEL A;  4DIG A;  3JYR A;  4F3B A;  1NH8 A;  2WKY A;  3C32 A;  4L17 A;  3FXQ A;  2D3I A;  3N6T A;  4XIG Q;  3U93 A;  1CE2 A;  4O3C A;  4EQB A;  1MY1 A;  3H03 A;  3OEM A;  3RLF E;  1LAG E;  1ZU0 A;  1NNK A;  4OZ9 A;  4QF9 A;  4QSD A;  4O3B A;  3TUS A;  3K6V A;  2CZL A;  5K2Y A;  4QHQ A;  1UTB A;  4JWO A;  1D3K A;  1URS A;  1SYH A;  3L6G A;  3LR1 A;  5KZT A;  2XXQ A;  1B4Z A;  1OLC A;  1BKA A;  1JEV A;  2XXR A;  3IOR A;  3HO7 A;  4EXK A;  1ATG A;  1UQW A;  1O7T A;  3TQW A;  3FUZ A;  5ISU A;  3MVY A;  3Q26 A;  4G4P A;  1DPP A;  4IO3 A;  3VDF A;  4DZ1 A;  1ZJL A;  1JW4 A;  4PFU A;  1B3L A;  4LVQ A;  1FTJ A;  2Q8J A;  1FTK A;  2UXA A;  1NNT A;  4BLA A;  3ONM A;  3IJX B;  1MXX A;  3SER A;  5JEI A;  4IB2 A;  5H8H A;  3I3V A;  2ZYN A;  3ZKL A;  5H8S A;  1I6A A;  3S9N C;  5DEX A;  5DEX B;  2I58 A;  3PUX E;  3S4U A;  2OCU A;  3EHU A;  2CMO A;  4WXJ A;  3IB2 A;  3TEL A;  4C1T A;  3TEP A;  2NUV A;  4KYS A;  3TTL A;  1OMP A;  3IOV A;  2R71 A;  3FV2 A;  4C0R A;  4ZS9 A;  2ZYO A;  3FAS A;  3PUZ E;  4FIM A;  4I8C A;  2DWH A;  2Q2A A;  1MPB A;  1MPC A;  3CSB A;  4TLL B;  1JQF A;  5LOM A;  4F1V A;  2I48 A;  1IIT A;  3W9V A;  3DP4 A;  3F11 A;  1NH7 A;  1XHY A;  2E0S A;  4LUB A;  4POW A;  5TU0 A;  4JSD A;  4R6K A;  1HSL A;  3MZB A;  2R9J A;  2UYE A;  4H8I A;  3S9M C;  1TWY A;  4OHN A;  3K4U A;  2PBW A;  4IY6 A;  5AA2 A;  3MPK A;  4OVJ A;  3FIR A;  4ZZE A;  4DXU A;  2DE3 A;  2B65 A;  2I3W A;  2HAU A;  3SEW A;  1I6Q A;  4ZDM A;  3UIF A;  3A3C A;  4X1D A;  5K2X A;  4XKQ A;  1MY0 A;  3MP6 A;  3C9H A;  4BDO A;  4ZZA A;  1B32 A;  1M5C A;  2Y7R A;  3OO8 A;  3O9P A;  4YMB A;  1JVX A;  4QFL A;  4KCD A;  1RYO A;  4U22 A;  4AQ4 A;  3B6T A;  3M3K A;  3SEU A;  3H7M A;  3T93 B;  3K01 A;  1FCK A;  4Z0I A;  1XVX A;  1P1U A;  4LP2 B;  5I59 A;  5KDT A;  3MQ9 A;  5I59 B;  5KDT B;  1D9Y A;  1EH3 A;  3O2A A;  3KG2 A;  3O29 A;  5EYF A;  2DQV A;  4GLI A;  4XTC Q;  4FEC A;  2O68 A;  4F2O A;  4NF5 A;  3VV5 A;  4NF5 B;  2ABH A;  4F31 B;  1JEU A;  4MF3 A;  1H3D A;  3TKD A;  2I49 A;  2YPN A;  4M1V A;  1AOV A;  3LSW A;  3L6H A;  4EQ7 A;  3PD9 A;  4FE8 A;  2HXW A;  5HPQ A;  5DYH A;  5J1D A;  4DE8 A;  1TFA A;  2HQ0 A;  2V3U A;  4NF8 A;  3OOA A;  2DVC A;  1MDQ A;  4FJP A;  3G3K A;  4DXB A;  1XOC A;  5I2N A;  2XXP A;  2ONK E;  3RT8 A;  2O7U A;  5I2N B;  1B51 A;  4ONY A;  4LQ5 A;  1IZ1 A;  1WDN A;  3VVE A;  4NF6 A;  4QFK A;  5JTY A;  1NL5 A;  4NF6 B;  5JTY B;  4F3G A;  3K2D A;  1Y3N A;  2Y7P A;  5EHM A;  2QMW A;  3FXU A;  4XKN A;  4NF4 A;  4GFR A;  1IXG A;  1F9B A;  3KZG A;  4NF4 B;  1BP5 A;  4RPN A;  1ZMG A;  1A99 A;  3KEI A;  1Y20 A;  3TMG A;  1N0T A;  3K6U A;  4G68 C;  3BKI B;  3V8X B;  2OBG A;  1VSO A;  5HBC A;  3O97 A;  3G7W A;  3H6U A;  2V3T A;  3HN0 A;  1HSJ A;  1Z7M E;  2F34 A;  2I6E A;  2H9B A;  1OLA A;  3K1N A;  1MM7 A;  3R7X A;  4G68 B;  2ESN A;  5DT6 A;  4F1Y A;  4QRZ A;  3C33 A;  4GQO A;  2NOO A;  3GZG A;  1SW4 A;  4QFO A;  1H45 A;  1OIB A;  1A8E A;  3KBR A;  3IR1 A;  1ZIU A;  3U8Q A;  3H6W A;  3VFJ A;  1B9J A;  1SW2 A;  1O64 A;  5I58 A;  2F5X A;  5I58 B;  3QSL A;  2YJP A;  2F6P A;  2F7A A;  4F2Q A;  1YCJ A;  3KN8 A;  3EF7 A;  1RKM A;  4X9T A;  3CVG A;  4R75 A;  1JW1 A;  1M5F A;  3MPL A;  1LCF A;  4GL0 A;  4LON B;  1MDP 1;  4N07 A;  1I6B A;  5B7D A;  3ZSF A;  4F39 A;  3VVF A;  3PPP A;  4FOR A;  1EZO A;  2V3Q A;  1ANF A;  1URG A;  3I5O A;  1UIU A;  4KPT A;  1R9L A;  4KQP A;  4Q0C A;  3CFZ A;  2XXY A;  2I0B A;  4ELR A;  1PBQ A;  3PUY E;  2XX7 A;  2D5W A;  3SET A;  4ZEI A;  2NWJ A;  1B3F A;  4R72 A;  1XS5 A;  4BDQ A;  4C1U A;  2D21 A;  5A5X A;  2OWT A;  3SEV A;  2ZNU A;  3HPI A;  5I56 B;  1B5H A;  5CMM A;  3PD8 A;  3RN8 A;  2A5S A;  2H99 A;  1B6H A;  1B7Z A;  2B3B A;  4P0I A;  2DS9 A;  3K6W A;  1FTM A;  1NMU A;  3B7D A;  4ZEB A;  3MW0 A;  4P0G A;  3D4C A;  1S50 A;  1US4 A;  3C31 A;  1B4H A;  4OXV A;  1POT A;  1D9V A;  2F6G A;  3C4M A;  1FQD A;  3TDJ A;  4DCY A;  4JXI A;  4H8J A;  4Q30 B;  1B05 A;  1MXU A;  2HZK A;  2THI A;  3RNN A;  4Q5T A;  1IXC A;  2XXH A;  1IQ7 A;  4G77 A;  3TOD A;  3EPE A;  4EUO A;  1PDA A;  3CG1 A;  2PMS A;  2GFE A;  4OFJ A;  3K00 A;  4IGR A;  4YAH X;  5KCJ B;  3PPO A;  3B6W A;  2DVZ A;  2F97 A;  1M5E A;  3MP8 A;  1LFG A;  4ELP A;  1LFI A;  3LSX A;  4H5G A;  3VLW A;  3C35 A;  1SYI A;  1RYX A;  2XXU A;  3PU5 A;  5ITP A;  2ANJ A;  2UVJ A;  2V25 A;  2AL4 A;  3SEX A;  2XXX A;  1SW5 A;  1ELJ A;  2ZMB A;  5F7V A;  5AA2 D;  1SQY A;  3PPN A;  2DXY A;  3IB0 A;  3KOT A;  1EZ9 A;  1IEJ A;  3TCH A;  5AE4 A;  2P2A A;  3MJN A;  3TTR A;  3A3U A;  1FQA A;  3CRB A;  3PMW A;  4YB7 A;  4GOT A;  4ELQ A;  3S9E A;  4I1D A;  4RK9 A;  4XXU A;  1QJM A;  3TTK A;  3VE1 B;  4NTL A;  3IOU A;  2VD2 A;  2ALU A;  1R9Q A;  1Y1M A;  3G3F A;  1NFT A;  1MM6 A;  2XXT A;  4OYV A;  1GR2 A;  3LUY A;  1GV8 A;  1Y4C A;  4X1B A;  3TTM A;  1A7L A;  3R26 A;  2OWS A;  2QS4 A;  3G3J A;  1J1N A;  5H8N A;  3IK6 B;  3G3I A;  5H8N B;  4JWY A;  1R6Z A;  2ONR A;  3UA8 A;  2OJT A;  4BDM A;  3EHT A;  5TP9 A;  5TP9 B;  4OER A;  3W15 C;  4RJZ A;  1UIV A;  3H6T A;  4IY5 A;  4OEN A;  2XHD A;  4LQ2 A;  2NVU B;  3RTW B;  1M5D A;  1EZP A;  1LB9 A;  1A40 A;  2UVI A;  3KSX A;  4EQ9 A;  2HCA A;  1TXF A;  3CIJ A;  3QYT A;  3E9X A;  5CC2 A;  1N3W A;  4Q8R A;  4Z7E A;  5FHO A;  2Z22 A;  2DE2 A;  3GXA A;  4WED A;  1SI0 A;  2XXI A;  3BBR A;  4H65 A;  5ICT A;  2Z23 A;  1B5J A;  1QKB A;  3P7I A;  3VVD A;  4AB6 A;  3UN6 A;  2DWJ A;  1ZTY A;  1IXI A;  1MRP A;  1R1N A;  1IIW A;  1BLF A;  3E4R A;  3PUW E;  4ZEK A;  4U21 A;  3T9V A;  1ZBM A;  4THI A;  2O1L A;  1A55 A;  5JK4 A;  3H06 B;  3TCG A;  3PMV A;  1DSN A;  4YKP A;  3KOS A;  1N7X A;  1AIV A;  5IAI A;  3FV1 A;  4NED A;  1PB9 A;  4GWO A;  3V5A A;  5CRY A;  3KFM A;  3MVX A;  4KR5 A;  3DLN A;  4R2F A;  2Q2C A;  4DCX A;  3U92 A;  3OEN A;  3N6U A;  1LBC A;  4EF2 A;  5L9M A;  4H67 A;  2R6G E;  3SDF A;  4G2Z A;  4OTE A;  2UYF A;  2GHB A;  2QPQ A;  3H6V A;  4R2B A;  4MLQ A;  3V89 B;  2V93 A;  2F35 A;  2Y7I A;  4LA9 A;  2O6A A;  1Z7N E;  1NNF A;  1O63 A;  2DXR A;  3O6G A;  4LZ8 A;  3KN3 A;  2H4I A;  2UVG A;  5L8D A;  1XVY A;  5ICQ A;  4N6P A;  3OD7 A;  1MQI A;  2E1S A;  3W9W A;  4BDR A;  4YIC A;  1II5 A;  4EF1 A;  3OSQ A;  2H5Y A;  2RC8 A;  4YU0 A;  2X7Q A;  1AMF A;  3UP9 A;  4PFW A;  2HZL A;  2QMX A;  3RT6 B;  3MC2 A;  3GBA A;  1B1H A;  4F3P A;  2RF1 A;  2YLN A;  5I57 A;  5I57 B;  4MH5 A;  2F78 A;  1MXV A;  1DMB A;  3PMX A;  1GVC A;  2ONS A;  3U72 A;  3QUF A;  3MUQ A;  3S2V A;  1MS7 A;  1M5B A;  1FTO A;  1B52 A;  1ZKB A;  2QL3 A;  1MG1 A;  3ODB A;  1US5 A;  3FD3 A;  5DVI A;  1T0K A;  2QSX A;  4F18 A;  3UK4 A;  1XT8 A;  4RY1 A;  5BWJ A;  1AL3 A;  2Y7K A;  4G68 A;  3FVN A;  1Y4T A;  1S7Y A;  2A5T A;  3G3G A;  2A5T B;  4HCY A;  3EN3 A;  3MVW A;  1VFD A;  3H4Z A;  3M3F A;  5FTI A;  1B46 A;  4AB5 A;  2O1M A;  2O51 A;  3K1P A;  3T22 A;  4GRK A;  5H8F A;  5H8F B;  2AYS A;  4MFI A;  2F7B A;  2M8C A;  3ILT B;  4PFT A;  4DDD A;  4WKM A;  1OQH A;  1AH5 A;  4ESW A;  3HHF A;  4RA1 A;  4JDF A;  2RCA A;  2BJJ X;  3PGF A;  1P1O A;  2I0C A;  2LAO A;  3B6Q A;  5DVJ A;  5H8Q A;  3N26 A;  5H8Q B;  4RXL A;  1JVY A;  3M8U A;  4NWD A;  3O6I A;  1TFD A;  4HS7 A;  1MY2 A;  2O84 X;  4GXA A;  3GLB A;  4YKJ A;  1BTJ A;  2Y84 A;  1LBB A;  1QUI A;  3RTF B;  1MQD A;  3DEL B;  3WAE A;  5EHS A;  2O69 A;  1A54 A;  2DSF A;  4FEB A;  1KWH A;  3QAX A;  4BDL A;  4IGT A;  3LC8 A;  3VLV A;  4IO7 A;  3C34 A;  3MAM A;  3FJM A;  4F3S A;  4BDN A;  3UOR A;  2X7P A;  3AXF A;  3K02 A;  3PV0 E;  4EXL A;  1WVJ A;  2QRY A;  4OFL A;  4HCW A;  1LAH E;  2O7I A;  1L5T A;  3Q29 A;  4GD5 A;  1H76 A;  1N76 A;  1P99 A;  1NKX A;  4OEV A;  2AL5 A;  4QFN A;  1PC3 A;  4U4X A;  5I56 A;  3ILU B;  4IO5 A;  4U23 A;  3EHS A;  4KHZ E;  1B40 A;  1MXY A;  1OQG A;  3S9L C;  4OEU A;  5FHN A;  3N5L A;  3H3G A;  1YAE A;  4NMY A;  2RKM A;  2NXO A;  1P1Q A;  4PFY A;  5TPA A;  1MY4 A;  5CM6 A;  2RIN A;  1DOT A;  5TPA B;  2VGQ A;  2G29 A;  4JBZ A;  1BIY A;  5IKB A;  2VD3 A;  1LLS A;  4ISU A;  1N84 A;  1IXH A;  4KD5 A;  4O3A A;  4NE4 A;  4RYA A;  4K3F A;  4KYE A;  3FJG A;  3GBB A;  1MPD A;  3QIM A;  4NWC A;  5FHM A;  3LSL A;  2RC9 A;  3OXN A;  3QXM A;  4QSC A;  5AA1 A;  1PB7 A;  4FAT A;  1QUL A;  4E0X A;  2RC7 A;  1OVB A;  1EU8 A;  5CI5 A;  1USY E;  4RPO A;  3OO7 A;  2GRV A;  5KCJ A;  3T9U A;  2VHA A;  3M3L A;  4IO2 A;  3O6H A;  3FVG A;  1DTZ A;  2DP8 A;  4KYD A;  2W7Y A;  4TQU Q;  4ZEF A;  4YKI A;  5CBR A;  4ELO A;  2DWI A;  4H6D A;  1MH3 A;  3TQL A;  1LFH A;  1MH4 A;  2XXW A;  1SI1 A;  3THI A;  1MQG A;  3RUM A;  1Y3P A;  4GVO A;  4X48 A;  4U2R A;  4U1O A;  4H1X A;  1N04 A;  1UTB B;  1I69 A;  3CG3 A;  2FYI A;  5L9O A;  3OO9 A;  4YMA A;  4GF8 A;  2F8D A;  3TYH A;  3FVK A;  1IUD A;  3PUV E;  4GL8 A;  3ECR A;  2V84 A;  4PE5 B;  2Z8E A;  3O66 A;  1QVS A;  1Q1K A;  2XX8 A;  3O28 A;  4R9G A;  4FAJ A;  1Y9U A;  3BFU A;  3E13 X;  3BFT A;  4XKP A;  3N94 A;  1CB6 A;  1LB8 A;  3OO6 A;  3TCF A;  2ZYM A;  4HW8 A;  3KGC A;  1FTL A;  2ZYK A;  3KJ7 A;  4H0W A;  3VXB A;  2F36 A;  3EQ1 A;  1A8F A;  4F1U A;  2GHA A;  4ESX A;  4H5F A;  5H8H B;  3TTN A;  3RPW A;  3FJ7 A;  3HCQ A;  2QJE A;  4TLM B;  5BUU A;  4KI0 E;  3MBP A;  1DPE A;  4OET A;  1P1W A;  5FTH A;  1LST A;  5M2V A;  4OFO A;  3SEY A;  1USY H;  1B0H A;  4YZZ A;  1P1N A;  2OLB A;  4R6Y A;  1FQC A;  3Q27 A;  1SBP A;  2Y7W A;  3QUJ A;  1B3E A;  1MY3 A;  1MXZ A;  1DTG A;  5DTB A;  2G93 A;  3IL1 B;  2XXV A;  2I4C A;  2P0S A;  2RCB A;  2VP1 A;  4OES A;  1B7U A;  5CMB A;  4I62 A;  3ZS6 A;  4GXS B;  2UVH A;  4F22 A;  1NNP A;  1SDX A;  3UGW A;  1VE4 A;  1B58 A;  1YPN A;  1B5I A;  5I2K A;  2DE4 A;  1B3H A;  5I2K B;  4XKR A;  2ZXT A;  2Q9T A;  3T66 A;  3IO4 A;  5AA2 B;  4OQO A;  4LAT A;  2PYY A;  2Z8F A;  3FVO A;  1FQE A;  5CBS A;  4R6H A;  4YKK A;  3CSG A;  3T9X B;  4E0W A;  3MVZ A;  3CI8 A;  3WAF A;  2H25 A;  2B3F A;  3MWB A;  1N7W A;  5ITO A;  4U1Z A;  3CFL A;  5DVF A;  3IOT A;  4LZ5 A;  3C36 A;  4I9D A;  3USD A;  3LSF B;  2KLF A;  3QK6 A;  4U4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...