4M4GA

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium lt2 in complex with effector ligand, n-acetylserine.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium LT2 in complex with effector ligand, N-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 57
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA02
4GVOA 3U92A 5AA2B 4EQ7A 3FJMA 3MBPA 4EQBA 4U1ZA 5ELVA 3OO9A 3Q26A 1NH8A 3UP9A 3TTNA 2E0SA 1OVTA 2X26A 5TPAB 4KCDA 2O69A 3MW0A 3USDA 1Y1MA 1Q1KA 3N94A 3RTWB 4OEVA 2I0BA 4OETA 2HFBA 1B52A 4N07A 3MPKA 5K2YA 4MLQA 3OO8A 3CVGA 1A8FA 3CRBA 3TPAA 4MFIA 4TOZA 1FTLA 1MDQA 5JK4A 3QUFA 1M5FA 1LB9A 4IO5A 1B1XA 4U22A 4YICA 1ZBMA 3ONMA 3KN3A 1DSNA 3W15C 4H5GA 5CBRA 1B32A 1M5BA 1VFEA 1EU8A 1IXIA 3LSXA 4XIGQ 2HQ0A 3VV5A 2XX8A 4YB6A 2Q9TA 3Q25A 4ZZEA 3O6IA 2ABHA 3VVFA 3PUXE 4IO6A 4EF1A 2UVHA 3CFLA 3G3IA 2FNCA 5FHMA 5CMKA 1B40A 4BLAA 1WODA 3KOSA 3T66A 2VP1A 3BBRA 5ICQA 1MXZA 3RLFE 3ILTB 2UYEA 1MDP1 1B4HA 2DP8A 1IIWA 1Y4TA 1SYIA 3TODA 1MQIA 2H5YA 1JNFA 3HN0A 2OLBA 3OSQA 5KDTA 1TFAA 3W9VA 2QS4A 5TP9A 2GH9A 1SW5A 1TFDA 1YCJA 2ESNA 3N26A 3K01A 4R9GA 5AE4A 5I59A 3F11A 1FTOA 4OFLA 1ZKBA 2REJA 4I62A 3RT8A 4XKQA 1LAFE 2HZLA 2OWTA 3Q27A 2VD2A 1AL3A 1XT8A 4O3CA 2HAUA 2WKYA 1D9VA 1ZMGA 3A09A 3O97A 3UIFA 3VLUA 3IL1B 4G2ZA 4POWA 2XD3A 3VLWA 1MY3A 2Y7RA 1S50A 1GVCA 3IB2A 4G8NA 1B5JA 5EHSA 1MS7A 2AYSA 4G68C 3RN8A 3FUZA 1B3EA 4YKKA 3U8QA 3EQ1A 1EZPA 1FCKA 4ZS9A 1N04A 1N3WA 2DWJA 5AA4A 1ELJA 3C33A 3TEPA 4XKRA 1TXFA 1OQHA 4FIMA 1YTVA 1B3FA 1NMUA 1LSTA 3S4UA 3MVZA 4QSEA 1LAHE 4N6PA 3TZAA 4LQ5A 1URGA 1QW0A 2HCAA 3GXAA 2A5SA 3HHGA 3IO4A 1HSJA 1TWYA 4F3SA 5AA2D 3FXUA 3ZKKA 4U1OA 5KDTB 4RYAA 2M8CA 5IKBA 3WAFA 2UXAA 4DCXA 3P7IA 3T9HB 5J1DA 4EXLA 5TP9B 4X1DA 3H03A 1SVXB 1MY4A 3VFJA 2Q2CA 5DYHA 1WDNA 2DVCA 4R2BA 1XVXA 4X1BA 4LONB 1UIUA 3QUJA 5I59B 2PYYA 3E3KA 3IORA 2OZZA 3MQ9A 1XS5A 2DWHA 2D21A 2YPNA 3G3GA 2ZMBA 3IAZA 4F39A 2NXOA 2O84X 3PMXA 4PFTA 2VD3A 3MAMA 2ONKE 1J1NA 3H6WA 4YB7A 2F8DA 2QS1A 4H65A 4R72A 5JTYB 4DIGA 1MXXA 3TMGA 1JW1A 4YAHX 4GXAA 3BKIB 1GTKA 2DE4A 1R9LA 3G7WA 3G3HA 3I6VA 4ZEBA 2ZYMA 2ZNTA 1OMPA 3UA8A 4G4PA 1MQDA 4O3AA 3RTFB 3LSFB 2GRVA 3DLNA 4ZZAA 4R6KA 3S9NC 3L6GA 1MQHA 2DVZA 4DXCA 4DDDA 3LUYA 3KFMA 4F29A 1P1QA 1JEVA 4BDMA 4IO3A 2Z8DA 3G3KA 4QF9A 3U94A 3VXCA 3JYRA 3BFUA 4KFQA 2B3FA 2X7PA 3MZBA 3S2VA 4KD5A 1VFDA 3KGCA 4F2OA 5JEIA 4THIA 5EYFA 3LSWA 3C34A 2H25A 1ZLQA 3LR1A 3QXMA 1LFGA 3O2AA 2ANJA 1JW5A 1P1UA 1FQDA 3RT6B 4OVJA 1SBPA 5I56A 4QFNA 1SW2A 4FECA 1IXGA 1H43A 5DTBA 2H4IA 1NH7A 1BIYA 3SESA 4BDLA 4Z7EA 2FA7A 4F18A 1R1NA 4NF8A 3VLVA 4F19A 4NWCA 3SEYA 2XXWA 3M3FA 3DP6A 4QHQA 4ELQA 2QSXA 1OIBA 4U2RA 3ZKLA 3SERA 4QFLA 4TLMB 4QFKA 3V83A 3HSTA 4RA1A 3MPLA 2GFEA 4U23A 3VE1B 2P1SA 3KJ7A 2Z23A 5DEXA 2G93A 3D4GA 4N13A 4RNSA 3KBRA 2NVUB 5DVJA 1MY1A 4F3BA 3K1MA 3DM0A 2O1MA 3K1NA 2ONSA 1JETA 4Q30B 4G8HA 4R75A 5IAIA 4HCWA 2RKMA 5ISUA 2QMWA 2Y7KA 1IEJA 3K0VA 4R2FA 5KCJA 3TCHA 1PB7A 5CC2A 1SYHA 1LLSA 3H4ZA 2Q8JA 3M8UA 3O29A 2PX1A 3THIA 2P2AA 4F3PA 2CZLA 3T9UA 1D9YA 5CBSA 4ND9A 3TCFA 1OLAA 4ZDMA 1Y3NA 3OEKA 4R74A 1OVBA 4H6DA 3FGSA 2I6EA 2RINA 5FTHA 1ZU0A 3BFTA 4H67A 3N5LA 5I56B 4OESA 3T9XB 3O9PA 3DP8A 2QL3A 5H8NA 4DCYA 2UYFA 2REGA 1MXYA 4NF8B 4JDFA 3PPNA 4ECFA 2PT1A 2F7AA 4M4GA 3PUVE 2GHBA 3KN8A 4IO2A 1HSLA 3SETA 4GQOA 1MXUA 4EXKA 1NFTA 3OO6A 3G3FA 4NTLA 4G77A 4RPNA 4F3GA 2QJEA 3I3VA 4OFOA 2I48A 3KEIA 5DEXB 3TQLA 1MH4A 2QS3A 3G3JA 4M1VA 3TELA 4GXSB 1QULA 5L9MA 3SKPA 3FV2A 2LAOA 1LBBA 4LZ5A 1Y3PA 3GBAA 5I57A 1IXCA 3OEMA 4R6YA 5KCJB 4R73A 5I58A 2XXXA 4KYEA 3AXFA 1BP5A 2XHDA 3V8XB 3N6UA 3MP6A 1B46A 4LVQA 1N7WA 3RUMA 1PBPA 4IY5A 4I8CA 2XXVA 4MBPA 4C1TA 1FTJA 1XVYA 5I2KA 2HEUA 1MM6A 4Q0CA 5M2VA 4OXVA 3JV9A 2ZNSA 4JB7A 2OJTA 4OENA 4RXLA 4RPOA 4OFJA 3TTMA 3T96B 3ILUB 4EQ9A 1MH3A 5CMBA 3T9VA 2RF1A 4HTGA 3S9MC 1FQEA 1NNFA 3DELB 2YLNA 3D4CA 1URDA 2E1SA 1R9QA 4L17A 5H8NB 4X48A 1SW4A 2XX9A 4YMAA 5CRYA 2I4BA 4GL8A 4BDOA 4H8JA 1B7UA 1Y1ZA 1O64A 3PPRA 4F1UA 3HHFA 1D4NA 4GD5A 1B7HA 1PB8A 3OELA 4JWYA 1CE2A 4MF3A 3MZ1A 2I3WA 2AIXA 1USYH 2H99A 3MC2A 3UORA 2THIA 3PV0E 4OMBA 4G68A 1B51A 2I3VA 1XOCA 4BDNA 5I57B 2I49A 1IUDA 5H8HA 1N0TA 4F2QA 1LBCA 4C1UA 4ZE9A 5I58B 4XXUA 4ONYA 1O7TA 3QK6A 4G8MA 3HCQA 1SD3A 3CI8A 1B4ZA 1I6QA 2XXTA 4OERA 2V93A 1B05A 3R6UA 1UIVA 2VHAA 1DTGA 4LP2B 4DLDA 3C36A 4R9FA 2I58A 1EZOA 3RNNA 1AH5A 2ZYKA 1FW0A 4OWDA 1WVJA 1P99A 1PBQA 1MPCA 3E4RA 4ISUA 1MPBA 4FEBA 3IB1A 2F97A 4I1DA 5A5XA 1QUIA 3IK6B 3IR1A 1A54A 3KOTA 2VOZA 1POY1 5H8FA 3PPOA 2XXRA 3QSLA 3FVNA 2Y84A 4P0IA 2F78A 2DWAA 3UK4A 2F36A 2QS2A 3MVWA 3K6XA 3RGYA 2H9BA 2V3QA 1MG1A 1D3KA 4KCCA 2O6AA 3S9EA 5LOMA 3K00A 2F34A 4BDQA 4GIZA 3IOWA 2OWSA 3E9XA 1CB6A 3M3LA 5HPQA 4G68B 3Q29A 2OBGA 2AL5A 1LCFA 4NEDA 5K2XA 2I4CA 4IGTA 1OLCA 4EDPA 3H6TA 3K6UA 5AA4B 4AQ4A 1VR5A 2UVIA 1UTBA 4NWDA 1ZIUA 4H0WA 3O6GA 1ATGA 3MJNA 3HPIA 3RY3A 1ZJLA 3CSBA 3PD9A 4ZE8A 1FTKA 4XTCQ 1YPNA 1BKAA 4K3FA 4LZ7A 4RK2A 2XXQA 1L5TA 2BJJX 2ALUA 3U72A 2XXHA 2F6GA 2DXRA 5DT6A 4IY6A 2RCBA 1RYOA 1EZ9A 2Q88A 3VVDA 1FQBA 4MLVA 4RK9A 5H8FB 4OQOA 2FYIA 4ELOA 2G29A 2DWIA 4R6HA 4GWOA 2O7IA 1LFIA 4KYSA 4RJZA 5B70A 4EUOA 3FASA 3R26A 3QIMA 3CSGA 5TU0A 5HBCA 3TCGA 3IOVA 1B5IA 5ICTA 3GBBA 2F7CA 1NNPA 5BWJA 3R7XA 5KZTA 4H8IA 4LATA 4PQJA 1B7ZA 1H44A 2NUVA 1GV8A 1AMFA 3CG1A 1NKXA 1Q35A 4OTEA 3K02A 1VE4A 1N84A 2DQVA 3GZGA 4JWXA 1QKBA 3PUYE 3IJXB 4PFUA 1PB9A 1UTBB 1P1OA 2XXPA 3QAXA 4ELRA 2I0CA 3MZ9A 4YZZA 3V89B 2QPQA 3C32A 4YB5A 5H8QA 4QFOA 4ESXA 3O66A 5AA1A 2CMOA 3C9HA 4ZEKA 3MWBA 1URSA 3FVKA 2OK2A 4HS7A 3CR9A 4KQPA 3C31A 2XD2A 3EHTA 1F9BA 3LC8A 1PC3A 2XX7A 4LA9A 1H76A 5CMMA 3CFZA 4ESWA 1US4A 5I84A 1M5DA 2DSFA 3RPWA 3N6TA 3ZS6A 3M3KA 3B6QA 1US5A 3KG2A 2YJPA 1A99A 1LAXA 1JVXA 1Y20A 5HM4B 4DE8A 4FE8A 4JSOA 3VVEA 3LBSA 3EHSA 3B7DA 2UVGA 1QKAA 3UGWA 2ONRA 3U93A 4IGRA 2DE3A 1MY0A 3W9WA 1NL5A 2GHAA 1B2HA 3E13X 3EPEA 1MQGA 5DVIA 3JZJA 5B7DA 1P1WA 3H6VA 3TTKA 4UACA 1LCTA 5CM6A 1B6HA 3QYTA 3PPQA 5H8SA 4AB6A 1JEUA 4QRZA 3TTRA 2QMXA 1GR2A 2RC8A 3CG3A 3OOAA 3K1PA 4DXUA 5H8QB 1R6ZA 4FAJA 3T22A 4PE5B 3DP4A 4I9DA 3FVOA 1A55A 2UVJA 4F1YA 3H06B 4DZ1A 1FQFA 3H3GA 1DPPA 3KJTA 1JVYA 3ZSFA 1Z7ME 4DXBA 3B6TA 3PUZE 5AA3A 4FORA 3PMVA 4IO4A 3CFXA 2D5WA 3FIRA 1FQAA 2DOJA 2W7YA 5ITPA 1AOVA 4JSDA 3IJOB 1I69A 1B0HA 2F7BA 1SI0A 4H1XA 2Y7WA 4TLLB 3OENA 1B0LA 3C35A 1Z7NE 2O1LA 4PFWA 4F1VA 1JW4A 2B65A 4KI0E 4GF8A 3I5OA 1II5A 3FZVA 3FD3A 2HZKA 1SQYA 5FHNA 4GL0A 4F22A 1IZ1A 1MRPA 4FJPA 4LUBA 3SEXA 3MP8A 1N7XA 1SW1A 4GRKA 1A8EA 3MP1A 1XHYA 4BDRA 1MXWA 4XKNA 4YKJA 3K2DA 3EN3A 2DYXA 4ZECA 3IB0A 4NF4A 4PP0A 1UQWA 1T0KA 5F1QA 2RCAA 4WKMA 3C4MA 3SDFA 4FATA 3OO7A 4KR5A 2NOOA 3MVXA 3GLBA 1N3XA 1O63A 1PEBA 1EH3A 1FTMA 3S9LC 3PD8A 4JWOA 3K6VA 1B3GA 1BTJA 2Y7IA 5L9OA 5JTYA 2OCUA 4AB5A 4NE4A 5F7VA 3PU5A 4P11A 3KZGA 4FEDA 3EHUA 4H5FA 3CIJA 1SDXA 3OMBA 1B5HA 4OYVA 1DMBA 4RY1A 4Q8RA 1Y9UA 4OHNA 2AL4A 2XXIA 3PPPA 4ZEIA 1POTA 1QJMA 3PGFA 1P1NA 4JXIA 5I2KB 2KLFA 4PFYA 4WEDA 3FJGA 4MH5A 4OEUA 1Y4CA 2QRYA 4F31B 4X9TA 3TDJA 4GOTA 3KSXA 1ANFA 3A3CA 3FATA 4U4SA 2Z8FA 2D3IA 4ZEFA 2V84A 5CI5A 1B3LA 1S7YA 3HV1A 5ITOA 2NWJA 1AIVA 1S9TA 3K6WA 4C0RA 1MY2A 2Y7PA 3SEVA 2A5TA 2Z22A 2H98A 5EHMA 3PUWE 3L6HA 1H3DA 2V25A 4WXJA 1UTHA 4NF4B 4EF2A 4IB2A 4LZ8A 5I2NA 4YMBA 3K4UA 1M5EA 1USYE 1MPDA 2PVUA 4NF5A 4UA8A 3OD7A 2O68A 3TUSA 4PETA 5H8HB 4JBZA 3VXBA 3VDFA 3FXQA 3FV1A 3O6HA 4Q5TA 4E0WA 3SEUA 1QUKA 1M5CA 4QSCA 3TAJA 1SI1A 2O51A 4TQUQ 3A3UA 4P0GA 2ZXTA 3HO7A 1MXVA 2F35A 4POXA 1BLFA 4ZEDA 1QVSA 1YAEA 1DTZA 2HAVA 2DE2A 3EF7A 1KWHA 4YU0A 2B3BA 2RC7A 1ZTYA 3IOUA 1RYXA 1B9JA 3ECRA 4HCYA 4HW8A 4YKPA 2VGQA 2PMSA 2DXYA 1TT1A 3MUQA 3RQTA 3FJ7A 1OQGA 5A5XB 1IITA 3TFLA 2HXWA 4NF6A 4QSDA 5DVFA 3KN7A 1NNTA 3PMWA 4KPTA 1GGGA 1VSOA 4GLIA 3ODBA 2XXUA 3MVYA 1LB8A 2R6GE 2V3TA 3T93B 3V5AA 5FTIA 3IX1A 2O7UA 5AA2A 1XC1A 1FQCA 2A5TB 3H7MA 3OXNA 2X7QA 1UTHB 1JQFA 3H6UA 5CMCA 4LQ2A 5I2NB 2IEEA 4KHZE 2F5XA 2R71A 2ZYOA 3IOTA 5TPAA 4OZ9A 3LSLA 1PDAA 3B6WA 1IXHA 4NF5B 4O3BA 3TKDA 3KSJA 3U1OA 2XXYA 3OSRA 3UN6A 3IO6A 1MQJA 1HSEA 3TQWA 1I6AA 4WEPA 1B1HA 1MM7A 5BUUA 4U21A 3FVGA 5L9SA 3SEWA 1NNKA 1A40A 1Y3QA 4GFRA 5FHOA 4YKIA 1B3HA 4XKPA 3TYHA 5L8DA 3TTLA 4U4XA 1LGBC 4ELPA 2ZNUA 2Q2AA 2PBWA 2R9JA 4E0XA 3O28A 1H45A 2ZYNA 4QFPA 1B58A 3Q28A 1IQ7A 1A7LA 2P0SA 1N76A 1I6BA 1DPEA 2DS9A 2V3UA 4IO7A 4NF6B 1RKMA 4NMYA 1LFHA 3FXRA 2F6PA 3WAEA 1DOTA 4KYDA 2RC9A 1QUJA 2PT2A 2Q89A 4Z0IA 2IA4A 1LAGE 2Z8EA
chains in the Genus database with same CATH superfamily
3E78A 2V4CA 4GVOA 3U92A 5AA2B 3T0JA 4EQ7A 3FJMA 5IZZA 3MBPA 4EQBA 4U1ZA 1NUWA 5ELVA 3KBZA 3OO9A 2WBDA 3Q26A 1NH8A 3UP9A 3TTNA 2E0SA 1OVTA 2X26A 5TPAB 4PDHA 4KCDA 1FPDA 2O69A 3MW0A 3USDA 1Y1MA 1IMFA 1Q1KA 3N94A 3RTWB 4OEVA 2I0BA 4OETA 2HFBA 1B52A 4N07A 3MPKA 5K2YA 4MLQA 3OO8A 3CVGA 1A8FA 3CRBA 3TPAA 4MFIA 4TOZA 1FTLA 1MDQA 5JK4A 3QUFA 1M5FA 1LB9A 4IO5A 1B1XA 4U22A 4MMPA 4YICA 1ZBMA 3ONMA 3KN3A 1DSNA 3W15C 3FXBA 4H5GA 5CBRA 1NV0A 1B32A 1M5BA 1VFEA 1EU8A 1IXIA 3LSXA 4XIGQ 2HQ0A 3VV5A 2XX8A 4YB6A 2Q9TA 3Q25A 2WYKA 4ZZEA 3O6IA 2ABHA 3VVFA 5IZ3A 3PUXE 4IO6A 4EF1A 2UVHA 3CFLA 3G3IA 4I40A 2FNCA 5FHMA 5CMKA 1B40A 4NG7A 4BLAA 1WODA 3KOSA 4GX3A 3T66A 2VP1A 3BBRA 4MCOA 3MSTA 5ICQA 1LBWA 1MXZA 3RLFE 3ILTB 2UYEA 1MDP1 1B4HA 2DP8A 1IIWA 1Y4TA 1SYIA 3TODA 1MQIA 2H5YA 1FPKA 1JNFA 3HN0A 1BK4A 4P3LA 4OVRA 2OLBA 1IMDA 3OSQA 4NF0A 5KDTA 1TFAA 3W9VA 2QS4A 5TP9A 2GH9A 1SW5A 1NV1A 1TFDA 1YCJA 2ESNA 3N26A 3K01A 4R9GA 5AE4A 5I59A 3F11A 1FTOA 4PBQA 4OFLA 1ZKBA 1IMAA 1LBVA 2REJA 4I62A 3RT8A 4XKQA 1LAFE 2HZLA 2OWTA 3Q27A 2VD2A 1AL3A 1XT8A 4O3CA 2HAUA 2WKYA 1D9VA 1ZMGA 4O8MA 3A09A 1G0HA 1KA1A 3O97A 3UIFA 3VLUA 3IL1B 4G2ZA 2ZZXA 4POWA 2XD3A 3VLWA 1MY3A 2Y7RA 1S50A 1GVCA 4DI4B 3IB2A 4G8NA 1B5JA 2PFZA 4AS4A 2WYPA 5EHSA 1MS7A 2AYSA 4G68C 3RN8A 3FUZA 1B3EA 4YKKA 3U8QA 3EQ1A 1EZPA 1FCKA 4ZS9A 1FBHA 1N04A 4P1LA 1N3WA 2DWJA 5AA4A 1ELJA 3C33A 3TEPA 4XKRA 4QXDA 5T3JA 1TXFA 1OQHA 4FIMA 1K9YA 1YTVA 4PFRA 1B3FA 1NMUA 1LSTA 3S4UA 2WEFA 3MVZA 4QSEA 4P9KA 1LAHE 4N6PA 3TZAA 3GYYA 4LQ5A 1URGA 1QW0A 2HCAA 3GXAA 2A5SA 3HHGA 3IO4A 1RDYA 1HSJA 1TWYA 4F3SA 1FPLA 5AA2D 3FXUA 3ZKKA 4U1OA 5KDTB 4RYAA 2M8CA 5IKBA 3WAFA 2UXAA 2OX3A 4DCXA 3P7IA 3T9HB 5J1DA 4EXLA 5TP9B 1NV6A 4X1DA 3H03A 1RDXA 1SVXB 1MY4A 3VFJA 2Q2CA 5DYHA 1WDNA 2DVCA 4R2BA 1XVXA 4X1BA 4LONB 1UIUA 3QUJA 5I59B 2PYYA 4NGUA 3E3KA 3IORA 2OZZA 3MQ9A 4XFEA 1DCUA 5EQ8A 4PFBA 1XS5A 2DWHA 2D21A 2YPNA 3G3GA 2ZMBA 3IAZA 4F39A 2NXOA 1IMBA 2O84X 3PMXA 4PFTA 2VD3A 3MAMA 2ONKE 1J1NA 3H6WA 4YB7A 5IZ1A 2F8DA 2QS1A 4H65A 4R72A 5JTYB 1NV2A 4DIGA 1MXXA 3TMGA 1JW1A 4YAHX 4HE2A 4GXAA 3BKIB 1GTKA 4N91A 1K9ZA 2DE4A 1R9LA 1INPA 2HHMA 3G7WA 3G3HA 3I6VA 4ZEBA 2ZYMA 2ZNTA 1OMPA 3UA8A 4G4PA 1MQDA 4O3AA 4MNPA 3RTFB 3LSFB 2GRVA 3QMFA 3DLNA 4ZZAA 4LN5A 4R6KA 2L5VA 3S9NC 2OWZA 5EQ7A 4DI3D 3L6GA 1MQHA 2DVZA 4DXCA 5ESYA 4DDDA 3LUYA 3KFMA 4F29A 1P1QA 1JEVA 4BDMA 4IO3A 2Z8DA 2FHYA 3G3KA 2PFYA 4QF9A 3U94A 3VXCA 3JYRA 3BFUA 4KFQA 2B3FA 3A29A 2X7PA 3MZBA 3S2VA 1YYZA 5J16A 4KD5A 1VFDA 3KGCA 4F2OA 1NUZA 5JEIA 4THIA 5EYFA 3LSWA 3C34A 2H25A 4MEVA 1ZLQA 3LR1A 3QXMA 1LFGA 3U65A 2XWVA 3O2AA 2ANJA 2CEYA 1JW5A 2QVVA 1FPEA 1P1UA 3E79A 1FQDA 3RT6B 1NV7A 4OVJA 1SBPA 5I56A 4OVPA 4QFNA 1SW2A 4FECA 4N6KA 1IXGA 1H43A 5DTBA 2H4IA 1NH7A 1BIYA 3SESA 4BDLA 4Z7EA 2FA7A 4F18A 1R1NA 4NF8A 3VLVA 4F19A 4NWCA 3SEYA 2XXWA 3M3FA 3DP6A 4PAFA 4QHQA 4ELQA 2QSXA 1OIBA 4U2RA 3ZKLA 3SERA 4QFLA 4TLMB 4QFKA 3V83A 3HSTA 4RA1A 3EKIA 3MPLA 2XWOA 4O94A 2Y5KA 2GFEA 4U23A 3VE1B 2P1SA 3KJ7A 2Z23A 5DEXA 1FPBA 2G93A 3D4GA 4N13A 4RNSA 3KBRA 2NVUB 5DVJA 1MY1A 4F3BA 3K1MA 3DM0A 2O1MA 3K1NA 2ONSA 4N15A 1JETA 4Q30B 4G8HA 4R75A 5IAIA 4HCWA 2RKMA 5ISUA 2QMWA 4PTKA 2Y7KA 1IEJA 3K0VA 4R2FA 5KCJA 3TCHA 1PB7A 5CC2A 1SYHA 1LLSA 3H4ZA 2Q8JA 3M8UA 3O29A 2PX1A 3THIA 2P2AA 4F3PA 1DK4A 2CZLA 3T9UA 1D9YA 5CBSA 4ND9A 3TCFA 3RPLA 1OLAA 4PAIA 1Y3NA 4ZDMA 3OEKA 4R74A 1OVBA 4H6DA 3FGSA 1YXIA 2I6EA 2RINA 5FTHA 2XWIA 1FTAA 1ZU0A 3BFTA 4H67A 3N5LA 5I56B 4OESA 4JVCA 3T9XB 3O9PA 4MX6A 3DP8A 2QL3A 5LTCA 4NQ8A 5ET8A 5H8NA 4DCYA 2UYFA 2REGA 1MXYA 4NF8B 4JDFA 3PPNA 4ECFA 2PT1A 2F7AA 4M4GA 3PUVE 2JJKA 2GHBA 3KN8A 4IO2A 1HSLA 3SETA 4GQOA 1MXUA 4EXKA 1NFTA 3OO6A 3G3FA 4HE1A 4NTLA 4G77A 4RPNA 2QJEA 4F3GA 3I3VA 4OFOA 2I48A 3KEIA 2R8TA 5DEXB 3TQLA 1MH4A 2QS3A 3G3JA 4M1VA 3TELA 4GXSB 1QULA 4PBHA 5L9MA 1FJ9A 1FPIA 3SKPA 3FV2A 2LAOA 1LBBA 4GWUA 4LZ5A 4OVQA 1Y3PA 3GBAA 5I57A 1IXCA 3OEMA 4R6YA 5KCJB 4R73A 5I58A 2XXXA 4KYEA 3AXFA 4GX4A 1D9QA 1BP5A 2XHDA 3V8XB 3N6UA 3MP6A 1B46A 4NAPA 5IM2A 4LVQA 1N7WA 3RUMA 3RPLB 1PBPA 4IY5A 4I8CA 5F24A 1NUXA 2XXVA 4MBPA 4C1TA 1FTJA 1XVYA 5I2KA 2HEUA 1MM6A 4Q0CA 5M2VA 4OXVA 3JV9A 2ZNSA 4UABA 4JB7A 2OJTA 4OENA 4RXLA 4RPOA 4OFJA 3TTMA 3T96B 3ILUB 4EQ9A 1MH3A 5CMBA 3T9VA 2RF1A 4HTGA 3S9MC 1FQEA 1NNFA 3DELB 2YLNA 3D4CA 1URDA 2E1SA 5I5PA 1R9QA 4L17A 2XXKA 5LDZA 5H8NB 4X48A 1SW4A 2FIXA 2XX9A 1LBYA 4YMAA 4AS5A 5CRYA 2WBBA 2I4BA 4GL8A 4PAKA 4BDOA 4H8JA 1B7UA 1Y1ZA 1O64A 2HXRA 3PPRA 4F1UA 3HHFA 4IR8A 1D4NA 4GD5A 1B7HA 1PB8A 3OELA 4JWYA 1CE2A 4MF3A 3MZ1A 2I3WA 5EYHA 2AIXA 1USYH 4PGPA 2H99A 3MC2A 3UORA 2THIA 3PV0E 1IMCA 4GWWA 4OMBA 5IZ3B 1FSAA 4G68A 1B51A 2I3VA 1XOCA 4BDNA 5I57B 2I49A 4GWSA 1IUDA 5H8HA 1N0TA 4F2QA 1LBCA 4C1UA 4ZE9A 5I58B 4XXUA 3NOHA 4ONYA 1O7TA 1QGXA 3QK6A 4G8MA 3HCQA 1SD3A 4P56A 3CI8A 1B4ZA 1I6QA 2XXTA 4N4UA 4OERA 2V93A 1B05A 3R6UA 1UIVA 2VHAA 1DTGA 4XF5A 4LP2B 4DLDA 3C36A 4NX1A 1EYJA 4R9FA 4MJOA 2I58A 1EZOA 3RNNA 1AH5A 2ZYKA 5A5LA 4MNIA 3KC1A 1FW0A 3HFUA 4OWDA 1WVJA 1P99A 1PBQA 1G0IA 1MPCA 4NN3A 3E4RA 4ISUA 1MPBA 4FEBA 3IB1A 2F97A 4I1DA 5A5XA 1QUIA 2Y5LA 1LBZA 3IK6B 3IR1A 1A54A 1NV4A 3KOTA 1NUYA 2VOZA 1POY1 5H8FA 1EYIA 1NV5A 3PPOA 2XXRA 3QSLA 3FVNA 2Y84A 3KC0A 4P0IA 2F78A 2DWAA 3UK4A 2F36A 2QFLA 2QS2A 3BIGA 3MVWA 3K6XA 3RGYA 2H9BA 2V3QA 1MG1A 1D3KA 4KCCA 2O6AA 3S9EA 5LOMA 3K00A 2F34A 4BDQA 2BJIA 4GIZA 3IOWA 2OWSA 3E9XA 1CB6A 3M3LA 5HPQA 2Q74A 4G68B 3Q29A 2OBGA 2AL5A 1LCFA 4NEDA 5K2XA 2I4CA 4IGTA 1OLCA 4EDPA 3H6TA 3K6UA 1IMEA 2DDKA 5AA4B 4AQ4A 1NI9A 1VR5A 2UVIA 1UTBA 2Q8MA 5EYGA 4NWDA 1ZIUA 4H0WA 3O6GA 2KQZA 1ATGA 3MJNA 3HPIA 3RY3A 1ZJLA 3CSBA 1FRPA 3PD9A 4ZE8A 1FTKA 1FJ6A 4XTCQ 1YPNA 1BKAA 4K3FA 4LZ7A 4RK2A 2XXQA 1L5TA 2BJJX 2ALUA 3U72A 2XXHA 2F6GA 2DXRA 1VDWA 4I3EA 1CNQA 5DT6A 4IY6A 2RCBA 3B50A 1RYOA 1EZ9A 2Q88A 3VVDA 1FQBA 4MLVA 4RK9A 4O7MA 5H8FB 4OQOA 2FYIA 4ELOA 2G29A 2DWIA 4R6HA 4GWOA 2O7IA 1LFIA 4KYSA 4RJZA 5B70A 4EUOA 3FASA 3R26A 2XA5A 3QIMA 3CHGA 2GQ1A 3CSGA 4GBVA 4NHBA 5HBCA 5TU0A 5EQ9A 3TCGA 1XI6A 3IOVA 1B5IA 5ICTA 3GBBA 2F7CA 1NNPA 5BWJA 3R7XA 5KZTA 2PCRA 4H8IA 4LATA 4PQJA 1B7ZA 1H44A 2NUVA 1GV8A 1AMFA 3CG1A 1NKXA 1Q35A 4OTEA 3K02A 1VE4A 1N84A 2DQVA 3GZGA 3LUZA 1QKBA 4JWXA 3PUYE 3IJXB 4PFUA 1PB9A 1UTBB 4GBWA 1P1OA 2XXPA 3QAXA 4ELRA 2I0CA 3MZ9A 4YZZA 3V89B 3ROJA 2QPQA 3C32A 4YB5A 5H8QA 4QFOA 4ESXA 3O66A 5AA1A 2CZKA 2CMOA 3C9HA 3B8BA 4ZEKA 3MWBA 1URSA 3FVKA 2OK2A 4HS7A 3CR9A 4KQPA 3C31A 2XD2A 3EHTA 1F9BA 3LC8A 5ET5A 1PC3A 2XX7A 4LA9A 1H76A 3BIHA 5CMMA 3CFZA 4ESWA 1US4A 4GWXA 1M5DA 2DSFA 3RPWA 5I84A 3N6TA 3ZS6A 4PFIA 3M3KA 3B6QA 4XEQA 1US5A 3KG2A 2YJPA 1A99A 1LAXA 1JVXA 1Y20A 5HM4B 5EQAA 4DE8A 2F3DA 4FE8A 4JSOA 3VVEA 3LBSA 3EHSA 4OA4A 3B7DA 2UVGA 1QKAA 2WX9A 3UGWA 2ONRA 3U93A 2QVUA 4IGRA 1FBCA 2DE3A 1MY0A 1SPIA 3W9WA 1NL5A 2GHAA 4QBAA 2FBPA 1B2HA 3E13X 3EPEA 1MQGA 5DVIA 3JZJA 5B7DA 1P1WA 2MKZA 3H6VA 3TTKA 4UACA 1LCTA 5CM6A 1B6HA 4PCDA 3QYTA 3PPQA 5H8SA 4AB6A 2ZZVA 1JEUA 4QRZA 3TTRA 2QMXA 4H46A 4HE0A 1GR2A 2RC8A 3CG3A 3OOAA 3K1PA 4DXUA 5H8QB 1R6ZA 4FAJA 3T22A 3ISPA 4JVDA 4PE5B 3DP4A 4I9DA 2CZHA 2HPGA 3FVOA 1A55A 4P8BA 2UVJA 4F1YA 3H06B 1KA0A 4DZ1A 1FQFA 3H3GA 1DPPA 4PDDA 3KJTA 1JVYA 3ZSFA 1NV3A 2KR0A 1Z7ME 4DXBA 3B6TA 3PUZE 5AA3A 3MYUA 4FORA 3PMVA 4IO4A 3CFXA 2D5WA 3FIRA 1FQAA 2DOJA 2W7YA 5ITPA 3FBPA 1Q9DA 1AOVA 4JSDA 1RDZA 3IJOB 1I69A 1B0HA 2F7BA 1SI0A 4H1XA 2Y7WA 4TLLB 3OENA 1B0LA 2VPNA 4GWYA 3C35A 1KZ8A 1Z7NE 4O7IA 2O1LA 4PFWA 4F1VA 1JW4A 2B65A 4KI0E 4GF8A 3I5OA 1II5A 1AWBA 3FZVA 3FD3A 2HZKA 1SQYA 5FHNA 4GL0A 4MNCA 4F22A 1IZ1A 1MRPA 5ET7A 4FJPA 4LUBA 2P3NA 3SEXA 3MP8A 1FBEA 1N7XA 4N6DA 1SW1A 4GRKA 1A8EA 3MP1A 4I3YA 1XHYA 4MHFA 4BDRA 1MXWA 4XKNA 4YKJA 3K2DA 3EN3A 2DYXA 4MIJA 3IB0A 4ZECA 4NF4A 4PP0A 1UQWA 3T1BA 1T0KA 5F1QA 2RCAA 4WKMA 3C4MA 3SDFA 4FATA 3OO7A 4KR5A 2NOOA 3MVXA 3GLBA 1N3XA 1O63A 4HXVA 1PEBA 1EH3A 1FTMA 3S9LC 3PD8A 4JWOA 3K6VA 1B3GA 5I7IA 1FPJA 1BTJA 2Y7IA 3LV0A 5L9OA 5JTYA 2OCUA 4AB5A 4NE4A 4OVSA 5F7VA 1FBPA 3PU5A 4GX6A 4X04A 4P11A 3KZGA 4FEDA 4X8RA 3EHUA 4H5FA 2VT5A 3CIJA 1SDXA 3OMBA 4MAGA 1B5HA 4OYVA 1DMBA 4RY1A 4Q8RA 1Y9UA 4OHNA 2AL4A 2XXIA 3PPPA 4ZEIA 5ET6A 1POTA 1QJMA 3PGFA 1P1NA 4JXIA 5I2KB 2KLFA 2B4MA 4PFYA 4WEDA 3FJGA 2XWKA 3SZPA 4MH5A 4OEUA 4GWZA 1Y4CA 2QRYA 4F31B 4X9TA 3TDJA 4GOTA 3KSXA 5I3SA 1YZ0A 1FPGA 1ANFA 3A3CA 5FBPA 3FATA 4U4SA 2Z8FA 4P47A 2D3IA 4ZEFA 2V84A 5CI5A 3IFCA 1B3LA 1S7YA 3HV1A 5ITOA 2NWJA 3IFAA 2ZZWA 1AIVA 1S9TA 3K6WA 4G61A 4C0RA 1MY2A 2Y7PA 3SEVA 4N81A 2A5TA 2Z22A 2H98A 5EHMA 3PUWE 4OVTA 3L6HA 1H3DA 2V25A 2FVZA 4WXJA 1UTHA 4NF4B 4EF2A 4IB2A 4LZ8A 5I2NA 4YMBA 3K4UA 1M5EA 1USYE 1FPFA 1MPDA 2PVUA 4NF5A 4P1EA 4PC9A 4UA8A 3OD7A 2O68A 3TUSA 4PETA 5H8HB 4JBZA 3VXBA 3VDFA 3FXQA 3FV1A 3O6HA 1FBFA 4Q5TA 4E0WA 3SEUA 1QUKA 1M5CA 4QSCA 3TAJA 1SI1A 2O51A 1LEVA 4TQUQ 3A3UA 4P0GA 2ZXTA 3HO7A 1MXVA 2F35A 4POXA 1BLFA 4ZEDA 3D1RA 1QVSA 1YAEA 1DTZA 2HAVA 2DE2A 2QVRA 3EF7A 3RYDA 1KWHA 4YU0A 2F3BA 2B3BA 2RC7A 1ZTYA 3IOUA 1RYXA 1B9JA 3ECRA 4HCYA 4HW8A 4YKPA 2VGQA 2PMSA 2DXYA 1TT1A 3MUQA 2P3VA 3RQTA 3FJ7A 1OQGA 5A5XB 1IITA 3TFLA 4N17A 2HXWA 4NF6A 4PGNA 4QSDA 5DVFA 3KN7A 1NNTA 3PMWA 4KPTA 1GGGA 1VSOA 4GLIA 3ODBA 2XXUA 3MVYA 1LB8A 4JVIA 2R6GE 1FBDA 2V3TA 3T93B 3V5AA 5FTIA 3IX1A 2O7UA 5AA2A 1XC1A 5DW8A 1FQCA 2A5TB 3H7MA 3OXNA 4FBPA 2CZIA 2X7QA 1UTHB 1JQFA 3H6UA 5CMCA 2FIEA 4LQ2A 5I2NB 2IEEA 4KHZE 2F5XA 1LBXA 2R71A 2ZYOA 3IOTA 5TPAA 4OZ9A 3LSLA 4N8YA 1PDAA 3B6WA 1IXHA 4NF5B 4O3BA 3TKDA 1DBZA 3KSJA 3U1OA 2XXYA 3OSRA 3UN6A 3IO6A 1MQJA 1HSEA 3TQWA 4PE3A 1I6AA 4WEPA 1B1HA 1MM7A 5BUUA 4N8GA 4U21A 3FVGA 5L9SA 3SEWA 1NNKA 1A40A 1Y3QA 4GFRA 5FHOA 4YKIA 1B3HA 4XKPA 3TYHA 4PF6A 3PTYA 5L8DA 5IGAA 3TTLA 4U4XA 1LGBC 4ELPA 2ZNUA 2Q2AA 2PBWA 2R9JA 1FBGA 4E0XA 1JP4A 3O28A 2VPOA 4OANA 1H45A 2ZYNA 4QFPA 4H45A 1B58A 4PF8A 3Q28A 1IQ7A 1A7LA 2B4LA 2P0SA 1N76A 1I6BA 1DPEA 2DS9A 2V3UA 4IO7A 1EYKA 4NF6B 4KXPA 1RKMA 4NMYA 1LFHA 3FXRA 2F6PA 3WAEA 1DOTA 2CEXA 4KYDA 2RC9A 1QUJA 2PT2A 2Q89A 4Z0IA 2IA4A 1LAGE 2Z8EA
chains in the Genus database with same CATH topology
4GVOA 3U92A 5AA2B 4EQ7A 3FJMA 3MBPA 4EQBA 4U1ZA 5ELVA 3OO9A 3Q26A 1NH8A 3UP9A 3TTNA 2E0SA 1OVTA 2X26A 5TPAB 4KCDA 2O69A 3MW0A 3USDA 1Y1MA 1Q1KA 3N94A 3RTWB 4OEVA 2I0BA 4OETA 2HFBA 1B52A 4N07A 3MPKA 5K2YA 4MLQA 3OO8A 3CVGA 1A8FA 3CRBA 3TPAA 4MFIA 4TOZA 1FTLA 1MDQA 5JK4A 3QUFA 1M5FA 1LB9A 4IO5A 1B1XA 4U22A 4YICA 1ZBMA 3ONMA 3KN3A 1DSNA 3W15C 4H5GA 5CBRA 1B32A 1M5BA 1VFEA 1EU8A 1IXIA 3LSXA 4XIGQ 2HQ0A 3VV5A 2XX8A 4YB6A 2Q9TA 3Q25A 4ZZEA 3O6IA 2ABHA 3VVFA 3PUXE 4IO6A 4EF1A 2UVHA 3CFLA 3G3IA 2FNCA 5FHMA 5CMKA 1B40A 4BLAA 1WODA 3KOSA 3T66A 2VP1A 3BBRA 5ICQA 1MXZA 3RLFE 3ILTB 2UYEA 1MDP1 1B4HA 2DP8A 1IIWA 1Y4TA 1SYIA 3TODA 1MQIA 2H5YA 1JNFA 3HN0A 2OLBA 3OSQA 5KDTA 1TFAA 3W9VA 2QS4A 5TP9A 2GH9A 1SW5A 1TFDA 1YCJA 2ESNA 3N26A 3K01A 4R9GA 5AE4A 5I59A 3F11A 1FTOA 4OFLA 1ZKBA 2REJA 4I62A 3RT8A 4XKQA 1LAFE 2HZLA 2OWTA 3Q27A 2VD2A 1AL3A 1XT8A 4O3CA 2HAUA 2WKYA 1D9VA 1ZMGA 3A09A 3O97A 3UIFA 3VLUA 3IL1B 4G2ZA 4POWA 2XD3A 3VLWA 1MY3A 2Y7RA 1S50A 1GVCA 3IB2A 4G8NA 1B5JA 5EHSA 1MS7A 2AYSA 4G68C 3RN8A 3FUZA 1B3EA 4YKKA 3U8QA 3EQ1A 1EZPA 1FCKA 4ZS9A 1N04A 1N3WA 2DWJA 5AA4A 1ELJA 3C33A 3TEPA 4XKRA 1TXFA 1OQHA 4FIMA 1YTVA 1B3FA 1NMUA 1LSTA 3S4UA 3MVZA 4QSEA 1LAHE 4N6PA 3TZAA 4LQ5A 1URGA 1QW0A 2HCAA 3GXAA 2A5SA 3HHGA 3IO4A 1HSJA 1TWYA 4F3SA 5AA2D 3FXUA 3ZKKA 4U1OA 5KDTB 4RYAA 2M8CA 5IKBA 3WAFA 2UXAA 4DCXA 3P7IA 3T9HB 5J1DA 4EXLA 5TP9B 4X1DA 3H03A 1SVXB 1MY4A 3VFJA 2Q2CA 5DYHA 1WDNA 2DVCA 4R2BA 1XVXA 4X1BA 4LONB 1UIUA 3QUJA 5I59B 2PYYA 3E3KA 3IORA 2OZZA 3MQ9A 1XS5A 2DWHA 2D21A 2YPNA 3G3GA 2ZMBA 3IAZA 4F39A 2NXOA 2O84X 3PMXA 4PFTA 2VD3A 3MAMA 2ONKE 1J1NA 3H6WA 4YB7A 2F8DA 2QS1A 4H65A 4R72A 5JTYB 4DIGA 1MXXA 3TMGA 1JW1A 4YAHX 4GXAA 3BKIB 1GTKA 2DE4A 1R9LA 3G7WA 3G3HA 3I6VA 4ZEBA 2ZYMA 2ZNTA 1OMPA 3UA8A 4G4PA 1MQDA 4O3AA 3RTFB 3LSFB 2GRVA 3DLNA 4ZZAA 4R6KA 3S9NC 3L6GA 1MQHA 2DVZA 4DXCA 4DDDA 3LUYA 3KFMA 4F29A 1P1QA 1JEVA 4BDMA 4IO3A 2Z8DA 3G3KA 4QF9A 3U94A 3VXCA 3JYRA 3BFUA 4KFQA 2B3FA 2X7PA 3MZBA 3S2VA 4KD5A 1VFDA 3KGCA 4F2OA 5JEIA 4THIA 5EYFA 3LSWA 3C34A 2H25A 1ZLQA 3LR1A 3QXMA 1LFGA 3O2AA 2ANJA 1JW5A 1P1UA 1FQDA 3RT6B 4OVJA 1SBPA 5I56A 4QFNA 1SW2A 4FECA 1IXGA 1H43A 5DTBA 2H4IA 1NH7A 1BIYA 3SESA 4BDLA 4Z7EA 2FA7A 4F18A 1R1NA 4NF8A 3VLVA 4F19A 4NWCA 3SEYA 2XXWA 3M3FA 3DP6A 4QHQA 4ELQA 2QSXA 1OIBA 4U2RA 3ZKLA 3SERA 4QFLA 4TLMB 4QFKA 3V83A 3HSTA 4RA1A 3MPLA 2GFEA 4U23A 3VE1B 2P1SA 3KJ7A 2Z23A 5DEXA 2G93A 3D4GA 4N13A 4RNSA 3KBRA 2NVUB 5DVJA 1MY1A 4F3BA 3K1MA 3DM0A 2O1MA 3K1NA 2ONSA 1JETA 4Q30B 4G8HA 4R75A 5IAIA 4HCWA 2RKMA 5ISUA 2QMWA 2Y7KA 1IEJA 3K0VA 4R2FA 5KCJA 3TCHA 1PB7A 5CC2A 1SYHA 1LLSA 3H4ZA 2Q8JA 3M8UA 3O29A 2PX1A 3THIA 2P2AA 4F3PA 2CZLA 3T9UA 1D9YA 5CBSA 4ND9A 3TCFA 1OLAA 4ZDMA 1Y3NA 3OEKA 4R74A 1OVBA 4H6DA 3FGSA 2I6EA 2RINA 5FTHA 1ZU0A 3BFTA 4H67A 3N5LA 5I56B 4OESA 3T9XB 3O9PA 3DP8A 2QL3A 5H8NA 4DCYA 2UYFA 2REGA 1MXYA 4NF8B 4JDFA 3PPNA 4ECFA 2PT1A 2F7AA 4M4GA 3PUVE 2GHBA 3KN8A 4IO2A 1HSLA 3SETA 4GQOA 1MXUA 4EXKA 1NFTA 3OO6A 3G3FA 4NTLA 4G77A 4RPNA 4F3GA 2QJEA 3I3VA 4OFOA 2I48A 3KEIA 5DEXB 3TQLA 1MH4A 2QS3A 3G3JA 4M1VA 3TELA 4GXSB 1QULA 5L9MA 3SKPA 3FV2A 2LAOA 1LBBA 4LZ5A 1Y3PA 3GBAA 5I57A 1IXCA 3OEMA 4R6YA 5KCJB 4R73A 5I58A 2XXXA 4KYEA 3AXFA 1BP5A 2XHDA 3V8XB 3N6UA 3MP6A 1B46A 4LVQA 1N7WA 3RUMA 1PBPA 4IY5A 4I8CA 2XXVA 4MBPA 4C1TA 1FTJA 1XVYA 5I2KA 2HEUA 1MM6A 4Q0CA 5M2VA 4OXVA 3JV9A 2ZNSA 4JB7A 2OJTA 4OENA 4RXLA 4RPOA 4OFJA 3TTMA 3T96B 3ILUB 4EQ9A 1MH3A 5CMBA 3T9VA 2RF1A 4HTGA 3S9MC 1FQEA 1NNFA 3DELB 2YLNA 3D4CA 1URDA 2E1SA 1R9QA 4L17A 5H8NB 4X48A 1SW4A 2XX9A 4YMAA 5CRYA 2I4BA 4GL8A 4BDOA 4H8JA 1B7UA 1Y1ZA 1O64A 3PPRA 4F1UA 3HHFA 1D4NA 4GD5A 1B7HA 1PB8A 3OELA 4JWYA 1CE2A 4MF3A 3MZ1A 2I3WA 2AIXA 1USYH 2H99A 3MC2A 3UORA 2THIA 3PV0E 4OMBA 4G68A 1B51A 2I3VA 1XOCA 4BDNA 5I57B 2I49A 1IUDA 5H8HA 1N0TA 4F2QA 1LBCA 4C1UA 4ZE9A 5I58B 4XXUA 4ONYA 1O7TA 3QK6A 4G8MA 3HCQA 1SD3A 3CI8A 1B4ZA 1I6QA 2XXTA 4OERA 2V93A 1B05A 3R6UA 1UIVA 2VHAA 1DTGA 4LP2B 4DLDA 3C36A 4R9FA 2I58A 1EZOA 3RNNA 1AH5A 2ZYKA 1FW0A 4OWDA 1WVJA 1P99A 1PBQA 1MPCA 3E4RA 4ISUA 1MPBA 4FEBA 3IB1A 2F97A 4I1DA 5A5XA 1QUIA 3IK6B 3IR1A 1A54A 3KOTA 2VOZA 1POY1 5H8FA 3PPOA 2XXRA 3QSLA 3FVNA 2Y84A 4P0IA 2F78A 2DWAA 3UK4A 2F36A 2QS2A 3MVWA 3K6XA 3RGYA 2H9BA 2V3QA 1MG1A 1D3KA 4KCCA 2O6AA 3S9EA 5LOMA 3K00A 2F34A 4BDQA 4GIZA 3IOWA 2OWSA 3E9XA 1CB6A 3M3LA 5HPQA 4G68B 3Q29A 2OBGA 2AL5A 1LCFA 4NEDA 5K2XA 2I4CA 4IGTA 1OLCA 4EDPA 3H6TA 3K6UA 5AA4B 4AQ4A 1VR5A 2UVIA 1UTBA 4NWDA 1ZIUA 4H0WA 3O6GA 1ATGA 3MJNA 3HPIA 3RY3A 1ZJLA 3CSBA 3PD9A 4ZE8A 1FTKA 4XTCQ 1YPNA 1BKAA 4K3FA 4LZ7A 4RK2A 2XXQA 1L5TA 2BJJX 2ALUA 3U72A 2XXHA 2F6GA 2DXRA 5DT6A 4IY6A 2RCBA 1RYOA 1EZ9A 2Q88A 3VVDA 1FQBA 4MLVA 4RK9A 5H8FB 4OQOA 2FYIA 4ELOA 2G29A 2DWIA 4R6HA 4GWOA 2O7IA 1LFIA 4KYSA 4RJZA 5B70A 4EUOA 3FASA 3R26A 3QIMA 3CSGA 5TU0A 5HBCA 3TCGA 3IOVA 1B5IA 5ICTA 3GBBA 2F7CA 1NNPA 5BWJA 3R7XA 5KZTA 4H8IA 4LATA 4PQJA 1B7ZA 1H44A 2NUVA 1GV8A 1AMFA 3CG1A 1NKXA 1Q35A 4OTEA 3K02A 1VE4A 1N84A 2DQVA 3GZGA 4JWXA 1QKBA 3PUYE 3IJXB 4PFUA 1PB9A 1UTBB 1P1OA 2XXPA 3QAXA 4ELRA 2I0CA 3MZ9A 4YZZA 3V89B 2QPQA 3C32A 4YB5A 5H8QA 4QFOA 4ESXA 3O66A 5AA1A 2CMOA 3C9HA 4ZEKA 3MWBA 1URSA 3FVKA 2OK2A 4HS7A 3CR9A 4KQPA 3C31A 2XD2A 3EHTA 1F9BA 3LC8A 1PC3A 2XX7A 4LA9A 1H76A 5CMMA 3CFZA 4ESWA 1US4A 5I84A 1M5DA 2DSFA 3RPWA 3N6TA 3ZS6A 3M3KA 3B6QA 1US5A 3KG2A 2YJPA 1A99A 1LAXA 1JVXA 1Y20A 5HM4B 4DE8A 4FE8A 4JSOA 3VVEA 3LBSA 3EHSA 3B7DA 2UVGA 1QKAA 3UGWA 2ONRA 3U93A 4IGRA 2DE3A 1MY0A 3W9WA 1NL5A 2GHAA 1B2HA 3E13X 3EPEA 1MQGA 5DVIA 3JZJA 5B7DA 1P1WA 3H6VA 3TTKA 4UACA 1LCTA 5CM6A 1B6HA 3QYTA 3PPQA 5H8SA 4AB6A 1JEUA 4QRZA 3TTRA 2QMXA 1GR2A 2RC8A 3CG3A 3OOAA 3K1PA 4DXUA 5H8QB 1R6ZA 4FAJA 3T22A 4PE5B 3DP4A 4I9DA 3FVOA 1A55A 2UVJA 4F1YA 3H06B 4DZ1A 1FQFA 3H3GA 1DPPA 3KJTA 1JVYA 3ZSFA 1Z7ME 4DXBA 3B6TA 3PUZE 5AA3A 4FORA 3PMVA 4IO4A 3CFXA 2D5WA 3FIRA 1FQAA 2DOJA 2W7YA 5ITPA 1AOVA 4JSDA 3IJOB 1I69A 1B0HA 2F7BA 1SI0A 4H1XA 2Y7WA 4TLLB 3OENA 1B0LA 3C35A 1Z7NE 2O1LA 4PFWA 4F1VA 1JW4A 2B65A 4KI0E 4GF8A 3I5OA 1II5A 3FZVA 3FD3A 2HZKA 1SQYA 5FHNA 4GL0A 4F22A 1IZ1A 1MRPA 4FJPA 4LUBA 3SEXA 3MP8A 1N7XA 1SW1A 4GRKA 1A8EA 3MP1A 1XHYA 4BDRA 1MXWA 4XKNA 4YKJA 3K2DA 3EN3A 2DYXA 4ZECA 3IB0A 4NF4A 4PP0A 1UQWA 1T0KA 5F1QA 2RCAA 4WKMA 3C4MA 3SDFA 4FATA 3OO7A 4KR5A 2NOOA 3MVXA 3GLBA 1N3XA 1O63A 1PEBA 1EH3A 1FTMA 3S9LC 3PD8A 4JWOA 3K6VA 1B3GA 1BTJA 2Y7IA 5L9OA 5JTYA 2OCUA 4AB5A 4NE4A 5F7VA 3PU5A 4P11A 3KZGA 4FEDA 3EHUA 4H5FA 3CIJA 1SDXA 3OMBA 1B5HA 4OYVA 1DMBA 4RY1A 4Q8RA 1Y9UA 4OHNA 2AL4A 2XXIA 3PPPA 4ZEIA 1POTA 1QJMA 3PGFA 1P1NA 4JXIA 5I2KB 2KLFA 4PFYA 4WEDA 3FJGA 4MH5A 4OEUA 1Y4CA 2QRYA 4F31B 4X9TA 3TDJA 4GOTA 3KSXA 1ANFA 3A3CA 3FATA 4U4SA 2Z8FA 2D3IA 4ZEFA 2V84A 5CI5A 1B3LA 1S7YA 3HV1A 5ITOA 2NWJA 1AIVA 1S9TA 3K6WA 4C0RA 1MY2A 2Y7PA 3SEVA 2A5TA 2Z22A 2H98A 5EHMA 3PUWE 3L6HA 1H3DA 2V25A 4WXJA 1UTHA 4NF4B 4EF2A 4IB2A 4LZ8A 5I2NA 4YMBA 3K4UA 1M5EA 1USYE 1MPDA 2PVUA 4NF5A 4UA8A 3OD7A 2O68A 3TUSA 4PETA 5H8HB 4JBZA 3VXBA 3VDFA 3FXQA 3FV1A 3O6HA 4Q5TA 4E0WA 3SEUA 1QUKA 1M5CA 4QSCA 3TAJA 1SI1A 2O51A 4TQUQ 3A3UA 4P0GA 2ZXTA 3HO7A 1MXVA 2F35A 4POXA 1BLFA 4ZEDA 1QVSA 1YAEA 1DTZA 2HAVA 2DE2A 3EF7A 1KWHA 4YU0A 2B3BA 2RC7A 1ZTYA 3IOUA 1RYXA 1B9JA 3ECRA 4HCYA 4HW8A 4YKPA 2VGQA 2PMSA 2DXYA 1TT1A 3MUQA 3RQTA 3FJ7A 1OQGA 5A5XB 1IITA 3TFLA 2HXWA 4NF6A 4QSDA 5DVFA 3KN7A 1NNTA 3PMWA 4KPTA 1GGGA 1VSOA 4GLIA 3ODBA 2XXUA 3MVYA 1LB8A 2R6GE 2V3TA 3T93B 3V5AA 5FTIA 3IX1A 2O7UA 5AA2A 1XC1A 1FQCA 2A5TB 3H7MA 3OXNA 2X7QA 1UTHB 1JQFA 3H6UA 5CMCA 4LQ2A 5I2NB 2IEEA 4KHZE 2F5XA 2R71A 2ZYOA 3IOTA 5TPAA 4OZ9A 3LSLA 1PDAA 3B6WA 1IXHA 4NF5B 4O3BA 3TKDA 3KSJA 3U1OA 2XXYA 3OSRA 3UN6A 3IO6A 1MQJA 1HSEA 3TQWA 1I6AA 4WEPA 1B1HA 1MM7A 5BUUA 4U21A 3FVGA 5L9SA 3SEWA 1NNKA 1A40A 1Y3QA 4GFRA 5FHOA 4YKIA 1B3HA 4XKPA 3TYHA 5L8DA 3TTLA 4U4XA 1LGBC 4ELPA 2ZNUA 2Q2AA 2PBWA 2R9JA 4E0XA 3O28A 1H45A 2ZYNA 4QFPA 1B58A 3Q28A 1IQ7A 1A7LA 2P0SA 1N76A 1I6BA 1DPEA 2DS9A 2V3UA 4IO7A 4NF6B 1RKMA 4NMYA 1LFHA 3FXRA 2F6PA 3WAEA 1DOTA 4KYDA 2RC9A 1QUJA 2PT2A 2Q89A 4Z0IA 2IA4A 1LAGE 2Z8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVO A;  3U92 A;  5AA2 B;  4EQ7 A;  3FJM A;  3MBP A;  4EQB A;  4U1Z A;  5ELV A;  3OO9 A;  3Q26 A;  1NH8 A;  3UP9 A;  3TTN A;  2E0S A;  1OVT A;  2X26 A;  5TPA B;  4KCD A;  2O69 A;  3MW0 A;  3USD A;  1Y1M A;  1Q1K A;  3N94 A;  3RTW B;  4OEV A;  2I0B A;  4OET A;  2HFB A;  1B52 A;  4N07 A;  3MPK A;  5K2Y A;  4MLQ A;  3OO8 A;  3CVG A;  1A8F A;  3CRB A;  3TPA A;  4MFI A;  4TOZ A;  1FTL A;  1MDQ A;  5JK4 A;  3QUF A;  1M5F A;  1LB9 A;  4IO5 A;  1B1X A;  4U22 A;  4YIC A;  1ZBM A;  3ONM A;  3KN3 A;  1DSN A;  3W15 C;  4H5G A;  5CBR A;  1B32 A;  1M5B A;  1VFE A;  1EU8 A;  1IXI A;  3LSX A;  4XIG Q;  2HQ0 A;  3VV5 A;  2XX8 A;  4YB6 A;  2Q9T A;  3Q25 A;  4ZZE A;  3O6I A;  2ABH A;  3VVF A;  3PUX E;  4IO6 A;  4EF1 A;  2UVH A;  3CFL A;  3G3I A;  2FNC A;  5FHM A;  5CMK A;  1B40 A;  4BLA A;  1WOD A;  3KOS A;  3T66 A;  2VP1 A;  3BBR A;  5ICQ A;  1MXZ A;  3RLF E;  3ILT B;  2UYE A;  1MDP 1;  1B4H A;  2DP8 A;  1IIW A;  1Y4T A;  1SYI A;  3TOD A;  1MQI A;  2H5Y A;  1JNF A;  3HN0 A;  2OLB A;  3OSQ A;  5KDT A;  1TFA A;  3W9V A;  2QS4 A;  5TP9 A;  2GH9 A;  1SW5 A;  1TFD A;  1YCJ A;  2ESN A;  3N26 A;  3K01 A;  4R9G A;  5AE4 A;  5I59 A;  3F11 A;  1FTO A;  4OFL A;  1ZKB A;  2REJ A;  4I62 A;  3RT8 A;  4XKQ A;  1LAF E;  2HZL A;  2OWT A;  3Q27 A;  2VD2 A;  1AL3 A;  1XT8 A;  4O3C A;  2HAU A;  2WKY A;  1D9V A;  1ZMG A;  3A09 A;  3O97 A;  3UIF A;  3VLU A;  3IL1 B;  4G2Z A;  4POW A;  2XD3 A;  3VLW A;  1MY3 A;  2Y7R A;  1S50 A;  1GVC A;  3IB2 A;  4G8N A;  1B5J A;  5EHS A;  1MS7 A;  2AYS A;  4G68 C;  3RN8 A;  3FUZ A;  1B3E A;  4YKK A;  3U8Q A;  3EQ1 A;  1EZP A;  1FCK A;  4ZS9 A;  1N04 A;  1N3W A;  2DWJ A;  5AA4 A;  1ELJ A;  3C33 A;  3TEP A;  4XKR A;  1TXF A;  1OQH A;  4FIM A;  1YTV A;  1B3F A;  1NMU A;  1LST A;  3S4U A;  3MVZ A;  4QSE A;  1LAH E;  4N6P A;  3TZA A;  4LQ5 A;  1URG A;  1QW0 A;  2HCA A;  3GXA A;  2A5S A;  3HHG A;  3IO4 A;  1HSJ A;  1TWY A;  4F3S A;  5AA2 D;  3FXU A;  3ZKK A;  4U1O A;  5KDT B;  4RYA A;  2M8C A;  5IKB A;  3WAF A;  2UXA A;  4DCX A;  3P7I A;  3T9H B;  5J1D A;  4EXL A;  5TP9 B;  4X1D A;  3H03 A;  1SVX B;  1MY4 A;  3VFJ A;  2Q2C A;  5DYH A;  1WDN A;  2DVC A;  4R2B A;  1XVX A;  4X1B A;  4LON B;  1UIU A;  3QUJ A;  5I59 B;  2PYY A;  3E3K A;  3IOR A;  2OZZ A;  3MQ9 A;  1XS5 A;  2DWH A;  2D21 A;  2YPN A;  3G3G A;  2ZMB A;  3IAZ A;  4F39 A;  2NXO A;  2O84 X;  3PMX A;  4PFT A;  2VD3 A;  3MAM A;  2ONK E;  1J1N A;  3H6W A;  4YB7 A;  2F8D A;  2QS1 A;  4H65 A;  4R72 A;  5JTY B;  4DIG A;  1MXX A;  3TMG A;  1JW1 A;  4YAH X;  4GXA A;  3BKI B;  1GTK A;  2DE4 A;  1R9L A;  3G7W A;  3G3H A;  3I6V A;  4ZEB A;  2ZYM A;  2ZNT A;  1OMP A;  3UA8 A;  4G4P A;  1MQD A;  4O3A A;  3RTF B;  3LSF B;  2GRV A;  3DLN A;  4ZZA A;  4R6K A;  3S9N C;  3L6G A;  1MQH A;  2DVZ A;  4DXC A;  4DDD A;  3LUY A;  3KFM A;  4F29 A;  1P1Q A;  1JEV A;  4BDM A;  4IO3 A;  2Z8D A;  3G3K A;  4QF9 A;  3U94 A;  3VXC A;  3JYR A;  3BFU A;  4KFQ A;  2B3F A;  2X7P A;  3MZB A;  3S2V A;  4KD5 A;  1VFD A;  3KGC A;  4F2O A;  5JEI A;  4THI A;  5EYF A;  3LSW A;  3C34 A;  2H25 A;  1ZLQ A;  3LR1 A;  3QXM A;  1LFG A;  3O2A A;  2ANJ A;  1JW5 A;  1P1U A;  1FQD A;  3RT6 B;  4OVJ A;  1SBP A;  5I56 A;  4QFN A;  1SW2 A;  4FEC A;  1IXG A;  1H43 A;  5DTB A;  2H4I A;  1NH7 A;  1BIY A;  3SES A;  4BDL A;  4Z7E A;  2FA7 A;  4F18 A;  1R1N A;  4NF8 A;  3VLV A;  4F19 A;  4NWC A;  3SEY A;  2XXW A;  3M3F A;  3DP6 A;  4QHQ A;  4ELQ A;  2QSX A;  1OIB A;  4U2R A;  3ZKL A;  3SER A;  4QFL A;  4TLM B;  4QFK A;  3V83 A;  3HST A;  4RA1 A;  3MPL A;  2GFE A;  4U23 A;  3VE1 B;  2P1S A;  3KJ7 A;  2Z23 A;  5DEX A;  2G93 A;  3D4G A;  4N13 A;  4RNS A;  3KBR A;  2NVU B;  5DVJ A;  1MY1 A;  4F3B A;  3K1M A;  3DM0 A;  2O1M A;  3K1N A;  2ONS A;  1JET A;  4Q30 B;  4G8H A;  4R75 A;  5IAI A;  4HCW A;  2RKM A;  5ISU A;  2QMW A;  2Y7K A;  1IEJ A;  3K0V A;  4R2F A;  5KCJ A;  3TCH A;  1PB7 A;  5CC2 A;  1SYH A;  1LLS A;  3H4Z A;  2Q8J A;  3M8U A;  3O29 A;  2PX1 A;  3THI A;  2P2A A;  4F3P A;  2CZL A;  3T9U A;  1D9Y A;  5CBS A;  4ND9 A;  3TCF A;  1OLA A;  4ZDM A;  1Y3N A;  3OEK A;  4R74 A;  1OVB A;  4H6D A;  3FGS A;  2I6E A;  2RIN A;  5FTH A;  1ZU0 A;  3BFT A;  4H67 A;  3N5L A;  5I56 B;  4OES A;  3T9X B;  3O9P A;  3DP8 A;  2QL3 A;  5H8N A;  4DCY A;  2UYF A;  2REG A;  1MXY A;  4NF8 B;  4JDF A;  3PPN A;  4ECF A;  2PT1 A;  2F7A A;  4M4G A;  3PUV E;  2GHB A;  3KN8 A;  4IO2 A;  1HSL A;  3SET A;  4GQO A;  1MXU A;  4EXK A;  1NFT A;  3OO6 A;  3G3F A;  4NTL A;  4G77 A;  4RPN A;  4F3G A;  2QJE A;  3I3V A;  4OFO A;  2I48 A;  3KEI A;  5DEX B;  3TQL A;  1MH4 A;  2QS3 A;  3G3J A;  4M1V A;  3TEL A;  4GXS B;  1QUL A;  5L9M A;  3SKP A;  3FV2 A;  2LAO A;  1LBB A;  4LZ5 A;  1Y3P A;  3GBA A;  5I57 A;  1IXC A;  3OEM A;  4R6Y A;  5KCJ B;  4R73 A;  5I58 A;  2XXX A;  4KYE A;  3AXF A;  1BP5 A;  2XHD A;  3V8X B;  3N6U A;  3MP6 A;  1B46 A;  4LVQ A;  1N7W A;  3RUM A;  1PBP A;  4IY5 A;  4I8C A;  2XXV A;  4MBP A;  4C1T A;  1FTJ A;  1XVY A;  5I2K A;  2HEU A;  1MM6 A;  4Q0C A;  5M2V A;  4OXV A;  3JV9 A;  2ZNS A;  4JB7 A;  2OJT A;  4OEN A;  4RXL A;  4RPO A;  4OFJ A;  3TTM A;  3T96 B;  3ILU B;  4EQ9 A;  1MH3 A;  5CMB A;  3T9V A;  2RF1 A;  4HTG A;  3S9M C;  1FQE A;  1NNF A;  3DEL B;  2YLN A;  3D4C A;  1URD A;  2E1S A;  1R9Q A;  4L17 A;  5H8N B;  4X48 A;  1SW4 A;  2XX9 A;  4YMA A;  5CRY A;  2I4B A;  4GL8 A;  4BDO A;  4H8J A;  1B7U A;  1Y1Z A;  1O64 A;  3PPR A;  4F1U A;  3HHF A;  1D4N A;  4GD5 A;  1B7H A;  1PB8 A;  3OEL A;  4JWY A;  1CE2 A;  4MF3 A;  3MZ1 A;  2I3W A;  2AIX A;  1USY H;  2H99 A;  3MC2 A;  3UOR A;  2THI A;  3PV0 E;  4OMB A;  4G68 A;  1B51 A;  2I3V A;  1XOC A;  4BDN A;  5I57 B;  2I49 A;  1IUD A;  5H8H A;  1N0T A;  4F2Q A;  1LBC A;  4C1U A;  4ZE9 A;  5I58 B;  4XXU A;  4ONY A;  1O7T A;  3QK6 A;  4G8M A;  3HCQ A;  1SD3 A;  3CI8 A;  1B4Z A;  1I6Q A;  2XXT A;  4OER A;  2V93 A;  1B05 A;  3R6U A;  1UIV A;  2VHA A;  1DTG A;  4LP2 B;  4DLD A;  3C36 A;  4R9F A;  2I58 A;  1EZO A;  3RNN A;  1AH5 A;  2ZYK A;  1FW0 A;  4OWD A;  1WVJ A;  1P99 A;  1PBQ A;  1MPC A;  3E4R A;  4ISU A;  1MPB A;  4FEB A;  3IB1 A;  2F97 A;  4I1D A;  5A5X A;  1QUI A;  3IK6 B;  3IR1 A;  1A54 A;  3KOT A;  2VOZ A;  1POY 1;  5H8F A;  3PPO A;  2XXR A;  3QSL A;  3FVN A;  2Y84 A;  4P0I A;  2F78 A;  2DWA A;  3UK4 A;  2F36 A;  2QS2 A;  3MVW A;  3K6X A;  3RGY A;  2H9B A;  2V3Q A;  1MG1 A;  1D3K A;  4KCC A;  2O6A A;  3S9E A;  5LOM A;  3K00 A;  2F34 A;  4BDQ A;  4GIZ A;  3IOW A;  2OWS A;  3E9X A;  1CB6 A;  3M3L A;  5HPQ A;  4G68 B;  3Q29 A;  2OBG A;  2AL5 A;  1LCF A;  4NED A;  5K2X A;  2I4C A;  4IGT A;  1OLC A;  4EDP A;  3H6T A;  3K6U A;  5AA4 B;  4AQ4 A;  1VR5 A;  2UVI A;  1UTB A;  4NWD A;  1ZIU A;  4H0W A;  3O6G A;  1ATG A;  3MJN A;  3HPI A;  3RY3 A;  1ZJL A;  3CSB A;  3PD9 A;  4ZE8 A;  1FTK A;  4XTC Q;  1YPN A;  1BKA A;  4K3F A;  4LZ7 A;  4RK2 A;  2XXQ A;  1L5T A;  2BJJ X;  2ALU A;  3U72 A;  2XXH A;  2F6G A;  2DXR A;  5DT6 A;  4IY6 A;  2RCB A;  1RYO A;  1EZ9 A;  2Q88 A;  3VVD A;  1FQB A;  4MLV A;  4RK9 A;  5H8F B;  4OQO A;  2FYI A;  4ELO A;  2G29 A;  2DWI A;  4R6H A;  4GWO A;  2O7I A;  1LFI A;  4KYS A;  4RJZ A;  5B70 A;  4EUO A;  3FAS A;  3R26 A;  3QIM A;  3CSG A;  5TU0 A;  5HBC A;  3TCG A;  3IOV A;  1B5I A;  5ICT A;  3GBB A;  2F7C A;  1NNP A;  5BWJ A;  3R7X A;  5KZT A;  4H8I A;  4LAT A;  4PQJ A;  1B7Z A;  1H44 A;  2NUV A;  1GV8 A;  1AMF A;  3CG1 A;  1NKX A;  1Q35 A;  4OTE A;  3K02 A;  1VE4 A;  1N84 A;  2DQV A;  3GZG A;  4JWX A;  1QKB A;  3PUY E;  3IJX B;  4PFU A;  1PB9 A;  1UTB B;  1P1O A;  2XXP A;  3QAX A;  4ELR A;  2I0C A;  3MZ9 A;  4YZZ A;  3V89 B;  2QPQ A;  3C32 A;  4YB5 A;  5H8Q A;  4QFO A;  4ESX A;  3O66 A;  5AA1 A;  2CMO A;  3C9H A;  4ZEK A;  3MWB A;  1URS A;  3FVK A;  2OK2 A;  4HS7 A;  3CR9 A;  4KQP A;  3C31 A;  2XD2 A;  3EHT A;  1F9B A;  3LC8 A;  1PC3 A;  2XX7 A;  4LA9 A;  1H76 A;  5CMM A;  3CFZ A;  4ESW A;  1US4 A;  5I84 A;  1M5D A;  2DSF A;  3RPW A;  3N6T A;  3ZS6 A;  3M3K A;  3B6Q A;  1US5 A;  3KG2 A;  2YJP A;  1A99 A;  1LAX A;  1JVX A;  1Y20 A;  5HM4 B;  4DE8 A;  4FE8 A;  4JSO A;  3VVE A;  3LBS A;  3EHS A;  3B7D A;  2UVG A;  1QKA A;  3UGW A;  2ONR A;  3U93 A;  4IGR A;  2DE3 A;  1MY0 A;  3W9W A;  1NL5 A;  2GHA A;  1B2H A;  3E13 X;  3EPE A;  1MQG A;  5DVI A;  3JZJ A;  5B7D A;  1P1W A;  3H6V A;  3TTK A;  4UAC A;  1LCT A;  5CM6 A;  1B6H A;  3QYT A;  3PPQ A;  5H8S A;  4AB6 A;  1JEU A;  4QRZ A;  3TTR A;  2QMX A;  1GR2 A;  2RC8 A;  3CG3 A;  3OOA A;  3K1P A;  4DXU A;  5H8Q B;  1R6Z A;  4FAJ A;  3T22 A;  4PE5 B;  3DP4 A;  4I9D A;  3FVO A;  1A55 A;  2UVJ A;  4F1Y A;  3H06 B;  4DZ1 A;  1FQF A;  3H3G A;  1DPP A;  3KJT A;  1JVY A;  3ZSF A;  1Z7M E;  4DXB A;  3B6T A;  3PUZ E;  5AA3 A;  4FOR A;  3PMV A;  4IO4 A;  3CFX A;  2D5W A;  3FIR A;  1FQA A;  2DOJ A;  2W7Y A;  5ITP A;  1AOV A;  4JSD A;  3IJO B;  1I69 A;  1B0H A;  2F7B A;  1SI0 A;  4H1X A;  2Y7W A;  4TLL B;  3OEN A;  1B0L A;  3C35 A;  1Z7N E;  2O1L A;  4PFW A;  4F1V A;  1JW4 A;  2B65 A;  4KI0 E;  4GF8 A;  3I5O A;  1II5 A;  3FZV A;  3FD3 A;  2HZK A;  1SQY A;  5FHN A;  4GL0 A;  4F22 A;  1IZ1 A;  1MRP A;  4FJP A;  4LUB A;  3SEX A;  3MP8 A;  1N7X A;  1SW1 A;  4GRK A;  1A8E A;  3MP1 A;  1XHY A;  4BDR A;  1MXW A;  4XKN A;  4YKJ A;  3K2D A;  3EN3 A;  2DYX A;  4ZEC A;  3IB0 A;  4NF4 A;  4PP0 A;  1UQW A;  1T0K A;  5F1Q A;  2RCA A;  4WKM A;  3C4M A;  3SDF A;  4FAT A;  3OO7 A;  4KR5 A;  2NOO A;  3MVX A;  3GLB A;  1N3X A;  1O63 A;  1PEB A;  1EH3 A;  1FTM A;  3S9L C;  3PD8 A;  4JWO A;  3K6V A;  1B3G A;  1BTJ A;  2Y7I A;  5L9O A;  5JTY A;  2OCU A;  4AB5 A;  4NE4 A;  5F7V A;  3PU5 A;  4P11 A;  3KZG A;  4FED A;  3EHU A;  4H5F A;  3CIJ A;  1SDX A;  3OMB A;  1B5H A;  4OYV A;  1DMB A;  4RY1 A;  4Q8R A;  1Y9U A;  4OHN A;  2AL4 A;  2XXI A;  3PPP A;  4ZEI A;  1POT A;  1QJM A;  3PGF A;  1P1N A;  4JXI A;  5I2K B;  2KLF A;  4PFY A;  4WED A;  3FJG A;  4MH5 A;  4OEU A;  1Y4C A;  2QRY A;  4F31 B;  4X9T A;  3TDJ A;  4GOT A;  3KSX A;  1ANF A;  3A3C A;  3FAT A;  4U4S A;  2Z8F A;  2D3I A;  4ZEF A;  2V84 A;  5CI5 A;  1B3L A;  1S7Y A;  3HV1 A;  5ITO A;  2NWJ A;  1AIV A;  1S9T A;  3K6W A;  4C0R A;  1MY2 A;  2Y7P A;  3SEV A;  2A5T A;  2Z22 A;  2H98 A;  5EHM A;  3PUW E;  3L6H A;  1H3D A;  2V25 A;  4WXJ A;  1UTH A;  4NF4 B;  4EF2 A;  4IB2 A;  4LZ8 A;  5I2N A;  4YMB A;  3K4U A;  1M5E A;  1USY E;  1MPD A;  2PVU A;  4NF5 A;  4UA8 A;  3OD7 A;  2O68 A;  3TUS A;  4PET A;  5H8H B;  4JBZ A;  3VXB A;  3VDF A;  3FXQ A;  3FV1 A;  3O6H A;  4Q5T A;  4E0W A;  3SEU A;  1QUK A;  1M5C A;  4QSC A;  3TAJ A;  1SI1 A;  2O51 A;  4TQU Q;  3A3U A;  4P0G A;  2ZXT A;  3HO7 A;  1MXV A;  2F35 A;  4POX A;  1BLF A;  4ZED A;  1QVS A;  1YAE A;  1DTZ A;  2HAV A;  2DE2 A;  3EF7 A;  1KWH A;  4YU0 A;  2B3B A;  2RC7 A;  1ZTY A;  3IOU A;  1RYX A;  1B9J A;  3ECR A;  4HCY A;  4HW8 A;  4YKP A;  2VGQ A;  2PMS A;  2DXY A;  1TT1 A;  3MUQ A;  3RQT A;  3FJ7 A;  1OQG A;  5A5X B;  1IIT A;  3TFL A;  2HXW A;  4NF6 A;  4QSD A;  5DVF A;  3KN7 A;  1NNT A;  3PMW A;  4KPT A;  1GGG A;  1VSO A;  4GLI A;  3ODB A;  2XXU A;  3MVY A;  1LB8 A;  2R6G E;  2V3T A;  3T93 B;  3V5A A;  5FTI A;  3IX1 A;  2O7U A;  5AA2 A;  1XC1 A;  1FQC A;  2A5T B;  3H7M A;  3OXN A;  2X7Q A;  1UTH B;  1JQF A;  3H6U A;  5CMC A;  4LQ2 A;  5I2N B;  2IEE A;  4KHZ E;  2F5X A;  2R71 A;  2ZYO A;  3IOT A;  5TPA A;  4OZ9 A;  3LSL A;  1PDA A;  3B6W A;  1IXH A;  4NF5 B;  4O3B A;  3TKD A;  3KSJ A;  3U1O A;  2XXY A;  3OSR A;  3UN6 A;  3IO6 A;  1MQJ A;  1HSE A;  3TQW A;  1I6A A;  4WEP A;  1B1H A;  1MM7 A;  5BUU A;  4U21 A;  3FVG A;  5L9S A;  3SEW A;  1NNK A;  1A40 A;  1Y3Q A;  4GFR A;  5FHO A;  4YKI A;  1B3H A;  4XKP A;  3TYH A;  5L8D A;  3TTL A;  4U4X A;  1LGB C;  4ELP A;  2ZNU A;  2Q2A A;  2PBW A;  2R9J A;  4E0X A;  3O28 A;  1H45 A;  2ZYN A;  4QFP A;  1B58 A;  3Q28 A;  1IQ7 A;  1A7L A;  2P0S A;  1N76 A;  1I6B A;  1DPE A;  2DS9 A;  2V3U A;  4IO7 A;  4NF6 B;  1RKM A;  4NMY A;  1LFH A;  3FXR A;  2F6P A;  3WAE A;  1DOT A;  4KYD A;  2RC9 A;  1QUJ A;  2PT2 A;  2Q89 A;  4Z0I A;  2IA4 A;  1LAG E;  2Z8E A; 
#chains in the Genus database with same CATH topology
 3E78 A;  2V4C A;  4GVO A;  3U92 A;  5AA2 B;  3T0J A;  4EQ7 A;  3FJM A;  5IZZ A;  3MBP A;  4EQB A;  4U1Z A;  1NUW A;  5ELV A;  3KBZ A;  3OO9 A;  2WBD A;  3Q26 A;  1NH8 A;  3UP9 A;  3TTN A;  2E0S A;  1OVT A;  2X26 A;  5TPA B;  4PDH A;  4KCD A;  1FPD A;  2O69 A;  3MW0 A;  3USD A;  1Y1M A;  1IMF A;  1Q1K A;  3N94 A;  3RTW B;  4OEV A;  2I0B A;  4OET A;  2HFB A;  1B52 A;  4N07 A;  3MPK A;  5K2Y A;  4MLQ A;  3OO8 A;  3CVG A;  1A8F A;  3CRB A;  3TPA A;  4MFI A;  4TOZ A;  1FTL A;  1MDQ A;  5JK4 A;  3QUF A;  1M5F A;  1LB9 A;  4IO5 A;  1B1X A;  4U22 A;  4MMP A;  4YIC A;  1ZBM A;  3ONM A;  3KN3 A;  1DSN A;  3W15 C;  3FXB A;  4H5G A;  5CBR A;  1NV0 A;  1B32 A;  1M5B A;  1VFE A;  1EU8 A;  1IXI A;  3LSX A;  4XIG Q;  2HQ0 A;  3VV5 A;  2XX8 A;  4YB6 A;  2Q9T A;  3Q25 A;  2WYK A;  4ZZE A;  3O6I A;  2ABH A;  3VVF A;  5IZ3 A;  3PUX E;  4IO6 A;  4EF1 A;  2UVH A;  3CFL A;  3G3I A;  4I40 A;  2FNC A;  5FHM A;  5CMK A;  1B40 A;  4NG7 A;  4BLA A;  1WOD A;  3KOS A;  4GX3 A;  3T66 A;  2VP1 A;  3BBR A;  4MCO A;  3MST A;  5ICQ A;  1LBW A;  1MXZ A;  3RLF E;  3ILT B;  2UYE A;  1MDP 1;  1B4H A;  2DP8 A;  1IIW A;  1Y4T A;  1SYI A;  3TOD A;  1MQI A;  2H5Y A;  1FPK A;  1JNF A;  3HN0 A;  1BK4 A;  4P3L A;  4OVR A;  2OLB A;  1IMD A;  3OSQ A;  4NF0 A;  5KDT A;  1TFA A;  3W9V A;  2QS4 A;  5TP9 A;  2GH9 A;  1SW5 A;  1NV1 A;  1TFD A;  1YCJ A;  2ESN A;  3N26 A;  3K01 A;  4R9G A;  5AE4 A;  5I59 A;  3F11 A;  1FTO A;  4PBQ A;  4OFL A;  1ZKB A;  1IMA A;  1LBV A;  2REJ A;  4I62 A;  3RT8 A;  4XKQ A;  1LAF E;  2HZL A;  2OWT A;  3Q27 A;  2VD2 A;  1AL3 A;  1XT8 A;  4O3C A;  2HAU A;  2WKY A;  1D9V A;  1ZMG A;  4O8M A;  3A09 A;  1G0H A;  1KA1 A;  3O97 A;  3UIF A;  3VLU A;  3IL1 B;  4G2Z A;  2ZZX A;  4POW A;  2XD3 A;  3VLW A;  1MY3 A;  2Y7R A;  1S50 A;  1GVC A;  4DI4 B;  3IB2 A;  4G8N A;  1B5J A;  2PFZ A;  4AS4 A;  2WYP A;  5EHS A;  1MS7 A;  2AYS A;  4G68 C;  3RN8 A;  3FUZ A;  1B3E A;  4YKK A;  3U8Q A;  3EQ1 A;  1EZP A;  1FCK A;  4ZS9 A;  1FBH A;  1N04 A;  4P1L A;  1N3W A;  2DWJ A;  5AA4 A;  1ELJ A;  3C33 A;  3TEP A;  4XKR A;  4QXD A;  5T3J A;  1TXF A;  1OQH A;  4FIM A;  1K9Y A;  1YTV A;  4PFR A;  1B3F A;  1NMU A;  1LST A;  3S4U A;  2WEF A;  3MVZ A;  4QSE A;  4P9K A;  1LAH E;  4N6P A;  3TZA A;  3GYY A;  4LQ5 A;  1URG A;  1QW0 A;  2HCA A;  3GXA A;  2A5S A;  3HHG A;  3IO4 A;  1RDY A;  1HSJ A;  1TWY A;  4F3S A;  1FPL A;  5AA2 D;  3FXU A;  3ZKK A;  4U1O A;  5KDT B;  4RYA A;  2M8C A;  5IKB A;  3WAF A;  2UXA A;  2OX3 A;  4DCX A;  3P7I A;  3T9H B;  5J1D A;  4EXL A;  5TP9 B;  1NV6 A;  4X1D A;  3H03 A;  1RDX A;  1SVX B;  1MY4 A;  3VFJ A;  2Q2C A;  5DYH A;  1WDN A;  2DVC A;  4R2B A;  1XVX A;  4X1B A;  4LON B;  1UIU A;  3QUJ A;  5I59 B;  2PYY A;  4NGU A;  3E3K A;  3IOR A;  2OZZ A;  3MQ9 A;  4XFE A;  1DCU A;  5EQ8 A;  4PFB A;  1XS5 A;  2DWH A;  2D21 A;  2YPN A;  3G3G A;  2ZMB A;  3IAZ A;  4F39 A;  2NXO A;  1IMB A;  2O84 X;  3PMX A;  4PFT A;  2VD3 A;  3MAM A;  2ONK E;  1J1N A;  3H6W A;  4YB7 A;  5IZ1 A;  2F8D A;  2QS1 A;  4H65 A;  4R72 A;  5JTY B;  1NV2 A;  4DIG A;  1MXX A;  3TMG A;  1JW1 A;  4YAH X;  4HE2 A;  4GXA A;  3BKI B;  1GTK A;  4N91 A;  1K9Z A;  2DE4 A;  1R9L A;  1INP A;  2HHM A;  3G7W A;  3G3H A;  3I6V A;  4ZEB A;  2ZYM A;  2ZNT A;  1OMP A;  3UA8 A;  4G4P A;  1MQD A;  4O3A A;  4MNP A;  3RTF B;  3LSF B;  2GRV A;  3QMF A;  3DLN A;  4ZZA A;  4LN5 A;  4R6K A;  2L5V A;  3S9N C;  2OWZ A;  5EQ7 A;  4DI3 D;  3L6G A;  1MQH A;  2DVZ A;  4DXC A;  5ESY A;  4DDD A;  3LUY A;  3KFM A;  4F29 A;  1P1Q A;  1JEV A;  4BDM A;  4IO3 A;  2Z8D A;  2FHY A;  3G3K A;  2PFY A;  4QF9 A;  3U94 A;  3VXC A;  3JYR A;  3BFU A;  4KFQ A;  2B3F A;  3A29 A;  2X7P A;  3MZB A;  3S2V A;  1YYZ A;  5J16 A;  4KD5 A;  1VFD A;  3KGC A;  4F2O A;  1NUZ A;  5JEI A;  4THI A;  5EYF A;  3LSW A;  3C34 A;  2H25 A;  4MEV A;  1ZLQ A;  3LR1 A;  3QXM A;  1LFG A;  3U65 A;  2XWV A;  3O2A A;  2ANJ A;  2CEY A;  1JW5 A;  2QVV A;  1FPE A;  1P1U A;  3E79 A;  1FQD A;  3RT6 B;  1NV7 A;  4OVJ A;  1SBP A;  5I56 A;  4OVP A;  4QFN A;  1SW2 A;  4FEC A;  4N6K A;  1IXG A;  1H43 A;  5DTB A;  2H4I A;  1NH7 A;  1BIY A;  3SES A;  4BDL A;  4Z7E A;  2FA7 A;  4F18 A;  1R1N A;  4NF8 A;  3VLV A;  4F19 A;  4NWC A;  3SEY A;  2XXW A;  3M3F A;  3DP6 A;  4PAF A;  4QHQ A;  4ELQ A;  2QSX A;  1OIB A;  4U2R A;  3ZKL A;  3SER A;  4QFL A;  4TLM B;  4QFK A;  3V83 A;  3HST A;  4RA1 A;  3EKI A;  3MPL A;  2XWO A;  4O94 A;  2Y5K A;  2GFE A;  4U23 A;  3VE1 B;  2P1S A;  3KJ7 A;  2Z23 A;  5DEX A;  1FPB A;  2G93 A;  3D4G A;  4N13 A;  4RNS A;  3KBR A;  2NVU B;  5DVJ A;  1MY1 A;  4F3B A;  3K1M A;  3DM0 A;  2O1M A;  3K1N A;  2ONS A;  4N15 A;  1JET A;  4Q30 B;  4G8H A;  4R75 A;  5IAI A;  4HCW A;  2RKM A;  5ISU A;  2QMW A;  4PTK A;  2Y7K A;  1IEJ A;  3K0V A;  4R2F A;  5KCJ A;  3TCH A;  1PB7 A;  5CC2 A;  1SYH A;  1LLS A;  3H4Z A;  2Q8J A;  3M8U A;  3O29 A;  2PX1 A;  3THI A;  2P2A A;  4F3P A;  1DK4 A;  2CZL A;  3T9U A;  1D9Y A;  5CBS A;  4ND9 A;  3TCF A;  3RPL A;  1OLA A;  4PAI A;  1Y3N A;  4ZDM A;  3OEK A;  4R74 A;  1OVB A;  4H6D A;  3FGS A;  1YXI A;  2I6E A;  2RIN A;  5FTH A;  2XWI A;  1FTA A;  1ZU0 A;  3BFT A;  4H67 A;  3N5L A;  5I56 B;  4OES A;  4JVC A;  3T9X B;  3O9P A;  4MX6 A;  3DP8 A;  2QL3 A;  5LTC A;  4NQ8 A;  5ET8 A;  5H8N A;  4DCY A;  2UYF A;  2REG A;  1MXY A;  4NF8 B;  4JDF A;  3PPN A;  4ECF A;  2PT1 A;  2F7A A;  4M4G A;  3PUV E;  2JJK A;  2GHB A;  3KN8 A;  4IO2 A;  1HSL A;  3SET A;  4GQO A;  1MXU A;  4EXK A;  1NFT A;  3OO6 A;  3G3F A;  4HE1 A;  4NTL A;  4G77 A;  4RPN A;  2QJE A;  4F3G A;  3I3V A;  4OFO A;  2I48 A;  3KEI A;  2R8T A;  5DEX B;  3TQL A;  1MH4 A;  2QS3 A;  3G3J A;  4M1V A;  3TEL A;  4GXS B;  1QUL A;  4PBH A;  5L9M A;  1FJ9 A;  1FPI A;  3SKP A;  3FV2 A;  2LAO A;  1LBB A;  4GWU A;  4LZ5 A;  4OVQ A;  1Y3P A;  3GBA A;  5I57 A;  1IXC A;  3OEM A;  4R6Y A;  5KCJ B;  4R73 A;  5I58 A;  2XXX A;  4KYE A;  3AXF A;  4GX4 A;  1D9Q A;  1BP5 A;  2XHD A;  3V8X B;  3N6U A;  3MP6 A;  1B46 A;  4NAP A;  5IM2 A;  4LVQ A;  1N7W A;  3RUM A;  3RPL B;  1PBP A;  4IY5 A;  4I8C A;  5F24 A;  1NUX A;  2XXV A;  4MBP A;  4C1T A;  1FTJ A;  1XVY A;  5I2K A;  2HEU A;  1MM6 A;  4Q0C A;  5M2V A;  4OXV A;  3JV9 A;  2ZNS A;  4UAB A;  4JB7 A;  2OJT A;  4OEN A;  4RXL A;  4RPO A;  4OFJ A;  3TTM A;  3T96 B;  3ILU B;  4EQ9 A;  1MH3 A;  5CMB A;  3T9V A;  2RF1 A;  4HTG A;  3S9M C;  1FQE A;  1NNF A;  3DEL B;  2YLN A;  3D4C A;  1URD A;  2E1S A;  5I5P A;  1R9Q A;  4L17 A;  2XXK A;  5LDZ A;  5H8N B;  4X48 A;  1SW4 A;  2FIX A;  2XX9 A;  1LBY A;  4YMA A;  4AS5 A;  5CRY A;  2WBB A;  2I4B A;  4GL8 A;  4PAK A;  4BDO A;  4H8J A;  1B7U A;  1Y1Z A;  1O64 A;  2HXR A;  3PPR A;  4F1U A;  3HHF A;  4IR8 A;  1D4N A;  4GD5 A;  1B7H A;  1PB8 A;  3OEL A;  4JWY A;  1CE2 A;  4MF3 A;  3MZ1 A;  2I3W A;  5EYH A;  2AIX A;  1USY H;  4PGP A;  2H99 A;  3MC2 A;  3UOR A;  2THI A;  3PV0 E;  1IMC A;  4GWW A;  4OMB A;  5IZ3 B;  1FSA A;  4G68 A;  1B51 A;  2I3V A;  1XOC A;  4BDN A;  5I57 B;  2I49 A;  4GWS A;  1IUD A;  5H8H A;  1N0T A;  4F2Q A;  1LBC A;  4C1U A;  4ZE9 A;  5I58 B;  4XXU A;  3NOH A;  4ONY A;  1O7T A;  1QGX A;  3QK6 A;  4G8M A;  3HCQ A;  1SD3 A;  4P56 A;  3CI8 A;  1B4Z A;  1I6Q A;  2XXT A;  4N4U A;  4OER A;  2V93 A;  1B05 A;  3R6U A;  1UIV A;  2VHA A;  1DTG A;  4XF5 A;  4LP2 B;  4DLD A;  3C36 A;  4NX1 A;  1EYJ A;  4R9F A;  4MJO A;  2I58 A;  1EZO A;  3RNN A;  1AH5 A;  2ZYK A;  5A5L A;  4MNI A;  3KC1 A;  1FW0 A;  3HFU A;  4OWD A;  1WVJ A;  1P99 A;  1PBQ A;  1G0I A;  1MPC A;  4NN3 A;  3E4R A;  4ISU A;  1MPB A;  4FEB A;  3IB1 A;  2F97 A;  4I1D A;  5A5X A;  1QUI A;  2Y5L A;  1LBZ A;  3IK6 B;  3IR1 A;  1A54 A;  1NV4 A;  3KOT A;  1NUY A;  2VOZ A;  1POY 1;  5H8F A;  1EYI A;  1NV5 A;  3PPO A;  2XXR A;  3QSL A;  3FVN A;  2Y84 A;  3KC0 A;  4P0I A;  2F78 A;  2DWA A;  3UK4 A;  2F36 A;  2QFL A;  2QS2 A;  3BIG A;  3MVW A;  3K6X A;  3RGY A;  2H9B A;  2V3Q A;  1MG1 A;  1D3K A;  4KCC A;  2O6A A;  3S9E A;  5LOM A;  3K00 A;  2F34 A;  4BDQ A;  2BJI A;  4GIZ A;  3IOW A;  2OWS A;  3E9X A;  1CB6 A;  3M3L A;  5HPQ A;  2Q74 A;  4G68 B;  3Q29 A;  2OBG A;  2AL5 A;  1LCF A;  4NED A;  5K2X A;  2I4C A;  4IGT A;  1OLC A;  4EDP A;  3H6T A;  3K6U A;  1IME A;  2DDK A;  5AA4 B;  4AQ4 A;  1NI9 A;  1VR5 A;  2UVI A;  1UTB A;  2Q8M A;  5EYG A;  4NWD A;  1ZIU A;  4H0W A;  3O6G A;  2KQZ A;  1ATG A;  3MJN A;  3HPI A;  3RY3 A;  1ZJL A;  3CSB A;  1FRP A;  3PD9 A;  4ZE8 A;  1FTK A;  1FJ6 A;  4XTC Q;  1YPN A;  1BKA A;  4K3F A;  4LZ7 A;  4RK2 A;  2XXQ A;  1L5T A;  2BJJ X;  2ALU A;  3U72 A;  2XXH A;  2F6G A;  2DXR A;  1VDW A;  4I3E A;  1CNQ A;  5DT6 A;  4IY6 A;  2RCB A;  3B50 A;  1RYO A;  1EZ9 A;  2Q88 A;  3VVD A;  1FQB A;  4MLV A;  4RK9 A;  4O7M A;  5H8F B;  4OQO A;  2FYI A;  4ELO A;  2G29 A;  2DWI A;  4R6H A;  4GWO A;  2O7I A;  1LFI A;  4KYS A;  4RJZ A;  5B70 A;  4EUO A;  3FAS A;  3R26 A;  2XA5 A;  3QIM A;  3CHG A;  2GQ1 A;  3CSG A;  4GBV A;  4NHB A;  5HBC A;  5TU0 A;  5EQ9 A;  3TCG A;  1XI6 A;  3IOV A;  1B5I A;  5ICT A;  3GBB A;  2F7C A;  1NNP A;  5BWJ A;  3R7X A;  5KZT A;  2PCR A;  4H8I A;  4LAT A;  4PQJ A;  1B7Z A;  1H44 A;  2NUV A;  1GV8 A;  1AMF A;  3CG1 A;  1NKX A;  1Q35 A;  4OTE A;  3K02 A;  1VE4 A;  1N84 A;  2DQV A;  3GZG A;  3LUZ A;  1QKB A;  4JWX A;  3PUY E;  3IJX B;  4PFU A;  1PB9 A;  1UTB B;  4GBW A;  1P1O A;  2XXP A;  3QAX A;  4ELR A;  2I0C A;  3MZ9 A;  4YZZ A;  3V89 B;  3ROJ A;  2QPQ A;  3C32 A;  4YB5 A;  5H8Q A;  4QFO A;  4ESX A;  3O66 A;  5AA1 A;  2CZK A;  2CMO A;  3C9H A;  3B8B A;  4ZEK A;  3MWB A;  1URS A;  3FVK A;  2OK2 A;  4HS7 A;  3CR9 A;  4KQP A;  3C31 A;  2XD2 A;  3EHT A;  1F9B A;  3LC8 A;  5ET5 A;  1PC3 A;  2XX7 A;  4LA9 A;  1H76 A;  3BIH A;  5CMM A;  3CFZ A;  4ESW A;  1US4 A;  4GWX A;  1M5D A;  2DSF A;  3RPW A;  5I84 A;  3N6T A;  3ZS6 A;  4PFI A;  3M3K A;  3B6Q A;  4XEQ A;  1US5 A;  3KG2 A;  2YJP A;  1A99 A;  1LAX A;  1JVX A;  1Y20 A;  5HM4 B;  5EQA A;  4DE8 A;  2F3D A;  4FE8 A;  4JSO A;  3VVE A;  3LBS A;  3EHS A;  4OA4 A;  3B7D A;  2UVG A;  1QKA A;  2WX9 A;  3UGW A;  2ONR A;  3U93 A;  2QVU A;  4IGR A;  1FBC A;  2DE3 A;  1MY0 A;  1SPI A;  3W9W A;  1NL5 A;  2GHA A;  4QBA A;  2FBP A;  1B2H A;  3E13 X;  3EPE A;  1MQG A;  5DVI A;  3JZJ A;  5B7D A;  1P1W A;  2MKZ A;  3H6V A;  3TTK A;  4UAC A;  1LCT A;  5CM6 A;  1B6H A;  4PCD A;  3QYT A;  3PPQ A;  5H8S A;  4AB6 A;  2ZZV A;  1JEU A;  4QRZ A;  3TTR A;  2QMX A;  4H46 A;  4HE0 A;  1GR2 A;  2RC8 A;  3CG3 A;  3OOA A;  3K1P A;  4DXU A;  5H8Q B;  1R6Z A;  4FAJ A;  3T22 A;  3ISP A;  4JVD A;  4PE5 B;  3DP4 A;  4I9D A;  2CZH A;  2HPG A;  3FVO A;  1A55 A;  4P8B A;  2UVJ A;  4F1Y A;  3H06 B;  1KA0 A;  4DZ1 A;  1FQF A;  3H3G A;  1DPP A;  4PDD A;  3KJT A;  1JVY A;  3ZSF A;  1NV3 A;  2KR0 A;  1Z7M E;  4DXB A;  3B6T A;  3PUZ E;  5AA3 A;  3MYU A;  4FOR A;  3PMV A;  4IO4 A;  3CFX A;  2D5W A;  3FIR A;  1FQA A;  2DOJ A;  2W7Y A;  5ITP A;  3FBP A;  1Q9D A;  1AOV A;  4JSD A;  1RDZ A;  3IJO B;  1I69 A;  1B0H A;  2F7B A;  1SI0 A;  4H1X A;  2Y7W A;  4TLL B;  3OEN A;  1B0L A;  2VPN A;  4GWY A;  3C35 A;  1KZ8 A;  1Z7N E;  4O7I A;  2O1L A;  4PFW A;  4F1V A;  1JW4 A;  2B65 A;  4KI0 E;  4GF8 A;  3I5O A;  1II5 A;  1AWB A;  3FZV A;  3FD3 A;  2HZK A;  1SQY A;  5FHN A;  4GL0 A;  4MNC A;  4F22 A;  1IZ1 A;  1MRP A;  5ET7 A;  4FJP A;  4LUB A;  2P3N A;  3SEX A;  3MP8 A;  1FBE A;  1N7X A;  4N6D A;  1SW1 A;  4GRK A;  1A8E A;  3MP1 A;  4I3Y A;  1XHY A;  4MHF A;  4BDR A;  1MXW A;  4XKN A;  4YKJ A;  3K2D A;  3EN3 A;  2DYX A;  4MIJ A;  3IB0 A;  4ZEC A;  4NF4 A;  4PP0 A;  1UQW A;  3T1B A;  1T0K A;  5F1Q A;  2RCA A;  4WKM A;  3C4M A;  3SDF A;  4FAT A;  3OO7 A;  4KR5 A;  2NOO A;  3MVX A;  3GLB A;  1N3X A;  1O63 A;  4HXV A;  1PEB A;  1EH3 A;  1FTM A;  3S9L C;  3PD8 A;  4JWO A;  3K6V A;  1B3G A;  5I7I A;  1FPJ A;  1BTJ A;  2Y7I A;  3LV0 A;  5L9O A;  5JTY A;  2OCU A;  4AB5 A;  4NE4 A;  4OVS A;  5F7V A;  1FBP A;  3PU5 A;  4GX6 A;  4X04 A;  4P11 A;  3KZG A;  4FED A;  4X8R A;  3EHU A;  4H5F A;  2VT5 A;  3CIJ A;  1SDX A;  3OMB A;  4MAG A;  1B5H A;  4OYV A;  1DMB A;  4RY1 A;  4Q8R A;  1Y9U A;  4OHN A;  2AL4 A;  2XXI A;  3PPP A;  4ZEI A;  5ET6 A;  1POT A;  1QJM A;  3PGF A;  1P1N A;  4JXI A;  5I2K B;  2KLF A;  2B4M A;  4PFY A;  4WED A;  3FJG A;  2XWK A;  3SZP A;  4MH5 A;  4OEU A;  4GWZ A;  1Y4C A;  2QRY A;  4F31 B;  4X9T A;  3TDJ A;  4GOT A;  3KSX A;  5I3S A;  1YZ0 A;  1FPG A;  1ANF A;  3A3C A;  5FBP A;  3FAT A;  4U4S A;  2Z8F A;  4P47 A;  2D3I A;  4ZEF A;  2V84 A;  5CI5 A;  3IFC A;  1B3L A;  1S7Y A;  3HV1 A;  5ITO A;  2NWJ A;  3IFA A;  2ZZW A;  1AIV A;  1S9T A;  3K6W A;  4G61 A;  4C0R A;  1MY2 A;  2Y7P A;  3SEV A;  4N81 A;  2A5T A;  2Z22 A;  2H98 A;  5EHM A;  3PUW E;  4OVT A;  3L6H A;  1H3D A;  2V25 A;  2FVZ A;  4WXJ A;  1UTH A;  4NF4 B;  4EF2 A;  4IB2 A;  4LZ8 A;  5I2N A;  4YMB A;  3K4U A;  1M5E A;  1USY E;  1FPF A;  1MPD A;  2PVU A;  4NF5 A;  4P1E A;  4PC9 A;  4UA8 A;  3OD7 A;  2O68 A;  3TUS A;  4PET A;  5H8H B;  4JBZ A;  3VXB A;  3VDF A;  3FXQ A;  3FV1 A;  3O6H A;  1FBF A;  4Q5T A;  4E0W A;  3SEU A;  1QUK A;  1M5C A;  4QSC A;  3TAJ A;  1SI1 A;  2O51 A;  1LEV A;  4TQU Q;  3A3U A;  4P0G A;  2ZXT A;  3HO7 A;  1MXV A;  2F35 A;  4POX A;  1BLF A;  4ZED A;  3D1R A;  1QVS A;  1YAE A;  1DTZ A;  2HAV A;  2DE2 A;  2QVR A;  3EF7 A;  3RYD A;  1KWH A;  4YU0 A;  2F3B A;  2B3B A;  2RC7 A;  1ZTY A;  3IOU A;  1RYX A;  1B9J A;  3ECR A;  4HCY A;  4HW8 A;  4YKP A;  2VGQ A;  2PMS A;  2DXY A;  1TT1 A;  3MUQ A;  2P3V A;  3RQT A;  3FJ7 A;  1OQG A;  5A5X B;  1IIT A;  3TFL A;  4N17 A;  2HXW A;  4NF6 A;  4PGN A;  4QSD A;  5DVF A;  3KN7 A;  1NNT A;  3PMW A;  4KPT A;  1GGG A;  1VSO A;  4GLI A;  3ODB A;  2XXU A;  3MVY A;  1LB8 A;  4JVI A;  2R6G E;  1FBD A;  2V3T A;  3T93 B;  3V5A A;  5FTI A;  3IX1 A;  2O7U A;  5AA2 A;  1XC1 A;  5DW8 A;  1FQC A;  2A5T B;  3H7M A;  3OXN A;  4FBP A;  2CZI A;  2X7Q A;  1UTH B;  1JQF A;  3H6U A;  5CMC A;  2FIE A;  4LQ2 A;  5I2N B;  2IEE A;  4KHZ E;  2F5X A;  1LBX A;  2R71 A;  2ZYO A;  3IOT A;  5TPA A;  4OZ9 A;  3LSL A;  4N8Y A;  1PDA A;  3B6W A;  1IXH A;  4NF5 B;  4O3B A;  3TKD A;  1DBZ A;  3KSJ A;  3U1O A;  2XXY A;  3OSR A;  3UN6 A;  3IO6 A;  1MQJ A;  1HSE A;  3TQW A;  4PE3 A;  1I6A A;  4WEP A;  1B1H A;  1MM7 A;  5BUU A;  4N8G A;  4U21 A;  3FVG A;  5L9S A;  3SEW A;  1NNK A;  1A40 A;  1Y3Q A;  4GFR A;  5FHO A;  4YKI A;  1B3H A;  4XKP A;  3TYH A;  4PF6 A;  3PTY A;  5L8D A;  5IGA A;  3TTL A;  4U4X A;  1LGB C;  4ELP A;  2ZNU A;  2Q2A A;  2PBW A;  2R9J A;  1FBG A;  4E0X A;  1JP4 A;  3O28 A;  2VPO A;  4OAN A;  1H45 A;  2ZYN A;  4QFP A;  4H45 A;  1B58 A;  4PF8 A;  3Q28 A;  1IQ7 A;  1A7L A;  2B4L A;  2P0S A;  1N76 A;  1I6B A;  1DPE A;  2DS9 A;  2V3U A;  4IO7 A;  1EYK A;  4NF6 B;  4KXP A;  1RKM A;  4NMY A;  1LFH A;  3FXR A;  2F6P A;  3WAE A;  1DOT A;  2CEX A;  4KYD A;  2RC9 A;  1QUJ A;  2PT2 A;  2Q89 A;  4Z0I A;  2IA4 A;  1LAG E;  2Z8E A; 
#chains in the Genus database with same CATH homology
 4GVO A;  3U92 A;  5AA2 B;  4EQ7 A;  3FJM A;  3MBP A;  4EQB A;  4U1Z A;  5ELV A;  3OO9 A;  3Q26 A;  1NH8 A;  3UP9 A;  3TTN A;  2E0S A;  1OVT A;  2X26 A;  5TPA B;  4KCD A;  2O69 A;  3MW0 A;  3USD A;  1Y1M A;  1Q1K A;  3N94 A;  3RTW B;  4OEV A;  2I0B A;  4OET A;  2HFB A;  1B52 A;  4N07 A;  3MPK A;  5K2Y A;  4MLQ A;  3OO8 A;  3CVG A;  1A8F A;  3CRB A;  3TPA A;  4MFI A;  4TOZ A;  1FTL A;  1MDQ A;  5JK4 A;  3QUF A;  1M5F A;  1LB9 A;  4IO5 A;  1B1X A;  4U22 A;  4YIC A;  1ZBM A;  3ONM A;  3KN3 A;  1DSN A;  3W15 C;  4H5G A;  5CBR A;  1B32 A;  1M5B A;  1VFE A;  1EU8 A;  1IXI A;  3LSX A;  4XIG Q;  2HQ0 A;  3VV5 A;  2XX8 A;  4YB6 A;  2Q9T A;  3Q25 A;  4ZZE A;  3O6I A;  2ABH A;  3VVF A;  3PUX E;  4IO6 A;  4EF1 A;  2UVH A;  3CFL A;  3G3I A;  2FNC A;  5FHM A;  5CMK A;  1B40 A;  4BLA A;  1WOD A;  3KOS A;  3T66 A;  2VP1 A;  3BBR A;  5ICQ A;  1MXZ A;  3RLF E;  3ILT B;  2UYE A;  1MDP 1;  1B4H A;  2DP8 A;  1IIW A;  1Y4T A;  1SYI A;  3TOD A;  1MQI A;  2H5Y A;  1JNF A;  3HN0 A;  2OLB A;  3OSQ A;  5KDT A;  1TFA A;  3W9V A;  2QS4 A;  5TP9 A;  2GH9 A;  1SW5 A;  1TFD A;  1YCJ A;  2ESN A;  3N26 A;  3K01 A;  4R9G A;  5AE4 A;  5I59 A;  3F11 A;  1FTO A;  4OFL A;  1ZKB A;  2REJ A;  4I62 A;  3RT8 A;  4XKQ A;  1LAF E;  2HZL A;  2OWT A;  3Q27 A;  2VD2 A;  1AL3 A;  1XT8 A;  4O3C A;  2HAU A;  2WKY A;  1D9V A;  1ZMG A;  3A09 A;  3O97 A;  3UIF A;  3VLU A;  3IL1 B;  4G2Z A;  4POW A;  2XD3 A;  3VLW A;  1MY3 A;  2Y7R A;  1S50 A;  1GVC A;  3IB2 A;  4G8N A;  1B5J A;  5EHS A;  1MS7 A;  2AYS A;  4G68 C;  3RN8 A;  3FUZ A;  1B3E A;  4YKK A;  3U8Q A;  3EQ1 A;  1EZP A;  1FCK A;  4ZS9 A;  1N04 A;  1N3W A;  2DWJ A;  5AA4 A;  1ELJ A;  3C33 A;  3TEP A;  4XKR A;  1TXF A;  1OQH A;  4FIM A;  1YTV A;  1B3F A;  1NMU A;  1LST A;  3S4U A;  3MVZ A;  4QSE A;  1LAH E;  4N6P A;  3TZA A;  4LQ5 A;  1URG A;  1QW0 A;  2HCA A;  3GXA A;  2A5S A;  3HHG A;  3IO4 A;  1HSJ A;  1TWY A;  4F3S A;  5AA2 D;  3FXU A;  3ZKK A;  4U1O A;  5KDT B;  4RYA A;  2M8C A;  5IKB A;  3WAF A;  2UXA A;  4DCX A;  3P7I A;  3T9H B;  5J1D A;  4EXL A;  5TP9 B;  4X1D A;  3H03 A;  1SVX B;  1MY4 A;  3VFJ A;  2Q2C A;  5DYH A;  1WDN A;  2DVC A;  4R2B A;  1XVX A;  4X1B A;  4LON B;  1UIU A;  3QUJ A;  5I59 B;  2PYY A;  3E3K A;  3IOR A;  2OZZ A;  3MQ9 A;  1XS5 A;  2DWH A;  2D21 A;  2YPN A;  3G3G A;  2ZMB A;  3IAZ A;  4F39 A;  2NXO A;  2O84 X;  3PMX A;  4PFT A;  2VD3 A;  3MAM A;  2ONK E;  1J1N A;  3H6W A;  4YB7 A;  2F8D A;  2QS1 A;  4H65 A;  4R72 A;  5JTY B;  4DIG A;  1MXX A;  3TMG A;  1JW1 A;  4YAH X;  4GXA A;  3BKI B;  1GTK A;  2DE4 A;  1R9L A;  3G7W A;  3G3H A;  3I6V A;  4ZEB A;  2ZYM A;  2ZNT A;  1OMP A;  3UA8 A;  4G4P A;  1MQD A;  4O3A A;  3RTF B;  3LSF B;  2GRV A;  3DLN A;  4ZZA A;  4R6K A;  3S9N C;  3L6G A;  1MQH A;  2DVZ A;  4DXC A;  4DDD A;  3LUY A;  3KFM A;  4F29 A;  1P1Q A;  1JEV A;  4BDM A;  4IO3 A;  2Z8D A;  3G3K A;  4QF9 A;  3U94 A;  3VXC A;  3JYR A;  3BFU A;  4KFQ A;  2B3F A;  2X7P A;  3MZB A;  3S2V A;  4KD5 A;  1VFD A;  3KGC A;  4F2O A;  5JEI A;  4THI A;  5EYF A;  3LSW A;  3C34 A;  2H25 A;  1ZLQ A;  3LR1 A;  3QXM A;  1LFG A;  3O2A A;  2ANJ A;  1JW5 A;  1P1U A;  1FQD A;  3RT6 B;  4OVJ A;  1SBP A;  5I56 A;  4QFN A;  1SW2 A;  4FEC A;  1IXG A;  1H43 A;  5DTB A;  2H4I A;  1NH7 A;  1BIY A;  3SES A;  4BDL A;  4Z7E A;  2FA7 A;  4F18 A;  1R1N A;  4NF8 A;  3VLV A;  4F19 A;  4NWC A;  3SEY A;  2XXW A;  3M3F A;  3DP6 A;  4QHQ A;  4ELQ A;  2QSX A;  1OIB A;  4U2R A;  3ZKL A;  3SER A;  4QFL A;  4TLM B;  4QFK A;  3V83 A;  3HST A;  4RA1 A;  3MPL A;  2GFE A;  4U23 A;  3VE1 B;  2P1S A;  3KJ7 A;  2Z23 A;  5DEX A;  2G93 A;  3D4G A;  4N13 A;  4RNS A;  3KBR A;  2NVU B;  5DVJ A;  1MY1 A;  4F3B A;  3K1M A;  3DM0 A;  2O1M A;  3K1N A;  2ONS A;  1JET A;  4Q30 B;  4G8H A;  4R75 A;  5IAI A;  4HCW A;  2RKM A;  5ISU A;  2QMW A;  2Y7K A;  1IEJ A;  3K0V A;  4R2F A;  5KCJ A;  3TCH A;  1PB7 A;  5CC2 A;  1SYH A;  1LLS A;  3H4Z A;  2Q8J A;  3M8U A;  3O29 A;  2PX1 A;  3THI A;  2P2A A;  4F3P A;  2CZL A;  3T9U A;  1D9Y A;  5CBS A;  4ND9 A;  3TCF A;  1OLA A;  4ZDM A;  1Y3N A;  3OEK A;  4R74 A;  1OVB A;  4H6D A;  3FGS A;  2I6E A;  2RIN A;  5FTH A;  1ZU0 A;  3BFT A;  4H67 A;  3N5L A;  5I56 B;  4OES A;  3T9X B;  3O9P A;  3DP8 A;  2QL3 A;  5H8N A;  4DCY A;  2UYF A;  2REG A;  1MXY A;  4NF8 B;  4JDF A;  3PPN A;  4ECF A;  2PT1 A;  2F7A A;  4M4G A;  3PUV E;  2GHB A;  3KN8 A;  4IO2 A;  1HSL A;  3SET A;  4GQO A;  1MXU A;  4EXK A;  1NFT A;  3OO6 A;  3G3F A;  4NTL A;  4G77 A;  4RPN A;  4F3G A;  2QJE A;  3I3V A;  4OFO A;  2I48 A;  3KEI A;  5DEX B;  3TQL A;  1MH4 A;  2QS3 A;  3G3J A;  4M1V A;  3TEL A;  4GXS B;  1QUL A;  5L9M A;  3SKP A;  3FV2 A;  2LAO A;  1LBB A;  4LZ5 A;  1Y3P A;  3GBA A;  5I57 A;  1IXC A;  3OEM A;  4R6Y A;  5KCJ B;  4R73 A;  5I58 A;  2XXX A;  4KYE A;  3AXF A;  1BP5 A;  2XHD A;  3V8X B;  3N6U A;  3MP6 A;  1B46 A;  4LVQ A;  1N7W A;  3RUM A;  1PBP A;  4IY5 A;  4I8C A;  2XXV A;  4MBP A;  4C1T A;  1FTJ A;  1XVY A;  5I2K A;  2HEU A;  1MM6 A;  4Q0C A;  5M2V A;  4OXV A;  3JV9 A;  2ZNS A;  4JB7 A;  2OJT A;  4OEN A;  4RXL A;  4RPO A;  4OFJ A;  3TTM A;  3T96 B;  3ILU B;  4EQ9 A;  1MH3 A;  5CMB A;  3T9V A;  2RF1 A;  4HTG A;  3S9M C;  1FQE A;  1NNF A;  3DEL B;  2YLN A;  3D4C A;  1URD A;  2E1S A;  1R9Q A;  4L17 A;  5H8N B;  4X48 A;  1SW4 A;  2XX9 A;  4YMA A;  5CRY A;  2I4B A;  4GL8 A;  4BDO A;  4H8J A;  1B7U A;  1Y1Z A;  1O64 A;  3PPR A;  4F1U A;  3HHF A;  1D4N A;  4GD5 A;  1B7H A;  1PB8 A;  3OEL A;  4JWY A;  1CE2 A;  4MF3 A;  3MZ1 A;  2I3W A;  2AIX A;  1USY H;  2H99 A;  3MC2 A;  3UOR A;  2THI A;  3PV0 E;  4OMB A;  4G68 A;  1B51 A;  2I3V A;  1XOC A;  4BDN A;  5I57 B;  2I49 A;  1IUD A;  5H8H A;  1N0T A;  4F2Q A;  1LBC A;  4C1U A;  4ZE9 A;  5I58 B;  4XXU A;  4ONY A;  1O7T A;  3QK6 A;  4G8M A;  3HCQ A;  1SD3 A;  3CI8 A;  1B4Z A;  1I6Q A;  2XXT A;  4OER A;  2V93 A;  1B05 A;  3R6U A;  1UIV A;  2VHA A;  1DTG A;  4LP2 B;  4DLD A;  3C36 A;  4R9F A;  2I58 A;  1EZO A;  3RNN A;  1AH5 A;  2ZYK A;  1FW0 A;  4OWD A;  1WVJ A;  1P99 A;  1PBQ A;  1MPC A;  3E4R A;  4ISU A;  1MPB A;  4FEB A;  3IB1 A;  2F97 A;  4I1D A;  5A5X A;  1QUI A;  3IK6 B;  3IR1 A;  1A54 A;  3KOT A;  2VOZ A;  1POY 1;  5H8F A;  3PPO A;  2XXR A;  3QSL A;  3FVN A;  2Y84 A;  4P0I A;  2F78 A;  2DWA A;  3UK4 A;  2F36 A;  2QS2 A;  3MVW A;  3K6X A;  3RGY A;  2H9B A;  2V3Q A;  1MG1 A;  1D3K A;  4KCC A;  2O6A A;  3S9E A;  5LOM A;  3K00 A;  2F34 A;  4BDQ A;  4GIZ A;  3IOW A;  2OWS A;  3E9X A;  1CB6 A;  3M3L A;  5HPQ A;  4G68 B;  3Q29 A;  2OBG A;  2AL5 A;  1LCF A;  4NED A;  5K2X A;  2I4C A;  4IGT A;  1OLC A;  4EDP A;  3H6T A;  3K6U A;  5AA4 B;  4AQ4 A;  1VR5 A;  2UVI A;  1UTB A;  4NWD A;  1ZIU A;  4H0W A;  3O6G A;  1ATG A;  3MJN A;  3HPI A;  3RY3 A;  1ZJL A;  3CSB A;  3PD9 A;  4ZE8 A;  1FTK A;  4XTC Q;  1YPN A;  1BKA A;  4K3F A;  4LZ7 A;  4RK2 A;  2XXQ A;  1L5T A;  2BJJ X;  2ALU A;  3U72 A;  2XXH A;  2F6G A;  2DXR A;  5DT6 A;  4IY6 A;  2RCB A;  1RYO A;  1EZ9 A;  2Q88 A;  3VVD A;  1FQB A;  4MLV A;  4RK9 A;  5H8F B;  4OQO A;  2FYI A;  4ELO A;  2G29 A;  2DWI A;  4R6H A;  4GWO A;  2O7I A;  1LFI A;  4KYS A;  4RJZ A;  5B70 A;  4EUO A;  3FAS A;  3R26 A;  3QIM A;  3CSG A;  5TU0 A;  5HBC A;  3TCG A;  3IOV A;  1B5I A;  5ICT A;  3GBB A;  2F7C A;  1NNP A;  5BWJ A;  3R7X A;  5KZT A;  4H8I A;  4LAT A;  4PQJ A;  1B7Z A;  1H44 A;  2NUV A;  1GV8 A;  1AMF A;  3CG1 A;  1NKX A;  1Q35 A;  4OTE A;  3K02 A;  1VE4 A;  1N84 A;  2DQV A;  3GZG A;  4JWX A;  1QKB A;  3PUY E;  3IJX B;  4PFU A;  1PB9 A;  1UTB B;  1P1O A;  2XXP A;  3QAX A;  4ELR A;  2I0C A;  3MZ9 A;  4YZZ A;  3V89 B;  2QPQ A;  3C32 A;  4YB5 A;  5H8Q A;  4QFO A;  4ESX A;  3O66 A;  5AA1 A;  2CMO A;  3C9H A;  4ZEK A;  3MWB A;  1URS A;  3FVK A;  2OK2 A;  4HS7 A;  3CR9 A;  4KQP A;  3C31 A;  2XD2 A;  3EHT A;  1F9B A;  3LC8 A;  1PC3 A;  2XX7 A;  4LA9 A;  1H76 A;  5CMM A;  3CFZ A;  4ESW A;  1US4 A;  5I84 A;  1M5D A;  2DSF A;  3RPW A;  3N6T A;  3ZS6 A;  3M3K A;  3B6Q A;  1US5 A;  3KG2 A;  2YJP A;  1A99 A;  1LAX A;  1JVX A;  1Y20 A;  5HM4 B;  4DE8 A;  4FE8 A;  4JSO A;  3VVE A;  3LBS A;  3EHS A;  3B7D A;  2UVG A;  1QKA A;  3UGW A;  2ONR A;  3U93 A;  4IGR A;  2DE3 A;  1MY0 A;  3W9W A;  1NL5 A;  2GHA A;  1B2H A;  3E13 X;  3EPE A;  1MQG A;  5DVI A;  3JZJ A;  5B7D A;  1P1W A;  3H6V A;  3TTK A;  4UAC A;  1LCT A;  5CM6 A;  1B6H A;  3QYT A;  3PPQ A;  5H8S A;  4AB6 A;  1JEU A;  4QRZ A;  3TTR A;  2QMX A;  1GR2 A;  2RC8 A;  3CG3 A;  3OOA A;  3K1P A;  4DXU A;  5H8Q B;  1R6Z A;  4FAJ A;  3T22 A;  4PE5 B;  3DP4 A;  4I9D A;  3FVO A;  1A55 A;  2UVJ A;  4F1Y A;  3H06 B;  4DZ1 A;  1FQF A;  3H3G A;  1DPP A;  3KJT A;  1JVY A;  3ZSF A;  1Z7M E;  4DXB A;  3B6T A;  3PUZ E;  5AA3 A;  4FOR A;  3PMV A;  4IO4 A;  3CFX A;  2D5W A;  3FIR A;  1FQA A;  2DOJ A;  2W7Y A;  5ITP A;  1AOV A;  4JSD A;  3IJO B;  1I69 A;  1B0H A;  2F7B A;  1SI0 A;  4H1X A;  2Y7W A;  4TLL B;  3OEN A;  1B0L A;  3C35 A;  1Z7N E;  2O1L A;  4PFW A;  4F1V A;  1JW4 A;  2B65 A;  4KI0 E;  4GF8 A;  3I5O A;  1II5 A;  3FZV A;  3FD3 A;  2HZK A;  1SQY A;  5FHN A;  4GL0 A;  4F22 A;  1IZ1 A;  1MRP A;  4FJP A;  4LUB A;  3SEX A;  3MP8 A;  1N7X A;  1SW1 A;  4GRK A;  1A8E A;  3MP1 A;  1XHY A;  4BDR A;  1MXW A;  4XKN A;  4YKJ A;  3K2D A;  3EN3 A;  2DYX A;  4ZEC A;  3IB0 A;  4NF4 A;  4PP0 A;  1UQW A;  1T0K A;  5F1Q A;  2RCA A;  4WKM A;  3C4M A;  3SDF A;  4FAT A;  3OO7 A;  4KR5 A;  2NOO A;  3MVX A;  3GLB A;  1N3X A;  1O63 A;  1PEB A;  1EH3 A;  1FTM A;  3S9L C;  3PD8 A;  4JWO A;  3K6V A;  1B3G A;  1BTJ A;  2Y7I A;  5L9O A;  5JTY A;  2OCU A;  4AB5 A;  4NE4 A;  5F7V A;  3PU5 A;  4P11 A;  3KZG A;  4FED A;  3EHU A;  4H5F A;  3CIJ A;  1SDX A;  3OMB A;  1B5H A;  4OYV A;  1DMB A;  4RY1 A;  4Q8R A;  1Y9U A;  4OHN A;  2AL4 A;  2XXI A;  3PPP A;  4ZEI A;  1POT A;  1QJM A;  3PGF A;  1P1N A;  4JXI A;  5I2K B;  2KLF A;  4PFY A;  4WED A;  3FJG A;  4MH5 A;  4OEU A;  1Y4C A;  2QRY A;  4F31 B;  4X9T A;  3TDJ A;  4GOT A;  3KSX A;  1ANF A;  3A3C A;  3FAT A;  4U4S A;  2Z8F A;  2D3I A;  4ZEF A;  2V84 A;  5CI5 A;  1B3L A;  1S7Y A;  3HV1 A;  5ITO A;  2NWJ A;  1AIV A;  1S9T A;  3K6W A;  4C0R A;  1MY2 A;  2Y7P A;  3SEV A;  2A5T A;  2Z22 A;  2H98 A;  5EHM A;  3PUW E;  3L6H A;  1H3D A;  2V25 A;  4WXJ A;  1UTH A;  4NF4 B;  4EF2 A;  4IB2 A;  4LZ8 A;  5I2N A;  4YMB A;  3K4U A;  1M5E A;  1USY E;  1MPD A;  2PVU A;  4NF5 A;  4UA8 A;  3OD7 A;  2O68 A;  3TUS A;  4PET A;  5H8H B;  4JBZ A;  3VXB A;  3VDF A;  3FXQ A;  3FV1 A;  3O6H A;  4Q5T A;  4E0W A;  3SEU A;  1QUK A;  1M5C A;  4QSC A;  3TAJ A;  1SI1 A;  2O51 A;  4TQU Q;  3A3U A;  4P0G A;  2ZXT A;  3HO7 A;  1MXV A;  2F35 A;  4POX A;  1BLF A;  4ZED A;  1QVS A;  1YAE A;  1DTZ A;  2HAV A;  2DE2 A;  3EF7 A;  1KWH A;  4YU0 A;  2B3B A;  2RC7 A;  1ZTY A;  3IOU A;  1RYX A;  1B9J A;  3ECR A;  4HCY A;  4HW8 A;  4YKP A;  2VGQ A;  2PMS A;  2DXY A;  1TT1 A;  3MUQ A;  3RQT A;  3FJ7 A;  1OQG A;  5A5X B;  1IIT A;  3TFL A;  2HXW A;  4NF6 A;  4QSD A;  5DVF A;  3KN7 A;  1NNT A;  3PMW A;  4KPT A;  1GGG A;  1VSO A;  4GLI A;  3ODB A;  2XXU A;  3MVY A;  1LB8 A;  2R6G E;  2V3T A;  3T93 B;  3V5A A;  5FTI A;  3IX1 A;  2O7U A;  5AA2 A;  1XC1 A;  1FQC A;  2A5T B;  3H7M A;  3OXN A;  2X7Q A;  1UTH B;  1JQF A;  3H6U A;  5CMC A;  4LQ2 A;  5I2N B;  2IEE A;  4KHZ E;  2F5X A;  2R71 A;  2ZYO A;  3IOT A;  5TPA A;  4OZ9 A;  3LSL A;  1PDA A;  3B6W A;  1IXH A;  4NF5 B;  4O3B A;  3TKD A;  3KSJ A;  3U1O A;  2XXY A;  3OSR A;  3UN6 A;  3IO6 A;  1MQJ A;  1HSE A;  3TQW A;  1I6A A;  4WEP A;  1B1H A;  1MM7 A;  5BUU A;  4U21 A;  3FVG A;  5L9S A;  3SEW A;  1NNK A;  1A40 A;  1Y3Q A;  4GFR A;  5FHO A;  4YKI A;  1B3H A;  4XKP A;  3TYH A;  5L8D A;  3TTL A;  4U4X A;  1LGB C;  4ELP A;  2ZNU A;  2Q2A A;  2PBW A;  2R9J A;  4E0X A;  3O28 A;  1H45 A;  2ZYN A;  4QFP A;  1B58 A;  3Q28 A;  1IQ7 A;  1A7L A;  2P0S A;  1N76 A;  1I6B A;  1DPE A;  2DS9 A;  2V3U A;  4IO7 A;  4NF6 B;  1RKM A;  4NMY A;  1LFH A;  3FXR A;  2F6P A;  3WAE A;  1DOT A;  4KYD A;  2RC9 A;  1QUJ A;  2PT2 A;  2Q89 A;  4Z0I A;  2IA4 A;  1LAG E;  2Z8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...