4M4GA

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium lt2 in complex with effector ligand, n-acetylserine.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium LT2 in complex with effector ligand, N-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
total genus 57
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA02
3DP8A 2ZNTA 3TDJA 4O3CA 3KJ7A 4Z0IA 1DTGA 2R71A 4PFUA 4G8HA 4F31B 1FQAA 1TFDA 3PGFA 3L6HA 1A7LA 4DZ1A 1XHYA 4IGTA 4GOTA 2P1SA 1B9JA 3LSFB 4IO6A 3G3FA 4KR5A 2UXAA 2Z8DA 5AA2A 3RT8A 5F1QA 1B40A 4F19A 2QSXA 1MQDA 3IR1A 1AIVA 4LQ2A 1Y9UA 2THIA 1TXFA 4OXVA 4OHNA 3MJNA 1MRPA 4ELPA 4R9GA 3MP6A 2AL4A 4ISUA 5DVJA 3D4GA 4ZEKA 2Z22A 5B70A 3SESA 5FHMA 2Q89A 4YMAA 3P7IA 3ONMA 3KSJA 4DXCA 1B51A 1SI1A 1FQDA 4K3FA 4H8IA 2XX8A 3CFZA 3DP6A 5FHOA 1UTBB 3TTRA 3IK6B 1OLAA 4OZ9A 2X7PA 2OCUA 3OO6A 1R9QA 4R74A 4GL0A 4MH5A 1LBBA 1B1XA 4F3PA 1POTA 2RC8A 1XVYA 1TWYA 2AL5A 4POXA 3RT6B 3FIRA 4ZEIA 3SETA 3K6VA 3PU5A 4E0WA 4DIGA 4KQPA 3MVZA 3E13X 5CBRA 1QUKA 1XS5A 3BBRA 1PC3A 1D9YA 4IB2A 3M3FA 4LP2B 5EYFA 3IX1A 4MFIA 4IO5A 2I4BA 1QKAA 4PE5B 2PVUA 4G8NA 2B3BA 4DCYA 1ZLQA 2OLBA 4Q8RA 1ATGA 3HCQA 4IO2A 2F7BA 4EQBA 1URGA 3KN3A 5A5XB 4U22A 2UVHA 1MY2A 2DYXA 4G68B 4EQ9A 3GLBA 1PBPA 3MP1A 1OQHA 3H4ZA 3VLVA 3QUFA 2O7IA 1MXZA 1QW0A 4DXUA 1B58A 3TFLA 4UACA 2OJTA 1LAGE 4ELQA 2DWHA 1B0HA 3TPAA 1HSEA 2IA4A 1URSA 3OD7A 4FIMA 1SI0A 4KCCA 1WDNA 5CC2A 1PBQA 3FGSA 3TQWA 3VLWA 2ABHA 2O6AA 1H44A 4MF3A 2P0SA 1OQGA 2I6EA 5H8NA 2D5WA 4YKKA 1II5A 1LCFA 2H5YA 1FTOA 3O29A 4I9DA 4G8MA 2Z8EA 4P11A 1CB6A 1MS7A 3N26A 2Z8FA 3T9VA 4WXJA 3B7DA 4X1DA 5I59B 4RJZA 4F3GA 5ITPA 3EQ1A 1P99A 1B2HA 3EPEA 1O7TA 2HFBA 2O84X 4YB7A 3PPNA 3FJMA 1ZKBA 3MAMA 5CI5A 4QSEA 3FVGA 3LR1A 3O6HA 4IGRA 2UVJA 5ISUA 3G3IA 1A54A 3IO4A 4DXBA 1FCKA 2HCAA 3OSQA 3LBSA 5J1DA 5I58B 1XOCA 2XD2A 2DWIA 2XXRA 1KWHA 4JSDA 1B7UA 3B6WA 4Q5TA 4Z7EA 2GH9A 4FEBA 1I6BA 3KZGA 2DSFA 3CRBA 1JVXA 4R2FA 4GLIA 3H6TA 3IOWA 2QPQA 3KOSA 2YPNA 2VHAA 1M5DA 4EXKA 4G77A 4BLAA 4MLQA 5AA4A 1UTHB 1ZJLA 5I57A 4EF2A 3PUWE 4U4XA 3T96B 5ITOA 2GHBA 4R75A 3T93B 2PBWA 1S50A 1M5BA 2Y7KA 2FA7A 1OLCA 3K4UA 1FTJA 3ECRA 2V3UA 3N94A 4F3BA 2F7AA 3C33A 1TFAA 3LUYA 4TQUQ 2DP8A 1AMFA 2E1SA 3B6QA 5CMKA 1YPNA 3PPOA 2CMOA 1LB9A 3RTWB 1LFIA 4WEPA 3K02A 3K6XA 3V89B 4IO4A 2PMSA 1B3FA 1H3DA 3SEYA 3USDA 1LSTA 3C4MA 1ZMGA 4ONYA 4KYDA 2YLNA 4GD5A 3TEPA 3CFLA 1GGGA 4F2OA 2Q8JA 2PYYA 3FJ7A 3HHGA 1Q1KA 4YKPA 3CSBA 3TCFA 1H76A 3KFMA 5HM4B 3MBPA 1NNFA 2DS9A 4RY1A 4QRZA 1GV8A 4LUBA 3VE1B 1EU8A 2NUVA 3TTMA 3KN8A 1MM7A 1SD3A 4F1VA 2FYIA 4KHZE 1AL3A 4OFJA 3B6TA 4OWDA 3QAXA 1PB7A 4NF5A 4KYSA 2ZYKA 5BWJA 2DWJA 3MC2A 4NF8A 3V5AA 3TUSA 4RK2A 3C36A 4R73A 1NL5A 2ZNSA 3Q29A 2CZLA 3W9WA 5DEXA 2XXTA 5I2NA 2DVCA 1MPDA 3KGCA 3FV1A 4FECA 3K1MA 1LFHA 3U92A 3OSRA 4EUOA 3ZS6A 3UGWA 2XXUA 4BDOA 1UTHA 3W9VA 3HHFA 5DT6A 5KCJA 3SEWA 5CBSA 1AH5A 2Y84A 4I8CA 2Q88A 3T9HB 4XKRA 3T22A 5ICTA 4AQ4A 4C0RA 1RYXA 2F78A 4HCYA 2HEUA 4QFPA 5AA3A 1H45A 3HN0A 3IJXB 3CFXA 4RA1A 2V93A 4X9TA 3VXBA 3MVXA 2XXWA 4UA8A 4ESXA 4Q30B 1ZIUA 4OERA 3K01A 4C1UA 2I58A 3PUVE 1D3KA 4N6PA 4F1YA 1A8FA 2ZYOA 3IOUA 4P0IA 3DLNA 4FE8A 4PETA 5AA2D 4JSOA 3UP9A 1J1NA 1D9VA 2UYFA 5H8SA 2V25A 3KOTA 2Y7PA 2I48A 3M8UA 2XX9A 5M2VA 1YCJA 3OO8A 2A5SA 3M3KA 3QIMA 4JDFA 5IAIA 3EF7A 3K1PA 3RY3A 3QYTA 5H8NB 1M5FA 3S9MC 1MQIA 3GBAA 5HBCA 2Y7RA 4EXLA 1P1UA 3S4UA 3FVKA 4U1OA 3I6VA 3IJOB 4OFOA 2HAVA 3MVYA 1B5HA 3UORA 3TODA 1EH3A 3F11A 1BKAA 3FXQA 2REGA 2X26A 2RC7A 4H1XA 5BUUA 4ZEBA 3FD3A 3RTFB 3IO6A 4NTLA 4O3AA 4RYAA 3WAFA 1SVXB 1F9BA 3C35A 1QJMA 4H67A 2F34A 2Y7IA 3JYRA 3MVWA 4OTEA 3VV5A 1GVCA 1I6AA 3TKDA 2DOJA 4TLLB 2G29A 1MQGA 1NH7A 1NFTA 2ONKE 1N3XA 3CG1A 5EHMA 1SW2A 3VLUA 5AA4B 2O68A 5I57B 1Y3PA 5I56A 4GL8A 1NNTA 2PT2A 4YB5A 1N76A 1M5CA 1LLSA 1NNKA 2VD3A 1MDQA 1VSOA 4H5GA 3UK4A 3BKIB 1ZU0A 3RNNA 1XT8A 4JWXA 3G3KA 3Q28A 3E4RA 4KFQA 4RXLA 3C32A 1SYIA 2DE3A 4ESWA 2D21A 3GZGA 3IL1B 1ZBMA 2Q2AA 3OO7A 4X1BA 2XD3A 2XXQA 1US4A 1UIVA 3MPLA 4WKMA 2NOOA 1DSNA 1MXUA 3RQTA 1FTKA 1SW1A 3ZKLA 4RPOA 5AA1A 2OWTA 2IEEA 1XVXA 2OZZA 1Y1MA 2ZNUA 4FORA 4GVOA 4ND9A 4YICA 2HZLA 2DVZA 2HZKA 1MH3A 1UQWA 4ELOA 3ZSFA 2V3QA 4I1DA 1IXCA 5H8FA 1A40A 1S9TA 1CE2A 2ANJA 4XTCQ 1FQBA 2V3TA 3N6TA 1LAXA 3PV0E 3O28A 5HPQA 3LSWA 5DVIA 2ZYMA 1JW5A 3G7WA 4LATA 4PQJA 3LSLA 1IXIA 1Y4CA 1B52A 4IO3A 4LA9A 1T0KA 2I0BA 2O1LA 4NF5B 4ZEDA 2RINA 2QRYA 4N13A 1BTJA 3H7MA 4NF8B 4GWOA 2OBGA 2REJA 4BDRA 4GF8A 1RKMA 2F97A 5I84A 4GQOA 4OQOA 1BIYA 3EHSA 3MZ9A 3G3HA 5DEXB 4RK9A 5I2NB 3ZKKA 5KDTA 1ANFA 3A09A 2FNCA 3LSXA 3L6GA 1MM6A 3O6GA 3OEMA 4F18A 3A3UA 1M5EA 3H6WA 3A3CA 4WEDA 3EHUA 5KCJB 1DPEA 1R9LA 3OXNA 3PMVA 1IITA 4PFWA 1IIWA 1P1NA 4FAJA 4LZ5A 1RYOA 1QULA 3IOTA 4QF9A 3CR9A 5IKBA 1R1NA 1B46A 4NEDA 3CI8A 2ONSA 2I3WA 4FEDA 1OVTA 3FVNA 4H6DA 5TPAA 2XXPA 3FUZA 2XXIA 4BDMA 1N04A 4GFRA 4MLVA 4QSDA 3FASA 5TP9A 1A55A 3U1OA 4ZDMA 2UVIA 3DM0A 4YKIA 1US5A 4Q0CA 4MBPA 4M1VA 2DQVA 1NMUA 4YAHX 1JETA 4F1UA 3AXFA 4XKPA 4H65A 3RN8A 1FQCA 3R7XA 3RGYA 5CMCA 3EN3A 1N3WA 2QL3A 2F6GA 4LVQA 2NVUB 5F7VA 2OWSA 4KPTA 1JW4A 1IUDA 4QFOA 3H03A 1N7WA 3S9NC 1P1WA 1GTKA 3BFUA 4POWA 1B7ZA 5KZTA 3OMBA 2H9BA 5JTYA 2H98A 1OVBA 2P2AA 3GBBA 4AB5A 2XXXA 2RKMA 2I49A 3VXCA 1PEBA 3U72A 3OEKA 4YKJA 1USYH 3R26A 1IXHA 1SDXA 3H06B 4IY6A 1JVYA 3MQ9A 3GXAA 1Y3QA 5JEIA 5LOMA 3TMGA 1SYHA 2HQ0A 2LAOA 1LGBC 1B3EA 4NF6A 4GRKA 3IB1A 4QHQA 4R72A 4R6HA 3Q26A 3VVDA 3KG2A 1A8EA 4HS7A 4OEVA 3C9HA 4R6YA 1B3LA 1NH8A 3FXRA 4AB6A 1QUJA 3UA8A 4NWCA 3KBRA 1LB8A 5JK4A 2R6GE 3K6UA 3TELA 3KSXA 2H4IA 5FTIA 3O66A 2H25A 1VFEA 1P1QA 3PD8A 1B4HA 3U8QA 4BDLA 3WAEA 3G3GA 3TAJA 5I56B 1JW1A 4DE8A 2ONRA 1FTLA 1L5TA 2O1MA 1I6QA 2AYSA 4X48A 4NE4A 3S2VA 3PMWA 5DVFA 2XXVA 3BFTA 1MXWA 2QMXA 4YB6A 2QS3A 3TQLA 1LCTA 5ELVA 5H8HA 2PT1A 2F36A 4H8JA 4YZZA 3TTKA 3MZBA 3PUXE 5DYHA 1UIUA 3OO9A 4KYEA 5L8DA 3TTNA 3I5OA 3M3LA 2BJJX 4U21A 2ZMBA 4R9FA 4GIZA 4QFKA 4G4PA 2HAUA 3O2AA 2RF1A 4IY5A 1MH4A 3PUZE 3E9XA 3K6WA 4XKQA 3V8XB 3VFJA 3PUYE 1B32A 3V83A 1B6HA 1N7XA 1POY1 4OENA 3N6UA 4OVJA 1MXXA 5H8FB 1LBCA 3ODBA 1MDP1 3PPPA 1Z7ME 5EHSA 4ZZEA 2A5TA 1URDA 1Y4TA 2WKYA 5FHNA 1IZ1A 4DCXA 3JZJA 1MY4A 1ELJA 1Y20A 4LZ8A 2O7UA 2NWJA 2O69A 1FW0A 4R2BA 3W15C 1B1HA 5L9MA 3G3JA 4HTGA 2Q2CA 2F6PA 4HCWA 1JQFA 1QVSA 5K2XA 1B7HA 1YAEA 2I0CA 2DXRA 4KD5A 3CVGA 5H8QA 1SQYA 1QKBA 2F8DA 5I2KA 1B5JA 3IB0A 1USYE 1NKXA 2ZYNA 4G2ZA 3I3VA 3OENA 1JEVA 1FQEA 1LAFE 2UYEA 3S9LC 4LONB 4XIGQ 3QK6A 1SBPA 3PPRA 3N5LA 4L17A 3T9UA 1PB9A 1LFGA 2E0SA 1IQ7A 5ICQA 3HSTA 4C1TA 5KDTB 4PFTA 4JXIA 2GHAA 4U4SA 3C34A 1EZOA 4R6KA 3KEIA 2O51A 1MPCA 2F7CA 4M4GA 1N0TA 3IAZA 2PX1A 1MQHA 4ZS9A 5CRYA 3H6UA 4JBZA 2VD2A 1EZ9A 4XKNA 3O97A 1FTMA 3S9EA 3FV2A 5DTBA 2VGQA 2X7QA 4ELRA 4OMBA 3JV9A 5TPAB 4ZZAA 2B65A 4ZE9A 4YMBA 4THIA 1IEJA 5TP9B 4HW8A 2RCBA 4QFLA 3FVOA 4U1ZA 1MG1A 1FQFA 3DP4A 1XC1A 3H3GA 1DMBA 2Q9TA 1EZPA 2RC9A 1LAHE 3IB2A 3FXUA 1B5IA 3RPWA 4JWOA 2QJEA 4RPNA 1I69A 3CG3A 3U94A 2QS1A 3SDFA 4JB7A 4NF4B 2GFEA 3SEXA 1MXYA 3TZAA 1P1OA 1B05A 2Z23A 3OOAA 3QXMA 1UTBA 3MP8A 2DXYA 4ZE8A 4N07A 3K1NA 5B7DA 5JTYB 1AOVA 4ZEFA 3PMXA 4YU0A 3OELA 4GXSB 1SW4A 4P0GA 2OK2A 4GXAA 2ZXTA 2R9JA 4JWYA 1OIBA 3T9XB 1MY0A 2M8CA 3UN6A 4EQ7A 4IO7A 4O3BA 4DDDA 1Z7NE 1PB8A 2XHDA 3HPIA 2G93A 2HXWA 3U93A 3MPKA 3E3KA 2VOZA 3H6VA 4NF6B 2F35A 1MQJA 3HO7A 4NMYA 2DE4A 4U23A 4ECFA 4QSCA 3ILTB 3MUQA 5L9OA 1B3HA 2D3IA 2I4CA 2RCAA 2NXOA 3VVEA 3O9PA 4XXUA 4F3SA 4FJPA 4FATA 1VFDA 4OFLA 3VVFA 2DE2A 4EF1A 2W7YA 3SKPA 4QFNA 2QS2A 4LQ5A 5TU0A 5CMBA 4KI0E 4KCDA 3R6UA 4F29A 4OETA 3FATA 5AE4A 3KJTA 4H5FA 2XX7A 1Q35A 3SEVA 1B4ZA 5A5XA 4G68C 2H99A 4G68A 4BDNA 1Y3NA 1N84A 2AIXA 3PPQA 5CMMA 4OYVA 4LZ7A 4OEUA 3IOVA 2QMWA 1H43A 1OMPA 4F39A 5H8HB 3HV1A 1PDAA 1QUIA 1R6ZA 1SW5A 5AA2B 2DWAA 3QUJA 5CM6A 3K0VA 5K2YA 4NF4A 4RNSA 3TTLA 3FZVA 2KLFA 4E0XA 3RUMA 3K00A 4PFYA 3T66A 3TCHA 2B3FA 4F22A 3VDFA 1IXGA 3SERA 1YTVA 1HSLA 3D4CA 2ESNA 1HSJA 3RLFE 1GR2A 1MXVA 1DTZA 2VP1A 3FJGA 3THIA 4H0WA 1JEUA 2XXHA 3C31A 2YJPA 2A5TB 4I62A 5I59A 3EHTA 3IORA 1A99A 3MW0A 3CSGA 1Y1ZA 3K2DA 3PD9A 4TLMB 1NNPA 4DLDA 1WVJA 2Y7WA 3MWBA 1B0LA 1O63A 1B3GA 3LC8A 3KN7A 3Q27A 4ZECA 3MZ1A 5I58A 1DPPA 1ZTYA 1MPBA 3QSLA 2V84A 1JNFA 2UVGA 1VE4A 1DOTA 4BDQA 2XXYA 4F2QA 5H8QB 1O64A 4NWDA 5I2KB 3Q25A 1VR5A 3UIFA 4TOZA 3CIJA 3TYHA 5L9SA 3ILUB 3O6IA 1WODA 1MY1A 1TT1A 1BP5A 1D4NA 4EDPA 2I3VA 4OESA 2QS4A 2GRVA 3TCGA 3DELB 1MY3A 3SEUA 4U2RA 1S7YA 2ALUA 2F5XA 4PP0A 1BLFA 5FTHA
chains in the Genus database with same CATH superfamily
3DP8A 2ZNTA 3TDJA 4O3CA 3KJ7A 4Z0IA 1DTGA 4N4UA 2R71A 4PFUA 3E78A 4G8HA 4F31B 3LV0A 1BK4A 4P3LA 1FQAA 1TFDA 3PGFA 3L6HA 1A7LA 4DZ1A 1XHYA 3ISPA 4IGTA 4GOTA 2P1SA 1B9JA 3LSFB 4IO6A 3G3FA 4KR5A 1EYKA 2UXAA 2Z8DA 5LTCA 5AA2A 3RT8A 5F1QA 1B40A 4F19A 2QSXA 1MQDA 3T1BA 4JVCA 3IR1A 1AIVA 4LQ2A 1Y9UA 2THIA 1TXFA 4OXVA 4OHNA 3MJNA 1MRPA 1NV0A 4ELPA 4R9GA 3MP6A 2AL4A 4ISUA 5DVJA 5IZ3B 3D4GA 2XWKA 4ZEKA 2Z22A 5B70A 3SESA 5FHMA 2QVRA 2Q89A 4YMAA 3P7IA 2XXKA 3ONMA 3KSJA 4DXCA 1B51A 1SI1A 1FQDA 4K3FA 4NF0A 4H8IA 2XX8A 3CFZA 3DP6A 5FHOA 1UTBB 3TTRA 3RYDA 5EQ8A 3IK6B 4OVSA 1OLAA 2WBBA 4OZ9A 2HXRA 3EKIA 2X7PA 2OCUA 3OO6A 4XEQA 1NV1A 5EQAA 1R9QA 4R74A 4GL0A 4MH5A 1LBBA 1B1XA 4F3PA 1LBYA 1POTA 2RC8A 1XVYA 1TWYA 2AL5A 4POXA 3RT6B 1VDWA 3FIRA 4N6KA 4ZEIA 3SETA 3K6VA 3PU5A 5EQ7A 4E0WA 4DIGA 4KQPA 3MVZA 3E13X 5CBRA 1QUKA 1DK4A 3E79A 1XS5A 4PAKA 3BBRA 2KQZA 1DBZA 1PC3A 1D9YA 4IB2A 3M3FA 3FXBA 4LP2B 2HPGA 5EYFA 3IX1A 4MFIA 5A5LA 4IO5A 2I4BA 1QKAA 4PE5B 2PVUA 4G8NA 2B3BA 4PDDA 4DCYA 1ZLQA 2OLBA 2Y5KA 4Q8RA 1ATGA 4MX6A 3HCQA 4IO2A 2F7BA 4EQBA 1URGA 3KN3A 5A5XB 4U22A 2UVHA 1MY2A 2PCRA 1FBHA 2DYXA 4G68B 4EQ9A 3GLBA 1PBPA 3MP1A 1OQHA 3H4ZA 3VLVA 3QUFA 2O7IA 1MXZA 1QW0A 2XWOA 2P3VA 3KC1A 4DXUA 1B58A 3TFLA 3A29A 4UACA 2OJTA 1LAGE 4ELQA 2DWHA 1B0HA 4LN5A 3TPAA 1HSEA 1FBDA 2IA4A 1URSA 3OD7A 4NG7A 4FIMA 1SI0A 4KCCA 2FHYA 1WDNA 5CC2A 1PBQA 3FGSA 3TQWA 3VLWA 2ABHA 2O6AA 1H44A 4MF3A 2P0SA 4AS4A 1OQGA 2I6EA 5H8NA 2D5WA 4YKKA 1II5A 1LCFA 2H5YA 4MMPA 5EYHA 1FTOA 3O29A 4I9DA 4G8MA 2Z8EA 4P11A 1CB6A 1MS7A 3N26A 4PF6A 2Z8FA 3T9VA 4WXJA 4PDHA 2FIEA 3B7DA 4X1DA 5I59B 4RJZA 4F3GA 5ITPA 3EQ1A 1P99A 1B2HA 3EPEA 1RDZA 2VPOA 1O7TA 2CEXA 2HFBA 2O84X 4YB7A 3PPNA 3FJMA 1ZKBA 3MAMA 5CI5A 4QSEA 3FVGA 3LR1A 3O6HA 4IGRA 2UVJA 5ISUA 3G3IA 1A54A 3IO4A 4DXBA 1FCKA 2HCAA 3OSQA 3LBSA 5J1DA 4JVDA 5I58B 1XOCA 2XD2A 2DDKA 2DWIA 2Y5LA 2XXRA 1KWHA 4JSDA 1B7UA 3B6WA 4Q5TA 4Z7EA 2GH9A 4FEBA 1I6BA 4GX4A 3KZGA 2DSFA 3CRBA 1JVXA 4R2FA 4GLIA 3H6TA 3IOWA 2QPQA 3KOSA 2YPNA 2VHAA 1M5DA 4EXKA 4G77A 4BLAA 4MLQA 5AA4A 1UTHB 1ZJLA 4I3EA 5I57A 2WYKA 4PFRA 2P3NA 4EF2A 3PUWE 1FPKA 4U4XA 3T96B 4R75A 2GHBA 5ITOA 3T93B 2PBWA 1G0IA 1S50A 1M5BA 2Y7KA 2FA7A 1OLCA 3K4UA 1FTJA 5I7IA 3ECRA 2V3UA 1FPJA 3N94A 4F3BA 2F7AA 3C33A 1TFAA 3LUYA 4TQUQ 4GX3A 5ET6A 2DP8A 1AMFA 2E1SA 3B6QA 5CMKA 1YPNA 3PPOA 2CMOA 1IMAA 1LB9A 3RTWB 1LFIA 4WEPA 1FBFA 4QBAA 3K02A 3RPLA 3K6XA 3V89B 4IO4A 2PMSA 1B3FA 2XWIA 1H3DA 3SEYA 3USDA 1LSTA 3C4MA 1ZMGA 4ONYA 4KYDA 2YLNA 4GD5A 3TEPA 3CFLA 1GGGA 4F2OA 2Q8JA 2PYYA 3FJ7A 3HHGA 1Q1KA 1FPEA 4YKPA 3CSBA 3TCFA 1H76A 3KFMA 5HM4B 4OVPA 3MBPA 1NNFA 2CEYA 5J16A 2DS9A 4DI4B 5I3SA 4RY1A 4QRZA 4GWZA 1GV8A 4LUBA 2PFYA 3VE1B 1EU8A 2NUVA 3TTMA 3KN8A 1MM7A 1SD3A 1XI6A 4F1VA 2FYIA 4KHZE 1DCUA 1AL3A 4OFJA 3B6TA 4OWDA 4X8RA 3QAXA 1PB7A 4NF5A 4KYSA 2ZYKA 5BWJA 2DWJA 3MC2A 4NF8A 4P9KA 4PBHA 3V5AA 3IFCA 3TUSA 4RK2A 3C36A 4R73A 2KR0A 1NL5A 2ZNSA 3Q29A 3LUZA 2CZLA 3W9WA 5DEXA 2XXTA 5I2NA 4H45A 2DVCA 4NX1A 1MPDA 4PGPA 3KGCA 3FV1A 4FECA 3K1MA 1LFHA 3U92A 3OSRA 4EUOA 3ZS6A 3UGWA 2XXUA 4BDOA 1UTHA 4GBVA 3W9VA 3HHFA 5DT6A 5KCJA 3SEWA 5CBSA 1AH5A 2Y84A 4I8CA 2Q88A 3T9HB 4XKRA 3T22A 5ICTA 4AQ4A 4C0RA 1RYXA 2F78A 4HCYA 2HEUA 4QFPA 5AA3A 1H45A 3HN0A 3IJXB 3CFXA 4RA1A 2V93A 4X9TA 3VXBA 1FRPA 1FBCA 3MVXA 2R8TA 4QXDA 2XXWA 4UA8A 4ESXA 3MSTA 4O7MA 4Q30B 2OWZA 1ZIUA 4OERA 2ZZXA 3K01A 4C1UA 2I58A 3U65A 3PUVE 1D3KA 4N6PA 1NV5A 4F1YA 1A8FA 4PFIA 2ZYOA 3IOUA 3GYYA 4P0IA 3DLNA 4FE8A 4PETA 5AA2D 4JSOA 3UP9A 4PE3A 1J1NA 1D9VA 2UYFA 5H8SA 1NUYA 2V25A 4MEVA 3KOTA 2Y7PA 2I48A 3M8UA 2XX9A 5M2VA 1YCJA 5I5PA 3OO8A 4N17A 2WX9A 2A5SA 3M3KA 3QIMA 4JDFA 5IAIA 3EF7A 3K1PA 3RY3A 3QYTA 5H8NB 1M5FA 3S9MC 1MQIA 1RDYA 3GBAA 4MHFA 5HBCA 4PFBA 2Y7RA 3CHGA 1K9YA 4EXLA 1P1UA 2B4LA 4MNPA 3S4UA 4XFEA 3FVKA 4U1OA 3I6VA 3IJOB 4OFOA 2HAVA 1IMEA 3MVYA 1B5HA 3UORA 3TODA 1EH3A 3F11A 1BKAA 4P56A 3FXQA 2REGA 2X26A 2RC7A 4H1XA 5BUUA 4ZEBA 3FD3A 1SPIA 3RTFB 3IO6A 1FTAA 4NTLA 4O3AA 4RYAA 3WAFA 1SVXB 1F9BA 3C35A 1LBVA 4GWSA 1QJMA 4H67A 2F34A 2Y7IA 3JYRA 4PF8A 3MVWA 2CZIA 4OTEA 3VV5A 1GVCA 2JJKA 1I6AA 1IMCA 3TKDA 2DOJA 4TLLB 2G29A 1MQGA 1NH7A 1NFTA 2ONKE 1N3XA 3CG1A 5EHMA 1SW2A 3VLUA 5IM2A 5AA4B 5ET8A 2O68A 2MKZA 5I57B 1Y3PA 5I56A 1FSAA 4GL8A 5IZ1A 1NNTA 2PT2A 4YB5A 1N76A 1IMDA 1LLSA 1M5CA 1NNKA 2VD3A 1MDQA 1VSOA 4H5GA 3UK4A 4H46A 3BKIB 2VPNA 1ZU0A 3RNNA 2ZZWA 1XT8A 4JWXA 3G3KA 3Q28A 3E4RA 4KFQA 4RXLA 1FBGA 3C32A 4OANA 1SYIA 2DE3A 4ESWA 4MCOA 2D21A 3GZGA 3IL1B 1ZBMA 2Q2AA 3OO7A 4X1BA 2XD3A 2XXQA 1US4A 1LBWA 1UIVA 3MPLA 4WKMA 2NOOA 1DSNA 1MXUA 3RQTA 1FTKA 1IMFA 3RPLB 4PC9A 1SW1A 3ZKLA 4RPOA 5AA1A 2OWTA 1FPGA 2IEEA 1XVXA 2OZZA 1Y1MA 2ZNUA 4FORA 4GVOA 4ND9A 4YICA 2HZLA 2DVZA 5IZZA 2HZKA 1MH3A 1UQWA 4ELOA 3ZSFA 2V3QA 4I1DA 1IXCA 2GQ1A 5H8FA 1A40A 1S9TA 1CE2A 2ANJA 4MJOA 4XTCQ 1QGXA 1FQBA 2V3TA 3N6TA 1LAXA 3PV0E 3O28A 4N81A 3LSWA 4N91A 5HPQA 5DVIA 2BJIA 2ZYMA 1JW5A 4UABA 3G7WA 4LATA 4PQJA 3LSLA 1FJ9A 1RDXA 1IXIA 1Y4CA 1B52A 4IO3A 4LA9A 1T0KA 2I0BA 2O1LA 4I40A 4GWUA 4NF5B 4ZEDA 1EYIA 2RINA 4N8YA 2QRYA 4N13A 4OVRA 1BTJA 1FPIA 3H7MA 4NF8B 4GWOA 2OBGA 2REJA 4BDRA 4GF8A 1RKMA 2F97A 5I84A 1YYZA 4GQOA 1IMBA 4OQOA 1JP4A 1BIYA 3EHSA 3MZ9A 3G3HA 5DEXB 3QMFA 4RK9A 5I2NB 3ZKKA 5KDTA 1NUZA 1ANFA 3A09A 2FNCA 3LSXA 3D1RA 3L6GA 1MM6A 3B8BA 4OVQA 5ESYA 3O6GA 4GWXA 3OEMA 4F18A 3A3UA 1M5EA 3H6WA 3A3CA 4WEDA 3EHUA 5KCJB 1DPEA 1R9LA 3OXNA 3PMVA 1IITA 4PFWA 1IIWA 1P1NA 5DW8A 4FAJA 4LZ5A 1RYOA 4DI3D 1QULA 4PBQA 3IOTA 4QF9A 3CR9A 2WEFA 3NOHA 1INPA 5IKBA 1R1NA 1B46A 4NEDA 3CI8A 2ONSA 2I3WA 4FEDA 1OVTA 3FVNA 4H6DA 5TPAA 1NV4A 2XXPA 3FUZA 3MYUA 2XXIA 4BDMA 1N04A 4GFRA 4MLVA 4QSDA 3FASA 5TP9A 1A55A 3U1OA 4ZDMA 2UVIA 4PCDA 3DM0A 1NV3A 4YKIA 5F24A 4P47A 1US5A 4Q0CA 4MBPA 4M1VA 2DQVA 1NMUA 1Q9DA 4YAHX 1JETA 4F1UA 3AXFA 4XKPA 4H65A 3RN8A 1FQCA 3R7XA 3RGYA 5CMCA 3EN3A 1N3WA 2QL3A 2F6GA 4OVTA 4LVQA 2NVUB 5F7VA 2OWSA 4KPTA 4QFOA 1JW4A 1IUDA 3H03A 1N7WA 3S9NC 1P1WA 1GTKA 3BFUA 4GBWA 4POWA 1B7ZA 5KZTA 3OMBA 2H9BA 5JTYA 2ZZVA 1FBPA 2H98A 1OVBA 5IGAA 2P2AA 2HHMA 3GBBA 4AB5A 2XXXA 1KA1A 2RKMA 2I49A 3VXCA 1PEBA 3U72A 3OEKA 4YKJA 2XWVA 1USYH 3R26A 1IXHA 1SDXA 5T3JA 3H06B 4IY6A 3ROJA 4GX6A 1JVYA 3MQ9A 4MNIA 3GXAA 4MAGA 1Y3QA 5JEIA 5LOMA 3TMGA 1SYHA 3B50A 2HQ0A 2LAOA 4XF5A 1LGBC 1B3EA 4NF6A 4GRKA 3IB1A 4QHQA 4R72A 4R6HA 3Q26A 3VVDA 3KG2A 1A8EA 3PTYA 4HS7A 4GWWA 4OEVA 3C9HA 4R6YA 1B3LA 1NH8A 3FXRA 4AB6A 1QUJA 3UA8A 4NWCA 3KBRA 1LB8A 5JK4A 2R6GE 2PFZA 3SZPA 4N8GA 1NUXA 3K6UA 3TELA 2B4MA 3KSXA 2H4IA 5FTIA 3O66A 2H25A 1VFEA 1P1QA 3PD8A 1B4HA 4O94A 3U8QA 4BDLA 3WAEA 3G3GA 3TAJA 5I56B 1JW1A 4DE8A 2ONRA 1FTLA 1L5TA 2O1MA 1I6QA 2AYSA 1NV7A 4X48A 4NE4A 3S2VA 1FBEA 3PMWA 2F3DA 5DVFA 1YXIA 2XXVA 3BFTA 1MXWA 2QMXA 2FVZA 4YB6A 5EQ9A 1FPFA 2QS3A 3TQLA 1LCTA 5ELVA 5H8HA 2PT1A 2F36A 4H8JA 4YZZA 3TTKA 4PAFA 5ET7A 3MZBA 3PUXE 5DYHA 1UIUA 3OO9A 4KYEA 4PAIA 5L8DA 3TTNA 4I3YA 3I5OA 3KC0A 3M3LA 2V4CA 2BJJX 4U21A 2ZMBA 4R9FA 4GIZA 4QFKA 4G4PA 2HAUA 3O2AA 2RF1A 4IY5A 1MH4A 4NQ8A 3PUZE 3E9XA 3K6WA 4XKQA 3V8XB 3VFJA 3PUYE 1B32A 3V83A 2WBDA 4FBPA 1B6HA 1N7XA 1POY1 4OENA 3N6UA 4OVJA 1MXXA 2QVVA 5H8FB 1LBCA 3ODBA 1MDP1 3PPPA 1Z7ME 5EHSA 4ZZEA 2A5TA 3HFUA 1URDA 1Y4TA 2WKYA 5FHNA 5ET5A 1IZ1A 1LBZA 4DCXA 3JZJA 1MY4A 1ELJA 1Y20A 4LZ8A 2O7UA 2VT5A 2NWJA 2O69A 3BIHA 1FW0A 4R2BA 3W15C 1B1HA 5L9MA 3G3JA 4HTGA 2Q2CA 2F6PA 4HCWA 1JQFA 4X04A 1QVSA 5K2XA 1B7HA 1YAEA 2I0CA 2DXRA 4KD5A 4PTKA 3CVGA 5H8QA 1SQYA 1QKBA 2F8DA 4NAPA 5I2KA 1B5JA 3IB0A 1USYE 1NKXA 2ZYNA 4G2ZA 3I3VA 3OENA 1JEVA 1FQEA 1LAFE 2UYEA 3S9LC 4LONB 4XIGQ 3QK6A 1SBPA 3PPRA 3N5LA 4L17A 3T9UA 1PB9A 1LFGA 2E0SA 1IQ7A 5ICQA 3HSTA 4C1TA 5KDTB 4HE2A 4PFTA 4O7IA 4JXIA 2GHAA 4U4SA 3C34A 1EZOA 4R6KA 3KEIA 3T0JA 2O51A 1MPCA 2F7CA 4M4GA 1N0TA 3IAZA 2PX1A 1MQHA 1KZ8A 4ZS9A 5CRYA 3H6UA 4JBZA 2VD2A 1EZ9A 4XKNA 3O97A 1FTMA 4OA4A 1CNQA 4HXVA 3S9EA 3FV2A 5DTBA 2OX3A 2VGQA 2X7QA 4ELRA 4OMBA 3JV9A 1K9ZA 5TPAB 4ZZAA 2B65A 4ZE9A 4YMBA 4N6DA 4THIA 1IEJA 5TP9B 4HW8A 4HE0A 3BIGA 2RCBA 4QFLA 3FVOA 4U1ZA 1MG1A 1FQFA 3DP4A 1XC1A 3H3GA 1AWBA 5IZ3A 1DMBA 2Q9TA 1EZPA 2RC9A 1LAHE 3IB2A 3FXUA 4GWYA 1D9QA 4HE1A 4N15A 1B5IA 3RPWA 4P8BA 4JWOA 2QJEA 4RPNA 1I69A 3CG3A 3U94A 2QS1A 3SDFA 4JB7A 4NF4B 2GFEA 3SEXA 1MXYA 3TZAA 4NGUA 1P1OA 1B05A 2QFLA 2XA5A 2Z23A 3OOAA 3QXMA 1UTBA 2QVUA 2Q8MA 3MP8A 2DXYA 4ZE8A 4N07A 3K1NA 5B7DA 5JTYB 1AOVA 4ZEFA 3PMXA 4YU0A 3OELA 4GXSB 1SW4A 4P0GA 2OK2A 2CZHA 4O8MA 2Q74A 4GXAA 3FBPA 5LDZA 2ZXTA 2R9JA 4JWYA 1OIBA 3T9XB 1MY0A 2M8CA 3UN6A 4EQ7A 4IO7A 4O3BA 2F3BA 4DDDA 1Z7NE 1PB8A 2XHDA 3HPIA 2G93A 2HXWA 3U93A 3MPKA 3E3KA 2VOZA 1LBXA 3IFAA 3H6VA 2L5VA 4NF6B 2F35A 1MQJA 1NV2A 3HO7A 4NMYA 2DE4A 4U23A 4ECFA 4QSCA 3ILTB 3MUQA 5FBPA 5L9OA 1B3HA 2D3IA 2I4CA 2RCAA 2NXOA 3VVEA 3O9PA 4XXUA 4F3SA 4FJPA 4FATA 1VFDA 4OFLA 3VVFA 2DE2A 4P1EA 4EF1A 2W7YA 3SKPA 1NV6A 1NI9A 4QFNA 2QS2A 5EYGA 4LQ5A 4MNCA 5TU0A 5CMBA 4KI0E 4KCDA 3R6UA 4F29A 4OETA 3FATA 5AE4A 3KJTA 4IR8A 1KA0A 4H5FA 2XX7A 1Q35A 3SEVA 1B4ZA 2FBPA 5A5XA 4G68C 2H99A 4G68A 4MIJA 4BDNA 1Y3NA 1N84A 2AIXA 3PPQA 5CMMA 4OYVA 4LZ7A 1FPDA 4OEUA 3IOVA 2QMWA 1H43A 4NN3A 1OMPA 4F39A 5H8HB 3HV1A 1PDAA 1QUIA 1R6ZA 1SW5A 5AA2B 4KXPA 2DWAA 3QUJA 5CM6A 3K0VA 5K2YA 4NF4A 4RNSA 3TTLA 3FZVA 2KLFA 4E0XA 3RUMA 3K00A 4PFYA 3T66A 3TCHA 2B3FA 1FPLA 2WYPA 4F22A 3VDFA 2CZKA 1NUWA 1IXGA 3SERA 1YTVA 1HSLA 3D4CA 2ESNA 1FJ6A 1HSJA 3RLFE 4G61A 1GR2A 3KBZA 1MXVA 1DTZA 2VP1A 3FJGA 3THIA 4H0WA 1JEUA 1FPBA 2XXHA 3C31A 2YJPA 1YZ0A 2A5TB 4I62A 5I59A 3EHTA 3IORA 1A99A 3MW0A 3CSGA 1Y1ZA 3K2DA 3PD9A 4TLMB 1EYJA 1NNPA 4DLDA 1WVJA 2Y7WA 3MWBA 1B0LA 4P1LA 1O63A 1B3GA 3LC8A 3KN7A 3Q27A 4ZECA 3MZ1A 5I58A 2FIXA 1DPPA 1ZTYA 1MPBA 3QSLA 2V84A 1JNFA 2UVGA 1VE4A 1DOTA 4BDQA 2XXYA 4F2QA 5H8QB 1O64A 4NWDA 5I2KB 4NHBA 3Q25A 1G0HA 1VR5A 3UIFA 1LEVA 4TOZA 3CIJA 3TYHA 5L9SA 3ILUB 3O6IA 4JVIA 1WODA 1MY1A 1TT1A 1BP5A 1D4NA 4EDPA 2I3VA 4PGNA 4OESA 2QS4A 4AS5A 2GRVA 3TCGA 3DELB 1MY3A 3SEUA 4U2RA 1S7YA 2ALUA 2F5XA 4PP0A 1BLFA 5FTHA
chains in the Genus database with same CATH topology
3DP8A 2ZNTA 3TDJA 4O3CA 3KJ7A 4Z0IA 1DTGA 2R71A 4PFUA 4G8HA 4F31B 1FQAA 1TFDA 3PGFA 3L6HA 1A7LA 4DZ1A 1XHYA 4IGTA 4GOTA 2P1SA 1B9JA 3LSFB 4IO6A 3G3FA 4KR5A 2UXAA 2Z8DA 5AA2A 3RT8A 5F1QA 1B40A 4F19A 2QSXA 1MQDA 3IR1A 1AIVA 4LQ2A 1Y9UA 2THIA 1TXFA 4OXVA 4OHNA 3MJNA 1MRPA 4ELPA 4R9GA 3MP6A 2AL4A 4ISUA 5DVJA 3D4GA 4ZEKA 2Z22A 5B70A 3SESA 5FHMA 2Q89A 4YMAA 3P7IA 3ONMA 3KSJA 4DXCA 1B51A 1SI1A 1FQDA 4K3FA 4H8IA 2XX8A 3CFZA 3DP6A 5FHOA 1UTBB 3TTRA 3IK6B 1OLAA 4OZ9A 2X7PA 2OCUA 3OO6A 1R9QA 4R74A 4GL0A 4MH5A 1LBBA 1B1XA 4F3PA 1POTA 2RC8A 1XVYA 1TWYA 2AL5A 4POXA 3RT6B 3FIRA 4ZEIA 3SETA 3K6VA 3PU5A 4E0WA 4DIGA 4KQPA 3MVZA 3E13X 5CBRA 1QUKA 1XS5A 3BBRA 1PC3A 1D9YA 4IB2A 3M3FA 4LP2B 5EYFA 3IX1A 4MFIA 4IO5A 2I4BA 1QKAA 4PE5B 2PVUA 4G8NA 2B3BA 4DCYA 1ZLQA 2OLBA 4Q8RA 1ATGA 3HCQA 4IO2A 2F7BA 4EQBA 1URGA 3KN3A 5A5XB 4U22A 2UVHA 1MY2A 2DYXA 4G68B 4EQ9A 3GLBA 1PBPA 3MP1A 1OQHA 3H4ZA 3VLVA 3QUFA 2O7IA 1MXZA 1QW0A 4DXUA 1B58A 3TFLA 4UACA 2OJTA 1LAGE 4ELQA 2DWHA 1B0HA 3TPAA 1HSEA 2IA4A 1URSA 3OD7A 4FIMA 1SI0A 4KCCA 1WDNA 5CC2A 1PBQA 3FGSA 3TQWA 3VLWA 2ABHA 2O6AA 1H44A 4MF3A 2P0SA 1OQGA 2I6EA 5H8NA 2D5WA 4YKKA 1II5A 1LCFA 2H5YA 1FTOA 3O29A 4I9DA 4G8MA 2Z8EA 4P11A 1CB6A 1MS7A 3N26A 2Z8FA 3T9VA 4WXJA 3B7DA 4X1DA 5I59B 4RJZA 4F3GA 5ITPA 3EQ1A 1P99A 1B2HA 3EPEA 1O7TA 2HFBA 2O84X 4YB7A 3PPNA 3FJMA 1ZKBA 3MAMA 5CI5A 4QSEA 3FVGA 3LR1A 3O6HA 4IGRA 2UVJA 5ISUA 3G3IA 1A54A 3IO4A 4DXBA 1FCKA 2HCAA 3OSQA 3LBSA 5J1DA 5I58B 1XOCA 2XD2A 2DWIA 2XXRA 1KWHA 4JSDA 1B7UA 3B6WA 4Q5TA 4Z7EA 2GH9A 4FEBA 1I6BA 3KZGA 2DSFA 3CRBA 1JVXA 4R2FA 4GLIA 3H6TA 3IOWA 2QPQA 3KOSA 2YPNA 2VHAA 1M5DA 4EXKA 4G77A 4BLAA 4MLQA 5AA4A 1UTHB 1ZJLA 5I57A 4EF2A 3PUWE 4U4XA 3T96B 5ITOA 2GHBA 4R75A 3T93B 2PBWA 1S50A 1M5BA 2Y7KA 2FA7A 1OLCA 3K4UA 1FTJA 3ECRA 2V3UA 3N94A 4F3BA 2F7AA 3C33A 1TFAA 3LUYA 4TQUQ 2DP8A 1AMFA 2E1SA 3B6QA 5CMKA 1YPNA 3PPOA 2CMOA 1LB9A 3RTWB 1LFIA 4WEPA 3K02A 3K6XA 3V89B 4IO4A 2PMSA 1B3FA 1H3DA 3SEYA 3USDA 1LSTA 3C4MA 1ZMGA 4ONYA 4KYDA 2YLNA 4GD5A 3TEPA 3CFLA 1GGGA 4F2OA 2Q8JA 2PYYA 3FJ7A 3HHGA 1Q1KA 4YKPA 3CSBA 3TCFA 1H76A 3KFMA 5HM4B 3MBPA 1NNFA 2DS9A 4RY1A 4QRZA 1GV8A 4LUBA 3VE1B 1EU8A 2NUVA 3TTMA 3KN8A 1MM7A 1SD3A 4F1VA 2FYIA 4KHZE 1AL3A 4OFJA 3B6TA 4OWDA 3QAXA 1PB7A 4NF5A 4KYSA 2ZYKA 5BWJA 2DWJA 3MC2A 4NF8A 3V5AA 3TUSA 4RK2A 3C36A 4R73A 1NL5A 2ZNSA 3Q29A 2CZLA 3W9WA 5DEXA 2XXTA 5I2NA 2DVCA 1MPDA 3KGCA 3FV1A 4FECA 3K1MA 1LFHA 3U92A 3OSRA 4EUOA 3ZS6A 3UGWA 2XXUA 4BDOA 1UTHA 3W9VA 3HHFA 5DT6A 5KCJA 3SEWA 5CBSA 1AH5A 2Y84A 4I8CA 2Q88A 3T9HB 4XKRA 3T22A 5ICTA 4AQ4A 4C0RA 1RYXA 2F78A 4HCYA 2HEUA 4QFPA 5AA3A 1H45A 3HN0A 3IJXB 3CFXA 4RA1A 2V93A 4X9TA 3VXBA 3MVXA 2XXWA 4UA8A 4ESXA 4Q30B 1ZIUA 4OERA 3K01A 4C1UA 2I58A 3PUVE 1D3KA 4N6PA 4F1YA 1A8FA 2ZYOA 3IOUA 4P0IA 3DLNA 4FE8A 4PETA 5AA2D 4JSOA 3UP9A 1J1NA 1D9VA 2UYFA 5H8SA 2V25A 3KOTA 2Y7PA 2I48A 3M8UA 2XX9A 5M2VA 1YCJA 3OO8A 2A5SA 3M3KA 3QIMA 4JDFA 5IAIA 3EF7A 3K1PA 3RY3A 3QYTA 5H8NB 1M5FA 3S9MC 1MQIA 3GBAA 5HBCA 2Y7RA 4EXLA 1P1UA 3S4UA 3FVKA 4U1OA 3I6VA 3IJOB 4OFOA 2HAVA 3MVYA 1B5HA 3UORA 3TODA 1EH3A 3F11A 1BKAA 3FXQA 2REGA 2X26A 2RC7A 4H1XA 5BUUA 4ZEBA 3FD3A 3RTFB 3IO6A 4NTLA 4O3AA 4RYAA 3WAFA 1SVXB 1F9BA 3C35A 1QJMA 4H67A 2F34A 2Y7IA 3JYRA 3MVWA 4OTEA 3VV5A 1GVCA 1I6AA 3TKDA 2DOJA 4TLLB 2G29A 1MQGA 1NH7A 1NFTA 2ONKE 1N3XA 3CG1A 5EHMA 1SW2A 3VLUA 5AA4B 2O68A 5I57B 1Y3PA 5I56A 4GL8A 1NNTA 2PT2A 4YB5A 1N76A 1M5CA 1LLSA 1NNKA 2VD3A 1MDQA 1VSOA 4H5GA 3UK4A 3BKIB 1ZU0A 3RNNA 1XT8A 4JWXA 3G3KA 3Q28A 3E4RA 4KFQA 4RXLA 3C32A 1SYIA 2DE3A 4ESWA 2D21A 3GZGA 3IL1B 1ZBMA 2Q2AA 3OO7A 4X1BA 2XD3A 2XXQA 1US4A 1UIVA 3MPLA 4WKMA 2NOOA 1DSNA 1MXUA 3RQTA 1FTKA 1SW1A 3ZKLA 4RPOA 5AA1A 2OWTA 2IEEA 1XVXA 2OZZA 1Y1MA 2ZNUA 4FORA 4GVOA 4ND9A 4YICA 2HZLA 2DVZA 2HZKA 1MH3A 1UQWA 4ELOA 3ZSFA 2V3QA 4I1DA 1IXCA 5H8FA 1A40A 1S9TA 1CE2A 2ANJA 4XTCQ 1FQBA 2V3TA 3N6TA 1LAXA 3PV0E 3O28A 5HPQA 3LSWA 5DVIA 2ZYMA 1JW5A 3G7WA 4LATA 4PQJA 3LSLA 1IXIA 1Y4CA 1B52A 4IO3A 4LA9A 1T0KA 2I0BA 2O1LA 4NF5B 4ZEDA 2RINA 2QRYA 4N13A 1BTJA 3H7MA 4NF8B 4GWOA 2OBGA 2REJA 4BDRA 4GF8A 1RKMA 2F97A 5I84A 4GQOA 4OQOA 1BIYA 3EHSA 3MZ9A 3G3HA 5DEXB 4RK9A 5I2NB 3ZKKA 5KDTA 1ANFA 3A09A 2FNCA 3LSXA 3L6GA 1MM6A 3O6GA 3OEMA 4F18A 3A3UA 1M5EA 3H6WA 3A3CA 4WEDA 3EHUA 5KCJB 1DPEA 1R9LA 3OXNA 3PMVA 1IITA 4PFWA 1IIWA 1P1NA 4FAJA 4LZ5A 1RYOA 1QULA 3IOTA 4QF9A 3CR9A 5IKBA 1R1NA 1B46A 4NEDA 3CI8A 2ONSA 2I3WA 4FEDA 1OVTA 3FVNA 4H6DA 5TPAA 2XXPA 3FUZA 2XXIA 4BDMA 1N04A 4GFRA 4MLVA 4QSDA 3FASA 5TP9A 1A55A 3U1OA 4ZDMA 2UVIA 3DM0A 4YKIA 1US5A 4Q0CA 4MBPA 4M1VA 2DQVA 1NMUA 4YAHX 1JETA 4F1UA 3AXFA 4XKPA 4H65A 3RN8A 1FQCA 3R7XA 3RGYA 5CMCA 3EN3A 1N3WA 2QL3A 2F6GA 4LVQA 2NVUB 5F7VA 2OWSA 4KPTA 1JW4A 1IUDA 4QFOA 3H03A 1N7WA 3S9NC 1P1WA 1GTKA 3BFUA 4POWA 1B7ZA 5KZTA 3OMBA 2H9BA 5JTYA 2H98A 1OVBA 2P2AA 3GBBA 4AB5A 2XXXA 2RKMA 2I49A 3VXCA 1PEBA 3U72A 3OEKA 4YKJA 1USYH 3R26A 1IXHA 1SDXA 3H06B 4IY6A 1JVYA 3MQ9A 3GXAA 1Y3QA 5JEIA 5LOMA 3TMGA 1SYHA 2HQ0A 2LAOA 1LGBC 1B3EA 4NF6A 4GRKA 3IB1A 4QHQA 4R72A 4R6HA 3Q26A 3VVDA 3KG2A 1A8EA 4HS7A 4OEVA 3C9HA 4R6YA 1B3LA 1NH8A 3FXRA 4AB6A 1QUJA 3UA8A 4NWCA 3KBRA 1LB8A 5JK4A 2R6GE 3K6UA 3TELA 3KSXA 2H4IA 5FTIA 3O66A 2H25A 1VFEA 1P1QA 3PD8A 1B4HA 3U8QA 4BDLA 3WAEA 3G3GA 3TAJA 5I56B 1JW1A 4DE8A 2ONRA 1FTLA 1L5TA 2O1MA 1I6QA 2AYSA 4X48A 4NE4A 3S2VA 3PMWA 5DVFA 2XXVA 3BFTA 1MXWA 2QMXA 4YB6A 2QS3A 3TQLA 1LCTA 5ELVA 5H8HA 2PT1A 2F36A 4H8JA 4YZZA 3TTKA 3MZBA 3PUXE 5DYHA 1UIUA 3OO9A 4KYEA 5L8DA 3TTNA 3I5OA 3M3LA 2BJJX 4U21A 2ZMBA 4R9FA 4GIZA 4QFKA 4G4PA 2HAUA 3O2AA 2RF1A 4IY5A 1MH4A 3PUZE 3E9XA 3K6WA 4XKQA 3V8XB 3VFJA 3PUYE 1B32A 3V83A 1B6HA 1N7XA 1POY1 4OENA 3N6UA 4OVJA 1MXXA 5H8FB 1LBCA 3ODBA 1MDP1 3PPPA 1Z7ME 5EHSA 4ZZEA 2A5TA 1URDA 1Y4TA 2WKYA 5FHNA 1IZ1A 4DCXA 3JZJA 1MY4A 1ELJA 1Y20A 4LZ8A 2O7UA 2NWJA 2O69A 1FW0A 4R2BA 3W15C 1B1HA 5L9MA 3G3JA 4HTGA 2Q2CA 2F6PA 4HCWA 1JQFA 1QVSA 5K2XA 1B7HA 1YAEA 2I0CA 2DXRA 4KD5A 3CVGA 5H8QA 1SQYA 1QKBA 2F8DA 5I2KA 1B5JA 3IB0A 1USYE 1NKXA 2ZYNA 4G2ZA 3I3VA 3OENA 1JEVA 1FQEA 1LAFE 2UYEA 3S9LC 4LONB 4XIGQ 3QK6A 1SBPA 3PPRA 3N5LA 4L17A 3T9UA 1PB9A 1LFGA 2E0SA 1IQ7A 5ICQA 3HSTA 4C1TA 5KDTB 4PFTA 4JXIA 2GHAA 4U4SA 3C34A 1EZOA 4R6KA 3KEIA 2O51A 1MPCA 2F7CA 4M4GA 1N0TA 3IAZA 2PX1A 1MQHA 4ZS9A 5CRYA 3H6UA 4JBZA 2VD2A 1EZ9A 4XKNA 3O97A 1FTMA 3S9EA 3FV2A 5DTBA 2VGQA 2X7QA 4ELRA 4OMBA 3JV9A 5TPAB 4ZZAA 2B65A 4ZE9A 4YMBA 4THIA 1IEJA 5TP9B 4HW8A 2RCBA 4QFLA 3FVOA 4U1ZA 1MG1A 1FQFA 3DP4A 1XC1A 3H3GA 1DMBA 2Q9TA 1EZPA 2RC9A 1LAHE 3IB2A 3FXUA 1B5IA 3RPWA 4JWOA 2QJEA 4RPNA 1I69A 3CG3A 3U94A 2QS1A 3SDFA 4JB7A 4NF4B 2GFEA 3SEXA 1MXYA 3TZAA 1P1OA 1B05A 2Z23A 3OOAA 3QXMA 1UTBA 3MP8A 2DXYA 4ZE8A 4N07A 3K1NA 5B7DA 5JTYB 1AOVA 4ZEFA 3PMXA 4YU0A 3OELA 4GXSB 1SW4A 4P0GA 2OK2A 4GXAA 2ZXTA 2R9JA 4JWYA 1OIBA 3T9XB 1MY0A 2M8CA 3UN6A 4EQ7A 4IO7A 4O3BA 4DDDA 1Z7NE 1PB8A 2XHDA 3HPIA 2G93A 2HXWA 3U93A 3MPKA 3E3KA 2VOZA 3H6VA 4NF6B 2F35A 1MQJA 3HO7A 4NMYA 2DE4A 4U23A 4ECFA 4QSCA 3ILTB 3MUQA 5L9OA 1B3HA 2D3IA 2I4CA 2RCAA 2NXOA 3VVEA 3O9PA 4XXUA 4F3SA 4FJPA 4FATA 1VFDA 4OFLA 3VVFA 2DE2A 4EF1A 2W7YA 3SKPA 4QFNA 2QS2A 4LQ5A 5TU0A 5CMBA 4KI0E 4KCDA 3R6UA 4F29A 4OETA 3FATA 5AE4A 3KJTA 4H5FA 2XX7A 1Q35A 3SEVA 1B4ZA 5A5XA 4G68C 2H99A 4G68A 4BDNA 1Y3NA 1N84A 2AIXA 3PPQA 5CMMA 4OYVA 4LZ7A 4OEUA 3IOVA 2QMWA 1H43A 1OMPA 4F39A 5H8HB 3HV1A 1PDAA 1QUIA 1R6ZA 1SW5A 5AA2B 2DWAA 3QUJA 5CM6A 3K0VA 5K2YA 4NF4A 4RNSA 3TTLA 3FZVA 2KLFA 4E0XA 3RUMA 3K00A 4PFYA 3T66A 3TCHA 2B3FA 4F22A 3VDFA 1IXGA 3SERA 1YTVA 1HSLA 3D4CA 2ESNA 1HSJA 3RLFE 1GR2A 1MXVA 1DTZA 2VP1A 3FJGA 3THIA 4H0WA 1JEUA 2XXHA 3C31A 2YJPA 2A5TB 4I62A 5I59A 3EHTA 3IORA 1A99A 3MW0A 3CSGA 1Y1ZA 3K2DA 3PD9A 4TLMB 1NNPA 4DLDA 1WVJA 2Y7WA 3MWBA 1B0LA 1O63A 1B3GA 3LC8A 3KN7A 3Q27A 4ZECA 3MZ1A 5I58A 1DPPA 1ZTYA 1MPBA 3QSLA 2V84A 1JNFA 2UVGA 1VE4A 1DOTA 4BDQA 2XXYA 4F2QA 5H8QB 1O64A 4NWDA 5I2KB 3Q25A 1VR5A 3UIFA 4TOZA 3CIJA 3TYHA 5L9SA 3ILUB 3O6IA 1WODA 1MY1A 1TT1A 1BP5A 1D4NA 4EDPA 2I3VA 4OESA 2QS4A 2GRVA 3TCGA 3DELB 1MY3A 3SEUA 4U2RA 1S7YA 2ALUA 2F5XA 4PP0A 1BLFA 5FTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP8 A;  2ZNT A;  3TDJ A;  4O3C A;  3KJ7 A;  4Z0I A;  1DTG A;  2R71 A;  4PFU A;  4G8H A;  4F31 B;  1FQA A;  1TFD A;  3PGF A;  3L6H A;  1A7L A;  4DZ1 A;  1XHY A;  4IGT A;  4GOT A;  2P1S A;  1B9J A;  3LSF B;  4IO6 A;  3G3F A;  4KR5 A;  2UXA A;  2Z8D A;  5AA2 A;  3RT8 A;  5F1Q A;  1B40 A;  4F19 A;  2QSX A;  1MQD A;  3IR1 A;  1AIV A;  4LQ2 A;  1Y9U A;  2THI A;  1TXF A;  4OXV A;  4OHN A;  3MJN A;  1MRP A;  4ELP A;  4R9G A;  3MP6 A;  2AL4 A;  4ISU A;  5DVJ A;  3D4G A;  4ZEK A;  2Z22 A;  5B70 A;  3SES A;  5FHM A;  2Q89 A;  4YMA A;  3P7I A;  3ONM A;  3KSJ A;  4DXC A;  1B51 A;  1SI1 A;  1FQD A;  4K3F A;  4H8I A;  2XX8 A;  3CFZ A;  3DP6 A;  5FHO A;  1UTB B;  3TTR A;  3IK6 B;  1OLA A;  4OZ9 A;  2X7P A;  2OCU A;  3OO6 A;  1R9Q A;  4R74 A;  4GL0 A;  4MH5 A;  1LBB A;  1B1X A;  4F3P A;  1POT A;  2RC8 A;  1XVY A;  1TWY A;  2AL5 A;  4POX A;  3RT6 B;  3FIR A;  4ZEI A;  3SET A;  3K6V A;  3PU5 A;  4E0W A;  4DIG A;  4KQP A;  3MVZ A;  3E13 X;  5CBR A;  1QUK A;  1XS5 A;  3BBR A;  1PC3 A;  1D9Y A;  4IB2 A;  3M3F A;  4LP2 B;  5EYF A;  3IX1 A;  4MFI A;  4IO5 A;  2I4B A;  1QKA A;  4PE5 B;  2PVU A;  4G8N A;  2B3B A;  4DCY A;  1ZLQ A;  2OLB A;  4Q8R A;  1ATG A;  3HCQ A;  4IO2 A;  2F7B A;  4EQB A;  1URG A;  3KN3 A;  5A5X B;  4U22 A;  2UVH A;  1MY2 A;  2DYX A;  4G68 B;  4EQ9 A;  3GLB A;  1PBP A;  3MP1 A;  1OQH A;  3H4Z A;  3VLV A;  3QUF A;  2O7I A;  1MXZ A;  1QW0 A;  4DXU A;  1B58 A;  3TFL A;  4UAC A;  2OJT A;  1LAG E;  4ELQ A;  2DWH A;  1B0H A;  3TPA A;  1HSE A;  2IA4 A;  1URS A;  3OD7 A;  4FIM A;  1SI0 A;  4KCC A;  1WDN A;  5CC2 A;  1PBQ A;  3FGS A;  3TQW A;  3VLW A;  2ABH A;  2O6A A;  1H44 A;  4MF3 A;  2P0S A;  1OQG A;  2I6E A;  5H8N A;  2D5W A;  4YKK A;  1II5 A;  1LCF A;  2H5Y A;  1FTO A;  3O29 A;  4I9D A;  4G8M A;  2Z8E A;  4P11 A;  1CB6 A;  1MS7 A;  3N26 A;  2Z8F A;  3T9V A;  4WXJ A;  3B7D A;  4X1D A;  5I59 B;  4RJZ A;  4F3G A;  5ITP A;  3EQ1 A;  1P99 A;  1B2H A;  3EPE A;  1O7T A;  2HFB A;  2O84 X;  4YB7 A;  3PPN A;  3FJM A;  1ZKB A;  3MAM A;  5CI5 A;  4QSE A;  3FVG A;  3LR1 A;  3O6H A;  4IGR A;  2UVJ A;  5ISU A;  3G3I A;  1A54 A;  3IO4 A;  4DXB A;  1FCK A;  2HCA A;  3OSQ A;  3LBS A;  5J1D A;  5I58 B;  1XOC A;  2XD2 A;  2DWI A;  2XXR A;  1KWH A;  4JSD A;  1B7U A;  3B6W A;  4Q5T A;  4Z7E A;  2GH9 A;  4FEB A;  1I6B A;  3KZG A;  2DSF A;  3CRB A;  1JVX A;  4R2F A;  4GLI A;  3H6T A;  3IOW A;  2QPQ A;  3KOS A;  2YPN A;  2VHA A;  1M5D A;  4EXK A;  4G77 A;  4BLA A;  4MLQ A;  5AA4 A;  1UTH B;  1ZJL A;  5I57 A;  4EF2 A;  3PUW E;  4U4X A;  3T96 B;  5ITO A;  2GHB A;  4R75 A;  3T93 B;  2PBW A;  1S50 A;  1M5B A;  2Y7K A;  2FA7 A;  1OLC A;  3K4U A;  1FTJ A;  3ECR A;  2V3U A;  3N94 A;  4F3B A;  2F7A A;  3C33 A;  1TFA A;  3LUY A;  4TQU Q;  2DP8 A;  1AMF A;  2E1S A;  3B6Q A;  5CMK A;  1YPN A;  3PPO A;  2CMO A;  1LB9 A;  3RTW B;  1LFI A;  4WEP A;  3K02 A;  3K6X A;  3V89 B;  4IO4 A;  2PMS A;  1B3F A;  1H3D A;  3SEY A;  3USD A;  1LST A;  3C4M A;  1ZMG A;  4ONY A;  4KYD A;  2YLN A;  4GD5 A;  3TEP A;  3CFL A;  1GGG A;  4F2O A;  2Q8J A;  2PYY A;  3FJ7 A;  3HHG A;  1Q1K A;  4YKP A;  3CSB A;  3TCF A;  1H76 A;  3KFM A;  5HM4 B;  3MBP A;  1NNF A;  2DS9 A;  4RY1 A;  4QRZ A;  1GV8 A;  4LUB A;  3VE1 B;  1EU8 A;  2NUV A;  3TTM A;  3KN8 A;  1MM7 A;  1SD3 A;  4F1V A;  2FYI A;  4KHZ E;  1AL3 A;  4OFJ A;  3B6T A;  4OWD A;  3QAX A;  1PB7 A;  4NF5 A;  4KYS A;  2ZYK A;  5BWJ A;  2DWJ A;  3MC2 A;  4NF8 A;  3V5A A;  3TUS A;  4RK2 A;  3C36 A;  4R73 A;  1NL5 A;  2ZNS A;  3Q29 A;  2CZL A;  3W9W A;  5DEX A;  2XXT A;  5I2N A;  2DVC A;  1MPD A;  3KGC A;  3FV1 A;  4FEC A;  3K1M A;  1LFH A;  3U92 A;  3OSR A;  4EUO A;  3ZS6 A;  3UGW A;  2XXU A;  4BDO A;  1UTH A;  3W9V A;  3HHF A;  5DT6 A;  5KCJ A;  3SEW A;  5CBS A;  1AH5 A;  2Y84 A;  4I8C A;  2Q88 A;  3T9H B;  4XKR A;  3T22 A;  5ICT A;  4AQ4 A;  4C0R A;  1RYX A;  2F78 A;  4HCY A;  2HEU A;  4QFP A;  5AA3 A;  1H45 A;  3HN0 A;  3IJX B;  3CFX A;  4RA1 A;  2V93 A;  4X9T A;  3VXB A;  3MVX A;  2XXW A;  4UA8 A;  4ESX A;  4Q30 B;  1ZIU A;  4OER A;  3K01 A;  4C1U A;  2I58 A;  3PUV E;  1D3K A;  4N6P A;  4F1Y A;  1A8F A;  2ZYO A;  3IOU A;  4P0I A;  3DLN A;  4FE8 A;  4PET A;  5AA2 D;  4JSO A;  3UP9 A;  1J1N A;  1D9V A;  2UYF A;  5H8S A;  2V25 A;  3KOT A;  2Y7P A;  2I48 A;  3M8U A;  2XX9 A;  5M2V A;  1YCJ A;  3OO8 A;  2A5S A;  3M3K A;  3QIM A;  4JDF A;  5IAI A;  3EF7 A;  3K1P A;  3RY3 A;  3QYT A;  5H8N B;  1M5F A;  3S9M C;  1MQI A;  3GBA A;  5HBC A;  2Y7R A;  4EXL A;  1P1U A;  3S4U A;  3FVK A;  4U1O A;  3I6V A;  3IJO B;  4OFO A;  2HAV A;  3MVY A;  1B5H A;  3UOR A;  3TOD A;  1EH3 A;  3F11 A;  1BKA A;  3FXQ A;  2REG A;  2X26 A;  2RC7 A;  4H1X A;  5BUU A;  4ZEB A;  3FD3 A;  3RTF B;  3IO6 A;  4NTL A;  4O3A A;  4RYA A;  3WAF A;  1SVX B;  1F9B A;  3C35 A;  1QJM A;  4H67 A;  2F34 A;  2Y7I A;  3JYR A;  3MVW A;  4OTE A;  3VV5 A;  1GVC A;  1I6A A;  3TKD A;  2DOJ A;  4TLL B;  2G29 A;  1MQG A;  1NH7 A;  1NFT A;  2ONK E;  1N3X A;  3CG1 A;  5EHM A;  1SW2 A;  3VLU A;  5AA4 B;  2O68 A;  5I57 B;  1Y3P A;  5I56 A;  4GL8 A;  1NNT A;  2PT2 A;  4YB5 A;  1N76 A;  1M5C A;  1LLS A;  1NNK A;  2VD3 A;  1MDQ A;  1VSO A;  4H5G A;  3UK4 A;  3BKI B;  1ZU0 A;  3RNN A;  1XT8 A;  4JWX A;  3G3K A;  3Q28 A;  3E4R A;  4KFQ A;  4RXL A;  3C32 A;  1SYI A;  2DE3 A;  4ESW A;  2D21 A;  3GZG A;  3IL1 B;  1ZBM A;  2Q2A A;  3OO7 A;  4X1B A;  2XD3 A;  2XXQ A;  1US4 A;  1UIV A;  3MPL A;  4WKM A;  2NOO A;  1DSN A;  1MXU A;  3RQT A;  1FTK A;  1SW1 A;  3ZKL A;  4RPO A;  5AA1 A;  2OWT A;  2IEE A;  1XVX A;  2OZZ A;  1Y1M A;  2ZNU A;  4FOR A;  4GVO A;  4ND9 A;  4YIC A;  2HZL A;  2DVZ A;  2HZK A;  1MH3 A;  1UQW A;  4ELO A;  3ZSF A;  2V3Q A;  4I1D A;  1IXC A;  5H8F A;  1A40 A;  1S9T A;  1CE2 A;  2ANJ A;  4XTC Q;  1FQB A;  2V3T A;  3N6T A;  1LAX A;  3PV0 E;  3O28 A;  5HPQ A;  3LSW A;  5DVI A;  2ZYM A;  1JW5 A;  3G7W A;  4LAT A;  4PQJ A;  3LSL A;  1IXI A;  1Y4C A;  1B52 A;  4IO3 A;  4LA9 A;  1T0K A;  2I0B A;  2O1L A;  4NF5 B;  4ZED A;  2RIN A;  2QRY A;  4N13 A;  1BTJ A;  3H7M A;  4NF8 B;  4GWO A;  2OBG A;  2REJ A;  4BDR A;  4GF8 A;  1RKM A;  2F97 A;  5I84 A;  4GQO A;  4OQO A;  1BIY A;  3EHS A;  3MZ9 A;  3G3H A;  5DEX B;  4RK9 A;  5I2N B;  3ZKK A;  5KDT A;  1ANF A;  3A09 A;  2FNC A;  3LSX A;  3L6G A;  1MM6 A;  3O6G A;  3OEM A;  4F18 A;  3A3U A;  1M5E A;  3H6W A;  3A3C A;  4WED A;  3EHU A;  5KCJ B;  1DPE A;  1R9L A;  3OXN A;  3PMV A;  1IIT A;  4PFW A;  1IIW A;  1P1N A;  4FAJ A;  4LZ5 A;  1RYO A;  1QUL A;  3IOT A;  4QF9 A;  3CR9 A;  5IKB A;  1R1N A;  1B46 A;  4NED A;  3CI8 A;  2ONS A;  2I3W A;  4FED A;  1OVT A;  3FVN A;  4H6D A;  5TPA A;  2XXP A;  3FUZ A;  2XXI A;  4BDM A;  1N04 A;  4GFR A;  4MLV A;  4QSD A;  3FAS A;  5TP9 A;  1A55 A;  3U1O A;  4ZDM A;  2UVI A;  3DM0 A;  4YKI A;  1US5 A;  4Q0C A;  4MBP A;  4M1V A;  2DQV A;  1NMU A;  4YAH X;  1JET A;  4F1U A;  3AXF A;  4XKP A;  4H65 A;  3RN8 A;  1FQC A;  3R7X A;  3RGY A;  5CMC A;  3EN3 A;  1N3W A;  2QL3 A;  2F6G A;  4LVQ A;  2NVU B;  5F7V A;  2OWS A;  4KPT A;  1JW4 A;  1IUD A;  4QFO A;  3H03 A;  1N7W A;  3S9N C;  1P1W A;  1GTK A;  3BFU A;  4POW A;  1B7Z A;  5KZT A;  3OMB A;  2H9B A;  5JTY A;  2H98 A;  1OVB A;  2P2A A;  3GBB A;  4AB5 A;  2XXX A;  2RKM A;  2I49 A;  3VXC A;  1PEB A;  3U72 A;  3OEK A;  4YKJ A;  1USY H;  3R26 A;  1IXH A;  1SDX A;  3H06 B;  4IY6 A;  1JVY A;  3MQ9 A;  3GXA A;  1Y3Q A;  5JEI A;  5LOM A;  3TMG A;  1SYH A;  2HQ0 A;  2LAO A;  1LGB C;  1B3E A;  4NF6 A;  4GRK A;  3IB1 A;  4QHQ A;  4R72 A;  4R6H A;  3Q26 A;  3VVD A;  3KG2 A;  1A8E A;  4HS7 A;  4OEV A;  3C9H A;  4R6Y A;  1B3L A;  1NH8 A;  3FXR A;  4AB6 A;  1QUJ A;  3UA8 A;  4NWC A;  3KBR A;  1LB8 A;  5JK4 A;  2R6G E;  3K6U A;  3TEL A;  3KSX A;  2H4I A;  5FTI A;  3O66 A;  2H25 A;  1VFE A;  1P1Q A;  3PD8 A;  1B4H A;  3U8Q A;  4BDL A;  3WAE A;  3G3G A;  3TAJ A;  5I56 B;  1JW1 A;  4DE8 A;  2ONR A;  1FTL A;  1L5T A;  2O1M A;  1I6Q A;  2AYS A;  4X48 A;  4NE4 A;  3S2V A;  3PMW A;  5DVF A;  2XXV A;  3BFT A;  1MXW A;  2QMX A;  4YB6 A;  2QS3 A;  3TQL A;  1LCT A;  5ELV A;  5H8H A;  2PT1 A;  2F36 A;  4H8J A;  4YZZ A;  3TTK A;  3MZB A;  3PUX E;  5DYH A;  1UIU A;  3OO9 A;  4KYE A;  5L8D A;  3TTN A;  3I5O A;  3M3L A;  2BJJ X;  4U21 A;  2ZMB A;  4R9F A;  4GIZ A;  4QFK A;  4G4P A;  2HAU A;  3O2A A;  2RF1 A;  4IY5 A;  1MH4 A;  3PUZ E;  3E9X A;  3K6W A;  4XKQ A;  3V8X B;  3VFJ A;  3PUY E;  1B32 A;  3V83 A;  1B6H A;  1N7X A;  1POY 1;  4OEN A;  3N6U A;  4OVJ A;  1MXX A;  5H8F B;  1LBC A;  3ODB A;  1MDP 1;  3PPP A;  1Z7M E;  5EHS A;  4ZZE A;  2A5T A;  1URD A;  1Y4T A;  2WKY A;  5FHN A;  1IZ1 A;  4DCX A;  3JZJ A;  1MY4 A;  1ELJ A;  1Y20 A;  4LZ8 A;  2O7U A;  2NWJ A;  2O69 A;  1FW0 A;  4R2B A;  3W15 C;  1B1H A;  5L9M A;  3G3J A;  4HTG A;  2Q2C A;  2F6P A;  4HCW A;  1JQF A;  1QVS A;  5K2X A;  1B7H A;  1YAE A;  2I0C A;  2DXR A;  4KD5 A;  3CVG A;  5H8Q A;  1SQY A;  1QKB A;  2F8D A;  5I2K A;  1B5J A;  3IB0 A;  1USY E;  1NKX A;  2ZYN A;  4G2Z A;  3I3V A;  3OEN A;  1JEV A;  1FQE A;  1LAF E;  2UYE A;  3S9L C;  4LON B;  4XIG Q;  3QK6 A;  1SBP A;  3PPR A;  3N5L A;  4L17 A;  3T9U A;  1PB9 A;  1LFG A;  2E0S A;  1IQ7 A;  5ICQ A;  3HST A;  4C1T A;  5KDT B;  4PFT A;  4JXI A;  2GHA A;  4U4S A;  3C34 A;  1EZO A;  4R6K A;  3KEI A;  2O51 A;  1MPC A;  2F7C A;  4M4G A;  1N0T A;  3IAZ A;  2PX1 A;  1MQH A;  4ZS9 A;  5CRY A;  3H6U A;  4JBZ A;  2VD2 A;  1EZ9 A;  4XKN A;  3O97 A;  1FTM A;  3S9E A;  3FV2 A;  5DTB A;  2VGQ A;  2X7Q A;  4ELR A;  4OMB A;  3JV9 A;  5TPA B;  4ZZA A;  2B65 A;  4ZE9 A;  4YMB A;  4THI A;  1IEJ A;  5TP9 B;  4HW8 A;  2RCB A;  4QFL A;  3FVO A;  4U1Z A;  1MG1 A;  1FQF A;  3DP4 A;  1XC1 A;  3H3G A;  1DMB A;  2Q9T A;  1EZP A;  2RC9 A;  1LAH E;  3IB2 A;  3FXU A;  1B5I A;  3RPW A;  4JWO A;  2QJE A;  4RPN A;  1I69 A;  3CG3 A;  3U94 A;  2QS1 A;  3SDF A;  4JB7 A;  4NF4 B;  2GFE A;  3SEX A;  1MXY A;  3TZA A;  1P1O A;  1B05 A;  2Z23 A;  3OOA A;  3QXM A;  1UTB A;  3MP8 A;  2DXY A;  4ZE8 A;  4N07 A;  3K1N A;  5B7D A;  5JTY B;  1AOV A;  4ZEF A;  3PMX A;  4YU0 A;  3OEL A;  4GXS B;  1SW4 A;  4P0G A;  2OK2 A;  4GXA A;  2ZXT A;  2R9J A;  4JWY A;  1OIB A;  3T9X B;  1MY0 A;  2M8C A;  3UN6 A;  4EQ7 A;  4IO7 A;  4O3B A;  4DDD A;  1Z7N E;  1PB8 A;  2XHD A;  3HPI A;  2G93 A;  2HXW A;  3U93 A;  3MPK A;  3E3K A;  2VOZ A;  3H6V A;  4NF6 B;  2F35 A;  1MQJ A;  3HO7 A;  4NMY A;  2DE4 A;  4U23 A;  4ECF A;  4QSC A;  3ILT B;  3MUQ A;  5L9O A;  1B3H A;  2D3I A;  2I4C A;  2RCA A;  2NXO A;  3VVE A;  3O9P A;  4XXU A;  4F3S A;  4FJP A;  4FAT A;  1VFD A;  4OFL A;  3VVF A;  2DE2 A;  4EF1 A;  2W7Y A;  3SKP A;  4QFN A;  2QS2 A;  4LQ5 A;  5TU0 A;  5CMB A;  4KI0 E;  4KCD A;  3R6U A;  4F29 A;  4OET A;  3FAT A;  5AE4 A;  3KJT A;  4H5F A;  2XX7 A;  1Q35 A;  3SEV A;  1B4Z A;  5A5X A;  4G68 C;  2H99 A;  4G68 A;  4BDN A;  1Y3N A;  1N84 A;  2AIX A;  3PPQ A;  5CMM A;  4OYV A;  4LZ7 A;  4OEU A;  3IOV A;  2QMW A;  1H43 A;  1OMP A;  4F39 A;  5H8H B;  3HV1 A;  1PDA A;  1QUI A;  1R6Z A;  1SW5 A;  5AA2 B;  2DWA A;  3QUJ A;  5CM6 A;  3K0V A;  5K2Y A;  4NF4 A;  4RNS A;  3TTL A;  3FZV A;  2KLF A;  4E0X A;  3RUM A;  3K00 A;  4PFY A;  3T66 A;  3TCH A;  2B3F A;  4F22 A;  3VDF A;  1IXG A;  3SER A;  1YTV A;  1HSL A;  3D4C A;  2ESN A;  1HSJ A;  3RLF E;  1GR2 A;  1MXV A;  1DTZ A;  2VP1 A;  3FJG A;  3THI A;  4H0W A;  1JEU A;  2XXH A;  3C31 A;  2YJP A;  2A5T B;  4I62 A;  5I59 A;  3EHT A;  3IOR A;  1A99 A;  3MW0 A;  3CSG A;  1Y1Z A;  3K2D A;  3PD9 A;  4TLM B;  1NNP A;  4DLD A;  1WVJ A;  2Y7W A;  3MWB A;  1B0L A;  1O63 A;  1B3G A;  3LC8 A;  3KN7 A;  3Q27 A;  4ZEC A;  3MZ1 A;  5I58 A;  1DPP A;  1ZTY A;  1MPB A;  3QSL A;  2V84 A;  1JNF A;  2UVG A;  1VE4 A;  1DOT A;  4BDQ A;  2XXY A;  4F2Q A;  5H8Q B;  1O64 A;  4NWD A;  5I2K B;  3Q25 A;  1VR5 A;  3UIF A;  4TOZ A;  3CIJ A;  3TYH A;  5L9S A;  3ILU B;  3O6I A;  1WOD A;  1MY1 A;  1TT1 A;  1BP5 A;  1D4N A;  4EDP A;  2I3V A;  4OES A;  2QS4 A;  2GRV A;  3TCG A;  3DEL B;  1MY3 A;  3SEU A;  4U2R A;  1S7Y A;  2ALU A;  2F5X A;  4PP0 A;  1BLF A;  5FTH A; 
#chains in the Genus database with same CATH topology
 3DP8 A;  2ZNT A;  3TDJ A;  4O3C A;  3KJ7 A;  4Z0I A;  1DTG A;  4N4U A;  2R71 A;  4PFU A;  3E78 A;  4G8H A;  4F31 B;  3LV0 A;  1BK4 A;  4P3L A;  1FQA A;  1TFD A;  3PGF A;  3L6H A;  1A7L A;  4DZ1 A;  1XHY A;  3ISP A;  4IGT A;  4GOT A;  2P1S A;  1B9J A;  3LSF B;  4IO6 A;  3G3F A;  4KR5 A;  1EYK A;  2UXA A;  2Z8D A;  5LTC A;  5AA2 A;  3RT8 A;  5F1Q A;  1B40 A;  4F19 A;  2QSX A;  1MQD A;  3T1B A;  4JVC A;  3IR1 A;  1AIV A;  4LQ2 A;  1Y9U A;  2THI A;  1TXF A;  4OXV A;  4OHN A;  3MJN A;  1MRP A;  1NV0 A;  4ELP A;  4R9G A;  3MP6 A;  2AL4 A;  4ISU A;  5DVJ A;  5IZ3 B;  3D4G A;  2XWK A;  4ZEK A;  2Z22 A;  5B70 A;  3SES A;  5FHM A;  2QVR A;  2Q89 A;  4YMA A;  3P7I A;  2XXK A;  3ONM A;  3KSJ A;  4DXC A;  1B51 A;  1SI1 A;  1FQD A;  4K3F A;  4NF0 A;  4H8I A;  2XX8 A;  3CFZ A;  3DP6 A;  5FHO A;  1UTB B;  3TTR A;  3RYD A;  5EQ8 A;  3IK6 B;  4OVS A;  1OLA A;  2WBB A;  4OZ9 A;  2HXR A;  3EKI A;  2X7P A;  2OCU A;  3OO6 A;  4XEQ A;  1NV1 A;  5EQA A;  1R9Q A;  4R74 A;  4GL0 A;  4MH5 A;  1LBB A;  1B1X A;  4F3P A;  1LBY A;  1POT A;  2RC8 A;  1XVY A;  1TWY A;  2AL5 A;  4POX A;  3RT6 B;  1VDW A;  3FIR A;  4N6K A;  4ZEI A;  3SET A;  3K6V A;  3PU5 A;  5EQ7 A;  4E0W A;  4DIG A;  4KQP A;  3MVZ A;  3E13 X;  5CBR A;  1QUK A;  1DK4 A;  3E79 A;  1XS5 A;  4PAK A;  3BBR A;  2KQZ A;  1DBZ A;  1PC3 A;  1D9Y A;  4IB2 A;  3M3F A;  3FXB A;  4LP2 B;  2HPG A;  5EYF A;  3IX1 A;  4MFI A;  5A5L A;  4IO5 A;  2I4B A;  1QKA A;  4PE5 B;  2PVU A;  4G8N A;  2B3B A;  4PDD A;  4DCY A;  1ZLQ A;  2OLB A;  2Y5K A;  4Q8R A;  1ATG A;  4MX6 A;  3HCQ A;  4IO2 A;  2F7B A;  4EQB A;  1URG A;  3KN3 A;  5A5X B;  4U22 A;  2UVH A;  1MY2 A;  2PCR A;  1FBH A;  2DYX A;  4G68 B;  4EQ9 A;  3GLB A;  1PBP A;  3MP1 A;  1OQH A;  3H4Z A;  3VLV A;  3QUF A;  2O7I A;  1MXZ A;  1QW0 A;  2XWO A;  2P3V A;  3KC1 A;  4DXU A;  1B58 A;  3TFL A;  3A29 A;  4UAC A;  2OJT A;  1LAG E;  4ELQ A;  2DWH A;  1B0H A;  4LN5 A;  3TPA A;  1HSE A;  1FBD A;  2IA4 A;  1URS A;  3OD7 A;  4NG7 A;  4FIM A;  1SI0 A;  4KCC A;  2FHY A;  1WDN A;  5CC2 A;  1PBQ A;  3FGS A;  3TQW A;  3VLW A;  2ABH A;  2O6A A;  1H44 A;  4MF3 A;  2P0S A;  4AS4 A;  1OQG A;  2I6E A;  5H8N A;  2D5W A;  4YKK A;  1II5 A;  1LCF A;  2H5Y A;  4MMP A;  5EYH A;  1FTO A;  3O29 A;  4I9D A;  4G8M A;  2Z8E A;  4P11 A;  1CB6 A;  1MS7 A;  3N26 A;  4PF6 A;  2Z8F A;  3T9V A;  4WXJ A;  4PDH A;  2FIE A;  3B7D A;  4X1D A;  5I59 B;  4RJZ A;  4F3G A;  5ITP A;  3EQ1 A;  1P99 A;  1B2H A;  3EPE A;  1RDZ A;  2VPO A;  1O7T A;  2CEX A;  2HFB A;  2O84 X;  4YB7 A;  3PPN A;  3FJM A;  1ZKB A;  3MAM A;  5CI5 A;  4QSE A;  3FVG A;  3LR1 A;  3O6H A;  4IGR A;  2UVJ A;  5ISU A;  3G3I A;  1A54 A;  3IO4 A;  4DXB A;  1FCK A;  2HCA A;  3OSQ A;  3LBS A;  5J1D A;  4JVD A;  5I58 B;  1XOC A;  2XD2 A;  2DDK A;  2DWI A;  2Y5L A;  2XXR A;  1KWH A;  4JSD A;  1B7U A;  3B6W A;  4Q5T A;  4Z7E A;  2GH9 A;  4FEB A;  1I6B A;  4GX4 A;  3KZG A;  2DSF A;  3CRB A;  1JVX A;  4R2F A;  4GLI A;  3H6T A;  3IOW A;  2QPQ A;  3KOS A;  2YPN A;  2VHA A;  1M5D A;  4EXK A;  4G77 A;  4BLA A;  4MLQ A;  5AA4 A;  1UTH B;  1ZJL A;  4I3E A;  5I57 A;  2WYK A;  4PFR A;  2P3N A;  4EF2 A;  3PUW E;  1FPK A;  4U4X A;  3T96 B;  4R75 A;  2GHB A;  5ITO A;  3T93 B;  2PBW A;  1G0I A;  1S50 A;  1M5B A;  2Y7K A;  2FA7 A;  1OLC A;  3K4U A;  1FTJ A;  5I7I A;  3ECR A;  2V3U A;  1FPJ A;  3N94 A;  4F3B A;  2F7A A;  3C33 A;  1TFA A;  3LUY A;  4TQU Q;  4GX3 A;  5ET6 A;  2DP8 A;  1AMF A;  2E1S A;  3B6Q A;  5CMK A;  1YPN A;  3PPO A;  2CMO A;  1IMA A;  1LB9 A;  3RTW B;  1LFI A;  4WEP A;  1FBF A;  4QBA A;  3K02 A;  3RPL A;  3K6X A;  3V89 B;  4IO4 A;  2PMS A;  1B3F A;  2XWI A;  1H3D A;  3SEY A;  3USD A;  1LST A;  3C4M A;  1ZMG A;  4ONY A;  4KYD A;  2YLN A;  4GD5 A;  3TEP A;  3CFL A;  1GGG A;  4F2O A;  2Q8J A;  2PYY A;  3FJ7 A;  3HHG A;  1Q1K A;  1FPE A;  4YKP A;  3CSB A;  3TCF A;  1H76 A;  3KFM A;  5HM4 B;  4OVP A;  3MBP A;  1NNF A;  2CEY A;  5J16 A;  2DS9 A;  4DI4 B;  5I3S A;  4RY1 A;  4QRZ A;  4GWZ A;  1GV8 A;  4LUB A;  2PFY A;  3VE1 B;  1EU8 A;  2NUV A;  3TTM A;  3KN8 A;  1MM7 A;  1SD3 A;  1XI6 A;  4F1V A;  2FYI A;  4KHZ E;  1DCU A;  1AL3 A;  4OFJ A;  3B6T A;  4OWD A;  4X8R A;  3QAX A;  1PB7 A;  4NF5 A;  4KYS A;  2ZYK A;  5BWJ A;  2DWJ A;  3MC2 A;  4NF8 A;  4P9K A;  4PBH A;  3V5A A;  3IFC A;  3TUS A;  4RK2 A;  3C36 A;  4R73 A;  2KR0 A;  1NL5 A;  2ZNS A;  3Q29 A;  3LUZ A;  2CZL A;  3W9W A;  5DEX A;  2XXT A;  5I2N A;  4H45 A;  2DVC A;  4NX1 A;  1MPD A;  4PGP A;  3KGC A;  3FV1 A;  4FEC A;  3K1M A;  1LFH A;  3U92 A;  3OSR A;  4EUO A;  3ZS6 A;  3UGW A;  2XXU A;  4BDO A;  1UTH A;  4GBV A;  3W9V A;  3HHF A;  5DT6 A;  5KCJ A;  3SEW A;  5CBS A;  1AH5 A;  2Y84 A;  4I8C A;  2Q88 A;  3T9H B;  4XKR A;  3T22 A;  5ICT A;  4AQ4 A;  4C0R A;  1RYX A;  2F78 A;  4HCY A;  2HEU A;  4QFP A;  5AA3 A;  1H45 A;  3HN0 A;  3IJX B;  3CFX A;  4RA1 A;  2V93 A;  4X9T A;  3VXB A;  1FRP A;  1FBC A;  3MVX A;  2R8T A;  4QXD A;  2XXW A;  4UA8 A;  4ESX A;  3MST A;  4O7M A;  4Q30 B;  2OWZ A;  1ZIU A;  4OER A;  2ZZX A;  3K01 A;  4C1U A;  2I58 A;  3U65 A;  3PUV E;  1D3K A;  4N6P A;  1NV5 A;  4F1Y A;  1A8F A;  4PFI A;  2ZYO A;  3IOU A;  3GYY A;  4P0I A;  3DLN A;  4FE8 A;  4PET A;  5AA2 D;  4JSO A;  3UP9 A;  4PE3 A;  1J1N A;  1D9V A;  2UYF A;  5H8S A;  1NUY A;  2V25 A;  4MEV A;  3KOT A;  2Y7P A;  2I48 A;  3M8U A;  2XX9 A;  5M2V A;  1YCJ A;  5I5P A;  3OO8 A;  4N17 A;  2WX9 A;  2A5S A;  3M3K A;  3QIM A;  4JDF A;  5IAI A;  3EF7 A;  3K1P A;  3RY3 A;  3QYT A;  5H8N B;  1M5F A;  3S9M C;  1MQI A;  1RDY A;  3GBA A;  4MHF A;  5HBC A;  4PFB A;  2Y7R A;  3CHG A;  1K9Y A;  4EXL A;  1P1U A;  2B4L A;  4MNP A;  3S4U A;  4XFE A;  3FVK A;  4U1O A;  3I6V A;  3IJO B;  4OFO A;  2HAV A;  1IME A;  3MVY A;  1B5H A;  3UOR A;  3TOD A;  1EH3 A;  3F11 A;  1BKA A;  4P56 A;  3FXQ A;  2REG A;  2X26 A;  2RC7 A;  4H1X A;  5BUU A;  4ZEB A;  3FD3 A;  1SPI A;  3RTF B;  3IO6 A;  1FTA A;  4NTL A;  4O3A A;  4RYA A;  3WAF A;  1SVX B;  1F9B A;  3C35 A;  1LBV A;  4GWS A;  1QJM A;  4H67 A;  2F34 A;  2Y7I A;  3JYR A;  4PF8 A;  3MVW A;  2CZI A;  4OTE A;  3VV5 A;  1GVC A;  2JJK A;  1I6A A;  1IMC A;  3TKD A;  2DOJ A;  4TLL B;  2G29 A;  1MQG A;  1NH7 A;  1NFT A;  2ONK E;  1N3X A;  3CG1 A;  5EHM A;  1SW2 A;  3VLU A;  5IM2 A;  5AA4 B;  5ET8 A;  2O68 A;  2MKZ A;  5I57 B;  1Y3P A;  5I56 A;  1FSA A;  4GL8 A;  5IZ1 A;  1NNT A;  2PT2 A;  4YB5 A;  1N76 A;  1IMD A;  1LLS A;  1M5C A;  1NNK A;  2VD3 A;  1MDQ A;  1VSO A;  4H5G A;  3UK4 A;  4H46 A;  3BKI B;  2VPN A;  1ZU0 A;  3RNN A;  2ZZW A;  1XT8 A;  4JWX A;  3G3K A;  3Q28 A;  3E4R A;  4KFQ A;  4RXL A;  1FBG A;  3C32 A;  4OAN A;  1SYI A;  2DE3 A;  4ESW A;  4MCO A;  2D21 A;  3GZG A;  3IL1 B;  1ZBM A;  2Q2A A;  3OO7 A;  4X1B A;  2XD3 A;  2XXQ A;  1US4 A;  1LBW A;  1UIV A;  3MPL A;  4WKM A;  2NOO A;  1DSN A;  1MXU A;  3RQT A;  1FTK A;  1IMF A;  3RPL B;  4PC9 A;  1SW1 A;  3ZKL A;  4RPO A;  5AA1 A;  2OWT A;  1FPG A;  2IEE A;  1XVX A;  2OZZ A;  1Y1M A;  2ZNU A;  4FOR A;  4GVO A;  4ND9 A;  4YIC A;  2HZL A;  2DVZ A;  5IZZ A;  2HZK A;  1MH3 A;  1UQW A;  4ELO A;  3ZSF A;  2V3Q A;  4I1D A;  1IXC A;  2GQ1 A;  5H8F A;  1A40 A;  1S9T A;  1CE2 A;  2ANJ A;  4MJO A;  4XTC Q;  1QGX A;  1FQB A;  2V3T A;  3N6T A;  1LAX A;  3PV0 E;  3O28 A;  4N81 A;  3LSW A;  4N91 A;  5HPQ A;  5DVI A;  2BJI A;  2ZYM A;  1JW5 A;  4UAB A;  3G7W A;  4LAT A;  4PQJ A;  3LSL A;  1FJ9 A;  1RDX A;  1IXI A;  1Y4C A;  1B52 A;  4IO3 A;  4LA9 A;  1T0K A;  2I0B A;  2O1L A;  4I40 A;  4GWU A;  4NF5 B;  4ZED A;  1EYI A;  2RIN A;  4N8Y A;  2QRY A;  4N13 A;  4OVR A;  1BTJ A;  1FPI A;  3H7M A;  4NF8 B;  4GWO A;  2OBG A;  2REJ A;  4BDR A;  4GF8 A;  1RKM A;  2F97 A;  5I84 A;  1YYZ A;  4GQO A;  1IMB A;  4OQO A;  1JP4 A;  1BIY A;  3EHS A;  3MZ9 A;  3G3H A;  5DEX B;  3QMF A;  4RK9 A;  5I2N B;  3ZKK A;  5KDT A;  1NUZ A;  1ANF A;  3A09 A;  2FNC A;  3LSX A;  3D1R A;  3L6G A;  1MM6 A;  3B8B A;  4OVQ A;  5ESY A;  3O6G A;  4GWX A;  3OEM A;  4F18 A;  3A3U A;  1M5E A;  3H6W A;  3A3C A;  4WED A;  3EHU A;  5KCJ B;  1DPE A;  1R9L A;  3OXN A;  3PMV A;  1IIT A;  4PFW A;  1IIW A;  1P1N A;  5DW8 A;  4FAJ A;  4LZ5 A;  1RYO A;  4DI3 D;  1QUL A;  4PBQ A;  3IOT A;  4QF9 A;  3CR9 A;  2WEF A;  3NOH A;  1INP A;  5IKB A;  1R1N A;  1B46 A;  4NED A;  3CI8 A;  2ONS A;  2I3W A;  4FED A;  1OVT A;  3FVN A;  4H6D A;  5TPA A;  1NV4 A;  2XXP A;  3FUZ A;  3MYU A;  2XXI A;  4BDM A;  1N04 A;  4GFR A;  4MLV A;  4QSD A;  3FAS A;  5TP9 A;  1A55 A;  3U1O A;  4ZDM A;  2UVI A;  4PCD A;  3DM0 A;  1NV3 A;  4YKI A;  5F24 A;  4P47 A;  1US5 A;  4Q0C A;  4MBP A;  4M1V A;  2DQV A;  1NMU A;  1Q9D A;  4YAH X;  1JET A;  4F1U A;  3AXF A;  4XKP A;  4H65 A;  3RN8 A;  1FQC A;  3R7X A;  3RGY A;  5CMC A;  3EN3 A;  1N3W A;  2QL3 A;  2F6G A;  4OVT A;  4LVQ A;  2NVU B;  5F7V A;  2OWS A;  4KPT A;  4QFO A;  1JW4 A;  1IUD A;  3H03 A;  1N7W A;  3S9N C;  1P1W A;  1GTK A;  3BFU A;  4GBW A;  4POW A;  1B7Z A;  5KZT A;  3OMB A;  2H9B A;  5JTY A;  2ZZV A;  1FBP A;  2H98 A;  1OVB A;  5IGA A;  2P2A A;  2HHM A;  3GBB A;  4AB5 A;  2XXX A;  1KA1 A;  2RKM A;  2I49 A;  3VXC A;  1PEB A;  3U72 A;  3OEK A;  4YKJ A;  2XWV A;  1USY H;  3R26 A;  1IXH A;  1SDX A;  5T3J A;  3H06 B;  4IY6 A;  3ROJ A;  4GX6 A;  1JVY A;  3MQ9 A;  4MNI A;  3GXA A;  4MAG A;  1Y3Q A;  5JEI A;  5LOM A;  3TMG A;  1SYH A;  3B50 A;  2HQ0 A;  2LAO A;  4XF5 A;  1LGB C;  1B3E A;  4NF6 A;  4GRK A;  3IB1 A;  4QHQ A;  4R72 A;  4R6H A;  3Q26 A;  3VVD A;  3KG2 A;  1A8E A;  3PTY A;  4HS7 A;  4GWW A;  4OEV A;  3C9H A;  4R6Y A;  1B3L A;  1NH8 A;  3FXR A;  4AB6 A;  1QUJ A;  3UA8 A;  4NWC A;  3KBR A;  1LB8 A;  5JK4 A;  2R6G E;  2PFZ A;  3SZP A;  4N8G A;  1NUX A;  3K6U A;  3TEL A;  2B4M A;  3KSX A;  2H4I A;  5FTI A;  3O66 A;  2H25 A;  1VFE A;  1P1Q A;  3PD8 A;  1B4H A;  4O94 A;  3U8Q A;  4BDL A;  3WAE A;  3G3G A;  3TAJ A;  5I56 B;  1JW1 A;  4DE8 A;  2ONR A;  1FTL A;  1L5T A;  2O1M A;  1I6Q A;  2AYS A;  1NV7 A;  4X48 A;  4NE4 A;  3S2V A;  1FBE A;  3PMW A;  2F3D A;  5DVF A;  1YXI A;  2XXV A;  3BFT A;  1MXW A;  2QMX A;  2FVZ A;  4YB6 A;  5EQ9 A;  1FPF A;  2QS3 A;  3TQL A;  1LCT A;  5ELV A;  5H8H A;  2PT1 A;  2F36 A;  4H8J A;  4YZZ A;  3TTK A;  4PAF A;  5ET7 A;  3MZB A;  3PUX E;  5DYH A;  1UIU A;  3OO9 A;  4KYE A;  4PAI A;  5L8D A;  3TTN A;  4I3Y A;  3I5O A;  3KC0 A;  3M3L A;  2V4C A;  2BJJ X;  4U21 A;  2ZMB A;  4R9F A;  4GIZ A;  4QFK A;  4G4P A;  2HAU A;  3O2A A;  2RF1 A;  4IY5 A;  1MH4 A;  4NQ8 A;  3PUZ E;  3E9X A;  3K6W A;  4XKQ A;  3V8X B;  3VFJ A;  3PUY E;  1B32 A;  3V83 A;  2WBD A;  4FBP A;  1B6H A;  1N7X A;  1POY 1;  4OEN A;  3N6U A;  4OVJ A;  1MXX A;  2QVV A;  5H8F B;  1LBC A;  3ODB A;  1MDP 1;  3PPP A;  1Z7M E;  5EHS A;  4ZZE A;  2A5T A;  3HFU A;  1URD A;  1Y4T A;  2WKY A;  5FHN A;  5ET5 A;  1IZ1 A;  1LBZ A;  4DCX A;  3JZJ A;  1MY4 A;  1ELJ A;  1Y20 A;  4LZ8 A;  2O7U A;  2VT5 A;  2NWJ A;  2O69 A;  3BIH A;  1FW0 A;  4R2B A;  3W15 C;  1B1H A;  5L9M A;  3G3J A;  4HTG A;  2Q2C A;  2F6P A;  4HCW A;  1JQF A;  4X04 A;  1QVS A;  5K2X A;  1B7H A;  1YAE A;  2I0C A;  2DXR A;  4KD5 A;  4PTK A;  3CVG A;  5H8Q A;  1SQY A;  1QKB A;  2F8D A;  4NAP A;  5I2K A;  1B5J A;  3IB0 A;  1USY E;  1NKX A;  2ZYN A;  4G2Z A;  3I3V A;  3OEN A;  1JEV A;  1FQE A;  1LAF E;  2UYE A;  3S9L C;  4LON B;  4XIG Q;  3QK6 A;  1SBP A;  3PPR A;  3N5L A;  4L17 A;  3T9U A;  1PB9 A;  1LFG A;  2E0S A;  1IQ7 A;  5ICQ A;  3HST A;  4C1T A;  5KDT B;  4HE2 A;  4PFT A;  4O7I A;  4JXI A;  2GHA A;  4U4S A;  3C34 A;  1EZO A;  4R6K A;  3KEI A;  3T0J A;  2O51 A;  1MPC A;  2F7C A;  4M4G A;  1N0T A;  3IAZ A;  2PX1 A;  1MQH A;  1KZ8 A;  4ZS9 A;  5CRY A;  3H6U A;  4JBZ A;  2VD2 A;  1EZ9 A;  4XKN A;  3O97 A;  1FTM A;  4OA4 A;  1CNQ A;  4HXV A;  3S9E A;  3FV2 A;  5DTB A;  2OX3 A;  2VGQ A;  2X7Q A;  4ELR A;  4OMB A;  3JV9 A;  1K9Z A;  5TPA B;  4ZZA A;  2B65 A;  4ZE9 A;  4YMB A;  4N6D A;  4THI A;  1IEJ A;  5TP9 B;  4HW8 A;  4HE0 A;  3BIG A;  2RCB A;  4QFL A;  3FVO A;  4U1Z A;  1MG1 A;  1FQF A;  3DP4 A;  1XC1 A;  3H3G A;  1AWB A;  5IZ3 A;  1DMB A;  2Q9T A;  1EZP A;  2RC9 A;  1LAH E;  3IB2 A;  3FXU A;  4GWY A;  1D9Q A;  4HE1 A;  4N15 A;  1B5I A;  3RPW A;  4P8B A;  4JWO A;  2QJE A;  4RPN A;  1I69 A;  3CG3 A;  3U94 A;  2QS1 A;  3SDF A;  4JB7 A;  4NF4 B;  2GFE A;  3SEX A;  1MXY A;  3TZA A;  4NGU A;  1P1O A;  1B05 A;  2QFL A;  2XA5 A;  2Z23 A;  3OOA A;  3QXM A;  1UTB A;  2QVU A;  2Q8M A;  3MP8 A;  2DXY A;  4ZE8 A;  4N07 A;  3K1N A;  5B7D A;  5JTY B;  1AOV A;  4ZEF A;  3PMX A;  4YU0 A;  3OEL A;  4GXS B;  1SW4 A;  4P0G A;  2OK2 A;  2CZH A;  4O8M A;  2Q74 A;  4GXA A;  3FBP A;  5LDZ A;  2ZXT A;  2R9J A;  4JWY A;  1OIB A;  3T9X B;  1MY0 A;  2M8C A;  3UN6 A;  4EQ7 A;  4IO7 A;  4O3B A;  2F3B A;  4DDD A;  1Z7N E;  1PB8 A;  2XHD A;  3HPI A;  2G93 A;  2HXW A;  3U93 A;  3MPK A;  3E3K A;  2VOZ A;  1LBX A;  3IFA A;  3H6V A;  2L5V A;  4NF6 B;  2F35 A;  1MQJ A;  1NV2 A;  3HO7 A;  4NMY A;  2DE4 A;  4U23 A;  4ECF A;  4QSC A;  3ILT B;  3MUQ A;  5FBP A;  5L9O A;  1B3H A;  2D3I A;  2I4C A;  2RCA A;  2NXO A;  3VVE A;  3O9P A;  4XXU A;  4F3S A;  4FJP A;  4FAT A;  1VFD A;  4OFL A;  3VVF A;  2DE2 A;  4P1E A;  4EF1 A;  2W7Y A;  3SKP A;  1NV6 A;  1NI9 A;  4QFN A;  2QS2 A;  5EYG A;  4LQ5 A;  4MNC A;  5TU0 A;  5CMB A;  4KI0 E;  4KCD A;  3R6U A;  4F29 A;  4OET A;  3FAT A;  5AE4 A;  3KJT A;  4IR8 A;  1KA0 A;  4H5F A;  2XX7 A;  1Q35 A;  3SEV A;  1B4Z A;  2FBP A;  5A5X A;  4G68 C;  2H99 A;  4G68 A;  4MIJ A;  4BDN A;  1Y3N A;  1N84 A;  2AIX A;  3PPQ A;  5CMM A;  4OYV A;  4LZ7 A;  1FPD A;  4OEU A;  3IOV A;  2QMW A;  1H43 A;  4NN3 A;  1OMP A;  4F39 A;  5H8H B;  3HV1 A;  1PDA A;  1QUI A;  1R6Z A;  1SW5 A;  5AA2 B;  4KXP A;  2DWA A;  3QUJ A;  5CM6 A;  3K0V A;  5K2Y A;  4NF4 A;  4RNS A;  3TTL A;  3FZV A;  2KLF A;  4E0X A;  3RUM A;  3K00 A;  4PFY A;  3T66 A;  3TCH A;  2B3F A;  1FPL A;  2WYP A;  4F22 A;  3VDF A;  2CZK A;  1NUW A;  1IXG A;  3SER A;  1YTV A;  1HSL A;  3D4C A;  2ESN A;  1FJ6 A;  1HSJ A;  3RLF E;  4G61 A;  1GR2 A;  3KBZ A;  1MXV A;  1DTZ A;  2VP1 A;  3FJG A;  3THI A;  4H0W A;  1JEU A;  1FPB A;  2XXH A;  3C31 A;  2YJP A;  1YZ0 A;  2A5T B;  4I62 A;  5I59 A;  3EHT A;  3IOR A;  1A99 A;  3MW0 A;  3CSG A;  1Y1Z A;  3K2D A;  3PD9 A;  4TLM B;  1EYJ A;  1NNP A;  4DLD A;  1WVJ A;  2Y7W A;  3MWB A;  1B0L A;  4P1L A;  1O63 A;  1B3G A;  3LC8 A;  3KN7 A;  3Q27 A;  4ZEC A;  3MZ1 A;  5I58 A;  2FIX A;  1DPP A;  1ZTY A;  1MPB A;  3QSL A;  2V84 A;  1JNF A;  2UVG A;  1VE4 A;  1DOT A;  4BDQ A;  2XXY A;  4F2Q A;  5H8Q B;  1O64 A;  4NWD A;  5I2K B;  4NHB A;  3Q25 A;  1G0H A;  1VR5 A;  3UIF A;  1LEV A;  4TOZ A;  3CIJ A;  3TYH A;  5L9S A;  3ILU B;  3O6I A;  4JVI A;  1WOD A;  1MY1 A;  1TT1 A;  1BP5 A;  1D4N A;  4EDP A;  2I3V A;  4PGN A;  4OES A;  2QS4 A;  4AS5 A;  2GRV A;  3TCG A;  3DEL B;  1MY3 A;  3SEU A;  4U2R A;  1S7Y A;  2ALU A;  2F5X A;  4PP0 A;  1BLF A;  5FTH A; 
#chains in the Genus database with same CATH homology
 3DP8 A;  2ZNT A;  3TDJ A;  4O3C A;  3KJ7 A;  4Z0I A;  1DTG A;  2R71 A;  4PFU A;  4G8H A;  4F31 B;  1FQA A;  1TFD A;  3PGF A;  3L6H A;  1A7L A;  4DZ1 A;  1XHY A;  4IGT A;  4GOT A;  2P1S A;  1B9J A;  3LSF B;  4IO6 A;  3G3F A;  4KR5 A;  2UXA A;  2Z8D A;  5AA2 A;  3RT8 A;  5F1Q A;  1B40 A;  4F19 A;  2QSX A;  1MQD A;  3IR1 A;  1AIV A;  4LQ2 A;  1Y9U A;  2THI A;  1TXF A;  4OXV A;  4OHN A;  3MJN A;  1MRP A;  4ELP A;  4R9G A;  3MP6 A;  2AL4 A;  4ISU A;  5DVJ A;  3D4G A;  4ZEK A;  2Z22 A;  5B70 A;  3SES A;  5FHM A;  2Q89 A;  4YMA A;  3P7I A;  3ONM A;  3KSJ A;  4DXC A;  1B51 A;  1SI1 A;  1FQD A;  4K3F A;  4H8I A;  2XX8 A;  3CFZ A;  3DP6 A;  5FHO A;  1UTB B;  3TTR A;  3IK6 B;  1OLA A;  4OZ9 A;  2X7P A;  2OCU A;  3OO6 A;  1R9Q A;  4R74 A;  4GL0 A;  4MH5 A;  1LBB A;  1B1X A;  4F3P A;  1POT A;  2RC8 A;  1XVY A;  1TWY A;  2AL5 A;  4POX A;  3RT6 B;  3FIR A;  4ZEI A;  3SET A;  3K6V A;  3PU5 A;  4E0W A;  4DIG A;  4KQP A;  3MVZ A;  3E13 X;  5CBR A;  1QUK A;  1XS5 A;  3BBR A;  1PC3 A;  1D9Y A;  4IB2 A;  3M3F A;  4LP2 B;  5EYF A;  3IX1 A;  4MFI A;  4IO5 A;  2I4B A;  1QKA A;  4PE5 B;  2PVU A;  4G8N A;  2B3B A;  4DCY A;  1ZLQ A;  2OLB A;  4Q8R A;  1ATG A;  3HCQ A;  4IO2 A;  2F7B A;  4EQB A;  1URG A;  3KN3 A;  5A5X B;  4U22 A;  2UVH A;  1MY2 A;  2DYX A;  4G68 B;  4EQ9 A;  3GLB A;  1PBP A;  3MP1 A;  1OQH A;  3H4Z A;  3VLV A;  3QUF A;  2O7I A;  1MXZ A;  1QW0 A;  4DXU A;  1B58 A;  3TFL A;  4UAC A;  2OJT A;  1LAG E;  4ELQ A;  2DWH A;  1B0H A;  3TPA A;  1HSE A;  2IA4 A;  1URS A;  3OD7 A;  4FIM A;  1SI0 A;  4KCC A;  1WDN A;  5CC2 A;  1PBQ A;  3FGS A;  3TQW A;  3VLW A;  2ABH A;  2O6A A;  1H44 A;  4MF3 A;  2P0S A;  1OQG A;  2I6E A;  5H8N A;  2D5W A;  4YKK A;  1II5 A;  1LCF A;  2H5Y A;  1FTO A;  3O29 A;  4I9D A;  4G8M A;  2Z8E A;  4P11 A;  1CB6 A;  1MS7 A;  3N26 A;  2Z8F A;  3T9V A;  4WXJ A;  3B7D A;  4X1D A;  5I59 B;  4RJZ A;  4F3G A;  5ITP A;  3EQ1 A;  1P99 A;  1B2H A;  3EPE A;  1O7T A;  2HFB A;  2O84 X;  4YB7 A;  3PPN A;  3FJM A;  1ZKB A;  3MAM A;  5CI5 A;  4QSE A;  3FVG A;  3LR1 A;  3O6H A;  4IGR A;  2UVJ A;  5ISU A;  3G3I A;  1A54 A;  3IO4 A;  4DXB A;  1FCK A;  2HCA A;  3OSQ A;  3LBS A;  5J1D A;  5I58 B;  1XOC A;  2XD2 A;  2DWI A;  2XXR A;  1KWH A;  4JSD A;  1B7U A;  3B6W A;  4Q5T A;  4Z7E A;  2GH9 A;  4FEB A;  1I6B A;  3KZG A;  2DSF A;  3CRB A;  1JVX A;  4R2F A;  4GLI A;  3H6T A;  3IOW A;  2QPQ A;  3KOS A;  2YPN A;  2VHA A;  1M5D A;  4EXK A;  4G77 A;  4BLA A;  4MLQ A;  5AA4 A;  1UTH B;  1ZJL A;  5I57 A;  4EF2 A;  3PUW E;  4U4X A;  3T96 B;  5ITO A;  2GHB A;  4R75 A;  3T93 B;  2PBW A;  1S50 A;  1M5B A;  2Y7K A;  2FA7 A;  1OLC A;  3K4U A;  1FTJ A;  3ECR A;  2V3U A;  3N94 A;  4F3B A;  2F7A A;  3C33 A;  1TFA A;  3LUY A;  4TQU Q;  2DP8 A;  1AMF A;  2E1S A;  3B6Q A;  5CMK A;  1YPN A;  3PPO A;  2CMO A;  1LB9 A;  3RTW B;  1LFI A;  4WEP A;  3K02 A;  3K6X A;  3V89 B;  4IO4 A;  2PMS A;  1B3F A;  1H3D A;  3SEY A;  3USD A;  1LST A;  3C4M A;  1ZMG A;  4ONY A;  4KYD A;  2YLN A;  4GD5 A;  3TEP A;  3CFL A;  1GGG A;  4F2O A;  2Q8J A;  2PYY A;  3FJ7 A;  3HHG A;  1Q1K A;  4YKP A;  3CSB A;  3TCF A;  1H76 A;  3KFM A;  5HM4 B;  3MBP A;  1NNF A;  2DS9 A;  4RY1 A;  4QRZ A;  1GV8 A;  4LUB A;  3VE1 B;  1EU8 A;  2NUV A;  3TTM A;  3KN8 A;  1MM7 A;  1SD3 A;  4F1V A;  2FYI A;  4KHZ E;  1AL3 A;  4OFJ A;  3B6T A;  4OWD A;  3QAX A;  1PB7 A;  4NF5 A;  4KYS A;  2ZYK A;  5BWJ A;  2DWJ A;  3MC2 A;  4NF8 A;  3V5A A;  3TUS A;  4RK2 A;  3C36 A;  4R73 A;  1NL5 A;  2ZNS A;  3Q29 A;  2CZL A;  3W9W A;  5DEX A;  2XXT A;  5I2N A;  2DVC A;  1MPD A;  3KGC A;  3FV1 A;  4FEC A;  3K1M A;  1LFH A;  3U92 A;  3OSR A;  4EUO A;  3ZS6 A;  3UGW A;  2XXU A;  4BDO A;  1UTH A;  3W9V A;  3HHF A;  5DT6 A;  5KCJ A;  3SEW A;  5CBS A;  1AH5 A;  2Y84 A;  4I8C A;  2Q88 A;  3T9H B;  4XKR A;  3T22 A;  5ICT A;  4AQ4 A;  4C0R A;  1RYX A;  2F78 A;  4HCY A;  2HEU A;  4QFP A;  5AA3 A;  1H45 A;  3HN0 A;  3IJX B;  3CFX A;  4RA1 A;  2V93 A;  4X9T A;  3VXB A;  3MVX A;  2XXW A;  4UA8 A;  4ESX A;  4Q30 B;  1ZIU A;  4OER A;  3K01 A;  4C1U A;  2I58 A;  3PUV E;  1D3K A;  4N6P A;  4F1Y A;  1A8F A;  2ZYO A;  3IOU A;  4P0I A;  3DLN A;  4FE8 A;  4PET A;  5AA2 D;  4JSO A;  3UP9 A;  1J1N A;  1D9V A;  2UYF A;  5H8S A;  2V25 A;  3KOT A;  2Y7P A;  2I48 A;  3M8U A;  2XX9 A;  5M2V A;  1YCJ A;  3OO8 A;  2A5S A;  3M3K A;  3QIM A;  4JDF A;  5IAI A;  3EF7 A;  3K1P A;  3RY3 A;  3QYT A;  5H8N B;  1M5F A;  3S9M C;  1MQI A;  3GBA A;  5HBC A;  2Y7R A;  4EXL A;  1P1U A;  3S4U A;  3FVK A;  4U1O A;  3I6V A;  3IJO B;  4OFO A;  2HAV A;  3MVY A;  1B5H A;  3UOR A;  3TOD A;  1EH3 A;  3F11 A;  1BKA A;  3FXQ A;  2REG A;  2X26 A;  2RC7 A;  4H1X A;  5BUU A;  4ZEB A;  3FD3 A;  3RTF B;  3IO6 A;  4NTL A;  4O3A A;  4RYA A;  3WAF A;  1SVX B;  1F9B A;  3C35 A;  1QJM A;  4H67 A;  2F34 A;  2Y7I A;  3JYR A;  3MVW A;  4OTE A;  3VV5 A;  1GVC A;  1I6A A;  3TKD A;  2DOJ A;  4TLL B;  2G29 A;  1MQG A;  1NH7 A;  1NFT A;  2ONK E;  1N3X A;  3CG1 A;  5EHM A;  1SW2 A;  3VLU A;  5AA4 B;  2O68 A;  5I57 B;  1Y3P A;  5I56 A;  4GL8 A;  1NNT A;  2PT2 A;  4YB5 A;  1N76 A;  1M5C A;  1LLS A;  1NNK A;  2VD3 A;  1MDQ A;  1VSO A;  4H5G A;  3UK4 A;  3BKI B;  1ZU0 A;  3RNN A;  1XT8 A;  4JWX A;  3G3K A;  3Q28 A;  3E4R A;  4KFQ A;  4RXL A;  3C32 A;  1SYI A;  2DE3 A;  4ESW A;  2D21 A;  3GZG A;  3IL1 B;  1ZBM A;  2Q2A A;  3OO7 A;  4X1B A;  2XD3 A;  2XXQ A;  1US4 A;  1UIV A;  3MPL A;  4WKM A;  2NOO A;  1DSN A;  1MXU A;  3RQT A;  1FTK A;  1SW1 A;  3ZKL A;  4RPO A;  5AA1 A;  2OWT A;  2IEE A;  1XVX A;  2OZZ A;  1Y1M A;  2ZNU A;  4FOR A;  4GVO A;  4ND9 A;  4YIC A;  2HZL A;  2DVZ A;  2HZK A;  1MH3 A;  1UQW A;  4ELO A;  3ZSF A;  2V3Q A;  4I1D A;  1IXC A;  5H8F A;  1A40 A;  1S9T A;  1CE2 A;  2ANJ A;  4XTC Q;  1FQB A;  2V3T A;  3N6T A;  1LAX A;  3PV0 E;  3O28 A;  5HPQ A;  3LSW A;  5DVI A;  2ZYM A;  1JW5 A;  3G7W A;  4LAT A;  4PQJ A;  3LSL A;  1IXI A;  1Y4C A;  1B52 A;  4IO3 A;  4LA9 A;  1T0K A;  2I0B A;  2O1L A;  4NF5 B;  4ZED A;  2RIN A;  2QRY A;  4N13 A;  1BTJ A;  3H7M A;  4NF8 B;  4GWO A;  2OBG A;  2REJ A;  4BDR A;  4GF8 A;  1RKM A;  2F97 A;  5I84 A;  4GQO A;  4OQO A;  1BIY A;  3EHS A;  3MZ9 A;  3G3H A;  5DEX B;  4RK9 A;  5I2N B;  3ZKK A;  5KDT A;  1ANF A;  3A09 A;  2FNC A;  3LSX A;  3L6G A;  1MM6 A;  3O6G A;  3OEM A;  4F18 A;  3A3U A;  1M5E A;  3H6W A;  3A3C A;  4WED A;  3EHU A;  5KCJ B;  1DPE A;  1R9L A;  3OXN A;  3PMV A;  1IIT A;  4PFW A;  1IIW A;  1P1N A;  4FAJ A;  4LZ5 A;  1RYO A;  1QUL A;  3IOT A;  4QF9 A;  3CR9 A;  5IKB A;  1R1N A;  1B46 A;  4NED A;  3CI8 A;  2ONS A;  2I3W A;  4FED A;  1OVT A;  3FVN A;  4H6D A;  5TPA A;  2XXP A;  3FUZ A;  2XXI A;  4BDM A;  1N04 A;  4GFR A;  4MLV A;  4QSD A;  3FAS A;  5TP9 A;  1A55 A;  3U1O A;  4ZDM A;  2UVI A;  3DM0 A;  4YKI A;  1US5 A;  4Q0C A;  4MBP A;  4M1V A;  2DQV A;  1NMU A;  4YAH X;  1JET A;  4F1U A;  3AXF A;  4XKP A;  4H65 A;  3RN8 A;  1FQC A;  3R7X A;  3RGY A;  5CMC A;  3EN3 A;  1N3W A;  2QL3 A;  2F6G A;  4LVQ A;  2NVU B;  5F7V A;  2OWS A;  4KPT A;  1JW4 A;  1IUD A;  4QFO A;  3H03 A;  1N7W A;  3S9N C;  1P1W A;  1GTK A;  3BFU A;  4POW A;  1B7Z A;  5KZT A;  3OMB A;  2H9B A;  5JTY A;  2H98 A;  1OVB A;  2P2A A;  3GBB A;  4AB5 A;  2XXX A;  2RKM A;  2I49 A;  3VXC A;  1PEB A;  3U72 A;  3OEK A;  4YKJ A;  1USY H;  3R26 A;  1IXH A;  1SDX A;  3H06 B;  4IY6 A;  1JVY A;  3MQ9 A;  3GXA A;  1Y3Q A;  5JEI A;  5LOM A;  3TMG A;  1SYH A;  2HQ0 A;  2LAO A;  1LGB C;  1B3E A;  4NF6 A;  4GRK A;  3IB1 A;  4QHQ A;  4R72 A;  4R6H A;  3Q26 A;  3VVD A;  3KG2 A;  1A8E A;  4HS7 A;  4OEV A;  3C9H A;  4R6Y A;  1B3L A;  1NH8 A;  3FXR A;  4AB6 A;  1QUJ A;  3UA8 A;  4NWC A;  3KBR A;  1LB8 A;  5JK4 A;  2R6G E;  3K6U A;  3TEL A;  3KSX A;  2H4I A;  5FTI A;  3O66 A;  2H25 A;  1VFE A;  1P1Q A;  3PD8 A;  1B4H A;  3U8Q A;  4BDL A;  3WAE A;  3G3G A;  3TAJ A;  5I56 B;  1JW1 A;  4DE8 A;  2ONR A;  1FTL A;  1L5T A;  2O1M A;  1I6Q A;  2AYS A;  4X48 A;  4NE4 A;  3S2V A;  3PMW A;  5DVF A;  2XXV A;  3BFT A;  1MXW A;  2QMX A;  4YB6 A;  2QS3 A;  3TQL A;  1LCT A;  5ELV A;  5H8H A;  2PT1 A;  2F36 A;  4H8J A;  4YZZ A;  3TTK A;  3MZB A;  3PUX E;  5DYH A;  1UIU A;  3OO9 A;  4KYE A;  5L8D A;  3TTN A;  3I5O A;  3M3L A;  2BJJ X;  4U21 A;  2ZMB A;  4R9F A;  4GIZ A;  4QFK A;  4G4P A;  2HAU A;  3O2A A;  2RF1 A;  4IY5 A;  1MH4 A;  3PUZ E;  3E9X A;  3K6W A;  4XKQ A;  3V8X B;  3VFJ A;  3PUY E;  1B32 A;  3V83 A;  1B6H A;  1N7X A;  1POY 1;  4OEN A;  3N6U A;  4OVJ A;  1MXX A;  5H8F B;  1LBC A;  3ODB A;  1MDP 1;  3PPP A;  1Z7M E;  5EHS A;  4ZZE A;  2A5T A;  1URD A;  1Y4T A;  2WKY A;  5FHN A;  1IZ1 A;  4DCX A;  3JZJ A;  1MY4 A;  1ELJ A;  1Y20 A;  4LZ8 A;  2O7U A;  2NWJ A;  2O69 A;  1FW0 A;  4R2B A;  3W15 C;  1B1H A;  5L9M A;  3G3J A;  4HTG A;  2Q2C A;  2F6P A;  4HCW A;  1JQF A;  1QVS A;  5K2X A;  1B7H A;  1YAE A;  2I0C A;  2DXR A;  4KD5 A;  3CVG A;  5H8Q A;  1SQY A;  1QKB A;  2F8D A;  5I2K A;  1B5J A;  3IB0 A;  1USY E;  1NKX A;  2ZYN A;  4G2Z A;  3I3V A;  3OEN A;  1JEV A;  1FQE A;  1LAF E;  2UYE A;  3S9L C;  4LON B;  4XIG Q;  3QK6 A;  1SBP A;  3PPR A;  3N5L A;  4L17 A;  3T9U A;  1PB9 A;  1LFG A;  2E0S A;  1IQ7 A;  5ICQ A;  3HST A;  4C1T A;  5KDT B;  4PFT A;  4JXI A;  2GHA A;  4U4S A;  3C34 A;  1EZO A;  4R6K A;  3KEI A;  2O51 A;  1MPC A;  2F7C A;  4M4G A;  1N0T A;  3IAZ A;  2PX1 A;  1MQH A;  4ZS9 A;  5CRY A;  3H6U A;  4JBZ A;  2VD2 A;  1EZ9 A;  4XKN A;  3O97 A;  1FTM A;  3S9E A;  3FV2 A;  5DTB A;  2VGQ A;  2X7Q A;  4ELR A;  4OMB A;  3JV9 A;  5TPA B;  4ZZA A;  2B65 A;  4ZE9 A;  4YMB A;  4THI A;  1IEJ A;  5TP9 B;  4HW8 A;  2RCB A;  4QFL A;  3FVO A;  4U1Z A;  1MG1 A;  1FQF A;  3DP4 A;  1XC1 A;  3H3G A;  1DMB A;  2Q9T A;  1EZP A;  2RC9 A;  1LAH E;  3IB2 A;  3FXU A;  1B5I A;  3RPW A;  4JWO A;  2QJE A;  4RPN A;  1I69 A;  3CG3 A;  3U94 A;  2QS1 A;  3SDF A;  4JB7 A;  4NF4 B;  2GFE A;  3SEX A;  1MXY A;  3TZA A;  1P1O A;  1B05 A;  2Z23 A;  3OOA A;  3QXM A;  1UTB A;  3MP8 A;  2DXY A;  4ZE8 A;  4N07 A;  3K1N A;  5B7D A;  5JTY B;  1AOV A;  4ZEF A;  3PMX A;  4YU0 A;  3OEL A;  4GXS B;  1SW4 A;  4P0G A;  2OK2 A;  4GXA A;  2ZXT A;  2R9J A;  4JWY A;  1OIB A;  3T9X B;  1MY0 A;  2M8C A;  3UN6 A;  4EQ7 A;  4IO7 A;  4O3B A;  4DDD A;  1Z7N E;  1PB8 A;  2XHD A;  3HPI A;  2G93 A;  2HXW A;  3U93 A;  3MPK A;  3E3K A;  2VOZ A;  3H6V A;  4NF6 B;  2F35 A;  1MQJ A;  3HO7 A;  4NMY A;  2DE4 A;  4U23 A;  4ECF A;  4QSC A;  3ILT B;  3MUQ A;  5L9O A;  1B3H A;  2D3I A;  2I4C A;  2RCA A;  2NXO A;  3VVE A;  3O9P A;  4XXU A;  4F3S A;  4FJP A;  4FAT A;  1VFD A;  4OFL A;  3VVF A;  2DE2 A;  4EF1 A;  2W7Y A;  3SKP A;  4QFN A;  2QS2 A;  4LQ5 A;  5TU0 A;  5CMB A;  4KI0 E;  4KCD A;  3R6U A;  4F29 A;  4OET A;  3FAT A;  5AE4 A;  3KJT A;  4H5F A;  2XX7 A;  1Q35 A;  3SEV A;  1B4Z A;  5A5X A;  4G68 C;  2H99 A;  4G68 A;  4BDN A;  1Y3N A;  1N84 A;  2AIX A;  3PPQ A;  5CMM A;  4OYV A;  4LZ7 A;  4OEU A;  3IOV A;  2QMW A;  1H43 A;  1OMP A;  4F39 A;  5H8H B;  3HV1 A;  1PDA A;  1QUI A;  1R6Z A;  1SW5 A;  5AA2 B;  2DWA A;  3QUJ A;  5CM6 A;  3K0V A;  5K2Y A;  4NF4 A;  4RNS A;  3TTL A;  3FZV A;  2KLF A;  4E0X A;  3RUM A;  3K00 A;  4PFY A;  3T66 A;  3TCH A;  2B3F A;  4F22 A;  3VDF A;  1IXG A;  3SER A;  1YTV A;  1HSL A;  3D4C A;  2ESN A;  1HSJ A;  3RLF E;  1GR2 A;  1MXV A;  1DTZ A;  2VP1 A;  3FJG A;  3THI A;  4H0W A;  1JEU A;  2XXH A;  3C31 A;  2YJP A;  2A5T B;  4I62 A;  5I59 A;  3EHT A;  3IOR A;  1A99 A;  3MW0 A;  3CSG A;  1Y1Z A;  3K2D A;  3PD9 A;  4TLM B;  1NNP A;  4DLD A;  1WVJ A;  2Y7W A;  3MWB A;  1B0L A;  1O63 A;  1B3G A;  3LC8 A;  3KN7 A;  3Q27 A;  4ZEC A;  3MZ1 A;  5I58 A;  1DPP A;  1ZTY A;  1MPB A;  3QSL A;  2V84 A;  1JNF A;  2UVG A;  1VE4 A;  1DOT A;  4BDQ A;  2XXY A;  4F2Q A;  5H8Q B;  1O64 A;  4NWD A;  5I2K B;  3Q25 A;  1VR5 A;  3UIF A;  4TOZ A;  3CIJ A;  3TYH A;  5L9S A;  3ILU B;  3O6I A;  1WOD A;  1MY1 A;  1TT1 A;  1BP5 A;  1D4N A;  4EDP A;  2I3V A;  4OES A;  2QS4 A;  2GRV A;  3TCG A;  3DEL B;  1MY3 A;  3SEU A;  4U2R A;  1S7Y A;  2ALU A;  2F5X A;  4PP0 A;  1BLF A;  5FTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...