4M4GA

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium lt2 in complex with effector ligand, n-acetylserine.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
b'EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium LT2 in complex with effector ligand, N-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
total genus 57
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA02
1ZJLA 3BKIB 3IX1A 1II5A 5TPAA 3KSJA 5KZTA 3IO4A 4F3BA 3VXCA 4H0WA 4GIZA 1VR5A 3C9HA 3UORA 3K1MA 2FYIA 3CFZA 1LCTA 2PT1A 3TMGA 4IO2A 5A5XB 3KG2A 1YAEA 4UA8A 4DXUA 1D9YA 4ZZAA 4F1YA 3U94A 3TCFA 3HHFA 3CRBA 3U72A 4G77A 4BLAA 3FVKA 4TOZA 2DXYA 1N7XA 3FJ7A 1NMUA 2F7CA 1PEBA 4ZEDA 1LFIA 3JV9A 1POY1 3Q25A 3O29A 3V89B 4QSEA 3FVNA 3IJOB 3LBSA 4H67A 3RPWA 2I0CA 1FTOA 2XXUA 5H8HB 2Y7RA 5KCJB 1MDP1 1WDNA 2A5TA 3Q28A 2QRYA 1XOCA 3R7XA 3EN3A 3KGCA 5CC2A 4G68B 2P1SA 4R6YA 5BUUA 1MXWA 3MP6A 1IXIA 3MVWA 4IB2A 4OESA 1ZBMA 3C31A 3O6HA 4XXUA 3MUQA 3PU5A 2FNCA 1Z7NE 2DS9A 3MC2A 3CSBA 1B5HA 2ZYMA 1Y1MA 2UVJA 4ESWA 2D3IA 4MLQA 3VLWA 1HSLA 1OQGA 3UGWA 3IOTA 5M2VA 2QS4A 5CRYA 5ISUA 4YKPA 4QRZA 1MG1A 4JXIA 2O68A 1I69A 5I56A 4ZEFA 1UQWA 4GRKA 5CMKA 1FQBA 2A5SA 4I1DA 3FXRA 4LZ5A 3BFUA 2F6PA 4Q8RA 4ZEBA 3E13X 1A99A 3MP8A 3FUZA 1OVBA 4E0XA 3L6GA 2XXVA 1MDQA 3S9LC 3B6QA 1LAHE 3G3HA 4KFQA 3O2AA 2NUVA 4F22A 4RYAA 4F1UA 3T93B 4IO5A 1Y4CA 2VGQA 1FQEA 2RINA 1QUJA 4ELPA 2OLBA 2V3TA 4G8HA 1B3EA 2F6GA 4YKIA 5I58A 4POXA 2DVZA 3PGFA 4JBZA 4DIGA 2QS3A 4NF5A 3RQTA 5EYFA 1MY0A 4BDQA 1XC1A 2E1SA 5FTIA 2R6GE 1N76A 2UVHA 1B52A 2Q8JA 5IAIA 3UP9A 1XS5A 1B3LA 4WXJA 1S50A 4IGRA 1VFEA 4LATA 4KCDA 3H6VA 3FXQA 4RY1A 3K01A 2GRVA 5DT6A 3OO7A 4QFPA 2F8DA 3DLNA 4H5FA 1Y3PA 3MZ9A 4R72A 1LAXA 1NL5A 1MQIA 2QS1A 3VDFA 3VXBA 4ZS9A 1ANFA 5A5XA 5DVIA 2Q9TA 3UN6A 1T0KA 4ZEKA 3IL1B 1B05A 3PPPA 2R71A 2XHDA 2DP8A 3C35A 3MVXA 5TP9B 1MXVA 2O1LA 3FATA 2ZNSA 5CMMA 4RK9A 5I2NB 5CMCA 3N5LA 4JWXA 1BIYA 3HN0A 2QPQA 3ONMA 5LOMA 4XKNA 1USYE 2UYEA 2I4CA 1PBPA 5H8HA 3W9VA 5KCJA 4RPNA 2DQVA 3K02A 1ZKBA 5JTYB 1QULA 5J1DA 2B3FA 3IOUA 4X1BA 4G68A 3VLVA 1PB7A 2O7IA 4PFTA 4G8MA 3K2DA 3M3FA 1XT8A 1B1HA 4DCXA 1CE2A 4LVQA 3H6TA 2I0BA 1WODA 2DE4A 2VP1A 4H1XA 4NTLA 3QUJA 4OHNA 4YB6A 4FAJA 4YB5A 2HFBA 1NH8A 2B65A 4R6HA 2UVGA 3V5AA 5JK4A 1MM6A 2Q88A 1AL3A 4IO3A 1EZPA 2ONKE 5HBCA 2HXWA 4OEUA 1IQ7A 1XHYA 2HAUA 3VE1B 1QJMA 2XX7A 1SW2A 1PC3A 3LUYA 2RC8A 1KWHA 3TYHA 3FXUA 2ZNUA 1P1WA 5JEIA 2O51A 3DELB 4XKQA 3JYRA 5L9MA 1MQDA 3S4UA 5CM6A 2HQ0A 4QFOA 3G3FA 3RLFE 1H43A 3C34A 1LCFA 3RTFB 3CSGA 1TFAA 1PB9A 3KOTA 2I58A 4OEVA 1DMBA 3MP1A 1EZ9A 3F11A 2OJTA 3CFLA 4QFKA 3T9HB 3RUMA 2GFEA 2I49A 2V25A 3QK6A 5K2YA 1EZOA 1LFHA 4TLMB 2RCAA 2B3BA 4F2OA 2THIA 1LLSA 2QJEA 1RYOA 2D5WA 1R6ZA 2OBGA 1FTMA 1QUKA 5L8DA 4MH5A 2F78A 3CVGA 3U1OA 2H25A 4LZ7A 3TODA 2F7AA 4N13A 4NF4B 1EH3A 3WAFA 2Z8DA 3FGSA 1ZLQA 4C1UA 2HCAA 3OOAA 4Q5TA 4KPTA 4OYVA 3TTMA 1I6BA 2O1MA 1B7UA 3H4ZA 4N6PA 4KHZE 4YZZA 3E3KA 2DSFA 2PVUA 5TP9A 2OCUA 4O3AA 1USYH 1UTBB 3ZSFA 1JVYA 2V93A 4NEDA 1UIUA 5I2NA 2DWJA 3PUYE 1B3GA 1UTHB 2HZLA 3OO9A 4U1OA 2XXXA 4OFJA 5ITPA 4WEDA 4ELQA 4NF6B 4PE5B 1QVSA 2W7YA 4IO6A 4M1VA 4QHQA 5JTYA 2P0SA 3ODBA 2ONRA 3USDA 3EPEA 1EU8A 3ECRA 1B5IA 1ZIUA 4BDRA 3R6UA 3C33A 2X26A 1WVJA 1P1OA 3O6IA 1URDA 1NFTA 4POWA 2V84A 5AA2D 2H98A 2PYYA 2QSXA 4HCYA 4ISUA 3ZS6A 5H8SA 3OXNA 4R73A 3PMWA 5EHSA 4Q30B 2YLNA 2RKMA 3CG1A 4U4XA 1OQHA 3HHGA 1YPNA 4BDOA 2DVCA 1B40A 2YJPA 3K0VA 3MJNA 3OEKA 3WAEA 3TZAA 3H03A 4KR5A 1DOTA 2I48A 3OELA 2AIXA 3K6WA 3S2VA 3UIFA 3HO7A 4BDMA 1L5TA 1MS7A 3PV0E 4U4SA 1MPDA 2Q89A 2PMSA 1A55A 2XD3A 5DVJA 3CI8A 2XX8A 1RYXA 4P0IA 2F7BA 2I4BA 3FV1A 5DTBA 1Z7ME 3M8UA 5CI5A 3SEYA 3CR9A 2O6AA 3OD7A 2ONSA 5K2XA 2Y7PA 3JZJA 2Z8EA 4R9FA 4ESXA 3FZVA 2CMOA 3H3GA 3W15C 4YB7A 3KSXA 4IY6A 3S9NC 4PFUA 1GR2A 4OXVA 2PT2A 4OERA 2ALUA 4GLIA 1H76A 1MY4A 3A3CA 3G7WA 2RC9A 4EXKA 3P7IA 1M5BA 3FJGA 2V3QA 3MW0A 2G29A 3C4MA 3VFJA 4JSDA 1Y20A 1IZ1A 3MPKA 3MQ9A 4NF4A 3G3JA 3QUFA 2AL4A 1OLCA 3ILUB 2XXTA 3KOSA 4Q0CA 1DTGA 3EHTA 4F3PA 4OTEA 2XD2A 1A8FA 2RF1A 1JNFA 1HSEA 4LUBA 3MZBA 2I6EA 1HSJA 1UTBA 1B2HA 4LZ8A 1P1QA 4C0RA 3QAXA 5AA4B 1Q1KA 1B4HA 3SETA 1UTHA 2UVIA 3G3GA 3GZGA 4DXBA 4H8IA 4PETA 3PUWE 2F35A 4NF6A 5H8QA 1AOVA 5DEXB 1D9VA 4G2ZA 1URSA 1OVTA 3VVDA 4R75A 1Y3QA 4U1ZA 3FIRA 5ELVA 3PUVE 3PPNA 4EUOA 3I5OA 5H8FB 5B70A 3M3LA 2AL5A 4XKRA 4F19A 4OFLA 3MWBA 2PX1A 4GL8A 1JEUA 1NH7A 3O97A 5F1QA 5AA1A 1YTVA 2H99A 1TT1A 3RN8A 2F5XA 3K6VA 4QFNA 3IOWA 3LSLA 3U8QA 5B7DA 3EQ1A 4NMYA 1LBBA 4PQJA 4FEDA 4YMAA 1P99A 1F9BA 3TPAA 4XTCQ 5KDTB 3HSTA 1VFDA 1ZMGA 2G93A 5I57B 2GHBA 1IIWA 3HPIA 3IR1A 4QF9A 4O3CA 5ICTA 2OK2A 4AQ4A 3A3UA 4GWOA 3PD8A 3DP6A 3B7DA 5I2KB 4YAHX 3KZGA 1MXXA 3QXMA 4ZDMA 3KJ7A 4NWDA 3OSRA 5ICQA 2WKYA 5FHOA 1SW1A 1SYHA 3OO6A 3OENA 1PBQA 4C1TA 3VV5A 1DTZA 1B58A 1OLAA 4DZ1A 1MH3A 3O28A 2QMXA 4K3FA 3Q26A 1BLFA 3T9VA 2PBWA 3IJXB 4JWOA 1A54A 1BTJA 2QMWA 1LB9A 1B3HA 3Q27A 2D21A 3O9PA 4EF2A 5HPQA 1Y9UA 1YCJA 3CG3A 2H9BA 3B6WA 5AE4A 4LQ5A 3GBBA 4X9TA 3FASA 2HAVA 1JW1A 4HCWA 1NNPA 2LAOA 1N3XA 1ZU0A 2F36A 2H5YA 4BDNA 2DWIA 3TELA 1LGBC 2V3UA 3SEVA 3PPRA 4DLDA 2XXQA 3LSFB 2X7QA 4X1DA 3UA8A 3RGYA 4JSOA 3TUSA 2QS2A 5AA4A 2RC7A 2IEEA 2ZYNA 3B6TA 4ZEIA 1B1XA 3KN8A 1M5EA 3N26A 1XVXA 4RA1A 1RKMA 1GGGA 2DOJA 4JDFA 1MQJA 4EQ7A 3OEMA 4GXSB 3GBAA 4ND9A 4RPOA 4QSCA 4RJZA 1BP5A 1GVCA 3LC8A 4FORA 5F7VA 1M5CA 3FV2A 1Y3NA 2O69A 2NOOA 1LBCA 4PFYA 1QW0A 5H8FA 3MVZA 1JETA 1Y4TA 2Q2AA 1Q35A 4ZECA 1OMPA 1IXCA 1DPPA 4O3BA 3OSQA 4NE4A 3DP8A 3SEUA 3A09A 1B7HA 2HZKA 2XXYA 4DXCA 5L9OA 4DCYA 2DWHA 1UIVA 1H45A 3D4GA 3TDJA 1MH4A 4X48A 3PD9A 4R2FA 2OZZA 1B0LA 1B46A 5KDTA 4EXLA 1FQDA 4OZ9A 4F29A 3FJMA 4FIMA 4LQ2A 3V8XB 3SKPA 5I57A 3K1NA 3TEPA 2Y7KA 1SI1A 1SD3A 1B0HA 5I2KA 3OO8A 3LR1A 3PUZE 1SDXA 5FTHA 3K6UA 2DE2A 1A8EA 2XX9A 1A7LA 1IEJA 4XIGQ 2X7PA 3KBRA 3LSWA 5I58B 4FECA 1NNFA 3LSXA 3TFLA 1Y1ZA 4H6DA 1DPEA 1N7WA 4LP2B 3T9UA 4KQPA 2R9JA 3IB1A 1B32A 1H3DA 4ONYA 5CBRA 5FHMA 4YMBA 3M3KA 3EHUA 2KLFA 1I6AA 3VVEA 1MPCA 2GH9A 3TAJA 3VLUA 4R2BA 1JVXA 2Y7WA 2OWSA 4G8NA 3K1PA 3R26A 4GOTA 4R9GA 1US4A 3FD3A 1MM7A 1O7TA 4JWYA 4GQOA 1JW4A 4L17A 4OVJA 3C36A 3HCQA 4TLLB 3TQLA 3RTWB 2NWJA 4P0GA 3TCGA 1QKBA 4F39A 3MZ1A 4ZE8A 3TTNA 4R6KA 1MXYA 3H7MA 5TU0A 3RNNA 4OENA 3PPQA 4GF8A 4NF8B 4E0WA 2REJA 3T66A 4Z7EA 3U93A 3CFXA 3PMXA 1NKXA 1TFDA 2ZNTA 2Y7IA 4LONB 4U2RA 4F18A 2HEUA 4H5GA 4KYEA 1P1NA 3O6GA 4MBPA 4EDPA 4I62A 1MXUA 5I59B 2ZYOA 4LA9A 3S9EA 2Z8FA 3KFMA 4KD5A 3S9MC 1J1NA 1M5DA 1B7ZA 4U22A 3T96B 5L9SA 1VSOA 3TTKA 1IXGA 4EF1A 4KCCA 2F97A 4WKMA 5AA3A 4U21A 1QKAA 3G3KA 4M4GA 4KYDA 1LSTA 2VD3A 2XXHA 2UYFA 2Q2CA 1XVYA 2IA4A 4EQBA 3SERA 4NWCA 4XKPA 4YKJA 3OMBA 3IORA 2NVUB 4KYSA 2DE3A 3TCHA 1FQCA 4OQOA 4RXLA 4U23A 3SEXA 3SEWA 3IO6A 3KJTA 5BWJA 4HS7A 1POTA 5DVFA 1PDAA 1FCKA 1N04A 1PB8A 1AH5A 3BFTA 4YICA 1B4ZA 5H8NB 1B3FA 4F3GA 2ESNA 1LAGE 5AA2B 4MF3A 2ZYKA 3PMVA 1MQGA 4IGTA 3D4CA 1N0TA 4QSDA 1LFGA 1N3WA 2XXIA 4P11A 3IAZA 2H4IA 5CBSA 1MY3A 4G4PA 1FQFA 4ELOA 1NNTA 4ECFA 3TKDA 2F34A 4KI0E 3E9XA 1MXZA 2OWTA 1B5JA 3QSLA 1FW0A 2UXAA 1VE4A 3T9XB 3FVOA 1SQYA 4MLVA 2Z23A 4HTGA 1SW5A 3TQWA 1FTJA 4WEPA 3MBPA 4GL0A 3C32A 3KEIA 3I6VA 3MAMA 2ANJA 3H6UA 1R1NA 4UACA 1IITA 2REGA 4HW8A 3K4UA 3Q29A 2NXOA 4F1VA 1MY2A 1O64A 2I3WA 3DM0A 1IUDA 1ELJA 2DYXA 3EHSA 3V83A 4RNSA 4NF8A 3G3IA 2ABHA 3K00A 2Z22A 3W9WA 2VOZA 4QFLA 2QL3A 1AMFA 4ZZEA 1TWYA 1ATGA 2ZXTA 4EQ9A 4F2QA 3SESA 3EF7A 1R9LA 3VVFA 5TPAB 3ZKLA 5I59A 2CZLA 4I8CA 3RT6B 3MVYA 2XXPA 1SI0A 1N84A 1JQFA 5I84A 4THIA 4OMBA 3MPLA 3PUXE 3PPOA 2DWAA 1CB6A 3O66A 4AB6A 4YKKA 1FQAA 1SVXB 4GD5A 1M5FA 1S7YA 4IY5A 2M8CA 4G68C 3THIA 2E0SA 2VD2A 2VHAA 4DE8A 2XXRA 4ZE9A 4GXAA 3I3VA 2Y84A 3KN3A 3RY3A 3UK4A 4H8JA 3ILTB 1GTKA 2O84X 3DP4A 3N94A 2GHAA 3E4RA 2DXRA 4BDLA 2FA7A 2P2AA 1DSNA 4H65A 3BBRA 5CMBA 4GVOA 2A5TB 3CIJA 3T22A 3RT8A 1B9JA 4ELRA 2AYSA 3IB0A 4R74A 3IK6B 4OWDA 1ZTYA 3TTRA 3TTLA 1FTLA 1H44A 1D4NA 5DEXA 4F31B 5H8NA 3IOVA 5AA2A 3N6TA 3ZKKA 4Z0IA 1B6HA 2RCBA 1MQHA 1JEVA 1LB8A 1SBPA 2ZMBA 1D3KA 3U92A 4YU0A 3QYTA 4FEBA 4RK2A 1FTKA 5DYHA 1AIVA 3GXAA 4IO7A 4GFRA 1IXHA 3K6XA 5I56B 1MY1A 4FATA 1A40A 1O63A 3QIMA 4F3SA 3N6UA 3FVGA 3KN7A 2O7UA 4N07A 1BKAA 1URGA 4JB7A 3H06B 5EHMA 3H6WA 1NNKA 1I6QA 1SW4A 4TQUQ 1LAFE 1JW5A 5ITOA 2BJJX 1R9QA 1B51A 3IB2A 4FE8A 1GV8A 1TXFA 1US5A 3AXFA 2YPNA 2I3VA 4FJPA 4OFOA 3L6HA 5IKBA 4I9DA 1SYIA 1MRPA 1P1UA 4AB5A 3GLBA 2XXWA 4OETA 4PP0A 1OIBA 4DDDA 5FHNA 4MFIA 4IO4A 5H8QB 4NF5B 1QUIA 4PFWA 3SDFA 3HV1A 5HM4B 1MPBA 1S9TA
chains in the Genus database with same CATH superfamily
1ZJLA 3BKIB 3IX1A 4PE3A 4GWXA 1II5A 5TPAA 3KSJA 5KZTA 4N4UA 4MX6A 3IO4A 4F3BA 3VXCA 4H0WA 4GIZA 1VR5A 3C9HA 3UORA 3K1MA 2FYIA 3CFZA 1LCTA 2PT1A 3TMGA 4IO2A 4MNIA 5A5XB 3KG2A 1YAEA 4UA8A 4DXUA 1D9YA 4ZZAA 2XA5A 4F1YA 3U94A 3TCFA 3HHFA 3CRBA 2WYKA 1IMEA 3U72A 4G77A 4BLAA 3FVKA 4TOZA 2DXYA 1N7XA 3FJ7A 1NMUA 2F7CA 1PEBA 4ZEDA 1LFIA 2WYPA 3JV9A 1POY1 3Q25A 4O7MA 5DW8A 3O29A 3V89B 1LBZA 4QSEA 3FVNA 3IJOB 3LBSA 4H67A 3RPWA 4N8YA 2I0CA 1FTOA 2XXUA 5H8HB 2Y7RA 5KCJB 1MDP1 2VPOA 1WDNA 2A5TA 3Q28A 2QRYA 1NUYA 1XOCA 3R7XA 3EN3A 3KGCA 5CC2A 5EYGA 4G68B 4N15A 2P1SA 4R6YA 5BUUA 1MXWA 2QVUA 3B8BA 2FBPA 1FBDA 3MP6A 1IXIA 4PTKA 1INPA 3GYYA 3MVWA 4IB2A 4PAFA 4OESA 1ZBMA 3C31A 3O6HA 2PFZA 4XXUA 3MUQA 3PU5A 1LBXA 2FNCA 1Z7NE 2DS9A 3MC2A 2Q8MA 3CSBA 1B5HA 4NGUA 2ZYMA 1Y1MA 2UVJA 4ESWA 2XWOA 2D3IA 4MLQA 3VLWA 1HSLA 1OQGA 1EYJA 3UGWA 2ZZWA 3IOTA 5M2VA 2QS4A 5CRYA 5ISUA 2BJIA 4YKPA 4QRZA 1MG1A 4JXIA 2O68A 1I69A 5I56A 5I3SA 4ZEFA 1UQWA 4GRKA 5CMKA 1FQBA 2A5SA 4I1DA 3FXRA 1G0HA 4LZ5A 3BFUA 2F6PA 5EQAA 4Q8RA 4ZEBA 3E13X 1A99A 3MP8A 3FUZA 2QVVA 1OVBA 4E0XA 3L6GA 2XXVA 1MDQA 3S9LC 3B6QA 1LAHE 2GQ1A 3G3HA 4KFQA 3O2AA 2NUVA 4OVSA 4F22A 4RYAA 2Y5KA 4F1UA 3T93B 1NV6A 4GX6A 4IO5A 1Y4CA 2VGQA 1FQEA 4MEVA 2RINA 1QUJA 2V4CA 3ROJA 4ELPA 4QBAA 2OLBA 2V3TA 4G8HA 3SZPA 1B3EA 1FJ9A 2F6GA 4YKIA 4G61A 5I58A 4POXA 2DVZA 3PGFA 4JBZA 4DIGA 2QS3A 4NF5A 3RQTA 5EYFA 1MY0A 4BDQA 1XC1A 3PTYA 2E1SA 5FTIA 2R6GE 1N76A 2UVHA 1B52A 2Q8JA 4GWZA 5IAIA 3UP9A 1XS5A 1B3LA 1FBEA 2WBDA 4WXJA 1S50A 4IGRA 1VFEA 4LATA 4KCDA 3H6VA 3FXQA 4RY1A 3K01A 2GRVA 5DT6A 3OO7A 4P47A 4QFPA 1LEVA 2F8DA 3DLNA 4H5FA 1Y3PA 3MZ9A 4R72A 1LAXA 1NL5A 1MQIA 2QS1A 3VDFA 3VXBA 4ZS9A 1ANFA 5A5XA 5DVIA 2Q9TA 3UN6A 1T0KA 4ZEKA 3IL1B 1B05A 2WBBA 3PPPA 1FPKA 2R71A 2L5VA 4P8BA 2XHDA 2DP8A 3C35A 3MVXA 5TP9B 1MXVA 2O1LA 3E79A 3FATA 1VDWA 2ZNSA 5CMMA 4RK9A 5I2NB 5CMCA 3N5LA 2KQZA 4JWXA 1BIYA 3B50A 2QPQA 3HN0A 3ONMA 5LOMA 4XKNA 1USYE 2UYEA 2I4CA 1PBPA 5H8HA 3W9VA 5KCJA 4RPNA 2DQVA 2FIXA 3K02A 1ZKBA 5JTYB 1QULA 5J1DA 2B3FA 3IOUA 4X1BA 4G68A 3VLVA 4PFTA 1PB7A 2O7IA 4G8MA 3K2DA 3M3FA 1XT8A 1B1HA 4DCXA 1CE2A 4LVQA 3H6TA 2I0BA 1WODA 2DE4A 2VP1A 4H1XA 4NTLA 3QUJA 4OHNA 4YB6A 4FAJA 5EYHA 4JVCA 4YB5A 2HFBA 2F3BA 1NH8A 2B65A 4R6HA 2UVGA 3V5AA 5JK4A 4H45A 1MM6A 2Q88A 1AL3A 4IO3A 1EZPA 2ONKE 5HBCA 2HXWA 4OEUA 1YYZA 1IQ7A 1XHYA 2HAUA 1NI9A 4O8MA 3VE1B 4N81A 1QJMA 2XX7A 1SW2A 1PC3A 3LUYA 2RC8A 1KWHA 4XF5A 3TYHA 3FXUA 2ZNUA 1P1WA 5JEIA 2O51A 3DELB 5EQ8A 4XKQA 3JYRA 5L9MA 1MQDA 3S4UA 5CM6A 4GWWA 2HQ0A 4GWSA 4QFOA 4PC9A 1NV1A 3G3FA 3LUZA 3RLFE 1H43A 3C34A 1LCFA 3RTFB 3CSGA 1TFAA 1PB9A 3KOTA 2I58A 4OEVA 1DMBA 3MP1A 1EZ9A 3F11A 3BIGA 4PFBA 2OJTA 3CFLA 4QFKA 3T9HB 3RUMA 2GFEA 2I49A 2V25A 4GWUA 3QK6A 5K2YA 1EZOA 1LFHA 4TLMB 2RCAA 2B3BA 4OVRA 4F2OA 2THIA 4PAKA 1LLSA 2QJEA 4NHBA 1RYOA 2D5WA 1R6ZA 2OBGA 3KC1A 1FTMA 1QUKA 5L8DA 4MH5A 2F78A 3CVGA 3U1OA 2H25A 4LZ7A 3TODA 2F7AA 4N13A 3IFAA 4NF4B 1EH3A 3WAFA 2Z8DA 3FGSA 1ZLQA 4C1UA 2HCAA 3OOAA 4Q5TA 2CEYA 4KPTA 4OYVA 3TTMA 1I6BA 2O1MA 1B7UA 3H4ZA 4N6PA 5IZ3B 4KHZE 4YZZA 1QGXA 4NQ8A 3E3KA 2DSFA 2PVUA 4MIJA 5TP9A 2OCUA 4O3AA 1USYH 1UTBB 3ZSFA 1EYIA 4HE2A 1JVYA 2V93A 4NEDA 1UIUA 5I2NA 2DWJA 3PUYE 1B3GA 4DI3D 1UTHB 2HZLA 3OO9A 4U1OA 2XXXA 4OFJA 5ITPA 4WEDA 3D1RA 4ELQA 4NF6B 4PE5B 1QVSA 2W7YA 4IO6A 4M1VA 4QHQA 5JTYA 2P0SA 3ODBA 1NV2A 2ONRA 3USDA 4MNCA 3EPEA 1EU8A 3ECRA 1FBPA 1B5IA 1ZIUA 1FPLA 4BDRA 5I7IA 3R6UA 3C33A 2X26A 1WVJA 1P1OA 3O6IA 1URDA 1NFTA 4POWA 2V84A 5AA2D 2H98A 2PYYA 2QSXA 1K9ZA 2P3VA 4HCYA 4ISUA 3ZS6A 4I3YA 5H8SA 3OXNA 4R73A 3PMWA 5EHSA 4Q30B 2YLNA 2RKMA 3CG1A 4U4XA 1OQHA 3HHGA 1YPNA 4BDOA 5LDZA 2DVCA 1B40A 2YJPA 3K0VA 5F24A 3MJNA 3OEKA 3WAEA 3TZAA 3H03A 4KR5A 1DOTA 2I48A 3OELA 2AIXA 3K6WA 3S2VA 3UIFA 3HO7A 4JVIA 4BDMA 1L5TA 1MS7A 3PV0E 4U4SA 4GX4A 5IGAA 4O7IA 1MPDA 2Q89A 2PMSA 3LV0A 1A55A 4GBWA 2XD3A 5DVJA 3CI8A 2XX8A 1RYXA 2CZHA 4P0IA 2F7BA 2I4BA 3FV1A 5DTBA 1Z7ME 2CZKA 1LBYA 3M8UA 1XI6A 5CI5A 3SEYA 3CR9A 2O6AA 4X8RA 3OD7A 2ONSA 5K2XA 2Y7PA 3JZJA 2Z8EA 4R9FA 4ESXA 1FBGA 3FZVA 3RPLB 2CMOA 3H3GA 3W15C 4YB7A 3KSXA 4IY6A 3S9NC 4PFUA 1GR2A 4OXVA 2PT2A 4GWYA 4OERA 2ALUA 4NX1A 4GLIA 1H76A 1MY4A 3A3CA 3G7WA 2RC9A 4EXKA 3P7IA 5ET5A 1M5BA 3FJGA 2V3QA 3MW0A 2G29A 3C4MA 3VFJA 4PF6A 4JSDA 1Y20A 1IZ1A 3MPKA 3MQ9A 4P9KA 4NF4A 3G3JA 3QUFA 5EQ7A 2AL4A 1OLCA 3ILUB 2OX3A 2XXTA 3KOSA 4Q0CA 4PBHA 4NF0A 1DTGA 3EHTA 4F3PA 4OTEA 2XD2A 1A8FA 2RF1A 1JNFA 5IZ3A 1LBWA 1HSEA 4LUBA 3MZBA 2I6EA 1FPJA 1HSJA 1UTBA 1B2HA 4LZ8A 4OVPA 1P1QA 2P3NA 4C0RA 3QAXA 5AA4B 4PFRA 1Q1KA 1B4HA 3SETA 1UTHA 2UVIA 3G3GA 2VPNA 3GZGA 4DXBA 4H8IA 4PETA 1BK4A 3PUWE 5ET7A 2F35A 1G0IA 4NF6A 5H8QA 1AOVA 5DEXB 1D9VA 4G2ZA 1URSA 1OVTA 3VVDA 4R75A 1Y3QA 4U1ZA 1SPIA 3FIRA 5ELVA 3PUVE 4N6DA 3PPNA 3CHGA 3I5OA 5H8FB 4EUOA 5B70A 3M3LA 2AL5A 4XKRA 4F19A 4OFLA 3MWBA 2PX1A 4GL8A 2ZZXA 1JEUA 1NH7A 3O97A 5F1QA 5AA1A 1YTVA 1KA1A 2H99A 3MSTA 1TT1A 2VT5A 3RN8A 2F5XA 3K6VA 4QFNA 3IOWA 3LSLA 3U8QA 5B7DA 3EQ1A 4NMYA 1LBBA 4PQJA 2Y5LA 5J16A 4FEDA 2MKZA 4YMAA 1P99A 1F9BA 3TPAA 4XTCQ 5KDTB 1FJ6A 5ESYA 3HSTA 1VFDA 1ZMGA 2G93A 5I57B 2GHBA 4XEQA 1IIWA 3HPIA 3IR1A 4QF9A 4O3CA 5ICTA 2OK2A 4AQ4A 4OANA 3A3UA 4GWOA 4PBQA 3PD8A 3DP6A 3B7DA 5I2KB 4YAHX 4PFIA 3KZGA 1MXXA 3QXMA 4ZDMA 3RYDA 4IR8A 3KJ7A 4NWDA 3OSRA 4I3EA 5ICQA 2WKYA 5FHOA 1K9YA 1SW1A 1SYHA 3OO6A 1DK4A 3OENA 1PBQA 4C1TA 2ZZVA 1DTZA 3VV5A 1B58A 3RPLA 5FBPA 1OLAA 4DZ1A 1MH3A 4P1LA 3O28A 2QMXA 4K3FA 3Q26A 1BLFA 2WX9A 3T9VA 2PBWA 3IJXB 5LTCA 4JWOA 1A54A 1BTJA 2QMWA 1LB9A 1B3HA 3Q27A 4PAIA 2D21A 2PCRA 3O9PA 4EF2A 5HPQA 1Y9UA 1YCJA 3CG3A 2H9BA 3B6WA 5AE4A 4LQ5A 3GBBA 4X9TA 3FASA 2HAVA 1JW1A 4HCWA 1NNPA 2LAOA 1N3XA 1ZU0A 2F36A 2H5YA 4BDNA 2DWIA 3TELA 4X04A 1LGBC 2V3UA 2OWZA 3SEVA 3PPRA 4DLDA 2XXQA 2CZIA 4AS5A 3LSFB 1FBCA 2X7QA 4X1DA 5EQ9A 1FPFA 4NG7A 3UA8A 3RGYA 4JSOA 3TUSA 2QS2A 5AA4A 2RC7A 2IEEA 2ZYNA 3B6TA 4ZEIA 1B1XA 3KN8A 4OVTA 2HXRA 1M5EA 1NV5A 3N26A 1XVXA 4RA1A 1RKMA 1GGGA 2DOJA 4JDFA 2WEFA 1MQJA 4EQ7A 3OEMA 4GXSB 3GBAA 4ND9A 4RPOA 4QSCA 4GBVA 4RJZA 1BP5A 1GVCA 1Q9DA 3LC8A 3MYUA 4FORA 5F7VA 1M5CA 3FV2A 1Y3NA 2O69A 2NOOA 1LBCA 4PFYA 1QW0A 5H8FA 3MVZA 1JETA 1Y4TA 2Q2AA 1Q35A 4ZECA 1OMPA 1IXCA 1DPPA 4O3BA 2XWKA 3T0JA 1RDXA 3OSQA 4NE4A 3DP8A 3SEUA 3A09A 1B7HA 2HZKA 2XXYA 4DXCA 5L9OA 2HHMA 4DCYA 2DWHA 3HFUA 1UIVA 2DDKA 1H45A 2KR0A 3D4GA 3TDJA 1MH4A 4X48A 3PD9A 4R2FA 2OZZA 2XXKA 4MJOA 1B0LA 1B46A 5KDTA 1FQDA 4EXLA 4OZ9A 4F29A 3FJMA 4FIMA 4LQ2A 3V8XB 3SKPA 5I57A 4N17A 3K1NA 2FVZA 3TEPA 2Y7KA 5I5PA 2R8TA 4P56A 4MHFA 1SI1A 5A5LA 1SD3A 1B0HA 5I2KA 3OO8A 3LR1A 3PUZE 1SDXA 5FTHA 3K6UA 2DE2A 1A8EA 2XX9A 1A7LA 1IEJA 4XIGQ 2X7PA 3KBRA 3LSWA 5I58B 4FECA 4PF8A 1NNFA 3LSXA 3TFLA 1Y1ZA 4H6DA 1DPEA 1N7WA 4LP2B 3T9UA 4KQPA 2R9JA 3KC0A 3IB1A 1B32A 1H3DA 4ONYA 4N6KA 1YXIA 5CBRA 3EKIA 5FHMA 4YMBA 3M3KA 3EHUA 2KLFA 1I6AA 2QFLA 3VVEA 1MPCA 2GH9A 3TAJA 3VLUA 4R2BA 1JVXA 2Y7WA 2OWSA 4G8NA 3K1PA 3R26A 4GOTA 1EYKA 4R9GA 1US4A 3FD3A 1MM7A 1O7TA 4JWYA 4GQOA 1JW4A 4L17A 4OVJA 3C36A 3HCQA 4TLLB 3TQLA 5IZ1A 2B4LA 3RTWB 2NWJA 4P0GA 3TCGA 1QKBA 4F39A 3MZ1A 1NV4A 4ZE8A 3TTNA 4R6KA 1YZ0A 1MXYA 4N8GA 3H7MA 5TU0A 4OA4A 3RNNA 1NUWA 4OENA 3PPQA 4GF8A 4NF8B 4E0WA 2REJA 4HE1A 3T66A 4Z7EA 3U93A 3CFXA 3PMXA 1NKXA 1TFDA 2ZNTA 2Y7IA 4LONB 4U2RA 1IMCA 4F18A 2HEUA 4H5GA 4KYEA 1P1NA 3O6GA 3IFCA 4MBPA 4EDPA 4I62A 1MXUA 1KA0A 5I59B 2ZYOA 4LA9A 3S9EA 2Z8FA 3KFMA 1LBVA 4KD5A 3S9MC 1J1NA 1M5DA 1B7ZA 4U22A 3T96B 5L9SA 1VSOA 3TTKA 1DBZA 5T3JA 1IXGA 4EF1A 4KCCA 2F97A 4WKMA 5AA3A 4U21A 1QKAA 4JVDA 3G3KA 4M4GA 4KYDA 1LSTA 2VD3A 2XXHA 2UYFA 4MCOA 2Q2CA 1XVYA 2IA4A 4EQBA 1CNQA 3SERA 3FXBA 4NWCA 4XKPA 3T1BA 4YKJA 3OMBA 1NUZA 3IORA 2NVUB 4KYSA 2DE3A 3TCHA 1FQCA 4OQOA 4RXLA 4U23A 3SEXA 4AS4A 3SEWA 3IO6A 3KJTA 5BWJA 4HS7A 1POTA 5DVFA 1FBHA 1NV0A 4N91A 1PDAA 3KBZA 1FCKA 1FPIA 1N04A 1KZ8A 1PB8A 1AH5A 3BFTA 4YICA 1B4ZA 5H8NB 1IMFA 1B3FA 4F3GA 2ESNA 1LAGE 5AA2B 4MF3A 2ZYKA 3PMVA 1MQGA 4IGTA 2B4MA 3D4CA 1N0TA 4QSDA 1LFGA 1N3WA 2XXIA 4UABA 4P11A 4O94A 1FRPA 2H4IA 3IAZA 5CBSA 1MY3A 4G4PA 4DI4B 1FQFA 4ELOA 1NNTA 4ECFA 4H46A 3TKDA 2F34A 4KI0E 3E9XA 1MXZA 4MAGA 4PDHA 2XWVA 2OWTA 1B5JA 2HPGA 3NOHA 3QSLA 1FW0A 2UXAA 4QXDA 1VE4A 3T9XB 3FVOA 1SQYA 4MLVA 2Z23A 4HTGA 1SW5A 3TQWA 1FTJA 4WEPA 3MBPA 4GL0A 3C32A 3KEIA 5ET8A 3I6VA 4HE0A 4PCDA 3MAMA 2ANJA 3H6UA 1R1NA 1NUXA 4UACA 1IITA 2REGA 1IMAA 4HW8A 3K4UA 2JJKA 3Q29A 2QVRA 2NXOA 4F1VA 1O64A 1D9QA 1MY2A 2I3WA 3DM0A 1FPDA 4I40A 1IUDA 1ELJA 2CEXA 2DYXA 3EHSA 3V83A 4NAPA 1AWBA 4RNSA 4NF8A 3G3IA 2ABHA 3K00A 2Z22A 3W9WA 2VOZA 4QFLA 2QL3A 1AMFA 4ZZEA 3ISPA 4XFEA 1TWYA 1FBFA 1ATGA 4FBPA 2ZXTA 2FHYA 4EQ9A 4P3LA 1FPBA 4F2QA 4PDDA 3SESA 3EF7A 2FIEA 1R9LA 3VVFA 1FTAA 5TPAB 3ZKLA 5I59A 2CZLA 4I8CA 3RT6B 3MVYA 2XXPA 4MNPA 1IMBA 1SI0A 1N84A 1JQFA 5I84A 4THIA 4OMBA 3MPLA 3PUXE 3PPOA 2DWAA 1CB6A 1NV7A 3O66A 4AB6A 4YKKA 1FQAA 1SVXB 4GD5A 1M5FA 1S7YA 4IY5A 2M8CA 4G68C 4PGPA 3THIA 2E0SA 2VD2A 2VHAA 5IM2A 4DE8A 2XXRA 2PFYA 4ZE9A 4GXAA 3I3VA 2Y84A 1RDYA 3KN3A 3RY3A 3UK4A 4HXVA 4H8JA 3ILTB 5ET6A 1GTKA 1FSAA 2O84X 3DP4A 3N94A 4GX3A 2GHAA 3E4RA 2DXRA 4BDLA 1JP4A 2FA7A 2P2AA 1DSNA 4H65A 3BBRA 5CMBA 4GVOA 2A5TB 3CIJA 3T22A 3RT8A 2F3DA 1B9JA 4ELRA 2AYSA 3IB0A 4R74A 3IK6B 2Q74A 1RDZA 4OWDA 1IMDA 1ZTYA 3TTRA 3TTLA 1FTLA 1H44A 4MMPA 1D4NA 5DEXA 4F31B 5H8NA 3IOVA 5AA2A 3N6TA 3ZKKA 4Z0IA 1B6HA 2RCBA 1MQHA 1JEVA 1LB8A 1SBPA 2ZMBA 1D3KA 3U92A 4YU0A 4PGNA 4LN5A 3BIHA 3QYTA 4NN3A 4FEBA 4RK2A 1FTKA 5DYHA 1AIVA 3GXAA 4IO7A 4GFRA 1IXHA 3K6XA 5I56B 1MY1A 5IZZA 1A40A 1O63A 3QIMA 4FATA 4F3SA 3N6UA 3FVGA 3KN7A 4KXPA 2O7UA 4N07A 1BKAA 1URGA 4JB7A 1FPEA 3H06B 5EHMA 3H6WA 1NNKA 1I6QA 1SW4A 4TQUQ 1LAFE 1JW5A 5ITOA 2BJJX 3FBPA 3A29A 4P1EA 1R9QA 1B51A 3IB2A 4FE8A 1DCUA 1GV8A 1TXFA 1US5A 3AXFA 2YPNA 2I3VA 4FJPA 4OFOA 3L6HA 5IKBA 4I9DA 1SYIA 1MRPA 1P1UA 3QMFA 4AB5A 3GLBA 2XXWA 4OETA 4PP0A 1OIBA 4DDDA 5FHNA 2XWIA 4MFIA 4IO4A 3E78A 5H8QB 4NF5B 1FPGA 1QUIA 4PFWA 3SDFA 3HV1A 1NV3A 5HM4B 1MPBA 4OVQA 1S9TA 3U65A
chains in the Genus database with same CATH topology
1ZJLA 3BKIB 3IX1A 1II5A 5TPAA 3KSJA 5KZTA 3IO4A 4F3BA 3VXCA 4H0WA 4GIZA 1VR5A 3C9HA 3UORA 3K1MA 2FYIA 3CFZA 1LCTA 2PT1A 3TMGA 4IO2A 5A5XB 3KG2A 1YAEA 4UA8A 4DXUA 1D9YA 4ZZAA 4F1YA 3U94A 3TCFA 3HHFA 3CRBA 3U72A 4G77A 4BLAA 3FVKA 4TOZA 2DXYA 1N7XA 3FJ7A 1NMUA 2F7CA 1PEBA 4ZEDA 1LFIA 3JV9A 1POY1 3Q25A 3O29A 3V89B 4QSEA 3FVNA 3IJOB 3LBSA 4H67A 3RPWA 2I0CA 1FTOA 2XXUA 5H8HB 2Y7RA 5KCJB 1MDP1 1WDNA 2A5TA 3Q28A 2QRYA 1XOCA 3R7XA 3EN3A 3KGCA 5CC2A 4G68B 2P1SA 4R6YA 5BUUA 1MXWA 3MP6A 1IXIA 3MVWA 4IB2A 4OESA 1ZBMA 3C31A 3O6HA 4XXUA 3MUQA 3PU5A 2FNCA 1Z7NE 2DS9A 3MC2A 3CSBA 1B5HA 2ZYMA 1Y1MA 2UVJA 4ESWA 2D3IA 4MLQA 3VLWA 1HSLA 1OQGA 3UGWA 3IOTA 5M2VA 2QS4A 5CRYA 5ISUA 4YKPA 4QRZA 1MG1A 4JXIA 2O68A 1I69A 5I56A 4ZEFA 1UQWA 4GRKA 5CMKA 1FQBA 2A5SA 4I1DA 3FXRA 4LZ5A 3BFUA 2F6PA 4Q8RA 4ZEBA 3E13X 1A99A 3MP8A 3FUZA 1OVBA 4E0XA 3L6GA 2XXVA 1MDQA 3S9LC 3B6QA 1LAHE 3G3HA 4KFQA 3O2AA 2NUVA 4F22A 4RYAA 4F1UA 3T93B 4IO5A 1Y4CA 2VGQA 1FQEA 2RINA 1QUJA 4ELPA 2OLBA 2V3TA 4G8HA 1B3EA 2F6GA 4YKIA 5I58A 4POXA 2DVZA 3PGFA 4JBZA 4DIGA 2QS3A 4NF5A 3RQTA 5EYFA 1MY0A 4BDQA 1XC1A 2E1SA 5FTIA 2R6GE 1N76A 2UVHA 1B52A 2Q8JA 5IAIA 3UP9A 1XS5A 1B3LA 4WXJA 1S50A 4IGRA 1VFEA 4LATA 4KCDA 3H6VA 3FXQA 4RY1A 3K01A 2GRVA 5DT6A 3OO7A 4QFPA 2F8DA 3DLNA 4H5FA 1Y3PA 3MZ9A 4R72A 1LAXA 1NL5A 1MQIA 2QS1A 3VDFA 3VXBA 4ZS9A 1ANFA 5A5XA 5DVIA 2Q9TA 3UN6A 1T0KA 4ZEKA 3IL1B 1B05A 3PPPA 2R71A 2XHDA 2DP8A 3C35A 3MVXA 5TP9B 1MXVA 2O1LA 3FATA 2ZNSA 5CMMA 4RK9A 5I2NB 5CMCA 3N5LA 4JWXA 1BIYA 3HN0A 2QPQA 3ONMA 5LOMA 4XKNA 1USYE 2UYEA 2I4CA 1PBPA 5H8HA 3W9VA 5KCJA 4RPNA 2DQVA 3K02A 1ZKBA 5JTYB 1QULA 5J1DA 2B3FA 3IOUA 4X1BA 4G68A 3VLVA 1PB7A 2O7IA 4PFTA 4G8MA 3K2DA 3M3FA 1XT8A 1B1HA 4DCXA 1CE2A 4LVQA 3H6TA 2I0BA 1WODA 2DE4A 2VP1A 4H1XA 4NTLA 3QUJA 4OHNA 4YB6A 4FAJA 4YB5A 2HFBA 1NH8A 2B65A 4R6HA 2UVGA 3V5AA 5JK4A 1MM6A 2Q88A 1AL3A 4IO3A 1EZPA 2ONKE 5HBCA 2HXWA 4OEUA 1IQ7A 1XHYA 2HAUA 3VE1B 1QJMA 2XX7A 1SW2A 1PC3A 3LUYA 2RC8A 1KWHA 3TYHA 3FXUA 2ZNUA 1P1WA 5JEIA 2O51A 3DELB 4XKQA 3JYRA 5L9MA 1MQDA 3S4UA 5CM6A 2HQ0A 4QFOA 3G3FA 3RLFE 1H43A 3C34A 1LCFA 3RTFB 3CSGA 1TFAA 1PB9A 3KOTA 2I58A 4OEVA 1DMBA 3MP1A 1EZ9A 3F11A 2OJTA 3CFLA 4QFKA 3T9HB 3RUMA 2GFEA 2I49A 2V25A 3QK6A 5K2YA 1EZOA 1LFHA 4TLMB 2RCAA 2B3BA 4F2OA 2THIA 1LLSA 2QJEA 1RYOA 2D5WA 1R6ZA 2OBGA 1FTMA 1QUKA 5L8DA 4MH5A 2F78A 3CVGA 3U1OA 2H25A 4LZ7A 3TODA 2F7AA 4N13A 4NF4B 1EH3A 3WAFA 2Z8DA 3FGSA 1ZLQA 4C1UA 2HCAA 3OOAA 4Q5TA 4KPTA 4OYVA 3TTMA 1I6BA 2O1MA 1B7UA 3H4ZA 4N6PA 4KHZE 4YZZA 3E3KA 2DSFA 2PVUA 5TP9A 2OCUA 4O3AA 1USYH 1UTBB 3ZSFA 1JVYA 2V93A 4NEDA 1UIUA 5I2NA 2DWJA 3PUYE 1B3GA 1UTHB 2HZLA 3OO9A 4U1OA 2XXXA 4OFJA 5ITPA 4WEDA 4ELQA 4NF6B 4PE5B 1QVSA 2W7YA 4IO6A 4M1VA 4QHQA 5JTYA 2P0SA 3ODBA 2ONRA 3USDA 3EPEA 1EU8A 3ECRA 1B5IA 1ZIUA 4BDRA 3R6UA 3C33A 2X26A 1WVJA 1P1OA 3O6IA 1URDA 1NFTA 4POWA 2V84A 5AA2D 2H98A 2PYYA 2QSXA 4HCYA 4ISUA 3ZS6A 5H8SA 3OXNA 4R73A 3PMWA 5EHSA 4Q30B 2YLNA 2RKMA 3CG1A 4U4XA 1OQHA 3HHGA 1YPNA 4BDOA 2DVCA 1B40A 2YJPA 3K0VA 3MJNA 3OEKA 3WAEA 3TZAA 3H03A 4KR5A 1DOTA 2I48A 3OELA 2AIXA 3K6WA 3S2VA 3UIFA 3HO7A 4BDMA 1L5TA 1MS7A 3PV0E 4U4SA 1MPDA 2Q89A 2PMSA 1A55A 2XD3A 5DVJA 3CI8A 2XX8A 1RYXA 4P0IA 2F7BA 2I4BA 3FV1A 5DTBA 1Z7ME 3M8UA 5CI5A 3SEYA 3CR9A 2O6AA 3OD7A 2ONSA 5K2XA 2Y7PA 3JZJA 2Z8EA 4R9FA 4ESXA 3FZVA 2CMOA 3H3GA 3W15C 4YB7A 3KSXA 4IY6A 3S9NC 4PFUA 1GR2A 4OXVA 2PT2A 4OERA 2ALUA 4GLIA 1H76A 1MY4A 3A3CA 3G7WA 2RC9A 4EXKA 3P7IA 1M5BA 3FJGA 2V3QA 3MW0A 2G29A 3C4MA 3VFJA 4JSDA 1Y20A 1IZ1A 3MPKA 3MQ9A 4NF4A 3G3JA 3QUFA 2AL4A 1OLCA 3ILUB 2XXTA 3KOSA 4Q0CA 1DTGA 3EHTA 4F3PA 4OTEA 2XD2A 1A8FA 2RF1A 1JNFA 1HSEA 4LUBA 3MZBA 2I6EA 1HSJA 1UTBA 1B2HA 4LZ8A 1P1QA 4C0RA 3QAXA 5AA4B 1Q1KA 1B4HA 3SETA 1UTHA 2UVIA 3G3GA 3GZGA 4DXBA 4H8IA 4PETA 3PUWE 2F35A 4NF6A 5H8QA 1AOVA 5DEXB 1D9VA 4G2ZA 1URSA 1OVTA 3VVDA 4R75A 1Y3QA 4U1ZA 3FIRA 5ELVA 3PUVE 3PPNA 4EUOA 3I5OA 5H8FB 5B70A 3M3LA 2AL5A 4XKRA 4F19A 4OFLA 3MWBA 2PX1A 4GL8A 1JEUA 1NH7A 3O97A 5F1QA 5AA1A 1YTVA 2H99A 1TT1A 3RN8A 2F5XA 3K6VA 4QFNA 3IOWA 3LSLA 3U8QA 5B7DA 3EQ1A 4NMYA 1LBBA 4PQJA 4FEDA 4YMAA 1P99A 1F9BA 3TPAA 4XTCQ 5KDTB 3HSTA 1VFDA 1ZMGA 2G93A 5I57B 2GHBA 1IIWA 3HPIA 3IR1A 4QF9A 4O3CA 5ICTA 2OK2A 4AQ4A 3A3UA 4GWOA 3PD8A 3DP6A 3B7DA 5I2KB 4YAHX 3KZGA 1MXXA 3QXMA 4ZDMA 3KJ7A 4NWDA 3OSRA 5ICQA 2WKYA 5FHOA 1SW1A 1SYHA 3OO6A 3OENA 1PBQA 4C1TA 3VV5A 1DTZA 1B58A 1OLAA 4DZ1A 1MH3A 3O28A 2QMXA 4K3FA 3Q26A 1BLFA 3T9VA 2PBWA 3IJXB 4JWOA 1A54A 1BTJA 2QMWA 1LB9A 1B3HA 3Q27A 2D21A 3O9PA 4EF2A 5HPQA 1Y9UA 1YCJA 3CG3A 2H9BA 3B6WA 5AE4A 4LQ5A 3GBBA 4X9TA 3FASA 2HAVA 1JW1A 4HCWA 1NNPA 2LAOA 1N3XA 1ZU0A 2F36A 2H5YA 4BDNA 2DWIA 3TELA 1LGBC 2V3UA 3SEVA 3PPRA 4DLDA 2XXQA 3LSFB 2X7QA 4X1DA 3UA8A 3RGYA 4JSOA 3TUSA 2QS2A 5AA4A 2RC7A 2IEEA 2ZYNA 3B6TA 4ZEIA 1B1XA 3KN8A 1M5EA 3N26A 1XVXA 4RA1A 1RKMA 1GGGA 2DOJA 4JDFA 1MQJA 4EQ7A 3OEMA 4GXSB 3GBAA 4ND9A 4RPOA 4QSCA 4RJZA 1BP5A 1GVCA 3LC8A 4FORA 5F7VA 1M5CA 3FV2A 1Y3NA 2O69A 2NOOA 1LBCA 4PFYA 1QW0A 5H8FA 3MVZA 1JETA 1Y4TA 2Q2AA 1Q35A 4ZECA 1OMPA 1IXCA 1DPPA 4O3BA 3OSQA 4NE4A 3DP8A 3SEUA 3A09A 1B7HA 2HZKA 2XXYA 4DXCA 5L9OA 4DCYA 2DWHA 1UIVA 1H45A 3D4GA 3TDJA 1MH4A 4X48A 3PD9A 4R2FA 2OZZA 1B0LA 1B46A 5KDTA 4EXLA 1FQDA 4OZ9A 4F29A 3FJMA 4FIMA 4LQ2A 3V8XB 3SKPA 5I57A 3K1NA 3TEPA 2Y7KA 1SI1A 1SD3A 1B0HA 5I2KA 3OO8A 3LR1A 3PUZE 1SDXA 5FTHA 3K6UA 2DE2A 1A8EA 2XX9A 1A7LA 1IEJA 4XIGQ 2X7PA 3KBRA 3LSWA 5I58B 4FECA 1NNFA 3LSXA 3TFLA 1Y1ZA 4H6DA 1DPEA 1N7WA 4LP2B 3T9UA 4KQPA 2R9JA 3IB1A 1B32A 1H3DA 4ONYA 5CBRA 5FHMA 4YMBA 3M3KA 3EHUA 2KLFA 1I6AA 3VVEA 1MPCA 2GH9A 3TAJA 3VLUA 4R2BA 1JVXA 2Y7WA 2OWSA 4G8NA 3K1PA 3R26A 4GOTA 4R9GA 1US4A 3FD3A 1MM7A 1O7TA 4JWYA 4GQOA 1JW4A 4L17A 4OVJA 3C36A 3HCQA 4TLLB 3TQLA 3RTWB 2NWJA 4P0GA 3TCGA 1QKBA 4F39A 3MZ1A 4ZE8A 3TTNA 4R6KA 1MXYA 3H7MA 5TU0A 3RNNA 4OENA 3PPQA 4GF8A 4NF8B 4E0WA 2REJA 3T66A 4Z7EA 3U93A 3CFXA 3PMXA 1NKXA 1TFDA 2ZNTA 2Y7IA 4LONB 4U2RA 4F18A 2HEUA 4H5GA 4KYEA 1P1NA 3O6GA 4MBPA 4EDPA 4I62A 1MXUA 5I59B 2ZYOA 4LA9A 3S9EA 2Z8FA 3KFMA 4KD5A 3S9MC 1J1NA 1M5DA 1B7ZA 4U22A 3T96B 5L9SA 1VSOA 3TTKA 1IXGA 4EF1A 4KCCA 2F97A 4WKMA 5AA3A 4U21A 1QKAA 3G3KA 4M4GA 4KYDA 1LSTA 2VD3A 2XXHA 2UYFA 2Q2CA 1XVYA 2IA4A 4EQBA 3SERA 4NWCA 4XKPA 4YKJA 3OMBA 3IORA 2NVUB 4KYSA 2DE3A 3TCHA 1FQCA 4OQOA 4RXLA 4U23A 3SEXA 3SEWA 3IO6A 3KJTA 5BWJA 4HS7A 1POTA 5DVFA 1PDAA 1FCKA 1N04A 1PB8A 1AH5A 3BFTA 4YICA 1B4ZA 5H8NB 1B3FA 4F3GA 2ESNA 1LAGE 5AA2B 4MF3A 2ZYKA 3PMVA 1MQGA 4IGTA 3D4CA 1N0TA 4QSDA 1LFGA 1N3WA 2XXIA 4P11A 3IAZA 2H4IA 5CBSA 1MY3A 4G4PA 1FQFA 4ELOA 1NNTA 4ECFA 3TKDA 2F34A 4KI0E 3E9XA 1MXZA 2OWTA 1B5JA 3QSLA 1FW0A 2UXAA 1VE4A 3T9XB 3FVOA 1SQYA 4MLVA 2Z23A 4HTGA 1SW5A 3TQWA 1FTJA 4WEPA 3MBPA 4GL0A 3C32A 3KEIA 3I6VA 3MAMA 2ANJA 3H6UA 1R1NA 4UACA 1IITA 2REGA 4HW8A 3K4UA 3Q29A 2NXOA 4F1VA 1MY2A 1O64A 2I3WA 3DM0A 1IUDA 1ELJA 2DYXA 3EHSA 3V83A 4RNSA 4NF8A 3G3IA 2ABHA 3K00A 2Z22A 3W9WA 2VOZA 4QFLA 2QL3A 1AMFA 4ZZEA 1TWYA 1ATGA 2ZXTA 4EQ9A 4F2QA 3SESA 3EF7A 1R9LA 3VVFA 5TPAB 3ZKLA 5I59A 2CZLA 4I8CA 3RT6B 3MVYA 2XXPA 1SI0A 1N84A 1JQFA 5I84A 4THIA 4OMBA 3MPLA 3PUXE 3PPOA 2DWAA 1CB6A 3O66A 4AB6A 4YKKA 1FQAA 1SVXB 4GD5A 1M5FA 1S7YA 4IY5A 2M8CA 4G68C 3THIA 2E0SA 2VD2A 2VHAA 4DE8A 2XXRA 4ZE9A 4GXAA 3I3VA 2Y84A 3KN3A 3RY3A 3UK4A 4H8JA 3ILTB 1GTKA 2O84X 3DP4A 3N94A 2GHAA 3E4RA 2DXRA 4BDLA 2FA7A 2P2AA 1DSNA 4H65A 3BBRA 5CMBA 4GVOA 2A5TB 3CIJA 3T22A 3RT8A 1B9JA 4ELRA 2AYSA 3IB0A 4R74A 3IK6B 4OWDA 1ZTYA 3TTRA 3TTLA 1FTLA 1H44A 1D4NA 5DEXA 4F31B 5H8NA 3IOVA 5AA2A 3N6TA 3ZKKA 4Z0IA 1B6HA 2RCBA 1MQHA 1JEVA 1LB8A 1SBPA 2ZMBA 1D3KA 3U92A 4YU0A 3QYTA 4FEBA 4RK2A 1FTKA 5DYHA 1AIVA 3GXAA 4IO7A 4GFRA 1IXHA 3K6XA 5I56B 1MY1A 4FATA 1A40A 1O63A 3QIMA 4F3SA 3N6UA 3FVGA 3KN7A 2O7UA 4N07A 1BKAA 1URGA 4JB7A 3H06B 5EHMA 3H6WA 1NNKA 1I6QA 1SW4A 4TQUQ 1LAFE 1JW5A 5ITOA 2BJJX 1R9QA 1B51A 3IB2A 4FE8A 1GV8A 1TXFA 1US5A 3AXFA 2YPNA 2I3VA 4FJPA 4OFOA 3L6HA 5IKBA 4I9DA 1SYIA 1MRPA 1P1UA 4AB5A 3GLBA 2XXWA 4OETA 4PP0A 1OIBA 4DDDA 5FHNA 4MFIA 4IO4A 5H8QB 4NF5B 1QUIA 4PFWA 3SDFA 3HV1A 5HM4B 1MPBA 1S9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJL A;  3BKI B;  3IX1 A;  1II5 A;  5TPA A;  3KSJ A;  5KZT A;  3IO4 A;  4F3B A;  3VXC A;  4H0W A;  4GIZ A;  1VR5 A;  3C9H A;  3UOR A;  3K1M A;  2FYI A;  3CFZ A;  1LCT A;  2PT1 A;  3TMG A;  4IO2 A;  5A5X B;  3KG2 A;  1YAE A;  4UA8 A;  4DXU A;  1D9Y A;  4ZZA A;  4F1Y A;  3U94 A;  3TCF A;  3HHF A;  3CRB A;  3U72 A;  4G77 A;  4BLA A;  3FVK A;  4TOZ A;  2DXY A;  1N7X A;  3FJ7 A;  1NMU A;  2F7C A;  1PEB A;  4ZED A;  1LFI A;  3JV9 A;  1POY 1;  3Q25 A;  3O29 A;  3V89 B;  4QSE A;  3FVN A;  3IJO B;  3LBS A;  4H67 A;  3RPW A;  2I0C A;  1FTO A;  2XXU A;  5H8H B;  2Y7R A;  5KCJ B;  1MDP 1;  1WDN A;  2A5T A;  3Q28 A;  2QRY A;  1XOC A;  3R7X A;  3EN3 A;  3KGC A;  5CC2 A;  4G68 B;  2P1S A;  4R6Y A;  5BUU A;  1MXW A;  3MP6 A;  1IXI A;  3MVW A;  4IB2 A;  4OES A;  1ZBM A;  3C31 A;  3O6H A;  4XXU A;  3MUQ A;  3PU5 A;  2FNC A;  1Z7N E;  2DS9 A;  3MC2 A;  3CSB A;  1B5H A;  2ZYM A;  1Y1M A;  2UVJ A;  4ESW A;  2D3I A;  4MLQ A;  3VLW A;  1HSL A;  1OQG A;  3UGW A;  3IOT A;  5M2V A;  2QS4 A;  5CRY A;  5ISU A;  4YKP A;  4QRZ A;  1MG1 A;  4JXI A;  2O68 A;  1I69 A;  5I56 A;  4ZEF A;  1UQW A;  4GRK A;  5CMK A;  1FQB A;  2A5S A;  4I1D A;  3FXR A;  4LZ5 A;  3BFU A;  2F6P A;  4Q8R A;  4ZEB A;  3E13 X;  1A99 A;  3MP8 A;  3FUZ A;  1OVB A;  4E0X A;  3L6G A;  2XXV A;  1MDQ A;  3S9L C;  3B6Q A;  1LAH E;  3G3H A;  4KFQ A;  3O2A A;  2NUV A;  4F22 A;  4RYA A;  4F1U A;  3T93 B;  4IO5 A;  1Y4C A;  2VGQ A;  1FQE A;  2RIN A;  1QUJ A;  4ELP A;  2OLB A;  2V3T A;  4G8H A;  1B3E A;  2F6G A;  4YKI A;  5I58 A;  4POX A;  2DVZ A;  3PGF A;  4JBZ A;  4DIG A;  2QS3 A;  4NF5 A;  3RQT A;  5EYF A;  1MY0 A;  4BDQ A;  1XC1 A;  2E1S A;  5FTI A;  2R6G E;  1N76 A;  2UVH A;  1B52 A;  2Q8J A;  5IAI A;  3UP9 A;  1XS5 A;  1B3L A;  4WXJ A;  1S50 A;  4IGR A;  1VFE A;  4LAT A;  4KCD A;  3H6V A;  3FXQ A;  4RY1 A;  3K01 A;  2GRV A;  5DT6 A;  3OO7 A;  4QFP A;  2F8D A;  3DLN A;  4H5F A;  1Y3P A;  3MZ9 A;  4R72 A;  1LAX A;  1NL5 A;  1MQI A;  2QS1 A;  3VDF A;  3VXB A;  4ZS9 A;  1ANF A;  5A5X A;  5DVI A;  2Q9T A;  3UN6 A;  1T0K A;  4ZEK A;  3IL1 B;  1B05 A;  3PPP A;  2R71 A;  2XHD A;  2DP8 A;  3C35 A;  3MVX A;  5TP9 B;  1MXV A;  2O1L A;  3FAT A;  2ZNS A;  5CMM A;  4RK9 A;  5I2N B;  5CMC A;  3N5L A;  4JWX A;  1BIY A;  3HN0 A;  2QPQ A;  3ONM A;  5LOM A;  4XKN A;  1USY E;  2UYE A;  2I4C A;  1PBP A;  5H8H A;  3W9V A;  5KCJ A;  4RPN A;  2DQV A;  3K02 A;  1ZKB A;  5JTY B;  1QUL A;  5J1D A;  2B3F A;  3IOU A;  4X1B A;  4G68 A;  3VLV A;  1PB7 A;  2O7I A;  4PFT A;  4G8M A;  3K2D A;  3M3F A;  1XT8 A;  1B1H A;  4DCX A;  1CE2 A;  4LVQ A;  3H6T A;  2I0B A;  1WOD A;  2DE4 A;  2VP1 A;  4H1X A;  4NTL A;  3QUJ A;  4OHN A;  4YB6 A;  4FAJ A;  4YB5 A;  2HFB A;  1NH8 A;  2B65 A;  4R6H A;  2UVG A;  3V5A A;  5JK4 A;  1MM6 A;  2Q88 A;  1AL3 A;  4IO3 A;  1EZP A;  2ONK E;  5HBC A;  2HXW A;  4OEU A;  1IQ7 A;  1XHY A;  2HAU A;  3VE1 B;  1QJM A;  2XX7 A;  1SW2 A;  1PC3 A;  3LUY A;  2RC8 A;  1KWH A;  3TYH A;  3FXU A;  2ZNU A;  1P1W A;  5JEI A;  2O51 A;  3DEL B;  4XKQ A;  3JYR A;  5L9M A;  1MQD A;  3S4U A;  5CM6 A;  2HQ0 A;  4QFO A;  3G3F A;  3RLF E;  1H43 A;  3C34 A;  1LCF A;  3RTF B;  3CSG A;  1TFA A;  1PB9 A;  3KOT A;  2I58 A;  4OEV A;  1DMB A;  3MP1 A;  1EZ9 A;  3F11 A;  2OJT A;  3CFL A;  4QFK A;  3T9H B;  3RUM A;  2GFE A;  2I49 A;  2V25 A;  3QK6 A;  5K2Y A;  1EZO A;  1LFH A;  4TLM B;  2RCA A;  2B3B A;  4F2O A;  2THI A;  1LLS A;  2QJE A;  1RYO A;  2D5W A;  1R6Z A;  2OBG A;  1FTM A;  1QUK A;  5L8D A;  4MH5 A;  2F78 A;  3CVG A;  3U1O A;  2H25 A;  4LZ7 A;  3TOD A;  2F7A A;  4N13 A;  4NF4 B;  1EH3 A;  3WAF A;  2Z8D A;  3FGS A;  1ZLQ A;  4C1U A;  2HCA A;  3OOA A;  4Q5T A;  4KPT A;  4OYV A;  3TTM A;  1I6B A;  2O1M A;  1B7U A;  3H4Z A;  4N6P A;  4KHZ E;  4YZZ A;  3E3K A;  2DSF A;  2PVU A;  5TP9 A;  2OCU A;  4O3A A;  1USY H;  1UTB B;  3ZSF A;  1JVY A;  2V93 A;  4NED A;  1UIU A;  5I2N A;  2DWJ A;  3PUY E;  1B3G A;  1UTH B;  2HZL A;  3OO9 A;  4U1O A;  2XXX A;  4OFJ A;  5ITP A;  4WED A;  4ELQ A;  4NF6 B;  4PE5 B;  1QVS A;  2W7Y A;  4IO6 A;  4M1V A;  4QHQ A;  5JTY A;  2P0S A;  3ODB A;  2ONR A;  3USD A;  3EPE A;  1EU8 A;  3ECR A;  1B5I A;  1ZIU A;  4BDR A;  3R6U A;  3C33 A;  2X26 A;  1WVJ A;  1P1O A;  3O6I A;  1URD A;  1NFT A;  4POW A;  2V84 A;  5AA2 D;  2H98 A;  2PYY A;  2QSX A;  4HCY A;  4ISU A;  3ZS6 A;  5H8S A;  3OXN A;  4R73 A;  3PMW A;  5EHS A;  4Q30 B;  2YLN A;  2RKM A;  3CG1 A;  4U4X A;  1OQH A;  3HHG A;  1YPN A;  4BDO A;  2DVC A;  1B40 A;  2YJP A;  3K0V A;  3MJN A;  3OEK A;  3WAE A;  3TZA A;  3H03 A;  4KR5 A;  1DOT A;  2I48 A;  3OEL A;  2AIX A;  3K6W A;  3S2V A;  3UIF A;  3HO7 A;  4BDM A;  1L5T A;  1MS7 A;  3PV0 E;  4U4S A;  1MPD A;  2Q89 A;  2PMS A;  1A55 A;  2XD3 A;  5DVJ A;  3CI8 A;  2XX8 A;  1RYX A;  4P0I A;  2F7B A;  2I4B A;  3FV1 A;  5DTB A;  1Z7M E;  3M8U A;  5CI5 A;  3SEY A;  3CR9 A;  2O6A A;  3OD7 A;  2ONS A;  5K2X A;  2Y7P A;  3JZJ A;  2Z8E A;  4R9F A;  4ESX A;  3FZV A;  2CMO A;  3H3G A;  3W15 C;  4YB7 A;  3KSX A;  4IY6 A;  3S9N C;  4PFU A;  1GR2 A;  4OXV A;  2PT2 A;  4OER A;  2ALU A;  4GLI A;  1H76 A;  1MY4 A;  3A3C A;  3G7W A;  2RC9 A;  4EXK A;  3P7I A;  1M5B A;  3FJG A;  2V3Q A;  3MW0 A;  2G29 A;  3C4M A;  3VFJ A;  4JSD A;  1Y20 A;  1IZ1 A;  3MPK A;  3MQ9 A;  4NF4 A;  3G3J A;  3QUF A;  2AL4 A;  1OLC A;  3ILU B;  2XXT A;  3KOS A;  4Q0C A;  1DTG A;  3EHT A;  4F3P A;  4OTE A;  2XD2 A;  1A8F A;  2RF1 A;  1JNF A;  1HSE A;  4LUB A;  3MZB A;  2I6E A;  1HSJ A;  1UTB A;  1B2H A;  4LZ8 A;  1P1Q A;  4C0R A;  3QAX A;  5AA4 B;  1Q1K A;  1B4H A;  3SET A;  1UTH A;  2UVI A;  3G3G A;  3GZG A;  4DXB A;  4H8I A;  4PET A;  3PUW E;  2F35 A;  4NF6 A;  5H8Q A;  1AOV A;  5DEX B;  1D9V A;  4G2Z A;  1URS A;  1OVT A;  3VVD A;  4R75 A;  1Y3Q A;  4U1Z A;  3FIR A;  5ELV A;  3PUV E;  3PPN A;  4EUO A;  3I5O A;  5H8F B;  5B70 A;  3M3L A;  2AL5 A;  4XKR A;  4F19 A;  4OFL A;  3MWB A;  2PX1 A;  4GL8 A;  1JEU A;  1NH7 A;  3O97 A;  5F1Q A;  5AA1 A;  1YTV A;  2H99 A;  1TT1 A;  3RN8 A;  2F5X A;  3K6V A;  4QFN A;  3IOW A;  3LSL A;  3U8Q A;  5B7D A;  3EQ1 A;  4NMY A;  1LBB A;  4PQJ A;  4FED A;  4YMA A;  1P99 A;  1F9B A;  3TPA A;  4XTC Q;  5KDT B;  3HST A;  1VFD A;  1ZMG A;  2G93 A;  5I57 B;  2GHB A;  1IIW A;  3HPI A;  3IR1 A;  4QF9 A;  4O3C A;  5ICT A;  2OK2 A;  4AQ4 A;  3A3U A;  4GWO A;  3PD8 A;  3DP6 A;  3B7D A;  5I2K B;  4YAH X;  3KZG A;  1MXX A;  3QXM A;  4ZDM A;  3KJ7 A;  4NWD A;  3OSR A;  5ICQ A;  2WKY A;  5FHO A;  1SW1 A;  1SYH A;  3OO6 A;  3OEN A;  1PBQ A;  4C1T A;  3VV5 A;  1DTZ A;  1B58 A;  1OLA A;  4DZ1 A;  1MH3 A;  3O28 A;  2QMX A;  4K3F A;  3Q26 A;  1BLF A;  3T9V A;  2PBW A;  3IJX B;  4JWO A;  1A54 A;  1BTJ A;  2QMW A;  1LB9 A;  1B3H A;  3Q27 A;  2D21 A;  3O9P A;  4EF2 A;  5HPQ A;  1Y9U A;  1YCJ A;  3CG3 A;  2H9B A;  3B6W A;  5AE4 A;  4LQ5 A;  3GBB A;  4X9T A;  3FAS A;  2HAV A;  1JW1 A;  4HCW A;  1NNP A;  2LAO A;  1N3X A;  1ZU0 A;  2F36 A;  2H5Y A;  4BDN A;  2DWI A;  3TEL A;  1LGB C;  2V3U A;  3SEV A;  3PPR A;  4DLD A;  2XXQ A;  3LSF B;  2X7Q A;  4X1D A;  3UA8 A;  3RGY A;  4JSO A;  3TUS A;  2QS2 A;  5AA4 A;  2RC7 A;  2IEE A;  2ZYN A;  3B6T A;  4ZEI A;  1B1X A;  3KN8 A;  1M5E A;  3N26 A;  1XVX A;  4RA1 A;  1RKM A;  1GGG A;  2DOJ A;  4JDF A;  1MQJ A;  4EQ7 A;  3OEM A;  4GXS B;  3GBA A;  4ND9 A;  4RPO A;  4QSC A;  4RJZ A;  1BP5 A;  1GVC A;  3LC8 A;  4FOR A;  5F7V A;  1M5C A;  3FV2 A;  1Y3N A;  2O69 A;  2NOO A;  1LBC A;  4PFY A;  1QW0 A;  5H8F A;  3MVZ A;  1JET A;  1Y4T A;  2Q2A A;  1Q35 A;  4ZEC A;  1OMP A;  1IXC A;  1DPP A;  4O3B A;  3OSQ A;  4NE4 A;  3DP8 A;  3SEU A;  3A09 A;  1B7H A;  2HZK A;  2XXY A;  4DXC A;  5L9O A;  4DCY A;  2DWH A;  1UIV A;  1H45 A;  3D4G A;  3TDJ A;  1MH4 A;  4X48 A;  3PD9 A;  4R2F A;  2OZZ A;  1B0L A;  1B46 A;  5KDT A;  4EXL A;  1FQD A;  4OZ9 A;  4F29 A;  3FJM A;  4FIM A;  4LQ2 A;  3V8X B;  3SKP A;  5I57 A;  3K1N A;  3TEP A;  2Y7K A;  1SI1 A;  1SD3 A;  1B0H A;  5I2K A;  3OO8 A;  3LR1 A;  3PUZ E;  1SDX A;  5FTH A;  3K6U A;  2DE2 A;  1A8E A;  2XX9 A;  1A7L A;  1IEJ A;  4XIG Q;  2X7P A;  3KBR A;  3LSW A;  5I58 B;  4FEC A;  1NNF A;  3LSX A;  3TFL A;  1Y1Z A;  4H6D A;  1DPE A;  1N7W A;  4LP2 B;  3T9U A;  4KQP A;  2R9J A;  3IB1 A;  1B32 A;  1H3D A;  4ONY A;  5CBR A;  5FHM A;  4YMB A;  3M3K A;  3EHU A;  2KLF A;  1I6A A;  3VVE A;  1MPC A;  2GH9 A;  3TAJ A;  3VLU A;  4R2B A;  1JVX A;  2Y7W A;  2OWS A;  4G8N A;  3K1P A;  3R26 A;  4GOT A;  4R9G A;  1US4 A;  3FD3 A;  1MM7 A;  1O7T A;  4JWY A;  4GQO A;  1JW4 A;  4L17 A;  4OVJ A;  3C36 A;  3HCQ A;  4TLL B;  3TQL A;  3RTW B;  2NWJ A;  4P0G A;  3TCG A;  1QKB A;  4F39 A;  3MZ1 A;  4ZE8 A;  3TTN A;  4R6K A;  1MXY A;  3H7M A;  5TU0 A;  3RNN A;  4OEN A;  3PPQ A;  4GF8 A;  4NF8 B;  4E0W A;  2REJ A;  3T66 A;  4Z7E A;  3U93 A;  3CFX A;  3PMX A;  1NKX A;  1TFD A;  2ZNT A;  2Y7I A;  4LON B;  4U2R A;  4F18 A;  2HEU A;  4H5G A;  4KYE A;  1P1N A;  3O6G A;  4MBP A;  4EDP A;  4I62 A;  1MXU A;  5I59 B;  2ZYO A;  4LA9 A;  3S9E A;  2Z8F A;  3KFM A;  4KD5 A;  3S9M C;  1J1N A;  1M5D A;  1B7Z A;  4U22 A;  3T96 B;  5L9S A;  1VSO A;  3TTK A;  1IXG A;  4EF1 A;  4KCC A;  2F97 A;  4WKM A;  5AA3 A;  4U21 A;  1QKA A;  3G3K A;  4M4G A;  4KYD A;  1LST A;  2VD3 A;  2XXH A;  2UYF A;  2Q2C A;  1XVY A;  2IA4 A;  4EQB A;  3SER A;  4NWC A;  4XKP A;  4YKJ A;  3OMB A;  3IOR A;  2NVU B;  4KYS A;  2DE3 A;  3TCH A;  1FQC A;  4OQO A;  4RXL A;  4U23 A;  3SEX A;  3SEW A;  3IO6 A;  3KJT A;  5BWJ A;  4HS7 A;  1POT A;  5DVF A;  1PDA A;  1FCK A;  1N04 A;  1PB8 A;  1AH5 A;  3BFT A;  4YIC A;  1B4Z A;  5H8N B;  1B3F A;  4F3G A;  2ESN A;  1LAG E;  5AA2 B;  4MF3 A;  2ZYK A;  3PMV A;  1MQG A;  4IGT A;  3D4C A;  1N0T A;  4QSD A;  1LFG A;  1N3W A;  2XXI A;  4P11 A;  3IAZ A;  2H4I A;  5CBS A;  1MY3 A;  4G4P A;  1FQF A;  4ELO A;  1NNT A;  4ECF A;  3TKD A;  2F34 A;  4KI0 E;  3E9X A;  1MXZ A;  2OWT A;  1B5J A;  3QSL A;  1FW0 A;  2UXA A;  1VE4 A;  3T9X B;  3FVO A;  1SQY A;  4MLV A;  2Z23 A;  4HTG A;  1SW5 A;  3TQW A;  1FTJ A;  4WEP A;  3MBP A;  4GL0 A;  3C32 A;  3KEI A;  3I6V A;  3MAM A;  2ANJ A;  3H6U A;  1R1N A;  4UAC A;  1IIT A;  2REG A;  4HW8 A;  3K4U A;  3Q29 A;  2NXO A;  4F1V A;  1MY2 A;  1O64 A;  2I3W A;  3DM0 A;  1IUD A;  1ELJ A;  2DYX A;  3EHS A;  3V83 A;  4RNS A;  4NF8 A;  3G3I A;  2ABH A;  3K00 A;  2Z22 A;  3W9W A;  2VOZ A;  4QFL A;  2QL3 A;  1AMF A;  4ZZE A;  1TWY A;  1ATG A;  2ZXT A;  4EQ9 A;  4F2Q A;  3SES A;  3EF7 A;  1R9L A;  3VVF A;  5TPA B;  3ZKL A;  5I59 A;  2CZL A;  4I8C A;  3RT6 B;  3MVY A;  2XXP A;  1SI0 A;  1N84 A;  1JQF A;  5I84 A;  4THI A;  4OMB A;  3MPL A;  3PUX E;  3PPO A;  2DWA A;  1CB6 A;  3O66 A;  4AB6 A;  4YKK A;  1FQA A;  1SVX B;  4GD5 A;  1M5F A;  1S7Y A;  4IY5 A;  2M8C A;  4G68 C;  3THI A;  2E0S A;  2VD2 A;  2VHA A;  4DE8 A;  2XXR A;  4ZE9 A;  4GXA A;  3I3V A;  2Y84 A;  3KN3 A;  3RY3 A;  3UK4 A;  4H8J A;  3ILT B;  1GTK A;  2O84 X;  3DP4 A;  3N94 A;  2GHA A;  3E4R A;  2DXR A;  4BDL A;  2FA7 A;  2P2A A;  1DSN A;  4H65 A;  3BBR A;  5CMB A;  4GVO A;  2A5T B;  3CIJ A;  3T22 A;  3RT8 A;  1B9J A;  4ELR A;  2AYS A;  3IB0 A;  4R74 A;  3IK6 B;  4OWD A;  1ZTY A;  3TTR A;  3TTL A;  1FTL A;  1H44 A;  1D4N A;  5DEX A;  4F31 B;  5H8N A;  3IOV A;  5AA2 A;  3N6T A;  3ZKK A;  4Z0I A;  1B6H A;  2RCB A;  1MQH A;  1JEV A;  1LB8 A;  1SBP A;  2ZMB A;  1D3K A;  3U92 A;  4YU0 A;  3QYT A;  4FEB A;  4RK2 A;  1FTK A;  5DYH A;  1AIV A;  3GXA A;  4IO7 A;  4GFR A;  1IXH A;  3K6X A;  5I56 B;  1MY1 A;  4FAT A;  1A40 A;  1O63 A;  3QIM A;  4F3S A;  3N6U A;  3FVG A;  3KN7 A;  2O7U A;  4N07 A;  1BKA A;  1URG A;  4JB7 A;  3H06 B;  5EHM A;  3H6W A;  1NNK A;  1I6Q A;  1SW4 A;  4TQU Q;  1LAF E;  1JW5 A;  5ITO A;  2BJJ X;  1R9Q A;  1B51 A;  3IB2 A;  4FE8 A;  1GV8 A;  1TXF A;  1US5 A;  3AXF A;  2YPN A;  2I3V A;  4FJP A;  4OFO A;  3L6H A;  5IKB A;  4I9D A;  1SYI A;  1MRP A;  1P1U A;  4AB5 A;  3GLB A;  2XXW A;  4OET A;  4PP0 A;  1OIB A;  4DDD A;  5FHN A;  4MFI A;  4IO4 A;  5H8Q B;  4NF5 B;  1QUI A;  4PFW A;  3SDF A;  3HV1 A;  5HM4 B;  1MPB A;  1S9T A; 
#chains in the Genus database with same CATH topology
 1ZJL A;  3BKI B;  3IX1 A;  4PE3 A;  4GWX A;  1II5 A;  5TPA A;  3KSJ A;  5KZT A;  4N4U A;  4MX6 A;  3IO4 A;  4F3B A;  3VXC A;  4H0W A;  4GIZ A;  1VR5 A;  3C9H A;  3UOR A;  3K1M A;  2FYI A;  3CFZ A;  1LCT A;  2PT1 A;  3TMG A;  4IO2 A;  4MNI A;  5A5X B;  3KG2 A;  1YAE A;  4UA8 A;  4DXU A;  1D9Y A;  4ZZA A;  2XA5 A;  4F1Y A;  3U94 A;  3TCF A;  3HHF A;  3CRB A;  2WYK A;  1IME A;  3U72 A;  4G77 A;  4BLA A;  3FVK A;  4TOZ A;  2DXY A;  1N7X A;  3FJ7 A;  1NMU A;  2F7C A;  1PEB A;  4ZED A;  1LFI A;  2WYP A;  3JV9 A;  1POY 1;  3Q25 A;  4O7M A;  5DW8 A;  3O29 A;  3V89 B;  1LBZ A;  4QSE A;  3FVN A;  3IJO B;  3LBS A;  4H67 A;  3RPW A;  4N8Y A;  2I0C A;  1FTO A;  2XXU A;  5H8H B;  2Y7R A;  5KCJ B;  1MDP 1;  2VPO A;  1WDN A;  2A5T A;  3Q28 A;  2QRY A;  1NUY A;  1XOC A;  3R7X A;  3EN3 A;  3KGC A;  5CC2 A;  5EYG A;  4G68 B;  4N15 A;  2P1S A;  4R6Y A;  5BUU A;  1MXW A;  2QVU A;  3B8B A;  2FBP A;  1FBD A;  3MP6 A;  1IXI A;  4PTK A;  1INP A;  3GYY A;  3MVW A;  4IB2 A;  4PAF A;  4OES A;  1ZBM A;  3C31 A;  3O6H A;  2PFZ A;  4XXU A;  3MUQ A;  3PU5 A;  1LBX A;  2FNC A;  1Z7N E;  2DS9 A;  3MC2 A;  2Q8M A;  3CSB A;  1B5H A;  4NGU A;  2ZYM A;  1Y1M A;  2UVJ A;  4ESW A;  2XWO A;  2D3I A;  4MLQ A;  3VLW A;  1HSL A;  1OQG A;  1EYJ A;  3UGW A;  2ZZW A;  3IOT A;  5M2V A;  2QS4 A;  5CRY A;  5ISU A;  2BJI A;  4YKP A;  4QRZ A;  1MG1 A;  4JXI A;  2O68 A;  1I69 A;  5I56 A;  5I3S A;  4ZEF A;  1UQW A;  4GRK A;  5CMK A;  1FQB A;  2A5S A;  4I1D A;  3FXR A;  1G0H A;  4LZ5 A;  3BFU A;  2F6P A;  5EQA A;  4Q8R A;  4ZEB A;  3E13 X;  1A99 A;  3MP8 A;  3FUZ A;  2QVV A;  1OVB A;  4E0X A;  3L6G A;  2XXV A;  1MDQ A;  3S9L C;  3B6Q A;  1LAH E;  2GQ1 A;  3G3H A;  4KFQ A;  3O2A A;  2NUV A;  4OVS A;  4F22 A;  4RYA A;  2Y5K A;  4F1U A;  3T93 B;  1NV6 A;  4GX6 A;  4IO5 A;  1Y4C A;  2VGQ A;  1FQE A;  4MEV A;  2RIN A;  1QUJ A;  2V4C A;  3ROJ A;  4ELP A;  4QBA A;  2OLB A;  2V3T A;  4G8H A;  3SZP A;  1B3E A;  1FJ9 A;  2F6G A;  4YKI A;  4G61 A;  5I58 A;  4POX A;  2DVZ A;  3PGF A;  4JBZ A;  4DIG A;  2QS3 A;  4NF5 A;  3RQT A;  5EYF A;  1MY0 A;  4BDQ A;  1XC1 A;  3PTY A;  2E1S A;  5FTI A;  2R6G E;  1N76 A;  2UVH A;  1B52 A;  2Q8J A;  4GWZ A;  5IAI A;  3UP9 A;  1XS5 A;  1B3L A;  1FBE A;  2WBD A;  4WXJ A;  1S50 A;  4IGR A;  1VFE A;  4LAT A;  4KCD A;  3H6V A;  3FXQ A;  4RY1 A;  3K01 A;  2GRV A;  5DT6 A;  3OO7 A;  4P47 A;  4QFP A;  1LEV A;  2F8D A;  3DLN A;  4H5F A;  1Y3P A;  3MZ9 A;  4R72 A;  1LAX A;  1NL5 A;  1MQI A;  2QS1 A;  3VDF A;  3VXB A;  4ZS9 A;  1ANF A;  5A5X A;  5DVI A;  2Q9T A;  3UN6 A;  1T0K A;  4ZEK A;  3IL1 B;  1B05 A;  2WBB A;  3PPP A;  1FPK A;  2R71 A;  2L5V A;  4P8B A;  2XHD A;  2DP8 A;  3C35 A;  3MVX A;  5TP9 B;  1MXV A;  2O1L A;  3E79 A;  3FAT A;  1VDW A;  2ZNS A;  5CMM A;  4RK9 A;  5I2N B;  5CMC A;  3N5L A;  2KQZ A;  4JWX A;  1BIY A;  3B50 A;  2QPQ A;  3HN0 A;  3ONM A;  5LOM A;  4XKN A;  1USY E;  2UYE A;  2I4C A;  1PBP A;  5H8H A;  3W9V A;  5KCJ A;  4RPN A;  2DQV A;  2FIX A;  3K02 A;  1ZKB A;  5JTY B;  1QUL A;  5J1D A;  2B3F A;  3IOU A;  4X1B A;  4G68 A;  3VLV A;  4PFT A;  1PB7 A;  2O7I A;  4G8M A;  3K2D A;  3M3F A;  1XT8 A;  1B1H A;  4DCX A;  1CE2 A;  4LVQ A;  3H6T A;  2I0B A;  1WOD A;  2DE4 A;  2VP1 A;  4H1X A;  4NTL A;  3QUJ A;  4OHN A;  4YB6 A;  4FAJ A;  5EYH A;  4JVC A;  4YB5 A;  2HFB A;  2F3B A;  1NH8 A;  2B65 A;  4R6H A;  2UVG A;  3V5A A;  5JK4 A;  4H45 A;  1MM6 A;  2Q88 A;  1AL3 A;  4IO3 A;  1EZP A;  2ONK E;  5HBC A;  2HXW A;  4OEU A;  1YYZ A;  1IQ7 A;  1XHY A;  2HAU A;  1NI9 A;  4O8M A;  3VE1 B;  4N81 A;  1QJM A;  2XX7 A;  1SW2 A;  1PC3 A;  3LUY A;  2RC8 A;  1KWH A;  4XF5 A;  3TYH A;  3FXU A;  2ZNU A;  1P1W A;  5JEI A;  2O51 A;  3DEL B;  5EQ8 A;  4XKQ A;  3JYR A;  5L9M A;  1MQD A;  3S4U A;  5CM6 A;  4GWW A;  2HQ0 A;  4GWS A;  4QFO A;  4PC9 A;  1NV1 A;  3G3F A;  3LUZ A;  3RLF E;  1H43 A;  3C34 A;  1LCF A;  3RTF B;  3CSG A;  1TFA A;  1PB9 A;  3KOT A;  2I58 A;  4OEV A;  1DMB A;  3MP1 A;  1EZ9 A;  3F11 A;  3BIG A;  4PFB A;  2OJT A;  3CFL A;  4QFK A;  3T9H B;  3RUM A;  2GFE A;  2I49 A;  2V25 A;  4GWU A;  3QK6 A;  5K2Y A;  1EZO A;  1LFH A;  4TLM B;  2RCA A;  2B3B A;  4OVR A;  4F2O A;  2THI A;  4PAK A;  1LLS A;  2QJE A;  4NHB A;  1RYO A;  2D5W A;  1R6Z A;  2OBG A;  3KC1 A;  1FTM A;  1QUK A;  5L8D A;  4MH5 A;  2F78 A;  3CVG A;  3U1O A;  2H25 A;  4LZ7 A;  3TOD A;  2F7A A;  4N13 A;  3IFA A;  4NF4 B;  1EH3 A;  3WAF A;  2Z8D A;  3FGS A;  1ZLQ A;  4C1U A;  2HCA A;  3OOA A;  4Q5T A;  2CEY A;  4KPT A;  4OYV A;  3TTM A;  1I6B A;  2O1M A;  1B7U A;  3H4Z A;  4N6P A;  5IZ3 B;  4KHZ E;  4YZZ A;  1QGX A;  4NQ8 A;  3E3K A;  2DSF A;  2PVU A;  4MIJ A;  5TP9 A;  2OCU A;  4O3A A;  1USY H;  1UTB B;  3ZSF A;  1EYI A;  4HE2 A;  1JVY A;  2V93 A;  4NED A;  1UIU A;  5I2N A;  2DWJ A;  3PUY E;  1B3G A;  4DI3 D;  1UTH B;  2HZL A;  3OO9 A;  4U1O A;  2XXX A;  4OFJ A;  5ITP A;  4WED A;  3D1R A;  4ELQ A;  4NF6 B;  4PE5 B;  1QVS A;  2W7Y A;  4IO6 A;  4M1V A;  4QHQ A;  5JTY A;  2P0S A;  3ODB A;  1NV2 A;  2ONR A;  3USD A;  4MNC A;  3EPE A;  1EU8 A;  3ECR A;  1FBP A;  1B5I A;  1ZIU A;  1FPL A;  4BDR A;  5I7I A;  3R6U A;  3C33 A;  2X26 A;  1WVJ A;  1P1O A;  3O6I A;  1URD A;  1NFT A;  4POW A;  2V84 A;  5AA2 D;  2H98 A;  2PYY A;  2QSX A;  1K9Z A;  2P3V A;  4HCY A;  4ISU A;  3ZS6 A;  4I3Y A;  5H8S A;  3OXN A;  4R73 A;  3PMW A;  5EHS A;  4Q30 B;  2YLN A;  2RKM A;  3CG1 A;  4U4X A;  1OQH A;  3HHG A;  1YPN A;  4BDO A;  5LDZ A;  2DVC A;  1B40 A;  2YJP A;  3K0V A;  5F24 A;  3MJN A;  3OEK A;  3WAE A;  3TZA A;  3H03 A;  4KR5 A;  1DOT A;  2I48 A;  3OEL A;  2AIX A;  3K6W A;  3S2V A;  3UIF A;  3HO7 A;  4JVI A;  4BDM A;  1L5T A;  1MS7 A;  3PV0 E;  4U4S A;  4GX4 A;  5IGA A;  4O7I A;  1MPD A;  2Q89 A;  2PMS A;  3LV0 A;  1A55 A;  4GBW A;  2XD3 A;  5DVJ A;  3CI8 A;  2XX8 A;  1RYX A;  2CZH A;  4P0I A;  2F7B A;  2I4B A;  3FV1 A;  5DTB A;  1Z7M E;  2CZK A;  1LBY A;  3M8U A;  1XI6 A;  5CI5 A;  3SEY A;  3CR9 A;  2O6A A;  4X8R A;  3OD7 A;  2ONS A;  5K2X A;  2Y7P A;  3JZJ A;  2Z8E A;  4R9F A;  4ESX A;  1FBG A;  3FZV A;  3RPL B;  2CMO A;  3H3G A;  3W15 C;  4YB7 A;  3KSX A;  4IY6 A;  3S9N C;  4PFU A;  1GR2 A;  4OXV A;  2PT2 A;  4GWY A;  4OER A;  2ALU A;  4NX1 A;  4GLI A;  1H76 A;  1MY4 A;  3A3C A;  3G7W A;  2RC9 A;  4EXK A;  3P7I A;  5ET5 A;  1M5B A;  3FJG A;  2V3Q A;  3MW0 A;  2G29 A;  3C4M A;  3VFJ A;  4PF6 A;  4JSD A;  1Y20 A;  1IZ1 A;  3MPK A;  3MQ9 A;  4P9K A;  4NF4 A;  3G3J A;  3QUF A;  5EQ7 A;  2AL4 A;  1OLC A;  3ILU B;  2OX3 A;  2XXT A;  3KOS A;  4Q0C A;  4PBH A;  4NF0 A;  1DTG A;  3EHT A;  4F3P A;  4OTE A;  2XD2 A;  1A8F A;  2RF1 A;  1JNF A;  5IZ3 A;  1LBW A;  1HSE A;  4LUB A;  3MZB A;  2I6E A;  1FPJ A;  1HSJ A;  1UTB A;  1B2H A;  4LZ8 A;  4OVP A;  1P1Q A;  2P3N A;  4C0R A;  3QAX A;  5AA4 B;  4PFR A;  1Q1K A;  1B4H A;  3SET A;  1UTH A;  2UVI A;  3G3G A;  2VPN A;  3GZG A;  4DXB A;  4H8I A;  4PET A;  1BK4 A;  3PUW E;  5ET7 A;  2F35 A;  1G0I A;  4NF6 A;  5H8Q A;  1AOV A;  5DEX B;  1D9V A;  4G2Z A;  1URS A;  1OVT A;  3VVD A;  4R75 A;  1Y3Q A;  4U1Z A;  1SPI A;  3FIR A;  5ELV A;  3PUV E;  4N6D A;  3PPN A;  3CHG A;  3I5O A;  5H8F B;  4EUO A;  5B70 A;  3M3L A;  2AL5 A;  4XKR A;  4F19 A;  4OFL A;  3MWB A;  2PX1 A;  4GL8 A;  2ZZX A;  1JEU A;  1NH7 A;  3O97 A;  5F1Q A;  5AA1 A;  1YTV A;  1KA1 A;  2H99 A;  3MST A;  1TT1 A;  2VT5 A;  3RN8 A;  2F5X A;  3K6V A;  4QFN A;  3IOW A;  3LSL A;  3U8Q A;  5B7D A;  3EQ1 A;  4NMY A;  1LBB A;  4PQJ A;  2Y5L A;  5J16 A;  4FED A;  2MKZ A;  4YMA A;  1P99 A;  1F9B A;  3TPA A;  4XTC Q;  5KDT B;  1FJ6 A;  5ESY A;  3HST A;  1VFD A;  1ZMG A;  2G93 A;  5I57 B;  2GHB A;  4XEQ A;  1IIW A;  3HPI A;  3IR1 A;  4QF9 A;  4O3C A;  5ICT A;  2OK2 A;  4AQ4 A;  4OAN A;  3A3U A;  4GWO A;  4PBQ A;  3PD8 A;  3DP6 A;  3B7D A;  5I2K B;  4YAH X;  4PFI A;  3KZG A;  1MXX A;  3QXM A;  4ZDM A;  3RYD A;  4IR8 A;  3KJ7 A;  4NWD A;  3OSR A;  4I3E A;  5ICQ A;  2WKY A;  5FHO A;  1K9Y A;  1SW1 A;  1SYH A;  3OO6 A;  1DK4 A;  3OEN A;  1PBQ A;  4C1T A;  2ZZV A;  1DTZ A;  3VV5 A;  1B58 A;  3RPL A;  5FBP A;  1OLA A;  4DZ1 A;  1MH3 A;  4P1L A;  3O28 A;  2QMX A;  4K3F A;  3Q26 A;  1BLF A;  2WX9 A;  3T9V A;  2PBW A;  3IJX B;  5LTC A;  4JWO A;  1A54 A;  1BTJ A;  2QMW A;  1LB9 A;  1B3H A;  3Q27 A;  4PAI A;  2D21 A;  2PCR A;  3O9P A;  4EF2 A;  5HPQ A;  1Y9U A;  1YCJ A;  3CG3 A;  2H9B A;  3B6W A;  5AE4 A;  4LQ5 A;  3GBB A;  4X9T A;  3FAS A;  2HAV A;  1JW1 A;  4HCW A;  1NNP A;  2LAO A;  1N3X A;  1ZU0 A;  2F36 A;  2H5Y A;  4BDN A;  2DWI A;  3TEL A;  4X04 A;  1LGB C;  2V3U A;  2OWZ A;  3SEV A;  3PPR A;  4DLD A;  2XXQ A;  2CZI A;  4AS5 A;  3LSF B;  1FBC A;  2X7Q A;  4X1D A;  5EQ9 A;  1FPF A;  4NG7 A;  3UA8 A;  3RGY A;  4JSO A;  3TUS A;  2QS2 A;  5AA4 A;  2RC7 A;  2IEE A;  2ZYN A;  3B6T A;  4ZEI A;  1B1X A;  3KN8 A;  4OVT A;  2HXR A;  1M5E A;  1NV5 A;  3N26 A;  1XVX A;  4RA1 A;  1RKM A;  1GGG A;  2DOJ A;  4JDF A;  2WEF A;  1MQJ A;  4EQ7 A;  3OEM A;  4GXS B;  3GBA A;  4ND9 A;  4RPO A;  4QSC A;  4GBV A;  4RJZ A;  1BP5 A;  1GVC A;  1Q9D A;  3LC8 A;  3MYU A;  4FOR A;  5F7V A;  1M5C A;  3FV2 A;  1Y3N A;  2O69 A;  2NOO A;  1LBC A;  4PFY A;  1QW0 A;  5H8F A;  3MVZ A;  1JET A;  1Y4T A;  2Q2A A;  1Q35 A;  4ZEC A;  1OMP A;  1IXC A;  1DPP A;  4O3B A;  2XWK A;  3T0J A;  1RDX A;  3OSQ A;  4NE4 A;  3DP8 A;  3SEU A;  3A09 A;  1B7H A;  2HZK A;  2XXY A;  4DXC A;  5L9O A;  2HHM A;  4DCY A;  2DWH A;  3HFU A;  1UIV A;  2DDK A;  1H45 A;  2KR0 A;  3D4G A;  3TDJ A;  1MH4 A;  4X48 A;  3PD9 A;  4R2F A;  2OZZ A;  2XXK A;  4MJO A;  1B0L A;  1B46 A;  5KDT A;  1FQD A;  4EXL A;  4OZ9 A;  4F29 A;  3FJM A;  4FIM A;  4LQ2 A;  3V8X B;  3SKP A;  5I57 A;  4N17 A;  3K1N A;  2FVZ A;  3TEP A;  2Y7K A;  5I5P A;  2R8T A;  4P56 A;  4MHF A;  1SI1 A;  5A5L A;  1SD3 A;  1B0H A;  5I2K A;  3OO8 A;  3LR1 A;  3PUZ E;  1SDX A;  5FTH A;  3K6U A;  2DE2 A;  1A8E A;  2XX9 A;  1A7L A;  1IEJ A;  4XIG Q;  2X7P A;  3KBR A;  3LSW A;  5I58 B;  4FEC A;  4PF8 A;  1NNF A;  3LSX A;  3TFL A;  1Y1Z A;  4H6D A;  1DPE A;  1N7W A;  4LP2 B;  3T9U A;  4KQP A;  2R9J A;  3KC0 A;  3IB1 A;  1B32 A;  1H3D A;  4ONY A;  4N6K A;  1YXI A;  5CBR A;  3EKI A;  5FHM A;  4YMB A;  3M3K A;  3EHU A;  2KLF A;  1I6A A;  2QFL A;  3VVE A;  1MPC A;  2GH9 A;  3TAJ A;  3VLU A;  4R2B A;  1JVX A;  2Y7W A;  2OWS A;  4G8N A;  3K1P A;  3R26 A;  4GOT A;  1EYK A;  4R9G A;  1US4 A;  3FD3 A;  1MM7 A;  1O7T A;  4JWY A;  4GQO A;  1JW4 A;  4L17 A;  4OVJ A;  3C36 A;  3HCQ A;  4TLL B;  3TQL A;  5IZ1 A;  2B4L A;  3RTW B;  2NWJ A;  4P0G A;  3TCG A;  1QKB A;  4F39 A;  3MZ1 A;  1NV4 A;  4ZE8 A;  3TTN A;  4R6K A;  1YZ0 A;  1MXY A;  4N8G A;  3H7M A;  5TU0 A;  4OA4 A;  3RNN A;  1NUW A;  4OEN A;  3PPQ A;  4GF8 A;  4NF8 B;  4E0W A;  2REJ A;  4HE1 A;  3T66 A;  4Z7E A;  3U93 A;  3CFX A;  3PMX A;  1NKX A;  1TFD A;  2ZNT A;  2Y7I A;  4LON B;  4U2R A;  1IMC A;  4F18 A;  2HEU A;  4H5G A;  4KYE A;  1P1N A;  3O6G A;  3IFC A;  4MBP A;  4EDP A;  4I62 A;  1MXU A;  1KA0 A;  5I59 B;  2ZYO A;  4LA9 A;  3S9E A;  2Z8F A;  3KFM A;  1LBV A;  4KD5 A;  3S9M C;  1J1N A;  1M5D A;  1B7Z A;  4U22 A;  3T96 B;  5L9S A;  1VSO A;  3TTK A;  1DBZ A;  5T3J A;  1IXG A;  4EF1 A;  4KCC A;  2F97 A;  4WKM A;  5AA3 A;  4U21 A;  1QKA A;  4JVD A;  3G3K A;  4M4G A;  4KYD A;  1LST A;  2VD3 A;  2XXH A;  2UYF A;  4MCO A;  2Q2C A;  1XVY A;  2IA4 A;  4EQB A;  1CNQ A;  3SER A;  3FXB A;  4NWC A;  4XKP A;  3T1B A;  4YKJ A;  3OMB A;  1NUZ A;  3IOR A;  2NVU B;  4KYS A;  2DE3 A;  3TCH A;  1FQC A;  4OQO A;  4RXL A;  4U23 A;  3SEX A;  4AS4 A;  3SEW A;  3IO6 A;  3KJT A;  5BWJ A;  4HS7 A;  1POT A;  5DVF A;  1FBH A;  1NV0 A;  4N91 A;  1PDA A;  3KBZ A;  1FCK A;  1FPI A;  1N04 A;  1KZ8 A;  1PB8 A;  1AH5 A;  3BFT A;  4YIC A;  1B4Z A;  5H8N B;  1IMF A;  1B3F A;  4F3G A;  2ESN A;  1LAG E;  5AA2 B;  4MF3 A;  2ZYK A;  3PMV A;  1MQG A;  4IGT A;  2B4M A;  3D4C A;  1N0T A;  4QSD A;  1LFG A;  1N3W A;  2XXI A;  4UAB A;  4P11 A;  4O94 A;  1FRP A;  2H4I A;  3IAZ A;  5CBS A;  1MY3 A;  4G4P A;  4DI4 B;  1FQF A;  4ELO A;  1NNT A;  4ECF A;  4H46 A;  3TKD A;  2F34 A;  4KI0 E;  3E9X A;  1MXZ A;  4MAG A;  4PDH A;  2XWV A;  2OWT A;  1B5J A;  2HPG A;  3NOH A;  3QSL A;  1FW0 A;  2UXA A;  4QXD A;  1VE4 A;  3T9X B;  3FVO A;  1SQY A;  4MLV A;  2Z23 A;  4HTG A;  1SW5 A;  3TQW A;  1FTJ A;  4WEP A;  3MBP A;  4GL0 A;  3C32 A;  3KEI A;  5ET8 A;  3I6V A;  4HE0 A;  4PCD A;  3MAM A;  2ANJ A;  3H6U A;  1R1N A;  1NUX A;  4UAC A;  1IIT A;  2REG A;  1IMA A;  4HW8 A;  3K4U A;  2JJK A;  3Q29 A;  2QVR A;  2NXO A;  4F1V A;  1O64 A;  1D9Q A;  1MY2 A;  2I3W A;  3DM0 A;  1FPD A;  4I40 A;  1IUD A;  1ELJ A;  2CEX A;  2DYX A;  3EHS A;  3V83 A;  4NAP A;  1AWB A;  4RNS A;  4NF8 A;  3G3I A;  2ABH A;  3K00 A;  2Z22 A;  3W9W A;  2VOZ A;  4QFL A;  2QL3 A;  1AMF A;  4ZZE A;  3ISP A;  4XFE A;  1TWY A;  1FBF A;  1ATG A;  4FBP A;  2ZXT A;  2FHY A;  4EQ9 A;  4P3L A;  1FPB A;  4F2Q A;  4PDD A;  3SES A;  3EF7 A;  2FIE A;  1R9L A;  3VVF A;  1FTA A;  5TPA B;  3ZKL A;  5I59 A;  2CZL A;  4I8C A;  3RT6 B;  3MVY A;  2XXP A;  4MNP A;  1IMB A;  1SI0 A;  1N84 A;  1JQF A;  5I84 A;  4THI A;  4OMB A;  3MPL A;  3PUX E;  3PPO A;  2DWA A;  1CB6 A;  1NV7 A;  3O66 A;  4AB6 A;  4YKK A;  1FQA A;  1SVX B;  4GD5 A;  1M5F A;  1S7Y A;  4IY5 A;  2M8C A;  4G68 C;  4PGP A;  3THI A;  2E0S A;  2VD2 A;  2VHA A;  5IM2 A;  4DE8 A;  2XXR A;  2PFY A;  4ZE9 A;  4GXA A;  3I3V A;  2Y84 A;  1RDY A;  3KN3 A;  3RY3 A;  3UK4 A;  4HXV A;  4H8J A;  3ILT B;  5ET6 A;  1GTK A;  1FSA A;  2O84 X;  3DP4 A;  3N94 A;  4GX3 A;  2GHA A;  3E4R A;  2DXR A;  4BDL A;  1JP4 A;  2FA7 A;  2P2A A;  1DSN A;  4H65 A;  3BBR A;  5CMB A;  4GVO A;  2A5T B;  3CIJ A;  3T22 A;  3RT8 A;  2F3D A;  1B9J A;  4ELR A;  2AYS A;  3IB0 A;  4R74 A;  3IK6 B;  2Q74 A;  1RDZ A;  4OWD A;  1IMD A;  1ZTY A;  3TTR A;  3TTL A;  1FTL A;  1H44 A;  4MMP A;  1D4N A;  5DEX A;  4F31 B;  5H8N A;  3IOV A;  5AA2 A;  3N6T A;  3ZKK A;  4Z0I A;  1B6H A;  2RCB A;  1MQH A;  1JEV A;  1LB8 A;  1SBP A;  2ZMB A;  1D3K A;  3U92 A;  4YU0 A;  4PGN A;  4LN5 A;  3BIH A;  3QYT A;  4NN3 A;  4FEB A;  4RK2 A;  1FTK A;  5DYH A;  1AIV A;  3GXA A;  4IO7 A;  4GFR A;  1IXH A;  3K6X A;  5I56 B;  1MY1 A;  5IZZ A;  1A40 A;  1O63 A;  3QIM A;  4FAT A;  4F3S A;  3N6U A;  3FVG A;  3KN7 A;  4KXP A;  2O7U A;  4N07 A;  1BKA A;  1URG A;  4JB7 A;  1FPE A;  3H06 B;  5EHM A;  3H6W A;  1NNK A;  1I6Q A;  1SW4 A;  4TQU Q;  1LAF E;  1JW5 A;  5ITO A;  2BJJ X;  3FBP A;  3A29 A;  4P1E A;  1R9Q A;  1B51 A;  3IB2 A;  4FE8 A;  1DCU A;  1GV8 A;  1TXF A;  1US5 A;  3AXF A;  2YPN A;  2I3V A;  4FJP A;  4OFO A;  3L6H A;  5IKB A;  4I9D A;  1SYI A;  1MRP A;  1P1U A;  3QMF A;  4AB5 A;  3GLB A;  2XXW A;  4OET A;  4PP0 A;  1OIB A;  4DDD A;  5FHN A;  2XWI A;  4MFI A;  4IO4 A;  3E78 A;  5H8Q B;  4NF5 B;  1FPG A;  1QUI A;  4PFW A;  3SDF A;  3HV1 A;  1NV3 A;  5HM4 B;  1MPB A;  4OVQ A;  1S9T A;  3U65 A; 
#chains in the Genus database with same CATH homology
 1ZJL A;  3BKI B;  3IX1 A;  1II5 A;  5TPA A;  3KSJ A;  5KZT A;  3IO4 A;  4F3B A;  3VXC A;  4H0W A;  4GIZ A;  1VR5 A;  3C9H A;  3UOR A;  3K1M A;  2FYI A;  3CFZ A;  1LCT A;  2PT1 A;  3TMG A;  4IO2 A;  5A5X B;  3KG2 A;  1YAE A;  4UA8 A;  4DXU A;  1D9Y A;  4ZZA A;  4F1Y A;  3U94 A;  3TCF A;  3HHF A;  3CRB A;  3U72 A;  4G77 A;  4BLA A;  3FVK A;  4TOZ A;  2DXY A;  1N7X A;  3FJ7 A;  1NMU A;  2F7C A;  1PEB A;  4ZED A;  1LFI A;  3JV9 A;  1POY 1;  3Q25 A;  3O29 A;  3V89 B;  4QSE A;  3FVN A;  3IJO B;  3LBS A;  4H67 A;  3RPW A;  2I0C A;  1FTO A;  2XXU A;  5H8H B;  2Y7R A;  5KCJ B;  1MDP 1;  1WDN A;  2A5T A;  3Q28 A;  2QRY A;  1XOC A;  3R7X A;  3EN3 A;  3KGC A;  5CC2 A;  4G68 B;  2P1S A;  4R6Y A;  5BUU A;  1MXW A;  3MP6 A;  1IXI A;  3MVW A;  4IB2 A;  4OES A;  1ZBM A;  3C31 A;  3O6H A;  4XXU A;  3MUQ A;  3PU5 A;  2FNC A;  1Z7N E;  2DS9 A;  3MC2 A;  3CSB A;  1B5H A;  2ZYM A;  1Y1M A;  2UVJ A;  4ESW A;  2D3I A;  4MLQ A;  3VLW A;  1HSL A;  1OQG A;  3UGW A;  3IOT A;  5M2V A;  2QS4 A;  5CRY A;  5ISU A;  4YKP A;  4QRZ A;  1MG1 A;  4JXI A;  2O68 A;  1I69 A;  5I56 A;  4ZEF A;  1UQW A;  4GRK A;  5CMK A;  1FQB A;  2A5S A;  4I1D A;  3FXR A;  4LZ5 A;  3BFU A;  2F6P A;  4Q8R A;  4ZEB A;  3E13 X;  1A99 A;  3MP8 A;  3FUZ A;  1OVB A;  4E0X A;  3L6G A;  2XXV A;  1MDQ A;  3S9L C;  3B6Q A;  1LAH E;  3G3H A;  4KFQ A;  3O2A A;  2NUV A;  4F22 A;  4RYA A;  4F1U A;  3T93 B;  4IO5 A;  1Y4C A;  2VGQ A;  1FQE A;  2RIN A;  1QUJ A;  4ELP A;  2OLB A;  2V3T A;  4G8H A;  1B3E A;  2F6G A;  4YKI A;  5I58 A;  4POX A;  2DVZ A;  3PGF A;  4JBZ A;  4DIG A;  2QS3 A;  4NF5 A;  3RQT A;  5EYF A;  1MY0 A;  4BDQ A;  1XC1 A;  2E1S A;  5FTI A;  2R6G E;  1N76 A;  2UVH A;  1B52 A;  2Q8J A;  5IAI A;  3UP9 A;  1XS5 A;  1B3L A;  4WXJ A;  1S50 A;  4IGR A;  1VFE A;  4LAT A;  4KCD A;  3H6V A;  3FXQ A;  4RY1 A;  3K01 A;  2GRV A;  5DT6 A;  3OO7 A;  4QFP A;  2F8D A;  3DLN A;  4H5F A;  1Y3P A;  3MZ9 A;  4R72 A;  1LAX A;  1NL5 A;  1MQI A;  2QS1 A;  3VDF A;  3VXB A;  4ZS9 A;  1ANF A;  5A5X A;  5DVI A;  2Q9T A;  3UN6 A;  1T0K A;  4ZEK A;  3IL1 B;  1B05 A;  3PPP A;  2R71 A;  2XHD A;  2DP8 A;  3C35 A;  3MVX A;  5TP9 B;  1MXV A;  2O1L A;  3FAT A;  2ZNS A;  5CMM A;  4RK9 A;  5I2N B;  5CMC A;  3N5L A;  4JWX A;  1BIY A;  3HN0 A;  2QPQ A;  3ONM A;  5LOM A;  4XKN A;  1USY E;  2UYE A;  2I4C A;  1PBP A;  5H8H A;  3W9V A;  5KCJ A;  4RPN A;  2DQV A;  3K02 A;  1ZKB A;  5JTY B;  1QUL A;  5J1D A;  2B3F A;  3IOU A;  4X1B A;  4G68 A;  3VLV A;  1PB7 A;  2O7I A;  4PFT A;  4G8M A;  3K2D A;  3M3F A;  1XT8 A;  1B1H A;  4DCX A;  1CE2 A;  4LVQ A;  3H6T A;  2I0B A;  1WOD A;  2DE4 A;  2VP1 A;  4H1X A;  4NTL A;  3QUJ A;  4OHN A;  4YB6 A;  4FAJ A;  4YB5 A;  2HFB A;  1NH8 A;  2B65 A;  4R6H A;  2UVG A;  3V5A A;  5JK4 A;  1MM6 A;  2Q88 A;  1AL3 A;  4IO3 A;  1EZP A;  2ONK E;  5HBC A;  2HXW A;  4OEU A;  1IQ7 A;  1XHY A;  2HAU A;  3VE1 B;  1QJM A;  2XX7 A;  1SW2 A;  1PC3 A;  3LUY A;  2RC8 A;  1KWH A;  3TYH A;  3FXU A;  2ZNU A;  1P1W A;  5JEI A;  2O51 A;  3DEL B;  4XKQ A;  3JYR A;  5L9M A;  1MQD A;  3S4U A;  5CM6 A;  2HQ0 A;  4QFO A;  3G3F A;  3RLF E;  1H43 A;  3C34 A;  1LCF A;  3RTF B;  3CSG A;  1TFA A;  1PB9 A;  3KOT A;  2I58 A;  4OEV A;  1DMB A;  3MP1 A;  1EZ9 A;  3F11 A;  2OJT A;  3CFL A;  4QFK A;  3T9H B;  3RUM A;  2GFE A;  2I49 A;  2V25 A;  3QK6 A;  5K2Y A;  1EZO A;  1LFH A;  4TLM B;  2RCA A;  2B3B A;  4F2O A;  2THI A;  1LLS A;  2QJE A;  1RYO A;  2D5W A;  1R6Z A;  2OBG A;  1FTM A;  1QUK A;  5L8D A;  4MH5 A;  2F78 A;  3CVG A;  3U1O A;  2H25 A;  4LZ7 A;  3TOD A;  2F7A A;  4N13 A;  4NF4 B;  1EH3 A;  3WAF A;  2Z8D A;  3FGS A;  1ZLQ A;  4C1U A;  2HCA A;  3OOA A;  4Q5T A;  4KPT A;  4OYV A;  3TTM A;  1I6B A;  2O1M A;  1B7U A;  3H4Z A;  4N6P A;  4KHZ E;  4YZZ A;  3E3K A;  2DSF A;  2PVU A;  5TP9 A;  2OCU A;  4O3A A;  1USY H;  1UTB B;  3ZSF A;  1JVY A;  2V93 A;  4NED A;  1UIU A;  5I2N A;  2DWJ A;  3PUY E;  1B3G A;  1UTH B;  2HZL A;  3OO9 A;  4U1O A;  2XXX A;  4OFJ A;  5ITP A;  4WED A;  4ELQ A;  4NF6 B;  4PE5 B;  1QVS A;  2W7Y A;  4IO6 A;  4M1V A;  4QHQ A;  5JTY A;  2P0S A;  3ODB A;  2ONR A;  3USD A;  3EPE A;  1EU8 A;  3ECR A;  1B5I A;  1ZIU A;  4BDR A;  3R6U A;  3C33 A;  2X26 A;  1WVJ A;  1P1O A;  3O6I A;  1URD A;  1NFT A;  4POW A;  2V84 A;  5AA2 D;  2H98 A;  2PYY A;  2QSX A;  4HCY A;  4ISU A;  3ZS6 A;  5H8S A;  3OXN A;  4R73 A;  3PMW A;  5EHS A;  4Q30 B;  2YLN A;  2RKM A;  3CG1 A;  4U4X A;  1OQH A;  3HHG A;  1YPN A;  4BDO A;  2DVC A;  1B40 A;  2YJP A;  3K0V A;  3MJN A;  3OEK A;  3WAE A;  3TZA A;  3H03 A;  4KR5 A;  1DOT A;  2I48 A;  3OEL A;  2AIX A;  3K6W A;  3S2V A;  3UIF A;  3HO7 A;  4BDM A;  1L5T A;  1MS7 A;  3PV0 E;  4U4S A;  1MPD A;  2Q89 A;  2PMS A;  1A55 A;  2XD3 A;  5DVJ A;  3CI8 A;  2XX8 A;  1RYX A;  4P0I A;  2F7B A;  2I4B A;  3FV1 A;  5DTB A;  1Z7M E;  3M8U A;  5CI5 A;  3SEY A;  3CR9 A;  2O6A A;  3OD7 A;  2ONS A;  5K2X A;  2Y7P A;  3JZJ A;  2Z8E A;  4R9F A;  4ESX A;  3FZV A;  2CMO A;  3H3G A;  3W15 C;  4YB7 A;  3KSX A;  4IY6 A;  3S9N C;  4PFU A;  1GR2 A;  4OXV A;  2PT2 A;  4OER A;  2ALU A;  4GLI A;  1H76 A;  1MY4 A;  3A3C A;  3G7W A;  2RC9 A;  4EXK A;  3P7I A;  1M5B A;  3FJG A;  2V3Q A;  3MW0 A;  2G29 A;  3C4M A;  3VFJ A;  4JSD A;  1Y20 A;  1IZ1 A;  3MPK A;  3MQ9 A;  4NF4 A;  3G3J A;  3QUF A;  2AL4 A;  1OLC A;  3ILU B;  2XXT A;  3KOS A;  4Q0C A;  1DTG A;  3EHT A;  4F3P A;  4OTE A;  2XD2 A;  1A8F A;  2RF1 A;  1JNF A;  1HSE A;  4LUB A;  3MZB A;  2I6E A;  1HSJ A;  1UTB A;  1B2H A;  4LZ8 A;  1P1Q A;  4C0R A;  3QAX A;  5AA4 B;  1Q1K A;  1B4H A;  3SET A;  1UTH A;  2UVI A;  3G3G A;  3GZG A;  4DXB A;  4H8I A;  4PET A;  3PUW E;  2F35 A;  4NF6 A;  5H8Q A;  1AOV A;  5DEX B;  1D9V A;  4G2Z A;  1URS A;  1OVT A;  3VVD A;  4R75 A;  1Y3Q A;  4U1Z A;  3FIR A;  5ELV A;  3PUV E;  3PPN A;  4EUO A;  3I5O A;  5H8F B;  5B70 A;  3M3L A;  2AL5 A;  4XKR A;  4F19 A;  4OFL A;  3MWB A;  2PX1 A;  4GL8 A;  1JEU A;  1NH7 A;  3O97 A;  5F1Q A;  5AA1 A;  1YTV A;  2H99 A;  1TT1 A;  3RN8 A;  2F5X A;  3K6V A;  4QFN A;  3IOW A;  3LSL A;  3U8Q A;  5B7D A;  3EQ1 A;  4NMY A;  1LBB A;  4PQJ A;  4FED A;  4YMA A;  1P99 A;  1F9B A;  3TPA A;  4XTC Q;  5KDT B;  3HST A;  1VFD A;  1ZMG A;  2G93 A;  5I57 B;  2GHB A;  1IIW A;  3HPI A;  3IR1 A;  4QF9 A;  4O3C A;  5ICT A;  2OK2 A;  4AQ4 A;  3A3U A;  4GWO A;  3PD8 A;  3DP6 A;  3B7D A;  5I2K B;  4YAH X;  3KZG A;  1MXX A;  3QXM A;  4ZDM A;  3KJ7 A;  4NWD A;  3OSR A;  5ICQ A;  2WKY A;  5FHO A;  1SW1 A;  1SYH A;  3OO6 A;  3OEN A;  1PBQ A;  4C1T A;  3VV5 A;  1DTZ A;  1B58 A;  1OLA A;  4DZ1 A;  1MH3 A;  3O28 A;  2QMX A;  4K3F A;  3Q26 A;  1BLF A;  3T9V A;  2PBW A;  3IJX B;  4JWO A;  1A54 A;  1BTJ A;  2QMW A;  1LB9 A;  1B3H A;  3Q27 A;  2D21 A;  3O9P A;  4EF2 A;  5HPQ A;  1Y9U A;  1YCJ A;  3CG3 A;  2H9B A;  3B6W A;  5AE4 A;  4LQ5 A;  3GBB A;  4X9T A;  3FAS A;  2HAV A;  1JW1 A;  4HCW A;  1NNP A;  2LAO A;  1N3X A;  1ZU0 A;  2F36 A;  2H5Y A;  4BDN A;  2DWI A;  3TEL A;  1LGB C;  2V3U A;  3SEV A;  3PPR A;  4DLD A;  2XXQ A;  3LSF B;  2X7Q A;  4X1D A;  3UA8 A;  3RGY A;  4JSO A;  3TUS A;  2QS2 A;  5AA4 A;  2RC7 A;  2IEE A;  2ZYN A;  3B6T A;  4ZEI A;  1B1X A;  3KN8 A;  1M5E A;  3N26 A;  1XVX A;  4RA1 A;  1RKM A;  1GGG A;  2DOJ A;  4JDF A;  1MQJ A;  4EQ7 A;  3OEM A;  4GXS B;  3GBA A;  4ND9 A;  4RPO A;  4QSC A;  4RJZ A;  1BP5 A;  1GVC A;  3LC8 A;  4FOR A;  5F7V A;  1M5C A;  3FV2 A;  1Y3N A;  2O69 A;  2NOO A;  1LBC A;  4PFY A;  1QW0 A;  5H8F A;  3MVZ A;  1JET A;  1Y4T A;  2Q2A A;  1Q35 A;  4ZEC A;  1OMP A;  1IXC A;  1DPP A;  4O3B A;  3OSQ A;  4NE4 A;  3DP8 A;  3SEU A;  3A09 A;  1B7H A;  2HZK A;  2XXY A;  4DXC A;  5L9O A;  4DCY A;  2DWH A;  1UIV A;  1H45 A;  3D4G A;  3TDJ A;  1MH4 A;  4X48 A;  3PD9 A;  4R2F A;  2OZZ A;  1B0L A;  1B46 A;  5KDT A;  4EXL A;  1FQD A;  4OZ9 A;  4F29 A;  3FJM A;  4FIM A;  4LQ2 A;  3V8X B;  3SKP A;  5I57 A;  3K1N A;  3TEP A;  2Y7K A;  1SI1 A;  1SD3 A;  1B0H A;  5I2K A;  3OO8 A;  3LR1 A;  3PUZ E;  1SDX A;  5FTH A;  3K6U A;  2DE2 A;  1A8E A;  2XX9 A;  1A7L A;  1IEJ A;  4XIG Q;  2X7P A;  3KBR A;  3LSW A;  5I58 B;  4FEC A;  1NNF A;  3LSX A;  3TFL A;  1Y1Z A;  4H6D A;  1DPE A;  1N7W A;  4LP2 B;  3T9U A;  4KQP A;  2R9J A;  3IB1 A;  1B32 A;  1H3D A;  4ONY A;  5CBR A;  5FHM A;  4YMB A;  3M3K A;  3EHU A;  2KLF A;  1I6A A;  3VVE A;  1MPC A;  2GH9 A;  3TAJ A;  3VLU A;  4R2B A;  1JVX A;  2Y7W A;  2OWS A;  4G8N A;  3K1P A;  3R26 A;  4GOT A;  4R9G A;  1US4 A;  3FD3 A;  1MM7 A;  1O7T A;  4JWY A;  4GQO A;  1JW4 A;  4L17 A;  4OVJ A;  3C36 A;  3HCQ A;  4TLL B;  3TQL A;  3RTW B;  2NWJ A;  4P0G A;  3TCG A;  1QKB A;  4F39 A;  3MZ1 A;  4ZE8 A;  3TTN A;  4R6K A;  1MXY A;  3H7M A;  5TU0 A;  3RNN A;  4OEN A;  3PPQ A;  4GF8 A;  4NF8 B;  4E0W A;  2REJ A;  3T66 A;  4Z7E A;  3U93 A;  3CFX A;  3PMX A;  1NKX A;  1TFD A;  2ZNT A;  2Y7I A;  4LON B;  4U2R A;  4F18 A;  2HEU A;  4H5G A;  4KYE A;  1P1N A;  3O6G A;  4MBP A;  4EDP A;  4I62 A;  1MXU A;  5I59 B;  2ZYO A;  4LA9 A;  3S9E A;  2Z8F A;  3KFM A;  4KD5 A;  3S9M C;  1J1N A;  1M5D A;  1B7Z A;  4U22 A;  3T96 B;  5L9S A;  1VSO A;  3TTK A;  1IXG A;  4EF1 A;  4KCC A;  2F97 A;  4WKM A;  5AA3 A;  4U21 A;  1QKA A;  3G3K A;  4M4G A;  4KYD A;  1LST A;  2VD3 A;  2XXH A;  2UYF A;  2Q2C A;  1XVY A;  2IA4 A;  4EQB A;  3SER A;  4NWC A;  4XKP A;  4YKJ A;  3OMB A;  3IOR A;  2NVU B;  4KYS A;  2DE3 A;  3TCH A;  1FQC A;  4OQO A;  4RXL A;  4U23 A;  3SEX A;  3SEW A;  3IO6 A;  3KJT A;  5BWJ A;  4HS7 A;  1POT A;  5DVF A;  1PDA A;  1FCK A;  1N04 A;  1PB8 A;  1AH5 A;  3BFT A;  4YIC A;  1B4Z A;  5H8N B;  1B3F A;  4F3G A;  2ESN A;  1LAG E;  5AA2 B;  4MF3 A;  2ZYK A;  3PMV A;  1MQG A;  4IGT A;  3D4C A;  1N0T A;  4QSD A;  1LFG A;  1N3W A;  2XXI A;  4P11 A;  3IAZ A;  2H4I A;  5CBS A;  1MY3 A;  4G4P A;  1FQF A;  4ELO A;  1NNT A;  4ECF A;  3TKD A;  2F34 A;  4KI0 E;  3E9X A;  1MXZ A;  2OWT A;  1B5J A;  3QSL A;  1FW0 A;  2UXA A;  1VE4 A;  3T9X B;  3FVO A;  1SQY A;  4MLV A;  2Z23 A;  4HTG A;  1SW5 A;  3TQW A;  1FTJ A;  4WEP A;  3MBP A;  4GL0 A;  3C32 A;  3KEI A;  3I6V A;  3MAM A;  2ANJ A;  3H6U A;  1R1N A;  4UAC A;  1IIT A;  2REG A;  4HW8 A;  3K4U A;  3Q29 A;  2NXO A;  4F1V A;  1MY2 A;  1O64 A;  2I3W A;  3DM0 A;  1IUD A;  1ELJ A;  2DYX A;  3EHS A;  3V83 A;  4RNS A;  4NF8 A;  3G3I A;  2ABH A;  3K00 A;  2Z22 A;  3W9W A;  2VOZ A;  4QFL A;  2QL3 A;  1AMF A;  4ZZE A;  1TWY A;  1ATG A;  2ZXT A;  4EQ9 A;  4F2Q A;  3SES A;  3EF7 A;  1R9L A;  3VVF A;  5TPA B;  3ZKL A;  5I59 A;  2CZL A;  4I8C A;  3RT6 B;  3MVY A;  2XXP A;  1SI0 A;  1N84 A;  1JQF A;  5I84 A;  4THI A;  4OMB A;  3MPL A;  3PUX E;  3PPO A;  2DWA A;  1CB6 A;  3O66 A;  4AB6 A;  4YKK A;  1FQA A;  1SVX B;  4GD5 A;  1M5F A;  1S7Y A;  4IY5 A;  2M8C A;  4G68 C;  3THI A;  2E0S A;  2VD2 A;  2VHA A;  4DE8 A;  2XXR A;  4ZE9 A;  4GXA A;  3I3V A;  2Y84 A;  3KN3 A;  3RY3 A;  3UK4 A;  4H8J A;  3ILT B;  1GTK A;  2O84 X;  3DP4 A;  3N94 A;  2GHA A;  3E4R A;  2DXR A;  4BDL A;  2FA7 A;  2P2A A;  1DSN A;  4H65 A;  3BBR A;  5CMB A;  4GVO A;  2A5T B;  3CIJ A;  3T22 A;  3RT8 A;  1B9J A;  4ELR A;  2AYS A;  3IB0 A;  4R74 A;  3IK6 B;  4OWD A;  1ZTY A;  3TTR A;  3TTL A;  1FTL A;  1H44 A;  1D4N A;  5DEX A;  4F31 B;  5H8N A;  3IOV A;  5AA2 A;  3N6T A;  3ZKK A;  4Z0I A;  1B6H A;  2RCB A;  1MQH A;  1JEV A;  1LB8 A;  1SBP A;  2ZMB A;  1D3K A;  3U92 A;  4YU0 A;  3QYT A;  4FEB A;  4RK2 A;  1FTK A;  5DYH A;  1AIV A;  3GXA A;  4IO7 A;  4GFR A;  1IXH A;  3K6X A;  5I56 B;  1MY1 A;  4FAT A;  1A40 A;  1O63 A;  3QIM A;  4F3S A;  3N6U A;  3FVG A;  3KN7 A;  2O7U A;  4N07 A;  1BKA A;  1URG A;  4JB7 A;  3H06 B;  5EHM A;  3H6W A;  1NNK A;  1I6Q A;  1SW4 A;  4TQU Q;  1LAF E;  1JW5 A;  5ITO A;  2BJJ X;  1R9Q A;  1B51 A;  3IB2 A;  4FE8 A;  1GV8 A;  1TXF A;  1US5 A;  3AXF A;  2YPN A;  2I3V A;  4FJP A;  4OFO A;  3L6H A;  5IKB A;  4I9D A;  1SYI A;  1MRP A;  1P1U A;  4AB5 A;  3GLB A;  2XXW A;  4OET A;  4PP0 A;  1OIB A;  4DDD A;  5FHN A;  4MFI A;  4IO4 A;  5H8Q B;  4NF5 B;  1QUI A;  4PFW A;  3SDF A;  3HV1 A;  5HM4 B;  1MPB A;  1S9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...