4M4GA

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium lt2 in complex with effector ligand, n-acetylserine.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium LT2 in complex with effector ligand, N-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
total genus 57
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4m4gA02
4JWOA 1R9QA 2YPNA 3KJ7A 3KN8A 1B46A 3FVOA 4G8MA 1FCKA 1JEUA 5CM6A 5H8SA 2IEEA 4JDFA 5I2KB 2VD3A 4OERA 2G93A 4GD5A 4NF6B 1Y1MA 3MUQA 4NWCA 4BLAA 4NE4A 2HAUA 1LFHA 4WEPA 5CBSA 4OQOA 1QW0A 2AL5A 2DXYA 4ZZAA 4AQ4A 4MLVA 1LCFA 1OMPA 4NEDA 3CVGA 2H25A 3L6GA 2G29A 1SW2A 1LAHE 5FHMA 2H9BA 3QIMA 5DEXB 4MFIA 2H98A 3H03A 3TKDA 2AIXA 3MJNA 3F11A 3H4ZA 2O84X 3HN0A 4POXA 4G77A 3N94A 4YB7A 3DM0A 2W7YA 3O2AA 5F7VA 2VD2A 4DCYA 4F2QA 3FJ7A 4I1DA 1MG1A 3VXBA 4TQUQ 3TTNA 4YB5A 2PT2A 3RTWB 1R6ZA 4NWDA 3U8QA 4OZ9A 1MDQA 1D9VA 1MY1A 1S7YA 4POWA 1LBBA 1B9JA 1WODA 1ZTYA 3LUYA 1MQJA 1NNKA 3O9PA 3R6UA 2Y7IA 1Y3QA 3P7IA 1OVTA 3EQ1A 5FTHA 1B58A 5FTIA 2PYYA 4GL8A 2PBWA 5EHMA 4ZS9A 3TCGA 3N26A 3S9MC 2I4BA 1EZPA 1N3WA 4H5FA 4BDMA 5K2XA 1MQGA 2I4CA 3GBBA 5JK4A 3PUYE 4KCCA 1B40A 4QF9A 3PD8A 4OHNA 4YKJA 5L9OA 2DWAA 4FEDA 2X7PA 3PUXE 4R6YA 4BDRA 1B51A 1Y4CA 3FXUA 4JSOA 4WKMA 4TLMB 3LSFB 1HSEA 3AXFA 2HCAA 2XXRA 1JW4A 4EF1A 2XXYA 4P0IA 3UGWA 4R6KA 3DP8A 3OO9A 5I57A 3WAFA 4JSDA 1GTKA 1UTHB 3FVNA 2X26A 2H99A 3C31A 3PPRA 5I84A 1MPDA 4C0RA 3TPAA 2I58A 2HFBA 1P1OA 3G3KA 1M5FA 2RC9A 1SW1A 1B3EA 4PFTA 2Z8FA 3MC2A 4NF8B 4Q0CA 3IORA 1XHYA 4OEVA 1MXYA 1RYOA 1Y3PA 4Q5TA 4O3AA 4E0XA 4R2BA 3H06B 3IK6B 4IB2A 4UACA 4Z0IA 3DP4A 2ZNUA 4G8NA 3TZAA 4BDLA 1Q1KA 4KYEA 4R9GA 3H6WA 2DOJA 2FA7A 3PUVE 2Z8DA 1EU8A 2ALUA 3TTMA 1SD3A 3TUSA 4IO4A 2O1LA 3QXMA 4OENA 4DXBA 1D3KA 3KN7A 4LZ5A 4U4SA 4FECA 4DE8A 4OETA 2ZXTA 1B3GA 5CMCA 3S4UA 4ESWA 4BDNA 5CMKA 4ZDMA 3Q28A 3PMXA 5TPAA 3THIA 4DCXA 3RLFE 4RK2A 5DVFA 3ILTB 2OZZA 3FIRA 2XXPA 2DSFA 4UA8A 1OLAA 3MP8A 2REGA 2O69A 4N6PA 1B4HA 5AA4A 2DE3A 3LR1A 2DVCA 1Y3NA 1A7LA 2I0BA 2DWHA 2ZMBA 3G3JA 3PPQA 4ONYA 4G68C 1QJMA 3K6UA 3OO8A 4DDDA 5AA2B 3C4MA 1O7TA 4FJPA 3FXQA 1DPPA 3U93A 4MF3A 3U1OA 4M4GA 4U1OA 1MXVA 4RY1A 1VSOA 1ZKBA 1S50A 2D5WA 1SYIA 3T66A 1B7ZA 4PFYA 4EDPA 1FW0A 3MAMA 4LVQA 4EXKA 1TXFA 2DE4A 2B3FA 3TFLA 2XD3A 4EXLA 3K02A 3LBSA 3TDJA 1H43A 1MM7A 4AB5A 5ICQA 5HM4B 1B52A 1MY0A 3IX1A 5I59A 3KG2A 2HZKA 1GGGA 1QVSA 2R6GE 4LZ8A 3ECRA 4IY5A 4PE5B 2I0CA 1CB6A 2QJEA 3C34A 1Y20A 3FVKA 3LC8A 4NF4B 3PMWA 4G4PA 1T0KA 2YLNA 1FTOA 3IL1B 2KLFA 3OELA 4R6HA 1LAGE 1WVJA 4GQOA 1LAXA 3HV1A 2QS1A 3SEVA 1LCTA 1M5EA 4BDQA 4RK9A 1N84A 1VR5A 1A54A 2BJJX 2XXQA 1UQWA 3GBAA 3W9VA 3BKIB 3RTFB 4NF8A 2QS3A 2AL4A 4HS7A 2WKYA 5CMBA 4BDOA 5I2NA 4N13A 2V3QA 3M3LA 3I3VA 3ZS6A 3V89B 1ATGA 2QMWA 4DIGA 1US5A 3OSRA 1BLFA 1B6HA 4LUBA 4H0WA 1QUIA 3PGFA 1MH3A 1BKAA 2R9JA 4PP0A 4QFLA 5FHOA 1BTJA 1LLSA 5M2VA 4P0GA 4KR5A 4QSDA 1B0LA 3VVFA 2HQ0A 3SKPA 3K6XA 1AOVA 1URDA 1FTKA 2UXAA 1AMFA 4GOTA 3BFUA 3UIFA 3H3GA 1N0TA 2F8DA 1P1NA 4HCYA 2F36A 1A55A 3QYTA 1KWHA 4NMYA 1FQCA 1MQIA 4EF2A 4G8HA 1LB9A 2F78A 3B6WA 4HTGA 4OWDA 3RN8A 4X1DA 1Z7ME 4F39A 3IOTA 4IO2A 2A5SA 3VV5A 1MPCA 1P99A 4PFUA 4ZE8A 1LFGA 4NF5B 3D4GA 3O29A 4FAJA 3HPIA 4F22A 1B7UA 4OXVA 5DEXA 3C32A 5TP9B 3UORA 2A5TB 4ESXA 1ZU0A 1DTGA 2X7QA 1UIUA 4THIA 4AB6A 4Q8RA 5AA2A 2OJTA 4KQPA 5CRYA 2H4IA 3SERA 3U94A 2F5XA 1B3LA 1FQDA 3KZGA 4IO6A 4X1BA 4YKKA 1DTZA 5HPQA 1MXWA 3TQLA 1XOCA 4DXCA 2OBGA 4F31B 2VP1A 1IQ7A 1QKAA 3O97A 2OWTA 5I2KA 1USYH 1H3DA 5I56A 3KN3A 4XKPA 3V8XB 4KHZE 3G3GA 4U21A 4YZZA 4ELRA 3EHTA 2F97A 2RKMA 1SW4A 3FVGA 4L17A 3HCQA 1EH3A 3H6TA 3N6UA 4QFNA 1URSA 4IGRA 5KCJB 3MZBA 2I6EA 5ELVA 3Q26A 2A5TA 3O66A 3PPOA 2PT1A 5AA2D 1MH4A 5ICTA 4R73A 3CSBA 4ZECA 1Y1ZA 3O28A 2QL3A 3QK6A 2Y84A 3FGSA 3CRBA 5H8FB 3BFTA 1MS7A 2D3IA 3IOUA 4FEBA 4PETA 1QKBA 4U23A 2UVIA 4JWYA 1LGBC 3IO4A 3KOSA 3G7WA 5KDTA 2Q2CA 2P1SA 2QPQA 1I6AA 3SEXA 1HSLA 2CZLA 2GH9A 2Q9TA 2Y7RA 2Z23A 3UN6A 3PPPA 4OYVA 1DPEA 1FQAA 1PB8A 4IO7A 4O3CA 3W9WA 2XX7A 3ZKLA 3Q25A 1S9TA 4F1UA 1XC1A 4PQJA 3MVZA 4IO3A 5K2YA 1N3XA 1O64A 5B7DA 1USYE 3T96B 4H67A 4LQ2A 1B7HA 2HXWA 4G68A 4X9TA 4GL0A 3FV1A 3O6IA 1FTJA 3RGYA 1OQHA 2O6AA 4OFLA 2OK2A 2XXUA 3FASA 4LONB 4QRZA 4ND9A 1B5JA 4U2RA 4Z7EA 3O6HA 1RYXA 1QUJA 3OOAA 4ELQA 3CFZA 3VFJA 3WAEA 1B4ZA 1YPNA 3I6VA 1A8FA 1AIVA 3ZKKA 4F29A 2QMXA 2OCUA 4TOZA 3C36A 1XS5A 2D21A 2ZYNA 1XVXA 3G3IA 3VVEA 5DTBA 4DXUA 1YTVA 2DE2A 1XVYA 2Z8EA 4LA9A 3G3HA 2GHAA 3IJOB 4KYSA 5H8QA 3OO6A 3MQ9A 2XX8A 5I58A 2ZNSA 4H65A 3EN3A 4RYAA 1CE2A 4HW8A 1MXXA 5H8NB 4I9DA 4YAHX 2NVUB 1ANFA 1SBPA 3FJGA 1QUKA 3W15C 1NNFA 1ZJLA 3GLBA 4YICA 3VDFA 3KOTA 5AA4B 5B70A 1B05A 1WDNA 1IEJA 1ZMGA 3MPLA 4JWXA 4DZ1A 3G3FA 4NF6A 3R26A 4I8CA 3EHSA 2Q89A 3PU5A 1ZLQA 4RPNA 3MZ9A 1I69A 1NFTA 1SVXB 2HEUA 1B3FA 3OXNA 4FORA 1TFAA 4GRKA 1ELJA 1IXHA 3MVYA 4O3BA 4OMBA 2ZYOA 2ESNA 3IB0A 4YKIA 4JXIA 3OMBA 4OTEA 1Y9UA 3CFLA 4QFPA 3TMGA 1O63A 3QUFA 4RNSA 3ZSFA 5JEIA 1PB7A 5CMMA 1DSNA 5ISUA 1PDAA 3OSQA 3PMVA 5I58B 3MP1A 1H45A 2ZYMA 4KPTA 5H8NA 3T9XB 3IB1A 1NKXA 1NL5A 1GVCA 2E0SA 2UVHA 3ILUB 4ECFA 4QFKA 3USDA 1NMUA 2O7IA 4GFRA 3FZVA 3FXRA 3SETA 1JW1A 1ZIUA 2F35A 3DELB 3N5LA 4ZEKA 5A5XB 3K01A 1B2HA 3GXAA 1NNTA 4ZEDA 5DYHA 1OQGA 5EYFA 2DWIA 2NOOA 3T9UA 1PBPA 1MY2A 3FUZA 3KGCA 3EPEA 1N7XA 5FHNA 4ZEFA 3KSJA 1M5CA 4MLQA 4EQ9A 3D4CA 4OEUA 4PFWA 2Y7KA 3U92A 2Y7PA 4KFQA 4NTLA 3K6WA 4R74A 4OFJA 4LATA 1N7WA 3UP9A 4FATA 3SEUA 3KBRA 1EZ9A 2REJA 1ZBMA 2ZYKA 3T93B 1PBQA 3HSTA 4C1TA 1MDP1 1Y4TA 4MBPA 5I2NB 4KYDA 2LAOA 3PD9A 3PPNA 5J1DA 2P0SA 4H8IA 2XD2A 2GHBA 2ANJA 2VGQA 2XHDA 2XXWA 2V3TA 3JYRA 5KCJA 1BIYA 3FJMA 3SEWA 4IGTA 3EF7A 3BBRA 4XKRA 5H8FA 4ZEBA 2QS2A 4XKQA 4G2ZA 4XTCQ 3QUJA 1VFDA 2P2AA 3TAJA 5L8DA 1B1HA 4QSEA 3M3FA 3DP6A 1JEVA 1SI1A 2RF1A 2ONKE 3HO7A 1MQHA 1YCJA 3ONMA 4JB7A 2HZLA 4JBZA 1A8EA 1YAEA 4QHQA 4ZEIA 4F3PA 1IXCA 1I6BA 2DP8A 1B5IA 4FE8A 4GXAA 1JQFA 5BUUA 1Z7NE 4F19A 2O51A 3E9XA 4R9FA 5TP9A 5DVIA 4ELPA 3K6VA 4GWOA 3VE1B 4EQBA 4U22A 2V3UA 1XT8A 3UK4A 5IKBA 1AL3A 5DT6A 2F7AA 1UTBB 3VVDA 1MRPA 3PV0E 1D9YA 3C35A 1M5DA 3HHGA 4H6DA 2I3WA 4R2FA 3OO7A 2OWSA 3Q27A 4KCDA 2XXHA 1B5HA 1B0HA 1P1WA 2V84A 1L5TA 2F6GA 3PUWE 5L9SA 3LSLA 1N04A 3TTKA 2RC7A 1IZ1A 1IUDA 3CFXA 2Y7WA 3CI8A 3JZJA 3TTRA 1MM6A 2F6PA 2F7BA 3Q29A 2O1MA 2DS9A 4F2OA 4P11A 2OLBA 3RUMA 1MQDA 5TPAB 5JTYB 3H6VA 3PUZE 4XIGQ 3TODA 2Z22A 3K00A 3U72A 5DVJA 4IY6A 1FTLA 2B65A 2O68A 4FIMA 3FATA 1JW5A 2ONRA 4R75A 2QRYA 1BP5A 1TWYA 1FQBA 3A09A 3C33A 2DWJA 4GF8A 2I3VA 4Q30B 3SEYA 3VLUA 4LZ7A 1A40A 5CC2A 4LQ5A 1H76A 4XKNA 1LAFE 2THIA 1IXIA 2PVUA 3TYHA 4GVOA 5AA1A 3IR1A 4F18A 2RINA 4H8JA 4MH5A 3RQTA 3IOVA 3C9HA 3SESA 1TFDA 1SQYA 5I59B 2NUVA 4M1VA 2UYFA 3QSLA 5H8HB 1R9LA 1URGA 2I49A 3OEMA 4H1XA 5JTYA 2XXXA 3RY3A 1FQFA 1OIBA 2RC8A 2QSXA 4G68B 2RCBA 5AE4A 3MWBA 2O7UA 3S9NC 1I6QA 4GXSB 5I57B 4KD5A 3LSWA 1OLCA 1IIWA 3IOWA 5HBCA 1MXZA 3KJTA 1HSJA 3V83A 2ZNTA 2DQVA 3H6UA 2ABHA 2YJPA 3IO6A 3K1MA 4WXJA 3RT8A 4YKPA 1LFIA 2UVJA 3MVWA 2CMOA 1NH8A 3RT6B 4U4XA 4H5GA 3IJXB 4OVJA 1IITA 1SI0A 3QAXA 3E4RA 1J1NA 4HCWA 4GLIA 3TCHA 1D4NA 4RA1A 3TQWA 2M8CA 2E1SA 3S9LC 2FNCA 4TLLB 1N76A 4X48A 1GV8A 2I48A 3N6TA 3RPWA 3B6TA 5I56B 1POY1 5CI5A 2F34A 3K1PA 3OEKA 4F3SA 1OVBA 3H7MA 1DOTA 3E13X 3KSXA 3MP6A 5EHSA 1GR2A 2HAVA 1JVXA 5ITPA 1MY3A 3GZGA 1PEBA 2Q88A 2XX9A 1IXGA 1VFEA 3MVXA 5ITOA 3MPKA 1SDXA 3TCFA 2V25A 2VOZA 1FQEA 1P1QA 1II5A 1POTA 3A3UA 3CG3A 1UTBA 3IB2A 1MXUA 4NF5A 4YU0A 5F1QA 2GFEA 2Q2AA 4F1YA 3KFMA 1TT1A 3OENA 1US4A 5LOMA 2RCAA 1H44A 3OD7A 1LB8A 3VXCA 1VE4A 3MW0A 4I62A 4K3FA 4N07A 2XXIA 1SW5A 1PC3A 3TEPA 3T9HB 2F7CA 4OFOA 1LBCA 1Q35A 2B3BA 1NNPA 2FYIA 3HHFA 3S9EA 3DLNA 3RNNA 4ZZEA 3EHUA 3FD3A 3MZ1A 1PB9A 3VLVA 4F3GA 1M5BA 2V93A 2XXTA 5H8QB 3T9VA 3L6HA 1B3HA 2QS4A 4RJZA 1EZOA 3CIJA 2NXOA 3JV9A 2DYXA 3K1NA 5KZTA 1B32A 2DXRA 1MY4A 3KEIA 1JNFA 1MPBA 4RXLA 1DMBA 3CR9A 3SDFA 5CBRA 2IA4A 4QSCA 4EQ7A 3MBPA 4KI0E 5H8HA 1NH7A 2XXVA 4C1UA 1RKMA 2H5YA 3CSGA 1UIVA 3ODBA 4QFOA 2Q8JA 4ZE9A 4WEDA 3R7XA 4R72A 1LSTA 2VHAA 1SYHA 3S2VA 3K4UA 1B1XA 1FTMA 1JVYA 2PMSA 1QULA 3K0VA 3LSXA 2UVGA 3O6GA 4YB6A 4E0WA 5TU0A 4ELOA 4F1VA 5L9MA 3UA8A 2PX1A 1UTHA 2UYEA 4NF4A 3TTLA 4XXUA 1AH5A 2ONSA 3FV2A 4U1ZA 3T22A 4RPOA 4YMAA 4YMBA 4EUOA 2GRVA 3V5AA 3E3KA 3IAZA 3TELA 2DVZA 4ISUA 4DLDA 5BWJA 2NWJA 3B7DA 5IAIA 3I5OA 2R71A 4LP2B 3M8UA 4F3BA 5AA3A 4IO5A 4OESA 1F9BA 1JETA 3A3CA 5A5XA 3M3KA 4GIZA 1R1NA 2AYSA 3VLWA 5KDTB 3B6QA 1A99A 3CG1A 3K2DA 1P1UA
chains in the Genus database with same CATH superfamily
2YPNA 3KJ7A 1B46A 5I2KB 4OERA 2G93A 4NWCA 4XEQA 2HAUA 1FBHA 1QW0A 4MLVA 1LCFA 2H25A 4O8MA 5FHMA 3QIMA 2H98A 3MJNA 3F11A 3H4ZA 2O84X 4G77A 3O2AA 4F2QA 4NAPA 3VXBA 2XWKA 4NWDA 3T1BA 1MDQA 1ZTYA 3P7IA 5FTIA 2PYYA 4ZS9A 3TCGA 2I4BA 2KR0A 4YKJA 2XXRA 4EF1A 4P0IA 4JSDA 2X26A 2H99A 3C31A 3PPRA 2I58A 2HFBA 1P1OA 3MC2A 4IB2A 4UACA 4G8NA 4KYEA 4R9GA 3H6WA 2DOJA 1EU8A 4DXBA 1D3KA 4LZ5A 4FECA 4BDNA 3Q28A 5TPAA 3THIA 2PFZA 4N81A 3ILTB 4PCDA 2DE3A 2DVCA 4ONYA 1A7LA 2DWHA 3K6UA 4NGUA 3C4MA 3U93A 1MXVA 4RY1A 2DE4A 3TFLA 3K02A 5HM4B 3IX1A 1GGGA 4PBQA 3ECRA 4PE5B 3LC8A 2YLNA 2KLFA 1LAGE 1WVJA 5FBPA 2QS1A 4NF8A 4BDOA 5I2NA 2Q74A 4DIGA 2Y5LA 1NV6A 3SZPA 3PGFA 2R9JA 5LTCA 4KR5A 1B0LA 1AOVA 3K6XA 3A29A 1MQIA 1LEVA 2F78A 4HTGA 2ZZWA 1FPBA 4IO2A 4ZE8A 1FJ6A 4F22A 5DEXA 5TP9B 3UORA 1DTGA 4THIA 4PGNA 2H4IA 2F5XA 3KZGA 3NOHA 2PFYA 4DXCA 2OBGA 1IQ7A 2Q8MA 5ET6A 3KN3A 5I56A 3G3GA 4L17A 1SW4A 3H6TA 4QFNA 1URSA 5KCJB 2HXRA 3Q26A 3KC0A 2PT1A 5ICTA 1MH4A 3LV0A 3QK6A 2Y84A 4HE0A 2UVIA 4JWYA 1HSLA 2CZLA 2Z23A 2Y7RA 4O3CA 5B7DA 4H67A 4N15A 3O6IA 3RGYA 1OQHA 4OFLA 2OK2A 1B5JA 4U2RA 3OOAA 3CFZA 4O7IA 3VFJA 3WAEA 1AIVA 2QMXA 2OCUA 2D21A 1XVXA 2DE2A 4LA9A 4KYSA 3MQ9A 5I58A 2ZNSA 4HW8A 1MXXA 5AA4B 3KOTA 3MPLA 1IEJA 4DZ1A 2CZIA 4I8CA 3EHSA 1ZLQA 1SVXB 4FORA 4O3BA 1TFAA 4YKIA 1IXHA 2ZYOA 4OTEA 1PB7A 5CMMA 5ISUA 3OSQA 3T9XB 2UVHA 4P9KA 4JVDA 4P47A 3SETA 2F35A 3DELB 5A5XB 1FPIA 4ZEDA 2QFLA 5DYHA 1OQGA 5EYFA 1MY2A 3FUZA 3KGCA 3U92A 1NI9A 4R74A 4OFJA 1N7WA 3SEUA 1Y4TA 5I2NB 3D1RA 3PD9A 2P0SA 2GHBA 2XHDA 2XWIA 3BBRA 4XKRA 4XKQA 2P2AA 2RF1A 5H8SA 3HO7A 1YCJA 4JBZA 1FPGA 2HZLA 4F3PA 2DP8A 1B5IA 1IMFA 4R9FA 5DVIA 1XT8A 1DBZA 1NUZA 3PV0E 4PDDA 3C35A 3HHGA 4H6DA 2I3WA 4MAGA 1B5HA 1B0HA 1P1WA 1L5TA 5L9SA 1N04A 1IZ1A 2Y7WA 4PAFA 5JTYB 2CZKA 3TODA 1FPFA 1A40A 5CC2A 2THIA 1IXIA 4GVOA 4F18A 4MH5A 3SESA 1SQYA 2NUVA 3QSLA 3OEMA 3ROJA 3RY3A 1FQFA 2QSXA 2RCBA 1I6QA 4GXSB 4HE2A 1HSJA 2YJPA 4YKPA 1FPDA 4H5GA 4OVJA 4HCWA 1D4NA 4RA1A 3TQWA 4TLLB 3B6TA 5I56B 4JVCA 3K1PA 1OVBA 3MP6A 5EHSA 1GR2A 1PEBA 1SDXA 2V25A 1UTBA 1VDWA 2XXIA 4OFOA 1LBCA 3HHFA 2B3BA 2FYIA 3DLNA 3EHUA 1PB9A 1EZOA 3CIJA 3JV9A 2DYXA 5KZTA 1MY4A 4PFIA 3CR9A 4QSCA 3MBPA 4KI0E 5H8HA 2H5YA 3CSGA 2Q8JA 4ZE9A 3HFUA 3K4UA 1JVYA 3LSXA 4E0WA 2ZZXA 3O6GA 4YB6A 4F1VA 1RDZA 4XF5A 4XXUA 1AH5A 4YMAA 4RPOA 4DLDA 4LP2B 5AA3A 4IO5A 4OESA 5KDTB 5F1QA 3G3HA 2PCRA 4MEVA 1R9QA 3FVOA 1JEUA 2IEEA 1Y1MA 4BLAA 4UABA 5CBSA 4AQ4A 3L6GA 2H9BA 3H03A 1FBEA 4POXA 3FJ7A 4I1DA 1MG1A 4TQUQ 4YB5A 3U8QA 2CEXA 1B9JA 1NNKA 2JJKA 1Y3QA 1EZPA 4GWSA 5K2XA 1MQGA 1FBDA 3GBBA 3PUYE 1B40A 5L9OA 2DWAA 3LSFB 3UGWA 5I57A 1MPDA 4C0RA 2RC9A 2Z8FA 2XA5A 1XHYA 3IORA 1Y3PA 4E0XA 3CHGA 2P3VA 4BDLA 1Q1KA 3PUVE 3TTMA 4N17A 1KZ8A 3KN7A 3S4UA 4ESWA 4PFRA 1KA0A 2OZZA 2XXPA 2DSFA 4UA8A 1Y3NA 1LBZA 2ZMBA 2I0BA 3OO8A 1O7TA 5IM2A 4MF3A 3U1OA 1SYIA 1FW0A 2Y5KA 4EXKA 4P56A 5ESYA 2XD3A 1LBVA 4AB5A 1B52A 2R6GE 3E79A 3FVKA 1IMCA 3PMWA 4P1EA 3IL1B 3OELA 3HV1A 3SEVA 4RK9A 1N84A 1A54A 1UQWA 3M3LA 3ZS6A 2OX3A 3V89B 4PC9A 3OSRA 4H0WA 5M2VA 4QSDA 3BFUA 1N0TA 4HCYA 2F36A 3QYTA 1FQCA 1AWBA 3B6WA 2A5SA 4PFUA 1P99A 3HPIA 1NUYA 1B7UA 4OXVA 2X7QA 4AB6A 4KQPA 5CRYA 1FQDA 5HPQA 1XOCA 4F31B 1QKAA 1USYH 1NV5A 3V8XB 4ELRA 3EHTA 5I3SA 4NQ8A 2I6EA 2A5TA 4R73A 3CSBA 2QL3A 3FGSA 3CRBA 4FEBA 4I3EA 4PETA 4U23A 1LGBC 3IO4A 1FSAA 3SEXA 3UN6A 3PPPA 1FQAA 1PB8A 4IO7A 3W9WA 2XX7A 1XC1A 4IO3A 4GX6A 2HXWA 4G68A 3FV1A 1FTJA 2O6AA 4LONB 1RYXA 4ELQA 5J16A 4F29A 4TOZA 2ZYNA 5DTBA 1YTVA 3OO6A 4G61A 4YAHX 2NVUB 1QUKA 3GLBA 1ZJLA 3VDFA 2HHMA 3R26A 2Q89A 2HEUA 1JP4A 3IB0A 3OMBA 4QFPA 3TMGA 5JEIA 2F3DA 1PDAA 3PMVA 2XXKA 2ZYMA 1NL5A 3ILUB 4ECFA 1NMUA 1JW1A 1ZIUA 3N5LA 3RPLA 3GXAA 3EPEA 4ZEFA 4PFWA 2Y7KA 4LATA 3T93B 2ZYKA 1PBQA 1MDP1 4KYDA 2LAOA 2ANJA 2VGQA 1BIYA 3FJMA 3SEWA 4IGTA 3EF7A 1K9YA 3EKIA 5H8FA 4ZEBA 2QS2A 1B1HA 5EYGA 4ZEIA 1I6BA 1NV2A 4GXAA 1DK4A 2O51A 3E9XA 3MSTA 3PTYA 4N91A 5DT6A 3VVDA 2OWSA 4KCDA 4X04A 2V84A 1IUDA 3JZJA 4P11A 1MQDA 2CEYA 5ET7A 4MNCA 4PBHA 1FTLA 2B65A 4R75A 3TQLA 1BP5A 1TWYA 4Q30B 3SEYA 2I3VA 4LQ5A 1H76A 1LAFE 2PVUA 2RINA 4H8JA 3RQTA 3IOVA 5I59B 2VT5A 1URGA 4H1XA 1NV1A 2XXXA 4DI4B 2RC8A 5I57B 3LSWA 3KJTA 4GWYA 3RT8A 2UVJA 3RT6B 4U4XA 3QAXA 3TCHA 2M8CA 4X48A 2I48A 3RPWA 4KXPA 1POY1 2F34A 3OEKA 5EQ7A 3E13X 1JVXA 4OVSA 1MY3A 2Q88A 1IXGA 3MPKA 2VOZA 3CG3A 3IB2A 2GFEA 4F1YA 1EYKA 3KFMA 1TT1A 1US4A 1H44A 1FPLA 3VXCA 1VE4A 4N07A 3S9EA 4ZZEA 3FD3A 3VLVA 1M5BA 2XXTA 2F3BA 2QS4A 2NXOA 4JVIA 1MPBA 1DMBA 1RKMA 1FBFA 3B8BA 4XFEA 4PGPA 3S2VA 4PF6A 1B1XA 2PMSA 2HPGA 5TU0A 5L9MA 1UTHA 2UYEA 3TTLA 3FV2A 3T22A 4YMBA 5BWJA 3E3KA 3IAZA 2R71A 5A5XA 2AYSA 3VLWA 3B6QA 3MZ9A 3CG1A 3K2DA 1P1UA 4JWOA 3KN8A 4G8MA 1FCKA 4JDFA 2VD3A 4NF6B 4GD5A 3MUQA 4NE4A 1LFHA 4WEPA 2AL5A 2DXYA 4GWUA 4ZZAA 3E78A 1OMPA 3CVGA 2G29A 5DEXB 4MFIA 3TKDA 2AIXA 3HN0A 2VD2A 3TTNA 3RTWB 4OZ9A 1D9VA 1S7YA 1LBBA 3O9PA 3LUYA 4GF8A 3R6UA 1MQJA 2Y7IA 3EQ1A 5FTHA 1B58A 5EHMA 3N26A 4H5FA 4GWWA 5JK4A 4FEDA 2X7PA 4OVPA 4JSOA 4WKMA 4TLMB 1HSEA 1JW4A 2XXYA 3DP8A 3WAFA 4MMPA 1FPEA 1UTHB 3FVNA 2XWVA 5I84A 3TPAA 4MJOA 3G3KA 1B3EA 4PFTA 4OEVA 2ZZVA 1MXYA 1RYOA 4Q5TA 4O3AA 5IZ3B 4Z0IA 3TZAA 2ZNUA 2Z8DA 1SD3A 3TUSA 3QXMA 4OETA 2ZXTA 1B3GA 2WX9A 1NV7A 3PMXA 3RLFE 4RK2A 5DVFA 1OLAA 3MP8A 2REGA 2O69A 4N6PA 1B4HA 3PPQA 3G3JA 4G68C 1QJMA 5AA2B 4DDDA 4GX4A 4FJPA 4M4GA 1VSOA 1ZKBA 4OVRA 2D5WA 2V4CA 3T66A 4PFYA 4LVQA 3MAMA 1TXFA 4PE3A 2B3FA 4EXLA 1MM7A 5ICQA 1SPIA 1MY0A 3KG2A 2FIXA 2HZKA 1YYZA 1Y20A 4NF4B 1T0KA 4G4PA 1FTOA 1LAXA 1LCTA 2KQZA 3IFAA 4BDQA 1VR5A 3GBAA 3BKIB 3RTFB 2AL4A 4HS7A 5CMBA 4N13A 2V3QA 4MNIA 4P1LA 2DDKA 3I3VA 1ATGA 4GBWA 1QUIA 5FHOA 1LLSA 2HQ0A 3SKPA 4GOTA 3UIFA 3H3GA 2F8DA 1A55A 4NMYA 4EF2A 2WBBA 3LUZA 4P8BA 1LB9A 3RN8A 4X1DA 1Z7ME 3IOTA 1MPCA 1LFGA 4NF5B 3D4GA 3O29A 2QVRA 4FAJA 5ET5A 4ESXA 2A5TB 1ZU0A 1UIUA 5AA2A 4N8GA 2OJTA 4YKKA 1B3LA 3O97A 4GWXA 5I2KA 1H3DA 4KHZE 4U21A 4N6DA 1YZ0A 1EH3A 3HCQA 3N6UA 4QBAA 4IGRA 5AA2D 3GYYA 2WEFA 1Y1ZA 5H8FB 1MS7A 2D3IA 1QKBA 5KDTA 3G7WA 2Q2CA 1I6AA 4P3LA 2GH9A 4OYVA 1DPEA 3Q25A 1S9TA 4F1UA 5K2YA 5T3JA 4LQ2A 1B7HA 4X9TA 4GL0A 1FTAA 4ND9A 3O6HA 1YPNA 1A8FA 4MIJA 4DXUA 2WBDA 3G3IA 5H8QA 3IJOB 4H65A 1NV4A 3EN3A 1CE2A 4RYAA 4AS4A 1ANFA 1SBPA 4PDHA 4YICA 1B05A 1WDNA 4I3YA 3PU5A 2BJIA 4GRKA 1I69A 4MHFA 1B3FA 1RDXA 1ELJA 4OMBA 2ESNA 1RDYA 4JXIA 1Y9UA 3CFLA 1O63A 4RNSA 1DSNA 5H8NA 3IB1A 1GVCA 2E0SA 3USDA 3FXRA 3K01A 1FBGA 1NNTA 2DWIA 3KSJA 3D4CA 4N6KA 4KFQA 3UP9A 3K6WA 5EQAA 3KBRA 1EZ9A 2REJA 1ZBMA 4C1TA 4OVQA 4DI3D 2FVZA 5J1DA 2XD2A 5KCJA 3JYRA 4NX1A 4XTCQ 4G2ZA 3QUJA 3TAJA 4QSEA 3DP6A 4JB7A 3ONMA 1A8EA 3U65A 1IXCA 1CNQA 1JQFA 1Z7NE 4F19A 5TP9A 4ELPA 4GX3A 3VE1B 4EQBA 4NG7A 2V3UA 2F7AA 3MYUA 1UTBB 3RYDA 4R2FA 3Q27A 2XXHA 3TTKA 2RC7A 3CFXA 3CI8A 3TTRA 3BIGA 4PAKA 2F7BA 3Q29A 2O1MA 2DS9A 2OLBA 3RUMA 5TPAB 4MX6A 2Z22A 3U72A 5DVJA 1D9QA 4IY6A 2O68A 4FIMA 1JW5A 3W9VA 3A09A 3C33A 1EYJA 2DWJA 4LZ7A 4XKNA 4NN3A 5AA1A 3C9HA 1TFDA 2UYFA 5H8HB 1R9LA 5JTYA 1QGXA 2I49A 5EQ9A 1OIBA 4G68B 2O7UA 5HBCA 1IIWA 4PFBA 2ZNTA 3H6UA 2ABHA 5IGAA 1LFIA 2CMOA 1NH8A 3IJXB 3E4RA 2E1SA 2B4MA 2FNCA 1N76A 4F3SA 3H7MA 4PF8A 5ITPA 1VFEA 2P3NA 3TCFA 5ITOA 1FQEA 4YU0A 1II5A 3A3UA 4NF5A 1MXUA 2Q2AA 3OENA 1IMEA 3FBPA 1INPA 1SW5A 1PC3A 3T9HB 3RNNA 4F3GA 5H8QB 3T9VA 1K9ZA 4I40A 4RJZA 1DCUA 4MCOA 1XI6A 1B32A 4LN5A 4RXLA 3SDFA 2IA4A 1NH7A 2XXVA 4QFOA 1IMAA 1UIVA 3ODBA 4WEDA 4NHBA 2VHAA 4ELOA 3K0VA 2PX1A 4NF4A 2ONSA 4O94A 2GRVA 2DVZA 4ISUA 2NWJA 3B7DA 5IAIA 3M8UA 4F3BA 1F9BA 3A3CA 3M3KA 4GIZA 1R1NA 2FHYA 5CM6A 4OQOA 4NEDA 1FRPA 1NUWA 1SW2A 1LAHE 4X8RA 4YB7A 3N94A 3DM0A 2W7YA 4GBVA 4DCYA 4NF0A 2PT2A 1R6ZA 1MY1A 4POWA 4R6HA 1WODA 1OVTA 4GL8A 3S9MC 2PBWA 4IR8A 1KA1A 1N3WA 4BDMA 2I4CA 4KCCA 4PAIA 4QF9A 3B50A 3PD8A 4OHNA 3BIHA 3PUXE 4R6YA 4BDRA 1B51A 1Y4CA 3FXUA 1LBYA 3AXFA 2CZHA 2HCAA 4R6KA 3OO9A 1GTKA 1BK4A 2QVVA 1M5FA 1SW1A 4NF8B 4Q0CA 4R2BA 3H06B 3IK6B 3DP4A 2FA7A 2ALUA 1IMDA 2FIEA 4IO4A 2O1LA 4OENA 4U4SA 4DE8A 5CMCA 4N8YA 4ZDMA 5CMKA 4DCXA 3FIRA 5AA4A 3LR1A 2MKZA 5A5LA 3FXQA 1DPPA 4U1OA 3KBZA 5I5PA 1S50A 5ET8A 1B7ZA 4EDPA 3LBSA 2GQ1A 1EYIA 1H43A 3TDJA 5I59A 1QVSA 4LZ8A 4IY5A 2I0CA 1CB6A 2QJEA 3C34A 3FXBA 4GQOA 1M5EA 2BJJX 2XXQA 2QS3A 2WKYA 2QMWA 1US5A 1BLFA 1B6HA 4LUBA 1MH3A 1BKAA 4PP0A 4QFLA 1BTJA 4P0GA 3VVFA 1URDA 1FTKA 2UXAA 1AMFA 1P1NA 3IFCA 1KWHA 1FBPA 4G8HA 4OWDA 1G0IA 4F39A 3VV5A 3C32A 4Q8RA 3U94A 3SERA 4X1BA 4IO6A 1DTZA 4H46A 4HE1A 1MXWA 2VP1A 2OWTA 4XKPA 4YZZA 2F97A 2RKMA 3FVGA 3MZBA 5ELVA 3O66A 3PPOA 1FPKA 4ZECA 1FJ9A 3O28A 3BFTA 3IOUA 3KOSA 2P1SA 2QPQA 2Q9TA 1LBXA 3RPLB 3ZKLA 4PQJA 3MVZA 1N3XA 1O64A 1USYE 3T96B 2XXUA 3FASA 4QRZA 1QUJA 1B4ZA 3I6VA 1G0HA 3ZKKA 3C36A 1XS5A 3VVEA 2Z8EA 1XVYA 4OANA 2GHAA 5DW8A 2XX8A 5H8NB 4I9DA 3FJGA 3W15C 1NNFA 5B70A 4JWXA 1ZMGA 3G3FA 4NF6A 2VPOA 4RPNA 3V5AA 1NFTA 3OXNA 4Z7EA 3MVYA 3QUFA 3ZSFA 3ISPA 5I58B 3MP1A 1H45A 4KPTA 1NKXA 5IZ1A 1FBCA 4QFKA 1NV0A 2O7IA 4GFRA 3FZVA 5IZ3A 4ZEKA 5LDZA 1B2HA 3QMFA 2L5VA 3T9UA 2NOOA 1PBPA 1YXIA 5FHNA 1N7XA 4EQ9A 1M5CA 4MLQA 4MNPA 4OEUA 2Y7PA 4NTLA 2OWZA 4HXVA 4FATA 2VPNA 3HSTA 4MBPA 3PPNA 4H8IA 2XXWA 2V3TA 1NUXA 1IMBA 1VFDA 5L8DA 3M3FA 1JEVA 1SI1A 2ONKE 1MQHA 1YAEA 4QHQA 4N4UA 4FE8A 5BUUA 3K6VA 4GWOA 4U22A 5IKBA 3UK4A 5I7IA 1AL3A 3T0JA 1MRPA 1D9YA 1M5DA 4FBPA 3OO7A 2F6GA 3PUWE 3LSLA 1FPJA 1MM6A 2F6PA 4F2OA 3H6VA 3PUZE 4XIGQ 3K00A 4GWZA 3FATA 2ONRA 2QRYA 1FQBA 3VLUA 1LBWA 3TYHA 2B4LA 2QVUA 3IR1A 4QXDA 4M1VA 5F24A 5AE4A 3MWBA 2WYPA 3S9NC 4KD5A 1OLCA 3IOWA 1MXZA 1NV3A 3V83A 2DQVA 1Q9DA 3IO6A 3K1MA 4WXJA 3MVWA 1IITA 1SI0A 1J1NA 4GLIA 3S9LC 1GV8A 5EYHA 3N6TA 4OA4A 5CI5A 1DOTA 3KSXA 2HAVA 3GZGA 4PTKA 2XX9A 3MVXA 1P1QA 1POTA 5F7VA 5LOMA 2RCAA 3OD7A 1LB8A 2WYKA 3MW0A 4I62A 4K3FA 4H45A 4OVTA 3TEPA 2F7CA 1Q35A 1NNPA 5IZZA 3MZ1A 2V93A 3L6HA 1B3HA 3K1NA 2DXRA 3KEIA 1JNFA 5CBRA 5EQ8A 4EQ7A 4C1UA 4AS5A 3KC1A 3R7XA 4R72A 1LSTA 2R8TA 1SYHA 1FTMA 1QULA 4O7MA 2UVGA 3UA8A 4U1ZA 4EUOA 3TELA 2FBPA 3I5OA 2XWOA 1JETA 1A99A
chains in the Genus database with same CATH topology
4JWOA 1R9QA 2YPNA 3KJ7A 3KN8A 1B46A 3FVOA 4G8MA 1FCKA 1JEUA 5CM6A 5H8SA 2IEEA 4JDFA 5I2KB 2VD3A 4OERA 2G93A 4GD5A 4NF6B 1Y1MA 3MUQA 4NWCA 4BLAA 4NE4A 2HAUA 1LFHA 4WEPA 5CBSA 4OQOA 1QW0A 2AL5A 2DXYA 4ZZAA 4AQ4A 4MLVA 1LCFA 1OMPA 4NEDA 3CVGA 2H25A 3L6GA 2G29A 1SW2A 1LAHE 5FHMA 2H9BA 3QIMA 5DEXB 4MFIA 2H98A 3H03A 3TKDA 2AIXA 3MJNA 3F11A 3H4ZA 2O84X 3HN0A 4POXA 4G77A 3N94A 4YB7A 3DM0A 2W7YA 3O2AA 5F7VA 2VD2A 4DCYA 4F2QA 3FJ7A 4I1DA 1MG1A 3VXBA 4TQUQ 3TTNA 4YB5A 2PT2A 3RTWB 1R6ZA 4NWDA 3U8QA 4OZ9A 1MDQA 1D9VA 1MY1A 1S7YA 4POWA 1LBBA 1B9JA 1WODA 1ZTYA 3LUYA 1MQJA 1NNKA 3O9PA 3R6UA 2Y7IA 1Y3QA 3P7IA 1OVTA 3EQ1A 5FTHA 1B58A 5FTIA 2PYYA 4GL8A 2PBWA 5EHMA 4ZS9A 3TCGA 3N26A 3S9MC 2I4BA 1EZPA 1N3WA 4H5FA 4BDMA 5K2XA 1MQGA 2I4CA 3GBBA 5JK4A 3PUYE 4KCCA 1B40A 4QF9A 3PD8A 4OHNA 4YKJA 5L9OA 2DWAA 4FEDA 2X7PA 3PUXE 4R6YA 4BDRA 1B51A 1Y4CA 3FXUA 4JSOA 4WKMA 4TLMB 3LSFB 1HSEA 3AXFA 2HCAA 2XXRA 1JW4A 4EF1A 2XXYA 4P0IA 3UGWA 4R6KA 3DP8A 3OO9A 5I57A 3WAFA 4JSDA 1GTKA 1UTHB 3FVNA 2X26A 2H99A 3C31A 3PPRA 5I84A 1MPDA 4C0RA 3TPAA 2I58A 2HFBA 1P1OA 3G3KA 1M5FA 2RC9A 1SW1A 1B3EA 4PFTA 2Z8FA 3MC2A 4NF8B 4Q0CA 3IORA 1XHYA 4OEVA 1MXYA 1RYOA 1Y3PA 4Q5TA 4O3AA 4E0XA 4R2BA 3H06B 3IK6B 4IB2A 4UACA 4Z0IA 3DP4A 2ZNUA 4G8NA 3TZAA 4BDLA 1Q1KA 4KYEA 4R9GA 3H6WA 2DOJA 2FA7A 3PUVE 2Z8DA 1EU8A 2ALUA 3TTMA 1SD3A 3TUSA 4IO4A 2O1LA 3QXMA 4OENA 4DXBA 1D3KA 3KN7A 4LZ5A 4U4SA 4FECA 4DE8A 4OETA 2ZXTA 1B3GA 5CMCA 3S4UA 4ESWA 4BDNA 5CMKA 4ZDMA 3Q28A 3PMXA 5TPAA 3THIA 4DCXA 3RLFE 4RK2A 5DVFA 3ILTB 2OZZA 3FIRA 2XXPA 2DSFA 4UA8A 1OLAA 3MP8A 2REGA 2O69A 4N6PA 1B4HA 5AA4A 2DE3A 3LR1A 2DVCA 1Y3NA 1A7LA 2I0BA 2DWHA 2ZMBA 3G3JA 3PPQA 4ONYA 4G68C 1QJMA 3K6UA 3OO8A 4DDDA 5AA2B 3C4MA 1O7TA 4FJPA 3FXQA 1DPPA 3U93A 4MF3A 3U1OA 4M4GA 4U1OA 1MXVA 4RY1A 1VSOA 1ZKBA 1S50A 2D5WA 1SYIA 3T66A 1B7ZA 4PFYA 4EDPA 1FW0A 3MAMA 4LVQA 4EXKA 1TXFA 2DE4A 2B3FA 3TFLA 2XD3A 4EXLA 3K02A 3LBSA 3TDJA 1H43A 1MM7A 4AB5A 5ICQA 5HM4B 1B52A 1MY0A 3IX1A 5I59A 3KG2A 2HZKA 1GGGA 1QVSA 2R6GE 4LZ8A 3ECRA 4IY5A 4PE5B 2I0CA 1CB6A 2QJEA 3C34A 1Y20A 3FVKA 3LC8A 4NF4B 3PMWA 4G4PA 1T0KA 2YLNA 1FTOA 3IL1B 2KLFA 3OELA 4R6HA 1LAGE 1WVJA 4GQOA 1LAXA 3HV1A 2QS1A 3SEVA 1LCTA 1M5EA 4BDQA 4RK9A 1N84A 1VR5A 1A54A 2BJJX 2XXQA 1UQWA 3GBAA 3W9VA 3BKIB 3RTFB 4NF8A 2QS3A 2AL4A 4HS7A 2WKYA 5CMBA 4BDOA 5I2NA 4N13A 2V3QA 3M3LA 3I3VA 3ZS6A 3V89B 1ATGA 2QMWA 4DIGA 1US5A 3OSRA 1BLFA 1B6HA 4LUBA 4H0WA 1QUIA 3PGFA 1MH3A 1BKAA 2R9JA 4PP0A 4QFLA 5FHOA 1BTJA 1LLSA 5M2VA 4P0GA 4KR5A 4QSDA 1B0LA 3VVFA 2HQ0A 3SKPA 3K6XA 1AOVA 1URDA 1FTKA 2UXAA 1AMFA 4GOTA 3BFUA 3UIFA 3H3GA 1N0TA 2F8DA 1P1NA 4HCYA 2F36A 1A55A 3QYTA 1KWHA 4NMYA 1FQCA 1MQIA 4EF2A 4G8HA 1LB9A 2F78A 3B6WA 4HTGA 4OWDA 3RN8A 4X1DA 1Z7ME 4F39A 3IOTA 4IO2A 2A5SA 3VV5A 1MPCA 1P99A 4PFUA 4ZE8A 1LFGA 4NF5B 3D4GA 3O29A 4FAJA 3HPIA 4F22A 1B7UA 4OXVA 5DEXA 3C32A 5TP9B 3UORA 2A5TB 4ESXA 1ZU0A 1DTGA 2X7QA 1UIUA 4THIA 4AB6A 4Q8RA 5AA2A 2OJTA 4KQPA 5CRYA 2H4IA 3SERA 3U94A 2F5XA 1B3LA 1FQDA 3KZGA 4IO6A 4X1BA 4YKKA 1DTZA 5HPQA 1MXWA 3TQLA 1XOCA 4DXCA 2OBGA 4F31B 2VP1A 1IQ7A 1QKAA 3O97A 2OWTA 5I2KA 1USYH 1H3DA 5I56A 3KN3A 4XKPA 3V8XB 4KHZE 3G3GA 4U21A 4YZZA 4ELRA 3EHTA 2F97A 2RKMA 1SW4A 3FVGA 4L17A 3HCQA 1EH3A 3H6TA 3N6UA 4QFNA 1URSA 4IGRA 5KCJB 3MZBA 2I6EA 5ELVA 3Q26A 2A5TA 3O66A 3PPOA 2PT1A 5AA2D 1MH4A 5ICTA 4R73A 3CSBA 4ZECA 1Y1ZA 3O28A 2QL3A 3QK6A 2Y84A 3FGSA 3CRBA 5H8FB 3BFTA 1MS7A 2D3IA 3IOUA 4FEBA 4PETA 1QKBA 4U23A 2UVIA 4JWYA 1LGBC 3IO4A 3KOSA 3G7WA 5KDTA 2Q2CA 2P1SA 2QPQA 1I6AA 3SEXA 1HSLA 2CZLA 2GH9A 2Q9TA 2Y7RA 2Z23A 3UN6A 3PPPA 4OYVA 1DPEA 1FQAA 1PB8A 4IO7A 4O3CA 3W9WA 2XX7A 3ZKLA 3Q25A 1S9TA 4F1UA 1XC1A 4PQJA 3MVZA 4IO3A 5K2YA 1N3XA 1O64A 5B7DA 1USYE 3T96B 4H67A 4LQ2A 1B7HA 2HXWA 4G68A 4X9TA 4GL0A 3FV1A 3O6IA 1FTJA 3RGYA 1OQHA 2O6AA 4OFLA 2OK2A 2XXUA 3FASA 4LONB 4QRZA 4ND9A 1B5JA 4U2RA 4Z7EA 3O6HA 1RYXA 1QUJA 3OOAA 4ELQA 3CFZA 3VFJA 3WAEA 1B4ZA 1YPNA 3I6VA 1A8FA 1AIVA 3ZKKA 4F29A 2QMXA 2OCUA 4TOZA 3C36A 1XS5A 2D21A 2ZYNA 1XVXA 3G3IA 3VVEA 5DTBA 4DXUA 1YTVA 2DE2A 1XVYA 2Z8EA 4LA9A 3G3HA 2GHAA 3IJOB 4KYSA 5H8QA 3OO6A 3MQ9A 2XX8A 5I58A 2ZNSA 4H65A 3EN3A 4RYAA 1CE2A 4HW8A 1MXXA 5H8NB 4I9DA 4YAHX 2NVUB 1ANFA 1SBPA 3FJGA 1QUKA 3W15C 1NNFA 1ZJLA 3GLBA 4YICA 3VDFA 3KOTA 5AA4B 5B70A 1B05A 1WDNA 1IEJA 1ZMGA 3MPLA 4JWXA 4DZ1A 3G3FA 4NF6A 3R26A 4I8CA 3EHSA 2Q89A 3PU5A 1ZLQA 4RPNA 3MZ9A 1I69A 1NFTA 1SVXB 2HEUA 1B3FA 3OXNA 4FORA 1TFAA 4GRKA 1ELJA 1IXHA 3MVYA 4O3BA 4OMBA 2ZYOA 2ESNA 3IB0A 4YKIA 4JXIA 3OMBA 4OTEA 1Y9UA 3CFLA 4QFPA 3TMGA 1O63A 3QUFA 4RNSA 3ZSFA 5JEIA 1PB7A 5CMMA 1DSNA 5ISUA 1PDAA 3OSQA 3PMVA 5I58B 3MP1A 1H45A 2ZYMA 4KPTA 5H8NA 3T9XB 3IB1A 1NKXA 1NL5A 1GVCA 2E0SA 2UVHA 3ILUB 4ECFA 4QFKA 3USDA 1NMUA 2O7IA 4GFRA 3FZVA 3FXRA 3SETA 1JW1A 1ZIUA 2F35A 3DELB 3N5LA 4ZEKA 5A5XB 3K01A 1B2HA 3GXAA 1NNTA 4ZEDA 5DYHA 1OQGA 5EYFA 2DWIA 2NOOA 3T9UA 1PBPA 1MY2A 3FUZA 3KGCA 3EPEA 1N7XA 5FHNA 4ZEFA 3KSJA 1M5CA 4MLQA 4EQ9A 3D4CA 4OEUA 4PFWA 2Y7KA 3U92A 2Y7PA 4KFQA 4NTLA 3K6WA 4R74A 4OFJA 4LATA 1N7WA 3UP9A 4FATA 3SEUA 3KBRA 1EZ9A 2REJA 1ZBMA 2ZYKA 3T93B 1PBQA 3HSTA 4C1TA 1MDP1 1Y4TA 4MBPA 5I2NB 4KYDA 2LAOA 3PD9A 3PPNA 5J1DA 2P0SA 4H8IA 2XD2A 2GHBA 2ANJA 2VGQA 2XHDA 2XXWA 2V3TA 3JYRA 5KCJA 1BIYA 3FJMA 3SEWA 4IGTA 3EF7A 3BBRA 4XKRA 5H8FA 4ZEBA 2QS2A 4XKQA 4G2ZA 4XTCQ 3QUJA 1VFDA 2P2AA 3TAJA 5L8DA 1B1HA 4QSEA 3M3FA 3DP6A 1JEVA 1SI1A 2RF1A 2ONKE 3HO7A 1MQHA 1YCJA 3ONMA 4JB7A 2HZLA 4JBZA 1A8EA 1YAEA 4QHQA 4ZEIA 4F3PA 1IXCA 1I6BA 2DP8A 1B5IA 4FE8A 4GXAA 1JQFA 5BUUA 1Z7NE 4F19A 2O51A 3E9XA 4R9FA 5TP9A 5DVIA 4ELPA 3K6VA 4GWOA 3VE1B 4EQBA 4U22A 2V3UA 1XT8A 3UK4A 5IKBA 1AL3A 5DT6A 2F7AA 1UTBB 3VVDA 1MRPA 3PV0E 1D9YA 3C35A 1M5DA 3HHGA 4H6DA 2I3WA 4R2FA 3OO7A 2OWSA 3Q27A 4KCDA 2XXHA 1B5HA 1B0HA 1P1WA 2V84A 1L5TA 2F6GA 3PUWE 5L9SA 3LSLA 1N04A 3TTKA 2RC7A 1IZ1A 1IUDA 3CFXA 2Y7WA 3CI8A 3JZJA 3TTRA 1MM6A 2F6PA 2F7BA 3Q29A 2O1MA 2DS9A 4F2OA 4P11A 2OLBA 3RUMA 1MQDA 5TPAB 5JTYB 3H6VA 3PUZE 4XIGQ 3TODA 2Z22A 3K00A 3U72A 5DVJA 4IY6A 1FTLA 2B65A 2O68A 4FIMA 3FATA 1JW5A 2ONRA 4R75A 2QRYA 1BP5A 1TWYA 1FQBA 3A09A 3C33A 2DWJA 4GF8A 2I3VA 4Q30B 3SEYA 3VLUA 4LZ7A 1A40A 5CC2A 4LQ5A 1H76A 4XKNA 1LAFE 2THIA 1IXIA 2PVUA 3TYHA 4GVOA 5AA1A 3IR1A 4F18A 2RINA 4H8JA 4MH5A 3RQTA 3IOVA 3C9HA 3SESA 1TFDA 1SQYA 5I59B 2NUVA 4M1VA 2UYFA 3QSLA 5H8HB 1R9LA 1URGA 2I49A 3OEMA 4H1XA 5JTYA 2XXXA 3RY3A 1FQFA 1OIBA 2RC8A 2QSXA 4G68B 2RCBA 5AE4A 3MWBA 2O7UA 3S9NC 1I6QA 4GXSB 5I57B 4KD5A 3LSWA 1OLCA 1IIWA 3IOWA 5HBCA 1MXZA 3KJTA 1HSJA 3V83A 2ZNTA 2DQVA 3H6UA 2ABHA 2YJPA 3IO6A 3K1MA 4WXJA 3RT8A 4YKPA 1LFIA 2UVJA 3MVWA 2CMOA 1NH8A 3RT6B 4U4XA 4H5GA 3IJXB 4OVJA 1IITA 1SI0A 3QAXA 3E4RA 1J1NA 4HCWA 4GLIA 3TCHA 1D4NA 4RA1A 3TQWA 2M8CA 2E1SA 3S9LC 2FNCA 4TLLB 1N76A 4X48A 1GV8A 2I48A 3N6TA 3RPWA 3B6TA 5I56B 1POY1 5CI5A 2F34A 3K1PA 3OEKA 4F3SA 1OVBA 3H7MA 1DOTA 3E13X 3KSXA 3MP6A 5EHSA 1GR2A 2HAVA 1JVXA 5ITPA 1MY3A 3GZGA 1PEBA 2Q88A 2XX9A 1IXGA 1VFEA 3MVXA 5ITOA 3MPKA 1SDXA 3TCFA 2V25A 2VOZA 1FQEA 1P1QA 1II5A 1POTA 3A3UA 3CG3A 1UTBA 3IB2A 1MXUA 4NF5A 4YU0A 5F1QA 2GFEA 2Q2AA 4F1YA 3KFMA 1TT1A 3OENA 1US4A 5LOMA 2RCAA 1H44A 3OD7A 1LB8A 3VXCA 1VE4A 3MW0A 4I62A 4K3FA 4N07A 2XXIA 1SW5A 1PC3A 3TEPA 3T9HB 2F7CA 4OFOA 1LBCA 1Q35A 2B3BA 1NNPA 2FYIA 3HHFA 3S9EA 3DLNA 3RNNA 4ZZEA 3EHUA 3FD3A 3MZ1A 1PB9A 3VLVA 4F3GA 1M5BA 2V93A 2XXTA 5H8QB 3T9VA 3L6HA 1B3HA 2QS4A 4RJZA 1EZOA 3CIJA 2NXOA 3JV9A 2DYXA 3K1NA 5KZTA 1B32A 2DXRA 1MY4A 3KEIA 1JNFA 1MPBA 4RXLA 1DMBA 3CR9A 3SDFA 5CBRA 2IA4A 4QSCA 4EQ7A 3MBPA 4KI0E 5H8HA 1NH7A 2XXVA 4C1UA 1RKMA 2H5YA 3CSGA 1UIVA 3ODBA 4QFOA 2Q8JA 4ZE9A 4WEDA 3R7XA 4R72A 1LSTA 2VHAA 1SYHA 3S2VA 3K4UA 1B1XA 1FTMA 1JVYA 2PMSA 1QULA 3K0VA 3LSXA 2UVGA 3O6GA 4YB6A 4E0WA 5TU0A 4ELOA 4F1VA 5L9MA 3UA8A 2PX1A 1UTHA 2UYEA 4NF4A 3TTLA 4XXUA 1AH5A 2ONSA 3FV2A 4U1ZA 3T22A 4RPOA 4YMAA 4YMBA 4EUOA 2GRVA 3V5AA 3E3KA 3IAZA 3TELA 2DVZA 4ISUA 4DLDA 5BWJA 2NWJA 3B7DA 5IAIA 3I5OA 2R71A 4LP2B 3M8UA 4F3BA 5AA3A 4IO5A 4OESA 1F9BA 1JETA 3A3CA 5A5XA 3M3KA 4GIZA 1R1NA 2AYSA 3VLWA 5KDTB 3B6QA 1A99A 3CG1A 3K2DA 1P1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWO A;  1R9Q A;  2YPN A;  3KJ7 A;  3KN8 A;  1B46 A;  3FVO A;  4G8M A;  1FCK A;  1JEU A;  5CM6 A;  5H8S A;  2IEE A;  4JDF A;  5I2K B;  2VD3 A;  4OER A;  2G93 A;  4GD5 A;  4NF6 B;  1Y1M A;  3MUQ A;  4NWC A;  4BLA A;  4NE4 A;  2HAU A;  1LFH A;  4WEP A;  5CBS A;  4OQO A;  1QW0 A;  2AL5 A;  2DXY A;  4ZZA A;  4AQ4 A;  4MLV A;  1LCF A;  1OMP A;  4NED A;  3CVG A;  2H25 A;  3L6G A;  2G29 A;  1SW2 A;  1LAH E;  5FHM A;  2H9B A;  3QIM A;  5DEX B;  4MFI A;  2H98 A;  3H03 A;  3TKD A;  2AIX A;  3MJN A;  3F11 A;  3H4Z A;  2O84 X;  3HN0 A;  4POX A;  4G77 A;  3N94 A;  4YB7 A;  3DM0 A;  2W7Y A;  3O2A A;  5F7V A;  2VD2 A;  4DCY A;  4F2Q A;  3FJ7 A;  4I1D A;  1MG1 A;  3VXB A;  4TQU Q;  3TTN A;  4YB5 A;  2PT2 A;  3RTW B;  1R6Z A;  4NWD A;  3U8Q A;  4OZ9 A;  1MDQ A;  1D9V A;  1MY1 A;  1S7Y A;  4POW A;  1LBB A;  1B9J A;  1WOD A;  1ZTY A;  3LUY A;  1MQJ A;  1NNK A;  3O9P A;  3R6U A;  2Y7I A;  1Y3Q A;  3P7I A;  1OVT A;  3EQ1 A;  5FTH A;  1B58 A;  5FTI A;  2PYY A;  4GL8 A;  2PBW A;  5EHM A;  4ZS9 A;  3TCG A;  3N26 A;  3S9M C;  2I4B A;  1EZP A;  1N3W A;  4H5F A;  4BDM A;  5K2X A;  1MQG A;  2I4C A;  3GBB A;  5JK4 A;  3PUY E;  4KCC A;  1B40 A;  4QF9 A;  3PD8 A;  4OHN A;  4YKJ A;  5L9O A;  2DWA A;  4FED A;  2X7P A;  3PUX E;  4R6Y A;  4BDR A;  1B51 A;  1Y4C A;  3FXU A;  4JSO A;  4WKM A;  4TLM B;  3LSF B;  1HSE A;  3AXF A;  2HCA A;  2XXR A;  1JW4 A;  4EF1 A;  2XXY A;  4P0I A;  3UGW A;  4R6K A;  3DP8 A;  3OO9 A;  5I57 A;  3WAF A;  4JSD A;  1GTK A;  1UTH B;  3FVN A;  2X26 A;  2H99 A;  3C31 A;  3PPR A;  5I84 A;  1MPD A;  4C0R A;  3TPA A;  2I58 A;  2HFB A;  1P1O A;  3G3K A;  1M5F A;  2RC9 A;  1SW1 A;  1B3E A;  4PFT A;  2Z8F A;  3MC2 A;  4NF8 B;  4Q0C A;  3IOR A;  1XHY A;  4OEV A;  1MXY A;  1RYO A;  1Y3P A;  4Q5T A;  4O3A A;  4E0X A;  4R2B A;  3H06 B;  3IK6 B;  4IB2 A;  4UAC A;  4Z0I A;  3DP4 A;  2ZNU A;  4G8N A;  3TZA A;  4BDL A;  1Q1K A;  4KYE A;  4R9G A;  3H6W A;  2DOJ A;  2FA7 A;  3PUV E;  2Z8D A;  1EU8 A;  2ALU A;  3TTM A;  1SD3 A;  3TUS A;  4IO4 A;  2O1L A;  3QXM A;  4OEN A;  4DXB A;  1D3K A;  3KN7 A;  4LZ5 A;  4U4S A;  4FEC A;  4DE8 A;  4OET A;  2ZXT A;  1B3G A;  5CMC A;  3S4U A;  4ESW A;  4BDN A;  5CMK A;  4ZDM A;  3Q28 A;  3PMX A;  5TPA A;  3THI A;  4DCX A;  3RLF E;  4RK2 A;  5DVF A;  3ILT B;  2OZZ A;  3FIR A;  2XXP A;  2DSF A;  4UA8 A;  1OLA A;  3MP8 A;  2REG A;  2O69 A;  4N6P A;  1B4H A;  5AA4 A;  2DE3 A;  3LR1 A;  2DVC A;  1Y3N A;  1A7L A;  2I0B A;  2DWH A;  2ZMB A;  3G3J A;  3PPQ A;  4ONY A;  4G68 C;  1QJM A;  3K6U A;  3OO8 A;  4DDD A;  5AA2 B;  3C4M A;  1O7T A;  4FJP A;  3FXQ A;  1DPP A;  3U93 A;  4MF3 A;  3U1O A;  4M4G A;  4U1O A;  1MXV A;  4RY1 A;  1VSO A;  1ZKB A;  1S50 A;  2D5W A;  1SYI A;  3T66 A;  1B7Z A;  4PFY A;  4EDP A;  1FW0 A;  3MAM A;  4LVQ A;  4EXK A;  1TXF A;  2DE4 A;  2B3F A;  3TFL A;  2XD3 A;  4EXL A;  3K02 A;  3LBS A;  3TDJ A;  1H43 A;  1MM7 A;  4AB5 A;  5ICQ A;  5HM4 B;  1B52 A;  1MY0 A;  3IX1 A;  5I59 A;  3KG2 A;  2HZK A;  1GGG A;  1QVS A;  2R6G E;  4LZ8 A;  3ECR A;  4IY5 A;  4PE5 B;  2I0C A;  1CB6 A;  2QJE A;  3C34 A;  1Y20 A;  3FVK A;  3LC8 A;  4NF4 B;  3PMW A;  4G4P A;  1T0K A;  2YLN A;  1FTO A;  3IL1 B;  2KLF A;  3OEL A;  4R6H A;  1LAG E;  1WVJ A;  4GQO A;  1LAX A;  3HV1 A;  2QS1 A;  3SEV A;  1LCT A;  1M5E A;  4BDQ A;  4RK9 A;  1N84 A;  1VR5 A;  1A54 A;  2BJJ X;  2XXQ A;  1UQW A;  3GBA A;  3W9V A;  3BKI B;  3RTF B;  4NF8 A;  2QS3 A;  2AL4 A;  4HS7 A;  2WKY A;  5CMB A;  4BDO A;  5I2N A;  4N13 A;  2V3Q A;  3M3L A;  3I3V A;  3ZS6 A;  3V89 B;  1ATG A;  2QMW A;  4DIG A;  1US5 A;  3OSR A;  1BLF A;  1B6H A;  4LUB A;  4H0W A;  1QUI A;  3PGF A;  1MH3 A;  1BKA A;  2R9J A;  4PP0 A;  4QFL A;  5FHO A;  1BTJ A;  1LLS A;  5M2V A;  4P0G A;  4KR5 A;  4QSD A;  1B0L A;  3VVF A;  2HQ0 A;  3SKP A;  3K6X A;  1AOV A;  1URD A;  1FTK A;  2UXA A;  1AMF A;  4GOT A;  3BFU A;  3UIF A;  3H3G A;  1N0T A;  2F8D A;  1P1N A;  4HCY A;  2F36 A;  1A55 A;  3QYT A;  1KWH A;  4NMY A;  1FQC A;  1MQI A;  4EF2 A;  4G8H A;  1LB9 A;  2F78 A;  3B6W A;  4HTG A;  4OWD A;  3RN8 A;  4X1D A;  1Z7M E;  4F39 A;  3IOT A;  4IO2 A;  2A5S A;  3VV5 A;  1MPC A;  1P99 A;  4PFU A;  4ZE8 A;  1LFG A;  4NF5 B;  3D4G A;  3O29 A;  4FAJ A;  3HPI A;  4F22 A;  1B7U A;  4OXV A;  5DEX A;  3C32 A;  5TP9 B;  3UOR A;  2A5T B;  4ESX A;  1ZU0 A;  1DTG A;  2X7Q A;  1UIU A;  4THI A;  4AB6 A;  4Q8R A;  5AA2 A;  2OJT A;  4KQP A;  5CRY A;  2H4I A;  3SER A;  3U94 A;  2F5X A;  1B3L A;  1FQD A;  3KZG A;  4IO6 A;  4X1B A;  4YKK A;  1DTZ A;  5HPQ A;  1MXW A;  3TQL A;  1XOC A;  4DXC A;  2OBG A;  4F31 B;  2VP1 A;  1IQ7 A;  1QKA A;  3O97 A;  2OWT A;  5I2K A;  1USY H;  1H3D A;  5I56 A;  3KN3 A;  4XKP A;  3V8X B;  4KHZ E;  3G3G A;  4U21 A;  4YZZ A;  4ELR A;  3EHT A;  2F97 A;  2RKM A;  1SW4 A;  3FVG A;  4L17 A;  3HCQ A;  1EH3 A;  3H6T A;  3N6U A;  4QFN A;  1URS A;  4IGR A;  5KCJ B;  3MZB A;  2I6E A;  5ELV A;  3Q26 A;  2A5T A;  3O66 A;  3PPO A;  2PT1 A;  5AA2 D;  1MH4 A;  5ICT A;  4R73 A;  3CSB A;  4ZEC A;  1Y1Z A;  3O28 A;  2QL3 A;  3QK6 A;  2Y84 A;  3FGS A;  3CRB A;  5H8F B;  3BFT A;  1MS7 A;  2D3I A;  3IOU A;  4FEB A;  4PET A;  1QKB A;  4U23 A;  2UVI A;  4JWY A;  1LGB C;  3IO4 A;  3KOS A;  3G7W A;  5KDT A;  2Q2C A;  2P1S A;  2QPQ A;  1I6A A;  3SEX A;  1HSL A;  2CZL A;  2GH9 A;  2Q9T A;  2Y7R A;  2Z23 A;  3UN6 A;  3PPP A;  4OYV A;  1DPE A;  1FQA A;  1PB8 A;  4IO7 A;  4O3C A;  3W9W A;  2XX7 A;  3ZKL A;  3Q25 A;  1S9T A;  4F1U A;  1XC1 A;  4PQJ A;  3MVZ A;  4IO3 A;  5K2Y A;  1N3X A;  1O64 A;  5B7D A;  1USY E;  3T96 B;  4H67 A;  4LQ2 A;  1B7H A;  2HXW A;  4G68 A;  4X9T A;  4GL0 A;  3FV1 A;  3O6I A;  1FTJ A;  3RGY A;  1OQH A;  2O6A A;  4OFL A;  2OK2 A;  2XXU A;  3FAS A;  4LON B;  4QRZ A;  4ND9 A;  1B5J A;  4U2R A;  4Z7E A;  3O6H A;  1RYX A;  1QUJ A;  3OOA A;  4ELQ A;  3CFZ A;  3VFJ A;  3WAE A;  1B4Z A;  1YPN A;  3I6V A;  1A8F A;  1AIV A;  3ZKK A;  4F29 A;  2QMX A;  2OCU A;  4TOZ A;  3C36 A;  1XS5 A;  2D21 A;  2ZYN A;  1XVX A;  3G3I A;  3VVE A;  5DTB A;  4DXU A;  1YTV A;  2DE2 A;  1XVY A;  2Z8E A;  4LA9 A;  3G3H A;  2GHA A;  3IJO B;  4KYS A;  5H8Q A;  3OO6 A;  3MQ9 A;  2XX8 A;  5I58 A;  2ZNS A;  4H65 A;  3EN3 A;  4RYA A;  1CE2 A;  4HW8 A;  1MXX A;  5H8N B;  4I9D A;  4YAH X;  2NVU B;  1ANF A;  1SBP A;  3FJG A;  1QUK A;  3W15 C;  1NNF A;  1ZJL A;  3GLB A;  4YIC A;  3VDF A;  3KOT A;  5AA4 B;  5B70 A;  1B05 A;  1WDN A;  1IEJ A;  1ZMG A;  3MPL A;  4JWX A;  4DZ1 A;  3G3F A;  4NF6 A;  3R26 A;  4I8C A;  3EHS A;  2Q89 A;  3PU5 A;  1ZLQ A;  4RPN A;  3MZ9 A;  1I69 A;  1NFT A;  1SVX B;  2HEU A;  1B3F A;  3OXN A;  4FOR A;  1TFA A;  4GRK A;  1ELJ A;  1IXH A;  3MVY A;  4O3B A;  4OMB A;  2ZYO A;  2ESN A;  3IB0 A;  4YKI A;  4JXI A;  3OMB A;  4OTE A;  1Y9U A;  3CFL A;  4QFP A;  3TMG A;  1O63 A;  3QUF A;  4RNS A;  3ZSF A;  5JEI A;  1PB7 A;  5CMM A;  1DSN A;  5ISU A;  1PDA A;  3OSQ A;  3PMV A;  5I58 B;  3MP1 A;  1H45 A;  2ZYM A;  4KPT A;  5H8N A;  3T9X B;  3IB1 A;  1NKX A;  1NL5 A;  1GVC A;  2E0S A;  2UVH A;  3ILU B;  4ECF A;  4QFK A;  3USD A;  1NMU A;  2O7I A;  4GFR A;  3FZV A;  3FXR A;  3SET A;  1JW1 A;  1ZIU A;  2F35 A;  3DEL B;  3N5L A;  4ZEK A;  5A5X B;  3K01 A;  1B2H A;  3GXA A;  1NNT A;  4ZED A;  5DYH A;  1OQG A;  5EYF A;  2DWI A;  2NOO A;  3T9U A;  1PBP A;  1MY2 A;  3FUZ A;  3KGC A;  3EPE A;  1N7X A;  5FHN A;  4ZEF A;  3KSJ A;  1M5C A;  4MLQ A;  4EQ9 A;  3D4C A;  4OEU A;  4PFW A;  2Y7K A;  3U92 A;  2Y7P A;  4KFQ A;  4NTL A;  3K6W A;  4R74 A;  4OFJ A;  4LAT A;  1N7W A;  3UP9 A;  4FAT A;  3SEU A;  3KBR A;  1EZ9 A;  2REJ A;  1ZBM A;  2ZYK A;  3T93 B;  1PBQ A;  3HST A;  4C1T A;  1MDP 1;  1Y4T A;  4MBP A;  5I2N B;  4KYD A;  2LAO A;  3PD9 A;  3PPN A;  5J1D A;  2P0S A;  4H8I A;  2XD2 A;  2GHB A;  2ANJ A;  2VGQ A;  2XHD A;  2XXW A;  2V3T A;  3JYR A;  5KCJ A;  1BIY A;  3FJM A;  3SEW A;  4IGT A;  3EF7 A;  3BBR A;  4XKR A;  5H8F A;  4ZEB A;  2QS2 A;  4XKQ A;  4G2Z A;  4XTC Q;  3QUJ A;  1VFD A;  2P2A A;  3TAJ A;  5L8D A;  1B1H A;  4QSE A;  3M3F A;  3DP6 A;  1JEV A;  1SI1 A;  2RF1 A;  2ONK E;  3HO7 A;  1MQH A;  1YCJ A;  3ONM A;  4JB7 A;  2HZL A;  4JBZ A;  1A8E A;  1YAE A;  4QHQ A;  4ZEI A;  4F3P A;  1IXC A;  1I6B A;  2DP8 A;  1B5I A;  4FE8 A;  4GXA A;  1JQF A;  5BUU A;  1Z7N E;  4F19 A;  2O51 A;  3E9X A;  4R9F A;  5TP9 A;  5DVI A;  4ELP A;  3K6V A;  4GWO A;  3VE1 B;  4EQB A;  4U22 A;  2V3U A;  1XT8 A;  3UK4 A;  5IKB A;  1AL3 A;  5DT6 A;  2F7A A;  1UTB B;  3VVD A;  1MRP A;  3PV0 E;  1D9Y A;  3C35 A;  1M5D A;  3HHG A;  4H6D A;  2I3W A;  4R2F A;  3OO7 A;  2OWS A;  3Q27 A;  4KCD A;  2XXH A;  1B5H A;  1B0H A;  1P1W A;  2V84 A;  1L5T A;  2F6G A;  3PUW E;  5L9S A;  3LSL A;  1N04 A;  3TTK A;  2RC7 A;  1IZ1 A;  1IUD A;  3CFX A;  2Y7W A;  3CI8 A;  3JZJ A;  3TTR A;  1MM6 A;  2F6P A;  2F7B A;  3Q29 A;  2O1M A;  2DS9 A;  4F2O A;  4P11 A;  2OLB A;  3RUM A;  1MQD A;  5TPA B;  5JTY B;  3H6V A;  3PUZ E;  4XIG Q;  3TOD A;  2Z22 A;  3K00 A;  3U72 A;  5DVJ A;  4IY6 A;  1FTL A;  2B65 A;  2O68 A;  4FIM A;  3FAT A;  1JW5 A;  2ONR A;  4R75 A;  2QRY A;  1BP5 A;  1TWY A;  1FQB A;  3A09 A;  3C33 A;  2DWJ A;  4GF8 A;  2I3V A;  4Q30 B;  3SEY A;  3VLU A;  4LZ7 A;  1A40 A;  5CC2 A;  4LQ5 A;  1H76 A;  4XKN A;  1LAF E;  2THI A;  1IXI A;  2PVU A;  3TYH A;  4GVO A;  5AA1 A;  3IR1 A;  4F18 A;  2RIN A;  4H8J A;  4MH5 A;  3RQT A;  3IOV A;  3C9H A;  3SES A;  1TFD A;  1SQY A;  5I59 B;  2NUV A;  4M1V A;  2UYF A;  3QSL A;  5H8H B;  1R9L A;  1URG A;  2I49 A;  3OEM A;  4H1X A;  5JTY A;  2XXX A;  3RY3 A;  1FQF A;  1OIB A;  2RC8 A;  2QSX A;  4G68 B;  2RCB A;  5AE4 A;  3MWB A;  2O7U A;  3S9N C;  1I6Q A;  4GXS B;  5I57 B;  4KD5 A;  3LSW A;  1OLC A;  1IIW A;  3IOW A;  5HBC A;  1MXZ A;  3KJT A;  1HSJ A;  3V83 A;  2ZNT A;  2DQV A;  3H6U A;  2ABH A;  2YJP A;  3IO6 A;  3K1M A;  4WXJ A;  3RT8 A;  4YKP A;  1LFI A;  2UVJ A;  3MVW A;  2CMO A;  1NH8 A;  3RT6 B;  4U4X A;  4H5G A;  3IJX B;  4OVJ A;  1IIT A;  1SI0 A;  3QAX A;  3E4R A;  1J1N A;  4HCW A;  4GLI A;  3TCH A;  1D4N A;  4RA1 A;  3TQW A;  2M8C A;  2E1S A;  3S9L C;  2FNC A;  4TLL B;  1N76 A;  4X48 A;  1GV8 A;  2I48 A;  3N6T A;  3RPW A;  3B6T A;  5I56 B;  1POY 1;  5CI5 A;  2F34 A;  3K1P A;  3OEK A;  4F3S A;  1OVB A;  3H7M A;  1DOT A;  3E13 X;  3KSX A;  3MP6 A;  5EHS A;  1GR2 A;  2HAV A;  1JVX A;  5ITP A;  1MY3 A;  3GZG A;  1PEB A;  2Q88 A;  2XX9 A;  1IXG A;  1VFE A;  3MVX A;  5ITO A;  3MPK A;  1SDX A;  3TCF A;  2V25 A;  2VOZ A;  1FQE A;  1P1Q A;  1II5 A;  1POT A;  3A3U A;  3CG3 A;  1UTB A;  3IB2 A;  1MXU A;  4NF5 A;  4YU0 A;  5F1Q A;  2GFE A;  2Q2A A;  4F1Y A;  3KFM A;  1TT1 A;  3OEN A;  1US4 A;  5LOM A;  2RCA A;  1H44 A;  3OD7 A;  1LB8 A;  3VXC A;  1VE4 A;  3MW0 A;  4I62 A;  4K3F A;  4N07 A;  2XXI A;  1SW5 A;  1PC3 A;  3TEP A;  3T9H B;  2F7C A;  4OFO A;  1LBC A;  1Q35 A;  2B3B A;  1NNP A;  2FYI A;  3HHF A;  3S9E A;  3DLN A;  3RNN A;  4ZZE A;  3EHU A;  3FD3 A;  3MZ1 A;  1PB9 A;  3VLV A;  4F3G A;  1M5B A;  2V93 A;  2XXT A;  5H8Q B;  3T9V A;  3L6H A;  1B3H A;  2QS4 A;  4RJZ A;  1EZO A;  3CIJ A;  2NXO A;  3JV9 A;  2DYX A;  3K1N A;  5KZT A;  1B32 A;  2DXR A;  1MY4 A;  3KEI A;  1JNF A;  1MPB A;  4RXL A;  1DMB A;  3CR9 A;  3SDF A;  5CBR A;  2IA4 A;  4QSC A;  4EQ7 A;  3MBP A;  4KI0 E;  5H8H A;  1NH7 A;  2XXV A;  4C1U A;  1RKM A;  2H5Y A;  3CSG A;  1UIV A;  3ODB A;  4QFO A;  2Q8J A;  4ZE9 A;  4WED A;  3R7X A;  4R72 A;  1LST A;  2VHA A;  1SYH A;  3S2V A;  3K4U A;  1B1X A;  1FTM A;  1JVY A;  2PMS A;  1QUL A;  3K0V A;  3LSX A;  2UVG A;  3O6G A;  4YB6 A;  4E0W A;  5TU0 A;  4ELO A;  4F1V A;  5L9M A;  3UA8 A;  2PX1 A;  1UTH A;  2UYE A;  4NF4 A;  3TTL A;  4XXU A;  1AH5 A;  2ONS A;  3FV2 A;  4U1Z A;  3T22 A;  4RPO A;  4YMA A;  4YMB A;  4EUO A;  2GRV A;  3V5A A;  3E3K A;  3IAZ A;  3TEL A;  2DVZ A;  4ISU A;  4DLD A;  5BWJ A;  2NWJ A;  3B7D A;  5IAI A;  3I5O A;  2R71 A;  4LP2 B;  3M8U A;  4F3B A;  5AA3 A;  4IO5 A;  4OES A;  1F9B A;  1JET A;  3A3C A;  5A5X A;  3M3K A;  4GIZ A;  1R1N A;  2AYS A;  3VLW A;  5KDT B;  3B6Q A;  1A99 A;  3CG1 A;  3K2D A;  1P1U A; 
#chains in the Genus database with same CATH topology
 2YPN A;  3KJ7 A;  1B46 A;  5I2K B;  4OER A;  2G93 A;  4NWC A;  4XEQ A;  2HAU A;  1FBH A;  1QW0 A;  4MLV A;  1LCF A;  2H25 A;  4O8M A;  5FHM A;  3QIM A;  2H98 A;  3MJN A;  3F11 A;  3H4Z A;  2O84 X;  4G77 A;  3O2A A;  4F2Q A;  4NAP A;  3VXB A;  2XWK A;  4NWD A;  3T1B A;  1MDQ A;  1ZTY A;  3P7I A;  5FTI A;  2PYY A;  4ZS9 A;  3TCG A;  2I4B A;  2KR0 A;  4YKJ A;  2XXR A;  4EF1 A;  4P0I A;  4JSD A;  2X26 A;  2H99 A;  3C31 A;  3PPR A;  2I58 A;  2HFB A;  1P1O A;  3MC2 A;  4IB2 A;  4UAC A;  4G8N A;  4KYE A;  4R9G A;  3H6W A;  2DOJ A;  1EU8 A;  4DXB A;  1D3K A;  4LZ5 A;  4FEC A;  4BDN A;  3Q28 A;  5TPA A;  3THI A;  2PFZ A;  4N81 A;  3ILT B;  4PCD A;  2DE3 A;  2DVC A;  4ONY A;  1A7L A;  2DWH A;  3K6U A;  4NGU A;  3C4M A;  3U93 A;  1MXV A;  4RY1 A;  2DE4 A;  3TFL A;  3K02 A;  5HM4 B;  3IX1 A;  1GGG A;  4PBQ A;  3ECR A;  4PE5 B;  3LC8 A;  2YLN A;  2KLF A;  1LAG E;  1WVJ A;  5FBP A;  2QS1 A;  4NF8 A;  4BDO A;  5I2N A;  2Q74 A;  4DIG A;  2Y5L A;  1NV6 A;  3SZP A;  3PGF A;  2R9J A;  5LTC A;  4KR5 A;  1B0L A;  1AOV A;  3K6X A;  3A29 A;  1MQI A;  1LEV A;  2F78 A;  4HTG A;  2ZZW A;  1FPB A;  4IO2 A;  4ZE8 A;  1FJ6 A;  4F22 A;  5DEX A;  5TP9 B;  3UOR A;  1DTG A;  4THI A;  4PGN A;  2H4I A;  2F5X A;  3KZG A;  3NOH A;  2PFY A;  4DXC A;  2OBG A;  1IQ7 A;  2Q8M A;  5ET6 A;  3KN3 A;  5I56 A;  3G3G A;  4L17 A;  1SW4 A;  3H6T A;  4QFN A;  1URS A;  5KCJ B;  2HXR A;  3Q26 A;  3KC0 A;  2PT1 A;  5ICT A;  1MH4 A;  3LV0 A;  3QK6 A;  2Y84 A;  4HE0 A;  2UVI A;  4JWY A;  1HSL A;  2CZL A;  2Z23 A;  2Y7R A;  4O3C A;  5B7D A;  4H67 A;  4N15 A;  3O6I A;  3RGY A;  1OQH A;  4OFL A;  2OK2 A;  1B5J A;  4U2R A;  3OOA A;  3CFZ A;  4O7I A;  3VFJ A;  3WAE A;  1AIV A;  2QMX A;  2OCU A;  2D21 A;  1XVX A;  2DE2 A;  4LA9 A;  4KYS A;  3MQ9 A;  5I58 A;  2ZNS A;  4HW8 A;  1MXX A;  5AA4 B;  3KOT A;  3MPL A;  1IEJ A;  4DZ1 A;  2CZI A;  4I8C A;  3EHS A;  1ZLQ A;  1SVX B;  4FOR A;  4O3B A;  1TFA A;  4YKI A;  1IXH A;  2ZYO A;  4OTE A;  1PB7 A;  5CMM A;  5ISU A;  3OSQ A;  3T9X B;  2UVH A;  4P9K A;  4JVD A;  4P47 A;  3SET A;  2F35 A;  3DEL B;  5A5X B;  1FPI A;  4ZED A;  2QFL A;  5DYH A;  1OQG A;  5EYF A;  1MY2 A;  3FUZ A;  3KGC A;  3U92 A;  1NI9 A;  4R74 A;  4OFJ A;  1N7W A;  3SEU A;  1Y4T A;  5I2N B;  3D1R A;  3PD9 A;  2P0S A;  2GHB A;  2XHD A;  2XWI A;  3BBR A;  4XKR A;  4XKQ A;  2P2A A;  2RF1 A;  5H8S A;  3HO7 A;  1YCJ A;  4JBZ A;  1FPG A;  2HZL A;  4F3P A;  2DP8 A;  1B5I A;  1IMF A;  4R9F A;  5DVI A;  1XT8 A;  1DBZ A;  1NUZ A;  3PV0 E;  4PDD A;  3C35 A;  3HHG A;  4H6D A;  2I3W A;  4MAG A;  1B5H A;  1B0H A;  1P1W A;  1L5T A;  5L9S A;  1N04 A;  1IZ1 A;  2Y7W A;  4PAF A;  5JTY B;  2CZK A;  3TOD A;  1FPF A;  1A40 A;  5CC2 A;  2THI A;  1IXI A;  4GVO A;  4F18 A;  4MH5 A;  3SES A;  1SQY A;  2NUV A;  3QSL A;  3OEM A;  3ROJ A;  3RY3 A;  1FQF A;  2QSX A;  2RCB A;  1I6Q A;  4GXS B;  4HE2 A;  1HSJ A;  2YJP A;  4YKP A;  1FPD A;  4H5G A;  4OVJ A;  4HCW A;  1D4N A;  4RA1 A;  3TQW A;  4TLL B;  3B6T A;  5I56 B;  4JVC A;  3K1P A;  1OVB A;  3MP6 A;  5EHS A;  1GR2 A;  1PEB A;  1SDX A;  2V25 A;  1UTB A;  1VDW A;  2XXI A;  4OFO A;  1LBC A;  3HHF A;  2B3B A;  2FYI A;  3DLN A;  3EHU A;  1PB9 A;  1EZO A;  3CIJ A;  3JV9 A;  2DYX A;  5KZT A;  1MY4 A;  4PFI A;  3CR9 A;  4QSC A;  3MBP A;  4KI0 E;  5H8H A;  2H5Y A;  3CSG A;  2Q8J A;  4ZE9 A;  3HFU A;  3K4U A;  1JVY A;  3LSX A;  4E0W A;  2ZZX A;  3O6G A;  4YB6 A;  4F1V A;  1RDZ A;  4XF5 A;  4XXU A;  1AH5 A;  4YMA A;  4RPO A;  4DLD A;  4LP2 B;  5AA3 A;  4IO5 A;  4OES A;  5KDT B;  5F1Q A;  3G3H A;  2PCR A;  4MEV A;  1R9Q A;  3FVO A;  1JEU A;  2IEE A;  1Y1M A;  4BLA A;  4UAB A;  5CBS A;  4AQ4 A;  3L6G A;  2H9B A;  3H03 A;  1FBE A;  4POX A;  3FJ7 A;  4I1D A;  1MG1 A;  4TQU Q;  4YB5 A;  3U8Q A;  2CEX A;  1B9J A;  1NNK A;  2JJK A;  1Y3Q A;  1EZP A;  4GWS A;  5K2X A;  1MQG A;  1FBD A;  3GBB A;  3PUY E;  1B40 A;  5L9O A;  2DWA A;  3LSF B;  3UGW A;  5I57 A;  1MPD A;  4C0R A;  2RC9 A;  2Z8F A;  2XA5 A;  1XHY A;  3IOR A;  1Y3P A;  4E0X A;  3CHG A;  2P3V A;  4BDL A;  1Q1K A;  3PUV E;  3TTM A;  4N17 A;  1KZ8 A;  3KN7 A;  3S4U A;  4ESW A;  4PFR A;  1KA0 A;  2OZZ A;  2XXP A;  2DSF A;  4UA8 A;  1Y3N A;  1LBZ A;  2ZMB A;  2I0B A;  3OO8 A;  1O7T A;  5IM2 A;  4MF3 A;  3U1O A;  1SYI A;  1FW0 A;  2Y5K A;  4EXK A;  4P56 A;  5ESY A;  2XD3 A;  1LBV A;  4AB5 A;  1B52 A;  2R6G E;  3E79 A;  3FVK A;  1IMC A;  3PMW A;  4P1E A;  3IL1 B;  3OEL A;  3HV1 A;  3SEV A;  4RK9 A;  1N84 A;  1A54 A;  1UQW A;  3M3L A;  3ZS6 A;  2OX3 A;  3V89 B;  4PC9 A;  3OSR A;  4H0W A;  5M2V A;  4QSD A;  3BFU A;  1N0T A;  4HCY A;  2F36 A;  3QYT A;  1FQC A;  1AWB A;  3B6W A;  2A5S A;  4PFU A;  1P99 A;  3HPI A;  1NUY A;  1B7U A;  4OXV A;  2X7Q A;  4AB6 A;  4KQP A;  5CRY A;  1FQD A;  5HPQ A;  1XOC A;  4F31 B;  1QKA A;  1USY H;  1NV5 A;  3V8X B;  4ELR A;  3EHT A;  5I3S A;  4NQ8 A;  2I6E A;  2A5T A;  4R73 A;  3CSB A;  2QL3 A;  3FGS A;  3CRB A;  4FEB A;  4I3E A;  4PET A;  4U23 A;  1LGB C;  3IO4 A;  1FSA A;  3SEX A;  3UN6 A;  3PPP A;  1FQA A;  1PB8 A;  4IO7 A;  3W9W A;  2XX7 A;  1XC1 A;  4IO3 A;  4GX6 A;  2HXW A;  4G68 A;  3FV1 A;  1FTJ A;  2O6A A;  4LON B;  1RYX A;  4ELQ A;  5J16 A;  4F29 A;  4TOZ A;  2ZYN A;  5DTB A;  1YTV A;  3OO6 A;  4G61 A;  4YAH X;  2NVU B;  1QUK A;  3GLB A;  1ZJL A;  3VDF A;  2HHM A;  3R26 A;  2Q89 A;  2HEU A;  1JP4 A;  3IB0 A;  3OMB A;  4QFP A;  3TMG A;  5JEI A;  2F3D A;  1PDA A;  3PMV A;  2XXK A;  2ZYM A;  1NL5 A;  3ILU B;  4ECF A;  1NMU A;  1JW1 A;  1ZIU A;  3N5L A;  3RPL A;  3GXA A;  3EPE A;  4ZEF A;  4PFW A;  2Y7K A;  4LAT A;  3T93 B;  2ZYK A;  1PBQ A;  1MDP 1;  4KYD A;  2LAO A;  2ANJ A;  2VGQ A;  1BIY A;  3FJM A;  3SEW A;  4IGT A;  3EF7 A;  1K9Y A;  3EKI A;  5H8F A;  4ZEB A;  2QS2 A;  1B1H A;  5EYG A;  4ZEI A;  1I6B A;  1NV2 A;  4GXA A;  1DK4 A;  2O51 A;  3E9X A;  3MST A;  3PTY A;  4N91 A;  5DT6 A;  3VVD A;  2OWS A;  4KCD A;  4X04 A;  2V84 A;  1IUD A;  3JZJ A;  4P11 A;  1MQD A;  2CEY A;  5ET7 A;  4MNC A;  4PBH A;  1FTL A;  2B65 A;  4R75 A;  3TQL A;  1BP5 A;  1TWY A;  4Q30 B;  3SEY A;  2I3V A;  4LQ5 A;  1H76 A;  1LAF E;  2PVU A;  2RIN A;  4H8J A;  3RQT A;  3IOV A;  5I59 B;  2VT5 A;  1URG A;  4H1X A;  1NV1 A;  2XXX A;  4DI4 B;  2RC8 A;  5I57 B;  3LSW A;  3KJT A;  4GWY A;  3RT8 A;  2UVJ A;  3RT6 B;  4U4X A;  3QAX A;  3TCH A;  2M8C A;  4X48 A;  2I48 A;  3RPW A;  4KXP A;  1POY 1;  2F34 A;  3OEK A;  5EQ7 A;  3E13 X;  1JVX A;  4OVS A;  1MY3 A;  2Q88 A;  1IXG A;  3MPK A;  2VOZ A;  3CG3 A;  3IB2 A;  2GFE A;  4F1Y A;  1EYK A;  3KFM A;  1TT1 A;  1US4 A;  1H44 A;  1FPL A;  3VXC A;  1VE4 A;  4N07 A;  3S9E A;  4ZZE A;  3FD3 A;  3VLV A;  1M5B A;  2XXT A;  2F3B A;  2QS4 A;  2NXO A;  4JVI A;  1MPB A;  1DMB A;  1RKM A;  1FBF A;  3B8B A;  4XFE A;  4PGP A;  3S2V A;  4PF6 A;  1B1X A;  2PMS A;  2HPG A;  5TU0 A;  5L9M A;  1UTH A;  2UYE A;  3TTL A;  3FV2 A;  3T22 A;  4YMB A;  5BWJ A;  3E3K A;  3IAZ A;  2R71 A;  5A5X A;  2AYS A;  3VLW A;  3B6Q A;  3MZ9 A;  3CG1 A;  3K2D A;  1P1U A;  4JWO A;  3KN8 A;  4G8M A;  1FCK A;  4JDF A;  2VD3 A;  4NF6 B;  4GD5 A;  3MUQ A;  4NE4 A;  1LFH A;  4WEP A;  2AL5 A;  2DXY A;  4GWU A;  4ZZA A;  3E78 A;  1OMP A;  3CVG A;  2G29 A;  5DEX B;  4MFI A;  3TKD A;  2AIX A;  3HN0 A;  2VD2 A;  3TTN A;  3RTW B;  4OZ9 A;  1D9V A;  1S7Y A;  1LBB A;  3O9P A;  3LUY A;  4GF8 A;  3R6U A;  1MQJ A;  2Y7I A;  3EQ1 A;  5FTH A;  1B58 A;  5EHM A;  3N26 A;  4H5F A;  4GWW A;  5JK4 A;  4FED A;  2X7P A;  4OVP A;  4JSO A;  4WKM A;  4TLM B;  1HSE A;  1JW4 A;  2XXY A;  3DP8 A;  3WAF A;  4MMP A;  1FPE A;  1UTH B;  3FVN A;  2XWV A;  5I84 A;  3TPA A;  4MJO A;  3G3K A;  1B3E A;  4PFT A;  4OEV A;  2ZZV A;  1MXY A;  1RYO A;  4Q5T A;  4O3A A;  5IZ3 B;  4Z0I A;  3TZA A;  2ZNU A;  2Z8D A;  1SD3 A;  3TUS A;  3QXM A;  4OET A;  2ZXT A;  1B3G A;  2WX9 A;  1NV7 A;  3PMX A;  3RLF E;  4RK2 A;  5DVF A;  1OLA A;  3MP8 A;  2REG A;  2O69 A;  4N6P A;  1B4H A;  3PPQ A;  3G3J A;  4G68 C;  1QJM A;  5AA2 B;  4DDD A;  4GX4 A;  4FJP A;  4M4G A;  1VSO A;  1ZKB A;  4OVR A;  2D5W A;  2V4C A;  3T66 A;  4PFY A;  4LVQ A;  3MAM A;  1TXF A;  4PE3 A;  2B3F A;  4EXL A;  1MM7 A;  5ICQ A;  1SPI A;  1MY0 A;  3KG2 A;  2FIX A;  2HZK A;  1YYZ A;  1Y20 A;  4NF4 B;  1T0K A;  4G4P A;  1FTO A;  1LAX A;  1LCT A;  2KQZ A;  3IFA A;  4BDQ A;  1VR5 A;  3GBA A;  3BKI B;  3RTF B;  2AL4 A;  4HS7 A;  5CMB A;  4N13 A;  2V3Q A;  4MNI A;  4P1L A;  2DDK A;  3I3V A;  1ATG A;  4GBW A;  1QUI A;  5FHO A;  1LLS A;  2HQ0 A;  3SKP A;  4GOT A;  3UIF A;  3H3G A;  2F8D A;  1A55 A;  4NMY A;  4EF2 A;  2WBB A;  3LUZ A;  4P8B A;  1LB9 A;  3RN8 A;  4X1D A;  1Z7M E;  3IOT A;  1MPC A;  1LFG A;  4NF5 B;  3D4G A;  3O29 A;  2QVR A;  4FAJ A;  5ET5 A;  4ESX A;  2A5T B;  1ZU0 A;  1UIU A;  5AA2 A;  4N8G A;  2OJT A;  4YKK A;  1B3L A;  3O97 A;  4GWX A;  5I2K A;  1H3D A;  4KHZ E;  4U21 A;  4N6D A;  1YZ0 A;  1EH3 A;  3HCQ A;  3N6U A;  4QBA A;  4IGR A;  5AA2 D;  3GYY A;  2WEF A;  1Y1Z A;  5H8F B;  1MS7 A;  2D3I A;  1QKB A;  5KDT A;  3G7W A;  2Q2C A;  1I6A A;  4P3L A;  2GH9 A;  4OYV A;  1DPE A;  3Q25 A;  1S9T A;  4F1U A;  5K2Y A;  5T3J A;  4LQ2 A;  1B7H A;  4X9T A;  4GL0 A;  1FTA A;  4ND9 A;  3O6H A;  1YPN A;  1A8F A;  4MIJ A;  4DXU A;  2WBD A;  3G3I A;  5H8Q A;  3IJO B;  4H65 A;  1NV4 A;  3EN3 A;  1CE2 A;  4RYA A;  4AS4 A;  1ANF A;  1SBP A;  4PDH A;  4YIC A;  1B05 A;  1WDN A;  4I3Y A;  3PU5 A;  2BJI A;  4GRK A;  1I69 A;  4MHF A;  1B3F A;  1RDX A;  1ELJ A;  4OMB A;  2ESN A;  1RDY A;  4JXI A;  1Y9U A;  3CFL A;  1O63 A;  4RNS A;  1DSN A;  5H8N A;  3IB1 A;  1GVC A;  2E0S A;  3USD A;  3FXR A;  3K01 A;  1FBG A;  1NNT A;  2DWI A;  3KSJ A;  3D4C A;  4N6K A;  4KFQ A;  3UP9 A;  3K6W A;  5EQA A;  3KBR A;  1EZ9 A;  2REJ A;  1ZBM A;  4C1T A;  4OVQ A;  4DI3 D;  2FVZ A;  5J1D A;  2XD2 A;  5KCJ A;  3JYR A;  4NX1 A;  4XTC Q;  4G2Z A;  3QUJ A;  3TAJ A;  4QSE A;  3DP6 A;  4JB7 A;  3ONM A;  1A8E A;  3U65 A;  1IXC A;  1CNQ A;  1JQF A;  1Z7N E;  4F19 A;  5TP9 A;  4ELP A;  4GX3 A;  3VE1 B;  4EQB A;  4NG7 A;  2V3U A;  2F7A A;  3MYU A;  1UTB B;  3RYD A;  4R2F A;  3Q27 A;  2XXH A;  3TTK A;  2RC7 A;  3CFX A;  3CI8 A;  3TTR A;  3BIG A;  4PAK A;  2F7B A;  3Q29 A;  2O1M A;  2DS9 A;  2OLB A;  3RUM A;  5TPA B;  4MX6 A;  2Z22 A;  3U72 A;  5DVJ A;  1D9Q A;  4IY6 A;  2O68 A;  4FIM A;  1JW5 A;  3W9V A;  3A09 A;  3C33 A;  1EYJ A;  2DWJ A;  4LZ7 A;  4XKN A;  4NN3 A;  5AA1 A;  3C9H A;  1TFD A;  2UYF A;  5H8H B;  1R9L A;  5JTY A;  1QGX A;  2I49 A;  5EQ9 A;  1OIB A;  4G68 B;  2O7U A;  5HBC A;  1IIW A;  4PFB A;  2ZNT A;  3H6U A;  2ABH A;  5IGA A;  1LFI A;  2CMO A;  1NH8 A;  3IJX B;  3E4R A;  2E1S A;  2B4M A;  2FNC A;  1N76 A;  4F3S A;  3H7M A;  4PF8 A;  5ITP A;  1VFE A;  2P3N A;  3TCF A;  5ITO A;  1FQE A;  4YU0 A;  1II5 A;  3A3U A;  4NF5 A;  1MXU A;  2Q2A A;  3OEN A;  1IME A;  3FBP A;  1INP A;  1SW5 A;  1PC3 A;  3T9H B;  3RNN A;  4F3G A;  5H8Q B;  3T9V A;  1K9Z A;  4I40 A;  4RJZ A;  1DCU A;  4MCO A;  1XI6 A;  1B32 A;  4LN5 A;  4RXL A;  3SDF A;  2IA4 A;  1NH7 A;  2XXV A;  4QFO A;  1IMA A;  1UIV A;  3ODB A;  4WED A;  4NHB A;  2VHA A;  4ELO A;  3K0V A;  2PX1 A;  4NF4 A;  2ONS A;  4O94 A;  2GRV A;  2DVZ A;  4ISU A;  2NWJ A;  3B7D A;  5IAI A;  3M8U A;  4F3B A;  1F9B A;  3A3C A;  3M3K A;  4GIZ A;  1R1N A;  2FHY A;  5CM6 A;  4OQO A;  4NED A;  1FRP A;  1NUW A;  1SW2 A;  1LAH E;  4X8R A;  4YB7 A;  3N94 A;  3DM0 A;  2W7Y A;  4GBV A;  4DCY A;  4NF0 A;  2PT2 A;  1R6Z A;  1MY1 A;  4POW A;  4R6H A;  1WOD A;  1OVT A;  4GL8 A;  3S9M C;  2PBW A;  4IR8 A;  1KA1 A;  1N3W A;  4BDM A;  2I4C A;  4KCC A;  4PAI A;  4QF9 A;  3B50 A;  3PD8 A;  4OHN A;  3BIH A;  3PUX E;  4R6Y A;  4BDR A;  1B51 A;  1Y4C A;  3FXU A;  1LBY A;  3AXF A;  2CZH A;  2HCA A;  4R6K A;  3OO9 A;  1GTK A;  1BK4 A;  2QVV A;  1M5F A;  1SW1 A;  4NF8 B;  4Q0C A;  4R2B A;  3H06 B;  3IK6 B;  3DP4 A;  2FA7 A;  2ALU A;  1IMD A;  2FIE A;  4IO4 A;  2O1L A;  4OEN A;  4U4S A;  4DE8 A;  5CMC A;  4N8Y A;  4ZDM A;  5CMK A;  4DCX A;  3FIR A;  5AA4 A;  3LR1 A;  2MKZ A;  5A5L A;  3FXQ A;  1DPP A;  4U1O A;  3KBZ A;  5I5P A;  1S50 A;  5ET8 A;  1B7Z A;  4EDP A;  3LBS A;  2GQ1 A;  1EYI A;  1H43 A;  3TDJ A;  5I59 A;  1QVS A;  4LZ8 A;  4IY5 A;  2I0C A;  1CB6 A;  2QJE A;  3C34 A;  3FXB A;  4GQO A;  1M5E A;  2BJJ X;  2XXQ A;  2QS3 A;  2WKY A;  2QMW A;  1US5 A;  1BLF A;  1B6H A;  4LUB A;  1MH3 A;  1BKA A;  4PP0 A;  4QFL A;  1BTJ A;  4P0G A;  3VVF A;  1URD A;  1FTK A;  2UXA A;  1AMF A;  1P1N A;  3IFC A;  1KWH A;  1FBP A;  4G8H A;  4OWD A;  1G0I A;  4F39 A;  3VV5 A;  3C32 A;  4Q8R A;  3U94 A;  3SER A;  4X1B A;  4IO6 A;  1DTZ A;  4H46 A;  4HE1 A;  1MXW A;  2VP1 A;  2OWT A;  4XKP A;  4YZZ A;  2F97 A;  2RKM A;  3FVG A;  3MZB A;  5ELV A;  3O66 A;  3PPO A;  1FPK A;  4ZEC A;  1FJ9 A;  3O28 A;  3BFT A;  3IOU A;  3KOS A;  2P1S A;  2QPQ A;  2Q9T A;  1LBX A;  3RPL B;  3ZKL A;  4PQJ A;  3MVZ A;  1N3X A;  1O64 A;  1USY E;  3T96 B;  2XXU A;  3FAS A;  4QRZ A;  1QUJ A;  1B4Z A;  3I6V A;  1G0H A;  3ZKK A;  3C36 A;  1XS5 A;  3VVE A;  2Z8E A;  1XVY A;  4OAN A;  2GHA A;  5DW8 A;  2XX8 A;  5H8N B;  4I9D A;  3FJG A;  3W15 C;  1NNF A;  5B70 A;  4JWX A;  1ZMG A;  3G3F A;  4NF6 A;  2VPO A;  4RPN A;  3V5A A;  1NFT A;  3OXN A;  4Z7E A;  3MVY A;  3QUF A;  3ZSF A;  3ISP A;  5I58 B;  3MP1 A;  1H45 A;  4KPT A;  1NKX A;  5IZ1 A;  1FBC A;  4QFK A;  1NV0 A;  2O7I A;  4GFR A;  3FZV A;  5IZ3 A;  4ZEK A;  5LDZ A;  1B2H A;  3QMF A;  2L5V A;  3T9U A;  2NOO A;  1PBP A;  1YXI A;  5FHN A;  1N7X A;  4EQ9 A;  1M5C A;  4MLQ A;  4MNP A;  4OEU A;  2Y7P A;  4NTL A;  2OWZ A;  4HXV A;  4FAT A;  2VPN A;  3HST A;  4MBP A;  3PPN A;  4H8I A;  2XXW A;  2V3T A;  1NUX A;  1IMB A;  1VFD A;  5L8D A;  3M3F A;  1JEV A;  1SI1 A;  2ONK E;  1MQH A;  1YAE A;  4QHQ A;  4N4U A;  4FE8 A;  5BUU A;  3K6V A;  4GWO A;  4U22 A;  5IKB A;  3UK4 A;  5I7I A;  1AL3 A;  3T0J A;  1MRP A;  1D9Y A;  1M5D A;  4FBP A;  3OO7 A;  2F6G A;  3PUW E;  3LSL A;  1FPJ A;  1MM6 A;  2F6P A;  4F2O A;  3H6V A;  3PUZ E;  4XIG Q;  3K00 A;  4GWZ A;  3FAT A;  2ONR A;  2QRY A;  1FQB A;  3VLU A;  1LBW A;  3TYH A;  2B4L A;  2QVU A;  3IR1 A;  4QXD A;  4M1V A;  5F24 A;  5AE4 A;  3MWB A;  2WYP A;  3S9N C;  4KD5 A;  1OLC A;  3IOW A;  1MXZ A;  1NV3 A;  3V83 A;  2DQV A;  1Q9D A;  3IO6 A;  3K1M A;  4WXJ A;  3MVW A;  1IIT A;  1SI0 A;  1J1N A;  4GLI A;  3S9L C;  1GV8 A;  5EYH A;  3N6T A;  4OA4 A;  5CI5 A;  1DOT A;  3KSX A;  2HAV A;  3GZG A;  4PTK A;  2XX9 A;  3MVX A;  1P1Q A;  1POT A;  5F7V A;  5LOM A;  2RCA A;  3OD7 A;  1LB8 A;  2WYK A;  3MW0 A;  4I62 A;  4K3F A;  4H45 A;  4OVT A;  3TEP A;  2F7C A;  1Q35 A;  1NNP A;  5IZZ A;  3MZ1 A;  2V93 A;  3L6H A;  1B3H A;  3K1N A;  2DXR A;  3KEI A;  1JNF A;  5CBR A;  5EQ8 A;  4EQ7 A;  4C1U A;  4AS5 A;  3KC1 A;  3R7X A;  4R72 A;  1LST A;  2R8T A;  1SYH A;  1FTM A;  1QUL A;  4O7M A;  2UVG A;  3UA8 A;  4U1Z A;  4EUO A;  3TEL A;  2FBP A;  3I5O A;  2XWO A;  1JET A;  1A99 A; 
#chains in the Genus database with same CATH homology
 4JWO A;  1R9Q A;  2YPN A;  3KJ7 A;  3KN8 A;  1B46 A;  3FVO A;  4G8M A;  1FCK A;  1JEU A;  5CM6 A;  5H8S A;  2IEE A;  4JDF A;  5I2K B;  2VD3 A;  4OER A;  2G93 A;  4GD5 A;  4NF6 B;  1Y1M A;  3MUQ A;  4NWC A;  4BLA A;  4NE4 A;  2HAU A;  1LFH A;  4WEP A;  5CBS A;  4OQO A;  1QW0 A;  2AL5 A;  2DXY A;  4ZZA A;  4AQ4 A;  4MLV A;  1LCF A;  1OMP A;  4NED A;  3CVG A;  2H25 A;  3L6G A;  2G29 A;  1SW2 A;  1LAH E;  5FHM A;  2H9B A;  3QIM A;  5DEX B;  4MFI A;  2H98 A;  3H03 A;  3TKD A;  2AIX A;  3MJN A;  3F11 A;  3H4Z A;  2O84 X;  3HN0 A;  4POX A;  4G77 A;  3N94 A;  4YB7 A;  3DM0 A;  2W7Y A;  3O2A A;  5F7V A;  2VD2 A;  4DCY A;  4F2Q A;  3FJ7 A;  4I1D A;  1MG1 A;  3VXB A;  4TQU Q;  3TTN A;  4YB5 A;  2PT2 A;  3RTW B;  1R6Z A;  4NWD A;  3U8Q A;  4OZ9 A;  1MDQ A;  1D9V A;  1MY1 A;  1S7Y A;  4POW A;  1LBB A;  1B9J A;  1WOD A;  1ZTY A;  3LUY A;  1MQJ A;  1NNK A;  3O9P A;  3R6U A;  2Y7I A;  1Y3Q A;  3P7I A;  1OVT A;  3EQ1 A;  5FTH A;  1B58 A;  5FTI A;  2PYY A;  4GL8 A;  2PBW A;  5EHM A;  4ZS9 A;  3TCG A;  3N26 A;  3S9M C;  2I4B A;  1EZP A;  1N3W A;  4H5F A;  4BDM A;  5K2X A;  1MQG A;  2I4C A;  3GBB A;  5JK4 A;  3PUY E;  4KCC A;  1B40 A;  4QF9 A;  3PD8 A;  4OHN A;  4YKJ A;  5L9O A;  2DWA A;  4FED A;  2X7P A;  3PUX E;  4R6Y A;  4BDR A;  1B51 A;  1Y4C A;  3FXU A;  4JSO A;  4WKM A;  4TLM B;  3LSF B;  1HSE A;  3AXF A;  2HCA A;  2XXR A;  1JW4 A;  4EF1 A;  2XXY A;  4P0I A;  3UGW A;  4R6K A;  3DP8 A;  3OO9 A;  5I57 A;  3WAF A;  4JSD A;  1GTK A;  1UTH B;  3FVN A;  2X26 A;  2H99 A;  3C31 A;  3PPR A;  5I84 A;  1MPD A;  4C0R A;  3TPA A;  2I58 A;  2HFB A;  1P1O A;  3G3K A;  1M5F A;  2RC9 A;  1SW1 A;  1B3E A;  4PFT A;  2Z8F A;  3MC2 A;  4NF8 B;  4Q0C A;  3IOR A;  1XHY A;  4OEV A;  1MXY A;  1RYO A;  1Y3P A;  4Q5T A;  4O3A A;  4E0X A;  4R2B A;  3H06 B;  3IK6 B;  4IB2 A;  4UAC A;  4Z0I A;  3DP4 A;  2ZNU A;  4G8N A;  3TZA A;  4BDL A;  1Q1K A;  4KYE A;  4R9G A;  3H6W A;  2DOJ A;  2FA7 A;  3PUV E;  2Z8D A;  1EU8 A;  2ALU A;  3TTM A;  1SD3 A;  3TUS A;  4IO4 A;  2O1L A;  3QXM A;  4OEN A;  4DXB A;  1D3K A;  3KN7 A;  4LZ5 A;  4U4S A;  4FEC A;  4DE8 A;  4OET A;  2ZXT A;  1B3G A;  5CMC A;  3S4U A;  4ESW A;  4BDN A;  5CMK A;  4ZDM A;  3Q28 A;  3PMX A;  5TPA A;  3THI A;  4DCX A;  3RLF E;  4RK2 A;  5DVF A;  3ILT B;  2OZZ A;  3FIR A;  2XXP A;  2DSF A;  4UA8 A;  1OLA A;  3MP8 A;  2REG A;  2O69 A;  4N6P A;  1B4H A;  5AA4 A;  2DE3 A;  3LR1 A;  2DVC A;  1Y3N A;  1A7L A;  2I0B A;  2DWH A;  2ZMB A;  3G3J A;  3PPQ A;  4ONY A;  4G68 C;  1QJM A;  3K6U A;  3OO8 A;  4DDD A;  5AA2 B;  3C4M A;  1O7T A;  4FJP A;  3FXQ A;  1DPP A;  3U93 A;  4MF3 A;  3U1O A;  4M4G A;  4U1O A;  1MXV A;  4RY1 A;  1VSO A;  1ZKB A;  1S50 A;  2D5W A;  1SYI A;  3T66 A;  1B7Z A;  4PFY A;  4EDP A;  1FW0 A;  3MAM A;  4LVQ A;  4EXK A;  1TXF A;  2DE4 A;  2B3F A;  3TFL A;  2XD3 A;  4EXL A;  3K02 A;  3LBS A;  3TDJ A;  1H43 A;  1MM7 A;  4AB5 A;  5ICQ A;  5HM4 B;  1B52 A;  1MY0 A;  3IX1 A;  5I59 A;  3KG2 A;  2HZK A;  1GGG A;  1QVS A;  2R6G E;  4LZ8 A;  3ECR A;  4IY5 A;  4PE5 B;  2I0C A;  1CB6 A;  2QJE A;  3C34 A;  1Y20 A;  3FVK A;  3LC8 A;  4NF4 B;  3PMW A;  4G4P A;  1T0K A;  2YLN A;  1FTO A;  3IL1 B;  2KLF A;  3OEL A;  4R6H A;  1LAG E;  1WVJ A;  4GQO A;  1LAX A;  3HV1 A;  2QS1 A;  3SEV A;  1LCT A;  1M5E A;  4BDQ A;  4RK9 A;  1N84 A;  1VR5 A;  1A54 A;  2BJJ X;  2XXQ A;  1UQW A;  3GBA A;  3W9V A;  3BKI B;  3RTF B;  4NF8 A;  2QS3 A;  2AL4 A;  4HS7 A;  2WKY A;  5CMB A;  4BDO A;  5I2N A;  4N13 A;  2V3Q A;  3M3L A;  3I3V A;  3ZS6 A;  3V89 B;  1ATG A;  2QMW A;  4DIG A;  1US5 A;  3OSR A;  1BLF A;  1B6H A;  4LUB A;  4H0W A;  1QUI A;  3PGF A;  1MH3 A;  1BKA A;  2R9J A;  4PP0 A;  4QFL A;  5FHO A;  1BTJ A;  1LLS A;  5M2V A;  4P0G A;  4KR5 A;  4QSD A;  1B0L A;  3VVF A;  2HQ0 A;  3SKP A;  3K6X A;  1AOV A;  1URD A;  1FTK A;  2UXA A;  1AMF A;  4GOT A;  3BFU A;  3UIF A;  3H3G A;  1N0T A;  2F8D A;  1P1N A;  4HCY A;  2F36 A;  1A55 A;  3QYT A;  1KWH A;  4NMY A;  1FQC A;  1MQI A;  4EF2 A;  4G8H A;  1LB9 A;  2F78 A;  3B6W A;  4HTG A;  4OWD A;  3RN8 A;  4X1D A;  1Z7M E;  4F39 A;  3IOT A;  4IO2 A;  2A5S A;  3VV5 A;  1MPC A;  1P99 A;  4PFU A;  4ZE8 A;  1LFG A;  4NF5 B;  3D4G A;  3O29 A;  4FAJ A;  3HPI A;  4F22 A;  1B7U A;  4OXV A;  5DEX A;  3C32 A;  5TP9 B;  3UOR A;  2A5T B;  4ESX A;  1ZU0 A;  1DTG A;  2X7Q A;  1UIU A;  4THI A;  4AB6 A;  4Q8R A;  5AA2 A;  2OJT A;  4KQP A;  5CRY A;  2H4I A;  3SER A;  3U94 A;  2F5X A;  1B3L A;  1FQD A;  3KZG A;  4IO6 A;  4X1B A;  4YKK A;  1DTZ A;  5HPQ A;  1MXW A;  3TQL A;  1XOC A;  4DXC A;  2OBG A;  4F31 B;  2VP1 A;  1IQ7 A;  1QKA A;  3O97 A;  2OWT A;  5I2K A;  1USY H;  1H3D A;  5I56 A;  3KN3 A;  4XKP A;  3V8X B;  4KHZ E;  3G3G A;  4U21 A;  4YZZ A;  4ELR A;  3EHT A;  2F97 A;  2RKM A;  1SW4 A;  3FVG A;  4L17 A;  3HCQ A;  1EH3 A;  3H6T A;  3N6U A;  4QFN A;  1URS A;  4IGR A;  5KCJ B;  3MZB A;  2I6E A;  5ELV A;  3Q26 A;  2A5T A;  3O66 A;  3PPO A;  2PT1 A;  5AA2 D;  1MH4 A;  5ICT A;  4R73 A;  3CSB A;  4ZEC A;  1Y1Z A;  3O28 A;  2QL3 A;  3QK6 A;  2Y84 A;  3FGS A;  3CRB A;  5H8F B;  3BFT A;  1MS7 A;  2D3I A;  3IOU A;  4FEB A;  4PET A;  1QKB A;  4U23 A;  2UVI A;  4JWY A;  1LGB C;  3IO4 A;  3KOS A;  3G7W A;  5KDT A;  2Q2C A;  2P1S A;  2QPQ A;  1I6A A;  3SEX A;  1HSL A;  2CZL A;  2GH9 A;  2Q9T A;  2Y7R A;  2Z23 A;  3UN6 A;  3PPP A;  4OYV A;  1DPE A;  1FQA A;  1PB8 A;  4IO7 A;  4O3C A;  3W9W A;  2XX7 A;  3ZKL A;  3Q25 A;  1S9T A;  4F1U A;  1XC1 A;  4PQJ A;  3MVZ A;  4IO3 A;  5K2Y A;  1N3X A;  1O64 A;  5B7D A;  1USY E;  3T96 B;  4H67 A;  4LQ2 A;  1B7H A;  2HXW A;  4G68 A;  4X9T A;  4GL0 A;  3FV1 A;  3O6I A;  1FTJ A;  3RGY A;  1OQH A;  2O6A A;  4OFL A;  2OK2 A;  2XXU A;  3FAS A;  4LON B;  4QRZ A;  4ND9 A;  1B5J A;  4U2R A;  4Z7E A;  3O6H A;  1RYX A;  1QUJ A;  3OOA A;  4ELQ A;  3CFZ A;  3VFJ A;  3WAE A;  1B4Z A;  1YPN A;  3I6V A;  1A8F A;  1AIV A;  3ZKK A;  4F29 A;  2QMX A;  2OCU A;  4TOZ A;  3C36 A;  1XS5 A;  2D21 A;  2ZYN A;  1XVX A;  3G3I A;  3VVE A;  5DTB A;  4DXU A;  1YTV A;  2DE2 A;  1XVY A;  2Z8E A;  4LA9 A;  3G3H A;  2GHA A;  3IJO B;  4KYS A;  5H8Q A;  3OO6 A;  3MQ9 A;  2XX8 A;  5I58 A;  2ZNS A;  4H65 A;  3EN3 A;  4RYA A;  1CE2 A;  4HW8 A;  1MXX A;  5H8N B;  4I9D A;  4YAH X;  2NVU B;  1ANF A;  1SBP A;  3FJG A;  1QUK A;  3W15 C;  1NNF A;  1ZJL A;  3GLB A;  4YIC A;  3VDF A;  3KOT A;  5AA4 B;  5B70 A;  1B05 A;  1WDN A;  1IEJ A;  1ZMG A;  3MPL A;  4JWX A;  4DZ1 A;  3G3F A;  4NF6 A;  3R26 A;  4I8C A;  3EHS A;  2Q89 A;  3PU5 A;  1ZLQ A;  4RPN A;  3MZ9 A;  1I69 A;  1NFT A;  1SVX B;  2HEU A;  1B3F A;  3OXN A;  4FOR A;  1TFA A;  4GRK A;  1ELJ A;  1IXH A;  3MVY A;  4O3B A;  4OMB A;  2ZYO A;  2ESN A;  3IB0 A;  4YKI A;  4JXI A;  3OMB A;  4OTE A;  1Y9U A;  3CFL A;  4QFP A;  3TMG A;  1O63 A;  3QUF A;  4RNS A;  3ZSF A;  5JEI A;  1PB7 A;  5CMM A;  1DSN A;  5ISU A;  1PDA A;  3OSQ A;  3PMV A;  5I58 B;  3MP1 A;  1H45 A;  2ZYM A;  4KPT A;  5H8N A;  3T9X B;  3IB1 A;  1NKX A;  1NL5 A;  1GVC A;  2E0S A;  2UVH A;  3ILU B;  4ECF A;  4QFK A;  3USD A;  1NMU A;  2O7I A;  4GFR A;  3FZV A;  3FXR A;  3SET A;  1JW1 A;  1ZIU A;  2F35 A;  3DEL B;  3N5L A;  4ZEK A;  5A5X B;  3K01 A;  1B2H A;  3GXA A;  1NNT A;  4ZED A;  5DYH A;  1OQG A;  5EYF A;  2DWI A;  2NOO A;  3T9U A;  1PBP A;  1MY2 A;  3FUZ A;  3KGC A;  3EPE A;  1N7X A;  5FHN A;  4ZEF A;  3KSJ A;  1M5C A;  4MLQ A;  4EQ9 A;  3D4C A;  4OEU A;  4PFW A;  2Y7K A;  3U92 A;  2Y7P A;  4KFQ A;  4NTL A;  3K6W A;  4R74 A;  4OFJ A;  4LAT A;  1N7W A;  3UP9 A;  4FAT A;  3SEU A;  3KBR A;  1EZ9 A;  2REJ A;  1ZBM A;  2ZYK A;  3T93 B;  1PBQ A;  3HST A;  4C1T A;  1MDP 1;  1Y4T A;  4MBP A;  5I2N B;  4KYD A;  2LAO A;  3PD9 A;  3PPN A;  5J1D A;  2P0S A;  4H8I A;  2XD2 A;  2GHB A;  2ANJ A;  2VGQ A;  2XHD A;  2XXW A;  2V3T A;  3JYR A;  5KCJ A;  1BIY A;  3FJM A;  3SEW A;  4IGT A;  3EF7 A;  3BBR A;  4XKR A;  5H8F A;  4ZEB A;  2QS2 A;  4XKQ A;  4G2Z A;  4XTC Q;  3QUJ A;  1VFD A;  2P2A A;  3TAJ A;  5L8D A;  1B1H A;  4QSE A;  3M3F A;  3DP6 A;  1JEV A;  1SI1 A;  2RF1 A;  2ONK E;  3HO7 A;  1MQH A;  1YCJ A;  3ONM A;  4JB7 A;  2HZL A;  4JBZ A;  1A8E A;  1YAE A;  4QHQ A;  4ZEI A;  4F3P A;  1IXC A;  1I6B A;  2DP8 A;  1B5I A;  4FE8 A;  4GXA A;  1JQF A;  5BUU A;  1Z7N E;  4F19 A;  2O51 A;  3E9X A;  4R9F A;  5TP9 A;  5DVI A;  4ELP A;  3K6V A;  4GWO A;  3VE1 B;  4EQB A;  4U22 A;  2V3U A;  1XT8 A;  3UK4 A;  5IKB A;  1AL3 A;  5DT6 A;  2F7A A;  1UTB B;  3VVD A;  1MRP A;  3PV0 E;  1D9Y A;  3C35 A;  1M5D A;  3HHG A;  4H6D A;  2I3W A;  4R2F A;  3OO7 A;  2OWS A;  3Q27 A;  4KCD A;  2XXH A;  1B5H A;  1B0H A;  1P1W A;  2V84 A;  1L5T A;  2F6G A;  3PUW E;  5L9S A;  3LSL A;  1N04 A;  3TTK A;  2RC7 A;  1IZ1 A;  1IUD A;  3CFX A;  2Y7W A;  3CI8 A;  3JZJ A;  3TTR A;  1MM6 A;  2F6P A;  2F7B A;  3Q29 A;  2O1M A;  2DS9 A;  4F2O A;  4P11 A;  2OLB A;  3RUM A;  1MQD A;  5TPA B;  5JTY B;  3H6V A;  3PUZ E;  4XIG Q;  3TOD A;  2Z22 A;  3K00 A;  3U72 A;  5DVJ A;  4IY6 A;  1FTL A;  2B65 A;  2O68 A;  4FIM A;  3FAT A;  1JW5 A;  2ONR A;  4R75 A;  2QRY A;  1BP5 A;  1TWY A;  1FQB A;  3A09 A;  3C33 A;  2DWJ A;  4GF8 A;  2I3V A;  4Q30 B;  3SEY A;  3VLU A;  4LZ7 A;  1A40 A;  5CC2 A;  4LQ5 A;  1H76 A;  4XKN A;  1LAF E;  2THI A;  1IXI A;  2PVU A;  3TYH A;  4GVO A;  5AA1 A;  3IR1 A;  4F18 A;  2RIN A;  4H8J A;  4MH5 A;  3RQT A;  3IOV A;  3C9H A;  3SES A;  1TFD A;  1SQY A;  5I59 B;  2NUV A;  4M1V A;  2UYF A;  3QSL A;  5H8H B;  1R9L A;  1URG A;  2I49 A;  3OEM A;  4H1X A;  5JTY A;  2XXX A;  3RY3 A;  1FQF A;  1OIB A;  2RC8 A;  2QSX A;  4G68 B;  2RCB A;  5AE4 A;  3MWB A;  2O7U A;  3S9N C;  1I6Q A;  4GXS B;  5I57 B;  4KD5 A;  3LSW A;  1OLC A;  1IIW A;  3IOW A;  5HBC A;  1MXZ A;  3KJT A;  1HSJ A;  3V83 A;  2ZNT A;  2DQV A;  3H6U A;  2ABH A;  2YJP A;  3IO6 A;  3K1M A;  4WXJ A;  3RT8 A;  4YKP A;  1LFI A;  2UVJ A;  3MVW A;  2CMO A;  1NH8 A;  3RT6 B;  4U4X A;  4H5G A;  3IJX B;  4OVJ A;  1IIT A;  1SI0 A;  3QAX A;  3E4R A;  1J1N A;  4HCW A;  4GLI A;  3TCH A;  1D4N A;  4RA1 A;  3TQW A;  2M8C A;  2E1S A;  3S9L C;  2FNC A;  4TLL B;  1N76 A;  4X48 A;  1GV8 A;  2I48 A;  3N6T A;  3RPW A;  3B6T A;  5I56 B;  1POY 1;  5CI5 A;  2F34 A;  3K1P A;  3OEK A;  4F3S A;  1OVB A;  3H7M A;  1DOT A;  3E13 X;  3KSX A;  3MP6 A;  5EHS A;  1GR2 A;  2HAV A;  1JVX A;  5ITP A;  1MY3 A;  3GZG A;  1PEB A;  2Q88 A;  2XX9 A;  1IXG A;  1VFE A;  3MVX A;  5ITO A;  3MPK A;  1SDX A;  3TCF A;  2V25 A;  2VOZ A;  1FQE A;  1P1Q A;  1II5 A;  1POT A;  3A3U A;  3CG3 A;  1UTB A;  3IB2 A;  1MXU A;  4NF5 A;  4YU0 A;  5F1Q A;  2GFE A;  2Q2A A;  4F1Y A;  3KFM A;  1TT1 A;  3OEN A;  1US4 A;  5LOM A;  2RCA A;  1H44 A;  3OD7 A;  1LB8 A;  3VXC A;  1VE4 A;  3MW0 A;  4I62 A;  4K3F A;  4N07 A;  2XXI A;  1SW5 A;  1PC3 A;  3TEP A;  3T9H B;  2F7C A;  4OFO A;  1LBC A;  1Q35 A;  2B3B A;  1NNP A;  2FYI A;  3HHF A;  3S9E A;  3DLN A;  3RNN A;  4ZZE A;  3EHU A;  3FD3 A;  3MZ1 A;  1PB9 A;  3VLV A;  4F3G A;  1M5B A;  2V93 A;  2XXT A;  5H8Q B;  3T9V A;  3L6H A;  1B3H A;  2QS4 A;  4RJZ A;  1EZO A;  3CIJ A;  2NXO A;  3JV9 A;  2DYX A;  3K1N A;  5KZT A;  1B32 A;  2DXR A;  1MY4 A;  3KEI A;  1JNF A;  1MPB A;  4RXL A;  1DMB A;  3CR9 A;  3SDF A;  5CBR A;  2IA4 A;  4QSC A;  4EQ7 A;  3MBP A;  4KI0 E;  5H8H A;  1NH7 A;  2XXV A;  4C1U A;  1RKM A;  2H5Y A;  3CSG A;  1UIV A;  3ODB A;  4QFO A;  2Q8J A;  4ZE9 A;  4WED A;  3R7X A;  4R72 A;  1LST A;  2VHA A;  1SYH A;  3S2V A;  3K4U A;  1B1X A;  1FTM A;  1JVY A;  2PMS A;  1QUL A;  3K0V A;  3LSX A;  2UVG A;  3O6G A;  4YB6 A;  4E0W A;  5TU0 A;  4ELO A;  4F1V A;  5L9M A;  3UA8 A;  2PX1 A;  1UTH A;  2UYE A;  4NF4 A;  3TTL A;  4XXU A;  1AH5 A;  2ONS A;  3FV2 A;  4U1Z A;  3T22 A;  4RPO A;  4YMA A;  4YMB A;  4EUO A;  2GRV A;  3V5A A;  3E3K A;  3IAZ A;  3TEL A;  2DVZ A;  4ISU A;  4DLD A;  5BWJ A;  2NWJ A;  3B7D A;  5IAI A;  3I5O A;  2R71 A;  4LP2 B;  3M8U A;  4F3B A;  5AA3 A;  4IO5 A;  4OES A;  1F9B A;  1JET A;  3A3C A;  5A5X A;  3M3K A;  4GIZ A;  1R1N A;  2AYS A;  3VLW A;  5KDT B;  3B6Q A;  1A99 A;  3CG1 A;  3K2D A;  1P1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...