3N6TA

Effector binding domain of tsar
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
205
Chain Sequence
GHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the effector binding domain of TsaR
rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 54
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA02
5CC2A 3PUYE 4TOZA 1B3FA 4NEDA 5ICQA 4IO6A 1IEJA 1A40A 2Y7WA 1M5CA 5CRYA 1VR5A 2R6GE 2F78A 3VV5A 4TQUQ 2QS3A 5KCJB 3OELA 3CSGA 4NF6B 4YZZA 5F7VA 3C4MA 1B6HA 4JB7A 2Q2AA 4WEDA 3OEKA 5ICTA 2IA4A 3DLNA 2YLNA 3KGCA 3SESA 2DWHA 2THIA 4Q0CA 2HZKA 2BJJX 5CMBA 5DVIA 3CFLA 3S9EA 3RT8A 1H76A 4L17A 2ZNTA 5I59B 4R74A 2XD3A 2RC8A 1TXFA 2ONSA 4LQ5A 4OEVA 3M3KA 1B7ZA 2XXTA 3K01A 1Y4TA 1FQCA 3PD9A 3JZJA 5K2XA 2QSXA 3SEWA 4QFKA 1M5BA 4ZEIA 4FIMA 4QFNA 3OOAA 4C0RA 3E3KA 3RNNA 4DLDA 3KN3A 3A3CA 4ESXA 2I48A 3CR9A 4NF5A 2F7AA 3VXBA 3U72A 3K6UA 3VE1B 5M2VA 5AA4B 4QRZA 3V89B 4GL0A 2GHBA 5F1QA 2FA7A 2ZMBA 2O51A 1GVCA 1CE2A 4Q8RA 4GLIA 5H8QB 2H98A 2NOOA 1MDQA 3GXAA 3IX1A 1MQIA 1OVBA 4MFIA 1B40A 4QSDA 1MXXA 4DDDA 1B1XA 1SYHA 4F1YA 1UIVA 1B3HA 3R6UA 3HPIA 3S9MC 1NFTA 4JBZA 3B6TA 4F3GA 1BP5A 2YJPA 1SD3A 5H8NB 5TP9A 3CI8A 1B4ZA 1BIYA 2XXYA 2Z8EA 2HZLA 3RUMA 2XHDA 3MP6A 4NF8B 4OESA 1O64A 2RKMA 2I0BA 4LZ7A 4ZS9A 5FHMA 2ZYMA 4X48A 4EXKA 5I58B 3RGYA 3WAEA 1IXGA 2F35A 2AL5A 3R7XA 1ELJA 1B5HA 1N76A 2O1LA 2XXXA 4G8NA 2GH9A 4JSDA 4XXUA 4KYDA 2F6PA 5DVJA 3IK6B 1US5A 1Y3NA 4EF1A 3UN6A 4F3PA 5ITOA 4O3BA 5HM4B 4UACA 2X7PA 2ZYNA 3KN8A 3O6IA 3O29A 1Y9UA 1N84A 2RINA 1RYXA 1SDXA 5FTIA 2OZZA 1LB9A 3OO8A 3ODBA 3I6VA 5H8SA 5I59A 1S9TA 3PV0E 2F36A 1ZMGA 2G29A 3OD7A 4F29A 4P0IA 4OERA 3MWBA 3RTFB 2ZNSA 3SETA 3MBPA 3D4CA 2PYYA 1LFIA 4N07A 2D21A 1KWHA 1ZIUA 3TTKA 2O84X 3VDFA 3PMXA 1DPPA 2DWJA 2ONRA 1R9LA 1IXHA 4JWYA 3R26A 3LR1A 1UTHA 2REGA 4BDLA 4DXCA 2QMWA 1B3EA 4R2BA 1PC3A 1LAXA 3MP1A 1MG1A 5DEXB 5BUUA 2XXHA 3KSJA 2PT2A 1IQ7A 4BDRA 3G3KA 4I62A 3IB0A 5H8QA 3C34A 2G93A 1DSNA 1H43A 1B0LA 1L5TA 3TTMA 5H8FA 3VVDA 3QYTA 2E1SA 1IUDA 4IGRA 3TCHA 3PPQA 3TELA 4EDPA 2UVJA 2LAOA 4YMBA 1J1NA 3CFZA 1B3LA 3EF7A 4BDMA 3FVNA 2NUVA 3IOVA 3CSBA 1LAFE 3U93A 1LFGA 3RTWB 4NF8A 2XX8A 3O6GA 4C1UA 5AE4A 3K00A 1USYE 4YKPA 5I58A 4IO3A 3H6TA 4O3CA 2DWIA 3A3UA 1URSA 4DZ1A 3GZGA 3PU5A 4MH5A 3MZBA 4H8JA 2F34A 1B9JA 4PFUA 2HCAA 2Q9TA 3SERA 2DE4A 1B1HA 3OO6A 4QF9A 4AB5A 5L8DA 1GTKA 5FTHA 2UVHA 3T22A 3N94A 1AOVA 1EZ9A 5L9OA 2PMSA 2VD2A 1OQGA 4TLLB 2Z8FA 5I2NA 4I9DA 4GIZA 1H45A 1M5FA 4NWCA 4DCXA 1B52A 2F97A 4RXLA 2REJA 1PDAA 2GFEA 3H6UA 2H99A 1S7YA 4U2RA 2XXIA 3S4UA 3EN3A 3C33A 4FE8A 2OWTA 3B7DA 3FD3A 3SEXA 1NL5A 1MS7A 4NF5B 4RNSA 2RF1A 3U92A 2XX7A 2ZYOA 3QIMA 4LQ2A 4OFLA 2QRYA 1OQHA 2RC9A 2NWJA 3M8UA 3TYHA 3MQ9A 4MLQA 2CZLA 4F2OA 1Q1KA 1I69A 1MQDA 2R71A 1N0TA 2F8DA 4LA9A 5CBRA 4IB2A 2VD3A 1BLFA 3LSLA 5I2KB 1B7UA 1QUJA 3K1MA 3TZAA 3Q26A 1URDA 4YKIA 5TP9B 4I1DA 1P1QA 5I57A 4YB7A 3MPLA 3CRBA 1WDNA 1LCFA 3KEIA 1B0HA 1YAEA 4NTLA 1B58A 4MF3A 4N13A 2Y7PA 4WKMA 4FEDA 1Z7NE 1US4A 3ONMA 5CMMA 1NH7A 4G8HA 3EHUA 4KYSA 4E0XA 2Y7KA 1ZJLA 1MXWA 3ZS6A 1VFEA 2UXAA 3LSFB 4QHQA 4OYVA 4ZDMA 3TEPA 3CIJA 4KYEA 4H1XA 2RCAA 4WXJA 4KR5A 3C32A 4QSEA 1M5DA 4OETA 3IOWA 3IR1A 3CG1A 3HHGA 2Y7RA 4OZ9A 3I5OA 3F11A 2I4BA 1P1NA 1BKAA 1UIUA 4C1TA 1HSLA 1PEBA 3JYRA 2DE2A 4DXBA 2DVZA 4BLAA 1AMFA 3HHFA 3MVWA 1P1UA 5TU0A 1DOTA 3IO4A 3N26A 3C9HA 3MJNA 2UVGA 1UTHB 1FW0A 2I58A 3FIRA 3B6WA 4P11A 1B3GA 4R75A 3FATA 4IGTA 5K2YA 4G68C 1POTA 1ZKBA 2V25A 3K6VA 3EQ1A 2DYXA 4DXUA 5CMCA 5B70A 3ECRA 3FXUA 4IY5A 2HAVA 4LATA 3W15C 2P0SA 5JK4A 1QW0A 3KOTA 1OLAA 1DPEA 1N3WA 5H8FB 4F1VA 3VLWA 3RQTA 1FTOA 5I84A 3HSTA 5AA1A 1SW4A 4IY6A 1MDP1 1B51A 4HTGA 5I2KA 1IIWA 5FHOA 3GBAA 4PFWA 5AA2A 3TTLA 2Q89A 3T9VA 2OLBA 1LB8A 4NWDA 2XX9A 3Q28A 2V3QA 4ECFA 2X7QA 3L6GA 3P7IA 4NF4A 3C35A 4ELOA 1VFDA 5AA3A 4OFOA 3IOUA 4ZEFA 4OMBA 2I4CA 2Y84A 1PBPA 2B3BA 2O69A 1XHYA 4JXIA 5J1DA 4EQ9A 1NNKA 3T93B 1QKBA 2W7YA 2OK2A 3TCFA 4KI0E 4ISUA 1FQFA 3EHTA 4KHZE 4OENA 4N6PA 1IXIA 1N3XA 1FTLA 4RK2A 3B6QA 1LSTA 3H6VA 4ZECA 4PFYA 4IO5A 3D4GA 4YKJA 1NMUA 5I2NB 4LZ5A 4JWXA 4TLMB 3ZSFA 4DCYA 1TWYA 4FECA 3E13X 3K6XA 1MY0A 1SVXB 3U94A 1TFDA 4FJPA 5DTBA 4H5FA 2X26A 3HCQA 4POXA 4OQOA 3TKDA 1B2HA 3K4UA 1Q35A 3BFTA 5I56B 1D9YA 4F18A 3W9VA 4GWOA 2ABHA 3O2AA 4G8MA 3LSWA 4LUBA 5FHNA 3T9XB 1SBPA 1NNTA 3VLUA 4M4GA 5KDTA 1AH5A 3RY3A 1R9QA 2Y7IA 2Z23A 4M1VA 5JEIA 1DTGA 3MVZA 2DP8A 4UA8A 1Z7ME 3KFMA 2WKYA 5TPAB 1MPCA 1MQGA 4YICA 3IO6A 3TDJA 2QS2A 3VFJA 4LVQA 2Q8JA 3CVGA 3UP9A 4ZE9A 5I57B 4OEUA 4ELPA 3S2VA 1MY1A 3OSQA 4R9FA 3MZ9A 1MH4A 1JEVA 1OVTA 1QJMA 1YPNA 2B3FA 2O1MA 4PETA 4EXLA 1MM7A 2XXWA 1N04A 4OWDA 1I6AA 4HW8A 2DE3A 1EH3A 1I6QA 2ESNA 2VP1A 1VE4A 3VVFA 3IB2A 4GXSB 3VXCA 3MZ1A 3OSRA 3KJTA 3QXMA 1PB7A 3HV1A 4JWOA 3MVXA 4XKRA 4PQJA 1RKMA 4R72A 1P99A 3UGWA 3PMWA 1MH3A 4OFJA 2HFBA 3H7MA 1QULA 4GXAA 1XC1A 1S50A 3PMVA 3K0VA 1AL3A 1CB6A 3DELB 4EUOA 3V5AA 3N5LA 4GOTA 3GLBA 3EHSA 2UYEA 4YKKA 5CI5A 5IKBA 1JW5A 4BDOA 1JW1A 4ZZAA 1O7TA 3VLVA 3PGFA 2XXPA 3BBRA 5LOMA 4F3BA 5I56A 2Z8DA 3MAMA 4JDFA 3MP8A 1LFHA 5DT6A 3G3IA 1JVYA 4RA1A 3HN0A 1LGBC 1MY2A 2HEUA 3LUYA 2UVIA 3KJ7A 2VHAA 2ANJA 3TFLA 3E9XA 2QL3A 4ZZEA 3I3VA 4HCYA 1II5A 1MPDA 4OHNA 4QFLA 4ND9A 2PX1A 3UORA 3M3LA 3G3GA 3QSLA 3M3FA 5TPAA 5ITPA 3QK6A 3FVGA 1SW5A 3PUVE 1B5IA 1D3KA 4EQBA 3FXRA 4XKNA 1SW1A 1ATGA 5AA2B 3TCGA 1FQDA 3RN8A 2VOZA 1UTBA 1URGA 4P0GA 2QS1A 2A5SA 5DVFA 3O9PA 3DP6A 3FJGA 3SEVA 3FV1A 2IEEA 4NF4B 5EHMA 4DIGA 4RPOA 2P2AA 4GQOA 2ZXTA 1OLCA 1PB8A 1MRPA 5B7DA 1FQBA 1DMBA 2KLFA 1TT1A 1MPBA 3DP8A 3N6TA 3IORA 1O63A 1NNFA 3KOSA 5JTYB 3FJMA 1BTJA 3T9HB 1EU8A 1NH8A 3Q27A 2A5TA 2Z22A 3ILUB 4Q5TA 5ELVA 1MQHA 1A8EA 1D4NA 1MXUA 2R9JA 4QSCA 1ZU0A 1B05A 3Q25A 2F7CA 4E0WA 1FTMA 4XIGQ 4ELQA 1B46A 5H8HB 3L6HA 1OMPA 1FTKA 1RYOA 4G2ZA 4OXVA 4XTCQ 1SI0A 3O6HA 1ANFA 4HS7A 1UQWA 3MVYA 2FNCA 3IL1B 4G77A 4YMAA 2DSFA 5HBCA 3RPWA 4JSOA 1JETA 1I6BA 2I49A 4IO4A 1N7XA 1XOCA 4F1UA 1FCKA 3W9WA 1MXZA 1SYIA 2O6AA 1JEUA 4Z0IA 1YTVA 1LAGE 3T96B 5CBSA 1LBCA 3H3GA 1F9BA 2V3TA 3LSXA 4YB6A 1NKXA 4QFPA 1WVJA 1Y3PA 2D5WA 1B4HA 1LCTA 1ZLQA 5L9MA 5KDTB 4R6HA 1MQJA 4GFRA 2O7UA 1PBQA 2O68A 4QFOA 1A8FA 1IZ1A 3O66A 3AXFA 4AQ4A 1T0KA 2I0CA 3CFXA 2ZNUA 2B65A 4G68A 2HAUA 3IOTA 4U4SA 3SEUA 4U1OA 5L9SA 4KD5A 4R2FA 3KZGA 5AA2D 3PUXE 2V3UA 4PFTA 3O28A 4IO2A 1MM6A 4WEPA 3FUZA 4GF8A 2XXUA 1A54A 3N6UA 1TFAA 3S9LC 3TMGA 4FAJA 1JQFA 1Y4CA 3OO7A 1R1NA 3LC8A 3RLFE 3H6WA 3PPPA 4XKPA 4ZE8A 4DE8A 3IJOB 4OTEA 1USYH 3O97A 2DXYA 3E4RA 2XD2A 3GBBA 1WODA 2HQ0A 2OWSA 1QKAA 2QS4A 3FJ7A 2DWAA 4GL8A 3DM0A 4X1DA 2RCBA 1N7WA 3THIA 5JTYA 2P1SA 3EPEA 4X9TA 1LBBA 3WAFA 4FATA 3A09A 5ISUA 3IJXB 1POY1 3PPNA 4MLVA 4YU0A 2RC7A 1MXYA 4ZEBA 3C31A 4GRKA 1ZTYA 3H4ZA 3PPOA 1MY3A 5KCJA 4BDNA 5H8HA 1HSJA 1EZPA 4NF6A 2QPQA 1Y20A 4F19A 1JNFA 1QVSA 4THIA 1Y1ZA 2H5YA 1B7HA 4RY1A 2I3WA 1ZBMA 1H3DA 1P1OA 1NNPA 2V84A 3MPKA 4H67A 3SEYA 3V83A 3MUQA 3OENA 3PD8A 3OXNA 3TTRA 3ZKKA 2AYSA 2OJTA 3K6WA 4OVJA 1H44A 1OIBA 2DVCA 2HXWA 2YPNA 2ZYKA 4NE4A 1M5EA 4KCDA 2NVUB 2AIXA 3OO9A 2M8CA 2O7IA 1XT8A 3FVKA 1D9VA 3K1PA 4YB5A 5A5XB 4ESWA 2DXRA 4EQ7A 2NXOA 3KG2A 3TQLA 3FVOA 4FEBA 4Q30B 5KZTA 2PVUA 1GGGA 1JVXA 2ALUA 1XVXA 5AA4A 4GD5A 4POWA 4RPNA 4KCCA 3Q29A 3OEMA 3ILTB 3BFUA 4PE5B 4O3AA 3FV2A 4FORA 3TUSA 4G4PA 4ELRA 1PB9A 3SKPA 3FASA 1IITA 3TPAA 2UYFA 1B5JA 1UTBB 4U4XA 3FGSA 1B32A 3V8XB 1MXVA 2H4IA 2F7BA 3MC2A 2D3IA 5H8NA 4R73A 1XS5A 2E0SA 3T9UA 2FYIA 3C36A 4U1ZA 1SW2A 4I8CA 5EYFA 3QUFA 4BDQA 2DOJA 4U21A 3OMBA 3TAJA 3H03A 4KPTA 3SDFA 4LZ8A 1A7LA 1HSEA 3K1NA 2A5TB 3FXQA 2GRVA 3U8QA 3KSXA 3BKIB 3VVEA 3PUZE 3JV9A 3K02A 4U23A 4GVOA 1GV8A 4LONB 2DS9A 1Y3QA 1Y1MA 3USDA 1A55A 4F31B 2XXQA 3H06B 2I3VA 2XXVA 4ZEDA 1XVYA 4HCWA 2Q2CA 2V93A 5HPQA 4X1BA 1GR2A 1IXCA 2OBGA 5BWJA 4F22A 3LBSA 2OCUA 4RK9A 3FZVA 3S9NC 1A99A 2ONKE 4R6KA 4K3FA 3MW0A 1QUIA 4H8IA 2VGQA 1JW4A 4R6YA 3ZKLA 3IAZA 4KQPA 3UIFA 3TQWA 3TODA 1FQEA 4H65A 3KN7A 3QAXA 4H5GA 3PPRA 1AIVA 1R6ZA 3U1OA 1DTZA 4RYAA 5A5XA 1SQYA 5CM6A 4H6DA 1EZOA 3G3HA 3TTNA 3QUJA 4R9GA 4KFQA 4EF2A 4MBPA 5IAIA 2I6EA 2GHAA 4NMYA 3K2DA 3G3JA 5CMKA 4F3SA 2DQVA 2PT1A 1FTJA 1FQAA 1YCJA 5DEXA 4G68B 2F5XA 1SI1A 3T66A 4H0WA 4YAHX 2F6GA 2CMOA 4LP2B 2H9BA 3G3FA 4RJZA 3KBRA 4XKQA 3UA8A 3DP4A 5EHSA 3PUWE 4Z7EA 1QUKA 3CG3A 4F2QA 2XXRA 4ONYA 2QJEA 3UK4A 4PP0A 1P1WA 3RT6B 4F39A 1LLSA 4U22A 1MY4A 4AB6A 1LAHE 2PBWA 5DYHA 2H25A 2QMXA 2Q88A 3G7WA 3IB1A 4ZEKA 2AL4A 3HO7A 1VSOA 4IO7A
chains in the Genus database with same CATH superfamily
5CC2A 2WEFA 3PUYE 4TOZA 1B3FA 4NEDA 5ICQA 4IO6A 1IEJA 1IMBA 1A40A 2Y7WA 1M5CA 5CRYA 1VR5A 1VDWA 2R6GE 2L5VA 2F78A 3VV5A 4TQUQ 2XXKA 2QS3A 4GBVA 5KCJB 3OELA 2B4LA 3CSGA 4NF6B 4YZZA 5F7VA 3C4MA 1B6HA 4JB7A 2Q2AA 4WEDA 2Q8MA 3OEKA 5ICTA 4GX6A 2IA4A 4GX4A 3DLNA 2YLNA 3KGCA 3SESA 2DWHA 2THIA 4NG7A 5ET6A 4Q0CA 2HZKA 2BJJX 5CMBA 5DVIA 3CFLA 3S9EA 3RT8A 4OVRA 3HFUA 1H76A 5EQ7A 4L17A 2ZNTA 5I59B 4R74A 2XD3A 2RC8A 1TXFA 2ONSA 4LQ5A 4OEVA 3M3KA 1B7ZA 2XXTA 5I3SA 3K01A 1Y4TA 1FQCA 3PD9A 3JZJA 5K2XA 2QSXA 3SEWA 4QFKA 1M5BA 4ZEIA 4FIMA 4QFNA 3OOAA 4C0RA 3E3KA 3RNNA 4DLDA 3KN3A 3A3CA 4ESXA 2HPGA 2P3VA 2I48A 3CR9A 4NF5A 1FJ6A 2F7AA 3VXBA 3U72A 3K6UA 3VE1B 5M2VA 5AA4B 5T3JA 4QRZA 3V89B 4GL0A 2GHBA 5F1QA 2FA7A 1D9QA 2ZMBA 2O51A 4NX1A 2QVUA 1GVCA 4OVSA 1CE2A 4Q8RA 4GLIA 5H8QB 3LV0A 2H98A 2NOOA 4JVCA 1IMCA 1FPBA 1MDQA 2VPNA 3GXAA 3IX1A 1MQIA 3RYDA 1OVBA 4MFIA 1B40A 4QSDA 1RDXA 1DCUA 1MXXA 4DDDA 1B1XA 4JVIA 1SYHA 4F1YA 1UIVA 4O94A 1B3HA 3R6UA 3HPIA 3S9MC 1NFTA 4JBZA 3B6TA 4F3GA 1BP5A 2YJPA 4O7MA 1SD3A 5H8NB 5TP9A 3CI8A 1B4ZA 1BIYA 5IGAA 2XXYA 2Z8EA 2HZLA 3RUMA 1KZ8A 2XHDA 3MP6A 4NF8B 4OESA 1O64A 2JJKA 2WYKA 2RKMA 2I0BA 4LZ7A 4ZS9A 5FHMA 4N6KA 2ZYMA 4OVQA 4X48A 4EXKA 5I58B 3RGYA 3WAEA 4MNIA 1IXGA 2F35A 2AL5A 3R7XA 1ELJA 3BIHA 1B5HA 1N76A 2O1LA 4MNCA 2XXXA 3FBPA 4G8NA 1G0IA 2GH9A 4JSDA 4PBHA 4XXUA 5IM2A 4KYDA 2F6PA 5DVJA 3IK6B 2CZHA 1US5A 1Y3NA 4EF1A 3UN6A 4F3PA 5ITOA 4O3BA 5HM4B 2WBBA 4UACA 2X7PA 2ZYNA 3KN8A 3O6IA 3O29A 1Y9UA 1N84A 2P3NA 2RINA 1RYXA 1SDXA 5FTIA 2OZZA 1LB9A 3OO8A 3ODBA 3I6VA 5H8SA 5I59A 1LBVA 1S9TA 3PV0E 4NGUA 2F36A 1ZMGA 2G29A 3OD7A 4F29A 4P0IA 4OERA 3MWBA 3RTFB 2ZNSA 3SETA 3MBPA 3D4CA 3PTYA 1G0HA 2PYYA 1LFIA 4N07A 2D21A 1KWHA 1ZIUA 3TTKA 2O84X 3VDFA 3PMXA 1DPPA 2DWJA 2ONRA 1R9LA 1IXHA 4JWYA 3R26A 3LR1A 1UTHA 2REGA 4BDLA 3IFAA 4DXCA 2QMWA 1B3EA 4R2BA 5FBPA 1PC3A 1LAXA 3MP1A 1MG1A 5DEXB 4N15A 5BUUA 2XXHA 3KSJA 1FBDA 2PT2A 1IQ7A 2Y5LA 4BDRA 3G3KA 2VPOA 4I62A 3IB0A 5H8QA 3C34A 2G93A 1DSNA 3ROJA 1H43A 1B0LA 3MSTA 1L5TA 3TTMA 5H8FA 3VVDA 2QVVA 3QYTA 2E1SA 1IUDA 4IGRA 3TCHA 3PPQA 3TELA 4EDPA 2UVJA 2LAOA 4YMBA 1J1NA 3CFZA 1B3LA 1FBEA 3EF7A 4BDMA 3FVNA 2NUVA 3IOVA 3CSBA 1LAFE 3U93A 1LFGA 3RTWB 4PCDA 4NF8A 2KQZA 2XX8A 1IMDA 3O6GA 3KC1A 4C1UA 5AE4A 3K00A 3B8BA 1USYE 4YKPA 5I58A 4MJOA 4IO3A 3H6TA 4O3CA 2DWIA 3A3UA 1URSA 4DZ1A 3GZGA 3PU5A 4MH5A 3MZBA 4H8JA 4PAKA 2F34A 1B9JA 4PFUA 2QFLA 2HCAA 2Q9TA 3SERA 2DE4A 1B1HA 4QF9A 3OO6A 1SPIA 4AB5A 5L8DA 1GTKA 5FTHA 2UVHA 3T22A 3N94A 1DBZA 1AOVA 2FVZA 1EZ9A 5L9OA 2PMSA 2VD2A 1OQGA 4TLLB 2OX3A 2Z8FA 5I2NA 4I9DA 4GIZA 4N8YA 1LBWA 1H45A 1M5FA 4NWCA 4DCXA 1B52A 5ET7A 2F97A 4RXLA 2REJA 3IFCA 1PDAA 2GFEA 3H6UA 2H99A 1S7YA 4U2RA 2XXIA 4N91A 3EN3A 3S4UA 4O7IA 3C33A 4FE8A 2OWTA 3B7DA 3FD3A 3SEXA 2VT5A 1NL5A 2FHYA 1LBXA 1MS7A 4NF5B 1FSAA 4RNSA 3T0JA 2RF1A 3U92A 2XX7A 2ZYOA 3QIMA 4LQ2A 4OFLA 2MKZA 2QRYA 1OQHA 2RC9A 3QMFA 2NWJA 4I3EA 3M8UA 3TYHA 3MQ9A 4UABA 4MLQA 2CZLA 4F2OA 1Q1KA 1I69A 1MQDA 2R71A 1N0TA 2F8DA 4LA9A 5CBRA 4IB2A 2VD3A 1BLFA 3LSLA 5I2KB 1B7UA 1QUJA 3K1MA 3TZAA 3Q26A 1URDA 4YKIA 5TP9B 4I1DA 4OVTA 1P1QA 5I57A 4YB7A 3MPLA 3CRBA 1WDNA 1LCFA 3KEIA 3GYYA 3CHGA 4I3YA 1B0HA 1YAEA 4NTLA 1B58A 2GQ1A 4AS4A 5EQAA 4MF3A 4N13A 2Y7PA 5IZ1A 4G61A 4FEDA 4WKMA 1Z7NE 4PF6A 1US4A 1NUYA 5LDZA 3ONMA 5CMMA 1NH7A 4G8HA 3EHUA 4KYSA 4E0XA 3E79A 2Y7KA 1ZJLA 1MXWA 3ZS6A 1VFEA 2UXAA 3LSFB 4QHQA 4OYVA 4ZDMA 3TEPA 4NHBA 5ESYA 3CIJA 4KYEA 4H1XA 2RCAA 4WXJA 4KR5A 3C32A 4QSEA 1M5DA 4OETA 3IOWA 3IR1A 3CG1A 4PTKA 3HHGA 2Y7RA 4OZ9A 2FBPA 3I5OA 3F11A 1KA1A 2I4BA 1P1NA 3MYUA 1BKAA 1NV4A 2FIEA 1UIUA 4C1TA 1HSLA 1PEBA 3JYRA 2DE2A 4DXBA 1FBGA 2DVZA 4BLAA 1AMFA 3HHFA 1NV0A 3MVWA 1P1UA 5TU0A 1DOTA 3IO4A 3N26A 3C9HA 3MJNA 2UVGA 1UTHB 1FW0A 2I58A 3FIRA 1EYKA 3B6WA 4P11A 1B3GA 3EKIA 2HXRA 4R75A 3FATA 4IGTA 5K2YA 4G68C 1POTA 1ZKBA 2V25A 3K6VA 4P1LA 5DW8A 3EQ1A 2DYXA 4DXUA 5CMCA 2CEXA 5B70A 3ECRA 3E78A 3FXUA 4IY5A 2HAVA 4LATA 3W15C 2P0SA 5JK4A 1QW0A 3KOTA 1OLAA 1DPEA 1N3WA 5H8FB 4F1VA 3VLWA 4N81A 3RQTA 1FTOA 5I84A 3HSTA 5AA1A 1SW4A 4IY6A 1MDP1 1B51A 2XWIA 4HTGA 5I2KA 1IIWA 5FHOA 3GBAA 4PFWA 5AA2A 3TTLA 2Q89A 3T9VA 2OLBA 1LB8A 4NWDA 2XX9A 2XA5A 3Q28A 2V3QA 4ECFA 4H46A 2X7QA 3L6GA 3P7IA 4NF4A 3C35A 4ELOA 1VFDA 5AA3A 4OFOA 3IOUA 4ZEFA 4OMBA 4LN5A 2I4CA 2V4CA 3LUZA 2Y84A 4GX3A 1PBPA 2B3BA 2O69A 1XHYA 4JXIA 5J1DA 4EQ9A 1NNKA 3T93B 4XF5A 1QKBA 2W7YA 2OK2A 3TCFA 1NV1A 4KI0E 4ISUA 4O8MA 1FQFA 3EHTA 4NN3A 4KHZE 4OENA 4N6PA 1IXIA 1N3XA 3FXBA 1FTLA 4RK2A 3B6QA 1LSTA 1YXIA 3H6VA 4GWXA 4ZECA 4PFYA 4IO5A 3D4GA 4YKJA 1NMUA 5I2NB 4LZ5A 4JWXA 4TLMB 3RPLA 3ZSFA 4DCYA 4MNPA 1FPDA 1TWYA 4GWZA 4FECA 3E13X 3K6XA 1MY0A 1SVXB 3U94A 1Q9DA 4QBAA 1TFDA 4FJPA 5DTBA 4H5FA 2X26A 3HCQA 1NV5A 4POXA 4OQOA 4PFBA 3TKDA 1B2HA 3K4UA 4OANA 1Q35A 3BFTA 5I56B 1D9YA 4F18A 3W9VA 4GWOA 2ABHA 3O2AA 4G8MA 3LSWA 4LUBA 5FHNA 3T9XB 1RDZA 1SBPA 1NNTA 4NAPA 3VLUA 4M4GA 5KDTA 1AH5A 3RY3A 1KA0A 1R9QA 4PFIA 2Y7IA 2Z23A 4M1VA 5JEIA 1DTGA 3MVZA 4N17A 2DP8A 1RDYA 4UA8A 1Z7ME 3KFMA 2WKYA 5TPAB 1MPCA 1MQGA 4YICA 4MX6A 3IO6A 3TDJA 2QS2A 3VFJA 4LVQA 2Q8JA 3CVGA 3UP9A 4ZE9A 5I57B 4OEUA 4ELPA 3S2VA 1MY1A 3OSQA 4R9FA 3MZ9A 1MH4A 5EQ9A 1JEVA 4NQ8A 4GWWA 1OVTA 4P47A 1QJMA 1YPNA 2B3FA 2O1MA 4PETA 4EXLA 3D1RA 4DI4B 1MM7A 2XXWA 4OA4A 1N04A 4OWDA 1I6AA 4HW8A 2DE3A 1EH3A 1I6QA 2ESNA 2VP1A 1VE4A 3VVFA 3IB2A 4GXSB 3VXCA 4MCOA 3MZ1A 3OSRA 3KJTA 3QXMA 1PB7A 3HV1A 4JWOA 3MVXA 4MHFA 4XKRA 4PQJA 1RKMA 4R72A 2HHMA 2R8TA 1P99A 3UGWA 1QGXA 3PMWA 1MH3A 4OFJA 2HFBA 4N6DA 3H7MA 1QULA 4GXAA 1XC1A 1S50A 4GWUA 3PMVA 3K0VA 1AL3A 1CB6A 3DELB 4EUOA 3V5AA 3N5LA 5EYHA 4GOTA 3GLBA 3EHSA 2UYEA 4YKKA 5CI5A 5IKBA 1JW5A 4BDOA 1JW1A 4ZZAA 1O7TA 2OWZA 3VLVA 3PGFA 2XXPA 3BBRA 5LOMA 4F3BA 5I56A 2Z8DA 3MAMA 4JDFA 3MP8A 1LFHA 3NOHA 5DT6A 3G3IA 4HXVA 5F24A 1JVYA 4RA1A 3HN0A 2B4MA 1NV3A 1LGBC 1MY2A 2HEUA 1NV7A 3LUYA 2UVIA 3KJ7A 2VHAA 2ANJA 3TFLA 3E9XA 1BK4A 2QL3A 4ZZEA 3I3VA 1FJ9A 4HCYA 1II5A 1MPDA 4OHNA 4P56A 4AS5A 4QFLA 4ND9A 2PX1A 3UORA 3M3LA 3G3GA 3QSLA 1FPEA 3M3FA 5TPAA 5ITPA 3QK6A 3FVGA 1SW5A 3PUVE 4PGPA 1B5IA 5ET8A 1D3KA 4EQBA 3FXRA 4XKNA 1SW1A 1ATGA 1FPIA 5AA2B 3TCGA 4DI3D 1FQDA 3RN8A 2VOZA 1LEVA 1UTBA 1URGA 4P0GA 2QS1A 2A5SA 5DVFA 3O9PA 3DP6A 1K9ZA 3FJGA 3SEVA 3FV1A 1NI9A 2IEEA 4NF4B 5EHMA 4DIGA 4HE1A 4RPOA 2P2AA 4GQOA 2ZXTA 1OLCA 4PBQA 1PB8A 1MRPA 5B7DA 1FQBA 1DMBA 2KLFA 1TT1A 1MPBA 3DP8A 3N6TA 3IORA 2F3DA 1O63A 1NNFA 3KOSA 5EYGA 5JTYB 3FJMA 1BTJA 3T9HB 1EU8A 1NH8A 3Q27A 2A5TA 2Z22A 3ILUB 4PDDA 4P1EA 4Q5TA 5A5LA 5ELVA 1MQHA 1A8EA 1D4NA 1MXUA 2R9JA 4QSCA 1ZU0A 1B05A 3Q25A 2F7CA 4E0WA 4HE0A 1FTMA 4XIGQ 4ELQA 1B46A 5H8HB 3L6HA 1OMPA 1FTKA 1RYOA 4G2ZA 1YZ0A 4OXVA 2Y5KA 3RPLB 4H45A 4XTCQ 4MMPA 1SI0A 3O6HA 1ANFA 4HS7A 1UQWA 3MVYA 2FNCA 3IL1B 4G77A 4YMAA 2DSFA 5HBCA 3RPWA 4JSOA 4QXDA 1JETA 1I6BA 2I49A 4IO4A 1N7XA 1XOCA 4F1UA 1FCKA 4GWSA 3W9WA 1MXZA 1SYIA 2O6AA 1JEUA 4Z0IA 1YTVA 1LAGE 4P8BA 3T96B 3ISPA 2QVRA 5CBSA 1LBCA 3H3GA 1F9BA 2V3TA 3LSXA 4YB6A 1NKXA 4QFPA 1WVJA 1Y3PA 2D5WA 1B4HA 1EYIA 1LCTA 1ZLQA 2KR0A 2DDKA 5L9MA 5KDTB 4R6HA 1MQJA 4GFRA 2O7UA 4OVPA 1PBQA 2O68A 2WX9A 4QFOA 1A8FA 1IZ1A 3O66A 3AXFA 4AQ4A 1T0KA 2I0CA 1LBZA 3CFXA 2ZNUA 2B65A 4G68A 2HAUA 3IOTA 4U4SA 3SEUA 4U1OA 5L9SA 4R2FA 4KD5A 3KZGA 5AA2D 3PUXE 4HE2A 2V3UA 4PFTA 3O28A 4IO2A 1AWBA 1MM6A 4WEPA 3FUZA 4GF8A 2XXUA 1A54A 3N6UA 1TFAA 3S9LC 3TMGA 4FAJA 1JQFA 1Y4CA 3OO7A 1FPJA 1R1NA 3LC8A 3RLFE 2ZZXA 3H6WA 3PPPA 4XKPA 4ZE8A 4DE8A 3IJOB 4OTEA 3KC0A 1USYH 3O97A 2DXYA 3E4RA 5IZ3A 2XD2A 3GBBA 1WODA 2HQ0A 2OWSA 1QKAA 2QS4A 3FJ7A 4PAFA 2DWAA 2ZZVA 3DM0A 4GL8A 4X1DA 1EYJA 2RCBA 5IZZA 1N7WA 3THIA 5JTYA 2P1SA 3EPEA 4X9TA 4GBWA 1LBBA 3WAFA 4FATA 3A09A 5ISUA 3IJXB 1POY1 3PPNA 4MLVA 3B50A 4YU0A 2RC7A 1MXYA 4ZEBA 3C31A 4GRKA 1ZTYA 4XEQA 3H4ZA 3PPOA 2CZKA 1MY3A 5KCJA 4BDNA 4N8GA 5H8HA 1HSJA 1EZPA 4NF6A 2QPQA 1Y20A 3T1BA 4F19A 1JNFA 1FPLA 1NUWA 1QVSA 2PFZA 4THIA 3SZPA 1Y1ZA 2H5YA 1B7HA 4RY1A 1IMEA 1ZBMA 2I3WA 1H3DA 1P1OA 5I7IA 1NNPA 2V84A 3MPKA 4X04A 4H67A 3SEYA 3V83A 1NV2A 3MUQA 3OENA 3PD8A 3OXNA 3TTRA 3ZKKA 3KBZA 2AYSA 1YYZA 4NF0A 2OJTA 3K6WA 4OVJA 1H44A 1DK4A 1INPA 1LBYA 1OIBA 2DVCA 2HXWA 2YPNA 2ZYKA 4NE4A 1M5EA 2CEYA 4KCDA 2NVUB 1FRPA 2AIXA 4PAIA 3OO9A 2M8CA 2O7IA 1XT8A 3FVKA 1D9VA 3K1PA 4YB5A 5A5XB 4ESWA 1IMAA 2DXRA 4EQ7A 2NXOA 3KG2A 3TQLA 3FVOA 4FEBA 4Q30B 2FIXA 5KZTA 2PVUA 1GGGA 1K9YA 1IMFA 1JVXA 2ALUA 4P3LA 1XVXA 1NV6A 5AA4A 4GD5A 4POWA 4RPNA 4KCCA 3Q29A 5ET5A 3OEMA 4IR8A 3ILTB 3BFUA 5J16A 4PE5B 4O3AA 3FV2A 4FORA 3TUSA 4G4PA 4ELRA 1PB9A 3SKPA 3FASA 1IITA 3TPAA 4MAGA 2UYFA 4MEVA 1B5JA 1UTBB 4PE3A 4PC9A 4U4XA 3FGSA 1B32A 2XWKA 3V8XB 1MXVA 2H4IA 2F7BA 3MC2A 2D3IA 2PFYA 5H8NA 4R73A 1XS5A 2E0SA 3T9UA 2FYIA 3C36A 4U1ZA 1SW2A 4I8CA 5EYFA 3QUFA 4BDQA 2DOJA 4U21A 4PDHA 3OMBA 3TAJA 3H03A 4KPTA 4LZ8A 1A7LA 1HSEA 3K1NA 3SDFA 3U65A 4JVDA 2A5TB 3FXQA 2GRVA 1NUZA 2ZZWA 3U8QA 3KSXA 3BKIB 3VVEA 3PUZE 3JV9A 3K02A 4U23A 4GVOA 1GV8A 4LONB 2DS9A 4FBPA 1Y3QA 1Y1MA 3USDA 1A55A 4F31B 2XXQA 3H06B 2I3VA 1FPKA 2XXVA 4P9KA 4ZEDA 1XVYA 4HCWA 2Q2CA 1FPFA 2V93A 5HPQA 4X1BA 2XWVA 1GR2A 2BJIA 1IXCA 3A29A 2OBGA 5BWJA 4F22A 3LBSA 2OCUA 4RK9A 5EQ8A 3FZVA 3S9NC 1JP4A 4PGNA 3BIGA 4R6KA 1A99A 2ONKE 4K3FA 3MW0A 1QUIA 4H8IA 2VGQA 1JW4A 4R6YA 3ZKLA 3IAZA 4KQPA 3UIFA 3TQWA 4N4UA 3TODA 1FTAA 4XFEA 1FQEA 4H65A 2XWOA 3KN7A 2CZIA 3QAXA 3PPRA 4H5GA 1AIVA 1R6ZA 3U1OA 1DTZA 4RYAA 5A5XA 1SQYA 5CM6A 4H6DA 1EZOA 3G3HA 3TTNA 3QUJA 4R9GA 1FBPA 4KFQA 4EF2A 4MBPA 5IAIA 2I6EA 2GHAA 4NMYA 3K2DA 2F3BA 3G3JA 5CMKA 4F3SA 2DQVA 2PT1A 1CNQA 5I5PA 1FTJA 1FQAA 4I40A 1YCJA 4GWYA 5DEXA 5LTCA 1FPGA 2Q74A 4G68B 2F5XA 1SI1A 3T66A 4KXPA 4H0WA 4YAHX 4X8RA 2F6GA 2WBDA 2CMOA 4LP2B 2H9BA 1FBFA 3G3FA 2PCRA 4RJZA 3KBRA 4XKQA 3UA8A 3DP4A 5EHSA 1FBCA 3PUWE 4Z7EA 2WYPA 4PFRA 1QUKA 3CG3A 4F2QA 2XXRA 4ONYA 2QJEA 3UK4A 4PP0A 1NUXA 1P1WA 4PF8A 3RT6B 4F39A 1XI6A 1LLSA 4U22A 1MY4A 1LAHE 4AB6A 2PBWA 5DYHA 5IZ3B 2H25A 2QMXA 2Q88A 3G7WA 4MIJA 3IB1A 1FBHA 2AL4A 4ZEKA 3HO7A 1VSOA 4IO7A
chains in the Genus database with same CATH topology
5CC2A 3PUYE 4TOZA 1B3FA 4NEDA 5ICQA 4IO6A 1IEJA 1A40A 2Y7WA 1M5CA 5CRYA 1VR5A 2R6GE 2F78A 3VV5A 4TQUQ 2QS3A 5KCJB 3OELA 3CSGA 4NF6B 4YZZA 5F7VA 3C4MA 1B6HA 4JB7A 2Q2AA 4WEDA 3OEKA 5ICTA 2IA4A 3DLNA 2YLNA 3KGCA 3SESA 2DWHA 2THIA 4Q0CA 2HZKA 2BJJX 5CMBA 5DVIA 3CFLA 3S9EA 3RT8A 1H76A 4L17A 2ZNTA 5I59B 4R74A 2XD3A 2RC8A 1TXFA 2ONSA 4LQ5A 4OEVA 3M3KA 1B7ZA 2XXTA 3K01A 1Y4TA 1FQCA 3PD9A 3JZJA 5K2XA 2QSXA 3SEWA 4QFKA 1M5BA 4ZEIA 4FIMA 4QFNA 3OOAA 4C0RA 3E3KA 3RNNA 4DLDA 3KN3A 3A3CA 4ESXA 2I48A 3CR9A 4NF5A 2F7AA 3VXBA 3U72A 3K6UA 3VE1B 5M2VA 5AA4B 4QRZA 3V89B 4GL0A 2GHBA 5F1QA 2FA7A 2ZMBA 2O51A 1GVCA 1CE2A 4Q8RA 4GLIA 5H8QB 2H98A 2NOOA 1MDQA 3GXAA 3IX1A 1MQIA 1OVBA 4MFIA 1B40A 4QSDA 1MXXA 4DDDA 1B1XA 1SYHA 4F1YA 1UIVA 1B3HA 3R6UA 3HPIA 3S9MC 1NFTA 4JBZA 3B6TA 4F3GA 1BP5A 2YJPA 1SD3A 5H8NB 5TP9A 3CI8A 1B4ZA 1BIYA 2XXYA 2Z8EA 2HZLA 3RUMA 2XHDA 3MP6A 4NF8B 4OESA 1O64A 2RKMA 2I0BA 4LZ7A 4ZS9A 5FHMA 2ZYMA 4X48A 4EXKA 5I58B 3RGYA 3WAEA 1IXGA 2F35A 2AL5A 3R7XA 1ELJA 1B5HA 1N76A 2O1LA 2XXXA 4G8NA 2GH9A 4JSDA 4XXUA 4KYDA 2F6PA 5DVJA 3IK6B 1US5A 1Y3NA 4EF1A 3UN6A 4F3PA 5ITOA 4O3BA 5HM4B 4UACA 2X7PA 2ZYNA 3KN8A 3O6IA 3O29A 1Y9UA 1N84A 2RINA 1RYXA 1SDXA 5FTIA 2OZZA 1LB9A 3OO8A 3ODBA 3I6VA 5H8SA 5I59A 1S9TA 3PV0E 2F36A 1ZMGA 2G29A 3OD7A 4F29A 4P0IA 4OERA 3MWBA 3RTFB 2ZNSA 3SETA 3MBPA 3D4CA 2PYYA 1LFIA 4N07A 2D21A 1KWHA 1ZIUA 3TTKA 2O84X 3VDFA 3PMXA 1DPPA 2DWJA 2ONRA 1R9LA 1IXHA 4JWYA 3R26A 3LR1A 1UTHA 2REGA 4BDLA 4DXCA 2QMWA 1B3EA 4R2BA 1PC3A 1LAXA 3MP1A 1MG1A 5DEXB 5BUUA 2XXHA 3KSJA 2PT2A 1IQ7A 4BDRA 3G3KA 4I62A 3IB0A 5H8QA 3C34A 2G93A 1DSNA 1H43A 1B0LA 1L5TA 3TTMA 5H8FA 3VVDA 3QYTA 2E1SA 1IUDA 4IGRA 3TCHA 3PPQA 3TELA 4EDPA 2UVJA 2LAOA 4YMBA 1J1NA 3CFZA 1B3LA 3EF7A 4BDMA 3FVNA 2NUVA 3IOVA 3CSBA 1LAFE 3U93A 1LFGA 3RTWB 4NF8A 2XX8A 3O6GA 4C1UA 5AE4A 3K00A 1USYE 4YKPA 5I58A 4IO3A 3H6TA 4O3CA 2DWIA 3A3UA 1URSA 4DZ1A 3GZGA 3PU5A 4MH5A 3MZBA 4H8JA 2F34A 1B9JA 4PFUA 2HCAA 2Q9TA 3SERA 2DE4A 1B1HA 3OO6A 4QF9A 4AB5A 5L8DA 1GTKA 5FTHA 2UVHA 3T22A 3N94A 1AOVA 1EZ9A 5L9OA 2PMSA 2VD2A 1OQGA 4TLLB 2Z8FA 5I2NA 4I9DA 4GIZA 1H45A 1M5FA 4NWCA 4DCXA 1B52A 2F97A 4RXLA 2REJA 1PDAA 2GFEA 3H6UA 2H99A 1S7YA 4U2RA 2XXIA 3S4UA 3EN3A 3C33A 4FE8A 2OWTA 3B7DA 3FD3A 3SEXA 1NL5A 1MS7A 4NF5B 4RNSA 2RF1A 3U92A 2XX7A 2ZYOA 3QIMA 4LQ2A 4OFLA 2QRYA 1OQHA 2RC9A 2NWJA 3M8UA 3TYHA 3MQ9A 4MLQA 2CZLA 4F2OA 1Q1KA 1I69A 1MQDA 2R71A 1N0TA 2F8DA 4LA9A 5CBRA 4IB2A 2VD3A 1BLFA 3LSLA 5I2KB 1B7UA 1QUJA 3K1MA 3TZAA 3Q26A 1URDA 4YKIA 5TP9B 4I1DA 1P1QA 5I57A 4YB7A 3MPLA 3CRBA 1WDNA 1LCFA 3KEIA 1B0HA 1YAEA 4NTLA 1B58A 4MF3A 4N13A 2Y7PA 4WKMA 4FEDA 1Z7NE 1US4A 3ONMA 5CMMA 1NH7A 4G8HA 3EHUA 4KYSA 4E0XA 2Y7KA 1ZJLA 1MXWA 3ZS6A 1VFEA 2UXAA 3LSFB 4QHQA 4OYVA 4ZDMA 3TEPA 3CIJA 4KYEA 4H1XA 2RCAA 4WXJA 4KR5A 3C32A 4QSEA 1M5DA 4OETA 3IOWA 3IR1A 3CG1A 3HHGA 2Y7RA 4OZ9A 3I5OA 3F11A 2I4BA 1P1NA 1BKAA 1UIUA 4C1TA 1HSLA 1PEBA 3JYRA 2DE2A 4DXBA 2DVZA 4BLAA 1AMFA 3HHFA 3MVWA 1P1UA 5TU0A 1DOTA 3IO4A 3N26A 3C9HA 3MJNA 2UVGA 1UTHB 1FW0A 2I58A 3FIRA 3B6WA 4P11A 1B3GA 4R75A 3FATA 4IGTA 5K2YA 4G68C 1POTA 1ZKBA 2V25A 3K6VA 3EQ1A 2DYXA 4DXUA 5CMCA 5B70A 3ECRA 3FXUA 4IY5A 2HAVA 4LATA 3W15C 2P0SA 5JK4A 1QW0A 3KOTA 1OLAA 1DPEA 1N3WA 5H8FB 4F1VA 3VLWA 3RQTA 1FTOA 5I84A 3HSTA 5AA1A 1SW4A 4IY6A 1MDP1 1B51A 4HTGA 5I2KA 1IIWA 5FHOA 3GBAA 4PFWA 5AA2A 3TTLA 2Q89A 3T9VA 2OLBA 1LB8A 4NWDA 2XX9A 3Q28A 2V3QA 4ECFA 2X7QA 3L6GA 3P7IA 4NF4A 3C35A 4ELOA 1VFDA 5AA3A 4OFOA 3IOUA 4ZEFA 4OMBA 2I4CA 2Y84A 1PBPA 2B3BA 2O69A 1XHYA 4JXIA 5J1DA 4EQ9A 1NNKA 3T93B 1QKBA 2W7YA 2OK2A 3TCFA 4KI0E 4ISUA 1FQFA 3EHTA 4KHZE 4OENA 4N6PA 1IXIA 1N3XA 1FTLA 4RK2A 3B6QA 1LSTA 3H6VA 4ZECA 4PFYA 4IO5A 3D4GA 4YKJA 1NMUA 5I2NB 4LZ5A 4JWXA 4TLMB 3ZSFA 4DCYA 1TWYA 4FECA 3E13X 3K6XA 1MY0A 1SVXB 3U94A 1TFDA 4FJPA 5DTBA 4H5FA 2X26A 3HCQA 4POXA 4OQOA 3TKDA 1B2HA 3K4UA 1Q35A 3BFTA 5I56B 1D9YA 4F18A 3W9VA 4GWOA 2ABHA 3O2AA 4G8MA 3LSWA 4LUBA 5FHNA 3T9XB 1SBPA 1NNTA 3VLUA 4M4GA 5KDTA 1AH5A 3RY3A 1R9QA 2Y7IA 2Z23A 4M1VA 5JEIA 1DTGA 3MVZA 2DP8A 4UA8A 1Z7ME 3KFMA 2WKYA 5TPAB 1MPCA 1MQGA 4YICA 3IO6A 3TDJA 2QS2A 3VFJA 4LVQA 2Q8JA 3CVGA 3UP9A 4ZE9A 5I57B 4OEUA 4ELPA 3S2VA 1MY1A 3OSQA 4R9FA 3MZ9A 1MH4A 1JEVA 1OVTA 1QJMA 1YPNA 2B3FA 2O1MA 4PETA 4EXLA 1MM7A 2XXWA 1N04A 4OWDA 1I6AA 4HW8A 2DE3A 1EH3A 1I6QA 2ESNA 2VP1A 1VE4A 3VVFA 3IB2A 4GXSB 3VXCA 3MZ1A 3OSRA 3KJTA 3QXMA 1PB7A 3HV1A 4JWOA 3MVXA 4XKRA 4PQJA 1RKMA 4R72A 1P99A 3UGWA 3PMWA 1MH3A 4OFJA 2HFBA 3H7MA 1QULA 4GXAA 1XC1A 1S50A 3PMVA 3K0VA 1AL3A 1CB6A 3DELB 4EUOA 3V5AA 3N5LA 4GOTA 3GLBA 3EHSA 2UYEA 4YKKA 5CI5A 5IKBA 1JW5A 4BDOA 1JW1A 4ZZAA 1O7TA 3VLVA 3PGFA 2XXPA 3BBRA 5LOMA 4F3BA 5I56A 2Z8DA 3MAMA 4JDFA 3MP8A 1LFHA 5DT6A 3G3IA 1JVYA 4RA1A 3HN0A 1LGBC 1MY2A 2HEUA 3LUYA 2UVIA 3KJ7A 2VHAA 2ANJA 3TFLA 3E9XA 2QL3A 4ZZEA 3I3VA 4HCYA 1II5A 1MPDA 4OHNA 4QFLA 4ND9A 2PX1A 3UORA 3M3LA 3G3GA 3QSLA 3M3FA 5TPAA 5ITPA 3QK6A 3FVGA 1SW5A 3PUVE 1B5IA 1D3KA 4EQBA 3FXRA 4XKNA 1SW1A 1ATGA 5AA2B 3TCGA 1FQDA 3RN8A 2VOZA 1UTBA 1URGA 4P0GA 2QS1A 2A5SA 5DVFA 3O9PA 3DP6A 3FJGA 3SEVA 3FV1A 2IEEA 4NF4B 5EHMA 4DIGA 4RPOA 2P2AA 4GQOA 2ZXTA 1OLCA 1PB8A 1MRPA 5B7DA 1FQBA 1DMBA 2KLFA 1TT1A 1MPBA 3DP8A 3N6TA 3IORA 1O63A 1NNFA 3KOSA 5JTYB 3FJMA 1BTJA 3T9HB 1EU8A 1NH8A 3Q27A 2A5TA 2Z22A 3ILUB 4Q5TA 5ELVA 1MQHA 1A8EA 1D4NA 1MXUA 2R9JA 4QSCA 1ZU0A 1B05A 3Q25A 2F7CA 4E0WA 1FTMA 4XIGQ 4ELQA 1B46A 5H8HB 3L6HA 1OMPA 1FTKA 1RYOA 4G2ZA 4OXVA 4XTCQ 1SI0A 3O6HA 1ANFA 4HS7A 1UQWA 3MVYA 2FNCA 3IL1B 4G77A 4YMAA 2DSFA 5HBCA 3RPWA 4JSOA 1JETA 1I6BA 2I49A 4IO4A 1N7XA 1XOCA 4F1UA 1FCKA 3W9WA 1MXZA 1SYIA 2O6AA 1JEUA 4Z0IA 1YTVA 1LAGE 3T96B 5CBSA 1LBCA 3H3GA 1F9BA 2V3TA 3LSXA 4YB6A 1NKXA 4QFPA 1WVJA 1Y3PA 2D5WA 1B4HA 1LCTA 1ZLQA 5L9MA 5KDTB 4R6HA 1MQJA 4GFRA 2O7UA 1PBQA 2O68A 4QFOA 1A8FA 1IZ1A 3O66A 3AXFA 4AQ4A 1T0KA 2I0CA 3CFXA 2ZNUA 2B65A 4G68A 2HAUA 3IOTA 4U4SA 3SEUA 4U1OA 5L9SA 4KD5A 4R2FA 3KZGA 5AA2D 3PUXE 2V3UA 4PFTA 3O28A 4IO2A 1MM6A 4WEPA 3FUZA 4GF8A 2XXUA 1A54A 3N6UA 1TFAA 3S9LC 3TMGA 4FAJA 1JQFA 1Y4CA 3OO7A 1R1NA 3LC8A 3RLFE 3H6WA 3PPPA 4XKPA 4ZE8A 4DE8A 3IJOB 4OTEA 1USYH 3O97A 2DXYA 3E4RA 2XD2A 3GBBA 1WODA 2HQ0A 2OWSA 1QKAA 2QS4A 3FJ7A 2DWAA 4GL8A 3DM0A 4X1DA 2RCBA 1N7WA 3THIA 5JTYA 2P1SA 3EPEA 4X9TA 1LBBA 3WAFA 4FATA 3A09A 5ISUA 3IJXB 1POY1 3PPNA 4MLVA 4YU0A 2RC7A 1MXYA 4ZEBA 3C31A 4GRKA 1ZTYA 3H4ZA 3PPOA 1MY3A 5KCJA 4BDNA 5H8HA 1HSJA 1EZPA 4NF6A 2QPQA 1Y20A 4F19A 1JNFA 1QVSA 4THIA 1Y1ZA 2H5YA 1B7HA 4RY1A 2I3WA 1ZBMA 1H3DA 1P1OA 1NNPA 2V84A 3MPKA 4H67A 3SEYA 3V83A 3MUQA 3OENA 3PD8A 3OXNA 3TTRA 3ZKKA 2AYSA 2OJTA 3K6WA 4OVJA 1H44A 1OIBA 2DVCA 2HXWA 2YPNA 2ZYKA 4NE4A 1M5EA 4KCDA 2NVUB 2AIXA 3OO9A 2M8CA 2O7IA 1XT8A 3FVKA 1D9VA 3K1PA 4YB5A 5A5XB 4ESWA 2DXRA 4EQ7A 2NXOA 3KG2A 3TQLA 3FVOA 4FEBA 4Q30B 5KZTA 2PVUA 1GGGA 1JVXA 2ALUA 1XVXA 5AA4A 4GD5A 4POWA 4RPNA 4KCCA 3Q29A 3OEMA 3ILTB 3BFUA 4PE5B 4O3AA 3FV2A 4FORA 3TUSA 4G4PA 4ELRA 1PB9A 3SKPA 3FASA 1IITA 3TPAA 2UYFA 1B5JA 1UTBB 4U4XA 3FGSA 1B32A 3V8XB 1MXVA 2H4IA 2F7BA 3MC2A 2D3IA 5H8NA 4R73A 1XS5A 2E0SA 3T9UA 2FYIA 3C36A 4U1ZA 1SW2A 4I8CA 5EYFA 3QUFA 4BDQA 2DOJA 4U21A 3OMBA 3TAJA 3H03A 4KPTA 3SDFA 4LZ8A 1A7LA 1HSEA 3K1NA 2A5TB 3FXQA 2GRVA 3U8QA 3KSXA 3BKIB 3VVEA 3PUZE 3JV9A 3K02A 4U23A 4GVOA 1GV8A 4LONB 2DS9A 1Y3QA 1Y1MA 3USDA 1A55A 4F31B 2XXQA 3H06B 2I3VA 2XXVA 4ZEDA 1XVYA 4HCWA 2Q2CA 2V93A 5HPQA 4X1BA 1GR2A 1IXCA 2OBGA 5BWJA 4F22A 3LBSA 2OCUA 4RK9A 3FZVA 3S9NC 1A99A 2ONKE 4R6KA 4K3FA 3MW0A 1QUIA 4H8IA 2VGQA 1JW4A 4R6YA 3ZKLA 3IAZA 4KQPA 3UIFA 3TQWA 3TODA 1FQEA 4H65A 3KN7A 3QAXA 4H5GA 3PPRA 1AIVA 1R6ZA 3U1OA 1DTZA 4RYAA 5A5XA 1SQYA 5CM6A 4H6DA 1EZOA 3G3HA 3TTNA 3QUJA 4R9GA 4KFQA 4EF2A 4MBPA 5IAIA 2I6EA 2GHAA 4NMYA 3K2DA 3G3JA 5CMKA 4F3SA 2DQVA 2PT1A 1FTJA 1FQAA 1YCJA 5DEXA 4G68B 2F5XA 1SI1A 3T66A 4H0WA 4YAHX 2F6GA 2CMOA 4LP2B 2H9BA 3G3FA 4RJZA 3KBRA 4XKQA 3UA8A 3DP4A 5EHSA 3PUWE 4Z7EA 1QUKA 3CG3A 4F2QA 2XXRA 4ONYA 2QJEA 3UK4A 4PP0A 1P1WA 3RT6B 4F39A 1LLSA 4U22A 1MY4A 4AB6A 1LAHE 2PBWA 5DYHA 2H25A 2QMXA 2Q88A 3G7WA 3IB1A 4ZEKA 2AL4A 3HO7A 1VSOA 4IO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CC2 A;  3PUY E;  4TOZ A;  1B3F A;  4NED A;  5ICQ A;  4IO6 A;  1IEJ A;  1A40 A;  2Y7W A;  1M5C A;  5CRY A;  1VR5 A;  2R6G E;  2F78 A;  3VV5 A;  4TQU Q;  2QS3 A;  5KCJ B;  3OEL A;  3CSG A;  4NF6 B;  4YZZ A;  5F7V A;  3C4M A;  1B6H A;  4JB7 A;  2Q2A A;  4WED A;  3OEK A;  5ICT A;  2IA4 A;  3DLN A;  2YLN A;  3KGC A;  3SES A;  2DWH A;  2THI A;  4Q0C A;  2HZK A;  2BJJ X;  5CMB A;  5DVI A;  3CFL A;  3S9E A;  3RT8 A;  1H76 A;  4L17 A;  2ZNT A;  5I59 B;  4R74 A;  2XD3 A;  2RC8 A;  1TXF A;  2ONS A;  4LQ5 A;  4OEV A;  3M3K A;  1B7Z A;  2XXT A;  3K01 A;  1Y4T A;  1FQC A;  3PD9 A;  3JZJ A;  5K2X A;  2QSX A;  3SEW A;  4QFK A;  1M5B A;  4ZEI A;  4FIM A;  4QFN A;  3OOA A;  4C0R A;  3E3K A;  3RNN A;  4DLD A;  3KN3 A;  3A3C A;  4ESX A;  2I48 A;  3CR9 A;  4NF5 A;  2F7A A;  3VXB A;  3U72 A;  3K6U A;  3VE1 B;  5M2V A;  5AA4 B;  4QRZ A;  3V89 B;  4GL0 A;  2GHB A;  5F1Q A;  2FA7 A;  2ZMB A;  2O51 A;  1GVC A;  1CE2 A;  4Q8R A;  4GLI A;  5H8Q B;  2H98 A;  2NOO A;  1MDQ A;  3GXA A;  3IX1 A;  1MQI A;  1OVB A;  4MFI A;  1B40 A;  4QSD A;  1MXX A;  4DDD A;  1B1X A;  1SYH A;  4F1Y A;  1UIV A;  1B3H A;  3R6U A;  3HPI A;  3S9M C;  1NFT A;  4JBZ A;  3B6T A;  4F3G A;  1BP5 A;  2YJP A;  1SD3 A;  5H8N B;  5TP9 A;  3CI8 A;  1B4Z A;  1BIY A;  2XXY A;  2Z8E A;  2HZL A;  3RUM A;  2XHD A;  3MP6 A;  4NF8 B;  4OES A;  1O64 A;  2RKM A;  2I0B A;  4LZ7 A;  4ZS9 A;  5FHM A;  2ZYM A;  4X48 A;  4EXK A;  5I58 B;  3RGY A;  3WAE A;  1IXG A;  2F35 A;  2AL5 A;  3R7X A;  1ELJ A;  1B5H A;  1N76 A;  2O1L A;  2XXX A;  4G8N A;  2GH9 A;  4JSD A;  4XXU A;  4KYD A;  2F6P A;  5DVJ A;  3IK6 B;  1US5 A;  1Y3N A;  4EF1 A;  3UN6 A;  4F3P A;  5ITO A;  4O3B A;  5HM4 B;  4UAC A;  2X7P A;  2ZYN A;  3KN8 A;  3O6I A;  3O29 A;  1Y9U A;  1N84 A;  2RIN A;  1RYX A;  1SDX A;  5FTI A;  2OZZ A;  1LB9 A;  3OO8 A;  3ODB A;  3I6V A;  5H8S A;  5I59 A;  1S9T A;  3PV0 E;  2F36 A;  1ZMG A;  2G29 A;  3OD7 A;  4F29 A;  4P0I A;  4OER A;  3MWB A;  3RTF B;  2ZNS A;  3SET A;  3MBP A;  3D4C A;  2PYY A;  1LFI A;  4N07 A;  2D21 A;  1KWH A;  1ZIU A;  3TTK A;  2O84 X;  3VDF A;  3PMX A;  1DPP A;  2DWJ A;  2ONR A;  1R9L A;  1IXH A;  4JWY A;  3R26 A;  3LR1 A;  1UTH A;  2REG A;  4BDL A;  4DXC A;  2QMW A;  1B3E A;  4R2B A;  1PC3 A;  1LAX A;  3MP1 A;  1MG1 A;  5DEX B;  5BUU A;  2XXH A;  3KSJ A;  2PT2 A;  1IQ7 A;  4BDR A;  3G3K A;  4I62 A;  3IB0 A;  5H8Q A;  3C34 A;  2G93 A;  1DSN A;  1H43 A;  1B0L A;  1L5T A;  3TTM A;  5H8F A;  3VVD A;  3QYT A;  2E1S A;  1IUD A;  4IGR A;  3TCH A;  3PPQ A;  3TEL A;  4EDP A;  2UVJ A;  2LAO A;  4YMB A;  1J1N A;  3CFZ A;  1B3L A;  3EF7 A;  4BDM A;  3FVN A;  2NUV A;  3IOV A;  3CSB A;  1LAF E;  3U93 A;  1LFG A;  3RTW B;  4NF8 A;  2XX8 A;  3O6G A;  4C1U A;  5AE4 A;  3K00 A;  1USY E;  4YKP A;  5I58 A;  4IO3 A;  3H6T A;  4O3C A;  2DWI A;  3A3U A;  1URS A;  4DZ1 A;  3GZG A;  3PU5 A;  4MH5 A;  3MZB A;  4H8J A;  2F34 A;  1B9J A;  4PFU A;  2HCA A;  2Q9T A;  3SER A;  2DE4 A;  1B1H A;  3OO6 A;  4QF9 A;  4AB5 A;  5L8D A;  1GTK A;  5FTH A;  2UVH A;  3T22 A;  3N94 A;  1AOV A;  1EZ9 A;  5L9O A;  2PMS A;  2VD2 A;  1OQG A;  4TLL B;  2Z8F A;  5I2N A;  4I9D A;  4GIZ A;  1H45 A;  1M5F A;  4NWC A;  4DCX A;  1B52 A;  2F97 A;  4RXL A;  2REJ A;  1PDA A;  2GFE A;  3H6U A;  2H99 A;  1S7Y A;  4U2R A;  2XXI A;  3S4U A;  3EN3 A;  3C33 A;  4FE8 A;  2OWT A;  3B7D A;  3FD3 A;  3SEX A;  1NL5 A;  1MS7 A;  4NF5 B;  4RNS A;  2RF1 A;  3U92 A;  2XX7 A;  2ZYO A;  3QIM A;  4LQ2 A;  4OFL A;  2QRY A;  1OQH A;  2RC9 A;  2NWJ A;  3M8U A;  3TYH A;  3MQ9 A;  4MLQ A;  2CZL A;  4F2O A;  1Q1K A;  1I69 A;  1MQD A;  2R71 A;  1N0T A;  2F8D A;  4LA9 A;  5CBR A;  4IB2 A;  2VD3 A;  1BLF A;  3LSL A;  5I2K B;  1B7U A;  1QUJ A;  3K1M A;  3TZA A;  3Q26 A;  1URD A;  4YKI A;  5TP9 B;  4I1D A;  1P1Q A;  5I57 A;  4YB7 A;  3MPL A;  3CRB A;  1WDN A;  1LCF A;  3KEI A;  1B0H A;  1YAE A;  4NTL A;  1B58 A;  4MF3 A;  4N13 A;  2Y7P A;  4WKM A;  4FED A;  1Z7N E;  1US4 A;  3ONM A;  5CMM A;  1NH7 A;  4G8H A;  3EHU A;  4KYS A;  4E0X A;  2Y7K A;  1ZJL A;  1MXW A;  3ZS6 A;  1VFE A;  2UXA A;  3LSF B;  4QHQ A;  4OYV A;  4ZDM A;  3TEP A;  3CIJ A;  4KYE A;  4H1X A;  2RCA A;  4WXJ A;  4KR5 A;  3C32 A;  4QSE A;  1M5D A;  4OET A;  3IOW A;  3IR1 A;  3CG1 A;  3HHG A;  2Y7R A;  4OZ9 A;  3I5O A;  3F11 A;  2I4B A;  1P1N A;  1BKA A;  1UIU A;  4C1T A;  1HSL A;  1PEB A;  3JYR A;  2DE2 A;  4DXB A;  2DVZ A;  4BLA A;  1AMF A;  3HHF A;  3MVW A;  1P1U A;  5TU0 A;  1DOT A;  3IO4 A;  3N26 A;  3C9H A;  3MJN A;  2UVG A;  1UTH B;  1FW0 A;  2I58 A;  3FIR A;  3B6W A;  4P11 A;  1B3G A;  4R75 A;  3FAT A;  4IGT A;  5K2Y A;  4G68 C;  1POT A;  1ZKB A;  2V25 A;  3K6V A;  3EQ1 A;  2DYX A;  4DXU A;  5CMC A;  5B70 A;  3ECR A;  3FXU A;  4IY5 A;  2HAV A;  4LAT A;  3W15 C;  2P0S A;  5JK4 A;  1QW0 A;  3KOT A;  1OLA A;  1DPE A;  1N3W A;  5H8F B;  4F1V A;  3VLW A;  3RQT A;  1FTO A;  5I84 A;  3HST A;  5AA1 A;  1SW4 A;  4IY6 A;  1MDP 1;  1B51 A;  4HTG A;  5I2K A;  1IIW A;  5FHO A;  3GBA A;  4PFW A;  5AA2 A;  3TTL A;  2Q89 A;  3T9V A;  2OLB A;  1LB8 A;  4NWD A;  2XX9 A;  3Q28 A;  2V3Q A;  4ECF A;  2X7Q A;  3L6G A;  3P7I A;  4NF4 A;  3C35 A;  4ELO A;  1VFD A;  5AA3 A;  4OFO A;  3IOU A;  4ZEF A;  4OMB A;  2I4C A;  2Y84 A;  1PBP A;  2B3B A;  2O69 A;  1XHY A;  4JXI A;  5J1D A;  4EQ9 A;  1NNK A;  3T93 B;  1QKB A;  2W7Y A;  2OK2 A;  3TCF A;  4KI0 E;  4ISU A;  1FQF A;  3EHT A;  4KHZ E;  4OEN A;  4N6P A;  1IXI A;  1N3X A;  1FTL A;  4RK2 A;  3B6Q A;  1LST A;  3H6V A;  4ZEC A;  4PFY A;  4IO5 A;  3D4G A;  4YKJ A;  1NMU A;  5I2N B;  4LZ5 A;  4JWX A;  4TLM B;  3ZSF A;  4DCY A;  1TWY A;  4FEC A;  3E13 X;  3K6X A;  1MY0 A;  1SVX B;  3U94 A;  1TFD A;  4FJP A;  5DTB A;  4H5F A;  2X26 A;  3HCQ A;  4POX A;  4OQO A;  3TKD A;  1B2H A;  3K4U A;  1Q35 A;  3BFT A;  5I56 B;  1D9Y A;  4F18 A;  3W9V A;  4GWO A;  2ABH A;  3O2A A;  4G8M A;  3LSW A;  4LUB A;  5FHN A;  3T9X B;  1SBP A;  1NNT A;  3VLU A;  4M4G A;  5KDT A;  1AH5 A;  3RY3 A;  1R9Q A;  2Y7I A;  2Z23 A;  4M1V A;  5JEI A;  1DTG A;  3MVZ A;  2DP8 A;  4UA8 A;  1Z7M E;  3KFM A;  2WKY A;  5TPA B;  1MPC A;  1MQG A;  4YIC A;  3IO6 A;  3TDJ A;  2QS2 A;  3VFJ A;  4LVQ A;  2Q8J A;  3CVG A;  3UP9 A;  4ZE9 A;  5I57 B;  4OEU A;  4ELP A;  3S2V A;  1MY1 A;  3OSQ A;  4R9F A;  3MZ9 A;  1MH4 A;  1JEV A;  1OVT A;  1QJM A;  1YPN A;  2B3F A;  2O1M A;  4PET A;  4EXL A;  1MM7 A;  2XXW A;  1N04 A;  4OWD A;  1I6A A;  4HW8 A;  2DE3 A;  1EH3 A;  1I6Q A;  2ESN A;  2VP1 A;  1VE4 A;  3VVF A;  3IB2 A;  4GXS B;  3VXC A;  3MZ1 A;  3OSR A;  3KJT A;  3QXM A;  1PB7 A;  3HV1 A;  4JWO A;  3MVX A;  4XKR A;  4PQJ A;  1RKM A;  4R72 A;  1P99 A;  3UGW A;  3PMW A;  1MH3 A;  4OFJ A;  2HFB A;  3H7M A;  1QUL A;  4GXA A;  1XC1 A;  1S50 A;  3PMV A;  3K0V A;  1AL3 A;  1CB6 A;  3DEL B;  4EUO A;  3V5A A;  3N5L A;  4GOT A;  3GLB A;  3EHS A;  2UYE A;  4YKK A;  5CI5 A;  5IKB A;  1JW5 A;  4BDO A;  1JW1 A;  4ZZA A;  1O7T A;  3VLV A;  3PGF A;  2XXP A;  3BBR A;  5LOM A;  4F3B A;  5I56 A;  2Z8D A;  3MAM A;  4JDF A;  3MP8 A;  1LFH A;  5DT6 A;  3G3I A;  1JVY A;  4RA1 A;  3HN0 A;  1LGB C;  1MY2 A;  2HEU A;  3LUY A;  2UVI A;  3KJ7 A;  2VHA A;  2ANJ A;  3TFL A;  3E9X A;  2QL3 A;  4ZZE A;  3I3V A;  4HCY A;  1II5 A;  1MPD A;  4OHN A;  4QFL A;  4ND9 A;  2PX1 A;  3UOR A;  3M3L A;  3G3G A;  3QSL A;  3M3F A;  5TPA A;  5ITP A;  3QK6 A;  3FVG A;  1SW5 A;  3PUV E;  1B5I A;  1D3K A;  4EQB A;  3FXR A;  4XKN A;  1SW1 A;  1ATG A;  5AA2 B;  3TCG A;  1FQD A;  3RN8 A;  2VOZ A;  1UTB A;  1URG A;  4P0G A;  2QS1 A;  2A5S A;  5DVF A;  3O9P A;  3DP6 A;  3FJG A;  3SEV A;  3FV1 A;  2IEE A;  4NF4 B;  5EHM A;  4DIG A;  4RPO A;  2P2A A;  4GQO A;  2ZXT A;  1OLC A;  1PB8 A;  1MRP A;  5B7D A;  1FQB A;  1DMB A;  2KLF A;  1TT1 A;  1MPB A;  3DP8 A;  3N6T A;  3IOR A;  1O63 A;  1NNF A;  3KOS A;  5JTY B;  3FJM A;  1BTJ A;  3T9H B;  1EU8 A;  1NH8 A;  3Q27 A;  2A5T A;  2Z22 A;  3ILU B;  4Q5T A;  5ELV A;  1MQH A;  1A8E A;  1D4N A;  1MXU A;  2R9J A;  4QSC A;  1ZU0 A;  1B05 A;  3Q25 A;  2F7C A;  4E0W A;  1FTM A;  4XIG Q;  4ELQ A;  1B46 A;  5H8H B;  3L6H A;  1OMP A;  1FTK A;  1RYO A;  4G2Z A;  4OXV A;  4XTC Q;  1SI0 A;  3O6H A;  1ANF A;  4HS7 A;  1UQW A;  3MVY A;  2FNC A;  3IL1 B;  4G77 A;  4YMA A;  2DSF A;  5HBC A;  3RPW A;  4JSO A;  1JET A;  1I6B A;  2I49 A;  4IO4 A;  1N7X A;  1XOC A;  4F1U A;  1FCK A;  3W9W A;  1MXZ A;  1SYI A;  2O6A A;  1JEU A;  4Z0I A;  1YTV A;  1LAG E;  3T96 B;  5CBS A;  1LBC A;  3H3G A;  1F9B A;  2V3T A;  3LSX A;  4YB6 A;  1NKX A;  4QFP A;  1WVJ A;  1Y3P A;  2D5W A;  1B4H A;  1LCT A;  1ZLQ A;  5L9M A;  5KDT B;  4R6H A;  1MQJ A;  4GFR A;  2O7U A;  1PBQ A;  2O68 A;  4QFO A;  1A8F A;  1IZ1 A;  3O66 A;  3AXF A;  4AQ4 A;  1T0K A;  2I0C A;  3CFX A;  2ZNU A;  2B65 A;  4G68 A;  2HAU A;  3IOT A;  4U4S A;  3SEU A;  4U1O A;  5L9S A;  4KD5 A;  4R2F A;  3KZG A;  5AA2 D;  3PUX E;  2V3U A;  4PFT A;  3O28 A;  4IO2 A;  1MM6 A;  4WEP A;  3FUZ A;  4GF8 A;  2XXU A;  1A54 A;  3N6U A;  1TFA A;  3S9L C;  3TMG A;  4FAJ A;  1JQF A;  1Y4C A;  3OO7 A;  1R1N A;  3LC8 A;  3RLF E;  3H6W A;  3PPP A;  4XKP A;  4ZE8 A;  4DE8 A;  3IJO B;  4OTE A;  1USY H;  3O97 A;  2DXY A;  3E4R A;  2XD2 A;  3GBB A;  1WOD A;  2HQ0 A;  2OWS A;  1QKA A;  2QS4 A;  3FJ7 A;  2DWA A;  4GL8 A;  3DM0 A;  4X1D A;  2RCB A;  1N7W A;  3THI A;  5JTY A;  2P1S A;  3EPE A;  4X9T A;  1LBB A;  3WAF A;  4FAT A;  3A09 A;  5ISU A;  3IJX B;  1POY 1;  3PPN A;  4MLV A;  4YU0 A;  2RC7 A;  1MXY A;  4ZEB A;  3C31 A;  4GRK A;  1ZTY A;  3H4Z A;  3PPO A;  1MY3 A;  5KCJ A;  4BDN A;  5H8H A;  1HSJ A;  1EZP A;  4NF6 A;  2QPQ A;  1Y20 A;  4F19 A;  1JNF A;  1QVS A;  4THI A;  1Y1Z A;  2H5Y A;  1B7H A;  4RY1 A;  2I3W A;  1ZBM A;  1H3D A;  1P1O A;  1NNP A;  2V84 A;  3MPK A;  4H67 A;  3SEY A;  3V83 A;  3MUQ A;  3OEN A;  3PD8 A;  3OXN A;  3TTR A;  3ZKK A;  2AYS A;  2OJT A;  3K6W A;  4OVJ A;  1H44 A;  1OIB A;  2DVC A;  2HXW A;  2YPN A;  2ZYK A;  4NE4 A;  1M5E A;  4KCD A;  2NVU B;  2AIX A;  3OO9 A;  2M8C A;  2O7I A;  1XT8 A;  3FVK A;  1D9V A;  3K1P A;  4YB5 A;  5A5X B;  4ESW A;  2DXR A;  4EQ7 A;  2NXO A;  3KG2 A;  3TQL A;  3FVO A;  4FEB A;  4Q30 B;  5KZT A;  2PVU A;  1GGG A;  1JVX A;  2ALU A;  1XVX A;  5AA4 A;  4GD5 A;  4POW A;  4RPN A;  4KCC A;  3Q29 A;  3OEM A;  3ILT B;  3BFU A;  4PE5 B;  4O3A A;  3FV2 A;  4FOR A;  3TUS A;  4G4P A;  4ELR A;  1PB9 A;  3SKP A;  3FAS A;  1IIT A;  3TPA A;  2UYF A;  1B5J A;  1UTB B;  4U4X A;  3FGS A;  1B32 A;  3V8X B;  1MXV A;  2H4I A;  2F7B A;  3MC2 A;  2D3I A;  5H8N A;  4R73 A;  1XS5 A;  2E0S A;  3T9U A;  2FYI A;  3C36 A;  4U1Z A;  1SW2 A;  4I8C A;  5EYF A;  3QUF A;  4BDQ A;  2DOJ A;  4U21 A;  3OMB A;  3TAJ A;  3H03 A;  4KPT A;  3SDF A;  4LZ8 A;  1A7L A;  1HSE A;  3K1N A;  2A5T B;  3FXQ A;  2GRV A;  3U8Q A;  3KSX A;  3BKI B;  3VVE A;  3PUZ E;  3JV9 A;  3K02 A;  4U23 A;  4GVO A;  1GV8 A;  4LON B;  2DS9 A;  1Y3Q A;  1Y1M A;  3USD A;  1A55 A;  4F31 B;  2XXQ A;  3H06 B;  2I3V A;  2XXV A;  4ZED A;  1XVY A;  4HCW A;  2Q2C A;  2V93 A;  5HPQ A;  4X1B A;  1GR2 A;  1IXC A;  2OBG A;  5BWJ A;  4F22 A;  3LBS A;  2OCU A;  4RK9 A;  3FZV A;  3S9N C;  1A99 A;  2ONK E;  4R6K A;  4K3F A;  3MW0 A;  1QUI A;  4H8I A;  2VGQ A;  1JW4 A;  4R6Y A;  3ZKL A;  3IAZ A;  4KQP A;  3UIF A;  3TQW A;  3TOD A;  1FQE A;  4H65 A;  3KN7 A;  3QAX A;  4H5G A;  3PPR A;  1AIV A;  1R6Z A;  3U1O A;  1DTZ A;  4RYA A;  5A5X A;  1SQY A;  5CM6 A;  4H6D A;  1EZO A;  3G3H A;  3TTN A;  3QUJ A;  4R9G A;  4KFQ A;  4EF2 A;  4MBP A;  5IAI A;  2I6E A;  2GHA A;  4NMY A;  3K2D A;  3G3J A;  5CMK A;  4F3S A;  2DQV A;  2PT1 A;  1FTJ A;  1FQA A;  1YCJ A;  5DEX A;  4G68 B;  2F5X A;  1SI1 A;  3T66 A;  4H0W A;  4YAH X;  2F6G A;  2CMO A;  4LP2 B;  2H9B A;  3G3F A;  4RJZ A;  3KBR A;  4XKQ A;  3UA8 A;  3DP4 A;  5EHS A;  3PUW E;  4Z7E A;  1QUK A;  3CG3 A;  4F2Q A;  2XXR A;  4ONY A;  2QJE A;  3UK4 A;  4PP0 A;  1P1W A;  3RT6 B;  4F39 A;  1LLS A;  4U22 A;  1MY4 A;  4AB6 A;  1LAH E;  2PBW A;  5DYH A;  2H25 A;  2QMX A;  2Q88 A;  3G7W A;  3IB1 A;  4ZEK A;  2AL4 A;  3HO7 A;  1VSO A;  4IO7 A; 
#chains in the Genus database with same CATH topology
 5CC2 A;  2WEF A;  3PUY E;  4TOZ A;  1B3F A;  4NED A;  5ICQ A;  4IO6 A;  1IEJ A;  1IMB A;  1A40 A;  2Y7W A;  1M5C A;  5CRY A;  1VR5 A;  1VDW A;  2R6G E;  2L5V A;  2F78 A;  3VV5 A;  4TQU Q;  2XXK A;  2QS3 A;  4GBV A;  5KCJ B;  3OEL A;  2B4L A;  3CSG A;  4NF6 B;  4YZZ A;  5F7V A;  3C4M A;  1B6H A;  4JB7 A;  2Q2A A;  4WED A;  2Q8M A;  3OEK A;  5ICT A;  4GX6 A;  2IA4 A;  4GX4 A;  3DLN A;  2YLN A;  3KGC A;  3SES A;  2DWH A;  2THI A;  4NG7 A;  5ET6 A;  4Q0C A;  2HZK A;  2BJJ X;  5CMB A;  5DVI A;  3CFL A;  3S9E A;  3RT8 A;  4OVR A;  3HFU A;  1H76 A;  5EQ7 A;  4L17 A;  2ZNT A;  5I59 B;  4R74 A;  2XD3 A;  2RC8 A;  1TXF A;  2ONS A;  4LQ5 A;  4OEV A;  3M3K A;  1B7Z A;  2XXT A;  5I3S A;  3K01 A;  1Y4T A;  1FQC A;  3PD9 A;  3JZJ A;  5K2X A;  2QSX A;  3SEW A;  4QFK A;  1M5B A;  4ZEI A;  4FIM A;  4QFN A;  3OOA A;  4C0R A;  3E3K A;  3RNN A;  4DLD A;  3KN3 A;  3A3C A;  4ESX A;  2HPG A;  2P3V A;  2I48 A;  3CR9 A;  4NF5 A;  1FJ6 A;  2F7A A;  3VXB A;  3U72 A;  3K6U A;  3VE1 B;  5M2V A;  5AA4 B;  5T3J A;  4QRZ A;  3V89 B;  4GL0 A;  2GHB A;  5F1Q A;  2FA7 A;  1D9Q A;  2ZMB A;  2O51 A;  4NX1 A;  2QVU A;  1GVC A;  4OVS A;  1CE2 A;  4Q8R A;  4GLI A;  5H8Q B;  3LV0 A;  2H98 A;  2NOO A;  4JVC A;  1IMC A;  1FPB A;  1MDQ A;  2VPN A;  3GXA A;  3IX1 A;  1MQI A;  3RYD A;  1OVB A;  4MFI A;  1B40 A;  4QSD A;  1RDX A;  1DCU A;  1MXX A;  4DDD A;  1B1X A;  4JVI A;  1SYH A;  4F1Y A;  1UIV A;  4O94 A;  1B3H A;  3R6U A;  3HPI A;  3S9M C;  1NFT A;  4JBZ A;  3B6T A;  4F3G A;  1BP5 A;  2YJP A;  4O7M A;  1SD3 A;  5H8N B;  5TP9 A;  3CI8 A;  1B4Z A;  1BIY A;  5IGA A;  2XXY A;  2Z8E A;  2HZL A;  3RUM A;  1KZ8 A;  2XHD A;  3MP6 A;  4NF8 B;  4OES A;  1O64 A;  2JJK A;  2WYK A;  2RKM A;  2I0B A;  4LZ7 A;  4ZS9 A;  5FHM A;  4N6K A;  2ZYM A;  4OVQ A;  4X48 A;  4EXK A;  5I58 B;  3RGY A;  3WAE A;  4MNI A;  1IXG A;  2F35 A;  2AL5 A;  3R7X A;  1ELJ A;  3BIH A;  1B5H A;  1N76 A;  2O1L A;  4MNC A;  2XXX A;  3FBP A;  4G8N A;  1G0I A;  2GH9 A;  4JSD A;  4PBH A;  4XXU A;  5IM2 A;  4KYD A;  2F6P A;  5DVJ A;  3IK6 B;  2CZH A;  1US5 A;  1Y3N A;  4EF1 A;  3UN6 A;  4F3P A;  5ITO A;  4O3B A;  5HM4 B;  2WBB A;  4UAC A;  2X7P A;  2ZYN A;  3KN8 A;  3O6I A;  3O29 A;  1Y9U A;  1N84 A;  2P3N A;  2RIN A;  1RYX A;  1SDX A;  5FTI A;  2OZZ A;  1LB9 A;  3OO8 A;  3ODB A;  3I6V A;  5H8S A;  5I59 A;  1LBV A;  1S9T A;  3PV0 E;  4NGU A;  2F36 A;  1ZMG A;  2G29 A;  3OD7 A;  4F29 A;  4P0I A;  4OER A;  3MWB A;  3RTF B;  2ZNS A;  3SET A;  3MBP A;  3D4C A;  3PTY A;  1G0H A;  2PYY A;  1LFI A;  4N07 A;  2D21 A;  1KWH A;  1ZIU A;  3TTK A;  2O84 X;  3VDF A;  3PMX A;  1DPP A;  2DWJ A;  2ONR A;  1R9L A;  1IXH A;  4JWY A;  3R26 A;  3LR1 A;  1UTH A;  2REG A;  4BDL A;  3IFA A;  4DXC A;  2QMW A;  1B3E A;  4R2B A;  5FBP A;  1PC3 A;  1LAX A;  3MP1 A;  1MG1 A;  5DEX B;  4N15 A;  5BUU A;  2XXH A;  3KSJ A;  1FBD A;  2PT2 A;  1IQ7 A;  2Y5L A;  4BDR A;  3G3K A;  2VPO A;  4I62 A;  3IB0 A;  5H8Q A;  3C34 A;  2G93 A;  1DSN A;  3ROJ A;  1H43 A;  1B0L A;  3MST A;  1L5T A;  3TTM A;  5H8F A;  3VVD A;  2QVV A;  3QYT A;  2E1S A;  1IUD A;  4IGR A;  3TCH A;  3PPQ A;  3TEL A;  4EDP A;  2UVJ A;  2LAO A;  4YMB A;  1J1N A;  3CFZ A;  1B3L A;  1FBE A;  3EF7 A;  4BDM A;  3FVN A;  2NUV A;  3IOV A;  3CSB A;  1LAF E;  3U93 A;  1LFG A;  3RTW B;  4PCD A;  4NF8 A;  2KQZ A;  2XX8 A;  1IMD A;  3O6G A;  3KC1 A;  4C1U A;  5AE4 A;  3K00 A;  3B8B A;  1USY E;  4YKP A;  5I58 A;  4MJO A;  4IO3 A;  3H6T A;  4O3C A;  2DWI A;  3A3U A;  1URS A;  4DZ1 A;  3GZG A;  3PU5 A;  4MH5 A;  3MZB A;  4H8J A;  4PAK A;  2F34 A;  1B9J A;  4PFU A;  2QFL A;  2HCA A;  2Q9T A;  3SER A;  2DE4 A;  1B1H A;  4QF9 A;  3OO6 A;  1SPI A;  4AB5 A;  5L8D A;  1GTK A;  5FTH A;  2UVH A;  3T22 A;  3N94 A;  1DBZ A;  1AOV A;  2FVZ A;  1EZ9 A;  5L9O A;  2PMS A;  2VD2 A;  1OQG A;  4TLL B;  2OX3 A;  2Z8F A;  5I2N A;  4I9D A;  4GIZ A;  4N8Y A;  1LBW A;  1H45 A;  1M5F A;  4NWC A;  4DCX A;  1B52 A;  5ET7 A;  2F97 A;  4RXL A;  2REJ A;  3IFC A;  1PDA A;  2GFE A;  3H6U A;  2H99 A;  1S7Y A;  4U2R A;  2XXI A;  4N91 A;  3EN3 A;  3S4U A;  4O7I A;  3C33 A;  4FE8 A;  2OWT A;  3B7D A;  3FD3 A;  3SEX A;  2VT5 A;  1NL5 A;  2FHY A;  1LBX A;  1MS7 A;  4NF5 B;  1FSA A;  4RNS A;  3T0J A;  2RF1 A;  3U92 A;  2XX7 A;  2ZYO A;  3QIM A;  4LQ2 A;  4OFL A;  2MKZ A;  2QRY A;  1OQH A;  2RC9 A;  3QMF A;  2NWJ A;  4I3E A;  3M8U A;  3TYH A;  3MQ9 A;  4UAB A;  4MLQ A;  2CZL A;  4F2O A;  1Q1K A;  1I69 A;  1MQD A;  2R71 A;  1N0T A;  2F8D A;  4LA9 A;  5CBR A;  4IB2 A;  2VD3 A;  1BLF A;  3LSL A;  5I2K B;  1B7U A;  1QUJ A;  3K1M A;  3TZA A;  3Q26 A;  1URD A;  4YKI A;  5TP9 B;  4I1D A;  4OVT A;  1P1Q A;  5I57 A;  4YB7 A;  3MPL A;  3CRB A;  1WDN A;  1LCF A;  3KEI A;  3GYY A;  3CHG A;  4I3Y A;  1B0H A;  1YAE A;  4NTL A;  1B58 A;  2GQ1 A;  4AS4 A;  5EQA A;  4MF3 A;  4N13 A;  2Y7P A;  5IZ1 A;  4G61 A;  4FED A;  4WKM A;  1Z7N E;  4PF6 A;  1US4 A;  1NUY A;  5LDZ A;  3ONM A;  5CMM A;  1NH7 A;  4G8H A;  3EHU A;  4KYS A;  4E0X A;  3E79 A;  2Y7K A;  1ZJL A;  1MXW A;  3ZS6 A;  1VFE A;  2UXA A;  3LSF B;  4QHQ A;  4OYV A;  4ZDM A;  3TEP A;  4NHB A;  5ESY A;  3CIJ A;  4KYE A;  4H1X A;  2RCA A;  4WXJ A;  4KR5 A;  3C32 A;  4QSE A;  1M5D A;  4OET A;  3IOW A;  3IR1 A;  3CG1 A;  4PTK A;  3HHG A;  2Y7R A;  4OZ9 A;  2FBP A;  3I5O A;  3F11 A;  1KA1 A;  2I4B A;  1P1N A;  3MYU A;  1BKA A;  1NV4 A;  2FIE A;  1UIU A;  4C1T A;  1HSL A;  1PEB A;  3JYR A;  2DE2 A;  4DXB A;  1FBG A;  2DVZ A;  4BLA A;  1AMF A;  3HHF A;  1NV0 A;  3MVW A;  1P1U A;  5TU0 A;  1DOT A;  3IO4 A;  3N26 A;  3C9H A;  3MJN A;  2UVG A;  1UTH B;  1FW0 A;  2I58 A;  3FIR A;  1EYK A;  3B6W A;  4P11 A;  1B3G A;  3EKI A;  2HXR A;  4R75 A;  3FAT A;  4IGT A;  5K2Y A;  4G68 C;  1POT A;  1ZKB A;  2V25 A;  3K6V A;  4P1L A;  5DW8 A;  3EQ1 A;  2DYX A;  4DXU A;  5CMC A;  2CEX A;  5B70 A;  3ECR A;  3E78 A;  3FXU A;  4IY5 A;  2HAV A;  4LAT A;  3W15 C;  2P0S A;  5JK4 A;  1QW0 A;  3KOT A;  1OLA A;  1DPE A;  1N3W A;  5H8F B;  4F1V A;  3VLW A;  4N81 A;  3RQT A;  1FTO A;  5I84 A;  3HST A;  5AA1 A;  1SW4 A;  4IY6 A;  1MDP 1;  1B51 A;  2XWI A;  4HTG A;  5I2K A;  1IIW A;  5FHO A;  3GBA A;  4PFW A;  5AA2 A;  3TTL A;  2Q89 A;  3T9V A;  2OLB A;  1LB8 A;  4NWD A;  2XX9 A;  2XA5 A;  3Q28 A;  2V3Q A;  4ECF A;  4H46 A;  2X7Q A;  3L6G A;  3P7I A;  4NF4 A;  3C35 A;  4ELO A;  1VFD A;  5AA3 A;  4OFO A;  3IOU A;  4ZEF A;  4OMB A;  4LN5 A;  2I4C A;  2V4C A;  3LUZ A;  2Y84 A;  4GX3 A;  1PBP A;  2B3B A;  2O69 A;  1XHY A;  4JXI A;  5J1D A;  4EQ9 A;  1NNK A;  3T93 B;  4XF5 A;  1QKB A;  2W7Y A;  2OK2 A;  3TCF A;  1NV1 A;  4KI0 E;  4ISU A;  4O8M A;  1FQF A;  3EHT A;  4NN3 A;  4KHZ E;  4OEN A;  4N6P A;  1IXI A;  1N3X A;  3FXB A;  1FTL A;  4RK2 A;  3B6Q A;  1LST A;  1YXI A;  3H6V A;  4GWX A;  4ZEC A;  4PFY A;  4IO5 A;  3D4G A;  4YKJ A;  1NMU A;  5I2N B;  4LZ5 A;  4JWX A;  4TLM B;  3RPL A;  3ZSF A;  4DCY A;  4MNP A;  1FPD A;  1TWY A;  4GWZ A;  4FEC A;  3E13 X;  3K6X A;  1MY0 A;  1SVX B;  3U94 A;  1Q9D A;  4QBA A;  1TFD A;  4FJP A;  5DTB A;  4H5F A;  2X26 A;  3HCQ A;  1NV5 A;  4POX A;  4OQO A;  4PFB A;  3TKD A;  1B2H A;  3K4U A;  4OAN A;  1Q35 A;  3BFT A;  5I56 B;  1D9Y A;  4F18 A;  3W9V A;  4GWO A;  2ABH A;  3O2A A;  4G8M A;  3LSW A;  4LUB A;  5FHN A;  3T9X B;  1RDZ A;  1SBP A;  1NNT A;  4NAP A;  3VLU A;  4M4G A;  5KDT A;  1AH5 A;  3RY3 A;  1KA0 A;  1R9Q A;  4PFI A;  2Y7I A;  2Z23 A;  4M1V A;  5JEI A;  1DTG A;  3MVZ A;  4N17 A;  2DP8 A;  1RDY A;  4UA8 A;  1Z7M E;  3KFM A;  2WKY A;  5TPA B;  1MPC A;  1MQG A;  4YIC A;  4MX6 A;  3IO6 A;  3TDJ A;  2QS2 A;  3VFJ A;  4LVQ A;  2Q8J A;  3CVG A;  3UP9 A;  4ZE9 A;  5I57 B;  4OEU A;  4ELP A;  3S2V A;  1MY1 A;  3OSQ A;  4R9F A;  3MZ9 A;  1MH4 A;  5EQ9 A;  1JEV A;  4NQ8 A;  4GWW A;  1OVT A;  4P47 A;  1QJM A;  1YPN A;  2B3F A;  2O1M A;  4PET A;  4EXL A;  3D1R A;  4DI4 B;  1MM7 A;  2XXW A;  4OA4 A;  1N04 A;  4OWD A;  1I6A A;  4HW8 A;  2DE3 A;  1EH3 A;  1I6Q A;  2ESN A;  2VP1 A;  1VE4 A;  3VVF A;  3IB2 A;  4GXS B;  3VXC A;  4MCO A;  3MZ1 A;  3OSR A;  3KJT A;  3QXM A;  1PB7 A;  3HV1 A;  4JWO A;  3MVX A;  4MHF A;  4XKR A;  4PQJ A;  1RKM A;  4R72 A;  2HHM A;  2R8T A;  1P99 A;  3UGW A;  1QGX A;  3PMW A;  1MH3 A;  4OFJ A;  2HFB A;  4N6D A;  3H7M A;  1QUL A;  4GXA A;  1XC1 A;  1S50 A;  4GWU A;  3PMV A;  3K0V A;  1AL3 A;  1CB6 A;  3DEL B;  4EUO A;  3V5A A;  3N5L A;  5EYH A;  4GOT A;  3GLB A;  3EHS A;  2UYE A;  4YKK A;  5CI5 A;  5IKB A;  1JW5 A;  4BDO A;  1JW1 A;  4ZZA A;  1O7T A;  2OWZ A;  3VLV A;  3PGF A;  2XXP A;  3BBR A;  5LOM A;  4F3B A;  5I56 A;  2Z8D A;  3MAM A;  4JDF A;  3MP8 A;  1LFH A;  3NOH A;  5DT6 A;  3G3I A;  4HXV A;  5F24 A;  1JVY A;  4RA1 A;  3HN0 A;  2B4M A;  1NV3 A;  1LGB C;  1MY2 A;  2HEU A;  1NV7 A;  3LUY A;  2UVI A;  3KJ7 A;  2VHA A;  2ANJ A;  3TFL A;  3E9X A;  1BK4 A;  2QL3 A;  4ZZE A;  3I3V A;  1FJ9 A;  4HCY A;  1II5 A;  1MPD A;  4OHN A;  4P56 A;  4AS5 A;  4QFL A;  4ND9 A;  2PX1 A;  3UOR A;  3M3L A;  3G3G A;  3QSL A;  1FPE A;  3M3F A;  5TPA A;  5ITP A;  3QK6 A;  3FVG A;  1SW5 A;  3PUV E;  4PGP A;  1B5I A;  5ET8 A;  1D3K A;  4EQB A;  3FXR A;  4XKN A;  1SW1 A;  1ATG A;  1FPI A;  5AA2 B;  3TCG A;  4DI3 D;  1FQD A;  3RN8 A;  2VOZ A;  1LEV A;  1UTB A;  1URG A;  4P0G A;  2QS1 A;  2A5S A;  5DVF A;  3O9P A;  3DP6 A;  1K9Z A;  3FJG A;  3SEV A;  3FV1 A;  1NI9 A;  2IEE A;  4NF4 B;  5EHM A;  4DIG A;  4HE1 A;  4RPO A;  2P2A A;  4GQO A;  2ZXT A;  1OLC A;  4PBQ A;  1PB8 A;  1MRP A;  5B7D A;  1FQB A;  1DMB A;  2KLF A;  1TT1 A;  1MPB A;  3DP8 A;  3N6T A;  3IOR A;  2F3D A;  1O63 A;  1NNF A;  3KOS A;  5EYG A;  5JTY B;  3FJM A;  1BTJ A;  3T9H B;  1EU8 A;  1NH8 A;  3Q27 A;  2A5T A;  2Z22 A;  3ILU B;  4PDD A;  4P1E A;  4Q5T A;  5A5L A;  5ELV A;  1MQH A;  1A8E A;  1D4N A;  1MXU A;  2R9J A;  4QSC A;  1ZU0 A;  1B05 A;  3Q25 A;  2F7C A;  4E0W A;  4HE0 A;  1FTM A;  4XIG Q;  4ELQ A;  1B46 A;  5H8H B;  3L6H A;  1OMP A;  1FTK A;  1RYO A;  4G2Z A;  1YZ0 A;  4OXV A;  2Y5K A;  3RPL B;  4H45 A;  4XTC Q;  4MMP A;  1SI0 A;  3O6H A;  1ANF A;  4HS7 A;  1UQW A;  3MVY A;  2FNC A;  3IL1 B;  4G77 A;  4YMA A;  2DSF A;  5HBC A;  3RPW A;  4JSO A;  4QXD A;  1JET A;  1I6B A;  2I49 A;  4IO4 A;  1N7X A;  1XOC A;  4F1U A;  1FCK A;  4GWS A;  3W9W A;  1MXZ A;  1SYI A;  2O6A A;  1JEU A;  4Z0I A;  1YTV A;  1LAG E;  4P8B A;  3T96 B;  3ISP A;  2QVR A;  5CBS A;  1LBC A;  3H3G A;  1F9B A;  2V3T A;  3LSX A;  4YB6 A;  1NKX A;  4QFP A;  1WVJ A;  1Y3P A;  2D5W A;  1B4H A;  1EYI A;  1LCT A;  1ZLQ A;  2KR0 A;  2DDK A;  5L9M A;  5KDT B;  4R6H A;  1MQJ A;  4GFR A;  2O7U A;  4OVP A;  1PBQ A;  2O68 A;  2WX9 A;  4QFO A;  1A8F A;  1IZ1 A;  3O66 A;  3AXF A;  4AQ4 A;  1T0K A;  2I0C A;  1LBZ A;  3CFX A;  2ZNU A;  2B65 A;  4G68 A;  2HAU A;  3IOT A;  4U4S A;  3SEU A;  4U1O A;  5L9S A;  4R2F A;  4KD5 A;  3KZG A;  5AA2 D;  3PUX E;  4HE2 A;  2V3U A;  4PFT A;  3O28 A;  4IO2 A;  1AWB A;  1MM6 A;  4WEP A;  3FUZ A;  4GF8 A;  2XXU A;  1A54 A;  3N6U A;  1TFA A;  3S9L C;  3TMG A;  4FAJ A;  1JQF A;  1Y4C A;  3OO7 A;  1FPJ A;  1R1N A;  3LC8 A;  3RLF E;  2ZZX A;  3H6W A;  3PPP A;  4XKP A;  4ZE8 A;  4DE8 A;  3IJO B;  4OTE A;  3KC0 A;  1USY H;  3O97 A;  2DXY A;  3E4R A;  5IZ3 A;  2XD2 A;  3GBB A;  1WOD A;  2HQ0 A;  2OWS A;  1QKA A;  2QS4 A;  3FJ7 A;  4PAF A;  2DWA A;  2ZZV A;  3DM0 A;  4GL8 A;  4X1D A;  1EYJ A;  2RCB A;  5IZZ A;  1N7W A;  3THI A;  5JTY A;  2P1S A;  3EPE A;  4X9T A;  4GBW A;  1LBB A;  3WAF A;  4FAT A;  3A09 A;  5ISU A;  3IJX B;  1POY 1;  3PPN A;  4MLV A;  3B50 A;  4YU0 A;  2RC7 A;  1MXY A;  4ZEB A;  3C31 A;  4GRK A;  1ZTY A;  4XEQ A;  3H4Z A;  3PPO A;  2CZK A;  1MY3 A;  5KCJ A;  4BDN A;  4N8G A;  5H8H A;  1HSJ A;  1EZP A;  4NF6 A;  2QPQ A;  1Y20 A;  3T1B A;  4F19 A;  1JNF A;  1FPL A;  1NUW A;  1QVS A;  2PFZ A;  4THI A;  3SZP A;  1Y1Z A;  2H5Y A;  1B7H A;  4RY1 A;  1IME A;  1ZBM A;  2I3W A;  1H3D A;  1P1O A;  5I7I A;  1NNP A;  2V84 A;  3MPK A;  4X04 A;  4H67 A;  3SEY A;  3V83 A;  1NV2 A;  3MUQ A;  3OEN A;  3PD8 A;  3OXN A;  3TTR A;  3ZKK A;  3KBZ A;  2AYS A;  1YYZ A;  4NF0 A;  2OJT A;  3K6W A;  4OVJ A;  1H44 A;  1DK4 A;  1INP A;  1LBY A;  1OIB A;  2DVC A;  2HXW A;  2YPN A;  2ZYK A;  4NE4 A;  1M5E A;  2CEY A;  4KCD A;  2NVU B;  1FRP A;  2AIX A;  4PAI A;  3OO9 A;  2M8C A;  2O7I A;  1XT8 A;  3FVK A;  1D9V A;  3K1P A;  4YB5 A;  5A5X B;  4ESW A;  1IMA A;  2DXR A;  4EQ7 A;  2NXO A;  3KG2 A;  3TQL A;  3FVO A;  4FEB A;  4Q30 B;  2FIX A;  5KZT A;  2PVU A;  1GGG A;  1K9Y A;  1IMF A;  1JVX A;  2ALU A;  4P3L A;  1XVX A;  1NV6 A;  5AA4 A;  4GD5 A;  4POW A;  4RPN A;  4KCC A;  3Q29 A;  5ET5 A;  3OEM A;  4IR8 A;  3ILT B;  3BFU A;  5J16 A;  4PE5 B;  4O3A A;  3FV2 A;  4FOR A;  3TUS A;  4G4P A;  4ELR A;  1PB9 A;  3SKP A;  3FAS A;  1IIT A;  3TPA A;  4MAG A;  2UYF A;  4MEV A;  1B5J A;  1UTB B;  4PE3 A;  4PC9 A;  4U4X A;  3FGS A;  1B32 A;  2XWK A;  3V8X B;  1MXV A;  2H4I A;  2F7B A;  3MC2 A;  2D3I A;  2PFY A;  5H8N A;  4R73 A;  1XS5 A;  2E0S A;  3T9U A;  2FYI A;  3C36 A;  4U1Z A;  1SW2 A;  4I8C A;  5EYF A;  3QUF A;  4BDQ A;  2DOJ A;  4U21 A;  4PDH A;  3OMB A;  3TAJ A;  3H03 A;  4KPT A;  4LZ8 A;  1A7L A;  1HSE A;  3K1N A;  3SDF A;  3U65 A;  4JVD A;  2A5T B;  3FXQ A;  2GRV A;  1NUZ A;  2ZZW A;  3U8Q A;  3KSX A;  3BKI B;  3VVE A;  3PUZ E;  3JV9 A;  3K02 A;  4U23 A;  4GVO A;  1GV8 A;  4LON B;  2DS9 A;  4FBP A;  1Y3Q A;  1Y1M A;  3USD A;  1A55 A;  4F31 B;  2XXQ A;  3H06 B;  2I3V A;  1FPK A;  2XXV A;  4P9K A;  4ZED A;  1XVY A;  4HCW A;  2Q2C A;  1FPF A;  2V93 A;  5HPQ A;  4X1B A;  2XWV A;  1GR2 A;  2BJI A;  1IXC A;  3A29 A;  2OBG A;  5BWJ A;  4F22 A;  3LBS A;  2OCU A;  4RK9 A;  5EQ8 A;  3FZV A;  3S9N C;  1JP4 A;  4PGN A;  3BIG A;  4R6K A;  1A99 A;  2ONK E;  4K3F A;  3MW0 A;  1QUI A;  4H8I A;  2VGQ A;  1JW4 A;  4R6Y A;  3ZKL A;  3IAZ A;  4KQP A;  3UIF A;  3TQW A;  4N4U A;  3TOD A;  1FTA A;  4XFE A;  1FQE A;  4H65 A;  2XWO A;  3KN7 A;  2CZI A;  3QAX A;  3PPR A;  4H5G A;  1AIV A;  1R6Z A;  3U1O A;  1DTZ A;  4RYA A;  5A5X A;  1SQY A;  5CM6 A;  4H6D A;  1EZO A;  3G3H A;  3TTN A;  3QUJ A;  4R9G A;  1FBP A;  4KFQ A;  4EF2 A;  4MBP A;  5IAI A;  2I6E A;  2GHA A;  4NMY A;  3K2D A;  2F3B A;  3G3J A;  5CMK A;  4F3S A;  2DQV A;  2PT1 A;  1CNQ A;  5I5P A;  1FTJ A;  1FQA A;  4I40 A;  1YCJ A;  4GWY A;  5DEX A;  5LTC A;  1FPG A;  2Q74 A;  4G68 B;  2F5X A;  1SI1 A;  3T66 A;  4KXP A;  4H0W A;  4YAH X;  4X8R A;  2F6G A;  2WBD A;  2CMO A;  4LP2 B;  2H9B A;  1FBF A;  3G3F A;  2PCR A;  4RJZ A;  3KBR A;  4XKQ A;  3UA8 A;  3DP4 A;  5EHS A;  1FBC A;  3PUW E;  4Z7E A;  2WYP A;  4PFR A;  1QUK A;  3CG3 A;  4F2Q A;  2XXR A;  4ONY A;  2QJE A;  3UK4 A;  4PP0 A;  1NUX A;  1P1W A;  4PF8 A;  3RT6 B;  4F39 A;  1XI6 A;  1LLS A;  4U22 A;  1MY4 A;  1LAH E;  4AB6 A;  2PBW A;  5DYH A;  5IZ3 B;  2H25 A;  2QMX A;  2Q88 A;  3G7W A;  4MIJ A;  3IB1 A;  1FBH A;  2AL4 A;  4ZEK A;  3HO7 A;  1VSO A;  4IO7 A; 
#chains in the Genus database with same CATH homology
 5CC2 A;  3PUY E;  4TOZ A;  1B3F A;  4NED A;  5ICQ A;  4IO6 A;  1IEJ A;  1A40 A;  2Y7W A;  1M5C A;  5CRY A;  1VR5 A;  2R6G E;  2F78 A;  3VV5 A;  4TQU Q;  2QS3 A;  5KCJ B;  3OEL A;  3CSG A;  4NF6 B;  4YZZ A;  5F7V A;  3C4M A;  1B6H A;  4JB7 A;  2Q2A A;  4WED A;  3OEK A;  5ICT A;  2IA4 A;  3DLN A;  2YLN A;  3KGC A;  3SES A;  2DWH A;  2THI A;  4Q0C A;  2HZK A;  2BJJ X;  5CMB A;  5DVI A;  3CFL A;  3S9E A;  3RT8 A;  1H76 A;  4L17 A;  2ZNT A;  5I59 B;  4R74 A;  2XD3 A;  2RC8 A;  1TXF A;  2ONS A;  4LQ5 A;  4OEV A;  3M3K A;  1B7Z A;  2XXT A;  3K01 A;  1Y4T A;  1FQC A;  3PD9 A;  3JZJ A;  5K2X A;  2QSX A;  3SEW A;  4QFK A;  1M5B A;  4ZEI A;  4FIM A;  4QFN A;  3OOA A;  4C0R A;  3E3K A;  3RNN A;  4DLD A;  3KN3 A;  3A3C A;  4ESX A;  2I48 A;  3CR9 A;  4NF5 A;  2F7A A;  3VXB A;  3U72 A;  3K6U A;  3VE1 B;  5M2V A;  5AA4 B;  4QRZ A;  3V89 B;  4GL0 A;  2GHB A;  5F1Q A;  2FA7 A;  2ZMB A;  2O51 A;  1GVC A;  1CE2 A;  4Q8R A;  4GLI A;  5H8Q B;  2H98 A;  2NOO A;  1MDQ A;  3GXA A;  3IX1 A;  1MQI A;  1OVB A;  4MFI A;  1B40 A;  4QSD A;  1MXX A;  4DDD A;  1B1X A;  1SYH A;  4F1Y A;  1UIV A;  1B3H A;  3R6U A;  3HPI A;  3S9M C;  1NFT A;  4JBZ A;  3B6T A;  4F3G A;  1BP5 A;  2YJP A;  1SD3 A;  5H8N B;  5TP9 A;  3CI8 A;  1B4Z A;  1BIY A;  2XXY A;  2Z8E A;  2HZL A;  3RUM A;  2XHD A;  3MP6 A;  4NF8 B;  4OES A;  1O64 A;  2RKM A;  2I0B A;  4LZ7 A;  4ZS9 A;  5FHM A;  2ZYM A;  4X48 A;  4EXK A;  5I58 B;  3RGY A;  3WAE A;  1IXG A;  2F35 A;  2AL5 A;  3R7X A;  1ELJ A;  1B5H A;  1N76 A;  2O1L A;  2XXX A;  4G8N A;  2GH9 A;  4JSD A;  4XXU A;  4KYD A;  2F6P A;  5DVJ A;  3IK6 B;  1US5 A;  1Y3N A;  4EF1 A;  3UN6 A;  4F3P A;  5ITO A;  4O3B A;  5HM4 B;  4UAC A;  2X7P A;  2ZYN A;  3KN8 A;  3O6I A;  3O29 A;  1Y9U A;  1N84 A;  2RIN A;  1RYX A;  1SDX A;  5FTI A;  2OZZ A;  1LB9 A;  3OO8 A;  3ODB A;  3I6V A;  5H8S A;  5I59 A;  1S9T A;  3PV0 E;  2F36 A;  1ZMG A;  2G29 A;  3OD7 A;  4F29 A;  4P0I A;  4OER A;  3MWB A;  3RTF B;  2ZNS A;  3SET A;  3MBP A;  3D4C A;  2PYY A;  1LFI A;  4N07 A;  2D21 A;  1KWH A;  1ZIU A;  3TTK A;  2O84 X;  3VDF A;  3PMX A;  1DPP A;  2DWJ A;  2ONR A;  1R9L A;  1IXH A;  4JWY A;  3R26 A;  3LR1 A;  1UTH A;  2REG A;  4BDL A;  4DXC A;  2QMW A;  1B3E A;  4R2B A;  1PC3 A;  1LAX A;  3MP1 A;  1MG1 A;  5DEX B;  5BUU A;  2XXH A;  3KSJ A;  2PT2 A;  1IQ7 A;  4BDR A;  3G3K A;  4I62 A;  3IB0 A;  5H8Q A;  3C34 A;  2G93 A;  1DSN A;  1H43 A;  1B0L A;  1L5T A;  3TTM A;  5H8F A;  3VVD A;  3QYT A;  2E1S A;  1IUD A;  4IGR A;  3TCH A;  3PPQ A;  3TEL A;  4EDP A;  2UVJ A;  2LAO A;  4YMB A;  1J1N A;  3CFZ A;  1B3L A;  3EF7 A;  4BDM A;  3FVN A;  2NUV A;  3IOV A;  3CSB A;  1LAF E;  3U93 A;  1LFG A;  3RTW B;  4NF8 A;  2XX8 A;  3O6G A;  4C1U A;  5AE4 A;  3K00 A;  1USY E;  4YKP A;  5I58 A;  4IO3 A;  3H6T A;  4O3C A;  2DWI A;  3A3U A;  1URS A;  4DZ1 A;  3GZG A;  3PU5 A;  4MH5 A;  3MZB A;  4H8J A;  2F34 A;  1B9J A;  4PFU A;  2HCA A;  2Q9T A;  3SER A;  2DE4 A;  1B1H A;  3OO6 A;  4QF9 A;  4AB5 A;  5L8D A;  1GTK A;  5FTH A;  2UVH A;  3T22 A;  3N94 A;  1AOV A;  1EZ9 A;  5L9O A;  2PMS A;  2VD2 A;  1OQG A;  4TLL B;  2Z8F A;  5I2N A;  4I9D A;  4GIZ A;  1H45 A;  1M5F A;  4NWC A;  4DCX A;  1B52 A;  2F97 A;  4RXL A;  2REJ A;  1PDA A;  2GFE A;  3H6U A;  2H99 A;  1S7Y A;  4U2R A;  2XXI A;  3S4U A;  3EN3 A;  3C33 A;  4FE8 A;  2OWT A;  3B7D A;  3FD3 A;  3SEX A;  1NL5 A;  1MS7 A;  4NF5 B;  4RNS A;  2RF1 A;  3U92 A;  2XX7 A;  2ZYO A;  3QIM A;  4LQ2 A;  4OFL A;  2QRY A;  1OQH A;  2RC9 A;  2NWJ A;  3M8U A;  3TYH A;  3MQ9 A;  4MLQ A;  2CZL A;  4F2O A;  1Q1K A;  1I69 A;  1MQD A;  2R71 A;  1N0T A;  2F8D A;  4LA9 A;  5CBR A;  4IB2 A;  2VD3 A;  1BLF A;  3LSL A;  5I2K B;  1B7U A;  1QUJ A;  3K1M A;  3TZA A;  3Q26 A;  1URD A;  4YKI A;  5TP9 B;  4I1D A;  1P1Q A;  5I57 A;  4YB7 A;  3MPL A;  3CRB A;  1WDN A;  1LCF A;  3KEI A;  1B0H A;  1YAE A;  4NTL A;  1B58 A;  4MF3 A;  4N13 A;  2Y7P A;  4WKM A;  4FED A;  1Z7N E;  1US4 A;  3ONM A;  5CMM A;  1NH7 A;  4G8H A;  3EHU A;  4KYS A;  4E0X A;  2Y7K A;  1ZJL A;  1MXW A;  3ZS6 A;  1VFE A;  2UXA A;  3LSF B;  4QHQ A;  4OYV A;  4ZDM A;  3TEP A;  3CIJ A;  4KYE A;  4H1X A;  2RCA A;  4WXJ A;  4KR5 A;  3C32 A;  4QSE A;  1M5D A;  4OET A;  3IOW A;  3IR1 A;  3CG1 A;  3HHG A;  2Y7R A;  4OZ9 A;  3I5O A;  3F11 A;  2I4B A;  1P1N A;  1BKA A;  1UIU A;  4C1T A;  1HSL A;  1PEB A;  3JYR A;  2DE2 A;  4DXB A;  2DVZ A;  4BLA A;  1AMF A;  3HHF A;  3MVW A;  1P1U A;  5TU0 A;  1DOT A;  3IO4 A;  3N26 A;  3C9H A;  3MJN A;  2UVG A;  1UTH B;  1FW0 A;  2I58 A;  3FIR A;  3B6W A;  4P11 A;  1B3G A;  4R75 A;  3FAT A;  4IGT A;  5K2Y A;  4G68 C;  1POT A;  1ZKB A;  2V25 A;  3K6V A;  3EQ1 A;  2DYX A;  4DXU A;  5CMC A;  5B70 A;  3ECR A;  3FXU A;  4IY5 A;  2HAV A;  4LAT A;  3W15 C;  2P0S A;  5JK4 A;  1QW0 A;  3KOT A;  1OLA A;  1DPE A;  1N3W A;  5H8F B;  4F1V A;  3VLW A;  3RQT A;  1FTO A;  5I84 A;  3HST A;  5AA1 A;  1SW4 A;  4IY6 A;  1MDP 1;  1B51 A;  4HTG A;  5I2K A;  1IIW A;  5FHO A;  3GBA A;  4PFW A;  5AA2 A;  3TTL A;  2Q89 A;  3T9V A;  2OLB A;  1LB8 A;  4NWD A;  2XX9 A;  3Q28 A;  2V3Q A;  4ECF A;  2X7Q A;  3L6G A;  3P7I A;  4NF4 A;  3C35 A;  4ELO A;  1VFD A;  5AA3 A;  4OFO A;  3IOU A;  4ZEF A;  4OMB A;  2I4C A;  2Y84 A;  1PBP A;  2B3B A;  2O69 A;  1XHY A;  4JXI A;  5J1D A;  4EQ9 A;  1NNK A;  3T93 B;  1QKB A;  2W7Y A;  2OK2 A;  3TCF A;  4KI0 E;  4ISU A;  1FQF A;  3EHT A;  4KHZ E;  4OEN A;  4N6P A;  1IXI A;  1N3X A;  1FTL A;  4RK2 A;  3B6Q A;  1LST A;  3H6V A;  4ZEC A;  4PFY A;  4IO5 A;  3D4G A;  4YKJ A;  1NMU A;  5I2N B;  4LZ5 A;  4JWX A;  4TLM B;  3ZSF A;  4DCY A;  1TWY A;  4FEC A;  3E13 X;  3K6X A;  1MY0 A;  1SVX B;  3U94 A;  1TFD A;  4FJP A;  5DTB A;  4H5F A;  2X26 A;  3HCQ A;  4POX A;  4OQO A;  3TKD A;  1B2H A;  3K4U A;  1Q35 A;  3BFT A;  5I56 B;  1D9Y A;  4F18 A;  3W9V A;  4GWO A;  2ABH A;  3O2A A;  4G8M A;  3LSW A;  4LUB A;  5FHN A;  3T9X B;  1SBP A;  1NNT A;  3VLU A;  4M4G A;  5KDT A;  1AH5 A;  3RY3 A;  1R9Q A;  2Y7I A;  2Z23 A;  4M1V A;  5JEI A;  1DTG A;  3MVZ A;  2DP8 A;  4UA8 A;  1Z7M E;  3KFM A;  2WKY A;  5TPA B;  1MPC A;  1MQG A;  4YIC A;  3IO6 A;  3TDJ A;  2QS2 A;  3VFJ A;  4LVQ A;  2Q8J A;  3CVG A;  3UP9 A;  4ZE9 A;  5I57 B;  4OEU A;  4ELP A;  3S2V A;  1MY1 A;  3OSQ A;  4R9F A;  3MZ9 A;  1MH4 A;  1JEV A;  1OVT A;  1QJM A;  1YPN A;  2B3F A;  2O1M A;  4PET A;  4EXL A;  1MM7 A;  2XXW A;  1N04 A;  4OWD A;  1I6A A;  4HW8 A;  2DE3 A;  1EH3 A;  1I6Q A;  2ESN A;  2VP1 A;  1VE4 A;  3VVF A;  3IB2 A;  4GXS B;  3VXC A;  3MZ1 A;  3OSR A;  3KJT A;  3QXM A;  1PB7 A;  3HV1 A;  4JWO A;  3MVX A;  4XKR A;  4PQJ A;  1RKM A;  4R72 A;  1P99 A;  3UGW A;  3PMW A;  1MH3 A;  4OFJ A;  2HFB A;  3H7M A;  1QUL A;  4GXA A;  1XC1 A;  1S50 A;  3PMV A;  3K0V A;  1AL3 A;  1CB6 A;  3DEL B;  4EUO A;  3V5A A;  3N5L A;  4GOT A;  3GLB A;  3EHS A;  2UYE A;  4YKK A;  5CI5 A;  5IKB A;  1JW5 A;  4BDO A;  1JW1 A;  4ZZA A;  1O7T A;  3VLV A;  3PGF A;  2XXP A;  3BBR A;  5LOM A;  4F3B A;  5I56 A;  2Z8D A;  3MAM A;  4JDF A;  3MP8 A;  1LFH A;  5DT6 A;  3G3I A;  1JVY A;  4RA1 A;  3HN0 A;  1LGB C;  1MY2 A;  2HEU A;  3LUY A;  2UVI A;  3KJ7 A;  2VHA A;  2ANJ A;  3TFL A;  3E9X A;  2QL3 A;  4ZZE A;  3I3V A;  4HCY A;  1II5 A;  1MPD A;  4OHN A;  4QFL A;  4ND9 A;  2PX1 A;  3UOR A;  3M3L A;  3G3G A;  3QSL A;  3M3F A;  5TPA A;  5ITP A;  3QK6 A;  3FVG A;  1SW5 A;  3PUV E;  1B5I A;  1D3K A;  4EQB A;  3FXR A;  4XKN A;  1SW1 A;  1ATG A;  5AA2 B;  3TCG A;  1FQD A;  3RN8 A;  2VOZ A;  1UTB A;  1URG A;  4P0G A;  2QS1 A;  2A5S A;  5DVF A;  3O9P A;  3DP6 A;  3FJG A;  3SEV A;  3FV1 A;  2IEE A;  4NF4 B;  5EHM A;  4DIG A;  4RPO A;  2P2A A;  4GQO A;  2ZXT A;  1OLC A;  1PB8 A;  1MRP A;  5B7D A;  1FQB A;  1DMB A;  2KLF A;  1TT1 A;  1MPB A;  3DP8 A;  3N6T A;  3IOR A;  1O63 A;  1NNF A;  3KOS A;  5JTY B;  3FJM A;  1BTJ A;  3T9H B;  1EU8 A;  1NH8 A;  3Q27 A;  2A5T A;  2Z22 A;  3ILU B;  4Q5T A;  5ELV A;  1MQH A;  1A8E A;  1D4N A;  1MXU A;  2R9J A;  4QSC A;  1ZU0 A;  1B05 A;  3Q25 A;  2F7C A;  4E0W A;  1FTM A;  4XIG Q;  4ELQ A;  1B46 A;  5H8H B;  3L6H A;  1OMP A;  1FTK A;  1RYO A;  4G2Z A;  4OXV A;  4XTC Q;  1SI0 A;  3O6H A;  1ANF A;  4HS7 A;  1UQW A;  3MVY A;  2FNC A;  3IL1 B;  4G77 A;  4YMA A;  2DSF A;  5HBC A;  3RPW A;  4JSO A;  1JET A;  1I6B A;  2I49 A;  4IO4 A;  1N7X A;  1XOC A;  4F1U A;  1FCK A;  3W9W A;  1MXZ A;  1SYI A;  2O6A A;  1JEU A;  4Z0I A;  1YTV A;  1LAG E;  3T96 B;  5CBS A;  1LBC A;  3H3G A;  1F9B A;  2V3T A;  3LSX A;  4YB6 A;  1NKX A;  4QFP A;  1WVJ A;  1Y3P A;  2D5W A;  1B4H A;  1LCT A;  1ZLQ A;  5L9M A;  5KDT B;  4R6H A;  1MQJ A;  4GFR A;  2O7U A;  1PBQ A;  2O68 A;  4QFO A;  1A8F A;  1IZ1 A;  3O66 A;  3AXF A;  4AQ4 A;  1T0K A;  2I0C A;  3CFX A;  2ZNU A;  2B65 A;  4G68 A;  2HAU A;  3IOT A;  4U4S A;  3SEU A;  4U1O A;  5L9S A;  4KD5 A;  4R2F A;  3KZG A;  5AA2 D;  3PUX E;  2V3U A;  4PFT A;  3O28 A;  4IO2 A;  1MM6 A;  4WEP A;  3FUZ A;  4GF8 A;  2XXU A;  1A54 A;  3N6U A;  1TFA A;  3S9L C;  3TMG A;  4FAJ A;  1JQF A;  1Y4C A;  3OO7 A;  1R1N A;  3LC8 A;  3RLF E;  3H6W A;  3PPP A;  4XKP A;  4ZE8 A;  4DE8 A;  3IJO B;  4OTE A;  1USY H;  3O97 A;  2DXY A;  3E4R A;  2XD2 A;  3GBB A;  1WOD A;  2HQ0 A;  2OWS A;  1QKA A;  2QS4 A;  3FJ7 A;  2DWA A;  4GL8 A;  3DM0 A;  4X1D A;  2RCB A;  1N7W A;  3THI A;  5JTY A;  2P1S A;  3EPE A;  4X9T A;  1LBB A;  3WAF A;  4FAT A;  3A09 A;  5ISU A;  3IJX B;  1POY 1;  3PPN A;  4MLV A;  4YU0 A;  2RC7 A;  1MXY A;  4ZEB A;  3C31 A;  4GRK A;  1ZTY A;  3H4Z A;  3PPO A;  1MY3 A;  5KCJ A;  4BDN A;  5H8H A;  1HSJ A;  1EZP A;  4NF6 A;  2QPQ A;  1Y20 A;  4F19 A;  1JNF A;  1QVS A;  4THI A;  1Y1Z A;  2H5Y A;  1B7H A;  4RY1 A;  2I3W A;  1ZBM A;  1H3D A;  1P1O A;  1NNP A;  2V84 A;  3MPK A;  4H67 A;  3SEY A;  3V83 A;  3MUQ A;  3OEN A;  3PD8 A;  3OXN A;  3TTR A;  3ZKK A;  2AYS A;  2OJT A;  3K6W A;  4OVJ A;  1H44 A;  1OIB A;  2DVC A;  2HXW A;  2YPN A;  2ZYK A;  4NE4 A;  1M5E A;  4KCD A;  2NVU B;  2AIX A;  3OO9 A;  2M8C A;  2O7I A;  1XT8 A;  3FVK A;  1D9V A;  3K1P A;  4YB5 A;  5A5X B;  4ESW A;  2DXR A;  4EQ7 A;  2NXO A;  3KG2 A;  3TQL A;  3FVO A;  4FEB A;  4Q30 B;  5KZT A;  2PVU A;  1GGG A;  1JVX A;  2ALU A;  1XVX A;  5AA4 A;  4GD5 A;  4POW A;  4RPN A;  4KCC A;  3Q29 A;  3OEM A;  3ILT B;  3BFU A;  4PE5 B;  4O3A A;  3FV2 A;  4FOR A;  3TUS A;  4G4P A;  4ELR A;  1PB9 A;  3SKP A;  3FAS A;  1IIT A;  3TPA A;  2UYF A;  1B5J A;  1UTB B;  4U4X A;  3FGS A;  1B32 A;  3V8X B;  1MXV A;  2H4I A;  2F7B A;  3MC2 A;  2D3I A;  5H8N A;  4R73 A;  1XS5 A;  2E0S A;  3T9U A;  2FYI A;  3C36 A;  4U1Z A;  1SW2 A;  4I8C A;  5EYF A;  3QUF A;  4BDQ A;  2DOJ A;  4U21 A;  3OMB A;  3TAJ A;  3H03 A;  4KPT A;  3SDF A;  4LZ8 A;  1A7L A;  1HSE A;  3K1N A;  2A5T B;  3FXQ A;  2GRV A;  3U8Q A;  3KSX A;  3BKI B;  3VVE A;  3PUZ E;  3JV9 A;  3K02 A;  4U23 A;  4GVO A;  1GV8 A;  4LON B;  2DS9 A;  1Y3Q A;  1Y1M A;  3USD A;  1A55 A;  4F31 B;  2XXQ A;  3H06 B;  2I3V A;  2XXV A;  4ZED A;  1XVY A;  4HCW A;  2Q2C A;  2V93 A;  5HPQ A;  4X1B A;  1GR2 A;  1IXC A;  2OBG A;  5BWJ A;  4F22 A;  3LBS A;  2OCU A;  4RK9 A;  3FZV A;  3S9N C;  1A99 A;  2ONK E;  4R6K A;  4K3F A;  3MW0 A;  1QUI A;  4H8I A;  2VGQ A;  1JW4 A;  4R6Y A;  3ZKL A;  3IAZ A;  4KQP A;  3UIF A;  3TQW A;  3TOD A;  1FQE A;  4H65 A;  3KN7 A;  3QAX A;  4H5G A;  3PPR A;  1AIV A;  1R6Z A;  3U1O A;  1DTZ A;  4RYA A;  5A5X A;  1SQY A;  5CM6 A;  4H6D A;  1EZO A;  3G3H A;  3TTN A;  3QUJ A;  4R9G A;  4KFQ A;  4EF2 A;  4MBP A;  5IAI A;  2I6E A;  2GHA A;  4NMY A;  3K2D A;  3G3J A;  5CMK A;  4F3S A;  2DQV A;  2PT1 A;  1FTJ A;  1FQA A;  1YCJ A;  5DEX A;  4G68 B;  2F5X A;  1SI1 A;  3T66 A;  4H0W A;  4YAH X;  2F6G A;  2CMO A;  4LP2 B;  2H9B A;  3G3F A;  4RJZ A;  3KBR A;  4XKQ A;  3UA8 A;  3DP4 A;  5EHS A;  3PUW E;  4Z7E A;  1QUK A;  3CG3 A;  4F2Q A;  2XXR A;  4ONY A;  2QJE A;  3UK4 A;  4PP0 A;  1P1W A;  3RT6 B;  4F39 A;  1LLS A;  4U22 A;  1MY4 A;  4AB6 A;  1LAH E;  2PBW A;  5DYH A;  2H25 A;  2QMX A;  2Q88 A;  3G7W A;  3IB1 A;  4ZEK A;  2AL4 A;  3HO7 A;  1VSO A;  4IO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...