3N6TA

Effector binding domain of tsar
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
205
Chain Sequence
GHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the effector binding domain of TsaR
rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 54
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA02
2THIA 3TQLA 3GBAA 1LBCA 3RPWA 5I58A 3Q28A 3IR1A 4GRKA 5KCJB 1H44A 4F31B 1EZ9A 2F7CA 1LCTA 3GBBA 4AB5A 3RLFE 4YMBA 2DE4A 1QULA 1MDP1 2B3FA 1OVBA 4LZ8A 3DP4A 3LC8A 2AYSA 1SVXB 1MXXA 2ABHA 2DSFA 2FA7A 4G68B 4RY1A 1B52A 1QUJA 3ODBA 2ANJA 2W7YA 1SW1A 3ECRA 2DVZA 1QVSA 3EN3A 3FJMA 3HO7A 3FD3A 4OERA 5TPAA 5I56B 1DMBA 1N84A 1A99A 2O68A 2O7IA 4LONB 3CSBA 2Q9TA 2UYEA 2I48A 3CFXA 4H5FA 1AH5A 5B7DA 1H45A 4XKQA 2RINA 4ND9A 3TKDA 1F9BA 4F29A 1Z7ME 4M1VA 1JW4A 1H76A 3MW0A 2Y7RA 4Q8RA 1LFIA 3K4UA 1URDA 1I6AA 2NVUB 3K1PA 2F97A 3R7XA 3U94A 1NNFA 1QKBA 2XX8A 5IKBA 3CG3A 3TCGA 1AMFA 2D5WA 1OQHA 2Q89A 4OTEA 4R6YA 1FTLA 4Z0IA 3OSRA 1DSNA 2E1SA 1MH4A 1OLAA 2Q88A 2UXAA 2X7PA 3MQ9A 4QRZA 3SERA 5CI5A 4EQ7A 3MAMA 2X26A 5AA2B 3C33A 4XKRA 1SW4A 5JTYB 1CE2A 3V83A 2AL4A 2I4BA 3K02A 4HS7A 1BKAA 5CMMA 5K2XA 4QFOA 4I1DA 3IO4A 3K2DA 3HN0A 4OZ9A 4ELRA 1POTA 1XT8A 2F34A 4YICA 3SKPA 2O1LA 1IXHA 4EQ9A 3UK4A 4LZ5A 1IEJA 4AQ4A 3C35A 4N13A 4ELOA 3H03A 1OQGA 1MPDA 2I49A 5H8QB 4E0XA 4WEPA 3TODA 3OXNA 3RT8A 4QSEA 3IJXB 4F3GA 4OWDA 1FQBA 3PUVE 1O63A 1ZMGA 1M5EA 2DWHA 4HCYA 4OENA 4H5GA 4OFLA 4ZS9A 1UIUA 5CMKA 5TPAB 3OEMA 2ZYOA 1B7UA 2UYFA 2G29A 4Q30B 2Q2CA 3ZKLA 1NH8A 4ELQA 4F22A 1B46A 4H8JA 2E0SA 3R26A 1HSJA 2V3UA 3O2AA 4HW8A 1J1NA 3VLUA 5AE4A 2UVIA 3OO7A 4PFUA 3RUMA 4X1BA 3O6IA 2ALUA 3I5OA 4FIMA 4G77A 2DWAA 2V3TA 1MQIA 2F7AA 3KEIA 4N6PA 1NFTA 3K0VA 1Y3NA 3S2VA 4NF5A 4IO7A 3DLNA 4RK9A 4IGTA 1FTKA 3N6UA 3U72A 1MM6A 4JSOA 3SEYA 4GD5A 4ZEIA 1AOVA 1N7WA 1SW5A 4DCYA 4JWXA 3JV9A 1ZTYA 2I3WA 4O3BA 2D3IA 4U1ZA 1L5TA 1LLSA 3HHGA 5CMBA 2REJA 1D4NA 3KFMA 3LBSA 3E3KA 3C32A 1WDNA 4NF6B 5ICTA 1MPCA 1YCJA 3TFLA 1FQEA 4R2FA 2H99A 2REGA 3TDJA 1B1HA 5ICQA 1VSOA 3EF7A 3O66A 4LQ5A 1S50A 1N3XA 1N3WA 4TLMB 4XXUA 5DT6A 2ONKE 1BP5A 3TELA 1BIYA 1MG1A 1LCFA 1UIVA 2ZYMA 3CFLA 2VD2A 4NF4B 4U22A 3PGFA 1LFGA 2RC7A 1OLCA 2XXWA 3PU5A 2QS4A 1B4HA 3Q29A 1B9JA 1GR2A 3ONMA 1AIVA 4ISUA 1B3HA 3MVZA 4KYDA 3DP8A 4PQJA 3T66A 3TTMA 4EUOA 2HEUA 3MP1A 3TYHA 2O1MA 3A3CA 4EQBA 3C4MA 4IB2A 2DXRA 2HXWA 4H67A 4DXBA 2PVUA 1DPEA 2QRYA 2Y84A 3Q26A 3H7MA 4GL8A 4IY5A 3RN8A 4G8MA 4BDQA 3BBRA 1SI0A 2XXQA 4X1DA 5AA4A 5JK4A 3G3KA 1IQ7A 4H8IA 1TXFA 2QS3A 4KYSA 2YJPA 2B3BA 1Y4CA 3I3VA 4QSCA 1M5FA 3E9XA 4GFRA 3TMGA 3W9WA 3OOAA 1AL3A 3IOVA 3FVOA 2Q2AA 3OMBA 4MLQA 2RF1A 4GXAA 4OQOA 3JYRA 2F78A 3W9VA 4F1YA 3HCQA 4P0GA 1D9YA 3OO6A 4QSDA 5HBCA 3H4ZA 1LB8A 1R1NA 1POY1 2F5XA 2H9BA 5DVIA 2H98A 4O3CA 1HSEA 5H8QA 1A55A 1OMPA 4RK2A 1US4A 4RA1A 3C9HA 2F6GA 4KD5A 2XD3A 4GQOA 4UACA 3VXCA 5CBSA 3FATA 5I59A 1Y20A 2X7QA 5TP9A 4QFKA 2PT2A 4JBZA 5F7VA 1B4ZA 4ESWA 4F2QA 3QAXA 3S4UA 2XXRA 1IXIA 4R6HA 2I0CA 2VD3A 5TP9B 4LZ7A 3K6WA 3S9MC 2V3QA 2F7BA 4YZZA 3O97A 3MZ1A 4BDRA 3H6WA 4H6DA 4FJPA 2R6GE 1FTOA 3U1OA 1N7XA 1QW0A 2P2AA 3KJTA 2VGQA 1D3KA 3OEKA 4JWYA 4U2RA 4ESXA 3UORA 1HSLA 3CIJA 3CI8A 2PT1A 3PMXA 1PB7A 2V25A 1NH7A 3V5AA 3HHFA 4IO5A 2GHBA 2QMXA 1GTKA 3G7WA 1A8EA 1M5DA 3PPRA 4JSDA 3A3UA 3LSXA 5FTHA 1PC3A 1URGA 4F3PA 4N07A 3KZGA 2QL3A 4R73A 1LB9A 3U8QA 5CMCA 3H6UA 2QS2A 3SEWA 2D21A 1UTBA 1PB8A 1GGGA 3FASA 3PUWE 2DE2A 1B32A 3OO9A 5EHMA 5H8SA 4DLDA 1EU8A 1SW2A 3MZ9A 4RJZA 1Y3PA 1RYOA 1MXZA 3VLVA 3ZS6A 1US5A 3M3KA 5H8HA 4ZEBA 4EXLA 5H8FA 5I57B 3VXBA 2YLNA 3Q25A 3MVYA 3T9UA 4E0WA 3RT6B 5I2NB 5H8HB 3S9LC 4I8CA 4JXIA 3VVFA 4HTGA 4EXKA 5AA2D 4YKKA 3KN8A 2NUVA 3IB2A 3TCHA 4OMBA 4DCXA 2UVJA 2ZYNA 1B3LA 1Q35A 1UTBB 2F35A 3B6QA 3GXAA 3KOTA 1MXVA 4GLIA 4PFWA 3JZJA 3LUYA 4NF4A 2P1SA 3LSLA 1NNKA 2FNCA 2Y7PA 3K1NA 2O6AA 1R6ZA 3O28A 1PDAA 3OD7A 1LGBC 3TTRA 3C36A 3CSGA 4TOZA 3TZAA 2G93A 1A8FA 3BFUA 1LAFE 3KG2A 5DTBA 1SQYA 1DTGA 2XXYA 3C31A 4M4GA 5BWJA 5KDTB 2QSXA 1M5CA 3N5LA 2GRVA 3MVXA 1PBPA 3KOSA 4QF9A 3K6XA 5AA2A 3G3GA 2ONSA 4JDFA 3UP9A 1CB6A 2I58A 1JW1A 4GOTA 3SEUA 3FIRA 3FVKA 1B0LA 2BJJX 4P0IA 3H3GA 1SDXA 1N04A 3V8XB 3PMVA 1ZU0A 1R9QA 5JTYA 1ANFA 2XXXA 4R74A 3FVNA 3H6TA 3PPOA 4POXA 3L6GA 4H65A 3HSTA 4FEDA 2XX7A 3PD9A 4YKIA 3T22A 2I4CA 2XXPA 4IGRA 4KR5A 1B05A 2XD2A 3MWBA 3K1MA 4NMYA 2HQ0A 4NF6A 4KCDA 4TQUQ 1P1OA 1DOTA 4OESA 4BLAA 4NF8A 2RC9A 2VP1A 1FTJA 1EH3A 2RCBA 2Y7WA 4X48A 4YKPA 3V89B 4GIZA 1NMUA 3RNNA 2DS9A 1YTVA 3WAFA 1N0TA 2VOZA 1I6BA 3O6HA 4G68C 5I56A 1I6QA 3KSXA 1B5JA 4WEDA 4DXCA 3DP6A 1FQAA 1MDQA 3QXMA 3K6VA 3H06B 2DE3A 1B3GA 4Q0CA 4RXLA 1LBBA 3ZKKA 1YAEA 3FV1A 4LP2B 3IX1A 2QS1A 5I58B 3CFZA 5HM4B 3BFTA 4OHNA 4THIA 4FATA 5ITPA 3MVWA 4OVJA 5FTIA 3IO6A 2Y7KA 2I6EA 2QPQA 4XKPA 3UN6A 4R9GA 1JVYA 3MZBA 3IOWA 4ZEDA 1I69A 3QUFA 1MM7A 2OBGA 3HV1A 3M3FA 3I6VA 3O9PA 3VVDA 3G3FA 3RTFB 5LOMA 5DEXA 3L6HA 4MF3A 4BDMA 2O51A 1B3EA 3PPNA 3RTWB 1MXWA 3CVGA 4IO6A 2XXIA 3MPLA 4LVQA 2NWJA 2XXHA 1O64A 4OFOA 1H3DA 1H43A 4BDNA 4F18A 3U93A 4O3AA 3USDA 3S9EA 3PMWA 4IO2A 4PE5B 4QFNA 4EF1A 3IJOB 3VFJA 3DELB 1LAHE 1VR5A 2HCAA 3VLWA 4ONYA 3B6WA 4XIGQ 1VFEA 4KHZE 1USYH 2QMWA 1JVXA 3FUZA 1QKAA 3OELA 3OO8A 4GL0A 2ZYKA 4KFQA 5CRYA 4F3BA 5CC2A 4P11A 5AA1A 2XXUA 4IO3A 4RYAA 4FAJA 5H8FB 1MPBA 4BDOA 5L9MA 1R9LA 4MBPA 2ZNTA 4LUBA 4OEUA 3WAEA 4PFYA 5F1QA 4ECFA 4EDPA 5H8NB 1MXYA 1Q1KA 1VFDA 2HFBA 4FEBA 2XXVA 4H0WA 4JWOA 3SESA 5KCJA 2GHAA 5DVJA 4R72A 2AIXA 4G8NA 3EHTA 4H1XA 2VHAA 3GZGA 5M2VA 1JEVA 2O69A 4KPTA 3IOUA 3LR1A 4OEVA 3G3IA 4R75A 5FHOA 2Z8FA 3T9VA 1ATGA 4OXVA 2OWSA 1MQHA 3K01A 3E4RA 4UA8A 5FHNA 2F6PA 1MY1A 4DE8A 4C1TA 3TTLA 5L9SA 3LSFB 3EHSA 3CRBA 3LSWA 4L17A 1ZKBA 3THIA 1JQFA 2DYXA 2RC8A 3QK6A 4WXJA 1A40A 1XHYA 1B51A 1TFDA 2NOOA 2OJTA 3UGWA 3MJNA 4G68A 4AB6A 1N76A 5B70A 4NTLA 1P99A 2ESNA 4GWOA 4NWCA 2XXTA 3B7DA 1MY3A 2DXYA 4JB7A 3TAJA 1B58A 1B5HA 1FCKA 1MS7A 1PEBA 3FGSA 1SBPA 3A09A 4U4XA 3VDFA 2PX1A 3BKIB 5BUUA 4ZZAA 2H25A 2Z22A 4WKMA 2XX9A 4OETA 3FVGA 5KZTA 4XKNA 1IITA 4GXSB 1MQJA 2R71A 3IOTA 3KBRA 1S7YA 4LQ2A 2OCUA 2CMOA 2ZXTA 3MP8A 1FQCA 2HZKA 3W15C 1B2HA 2Y7IA 3O29A 1MH3A 4ZE8A 1EZOA 2A5TB 1IXCA 3C34A 3HPIA 1JNFA 2HAVA 4POWA 1SYHA 3ILTB 4FECA 3QUJA 3R6UA 4QFPA 4RNSA 1FQFA 1GV8A 1MXUA 1UQWA 2ZMBA 2HAUA 4GF8A 4NWDA 4U4SA 3D4GA 3SDFA 3G3JA 4C0RA 3G3HA 3KGCA 1Y9UA 2XHDA 1TT1A 2I3VA 3FV2A 4YMAA 4IO4A 4YB7A 1IUDA 3IB1A 4DDDA 2KLFA 1XVXA 1B6HA 4FORA 1B7ZA 2YPNA 5IAIA 3AXFA 4R6KA 5TU0A 2CZLA 4NF5B 1ZBMA 2Z23A 3SETA 5AA4B 1ZLQA 3VVEA 2LAOA 1B5IA 1QJMA 1JETA 2OK2A 3CG1A 4DIGA 4NEDA 5EHSA 1ZJLA 3K6UA 3QSLA 4MFIA 5H8NA 3Q27A 1BLFA 4FE8A 1P1QA 4OFJA 4RPOA 3UA8A 1QUIA 1Y1MA 5I2NA 1OIBA 4U23A 3PPPA 2F36A 4KYEA 1GVCA 4ZEKA 1D9VA 2IA4A 1B0HA 3T9XB 4BDLA 4F1UA 4XTCQ 1YPNA 2UVHA 2A5SA 4U21A 1B40A 2GFEA 3VE1B 4PFTA 3S9NC 1PB9A 4F2OA 3EQ1A 4K3FA 1A7LA 3KN7A 4YKJA 1FTMA 4IY6A 2I0BA 1A54A 3K00A 4KI0E 4I62A 3M3LA 3P7IA 2Q8JA 4LATA 4MH5A 4TLLB 5I2KA 3TTNA 1LAXA 2RKMA 1OVTA 2ONRA 1SD3A 1MQGA 4KQPA 1XS5A 4PETA 1BTJA 1Z7NE 4C1UA 2ZNUA 5DYHA 5JEIA 2ZNSA 1XOCA 4NF8B 1WODA 3FZVA 3PUYE 1P1WA 2DVCA 2OWTA 3VV5A 3IB0A 2H4IA 1TFAA 3OENA 3O6GA 3QYTA 4G2ZA 3T96B 4Z7EA 4ZECA 5DEXB 4R9FA 4F39A 4GVOA 3SEVA 1TWYA 3UIFA 2Z8DA 1KWHA 3N26A 5DVFA 4Q5TA 1URSA 2DQVA 4F3SA 2FYIA 2WKYA 4YB6A 1XC1A 3B6TA 1Y3QA 4ZDMA 2O7UA 2RCAA 3IK6B 4EF2A 4YB5A 5HPQA 4F19A 1NL5A 1RYXA 4MLVA 3MPKA 2PYYA 3TEPA 3FJGA 1SYIA 2GH9A 2PBWA 1MQDA 1MY2A 3IORA 5KDTA 4YU0A 4LA9A 5ITOA 3IAZA 5AA3A 2PMSA 3EHUA 3H6VA 1NKXA 1MY0A 1NNTA 2B65A 4YAHX 1Y4TA 2OLBA 5L8DA 1MY4A 3FXQA 1MRPA 1RKMA 1B1XA 5A5XA 3FXUA 2M8CA 1FQDA 3F11A 3IL1B 2NXOA 2O84X 3PUZE 1ELJA 3DM0A 3TTKA 5J1DA 1DPPA 3ZSFA 4RPNA 3PV0E 4HCWA 3T9HB 1LSTA 1XVYA 4ZEFA 4ZE9A 5A5XB 2OZZA 5ELVA 3GLBA 2R9JA 5FHMA 3TCFA 4G4PA 4NE4A 3D4CA 1EZPA 4G8HA 1ZIUA 2A5TA 1QUKA 3PPQA 5I57A 3CR9A 3N94A 4KCCA 1B3FA 4R2BA 2HZLA 1WVJA 4U1OA 5I84A 3KJ7A 3RGYA 5ISUA 1DTZA 1IXGA 2V84A 4ZZEA 1S9TA 3SEXA 3U92A 3TUSA 1USYE 1UTHB 1B7HA 2H5YA 1JW5A 3FJ7A 2P0SA 1FW0A 1O7TA 4QHQA 4I9DA 1II5A 1LAGE 3TPAA 4DZ1A 1T0KA 1NNPA 3PD8A 3ILUB 2F8DA 3RY3A 4QFLA 2QJEA 2Z8EA 1JEUA 3TQWA 1P1UA 2AL5A 1Y1ZA 4ELPA 4OYVA 3E13X 5K2YA 4F1VA 4PP0A 3FXRA 3MBPA 5EYFA 2IEEA 1P1NA 4X9TA 5CBRA 5L9OA 4DXUA 1PBQA 3RQTA 3T93B 1UTHA 5I59B 3MC2A 1LFHA 1IZ1A 5I2KB 3MP6A 3PUXE 1SI1A 1M5BA 3N6TA 3OSQA 3KSJA 2DWIA 3EPEA 3MUQA 2UVGA 3M8UA 3QIMA 1VE4A 2DWJA 5CM6A 2V93A 2DP8A 1IIWA 2DOJA 3KN3A
chains in the Genus database with same CATH superfamily
2THIA 3GBAA 4GRKA 2F7CA 4AB5A 1NV4A 2B3FA 4LZ8A 4G68B 2DSFA 1QUJA 4OERA 3EN3A 3FJMA 3HO7A 1N84A 2O7IA 2Q9TA 2UYEA 3CFXA 2RINA 4NQ8A 3TKDA 4F29A 4M1VA 4Q8RA 2Y7RA 3TCGA 2Q88A 2X7PA 1SW4A 4HS7A 1BKAA 4QFOA 4JVIA 3IO4A 3HN0A 4P1LA 4YICA 2O1LA 4I3YA 3C35A 4N13A 1NV7A 2I49A 3EKIA 3RT8A 4QSEA 4F3GA 4OWDA 3PUVE 1O63A 1M5EA 4OENA 5CMKA 2Q2CA 1NH8A 4H8JA 4N6DA 3O2AA 4HW8A 5AE4A 2Q8MA 2DWAA 2V3TA 3FBPA 3KEIA 4GWYA 4MX6A 1NFTA 3K0VA 3S2VA 3N6UA 4JSOA 4O8MA 4XFEA 4N4UA 1SW5A 4U1ZA 1L5TA 4N15A 3HHGA 3KFMA 3LBSA 5ICTA 1MPCA 2REGA 2FBPA 3GYYA 2QFLA 2FIEA 3CFLA 4U22A 2XXWA 2QS4A 3T1BA 1GR2A 3DP8A 2HEUA 2O1MA 3C4MA 2DXRA 1DPEA 3LV0A 1SI0A 5JK4A 4H8IA 4MMPA 4QSCA 3I3VA 1M5FA 4GFRA 3W9WA 2L5VA 3FVOA 1LBXA 3E78A 4QSDA 5EQ8A 2F5XA 2H98A 5DW8A 4RA1A 2X7QA 5TP9A 2PT2A 3S4UA 2XXRA 2VD3A 4JVCA 5TP9B 2V3QA 1JP4A 4N6KA 2Q74A 3H6WA 4H6DA 4FJPA 1FTOA 3U1OA 4U2RA 3CI8A 2XWVA 3HHFA 1M5DA 4JSDA 3LSXA 1EYIA 2P3NA 5H8HA 5H8FA 4PF6A 3VXBA 5I2NB 5H8HB 3VVFA 4XKRA 3B6QA 1Q35A 1UTBB 3KOTA 3LUYA 2P1SA 3LSLA 1NNKA 1PDAA 4PDHA 3C36A 3TZAA 3BFUA 3KG2A 5EYGA 2XXYA 4QF9A 3K6XA 4GOTA 3SEUA 3FVKA 1B0LA 4P0IA 1ZU0A 4R74A 3FVNA 4POXA 3PD9A 4F18A 4IGRA 2XD2A 4KCDA 4OESA 1FPGA 4NF8A 2RC9A 4BLAA 2Y7WA 1K9ZA 1YTVA 1FPLA 1I6QA 4WEDA 1B5JA 3H06B 1B3GA 3ZKKA 1YAEA 3FV1A 3IX1A 1QGXA 4FATA 5FTIA 2Y7KA 4PBQA 3I6VA 3O9PA 3RTFB 4IO6A 3MPLA 1FPJA 4OFOA 1H3DA 4IO2A 5IGAA 1LAHE 3B6WA 5CRYA 4KFQA 1QKAA 5ET7A 3OO8A 2P3VA 2XXUA 4PFBA 4PGNA 4ECFA 1RDZA 2GHAA 3EHTA 5M2VA 1JEVA 3IOUA 4OEVA 3K01A 5FHNA 1MY1A 4C1TA 3LSFB 3EHSA 3LSWA 4OANA 1JQFA 4G68A 2CZIA 4AB6A 2ESNA 2DXYA 3TAJA 1B58A 2XWIA 1SBPA 2PX1A 2XWOA 2XX9A 4OETA 4LQ2A 1IMDA 4LN5A 1FQCA 2Y7IA 4ZE8A 1IXCA 3HPIA 1JNFA 2HAVA 4GWUA 1UQWA 3D4GA 3SDFA 1Y9UA 2I3VA 3FV2A 1RDYA 1IUDA 5I7IA 1B7ZA 2Z23A 5AA4B 3SETA 1ZLQA 2OK2A 4PCDA 1ZJLA 4MFIA 3Q27A 1BLFA 4FE8A 1P1QA 4OFJA 1QUIA 1Y1MA 4H46A 3BIGA 4XTCQ 1PB9A 3EQ1A 4I40A 1A54A 3M3LA 4TLLB 4NF8B 2DVCA 2OWTA 3VV5A 3IB0A 2H4IA 4Z7EA 3OENA 3T96B 4ZECA 5DEXB 1TWYA 2CEXA 1IMFA 3N26A 3B6TA 1Y3QA 2O7UA 5HPQA 1NL5A 4MLVA 1DCUA 3TEPA 3FJGA 1SYIA 1D9QA 1MY2A 5AA3A 4YAHX 4NG7A 1MY0A 2OLBA 4N91A 3FXQA 3FXUA 1FQDA 3F11A 5J1DA 4RPNA 1LSTA 1XVYA 3GLBA 2QVVA 1ZIUA 3A29A 5I57A 3T0JA 4U1OA 2HZLA 4GWZA 3RGYA 1IXGA 1USYE 2H5YA 5ESYA 1JW5A 2QJEA 1JEUA 1P1UA 4OVPA 4ELPA 4F1VA 4X9TA 1PBQA 1IMEA 2WEFA 5I2KB 2DWIA 3EPEA 3QIMA 1IIWA 3TQLA 3RPWA 5I58A 3Q28A 1LCTA 2AYSA 1MXXA 1B52A 5TPAA 1FJ6A 1FBGA 3FD3A 1A99A 3CSBA 5B7DA 3IFCA 1I6AA 3K1PA 5IKBA 1NNFA 1QKBA 1AMFA 2D5WA 4R6YA 4Z0IA 4OTEA 1FTLA 3OSRA 1DSNA 1LBZA 2X26A 5JTYB 1CE2A 1XT8A 2F34A 1IEJA 4ELOA 1OQGA 4GX4A 5IZ3B 1FQBA 1EYJA 4OFLA 4MIJA 1UIUA 4OVSA 1B7UA 1B46A 3OO7A 4PFUA 4PF8A 2ALUA 3I5OA 4NF5A 5ET8A 4IO7A 2GQ1A 4ZEIA 4JWXA 1NV0A 1ZTYA 1LLSA 4KXPA 5CMBA 5ICQA 1YCJA 4R2FA 1VSOA 4P1EA 4XXUA 1BIYA 1MG1A 1LCFA 2ZYMA 2VD2A 3PU5A 1LFGA 3Q29A 1AIVA 4PQJA 2ZZVA 3TTMA 3A3CA 3Q26A 3H7MA 4IY5A 4G8MA 3BBRA 1IQ7A 1TXFA 2QS3A 2Y5KA 1Y4CA 3OOAA 3IOVA 3HCQA 5HBCA 3OO6A 1LB8A 1R1NA 4O3CA 1HSEA 1OMPA 1US4A 5CBSA 1Y20A 1FBDA 5LTCA 4JBZA 1B4ZA 3QAXA 1IXIA 3RPLB 3K6WA 4YZZA 3O97A 2P2AA 3KJTA 4PAIA 4ESXA 2PT1A 1PC3A 3KZGA 2QL3A 4R73A 1LB9A 3U8QA 5CMCA 3H6UA 5F7VA 1UTBA 1PB8A 2D21A 4DLDA 1B32A 3OO9A 1Y3PA 1RYOA 3VLVA 3ZS6A 4MNPA 4ZEBA 2YLNA 3MVYA 3RT6B 4JXIA 1NV6A 5AA2D 2Y5LA 2NUVA 3IB2A 3TCHA 4OMBA 3GXAA 5IZ1A 2FHYA 4GLIA 5IZ3A 4AS5A 2XA5A 4NGUA 2FNCA 3K1NA 5IZZA 2O6AA 3O28A 5LDZA 3TTRA 3CSGA 2G93A 1SQYA 5BWJA 1M5CA 3KOSA 2ONSA 4JDFA 3UP9A 3H3GA 1ANFA 1YXIA 5DVFA 5I59B 3T22A 3HSTA 4DI4B 4F3BA 4YKIA 2I4CA 2XXPA 4NMYA 4NF6A 1P1OA 1DOTA 2VP1A 4YKPA 4X48A 4GIZA 1N0TA 2VOZA 1I6BA 3O6HA 5I56A 3KSXA 1MDQA 1NUXA 4RXLA 2CEYA 2WBBA 4THIA 4N8GA 5ITPA 4OVJA 3UN6A 1JVYA 3IOWA 3QUFA 2OBGA 3HV1A 3M3FA 3VVDA 4MF3A 3RTWB 2XXIA 4LVQA 2WX9A 1G0HA 1H43A 3U93A 4O3AA 4PE5B 4QFNA 4NF0A 3VFJA 3DELB 2HCAA 4XIGQ 4KHZE 2QMWA 4UABA 5AA1A 4FAJA 4P8BA 1R9LA 2ZNTA 4LUBA 5F1QA 4EDPA 2JJKA 2HFBA 3IFAA 5KCJA 1FJ9A 2AIXA 4H1XA 4R72A 4KPTA 3LR1A 3T9VA 1ATGA 2OWSA 5F24A 5L9SA 3CRBA 1ZKBA 2RC8A 4WXJA 2OJTA 2NOOA 1N76A 4NTLA 4GWOA 1B5HA 1FCKA 1XI6A 1MS7A 3FGSA 3A09A 3BKIB 5BUUA 4ZZAA 2H25A 4GXSB 1MQJA 3IOTA 2ZXTA 3MP8A 2HZKA 3W15C 3O29A 2A5TB 4POWA 3ILTB 1GV8A 3QUJA 3R6UA 1FQFA 1TT1A 5FBPA 5J16A 5IAIA 1B6HA 1XVXA 2CZLA 4NF5B 2FIXA 1NI9A 1JETA 3CG1A 4QBAA 4DIGA 5EHSA 3K6UA 3UA8A 4RPOA 4PBHA 5I2NA 1OIBA 3PPPA 4ZEKA 2IA4A 5ET6A 1G0IA 3KBZA 3T9XB 4BDLA 1YPNA 2UVHA 2A5SA 3VE1B 3S9NC 4K3FA 4YKJA 5EQ7A 1FTMA 1EYKA 5I2KA 1OVTA 4PETA 1Z7NE 2ZNUA 5JEIA 1XOCA 1WODA 3FZVA 1P1WA 4R9FA 4F39A 4F3SA 2FYIA 4MNIA 4EF2A 3IK6B 2PYYA 2GH9A 5KDTA 4LA9A 5ITOA 3IAZA 1LBVA 2VPOA 3EHUA 1Y4TA 1MRPA 2M8CA 3IL1B 4P47A 1DPPA 3ZSFA 2B4MA 4HCWA 5A5XB 2OZZA 1VDWA 3TCFA 4G4PA 4G8HA 2A5TA 1QUKA 3N94A 1B3FA 4MCOA 3KJ7A 5ISUA 1DTZA 2V84A 3TUSA 4HE1A 4NN3A 1FW0A 1O7TA 4QHQA 4I9DA 1II5A 1LAGE 4GWWA 3RY3A 3QMFA 2Z8EA 4OYVA 4PP0A 4GBVA 5L9OA 3MC2A 3U65A 4MEVA 1M5BA 3OSQA 5CM6A 2DP8A 2DOJA 4KQPA 3KN3A 1LBCA 3MYUA 3IR1A 4HE0A 3RLFE 4YMBA 1QULA 1MDP1 3LC8A 1SVXB 2ABHA 4RY1A 3ODBA 2ANJA 2W7YA 3B8BA 3ECRA 2DVZA 2O68A 4H5FA 4XKQA 4ND9A 1Z7ME 1H76A 4P56A 3K4UA 1URDA 2NVUB 3ISPA 1NV2A 2F97A 3R7XA 3U94A 3CG3A 2Q89A 2E1SA 2UXAA 4QRZA 3MQ9A 3S9EA 5CI5A 3MAMA 3V83A 2I4BA 5K2XA 5CMMA 4I1DA 4OZ9A 1POTA 3SKPA 4EQ9A 3UK4A 4AQ4A 1MPDA 4E0XA 4WEPA 2ZZWA 3IJXB 4HCYA 2DWHA 2PFZA 5TPAB 3ZKLA 4Q30B 2G29A 4ELQA 3R26A 2V3UA 4IGTA 1MM6A 3SEYA 1AOVA 2KR0A 1N7WA 4DCYA 4O3BA 2REJA 1D4NA 3E3KA 3TFLA 3EF7A 4LQ5A 1N3XA 2VPNA 4TLMB 2ONKE 4JVDA 4NF4B 3PGFA 1OLCA 1B4HA 1B9JA 3ONMA 1B3HA 3MVZA 4KYDA 4N17A 4EUOA 3TYHA 4EQBA 4IB2A 2HXWA 4H67A 2PVUA 4BDQA 4GL8A 3RN8A 2XXQA 4X1DA 4GWXA 2B3BA 3E9XA 3OMBA 5EQ9A 4MLQA 2RF1A 3W9VA 2F78A 4P0GA 1D9YA 3H4ZA 5DVIA 1INPA 2XD3A 4GQOA 4UACA 2HXRA 4QFKA 4ESWA 4F2QA 3SZPA 2F7BA 4BDRA 1QW0A 3OEKA 4JWYA 3UORA 3CIJA 1NH7A 2QMXA 1GTKA 5ET5A 3A3UA 1URGA 4F3PA 2QVRA 4N07A 2QS2A 3PUWE 5EHMA 1KA0A 1SW2A 1FTAA 1MXZA 3M3KA 4EXLA 3NOHA 3Q25A 1KA1A 4E0WA 3S9LC 1FPFA 4HTGA 4N8YA 4EXKA 3KN8A 2UVJA 2ZYNA 1B3LA 2F35A 1MXVA 4PFWA 4NF4A 4TOZA 1LAFE 5DTBA 4PAKA 2QSXA 2GRVA 1PBPA 4MNCA 5AA2A 4NAPA 1JW1A 4GX3A 2BJJX 5I5PA 2F3BA 2VT5A 5JTYA 1R9QA 2XXXA 1Q9DA 4G61A 3PPOA 3H6TA 3VVEA 4GX6A 4H65A 4FEDA 4OQOA 1B05A 2CZKA 2HQ0A 4TQUQ 2RCBA 2WYPA 1NMUA 3RNNA 3WAFA 3DP6A 1FQAA 3K6VA 1LBBA 2ZZXA 5EQAA 4LP2B 2QS1A 5I58B 5HM4B 3BFTA 4PGPA 3MVWA 3IO6A 2I6EA 4XKPA 3MZBA 1I69A 3G3FA 5LOMA 3L6HA 4H45A 3PPNA 3CVGA 3KC1A 2XXHA 1RDXA 3USDA 1FBHA 4EF1A 1USYH 2B4LA 3OELA 2ZYKA 5CC2A 4IO3A 1MPBA 4BDOA 1FSAA 3WAEA 4PFYA 1IMAA 5H8NB 1Q1KA 1VFDA 4FEBA 4JWOA 2XXVA 5DVJA 2QVUA 4G8NA 2VHAA 3GZGA 5FHOA 2DDKA 4OXVA 4UA8A 3E4RA 4DE8A 2F6PA 1DBZA 4IR8A 3THIA 1XHYA 1B51A 1TFDA 4OA4A 5B70A 1P99A 4NWCA 2XXTA 3B7DA 1FPKA 1PEBA 3FVGA 5KZTA 4XKNA 2OCUA 1B2HA 1EZOA 1SYHA 4QFPA 2ZMBA 4GF8A 4U4SA 4C0RA 3G3HA 2XHDA 4YMAA 3IB1A 4DDDA 2YPNA 3AXFA 5TU0A 2LAOA 1B5IA 4ZE9A 5H8NA 4NEDA 4U23A 2F36A 1D9VA 5EYHA 1B0HA 4F1UA 1B40A 2GFEA 4PFTA 3KN7A 2I0BA 3K00A 4KI0E 4I62A 2Q8JA 4LATA 4MH5A 1LAXA 2RKMA 2ONRA 1FPIA 1CNQA 4PE3A 4G2ZA 3QYTA 3FXBA 4GVOA 3SEVA 1BK4A 3UIFA 1URSA 4YB6A 1XC1A 4ZDMA 4YB5A 1RYXA 4OVQA 2PBWA 4N81A 3H6VA 1MY4A 2OX3A 1RKMA 1B1XA 2KQZA 3DM0A 4MHFA 4ZEFA 5ELVA 4NE4A 4QXDA 5A5LA 1NUYA 1NV1A 4R2BA 1AWBA 4ZZEA 3SEXA 3U92A 2V4CA 1UTHB 3FJ7A 2XXKA 1T0KA 1NNPA 3PD8A 3ILUB 2F8DA 4QFLA 3TQWA 3E13X 5K2YA 5EYFA 5CBRA 2IEEA 4DXUA 3T93B 3RQTA 1LFHA 3PTYA 4GWSA 1IZ1A 1SI1A 3MUQA 1VE4A 2I0CA 2V93A 5KCJB 1H44A 4F31B 1EZ9A 3GBBA 2DE4A 1OVBA 3DP4A 4FBPA 3VDFA 2FA7A 1SW1A 1QVSA 5I56B 1NV3A 1DMBA 2F3DA 4LONB 1FRPA 2I48A 1AH5A 1H45A 1F9BA 1JW4A 3MW0A 1LFIA 1LEVA 1FPBA 2XX8A 3B50A 1OQHA 1MH4A 1OLAA 3SERA 4EQ7A 5AA2B 3C33A 2AL4A 3K02A 3K2DA 4ELRA 4NX1A 1IXHA 1FPEA 3H03A 5H8QB 3TODA 1NUWA 3OXNA 4O94A 1ZMGA 1YZ0A 4H5GA 1K9YA 4ZS9A 3OEMA 2ZYOA 2UYFA 4F22A 2E0SA 1HSJA 1J1NA 3VLUA 2UVIA 3KC0A 3RUMA 4X1BA 3O6IA 4FIMA 4PC9A 4G77A 1LBWA 1MQIA 2F7AA 4N6PA 1Y3NA 3DLNA 4RK9A 1FTKA 3U72A 4GD5A 3JV9A 2I3WA 2D3IA 1DK4A 3C32A 1WDNA 4NF6B 4MJOA 1FQEA 2H99A 3TDJA 1B1HA 3CHGA 3O66A 1S50A 1N3WA 4P3LA 5DT6A 3TELA 1BP5A 1UIVA 2RC7A 4ISUA 3T66A 3MP1A 4DXBA 2QRYA 2Y84A 5AA4A 3G3KA 4KYSA 2YJPA 3TMGA 4PDDA 1AL3A 2Q2AA 4GXAA 4F1YA 3JYRA 2H9BA 1POY1 5H8QA 1A55A 4RK2A 3C9HA 2BJIA 2F6GA 4KD5A 3VXCA 5T3JA 5I59A 3FATA 2MKZA 4R6HA 4LZ7A 3S9MC 3MZ1A 4O7IA 2R6GE 1N7XA 2VGQA 1D3KA 1HSLA 1FPDA 3PMXA 1PB7A 2V25A 1YYZA 3V5AA 4IO5A 2GHBA 3G7WA 1A8EA 3PPRA 3HFUA 3SEWA 3FASA 1GGGA 2DE2A 5H8SA 1EU8A 3MZ9A 4RJZA 1US5A 5I57B 3T9UA 4X04A 4I8CA 4YKKA 2WBDA 4DCXA 3JZJA 2Y7PA 1R6ZA 3OD7A 1LGBC 1A8FA 1DTGA 3C31A 4M4GA 5KDTB 3N5LA 3MVXA 3G3GA 1FBEA 1CB6A 2I58A 2WYKA 3FIRA 4DI3D 2HHMA 1SDXA 1N04A 3V8XB 4P9KA 3PMVA 4PTKA 3L6GA 2XX7A 4KR5A 3MWBA 2OWZA 3K1MA 1FTJA 1EH3A 3V89B 2DS9A 4G68C 4DXCA 3QXMA 4GBWA 2DE3A 4Q0CA 3CFZA 4XF5A 4OHNA 3D1RA 2QPQA 4R9GA 4ZEDA 1MM7A 4HXVA 5DEXA 4BDMA 2O51A 1B3EA 1MXWA 2NWJA 1O64A 4BDNA 1NV5A 3PMWA 3IJOB 1VR5A 3VLWA 4OVTA 4ONYA 1VFEA 1JVXA 3FUZA 4GL0A 4P11A 4RYAA 3RPLA 4NHBA 5H8FB 1SPIA 5L9MA 3MSTA 4MBPA 4OEUA 1FBPA 1MXYA 3SESA 4H0WA 4O7MA 2R8TA 4I3EA 2O69A 4R75A 3G3IA 2Z8FA 1MQHA 3TTLA 4L17A 2DYXA 3QK6A 1A40A 3UGWA 3MJNA 4OVRA 1MY3A 4JB7A 4U4XA 2Z22A 4WKMA 1IITA 4HE2A 2R71A 3KBRA 1S7YA 2CMOA 1MH3A 3C34A 5IM2A 2XWKA 4FECA 4RNSA 1MXUA 4AS4A 2HAUA 4NWDA 3G3JA 3KGCA 4IO4A 4YB7A 2KLFA 4FORA 4R6KA 1ZBMA 1LBYA 1FBFA 1QJMA 3QSLA 4KYEA 1GVCA 1IMCA 4U21A 2HPGA 4F2OA 1A7LA 4X8RA 4IY6A 4PFRA 4XEQA 2PFYA 3P7IA 3TTNA 1SD3A 1MQGA 4PFIA 1XS5A 1BTJA 4C1UA 5DYHA 2ZNSA 3PUYE 1TFAA 3O6GA 5I3SA 3ROJA 2Z8DA 1KWHA 4Q5TA 2DQVA 2WKYA 2RCAA 4F19A 3MPKA 1MQDA 3IORA 4YU0A 2PCRA 2PMSA 1NKXA 1NNTA 2B65A 5L8DA 1KZ8A 5A5XA 2NXOA 2O84X 3PUZE 1ELJA 3TTKA 2CZHA 1FBCA 3RYDA 3PV0E 3T9HB 5FHMA 2R9JA 3D4CA 1EZPA 3PPQA 3CR9A 1NUZA 4KCCA 5I84A 1WVJA 2FVZA 1S9TA 3LUZA 4PAFA 1B7HA 2P0SA 3TPAA 4DZ1A 2AL5A 1Y1ZA 4MAGA 3FXRA 3MBPA 1P1NA 1UTHA 1IMBA 3MP6A 3PUXE 3N6TA 3KSJA 3E79A 2UVGA 3M8UA 3BIHA 2DWJA 4LZ5A 5FTHA
chains in the Genus database with same CATH topology
2THIA 3TQLA 3GBAA 1LBCA 3RPWA 5I58A 3Q28A 3IR1A 4GRKA 5KCJB 1H44A 4F31B 1EZ9A 2F7CA 1LCTA 3GBBA 4AB5A 3RLFE 4YMBA 2DE4A 1QULA 1MDP1 2B3FA 1OVBA 4LZ8A 3DP4A 3LC8A 2AYSA 1SVXB 1MXXA 2ABHA 2DSFA 2FA7A 4G68B 4RY1A 1B52A 1QUJA 3ODBA 2ANJA 2W7YA 1SW1A 3ECRA 2DVZA 1QVSA 3EN3A 3FJMA 3HO7A 3FD3A 4OERA 5TPAA 5I56B 1DMBA 1N84A 1A99A 2O68A 2O7IA 4LONB 3CSBA 2Q9TA 2UYEA 2I48A 3CFXA 4H5FA 1AH5A 5B7DA 1H45A 4XKQA 2RINA 4ND9A 3TKDA 1F9BA 4F29A 1Z7ME 4M1VA 1JW4A 1H76A 3MW0A 2Y7RA 4Q8RA 1LFIA 3K4UA 1URDA 1I6AA 2NVUB 3K1PA 2F97A 3R7XA 3U94A 1NNFA 1QKBA 2XX8A 5IKBA 3CG3A 3TCGA 1AMFA 2D5WA 1OQHA 2Q89A 4OTEA 4R6YA 1FTLA 4Z0IA 3OSRA 1DSNA 2E1SA 1MH4A 1OLAA 2Q88A 2UXAA 2X7PA 3MQ9A 4QRZA 3SERA 5CI5A 4EQ7A 3MAMA 2X26A 5AA2B 3C33A 4XKRA 1SW4A 5JTYB 1CE2A 3V83A 2AL4A 2I4BA 3K02A 4HS7A 1BKAA 5CMMA 5K2XA 4QFOA 4I1DA 3IO4A 3K2DA 3HN0A 4OZ9A 4ELRA 1POTA 1XT8A 2F34A 4YICA 3SKPA 2O1LA 1IXHA 4EQ9A 3UK4A 4LZ5A 1IEJA 4AQ4A 3C35A 4N13A 4ELOA 3H03A 1OQGA 1MPDA 2I49A 5H8QB 4E0XA 4WEPA 3TODA 3OXNA 3RT8A 4QSEA 3IJXB 4F3GA 4OWDA 1FQBA 3PUVE 1O63A 1ZMGA 1M5EA 2DWHA 4HCYA 4OENA 4H5GA 4OFLA 4ZS9A 1UIUA 5CMKA 5TPAB 3OEMA 2ZYOA 1B7UA 2UYFA 2G29A 4Q30B 2Q2CA 3ZKLA 1NH8A 4ELQA 4F22A 1B46A 4H8JA 2E0SA 3R26A 1HSJA 2V3UA 3O2AA 4HW8A 1J1NA 3VLUA 5AE4A 2UVIA 3OO7A 4PFUA 3RUMA 4X1BA 3O6IA 2ALUA 3I5OA 4FIMA 4G77A 2DWAA 2V3TA 1MQIA 2F7AA 3KEIA 4N6PA 1NFTA 3K0VA 1Y3NA 3S2VA 4NF5A 4IO7A 3DLNA 4RK9A 4IGTA 1FTKA 3N6UA 3U72A 1MM6A 4JSOA 3SEYA 4GD5A 4ZEIA 1AOVA 1N7WA 1SW5A 4DCYA 4JWXA 3JV9A 1ZTYA 2I3WA 4O3BA 2D3IA 4U1ZA 1L5TA 1LLSA 3HHGA 5CMBA 2REJA 1D4NA 3KFMA 3LBSA 3E3KA 3C32A 1WDNA 4NF6B 5ICTA 1MPCA 1YCJA 3TFLA 1FQEA 4R2FA 2H99A 2REGA 3TDJA 1B1HA 5ICQA 1VSOA 3EF7A 3O66A 4LQ5A 1S50A 1N3XA 1N3WA 4TLMB 4XXUA 5DT6A 2ONKE 1BP5A 3TELA 1BIYA 1MG1A 1LCFA 1UIVA 2ZYMA 3CFLA 2VD2A 4NF4B 4U22A 3PGFA 1LFGA 2RC7A 1OLCA 2XXWA 3PU5A 2QS4A 1B4HA 3Q29A 1B9JA 1GR2A 3ONMA 1AIVA 4ISUA 1B3HA 3MVZA 4KYDA 3DP8A 4PQJA 3T66A 3TTMA 4EUOA 2HEUA 3MP1A 3TYHA 2O1MA 3A3CA 4EQBA 3C4MA 4IB2A 2DXRA 2HXWA 4H67A 4DXBA 2PVUA 1DPEA 2QRYA 2Y84A 3Q26A 3H7MA 4GL8A 4IY5A 3RN8A 4G8MA 4BDQA 3BBRA 1SI0A 2XXQA 4X1DA 5AA4A 5JK4A 3G3KA 1IQ7A 4H8IA 1TXFA 2QS3A 4KYSA 2YJPA 2B3BA 1Y4CA 3I3VA 4QSCA 1M5FA 3E9XA 4GFRA 3TMGA 3W9WA 3OOAA 1AL3A 3IOVA 3FVOA 2Q2AA 3OMBA 4MLQA 2RF1A 4GXAA 4OQOA 3JYRA 2F78A 3W9VA 4F1YA 3HCQA 4P0GA 1D9YA 3OO6A 4QSDA 5HBCA 3H4ZA 1LB8A 1R1NA 1POY1 2F5XA 2H9BA 5DVIA 2H98A 4O3CA 1HSEA 5H8QA 1A55A 1OMPA 4RK2A 1US4A 4RA1A 3C9HA 2F6GA 4KD5A 2XD3A 4GQOA 4UACA 3VXCA 5CBSA 3FATA 5I59A 1Y20A 2X7QA 5TP9A 4QFKA 2PT2A 4JBZA 5F7VA 1B4ZA 4ESWA 4F2QA 3QAXA 3S4UA 2XXRA 1IXIA 4R6HA 2I0CA 2VD3A 5TP9B 4LZ7A 3K6WA 3S9MC 2V3QA 2F7BA 4YZZA 3O97A 3MZ1A 4BDRA 3H6WA 4H6DA 4FJPA 2R6GE 1FTOA 3U1OA 1N7XA 1QW0A 2P2AA 3KJTA 2VGQA 1D3KA 3OEKA 4JWYA 4U2RA 4ESXA 3UORA 1HSLA 3CIJA 3CI8A 2PT1A 3PMXA 1PB7A 2V25A 1NH7A 3V5AA 3HHFA 4IO5A 2GHBA 2QMXA 1GTKA 3G7WA 1A8EA 1M5DA 3PPRA 4JSDA 3A3UA 3LSXA 5FTHA 1PC3A 1URGA 4F3PA 4N07A 3KZGA 2QL3A 4R73A 1LB9A 3U8QA 5CMCA 3H6UA 2QS2A 3SEWA 2D21A 1UTBA 1PB8A 1GGGA 3FASA 3PUWE 2DE2A 1B32A 3OO9A 5EHMA 5H8SA 4DLDA 1EU8A 1SW2A 3MZ9A 4RJZA 1Y3PA 1RYOA 1MXZA 3VLVA 3ZS6A 1US5A 3M3KA 5H8HA 4ZEBA 4EXLA 5H8FA 5I57B 3VXBA 2YLNA 3Q25A 3MVYA 3T9UA 4E0WA 3RT6B 5I2NB 5H8HB 3S9LC 4I8CA 4JXIA 3VVFA 4HTGA 4EXKA 5AA2D 4YKKA 3KN8A 2NUVA 3IB2A 3TCHA 4OMBA 4DCXA 2UVJA 2ZYNA 1B3LA 1Q35A 1UTBB 2F35A 3B6QA 3GXAA 3KOTA 1MXVA 4GLIA 4PFWA 3JZJA 3LUYA 4NF4A 2P1SA 3LSLA 1NNKA 2FNCA 2Y7PA 3K1NA 2O6AA 1R6ZA 3O28A 1PDAA 3OD7A 1LGBC 3TTRA 3C36A 3CSGA 4TOZA 3TZAA 2G93A 1A8FA 3BFUA 1LAFE 3KG2A 5DTBA 1SQYA 1DTGA 2XXYA 3C31A 4M4GA 5BWJA 5KDTB 2QSXA 1M5CA 3N5LA 2GRVA 3MVXA 1PBPA 3KOSA 4QF9A 3K6XA 5AA2A 3G3GA 2ONSA 4JDFA 3UP9A 1CB6A 2I58A 1JW1A 4GOTA 3SEUA 3FIRA 3FVKA 1B0LA 2BJJX 4P0IA 3H3GA 1SDXA 1N04A 3V8XB 3PMVA 1ZU0A 1R9QA 5JTYA 1ANFA 2XXXA 4R74A 3FVNA 3H6TA 3PPOA 4POXA 3L6GA 4H65A 3HSTA 4FEDA 2XX7A 3PD9A 4YKIA 3T22A 2I4CA 2XXPA 4IGRA 4KR5A 1B05A 2XD2A 3MWBA 3K1MA 4NMYA 2HQ0A 4NF6A 4KCDA 4TQUQ 1P1OA 1DOTA 4OESA 4BLAA 4NF8A 2RC9A 2VP1A 1FTJA 1EH3A 2RCBA 2Y7WA 4X48A 4YKPA 3V89B 4GIZA 1NMUA 3RNNA 2DS9A 1YTVA 3WAFA 1N0TA 2VOZA 1I6BA 3O6HA 4G68C 5I56A 1I6QA 3KSXA 1B5JA 4WEDA 4DXCA 3DP6A 1FQAA 1MDQA 3QXMA 3K6VA 3H06B 2DE3A 1B3GA 4Q0CA 4RXLA 1LBBA 3ZKKA 1YAEA 3FV1A 4LP2B 3IX1A 2QS1A 5I58B 3CFZA 5HM4B 3BFTA 4OHNA 4THIA 4FATA 5ITPA 3MVWA 4OVJA 5FTIA 3IO6A 2Y7KA 2I6EA 2QPQA 4XKPA 3UN6A 4R9GA 1JVYA 3MZBA 3IOWA 4ZEDA 1I69A 3QUFA 1MM7A 2OBGA 3HV1A 3M3FA 3I6VA 3O9PA 3VVDA 3G3FA 3RTFB 5LOMA 5DEXA 3L6HA 4MF3A 4BDMA 2O51A 1B3EA 3PPNA 3RTWB 1MXWA 3CVGA 4IO6A 2XXIA 3MPLA 4LVQA 2NWJA 2XXHA 1O64A 4OFOA 1H3DA 1H43A 4BDNA 4F18A 3U93A 4O3AA 3USDA 3S9EA 3PMWA 4IO2A 4PE5B 4QFNA 4EF1A 3IJOB 3VFJA 3DELB 1LAHE 1VR5A 2HCAA 3VLWA 4ONYA 3B6WA 4XIGQ 1VFEA 4KHZE 1USYH 2QMWA 1JVXA 3FUZA 1QKAA 3OELA 3OO8A 4GL0A 2ZYKA 4KFQA 5CRYA 4F3BA 5CC2A 4P11A 5AA1A 2XXUA 4IO3A 4RYAA 4FAJA 5H8FB 1MPBA 4BDOA 5L9MA 1R9LA 4MBPA 2ZNTA 4LUBA 4OEUA 3WAEA 4PFYA 5F1QA 4ECFA 4EDPA 5H8NB 1MXYA 1Q1KA 1VFDA 2HFBA 4FEBA 2XXVA 4H0WA 4JWOA 3SESA 5KCJA 2GHAA 5DVJA 4R72A 2AIXA 4G8NA 3EHTA 4H1XA 2VHAA 3GZGA 5M2VA 1JEVA 2O69A 4KPTA 3IOUA 3LR1A 4OEVA 3G3IA 4R75A 5FHOA 2Z8FA 3T9VA 1ATGA 4OXVA 2OWSA 1MQHA 3K01A 3E4RA 4UA8A 5FHNA 2F6PA 1MY1A 4DE8A 4C1TA 3TTLA 5L9SA 3LSFB 3EHSA 3CRBA 3LSWA 4L17A 1ZKBA 3THIA 1JQFA 2DYXA 2RC8A 3QK6A 4WXJA 1A40A 1XHYA 1B51A 1TFDA 2NOOA 2OJTA 3UGWA 3MJNA 4G68A 4AB6A 1N76A 5B70A 4NTLA 1P99A 2ESNA 4GWOA 4NWCA 2XXTA 3B7DA 1MY3A 2DXYA 4JB7A 3TAJA 1B58A 1B5HA 1FCKA 1MS7A 1PEBA 3FGSA 1SBPA 3A09A 4U4XA 3VDFA 2PX1A 3BKIB 5BUUA 4ZZAA 2H25A 2Z22A 4WKMA 2XX9A 4OETA 3FVGA 5KZTA 4XKNA 1IITA 4GXSB 1MQJA 2R71A 3IOTA 3KBRA 1S7YA 4LQ2A 2OCUA 2CMOA 2ZXTA 3MP8A 1FQCA 2HZKA 3W15C 1B2HA 2Y7IA 3O29A 1MH3A 4ZE8A 1EZOA 2A5TB 1IXCA 3C34A 3HPIA 1JNFA 2HAVA 4POWA 1SYHA 3ILTB 4FECA 3QUJA 3R6UA 4QFPA 4RNSA 1FQFA 1GV8A 1MXUA 1UQWA 2ZMBA 2HAUA 4GF8A 4NWDA 4U4SA 3D4GA 3SDFA 3G3JA 4C0RA 3G3HA 3KGCA 1Y9UA 2XHDA 1TT1A 2I3VA 3FV2A 4YMAA 4IO4A 4YB7A 1IUDA 3IB1A 4DDDA 2KLFA 1XVXA 1B6HA 4FORA 1B7ZA 2YPNA 5IAIA 3AXFA 4R6KA 5TU0A 2CZLA 4NF5B 1ZBMA 2Z23A 3SETA 5AA4B 1ZLQA 3VVEA 2LAOA 1B5IA 1QJMA 1JETA 2OK2A 3CG1A 4DIGA 4NEDA 5EHSA 1ZJLA 3K6UA 3QSLA 4MFIA 5H8NA 3Q27A 1BLFA 4FE8A 1P1QA 4OFJA 4RPOA 3UA8A 1QUIA 1Y1MA 5I2NA 1OIBA 4U23A 3PPPA 2F36A 4KYEA 1GVCA 4ZEKA 1D9VA 2IA4A 1B0HA 3T9XB 4BDLA 4F1UA 4XTCQ 1YPNA 2UVHA 2A5SA 4U21A 1B40A 2GFEA 3VE1B 4PFTA 3S9NC 1PB9A 4F2OA 3EQ1A 4K3FA 1A7LA 3KN7A 4YKJA 1FTMA 4IY6A 2I0BA 1A54A 3K00A 4KI0E 4I62A 3M3LA 3P7IA 2Q8JA 4LATA 4MH5A 4TLLB 5I2KA 3TTNA 1LAXA 2RKMA 1OVTA 2ONRA 1SD3A 1MQGA 4KQPA 1XS5A 4PETA 1BTJA 1Z7NE 4C1UA 2ZNUA 5DYHA 5JEIA 2ZNSA 1XOCA 4NF8B 1WODA 3FZVA 3PUYE 1P1WA 2DVCA 2OWTA 3VV5A 3IB0A 2H4IA 1TFAA 3OENA 3O6GA 3QYTA 4G2ZA 3T96B 4Z7EA 4ZECA 5DEXB 4R9FA 4F39A 4GVOA 3SEVA 1TWYA 3UIFA 2Z8DA 1KWHA 3N26A 5DVFA 4Q5TA 1URSA 2DQVA 4F3SA 2FYIA 2WKYA 4YB6A 1XC1A 3B6TA 1Y3QA 4ZDMA 2O7UA 2RCAA 3IK6B 4EF2A 4YB5A 5HPQA 4F19A 1NL5A 1RYXA 4MLVA 3MPKA 2PYYA 3TEPA 3FJGA 1SYIA 2GH9A 2PBWA 1MQDA 1MY2A 3IORA 5KDTA 4YU0A 4LA9A 5ITOA 3IAZA 5AA3A 2PMSA 3EHUA 3H6VA 1NKXA 1MY0A 1NNTA 2B65A 4YAHX 1Y4TA 2OLBA 5L8DA 1MY4A 3FXQA 1MRPA 1RKMA 1B1XA 5A5XA 3FXUA 2M8CA 1FQDA 3F11A 3IL1B 2NXOA 2O84X 3PUZE 1ELJA 3DM0A 3TTKA 5J1DA 1DPPA 3ZSFA 4RPNA 3PV0E 4HCWA 3T9HB 1LSTA 1XVYA 4ZEFA 4ZE9A 5A5XB 2OZZA 5ELVA 3GLBA 2R9JA 5FHMA 3TCFA 4G4PA 4NE4A 3D4CA 1EZPA 4G8HA 1ZIUA 2A5TA 1QUKA 3PPQA 5I57A 3CR9A 3N94A 4KCCA 1B3FA 4R2BA 2HZLA 1WVJA 4U1OA 5I84A 3KJ7A 3RGYA 5ISUA 1DTZA 1IXGA 2V84A 4ZZEA 1S9TA 3SEXA 3U92A 3TUSA 1USYE 1UTHB 1B7HA 2H5YA 1JW5A 3FJ7A 2P0SA 1FW0A 1O7TA 4QHQA 4I9DA 1II5A 1LAGE 3TPAA 4DZ1A 1T0KA 1NNPA 3PD8A 3ILUB 2F8DA 3RY3A 4QFLA 2QJEA 2Z8EA 1JEUA 3TQWA 1P1UA 2AL5A 1Y1ZA 4ELPA 4OYVA 3E13X 5K2YA 4F1VA 4PP0A 3FXRA 3MBPA 5EYFA 2IEEA 1P1NA 4X9TA 5CBRA 5L9OA 4DXUA 1PBQA 3RQTA 3T93B 1UTHA 5I59B 3MC2A 1LFHA 1IZ1A 5I2KB 3MP6A 3PUXE 1SI1A 1M5BA 3N6TA 3OSQA 3KSJA 2DWIA 3EPEA 3MUQA 2UVGA 3M8UA 3QIMA 1VE4A 2DWJA 5CM6A 2V93A 2DP8A 1IIWA 2DOJA 3KN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2THI A;  3TQL A;  3GBA A;  1LBC A;  3RPW A;  5I58 A;  3Q28 A;  3IR1 A;  4GRK A;  5KCJ B;  1H44 A;  4F31 B;  1EZ9 A;  2F7C A;  1LCT A;  3GBB A;  4AB5 A;  3RLF E;  4YMB A;  2DE4 A;  1QUL A;  1MDP 1;  2B3F A;  1OVB A;  4LZ8 A;  3DP4 A;  3LC8 A;  2AYS A;  1SVX B;  1MXX A;  2ABH A;  2DSF A;  2FA7 A;  4G68 B;  4RY1 A;  1B52 A;  1QUJ A;  3ODB A;  2ANJ A;  2W7Y A;  1SW1 A;  3ECR A;  2DVZ A;  1QVS A;  3EN3 A;  3FJM A;  3HO7 A;  3FD3 A;  4OER A;  5TPA A;  5I56 B;  1DMB A;  1N84 A;  1A99 A;  2O68 A;  2O7I A;  4LON B;  3CSB A;  2Q9T A;  2UYE A;  2I48 A;  3CFX A;  4H5F A;  1AH5 A;  5B7D A;  1H45 A;  4XKQ A;  2RIN A;  4ND9 A;  3TKD A;  1F9B A;  4F29 A;  1Z7M E;  4M1V A;  1JW4 A;  1H76 A;  3MW0 A;  2Y7R A;  4Q8R A;  1LFI A;  3K4U A;  1URD A;  1I6A A;  2NVU B;  3K1P A;  2F97 A;  3R7X A;  3U94 A;  1NNF A;  1QKB A;  2XX8 A;  5IKB A;  3CG3 A;  3TCG A;  1AMF A;  2D5W A;  1OQH A;  2Q89 A;  4OTE A;  4R6Y A;  1FTL A;  4Z0I A;  3OSR A;  1DSN A;  2E1S A;  1MH4 A;  1OLA A;  2Q88 A;  2UXA A;  2X7P A;  3MQ9 A;  4QRZ A;  3SER A;  5CI5 A;  4EQ7 A;  3MAM A;  2X26 A;  5AA2 B;  3C33 A;  4XKR A;  1SW4 A;  5JTY B;  1CE2 A;  3V83 A;  2AL4 A;  2I4B A;  3K02 A;  4HS7 A;  1BKA A;  5CMM A;  5K2X A;  4QFO A;  4I1D A;  3IO4 A;  3K2D A;  3HN0 A;  4OZ9 A;  4ELR A;  1POT A;  1XT8 A;  2F34 A;  4YIC A;  3SKP A;  2O1L A;  1IXH A;  4EQ9 A;  3UK4 A;  4LZ5 A;  1IEJ A;  4AQ4 A;  3C35 A;  4N13 A;  4ELO A;  3H03 A;  1OQG A;  1MPD A;  2I49 A;  5H8Q B;  4E0X A;  4WEP A;  3TOD A;  3OXN A;  3RT8 A;  4QSE A;  3IJX B;  4F3G A;  4OWD A;  1FQB A;  3PUV E;  1O63 A;  1ZMG A;  1M5E A;  2DWH A;  4HCY A;  4OEN A;  4H5G A;  4OFL A;  4ZS9 A;  1UIU A;  5CMK A;  5TPA B;  3OEM A;  2ZYO A;  1B7U A;  2UYF A;  2G29 A;  4Q30 B;  2Q2C A;  3ZKL A;  1NH8 A;  4ELQ A;  4F22 A;  1B46 A;  4H8J A;  2E0S A;  3R26 A;  1HSJ A;  2V3U A;  3O2A A;  4HW8 A;  1J1N A;  3VLU A;  5AE4 A;  2UVI A;  3OO7 A;  4PFU A;  3RUM A;  4X1B A;  3O6I A;  2ALU A;  3I5O A;  4FIM A;  4G77 A;  2DWA A;  2V3T A;  1MQI A;  2F7A A;  3KEI A;  4N6P A;  1NFT A;  3K0V A;  1Y3N A;  3S2V A;  4NF5 A;  4IO7 A;  3DLN A;  4RK9 A;  4IGT A;  1FTK A;  3N6U A;  3U72 A;  1MM6 A;  4JSO A;  3SEY A;  4GD5 A;  4ZEI A;  1AOV A;  1N7W A;  1SW5 A;  4DCY A;  4JWX A;  3JV9 A;  1ZTY A;  2I3W A;  4O3B A;  2D3I A;  4U1Z A;  1L5T A;  1LLS A;  3HHG A;  5CMB A;  2REJ A;  1D4N A;  3KFM A;  3LBS A;  3E3K A;  3C32 A;  1WDN A;  4NF6 B;  5ICT A;  1MPC A;  1YCJ A;  3TFL A;  1FQE A;  4R2F A;  2H99 A;  2REG A;  3TDJ A;  1B1H A;  5ICQ A;  1VSO A;  3EF7 A;  3O66 A;  4LQ5 A;  1S50 A;  1N3X A;  1N3W A;  4TLM B;  4XXU A;  5DT6 A;  2ONK E;  1BP5 A;  3TEL A;  1BIY A;  1MG1 A;  1LCF A;  1UIV A;  2ZYM A;  3CFL A;  2VD2 A;  4NF4 B;  4U22 A;  3PGF A;  1LFG A;  2RC7 A;  1OLC A;  2XXW A;  3PU5 A;  2QS4 A;  1B4H A;  3Q29 A;  1B9J A;  1GR2 A;  3ONM A;  1AIV A;  4ISU A;  1B3H A;  3MVZ A;  4KYD A;  3DP8 A;  4PQJ A;  3T66 A;  3TTM A;  4EUO A;  2HEU A;  3MP1 A;  3TYH A;  2O1M A;  3A3C A;  4EQB A;  3C4M A;  4IB2 A;  2DXR A;  2HXW A;  4H67 A;  4DXB A;  2PVU A;  1DPE A;  2QRY A;  2Y84 A;  3Q26 A;  3H7M A;  4GL8 A;  4IY5 A;  3RN8 A;  4G8M A;  4BDQ A;  3BBR A;  1SI0 A;  2XXQ A;  4X1D A;  5AA4 A;  5JK4 A;  3G3K A;  1IQ7 A;  4H8I A;  1TXF A;  2QS3 A;  4KYS A;  2YJP A;  2B3B A;  1Y4C A;  3I3V A;  4QSC A;  1M5F A;  3E9X A;  4GFR A;  3TMG A;  3W9W A;  3OOA A;  1AL3 A;  3IOV A;  3FVO A;  2Q2A A;  3OMB A;  4MLQ A;  2RF1 A;  4GXA A;  4OQO A;  3JYR A;  2F78 A;  3W9V A;  4F1Y A;  3HCQ A;  4P0G A;  1D9Y A;  3OO6 A;  4QSD A;  5HBC A;  3H4Z A;  1LB8 A;  1R1N A;  1POY 1;  2F5X A;  2H9B A;  5DVI A;  2H98 A;  4O3C A;  1HSE A;  5H8Q A;  1A55 A;  1OMP A;  4RK2 A;  1US4 A;  4RA1 A;  3C9H A;  2F6G A;  4KD5 A;  2XD3 A;  4GQO A;  4UAC A;  3VXC A;  5CBS A;  3FAT A;  5I59 A;  1Y20 A;  2X7Q A;  5TP9 A;  4QFK A;  2PT2 A;  4JBZ A;  5F7V A;  1B4Z A;  4ESW A;  4F2Q A;  3QAX A;  3S4U A;  2XXR A;  1IXI A;  4R6H A;  2I0C A;  2VD3 A;  5TP9 B;  4LZ7 A;  3K6W A;  3S9M C;  2V3Q A;  2F7B A;  4YZZ A;  3O97 A;  3MZ1 A;  4BDR A;  3H6W A;  4H6D A;  4FJP A;  2R6G E;  1FTO A;  3U1O A;  1N7X A;  1QW0 A;  2P2A A;  3KJT A;  2VGQ A;  1D3K A;  3OEK A;  4JWY A;  4U2R A;  4ESX A;  3UOR A;  1HSL A;  3CIJ A;  3CI8 A;  2PT1 A;  3PMX A;  1PB7 A;  2V25 A;  1NH7 A;  3V5A A;  3HHF A;  4IO5 A;  2GHB A;  2QMX A;  1GTK A;  3G7W A;  1A8E A;  1M5D A;  3PPR A;  4JSD A;  3A3U A;  3LSX A;  5FTH A;  1PC3 A;  1URG A;  4F3P A;  4N07 A;  3KZG A;  2QL3 A;  4R73 A;  1LB9 A;  3U8Q A;  5CMC A;  3H6U A;  2QS2 A;  3SEW A;  2D21 A;  1UTB A;  1PB8 A;  1GGG A;  3FAS A;  3PUW E;  2DE2 A;  1B32 A;  3OO9 A;  5EHM A;  5H8S A;  4DLD A;  1EU8 A;  1SW2 A;  3MZ9 A;  4RJZ A;  1Y3P A;  1RYO A;  1MXZ A;  3VLV A;  3ZS6 A;  1US5 A;  3M3K A;  5H8H A;  4ZEB A;  4EXL A;  5H8F A;  5I57 B;  3VXB A;  2YLN A;  3Q25 A;  3MVY A;  3T9U A;  4E0W A;  3RT6 B;  5I2N B;  5H8H B;  3S9L C;  4I8C A;  4JXI A;  3VVF A;  4HTG A;  4EXK A;  5AA2 D;  4YKK A;  3KN8 A;  2NUV A;  3IB2 A;  3TCH A;  4OMB A;  4DCX A;  2UVJ A;  2ZYN A;  1B3L A;  1Q35 A;  1UTB B;  2F35 A;  3B6Q A;  3GXA A;  3KOT A;  1MXV A;  4GLI A;  4PFW A;  3JZJ A;  3LUY A;  4NF4 A;  2P1S A;  3LSL A;  1NNK A;  2FNC A;  2Y7P A;  3K1N A;  2O6A A;  1R6Z A;  3O28 A;  1PDA A;  3OD7 A;  1LGB C;  3TTR A;  3C36 A;  3CSG A;  4TOZ A;  3TZA A;  2G93 A;  1A8F A;  3BFU A;  1LAF E;  3KG2 A;  5DTB A;  1SQY A;  1DTG A;  2XXY A;  3C31 A;  4M4G A;  5BWJ A;  5KDT B;  2QSX A;  1M5C A;  3N5L A;  2GRV A;  3MVX A;  1PBP A;  3KOS A;  4QF9 A;  3K6X A;  5AA2 A;  3G3G A;  2ONS A;  4JDF A;  3UP9 A;  1CB6 A;  2I58 A;  1JW1 A;  4GOT A;  3SEU A;  3FIR A;  3FVK A;  1B0L A;  2BJJ X;  4P0I A;  3H3G A;  1SDX A;  1N04 A;  3V8X B;  3PMV A;  1ZU0 A;  1R9Q A;  5JTY A;  1ANF A;  2XXX A;  4R74 A;  3FVN A;  3H6T A;  3PPO A;  4POX A;  3L6G A;  4H65 A;  3HST A;  4FED A;  2XX7 A;  3PD9 A;  4YKI A;  3T22 A;  2I4C A;  2XXP A;  4IGR A;  4KR5 A;  1B05 A;  2XD2 A;  3MWB A;  3K1M A;  4NMY A;  2HQ0 A;  4NF6 A;  4KCD A;  4TQU Q;  1P1O A;  1DOT A;  4OES A;  4BLA A;  4NF8 A;  2RC9 A;  2VP1 A;  1FTJ A;  1EH3 A;  2RCB A;  2Y7W A;  4X48 A;  4YKP A;  3V89 B;  4GIZ A;  1NMU A;  3RNN A;  2DS9 A;  1YTV A;  3WAF A;  1N0T A;  2VOZ A;  1I6B A;  3O6H A;  4G68 C;  5I56 A;  1I6Q A;  3KSX A;  1B5J A;  4WED A;  4DXC A;  3DP6 A;  1FQA A;  1MDQ A;  3QXM A;  3K6V A;  3H06 B;  2DE3 A;  1B3G A;  4Q0C A;  4RXL A;  1LBB A;  3ZKK A;  1YAE A;  3FV1 A;  4LP2 B;  3IX1 A;  2QS1 A;  5I58 B;  3CFZ A;  5HM4 B;  3BFT A;  4OHN A;  4THI A;  4FAT A;  5ITP A;  3MVW A;  4OVJ A;  5FTI A;  3IO6 A;  2Y7K A;  2I6E A;  2QPQ A;  4XKP A;  3UN6 A;  4R9G A;  1JVY A;  3MZB A;  3IOW A;  4ZED A;  1I69 A;  3QUF A;  1MM7 A;  2OBG A;  3HV1 A;  3M3F A;  3I6V A;  3O9P A;  3VVD A;  3G3F A;  3RTF B;  5LOM A;  5DEX A;  3L6H A;  4MF3 A;  4BDM A;  2O51 A;  1B3E A;  3PPN A;  3RTW B;  1MXW A;  3CVG A;  4IO6 A;  2XXI A;  3MPL A;  4LVQ A;  2NWJ A;  2XXH A;  1O64 A;  4OFO A;  1H3D A;  1H43 A;  4BDN A;  4F18 A;  3U93 A;  4O3A A;  3USD A;  3S9E A;  3PMW A;  4IO2 A;  4PE5 B;  4QFN A;  4EF1 A;  3IJO B;  3VFJ A;  3DEL B;  1LAH E;  1VR5 A;  2HCA A;  3VLW A;  4ONY A;  3B6W A;  4XIG Q;  1VFE A;  4KHZ E;  1USY H;  2QMW A;  1JVX A;  3FUZ A;  1QKA A;  3OEL A;  3OO8 A;  4GL0 A;  2ZYK A;  4KFQ A;  5CRY A;  4F3B A;  5CC2 A;  4P11 A;  5AA1 A;  2XXU A;  4IO3 A;  4RYA A;  4FAJ A;  5H8F B;  1MPB A;  4BDO A;  5L9M A;  1R9L A;  4MBP A;  2ZNT A;  4LUB A;  4OEU A;  3WAE A;  4PFY A;  5F1Q A;  4ECF A;  4EDP A;  5H8N B;  1MXY A;  1Q1K A;  1VFD A;  2HFB A;  4FEB A;  2XXV A;  4H0W A;  4JWO A;  3SES A;  5KCJ A;  2GHA A;  5DVJ A;  4R72 A;  2AIX A;  4G8N A;  3EHT A;  4H1X A;  2VHA A;  3GZG A;  5M2V A;  1JEV A;  2O69 A;  4KPT A;  3IOU A;  3LR1 A;  4OEV A;  3G3I A;  4R75 A;  5FHO A;  2Z8F A;  3T9V A;  1ATG A;  4OXV A;  2OWS A;  1MQH A;  3K01 A;  3E4R A;  4UA8 A;  5FHN A;  2F6P A;  1MY1 A;  4DE8 A;  4C1T A;  3TTL A;  5L9S A;  3LSF B;  3EHS A;  3CRB A;  3LSW A;  4L17 A;  1ZKB A;  3THI A;  1JQF A;  2DYX A;  2RC8 A;  3QK6 A;  4WXJ A;  1A40 A;  1XHY A;  1B51 A;  1TFD A;  2NOO A;  2OJT A;  3UGW A;  3MJN A;  4G68 A;  4AB6 A;  1N76 A;  5B70 A;  4NTL A;  1P99 A;  2ESN A;  4GWO A;  4NWC A;  2XXT A;  3B7D A;  1MY3 A;  2DXY A;  4JB7 A;  3TAJ A;  1B58 A;  1B5H A;  1FCK A;  1MS7 A;  1PEB A;  3FGS A;  1SBP A;  3A09 A;  4U4X A;  3VDF A;  2PX1 A;  3BKI B;  5BUU A;  4ZZA A;  2H25 A;  2Z22 A;  4WKM A;  2XX9 A;  4OET A;  3FVG A;  5KZT A;  4XKN A;  1IIT A;  4GXS B;  1MQJ A;  2R71 A;  3IOT A;  3KBR A;  1S7Y A;  4LQ2 A;  2OCU A;  2CMO A;  2ZXT A;  3MP8 A;  1FQC A;  2HZK A;  3W15 C;  1B2H A;  2Y7I A;  3O29 A;  1MH3 A;  4ZE8 A;  1EZO A;  2A5T B;  1IXC A;  3C34 A;  3HPI A;  1JNF A;  2HAV A;  4POW A;  1SYH A;  3ILT B;  4FEC A;  3QUJ A;  3R6U A;  4QFP A;  4RNS A;  1FQF A;  1GV8 A;  1MXU A;  1UQW A;  2ZMB A;  2HAU A;  4GF8 A;  4NWD A;  4U4S A;  3D4G A;  3SDF A;  3G3J A;  4C0R A;  3G3H A;  3KGC A;  1Y9U A;  2XHD A;  1TT1 A;  2I3V A;  3FV2 A;  4YMA A;  4IO4 A;  4YB7 A;  1IUD A;  3IB1 A;  4DDD A;  2KLF A;  1XVX A;  1B6H A;  4FOR A;  1B7Z A;  2YPN A;  5IAI A;  3AXF A;  4R6K A;  5TU0 A;  2CZL A;  4NF5 B;  1ZBM A;  2Z23 A;  3SET A;  5AA4 B;  1ZLQ A;  3VVE A;  2LAO A;  1B5I A;  1QJM A;  1JET A;  2OK2 A;  3CG1 A;  4DIG A;  4NED A;  5EHS A;  1ZJL A;  3K6U A;  3QSL A;  4MFI A;  5H8N A;  3Q27 A;  1BLF A;  4FE8 A;  1P1Q A;  4OFJ A;  4RPO A;  3UA8 A;  1QUI A;  1Y1M A;  5I2N A;  1OIB A;  4U23 A;  3PPP A;  2F36 A;  4KYE A;  1GVC A;  4ZEK A;  1D9V A;  2IA4 A;  1B0H A;  3T9X B;  4BDL A;  4F1U A;  4XTC Q;  1YPN A;  2UVH A;  2A5S A;  4U21 A;  1B40 A;  2GFE A;  3VE1 B;  4PFT A;  3S9N C;  1PB9 A;  4F2O A;  3EQ1 A;  4K3F A;  1A7L A;  3KN7 A;  4YKJ A;  1FTM A;  4IY6 A;  2I0B A;  1A54 A;  3K00 A;  4KI0 E;  4I62 A;  3M3L A;  3P7I A;  2Q8J A;  4LAT A;  4MH5 A;  4TLL B;  5I2K A;  3TTN A;  1LAX A;  2RKM A;  1OVT A;  2ONR A;  1SD3 A;  1MQG A;  4KQP A;  1XS5 A;  4PET A;  1BTJ A;  1Z7N E;  4C1U A;  2ZNU A;  5DYH A;  5JEI A;  2ZNS A;  1XOC A;  4NF8 B;  1WOD A;  3FZV A;  3PUY E;  1P1W A;  2DVC A;  2OWT A;  3VV5 A;  3IB0 A;  2H4I A;  1TFA A;  3OEN A;  3O6G A;  3QYT A;  4G2Z A;  3T96 B;  4Z7E A;  4ZEC A;  5DEX B;  4R9F A;  4F39 A;  4GVO A;  3SEV A;  1TWY A;  3UIF A;  2Z8D A;  1KWH A;  3N26 A;  5DVF A;  4Q5T A;  1URS A;  2DQV A;  4F3S A;  2FYI A;  2WKY A;  4YB6 A;  1XC1 A;  3B6T A;  1Y3Q A;  4ZDM A;  2O7U A;  2RCA A;  3IK6 B;  4EF2 A;  4YB5 A;  5HPQ A;  4F19 A;  1NL5 A;  1RYX A;  4MLV A;  3MPK A;  2PYY A;  3TEP A;  3FJG A;  1SYI A;  2GH9 A;  2PBW A;  1MQD A;  1MY2 A;  3IOR A;  5KDT A;  4YU0 A;  4LA9 A;  5ITO A;  3IAZ A;  5AA3 A;  2PMS A;  3EHU A;  3H6V A;  1NKX A;  1MY0 A;  1NNT A;  2B65 A;  4YAH X;  1Y4T A;  2OLB A;  5L8D A;  1MY4 A;  3FXQ A;  1MRP A;  1RKM A;  1B1X A;  5A5X A;  3FXU A;  2M8C A;  1FQD A;  3F11 A;  3IL1 B;  2NXO A;  2O84 X;  3PUZ E;  1ELJ A;  3DM0 A;  3TTK A;  5J1D A;  1DPP A;  3ZSF A;  4RPN A;  3PV0 E;  4HCW A;  3T9H B;  1LST A;  1XVY A;  4ZEF A;  4ZE9 A;  5A5X B;  2OZZ A;  5ELV A;  3GLB A;  2R9J A;  5FHM A;  3TCF A;  4G4P A;  4NE4 A;  3D4C A;  1EZP A;  4G8H A;  1ZIU A;  2A5T A;  1QUK A;  3PPQ A;  5I57 A;  3CR9 A;  3N94 A;  4KCC A;  1B3F A;  4R2B A;  2HZL A;  1WVJ A;  4U1O A;  5I84 A;  3KJ7 A;  3RGY A;  5ISU A;  1DTZ A;  1IXG A;  2V84 A;  4ZZE A;  1S9T A;  3SEX A;  3U92 A;  3TUS A;  1USY E;  1UTH B;  1B7H A;  2H5Y A;  1JW5 A;  3FJ7 A;  2P0S A;  1FW0 A;  1O7T A;  4QHQ A;  4I9D A;  1II5 A;  1LAG E;  3TPA A;  4DZ1 A;  1T0K A;  1NNP A;  3PD8 A;  3ILU B;  2F8D A;  3RY3 A;  4QFL A;  2QJE A;  2Z8E A;  1JEU A;  3TQW A;  1P1U A;  2AL5 A;  1Y1Z A;  4ELP A;  4OYV A;  3E13 X;  5K2Y A;  4F1V A;  4PP0 A;  3FXR A;  3MBP A;  5EYF A;  2IEE A;  1P1N A;  4X9T A;  5CBR A;  5L9O A;  4DXU A;  1PBQ A;  3RQT A;  3T93 B;  1UTH A;  5I59 B;  3MC2 A;  1LFH A;  1IZ1 A;  5I2K B;  3MP6 A;  3PUX E;  1SI1 A;  1M5B A;  3N6T A;  3OSQ A;  3KSJ A;  2DWI A;  3EPE A;  3MUQ A;  2UVG A;  3M8U A;  3QIM A;  1VE4 A;  2DWJ A;  5CM6 A;  2V93 A;  2DP8 A;  1IIW A;  2DOJ A;  3KN3 A; 
#chains in the Genus database with same CATH topology
 2THI A;  3GBA A;  4GRK A;  2F7C A;  4AB5 A;  1NV4 A;  2B3F A;  4LZ8 A;  4G68 B;  2DSF A;  1QUJ A;  4OER A;  3EN3 A;  3FJM A;  3HO7 A;  1N84 A;  2O7I A;  2Q9T A;  2UYE A;  3CFX A;  2RIN A;  4NQ8 A;  3TKD A;  4F29 A;  4M1V A;  4Q8R A;  2Y7R A;  3TCG A;  2Q88 A;  2X7P A;  1SW4 A;  4HS7 A;  1BKA A;  4QFO A;  4JVI A;  3IO4 A;  3HN0 A;  4P1L A;  4YIC A;  2O1L A;  4I3Y A;  3C35 A;  4N13 A;  1NV7 A;  2I49 A;  3EKI A;  3RT8 A;  4QSE A;  4F3G A;  4OWD A;  3PUV E;  1O63 A;  1M5E A;  4OEN A;  5CMK A;  2Q2C A;  1NH8 A;  4H8J A;  4N6D A;  3O2A A;  4HW8 A;  5AE4 A;  2Q8M A;  2DWA A;  2V3T A;  3FBP A;  3KEI A;  4GWY A;  4MX6 A;  1NFT A;  3K0V A;  3S2V A;  3N6U A;  4JSO A;  4O8M A;  4XFE A;  4N4U A;  1SW5 A;  4U1Z A;  1L5T A;  4N15 A;  3HHG A;  3KFM A;  3LBS A;  5ICT A;  1MPC A;  2REG A;  2FBP A;  3GYY A;  2QFL A;  2FIE A;  3CFL A;  4U22 A;  2XXW A;  2QS4 A;  3T1B A;  1GR2 A;  3DP8 A;  2HEU A;  2O1M A;  3C4M A;  2DXR A;  1DPE A;  3LV0 A;  1SI0 A;  5JK4 A;  4H8I A;  4MMP A;  4QSC A;  3I3V A;  1M5F A;  4GFR A;  3W9W A;  2L5V A;  3FVO A;  1LBX A;  3E78 A;  4QSD A;  5EQ8 A;  2F5X A;  2H98 A;  5DW8 A;  4RA1 A;  2X7Q A;  5TP9 A;  2PT2 A;  3S4U A;  2XXR A;  2VD3 A;  4JVC A;  5TP9 B;  2V3Q A;  1JP4 A;  4N6K A;  2Q74 A;  3H6W A;  4H6D A;  4FJP A;  1FTO A;  3U1O A;  4U2R A;  3CI8 A;  2XWV A;  3HHF A;  1M5D A;  4JSD A;  3LSX A;  1EYI A;  2P3N A;  5H8H A;  5H8F A;  4PF6 A;  3VXB A;  5I2N B;  5H8H B;  3VVF A;  4XKR A;  3B6Q A;  1Q35 A;  1UTB B;  3KOT A;  3LUY A;  2P1S A;  3LSL A;  1NNK A;  1PDA A;  4PDH A;  3C36 A;  3TZA A;  3BFU A;  3KG2 A;  5EYG A;  2XXY A;  4QF9 A;  3K6X A;  4GOT A;  3SEU A;  3FVK A;  1B0L A;  4P0I A;  1ZU0 A;  4R74 A;  3FVN A;  4POX A;  3PD9 A;  4F18 A;  4IGR A;  2XD2 A;  4KCD A;  4OES A;  1FPG A;  4NF8 A;  2RC9 A;  4BLA A;  2Y7W A;  1K9Z A;  1YTV A;  1FPL A;  1I6Q A;  4WED A;  1B5J A;  3H06 B;  1B3G A;  3ZKK A;  1YAE A;  3FV1 A;  3IX1 A;  1QGX A;  4FAT A;  5FTI A;  2Y7K A;  4PBQ A;  3I6V A;  3O9P A;  3RTF B;  4IO6 A;  3MPL A;  1FPJ A;  4OFO A;  1H3D A;  4IO2 A;  5IGA A;  1LAH E;  3B6W A;  5CRY A;  4KFQ A;  1QKA A;  5ET7 A;  3OO8 A;  2P3V A;  2XXU A;  4PFB A;  4PGN A;  4ECF A;  1RDZ A;  2GHA A;  3EHT A;  5M2V A;  1JEV A;  3IOU A;  4OEV A;  3K01 A;  5FHN A;  1MY1 A;  4C1T A;  3LSF B;  3EHS A;  3LSW A;  4OAN A;  1JQF A;  4G68 A;  2CZI A;  4AB6 A;  2ESN A;  2DXY A;  3TAJ A;  1B58 A;  2XWI A;  1SBP A;  2PX1 A;  2XWO A;  2XX9 A;  4OET A;  4LQ2 A;  1IMD A;  4LN5 A;  1FQC A;  2Y7I A;  4ZE8 A;  1IXC A;  3HPI A;  1JNF A;  2HAV A;  4GWU A;  1UQW A;  3D4G A;  3SDF A;  1Y9U A;  2I3V A;  3FV2 A;  1RDY A;  1IUD A;  5I7I A;  1B7Z A;  2Z23 A;  5AA4 B;  3SET A;  1ZLQ A;  2OK2 A;  4PCD A;  1ZJL A;  4MFI A;  3Q27 A;  1BLF A;  4FE8 A;  1P1Q A;  4OFJ A;  1QUI A;  1Y1M A;  4H46 A;  3BIG A;  4XTC Q;  1PB9 A;  3EQ1 A;  4I40 A;  1A54 A;  3M3L A;  4TLL B;  4NF8 B;  2DVC A;  2OWT A;  3VV5 A;  3IB0 A;  2H4I A;  4Z7E A;  3OEN A;  3T96 B;  4ZEC A;  5DEX B;  1TWY A;  2CEX A;  1IMF A;  3N26 A;  3B6T A;  1Y3Q A;  2O7U A;  5HPQ A;  1NL5 A;  4MLV A;  1DCU A;  3TEP A;  3FJG A;  1SYI A;  1D9Q A;  1MY2 A;  5AA3 A;  4YAH X;  4NG7 A;  1MY0 A;  2OLB A;  4N91 A;  3FXQ A;  3FXU A;  1FQD A;  3F11 A;  5J1D A;  4RPN A;  1LST A;  1XVY A;  3GLB A;  2QVV A;  1ZIU A;  3A29 A;  5I57 A;  3T0J A;  4U1O A;  2HZL A;  4GWZ A;  3RGY A;  1IXG A;  1USY E;  2H5Y A;  5ESY A;  1JW5 A;  2QJE A;  1JEU A;  1P1U A;  4OVP A;  4ELP A;  4F1V A;  4X9T A;  1PBQ A;  1IME A;  2WEF A;  5I2K B;  2DWI A;  3EPE A;  3QIM A;  1IIW A;  3TQL A;  3RPW A;  5I58 A;  3Q28 A;  1LCT A;  2AYS A;  1MXX A;  1B52 A;  5TPA A;  1FJ6 A;  1FBG A;  3FD3 A;  1A99 A;  3CSB A;  5B7D A;  3IFC A;  1I6A A;  3K1P A;  5IKB A;  1NNF A;  1QKB A;  1AMF A;  2D5W A;  4R6Y A;  4Z0I A;  4OTE A;  1FTL A;  3OSR A;  1DSN A;  1LBZ A;  2X26 A;  5JTY B;  1CE2 A;  1XT8 A;  2F34 A;  1IEJ A;  4ELO A;  1OQG A;  4GX4 A;  5IZ3 B;  1FQB A;  1EYJ A;  4OFL A;  4MIJ A;  1UIU A;  4OVS A;  1B7U A;  1B46 A;  3OO7 A;  4PFU A;  4PF8 A;  2ALU A;  3I5O A;  4NF5 A;  5ET8 A;  4IO7 A;  2GQ1 A;  4ZEI A;  4JWX A;  1NV0 A;  1ZTY A;  1LLS A;  4KXP A;  5CMB A;  5ICQ A;  1YCJ A;  4R2F A;  1VSO A;  4P1E A;  4XXU A;  1BIY A;  1MG1 A;  1LCF A;  2ZYM A;  2VD2 A;  3PU5 A;  1LFG A;  3Q29 A;  1AIV A;  4PQJ A;  2ZZV A;  3TTM A;  3A3C A;  3Q26 A;  3H7M A;  4IY5 A;  4G8M A;  3BBR A;  1IQ7 A;  1TXF A;  2QS3 A;  2Y5K A;  1Y4C A;  3OOA A;  3IOV A;  3HCQ A;  5HBC A;  3OO6 A;  1LB8 A;  1R1N A;  4O3C A;  1HSE A;  1OMP A;  1US4 A;  5CBS A;  1Y20 A;  1FBD A;  5LTC A;  4JBZ A;  1B4Z A;  3QAX A;  1IXI A;  3RPL B;  3K6W A;  4YZZ A;  3O97 A;  2P2A A;  3KJT A;  4PAI A;  4ESX A;  2PT1 A;  1PC3 A;  3KZG A;  2QL3 A;  4R73 A;  1LB9 A;  3U8Q A;  5CMC A;  3H6U A;  5F7V A;  1UTB A;  1PB8 A;  2D21 A;  4DLD A;  1B32 A;  3OO9 A;  1Y3P A;  1RYO A;  3VLV A;  3ZS6 A;  4MNP A;  4ZEB A;  2YLN A;  3MVY A;  3RT6 B;  4JXI A;  1NV6 A;  5AA2 D;  2Y5L A;  2NUV A;  3IB2 A;  3TCH A;  4OMB A;  3GXA A;  5IZ1 A;  2FHY A;  4GLI A;  5IZ3 A;  4AS5 A;  2XA5 A;  4NGU A;  2FNC A;  3K1N A;  5IZZ A;  2O6A A;  3O28 A;  5LDZ A;  3TTR A;  3CSG A;  2G93 A;  1SQY A;  5BWJ A;  1M5C A;  3KOS A;  2ONS A;  4JDF A;  3UP9 A;  3H3G A;  1ANF A;  1YXI A;  5DVF A;  5I59 B;  3T22 A;  3HST A;  4DI4 B;  4F3B A;  4YKI A;  2I4C A;  2XXP A;  4NMY A;  4NF6 A;  1P1O A;  1DOT A;  2VP1 A;  4YKP A;  4X48 A;  4GIZ A;  1N0T A;  2VOZ A;  1I6B A;  3O6H A;  5I56 A;  3KSX A;  1MDQ A;  1NUX A;  4RXL A;  2CEY A;  2WBB A;  4THI A;  4N8G A;  5ITP A;  4OVJ A;  3UN6 A;  1JVY A;  3IOW A;  3QUF A;  2OBG A;  3HV1 A;  3M3F A;  3VVD A;  4MF3 A;  3RTW B;  2XXI A;  4LVQ A;  2WX9 A;  1G0H A;  1H43 A;  3U93 A;  4O3A A;  4PE5 B;  4QFN A;  4NF0 A;  3VFJ A;  3DEL B;  2HCA A;  4XIG Q;  4KHZ E;  2QMW A;  4UAB A;  5AA1 A;  4FAJ A;  4P8B A;  1R9L A;  2ZNT A;  4LUB A;  5F1Q A;  4EDP A;  2JJK A;  2HFB A;  3IFA A;  5KCJ A;  1FJ9 A;  2AIX A;  4H1X A;  4R72 A;  4KPT A;  3LR1 A;  3T9V A;  1ATG A;  2OWS A;  5F24 A;  5L9S A;  3CRB A;  1ZKB A;  2RC8 A;  4WXJ A;  2OJT A;  2NOO A;  1N76 A;  4NTL A;  4GWO A;  1B5H A;  1FCK A;  1XI6 A;  1MS7 A;  3FGS A;  3A09 A;  3BKI B;  5BUU A;  4ZZA A;  2H25 A;  4GXS B;  1MQJ A;  3IOT A;  2ZXT A;  3MP8 A;  2HZK A;  3W15 C;  3O29 A;  2A5T B;  4POW A;  3ILT B;  1GV8 A;  3QUJ A;  3R6U A;  1FQF A;  1TT1 A;  5FBP A;  5J16 A;  5IAI A;  1B6H A;  1XVX A;  2CZL A;  4NF5 B;  2FIX A;  1NI9 A;  1JET A;  3CG1 A;  4QBA A;  4DIG A;  5EHS A;  3K6U A;  3UA8 A;  4RPO A;  4PBH A;  5I2N A;  1OIB A;  3PPP A;  4ZEK A;  2IA4 A;  5ET6 A;  1G0I A;  3KBZ A;  3T9X B;  4BDL A;  1YPN A;  2UVH A;  2A5S A;  3VE1 B;  3S9N C;  4K3F A;  4YKJ A;  5EQ7 A;  1FTM A;  1EYK A;  5I2K A;  1OVT A;  4PET A;  1Z7N E;  2ZNU A;  5JEI A;  1XOC A;  1WOD A;  3FZV A;  1P1W A;  4R9F A;  4F39 A;  4F3S A;  2FYI A;  4MNI A;  4EF2 A;  3IK6 B;  2PYY A;  2GH9 A;  5KDT A;  4LA9 A;  5ITO A;  3IAZ A;  1LBV A;  2VPO A;  3EHU A;  1Y4T A;  1MRP A;  2M8C A;  3IL1 B;  4P47 A;  1DPP A;  3ZSF A;  2B4M A;  4HCW A;  5A5X B;  2OZZ A;  1VDW A;  3TCF A;  4G4P A;  4G8H A;  2A5T A;  1QUK A;  3N94 A;  1B3F A;  4MCO A;  3KJ7 A;  5ISU A;  1DTZ A;  2V84 A;  3TUS A;  4HE1 A;  4NN3 A;  1FW0 A;  1O7T A;  4QHQ A;  4I9D A;  1II5 A;  1LAG E;  4GWW A;  3RY3 A;  3QMF A;  2Z8E A;  4OYV A;  4PP0 A;  4GBV A;  5L9O A;  3MC2 A;  3U65 A;  4MEV A;  1M5B A;  3OSQ A;  5CM6 A;  2DP8 A;  2DOJ A;  4KQP A;  3KN3 A;  1LBC A;  3MYU A;  3IR1 A;  4HE0 A;  3RLF E;  4YMB A;  1QUL A;  1MDP 1;  3LC8 A;  1SVX B;  2ABH A;  4RY1 A;  3ODB A;  2ANJ A;  2W7Y A;  3B8B A;  3ECR A;  2DVZ A;  2O68 A;  4H5F A;  4XKQ A;  4ND9 A;  1Z7M E;  1H76 A;  4P56 A;  3K4U A;  1URD A;  2NVU B;  3ISP A;  1NV2 A;  2F97 A;  3R7X A;  3U94 A;  3CG3 A;  2Q89 A;  2E1S A;  2UXA A;  4QRZ A;  3MQ9 A;  3S9E A;  5CI5 A;  3MAM A;  3V83 A;  2I4B A;  5K2X A;  5CMM A;  4I1D A;  4OZ9 A;  1POT A;  3SKP A;  4EQ9 A;  3UK4 A;  4AQ4 A;  1MPD A;  4E0X A;  4WEP A;  2ZZW A;  3IJX B;  4HCY A;  2DWH A;  2PFZ A;  5TPA B;  3ZKL A;  4Q30 B;  2G29 A;  4ELQ A;  3R26 A;  2V3U A;  4IGT A;  1MM6 A;  3SEY A;  1AOV A;  2KR0 A;  1N7W A;  4DCY A;  4O3B A;  2REJ A;  1D4N A;  3E3K A;  3TFL A;  3EF7 A;  4LQ5 A;  1N3X A;  2VPN A;  4TLM B;  2ONK E;  4JVD A;  4NF4 B;  3PGF A;  1OLC A;  1B4H A;  1B9J A;  3ONM A;  1B3H A;  3MVZ A;  4KYD A;  4N17 A;  4EUO A;  3TYH A;  4EQB A;  4IB2 A;  2HXW A;  4H67 A;  2PVU A;  4BDQ A;  4GL8 A;  3RN8 A;  2XXQ A;  4X1D A;  4GWX A;  2B3B A;  3E9X A;  3OMB A;  5EQ9 A;  4MLQ A;  2RF1 A;  3W9V A;  2F78 A;  4P0G A;  1D9Y A;  3H4Z A;  5DVI A;  1INP A;  2XD3 A;  4GQO A;  4UAC A;  2HXR A;  4QFK A;  4ESW A;  4F2Q A;  3SZP A;  2F7B A;  4BDR A;  1QW0 A;  3OEK A;  4JWY A;  3UOR A;  3CIJ A;  1NH7 A;  2QMX A;  1GTK A;  5ET5 A;  3A3U A;  1URG A;  4F3P A;  2QVR A;  4N07 A;  2QS2 A;  3PUW E;  5EHM A;  1KA0 A;  1SW2 A;  1FTA A;  1MXZ A;  3M3K A;  4EXL A;  3NOH A;  3Q25 A;  1KA1 A;  4E0W A;  3S9L C;  1FPF A;  4HTG A;  4N8Y A;  4EXK A;  3KN8 A;  2UVJ A;  2ZYN A;  1B3L A;  2F35 A;  1MXV A;  4PFW A;  4NF4 A;  4TOZ A;  1LAF E;  5DTB A;  4PAK A;  2QSX A;  2GRV A;  1PBP A;  4MNC A;  5AA2 A;  4NAP A;  1JW1 A;  4GX3 A;  2BJJ X;  5I5P A;  2F3B A;  2VT5 A;  5JTY A;  1R9Q A;  2XXX A;  1Q9D A;  4G61 A;  3PPO A;  3H6T A;  3VVE A;  4GX6 A;  4H65 A;  4FED A;  4OQO A;  1B05 A;  2CZK A;  2HQ0 A;  4TQU Q;  2RCB A;  2WYP A;  1NMU A;  3RNN A;  3WAF A;  3DP6 A;  1FQA A;  3K6V A;  1LBB A;  2ZZX A;  5EQA A;  4LP2 B;  2QS1 A;  5I58 B;  5HM4 B;  3BFT A;  4PGP A;  3MVW A;  3IO6 A;  2I6E A;  4XKP A;  3MZB A;  1I69 A;  3G3F A;  5LOM A;  3L6H A;  4H45 A;  3PPN A;  3CVG A;  3KC1 A;  2XXH A;  1RDX A;  3USD A;  1FBH A;  4EF1 A;  1USY H;  2B4L A;  3OEL A;  2ZYK A;  5CC2 A;  4IO3 A;  1MPB A;  4BDO A;  1FSA A;  3WAE A;  4PFY A;  1IMA A;  5H8N B;  1Q1K A;  1VFD A;  4FEB A;  4JWO A;  2XXV A;  5DVJ A;  2QVU A;  4G8N A;  2VHA A;  3GZG A;  5FHO A;  2DDK A;  4OXV A;  4UA8 A;  3E4R A;  4DE8 A;  2F6P A;  1DBZ A;  4IR8 A;  3THI A;  1XHY A;  1B51 A;  1TFD A;  4OA4 A;  5B70 A;  1P99 A;  4NWC A;  2XXT A;  3B7D A;  1FPK A;  1PEB A;  3FVG A;  5KZT A;  4XKN A;  2OCU A;  1B2H A;  1EZO A;  1SYH A;  4QFP A;  2ZMB A;  4GF8 A;  4U4S A;  4C0R A;  3G3H A;  2XHD A;  4YMA A;  3IB1 A;  4DDD A;  2YPN A;  3AXF A;  5TU0 A;  2LAO A;  1B5I A;  4ZE9 A;  5H8N A;  4NED A;  4U23 A;  2F36 A;  1D9V A;  5EYH A;  1B0H A;  4F1U A;  1B40 A;  2GFE A;  4PFT A;  3KN7 A;  2I0B A;  3K00 A;  4KI0 E;  4I62 A;  2Q8J A;  4LAT A;  4MH5 A;  1LAX A;  2RKM A;  2ONR A;  1FPI A;  1CNQ A;  4PE3 A;  4G2Z A;  3QYT A;  3FXB A;  4GVO A;  3SEV A;  1BK4 A;  3UIF A;  1URS A;  4YB6 A;  1XC1 A;  4ZDM A;  4YB5 A;  1RYX A;  4OVQ A;  2PBW A;  4N81 A;  3H6V A;  1MY4 A;  2OX3 A;  1RKM A;  1B1X A;  2KQZ A;  3DM0 A;  4MHF A;  4ZEF A;  5ELV A;  4NE4 A;  4QXD A;  5A5L A;  1NUY A;  1NV1 A;  4R2B A;  1AWB A;  4ZZE A;  3SEX A;  3U92 A;  2V4C A;  1UTH B;  3FJ7 A;  2XXK A;  1T0K A;  1NNP A;  3PD8 A;  3ILU B;  2F8D A;  4QFL A;  3TQW A;  3E13 X;  5K2Y A;  5EYF A;  5CBR A;  2IEE A;  4DXU A;  3T93 B;  3RQT A;  1LFH A;  3PTY A;  4GWS A;  1IZ1 A;  1SI1 A;  3MUQ A;  1VE4 A;  2I0C A;  2V93 A;  5KCJ B;  1H44 A;  4F31 B;  1EZ9 A;  3GBB A;  2DE4 A;  1OVB A;  3DP4 A;  4FBP A;  3VDF A;  2FA7 A;  1SW1 A;  1QVS A;  5I56 B;  1NV3 A;  1DMB A;  2F3D A;  4LON B;  1FRP A;  2I48 A;  1AH5 A;  1H45 A;  1F9B A;  1JW4 A;  3MW0 A;  1LFI A;  1LEV A;  1FPB A;  2XX8 A;  3B50 A;  1OQH A;  1MH4 A;  1OLA A;  3SER A;  4EQ7 A;  5AA2 B;  3C33 A;  2AL4 A;  3K02 A;  3K2D A;  4ELR A;  4NX1 A;  1IXH A;  1FPE A;  3H03 A;  5H8Q B;  3TOD A;  1NUW A;  3OXN A;  4O94 A;  1ZMG A;  1YZ0 A;  4H5G A;  1K9Y A;  4ZS9 A;  3OEM A;  2ZYO A;  2UYF A;  4F22 A;  2E0S A;  1HSJ A;  1J1N A;  3VLU A;  2UVI A;  3KC0 A;  3RUM A;  4X1B A;  3O6I A;  4FIM A;  4PC9 A;  4G77 A;  1LBW A;  1MQI A;  2F7A A;  4N6P A;  1Y3N A;  3DLN A;  4RK9 A;  1FTK A;  3U72 A;  4GD5 A;  3JV9 A;  2I3W A;  2D3I A;  1DK4 A;  3C32 A;  1WDN A;  4NF6 B;  4MJO A;  1FQE A;  2H99 A;  3TDJ A;  1B1H A;  3CHG A;  3O66 A;  1S50 A;  1N3W A;  4P3L A;  5DT6 A;  3TEL A;  1BP5 A;  1UIV A;  2RC7 A;  4ISU A;  3T66 A;  3MP1 A;  4DXB A;  2QRY A;  2Y84 A;  5AA4 A;  3G3K A;  4KYS A;  2YJP A;  3TMG A;  4PDD A;  1AL3 A;  2Q2A A;  4GXA A;  4F1Y A;  3JYR A;  2H9B A;  1POY 1;  5H8Q A;  1A55 A;  4RK2 A;  3C9H A;  2BJI A;  2F6G A;  4KD5 A;  3VXC A;  5T3J A;  5I59 A;  3FAT A;  2MKZ A;  4R6H A;  4LZ7 A;  3S9M C;  3MZ1 A;  4O7I A;  2R6G E;  1N7X A;  2VGQ A;  1D3K A;  1HSL A;  1FPD A;  3PMX A;  1PB7 A;  2V25 A;  1YYZ A;  3V5A A;  4IO5 A;  2GHB A;  3G7W A;  1A8E A;  3PPR A;  3HFU A;  3SEW A;  3FAS A;  1GGG A;  2DE2 A;  5H8S A;  1EU8 A;  3MZ9 A;  4RJZ A;  1US5 A;  5I57 B;  3T9U A;  4X04 A;  4I8C A;  4YKK A;  2WBD A;  4DCX A;  3JZJ A;  2Y7P A;  1R6Z A;  3OD7 A;  1LGB C;  1A8F A;  1DTG A;  3C31 A;  4M4G A;  5KDT B;  3N5L A;  3MVX A;  3G3G A;  1FBE A;  1CB6 A;  2I58 A;  2WYK A;  3FIR A;  4DI3 D;  2HHM A;  1SDX A;  1N04 A;  3V8X B;  4P9K A;  3PMV A;  4PTK A;  3L6G A;  2XX7 A;  4KR5 A;  3MWB A;  2OWZ A;  3K1M A;  1FTJ A;  1EH3 A;  3V89 B;  2DS9 A;  4G68 C;  4DXC A;  3QXM A;  4GBW A;  2DE3 A;  4Q0C A;  3CFZ A;  4XF5 A;  4OHN A;  3D1R A;  2QPQ A;  4R9G A;  4ZED A;  1MM7 A;  4HXV A;  5DEX A;  4BDM A;  2O51 A;  1B3E A;  1MXW A;  2NWJ A;  1O64 A;  4BDN A;  1NV5 A;  3PMW A;  3IJO B;  1VR5 A;  3VLW A;  4OVT A;  4ONY A;  1VFE A;  1JVX A;  3FUZ A;  4GL0 A;  4P11 A;  4RYA A;  3RPL A;  4NHB A;  5H8F B;  1SPI A;  5L9M A;  3MST A;  4MBP A;  4OEU A;  1FBP A;  1MXY A;  3SES A;  4H0W A;  4O7M A;  2R8T A;  4I3E A;  2O69 A;  4R75 A;  3G3I A;  2Z8F A;  1MQH A;  3TTL A;  4L17 A;  2DYX A;  3QK6 A;  1A40 A;  3UGW A;  3MJN A;  4OVR A;  1MY3 A;  4JB7 A;  4U4X A;  2Z22 A;  4WKM A;  1IIT A;  4HE2 A;  2R71 A;  3KBR A;  1S7Y A;  2CMO A;  1MH3 A;  3C34 A;  5IM2 A;  2XWK A;  4FEC A;  4RNS A;  1MXU A;  4AS4 A;  2HAU A;  4NWD A;  3G3J A;  3KGC A;  4IO4 A;  4YB7 A;  2KLF A;  4FOR A;  4R6K A;  1ZBM A;  1LBY A;  1FBF A;  1QJM A;  3QSL A;  4KYE A;  1GVC A;  1IMC A;  4U21 A;  2HPG A;  4F2O A;  1A7L A;  4X8R A;  4IY6 A;  4PFR A;  4XEQ A;  2PFY A;  3P7I A;  3TTN A;  1SD3 A;  1MQG A;  4PFI A;  1XS5 A;  1BTJ A;  4C1U A;  5DYH A;  2ZNS A;  3PUY E;  1TFA A;  3O6G A;  5I3S A;  3ROJ A;  2Z8D A;  1KWH A;  4Q5T A;  2DQV A;  2WKY A;  2RCA A;  4F19 A;  3MPK A;  1MQD A;  3IOR A;  4YU0 A;  2PCR A;  2PMS A;  1NKX A;  1NNT A;  2B65 A;  5L8D A;  1KZ8 A;  5A5X A;  2NXO A;  2O84 X;  3PUZ E;  1ELJ A;  3TTK A;  2CZH A;  1FBC A;  3RYD A;  3PV0 E;  3T9H B;  5FHM A;  2R9J A;  3D4C A;  1EZP A;  3PPQ A;  3CR9 A;  1NUZ A;  4KCC A;  5I84 A;  1WVJ A;  2FVZ A;  1S9T A;  3LUZ A;  4PAF A;  1B7H A;  2P0S A;  3TPA A;  4DZ1 A;  2AL5 A;  1Y1Z A;  4MAG A;  3FXR A;  3MBP A;  1P1N A;  1UTH A;  1IMB A;  3MP6 A;  3PUX E;  3N6T A;  3KSJ A;  3E79 A;  2UVG A;  3M8U A;  3BIH A;  2DWJ A;  4LZ5 A;  5FTH A; 
#chains in the Genus database with same CATH homology
 2THI A;  3TQL A;  3GBA A;  1LBC A;  3RPW A;  5I58 A;  3Q28 A;  3IR1 A;  4GRK A;  5KCJ B;  1H44 A;  4F31 B;  1EZ9 A;  2F7C A;  1LCT A;  3GBB A;  4AB5 A;  3RLF E;  4YMB A;  2DE4 A;  1QUL A;  1MDP 1;  2B3F A;  1OVB A;  4LZ8 A;  3DP4 A;  3LC8 A;  2AYS A;  1SVX B;  1MXX A;  2ABH A;  2DSF A;  2FA7 A;  4G68 B;  4RY1 A;  1B52 A;  1QUJ A;  3ODB A;  2ANJ A;  2W7Y A;  1SW1 A;  3ECR A;  2DVZ A;  1QVS A;  3EN3 A;  3FJM A;  3HO7 A;  3FD3 A;  4OER A;  5TPA A;  5I56 B;  1DMB A;  1N84 A;  1A99 A;  2O68 A;  2O7I A;  4LON B;  3CSB A;  2Q9T A;  2UYE A;  2I48 A;  3CFX A;  4H5F A;  1AH5 A;  5B7D A;  1H45 A;  4XKQ A;  2RIN A;  4ND9 A;  3TKD A;  1F9B A;  4F29 A;  1Z7M E;  4M1V A;  1JW4 A;  1H76 A;  3MW0 A;  2Y7R A;  4Q8R A;  1LFI A;  3K4U A;  1URD A;  1I6A A;  2NVU B;  3K1P A;  2F97 A;  3R7X A;  3U94 A;  1NNF A;  1QKB A;  2XX8 A;  5IKB A;  3CG3 A;  3TCG A;  1AMF A;  2D5W A;  1OQH A;  2Q89 A;  4OTE A;  4R6Y A;  1FTL A;  4Z0I A;  3OSR A;  1DSN A;  2E1S A;  1MH4 A;  1OLA A;  2Q88 A;  2UXA A;  2X7P A;  3MQ9 A;  4QRZ A;  3SER A;  5CI5 A;  4EQ7 A;  3MAM A;  2X26 A;  5AA2 B;  3C33 A;  4XKR A;  1SW4 A;  5JTY B;  1CE2 A;  3V83 A;  2AL4 A;  2I4B A;  3K02 A;  4HS7 A;  1BKA A;  5CMM A;  5K2X A;  4QFO A;  4I1D A;  3IO4 A;  3K2D A;  3HN0 A;  4OZ9 A;  4ELR A;  1POT A;  1XT8 A;  2F34 A;  4YIC A;  3SKP A;  2O1L A;  1IXH A;  4EQ9 A;  3UK4 A;  4LZ5 A;  1IEJ A;  4AQ4 A;  3C35 A;  4N13 A;  4ELO A;  3H03 A;  1OQG A;  1MPD A;  2I49 A;  5H8Q B;  4E0X A;  4WEP A;  3TOD A;  3OXN A;  3RT8 A;  4QSE A;  3IJX B;  4F3G A;  4OWD A;  1FQB A;  3PUV E;  1O63 A;  1ZMG A;  1M5E A;  2DWH A;  4HCY A;  4OEN A;  4H5G A;  4OFL A;  4ZS9 A;  1UIU A;  5CMK A;  5TPA B;  3OEM A;  2ZYO A;  1B7U A;  2UYF A;  2G29 A;  4Q30 B;  2Q2C A;  3ZKL A;  1NH8 A;  4ELQ A;  4F22 A;  1B46 A;  4H8J A;  2E0S A;  3R26 A;  1HSJ A;  2V3U A;  3O2A A;  4HW8 A;  1J1N A;  3VLU A;  5AE4 A;  2UVI A;  3OO7 A;  4PFU A;  3RUM A;  4X1B A;  3O6I A;  2ALU A;  3I5O A;  4FIM A;  4G77 A;  2DWA A;  2V3T A;  1MQI A;  2F7A A;  3KEI A;  4N6P A;  1NFT A;  3K0V A;  1Y3N A;  3S2V A;  4NF5 A;  4IO7 A;  3DLN A;  4RK9 A;  4IGT A;  1FTK A;  3N6U A;  3U72 A;  1MM6 A;  4JSO A;  3SEY A;  4GD5 A;  4ZEI A;  1AOV A;  1N7W A;  1SW5 A;  4DCY A;  4JWX A;  3JV9 A;  1ZTY A;  2I3W A;  4O3B A;  2D3I A;  4U1Z A;  1L5T A;  1LLS A;  3HHG A;  5CMB A;  2REJ A;  1D4N A;  3KFM A;  3LBS A;  3E3K A;  3C32 A;  1WDN A;  4NF6 B;  5ICT A;  1MPC A;  1YCJ A;  3TFL A;  1FQE A;  4R2F A;  2H99 A;  2REG A;  3TDJ A;  1B1H A;  5ICQ A;  1VSO A;  3EF7 A;  3O66 A;  4LQ5 A;  1S50 A;  1N3X A;  1N3W A;  4TLM B;  4XXU A;  5DT6 A;  2ONK E;  1BP5 A;  3TEL A;  1BIY A;  1MG1 A;  1LCF A;  1UIV A;  2ZYM A;  3CFL A;  2VD2 A;  4NF4 B;  4U22 A;  3PGF A;  1LFG A;  2RC7 A;  1OLC A;  2XXW A;  3PU5 A;  2QS4 A;  1B4H A;  3Q29 A;  1B9J A;  1GR2 A;  3ONM A;  1AIV A;  4ISU A;  1B3H A;  3MVZ A;  4KYD A;  3DP8 A;  4PQJ A;  3T66 A;  3TTM A;  4EUO A;  2HEU A;  3MP1 A;  3TYH A;  2O1M A;  3A3C A;  4EQB A;  3C4M A;  4IB2 A;  2DXR A;  2HXW A;  4H67 A;  4DXB A;  2PVU A;  1DPE A;  2QRY A;  2Y84 A;  3Q26 A;  3H7M A;  4GL8 A;  4IY5 A;  3RN8 A;  4G8M A;  4BDQ A;  3BBR A;  1SI0 A;  2XXQ A;  4X1D A;  5AA4 A;  5JK4 A;  3G3K A;  1IQ7 A;  4H8I A;  1TXF A;  2QS3 A;  4KYS A;  2YJP A;  2B3B A;  1Y4C A;  3I3V A;  4QSC A;  1M5F A;  3E9X A;  4GFR A;  3TMG A;  3W9W A;  3OOA A;  1AL3 A;  3IOV A;  3FVO A;  2Q2A A;  3OMB A;  4MLQ A;  2RF1 A;  4GXA A;  4OQO A;  3JYR A;  2F78 A;  3W9V A;  4F1Y A;  3HCQ A;  4P0G A;  1D9Y A;  3OO6 A;  4QSD A;  5HBC A;  3H4Z A;  1LB8 A;  1R1N A;  1POY 1;  2F5X A;  2H9B A;  5DVI A;  2H98 A;  4O3C A;  1HSE A;  5H8Q A;  1A55 A;  1OMP A;  4RK2 A;  1US4 A;  4RA1 A;  3C9H A;  2F6G A;  4KD5 A;  2XD3 A;  4GQO A;  4UAC A;  3VXC A;  5CBS A;  3FAT A;  5I59 A;  1Y20 A;  2X7Q A;  5TP9 A;  4QFK A;  2PT2 A;  4JBZ A;  5F7V A;  1B4Z A;  4ESW A;  4F2Q A;  3QAX A;  3S4U A;  2XXR A;  1IXI A;  4R6H A;  2I0C A;  2VD3 A;  5TP9 B;  4LZ7 A;  3K6W A;  3S9M C;  2V3Q A;  2F7B A;  4YZZ A;  3O97 A;  3MZ1 A;  4BDR A;  3H6W A;  4H6D A;  4FJP A;  2R6G E;  1FTO A;  3U1O A;  1N7X A;  1QW0 A;  2P2A A;  3KJT A;  2VGQ A;  1D3K A;  3OEK A;  4JWY A;  4U2R A;  4ESX A;  3UOR A;  1HSL A;  3CIJ A;  3CI8 A;  2PT1 A;  3PMX A;  1PB7 A;  2V25 A;  1NH7 A;  3V5A A;  3HHF A;  4IO5 A;  2GHB A;  2QMX A;  1GTK A;  3G7W A;  1A8E A;  1M5D A;  3PPR A;  4JSD A;  3A3U A;  3LSX A;  5FTH A;  1PC3 A;  1URG A;  4F3P A;  4N07 A;  3KZG A;  2QL3 A;  4R73 A;  1LB9 A;  3U8Q A;  5CMC A;  3H6U A;  2QS2 A;  3SEW A;  2D21 A;  1UTB A;  1PB8 A;  1GGG A;  3FAS A;  3PUW E;  2DE2 A;  1B32 A;  3OO9 A;  5EHM A;  5H8S A;  4DLD A;  1EU8 A;  1SW2 A;  3MZ9 A;  4RJZ A;  1Y3P A;  1RYO A;  1MXZ A;  3VLV A;  3ZS6 A;  1US5 A;  3M3K A;  5H8H A;  4ZEB A;  4EXL A;  5H8F A;  5I57 B;  3VXB A;  2YLN A;  3Q25 A;  3MVY A;  3T9U A;  4E0W A;  3RT6 B;  5I2N B;  5H8H B;  3S9L C;  4I8C A;  4JXI A;  3VVF A;  4HTG A;  4EXK A;  5AA2 D;  4YKK A;  3KN8 A;  2NUV A;  3IB2 A;  3TCH A;  4OMB A;  4DCX A;  2UVJ A;  2ZYN A;  1B3L A;  1Q35 A;  1UTB B;  2F35 A;  3B6Q A;  3GXA A;  3KOT A;  1MXV A;  4GLI A;  4PFW A;  3JZJ A;  3LUY A;  4NF4 A;  2P1S A;  3LSL A;  1NNK A;  2FNC A;  2Y7P A;  3K1N A;  2O6A A;  1R6Z A;  3O28 A;  1PDA A;  3OD7 A;  1LGB C;  3TTR A;  3C36 A;  3CSG A;  4TOZ A;  3TZA A;  2G93 A;  1A8F A;  3BFU A;  1LAF E;  3KG2 A;  5DTB A;  1SQY A;  1DTG A;  2XXY A;  3C31 A;  4M4G A;  5BWJ A;  5KDT B;  2QSX A;  1M5C A;  3N5L A;  2GRV A;  3MVX A;  1PBP A;  3KOS A;  4QF9 A;  3K6X A;  5AA2 A;  3G3G A;  2ONS A;  4JDF A;  3UP9 A;  1CB6 A;  2I58 A;  1JW1 A;  4GOT A;  3SEU A;  3FIR A;  3FVK A;  1B0L A;  2BJJ X;  4P0I A;  3H3G A;  1SDX A;  1N04 A;  3V8X B;  3PMV A;  1ZU0 A;  1R9Q A;  5JTY A;  1ANF A;  2XXX A;  4R74 A;  3FVN A;  3H6T A;  3PPO A;  4POX A;  3L6G A;  4H65 A;  3HST A;  4FED A;  2XX7 A;  3PD9 A;  4YKI A;  3T22 A;  2I4C A;  2XXP A;  4IGR A;  4KR5 A;  1B05 A;  2XD2 A;  3MWB A;  3K1M A;  4NMY A;  2HQ0 A;  4NF6 A;  4KCD A;  4TQU Q;  1P1O A;  1DOT A;  4OES A;  4BLA A;  4NF8 A;  2RC9 A;  2VP1 A;  1FTJ A;  1EH3 A;  2RCB A;  2Y7W A;  4X48 A;  4YKP A;  3V89 B;  4GIZ A;  1NMU A;  3RNN A;  2DS9 A;  1YTV A;  3WAF A;  1N0T A;  2VOZ A;  1I6B A;  3O6H A;  4G68 C;  5I56 A;  1I6Q A;  3KSX A;  1B5J A;  4WED A;  4DXC A;  3DP6 A;  1FQA A;  1MDQ A;  3QXM A;  3K6V A;  3H06 B;  2DE3 A;  1B3G A;  4Q0C A;  4RXL A;  1LBB A;  3ZKK A;  1YAE A;  3FV1 A;  4LP2 B;  3IX1 A;  2QS1 A;  5I58 B;  3CFZ A;  5HM4 B;  3BFT A;  4OHN A;  4THI A;  4FAT A;  5ITP A;  3MVW A;  4OVJ A;  5FTI A;  3IO6 A;  2Y7K A;  2I6E A;  2QPQ A;  4XKP A;  3UN6 A;  4R9G A;  1JVY A;  3MZB A;  3IOW A;  4ZED A;  1I69 A;  3QUF A;  1MM7 A;  2OBG A;  3HV1 A;  3M3F A;  3I6V A;  3O9P A;  3VVD A;  3G3F A;  3RTF B;  5LOM A;  5DEX A;  3L6H A;  4MF3 A;  4BDM A;  2O51 A;  1B3E A;  3PPN A;  3RTW B;  1MXW A;  3CVG A;  4IO6 A;  2XXI A;  3MPL A;  4LVQ A;  2NWJ A;  2XXH A;  1O64 A;  4OFO A;  1H3D A;  1H43 A;  4BDN A;  4F18 A;  3U93 A;  4O3A A;  3USD A;  3S9E A;  3PMW A;  4IO2 A;  4PE5 B;  4QFN A;  4EF1 A;  3IJO B;  3VFJ A;  3DEL B;  1LAH E;  1VR5 A;  2HCA A;  3VLW A;  4ONY A;  3B6W A;  4XIG Q;  1VFE A;  4KHZ E;  1USY H;  2QMW A;  1JVX A;  3FUZ A;  1QKA A;  3OEL A;  3OO8 A;  4GL0 A;  2ZYK A;  4KFQ A;  5CRY A;  4F3B A;  5CC2 A;  4P11 A;  5AA1 A;  2XXU A;  4IO3 A;  4RYA A;  4FAJ A;  5H8F B;  1MPB A;  4BDO A;  5L9M A;  1R9L A;  4MBP A;  2ZNT A;  4LUB A;  4OEU A;  3WAE A;  4PFY A;  5F1Q A;  4ECF A;  4EDP A;  5H8N B;  1MXY A;  1Q1K A;  1VFD A;  2HFB A;  4FEB A;  2XXV A;  4H0W A;  4JWO A;  3SES A;  5KCJ A;  2GHA A;  5DVJ A;  4R72 A;  2AIX A;  4G8N A;  3EHT A;  4H1X A;  2VHA A;  3GZG A;  5M2V A;  1JEV A;  2O69 A;  4KPT A;  3IOU A;  3LR1 A;  4OEV A;  3G3I A;  4R75 A;  5FHO A;  2Z8F A;  3T9V A;  1ATG A;  4OXV A;  2OWS A;  1MQH A;  3K01 A;  3E4R A;  4UA8 A;  5FHN A;  2F6P A;  1MY1 A;  4DE8 A;  4C1T A;  3TTL A;  5L9S A;  3LSF B;  3EHS A;  3CRB A;  3LSW A;  4L17 A;  1ZKB A;  3THI A;  1JQF A;  2DYX A;  2RC8 A;  3QK6 A;  4WXJ A;  1A40 A;  1XHY A;  1B51 A;  1TFD A;  2NOO A;  2OJT A;  3UGW A;  3MJN A;  4G68 A;  4AB6 A;  1N76 A;  5B70 A;  4NTL A;  1P99 A;  2ESN A;  4GWO A;  4NWC A;  2XXT A;  3B7D A;  1MY3 A;  2DXY A;  4JB7 A;  3TAJ A;  1B58 A;  1B5H A;  1FCK A;  1MS7 A;  1PEB A;  3FGS A;  1SBP A;  3A09 A;  4U4X A;  3VDF A;  2PX1 A;  3BKI B;  5BUU A;  4ZZA A;  2H25 A;  2Z22 A;  4WKM A;  2XX9 A;  4OET A;  3FVG A;  5KZT A;  4XKN A;  1IIT A;  4GXS B;  1MQJ A;  2R71 A;  3IOT A;  3KBR A;  1S7Y A;  4LQ2 A;  2OCU A;  2CMO A;  2ZXT A;  3MP8 A;  1FQC A;  2HZK A;  3W15 C;  1B2H A;  2Y7I A;  3O29 A;  1MH3 A;  4ZE8 A;  1EZO A;  2A5T B;  1IXC A;  3C34 A;  3HPI A;  1JNF A;  2HAV A;  4POW A;  1SYH A;  3ILT B;  4FEC A;  3QUJ A;  3R6U A;  4QFP A;  4RNS A;  1FQF A;  1GV8 A;  1MXU A;  1UQW A;  2ZMB A;  2HAU A;  4GF8 A;  4NWD A;  4U4S A;  3D4G A;  3SDF A;  3G3J A;  4C0R A;  3G3H A;  3KGC A;  1Y9U A;  2XHD A;  1TT1 A;  2I3V A;  3FV2 A;  4YMA A;  4IO4 A;  4YB7 A;  1IUD A;  3IB1 A;  4DDD A;  2KLF A;  1XVX A;  1B6H A;  4FOR A;  1B7Z A;  2YPN A;  5IAI A;  3AXF A;  4R6K A;  5TU0 A;  2CZL A;  4NF5 B;  1ZBM A;  2Z23 A;  3SET A;  5AA4 B;  1ZLQ A;  3VVE A;  2LAO A;  1B5I A;  1QJM A;  1JET A;  2OK2 A;  3CG1 A;  4DIG A;  4NED A;  5EHS A;  1ZJL A;  3K6U A;  3QSL A;  4MFI A;  5H8N A;  3Q27 A;  1BLF A;  4FE8 A;  1P1Q A;  4OFJ A;  4RPO A;  3UA8 A;  1QUI A;  1Y1M A;  5I2N A;  1OIB A;  4U23 A;  3PPP A;  2F36 A;  4KYE A;  1GVC A;  4ZEK A;  1D9V A;  2IA4 A;  1B0H A;  3T9X B;  4BDL A;  4F1U A;  4XTC Q;  1YPN A;  2UVH A;  2A5S A;  4U21 A;  1B40 A;  2GFE A;  3VE1 B;  4PFT A;  3S9N C;  1PB9 A;  4F2O A;  3EQ1 A;  4K3F A;  1A7L A;  3KN7 A;  4YKJ A;  1FTM A;  4IY6 A;  2I0B A;  1A54 A;  3K00 A;  4KI0 E;  4I62 A;  3M3L A;  3P7I A;  2Q8J A;  4LAT A;  4MH5 A;  4TLL B;  5I2K A;  3TTN A;  1LAX A;  2RKM A;  1OVT A;  2ONR A;  1SD3 A;  1MQG A;  4KQP A;  1XS5 A;  4PET A;  1BTJ A;  1Z7N E;  4C1U A;  2ZNU A;  5DYH A;  5JEI A;  2ZNS A;  1XOC A;  4NF8 B;  1WOD A;  3FZV A;  3PUY E;  1P1W A;  2DVC A;  2OWT A;  3VV5 A;  3IB0 A;  2H4I A;  1TFA A;  3OEN A;  3O6G A;  3QYT A;  4G2Z A;  3T96 B;  4Z7E A;  4ZEC A;  5DEX B;  4R9F A;  4F39 A;  4GVO A;  3SEV A;  1TWY A;  3UIF A;  2Z8D A;  1KWH A;  3N26 A;  5DVF A;  4Q5T A;  1URS A;  2DQV A;  4F3S A;  2FYI A;  2WKY A;  4YB6 A;  1XC1 A;  3B6T A;  1Y3Q A;  4ZDM A;  2O7U A;  2RCA A;  3IK6 B;  4EF2 A;  4YB5 A;  5HPQ A;  4F19 A;  1NL5 A;  1RYX A;  4MLV A;  3MPK A;  2PYY A;  3TEP A;  3FJG A;  1SYI A;  2GH9 A;  2PBW A;  1MQD A;  1MY2 A;  3IOR A;  5KDT A;  4YU0 A;  4LA9 A;  5ITO A;  3IAZ A;  5AA3 A;  2PMS A;  3EHU A;  3H6V A;  1NKX A;  1MY0 A;  1NNT A;  2B65 A;  4YAH X;  1Y4T A;  2OLB A;  5L8D A;  1MY4 A;  3FXQ A;  1MRP A;  1RKM A;  1B1X A;  5A5X A;  3FXU A;  2M8C A;  1FQD A;  3F11 A;  3IL1 B;  2NXO A;  2O84 X;  3PUZ E;  1ELJ A;  3DM0 A;  3TTK A;  5J1D A;  1DPP A;  3ZSF A;  4RPN A;  3PV0 E;  4HCW A;  3T9H B;  1LST A;  1XVY A;  4ZEF A;  4ZE9 A;  5A5X B;  2OZZ A;  5ELV A;  3GLB A;  2R9J A;  5FHM A;  3TCF A;  4G4P A;  4NE4 A;  3D4C A;  1EZP A;  4G8H A;  1ZIU A;  2A5T A;  1QUK A;  3PPQ A;  5I57 A;  3CR9 A;  3N94 A;  4KCC A;  1B3F A;  4R2B A;  2HZL A;  1WVJ A;  4U1O A;  5I84 A;  3KJ7 A;  3RGY A;  5ISU A;  1DTZ A;  1IXG A;  2V84 A;  4ZZE A;  1S9T A;  3SEX A;  3U92 A;  3TUS A;  1USY E;  1UTH B;  1B7H A;  2H5Y A;  1JW5 A;  3FJ7 A;  2P0S A;  1FW0 A;  1O7T A;  4QHQ A;  4I9D A;  1II5 A;  1LAG E;  3TPA A;  4DZ1 A;  1T0K A;  1NNP A;  3PD8 A;  3ILU B;  2F8D A;  3RY3 A;  4QFL A;  2QJE A;  2Z8E A;  1JEU A;  3TQW A;  1P1U A;  2AL5 A;  1Y1Z A;  4ELP A;  4OYV A;  3E13 X;  5K2Y A;  4F1V A;  4PP0 A;  3FXR A;  3MBP A;  5EYF A;  2IEE A;  1P1N A;  4X9T A;  5CBR A;  5L9O A;  4DXU A;  1PBQ A;  3RQT A;  3T93 B;  1UTH A;  5I59 B;  3MC2 A;  1LFH A;  1IZ1 A;  5I2K B;  3MP6 A;  3PUX E;  1SI1 A;  1M5B A;  3N6T A;  3OSQ A;  3KSJ A;  2DWI A;  3EPE A;  3MUQ A;  2UVG A;  3M8U A;  3QIM A;  1VE4 A;  2DWJ A;  5CM6 A;  2V93 A;  2DP8 A;  1IIW A;  2DOJ A;  3KN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...