3N6TA

Effector binding domain of tsar
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
205
Chain Sequence
GHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the effector binding domain of TsaR
rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 54
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA02
4R74A 5AA2B 3C9HA 3S9MC 3W9VA 3GXAA 4G68A 3SEYA 3G3KA 3HSTA 1R9QA 2F7CA 3MC2A 3K1PA 1IXIA 3KN7A 1L5TA 3HV1A 1NNTA 3DP6A 2P1SA 3O2AA 2Z8DA 4HCYA 4OETA 4LZ7A 2NWJA 3WAEA 1FW0A 1SW1A 2O84X 4YMBA 2XD3A 3B6QA 3TQLA 4DLDA 4YU0A 4UA8A 4C1UA 3RGYA 1GTKA 5B70A 4XTCQ 1I6BA 1IEJA 3T22A 3IOUA 1FQEA 2Y7RA 4NF8B 5DYHA 3CFXA 3IX1A 4AB6A 4ZDMA 3SEWA 4EXKA 5JTYB 1HSEA 1AMFA 3CVGA 1AL3A 1FQAA 3K02A 5HBCA 5DTBA 5KZTA 3UN6A 3FGSA 3C4MA 4XKPA 3QSLA 2V25A 1USYH 2UVGA 3VXCA 4JBZA 2F5XA 1A55A 4E0WA 1N84A 3HPIA 3F11A 2Z23A 3PMXA 3KBRA 4X48A 2O7IA 1FQDA 3R26A 4POXA 2A5TA 3GBBA 5CMKA 1MY0A 2ZMBA 5AA4B 3L6HA 1MXUA 3S2VA 2OLBA 4I1DA 2HAUA 1SW5A 3Q25A 4U1OA 1LFGA 1SI0A 2DWHA 2DOJA 3JYRA 3K1MA 4QSCA 2E1SA 3KJTA 3PUYE 4IO7A 3KGCA 4AB5A 5TP9A 2OWSA 3T9HB 4RPOA 1ZLQA 4ISUA 1MDP1 4ZE8A 4FJPA 1Y3NA 3H4ZA 1WDNA 3R6UA 2X26A 5DEXB 3L6GA 1IITA 1B05A 3G3JA 3UGWA 2V3UA 4F2QA 2FNCA 2UYEA 2WKYA 3PPRA 4F19A 4YMAA 3VLVA 3OD7A 1T0KA 2QMXA 4NF4B 3TTNA 1A40A 4R9GA 4X1BA 5H8QB 3ZKKA 4IY5A 4ZZEA 1RKMA 1MQJA 4BDMA 3PUWE 3FJGA 3MPLA 4EQ7A 3FXRA 4HS7A 1DTZA 5A5XB 4RK9A 1D3KA 1I6QA 3C35A 3O29A 4G4PA 2CMOA 4XIGQ 3H3GA 1Y1MA 4EDPA 1B3GA 2ONKE 4DZ1A 3I6VA 1Y1ZA 4K3FA 1ZTYA 3UA8A 5EHSA 3LSWA 4F1UA 5AA2D 1YPNA 5CRYA 4H5FA 3DLNA 5H8SA 1ANFA 1TFAA 1JW1A 3HCQA 1XHYA 1DTGA 1UTBB 4FORA 4POWA 4ZEIA 3RY3A 3VV5A 3MVZA 3VVEA 1SI1A 2HXWA 5F1QA 3N5LA 5I58A 1PBQA 1IQ7A 2XXTA 1B3FA 2ALUA 1MQHA 3IK6B 4DDDA 1NL5A 4F3BA 1B3HA 2W7YA 5L9SA 4IGTA 3MWBA 4L17A 1HSLA 2I58A 4MFIA 4H65A 2V3QA 3A3UA 4OMBA 5TPAA 3TZAA 3R7XA 1FTKA 1PDAA 5FTIA 3PPQA 1Z7ME 2V84A 4MLQA 4U4SA 2RCAA 3V83A 2DWIA 1S7YA 1YTVA 2HQ0A 4LATA 4ZE9A 4OERA 3RPWA 5AE4A 1MS7A 5IAIA 3MP1A 4TLLB 4DXCA 5JTYA 1B40A 4LP2B 4X9TA 3S9NC 4RNSA 3K6UA 4ND9A 3UIFA 2QMWA 4DIGA 5ICQA 3VLUA 4DXUA 3IJXB 2I3VA 4DXBA 4ZEKA 2OJTA 5DVIA 5CI5A 2D3IA 2Q8JA 3PPOA 2H9BA 1GR2A 3S9LC 2XX7A 3MVWA 2FA7A 3TDJA 3FZVA 3LC8A 1AIVA 3VLWA 1LFHA 2ZYMA 4YB6A 1FTJA 3O28A 3PGFA 3FATA 1PB7A 3C33A 1EU8A 4ZZAA 1LAHE 3BFUA 2Y7WA 1A8FA 3DM0A 3D4GA 1MDQA 3KZGA 5DEXA 1WODA 2A5SA 2XXXA 3CFZA 4X1DA 3W9WA 1LCFA 1P1QA 2GHAA 2QS4A 3PD8A 4PFTA 3N6UA 4G68B 3T96B 1NNFA 1OQGA 1M5FA 3IO6A 4F1YA 4ELOA 4IO3A 3CI8A 3QUFA 3H6TA 2BJJX 3PU5A 4WEDA 4I8CA 3TTKA 3KOSA 4FATA 1PB9A 2I0CA 4QFNA 1Y4CA 1POTA 5AA4A 3IL1B 3PUVE 4HCWA 4RA1A 2O1MA 4EF2A 4ELRA 2Z22A 5H8QA 3QXMA 1NH7A 1IXGA 3EN3A 3KSJA 2DVCA 4KFQA 4OYVA 1ZKBA 4F3SA 4F18A 3OEMA 3RT6B 4NTLA 4N6PA 3TYHA 3RTFB 3V5AA 2I4BA 5I57B 5FTHA 3H7MA 5TP9B 1QVSA 3VE1B 3K4UA 4BLAA 4EF1A 4P11A 5JK4A 1DPEA 1ZIUA 1MY1A 2PVUA 3PD9A 4YKJA 4BDNA 4Z7EA 2A5TB 4G8MA 3TTRA 4H67A 4KQPA 3SERA 1VSOA 3W15C 1TWYA 2F6PA 2F97A 1XT8A 1B2HA 4C1TA 2UYFA 4N13A 3PPNA 2YPNA 1O7TA 2ESNA 3ILUB 4PE5B 3CG3A 3MVYA 1XC1A 3OOAA 4NWCA 4M1VA 1SD3A 2YLNA 4M4GA 2XXQA 3Q26A 2DWJA 3ONMA 4H8IA 2XHDA 4WKMA 3V89B 3U94A 3WAFA 1N7XA 1QUIA 4U2RA 3KOTA 2H5YA 2O51A 3TUSA 1SYHA 1MY3A 3MJNA 3OXNA 4R2BA 4FE8A 5L9OA 1MH4A 3MP8A 3QUJA 1QUJA 2ZYNA 1LAXA 2NUVA 3BBRA 3KG2A 2Q2CA 5I2KB 4ZECA 1BTJA 4OENA 4G8NA 3MBPA 1R9LA 1B5JA 1BKAA 1MY2A 2XX8A 4JDFA 2XX9A 3UORA 2P0SA 1MRPA 2GHBA 3HN0A 3IOWA 3B7DA 1VR5A 1H44A 3FXQA 1QULA 4OFJA 4WEPA 4BDLA 1M5BA 1OIBA 2O1LA 2QRYA 4R2FA 2DXYA 3GLBA 4H0WA 3C36A 5I56B 1BIYA 1IIWA 2VGQA 2HZLA 2H98A 3K0VA 3KFMA 4FIMA 5ELVA 4DE8A 4PFWA 5BUUA 2ZNTA 1DPPA 5JEIA 5I58B 5HPQA 2P2AA 5H8FB 1N04A 2Y7IA 2I6EA 4LQ5A 3ODBA 2GRVA 2Q2AA 3TODA 3K6VA 3TTLA 4P0GA 3MW0A 5ITPA 3FV1A 4NF6A 1N7WA 5CBRA 4KR5A 1VFEA 1RYXA 1UTBA 3C34A 1LB9A 4JSDA 2DS9A 3PMWA 4IO4A 4YKKA 4GL0A 1QUKA 1Y4TA 2Q88A 2RKMA 4GD5A 4H1XA 4R6KA 2I49A 4KI0E 4UACA 2DXRA 5FHOA 1M5DA 4HTGA 1MQGA 1B1HA 4PQJA 3RN8A 1EZOA 1LLSA 4OWDA 3EPEA 3A09A 1PC3A 2IEEA 1N3XA 1XVYA 2PBWA 1EZPA 2GH9A 2OCUA 4LZ5A 1CE2A 1F9BA 1JW4A 3M8UA 4ZEFA 3QIMA 5AA1A 1MH3A 2B3FA 1B1XA 3P7IA 4ONYA 1D4NA 4YICA 2YJPA 4QSDA 4IB2A 1JVXA 1TFDA 1B5IA 1FTLA 3T9VA 1H76A 3EQ1A 4R75A 1LFIA 2VHAA 1B7UA 4XKNA 3VVFA 4I62A 3S4UA 3RLFE 3GZGA 1JW5A 3M3KA 3U92A 4JWYA 5I2NB 1US5A 1OMPA 4MBPA 4RK2A 3TEPA 3TCGA 4GXAA 1P1WA 2OK2A 3BFTA 3T66A 1OLCA 3TKDA 1NNKA 2ZNSA 1WVJA 5TPAB 2ANJA 5KCJA 2XXYA 5H8FA 4NEDA 1M5CA 5I59B 5H8NA 1FTOA 3M3FA 2X7PA 4YB7A 3FVOA 1UTHB 5A5XA 4ELQA 3SKPA 3IB2A 4Q30B 3SETA 2FYIA 3JZJA 2RF1A 2X7QA 4R73A 5KDTB 1HSJA 1PBPA 4KHZE 1D9YA 3EF7A 3CRBA 3KSXA 1GV8A 2Y7PA 3DELB 4QFLA 5EYFA 3TQWA 5I2NA 2ZXTA 4FECA 3M3LA 3U93A 3G3IA 1URSA 2REJA 5L9MA 5ISUA 4IGRA 2VP1A 1OLAA 1PB8A 1MXVA 5TU0A 2UVIA 2NOOA 3VVDA 1O64A 4U21A 1B4HA 4F3PA 4QFOA 4KD5A 4FEDA 1NKXA 2VOZA 3OSQA 4AQ4A 2QL3A 3IORA 5ICTA 3UK4A 2PMSA 1B7HA 3CFLA 3I5OA 5J1DA 2UXAA 3PMVA 3VFJA 3LUYA 2ONSA 4OEUA 3IB1A 2RC8A 1SYIA 2HAVA 5F7VA 1R1NA 1NH8A 3JV9A 2DQVA 4G77A 2V3TA 3RQTA 2Q89A 1LSTA 3PUXE 4GRKA 3SDFA 1JVYA 4LZ8A 1MPCA 4G8HA 5CMCA 1RYOA 4QRZA 4YZZA 1II5A 4JSOA 4F31B 3S9EA 1VE4A 2E0SA 4RXLA 2VD3A 2Z8FA 3FV2A 1SW2A 4LUBA 4RJZA 1MXZA 1Y20A 1A54A 1H3DA 1R6ZA 1UIVA 5I2KA 2DWAA 1SBPA 2F78A 4RPNA 3OSRA 1LBCA 1J1NA 2PT2A 3VXBA 1QW0A 1OQHA 3MVXA 3UP9A 4BDQA 4JXIA 2IA4A 3FXUA 3AXFA 1BLFA 4U4XA 2THIA 4P0IA 4YAHX 3OELA 4LA9A 4TQUQ 3EHSA 3MZ1A 2OBGA 4I9DA 4NF8A 4F29A 5H8HB 3D4CA 3CR9A 2HCAA 1URDA 2I48A 2UVHA 3HHFA 1NNPA 3DP8A 3OO6A 4GOTA 4LQ2A 4YB5A 1B52A 4PFUA 3OO9A 2DE4A 4LONB 1ATGA 3DP4A 4QFKA 1SQYA 1QKBA 4R6HA 4KYEA 3TMGA 1B7ZA 4ELPA 2F6GA 4EXLA 1Y3PA 1CB6A 1SVXB 1UIUA 3ILTB 3H6WA 1B3LA 4ZEBA 2I0BA 3SEUA 2V93A 3K6WA 2F7BA 3HO7A 1EH3A 4XXUA 1KWHA 3Q28A 1B0LA 1UQWA 4ESWA 2KLFA 2DE2A 1O63A 4QF9A 1EZ9A 3O6HA 3FJ7A 3SESA 4BDRA 2R9JA 5CC2A 2PYYA 3C31A 1TT1A 4QHQA 4QFPA 1LAFE 2CZLA 2ZNUA 3G3HA 3IO4A 4ESXA 4R6YA 2DYXA 5M2VA 3IOVA 4MH5A 2ONRA 2RC7A 4GLIA 1YCJA 1B46A 3G7WA 3RTWB 5I59A 4LVQA 3ZSFA 5IKBA 4KPTA 5L8DA 3RT8A 5I57A 4OVJA 1B3EA 2H4IA 2NVUB 3MPKA 3QAXA 4GWOA 2F36A 1JNFA 4O3AA 3MZ9A 3K6XA 1B51A 2Y7KA 3OO8A 4G2ZA 4PETA 4XKRA 4MF3A 3ZKLA 1XVXA 2B65A 2XD2A 2XXWA 3O6IA 3Q29A 2F7AA 5CMBA 5H8HA 4DCYA 1P1NA 3K1NA 1MQIA 4O3CA 4GF8A 3MAMA 4R9FA 3SEXA 3TPAA 5I84A 4TOZA 3LSLA 5CM6A 1LBBA 2RINA 3PPPA 1M5EA 4NF5B 3IJOB 3Q27A 2PT1A 3FD3A 3O6GA 3KN3A 4OTEA 1MXXA 3LBSA 3CIJA 4G68C 3K00A 4YKIA 3O97A 3IB0A 3FIRA 4E0XA 1B0HA 5K2XA 5DVJA 5KDTA 3U1OA 3TAJA 2DSFA 1I69A 4Q5TA 3EHTA 4XKQA 4GQOA 4F3GA 1D9VA 2NXOA 3VDFA 2ZYOA 2GFEA 4O3BA 4OFOA 3U8QA 3FVKA 3KJ7A 4TLMB 2XXVA 3BKIB 2XXPA 4U23A 2O68A 2HEUA 1DOTA 4EQ9A 3USDA 5B7DA 1B58A 4IO6A 1US4A 1LCTA 3N94A 3T93B 2AIXA 4OHNA 1JEVA 4GL8A 1H43A 3KEIA 3MZBA 1FQBA 4JWXA 5AA2A 4U22A 1ZMGA 4H5GA 2QS2A 4NWDA 4Z0IA 1LB8A 3TELA 1YAEA 1SDXA 4IO5A 3EHUA 2F8DA 3I3VA 1FQFA 2HFBA 1GGGA 1S9TA 3OMBA 4EUOA 4OEVA 3GBAA 3PV0E 4RYAA 4FEBA 4NF6B 2LAOA 3CSBA 2O7UA 2OWTA 3ZS6A 5HM4B 1JETA 3O9PA 4H8JA 4FAJA 4NF4A 2G93A 3G3FA 2F35A 1PEBA 1B32A 1A7LA 3IOTA 4MLVA 4JWOA 3E13X 3H06B 4NF5A 4RY1A 3IR1A 1MXYA 2HZKA 2OZZA 2O69A 3TTMA 4ZS9A 1AH5A 2H25A 3ECRA 3G3GA 2QS3A 3LSFB 1N76A 4OQOA 1GVCA 5CBSA 1BP5A 1IUDA 5BWJA 2PX1A 5KCJB 3TCFA 2R6GE 1DSNA 2Q9TA 1IZ1A 2I3WA 4GXSB 1VFDA 4PP0A 3MQ9A 3A3CA 1LGBC 3QK6A 2H99A 4N07A 1UTHA 2RC9A 3TFLA 3THIA 4ECFA 2DVZA 4EQBA 1N0TA 2ZYKA 1FQCA 1OVTA 4GIZA 4ZEDA 3RNNA 3SEVA 1XOCA 2QPQA 4OESA 3TCHA 3PUZE 1Y9UA 3FUZA 5DT6A 3T9UA 2Z8EA 1QKAA 3FASA 3MP6A 2UVJA 4H6DA 2QJEA 5K2YA 4IO2A 4OZ9A 1IXHA 2D5WA 3N26A 1JQFA 1OVBA 3K01A 5FHMA 2B3BA 3FVGA 3B6WA 3CSGA 1B5HA 1P99A 3FVNA 4Q0CA 2XXRA 1ZU0A 3HHGA 5H8NB 4OXVA 1FTMA 1MPBA 2RCBA 4KCCA 4NMYA 3KN8A 3E3KA 5ITOA 1Y3QA 4F39A 3MUQA 1NFTA 1SW4A 3IAZA 3E9XA 3V8XB 1AOVA 1B6HA 1P1UA 1POY1 3CG1A 3FJMA 5EHMA 4C0RA 4HW8A 2F34A 1S50A 4KYDA 2D21A 2REGA 2QS1A 1ZJLA 2XXUA 1JEUA 1XS5A 4PFYA 4KYSA 2ABHA 1MM6A 1Q1KA 3E4RA 1MG1A 4OFLA 4GVOA 1Q35A 1ELJA 1A99A 3H03A 3OEKA 4WXJA 3B6TA 3LR1A 3OO7A 4JB7A 4THIA 3K2DA 3H6VA 1MPDA 3QYTA 1Z7NE 3U72A 1IXCA 1H45A 1NMUA 2O6AA 4R72A 3C32A 1MQDA 2G29A 4DCXA 2XXIA 1B4ZA 4F2OA 1ZBMA 5DVFA 1URGA 1DMBA 1A8EA 2DE3A 4Q8RA 1MM7A 4BDOA 4NE4A 2DP8A 5FHNA 1QJMA 3H6UA 3N6TA 2I4CA 4F1VA 2AL4A 4KCDA 3T9XB 5I56A 5LOMA 2VD2A 1P1OA 4YKPA 4F22A 1I6AA 4U1ZA 2AYSA 1FCKA 3RUMA 1MY4A 2R71A 3OENA 5CMMA 4QSEA 2XXHA 2QSXA 1B9JA 1N3WA 2Y84A 4GFRA 4IY6A 2AL5A 1USYE 3LSXA 3O66A 1MXWA 2M8CA 1TXFA 5AA3A 1LAGE
chains in the Genus database with same CATH superfamily
3SEYA 3G3KA 1R9QA 1L5TA 3DP6A 2P1SA 2Z8DA 1FPFA 1EYIA 3TQLA 1YYZA 3RGYA 2Y7RA 1VDWA 3SEWA 1AL3A 5HBCA 3K02A 4XKPA 2V25A 2UVGA 2F5XA 3F11A 4N6KA 1FQDA 3R26A 4PCDA 4NN3A 2ZZWA 2E1SA 2WX9A 4RPOA 3R6UA 2X26A 3L6GA 2QMXA 4NF4B 5H8QB 4X1BA 3ZKKA 4IY5A 4ZZEA 1RKMA 1MQJA 4BDMA 3MPLA 1DTZA 5A5XB 4RK9A 3O29A 4EDPA 2ONKE 3I6VA 4K3FA 1ZTYA 3UA8A 4F1UA 5CRYA 1ANFA 3VV5A 1DTGA 1RDZA 1PBQA 1IQ7A 4PBHA 1MQHA 1NV1A 4F3BA 4IGTA 4L17A 1FTKA 3PPQA 3V83A 2V84A 1YTVA 4LATA 3RPWA 4RNSA 4ND9A 2I3VA 5DVIA 5CI5A 2D3IA 1FPBA 5IZZA 1GR2A 3S9LC 2XX7A 3MVWA 4N15A 3VLWA 2ZYMA 1LAHE 3KZGA 4EQ7A 1WODA 2FIXA 3CFZA 1NV4A 3N6UA 1NNFA 4F1YA 4ELOA 3QUFA 4WEDA 1YZ0A 3KOSA 4MMPA 1Y4CA 4EF2A 5IM2A 3KSJA 4G61A 3OEMA 4N6PA 1XI6A 3V5AA 2GQ1A 3K4UA 1MY1A 3TTRA 4XEQA 4KQPA 3SERA 1B2HA 2UYFA 3PPNA 5I2NA 5H8QA 4QFOA 4OVRA 5KZTA 4M4GA 2XXQA 3V89B 2O51A 1MY3A 3OXNA 3MP8A 4O7IA 1LAXA 1BTJA 3ISPA 4OENA 3MBPA 1B5JA 1MY2A 2R8TA 4JDFA 1MRPA 2GHBA 4BDLA 5A5LA 1M5BA 2QRYA 3C36A 1IIWA 2VGQA 3RPLB 1DPPA 3TTNA 2Q2AA 3MW0A 3FV1A 1N7WA 1RYXA 3C34A 5T3JA 1LB9A 3PMWA 2Q88A 4R6KA 4KI0E 3RN8A 1M5DA 1B1HA 2F3DA 4PQJA 4OWDA 2GH9A 2OCUA 3M8UA 1MH3A 4ONYA 1D4NA 3T9VA 1H76A 4R75A 1LFIA 2HHMA 3RLFE 5I2NB 4PFBA 3U92A 3TCGA 1CNQA 5IZ3A 1NNKA 4XF5A 1M5CA 5I59B 5F24A 4YB7A 5A5XA 3SKPA 3IB2A 3SETA 5KDTB 1GV8A 2Y7PA 2Y5LA 2REJA 3RPLA 2VP1A 4PFIA 1PB8A 4GWXA 5TU0A 2UVIA 2NOOA 4U21A 4KD5A 1NKXA 3LV0A 3OSQA 3UK4A 2PMSA 2PFYA 2UXAA 3VFJA 3LUYA 2RC8A 5F7VA 1NH8A 3RQTA 4LZ8A 4G8HA 1II5A 3IFCA 1MXZA 1R6ZA 1Y20A 5I2KA 4I40A 2F78A 3NOHA 4RPNA 1LBCA 1J1NA 3MVXA 2IA4A 1EYKA 1BLFA 2THIA 4YAHX 4NF8A 2HCAA 3OO6A 2I48A 2UVHA 4YB5A 1B52A 3OO9A 4QFKA 3DP4A 2XWKA 1SQYA 4KYEA 1B7ZA 2QFLA 4EXLA 1SVXB 4ZEBA 3H6WA 4P47A 3Q28A 3SESA 3O6HA 4N81A 4ESXA 1B46A 5I59A 4LVQA 4GWWA 1B3EA 2NVUB 4TLLB 1JNFA 2B65A 3FBPA 3O6IA 2F7AA 5H8HA 1IMDA 3FXBA 4GF8A 4TOZA 3LSLA 1LBBA 5ESYA 1NUWA 3FD3A 3FIRA 3U1OA 3TAJA 2GFEA 4OFOA 1NV0A 3KJ7A 2HEUA 4EQ9A 5B7DA 4IO6A 2AIXA 1JEVA 4P8BA 3MZBA 1FQBA 1FPKA 2QS2A 1LB8A 1YAEA 3I3VA 1FQFA 1GGGA 1S9TA 4OEVA 3ZS6A 2O7UA 5HM4B 1JETA 3O9PA 4JWOA 2OZZA 2O69A 3TTMA 4DIGA 3G3GA 3ECRA 1GVCA 5KCJB 2PX1A 4IR8A 2Q9TA 3KC0A 4PP0A 1VFDA 4N07A 4EQBA 3RNNA 5EQ8A 3TCHA 2D5WA 4H46A 3K01A 3B6WA 3HHGA 1ZU0A 1FTMA 4KCCA 2RCBA 4NMYA 1Y3QA 1SW4A 2MKZA 3V8XB 5EHMA 1LBWA 4KYDA 1S50A 2QS1A 2XXUA 1LEVA 1XS5A 4KYSA 1ELJA 3OO7A 3LUZA 3U72A 4R72A 4DCXA 1DMBA 4BDOA 4NE4A 2DP8A 2CZHA 5I3SA 2AYSA 5CMMA 2QSXA 2FHYA 2Y84A 4GFRA 2M8CA 2B3BA 1TXFA 1LAGE 2VPOA 3W9VA 3GXAA 4G68A 3A29A 1IXIA 2Q8JA 3O2AA 4HCYA 2NWJA 4ECFA 4N8YA 4OETA 1FW0A 4YU0A 4UA8A 1I6BA 1IEJA 3T22A 1FQEA 5DYHA 1IMAA 3IX1A 5DTBA 4NAPA 4AS4A 4KXPA 2ZMBA 1MXUA 2OLBA 2HAUA 1SW5A 2DWHA 2DOJA 4QXDA 1BK4A 4ISUA 4NF0A 1MDP1 4ZE8A 1B05A 3ROJA 3UGWA 2V3UA 2FNCA 2UYEA 2WKYA 4F19A 3VLVA 1A40A 4R9GA 4PDDA 1LBYA 3PUWE 4XIGQ 4DZ1A 1Y1ZA 3LSWA 4H5FA 1SI1A 2HXWA 3IK6B 1NL5A 1B3HA 5TPAA 3A3UA 4OMBA 4N4UA 1PDAA 1Z7ME 5AE4A 1MS7A 3MP1A 1B40A 3VLUA 4DXUA 4DXBA 4GWZA 3TDJA 3LC8A 4HE1A 2Y7WA 1MDQA 2XXXA 1DCUA 2A5SA 4X1DA 1LCFA 1P1QA 2QS4A 2ZZVA 4G68B 1M5FA 1INPA 3H6TA 3PU5A 4GBWA 2I0CA 4QFNA 5IZ3B 2O1MA 2Z22A 3QXMA 4F3SA 4F18A 4MJOA 4NTLA 2WEFA 3TYHA 3RTFB 2I4BA 4MAGA 3H7MA 3VE1B 1QVSA 4EF1A 1Q9DA 5JK4A 4YKJA 1FPLA 1TWYA 2F6PA 4N13A 1O7TA 2ESNA 3MVYA 1XC1A 4NWCA 4M1VA 1SD3A 4H8IA 3U94A 1N7XA 4R2BA 1LBZA 5I2KB 1R9LA 2XX8A 3UORA 3HN0A 3IOWA 3FXQA 1H44A 4R2FA 4H0WA 5I56B 5ELVA 2HZLA 5BUUA 4P1EA 4PFWA 3T1BA 3TODA 3ODBA 3TTLA 4P0GA 4NF6A 1QUKA 4GD5A 2I49A 5FHOA 3EPEA 3A09A 2IEEA 1N3XA 4LZ5A 4ZEFA 3QIMA 3P7IA 1FJ6A 4XKNA 3VVFA 1JW5A 3M3KA 1US5A 1KZ8A 4MBPA 3TEPA 2OK2A 3BFTA 1OLCA 3TKDA 1WVJA 2XXYA 5H8FA 1FBEA 2B4MA 4Q30B 3JZJA 4R73A 1PBPA 4KHZE 3EF7A 3DELB 2ZXTA 3M3LA 2L5VA 5L9MA 1OLAA 1MXVA 5IGAA 3VVDA 1O64A 4F3PA 2VOZA 2QL3A 3E78A 5J1DA 3EKIA 3PMVA 3IB1A 1SYIA 2HAVA 1R1NA 3JV9A 4G77A 2V3TA 3PTYA 1FPDA 2Q89A 2FIEA 1LSTA 3E79A 1MPCA 4YZZA 3S9EA 1VE4A 4RXLA 2VD3A 2Z8FA 3UP9A 3AXFA 1JP4A 3EHSA 1FBDA 2OBGA 4HE0A 3D4CA 3CR9A 4GWYA 5J16A 4LONB 1ATGA 1QKBA 3TMGA 2I0BA 4ESWA 1UQWA 1EZ9A 4BDRA 4HE2A 2PYYA 3C31A 3IO4A 2DYXA 1FBHA 4GLIA 3ZSFA 5IKBA 5L8DA 3RT8A 2H4IA 3MPKA 3QAXA 4GWOA 4O3AA 4G2ZA 3OO8A 3ZKLA 4MF3A 5CMBA 3K1NA 5EYHA 4R9FA 5CM6A 3PPPA 3Q27A 2WBBA 3KN3A 4YKIA 3O97A 3IB0A 1B0HA 1FPJA 4Q5TA 4XKQA 4PF8A 1D9VA 3FVKA 4TLMB 2XXVA 2XXPA 4U23A 1DOTA 1LCTA 3T93B 1H43A 3KEIA 4U22A 4NWDA 4IO5A 2F8DA 3GBAA 3PV0E 4FEBA 4NF6B 4H8JA 4NF4A 1A7LA 3E13X 3H06B 4NF5A 1MXYA 4ZS9A 1AH5A 3LSFB 4OQOA 1BP5A 1IUDA 5BWJA 5I5PA 2R6GE 1IZ1A 2VT5A 2I3WA 1LGBC 2RC9A 3TFLA 4OESA 3PUZE 3FUZA 5DT6A 3FASA 3MP6A 5K2YA 2P3VA 1OVBA 1P99A 3RYDA 4OXVA 3KBZA 4GX4A 4P3LA 2F3BA 1AWBA 3IAZA 1P1UA 3CG1A 5AA4B 2ABHA 3E4RA 4WXJA 4OVQA 5LOMA 4GVOA 3RUMA 3H03A 3H6VA 1MPDA 3QYTA 1ZBMA 1URGA 2DE3A 3H6UA 3N6TA 1RDYA 2I4CA 2VD2A 4YKPA 2FBPA 2VPNA 4P9KA 4MNCA 2R71A 3O66A 4HXVA 1FBPA 2F34A 4JBZA 5AA2B 3T0JA 2F7CA 3MC2A 3K1PA 3KN7A 1NNTA 1NV2A 3WAEA 4LZ7A 2O84X 5FBPA 3B6QA 4DLDA 4X8RA 4C1UA 1GTKA 4XTCQ 3IOUA 4NF8B 1FBFA 3CVGA 1AMFA 1FQAA 3FGSA 1USYH 4E0WA 3HPIA 2Z23A 3PMXA 4X48A 3L6HA 5EYGA 4P1LA 3S2VA 4I1DA 4MNPA 4U1OA 1LFGA 1SI0A 3JYRA 3K1MA 4QSCA 3KJTA 3PUYE 4IO7A 4OVSA 4AB5A 1Y3NA 3H4ZA 1IITA 3IFAA 2XWIA 1T0KA 1KA0A 4NHBA 2OWZA 3FJGA 3FXRA 4G4PA 2WYKA 5LDZA 1Y1MA 5AA2D 3DLNA 5H8SA 1TFAA 3HCQA 4FORA 3MVZA 2V4CA 5F1QA 3N5LA 2ALUA 4DDDA 2W7YA 3MWBA 1HSLA 4MFIA 4H65A 3R7XA 4U4SA 2HQ0A 4OERA 5IAIA 2KR0A 3UIFA 2QMWA 5ICQA 4ZEKA 2OJTA 1AIVA 2FA7A 3FZVA 1FTJA 1NV6A 3FATA 1PB7A 3C33A 3BFUA 3DM0A 4Z7EA 3D4GA 3W9WA 2HPGA 4PFTA 3T96B 2WBDA 4IO3A 3CI8A 2BJJX 1POTA 3IL1B 3PUVE 4HCWA 4ELRA 1NH7A 1NUZA 2DVCA 4OYVA 1ZKBA 4MIJA 5LTCA 3RT6B 5FTHA 5TP9B 1DPEA 4BDNA 2A5TB 4G8MA 1VSOA 3W15C 2F97A 4C1TA 1XT8A 4F2OA 4PE5B 4QBAA 2YLNA 4WKMA 3Q26A 2DWJA 3ONMA 1QUIA 3TUSA 3KOTA 2H5YA 1SYHA 3MJNA 5L9OA 3QUJA 1QUJA 2ZYNA 2NUVA 3BBRA 2P0SA 4WEPA 1OIBA 2O1LA 2DXYA 1BIYA 3K0VA 4DE8A 2H98A 5JEIA 5HPQA 2P2AA 1N04A 2I6EA 4LQ5A 4KR5A 1UTBA 2DS9A 4GL0A 4H1XA 1NV7A 4JVCA 2DXRA 1EZOA 1PC3A 1EZPA 2PBWA 1IMEA 1CE2A 1JW4A 5AA1A 1B1XA 4PAIA 4YICA 2WYPA 1TFDA 1FTLA 4I62A 4JWYA 4GXAA 5ET6A 3T66A 3B8BA 2ANJA 4NEDA 5H8NA 1FTOA 3FVOA 4ELQA 2FYIA 2RF1A 1IMCA 1HSJA 3CRBA 4QFLA 5EYFA 3TQWA 3U93A 1URSA 2B4LA 1NI9A 1DK4A 1FTAA 1B4HA 4AQ4A 5ICTA 3D1RA 3I5OA 4PC9A 2ONSA 4OEUA 2DQVA 1K9ZA 4MHFA 4GRKA 1JVYA 1RYOA 4QRZA 4RJZA 1SW2A 1UIVA 1H3DA 1SBPA 2ZZXA 2PT2A 3VXBA 1OQHA 4BDQA 4JXIA 4U4XA 4P0IA 4LA9A 4TQUQ 1NV5A 1URDA 3DP8A 5EQ7A 4GOTA 4LQ2A 4PFUA 2CZKA 3SEUA 1UIUA 1FRPA 1B3LA 2V93A 3K6WA 2F7BA 4NGUA 1B0LA 2KLFA 5ET5A 3MYUA 4QF9A 5CC2A 2R9JA 4QHQA 1LAFE 3G3HA 4R6YA 5M2VA 3IOVA 2ONRA 4JVDA 3RTWB 4MEVA 4PF6A 4OVJA 4GWUA 2F36A 4FATA 3MZ9A 1B51A 4P56A 1XVXA 1SPIA 2KQZA 2XD2A 2XXWA 2Y5KA 4DCYA 1P1NA 3TPAA 3SEXA 1M5EA 5EQ9A 2PT1A 3CIJA 3K00A 5KDTA 2DDKA 5DVJA 3EHTA 2XXKA 4OANA 4GQOA 3VDFA 3SZPA 3USDA 2Q74A 4GL8A 4JWXA 5AA2A 1ZMGA 3EHUA 2HFBA 2FVZA 2LAOA 1K9YA 4PBQA 3G3FA 1G0HA 1PEBA 1B32A 2F35A 4RY1A 2QS3A 5CBSA 1N76A 4NX1A 2PCRA 4ZEDA 3QK6A 2H99A 2DVZA 1N0TA 2ZYKA 1OVTA 4GIZA 1XOCA 4NQ8A 2QPQA 3T9UA 2Z8EA 4H6DA 4MNIA 5ET8A 4IO2A 4OZ9A 5FHMA 3FVNA 1IMBA 3FVGA 4I3YA 5IZ1A 2XXRA 5H8NB 1MPBA 4F39A 3E3KA 3MUQA 1NFTA 1AOVA 3FJMA 4HW8A 3TCFA 4PFYA 1DBZA 1ZJLA 1JEUA 1MM6A 1FBGA 1Q1KA 4OFLA 1A99A 3OEKA 1Z7NE 4PAKA 1IXCA 1NMUA 1MQDA 2G29A 1B4ZA 5DVFA 5I7IA 1MM7A 5FHNA 2CEXA 1QJMA 4F1VA 4KCDA 1P1OA 1I6AA 4U1ZA 1MY4A 2XWOA 1B9JA 1USYE 3LSXA 2HZKA 4R74A 3S9MC 3C9HA 4OVPA 3HSTA 3HV1A 1SW1A 4YMBA 2XD3A 5B70A 4XFEA 3CFXA 4AB6A 4ZDMA 4EXKA 5JTYB 1HSEA 4FBPA 4GX3A 3C4MA 3QSLA 3VXCA 2QVVA 1A55A 1N84A 3KBRA 2O7IA 4POXA 1FPEA 2A5TA 3GBBA 5CMKA 1MY0A 1NUYA 3Q25A 3KGCA 5TP9A 2OWSA 3T9HB 1ZLQA 4PFRA 5EQAA 4FJPA 1WDNA 5DEXB 3G3JA 4F2QA 3PPRA 4YMAA 3OD7A 4HS7A 1NV3A 4PGNA 4NG7A 1D3KA 1I6QA 3C35A 2CMOA 3H3GA 1B3GA 5EHSA 1YPNA 1JW1A 4ZEIA 1XHYA 3RY3A 1UTBB 4POWA 3VVEA 1IMFA 5I58A 2XXTA 1B3FA 5L9SA 2BJIA 2I58A 3QMFA 3BIGA 2V3QA 4OVTA 3TZAA 5FTIA 4MLQA 2RCAA 1S7YA 2DWIA 4ZE9A 4O8MA 4DXCA 4LP2B 4X9TA 3S9NC 3K6UA 5ET7A 1QGXA 3IJXB 4MX6A 3PPOA 2H9BA 4N6DA 2XWVA 1LFHA 2P3NA 4YB6A 3O28A 3PGFA 1EU8A 4ZZAA 5DEXA 5JTYA 1A8FA 2GHAA 3PD8A 1OQGA 3IO6A 3U65A 4I8CA 3TTKA 4PE3A 1PB9A 4RA1A 5DW8A 1IXGA 3EN3A 4KFQA 1KA1A 5I57B 4O94A 4BLAA 4P11A 1ZIUA 2PVUA 3PD9A 4H67A 1FJ9A 2YPNA 3ILUB 3CG3A 3OOAA 5AA4A 3WAFA 2XHDA 4U2RA 4FE8A 1MH4A 2XA5A 3KG2A 2Q2CA 4ZECA 2Q8MA 4G8NA 1BKAA 2XX9A 3B7DA 1VR5A 1QULA 4OFJA 3GLBA 4FIMA 3KFMA 4OA4A 2ZNTA 5H8FB 1YXIA 2Y7IA 2GRVA 3K6VA 5ITPA 2CEYA 5CBRA 1VFEA 4JSDA 4IO4A 4YKKA 1D9QA 1Y4TA 2RKMA 4UACA 4HTGA 1MQGA 1LLSA 1XVYA 4GBVA 1F9BA 2B3FA 2YJPA 4QSDA 4IB2A 1JVXA 1B5IA 3EQ1A 2VHAA 1B7UA 3S4UA 1RDXA 3GZGA 1OMPA 4RK2A 1P1WA 4MCOA 2ZNSA 5TPAB 1FPIA 5KCJA 4N8GA 4O7MA 3M3FA 2X7PA 3B50A 4PTKA 1UTHB 2X7QA 4I3EA 1D9YA 3KSXA 4GX6A 4FECA 3G3IA 5ISUA 4IGRA 4FEDA 4DI4B 3IORA 1B7HA 3CFLA 3PUXE 4GWSA 5CMCA 3SDFA 4JSOA 4F31B 2E0SA 3FV2A 2HXRA 4LUBA 1A54A 2DWAA 3OSRA 1QW0A 3FXUA 1FBCA 3OELA 3MZ1A 4I9DA 4F29A 1FSAA 5H8HB 3HHFA 1NNPA 3HFUA 2DE4A 4R6HA 4PDHA 4ELPA 2F6GA 1Y3PA 1CB6A 3ILTB 3HO7A 1EH3A 4XXUA 1KWHA 2DE2A 1O63A 3CHGA 3FJ7A 4H45A 1TT1A 4QFPA 2CZLA 2ZNUA 4MH5A 2RC7A 1YCJA 3G7WA 4N91A 4KPTA 5I57A 4XKRA 3K6XA 2Y7KA 4PETA 3Q29A 4O3CA 5I84A 1MQIA 3MAMA 4X04A 2RINA 3KC1A 3IJOB 4NF5B 1NUXA 3O6GA 4OTEA 1MXXA 3LBSA 4G68C 4E0XA 5K2XA 2DSFA 1I69A 4F3GA 2NXOA 4DI3D 2ZYOA 4JVIA 4O3BA 3U8QA 3BKIB 2O68A 1LBVA 1B58A 1US4A 3N94A 4OHNA 4PAFA 4H5GA 4Z0IA 3TELA 1SDXA 1G0IA 3OMBA 4EUOA 4RYAA 3CSBA 2OWTA 4FAJA 2G93A 4MLVA 3IOTA 1FPGA 2OX3A 3IR1A 2H25A 2QVRA 1DSNA 3GYYA 4GXSB 3MQ9A 3A3CA 3THIA 1UTHA 1FQCA 2PFZA 4PGPA 3SEVA 4UABA 1Y9UA 1EYJA 1QKAA 3MSTA 2UVJA 2QJEA 1IXHA 1LBXA 3N26A 1JQFA 3CSGA 4Q0CA 1B5HA 3KN8A 5ITOA 3E9XA 4AS5A 2JJKA 1B6HA 4C0RA 1POY1 2D21A 2REGA 3BIHA 5I58B 1MG1A 1Q35A 4N17A 3UN6A 2CZIA 3B6TA 3LR1A 4JB7A 4THIA 3K2DA 4LN5A 1H45A 2O6AA 3C32A 2XXIA 2QVUA 4Q8RA 1A8EA 2AL4A 3T9XB 5I56A 4F22A 1FCKA 3OENA 4QSEA 2XXHA 1N3WA 4IY6A 2AL5A 5AA3A 1MXWA
chains in the Genus database with same CATH topology
4R74A 5AA2B 3C9HA 3S9MC 3W9VA 3GXAA 4G68A 3SEYA 3G3KA 3HSTA 1R9QA 2F7CA 3MC2A 3K1PA 1IXIA 3KN7A 1L5TA 3HV1A 1NNTA 3DP6A 2P1SA 3O2AA 2Z8DA 4HCYA 4OETA 4LZ7A 2NWJA 3WAEA 1FW0A 1SW1A 2O84X 4YMBA 2XD3A 3B6QA 3TQLA 4DLDA 4YU0A 4UA8A 4C1UA 3RGYA 1GTKA 5B70A 4XTCQ 1I6BA 1IEJA 3T22A 3IOUA 1FQEA 2Y7RA 4NF8B 5DYHA 3CFXA 3IX1A 4AB6A 4ZDMA 3SEWA 4EXKA 5JTYB 1HSEA 1AMFA 3CVGA 1AL3A 1FQAA 3K02A 5HBCA 5DTBA 5KZTA 3UN6A 3FGSA 3C4MA 4XKPA 3QSLA 2V25A 1USYH 2UVGA 3VXCA 4JBZA 2F5XA 1A55A 4E0WA 1N84A 3HPIA 3F11A 2Z23A 3PMXA 3KBRA 4X48A 2O7IA 1FQDA 3R26A 4POXA 2A5TA 3GBBA 5CMKA 1MY0A 2ZMBA 5AA4B 3L6HA 1MXUA 3S2VA 2OLBA 4I1DA 2HAUA 1SW5A 3Q25A 4U1OA 1LFGA 1SI0A 2DWHA 2DOJA 3JYRA 3K1MA 4QSCA 2E1SA 3KJTA 3PUYE 4IO7A 3KGCA 4AB5A 5TP9A 2OWSA 3T9HB 4RPOA 1ZLQA 4ISUA 1MDP1 4ZE8A 4FJPA 1Y3NA 3H4ZA 1WDNA 3R6UA 2X26A 5DEXB 3L6GA 1IITA 1B05A 3G3JA 3UGWA 2V3UA 4F2QA 2FNCA 2UYEA 2WKYA 3PPRA 4F19A 4YMAA 3VLVA 3OD7A 1T0KA 2QMXA 4NF4B 3TTNA 1A40A 4R9GA 4X1BA 5H8QB 3ZKKA 4IY5A 4ZZEA 1RKMA 1MQJA 4BDMA 3PUWE 3FJGA 3MPLA 4EQ7A 3FXRA 4HS7A 1DTZA 5A5XB 4RK9A 1D3KA 1I6QA 3C35A 3O29A 4G4PA 2CMOA 4XIGQ 3H3GA 1Y1MA 4EDPA 1B3GA 2ONKE 4DZ1A 3I6VA 1Y1ZA 4K3FA 1ZTYA 3UA8A 5EHSA 3LSWA 4F1UA 5AA2D 1YPNA 5CRYA 4H5FA 3DLNA 5H8SA 1ANFA 1TFAA 1JW1A 3HCQA 1XHYA 1DTGA 1UTBB 4FORA 4POWA 4ZEIA 3RY3A 3VV5A 3MVZA 3VVEA 1SI1A 2HXWA 5F1QA 3N5LA 5I58A 1PBQA 1IQ7A 2XXTA 1B3FA 2ALUA 1MQHA 3IK6B 4DDDA 1NL5A 4F3BA 1B3HA 2W7YA 5L9SA 4IGTA 3MWBA 4L17A 1HSLA 2I58A 4MFIA 4H65A 2V3QA 3A3UA 4OMBA 5TPAA 3TZAA 3R7XA 1FTKA 1PDAA 5FTIA 3PPQA 1Z7ME 2V84A 4MLQA 4U4SA 2RCAA 3V83A 2DWIA 1S7YA 1YTVA 2HQ0A 4LATA 4ZE9A 4OERA 3RPWA 5AE4A 1MS7A 5IAIA 3MP1A 4TLLB 4DXCA 5JTYA 1B40A 4LP2B 4X9TA 3S9NC 4RNSA 3K6UA 4ND9A 3UIFA 2QMWA 4DIGA 5ICQA 3VLUA 4DXUA 3IJXB 2I3VA 4DXBA 4ZEKA 2OJTA 5DVIA 5CI5A 2D3IA 2Q8JA 3PPOA 2H9BA 1GR2A 3S9LC 2XX7A 3MVWA 2FA7A 3TDJA 3FZVA 3LC8A 1AIVA 3VLWA 1LFHA 2ZYMA 4YB6A 1FTJA 3O28A 3PGFA 3FATA 1PB7A 3C33A 1EU8A 4ZZAA 1LAHE 3BFUA 2Y7WA 1A8FA 3DM0A 3D4GA 1MDQA 3KZGA 5DEXA 1WODA 2A5SA 2XXXA 3CFZA 4X1DA 3W9WA 1LCFA 1P1QA 2GHAA 2QS4A 3PD8A 4PFTA 3N6UA 4G68B 3T96B 1NNFA 1OQGA 1M5FA 3IO6A 4F1YA 4ELOA 4IO3A 3CI8A 3QUFA 3H6TA 2BJJX 3PU5A 4WEDA 4I8CA 3TTKA 3KOSA 4FATA 1PB9A 2I0CA 4QFNA 1Y4CA 1POTA 5AA4A 3IL1B 3PUVE 4HCWA 4RA1A 2O1MA 4EF2A 4ELRA 2Z22A 5H8QA 3QXMA 1NH7A 1IXGA 3EN3A 3KSJA 2DVCA 4KFQA 4OYVA 1ZKBA 4F3SA 4F18A 3OEMA 3RT6B 4NTLA 4N6PA 3TYHA 3RTFB 3V5AA 2I4BA 5I57B 5FTHA 3H7MA 5TP9B 1QVSA 3VE1B 3K4UA 4BLAA 4EF1A 4P11A 5JK4A 1DPEA 1ZIUA 1MY1A 2PVUA 3PD9A 4YKJA 4BDNA 4Z7EA 2A5TB 4G8MA 3TTRA 4H67A 4KQPA 3SERA 1VSOA 3W15C 1TWYA 2F6PA 2F97A 1XT8A 1B2HA 4C1TA 2UYFA 4N13A 3PPNA 2YPNA 1O7TA 2ESNA 3ILUB 4PE5B 3CG3A 3MVYA 1XC1A 3OOAA 4NWCA 4M1VA 1SD3A 2YLNA 4M4GA 2XXQA 3Q26A 2DWJA 3ONMA 4H8IA 2XHDA 4WKMA 3V89B 3U94A 3WAFA 1N7XA 1QUIA 4U2RA 3KOTA 2H5YA 2O51A 3TUSA 1SYHA 1MY3A 3MJNA 3OXNA 4R2BA 4FE8A 5L9OA 1MH4A 3MP8A 3QUJA 1QUJA 2ZYNA 1LAXA 2NUVA 3BBRA 3KG2A 2Q2CA 5I2KB 4ZECA 1BTJA 4OENA 4G8NA 3MBPA 1R9LA 1B5JA 1BKAA 1MY2A 2XX8A 4JDFA 2XX9A 3UORA 2P0SA 1MRPA 2GHBA 3HN0A 3IOWA 3B7DA 1VR5A 1H44A 3FXQA 1QULA 4OFJA 4WEPA 4BDLA 1M5BA 1OIBA 2O1LA 2QRYA 4R2FA 2DXYA 3GLBA 4H0WA 3C36A 5I56B 1BIYA 1IIWA 2VGQA 2HZLA 2H98A 3K0VA 3KFMA 4FIMA 5ELVA 4DE8A 4PFWA 5BUUA 2ZNTA 1DPPA 5JEIA 5I58B 5HPQA 2P2AA 5H8FB 1N04A 2Y7IA 2I6EA 4LQ5A 3ODBA 2GRVA 2Q2AA 3TODA 3K6VA 3TTLA 4P0GA 3MW0A 5ITPA 3FV1A 4NF6A 1N7WA 5CBRA 4KR5A 1VFEA 1RYXA 1UTBA 3C34A 1LB9A 4JSDA 2DS9A 3PMWA 4IO4A 4YKKA 4GL0A 1QUKA 1Y4TA 2Q88A 2RKMA 4GD5A 4H1XA 4R6KA 2I49A 4KI0E 4UACA 2DXRA 5FHOA 1M5DA 4HTGA 1MQGA 1B1HA 4PQJA 3RN8A 1EZOA 1LLSA 4OWDA 3EPEA 3A09A 1PC3A 2IEEA 1N3XA 1XVYA 2PBWA 1EZPA 2GH9A 2OCUA 4LZ5A 1CE2A 1F9BA 1JW4A 3M8UA 4ZEFA 3QIMA 5AA1A 1MH3A 2B3FA 1B1XA 3P7IA 4ONYA 1D4NA 4YICA 2YJPA 4QSDA 4IB2A 1JVXA 1TFDA 1B5IA 1FTLA 3T9VA 1H76A 3EQ1A 4R75A 1LFIA 2VHAA 1B7UA 4XKNA 3VVFA 4I62A 3S4UA 3RLFE 3GZGA 1JW5A 3M3KA 3U92A 4JWYA 5I2NB 1US5A 1OMPA 4MBPA 4RK2A 3TEPA 3TCGA 4GXAA 1P1WA 2OK2A 3BFTA 3T66A 1OLCA 3TKDA 1NNKA 2ZNSA 1WVJA 5TPAB 2ANJA 5KCJA 2XXYA 5H8FA 4NEDA 1M5CA 5I59B 5H8NA 1FTOA 3M3FA 2X7PA 4YB7A 3FVOA 1UTHB 5A5XA 4ELQA 3SKPA 3IB2A 4Q30B 3SETA 2FYIA 3JZJA 2RF1A 2X7QA 4R73A 5KDTB 1HSJA 1PBPA 4KHZE 1D9YA 3EF7A 3CRBA 3KSXA 1GV8A 2Y7PA 3DELB 4QFLA 5EYFA 3TQWA 5I2NA 2ZXTA 4FECA 3M3LA 3U93A 3G3IA 1URSA 2REJA 5L9MA 5ISUA 4IGRA 2VP1A 1OLAA 1PB8A 1MXVA 5TU0A 2UVIA 2NOOA 3VVDA 1O64A 4U21A 1B4HA 4F3PA 4QFOA 4KD5A 4FEDA 1NKXA 2VOZA 3OSQA 4AQ4A 2QL3A 3IORA 5ICTA 3UK4A 2PMSA 1B7HA 3CFLA 3I5OA 5J1DA 2UXAA 3PMVA 3VFJA 3LUYA 2ONSA 4OEUA 3IB1A 2RC8A 1SYIA 2HAVA 5F7VA 1R1NA 1NH8A 3JV9A 2DQVA 4G77A 2V3TA 3RQTA 2Q89A 1LSTA 3PUXE 4GRKA 3SDFA 1JVYA 4LZ8A 1MPCA 4G8HA 5CMCA 1RYOA 4QRZA 4YZZA 1II5A 4JSOA 4F31B 3S9EA 1VE4A 2E0SA 4RXLA 2VD3A 2Z8FA 3FV2A 1SW2A 4LUBA 4RJZA 1MXZA 1Y20A 1A54A 1H3DA 1R6ZA 1UIVA 5I2KA 2DWAA 1SBPA 2F78A 4RPNA 3OSRA 1LBCA 1J1NA 2PT2A 3VXBA 1QW0A 1OQHA 3MVXA 3UP9A 4BDQA 4JXIA 2IA4A 3FXUA 3AXFA 1BLFA 4U4XA 2THIA 4P0IA 4YAHX 3OELA 4LA9A 4TQUQ 3EHSA 3MZ1A 2OBGA 4I9DA 4NF8A 4F29A 5H8HB 3D4CA 3CR9A 2HCAA 1URDA 2I48A 2UVHA 3HHFA 1NNPA 3DP8A 3OO6A 4GOTA 4LQ2A 4YB5A 1B52A 4PFUA 3OO9A 2DE4A 4LONB 1ATGA 3DP4A 4QFKA 1SQYA 1QKBA 4R6HA 4KYEA 3TMGA 1B7ZA 4ELPA 2F6GA 4EXLA 1Y3PA 1CB6A 1SVXB 1UIUA 3ILTB 3H6WA 1B3LA 4ZEBA 2I0BA 3SEUA 2V93A 3K6WA 2F7BA 3HO7A 1EH3A 4XXUA 1KWHA 3Q28A 1B0LA 1UQWA 4ESWA 2KLFA 2DE2A 1O63A 4QF9A 1EZ9A 3O6HA 3FJ7A 3SESA 4BDRA 2R9JA 5CC2A 2PYYA 3C31A 1TT1A 4QHQA 4QFPA 1LAFE 2CZLA 2ZNUA 3G3HA 3IO4A 4ESXA 4R6YA 2DYXA 5M2VA 3IOVA 4MH5A 2ONRA 2RC7A 4GLIA 1YCJA 1B46A 3G7WA 3RTWB 5I59A 4LVQA 3ZSFA 5IKBA 4KPTA 5L8DA 3RT8A 5I57A 4OVJA 1B3EA 2H4IA 2NVUB 3MPKA 3QAXA 4GWOA 2F36A 1JNFA 4O3AA 3MZ9A 3K6XA 1B51A 2Y7KA 3OO8A 4G2ZA 4PETA 4XKRA 4MF3A 3ZKLA 1XVXA 2B65A 2XD2A 2XXWA 3O6IA 3Q29A 2F7AA 5CMBA 5H8HA 4DCYA 1P1NA 3K1NA 1MQIA 4O3CA 4GF8A 3MAMA 4R9FA 3SEXA 3TPAA 5I84A 4TOZA 3LSLA 5CM6A 1LBBA 2RINA 3PPPA 1M5EA 4NF5B 3IJOB 3Q27A 2PT1A 3FD3A 3O6GA 3KN3A 4OTEA 1MXXA 3LBSA 3CIJA 4G68C 3K00A 4YKIA 3O97A 3IB0A 3FIRA 4E0XA 1B0HA 5K2XA 5DVJA 5KDTA 3U1OA 3TAJA 2DSFA 1I69A 4Q5TA 3EHTA 4XKQA 4GQOA 4F3GA 1D9VA 2NXOA 3VDFA 2ZYOA 2GFEA 4O3BA 4OFOA 3U8QA 3FVKA 3KJ7A 4TLMB 2XXVA 3BKIB 2XXPA 4U23A 2O68A 2HEUA 1DOTA 4EQ9A 3USDA 5B7DA 1B58A 4IO6A 1US4A 1LCTA 3N94A 3T93B 2AIXA 4OHNA 1JEVA 4GL8A 1H43A 3KEIA 3MZBA 1FQBA 4JWXA 5AA2A 4U22A 1ZMGA 4H5GA 2QS2A 4NWDA 4Z0IA 1LB8A 3TELA 1YAEA 1SDXA 4IO5A 3EHUA 2F8DA 3I3VA 1FQFA 2HFBA 1GGGA 1S9TA 3OMBA 4EUOA 4OEVA 3GBAA 3PV0E 4RYAA 4FEBA 4NF6B 2LAOA 3CSBA 2O7UA 2OWTA 3ZS6A 5HM4B 1JETA 3O9PA 4H8JA 4FAJA 4NF4A 2G93A 3G3FA 2F35A 1PEBA 1B32A 1A7LA 3IOTA 4MLVA 4JWOA 3E13X 3H06B 4NF5A 4RY1A 3IR1A 1MXYA 2HZKA 2OZZA 2O69A 3TTMA 4ZS9A 1AH5A 2H25A 3ECRA 3G3GA 2QS3A 3LSFB 1N76A 4OQOA 1GVCA 5CBSA 1BP5A 1IUDA 5BWJA 2PX1A 5KCJB 3TCFA 2R6GE 1DSNA 2Q9TA 1IZ1A 2I3WA 4GXSB 1VFDA 4PP0A 3MQ9A 3A3CA 1LGBC 3QK6A 2H99A 4N07A 1UTHA 2RC9A 3TFLA 3THIA 4ECFA 2DVZA 4EQBA 1N0TA 2ZYKA 1FQCA 1OVTA 4GIZA 4ZEDA 3RNNA 3SEVA 1XOCA 2QPQA 4OESA 3TCHA 3PUZE 1Y9UA 3FUZA 5DT6A 3T9UA 2Z8EA 1QKAA 3FASA 3MP6A 2UVJA 4H6DA 2QJEA 5K2YA 4IO2A 4OZ9A 1IXHA 2D5WA 3N26A 1JQFA 1OVBA 3K01A 5FHMA 2B3BA 3FVGA 3B6WA 3CSGA 1B5HA 1P99A 3FVNA 4Q0CA 2XXRA 1ZU0A 3HHGA 5H8NB 4OXVA 1FTMA 1MPBA 2RCBA 4KCCA 4NMYA 3KN8A 3E3KA 5ITOA 1Y3QA 4F39A 3MUQA 1NFTA 1SW4A 3IAZA 3E9XA 3V8XB 1AOVA 1B6HA 1P1UA 1POY1 3CG1A 3FJMA 5EHMA 4C0RA 4HW8A 2F34A 1S50A 4KYDA 2D21A 2REGA 2QS1A 1ZJLA 2XXUA 1JEUA 1XS5A 4PFYA 4KYSA 2ABHA 1MM6A 1Q1KA 3E4RA 1MG1A 4OFLA 4GVOA 1Q35A 1ELJA 1A99A 3H03A 3OEKA 4WXJA 3B6TA 3LR1A 3OO7A 4JB7A 4THIA 3K2DA 3H6VA 1MPDA 3QYTA 1Z7NE 3U72A 1IXCA 1H45A 1NMUA 2O6AA 4R72A 3C32A 1MQDA 2G29A 4DCXA 2XXIA 1B4ZA 4F2OA 1ZBMA 5DVFA 1URGA 1DMBA 1A8EA 2DE3A 4Q8RA 1MM7A 4BDOA 4NE4A 2DP8A 5FHNA 1QJMA 3H6UA 3N6TA 2I4CA 4F1VA 2AL4A 4KCDA 3T9XB 5I56A 5LOMA 2VD2A 1P1OA 4YKPA 4F22A 1I6AA 4U1ZA 2AYSA 1FCKA 3RUMA 1MY4A 2R71A 3OENA 5CMMA 4QSEA 2XXHA 2QSXA 1B9JA 1N3WA 2Y84A 4GFRA 4IY6A 2AL5A 1USYE 3LSXA 3O66A 1MXWA 2M8CA 1TXFA 5AA3A 1LAGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R74 A;  5AA2 B;  3C9H A;  3S9M C;  3W9V A;  3GXA A;  4G68 A;  3SEY A;  3G3K A;  3HST A;  1R9Q A;  2F7C A;  3MC2 A;  3K1P A;  1IXI A;  3KN7 A;  1L5T A;  3HV1 A;  1NNT A;  3DP6 A;  2P1S A;  3O2A A;  2Z8D A;  4HCY A;  4OET A;  4LZ7 A;  2NWJ A;  3WAE A;  1FW0 A;  1SW1 A;  2O84 X;  4YMB A;  2XD3 A;  3B6Q A;  3TQL A;  4DLD A;  4YU0 A;  4UA8 A;  4C1U A;  3RGY A;  1GTK A;  5B70 A;  4XTC Q;  1I6B A;  1IEJ A;  3T22 A;  3IOU A;  1FQE A;  2Y7R A;  4NF8 B;  5DYH A;  3CFX A;  3IX1 A;  4AB6 A;  4ZDM A;  3SEW A;  4EXK A;  5JTY B;  1HSE A;  1AMF A;  3CVG A;  1AL3 A;  1FQA A;  3K02 A;  5HBC A;  5DTB A;  5KZT A;  3UN6 A;  3FGS A;  3C4M A;  4XKP A;  3QSL A;  2V25 A;  1USY H;  2UVG A;  3VXC A;  4JBZ A;  2F5X A;  1A55 A;  4E0W A;  1N84 A;  3HPI A;  3F11 A;  2Z23 A;  3PMX A;  3KBR A;  4X48 A;  2O7I A;  1FQD A;  3R26 A;  4POX A;  2A5T A;  3GBB A;  5CMK A;  1MY0 A;  2ZMB A;  5AA4 B;  3L6H A;  1MXU A;  3S2V A;  2OLB A;  4I1D A;  2HAU A;  1SW5 A;  3Q25 A;  4U1O A;  1LFG A;  1SI0 A;  2DWH A;  2DOJ A;  3JYR A;  3K1M A;  4QSC A;  2E1S A;  3KJT A;  3PUY E;  4IO7 A;  3KGC A;  4AB5 A;  5TP9 A;  2OWS A;  3T9H B;  4RPO A;  1ZLQ A;  4ISU A;  1MDP 1;  4ZE8 A;  4FJP A;  1Y3N A;  3H4Z A;  1WDN A;  3R6U A;  2X26 A;  5DEX B;  3L6G A;  1IIT A;  1B05 A;  3G3J A;  3UGW A;  2V3U A;  4F2Q A;  2FNC A;  2UYE A;  2WKY A;  3PPR A;  4F19 A;  4YMA A;  3VLV A;  3OD7 A;  1T0K A;  2QMX A;  4NF4 B;  3TTN A;  1A40 A;  4R9G A;  4X1B A;  5H8Q B;  3ZKK A;  4IY5 A;  4ZZE A;  1RKM A;  1MQJ A;  4BDM A;  3PUW E;  3FJG A;  3MPL A;  4EQ7 A;  3FXR A;  4HS7 A;  1DTZ A;  5A5X B;  4RK9 A;  1D3K A;  1I6Q A;  3C35 A;  3O29 A;  4G4P A;  2CMO A;  4XIG Q;  3H3G A;  1Y1M A;  4EDP A;  1B3G A;  2ONK E;  4DZ1 A;  3I6V A;  1Y1Z A;  4K3F A;  1ZTY A;  3UA8 A;  5EHS A;  3LSW A;  4F1U A;  5AA2 D;  1YPN A;  5CRY A;  4H5F A;  3DLN A;  5H8S A;  1ANF A;  1TFA A;  1JW1 A;  3HCQ A;  1XHY A;  1DTG A;  1UTB B;  4FOR A;  4POW A;  4ZEI A;  3RY3 A;  3VV5 A;  3MVZ A;  3VVE A;  1SI1 A;  2HXW A;  5F1Q A;  3N5L A;  5I58 A;  1PBQ A;  1IQ7 A;  2XXT A;  1B3F A;  2ALU A;  1MQH A;  3IK6 B;  4DDD A;  1NL5 A;  4F3B A;  1B3H A;  2W7Y A;  5L9S A;  4IGT A;  3MWB A;  4L17 A;  1HSL A;  2I58 A;  4MFI A;  4H65 A;  2V3Q A;  3A3U A;  4OMB A;  5TPA A;  3TZA A;  3R7X A;  1FTK A;  1PDA A;  5FTI A;  3PPQ A;  1Z7M E;  2V84 A;  4MLQ A;  4U4S A;  2RCA A;  3V83 A;  2DWI A;  1S7Y A;  1YTV A;  2HQ0 A;  4LAT A;  4ZE9 A;  4OER A;  3RPW A;  5AE4 A;  1MS7 A;  5IAI A;  3MP1 A;  4TLL B;  4DXC A;  5JTY A;  1B40 A;  4LP2 B;  4X9T A;  3S9N C;  4RNS A;  3K6U A;  4ND9 A;  3UIF A;  2QMW A;  4DIG A;  5ICQ A;  3VLU A;  4DXU A;  3IJX B;  2I3V A;  4DXB A;  4ZEK A;  2OJT A;  5DVI A;  5CI5 A;  2D3I A;  2Q8J A;  3PPO A;  2H9B A;  1GR2 A;  3S9L C;  2XX7 A;  3MVW A;  2FA7 A;  3TDJ A;  3FZV A;  3LC8 A;  1AIV A;  3VLW A;  1LFH A;  2ZYM A;  4YB6 A;  1FTJ A;  3O28 A;  3PGF A;  3FAT A;  1PB7 A;  3C33 A;  1EU8 A;  4ZZA A;  1LAH E;  3BFU A;  2Y7W A;  1A8F A;  3DM0 A;  3D4G A;  1MDQ A;  3KZG A;  5DEX A;  1WOD A;  2A5S A;  2XXX A;  3CFZ A;  4X1D A;  3W9W A;  1LCF A;  1P1Q A;  2GHA A;  2QS4 A;  3PD8 A;  4PFT A;  3N6U A;  4G68 B;  3T96 B;  1NNF A;  1OQG A;  1M5F A;  3IO6 A;  4F1Y A;  4ELO A;  4IO3 A;  3CI8 A;  3QUF A;  3H6T A;  2BJJ X;  3PU5 A;  4WED A;  4I8C A;  3TTK A;  3KOS A;  4FAT A;  1PB9 A;  2I0C A;  4QFN A;  1Y4C A;  1POT A;  5AA4 A;  3IL1 B;  3PUV E;  4HCW A;  4RA1 A;  2O1M A;  4EF2 A;  4ELR A;  2Z22 A;  5H8Q A;  3QXM A;  1NH7 A;  1IXG A;  3EN3 A;  3KSJ A;  2DVC A;  4KFQ A;  4OYV A;  1ZKB A;  4F3S A;  4F18 A;  3OEM A;  3RT6 B;  4NTL A;  4N6P A;  3TYH A;  3RTF B;  3V5A A;  2I4B A;  5I57 B;  5FTH A;  3H7M A;  5TP9 B;  1QVS A;  3VE1 B;  3K4U A;  4BLA A;  4EF1 A;  4P11 A;  5JK4 A;  1DPE A;  1ZIU A;  1MY1 A;  2PVU A;  3PD9 A;  4YKJ A;  4BDN A;  4Z7E A;  2A5T B;  4G8M A;  3TTR A;  4H67 A;  4KQP A;  3SER A;  1VSO A;  3W15 C;  1TWY A;  2F6P A;  2F97 A;  1XT8 A;  1B2H A;  4C1T A;  2UYF A;  4N13 A;  3PPN A;  2YPN A;  1O7T A;  2ESN A;  3ILU B;  4PE5 B;  3CG3 A;  3MVY A;  1XC1 A;  3OOA A;  4NWC A;  4M1V A;  1SD3 A;  2YLN A;  4M4G A;  2XXQ A;  3Q26 A;  2DWJ A;  3ONM A;  4H8I A;  2XHD A;  4WKM A;  3V89 B;  3U94 A;  3WAF A;  1N7X A;  1QUI A;  4U2R A;  3KOT A;  2H5Y A;  2O51 A;  3TUS A;  1SYH A;  1MY3 A;  3MJN A;  3OXN A;  4R2B A;  4FE8 A;  5L9O A;  1MH4 A;  3MP8 A;  3QUJ A;  1QUJ A;  2ZYN A;  1LAX A;  2NUV A;  3BBR A;  3KG2 A;  2Q2C A;  5I2K B;  4ZEC A;  1BTJ A;  4OEN A;  4G8N A;  3MBP A;  1R9L A;  1B5J A;  1BKA A;  1MY2 A;  2XX8 A;  4JDF A;  2XX9 A;  3UOR A;  2P0S A;  1MRP A;  2GHB A;  3HN0 A;  3IOW A;  3B7D A;  1VR5 A;  1H44 A;  3FXQ A;  1QUL A;  4OFJ A;  4WEP A;  4BDL A;  1M5B A;  1OIB A;  2O1L A;  2QRY A;  4R2F A;  2DXY A;  3GLB A;  4H0W A;  3C36 A;  5I56 B;  1BIY A;  1IIW A;  2VGQ A;  2HZL A;  2H98 A;  3K0V A;  3KFM A;  4FIM A;  5ELV A;  4DE8 A;  4PFW A;  5BUU A;  2ZNT A;  1DPP A;  5JEI A;  5I58 B;  5HPQ A;  2P2A A;  5H8F B;  1N04 A;  2Y7I A;  2I6E A;  4LQ5 A;  3ODB A;  2GRV A;  2Q2A A;  3TOD A;  3K6V A;  3TTL A;  4P0G A;  3MW0 A;  5ITP A;  3FV1 A;  4NF6 A;  1N7W A;  5CBR A;  4KR5 A;  1VFE A;  1RYX A;  1UTB A;  3C34 A;  1LB9 A;  4JSD A;  2DS9 A;  3PMW A;  4IO4 A;  4YKK A;  4GL0 A;  1QUK A;  1Y4T A;  2Q88 A;  2RKM A;  4GD5 A;  4H1X A;  4R6K A;  2I49 A;  4KI0 E;  4UAC A;  2DXR A;  5FHO A;  1M5D A;  4HTG A;  1MQG A;  1B1H A;  4PQJ A;  3RN8 A;  1EZO A;  1LLS A;  4OWD A;  3EPE A;  3A09 A;  1PC3 A;  2IEE A;  1N3X A;  1XVY A;  2PBW A;  1EZP A;  2GH9 A;  2OCU A;  4LZ5 A;  1CE2 A;  1F9B A;  1JW4 A;  3M8U A;  4ZEF A;  3QIM A;  5AA1 A;  1MH3 A;  2B3F A;  1B1X A;  3P7I A;  4ONY A;  1D4N A;  4YIC A;  2YJP A;  4QSD A;  4IB2 A;  1JVX A;  1TFD A;  1B5I A;  1FTL A;  3T9V A;  1H76 A;  3EQ1 A;  4R75 A;  1LFI A;  2VHA A;  1B7U A;  4XKN A;  3VVF A;  4I62 A;  3S4U A;  3RLF E;  3GZG A;  1JW5 A;  3M3K A;  3U92 A;  4JWY A;  5I2N B;  1US5 A;  1OMP A;  4MBP A;  4RK2 A;  3TEP A;  3TCG A;  4GXA A;  1P1W A;  2OK2 A;  3BFT A;  3T66 A;  1OLC A;  3TKD A;  1NNK A;  2ZNS A;  1WVJ A;  5TPA B;  2ANJ A;  5KCJ A;  2XXY A;  5H8F A;  4NED A;  1M5C A;  5I59 B;  5H8N A;  1FTO A;  3M3F A;  2X7P A;  4YB7 A;  3FVO A;  1UTH B;  5A5X A;  4ELQ A;  3SKP A;  3IB2 A;  4Q30 B;  3SET A;  2FYI A;  3JZJ A;  2RF1 A;  2X7Q A;  4R73 A;  5KDT B;  1HSJ A;  1PBP A;  4KHZ E;  1D9Y A;  3EF7 A;  3CRB A;  3KSX A;  1GV8 A;  2Y7P A;  3DEL B;  4QFL A;  5EYF A;  3TQW A;  5I2N A;  2ZXT A;  4FEC A;  3M3L A;  3U93 A;  3G3I A;  1URS A;  2REJ A;  5L9M A;  5ISU A;  4IGR A;  2VP1 A;  1OLA A;  1PB8 A;  1MXV A;  5TU0 A;  2UVI A;  2NOO A;  3VVD A;  1O64 A;  4U21 A;  1B4H A;  4F3P A;  4QFO A;  4KD5 A;  4FED A;  1NKX A;  2VOZ A;  3OSQ A;  4AQ4 A;  2QL3 A;  3IOR A;  5ICT A;  3UK4 A;  2PMS A;  1B7H A;  3CFL A;  3I5O A;  5J1D A;  2UXA A;  3PMV A;  3VFJ A;  3LUY A;  2ONS A;  4OEU A;  3IB1 A;  2RC8 A;  1SYI A;  2HAV A;  5F7V A;  1R1N A;  1NH8 A;  3JV9 A;  2DQV A;  4G77 A;  2V3T A;  3RQT A;  2Q89 A;  1LST A;  3PUX E;  4GRK A;  3SDF A;  1JVY A;  4LZ8 A;  1MPC A;  4G8H A;  5CMC A;  1RYO A;  4QRZ A;  4YZZ A;  1II5 A;  4JSO A;  4F31 B;  3S9E A;  1VE4 A;  2E0S A;  4RXL A;  2VD3 A;  2Z8F A;  3FV2 A;  1SW2 A;  4LUB A;  4RJZ A;  1MXZ A;  1Y20 A;  1A54 A;  1H3D A;  1R6Z A;  1UIV A;  5I2K A;  2DWA A;  1SBP A;  2F78 A;  4RPN A;  3OSR A;  1LBC A;  1J1N A;  2PT2 A;  3VXB A;  1QW0 A;  1OQH A;  3MVX A;  3UP9 A;  4BDQ A;  4JXI A;  2IA4 A;  3FXU A;  3AXF A;  1BLF A;  4U4X A;  2THI A;  4P0I A;  4YAH X;  3OEL A;  4LA9 A;  4TQU Q;  3EHS A;  3MZ1 A;  2OBG A;  4I9D A;  4NF8 A;  4F29 A;  5H8H B;  3D4C A;  3CR9 A;  2HCA A;  1URD A;  2I48 A;  2UVH A;  3HHF A;  1NNP A;  3DP8 A;  3OO6 A;  4GOT A;  4LQ2 A;  4YB5 A;  1B52 A;  4PFU A;  3OO9 A;  2DE4 A;  4LON B;  1ATG A;  3DP4 A;  4QFK A;  1SQY A;  1QKB A;  4R6H A;  4KYE A;  3TMG A;  1B7Z A;  4ELP A;  2F6G A;  4EXL A;  1Y3P A;  1CB6 A;  1SVX B;  1UIU A;  3ILT B;  3H6W A;  1B3L A;  4ZEB A;  2I0B A;  3SEU A;  2V93 A;  3K6W A;  2F7B A;  3HO7 A;  1EH3 A;  4XXU A;  1KWH A;  3Q28 A;  1B0L A;  1UQW A;  4ESW A;  2KLF A;  2DE2 A;  1O63 A;  4QF9 A;  1EZ9 A;  3O6H A;  3FJ7 A;  3SES A;  4BDR A;  2R9J A;  5CC2 A;  2PYY A;  3C31 A;  1TT1 A;  4QHQ A;  4QFP A;  1LAF E;  2CZL A;  2ZNU A;  3G3H A;  3IO4 A;  4ESX A;  4R6Y A;  2DYX A;  5M2V A;  3IOV A;  4MH5 A;  2ONR A;  2RC7 A;  4GLI A;  1YCJ A;  1B46 A;  3G7W A;  3RTW B;  5I59 A;  4LVQ A;  3ZSF A;  5IKB A;  4KPT A;  5L8D A;  3RT8 A;  5I57 A;  4OVJ A;  1B3E A;  2H4I A;  2NVU B;  3MPK A;  3QAX A;  4GWO A;  2F36 A;  1JNF A;  4O3A A;  3MZ9 A;  3K6X A;  1B51 A;  2Y7K A;  3OO8 A;  4G2Z A;  4PET A;  4XKR A;  4MF3 A;  3ZKL A;  1XVX A;  2B65 A;  2XD2 A;  2XXW A;  3O6I A;  3Q29 A;  2F7A A;  5CMB A;  5H8H A;  4DCY A;  1P1N A;  3K1N A;  1MQI A;  4O3C A;  4GF8 A;  3MAM A;  4R9F A;  3SEX A;  3TPA A;  5I84 A;  4TOZ A;  3LSL A;  5CM6 A;  1LBB A;  2RIN A;  3PPP A;  1M5E A;  4NF5 B;  3IJO B;  3Q27 A;  2PT1 A;  3FD3 A;  3O6G A;  3KN3 A;  4OTE A;  1MXX A;  3LBS A;  3CIJ A;  4G68 C;  3K00 A;  4YKI A;  3O97 A;  3IB0 A;  3FIR A;  4E0X A;  1B0H A;  5K2X A;  5DVJ A;  5KDT A;  3U1O A;  3TAJ A;  2DSF A;  1I69 A;  4Q5T A;  3EHT A;  4XKQ A;  4GQO A;  4F3G A;  1D9V A;  2NXO A;  3VDF A;  2ZYO A;  2GFE A;  4O3B A;  4OFO A;  3U8Q A;  3FVK A;  3KJ7 A;  4TLM B;  2XXV A;  3BKI B;  2XXP A;  4U23 A;  2O68 A;  2HEU A;  1DOT A;  4EQ9 A;  3USD A;  5B7D A;  1B58 A;  4IO6 A;  1US4 A;  1LCT A;  3N94 A;  3T93 B;  2AIX A;  4OHN A;  1JEV A;  4GL8 A;  1H43 A;  3KEI A;  3MZB A;  1FQB A;  4JWX A;  5AA2 A;  4U22 A;  1ZMG A;  4H5G A;  2QS2 A;  4NWD A;  4Z0I A;  1LB8 A;  3TEL A;  1YAE A;  1SDX A;  4IO5 A;  3EHU A;  2F8D A;  3I3V A;  1FQF A;  2HFB A;  1GGG A;  1S9T A;  3OMB A;  4EUO A;  4OEV A;  3GBA A;  3PV0 E;  4RYA A;  4FEB A;  4NF6 B;  2LAO A;  3CSB A;  2O7U A;  2OWT A;  3ZS6 A;  5HM4 B;  1JET A;  3O9P A;  4H8J A;  4FAJ A;  4NF4 A;  2G93 A;  3G3F A;  2F35 A;  1PEB A;  1B32 A;  1A7L A;  3IOT A;  4MLV A;  4JWO A;  3E13 X;  3H06 B;  4NF5 A;  4RY1 A;  3IR1 A;  1MXY A;  2HZK A;  2OZZ A;  2O69 A;  3TTM A;  4ZS9 A;  1AH5 A;  2H25 A;  3ECR A;  3G3G A;  2QS3 A;  3LSF B;  1N76 A;  4OQO A;  1GVC A;  5CBS A;  1BP5 A;  1IUD A;  5BWJ A;  2PX1 A;  5KCJ B;  3TCF A;  2R6G E;  1DSN A;  2Q9T A;  1IZ1 A;  2I3W A;  4GXS B;  1VFD A;  4PP0 A;  3MQ9 A;  3A3C A;  1LGB C;  3QK6 A;  2H99 A;  4N07 A;  1UTH A;  2RC9 A;  3TFL A;  3THI A;  4ECF A;  2DVZ A;  4EQB A;  1N0T A;  2ZYK A;  1FQC A;  1OVT A;  4GIZ A;  4ZED A;  3RNN A;  3SEV A;  1XOC A;  2QPQ A;  4OES A;  3TCH A;  3PUZ E;  1Y9U A;  3FUZ A;  5DT6 A;  3T9U A;  2Z8E A;  1QKA A;  3FAS A;  3MP6 A;  2UVJ A;  4H6D A;  2QJE A;  5K2Y A;  4IO2 A;  4OZ9 A;  1IXH A;  2D5W A;  3N26 A;  1JQF A;  1OVB A;  3K01 A;  5FHM A;  2B3B A;  3FVG A;  3B6W A;  3CSG A;  1B5H A;  1P99 A;  3FVN A;  4Q0C A;  2XXR A;  1ZU0 A;  3HHG A;  5H8N B;  4OXV A;  1FTM A;  1MPB A;  2RCB A;  4KCC A;  4NMY A;  3KN8 A;  3E3K A;  5ITO A;  1Y3Q A;  4F39 A;  3MUQ A;  1NFT A;  1SW4 A;  3IAZ A;  3E9X A;  3V8X B;  1AOV A;  1B6H A;  1P1U A;  1POY 1;  3CG1 A;  3FJM A;  5EHM A;  4C0R A;  4HW8 A;  2F34 A;  1S50 A;  4KYD A;  2D21 A;  2REG A;  2QS1 A;  1ZJL A;  2XXU A;  1JEU A;  1XS5 A;  4PFY A;  4KYS A;  2ABH A;  1MM6 A;  1Q1K A;  3E4R A;  1MG1 A;  4OFL A;  4GVO A;  1Q35 A;  1ELJ A;  1A99 A;  3H03 A;  3OEK A;  4WXJ A;  3B6T A;  3LR1 A;  3OO7 A;  4JB7 A;  4THI A;  3K2D A;  3H6V A;  1MPD A;  3QYT A;  1Z7N E;  3U72 A;  1IXC A;  1H45 A;  1NMU A;  2O6A A;  4R72 A;  3C32 A;  1MQD A;  2G29 A;  4DCX A;  2XXI A;  1B4Z A;  4F2O A;  1ZBM A;  5DVF A;  1URG A;  1DMB A;  1A8E A;  2DE3 A;  4Q8R A;  1MM7 A;  4BDO A;  4NE4 A;  2DP8 A;  5FHN A;  1QJM A;  3H6U A;  3N6T A;  2I4C A;  4F1V A;  2AL4 A;  4KCD A;  3T9X B;  5I56 A;  5LOM A;  2VD2 A;  1P1O A;  4YKP A;  4F22 A;  1I6A A;  4U1Z A;  2AYS A;  1FCK A;  3RUM A;  1MY4 A;  2R71 A;  3OEN A;  5CMM A;  4QSE A;  2XXH A;  2QSX A;  1B9J A;  1N3W A;  2Y84 A;  4GFR A;  4IY6 A;  2AL5 A;  1USY E;  3LSX A;  3O66 A;  1MXW A;  2M8C A;  1TXF A;  5AA3 A;  1LAG E; 
#chains in the Genus database with same CATH topology
 3SEY A;  3G3K A;  1R9Q A;  1L5T A;  3DP6 A;  2P1S A;  2Z8D A;  1FPF A;  1EYI A;  3TQL A;  1YYZ A;  3RGY A;  2Y7R A;  1VDW A;  3SEW A;  1AL3 A;  5HBC A;  3K02 A;  4XKP A;  2V25 A;  2UVG A;  2F5X A;  3F11 A;  4N6K A;  1FQD A;  3R26 A;  4PCD A;  4NN3 A;  2ZZW A;  2E1S A;  2WX9 A;  4RPO A;  3R6U A;  2X26 A;  3L6G A;  2QMX A;  4NF4 B;  5H8Q B;  4X1B A;  3ZKK A;  4IY5 A;  4ZZE A;  1RKM A;  1MQJ A;  4BDM A;  3MPL A;  1DTZ A;  5A5X B;  4RK9 A;  3O29 A;  4EDP A;  2ONK E;  3I6V A;  4K3F A;  1ZTY A;  3UA8 A;  4F1U A;  5CRY A;  1ANF A;  3VV5 A;  1DTG A;  1RDZ A;  1PBQ A;  1IQ7 A;  4PBH A;  1MQH A;  1NV1 A;  4F3B A;  4IGT A;  4L17 A;  1FTK A;  3PPQ A;  3V83 A;  2V84 A;  1YTV A;  4LAT A;  3RPW A;  4RNS A;  4ND9 A;  2I3V A;  5DVI A;  5CI5 A;  2D3I A;  1FPB A;  5IZZ A;  1GR2 A;  3S9L C;  2XX7 A;  3MVW A;  4N15 A;  3VLW A;  2ZYM A;  1LAH E;  3KZG A;  4EQ7 A;  1WOD A;  2FIX A;  3CFZ A;  1NV4 A;  3N6U A;  1NNF A;  4F1Y A;  4ELO A;  3QUF A;  4WED A;  1YZ0 A;  3KOS A;  4MMP A;  1Y4C A;  4EF2 A;  5IM2 A;  3KSJ A;  4G61 A;  3OEM A;  4N6P A;  1XI6 A;  3V5A A;  2GQ1 A;  3K4U A;  1MY1 A;  3TTR A;  4XEQ A;  4KQP A;  3SER A;  1B2H A;  2UYF A;  3PPN A;  5I2N A;  5H8Q A;  4QFO A;  4OVR A;  5KZT A;  4M4G A;  2XXQ A;  3V89 B;  2O51 A;  1MY3 A;  3OXN A;  3MP8 A;  4O7I A;  1LAX A;  1BTJ A;  3ISP A;  4OEN A;  3MBP A;  1B5J A;  1MY2 A;  2R8T A;  4JDF A;  1MRP A;  2GHB A;  4BDL A;  5A5L A;  1M5B A;  2QRY A;  3C36 A;  1IIW A;  2VGQ A;  3RPL B;  1DPP A;  3TTN A;  2Q2A A;  3MW0 A;  3FV1 A;  1N7W A;  1RYX A;  3C34 A;  5T3J A;  1LB9 A;  3PMW A;  2Q88 A;  4R6K A;  4KI0 E;  3RN8 A;  1M5D A;  1B1H A;  2F3D A;  4PQJ A;  4OWD A;  2GH9 A;  2OCU A;  3M8U A;  1MH3 A;  4ONY A;  1D4N A;  3T9V A;  1H76 A;  4R75 A;  1LFI A;  2HHM A;  3RLF E;  5I2N B;  4PFB A;  3U92 A;  3TCG A;  1CNQ A;  5IZ3 A;  1NNK A;  4XF5 A;  1M5C A;  5I59 B;  5F24 A;  4YB7 A;  5A5X A;  3SKP A;  3IB2 A;  3SET A;  5KDT B;  1GV8 A;  2Y7P A;  2Y5L A;  2REJ A;  3RPL A;  2VP1 A;  4PFI A;  1PB8 A;  4GWX A;  5TU0 A;  2UVI A;  2NOO A;  4U21 A;  4KD5 A;  1NKX A;  3LV0 A;  3OSQ A;  3UK4 A;  2PMS A;  2PFY A;  2UXA A;  3VFJ A;  3LUY A;  2RC8 A;  5F7V A;  1NH8 A;  3RQT A;  4LZ8 A;  4G8H A;  1II5 A;  3IFC A;  1MXZ A;  1R6Z A;  1Y20 A;  5I2K A;  4I40 A;  2F78 A;  3NOH A;  4RPN A;  1LBC A;  1J1N A;  3MVX A;  2IA4 A;  1EYK A;  1BLF A;  2THI A;  4YAH X;  4NF8 A;  2HCA A;  3OO6 A;  2I48 A;  2UVH A;  4YB5 A;  1B52 A;  3OO9 A;  4QFK A;  3DP4 A;  2XWK A;  1SQY A;  4KYE A;  1B7Z A;  2QFL A;  4EXL A;  1SVX B;  4ZEB A;  3H6W A;  4P47 A;  3Q28 A;  3SES A;  3O6H A;  4N81 A;  4ESX A;  1B46 A;  5I59 A;  4LVQ A;  4GWW A;  1B3E A;  2NVU B;  4TLL B;  1JNF A;  2B65 A;  3FBP A;  3O6I A;  2F7A A;  5H8H A;  1IMD A;  3FXB A;  4GF8 A;  4TOZ A;  3LSL A;  1LBB A;  5ESY A;  1NUW A;  3FD3 A;  3FIR A;  3U1O A;  3TAJ A;  2GFE A;  4OFO A;  1NV0 A;  3KJ7 A;  2HEU A;  4EQ9 A;  5B7D A;  4IO6 A;  2AIX A;  1JEV A;  4P8B A;  3MZB A;  1FQB A;  1FPK A;  2QS2 A;  1LB8 A;  1YAE A;  3I3V A;  1FQF A;  1GGG A;  1S9T A;  4OEV A;  3ZS6 A;  2O7U A;  5HM4 B;  1JET A;  3O9P A;  4JWO A;  2OZZ A;  2O69 A;  3TTM A;  4DIG A;  3G3G A;  3ECR A;  1GVC A;  5KCJ B;  2PX1 A;  4IR8 A;  2Q9T A;  3KC0 A;  4PP0 A;  1VFD A;  4N07 A;  4EQB A;  3RNN A;  5EQ8 A;  3TCH A;  2D5W A;  4H46 A;  3K01 A;  3B6W A;  3HHG A;  1ZU0 A;  1FTM A;  4KCC A;  2RCB A;  4NMY A;  1Y3Q A;  1SW4 A;  2MKZ A;  3V8X B;  5EHM A;  1LBW A;  4KYD A;  1S50 A;  2QS1 A;  2XXU A;  1LEV A;  1XS5 A;  4KYS A;  1ELJ A;  3OO7 A;  3LUZ A;  3U72 A;  4R72 A;  4DCX A;  1DMB A;  4BDO A;  4NE4 A;  2DP8 A;  2CZH A;  5I3S A;  2AYS A;  5CMM A;  2QSX A;  2FHY A;  2Y84 A;  4GFR A;  2M8C A;  2B3B A;  1TXF A;  1LAG E;  2VPO A;  3W9V A;  3GXA A;  4G68 A;  3A29 A;  1IXI A;  2Q8J A;  3O2A A;  4HCY A;  2NWJ A;  4ECF A;  4N8Y A;  4OET A;  1FW0 A;  4YU0 A;  4UA8 A;  1I6B A;  1IEJ A;  3T22 A;  1FQE A;  5DYH A;  1IMA A;  3IX1 A;  5DTB A;  4NAP A;  4AS4 A;  4KXP A;  2ZMB A;  1MXU A;  2OLB A;  2HAU A;  1SW5 A;  2DWH A;  2DOJ A;  4QXD A;  1BK4 A;  4ISU A;  4NF0 A;  1MDP 1;  4ZE8 A;  1B05 A;  3ROJ A;  3UGW A;  2V3U A;  2FNC A;  2UYE A;  2WKY A;  4F19 A;  3VLV A;  1A40 A;  4R9G A;  4PDD A;  1LBY A;  3PUW E;  4XIG Q;  4DZ1 A;  1Y1Z A;  3LSW A;  4H5F A;  1SI1 A;  2HXW A;  3IK6 B;  1NL5 A;  1B3H A;  5TPA A;  3A3U A;  4OMB A;  4N4U A;  1PDA A;  1Z7M E;  5AE4 A;  1MS7 A;  3MP1 A;  1B40 A;  3VLU A;  4DXU A;  4DXB A;  4GWZ A;  3TDJ A;  3LC8 A;  4HE1 A;  2Y7W A;  1MDQ A;  2XXX A;  1DCU A;  2A5S A;  4X1D A;  1LCF A;  1P1Q A;  2QS4 A;  2ZZV A;  4G68 B;  1M5F A;  1INP A;  3H6T A;  3PU5 A;  4GBW A;  2I0C A;  4QFN A;  5IZ3 B;  2O1M A;  2Z22 A;  3QXM A;  4F3S A;  4F18 A;  4MJO A;  4NTL A;  2WEF A;  3TYH A;  3RTF B;  2I4B A;  4MAG A;  3H7M A;  3VE1 B;  1QVS A;  4EF1 A;  1Q9D A;  5JK4 A;  4YKJ A;  1FPL A;  1TWY A;  2F6P A;  4N13 A;  1O7T A;  2ESN A;  3MVY A;  1XC1 A;  4NWC A;  4M1V A;  1SD3 A;  4H8I A;  3U94 A;  1N7X A;  4R2B A;  1LBZ A;  5I2K B;  1R9L A;  2XX8 A;  3UOR A;  3HN0 A;  3IOW A;  3FXQ A;  1H44 A;  4R2F A;  4H0W A;  5I56 B;  5ELV A;  2HZL A;  5BUU A;  4P1E A;  4PFW A;  3T1B A;  3TOD A;  3ODB A;  3TTL A;  4P0G A;  4NF6 A;  1QUK A;  4GD5 A;  2I49 A;  5FHO A;  3EPE A;  3A09 A;  2IEE A;  1N3X A;  4LZ5 A;  4ZEF A;  3QIM A;  3P7I A;  1FJ6 A;  4XKN A;  3VVF A;  1JW5 A;  3M3K A;  1US5 A;  1KZ8 A;  4MBP A;  3TEP A;  2OK2 A;  3BFT A;  1OLC A;  3TKD A;  1WVJ A;  2XXY A;  5H8F A;  1FBE A;  2B4M A;  4Q30 B;  3JZJ A;  4R73 A;  1PBP A;  4KHZ E;  3EF7 A;  3DEL B;  2ZXT A;  3M3L A;  2L5V A;  5L9M A;  1OLA A;  1MXV A;  5IGA A;  3VVD A;  1O64 A;  4F3P A;  2VOZ A;  2QL3 A;  3E78 A;  5J1D A;  3EKI A;  3PMV A;  3IB1 A;  1SYI A;  2HAV A;  1R1N A;  3JV9 A;  4G77 A;  2V3T A;  3PTY A;  1FPD A;  2Q89 A;  2FIE A;  1LST A;  3E79 A;  1MPC A;  4YZZ A;  3S9E A;  1VE4 A;  4RXL A;  2VD3 A;  2Z8F A;  3UP9 A;  3AXF A;  1JP4 A;  3EHS A;  1FBD A;  2OBG A;  4HE0 A;  3D4C A;  3CR9 A;  4GWY A;  5J16 A;  4LON B;  1ATG A;  1QKB A;  3TMG A;  2I0B A;  4ESW A;  1UQW A;  1EZ9 A;  4BDR A;  4HE2 A;  2PYY A;  3C31 A;  3IO4 A;  2DYX A;  1FBH A;  4GLI A;  3ZSF A;  5IKB A;  5L8D A;  3RT8 A;  2H4I A;  3MPK A;  3QAX A;  4GWO A;  4O3A A;  4G2Z A;  3OO8 A;  3ZKL A;  4MF3 A;  5CMB A;  3K1N A;  5EYH A;  4R9F A;  5CM6 A;  3PPP A;  3Q27 A;  2WBB A;  3KN3 A;  4YKI A;  3O97 A;  3IB0 A;  1B0H A;  1FPJ A;  4Q5T A;  4XKQ A;  4PF8 A;  1D9V A;  3FVK A;  4TLM B;  2XXV A;  2XXP A;  4U23 A;  1DOT A;  1LCT A;  3T93 B;  1H43 A;  3KEI A;  4U22 A;  4NWD A;  4IO5 A;  2F8D A;  3GBA A;  3PV0 E;  4FEB A;  4NF6 B;  4H8J A;  4NF4 A;  1A7L A;  3E13 X;  3H06 B;  4NF5 A;  1MXY A;  4ZS9 A;  1AH5 A;  3LSF B;  4OQO A;  1BP5 A;  1IUD A;  5BWJ A;  5I5P A;  2R6G E;  1IZ1 A;  2VT5 A;  2I3W A;  1LGB C;  2RC9 A;  3TFL A;  4OES A;  3PUZ E;  3FUZ A;  5DT6 A;  3FAS A;  3MP6 A;  5K2Y A;  2P3V A;  1OVB A;  1P99 A;  3RYD A;  4OXV A;  3KBZ A;  4GX4 A;  4P3L A;  2F3B A;  1AWB A;  3IAZ A;  1P1U A;  3CG1 A;  5AA4 B;  2ABH A;  3E4R A;  4WXJ A;  4OVQ A;  5LOM A;  4GVO A;  3RUM A;  3H03 A;  3H6V A;  1MPD A;  3QYT A;  1ZBM A;  1URG A;  2DE3 A;  3H6U A;  3N6T A;  1RDY A;  2I4C A;  2VD2 A;  4YKP A;  2FBP A;  2VPN A;  4P9K A;  4MNC A;  2R71 A;  3O66 A;  4HXV A;  1FBP A;  2F34 A;  4JBZ A;  5AA2 B;  3T0J A;  2F7C A;  3MC2 A;  3K1P A;  3KN7 A;  1NNT A;  1NV2 A;  3WAE A;  4LZ7 A;  2O84 X;  5FBP A;  3B6Q A;  4DLD A;  4X8R A;  4C1U A;  1GTK A;  4XTC Q;  3IOU A;  4NF8 B;  1FBF A;  3CVG A;  1AMF A;  1FQA A;  3FGS A;  1USY H;  4E0W A;  3HPI A;  2Z23 A;  3PMX A;  4X48 A;  3L6H A;  5EYG A;  4P1L A;  3S2V A;  4I1D A;  4MNP A;  4U1O A;  1LFG A;  1SI0 A;  3JYR A;  3K1M A;  4QSC A;  3KJT A;  3PUY E;  4IO7 A;  4OVS A;  4AB5 A;  1Y3N A;  3H4Z A;  1IIT A;  3IFA A;  2XWI A;  1T0K A;  1KA0 A;  4NHB A;  2OWZ A;  3FJG A;  3FXR A;  4G4P A;  2WYK A;  5LDZ A;  1Y1M A;  5AA2 D;  3DLN A;  5H8S A;  1TFA A;  3HCQ A;  4FOR A;  3MVZ A;  2V4C A;  5F1Q A;  3N5L A;  2ALU A;  4DDD A;  2W7Y A;  3MWB A;  1HSL A;  4MFI A;  4H65 A;  3R7X A;  4U4S A;  2HQ0 A;  4OER A;  5IAI A;  2KR0 A;  3UIF A;  2QMW A;  5ICQ A;  4ZEK A;  2OJT A;  1AIV A;  2FA7 A;  3FZV A;  1FTJ A;  1NV6 A;  3FAT A;  1PB7 A;  3C33 A;  3BFU A;  3DM0 A;  4Z7E A;  3D4G A;  3W9W A;  2HPG A;  4PFT A;  3T96 B;  2WBD A;  4IO3 A;  3CI8 A;  2BJJ X;  1POT A;  3IL1 B;  3PUV E;  4HCW A;  4ELR A;  1NH7 A;  1NUZ A;  2DVC A;  4OYV A;  1ZKB A;  4MIJ A;  5LTC A;  3RT6 B;  5FTH A;  5TP9 B;  1DPE A;  4BDN A;  2A5T B;  4G8M A;  1VSO A;  3W15 C;  2F97 A;  4C1T A;  1XT8 A;  4F2O A;  4PE5 B;  4QBA A;  2YLN A;  4WKM A;  3Q26 A;  2DWJ A;  3ONM A;  1QUI A;  3TUS A;  3KOT A;  2H5Y A;  1SYH A;  3MJN A;  5L9O A;  3QUJ A;  1QUJ A;  2ZYN A;  2NUV A;  3BBR A;  2P0S A;  4WEP A;  1OIB A;  2O1L A;  2DXY A;  1BIY A;  3K0V A;  4DE8 A;  2H98 A;  5JEI A;  5HPQ A;  2P2A A;  1N04 A;  2I6E A;  4LQ5 A;  4KR5 A;  1UTB A;  2DS9 A;  4GL0 A;  4H1X A;  1NV7 A;  4JVC A;  2DXR A;  1EZO A;  1PC3 A;  1EZP A;  2PBW A;  1IME A;  1CE2 A;  1JW4 A;  5AA1 A;  1B1X A;  4PAI A;  4YIC A;  2WYP A;  1TFD A;  1FTL A;  4I62 A;  4JWY A;  4GXA A;  5ET6 A;  3T66 A;  3B8B A;  2ANJ A;  4NED A;  5H8N A;  1FTO A;  3FVO A;  4ELQ A;  2FYI A;  2RF1 A;  1IMC A;  1HSJ A;  3CRB A;  4QFL A;  5EYF A;  3TQW A;  3U93 A;  1URS A;  2B4L A;  1NI9 A;  1DK4 A;  1FTA A;  1B4H A;  4AQ4 A;  5ICT A;  3D1R A;  3I5O A;  4PC9 A;  2ONS A;  4OEU A;  2DQV A;  1K9Z A;  4MHF A;  4GRK A;  1JVY A;  1RYO A;  4QRZ A;  4RJZ A;  1SW2 A;  1UIV A;  1H3D A;  1SBP A;  2ZZX A;  2PT2 A;  3VXB A;  1OQH A;  4BDQ A;  4JXI A;  4U4X A;  4P0I A;  4LA9 A;  4TQU Q;  1NV5 A;  1URD A;  3DP8 A;  5EQ7 A;  4GOT A;  4LQ2 A;  4PFU A;  2CZK A;  3SEU A;  1UIU A;  1FRP A;  1B3L A;  2V93 A;  3K6W A;  2F7B A;  4NGU A;  1B0L A;  2KLF A;  5ET5 A;  3MYU A;  4QF9 A;  5CC2 A;  2R9J A;  4QHQ A;  1LAF E;  3G3H A;  4R6Y A;  5M2V A;  3IOV A;  2ONR A;  4JVD A;  3RTW B;  4MEV A;  4PF6 A;  4OVJ A;  4GWU A;  2F36 A;  4FAT A;  3MZ9 A;  1B51 A;  4P56 A;  1XVX A;  1SPI A;  2KQZ A;  2XD2 A;  2XXW A;  2Y5K A;  4DCY A;  1P1N A;  3TPA A;  3SEX A;  1M5E A;  5EQ9 A;  2PT1 A;  3CIJ A;  3K00 A;  5KDT A;  2DDK A;  5DVJ A;  3EHT A;  2XXK A;  4OAN A;  4GQO A;  3VDF A;  3SZP A;  3USD A;  2Q74 A;  4GL8 A;  4JWX A;  5AA2 A;  1ZMG A;  3EHU A;  2HFB A;  2FVZ A;  2LAO A;  1K9Y A;  4PBQ A;  3G3F A;  1G0H A;  1PEB A;  1B32 A;  2F35 A;  4RY1 A;  2QS3 A;  5CBS A;  1N76 A;  4NX1 A;  2PCR A;  4ZED A;  3QK6 A;  2H99 A;  2DVZ A;  1N0T A;  2ZYK A;  1OVT A;  4GIZ A;  1XOC A;  4NQ8 A;  2QPQ A;  3T9U A;  2Z8E A;  4H6D A;  4MNI A;  5ET8 A;  4IO2 A;  4OZ9 A;  5FHM A;  3FVN A;  1IMB A;  3FVG A;  4I3Y A;  5IZ1 A;  2XXR A;  5H8N B;  1MPB A;  4F39 A;  3E3K A;  3MUQ A;  1NFT A;  1AOV A;  3FJM A;  4HW8 A;  3TCF A;  4PFY A;  1DBZ A;  1ZJL A;  1JEU A;  1MM6 A;  1FBG A;  1Q1K A;  4OFL A;  1A99 A;  3OEK A;  1Z7N E;  4PAK A;  1IXC A;  1NMU A;  1MQD A;  2G29 A;  1B4Z A;  5DVF A;  5I7I A;  1MM7 A;  5FHN A;  2CEX A;  1QJM A;  4F1V A;  4KCD A;  1P1O A;  1I6A A;  4U1Z A;  1MY4 A;  2XWO A;  1B9J A;  1USY E;  3LSX A;  2HZK A;  4R74 A;  3S9M C;  3C9H A;  4OVP A;  3HST A;  3HV1 A;  1SW1 A;  4YMB A;  2XD3 A;  5B70 A;  4XFE A;  3CFX A;  4AB6 A;  4ZDM A;  4EXK A;  5JTY B;  1HSE A;  4FBP A;  4GX3 A;  3C4M A;  3QSL A;  3VXC A;  2QVV A;  1A55 A;  1N84 A;  3KBR A;  2O7I A;  4POX A;  1FPE A;  2A5T A;  3GBB A;  5CMK A;  1MY0 A;  1NUY A;  3Q25 A;  3KGC A;  5TP9 A;  2OWS A;  3T9H B;  1ZLQ A;  4PFR A;  5EQA A;  4FJP A;  1WDN A;  5DEX B;  3G3J A;  4F2Q A;  3PPR A;  4YMA A;  3OD7 A;  4HS7 A;  1NV3 A;  4PGN A;  4NG7 A;  1D3K A;  1I6Q A;  3C35 A;  2CMO A;  3H3G A;  1B3G A;  5EHS A;  1YPN A;  1JW1 A;  4ZEI A;  1XHY A;  3RY3 A;  1UTB B;  4POW A;  3VVE A;  1IMF A;  5I58 A;  2XXT A;  1B3F A;  5L9S A;  2BJI A;  2I58 A;  3QMF A;  3BIG A;  2V3Q A;  4OVT A;  3TZA A;  5FTI A;  4MLQ A;  2RCA A;  1S7Y A;  2DWI A;  4ZE9 A;  4O8M A;  4DXC A;  4LP2 B;  4X9T A;  3S9N C;  3K6U A;  5ET7 A;  1QGX A;  3IJX B;  4MX6 A;  3PPO A;  2H9B A;  4N6D A;  2XWV A;  1LFH A;  2P3N A;  4YB6 A;  3O28 A;  3PGF A;  1EU8 A;  4ZZA A;  5DEX A;  5JTY A;  1A8F A;  2GHA A;  3PD8 A;  1OQG A;  3IO6 A;  3U65 A;  4I8C A;  3TTK A;  4PE3 A;  1PB9 A;  4RA1 A;  5DW8 A;  1IXG A;  3EN3 A;  4KFQ A;  1KA1 A;  5I57 B;  4O94 A;  4BLA A;  4P11 A;  1ZIU A;  2PVU A;  3PD9 A;  4H67 A;  1FJ9 A;  2YPN A;  3ILU B;  3CG3 A;  3OOA A;  5AA4 A;  3WAF A;  2XHD A;  4U2R A;  4FE8 A;  1MH4 A;  2XA5 A;  3KG2 A;  2Q2C A;  4ZEC A;  2Q8M A;  4G8N A;  1BKA A;  2XX9 A;  3B7D A;  1VR5 A;  1QUL A;  4OFJ A;  3GLB A;  4FIM A;  3KFM A;  4OA4 A;  2ZNT A;  5H8F B;  1YXI A;  2Y7I A;  2GRV A;  3K6V A;  5ITP A;  2CEY A;  5CBR A;  1VFE A;  4JSD A;  4IO4 A;  4YKK A;  1D9Q A;  1Y4T A;  2RKM A;  4UAC A;  4HTG A;  1MQG A;  1LLS A;  1XVY A;  4GBV A;  1F9B A;  2B3F A;  2YJP A;  4QSD A;  4IB2 A;  1JVX A;  1B5I A;  3EQ1 A;  2VHA A;  1B7U A;  3S4U A;  1RDX A;  3GZG A;  1OMP A;  4RK2 A;  1P1W A;  4MCO A;  2ZNS A;  5TPA B;  1FPI A;  5KCJ A;  4N8G A;  4O7M A;  3M3F A;  2X7P A;  3B50 A;  4PTK A;  1UTH B;  2X7Q A;  4I3E A;  1D9Y A;  3KSX A;  4GX6 A;  4FEC A;  3G3I A;  5ISU A;  4IGR A;  4FED A;  4DI4 B;  3IOR A;  1B7H A;  3CFL A;  3PUX E;  4GWS A;  5CMC A;  3SDF A;  4JSO A;  4F31 B;  2E0S A;  3FV2 A;  2HXR A;  4LUB A;  1A54 A;  2DWA A;  3OSR A;  1QW0 A;  3FXU A;  1FBC A;  3OEL A;  3MZ1 A;  4I9D A;  4F29 A;  1FSA A;  5H8H B;  3HHF A;  1NNP A;  3HFU A;  2DE4 A;  4R6H A;  4PDH A;  4ELP A;  2F6G A;  1Y3P A;  1CB6 A;  3ILT B;  3HO7 A;  1EH3 A;  4XXU A;  1KWH A;  2DE2 A;  1O63 A;  3CHG A;  3FJ7 A;  4H45 A;  1TT1 A;  4QFP A;  2CZL A;  2ZNU A;  4MH5 A;  2RC7 A;  1YCJ A;  3G7W A;  4N91 A;  4KPT A;  5I57 A;  4XKR A;  3K6X A;  2Y7K A;  4PET A;  3Q29 A;  4O3C A;  5I84 A;  1MQI A;  3MAM A;  4X04 A;  2RIN A;  3KC1 A;  3IJO B;  4NF5 B;  1NUX A;  3O6G A;  4OTE A;  1MXX A;  3LBS A;  4G68 C;  4E0X A;  5K2X A;  2DSF A;  1I69 A;  4F3G A;  2NXO A;  4DI3 D;  2ZYO A;  4JVI A;  4O3B A;  3U8Q A;  3BKI B;  2O68 A;  1LBV A;  1B58 A;  1US4 A;  3N94 A;  4OHN A;  4PAF A;  4H5G A;  4Z0I A;  3TEL A;  1SDX A;  1G0I A;  3OMB A;  4EUO A;  4RYA A;  3CSB A;  2OWT A;  4FAJ A;  2G93 A;  4MLV A;  3IOT A;  1FPG A;  2OX3 A;  3IR1 A;  2H25 A;  2QVR A;  1DSN A;  3GYY A;  4GXS B;  3MQ9 A;  3A3C A;  3THI A;  1UTH A;  1FQC A;  2PFZ A;  4PGP A;  3SEV A;  4UAB A;  1Y9U A;  1EYJ A;  1QKA A;  3MST A;  2UVJ A;  2QJE A;  1IXH A;  1LBX A;  3N26 A;  1JQF A;  3CSG A;  4Q0C A;  1B5H A;  3KN8 A;  5ITO A;  3E9X A;  4AS5 A;  2JJK A;  1B6H A;  4C0R A;  1POY 1;  2D21 A;  2REG A;  3BIH A;  5I58 B;  1MG1 A;  1Q35 A;  4N17 A;  3UN6 A;  2CZI A;  3B6T A;  3LR1 A;  4JB7 A;  4THI A;  3K2D A;  4LN5 A;  1H45 A;  2O6A A;  3C32 A;  2XXI A;  2QVU A;  4Q8R A;  1A8E A;  2AL4 A;  3T9X B;  5I56 A;  4F22 A;  1FCK A;  3OEN A;  4QSE A;  2XXH A;  1N3W A;  4IY6 A;  2AL5 A;  5AA3 A;  1MXW A; 
#chains in the Genus database with same CATH homology
 4R74 A;  5AA2 B;  3C9H A;  3S9M C;  3W9V A;  3GXA A;  4G68 A;  3SEY A;  3G3K A;  3HST A;  1R9Q A;  2F7C A;  3MC2 A;  3K1P A;  1IXI A;  3KN7 A;  1L5T A;  3HV1 A;  1NNT A;  3DP6 A;  2P1S A;  3O2A A;  2Z8D A;  4HCY A;  4OET A;  4LZ7 A;  2NWJ A;  3WAE A;  1FW0 A;  1SW1 A;  2O84 X;  4YMB A;  2XD3 A;  3B6Q A;  3TQL A;  4DLD A;  4YU0 A;  4UA8 A;  4C1U A;  3RGY A;  1GTK A;  5B70 A;  4XTC Q;  1I6B A;  1IEJ A;  3T22 A;  3IOU A;  1FQE A;  2Y7R A;  4NF8 B;  5DYH A;  3CFX A;  3IX1 A;  4AB6 A;  4ZDM A;  3SEW A;  4EXK A;  5JTY B;  1HSE A;  1AMF A;  3CVG A;  1AL3 A;  1FQA A;  3K02 A;  5HBC A;  5DTB A;  5KZT A;  3UN6 A;  3FGS A;  3C4M A;  4XKP A;  3QSL A;  2V25 A;  1USY H;  2UVG A;  3VXC A;  4JBZ A;  2F5X A;  1A55 A;  4E0W A;  1N84 A;  3HPI A;  3F11 A;  2Z23 A;  3PMX A;  3KBR A;  4X48 A;  2O7I A;  1FQD A;  3R26 A;  4POX A;  2A5T A;  3GBB A;  5CMK A;  1MY0 A;  2ZMB A;  5AA4 B;  3L6H A;  1MXU A;  3S2V A;  2OLB A;  4I1D A;  2HAU A;  1SW5 A;  3Q25 A;  4U1O A;  1LFG A;  1SI0 A;  2DWH A;  2DOJ A;  3JYR A;  3K1M A;  4QSC A;  2E1S A;  3KJT A;  3PUY E;  4IO7 A;  3KGC A;  4AB5 A;  5TP9 A;  2OWS A;  3T9H B;  4RPO A;  1ZLQ A;  4ISU A;  1MDP 1;  4ZE8 A;  4FJP A;  1Y3N A;  3H4Z A;  1WDN A;  3R6U A;  2X26 A;  5DEX B;  3L6G A;  1IIT A;  1B05 A;  3G3J A;  3UGW A;  2V3U A;  4F2Q A;  2FNC A;  2UYE A;  2WKY A;  3PPR A;  4F19 A;  4YMA A;  3VLV A;  3OD7 A;  1T0K A;  2QMX A;  4NF4 B;  3TTN A;  1A40 A;  4R9G A;  4X1B A;  5H8Q B;  3ZKK A;  4IY5 A;  4ZZE A;  1RKM A;  1MQJ A;  4BDM A;  3PUW E;  3FJG A;  3MPL A;  4EQ7 A;  3FXR A;  4HS7 A;  1DTZ A;  5A5X B;  4RK9 A;  1D3K A;  1I6Q A;  3C35 A;  3O29 A;  4G4P A;  2CMO A;  4XIG Q;  3H3G A;  1Y1M A;  4EDP A;  1B3G A;  2ONK E;  4DZ1 A;  3I6V A;  1Y1Z A;  4K3F A;  1ZTY A;  3UA8 A;  5EHS A;  3LSW A;  4F1U A;  5AA2 D;  1YPN A;  5CRY A;  4H5F A;  3DLN A;  5H8S A;  1ANF A;  1TFA A;  1JW1 A;  3HCQ A;  1XHY A;  1DTG A;  1UTB B;  4FOR A;  4POW A;  4ZEI A;  3RY3 A;  3VV5 A;  3MVZ A;  3VVE A;  1SI1 A;  2HXW A;  5F1Q A;  3N5L A;  5I58 A;  1PBQ A;  1IQ7 A;  2XXT A;  1B3F A;  2ALU A;  1MQH A;  3IK6 B;  4DDD A;  1NL5 A;  4F3B A;  1B3H A;  2W7Y A;  5L9S A;  4IGT A;  3MWB A;  4L17 A;  1HSL A;  2I58 A;  4MFI A;  4H65 A;  2V3Q A;  3A3U A;  4OMB A;  5TPA A;  3TZA A;  3R7X A;  1FTK A;  1PDA A;  5FTI A;  3PPQ A;  1Z7M E;  2V84 A;  4MLQ A;  4U4S A;  2RCA A;  3V83 A;  2DWI A;  1S7Y A;  1YTV A;  2HQ0 A;  4LAT A;  4ZE9 A;  4OER A;  3RPW A;  5AE4 A;  1MS7 A;  5IAI A;  3MP1 A;  4TLL B;  4DXC A;  5JTY A;  1B40 A;  4LP2 B;  4X9T A;  3S9N C;  4RNS A;  3K6U A;  4ND9 A;  3UIF A;  2QMW A;  4DIG A;  5ICQ A;  3VLU A;  4DXU A;  3IJX B;  2I3V A;  4DXB A;  4ZEK A;  2OJT A;  5DVI A;  5CI5 A;  2D3I A;  2Q8J A;  3PPO A;  2H9B A;  1GR2 A;  3S9L C;  2XX7 A;  3MVW A;  2FA7 A;  3TDJ A;  3FZV A;  3LC8 A;  1AIV A;  3VLW A;  1LFH A;  2ZYM A;  4YB6 A;  1FTJ A;  3O28 A;  3PGF A;  3FAT A;  1PB7 A;  3C33 A;  1EU8 A;  4ZZA A;  1LAH E;  3BFU A;  2Y7W A;  1A8F A;  3DM0 A;  3D4G A;  1MDQ A;  3KZG A;  5DEX A;  1WOD A;  2A5S A;  2XXX A;  3CFZ A;  4X1D A;  3W9W A;  1LCF A;  1P1Q A;  2GHA A;  2QS4 A;  3PD8 A;  4PFT A;  3N6U A;  4G68 B;  3T96 B;  1NNF A;  1OQG A;  1M5F A;  3IO6 A;  4F1Y A;  4ELO A;  4IO3 A;  3CI8 A;  3QUF A;  3H6T A;  2BJJ X;  3PU5 A;  4WED A;  4I8C A;  3TTK A;  3KOS A;  4FAT A;  1PB9 A;  2I0C A;  4QFN A;  1Y4C A;  1POT A;  5AA4 A;  3IL1 B;  3PUV E;  4HCW A;  4RA1 A;  2O1M A;  4EF2 A;  4ELR A;  2Z22 A;  5H8Q A;  3QXM A;  1NH7 A;  1IXG A;  3EN3 A;  3KSJ A;  2DVC A;  4KFQ A;  4OYV A;  1ZKB A;  4F3S A;  4F18 A;  3OEM A;  3RT6 B;  4NTL A;  4N6P A;  3TYH A;  3RTF B;  3V5A A;  2I4B A;  5I57 B;  5FTH A;  3H7M A;  5TP9 B;  1QVS A;  3VE1 B;  3K4U A;  4BLA A;  4EF1 A;  4P11 A;  5JK4 A;  1DPE A;  1ZIU A;  1MY1 A;  2PVU A;  3PD9 A;  4YKJ A;  4BDN A;  4Z7E A;  2A5T B;  4G8M A;  3TTR A;  4H67 A;  4KQP A;  3SER A;  1VSO A;  3W15 C;  1TWY A;  2F6P A;  2F97 A;  1XT8 A;  1B2H A;  4C1T A;  2UYF A;  4N13 A;  3PPN A;  2YPN A;  1O7T A;  2ESN A;  3ILU B;  4PE5 B;  3CG3 A;  3MVY A;  1XC1 A;  3OOA A;  4NWC A;  4M1V A;  1SD3 A;  2YLN A;  4M4G A;  2XXQ A;  3Q26 A;  2DWJ A;  3ONM A;  4H8I A;  2XHD A;  4WKM A;  3V89 B;  3U94 A;  3WAF A;  1N7X A;  1QUI A;  4U2R A;  3KOT A;  2H5Y A;  2O51 A;  3TUS A;  1SYH A;  1MY3 A;  3MJN A;  3OXN A;  4R2B A;  4FE8 A;  5L9O A;  1MH4 A;  3MP8 A;  3QUJ A;  1QUJ A;  2ZYN A;  1LAX A;  2NUV A;  3BBR A;  3KG2 A;  2Q2C A;  5I2K B;  4ZEC A;  1BTJ A;  4OEN A;  4G8N A;  3MBP A;  1R9L A;  1B5J A;  1BKA A;  1MY2 A;  2XX8 A;  4JDF A;  2XX9 A;  3UOR A;  2P0S A;  1MRP A;  2GHB A;  3HN0 A;  3IOW A;  3B7D A;  1VR5 A;  1H44 A;  3FXQ A;  1QUL A;  4OFJ A;  4WEP A;  4BDL A;  1M5B A;  1OIB A;  2O1L A;  2QRY A;  4R2F A;  2DXY A;  3GLB A;  4H0W A;  3C36 A;  5I56 B;  1BIY A;  1IIW A;  2VGQ A;  2HZL A;  2H98 A;  3K0V A;  3KFM A;  4FIM A;  5ELV A;  4DE8 A;  4PFW A;  5BUU A;  2ZNT A;  1DPP A;  5JEI A;  5I58 B;  5HPQ A;  2P2A A;  5H8F B;  1N04 A;  2Y7I A;  2I6E A;  4LQ5 A;  3ODB A;  2GRV A;  2Q2A A;  3TOD A;  3K6V A;  3TTL A;  4P0G A;  3MW0 A;  5ITP A;  3FV1 A;  4NF6 A;  1N7W A;  5CBR A;  4KR5 A;  1VFE A;  1RYX A;  1UTB A;  3C34 A;  1LB9 A;  4JSD A;  2DS9 A;  3PMW A;  4IO4 A;  4YKK A;  4GL0 A;  1QUK A;  1Y4T A;  2Q88 A;  2RKM A;  4GD5 A;  4H1X A;  4R6K A;  2I49 A;  4KI0 E;  4UAC A;  2DXR A;  5FHO A;  1M5D A;  4HTG A;  1MQG A;  1B1H A;  4PQJ A;  3RN8 A;  1EZO A;  1LLS A;  4OWD A;  3EPE A;  3A09 A;  1PC3 A;  2IEE A;  1N3X A;  1XVY A;  2PBW A;  1EZP A;  2GH9 A;  2OCU A;  4LZ5 A;  1CE2 A;  1F9B A;  1JW4 A;  3M8U A;  4ZEF A;  3QIM A;  5AA1 A;  1MH3 A;  2B3F A;  1B1X A;  3P7I A;  4ONY A;  1D4N A;  4YIC A;  2YJP A;  4QSD A;  4IB2 A;  1JVX A;  1TFD A;  1B5I A;  1FTL A;  3T9V A;  1H76 A;  3EQ1 A;  4R75 A;  1LFI A;  2VHA A;  1B7U A;  4XKN A;  3VVF A;  4I62 A;  3S4U A;  3RLF E;  3GZG A;  1JW5 A;  3M3K A;  3U92 A;  4JWY A;  5I2N B;  1US5 A;  1OMP A;  4MBP A;  4RK2 A;  3TEP A;  3TCG A;  4GXA A;  1P1W A;  2OK2 A;  3BFT A;  3T66 A;  1OLC A;  3TKD A;  1NNK A;  2ZNS A;  1WVJ A;  5TPA B;  2ANJ A;  5KCJ A;  2XXY A;  5H8F A;  4NED A;  1M5C A;  5I59 B;  5H8N A;  1FTO A;  3M3F A;  2X7P A;  4YB7 A;  3FVO A;  1UTH B;  5A5X A;  4ELQ A;  3SKP A;  3IB2 A;  4Q30 B;  3SET A;  2FYI A;  3JZJ A;  2RF1 A;  2X7Q A;  4R73 A;  5KDT B;  1HSJ A;  1PBP A;  4KHZ E;  1D9Y A;  3EF7 A;  3CRB A;  3KSX A;  1GV8 A;  2Y7P A;  3DEL B;  4QFL A;  5EYF A;  3TQW A;  5I2N A;  2ZXT A;  4FEC A;  3M3L A;  3U93 A;  3G3I A;  1URS A;  2REJ A;  5L9M A;  5ISU A;  4IGR A;  2VP1 A;  1OLA A;  1PB8 A;  1MXV A;  5TU0 A;  2UVI A;  2NOO A;  3VVD A;  1O64 A;  4U21 A;  1B4H A;  4F3P A;  4QFO A;  4KD5 A;  4FED A;  1NKX A;  2VOZ A;  3OSQ A;  4AQ4 A;  2QL3 A;  3IOR A;  5ICT A;  3UK4 A;  2PMS A;  1B7H A;  3CFL A;  3I5O A;  5J1D A;  2UXA A;  3PMV A;  3VFJ A;  3LUY A;  2ONS A;  4OEU A;  3IB1 A;  2RC8 A;  1SYI A;  2HAV A;  5F7V A;  1R1N A;  1NH8 A;  3JV9 A;  2DQV A;  4G77 A;  2V3T A;  3RQT A;  2Q89 A;  1LST A;  3PUX E;  4GRK A;  3SDF A;  1JVY A;  4LZ8 A;  1MPC A;  4G8H A;  5CMC A;  1RYO A;  4QRZ A;  4YZZ A;  1II5 A;  4JSO A;  4F31 B;  3S9E A;  1VE4 A;  2E0S A;  4RXL A;  2VD3 A;  2Z8F A;  3FV2 A;  1SW2 A;  4LUB A;  4RJZ A;  1MXZ A;  1Y20 A;  1A54 A;  1H3D A;  1R6Z A;  1UIV A;  5I2K A;  2DWA A;  1SBP A;  2F78 A;  4RPN A;  3OSR A;  1LBC A;  1J1N A;  2PT2 A;  3VXB A;  1QW0 A;  1OQH A;  3MVX A;  3UP9 A;  4BDQ A;  4JXI A;  2IA4 A;  3FXU A;  3AXF A;  1BLF A;  4U4X A;  2THI A;  4P0I A;  4YAH X;  3OEL A;  4LA9 A;  4TQU Q;  3EHS A;  3MZ1 A;  2OBG A;  4I9D A;  4NF8 A;  4F29 A;  5H8H B;  3D4C A;  3CR9 A;  2HCA A;  1URD A;  2I48 A;  2UVH A;  3HHF A;  1NNP A;  3DP8 A;  3OO6 A;  4GOT A;  4LQ2 A;  4YB5 A;  1B52 A;  4PFU A;  3OO9 A;  2DE4 A;  4LON B;  1ATG A;  3DP4 A;  4QFK A;  1SQY A;  1QKB A;  4R6H A;  4KYE A;  3TMG A;  1B7Z A;  4ELP A;  2F6G A;  4EXL A;  1Y3P A;  1CB6 A;  1SVX B;  1UIU A;  3ILT B;  3H6W A;  1B3L A;  4ZEB A;  2I0B A;  3SEU A;  2V93 A;  3K6W A;  2F7B A;  3HO7 A;  1EH3 A;  4XXU A;  1KWH A;  3Q28 A;  1B0L A;  1UQW A;  4ESW A;  2KLF A;  2DE2 A;  1O63 A;  4QF9 A;  1EZ9 A;  3O6H A;  3FJ7 A;  3SES A;  4BDR A;  2R9J A;  5CC2 A;  2PYY A;  3C31 A;  1TT1 A;  4QHQ A;  4QFP A;  1LAF E;  2CZL A;  2ZNU A;  3G3H A;  3IO4 A;  4ESX A;  4R6Y A;  2DYX A;  5M2V A;  3IOV A;  4MH5 A;  2ONR A;  2RC7 A;  4GLI A;  1YCJ A;  1B46 A;  3G7W A;  3RTW B;  5I59 A;  4LVQ A;  3ZSF A;  5IKB A;  4KPT A;  5L8D A;  3RT8 A;  5I57 A;  4OVJ A;  1B3E A;  2H4I A;  2NVU B;  3MPK A;  3QAX A;  4GWO A;  2F36 A;  1JNF A;  4O3A A;  3MZ9 A;  3K6X A;  1B51 A;  2Y7K A;  3OO8 A;  4G2Z A;  4PET A;  4XKR A;  4MF3 A;  3ZKL A;  1XVX A;  2B65 A;  2XD2 A;  2XXW A;  3O6I A;  3Q29 A;  2F7A A;  5CMB A;  5H8H A;  4DCY A;  1P1N A;  3K1N A;  1MQI A;  4O3C A;  4GF8 A;  3MAM A;  4R9F A;  3SEX A;  3TPA A;  5I84 A;  4TOZ A;  3LSL A;  5CM6 A;  1LBB A;  2RIN A;  3PPP A;  1M5E A;  4NF5 B;  3IJO B;  3Q27 A;  2PT1 A;  3FD3 A;  3O6G A;  3KN3 A;  4OTE A;  1MXX A;  3LBS A;  3CIJ A;  4G68 C;  3K00 A;  4YKI A;  3O97 A;  3IB0 A;  3FIR A;  4E0X A;  1B0H A;  5K2X A;  5DVJ A;  5KDT A;  3U1O A;  3TAJ A;  2DSF A;  1I69 A;  4Q5T A;  3EHT A;  4XKQ A;  4GQO A;  4F3G A;  1D9V A;  2NXO A;  3VDF A;  2ZYO A;  2GFE A;  4O3B A;  4OFO A;  3U8Q A;  3FVK A;  3KJ7 A;  4TLM B;  2XXV A;  3BKI B;  2XXP A;  4U23 A;  2O68 A;  2HEU A;  1DOT A;  4EQ9 A;  3USD A;  5B7D A;  1B58 A;  4IO6 A;  1US4 A;  1LCT A;  3N94 A;  3T93 B;  2AIX A;  4OHN A;  1JEV A;  4GL8 A;  1H43 A;  3KEI A;  3MZB A;  1FQB A;  4JWX A;  5AA2 A;  4U22 A;  1ZMG A;  4H5G A;  2QS2 A;  4NWD A;  4Z0I A;  1LB8 A;  3TEL A;  1YAE A;  1SDX A;  4IO5 A;  3EHU A;  2F8D A;  3I3V A;  1FQF A;  2HFB A;  1GGG A;  1S9T A;  3OMB A;  4EUO A;  4OEV A;  3GBA A;  3PV0 E;  4RYA A;  4FEB A;  4NF6 B;  2LAO A;  3CSB A;  2O7U A;  2OWT A;  3ZS6 A;  5HM4 B;  1JET A;  3O9P A;  4H8J A;  4FAJ A;  4NF4 A;  2G93 A;  3G3F A;  2F35 A;  1PEB A;  1B32 A;  1A7L A;  3IOT A;  4MLV A;  4JWO A;  3E13 X;  3H06 B;  4NF5 A;  4RY1 A;  3IR1 A;  1MXY A;  2HZK A;  2OZZ A;  2O69 A;  3TTM A;  4ZS9 A;  1AH5 A;  2H25 A;  3ECR A;  3G3G A;  2QS3 A;  3LSF B;  1N76 A;  4OQO A;  1GVC A;  5CBS A;  1BP5 A;  1IUD A;  5BWJ A;  2PX1 A;  5KCJ B;  3TCF A;  2R6G E;  1DSN A;  2Q9T A;  1IZ1 A;  2I3W A;  4GXS B;  1VFD A;  4PP0 A;  3MQ9 A;  3A3C A;  1LGB C;  3QK6 A;  2H99 A;  4N07 A;  1UTH A;  2RC9 A;  3TFL A;  3THI A;  4ECF A;  2DVZ A;  4EQB A;  1N0T A;  2ZYK A;  1FQC A;  1OVT A;  4GIZ A;  4ZED A;  3RNN A;  3SEV A;  1XOC A;  2QPQ A;  4OES A;  3TCH A;  3PUZ E;  1Y9U A;  3FUZ A;  5DT6 A;  3T9U A;  2Z8E A;  1QKA A;  3FAS A;  3MP6 A;  2UVJ A;  4H6D A;  2QJE A;  5K2Y A;  4IO2 A;  4OZ9 A;  1IXH A;  2D5W A;  3N26 A;  1JQF A;  1OVB A;  3K01 A;  5FHM A;  2B3B A;  3FVG A;  3B6W A;  3CSG A;  1B5H A;  1P99 A;  3FVN A;  4Q0C A;  2XXR A;  1ZU0 A;  3HHG A;  5H8N B;  4OXV A;  1FTM A;  1MPB A;  2RCB A;  4KCC A;  4NMY A;  3KN8 A;  3E3K A;  5ITO A;  1Y3Q A;  4F39 A;  3MUQ A;  1NFT A;  1SW4 A;  3IAZ A;  3E9X A;  3V8X B;  1AOV A;  1B6H A;  1P1U A;  1POY 1;  3CG1 A;  3FJM A;  5EHM A;  4C0R A;  4HW8 A;  2F34 A;  1S50 A;  4KYD A;  2D21 A;  2REG A;  2QS1 A;  1ZJL A;  2XXU A;  1JEU A;  1XS5 A;  4PFY A;  4KYS A;  2ABH A;  1MM6 A;  1Q1K A;  3E4R A;  1MG1 A;  4OFL A;  4GVO A;  1Q35 A;  1ELJ A;  1A99 A;  3H03 A;  3OEK A;  4WXJ A;  3B6T A;  3LR1 A;  3OO7 A;  4JB7 A;  4THI A;  3K2D A;  3H6V A;  1MPD A;  3QYT A;  1Z7N E;  3U72 A;  1IXC A;  1H45 A;  1NMU A;  2O6A A;  4R72 A;  3C32 A;  1MQD A;  2G29 A;  4DCX A;  2XXI A;  1B4Z A;  4F2O A;  1ZBM A;  5DVF A;  1URG A;  1DMB A;  1A8E A;  2DE3 A;  4Q8R A;  1MM7 A;  4BDO A;  4NE4 A;  2DP8 A;  5FHN A;  1QJM A;  3H6U A;  3N6T A;  2I4C A;  4F1V A;  2AL4 A;  4KCD A;  3T9X B;  5I56 A;  5LOM A;  2VD2 A;  1P1O A;  4YKP A;  4F22 A;  1I6A A;  4U1Z A;  2AYS A;  1FCK A;  3RUM A;  1MY4 A;  2R71 A;  3OEN A;  5CMM A;  4QSE A;  2XXH A;  2QSX A;  1B9J A;  1N3W A;  2Y84 A;  4GFR A;  4IY6 A;  2AL5 A;  1USY E;  3LSX A;  3O66 A;  1MXW A;  2M8C A;  1TXF A;  5AA3 A;  1LAG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...