3N6TA

Effector binding domain of tsar
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
205
Chain Sequence
GHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the effector binding domain of TsaR
rcsb
source organism Comamonas testosteroni
total genus 54
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA02
3TODA 1B7ZA 2NOOA 1Y3QA 3RGYA 3LUYA 3EHUA 4QSEA 4XTCQ 4LZ7A 1EU8A 4Q30B 5KCJA 2R9JA 3MC2A 5I56B 3UORA 3KGCA 1LBCA 2X7QA 1NL5A 2QS4A 3MBPA 2PYYA 3DP8A 1Q35A 2VD3A 4FORA 4MH5A 3TEPA 2Y7RA 3V8XB 1URSA 5DVIA 4YMBA 1A99A 3EPEA 3FXQA 4HCYA 1MY2A 3G3HA 2R71A 3RT6B 2P1SA 1MM7A 1SDXA 1NKXA 4NTLA 1DOTA 1B3HA 2F7AA 1ZU0A 2O7UA 1CB6A 4GF8A 3OSRA 1QW0A 5H8FA 2F36A 3WAEA 2DWIA 2NWJA 4EQ7A 4OERA 3H06B 2VGQA 3A3CA 2VD2A 1MQJA 2AYSA 1XS5A 2LAOA 2OBGA 2THIA 4NF5B 2V84A 4ZEIA 3KG2A 1URDA 2Q2CA 2V3TA 1XT8A 4WEDA 1ZLQA 2XXVA 2AL5A 3G3IA 3KOTA 4HCWA 3IOUA 3K4UA 3FXUA 3IOVA 4YKJA 4O3AA 1HSLA 2WKYA 4XKRA 1LB8A 4ZE8A 4R75A 3CI8A 4NMYA 4DIGA 2PMSA 3PGFA 3TCFA 3DM0A 4HW8A 3V89B 4OFLA 4O3CA 5DVJA 4ESXA 3KN8A 4ONYA 1S50A 3TTMA 3C31A 4H1XA 3IAZA 2O68A 4JWOA 4YKIA 3CVGA 2QS2A 1M5CA 4YKPA 1MXUA 4F18A 3CR9A 5F7VA 4OVJA 3A3UA 1MQGA 4ISUA 4LVQA 1F9BA 2F78A 3FD3A 4KCDA 5B7DA 1BP5A 1IXCA 4IY6A 3SEYA 3JV9A 5I59B 3RUMA 4ELOA 2G29A 2UVGA 1N3XA 4BDNA 1N0TA 3LSWA 3K2DA 3QUFA 4F3GA 4YB7A 3FATA 3FVGA 4XXUA 5KCJB 1MY1A 2XHDA 5ICQA 4UACA 3KOSA 4JSDA 2E0SA 2XX9A 2OJTA 4POXA 4IO3A 1II5A 4BDRA 4RXLA 2NUVA 1MXZA 1MRPA 3H7MA 1FW0A 2DE2A 2Y84A 4PFTA 4QFOA 3SKPA 2Y7WA 1B51A 2RF1A 5TP9A 3KZGA 1N04A 2F97A 1QVSA 4YU0A 3ZS6A 3WAFA 2HZKA 4X1BA 1UIUA 1VSOA 1VE4A 1URGA 1H45A 1A8FA 1LGBC 2I58A 3S9LC 2RCAA 1OIBA 1R1NA 4GIZA 1Y1MA 2W7YA 2UYFA 3IOTA 1A8EA 4IO7A 5H8FB 1MG1A 3FJGA 4U21A 4HTGA 4KCCA 2XXRA 1RYXA 3CFXA 2VP1A 3GXAA 1I6BA 4I62A 1NNTA 2H99A 4KI0E 2VOZA 1EZOA 4XKQA 1POY1 3K1NA 1J1NA 3K6VA 5DVFA 2RINA 3H4ZA 3PD8A 3QAXA 2G93A 1B1HA 3M3LA 1TFDA 1MY4A 2Y7KA 3IJXB 3PUYE 2ZYNA 3UIFA 1ELJA 4FIMA 1P1OA 3K6UA 3G3GA 3TCGA 3U94A 1LAHE 5CMKA 4MF3A 1AL3A 3M3FA 4NF8A 4AQ4A 1MY3A 2CMOA 4RJZA 1YAEA 4MLVA 3SDFA 2DVCA 2A5SA 4RPNA 2DE3A 3TTNA 3TQLA 2I0CA 1GGGA 2ZYKA 1Y3NA 5DYHA 3D4GA 1FTKA 3MZBA 4OEVA 5KZTA 4OMBA 4JWXA 2I49A 4ZS9A 2QL3A 1HSEA 3L6HA 4KQPA 3OEMA 1IUDA 3VVDA 4M1VA 2RKMA 3T96B 1O64A 1IZ1A 3U72A 1S7YA 3VFJA 5JTYA 1JEVA 1PC3A 3I6VA 4GVOA 4JB7A 4ESWA 2F35A 2OZZA 3Q29A 3PUVE 2HXWA 1SD3A 3H6UA 5H8NB 1QUKA 3IX1A 2XXQA 1US5A 5L9OA 2OK2A 2UVHA 4ZE9A 2O6AA 3N94A 2HAVA 2OCUA 3KN3A 3PPQA 1PBPA 3USDA 2CZLA 4YB6A 5TPAA 2BJJX 1B7HA 1IIWA 4IY5A 3K1PA 1NNFA 1XVYA 1B9JA 3O9PA 4G8HA 4PP0A 1A54A 4DLDA 4IGTA 3PPRA 1L5TA 4G68A 5TP9B 1NMUA 4I1DA 3FGSA 3MVWA 2OLBA 3P7IA 2X7PA 3B6WA 3ILUB 3GBAA 4P11A 3R6UA 3RNNA 3D4CA 1IXHA 4R9GA 1JVYA 4U4SA 4DE8A 2FA7A 4DXCA 4L17A 4U22A 3RT8A 2REJA 4AB5A 1LSTA 1A7LA 2ZMBA 3EQ1A 3SERA 4H8JA 2XXIA 3UP9A 5I59A 1EZPA 1LFIA 2DS9A 3T9XB 2Q8JA 1TFAA 3TTRA 1JQFA 2I3WA 2PVUA 2QJEA 1M5EA 3PUXE 4E0WA 1D9YA 2QS3A 2DWHA 1H3DA 4OQOA 3G7WA 4GLIA 2D5WA 4R73A 4JSOA 3TMGA 2B3FA 4NF8B 4OENA 1MQIA 4O3BA 3I3VA 3KFMA 3H6WA 2OWTA 2KLFA 2Z22A 5I84A 1MXVA 1QKBA 2A5TA 1AOVA 3TZAA 1B32A 3VVFA 4OEUA 4Q8RA 1FQDA 1LCFA 3E4RA 4GRKA 1PB8A 4IB2A 3E9XA 3FXRA 3BFUA 1MPBA 3T93B 2PBWA 2O69A 2DSFA 4QFLA 5EYFA 3K01A 4IO4A 1DTGA 3IJOB 3S4UA 3PV0E 4Q0CA 3HV1A 2DWAA 3OOAA 1UIVA 4ND9A 1LFGA 1SW4A 2Y7PA 5JTYB 5DTBA 3H03A 2F8DA 1B46A 3FUZA 5IAIA 3PPOA 3RTFB 4ZZAA 1OVBA 2H4IA 4KD5A 3O97A 4Z7EA 3H6VA 4KFQA 3EHTA 2P2AA 3MQ9A 1SYIA 3RLFE 4TOZA 2V3UA 4F29A 3MVZA 1UTBB 2IEEA 5TPAB 2AIXA 1QUIA 1YTVA 3MP1A 1JEUA 2H9BA 4R6YA 2HEUA 1ZIUA 3VXCA 2ONRA 3MWBA 3PUZE 5CM6A 2FYIA 2QRYA 1WVJA 1FCKA 3O6IA 4G68B 5ITOA 1POTA 4GWOA 2UVJA 3ILTB 3L6GA 5FTHA 3CRBA 4U1ZA 1ANFA 4U23A 2B65A 1B40A 4NF4A 5FHOA 1DPPA 1I69A 4QRZA 1D3KA 2DYXA 3TCHA 3K00A 1DTZA 3O6HA 3ZKLA 3T9VA 2XXHA 3FV1A 1P1QA 5BUUA 3F11A 3B6TA 4I8CA 3IK6B 1Y1ZA 5HM4B 4PE5B 4U4XA 3LSXA 1H44A 3OO8A 3G3KA 3LBSA 3IO4A 3FVNA 1USYH 5H8NA 2O7IA 3C35A 3B7DA 3V5AA 1UQWA 2M8CA 1N7WA 1BIYA 2NVUB 1MS7A 4R6HA 3LSFB 3PD9A 4P0IA 5I57B 1Y20A 3DELB 3OO9A 3FVOA 4ZEKA 4P0GA 4BDLA 4DDDA 4G8NA 4OWDA 1IXGA 2E1SA 1WODA 4KR5A 3CFZA 1AH5A 3QXMA 4FEDA 1JW4A 1FTMA 1ZJLA 5FTIA 1M5DA 1PB7A 1B7UA 1MXWA 2IA4A 3O28A 3IOWA 3N6TA 1GVCA 3U93A 3MZ1A 2A5TB 1MPDA 3IB2A 2UYEA 1BLFA 4H6DA 3MPLA 4XKNA 4BLAA 4X9TA 4H5FA 3TYHA 2RC8A 4RK9A 3TUSA 1Y3PA 4WKMA 4U2RA 4AB6A 2DVZA 5K2XA 1H76A 4RK2A 4RA1A 3T9HB 5CRYA 2O51A 4TQUQ 1B2HA 5IKBA 1SI0A 2PX1A 4EF2A 3O6GA 3VLWA 3VXBA 2O84X 3QIMA 3PU5A 5AA2D 4PETA 1M5BA 5HPQA 4LQ2A 4LONB 1US4A 1I6QA 1MPCA 1JVXA 1SYHA 4POWA 1Y4CA 3FIRA 3E13X 4QHQA 4BDMA 2RC7A 4NF6A 3U1OA 4JBZA 3Q26A 2F6GA 3UGWA 4FECA 4X1DA 3EHSA 1UTHA 3MZ9A 3MW0A 4LA9A 4H65A 2Z8DA 2XD3A 4R9FA 2Y7IA 2ONSA 2DWJA 4RNSA 1SW5A 5L8DA 1B58A 4C0RA 4RY1A 3OXNA 1SBPA 1ZKBA 1LAFE 1VFEA 3DLNA 3K1MA 1OQHA 3PPNA 4THIA 5CC2A 1LBBA 3QUJA 5I2KA 5DEXA 4LUBA 4M4GA 1DMBA 5AA2B 4IGRA 4GD5A 2ZNTA 4LQ5A 5H8SA 4F31B 1NNPA 2I4BA 2X26A 4NF4B 4EDPA 4KHZE 1GV8A 3PUWE 1FQCA 5L9MA 4GXAA 3TAJA 3RTWB 4RPOA 2XXUA 3DP4A 1FQAA 5ITPA 2F6PA 1B3GA 4OFOA 3HN0A 4EQBA 1AIVA 4PFYA 4NEDA 3S9EA 5F1QA 1B3EA 1LFHA 1DSNA 1JW5A 5A5XB 5J1DA 3TELA 1FTJA 2ABHA 4E0XA 3RY3A 4G4PA 1OLAA 1A55A 3SEXA 1UTBA 4LATA 1B4HA 4PFWA 2F7CA 3N26A 3MVXA 4YZZA 1GR2A 3BBRA 5M2VA 4UA8A 2ALUA 4FATA 1B5IA 1R9LA 1OMPA 2XX7A 4G2ZA 4QFKA 2H25A 2O1MA 3S9MC 2DQVA 1LCTA 2R6GE 3IR1A 4BDQA 3FJMA 3VE1B 1N84A 3VLUA 3TFLA 4R72A 2B3BA 2QMXA 4JWYA 4JXIA 3FVKA 4F1UA 1B05A 1P1WA 1Y9UA 1FTLA 1EH3A 2OWSA 1D4NA 3KJTA 3VLVA 1XVXA 1YCJA 5EHSA 3MVYA 2QS1A 3MAMA 1RKMA 4OFJA 3G3JA 1PB9A 3TKDA 4MBPA 1OQGA 5AA4A 4EXKA 3QK6A 3W9VA 1A40A 3VVEA 4K3FA 4KYSA 3KBRA 2ZNUA 2Z8FA 1QULA 4NE4A 2I3VA 3V83A 2Q89A 1MM6A 4KYDA 5I57A 5H8QA 1OVTA 4FEBA 2GHAA 4NF6B 1B6HA 4OXVA 2I0BA 1B1XA 2H98A 2DOJA 1UTHB 2GH9A 2ESNA 4F39A 4OZ9A 1MXYA 4YB5A 1MXXA 1ATGA 1MDP1 3GZGA 4MLQA 3TQWA 3KEIA 1PDAA 3KJ7A 3T22A 3CSGA 1SW2A 4XKPA 3CIJA 3SETA 4QSCA 5HBCA 5I2KB 5DEXB 1RYOA 1BTJA 3KN7A 4DCYA 4ELQA 4KPTA 5CBSA 4QSDA 3T9UA 4Q5TA 1NH8A 1IXIA 1R9QA 3GLBA 3CFLA 3K6XA 4ECFA 1XOCA 2I48A 3TTLA 5TU0A 1P1NA 4WXJA 4N13A 4YMAA 2D3IA 4QFPA 4ZZEA 3K6WA 4YICA 4ZEBA 3MJNA 1BKAA 1B5HA 3N5LA 2D21A 3UK4A 1Q1KA 5H8HA 3SEWA 4BDOA 3JZJA 5ELVA 3HO7A 1PBQA 5KDTA 2YLNA 2REGA 1NH7A 1S9TA 3ONMA 3C4MA 4LP2B 1Y4TA 4F19A 4GL8A 1SI1A 1KWHA 2DP8A 4ZEFA 2HZLA 2ONKE 1QUJA 4F3SA 1MQHA 3SEUA 1LB9A 4F1VA 2ZNSA 1FQBA 4OESA 4ZDMA 3Q25A 1P99A 5B70A 4OYVA 4ZECA 3Q27A 4MFIA 1LAGE 3HCQA 2XX8A 1USYE 4IO2A 3S2VA 5AA2A 4C1TA 3MPKA 3OEKA 4Z0IA 3HHFA 2RCBA 3HPIA 1T0KA 4FAJA 1ZBMA 5CBRA 3RPWA 2V93A 4R74A 4DCXA 2UVIA 3UA8A 3OENA 1TXFA 1N3WA 2DXRA 5AA4B 4EF1A 3UN6A 3EF7A 1IQ7A 3PMXA 4G77A 3HSTA 1VR5A 4R2FA 2XXXA 5A5XA 2V3QA 3ZSFA 3C36A 4LZ5A 1FQFA 4KYEA 1FQEA 4ZEDA 2GFEA 4NWCA 1JNFA 4FE8A 2Q9TA 5H8QB 2I6EA 2XD2A 3HHGA 2YPNA 3QYTA 1LAXA 3K0VA 4F2QA 4TLMB 1SQYA 3W15C 1SVXB 5AA3A 4WEPA 4OHNA 4H0WA 4LZ8A 1JW1A 4F3PA 3O66A 4G8MA 4N07A 3PMVA 1ZMGA 5CI5A 5JEIA 4JDFA 1D9VA 1Z7NE 3IL1B 1B4ZA 3CG3A 3R26A 1Z7ME 3KSJA 4H8IA 5I2NA 3OMBA 1CE2A 4XIGQ 5BWJA 5K2YA 3ODBA 4I9DA 1LLSA 1B0HA 4IO5A 1TWYA 2XXPA 3EN3A 3MP8A 1XHYA 1M5FA 5I58A 1JETA 3LC8A 4TLLB 3TPAA 3IB1A 3S9NC 1NFTA 4F22A 2ANJA 2PT1A 5CMMA 5FHNA 4PFUA 3MUQA 5LOMA 2VHAA 3THIA 3PMWA 3SESA 1TT1A 3VV5A 2DE4A 5DT6A 2HAUA 2QSXA 5H8HB 2XXTA 3BFTA 2PT2A 1N76A 2I4CA 4QFNA 5KDTB 4H67A 3C9HA 4EXLA 2XXWA 3OO6A 3C34A 1QKAA 5EHMA 3R7XA 3IO6A 2YJPA 4R2BA 4GFRA 3C33A 1QJMA 5I56A 1AMFA 3U8QA 1B3FA 2HFBA 2UXAA 4DZ1A 3U92A 4ELRA 1MH4A 2ZYOA 1FTOA 1MDQA 1EZ9A 1VFDA 4N6PA 1NNKA 5AA1A 1O7TA 2AL4A 3LR1A 3VDFA 3OD7A 4F3BA 2F34A 3LSLA 1DPEA 2FNCA 4ELPA 3AXFA 3OSQA 4NWDA 1OLCA 1MQDA 2QPQA 2F5XA 2QMWA 3RQTA 5ICTA 3ZKKA 3FJ7A 3OO7A 5ISUA 2NXOA 2XXYA 2GRVA 3H6TA 3IORA 1MH3A 5AE4A 3K02A 3H3GA 3TTKA 4R6KA 3CG1A 1B52A 1MY0A 1R6ZA 2DXYA 4DXUA 2F7BA 1ZTYA 2GHBA 2H5YA 2O1LA 4F2OA 3T66A 3G3FA 3W9WA 3RN8A 3E3KA 4NF5A 3M8UA 3A09A 4GQOA 1PEBA 2Z8EA 2HCAA 3FV2A 1B0LA 2Q88A 2HQ0A 3KSXA 1N7XA 4PQJA 1XC1A 1IITA 4GXSB 3I5OA 3ECRA 4GL0A 5JK4A 4F1YA 3FASA 4HS7A 1B3LA 3O29A 4YAHX 1H43A 1WDNA 2Z23A 3JYRA 4U1OA 1IEJA 3DP6A 1O63A 4QF9A 2ZYMA 3SEVA 2RC9A 4YKKA 3B6QA 4FJPA 3CSBA 2V25A 5I2NB 4EQ9A 3C32A 1I6AA 3TDJA 3MP6A 3FZVA 4OETA 5FHMA 1HSJA 4RYAA 1B5JA 1YPNA 2ZXTA 4OTEA 5CMBA 4EUOA 5I58B 3PPPA 3O2AA 4GOTA 5CMCA 4G68C 1GTKA 3OELA 1P1UA 1SW1A 3QSLA 4C1UA 3N6UA 4IO6A 3BKIB 3Q28A 2Q2AA 4X48A 4H5GA 3IB0A 3M3KA 4DXBA 2P0SA 3GBBA 5L9SA
chains in the Genus database with same CATH superfamily
4N6DA 3TODA 1B7ZA 2NOOA 1Y3QA 3RGYA 3LUYA 1NV7A 3EHUA 4QSEA 4XTCQ 4LZ7A 4GX4A 3E79A 4P1LA 1EU8A 4Q30B 5KCJA 2R9JA 4OANA 3MC2A 5I56B 3UORA 3KGCA 1LBCA 2X7QA 1NL5A 2QS4A 3MBPA 1LBVA 2PYYA 1INPA 3DP8A 1Q35A 2VD3A 4FORA 2Y5LA 4MH5A 4P3LA 3TEPA 2Y7RA 3V8XB 1URSA 1FPBA 5DVIA 4YMBA 2XWOA 1A99A 3EPEA 3FXQA 4HCYA 1MY2A 3G3HA 2R71A 3RT6B 2P1SA 1MM7A 1SDXA 1NKXA 4NTLA 1DOTA 1B3HA 2F7AA 4GBWA 1ZU0A 2O7UA 1D9QA 1CB6A 4N91A 4JVIA 4GF8A 3OSRA 1QW0A 5H8FA 2F36A 3WAEA 2DWIA 3LV0A 2NWJA 4EQ7A 4OERA 1DCUA 3H06B 2VGQA 2FIEA 2PFYA 3A3CA 2VD2A 1MQJA 2AYSA 1XS5A 2LAOA 2OBGA 2THIA 4NF5B 2V84A 2PCRA 4ZEIA 3KG2A 1URDA 2Q2CA 2V3TA 1XT8A 4N4UA 4WEDA 5EQ8A 1ZLQA 2XXVA 2AL5A 1DBZA 3G3IA 3KOTA 4HCWA 3IOUA 3K4UA 3FXUA 3IOVA 4YKJA 4O3AA 1HSLA 2WKYA 4XKRA 1G0IA 4P1EA 1LB8A 4ZE8A 4R75A 3CI8A 4NMYA 2FHYA 1FRPA 4DIGA 2PMSA 3PGFA 2B4LA 2DDKA 4HE0A 3TCFA 3DM0A 4NGUA 4HW8A 3V89B 4OFLA 2ZZWA 4O3CA 5DVJA 4ESXA 3E78A 1BK4A 3KN8A 4ONYA 1S50A 3TTMA 3C31A 4H1XA 3IAZA 2O68A 4JWOA 3KBZA 4YKIA 3CVGA 1AWBA 2QS2A 4HE1A 1M5CA 1NV4A 1MXUA 4YKPA 4F18A 3CR9A 5F7VA 4OVJA 3A3UA 1MQGA 4ISUA 4LVQA 1F9BA 2F78A 3FD3A 4O7IA 4KCDA 5B7DA 1BP5A 3IFAA 1IXCA 4IY6A 3SEYA 3JV9A 5I59B 4PGNA 2MKZA 3RUMA 4ELOA 2G29A 2UVGA 1IMFA 1N3XA 4BDNA 1N0TA 3LSWA 3K2DA 3QUFA 4F3GA 4YB7A 3FATA 1YZ0A 1NV2A 4NQ8A 3FVGA 4XXUA 5KCJB 1MY1A 3GYYA 2XHDA 5ICQA 4UACA 3KOSA 4JSDA 2E0SA 2XX9A 2OJTA 4POXA 4IO3A 1KA0A 1II5A 4BDRA 4RXLA 2NUVA 1MXZA 1MRPA 3H7MA 1FW0A 3BIHA 2DE2A 2Y84A 4PFTA 4QFOA 3SKPA 2Y7WA 1B51A 2RF1A 5TP9A 4OVRA 3KZGA 1QGXA 1N04A 2F97A 1QVSA 4YU0A 3ZS6A 4MIJA 3WAFA 2HZKA 4X1BA 1UIUA 1VSOA 1VE4A 1URGA 1FSAA 1H45A 1A8FA 1FPDA 4N17A 1LGBC 2I58A 3S9LC 1FBFA 2RCAA 1OIBA 1R1NA 4GIZA 1Y1MA 1YYZA 2W7YA 2UYFA 3IOTA 1A8EA 4IO7A 5H8FB 1MG1A 3FJGA 4U21A 4HTGA 4KCCA 2XXRA 1RYXA 3CFXA 2VP1A 3GXAA 1I6BA 4I62A 1NNTA 2H99A 4KI0E 4DI3D 2VOZA 1EZOA 4XKQA 1POY1 3K1NA 1J1NA 3K6VA 5DVFA 2RINA 3H4ZA 3PD8A 3QAXA 2G93A 1IMDA 1B1HA 3M3LA 2QVRA 1TFDA 1MY4A 2Y7KA 3IJXB 3PUYE 2ZYNA 3UIFA 1ELJA 4FIMA 1P1OA 3K6UA 3G3GA 3TCGA 4PGPA 3U94A 1LAHE 5CMKA 4MF3A 1AL3A 3M3FA 4NF8A 4AQ4A 1MY3A 4LN5A 2CMOA 4RJZA 1YAEA 2F3DA 4MLVA 3SDFA 2DVCA 2A5SA 1K9ZA 4RPNA 2DE3A 3TTNA 3TQLA 2I0CA 1GGGA 2ZYKA 5ESYA 5ET6A 1Y3NA 5DYHA 4I40A 3D4GA 1FTKA 3MZBA 4OEVA 1IMCA 5KZTA 5LDZA 4OMBA 4JWXA 2I49A 4ZS9A 2QL3A 3IFCA 1HSEA 3L6HA 4KQPA 3OEMA 1IUDA 3VVDA 4M1VA 2RKMA 3T96B 1DK4A 1O64A 2XXKA 4P47A 1IZ1A 3U72A 1S7YA 3VFJA 5JTYA 1JEVA 1PC3A 3I6VA 4GVOA 4JB7A 4ESWA 2F35A 2OZZA 3Q29A 3PUVE 2HXWA 1SD3A 5FBPA 3H6UA 5H8NB 1QUKA 2HXRA 3IX1A 2XXQA 1US5A 4P56A 5L9OA 2OK2A 2UVHA 4ZE9A 2O6AA 3N94A 1EYKA 2HAVA 2OCUA 3KN3A 3PPQA 1PBPA 3USDA 2CZLA 4NF0A 2QVVA 4YB6A 5TPAA 2CZKA 2BJJX 1B7HA 1IIWA 4IY5A 1KZ8A 3K1PA 1NNFA 1XVYA 1B9JA 4N8GA 3O9PA 5EQ7A 3ISPA 4XEQA 4G8HA 4PP0A 1A54A 4DLDA 5IGAA 4IGTA 3PPRA 1L5TA 4G68A 5F24A 5TP9B 1NMUA 4I1DA 3FGSA 1RDXA 3MVWA 2OLBA 3P7IA 2X7PA 2XA5A 3B6WA 3ILUB 3GBAA 4P11A 3R6UA 1NUYA 5LTCA 3RNNA 3D4CA 1IXHA 4R9GA 1JVYA 4U4SA 4DE8A 2FA7A 4DXCA 4L17A 4U22A 3RT8A 2REJA 2CZHA 4AB5A 1LSTA 2WYKA 1A7LA 2ZMBA 4X8RA 3EQ1A 4GWXA 1EYIA 4H8JA 3SERA 2XXIA 3UP9A 4MMPA 5ET7A 3D1RA 5I59A 3T0JA 1EZPA 1LFIA 2DS9A 3T9XB 4GWUA 1FBDA 2Q8JA 1TFAA 3TTRA 1JQFA 2I3WA 2PVUA 2QJEA 1M5EA 3PUXE 4E0WA 4NAPA 1FBPA 4JVDA 1D9YA 2QS3A 2DWHA 4PDHA 1H3DA 4OQOA 3G7WA 3CHGA 4GLIA 2D5WA 4R73A 4JSOA 3TMGA 2B3FA 4NF8B 4OENA 1MQIA 4O3BA 3I3VA 3KFMA 2L5VA 3MSTA 3H6WA 2OWTA 2KLFA 1FJ6A 4PE3A 4MEVA 2Z22A 5I84A 1MXVA 1FBEA 1QKBA 2A5TA 1AOVA 3TZAA 1B32A 3VVFA 4OEUA 4Q8RA 1FQDA 1LCFA 3E4RA 4GRKA 1PB8A 4IB2A 3E9XA 3FXRA 3BFUA 1MPBA 3T93B 2PBWA 2O69A 4OA4A 2DSFA 4QFLA 5EYFA 3K01A 4IO4A 1DTGA 1FBGA 3IJOB 3S4UA 2F3BA 3PV0E 4X04A 4Q0CA 3HV1A 3U65A 4N81A 1CNQA 2DWAA 3OOAA 1UIVA 4ND9A 1LFGA 3NOHA 2OWZA 1SW4A 2Y7PA 5JTYB 1K9YA 5DTBA 3H03A 5I3SA 4PCDA 2F8DA 1B46A 3FUZA 4GWSA 5IAIA 3T1BA 3PPOA 3RTFB 4ZZAA 1OVBA 4XF5A 2QVUA 2H4IA 4KD5A 3O97A 1G0HA 4Z7EA 3H6VA 4KFQA 2CEXA 3EHTA 2P2AA 3MQ9A 1SYIA 3RLFE 4TOZA 1YXIA 2V3UA 4F29A 2WBDA 1UTBB 3MVZA 2IEEA 5TPAB 2AIXA 1QUIA 1YTVA 3MP1A 1JEUA 4N15A 2H9BA 3EKIA 5ET8A 4R6YA 2HEUA 2Q8MA 1ZIUA 3VXCA 2ONRA 3MWBA 3PUZE 5CM6A 4PF8A 2FYIA 2QRYA 1WVJA 1FCKA 3O6IA 2XWKA 4G68B 5ITOA 1POTA 4GWOA 2UVJA 3SZPA 3ILTB 3L6GA 5FTHA 3CRBA 4U1ZA 2V4CA 1ANFA 4U23A 2B65A 1B40A 4IR8A 1FPIA 4NF4A 5FHOA 2XWVA 1DPPA 4GWYA 1I69A 4QRZA 1D3KA 2DYXA 3TCHA 3K00A 1DTZA 3O6HA 3ZKLA 3T9VA 2XXHA 3FV1A 1P1QA 5BUUA 3F11A 3B6TA 4I8CA 3IK6B 1Y1ZA 5HM4B 4PE5B 5IZ3B 4U4XA 3LSXA 5I5PA 1H44A 3OO8A 3G3KA 3LBSA 3IO4A 3FVNA 1USYH 5H8NA 2O7IA 3C35A 3B7DA 3V5AA 1UQWA 4PBHA 2M8CA 2KQZA 1N7WA 1BIYA 2NVUB 1MS7A 4R6HA 3LSFB 3PD9A 4P0IA 5I57B 1Y20A 3DELB 3OO9A 3FVOA 3MYUA 4ZEKA 4P0GA 4BDLA 4DDDA 4G8NA 4OWDA 4XFEA 1IXGA 2E1SA 1WODA 4KR5A 1FJ9A 3CFZA 1AH5A 3QXMA 4FEDA 1JW4A 1FTMA 1ZJLA 4HXVA 5FTIA 1M5DA 1PB7A 1B7UA 1MXWA 5T3JA 2IA4A 3O28A 3IOWA 3N6TA 1GVCA 3U93A 3MZ1A 2A5TB 1MPDA 3IB2A 2UYEA 1BLFA 1NUZA 4H6DA 3MPLA 4XKNA 4BLAA 4X9TA 4H5FA 3TYHA 2RC8A 4RK9A 3TUSA 4PTKA 1Y3PA 4WKMA 4U2RA 4AB6A 1IMBA 2DVZA 1VDWA 5K2XA 1H76A 4RK2A 5IZZA 4RA1A 3T9HB 5CRYA 4MNPA 5A5LA 4N6KA 2O51A 4TQUQ 1B2HA 5IKBA 5J16A 1NV1A 1SI0A 2PX1A 4EF2A 3O6GA 3VLWA 3VXBA 2O84X 3QIMA 3PU5A 5AA2D 4PETA 1M5BA 5HPQA 1FTAA 4PAFA 4LQ2A 1NV3A 4LONB 1US4A 1I6QA 1MPCA 1JVXA 1SYHA 4POWA 1LBZA 1Y4CA 3FIRA 3E13X 4QHQA 4BDMA 2RC7A 4NF6A 3U1OA 4JBZA 3Q26A 2F6GA 3UGWA 2CEYA 4FECA 4X1DA 3EHSA 1UTHA 3MZ9A 3PTYA 3MW0A 4LA9A 1RDZA 4H65A 4MHFA 2Z8DA 4MJOA 2P3NA 2XD3A 4R9FA 2Y7IA 2ONSA 2DWJA 4RNSA 1SPIA 1SW5A 5L8DA 1B58A 4C0RA 4RY1A 3OXNA 1SBPA 1LAFE 1VFEA 1ZKBA 3DLNA 3K1MA 1OQHA 3PPNA 4THIA 5CC2A 1LBBA 4P8BA 3QUJA 1NV0A 5I2KA 5DEXA 4LUBA 4M4GA 1DMBA 5AA2B 4IGRA 5EQAA 4GD5A 2ZNTA 4LQ5A 5H8SA 4F31B 1NNPA 2I4BA 2X26A 4NF4B 4EDPA 4KHZE 1GV8A 3PUWE 1FQCA 1FPLA 5L9MA 4GXAA 3TAJA 3RTWB 4RPOA 2XXUA 2VPNA 3DP4A 1FQAA 1NUWA 4HE2A 5ITPA 2F6PA 1B3GA 2Y5KA 2R8TA 4OFOA 3HN0A 4EQBA 1AIVA 4PFYA 4NEDA 3S9EA 1Q9DA 5F1QA 1B3EA 1NV5A 4GBVA 1LFHA 1DSNA 1JW5A 4MX6A 4NHBA 5A5XB 5J1DA 3TELA 1FTJA 2ABHA 4E0XA 3RY3A 4G4PA 1OLAA 1A55A 3SEXA 2GQ1A 1UTBA 5IZ1A 4LATA 1B4HA 4PFWA 2F7CA 1KA1A 3N26A 3MVXA 4YZZA 1GR2A 3BBRA 5M2VA 4UA8A 2ALUA 4FATA 1B5IA 1R9LA 4H46A 1OMPA 2XX7A 4G2ZA 4QFKA 2H25A 2O1MA 1XI6A 1FPEA 3S9MC 2DQVA 1LCTA 2R6GE 3IR1A 4BDQA 3FJMA 3VE1B 1N84A 3VLUA 3TFLA 4R72A 4O94A 2B3BA 2QMXA 4JWYA 4JXIA 2PFZA 3FVKA 5EYGA 4F1UA 1B05A 1P1WA 1Y9UA 1FTLA 3RYDA 1EH3A 2OWSA 1D4NA 3KJTA 1LEVA 3VLVA 1XVXA 2HPGA 4QXDA 2QFLA 1YCJA 5EHSA 3MVYA 2QS1A 5IM2A 2BJIA 3MAMA 1RDYA 1RKMA 4OFJA 3G3JA 1PB9A 3TKDA 4OVQA 4MBPA 1OQGA 5IZ3A 4OVTA 1NI9A 5AA4A 4EXKA 1EYJA 3QK6A 3W9VA 1A40A 3VVEA 4K3FA 4H45A 4KYSA 1LBYA 3KBRA 4O8MA 4NX1A 2ZNUA 2Z8FA 3QMFA 1QULA 4NE4A 2I3VA 3V83A 2Q89A 1MM6A 4KYDA 5I57A 5H8QA 1OVTA 4FEBA 2GHAA 4NF6B 1B6HA 4OXVA 2Q74A 5DW8A 2I0BA 1B1XA 2H98A 2DOJA 1UTHB 2GH9A 2ESNA 4F39A 4OZ9A 1MXYA 4YB5A 1MXXA 1ATGA 1MDP1 3GZGA 2OX3A 4MLQA 3TQWA 2VPOA 3KEIA 1PDAA 4G61A 4DI4B 3KJ7A 3T22A 3CSGA 2ZZXA 1SW2A 4XKPA 3CIJA 3SETA 4QSCA 4GX3A 5HBCA 5I2KB 5DEXB 1RYOA 1BTJA 3KN7A 4DCYA 4ELQA 4KPTA 5CBSA 4QSDA 3T9UA 4Q5TA 4O7MA 1NH8A 1IXIA 1R9QA 3HFUA 5EQ9A 3GLBA 3CFLA 3K6XA 2FIXA 4ECFA 1XOCA 2I48A 3TTLA 5TU0A 1P1NA 4WXJA 4PBQA 4N13A 4YMAA 2D3IA 3FBPA 4QFPA 4ZZEA 3K6WA 4YICA 4ZEBA 3MJNA 1BKAA 1B5HA 3N5LA 2D21A 4NG7A 4GX6A 3UK4A 1Q1KA 5H8HA 4KXPA 4OVPA 3SEWA 4BDOA 3JZJA 5ELVA 3HO7A 1PBQA 5KDTA 2YLNA 2REGA 1FPFA 4I3EA 1NH7A 1S9TA 4PFRA 3ONMA 3C4MA 5I7IA 4LP2B 1Y4TA 4F19A 4GL8A 1SI1A 1KWHA 2DP8A 4ZEFA 1LBWA 2HZLA 2ONKE 1QUJA 4F3SA 1MQHA 3SEUA 1LB9A 4F1VA 2ZNSA 3ROJA 1FQBA 4OESA 4ZDMA 3Q25A 1P99A 4QBAA 5B70A 4OYVA 4ZECA 3Q27A 4MFIA 1FPGA 1LAGE 3HCQA 2XX8A 1USYE 4IO2A 3S2VA 5AA2A 4C1TA 3BIGA 2VT5A 3MPKA 3OEKA 2XWIA 4Z0IA 3HHFA 2RCBA 3HPIA 1T0KA 4FAJA 1ZBMA 5CBRA 3RPLA 3RPWA 4I3YA 2V93A 4AS5A 1JP4A 4R74A 4DCXA 5ET5A 2UVIA 3UA8A 3OENA 1TXFA 1N3WA 2DXRA 5AA4B 4FBPA 4EF1A 3UN6A 3EF7A 1IQ7A 3PMXA 4G77A 3HSTA 1VR5A 4R2FA 2XXXA 5A5XA 2V3QA 3ZSFA 3C36A 4LZ5A 1FQFA 4KYEA 1FQEA 4ZEDA 2GFEA 4NWCA 4PAKA 1JNFA 4FE8A 2Q9TA 5H8QB 2I6EA 2XD2A 3HHGA 2YPNA 3QYTA 1LAXA 4MCOA 3K0VA 4F2QA 4NN3A 4TLMB 1SQYA 3W15C 1SVXB 5AA3A 4WEPA 4MNIA 4OHNA 4H0WA 2HHMA 2WBBA 2WX9A 4LZ8A 1JW1A 4F3PA 4N8YA 3O66A 4G8MA 4N07A 3PMVA 4OVSA 1ZMGA 5CI5A 5JEIA 4JDFA 2FVZA 1D9VA 1Z7NE 3FXBA 3IL1B 1B4ZA 4PAIA 3CG3A 3R26A 4P9KA 1Z7ME 3KSJA 4H8IA 5I2NA 3OMBA 1CE2A 4XIGQ 5BWJA 5K2YA 3B8BA 3ODBA 4I9DA 1LLSA 4JVCA 1B0HA 4IO5A 1TWYA 2XXPA 3EN3A 3MP8A 1XHYA 1M5FA 5I58A 1JETA 3LC8A 1LBXA 4TLLB 3TPAA 3IB1A 3S9NC 1NFTA 2ANJA 1NUXA 2PT1A 5CMMA 4F22A 5FHNA 4PFUA 4PDDA 3MUQA 5LOMA 2VHAA 3THIA 3PMWA 3SESA 1TT1A 3VV5A 2DE4A 2WEFA 5DT6A 2HAUA 2QSXA 5H8HB 2XXTA 3BFTA 2PT2A 1N76A 1FPJA 2I4CA 4QFNA 2B4MA 5KDTB 4H67A 4AS4A 3C9HA 4EXLA 4PF6A 2XXWA 3OO6A 3C34A 1QKAA 5EHMA 3R7XA 3IO6A 2YJPA 4R2BA 4GFRA 3C33A 1QJMA 5I56A 1AMFA 3U8QA 1B3FA 2HFBA 2UXAA 4DZ1A 3U92A 4PFIA 4ELRA 1MH4A 2ZYOA 1FTOA 4MAGA 1MDQA 1EZ9A 1VFDA 4N6PA 1NNKA 5AA1A 1O7TA 2AL4A 3LR1A 3VDFA 3OD7A 4F3BA 2F34A 3LSLA 1DPEA 2FNCA 4ELPA 3AXFA 3OSQA 3A29A 4NWDA 2WYPA 1OLCA 1MQDA 2QPQA 2F5XA 2QMWA 3RQTA 5ICTA 3ZKKA 3FJ7A 3OO7A 3RPLB 5ISUA 2NXOA 2XXYA 2GRVA 3H6TA 3IORA 1MH3A 5AE4A 3K02A 2ZZVA 1FBCA 3H3GA 3TTKA 4R6KA 3CG1A 1B52A 1MY0A 1R6ZA 2DXYA 4DXUA 2F7BA 4PFBA 1ZTYA 2P3VA 2GHBA 2H5YA 2O1LA 4F2OA 3T66A 3G3FA 3W9WA 3RN8A 4GWZA 3E3KA 4NF5A 3M8UA 3A09A 3B50A 4GQOA 1PEBA 2Z8EA 2HCAA 3FV2A 5EYHA 1B0LA 2Q88A 2HQ0A 3KSXA 1N7XA 4PQJA 1XC1A 1IITA 4GXSB 3I5OA 3ECRA 4GL0A 5JK4A 3KC1A 2FBPA 4F1YA 4UABA 3FASA 4HS7A 1B3LA 1NV6A 3O29A 4YAHX 1H43A 1WDNA 2Z23A 3JYRA 4U1OA 1IEJA 3DP6A 1O63A 4QF9A 2ZYMA 1IMAA 3SEVA 2RC9A 4YKKA 3B6QA 4FJPA 3CSBA 2V25A 5I2NB 1FPKA 4EQ9A 3C32A 2KR0A 1I6AA 2JJKA 3TDJA 3MP6A 3FZVA 4OETA 2CZIA 5FHMA 1HSJA 4RYAA 1B5JA 1YPNA 2ZXTA 4PC9A 4OTEA 4MNCA 5CMBA 4GWWA 4EUOA 5I58B 3PPPA 3O2AA 4GOTA 5CMCA 4G68C 1GTKA 3KC0A 3OELA 1P1UA 1SW1A 3QSLA 3LUZA 4C1UA 3N6UA 4IO6A 3BKIB 3Q28A 1IMEA 2Q2AA 4X48A 4H5GA 3IB0A 3M3KA 4DXBA 2P0SA 3GBBA 5L9SA 1FBHA
chains in the Genus database with same CATH topology
3TODA 1B7ZA 2NOOA 1Y3QA 3RGYA 3LUYA 3EHUA 4QSEA 4XTCQ 4LZ7A 1EU8A 4Q30B 5KCJA 2R9JA 3MC2A 5I56B 3UORA 3KGCA 1LBCA 2X7QA 1NL5A 2QS4A 3MBPA 2PYYA 3DP8A 1Q35A 2VD3A 4FORA 4MH5A 3TEPA 2Y7RA 3V8XB 1URSA 5DVIA 4YMBA 1A99A 3EPEA 3FXQA 4HCYA 1MY2A 3G3HA 2R71A 3RT6B 2P1SA 1MM7A 1SDXA 1NKXA 4NTLA 1DOTA 1B3HA 2F7AA 1ZU0A 2O7UA 1CB6A 4GF8A 3OSRA 1QW0A 5H8FA 2F36A 3WAEA 2DWIA 2NWJA 4EQ7A 4OERA 3H06B 2VGQA 3A3CA 2VD2A 1MQJA 2AYSA 1XS5A 2LAOA 2OBGA 2THIA 4NF5B 2V84A 4ZEIA 3KG2A 1URDA 2Q2CA 2V3TA 1XT8A 4WEDA 1ZLQA 2XXVA 2AL5A 3G3IA 3KOTA 4HCWA 3IOUA 3K4UA 3FXUA 3IOVA 4YKJA 4O3AA 1HSLA 2WKYA 4XKRA 1LB8A 4ZE8A 4R75A 3CI8A 4NMYA 4DIGA 2PMSA 3PGFA 3TCFA 3DM0A 4HW8A 3V89B 4OFLA 4O3CA 5DVJA 4ESXA 3KN8A 4ONYA 1S50A 3TTMA 3C31A 4H1XA 3IAZA 2O68A 4JWOA 4YKIA 3CVGA 2QS2A 1M5CA 4YKPA 1MXUA 4F18A 3CR9A 5F7VA 4OVJA 3A3UA 1MQGA 4ISUA 4LVQA 1F9BA 2F78A 3FD3A 4KCDA 5B7DA 1BP5A 1IXCA 4IY6A 3SEYA 3JV9A 5I59B 3RUMA 4ELOA 2G29A 2UVGA 1N3XA 4BDNA 1N0TA 3LSWA 3K2DA 3QUFA 4F3GA 4YB7A 3FATA 3FVGA 4XXUA 5KCJB 1MY1A 2XHDA 5ICQA 4UACA 3KOSA 4JSDA 2E0SA 2XX9A 2OJTA 4POXA 4IO3A 1II5A 4BDRA 4RXLA 2NUVA 1MXZA 1MRPA 3H7MA 1FW0A 2DE2A 2Y84A 4PFTA 4QFOA 3SKPA 2Y7WA 1B51A 2RF1A 5TP9A 3KZGA 1N04A 2F97A 1QVSA 4YU0A 3ZS6A 3WAFA 2HZKA 4X1BA 1UIUA 1VSOA 1VE4A 1URGA 1H45A 1A8FA 1LGBC 2I58A 3S9LC 2RCAA 1OIBA 1R1NA 4GIZA 1Y1MA 2W7YA 2UYFA 3IOTA 1A8EA 4IO7A 5H8FB 1MG1A 3FJGA 4U21A 4HTGA 4KCCA 2XXRA 1RYXA 3CFXA 2VP1A 3GXAA 1I6BA 4I62A 1NNTA 2H99A 4KI0E 2VOZA 1EZOA 4XKQA 1POY1 3K1NA 1J1NA 3K6VA 5DVFA 2RINA 3H4ZA 3PD8A 3QAXA 2G93A 1B1HA 3M3LA 1TFDA 1MY4A 2Y7KA 3IJXB 3PUYE 2ZYNA 3UIFA 1ELJA 4FIMA 1P1OA 3K6UA 3G3GA 3TCGA 3U94A 1LAHE 5CMKA 4MF3A 1AL3A 3M3FA 4NF8A 4AQ4A 1MY3A 2CMOA 4RJZA 1YAEA 4MLVA 3SDFA 2DVCA 2A5SA 4RPNA 2DE3A 3TTNA 3TQLA 2I0CA 1GGGA 2ZYKA 1Y3NA 5DYHA 3D4GA 1FTKA 3MZBA 4OEVA 5KZTA 4OMBA 4JWXA 2I49A 4ZS9A 2QL3A 1HSEA 3L6HA 4KQPA 3OEMA 1IUDA 3VVDA 4M1VA 2RKMA 3T96B 1O64A 1IZ1A 3U72A 1S7YA 3VFJA 5JTYA 1JEVA 1PC3A 3I6VA 4GVOA 4JB7A 4ESWA 2F35A 2OZZA 3Q29A 3PUVE 2HXWA 1SD3A 3H6UA 5H8NB 1QUKA 3IX1A 2XXQA 1US5A 5L9OA 2OK2A 2UVHA 4ZE9A 2O6AA 3N94A 2HAVA 2OCUA 3KN3A 3PPQA 1PBPA 3USDA 2CZLA 4YB6A 5TPAA 2BJJX 1B7HA 1IIWA 4IY5A 3K1PA 1NNFA 1XVYA 1B9JA 3O9PA 4G8HA 4PP0A 1A54A 4DLDA 4IGTA 3PPRA 1L5TA 4G68A 5TP9B 1NMUA 4I1DA 3FGSA 3MVWA 2OLBA 3P7IA 2X7PA 3B6WA 3ILUB 3GBAA 4P11A 3R6UA 3RNNA 3D4CA 1IXHA 4R9GA 1JVYA 4U4SA 4DE8A 2FA7A 4DXCA 4L17A 4U22A 3RT8A 2REJA 4AB5A 1LSTA 1A7LA 2ZMBA 3EQ1A 3SERA 4H8JA 2XXIA 3UP9A 5I59A 1EZPA 1LFIA 2DS9A 3T9XB 2Q8JA 1TFAA 3TTRA 1JQFA 2I3WA 2PVUA 2QJEA 1M5EA 3PUXE 4E0WA 1D9YA 2QS3A 2DWHA 1H3DA 4OQOA 3G7WA 4GLIA 2D5WA 4R73A 4JSOA 3TMGA 2B3FA 4NF8B 4OENA 1MQIA 4O3BA 3I3VA 3KFMA 3H6WA 2OWTA 2KLFA 2Z22A 5I84A 1MXVA 1QKBA 2A5TA 1AOVA 3TZAA 1B32A 3VVFA 4OEUA 4Q8RA 1FQDA 1LCFA 3E4RA 4GRKA 1PB8A 4IB2A 3E9XA 3FXRA 3BFUA 1MPBA 3T93B 2PBWA 2O69A 2DSFA 4QFLA 5EYFA 3K01A 4IO4A 1DTGA 3IJOB 3S4UA 3PV0E 4Q0CA 3HV1A 2DWAA 3OOAA 1UIVA 4ND9A 1LFGA 1SW4A 2Y7PA 5JTYB 5DTBA 3H03A 2F8DA 1B46A 3FUZA 5IAIA 3PPOA 3RTFB 4ZZAA 1OVBA 2H4IA 4KD5A 3O97A 4Z7EA 3H6VA 4KFQA 3EHTA 2P2AA 3MQ9A 1SYIA 3RLFE 4TOZA 2V3UA 4F29A 3MVZA 1UTBB 2IEEA 5TPAB 2AIXA 1QUIA 1YTVA 3MP1A 1JEUA 2H9BA 4R6YA 2HEUA 1ZIUA 3VXCA 2ONRA 3MWBA 3PUZE 5CM6A 2FYIA 2QRYA 1WVJA 1FCKA 3O6IA 4G68B 5ITOA 1POTA 4GWOA 2UVJA 3ILTB 3L6GA 5FTHA 3CRBA 4U1ZA 1ANFA 4U23A 2B65A 1B40A 4NF4A 5FHOA 1DPPA 1I69A 4QRZA 1D3KA 2DYXA 3TCHA 3K00A 1DTZA 3O6HA 3ZKLA 3T9VA 2XXHA 3FV1A 1P1QA 5BUUA 3F11A 3B6TA 4I8CA 3IK6B 1Y1ZA 5HM4B 4PE5B 4U4XA 3LSXA 1H44A 3OO8A 3G3KA 3LBSA 3IO4A 3FVNA 1USYH 5H8NA 2O7IA 3C35A 3B7DA 3V5AA 1UQWA 2M8CA 1N7WA 1BIYA 2NVUB 1MS7A 4R6HA 3LSFB 3PD9A 4P0IA 5I57B 1Y20A 3DELB 3OO9A 3FVOA 4ZEKA 4P0GA 4BDLA 4DDDA 4G8NA 4OWDA 1IXGA 2E1SA 1WODA 4KR5A 3CFZA 1AH5A 3QXMA 4FEDA 1JW4A 1FTMA 1ZJLA 5FTIA 1M5DA 1PB7A 1B7UA 1MXWA 2IA4A 3O28A 3IOWA 3N6TA 1GVCA 3U93A 3MZ1A 2A5TB 1MPDA 3IB2A 2UYEA 1BLFA 4H6DA 3MPLA 4XKNA 4BLAA 4X9TA 4H5FA 3TYHA 2RC8A 4RK9A 3TUSA 1Y3PA 4WKMA 4U2RA 4AB6A 2DVZA 5K2XA 1H76A 4RK2A 4RA1A 3T9HB 5CRYA 2O51A 4TQUQ 1B2HA 5IKBA 1SI0A 2PX1A 4EF2A 3O6GA 3VLWA 3VXBA 2O84X 3QIMA 3PU5A 5AA2D 4PETA 1M5BA 5HPQA 4LQ2A 4LONB 1US4A 1I6QA 1MPCA 1JVXA 1SYHA 4POWA 1Y4CA 3FIRA 3E13X 4QHQA 4BDMA 2RC7A 4NF6A 3U1OA 4JBZA 3Q26A 2F6GA 3UGWA 4FECA 4X1DA 3EHSA 1UTHA 3MZ9A 3MW0A 4LA9A 4H65A 2Z8DA 2XD3A 4R9FA 2Y7IA 2ONSA 2DWJA 4RNSA 1SW5A 5L8DA 1B58A 4C0RA 4RY1A 3OXNA 1SBPA 1ZKBA 1LAFE 1VFEA 3DLNA 3K1MA 1OQHA 3PPNA 4THIA 5CC2A 1LBBA 3QUJA 5I2KA 5DEXA 4LUBA 4M4GA 1DMBA 5AA2B 4IGRA 4GD5A 2ZNTA 4LQ5A 5H8SA 4F31B 1NNPA 2I4BA 2X26A 4NF4B 4EDPA 4KHZE 1GV8A 3PUWE 1FQCA 5L9MA 4GXAA 3TAJA 3RTWB 4RPOA 2XXUA 3DP4A 1FQAA 5ITPA 2F6PA 1B3GA 4OFOA 3HN0A 4EQBA 1AIVA 4PFYA 4NEDA 3S9EA 5F1QA 1B3EA 1LFHA 1DSNA 1JW5A 5A5XB 5J1DA 3TELA 1FTJA 2ABHA 4E0XA 3RY3A 4G4PA 1OLAA 1A55A 3SEXA 1UTBA 4LATA 1B4HA 4PFWA 2F7CA 3N26A 3MVXA 4YZZA 1GR2A 3BBRA 5M2VA 4UA8A 2ALUA 4FATA 1B5IA 1R9LA 1OMPA 2XX7A 4G2ZA 4QFKA 2H25A 2O1MA 3S9MC 2DQVA 1LCTA 2R6GE 3IR1A 4BDQA 3FJMA 3VE1B 1N84A 3VLUA 3TFLA 4R72A 2B3BA 2QMXA 4JWYA 4JXIA 3FVKA 4F1UA 1B05A 1P1WA 1Y9UA 1FTLA 1EH3A 2OWSA 1D4NA 3KJTA 3VLVA 1XVXA 1YCJA 5EHSA 3MVYA 2QS1A 3MAMA 1RKMA 4OFJA 3G3JA 1PB9A 3TKDA 4MBPA 1OQGA 5AA4A 4EXKA 3QK6A 3W9VA 1A40A 3VVEA 4K3FA 4KYSA 3KBRA 2ZNUA 2Z8FA 1QULA 4NE4A 2I3VA 3V83A 2Q89A 1MM6A 4KYDA 5I57A 5H8QA 1OVTA 4FEBA 2GHAA 4NF6B 1B6HA 4OXVA 2I0BA 1B1XA 2H98A 2DOJA 1UTHB 2GH9A 2ESNA 4F39A 4OZ9A 1MXYA 4YB5A 1MXXA 1ATGA 1MDP1 3GZGA 4MLQA 3TQWA 3KEIA 1PDAA 3KJ7A 3T22A 3CSGA 1SW2A 4XKPA 3CIJA 3SETA 4QSCA 5HBCA 5I2KB 5DEXB 1RYOA 1BTJA 3KN7A 4DCYA 4ELQA 4KPTA 5CBSA 4QSDA 3T9UA 4Q5TA 1NH8A 1IXIA 1R9QA 3GLBA 3CFLA 3K6XA 4ECFA 1XOCA 2I48A 3TTLA 5TU0A 1P1NA 4WXJA 4N13A 4YMAA 2D3IA 4QFPA 4ZZEA 3K6WA 4YICA 4ZEBA 3MJNA 1BKAA 1B5HA 3N5LA 2D21A 3UK4A 1Q1KA 5H8HA 3SEWA 4BDOA 3JZJA 5ELVA 3HO7A 1PBQA 5KDTA 2YLNA 2REGA 1NH7A 1S9TA 3ONMA 3C4MA 4LP2B 1Y4TA 4F19A 4GL8A 1SI1A 1KWHA 2DP8A 4ZEFA 2HZLA 2ONKE 1QUJA 4F3SA 1MQHA 3SEUA 1LB9A 4F1VA 2ZNSA 1FQBA 4OESA 4ZDMA 3Q25A 1P99A 5B70A 4OYVA 4ZECA 3Q27A 4MFIA 1LAGE 3HCQA 2XX8A 1USYE 4IO2A 3S2VA 5AA2A 4C1TA 3MPKA 3OEKA 4Z0IA 3HHFA 2RCBA 3HPIA 1T0KA 4FAJA 1ZBMA 5CBRA 3RPWA 2V93A 4R74A 4DCXA 2UVIA 3UA8A 3OENA 1TXFA 1N3WA 2DXRA 5AA4B 4EF1A 3UN6A 3EF7A 1IQ7A 3PMXA 4G77A 3HSTA 1VR5A 4R2FA 2XXXA 5A5XA 2V3QA 3ZSFA 3C36A 4LZ5A 1FQFA 4KYEA 1FQEA 4ZEDA 2GFEA 4NWCA 1JNFA 4FE8A 2Q9TA 5H8QB 2I6EA 2XD2A 3HHGA 2YPNA 3QYTA 1LAXA 3K0VA 4F2QA 4TLMB 1SQYA 3W15C 1SVXB 5AA3A 4WEPA 4OHNA 4H0WA 4LZ8A 1JW1A 4F3PA 3O66A 4G8MA 4N07A 3PMVA 1ZMGA 5CI5A 5JEIA 4JDFA 1D9VA 1Z7NE 3IL1B 1B4ZA 3CG3A 3R26A 1Z7ME 3KSJA 4H8IA 5I2NA 3OMBA 1CE2A 4XIGQ 5BWJA 5K2YA 3ODBA 4I9DA 1LLSA 1B0HA 4IO5A 1TWYA 2XXPA 3EN3A 3MP8A 1XHYA 1M5FA 5I58A 1JETA 3LC8A 4TLLB 3TPAA 3IB1A 3S9NC 1NFTA 4F22A 2ANJA 2PT1A 5CMMA 5FHNA 4PFUA 3MUQA 5LOMA 2VHAA 3THIA 3PMWA 3SESA 1TT1A 3VV5A 2DE4A 5DT6A 2HAUA 2QSXA 5H8HB 2XXTA 3BFTA 2PT2A 1N76A 2I4CA 4QFNA 5KDTB 4H67A 3C9HA 4EXLA 2XXWA 3OO6A 3C34A 1QKAA 5EHMA 3R7XA 3IO6A 2YJPA 4R2BA 4GFRA 3C33A 1QJMA 5I56A 1AMFA 3U8QA 1B3FA 2HFBA 2UXAA 4DZ1A 3U92A 4ELRA 1MH4A 2ZYOA 1FTOA 1MDQA 1EZ9A 1VFDA 4N6PA 1NNKA 5AA1A 1O7TA 2AL4A 3LR1A 3VDFA 3OD7A 4F3BA 2F34A 3LSLA 1DPEA 2FNCA 4ELPA 3AXFA 3OSQA 4NWDA 1OLCA 1MQDA 2QPQA 2F5XA 2QMWA 3RQTA 5ICTA 3ZKKA 3FJ7A 3OO7A 5ISUA 2NXOA 2XXYA 2GRVA 3H6TA 3IORA 1MH3A 5AE4A 3K02A 3H3GA 3TTKA 4R6KA 3CG1A 1B52A 1MY0A 1R6ZA 2DXYA 4DXUA 2F7BA 1ZTYA 2GHBA 2H5YA 2O1LA 4F2OA 3T66A 3G3FA 3W9WA 3RN8A 3E3KA 4NF5A 3M8UA 3A09A 4GQOA 1PEBA 2Z8EA 2HCAA 3FV2A 1B0LA 2Q88A 2HQ0A 3KSXA 1N7XA 4PQJA 1XC1A 1IITA 4GXSB 3I5OA 3ECRA 4GL0A 5JK4A 4F1YA 3FASA 4HS7A 1B3LA 3O29A 4YAHX 1H43A 1WDNA 2Z23A 3JYRA 4U1OA 1IEJA 3DP6A 1O63A 4QF9A 2ZYMA 3SEVA 2RC9A 4YKKA 3B6QA 4FJPA 3CSBA 2V25A 5I2NB 4EQ9A 3C32A 1I6AA 3TDJA 3MP6A 3FZVA 4OETA 5FHMA 1HSJA 4RYAA 1B5JA 1YPNA 2ZXTA 4OTEA 5CMBA 4EUOA 5I58B 3PPPA 3O2AA 4GOTA 5CMCA 4G68C 1GTKA 3OELA 1P1UA 1SW1A 3QSLA 4C1UA 3N6UA 4IO6A 3BKIB 3Q28A 2Q2AA 4X48A 4H5GA 3IB0A 3M3KA 4DXBA 2P0SA 3GBBA 5L9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOD A;  1B7Z A;  2NOO A;  1Y3Q A;  3RGY A;  3LUY A;  3EHU A;  4QSE A;  4XTC Q;  4LZ7 A;  1EU8 A;  4Q30 B;  5KCJ A;  2R9J A;  3MC2 A;  5I56 B;  3UOR A;  3KGC A;  1LBC A;  2X7Q A;  1NL5 A;  2QS4 A;  3MBP A;  2PYY A;  3DP8 A;  1Q35 A;  2VD3 A;  4FOR A;  4MH5 A;  3TEP A;  2Y7R A;  3V8X B;  1URS A;  5DVI A;  4YMB A;  1A99 A;  3EPE A;  3FXQ A;  4HCY A;  1MY2 A;  3G3H A;  2R71 A;  3RT6 B;  2P1S A;  1MM7 A;  1SDX A;  1NKX A;  4NTL A;  1DOT A;  1B3H A;  2F7A A;  1ZU0 A;  2O7U A;  1CB6 A;  4GF8 A;  3OSR A;  1QW0 A;  5H8F A;  2F36 A;  3WAE A;  2DWI A;  2NWJ A;  4EQ7 A;  4OER A;  3H06 B;  2VGQ A;  3A3C A;  2VD2 A;  1MQJ A;  2AYS A;  1XS5 A;  2LAO A;  2OBG A;  2THI A;  4NF5 B;  2V84 A;  4ZEI A;  3KG2 A;  1URD A;  2Q2C A;  2V3T A;  1XT8 A;  4WED A;  1ZLQ A;  2XXV A;  2AL5 A;  3G3I A;  3KOT A;  4HCW A;  3IOU A;  3K4U A;  3FXU A;  3IOV A;  4YKJ A;  4O3A A;  1HSL A;  2WKY A;  4XKR A;  1LB8 A;  4ZE8 A;  4R75 A;  3CI8 A;  4NMY A;  4DIG A;  2PMS A;  3PGF A;  3TCF A;  3DM0 A;  4HW8 A;  3V89 B;  4OFL A;  4O3C A;  5DVJ A;  4ESX A;  3KN8 A;  4ONY A;  1S50 A;  3TTM A;  3C31 A;  4H1X A;  3IAZ A;  2O68 A;  4JWO A;  4YKI A;  3CVG A;  2QS2 A;  1M5C A;  4YKP A;  1MXU A;  4F18 A;  3CR9 A;  5F7V A;  4OVJ A;  3A3U A;  1MQG A;  4ISU A;  4LVQ A;  1F9B A;  2F78 A;  3FD3 A;  4KCD A;  5B7D A;  1BP5 A;  1IXC A;  4IY6 A;  3SEY A;  3JV9 A;  5I59 B;  3RUM A;  4ELO A;  2G29 A;  2UVG A;  1N3X A;  4BDN A;  1N0T A;  3LSW A;  3K2D A;  3QUF A;  4F3G A;  4YB7 A;  3FAT A;  3FVG A;  4XXU A;  5KCJ B;  1MY1 A;  2XHD A;  5ICQ A;  4UAC A;  3KOS A;  4JSD A;  2E0S A;  2XX9 A;  2OJT A;  4POX A;  4IO3 A;  1II5 A;  4BDR A;  4RXL A;  2NUV A;  1MXZ A;  1MRP A;  3H7M A;  1FW0 A;  2DE2 A;  2Y84 A;  4PFT A;  4QFO A;  3SKP A;  2Y7W A;  1B51 A;  2RF1 A;  5TP9 A;  3KZG A;  1N04 A;  2F97 A;  1QVS A;  4YU0 A;  3ZS6 A;  3WAF A;  2HZK A;  4X1B A;  1UIU A;  1VSO A;  1VE4 A;  1URG A;  1H45 A;  1A8F A;  1LGB C;  2I58 A;  3S9L C;  2RCA A;  1OIB A;  1R1N A;  4GIZ A;  1Y1M A;  2W7Y A;  2UYF A;  3IOT A;  1A8E A;  4IO7 A;  5H8F B;  1MG1 A;  3FJG A;  4U21 A;  4HTG A;  4KCC A;  2XXR A;  1RYX A;  3CFX A;  2VP1 A;  3GXA A;  1I6B A;  4I62 A;  1NNT A;  2H99 A;  4KI0 E;  2VOZ A;  1EZO A;  4XKQ A;  1POY 1;  3K1N A;  1J1N A;  3K6V A;  5DVF A;  2RIN A;  3H4Z A;  3PD8 A;  3QAX A;  2G93 A;  1B1H A;  3M3L A;  1TFD A;  1MY4 A;  2Y7K A;  3IJX B;  3PUY E;  2ZYN A;  3UIF A;  1ELJ A;  4FIM A;  1P1O A;  3K6U A;  3G3G A;  3TCG A;  3U94 A;  1LAH E;  5CMK A;  4MF3 A;  1AL3 A;  3M3F A;  4NF8 A;  4AQ4 A;  1MY3 A;  2CMO A;  4RJZ A;  1YAE A;  4MLV A;  3SDF A;  2DVC A;  2A5S A;  4RPN A;  2DE3 A;  3TTN A;  3TQL A;  2I0C A;  1GGG A;  2ZYK A;  1Y3N A;  5DYH A;  3D4G A;  1FTK A;  3MZB A;  4OEV A;  5KZT A;  4OMB A;  4JWX A;  2I49 A;  4ZS9 A;  2QL3 A;  1HSE A;  3L6H A;  4KQP A;  3OEM A;  1IUD A;  3VVD A;  4M1V A;  2RKM A;  3T96 B;  1O64 A;  1IZ1 A;  3U72 A;  1S7Y A;  3VFJ A;  5JTY A;  1JEV A;  1PC3 A;  3I6V A;  4GVO A;  4JB7 A;  4ESW A;  2F35 A;  2OZZ A;  3Q29 A;  3PUV E;  2HXW A;  1SD3 A;  3H6U A;  5H8N B;  1QUK A;  3IX1 A;  2XXQ A;  1US5 A;  5L9O A;  2OK2 A;  2UVH A;  4ZE9 A;  2O6A A;  3N94 A;  2HAV A;  2OCU A;  3KN3 A;  3PPQ A;  1PBP A;  3USD A;  2CZL A;  4YB6 A;  5TPA A;  2BJJ X;  1B7H A;  1IIW A;  4IY5 A;  3K1P A;  1NNF A;  1XVY A;  1B9J A;  3O9P A;  4G8H A;  4PP0 A;  1A54 A;  4DLD A;  4IGT A;  3PPR A;  1L5T A;  4G68 A;  5TP9 B;  1NMU A;  4I1D A;  3FGS A;  3MVW A;  2OLB A;  3P7I A;  2X7P A;  3B6W A;  3ILU B;  3GBA A;  4P11 A;  3R6U A;  3RNN A;  3D4C A;  1IXH A;  4R9G A;  1JVY A;  4U4S A;  4DE8 A;  2FA7 A;  4DXC A;  4L17 A;  4U22 A;  3RT8 A;  2REJ A;  4AB5 A;  1LST A;  1A7L A;  2ZMB A;  3EQ1 A;  3SER A;  4H8J A;  2XXI A;  3UP9 A;  5I59 A;  1EZP A;  1LFI A;  2DS9 A;  3T9X B;  2Q8J A;  1TFA A;  3TTR A;  1JQF A;  2I3W A;  2PVU A;  2QJE A;  1M5E A;  3PUX E;  4E0W A;  1D9Y A;  2QS3 A;  2DWH A;  1H3D A;  4OQO A;  3G7W A;  4GLI A;  2D5W A;  4R73 A;  4JSO A;  3TMG A;  2B3F A;  4NF8 B;  4OEN A;  1MQI A;  4O3B A;  3I3V A;  3KFM A;  3H6W A;  2OWT A;  2KLF A;  2Z22 A;  5I84 A;  1MXV A;  1QKB A;  2A5T A;  1AOV A;  3TZA A;  1B32 A;  3VVF A;  4OEU A;  4Q8R A;  1FQD A;  1LCF A;  3E4R A;  4GRK A;  1PB8 A;  4IB2 A;  3E9X A;  3FXR A;  3BFU A;  1MPB A;  3T93 B;  2PBW A;  2O69 A;  2DSF A;  4QFL A;  5EYF A;  3K01 A;  4IO4 A;  1DTG A;  3IJO B;  3S4U A;  3PV0 E;  4Q0C A;  3HV1 A;  2DWA A;  3OOA A;  1UIV A;  4ND9 A;  1LFG A;  1SW4 A;  2Y7P A;  5JTY B;  5DTB A;  3H03 A;  2F8D A;  1B46 A;  3FUZ A;  5IAI A;  3PPO A;  3RTF B;  4ZZA A;  1OVB A;  2H4I A;  4KD5 A;  3O97 A;  4Z7E A;  3H6V A;  4KFQ A;  3EHT A;  2P2A A;  3MQ9 A;  1SYI A;  3RLF E;  4TOZ A;  2V3U A;  4F29 A;  3MVZ A;  1UTB B;  2IEE A;  5TPA B;  2AIX A;  1QUI A;  1YTV A;  3MP1 A;  1JEU A;  2H9B A;  4R6Y A;  2HEU A;  1ZIU A;  3VXC A;  2ONR A;  3MWB A;  3PUZ E;  5CM6 A;  2FYI A;  2QRY A;  1WVJ A;  1FCK A;  3O6I A;  4G68 B;  5ITO A;  1POT A;  4GWO A;  2UVJ A;  3ILT B;  3L6G A;  5FTH A;  3CRB A;  4U1Z A;  1ANF A;  4U23 A;  2B65 A;  1B40 A;  4NF4 A;  5FHO A;  1DPP A;  1I69 A;  4QRZ A;  1D3K A;  2DYX A;  3TCH A;  3K00 A;  1DTZ A;  3O6H A;  3ZKL A;  3T9V A;  2XXH A;  3FV1 A;  1P1Q A;  5BUU A;  3F11 A;  3B6T A;  4I8C A;  3IK6 B;  1Y1Z A;  5HM4 B;  4PE5 B;  4U4X A;  3LSX A;  1H44 A;  3OO8 A;  3G3K A;  3LBS A;  3IO4 A;  3FVN A;  1USY H;  5H8N A;  2O7I A;  3C35 A;  3B7D A;  3V5A A;  1UQW A;  2M8C A;  1N7W A;  1BIY A;  2NVU B;  1MS7 A;  4R6H A;  3LSF B;  3PD9 A;  4P0I A;  5I57 B;  1Y20 A;  3DEL B;  3OO9 A;  3FVO A;  4ZEK A;  4P0G A;  4BDL A;  4DDD A;  4G8N A;  4OWD A;  1IXG A;  2E1S A;  1WOD A;  4KR5 A;  3CFZ A;  1AH5 A;  3QXM A;  4FED A;  1JW4 A;  1FTM A;  1ZJL A;  5FTI A;  1M5D A;  1PB7 A;  1B7U A;  1MXW A;  2IA4 A;  3O28 A;  3IOW A;  3N6T A;  1GVC A;  3U93 A;  3MZ1 A;  2A5T B;  1MPD A;  3IB2 A;  2UYE A;  1BLF A;  4H6D A;  3MPL A;  4XKN A;  4BLA A;  4X9T A;  4H5F A;  3TYH A;  2RC8 A;  4RK9 A;  3TUS A;  1Y3P A;  4WKM A;  4U2R A;  4AB6 A;  2DVZ A;  5K2X A;  1H76 A;  4RK2 A;  4RA1 A;  3T9H B;  5CRY A;  2O51 A;  4TQU Q;  1B2H A;  5IKB A;  1SI0 A;  2PX1 A;  4EF2 A;  3O6G A;  3VLW A;  3VXB A;  2O84 X;  3QIM A;  3PU5 A;  5AA2 D;  4PET A;  1M5B A;  5HPQ A;  4LQ2 A;  4LON B;  1US4 A;  1I6Q A;  1MPC A;  1JVX A;  1SYH A;  4POW A;  1Y4C A;  3FIR A;  3E13 X;  4QHQ A;  4BDM A;  2RC7 A;  4NF6 A;  3U1O A;  4JBZ A;  3Q26 A;  2F6G A;  3UGW A;  4FEC A;  4X1D A;  3EHS A;  1UTH A;  3MZ9 A;  3MW0 A;  4LA9 A;  4H65 A;  2Z8D A;  2XD3 A;  4R9F A;  2Y7I A;  2ONS A;  2DWJ A;  4RNS A;  1SW5 A;  5L8D A;  1B58 A;  4C0R A;  4RY1 A;  3OXN A;  1SBP A;  1ZKB A;  1LAF E;  1VFE A;  3DLN A;  3K1M A;  1OQH A;  3PPN A;  4THI A;  5CC2 A;  1LBB A;  3QUJ A;  5I2K A;  5DEX A;  4LUB A;  4M4G A;  1DMB A;  5AA2 B;  4IGR A;  4GD5 A;  2ZNT A;  4LQ5 A;  5H8S A;  4F31 B;  1NNP A;  2I4B A;  2X26 A;  4NF4 B;  4EDP A;  4KHZ E;  1GV8 A;  3PUW E;  1FQC A;  5L9M A;  4GXA A;  3TAJ A;  3RTW B;  4RPO A;  2XXU A;  3DP4 A;  1FQA A;  5ITP A;  2F6P A;  1B3G A;  4OFO A;  3HN0 A;  4EQB A;  1AIV A;  4PFY A;  4NED A;  3S9E A;  5F1Q A;  1B3E A;  1LFH A;  1DSN A;  1JW5 A;  5A5X B;  5J1D A;  3TEL A;  1FTJ A;  2ABH A;  4E0X A;  3RY3 A;  4G4P A;  1OLA A;  1A55 A;  3SEX A;  1UTB A;  4LAT A;  1B4H A;  4PFW A;  2F7C A;  3N26 A;  3MVX A;  4YZZ A;  1GR2 A;  3BBR A;  5M2V A;  4UA8 A;  2ALU A;  4FAT A;  1B5I A;  1R9L A;  1OMP A;  2XX7 A;  4G2Z A;  4QFK A;  2H25 A;  2O1M A;  3S9M C;  2DQV A;  1LCT A;  2R6G E;  3IR1 A;  4BDQ A;  3FJM A;  3VE1 B;  1N84 A;  3VLU A;  3TFL A;  4R72 A;  2B3B A;  2QMX A;  4JWY A;  4JXI A;  3FVK A;  4F1U A;  1B05 A;  1P1W A;  1Y9U A;  1FTL A;  1EH3 A;  2OWS A;  1D4N A;  3KJT A;  3VLV A;  1XVX A;  1YCJ A;  5EHS A;  3MVY A;  2QS1 A;  3MAM A;  1RKM A;  4OFJ A;  3G3J A;  1PB9 A;  3TKD A;  4MBP A;  1OQG A;  5AA4 A;  4EXK A;  3QK6 A;  3W9V A;  1A40 A;  3VVE A;  4K3F A;  4KYS A;  3KBR A;  2ZNU A;  2Z8F A;  1QUL A;  4NE4 A;  2I3V A;  3V83 A;  2Q89 A;  1MM6 A;  4KYD A;  5I57 A;  5H8Q A;  1OVT A;  4FEB A;  2GHA A;  4NF6 B;  1B6H A;  4OXV A;  2I0B A;  1B1X A;  2H98 A;  2DOJ A;  1UTH B;  2GH9 A;  2ESN A;  4F39 A;  4OZ9 A;  1MXY A;  4YB5 A;  1MXX A;  1ATG A;  1MDP 1;  3GZG A;  4MLQ A;  3TQW A;  3KEI A;  1PDA A;  3KJ7 A;  3T22 A;  3CSG A;  1SW2 A;  4XKP A;  3CIJ A;  3SET A;  4QSC A;  5HBC A;  5I2K B;  5DEX B;  1RYO A;  1BTJ A;  3KN7 A;  4DCY A;  4ELQ A;  4KPT A;  5CBS A;  4QSD A;  3T9U A;  4Q5T A;  1NH8 A;  1IXI A;  1R9Q A;  3GLB A;  3CFL A;  3K6X A;  4ECF A;  1XOC A;  2I48 A;  3TTL A;  5TU0 A;  1P1N A;  4WXJ A;  4N13 A;  4YMA A;  2D3I A;  4QFP A;  4ZZE A;  3K6W A;  4YIC A;  4ZEB A;  3MJN A;  1BKA A;  1B5H A;  3N5L A;  2D21 A;  3UK4 A;  1Q1K A;  5H8H A;  3SEW A;  4BDO A;  3JZJ A;  5ELV A;  3HO7 A;  1PBQ A;  5KDT A;  2YLN A;  2REG A;  1NH7 A;  1S9T A;  3ONM A;  3C4M A;  4LP2 B;  1Y4T A;  4F19 A;  4GL8 A;  1SI1 A;  1KWH A;  2DP8 A;  4ZEF A;  2HZL A;  2ONK E;  1QUJ A;  4F3S A;  1MQH A;  3SEU A;  1LB9 A;  4F1V A;  2ZNS A;  1FQB A;  4OES A;  4ZDM A;  3Q25 A;  1P99 A;  5B70 A;  4OYV A;  4ZEC A;  3Q27 A;  4MFI A;  1LAG E;  3HCQ A;  2XX8 A;  1USY E;  4IO2 A;  3S2V A;  5AA2 A;  4C1T A;  3MPK A;  3OEK A;  4Z0I A;  3HHF A;  2RCB A;  3HPI A;  1T0K A;  4FAJ A;  1ZBM A;  5CBR A;  3RPW A;  2V93 A;  4R74 A;  4DCX A;  2UVI A;  3UA8 A;  3OEN A;  1TXF A;  1N3W A;  2DXR A;  5AA4 B;  4EF1 A;  3UN6 A;  3EF7 A;  1IQ7 A;  3PMX A;  4G77 A;  3HST A;  1VR5 A;  4R2F A;  2XXX A;  5A5X A;  2V3Q A;  3ZSF A;  3C36 A;  4LZ5 A;  1FQF A;  4KYE A;  1FQE A;  4ZED A;  2GFE A;  4NWC A;  1JNF A;  4FE8 A;  2Q9T A;  5H8Q B;  2I6E A;  2XD2 A;  3HHG A;  2YPN A;  3QYT A;  1LAX A;  3K0V A;  4F2Q A;  4TLM B;  1SQY A;  3W15 C;  1SVX B;  5AA3 A;  4WEP A;  4OHN A;  4H0W A;  4LZ8 A;  1JW1 A;  4F3P A;  3O66 A;  4G8M A;  4N07 A;  3PMV A;  1ZMG A;  5CI5 A;  5JEI A;  4JDF A;  1D9V A;  1Z7N E;  3IL1 B;  1B4Z A;  3CG3 A;  3R26 A;  1Z7M E;  3KSJ A;  4H8I A;  5I2N A;  3OMB A;  1CE2 A;  4XIG Q;  5BWJ A;  5K2Y A;  3ODB A;  4I9D A;  1LLS A;  1B0H A;  4IO5 A;  1TWY A;  2XXP A;  3EN3 A;  3MP8 A;  1XHY A;  1M5F A;  5I58 A;  1JET A;  3LC8 A;  4TLL B;  3TPA A;  3IB1 A;  3S9N C;  1NFT A;  4F22 A;  2ANJ A;  2PT1 A;  5CMM A;  5FHN A;  4PFU A;  3MUQ A;  5LOM A;  2VHA A;  3THI A;  3PMW A;  3SES A;  1TT1 A;  3VV5 A;  2DE4 A;  5DT6 A;  2HAU A;  2QSX A;  5H8H B;  2XXT A;  3BFT A;  2PT2 A;  1N76 A;  2I4C A;  4QFN A;  5KDT B;  4H67 A;  3C9H A;  4EXL A;  2XXW A;  3OO6 A;  3C34 A;  1QKA A;  5EHM A;  3R7X A;  3IO6 A;  2YJP A;  4R2B A;  4GFR A;  3C33 A;  1QJM A;  5I56 A;  1AMF A;  3U8Q A;  1B3F A;  2HFB A;  2UXA A;  4DZ1 A;  3U92 A;  4ELR A;  1MH4 A;  2ZYO A;  1FTO A;  1MDQ A;  1EZ9 A;  1VFD A;  4N6P A;  1NNK A;  5AA1 A;  1O7T A;  2AL4 A;  3LR1 A;  3VDF A;  3OD7 A;  4F3B A;  2F34 A;  3LSL A;  1DPE A;  2FNC A;  4ELP A;  3AXF A;  3OSQ A;  4NWD A;  1OLC A;  1MQD A;  2QPQ A;  2F5X A;  2QMW A;  3RQT A;  5ICT A;  3ZKK A;  3FJ7 A;  3OO7 A;  5ISU A;  2NXO A;  2XXY A;  2GRV A;  3H6T A;  3IOR A;  1MH3 A;  5AE4 A;  3K02 A;  3H3G A;  3TTK A;  4R6K A;  3CG1 A;  1B52 A;  1MY0 A;  1R6Z A;  2DXY A;  4DXU A;  2F7B A;  1ZTY A;  2GHB A;  2H5Y A;  2O1L A;  4F2O A;  3T66 A;  3G3F A;  3W9W A;  3RN8 A;  3E3K A;  4NF5 A;  3M8U A;  3A09 A;  4GQO A;  1PEB A;  2Z8E A;  2HCA A;  3FV2 A;  1B0L A;  2Q88 A;  2HQ0 A;  3KSX A;  1N7X A;  4PQJ A;  1XC1 A;  1IIT A;  4GXS B;  3I5O A;  3ECR A;  4GL0 A;  5JK4 A;  4F1Y A;  3FAS A;  4HS7 A;  1B3L A;  3O29 A;  4YAH X;  1H43 A;  1WDN A;  2Z23 A;  3JYR A;  4U1O A;  1IEJ A;  3DP6 A;  1O63 A;  4QF9 A;  2ZYM A;  3SEV A;  2RC9 A;  4YKK A;  3B6Q A;  4FJP A;  3CSB A;  2V25 A;  5I2N B;  4EQ9 A;  3C32 A;  1I6A A;  3TDJ A;  3MP6 A;  3FZV A;  4OET A;  5FHM A;  1HSJ A;  4RYA A;  1B5J A;  1YPN A;  2ZXT A;  4OTE A;  5CMB A;  4EUO A;  5I58 B;  3PPP A;  3O2A A;  4GOT A;  5CMC A;  4G68 C;  1GTK A;  3OEL A;  1P1U A;  1SW1 A;  3QSL A;  4C1U A;  3N6U A;  4IO6 A;  3BKI B;  3Q28 A;  2Q2A A;  4X48 A;  4H5G A;  3IB0 A;  3M3K A;  4DXB A;  2P0S A;  3GBB A;  5L9S A; 
#chains in the Genus database with same CATH topology
 4N6D A;  3TOD A;  1B7Z A;  2NOO A;  1Y3Q A;  3RGY A;  3LUY A;  1NV7 A;  3EHU A;  4QSE A;  4XTC Q;  4LZ7 A;  4GX4 A;  3E79 A;  4P1L A;  1EU8 A;  4Q30 B;  5KCJ A;  2R9J A;  4OAN A;  3MC2 A;  5I56 B;  3UOR A;  3KGC A;  1LBC A;  2X7Q A;  1NL5 A;  2QS4 A;  3MBP A;  1LBV A;  2PYY A;  1INP A;  3DP8 A;  1Q35 A;  2VD3 A;  4FOR A;  2Y5L A;  4MH5 A;  4P3L A;  3TEP A;  2Y7R A;  3V8X B;  1URS A;  1FPB A;  5DVI A;  4YMB A;  2XWO A;  1A99 A;  3EPE A;  3FXQ A;  4HCY A;  1MY2 A;  3G3H A;  2R71 A;  3RT6 B;  2P1S A;  1MM7 A;  1SDX A;  1NKX A;  4NTL A;  1DOT A;  1B3H A;  2F7A A;  4GBW A;  1ZU0 A;  2O7U A;  1D9Q A;  1CB6 A;  4N91 A;  4JVI A;  4GF8 A;  3OSR A;  1QW0 A;  5H8F A;  2F36 A;  3WAE A;  2DWI A;  3LV0 A;  2NWJ A;  4EQ7 A;  4OER A;  1DCU A;  3H06 B;  2VGQ A;  2FIE A;  2PFY A;  3A3C A;  2VD2 A;  1MQJ A;  2AYS A;  1XS5 A;  2LAO A;  2OBG A;  2THI A;  4NF5 B;  2V84 A;  2PCR A;  4ZEI A;  3KG2 A;  1URD A;  2Q2C A;  2V3T A;  1XT8 A;  4N4U A;  4WED A;  5EQ8 A;  1ZLQ A;  2XXV A;  2AL5 A;  1DBZ A;  3G3I A;  3KOT A;  4HCW A;  3IOU A;  3K4U A;  3FXU A;  3IOV A;  4YKJ A;  4O3A A;  1HSL A;  2WKY A;  4XKR A;  1G0I A;  4P1E A;  1LB8 A;  4ZE8 A;  4R75 A;  3CI8 A;  4NMY A;  2FHY A;  1FRP A;  4DIG A;  2PMS A;  3PGF A;  2B4L A;  2DDK A;  4HE0 A;  3TCF A;  3DM0 A;  4NGU A;  4HW8 A;  3V89 B;  4OFL A;  2ZZW A;  4O3C A;  5DVJ A;  4ESX A;  3E78 A;  1BK4 A;  3KN8 A;  4ONY A;  1S50 A;  3TTM A;  3C31 A;  4H1X A;  3IAZ A;  2O68 A;  4JWO A;  3KBZ A;  4YKI A;  3CVG A;  1AWB A;  2QS2 A;  4HE1 A;  1M5C A;  1NV4 A;  1MXU A;  4YKP A;  4F18 A;  3CR9 A;  5F7V A;  4OVJ A;  3A3U A;  1MQG A;  4ISU A;  4LVQ A;  1F9B A;  2F78 A;  3FD3 A;  4O7I A;  4KCD A;  5B7D A;  1BP5 A;  3IFA A;  1IXC A;  4IY6 A;  3SEY A;  3JV9 A;  5I59 B;  4PGN A;  2MKZ A;  3RUM A;  4ELO A;  2G29 A;  2UVG A;  1IMF A;  1N3X A;  4BDN A;  1N0T A;  3LSW A;  3K2D A;  3QUF A;  4F3G A;  4YB7 A;  3FAT A;  1YZ0 A;  1NV2 A;  4NQ8 A;  3FVG A;  4XXU A;  5KCJ B;  1MY1 A;  3GYY A;  2XHD A;  5ICQ A;  4UAC A;  3KOS A;  4JSD A;  2E0S A;  2XX9 A;  2OJT A;  4POX A;  4IO3 A;  1KA0 A;  1II5 A;  4BDR A;  4RXL A;  2NUV A;  1MXZ A;  1MRP A;  3H7M A;  1FW0 A;  3BIH A;  2DE2 A;  2Y84 A;  4PFT A;  4QFO A;  3SKP A;  2Y7W A;  1B51 A;  2RF1 A;  5TP9 A;  4OVR A;  3KZG A;  1QGX A;  1N04 A;  2F97 A;  1QVS A;  4YU0 A;  3ZS6 A;  4MIJ A;  3WAF A;  2HZK A;  4X1B A;  1UIU A;  1VSO A;  1VE4 A;  1URG A;  1FSA A;  1H45 A;  1A8F A;  1FPD A;  4N17 A;  1LGB C;  2I58 A;  3S9L C;  1FBF A;  2RCA A;  1OIB A;  1R1N A;  4GIZ A;  1Y1M A;  1YYZ A;  2W7Y A;  2UYF A;  3IOT A;  1A8E A;  4IO7 A;  5H8F B;  1MG1 A;  3FJG A;  4U21 A;  4HTG A;  4KCC A;  2XXR A;  1RYX A;  3CFX A;  2VP1 A;  3GXA A;  1I6B A;  4I62 A;  1NNT A;  2H99 A;  4KI0 E;  4DI3 D;  2VOZ A;  1EZO A;  4XKQ A;  1POY 1;  3K1N A;  1J1N A;  3K6V A;  5DVF A;  2RIN A;  3H4Z A;  3PD8 A;  3QAX A;  2G93 A;  1IMD A;  1B1H A;  3M3L A;  2QVR A;  1TFD A;  1MY4 A;  2Y7K A;  3IJX B;  3PUY E;  2ZYN A;  3UIF A;  1ELJ A;  4FIM A;  1P1O A;  3K6U A;  3G3G A;  3TCG A;  4PGP A;  3U94 A;  1LAH E;  5CMK A;  4MF3 A;  1AL3 A;  3M3F A;  4NF8 A;  4AQ4 A;  1MY3 A;  4LN5 A;  2CMO A;  4RJZ A;  1YAE A;  2F3D A;  4MLV A;  3SDF A;  2DVC A;  2A5S A;  1K9Z A;  4RPN A;  2DE3 A;  3TTN A;  3TQL A;  2I0C A;  1GGG A;  2ZYK A;  5ESY A;  5ET6 A;  1Y3N A;  5DYH A;  4I40 A;  3D4G A;  1FTK A;  3MZB A;  4OEV A;  1IMC A;  5KZT A;  5LDZ A;  4OMB A;  4JWX A;  2I49 A;  4ZS9 A;  2QL3 A;  3IFC A;  1HSE A;  3L6H A;  4KQP A;  3OEM A;  1IUD A;  3VVD A;  4M1V A;  2RKM A;  3T96 B;  1DK4 A;  1O64 A;  2XXK A;  4P47 A;  1IZ1 A;  3U72 A;  1S7Y A;  3VFJ A;  5JTY A;  1JEV A;  1PC3 A;  3I6V A;  4GVO A;  4JB7 A;  4ESW A;  2F35 A;  2OZZ A;  3Q29 A;  3PUV E;  2HXW A;  1SD3 A;  5FBP A;  3H6U A;  5H8N B;  1QUK A;  2HXR A;  3IX1 A;  2XXQ A;  1US5 A;  4P56 A;  5L9O A;  2OK2 A;  2UVH A;  4ZE9 A;  2O6A A;  3N94 A;  1EYK A;  2HAV A;  2OCU A;  3KN3 A;  3PPQ A;  1PBP A;  3USD A;  2CZL A;  4NF0 A;  2QVV A;  4YB6 A;  5TPA A;  2CZK A;  2BJJ X;  1B7H A;  1IIW A;  4IY5 A;  1KZ8 A;  3K1P A;  1NNF A;  1XVY A;  1B9J A;  4N8G A;  3O9P A;  5EQ7 A;  3ISP A;  4XEQ A;  4G8H A;  4PP0 A;  1A54 A;  4DLD A;  5IGA A;  4IGT A;  3PPR A;  1L5T A;  4G68 A;  5F24 A;  5TP9 B;  1NMU A;  4I1D A;  3FGS A;  1RDX A;  3MVW A;  2OLB A;  3P7I A;  2X7P A;  2XA5 A;  3B6W A;  3ILU B;  3GBA A;  4P11 A;  3R6U A;  1NUY A;  5LTC A;  3RNN A;  3D4C A;  1IXH A;  4R9G A;  1JVY A;  4U4S A;  4DE8 A;  2FA7 A;  4DXC A;  4L17 A;  4U22 A;  3RT8 A;  2REJ A;  2CZH A;  4AB5 A;  1LST A;  2WYK A;  1A7L A;  2ZMB A;  4X8R A;  3EQ1 A;  4GWX A;  1EYI A;  4H8J A;  3SER A;  2XXI A;  3UP9 A;  4MMP A;  5ET7 A;  3D1R A;  5I59 A;  3T0J A;  1EZP A;  1LFI A;  2DS9 A;  3T9X B;  4GWU A;  1FBD A;  2Q8J A;  1TFA A;  3TTR A;  1JQF A;  2I3W A;  2PVU A;  2QJE A;  1M5E A;  3PUX E;  4E0W A;  4NAP A;  1FBP A;  4JVD A;  1D9Y A;  2QS3 A;  2DWH A;  4PDH A;  1H3D A;  4OQO A;  3G7W A;  3CHG A;  4GLI A;  2D5W A;  4R73 A;  4JSO A;  3TMG A;  2B3F A;  4NF8 B;  4OEN A;  1MQI A;  4O3B A;  3I3V A;  3KFM A;  2L5V A;  3MST A;  3H6W A;  2OWT A;  2KLF A;  1FJ6 A;  4PE3 A;  4MEV A;  2Z22 A;  5I84 A;  1MXV A;  1FBE A;  1QKB A;  2A5T A;  1AOV A;  3TZA A;  1B32 A;  3VVF A;  4OEU A;  4Q8R A;  1FQD A;  1LCF A;  3E4R A;  4GRK A;  1PB8 A;  4IB2 A;  3E9X A;  3FXR A;  3BFU A;  1MPB A;  3T93 B;  2PBW A;  2O69 A;  4OA4 A;  2DSF A;  4QFL A;  5EYF A;  3K01 A;  4IO4 A;  1DTG A;  1FBG A;  3IJO B;  3S4U A;  2F3B A;  3PV0 E;  4X04 A;  4Q0C A;  3HV1 A;  3U65 A;  4N81 A;  1CNQ A;  2DWA A;  3OOA A;  1UIV A;  4ND9 A;  1LFG A;  3NOH A;  2OWZ A;  1SW4 A;  2Y7P A;  5JTY B;  1K9Y A;  5DTB A;  3H03 A;  5I3S A;  4PCD A;  2F8D A;  1B46 A;  3FUZ A;  4GWS A;  5IAI A;  3T1B A;  3PPO A;  3RTF B;  4ZZA A;  1OVB A;  4XF5 A;  2QVU A;  2H4I A;  4KD5 A;  3O97 A;  1G0H A;  4Z7E A;  3H6V A;  4KFQ A;  2CEX A;  3EHT A;  2P2A A;  3MQ9 A;  1SYI A;  3RLF E;  4TOZ A;  1YXI A;  2V3U A;  4F29 A;  2WBD A;  1UTB B;  3MVZ A;  2IEE A;  5TPA B;  2AIX A;  1QUI A;  1YTV A;  3MP1 A;  1JEU A;  4N15 A;  2H9B A;  3EKI A;  5ET8 A;  4R6Y A;  2HEU A;  2Q8M A;  1ZIU A;  3VXC A;  2ONR A;  3MWB A;  3PUZ E;  5CM6 A;  4PF8 A;  2FYI A;  2QRY A;  1WVJ A;  1FCK A;  3O6I A;  2XWK A;  4G68 B;  5ITO A;  1POT A;  4GWO A;  2UVJ A;  3SZP A;  3ILT B;  3L6G A;  5FTH A;  3CRB A;  4U1Z A;  2V4C A;  1ANF A;  4U23 A;  2B65 A;  1B40 A;  4IR8 A;  1FPI A;  4NF4 A;  5FHO A;  2XWV A;  1DPP A;  4GWY A;  1I69 A;  4QRZ A;  1D3K A;  2DYX A;  3TCH A;  3K00 A;  1DTZ A;  3O6H A;  3ZKL A;  3T9V A;  2XXH A;  3FV1 A;  1P1Q A;  5BUU A;  3F11 A;  3B6T A;  4I8C A;  3IK6 B;  1Y1Z A;  5HM4 B;  4PE5 B;  5IZ3 B;  4U4X A;  3LSX A;  5I5P A;  1H44 A;  3OO8 A;  3G3K A;  3LBS A;  3IO4 A;  3FVN A;  1USY H;  5H8N A;  2O7I A;  3C35 A;  3B7D A;  3V5A A;  1UQW A;  4PBH A;  2M8C A;  2KQZ A;  1N7W A;  1BIY A;  2NVU B;  1MS7 A;  4R6H A;  3LSF B;  3PD9 A;  4P0I A;  5I57 B;  1Y20 A;  3DEL B;  3OO9 A;  3FVO A;  3MYU A;  4ZEK A;  4P0G A;  4BDL A;  4DDD A;  4G8N A;  4OWD A;  4XFE A;  1IXG A;  2E1S A;  1WOD A;  4KR5 A;  1FJ9 A;  3CFZ A;  1AH5 A;  3QXM A;  4FED A;  1JW4 A;  1FTM A;  1ZJL A;  4HXV A;  5FTI A;  1M5D A;  1PB7 A;  1B7U A;  1MXW A;  5T3J A;  2IA4 A;  3O28 A;  3IOW A;  3N6T A;  1GVC A;  3U93 A;  3MZ1 A;  2A5T B;  1MPD A;  3IB2 A;  2UYE A;  1BLF A;  1NUZ A;  4H6D A;  3MPL A;  4XKN A;  4BLA A;  4X9T A;  4H5F A;  3TYH A;  2RC8 A;  4RK9 A;  3TUS A;  4PTK A;  1Y3P A;  4WKM A;  4U2R A;  4AB6 A;  1IMB A;  2DVZ A;  1VDW A;  5K2X A;  1H76 A;  4RK2 A;  5IZZ A;  4RA1 A;  3T9H B;  5CRY A;  4MNP A;  5A5L A;  4N6K A;  2O51 A;  4TQU Q;  1B2H A;  5IKB A;  5J16 A;  1NV1 A;  1SI0 A;  2PX1 A;  4EF2 A;  3O6G A;  3VLW A;  3VXB A;  2O84 X;  3QIM A;  3PU5 A;  5AA2 D;  4PET A;  1M5B A;  5HPQ A;  1FTA A;  4PAF A;  4LQ2 A;  1NV3 A;  4LON B;  1US4 A;  1I6Q A;  1MPC A;  1JVX A;  1SYH A;  4POW A;  1LBZ A;  1Y4C A;  3FIR A;  3E13 X;  4QHQ A;  4BDM A;  2RC7 A;  4NF6 A;  3U1O A;  4JBZ A;  3Q26 A;  2F6G A;  3UGW A;  2CEY A;  4FEC A;  4X1D A;  3EHS A;  1UTH A;  3MZ9 A;  3PTY A;  3MW0 A;  4LA9 A;  1RDZ A;  4H65 A;  4MHF A;  2Z8D A;  4MJO A;  2P3N A;  2XD3 A;  4R9F A;  2Y7I A;  2ONS A;  2DWJ A;  4RNS A;  1SPI A;  1SW5 A;  5L8D A;  1B58 A;  4C0R A;  4RY1 A;  3OXN A;  1SBP A;  1LAF E;  1VFE A;  1ZKB A;  3DLN A;  3K1M A;  1OQH A;  3PPN A;  4THI A;  5CC2 A;  1LBB A;  4P8B A;  3QUJ A;  1NV0 A;  5I2K A;  5DEX A;  4LUB A;  4M4G A;  1DMB A;  5AA2 B;  4IGR A;  5EQA A;  4GD5 A;  2ZNT A;  4LQ5 A;  5H8S A;  4F31 B;  1NNP A;  2I4B A;  2X26 A;  4NF4 B;  4EDP A;  4KHZ E;  1GV8 A;  3PUW E;  1FQC A;  1FPL A;  5L9M A;  4GXA A;  3TAJ A;  3RTW B;  4RPO A;  2XXU A;  2VPN A;  3DP4 A;  1FQA A;  1NUW A;  4HE2 A;  5ITP A;  2F6P A;  1B3G A;  2Y5K A;  2R8T A;  4OFO A;  3HN0 A;  4EQB A;  1AIV A;  4PFY A;  4NED A;  3S9E A;  1Q9D A;  5F1Q A;  1B3E A;  1NV5 A;  4GBV A;  1LFH A;  1DSN A;  1JW5 A;  4MX6 A;  4NHB A;  5A5X B;  5J1D A;  3TEL A;  1FTJ A;  2ABH A;  4E0X A;  3RY3 A;  4G4P A;  1OLA A;  1A55 A;  3SEX A;  2GQ1 A;  1UTB A;  5IZ1 A;  4LAT A;  1B4H A;  4PFW A;  2F7C A;  1KA1 A;  3N26 A;  3MVX A;  4YZZ A;  1GR2 A;  3BBR A;  5M2V A;  4UA8 A;  2ALU A;  4FAT A;  1B5I A;  1R9L A;  4H46 A;  1OMP A;  2XX7 A;  4G2Z A;  4QFK A;  2H25 A;  2O1M A;  1XI6 A;  1FPE A;  3S9M C;  2DQV A;  1LCT A;  2R6G E;  3IR1 A;  4BDQ A;  3FJM A;  3VE1 B;  1N84 A;  3VLU A;  3TFL A;  4R72 A;  4O94 A;  2B3B A;  2QMX A;  4JWY A;  4JXI A;  2PFZ A;  3FVK A;  5EYG A;  4F1U A;  1B05 A;  1P1W A;  1Y9U A;  1FTL A;  3RYD A;  1EH3 A;  2OWS A;  1D4N A;  3KJT A;  1LEV A;  3VLV A;  1XVX A;  2HPG A;  4QXD A;  2QFL A;  1YCJ A;  5EHS A;  3MVY A;  2QS1 A;  5IM2 A;  2BJI A;  3MAM A;  1RDY A;  1RKM A;  4OFJ A;  3G3J A;  1PB9 A;  3TKD A;  4OVQ A;  4MBP A;  1OQG A;  5IZ3 A;  4OVT A;  1NI9 A;  5AA4 A;  4EXK A;  1EYJ A;  3QK6 A;  3W9V A;  1A40 A;  3VVE A;  4K3F A;  4H45 A;  4KYS A;  1LBY A;  3KBR A;  4O8M A;  4NX1 A;  2ZNU A;  2Z8F A;  3QMF A;  1QUL A;  4NE4 A;  2I3V A;  3V83 A;  2Q89 A;  1MM6 A;  4KYD A;  5I57 A;  5H8Q A;  1OVT A;  4FEB A;  2GHA A;  4NF6 B;  1B6H A;  4OXV A;  2Q74 A;  5DW8 A;  2I0B A;  1B1X A;  2H98 A;  2DOJ A;  1UTH B;  2GH9 A;  2ESN A;  4F39 A;  4OZ9 A;  1MXY A;  4YB5 A;  1MXX A;  1ATG A;  1MDP 1;  3GZG A;  2OX3 A;  4MLQ A;  3TQW A;  2VPO A;  3KEI A;  1PDA A;  4G61 A;  4DI4 B;  3KJ7 A;  3T22 A;  3CSG A;  2ZZX A;  1SW2 A;  4XKP A;  3CIJ A;  3SET A;  4QSC A;  4GX3 A;  5HBC A;  5I2K B;  5DEX B;  1RYO A;  1BTJ A;  3KN7 A;  4DCY A;  4ELQ A;  4KPT A;  5CBS A;  4QSD A;  3T9U A;  4Q5T A;  4O7M A;  1NH8 A;  1IXI A;  1R9Q A;  3HFU A;  5EQ9 A;  3GLB A;  3CFL A;  3K6X A;  2FIX A;  4ECF A;  1XOC A;  2I48 A;  3TTL A;  5TU0 A;  1P1N A;  4WXJ A;  4PBQ A;  4N13 A;  4YMA A;  2D3I A;  3FBP A;  4QFP A;  4ZZE A;  3K6W A;  4YIC A;  4ZEB A;  3MJN A;  1BKA A;  1B5H A;  3N5L A;  2D21 A;  4NG7 A;  4GX6 A;  3UK4 A;  1Q1K A;  5H8H A;  4KXP A;  4OVP A;  3SEW A;  4BDO A;  3JZJ A;  5ELV A;  3HO7 A;  1PBQ A;  5KDT A;  2YLN A;  2REG A;  1FPF A;  4I3E A;  1NH7 A;  1S9T A;  4PFR A;  3ONM A;  3C4M A;  5I7I A;  4LP2 B;  1Y4T A;  4F19 A;  4GL8 A;  1SI1 A;  1KWH A;  2DP8 A;  4ZEF A;  1LBW A;  2HZL A;  2ONK E;  1QUJ A;  4F3S A;  1MQH A;  3SEU A;  1LB9 A;  4F1V A;  2ZNS A;  3ROJ A;  1FQB A;  4OES A;  4ZDM A;  3Q25 A;  1P99 A;  4QBA A;  5B70 A;  4OYV A;  4ZEC A;  3Q27 A;  4MFI A;  1FPG A;  1LAG E;  3HCQ A;  2XX8 A;  1USY E;  4IO2 A;  3S2V A;  5AA2 A;  4C1T A;  3BIG A;  2VT5 A;  3MPK A;  3OEK A;  2XWI A;  4Z0I A;  3HHF A;  2RCB A;  3HPI A;  1T0K A;  4FAJ A;  1ZBM A;  5CBR A;  3RPL A;  3RPW A;  4I3Y A;  2V93 A;  4AS5 A;  1JP4 A;  4R74 A;  4DCX A;  5ET5 A;  2UVI A;  3UA8 A;  3OEN A;  1TXF A;  1N3W A;  2DXR A;  5AA4 B;  4FBP A;  4EF1 A;  3UN6 A;  3EF7 A;  1IQ7 A;  3PMX A;  4G77 A;  3HST A;  1VR5 A;  4R2F A;  2XXX A;  5A5X A;  2V3Q A;  3ZSF A;  3C36 A;  4LZ5 A;  1FQF A;  4KYE A;  1FQE A;  4ZED A;  2GFE A;  4NWC A;  4PAK A;  1JNF A;  4FE8 A;  2Q9T A;  5H8Q B;  2I6E A;  2XD2 A;  3HHG A;  2YPN A;  3QYT A;  1LAX A;  4MCO A;  3K0V A;  4F2Q A;  4NN3 A;  4TLM B;  1SQY A;  3W15 C;  1SVX B;  5AA3 A;  4WEP A;  4MNI A;  4OHN A;  4H0W A;  2HHM A;  2WBB A;  2WX9 A;  4LZ8 A;  1JW1 A;  4F3P A;  4N8Y A;  3O66 A;  4G8M A;  4N07 A;  3PMV A;  4OVS A;  1ZMG A;  5CI5 A;  5JEI A;  4JDF A;  2FVZ A;  1D9V A;  1Z7N E;  3FXB A;  3IL1 B;  1B4Z A;  4PAI A;  3CG3 A;  3R26 A;  4P9K A;  1Z7M E;  3KSJ A;  4H8I A;  5I2N A;  3OMB A;  1CE2 A;  4XIG Q;  5BWJ A;  5K2Y A;  3B8B A;  3ODB A;  4I9D A;  1LLS A;  4JVC A;  1B0H A;  4IO5 A;  1TWY A;  2XXP A;  3EN3 A;  3MP8 A;  1XHY A;  1M5F A;  5I58 A;  1JET A;  3LC8 A;  1LBX A;  4TLL B;  3TPA A;  3IB1 A;  3S9N C;  1NFT A;  2ANJ A;  1NUX A;  2PT1 A;  5CMM A;  4F22 A;  5FHN A;  4PFU A;  4PDD A;  3MUQ A;  5LOM A;  2VHA A;  3THI A;  3PMW A;  3SES A;  1TT1 A;  3VV5 A;  2DE4 A;  2WEF A;  5DT6 A;  2HAU A;  2QSX A;  5H8H B;  2XXT A;  3BFT A;  2PT2 A;  1N76 A;  1FPJ A;  2I4C A;  4QFN A;  2B4M A;  5KDT B;  4H67 A;  4AS4 A;  3C9H A;  4EXL A;  4PF6 A;  2XXW A;  3OO6 A;  3C34 A;  1QKA A;  5EHM A;  3R7X A;  3IO6 A;  2YJP A;  4R2B A;  4GFR A;  3C33 A;  1QJM A;  5I56 A;  1AMF A;  3U8Q A;  1B3F A;  2HFB A;  2UXA A;  4DZ1 A;  3U92 A;  4PFI A;  4ELR A;  1MH4 A;  2ZYO A;  1FTO A;  4MAG A;  1MDQ A;  1EZ9 A;  1VFD A;  4N6P A;  1NNK A;  5AA1 A;  1O7T A;  2AL4 A;  3LR1 A;  3VDF A;  3OD7 A;  4F3B A;  2F34 A;  3LSL A;  1DPE A;  2FNC A;  4ELP A;  3AXF A;  3OSQ A;  3A29 A;  4NWD A;  2WYP A;  1OLC A;  1MQD A;  2QPQ A;  2F5X A;  2QMW A;  3RQT A;  5ICT A;  3ZKK A;  3FJ7 A;  3OO7 A;  3RPL B;  5ISU A;  2NXO A;  2XXY A;  2GRV A;  3H6T A;  3IOR A;  1MH3 A;  5AE4 A;  3K02 A;  2ZZV A;  1FBC A;  3H3G A;  3TTK A;  4R6K A;  3CG1 A;  1B52 A;  1MY0 A;  1R6Z A;  2DXY A;  4DXU A;  2F7B A;  4PFB A;  1ZTY A;  2P3V A;  2GHB A;  2H5Y A;  2O1L A;  4F2O A;  3T66 A;  3G3F A;  3W9W A;  3RN8 A;  4GWZ A;  3E3K A;  4NF5 A;  3M8U A;  3A09 A;  3B50 A;  4GQO A;  1PEB A;  2Z8E A;  2HCA A;  3FV2 A;  5EYH A;  1B0L A;  2Q88 A;  2HQ0 A;  3KSX A;  1N7X A;  4PQJ A;  1XC1 A;  1IIT A;  4GXS B;  3I5O A;  3ECR A;  4GL0 A;  5JK4 A;  3KC1 A;  2FBP A;  4F1Y A;  4UAB A;  3FAS A;  4HS7 A;  1B3L A;  1NV6 A;  3O29 A;  4YAH X;  1H43 A;  1WDN A;  2Z23 A;  3JYR A;  4U1O A;  1IEJ A;  3DP6 A;  1O63 A;  4QF9 A;  2ZYM A;  1IMA A;  3SEV A;  2RC9 A;  4YKK A;  3B6Q A;  4FJP A;  3CSB A;  2V25 A;  5I2N B;  1FPK A;  4EQ9 A;  3C32 A;  2KR0 A;  1I6A A;  2JJK A;  3TDJ A;  3MP6 A;  3FZV A;  4OET A;  2CZI A;  5FHM A;  1HSJ A;  4RYA A;  1B5J A;  1YPN A;  2ZXT A;  4PC9 A;  4OTE A;  4MNC A;  5CMB A;  4GWW A;  4EUO A;  5I58 B;  3PPP A;  3O2A A;  4GOT A;  5CMC A;  4G68 C;  1GTK A;  3KC0 A;  3OEL A;  1P1U A;  1SW1 A;  3QSL A;  3LUZ A;  4C1U A;  3N6U A;  4IO6 A;  3BKI B;  3Q28 A;  1IME A;  2Q2A A;  4X48 A;  4H5G A;  3IB0 A;  3M3K A;  4DXB A;  2P0S A;  3GBB A;  5L9S A;  1FBH A; 
#chains in the Genus database with same CATH homology
 3TOD A;  1B7Z A;  2NOO A;  1Y3Q A;  3RGY A;  3LUY A;  3EHU A;  4QSE A;  4XTC Q;  4LZ7 A;  1EU8 A;  4Q30 B;  5KCJ A;  2R9J A;  3MC2 A;  5I56 B;  3UOR A;  3KGC A;  1LBC A;  2X7Q A;  1NL5 A;  2QS4 A;  3MBP A;  2PYY A;  3DP8 A;  1Q35 A;  2VD3 A;  4FOR A;  4MH5 A;  3TEP A;  2Y7R A;  3V8X B;  1URS A;  5DVI A;  4YMB A;  1A99 A;  3EPE A;  3FXQ A;  4HCY A;  1MY2 A;  3G3H A;  2R71 A;  3RT6 B;  2P1S A;  1MM7 A;  1SDX A;  1NKX A;  4NTL A;  1DOT A;  1B3H A;  2F7A A;  1ZU0 A;  2O7U A;  1CB6 A;  4GF8 A;  3OSR A;  1QW0 A;  5H8F A;  2F36 A;  3WAE A;  2DWI A;  2NWJ A;  4EQ7 A;  4OER A;  3H06 B;  2VGQ A;  3A3C A;  2VD2 A;  1MQJ A;  2AYS A;  1XS5 A;  2LAO A;  2OBG A;  2THI A;  4NF5 B;  2V84 A;  4ZEI A;  3KG2 A;  1URD A;  2Q2C A;  2V3T A;  1XT8 A;  4WED A;  1ZLQ A;  2XXV A;  2AL5 A;  3G3I A;  3KOT A;  4HCW A;  3IOU A;  3K4U A;  3FXU A;  3IOV A;  4YKJ A;  4O3A A;  1HSL A;  2WKY A;  4XKR A;  1LB8 A;  4ZE8 A;  4R75 A;  3CI8 A;  4NMY A;  4DIG A;  2PMS A;  3PGF A;  3TCF A;  3DM0 A;  4HW8 A;  3V89 B;  4OFL A;  4O3C A;  5DVJ A;  4ESX A;  3KN8 A;  4ONY A;  1S50 A;  3TTM A;  3C31 A;  4H1X A;  3IAZ A;  2O68 A;  4JWO A;  4YKI A;  3CVG A;  2QS2 A;  1M5C A;  4YKP A;  1MXU A;  4F18 A;  3CR9 A;  5F7V A;  4OVJ A;  3A3U A;  1MQG A;  4ISU A;  4LVQ A;  1F9B A;  2F78 A;  3FD3 A;  4KCD A;  5B7D A;  1BP5 A;  1IXC A;  4IY6 A;  3SEY A;  3JV9 A;  5I59 B;  3RUM A;  4ELO A;  2G29 A;  2UVG A;  1N3X A;  4BDN A;  1N0T A;  3LSW A;  3K2D A;  3QUF A;  4F3G A;  4YB7 A;  3FAT A;  3FVG A;  4XXU A;  5KCJ B;  1MY1 A;  2XHD A;  5ICQ A;  4UAC A;  3KOS A;  4JSD A;  2E0S A;  2XX9 A;  2OJT A;  4POX A;  4IO3 A;  1II5 A;  4BDR A;  4RXL A;  2NUV A;  1MXZ A;  1MRP A;  3H7M A;  1FW0 A;  2DE2 A;  2Y84 A;  4PFT A;  4QFO A;  3SKP A;  2Y7W A;  1B51 A;  2RF1 A;  5TP9 A;  3KZG A;  1N04 A;  2F97 A;  1QVS A;  4YU0 A;  3ZS6 A;  3WAF A;  2HZK A;  4X1B A;  1UIU A;  1VSO A;  1VE4 A;  1URG A;  1H45 A;  1A8F A;  1LGB C;  2I58 A;  3S9L C;  2RCA A;  1OIB A;  1R1N A;  4GIZ A;  1Y1M A;  2W7Y A;  2UYF A;  3IOT A;  1A8E A;  4IO7 A;  5H8F B;  1MG1 A;  3FJG A;  4U21 A;  4HTG A;  4KCC A;  2XXR A;  1RYX A;  3CFX A;  2VP1 A;  3GXA A;  1I6B A;  4I62 A;  1NNT A;  2H99 A;  4KI0 E;  2VOZ A;  1EZO A;  4XKQ A;  1POY 1;  3K1N A;  1J1N A;  3K6V A;  5DVF A;  2RIN A;  3H4Z A;  3PD8 A;  3QAX A;  2G93 A;  1B1H A;  3M3L A;  1TFD A;  1MY4 A;  2Y7K A;  3IJX B;  3PUY E;  2ZYN A;  3UIF A;  1ELJ A;  4FIM A;  1P1O A;  3K6U A;  3G3G A;  3TCG A;  3U94 A;  1LAH E;  5CMK A;  4MF3 A;  1AL3 A;  3M3F A;  4NF8 A;  4AQ4 A;  1MY3 A;  2CMO A;  4RJZ A;  1YAE A;  4MLV A;  3SDF A;  2DVC A;  2A5S A;  4RPN A;  2DE3 A;  3TTN A;  3TQL A;  2I0C A;  1GGG A;  2ZYK A;  1Y3N A;  5DYH A;  3D4G A;  1FTK A;  3MZB A;  4OEV A;  5KZT A;  4OMB A;  4JWX A;  2I49 A;  4ZS9 A;  2QL3 A;  1HSE A;  3L6H A;  4KQP A;  3OEM A;  1IUD A;  3VVD A;  4M1V A;  2RKM A;  3T96 B;  1O64 A;  1IZ1 A;  3U72 A;  1S7Y A;  3VFJ A;  5JTY A;  1JEV A;  1PC3 A;  3I6V A;  4GVO A;  4JB7 A;  4ESW A;  2F35 A;  2OZZ A;  3Q29 A;  3PUV E;  2HXW A;  1SD3 A;  3H6U A;  5H8N B;  1QUK A;  3IX1 A;  2XXQ A;  1US5 A;  5L9O A;  2OK2 A;  2UVH A;  4ZE9 A;  2O6A A;  3N94 A;  2HAV A;  2OCU A;  3KN3 A;  3PPQ A;  1PBP A;  3USD A;  2CZL A;  4YB6 A;  5TPA A;  2BJJ X;  1B7H A;  1IIW A;  4IY5 A;  3K1P A;  1NNF A;  1XVY A;  1B9J A;  3O9P A;  4G8H A;  4PP0 A;  1A54 A;  4DLD A;  4IGT A;  3PPR A;  1L5T A;  4G68 A;  5TP9 B;  1NMU A;  4I1D A;  3FGS A;  3MVW A;  2OLB A;  3P7I A;  2X7P A;  3B6W A;  3ILU B;  3GBA A;  4P11 A;  3R6U A;  3RNN A;  3D4C A;  1IXH A;  4R9G A;  1JVY A;  4U4S A;  4DE8 A;  2FA7 A;  4DXC A;  4L17 A;  4U22 A;  3RT8 A;  2REJ A;  4AB5 A;  1LST A;  1A7L A;  2ZMB A;  3EQ1 A;  3SER A;  4H8J A;  2XXI A;  3UP9 A;  5I59 A;  1EZP A;  1LFI A;  2DS9 A;  3T9X B;  2Q8J A;  1TFA A;  3TTR A;  1JQF A;  2I3W A;  2PVU A;  2QJE A;  1M5E A;  3PUX E;  4E0W A;  1D9Y A;  2QS3 A;  2DWH A;  1H3D A;  4OQO A;  3G7W A;  4GLI A;  2D5W A;  4R73 A;  4JSO A;  3TMG A;  2B3F A;  4NF8 B;  4OEN A;  1MQI A;  4O3B A;  3I3V A;  3KFM A;  3H6W A;  2OWT A;  2KLF A;  2Z22 A;  5I84 A;  1MXV A;  1QKB A;  2A5T A;  1AOV A;  3TZA A;  1B32 A;  3VVF A;  4OEU A;  4Q8R A;  1FQD A;  1LCF A;  3E4R A;  4GRK A;  1PB8 A;  4IB2 A;  3E9X A;  3FXR A;  3BFU A;  1MPB A;  3T93 B;  2PBW A;  2O69 A;  2DSF A;  4QFL A;  5EYF A;  3K01 A;  4IO4 A;  1DTG A;  3IJO B;  3S4U A;  3PV0 E;  4Q0C A;  3HV1 A;  2DWA A;  3OOA A;  1UIV A;  4ND9 A;  1LFG A;  1SW4 A;  2Y7P A;  5JTY B;  5DTB A;  3H03 A;  2F8D A;  1B46 A;  3FUZ A;  5IAI A;  3PPO A;  3RTF B;  4ZZA A;  1OVB A;  2H4I A;  4KD5 A;  3O97 A;  4Z7E A;  3H6V A;  4KFQ A;  3EHT A;  2P2A A;  3MQ9 A;  1SYI A;  3RLF E;  4TOZ A;  2V3U A;  4F29 A;  3MVZ A;  1UTB B;  2IEE A;  5TPA B;  2AIX A;  1QUI A;  1YTV A;  3MP1 A;  1JEU A;  2H9B A;  4R6Y A;  2HEU A;  1ZIU A;  3VXC A;  2ONR A;  3MWB A;  3PUZ E;  5CM6 A;  2FYI A;  2QRY A;  1WVJ A;  1FCK A;  3O6I A;  4G68 B;  5ITO A;  1POT A;  4GWO A;  2UVJ A;  3ILT B;  3L6G A;  5FTH A;  3CRB A;  4U1Z A;  1ANF A;  4U23 A;  2B65 A;  1B40 A;  4NF4 A;  5FHO A;  1DPP A;  1I69 A;  4QRZ A;  1D3K A;  2DYX A;  3TCH A;  3K00 A;  1DTZ A;  3O6H A;  3ZKL A;  3T9V A;  2XXH A;  3FV1 A;  1P1Q A;  5BUU A;  3F11 A;  3B6T A;  4I8C A;  3IK6 B;  1Y1Z A;  5HM4 B;  4PE5 B;  4U4X A;  3LSX A;  1H44 A;  3OO8 A;  3G3K A;  3LBS A;  3IO4 A;  3FVN A;  1USY H;  5H8N A;  2O7I A;  3C35 A;  3B7D A;  3V5A A;  1UQW A;  2M8C A;  1N7W A;  1BIY A;  2NVU B;  1MS7 A;  4R6H A;  3LSF B;  3PD9 A;  4P0I A;  5I57 B;  1Y20 A;  3DEL B;  3OO9 A;  3FVO A;  4ZEK A;  4P0G A;  4BDL A;  4DDD A;  4G8N A;  4OWD A;  1IXG A;  2E1S A;  1WOD A;  4KR5 A;  3CFZ A;  1AH5 A;  3QXM A;  4FED A;  1JW4 A;  1FTM A;  1ZJL A;  5FTI A;  1M5D A;  1PB7 A;  1B7U A;  1MXW A;  2IA4 A;  3O28 A;  3IOW A;  3N6T A;  1GVC A;  3U93 A;  3MZ1 A;  2A5T B;  1MPD A;  3IB2 A;  2UYE A;  1BLF A;  4H6D A;  3MPL A;  4XKN A;  4BLA A;  4X9T A;  4H5F A;  3TYH A;  2RC8 A;  4RK9 A;  3TUS A;  1Y3P A;  4WKM A;  4U2R A;  4AB6 A;  2DVZ A;  5K2X A;  1H76 A;  4RK2 A;  4RA1 A;  3T9H B;  5CRY A;  2O51 A;  4TQU Q;  1B2H A;  5IKB A;  1SI0 A;  2PX1 A;  4EF2 A;  3O6G A;  3VLW A;  3VXB A;  2O84 X;  3QIM A;  3PU5 A;  5AA2 D;  4PET A;  1M5B A;  5HPQ A;  4LQ2 A;  4LON B;  1US4 A;  1I6Q A;  1MPC A;  1JVX A;  1SYH A;  4POW A;  1Y4C A;  3FIR A;  3E13 X;  4QHQ A;  4BDM A;  2RC7 A;  4NF6 A;  3U1O A;  4JBZ A;  3Q26 A;  2F6G A;  3UGW A;  4FEC A;  4X1D A;  3EHS A;  1UTH A;  3MZ9 A;  3MW0 A;  4LA9 A;  4H65 A;  2Z8D A;  2XD3 A;  4R9F A;  2Y7I A;  2ONS A;  2DWJ A;  4RNS A;  1SW5 A;  5L8D A;  1B58 A;  4C0R A;  4RY1 A;  3OXN A;  1SBP A;  1ZKB A;  1LAF E;  1VFE A;  3DLN A;  3K1M A;  1OQH A;  3PPN A;  4THI A;  5CC2 A;  1LBB A;  3QUJ A;  5I2K A;  5DEX A;  4LUB A;  4M4G A;  1DMB A;  5AA2 B;  4IGR A;  4GD5 A;  2ZNT A;  4LQ5 A;  5H8S A;  4F31 B;  1NNP A;  2I4B A;  2X26 A;  4NF4 B;  4EDP A;  4KHZ E;  1GV8 A;  3PUW E;  1FQC A;  5L9M A;  4GXA A;  3TAJ A;  3RTW B;  4RPO A;  2XXU A;  3DP4 A;  1FQA A;  5ITP A;  2F6P A;  1B3G A;  4OFO A;  3HN0 A;  4EQB A;  1AIV A;  4PFY A;  4NED A;  3S9E A;  5F1Q A;  1B3E A;  1LFH A;  1DSN A;  1JW5 A;  5A5X B;  5J1D A;  3TEL A;  1FTJ A;  2ABH A;  4E0X A;  3RY3 A;  4G4P A;  1OLA A;  1A55 A;  3SEX A;  1UTB A;  4LAT A;  1B4H A;  4PFW A;  2F7C A;  3N26 A;  3MVX A;  4YZZ A;  1GR2 A;  3BBR A;  5M2V A;  4UA8 A;  2ALU A;  4FAT A;  1B5I A;  1R9L A;  1OMP A;  2XX7 A;  4G2Z A;  4QFK A;  2H25 A;  2O1M A;  3S9M C;  2DQV A;  1LCT A;  2R6G E;  3IR1 A;  4BDQ A;  3FJM A;  3VE1 B;  1N84 A;  3VLU A;  3TFL A;  4R72 A;  2B3B A;  2QMX A;  4JWY A;  4JXI A;  3FVK A;  4F1U A;  1B05 A;  1P1W A;  1Y9U A;  1FTL A;  1EH3 A;  2OWS A;  1D4N A;  3KJT A;  3VLV A;  1XVX A;  1YCJ A;  5EHS A;  3MVY A;  2QS1 A;  3MAM A;  1RKM A;  4OFJ A;  3G3J A;  1PB9 A;  3TKD A;  4MBP A;  1OQG A;  5AA4 A;  4EXK A;  3QK6 A;  3W9V A;  1A40 A;  3VVE A;  4K3F A;  4KYS A;  3KBR A;  2ZNU A;  2Z8F A;  1QUL A;  4NE4 A;  2I3V A;  3V83 A;  2Q89 A;  1MM6 A;  4KYD A;  5I57 A;  5H8Q A;  1OVT A;  4FEB A;  2GHA A;  4NF6 B;  1B6H A;  4OXV A;  2I0B A;  1B1X A;  2H98 A;  2DOJ A;  1UTH B;  2GH9 A;  2ESN A;  4F39 A;  4OZ9 A;  1MXY A;  4YB5 A;  1MXX A;  1ATG A;  1MDP 1;  3GZG A;  4MLQ A;  3TQW A;  3KEI A;  1PDA A;  3KJ7 A;  3T22 A;  3CSG A;  1SW2 A;  4XKP A;  3CIJ A;  3SET A;  4QSC A;  5HBC A;  5I2K B;  5DEX B;  1RYO A;  1BTJ A;  3KN7 A;  4DCY A;  4ELQ A;  4KPT A;  5CBS A;  4QSD A;  3T9U A;  4Q5T A;  1NH8 A;  1IXI A;  1R9Q A;  3GLB A;  3CFL A;  3K6X A;  4ECF A;  1XOC A;  2I48 A;  3TTL A;  5TU0 A;  1P1N A;  4WXJ A;  4N13 A;  4YMA A;  2D3I A;  4QFP A;  4ZZE A;  3K6W A;  4YIC A;  4ZEB A;  3MJN A;  1BKA A;  1B5H A;  3N5L A;  2D21 A;  3UK4 A;  1Q1K A;  5H8H A;  3SEW A;  4BDO A;  3JZJ A;  5ELV A;  3HO7 A;  1PBQ A;  5KDT A;  2YLN A;  2REG A;  1NH7 A;  1S9T A;  3ONM A;  3C4M A;  4LP2 B;  1Y4T A;  4F19 A;  4GL8 A;  1SI1 A;  1KWH A;  2DP8 A;  4ZEF A;  2HZL A;  2ONK E;  1QUJ A;  4F3S A;  1MQH A;  3SEU A;  1LB9 A;  4F1V A;  2ZNS A;  1FQB A;  4OES A;  4ZDM A;  3Q25 A;  1P99 A;  5B70 A;  4OYV A;  4ZEC A;  3Q27 A;  4MFI A;  1LAG E;  3HCQ A;  2XX8 A;  1USY E;  4IO2 A;  3S2V A;  5AA2 A;  4C1T A;  3MPK A;  3OEK A;  4Z0I A;  3HHF A;  2RCB A;  3HPI A;  1T0K A;  4FAJ A;  1ZBM A;  5CBR A;  3RPW A;  2V93 A;  4R74 A;  4DCX A;  2UVI A;  3UA8 A;  3OEN A;  1TXF A;  1N3W A;  2DXR A;  5AA4 B;  4EF1 A;  3UN6 A;  3EF7 A;  1IQ7 A;  3PMX A;  4G77 A;  3HST A;  1VR5 A;  4R2F A;  2XXX A;  5A5X A;  2V3Q A;  3ZSF A;  3C36 A;  4LZ5 A;  1FQF A;  4KYE A;  1FQE A;  4ZED A;  2GFE A;  4NWC A;  1JNF A;  4FE8 A;  2Q9T A;  5H8Q B;  2I6E A;  2XD2 A;  3HHG A;  2YPN A;  3QYT A;  1LAX A;  3K0V A;  4F2Q A;  4TLM B;  1SQY A;  3W15 C;  1SVX B;  5AA3 A;  4WEP A;  4OHN A;  4H0W A;  4LZ8 A;  1JW1 A;  4F3P A;  3O66 A;  4G8M A;  4N07 A;  3PMV A;  1ZMG A;  5CI5 A;  5JEI A;  4JDF A;  1D9V A;  1Z7N E;  3IL1 B;  1B4Z A;  3CG3 A;  3R26 A;  1Z7M E;  3KSJ A;  4H8I A;  5I2N A;  3OMB A;  1CE2 A;  4XIG Q;  5BWJ A;  5K2Y A;  3ODB A;  4I9D A;  1LLS A;  1B0H A;  4IO5 A;  1TWY A;  2XXP A;  3EN3 A;  3MP8 A;  1XHY A;  1M5F A;  5I58 A;  1JET A;  3LC8 A;  4TLL B;  3TPA A;  3IB1 A;  3S9N C;  1NFT A;  4F22 A;  2ANJ A;  2PT1 A;  5CMM A;  5FHN A;  4PFU A;  3MUQ A;  5LOM A;  2VHA A;  3THI A;  3PMW A;  3SES A;  1TT1 A;  3VV5 A;  2DE4 A;  5DT6 A;  2HAU A;  2QSX A;  5H8H B;  2XXT A;  3BFT A;  2PT2 A;  1N76 A;  2I4C A;  4QFN A;  5KDT B;  4H67 A;  3C9H A;  4EXL A;  2XXW A;  3OO6 A;  3C34 A;  1QKA A;  5EHM A;  3R7X A;  3IO6 A;  2YJP A;  4R2B A;  4GFR A;  3C33 A;  1QJM A;  5I56 A;  1AMF A;  3U8Q A;  1B3F A;  2HFB A;  2UXA A;  4DZ1 A;  3U92 A;  4ELR A;  1MH4 A;  2ZYO A;  1FTO A;  1MDQ A;  1EZ9 A;  1VFD A;  4N6P A;  1NNK A;  5AA1 A;  1O7T A;  2AL4 A;  3LR1 A;  3VDF A;  3OD7 A;  4F3B A;  2F34 A;  3LSL A;  1DPE A;  2FNC A;  4ELP A;  3AXF A;  3OSQ A;  4NWD A;  1OLC A;  1MQD A;  2QPQ A;  2F5X A;  2QMW A;  3RQT A;  5ICT A;  3ZKK A;  3FJ7 A;  3OO7 A;  5ISU A;  2NXO A;  2XXY A;  2GRV A;  3H6T A;  3IOR A;  1MH3 A;  5AE4 A;  3K02 A;  3H3G A;  3TTK A;  4R6K A;  3CG1 A;  1B52 A;  1MY0 A;  1R6Z A;  2DXY A;  4DXU A;  2F7B A;  1ZTY A;  2GHB A;  2H5Y A;  2O1L A;  4F2O A;  3T66 A;  3G3F A;  3W9W A;  3RN8 A;  3E3K A;  4NF5 A;  3M8U A;  3A09 A;  4GQO A;  1PEB A;  2Z8E A;  2HCA A;  3FV2 A;  1B0L A;  2Q88 A;  2HQ0 A;  3KSX A;  1N7X A;  4PQJ A;  1XC1 A;  1IIT A;  4GXS B;  3I5O A;  3ECR A;  4GL0 A;  5JK4 A;  4F1Y A;  3FAS A;  4HS7 A;  1B3L A;  3O29 A;  4YAH X;  1H43 A;  1WDN A;  2Z23 A;  3JYR A;  4U1O A;  1IEJ A;  3DP6 A;  1O63 A;  4QF9 A;  2ZYM A;  3SEV A;  2RC9 A;  4YKK A;  3B6Q A;  4FJP A;  3CSB A;  2V25 A;  5I2N B;  4EQ9 A;  3C32 A;  1I6A A;  3TDJ A;  3MP6 A;  3FZV A;  4OET A;  5FHM A;  1HSJ A;  4RYA A;  1B5J A;  1YPN A;  2ZXT A;  4OTE A;  5CMB A;  4EUO A;  5I58 B;  3PPP A;  3O2A A;  4GOT A;  5CMC A;  4G68 C;  1GTK A;  3OEL A;  1P1U A;  1SW1 A;  3QSL A;  4C1U A;  3N6U A;  4IO6 A;  3BKI B;  3Q28 A;  2Q2A A;  4X48 A;  4H5G A;  3IB0 A;  3M3K A;  4DXB A;  2P0S A;  3GBB A;  5L9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...