3N6TA

Effector binding domain of tsar
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
205
Chain Sequence
b'GHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the effector binding domain of TsaR
rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 54
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6tA02
3FVGA 1B52A 4KPTA 5CRYA 4IO6A 1HSEA 4ELPA 2OK2A 3SETA 2ZXTA 4ZECA 1IITA 1B5IA 3TAJA 1BP5A 5B70A 1B51A 3O66A 4G68C 3KSJA 4HS7A 1SVXB 4NF5A 1Y4TA 2DOJA 4QFKA 1RYXA 4EQBA 4X1DA 4RPOA 5JTYB 1N0TA 1ZIUA 2H98A 1JW1A 3RUMA 3PUVE 5I2NA 3VVDA 4ZEIA 2DWIA 1QW0A 3TYHA 5I57A 3MZBA 1LFHA 2H99A 2F7BA 3U8QA 3LSFB 1FTMA 1MQJA 4YZZA 4LZ8A 1LB9A 4OZ9A 5ITPA 5CBSA 5AA2D 1FQBA 3KGCA 2V93A 4I9DA 1JEUA 5ELVA 1BLFA 3MVYA 3KJTA 4DXUA 3RN8A 2UYFA 1P1WA 3U1OA 1B2HA 5H8SA 4GXAA 3SEWA 2UVHA 1OMPA 1URDA 4I62A 4G68A 1B7UA 4C1TA 5AA3A 1A54A 5L9SA 4QFNA 3TELA 5HM4B 4BDNA 5I56A 3U72A 4GOTA 1Y1ZA 3A3CA 2PT1A 1B3HA 3K6WA 3OO7A 1QUJA 2RINA 1LBCA 1J1NA 1ATGA 1LCFA 2E0SA 1PB7A 3LUYA 1A8FA 3SEYA 2LAOA 4DCXA 3HSTA 2ABHA 4U1OA 3IOVA 1PDAA 4GF8A 3PU5A 3OENA 1OIBA 3KBRA 5H8NB 1SW2A 3IOWA 1PEBA 1P1QA 4XKPA 5KCJB 3HO7A 1LSTA 3SEUA 5DT6A 4MF3A 3CFZA 4IB2A 3CSGA 3B6WA 2B3BA 3B7DA 3CR9A 1DPEA 1NKXA 3U92A 3RTWB 1B5HA 3PD9A 2Y7WA 2ZNSA 2DXRA 3FV2A 1M5EA 2CMOA 2XXYA 1LGBC 1MXYA 4KYSA 3RY3A 3TKDA 4U2RA 2THIA 2ZMBA 2Y84A 1N84A 1FTJA 3EHTA 1UTBA 1GVCA 5B7DA 2RKMA 3H06B 3UN6A 4N6PA 1OQHA 2DSFA 5CI5A 2ZNTA 2YPNA 4P0IA 3IOUA 4XXUA 1HSLA 3OSRA 1Y4CA 3KN8A 1RKMA 4OFOA 2PX1A 4E0XA 3K01A 4GVOA 4KQPA 2YLNA 4F29A 5H8FA 3H7MA 3QXMA 3PPNA 1P1OA 5ICTA 1TFDA 4F3SA 1NNTA 3IAZA 5H8QB 3VE1B 4MLVA 1ZMGA 4TQUQ 1DTGA 1MXVA 3A3UA 4ZS9A 3PUXE 3SKPA 1Z7NE 3RT6B 2AYSA 4RNSA 1B0HA 3LSLA 2NOOA 1BIYA 3Q28A 1XVXA 1I69A 2XHDA 4ZDMA 2VD3A 3E3KA 3PGFA 4IGRA 4AB5A 3R26A 2O6AA 1DSNA 3MC2A 2P2AA 5JTYA 1VSOA 2DVZA 3MZ1A 2XXIA 3MP8A 1B0LA 2AL4A 4N07A 2Z8EA 3FJGA 2RCBA 1EZPA 2AIXA 4KD5A 3T9HB 4H0WA 4GRKA 3FXUA 4ONYA 2O69A 3N26A 5AE4A 4F3PA 1OLAA 3H6VA 4DCYA 2VGQA 2PMSA 3O6IA 1SW1A 2ONKE 4EF2A 1R9QA 2XXXA 3S9NC 3HV1A 3MPKA 4YKIA 4PETA 4YAHX 4WEPA 3K4UA 4Z0IA 2XX7A 4H8IA 4LQ5A 2DWHA 1TT1A 1UIUA 2Q8JA 3KOSA 1JVYA 1SYIA 3ECRA 4DE8A 3K6UA 1NNFA 1S50A 2DE3A 3SEXA 4ZZEA 3RT8A 3TEPA 3LSWA 4JB7A 1Y3QA 1US4A 5CBRA 5FHOA 1B3EA 3FUZA 2XXQA 2RC9A 3H6UA 2DS9A 3ZKLA 3T9VA 4PFWA 1MXZA 3PUWE 3VLVA 5ISUA 2F7AA 5LOMA 2B3FA 3ODBA 4KCDA 3ZKKA 4FORA 1Q35A 4HCWA 3H6TA 4EUOA 5CMKA 1A7LA 4OEUA 4JWYA 1R6ZA 4XTCQ 3C9HA 5H8NA 4K3FA 3TTRA 2Y7KA 3I6VA 3ONMA 1XHYA 5I59B 4DZ1A 4G8MA 1A99A 1L5TA 5BWJA 3MW0A 4U1ZA 3G3KA 5IAIA 1OVTA 2HAVA 1KWHA 3KEIA 1MY3A 5F1QA 3K2DA 4EXLA 4RJZA 3R6UA 3FATA 3HHGA 3PPOA 1N3XA 1P1NA 1AOVA 3G7WA 2Q89A 3QAXA 1M5BA 2Y7IA 1B46A 1R1NA 1MXXA 3PUYE 3M3FA 1RYOA 3UIFA 5TP9B 2PVUA 4YB6A 1O63A 1SYHA 4NWCA 2HEUA 4BDQA 4F18A 4KFQA 3KSXA 1TXFA 3P7IA 5J1DA 1AL3A 3ZS6A 2I4CA 2YJPA 2F8DA 4ZEBA 1EH3A 1MQGA 5CMMA 2UXAA 3IX1A 3DM0A 1LFIA 4M4GA 4R74A 4JBZA 2I4BA 2H25A 2O1MA 2PT2A 1DMBA 3CVGA 3UORA 4QRZA 4G8HA 1POTA 2O7UA 3S9MC 2FYIA 3TCGA 4QFLA 4DDDA 2ZYNA 2OBGA 3SERA 3OO6A 4M1VA 4F1VA 1USYE 2R71A 2XD2A 3CG1A 1T0KA 3MUQA 1ANFA 3Q29A 5EHSA 3KN3A 3TQLA 3T66A 1CE2A 5AA4B 5H8QA 2QS3A 2GHBA 4G2ZA 1DOTA 2AL5A 4FECA 1MM7A 1IIWA 1P1UA 3S9LC 2REJA 1QUIA 4HTGA 1H45A 3PPQA 3W9WA 4POWA 3KFMA 1MY0A 3CSBA 4R75A 1A40A 3E9XA 4F19A 4LZ7A 4XKRA 3O6GA 1LAFE 4YB7A 1DPPA 2RC8A 4QSEA 4FATA 3R7XA 1B40A 4N13A 3LSXA 4RY1A 3K0VA 3L6HA 4NWDA 2XXVA 4IO4A 1URSA 2P0SA 4BDOA 1D9YA 3WAEA 4H5GA 1N04A 3VLUA 4FE8A 4OEVA 3HHFA 3SDFA 1JVXA 1H3DA 1SD3A 1MQDA 2NWJA 2X26A 3G3FA 5CMBA 4WXJA 1IXGA 5CC2A 1LBBA 1PBPA 2Y7PA 3OMBA 4JDFA 3MVWA 2DXYA 1QVSA 4F1UA 3BBRA 2V3UA 1UQWA 3Q27A 1XC1A 1LAGE 1D4NA 2UYEA 4NTLA 1YAEA 2HQ0A 4U22A 4QSDA 4OWDA 3RGYA 1JETA 4GLIA 2HAUA 4XKNA 1Y20A 1NH7A 2F36A 3EF7A 1B7ZA 3TMGA 5I59A 4ND9A 1PB8A 4NF8B 3K6XA 3EHSA 4PQJA 4DXCA 3V89B 1B32A 3IOTA 1OQGA 3TTLA 2XXRA 2OWSA 1GR2A 2QSXA 2I58A 2I0BA 3G3HA 4RYAA 1FQDA 1Y1MA 1XOCA 1FTKA 1LAXA 5AA1A 1MY1A 3MBPA 4IGTA 2OZZA 3IB1A 5TP9A 4X1BA 2GRVA 2RC7A 2OWTA 3MZ9A 4GXSB 5L9OA 3H6WA 1JEVA 1FQAA 1VFDA 1Y9UA 1B3GA 3FJMA 3RPWA 1H43A 2O7IA 1MH3A 3Q26A 2DE2A 1H44A 1EZOA 3D4CA 1NNKA 4YICA 3PMVA 3HCQA 3FV1A 3T96B 3E4RA 1LFGA 3KG2A 3ILTB 1Y3NA 1US5A 1PBQA 4GFRA 4YKKA 2QL3A 4G77A 5L8DA 5AA4A 1CB6A 5K2XA 1A55A 4OERA 2V3QA 1Z7ME 2O68A 2Z8DA 2W7YA 4OENA 4P11A 3TDJA 2M8CA 4JWXA 2XXWA 1TFAA 3O97A 4FAJA 5FHNA 3O29A 4GL8A 1FCKA 2UVGA 3IJOB 2OCUA 4KHZE 4LATA 4OETA 3K00A 3THIA 4Q8RA 3OELA 5I2KB 5H8HB 2V25A 1O7TA 3H03A 4R6YA 2D3IA 3FJ7A 5DYHA 2HZKA 3IL1B 3IB2A 3LC8A 4KYEA 2D21A 3QK6A 4F3BA 3OO9A 3OO8A 1VR5A 2GHAA 2RF1A 3OD7A 3GBBA 4MH5A 4KI0E 2PBWA 4U4SA 3T22A 4PFTA 4IY5A 4ZEDA 3SEVA 4H1XA 5K2YA 2I6EA 1IEJA 4MLQA 3RQTA 4THIA 4ESXA 2F34A 1UTHB 4EQ9A 3IR1A 1UIVA 4RA1A 4BDMA 4LZ5A 4JWOA 4PP0A 1DTZA 1MDP1 2F78A 3I3VA 2V3TA 4FEDA 4XIGQ 3CRBA 3C34A 3PPRA 1MM6A 2I3WA 3UK4A 5ICQA 1M5CA 1WODA 1ZTYA 1ZU0A 1JW4A 2HFBA 3A09A 3MP6A 1N76A 2XD3A 4IY6A 4AQ4A 1BTJA 3IK6B 4YKJA 1NMUA 4R6HA 3MAMA 2OJTA 5AA2B 4OFLA 5KCJA 2HXWA 2R6GE 4NF4B 2QS1A 1IUDA 3W9VA 3MWBA 3TTMA 5A5XB 4NF8A 5JEIA 3AXFA 4IO5A 1B6HA 1SDXA 4RK2A 1XVYA 3N6UA 3G3JA 3C4MA 2X7QA 5KZTA 1B4HA 1MY4A 1NH8A 1SI0A 2OLBA 4LUBA 5F7VA 4ZE9A 3T93B 2I49A 4Q5TA 2ZYOA 2VD2A 1P99A 4FJPA 3OSQA 1ZKBA 4GL0A 4WEDA 4AB6A 5FHMA 4O3BA 2VOZA 3WAFA 4Q30B 4GQOA 3QUFA 1Y3PA 5KDTB 1H76A 2QPQA 1EU8A 2QMXA 2A5TB 1B1HA 1N7XA 3PUZE 5TPAB 4QFOA 2ONRA 4OQOA 3GZGA 3T9XB 3CG3A 1MH4A 3E13X 1XT8A 1MXWA 4ELOA 3QUJA 3HN0A 1EZ9A 3VVEA 4ZZAA 1SI1A 1M5FA 4R6KA 2QRYA 3QYTA 2XXPA 4R72A 1JNFA 1LCTA 1SW5A 2QJEA 4POXA 3MVZA 3IB0A 1QKAA 4F39A 3S2VA 1QULA 3RLFE 3SESA 2ALUA 1II5A 2HZLA 1USYH 4ZEFA 5CM6A 4HCYA 3CFLA 2XXUA 2NXOA 4PFUA 3FVKA 3I5OA 2O51A 2Y7RA 1YCJA 4YKPA 3TUSA 4DIGA 4C0RA 3FIRA 2I48A 4PE5B 4X48A 1VFEA 4Z7EA 3JZJA 3IO4A 2DWAA 4ECFA 2O1LA 3MVXA 1MY2A 4NF6B 3V5AA 2F7CA 3JV9A 5I2KA 5H8HA 1URGA 1F9BA 1MPBA 4H65A 4BDLA 1Q1KA 4PFYA 4KYDA 1AIVA 3N5LA 2A5SA 4TOZA 2ZNUA 3GBAA 5FTHA 4MBPA 2DYXA 5FTIA 4LONB 3DP4A 3K1NA 2PYYA 2KLFA 4BDRA 3KJ7A 1QJMA 1MXUA 3N6TA 3PMXA 3TFLA 1UTHA 3MP1A 1IXIA 4H6DA 5M2VA 4F31B 4GIZA 1MG1A 3IORA 1FQFA 1XS5A 4R9FA 3V8XB 1ELJA 4IO2A 1M5DA 3TTKA 4F22A 4RXLA 3BFTA 1IQ7A 2I3VA 3MPLA 4Q0CA 3S9EA 1S7YA 2XXHA 4TLMB 4YMAA 4H8JA 3DLNA 2Z8FA 1LLSA 5EYFA 3EN3A 1B7HA 4OMBA 1PC3A 3PV0E 3FXRA 4EQ7A 4JSOA 5AA2A 1WVJA 4LP2B 1I6QA 4G4PA 5I58B 4F2QA 3OEKA 4ELQA 1ZBMA 2XXTA 4IO3A 1D9VA 4NF4A 3JYRA 4F1YA 4ZE8A 4X9TA 1B3FA 3L6GA 4EF1A 5A5XA 2FA7A 1IXHA 3CIJA 3V83A 4IO7A 2Q2CA 1I6AA 2G93A 3C36A 5I84A 5IKBA 3KN7A 1IZ1A 3QIMA 4C1UA 3BFUA 3TCFA 5ITOA 3K6VA 4E0WA 1OVBA 1LB8A 3DP6A 1FTOA 5DEXB 1ZJLA 4H5FA 3M3LA 1LAHE 4YMBA 3KOTA 3Q25A 3TODA 2Q2AA 3KZGA 4I8CA 2DP8A 3BKIB 4JSDA 4LVQA 2X7PA 1GGGA 1ZLQA 4FIMA 4U21A 1FW0A 3IJXB 4U4XA 4QSCA 3PMWA 5KDTA 1A8EA 2QS4A 4UA8A 1JQFA 2Q88A 2A5TA 1N7WA 4EDPA 2ESNA 4R9GA 4OTEA 5TPAA 4OESA 1MQIA 3U94A 2Z22A 2D5WA 3H4ZA 1NFTA 4KCCA 5HBCA 4JXIA 2H4IA 3FASA 4QHQA 1NL5A 3C35A 1R9LA 3DELB 1MQHA 2E1SA 4QF9A 5CMCA 2O84X 1PB9A 1FQEA 5HPQA 4GD5A 2QS2A 3OEMA 4O3CA 3OXNA 3TPAA 3RTFB 1JW5A 2QMWA 3C33A 4R2FA 3K1PA 4NF5B 4YB5A 2FNCA 3O2AA 4NMYA 4LA9A 1O64A 4F2OA 3EPEA 2F97A 1TWYA 3DP8A 1MDQA 4XKQA 3C32A 1IXCA 5I2NB 2GFEA 3B6TA 2Z23A 1SQYA 2ANJA 1FTLA 3CFXA 3G3IA 4GWOA 4KR5A 3FXQA 3HPIA 4RK9A 3TCHA 3LR1A 5I57B 3PD8A 1POY1 4NEDA 4WKMA 4NF6A 2NVUB 3N94A 4NE4A 2H5YA 2RCAA 3ZSFA 1BKAA 2DE4A 3VXCA 4ESWA 2ZYKA 2R9JA 1AH5A 1B5JA 4OYVA 2VHAA 4BLAA 3VLWA 1NNPA 3IO6A 3TQWA 3VVFA 3VXBA 2B65A 3GLBA 3FVOA 2CZLA 1S9TA 3RNNA 2REGA 4OFJA 3M8UA 2F6GA 2XX9A 3B6QA 1QUKA 1B3LA 5BUUA 4G68B 1WDNA 2DWJA 1AMFA 3D4GA 1MS7A 1QKBA 4TLLB 1FQCA 4ISUA 2IEEA 2F35A 3MJNA 5I56B 1MPCA 4DXBA 2Q9TA 1B1XA 1B9JA 1N3WA 2ONSA 1HSJA 3QSLA 1YTVA 4EXKA 5DVIA 4DLDA 3K1MA 2UVJA 3S4UA 3CI8A 3O28A 4U23A 4O3AA 4RPNA 4P0GA 1B05A 2XX8A 3C31A 3T9UA 4YU0A 3ILUB 1GTKA 5L9MA 4FEBA 3TTNA 3O9PA 2V84A 5EHMA 3G3GA 4L17A 3K02A 1B58A 1SW4A 1B4ZA 3F11A 1SBPA 4F3GA 5I58A 2F5XA 3EQ1A 4H67A 3UGWA 1D3KA 3UP9A 2ZYMA 3PPPA 2IA4A 5DVFA 3VV5A 3LBSA 2UVIA 3UA8A 2DQVA 3OOAA 4I1DA 4LQ2A 2VP1A 5DTBA 4ZEKA 3FZVA 2NUVA 1MPDA 2HCAA 5DEXA 3W15C 4MFIA 4OXVA 4UACA 4ELRA 3O6HA 3FVNA 4OHNA 3FD3A 2H9BA 2F6PA 2G29A 3TZAA 1UTBB 4R73A 1OLCA 1GV8A 5TU0A 2P1SA 2BJJX 2GH9A 1MRPA 2WKYA 4HW8A 4OVJA 4R2BA 3VDFA 1I6BA 3MQ9A 1VE4A 2I0CA 1YPNA 3USDA 5JK4A 3EHUA 3U93A 2DVCA 3H3GA 3GXAA 4G8NA 4QFPA 3M3KA 5DVJA 3FGSA 3VFJA 5H8FB
chains in the Genus database with same CATH superfamily
3FVGA 1B52A 4KPTA 4PCDA 5CRYA 4IO6A 1HSEA 4ELPA 4HE2A 2OK2A 3ROJA 3SETA 2ZXTA 3RPLA 4PF8A 4ZECA 1IITA 1B5IA 3TAJA 1BP5A 5B70A 1B51A 3O66A 4G68C 1NV0A 3KSJA 4HS7A 1NUXA 4P3LA 1SVXB 5J16A 4NF5A 1Y4TA 2DOJA 1FTAA 4QFKA 1RYXA 4EQBA 4X1DA 4RPOA 1FBPA 2PFZA 5JTYB 1N0TA 1ZIUA 2H98A 1JW1A 3RUMA 3PUVE 5I2NA 3VVDA 2ZZXA 4ZEIA 2DWIA 1QW0A 4MIJA 2HPGA 3TYHA 5I57A 3MZBA 1LFHA 2H99A 1FPIA 2F7BA 3U8QA 4MEVA 1DK4A 3LSFB 1FTMA 1MQJA 4YZZA 4LZ8A 1LB9A 4GWUA 4OZ9A 5ITPA 5CBSA 5AA2D 1FQBA 3KGCA 2V93A 4I9DA 4MJOA 1JEUA 1BLFA 5ELVA 3MVYA 5IM2A 3KJTA 4DXUA 3RN8A 2UYFA 1P1WA 2WYPA 3U1OA 1B2HA 5H8SA 4GXAA 3SEWA 2UVHA 1OMPA 1URDA 4I62A 4G68A 1FPEA 1B7UA 4C1TA 5AA3A 1A54A 5L9SA 4QFNA 3TELA 2FIXA 1FPFA 5HM4B 4BDNA 5I56A 3U72A 4GOTA 1Y1ZA 3A3CA 2PT1A 1B3HA 1IMFA 3K6WA 3OO7A 1QUJA 2RINA 1LBCA 1J1NA 1ATGA 1LCFA 2E0SA 1PB7A 3LUYA 4JVDA 3LV0A 2V4CA 1A8FA 3SEYA 2LAOA 4HE1A 4DCXA 3HSTA 4GWSA 2ABHA 4U1OA 3IOVA 1PDAA 4GF8A 3PU5A 3OENA 1OIBA 3KBRA 5H8NB 1SW2A 3IOWA 1PEBA 4XFEA 1P1QA 4XKPA 5KCJB 3HO7A 1LSTA 5EQAA 3SEUA 5DT6A 1IMEA 1RDXA 4MF3A 3CFZA 4IB2A 3CSGA 1FPBA 3B6WA 2B3BA 3B7DA 3CR9A 1DPEA 1NKXA 1FPKA 3U92A 3RTWB 1B5HA 3PD9A 1NUYA 2Y7WA 2ZNSA 2DXRA 3FV2A 1M5EA 2CMOA 2XXYA 1LGBC 1MXYA 4KYSA 3RY3A 3TKDA 4U2RA 2THIA 5IZ3A 2ZMBA 2Y84A 4NQ8A 1N84A 1FTJA 3EHTA 1UTBA 1GVCA 5B7DA 2RKMA 3H06B 3UN6A 4N6PA 1OQHA 2DSFA 5CI5A 4P9KA 2ZNTA 2YPNA 4P0IA 3IOUA 4XXUA 1HSLA 3OSRA 1Y4CA 3KN8A 1FSAA 2OWZA 1RKMA 4OFOA 2PX1A 4E0XA 3K01A 4GVOA 4KQPA 2YLNA 4F29A 4JVCA 5I7IA 5H8FA 3H7MA 3QXMA 3PPNA 1P1OA 5ICTA 1TFDA 4F3SA 1NNTA 2DDKA 1EYIA 3IAZA 5H8QB 5I5PA 3VE1B 4MLVA 1ZMGA 4TQUQ 1DTGA 4MAGA 1MXVA 3A3UA 4ZS9A 3PUXE 3SKPA 3FXBA 1Z7NE 3RT6B 2AYSA 4RNSA 1B0HA 3LSLA 2NOOA 3IFCA 4GWYA 1BIYA 3Q28A 1XVXA 2QFLA 1I69A 2XHDA 4ZDMA 2VD3A 4MNIA 4MMPA 3E3KA 3PGFA 4IGRA 4AB5A 4PFRA 3R26A 2O6AA 1DSNA 3MC2A 2P2AA 5JTYA 1VSOA 1IMAA 2DVZA 3MZ1A 2XXIA 4NX1A 3MP8A 1B0LA 2AL4A 4N07A 2Z8EA 3FJGA 2RCBA 1EZPA 2AIXA 4KD5A 3T9HB 4H0WA 4GRKA 3FXUA 4ONYA 2O69A 2F3BA 3N26A 5AE4A 4F3PA 1OLAA 3H6VA 4DCYA 2VGQA 2PMSA 3O6IA 1SW1A 2ONKE 4EF2A 1R9QA 2XXXA 3S9NC 1G0IA 3HV1A 3MPKA 4YKIA 4PETA 4YAHX 4WEPA 3K4UA 4Z0IA 2XX7A 4H8IA 4LQ5A 2DWHA 1TT1A 1UIUA 2Q8JA 3KOSA 1JVYA 1SYIA 2PCRA 3ECRA 4DE8A 4GBWA 3K6UA 1NNFA 1S50A 2DE3A 3SEXA 4ZZEA 3RT8A 4N4UA 3TEPA 3LSWA 4JB7A 1Y3QA 5EQ7A 1US4A 3E78A 5CBRA 5FHOA 1B3EA 1K9ZA 3FUZA 2XXQA 4PBHA 2RC9A 1EYJA 3H6UA 2DS9A 3ZKLA 4N6DA 3T9VA 1KZ8A 4PFWA 1MXZA 3PUWE 3VLVA 5ISUA 2F7AA 5LOMA 2HHMA 2B3FA 3ODBA 4KCDA 3ZKKA 4FORA 1Q35A 4HCWA 3H6TA 4EUOA 5CMKA 1A7LA 4OEUA 4JWYA 1NV5A 1R6ZA 4XTCQ 3C9HA 1RDYA 5H8NA 4K3FA 3TTRA 2Y7KA 4HXVA 4QXDA 3I6VA 3ONMA 1LBXA 1XHYA 5I59B 4DZ1A 4G8MA 1A99A 2ZZVA 1L5TA 5BWJA 3MW0A 4U1ZA 3G3KA 5IAIA 1OVTA 2HAVA 1KWHA 3KEIA 4P47A 1MY3A 5F1QA 3K2DA 4EXLA 4RJZA 3R6UA 1NV6A 4MX6A 3FATA 4NGUA 4PBQA 3HHGA 3PPOA 1N3XA 1P1NA 1AOVA 1SPIA 3G7WA 2Q89A 3QAXA 1M5BA 2Y7IA 1B46A 1R1NA 1MXXA 3PUYE 3M3FA 1RYOA 3UIFA 5TP9B 2PVUA 4YB6A 4O8MA 1O63A 1SYHA 4NWCA 2HEUA 4BDQA 4F18A 4KFQA 3KSXA 1TXFA 3P7IA 5J1DA 2QVRA 1AL3A 3ZS6A 2I4CA 2YJPA 2F8DA 4ZEBA 1EH3A 1MQGA 5CMMA 2UXAA 3IX1A 3DM0A 1LFIA 4M4GA 4R74A 4JBZA 2I4BA 1LBZA 2H25A 2O1MA 2PT2A 1DMBA 3CVGA 3UORA 4QRZA 1FPDA 4G8HA 1POTA 2O7UA 3S9MC 2FYIA 2FIEA 3TCGA 4QFLA 4DDDA 2ZYNA 2OBGA 3SERA 3OO6A 4M1VA 4F1VA 4N15A 4IR8A 1USYE 2R71A 2XD2A 3CG1A 1T0KA 2QVVA 3MUQA 1ANFA 3Q29A 3IFAA 5EHSA 3KN3A 3TQLA 3T66A 1CE2A 5AA4B 5H8QA 2QS3A 4GWWA 3KC1A 2GHBA 4G2ZA 1DOTA 2AL5A 4FECA 1IMCA 1MM7A 1IIWA 1P1UA 5A5LA 3S9LC 2REJA 1IMBA 1QUIA 4HTGA 1H45A 3PPQA 3W9WA 4POWA 3KFMA 1MY0A 3CSBA 4R75A 1A40A 3E9XA 3CHGA 1NV1A 2Y5KA 4F19A 4LZ7A 4XKRA 3O6GA 1LAFE 4YB7A 5I3SA 1DPPA 2RC8A 4QSEA 4FATA 4AS4A 3R7XA 1B40A 4N13A 3LSXA 4RY1A 3K0VA 3L6HA 4NWDA 2XXVA 4XF5A 4IO4A 1URSA 2P0SA 4BDOA 1D9YA 3WAEA 4H5GA 5ET8A 1N04A 3VLUA 4FE8A 4OEVA 4PDDA 3HHFA 3SDFA 1JVXA 3MYUA 1H3DA 1SD3A 1FBHA 1MQDA 2NWJA 5ET6A 2X26A 3G3FA 5CMBA 4WXJA 1IXGA 3T0JA 5CC2A 1LBBA 1PBPA 2Y7PA 3OMBA 4JDFA 3MVWA 2DXYA 1QVSA 4F1UA 3BBRA 2CZIA 2V3UA 4PAFA 2VPNA 1UQWA 1Q9DA 3Q27A 1XC1A 1LAGE 1D4NA 2UYEA 3GYYA 4NTLA 4PTKA 4P1LA 1YAEA 2HQ0A 4U22A 4QSDA 4OWDA 3RGYA 1JETA 4GLIA 1NV3A 2HAUA 4N6KA 4XKNA 1Y20A 1NH7A 2F36A 3ISPA 2B4LA 3EF7A 1B7ZA 3TMGA 5I59A 4ND9A 4N81A 4NN3A 1PB8A 1QGXA 4NF8B 3K6XA 3EHSA 4PQJA 4DXCA 3V89B 3PTYA 1B32A 3IOTA 1OQGA 3TTLA 4O94A 2XXRA 2OWSA 1GR2A 1LBWA 2QSXA 2I58A 2I0BA 3G3HA 4RYAA 4GX4A 5IGAA 1FQDA 1Y1MA 1XOCA 1FTKA 1LAXA 5AA1A 1MY1A 3MBPA 4IGTA 2OZZA 3IB1A 1NV4A 1VDWA 5TP9A 4X1BA 3MSTA 5ET5A 2GRVA 2RC7A 1RDZA 2OWTA 3MZ9A 4GXSB 5L9OA 3B8BA 2GQ1A 3H6WA 1JEVA 1FQAA 1FPLA 1VFDA 1Y9UA 1B3GA 3FJMA 3RPWA 1H43A 4H46A 2O7IA 5EQ8A 1G0HA 2KR0A 1MH3A 3Q26A 2DE2A 1H44A 1EZOA 4GBVA 3D4CA 1NNKA 4YICA 3PMVA 3HCQA 4HE0A 3FV1A 3T96B 2B4MA 3E4RA 1LFGA 3KG2A 1DBZA 3ILTB 4DI3D 1Y3NA 1US5A 1PBQA 4GFRA 4YKKA 2QL3A 4G77A 5L8DA 5AA4A 4I40A 1CB6A 5K2XA 1A55A 4OERA 2V3QA 1Z7ME 2O68A 2Z8DA 2W7YA 4MCOA 4OENA 4P11A 3TDJA 2M8CA 4JWXA 4OVSA 2XXWA 1BK4A 1TFAA 3O97A 4FAJA 5FHNA 3O29A 4GL8A 1FCKA 2UVGA 3IJOB 2OCUA 4KHZE 4LATA 4LN5A 4OETA 3K00A 4NG7A 3THIA 4Q8RA 3OELA 5I2KB 5H8HB 2V25A 1O7TA 3H03A 3A29A 1AWBA 2D3IA 4R6YA 3FJ7A 2WEFA 5DYHA 4GX3A 2HZKA 3IL1B 3IB2A 3LC8A 4KYEA 2D21A 4PF6A 3QK6A 4F3BA 3OO9A 1K9YA 3OO8A 1VR5A 2GHAA 2JJKA 2RF1A 3OD7A 3GBBA 4MH5A 4KI0E 2PBWA 4U4SA 3T22A 4PFTA 4IY5A 4ZEDA 3SEVA 4H1XA 5K2YA 2I6EA 1IEJA 4MLQA 4N8GA 3RQTA 4THIA 4ESXA 2F34A 1UTHB 4EQ9A 3IR1A 2CZHA 1UIVA 4RA1A 2F3DA 4BDMA 3D1RA 4LZ5A 4JWOA 4PP0A 1DTZA 1MDP1 2F78A 5EQ9A 3KC0A 3I3VA 2V3TA 4FEDA 4P1EA 4XIGQ 3CRBA 3C34A 3PPRA 1MM6A 4GX6A 2I3WA 3UK4A 5ICQA 1M5CA 1LBYA 1WODA 1ZTYA 1ZU0A 1JW4A 2HFBA 3A09A 1DCUA 3MP6A 5EYGA 1N76A 2XD3A 4IY6A 4XEQA 1XI6A 1BTJA 4AQ4A 1FRPA 3IK6B 4YKJA 1NMUA 5IZ1A 1FBGA 4R6HA 3MAMA 2OJTA 5AA2B 2PFYA 4OFLA 1FPGA 5KCJA 2HXWA 2R6GE 4UABA 4NF4B 2QS1A 1IUDA 2Q8MA 3W9VA 3MWBA 3TTMA 5A5XB 4NF8A 4DI4B 5JEIA 2WYKA 3AXFA 2VT5A 4IO5A 1B6HA 1SDXA 4RK2A 1XVYA 3N6UA 3G3JA 3C4MA 2X7QA 4GWXA 3U65A 5KZTA 1B4HA 1MY4A 1NH8A 1SI0A 2OLBA 4LUBA 5F7VA 4ZE9A 3T93B 2I49A 4FBPA 4Q5TA 2ZYOA 2VD2A 1P99A 4FJPA 3OSQA 1ZKBA 4GL0A 4WEDA 4AB6A 5FHMA 4NHBA 4O3BA 2VOZA 3WAFA 4Q30B 2QVUA 1YXIA 4GQOA 2BJIA 3QUFA 1Y3PA 5KDTB 1H76A 4N91A 2QPQA 1EU8A 2QMXA 2A5TB 1B1HA 2OX3A 1N7XA 3PUZE 5TPAB 4QFOA 2ONRA 4OVQA 1FBFA 4OQOA 3GZGA 3LUZA 2ZZWA 3T9XB 3CG3A 1MH4A 2XA5A 3E13X 1XT8A 1MXWA 4ELOA 3QUJA 3HN0A 1EZ9A 1KA1A 3VVEA 4ZZAA 1SI1A 1M5FA 4R6KA 2QRYA 3QYTA 5DW8A 2XXPA 4R72A 1NUWA 1JNFA 3EKIA 1LCTA 1SW5A 2QJEA 4POXA 3MVZA 3IB0A 1QKAA 4F39A 3S2VA 1QULA 3RLFE 4N17A 3SESA 2ALUA 1II5A 2CZKA 2HZLA 1USYH 4ZEFA 5CM6A 4HCYA 3CFLA 2XXUA 2Y5LA 2NXOA 4PFUA 5F24A 3FVKA 3I5OA 2FVZA 2O51A 2Y7RA 1YCJA 4YKPA 3TUSA 4DIGA 4QBAA 4MNPA 4C0RA 3FIRA 2I48A 4PE5B 4X48A 1VFEA 4Z7EA 3JZJA 3FBPA 3IO4A 2DWAA 4ECFA 2O1LA 3MVXA 1MY2A 4NF6B 4OANA 2FHYA 3V5AA 2F7CA 3JV9A 5I2KA 5H8HA 1URGA 1F9BA 1MPBA 4H65A 4X8RA 4BDLA 4I3YA 1Q1KA 4PFYA 4KYDA 1AIVA 3N5LA 2A5SA 1LEVA 4TOZA 2ZNUA 3GBAA 5FTHA 4MBPA 2DYXA 5FTIA 4LONB 3DP4A 3K1NA 2PYYA 2KLFA 4BDRA 3KJ7A 2CEYA 1QJMA 1MXUA 3N6TA 4PDHA 3PMXA 3TFLA 1UTHA 1YYZA 3BIHA 3MP1A 1IXIA 4H6DA 1NV2A 5M2VA 4F31B 4GIZA 1MG1A 3IORA 1FQFA 1XS5A 4R9FA 3V8XB 1ELJA 4IO2A 1M5DA 4MHFA 5ESYA 4OVPA 3TTKA 4F22A 4PGPA 4PC9A 4RXLA 3BFTA 1IQ7A 4X04A 2I3VA 3MPLA 4Q0CA 3S9EA 1S7YA 2XXHA 4TLMB 4YMAA 4H8JA 5LDZA 3DLNA 1CNQA 2Z8FA 1LLSA 4GWZA 3B50A 4P56A 5EYFA 3EN3A 1B7HA 4OMBA 1PC3A 3QMFA 3PV0E 3FXRA 4EQ7A 4JSOA 1INPA 5FBPA 5AA2A 1WVJA 4LP2B 1I6QA 4G4PA 4O7MA 5I58B 4F2QA 3OEKA 4G61A 2CEXA 2HXRA 4ELQA 1ZBMA 2XXTA 4IO3A 1D9VA 4NF4A 3JYRA 4F1YA 4ZE8A 4X9TA 1B3FA 4PGNA 3E79A 3L6GA 4EF1A 5A5XA 2FA7A 1NUZA 1IXHA 3CIJA 1NV7A 3V83A 4IO7A 2Q2CA 1I6AA 2G93A 3C36A 5I84A 5IKBA 3KN7A 1IZ1A 3KBZA 3QIMA 4I3EA 4C1UA 2P3VA 3BFUA 3TCFA 4NF0A 5ITOA 3K6VA 4E0WA 1OVBA 1LB8A 3DP6A 1FTOA 5DEXB 1ZJLA 2KQZA 4H5FA 3M3LA 1LAHE 4YMBA 4OVRA 1YZ0A 3KOTA 3Q25A 3TODA 1NI9A 2Q2AA 3KZGA 4I8CA 2DP8A 4O7IA 5LTCA 3BKIB 4JSDA 4LVQA 2X7PA 3BIGA 1GGGA 1ZLQA 4FIMA 4U21A 1FW0A 3IJXB 4U4XA 4QSCA 3PMWA 5KDTA 3HFUA 1A8EA 2QS4A 4UA8A 1JQFA 2Q88A 2A5TA 1N7WA 4EDPA 2ESNA 4P8BA 4R9GA 4OTEA 5TPAA 4OESA 1MQIA 3U94A 2Z22A 4PAIA 2D5WA 3H4ZA 1NFTA 4KCCA 2WBDA 5HBCA 3SZPA 1FBEA 4JXIA 2H4IA 3FASA 4QHQA 1NL5A 3C35A 3NOHA 1R9LA 3DELB 1MQHA 2E1SA 3RPLB 4QF9A 3T1BA 5CMCA 2O84X 1PB9A 1FQEA 5HPQA 4PFIA 4GD5A 2QS2A 3OEMA 4O3CA 3OXNA 3TPAA 3RTFB 1IMDA 1JW5A 2QMWA 3C33A 4R2FA 3K1PA 4NF5B 4YB5A 2FNCA 3O2AA 2XWIA 4NMYA 1FJ6A 4LA9A 1O64A 4F2OA 5T3JA 3EPEA 2F97A 1TWYA 3DP8A 1MDQA 4XKQA 2VPOA 3C32A 1IXCA 5I2NB 2GFEA 3B6TA 2Z23A 1SQYA 2ANJA 1FTLA 4H45A 3CFXA 3G3IA 4GWOA 4KR5A 3FXQA 1EYKA 3HPIA 4RK9A 3TCHA 3LR1A 5I57B 3PD8A 4PAKA 4JVIA 1POY1 4NEDA 4WKMA 4NF6A 4OVTA 2NVUB 3N94A 1FBCA 4NE4A 2H5YA 4NAPA 4KXPA 2RCAA 3ZSFA 2XWKA 1BKAA 2DE4A 3VXCA 4ESWA 2ZYKA 2R9JA 1AH5A 1B5JA 4OYVA 4N8YA 2VHAA 4BLAA 3VLWA 3RYDA 1NNPA 3IO6A 3TQWA 3VVFA 3VXBA 2B65A 3GLBA 3FVOA 2CZLA 1S9TA 3RNNA 4OA4A 2REGA 4OFJA 3M8UA 2F6GA 2XX9A 3B6QA 1QUKA 1B3LA 5BUUA 4G68B 1FPJA 1WDNA 2DWJA 1AMFA 3D4GA 1MS7A 1QKBA 4TLLB 1FQCA 4ISUA 2IEEA 2F35A 5ET7A 3MJNA 5I56B 1MPCA 2MKZA 4DXBA 2Q9TA 1B1XA 1B9JA 1N3WA 2ONSA 1HSJA 3QSLA 1YTVA 5DVIA 4EXKA 4DLDA 3K1MA 2UVJA 3S4UA 3CI8A 3O28A 4PFBA 4U23A 4O3AA 2R8TA 4RPNA 4P0GA 1B05A 2XWVA 1KA0A 2XX8A 3C31A 2Q74A 3T9UA 4YU0A 2P3NA 3ILUB 2WBBA 2WX9A 1GTKA 5L9MA 4FEBA 3TTNA 3O9PA 2V84A 5EHMA 3G3GA 4L17A 3K02A 1B58A 1SW4A 1B4ZA 3F11A 1SBPA 4F3GA 5I58A 2F5XA 3EQ1A 4H67A 1FBDA 3UGWA 1D3KA 3UP9A 2ZYMA 4PE3A 3PPPA 2IA4A 5DVFA 5EYHA 3VV5A 3LBSA 2UVIA 3UA8A 2DQVA 2FBPA 3OOAA 4I1DA 4LQ2A 2VP1A 5DTBA 4ZEKA 3FZVA 2NUVA 1LBVA 1MPDA 2HCAA 5DEXA 2XWOA 3W15C 4MFIA 4OXVA 1JP4A 4UACA 4ELRA 2XXKA 3O6HA 3FVNA 5IZ3B 4OHNA 3FD3A 2H9BA 2F6PA 2G29A 3TZAA 1UTBB 4R73A 1OLCA 1GV8A 5TU0A 2P1SA 2BJJX 2GH9A 1MRPA 2WKYA 4MNCA 4HW8A 5IZZA 4OVJA 4R2BA 3VDFA 1I6BA 3MQ9A 1VE4A 2I0CA 2L5VA 1YPNA 3USDA 5JK4A 3EHUA 4AS5A 1D9QA 3U93A 2DVCA 1FJ9A 3H3GA 3GXAA 4G8NA 4QFPA 3M3KA 5DVJA 3FGSA 3VFJA 5H8FB
chains in the Genus database with same CATH topology
3FVGA 1B52A 4KPTA 5CRYA 4IO6A 1HSEA 4ELPA 2OK2A 3SETA 2ZXTA 4ZECA 1IITA 1B5IA 3TAJA 1BP5A 5B70A 1B51A 3O66A 4G68C 3KSJA 4HS7A 1SVXB 4NF5A 1Y4TA 2DOJA 4QFKA 1RYXA 4EQBA 4X1DA 4RPOA 5JTYB 1N0TA 1ZIUA 2H98A 1JW1A 3RUMA 3PUVE 5I2NA 3VVDA 4ZEIA 2DWIA 1QW0A 3TYHA 5I57A 3MZBA 1LFHA 2H99A 2F7BA 3U8QA 3LSFB 1FTMA 1MQJA 4YZZA 4LZ8A 1LB9A 4OZ9A 5ITPA 5CBSA 5AA2D 1FQBA 3KGCA 2V93A 4I9DA 1JEUA 5ELVA 1BLFA 3MVYA 3KJTA 4DXUA 3RN8A 2UYFA 1P1WA 3U1OA 1B2HA 5H8SA 4GXAA 3SEWA 2UVHA 1OMPA 1URDA 4I62A 4G68A 1B7UA 4C1TA 5AA3A 1A54A 5L9SA 4QFNA 3TELA 5HM4B 4BDNA 5I56A 3U72A 4GOTA 1Y1ZA 3A3CA 2PT1A 1B3HA 3K6WA 3OO7A 1QUJA 2RINA 1LBCA 1J1NA 1ATGA 1LCFA 2E0SA 1PB7A 3LUYA 1A8FA 3SEYA 2LAOA 4DCXA 3HSTA 2ABHA 4U1OA 3IOVA 1PDAA 4GF8A 3PU5A 3OENA 1OIBA 3KBRA 5H8NB 1SW2A 3IOWA 1PEBA 1P1QA 4XKPA 5KCJB 3HO7A 1LSTA 3SEUA 5DT6A 4MF3A 3CFZA 4IB2A 3CSGA 3B6WA 2B3BA 3B7DA 3CR9A 1DPEA 1NKXA 3U92A 3RTWB 1B5HA 3PD9A 2Y7WA 2ZNSA 2DXRA 3FV2A 1M5EA 2CMOA 2XXYA 1LGBC 1MXYA 4KYSA 3RY3A 3TKDA 4U2RA 2THIA 2ZMBA 2Y84A 1N84A 1FTJA 3EHTA 1UTBA 1GVCA 5B7DA 2RKMA 3H06B 3UN6A 4N6PA 1OQHA 2DSFA 5CI5A 2ZNTA 2YPNA 4P0IA 3IOUA 4XXUA 1HSLA 3OSRA 1Y4CA 3KN8A 1RKMA 4OFOA 2PX1A 4E0XA 3K01A 4GVOA 4KQPA 2YLNA 4F29A 5H8FA 3H7MA 3QXMA 3PPNA 1P1OA 5ICTA 1TFDA 4F3SA 1NNTA 3IAZA 5H8QB 3VE1B 4MLVA 1ZMGA 4TQUQ 1DTGA 1MXVA 3A3UA 4ZS9A 3PUXE 3SKPA 1Z7NE 3RT6B 2AYSA 4RNSA 1B0HA 3LSLA 2NOOA 1BIYA 3Q28A 1XVXA 1I69A 2XHDA 4ZDMA 2VD3A 3E3KA 3PGFA 4IGRA 4AB5A 3R26A 2O6AA 1DSNA 3MC2A 2P2AA 5JTYA 1VSOA 2DVZA 3MZ1A 2XXIA 3MP8A 1B0LA 2AL4A 4N07A 2Z8EA 3FJGA 2RCBA 1EZPA 2AIXA 4KD5A 3T9HB 4H0WA 4GRKA 3FXUA 4ONYA 2O69A 3N26A 5AE4A 4F3PA 1OLAA 3H6VA 4DCYA 2VGQA 2PMSA 3O6IA 1SW1A 2ONKE 4EF2A 1R9QA 2XXXA 3S9NC 3HV1A 3MPKA 4YKIA 4PETA 4YAHX 4WEPA 3K4UA 4Z0IA 2XX7A 4H8IA 4LQ5A 2DWHA 1TT1A 1UIUA 2Q8JA 3KOSA 1JVYA 1SYIA 3ECRA 4DE8A 3K6UA 1NNFA 1S50A 2DE3A 3SEXA 4ZZEA 3RT8A 3TEPA 3LSWA 4JB7A 1Y3QA 1US4A 5CBRA 5FHOA 1B3EA 3FUZA 2XXQA 2RC9A 3H6UA 2DS9A 3ZKLA 3T9VA 4PFWA 1MXZA 3PUWE 3VLVA 5ISUA 2F7AA 5LOMA 2B3FA 3ODBA 4KCDA 3ZKKA 4FORA 1Q35A 4HCWA 3H6TA 4EUOA 5CMKA 1A7LA 4OEUA 4JWYA 1R6ZA 4XTCQ 3C9HA 5H8NA 4K3FA 3TTRA 2Y7KA 3I6VA 3ONMA 1XHYA 5I59B 4DZ1A 4G8MA 1A99A 1L5TA 5BWJA 3MW0A 4U1ZA 3G3KA 5IAIA 1OVTA 2HAVA 1KWHA 3KEIA 1MY3A 5F1QA 3K2DA 4EXLA 4RJZA 3R6UA 3FATA 3HHGA 3PPOA 1N3XA 1P1NA 1AOVA 3G7WA 2Q89A 3QAXA 1M5BA 2Y7IA 1B46A 1R1NA 1MXXA 3PUYE 3M3FA 1RYOA 3UIFA 5TP9B 2PVUA 4YB6A 1O63A 1SYHA 4NWCA 2HEUA 4BDQA 4F18A 4KFQA 3KSXA 1TXFA 3P7IA 5J1DA 1AL3A 3ZS6A 2I4CA 2YJPA 2F8DA 4ZEBA 1EH3A 1MQGA 5CMMA 2UXAA 3IX1A 3DM0A 1LFIA 4M4GA 4R74A 4JBZA 2I4BA 2H25A 2O1MA 2PT2A 1DMBA 3CVGA 3UORA 4QRZA 4G8HA 1POTA 2O7UA 3S9MC 2FYIA 3TCGA 4QFLA 4DDDA 2ZYNA 2OBGA 3SERA 3OO6A 4M1VA 4F1VA 1USYE 2R71A 2XD2A 3CG1A 1T0KA 3MUQA 1ANFA 3Q29A 5EHSA 3KN3A 3TQLA 3T66A 1CE2A 5AA4B 5H8QA 2QS3A 2GHBA 4G2ZA 1DOTA 2AL5A 4FECA 1MM7A 1IIWA 1P1UA 3S9LC 2REJA 1QUIA 4HTGA 1H45A 3PPQA 3W9WA 4POWA 3KFMA 1MY0A 3CSBA 4R75A 1A40A 3E9XA 4F19A 4LZ7A 4XKRA 3O6GA 1LAFE 4YB7A 1DPPA 2RC8A 4QSEA 4FATA 3R7XA 1B40A 4N13A 3LSXA 4RY1A 3K0VA 3L6HA 4NWDA 2XXVA 4IO4A 1URSA 2P0SA 4BDOA 1D9YA 3WAEA 4H5GA 1N04A 3VLUA 4FE8A 4OEVA 3HHFA 3SDFA 1JVXA 1H3DA 1SD3A 1MQDA 2NWJA 2X26A 3G3FA 5CMBA 4WXJA 1IXGA 5CC2A 1LBBA 1PBPA 2Y7PA 3OMBA 4JDFA 3MVWA 2DXYA 1QVSA 4F1UA 3BBRA 2V3UA 1UQWA 3Q27A 1XC1A 1LAGE 1D4NA 2UYEA 4NTLA 1YAEA 2HQ0A 4U22A 4QSDA 4OWDA 3RGYA 1JETA 4GLIA 2HAUA 4XKNA 1Y20A 1NH7A 2F36A 3EF7A 1B7ZA 3TMGA 5I59A 4ND9A 1PB8A 4NF8B 3K6XA 3EHSA 4PQJA 4DXCA 3V89B 1B32A 3IOTA 1OQGA 3TTLA 2XXRA 2OWSA 1GR2A 2QSXA 2I58A 2I0BA 3G3HA 4RYAA 1FQDA 1Y1MA 1XOCA 1FTKA 1LAXA 5AA1A 1MY1A 3MBPA 4IGTA 2OZZA 3IB1A 5TP9A 4X1BA 2GRVA 2RC7A 2OWTA 3MZ9A 4GXSB 5L9OA 3H6WA 1JEVA 1FQAA 1VFDA 1Y9UA 1B3GA 3FJMA 3RPWA 1H43A 2O7IA 1MH3A 3Q26A 2DE2A 1H44A 1EZOA 3D4CA 1NNKA 4YICA 3PMVA 3HCQA 3FV1A 3T96B 3E4RA 1LFGA 3KG2A 3ILTB 1Y3NA 1US5A 1PBQA 4GFRA 4YKKA 2QL3A 4G77A 5L8DA 5AA4A 1CB6A 5K2XA 1A55A 4OERA 2V3QA 1Z7ME 2O68A 2Z8DA 2W7YA 4OENA 4P11A 3TDJA 2M8CA 4JWXA 2XXWA 1TFAA 3O97A 4FAJA 5FHNA 3O29A 4GL8A 1FCKA 2UVGA 3IJOB 2OCUA 4KHZE 4LATA 4OETA 3K00A 3THIA 4Q8RA 3OELA 5I2KB 5H8HB 2V25A 1O7TA 3H03A 4R6YA 2D3IA 3FJ7A 5DYHA 2HZKA 3IL1B 3IB2A 3LC8A 4KYEA 2D21A 3QK6A 4F3BA 3OO9A 3OO8A 1VR5A 2GHAA 2RF1A 3OD7A 3GBBA 4MH5A 4KI0E 2PBWA 4U4SA 3T22A 4PFTA 4IY5A 4ZEDA 3SEVA 4H1XA 5K2YA 2I6EA 1IEJA 4MLQA 3RQTA 4THIA 4ESXA 2F34A 1UTHB 4EQ9A 3IR1A 1UIVA 4RA1A 4BDMA 4LZ5A 4JWOA 4PP0A 1DTZA 1MDP1 2F78A 3I3VA 2V3TA 4FEDA 4XIGQ 3CRBA 3C34A 3PPRA 1MM6A 2I3WA 3UK4A 5ICQA 1M5CA 1WODA 1ZTYA 1ZU0A 1JW4A 2HFBA 3A09A 3MP6A 1N76A 2XD3A 4IY6A 4AQ4A 1BTJA 3IK6B 4YKJA 1NMUA 4R6HA 3MAMA 2OJTA 5AA2B 4OFLA 5KCJA 2HXWA 2R6GE 4NF4B 2QS1A 1IUDA 3W9VA 3MWBA 3TTMA 5A5XB 4NF8A 5JEIA 3AXFA 4IO5A 1B6HA 1SDXA 4RK2A 1XVYA 3N6UA 3G3JA 3C4MA 2X7QA 5KZTA 1B4HA 1MY4A 1NH8A 1SI0A 2OLBA 4LUBA 5F7VA 4ZE9A 3T93B 2I49A 4Q5TA 2ZYOA 2VD2A 1P99A 4FJPA 3OSQA 1ZKBA 4GL0A 4WEDA 4AB6A 5FHMA 4O3BA 2VOZA 3WAFA 4Q30B 4GQOA 3QUFA 1Y3PA 5KDTB 1H76A 2QPQA 1EU8A 2QMXA 2A5TB 1B1HA 1N7XA 3PUZE 5TPAB 4QFOA 2ONRA 4OQOA 3GZGA 3T9XB 3CG3A 1MH4A 3E13X 1XT8A 1MXWA 4ELOA 3QUJA 3HN0A 1EZ9A 3VVEA 4ZZAA 1SI1A 1M5FA 4R6KA 2QRYA 3QYTA 2XXPA 4R72A 1JNFA 1LCTA 1SW5A 2QJEA 4POXA 3MVZA 3IB0A 1QKAA 4F39A 3S2VA 1QULA 3RLFE 3SESA 2ALUA 1II5A 2HZLA 1USYH 4ZEFA 5CM6A 4HCYA 3CFLA 2XXUA 2NXOA 4PFUA 3FVKA 3I5OA 2O51A 2Y7RA 1YCJA 4YKPA 3TUSA 4DIGA 4C0RA 3FIRA 2I48A 4PE5B 4X48A 1VFEA 4Z7EA 3JZJA 3IO4A 2DWAA 4ECFA 2O1LA 3MVXA 1MY2A 4NF6B 3V5AA 2F7CA 3JV9A 5I2KA 5H8HA 1URGA 1F9BA 1MPBA 4H65A 4BDLA 1Q1KA 4PFYA 4KYDA 1AIVA 3N5LA 2A5SA 4TOZA 2ZNUA 3GBAA 5FTHA 4MBPA 2DYXA 5FTIA 4LONB 3DP4A 3K1NA 2PYYA 2KLFA 4BDRA 3KJ7A 1QJMA 1MXUA 3N6TA 3PMXA 3TFLA 1UTHA 3MP1A 1IXIA 4H6DA 5M2VA 4F31B 4GIZA 1MG1A 3IORA 1FQFA 1XS5A 4R9FA 3V8XB 1ELJA 4IO2A 1M5DA 3TTKA 4F22A 4RXLA 3BFTA 1IQ7A 2I3VA 3MPLA 4Q0CA 3S9EA 1S7YA 2XXHA 4TLMB 4YMAA 4H8JA 3DLNA 2Z8FA 1LLSA 5EYFA 3EN3A 1B7HA 4OMBA 1PC3A 3PV0E 3FXRA 4EQ7A 4JSOA 5AA2A 1WVJA 4LP2B 1I6QA 4G4PA 5I58B 4F2QA 3OEKA 4ELQA 1ZBMA 2XXTA 4IO3A 1D9VA 4NF4A 3JYRA 4F1YA 4ZE8A 4X9TA 1B3FA 3L6GA 4EF1A 5A5XA 2FA7A 1IXHA 3CIJA 3V83A 4IO7A 2Q2CA 1I6AA 2G93A 3C36A 5I84A 5IKBA 3KN7A 1IZ1A 3QIMA 4C1UA 3BFUA 3TCFA 5ITOA 3K6VA 4E0WA 1OVBA 1LB8A 3DP6A 1FTOA 5DEXB 1ZJLA 4H5FA 3M3LA 1LAHE 4YMBA 3KOTA 3Q25A 3TODA 2Q2AA 3KZGA 4I8CA 2DP8A 3BKIB 4JSDA 4LVQA 2X7PA 1GGGA 1ZLQA 4FIMA 4U21A 1FW0A 3IJXB 4U4XA 4QSCA 3PMWA 5KDTA 1A8EA 2QS4A 4UA8A 1JQFA 2Q88A 2A5TA 1N7WA 4EDPA 2ESNA 4R9GA 4OTEA 5TPAA 4OESA 1MQIA 3U94A 2Z22A 2D5WA 3H4ZA 1NFTA 4KCCA 5HBCA 4JXIA 2H4IA 3FASA 4QHQA 1NL5A 3C35A 1R9LA 3DELB 1MQHA 2E1SA 4QF9A 5CMCA 2O84X 1PB9A 1FQEA 5HPQA 4GD5A 2QS2A 3OEMA 4O3CA 3OXNA 3TPAA 3RTFB 1JW5A 2QMWA 3C33A 4R2FA 3K1PA 4NF5B 4YB5A 2FNCA 3O2AA 4NMYA 4LA9A 1O64A 4F2OA 3EPEA 2F97A 1TWYA 3DP8A 1MDQA 4XKQA 3C32A 1IXCA 5I2NB 2GFEA 3B6TA 2Z23A 1SQYA 2ANJA 1FTLA 3CFXA 3G3IA 4GWOA 4KR5A 3FXQA 3HPIA 4RK9A 3TCHA 3LR1A 5I57B 3PD8A 1POY1 4NEDA 4WKMA 4NF6A 2NVUB 3N94A 4NE4A 2H5YA 2RCAA 3ZSFA 1BKAA 2DE4A 3VXCA 4ESWA 2ZYKA 2R9JA 1AH5A 1B5JA 4OYVA 2VHAA 4BLAA 3VLWA 1NNPA 3IO6A 3TQWA 3VVFA 3VXBA 2B65A 3GLBA 3FVOA 2CZLA 1S9TA 3RNNA 2REGA 4OFJA 3M8UA 2F6GA 2XX9A 3B6QA 1QUKA 1B3LA 5BUUA 4G68B 1WDNA 2DWJA 1AMFA 3D4GA 1MS7A 1QKBA 4TLLB 1FQCA 4ISUA 2IEEA 2F35A 3MJNA 5I56B 1MPCA 4DXBA 2Q9TA 1B1XA 1B9JA 1N3WA 2ONSA 1HSJA 3QSLA 1YTVA 4EXKA 5DVIA 4DLDA 3K1MA 2UVJA 3S4UA 3CI8A 3O28A 4U23A 4O3AA 4RPNA 4P0GA 1B05A 2XX8A 3C31A 3T9UA 4YU0A 3ILUB 1GTKA 5L9MA 4FEBA 3TTNA 3O9PA 2V84A 5EHMA 3G3GA 4L17A 3K02A 1B58A 1SW4A 1B4ZA 3F11A 1SBPA 4F3GA 5I58A 2F5XA 3EQ1A 4H67A 3UGWA 1D3KA 3UP9A 2ZYMA 3PPPA 2IA4A 5DVFA 3VV5A 3LBSA 2UVIA 3UA8A 2DQVA 3OOAA 4I1DA 4LQ2A 2VP1A 5DTBA 4ZEKA 3FZVA 2NUVA 1MPDA 2HCAA 5DEXA 3W15C 4MFIA 4OXVA 4UACA 4ELRA 3O6HA 3FVNA 4OHNA 3FD3A 2H9BA 2F6PA 2G29A 3TZAA 1UTBB 4R73A 1OLCA 1GV8A 5TU0A 2P1SA 2BJJX 2GH9A 1MRPA 2WKYA 4HW8A 4OVJA 4R2BA 3VDFA 1I6BA 3MQ9A 1VE4A 2I0CA 1YPNA 3USDA 5JK4A 3EHUA 3U93A 2DVCA 3H3GA 3GXAA 4G8NA 4QFPA 3M3KA 5DVJA 3FGSA 3VFJA 5H8FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVG A;  1B52 A;  4KPT A;  5CRY A;  4IO6 A;  1HSE A;  4ELP A;  2OK2 A;  3SET A;  2ZXT A;  4ZEC A;  1IIT A;  1B5I A;  3TAJ A;  1BP5 A;  5B70 A;  1B51 A;  3O66 A;  4G68 C;  3KSJ A;  4HS7 A;  1SVX B;  4NF5 A;  1Y4T A;  2DOJ A;  4QFK A;  1RYX A;  4EQB A;  4X1D A;  4RPO A;  5JTY B;  1N0T A;  1ZIU A;  2H98 A;  1JW1 A;  3RUM A;  3PUV E;  5I2N A;  3VVD A;  4ZEI A;  2DWI A;  1QW0 A;  3TYH A;  5I57 A;  3MZB A;  1LFH A;  2H99 A;  2F7B A;  3U8Q A;  3LSF B;  1FTM A;  1MQJ A;  4YZZ A;  4LZ8 A;  1LB9 A;  4OZ9 A;  5ITP A;  5CBS A;  5AA2 D;  1FQB A;  3KGC A;  2V93 A;  4I9D A;  1JEU A;  5ELV A;  1BLF A;  3MVY A;  3KJT A;  4DXU A;  3RN8 A;  2UYF A;  1P1W A;  3U1O A;  1B2H A;  5H8S A;  4GXA A;  3SEW A;  2UVH A;  1OMP A;  1URD A;  4I62 A;  4G68 A;  1B7U A;  4C1T A;  5AA3 A;  1A54 A;  5L9S A;  4QFN A;  3TEL A;  5HM4 B;  4BDN A;  5I56 A;  3U72 A;  4GOT A;  1Y1Z A;  3A3C A;  2PT1 A;  1B3H A;  3K6W A;  3OO7 A;  1QUJ A;  2RIN A;  1LBC A;  1J1N A;  1ATG A;  1LCF A;  2E0S A;  1PB7 A;  3LUY A;  1A8F A;  3SEY A;  2LAO A;  4DCX A;  3HST A;  2ABH A;  4U1O A;  3IOV A;  1PDA A;  4GF8 A;  3PU5 A;  3OEN A;  1OIB A;  3KBR A;  5H8N B;  1SW2 A;  3IOW A;  1PEB A;  1P1Q A;  4XKP A;  5KCJ B;  3HO7 A;  1LST A;  3SEU A;  5DT6 A;  4MF3 A;  3CFZ A;  4IB2 A;  3CSG A;  3B6W A;  2B3B A;  3B7D A;  3CR9 A;  1DPE A;  1NKX A;  3U92 A;  3RTW B;  1B5H A;  3PD9 A;  2Y7W A;  2ZNS A;  2DXR A;  3FV2 A;  1M5E A;  2CMO A;  2XXY A;  1LGB C;  1MXY A;  4KYS A;  3RY3 A;  3TKD A;  4U2R A;  2THI A;  2ZMB A;  2Y84 A;  1N84 A;  1FTJ A;  3EHT A;  1UTB A;  1GVC A;  5B7D A;  2RKM A;  3H06 B;  3UN6 A;  4N6P A;  1OQH A;  2DSF A;  5CI5 A;  2ZNT A;  2YPN A;  4P0I A;  3IOU A;  4XXU A;  1HSL A;  3OSR A;  1Y4C A;  3KN8 A;  1RKM A;  4OFO A;  2PX1 A;  4E0X A;  3K01 A;  4GVO A;  4KQP A;  2YLN A;  4F29 A;  5H8F A;  3H7M A;  3QXM A;  3PPN A;  1P1O A;  5ICT A;  1TFD A;  4F3S A;  1NNT A;  3IAZ A;  5H8Q B;  3VE1 B;  4MLV A;  1ZMG A;  4TQU Q;  1DTG A;  1MXV A;  3A3U A;  4ZS9 A;  3PUX E;  3SKP A;  1Z7N E;  3RT6 B;  2AYS A;  4RNS A;  1B0H A;  3LSL A;  2NOO A;  1BIY A;  3Q28 A;  1XVX A;  1I69 A;  2XHD A;  4ZDM A;  2VD3 A;  3E3K A;  3PGF A;  4IGR A;  4AB5 A;  3R26 A;  2O6A A;  1DSN A;  3MC2 A;  2P2A A;  5JTY A;  1VSO A;  2DVZ A;  3MZ1 A;  2XXI A;  3MP8 A;  1B0L A;  2AL4 A;  4N07 A;  2Z8E A;  3FJG A;  2RCB A;  1EZP A;  2AIX A;  4KD5 A;  3T9H B;  4H0W A;  4GRK A;  3FXU A;  4ONY A;  2O69 A;  3N26 A;  5AE4 A;  4F3P A;  1OLA A;  3H6V A;  4DCY A;  2VGQ A;  2PMS A;  3O6I A;  1SW1 A;  2ONK E;  4EF2 A;  1R9Q A;  2XXX A;  3S9N C;  3HV1 A;  3MPK A;  4YKI A;  4PET A;  4YAH X;  4WEP A;  3K4U A;  4Z0I A;  2XX7 A;  4H8I A;  4LQ5 A;  2DWH A;  1TT1 A;  1UIU A;  2Q8J A;  3KOS A;  1JVY A;  1SYI A;  3ECR A;  4DE8 A;  3K6U A;  1NNF A;  1S50 A;  2DE3 A;  3SEX A;  4ZZE A;  3RT8 A;  3TEP A;  3LSW A;  4JB7 A;  1Y3Q A;  1US4 A;  5CBR A;  5FHO A;  1B3E A;  3FUZ A;  2XXQ A;  2RC9 A;  3H6U A;  2DS9 A;  3ZKL A;  3T9V A;  4PFW A;  1MXZ A;  3PUW E;  3VLV A;  5ISU A;  2F7A A;  5LOM A;  2B3F A;  3ODB A;  4KCD A;  3ZKK A;  4FOR A;  1Q35 A;  4HCW A;  3H6T A;  4EUO A;  5CMK A;  1A7L A;  4OEU A;  4JWY A;  1R6Z A;  4XTC Q;  3C9H A;  5H8N A;  4K3F A;  3TTR A;  2Y7K A;  3I6V A;  3ONM A;  1XHY A;  5I59 B;  4DZ1 A;  4G8M A;  1A99 A;  1L5T A;  5BWJ A;  3MW0 A;  4U1Z A;  3G3K A;  5IAI A;  1OVT A;  2HAV A;  1KWH A;  3KEI A;  1MY3 A;  5F1Q A;  3K2D A;  4EXL A;  4RJZ A;  3R6U A;  3FAT A;  3HHG A;  3PPO A;  1N3X A;  1P1N A;  1AOV A;  3G7W A;  2Q89 A;  3QAX A;  1M5B A;  2Y7I A;  1B46 A;  1R1N A;  1MXX A;  3PUY E;  3M3F A;  1RYO A;  3UIF A;  5TP9 B;  2PVU A;  4YB6 A;  1O63 A;  1SYH A;  4NWC A;  2HEU A;  4BDQ A;  4F18 A;  4KFQ A;  3KSX A;  1TXF A;  3P7I A;  5J1D A;  1AL3 A;  3ZS6 A;  2I4C A;  2YJP A;  2F8D A;  4ZEB A;  1EH3 A;  1MQG A;  5CMM A;  2UXA A;  3IX1 A;  3DM0 A;  1LFI A;  4M4G A;  4R74 A;  4JBZ A;  2I4B A;  2H25 A;  2O1M A;  2PT2 A;  1DMB A;  3CVG A;  3UOR A;  4QRZ A;  4G8H A;  1POT A;  2O7U A;  3S9M C;  2FYI A;  3TCG A;  4QFL A;  4DDD A;  2ZYN A;  2OBG A;  3SER A;  3OO6 A;  4M1V A;  4F1V A;  1USY E;  2R71 A;  2XD2 A;  3CG1 A;  1T0K A;  3MUQ A;  1ANF A;  3Q29 A;  5EHS A;  3KN3 A;  3TQL A;  3T66 A;  1CE2 A;  5AA4 B;  5H8Q A;  2QS3 A;  2GHB A;  4G2Z A;  1DOT A;  2AL5 A;  4FEC A;  1MM7 A;  1IIW A;  1P1U A;  3S9L C;  2REJ A;  1QUI A;  4HTG A;  1H45 A;  3PPQ A;  3W9W A;  4POW A;  3KFM A;  1MY0 A;  3CSB A;  4R75 A;  1A40 A;  3E9X A;  4F19 A;  4LZ7 A;  4XKR A;  3O6G A;  1LAF E;  4YB7 A;  1DPP A;  2RC8 A;  4QSE A;  4FAT A;  3R7X A;  1B40 A;  4N13 A;  3LSX A;  4RY1 A;  3K0V A;  3L6H A;  4NWD A;  2XXV A;  4IO4 A;  1URS A;  2P0S A;  4BDO A;  1D9Y A;  3WAE A;  4H5G A;  1N04 A;  3VLU A;  4FE8 A;  4OEV A;  3HHF A;  3SDF A;  1JVX A;  1H3D A;  1SD3 A;  1MQD A;  2NWJ A;  2X26 A;  3G3F A;  5CMB A;  4WXJ A;  1IXG A;  5CC2 A;  1LBB A;  1PBP A;  2Y7P A;  3OMB A;  4JDF A;  3MVW A;  2DXY A;  1QVS A;  4F1U A;  3BBR A;  2V3U A;  1UQW A;  3Q27 A;  1XC1 A;  1LAG E;  1D4N A;  2UYE A;  4NTL A;  1YAE A;  2HQ0 A;  4U22 A;  4QSD A;  4OWD A;  3RGY A;  1JET A;  4GLI A;  2HAU A;  4XKN A;  1Y20 A;  1NH7 A;  2F36 A;  3EF7 A;  1B7Z A;  3TMG A;  5I59 A;  4ND9 A;  1PB8 A;  4NF8 B;  3K6X A;  3EHS A;  4PQJ A;  4DXC A;  3V89 B;  1B32 A;  3IOT A;  1OQG A;  3TTL A;  2XXR A;  2OWS A;  1GR2 A;  2QSX A;  2I58 A;  2I0B A;  3G3H A;  4RYA A;  1FQD A;  1Y1M A;  1XOC A;  1FTK A;  1LAX A;  5AA1 A;  1MY1 A;  3MBP A;  4IGT A;  2OZZ A;  3IB1 A;  5TP9 A;  4X1B A;  2GRV A;  2RC7 A;  2OWT A;  3MZ9 A;  4GXS B;  5L9O A;  3H6W A;  1JEV A;  1FQA A;  1VFD A;  1Y9U A;  1B3G A;  3FJM A;  3RPW A;  1H43 A;  2O7I A;  1MH3 A;  3Q26 A;  2DE2 A;  1H44 A;  1EZO A;  3D4C A;  1NNK A;  4YIC A;  3PMV A;  3HCQ A;  3FV1 A;  3T96 B;  3E4R A;  1LFG A;  3KG2 A;  3ILT B;  1Y3N A;  1US5 A;  1PBQ A;  4GFR A;  4YKK A;  2QL3 A;  4G77 A;  5L8D A;  5AA4 A;  1CB6 A;  5K2X A;  1A55 A;  4OER A;  2V3Q A;  1Z7M E;  2O68 A;  2Z8D A;  2W7Y A;  4OEN A;  4P11 A;  3TDJ A;  2M8C A;  4JWX A;  2XXW A;  1TFA A;  3O97 A;  4FAJ A;  5FHN A;  3O29 A;  4GL8 A;  1FCK A;  2UVG A;  3IJO B;  2OCU A;  4KHZ E;  4LAT A;  4OET A;  3K00 A;  3THI A;  4Q8R A;  3OEL A;  5I2K B;  5H8H B;  2V25 A;  1O7T A;  3H03 A;  4R6Y A;  2D3I A;  3FJ7 A;  5DYH A;  2HZK A;  3IL1 B;  3IB2 A;  3LC8 A;  4KYE A;  2D21 A;  3QK6 A;  4F3B A;  3OO9 A;  3OO8 A;  1VR5 A;  2GHA A;  2RF1 A;  3OD7 A;  3GBB A;  4MH5 A;  4KI0 E;  2PBW A;  4U4S A;  3T22 A;  4PFT A;  4IY5 A;  4ZED A;  3SEV A;  4H1X A;  5K2Y A;  2I6E A;  1IEJ A;  4MLQ A;  3RQT A;  4THI A;  4ESX A;  2F34 A;  1UTH B;  4EQ9 A;  3IR1 A;  1UIV A;  4RA1 A;  4BDM A;  4LZ5 A;  4JWO A;  4PP0 A;  1DTZ A;  1MDP 1;  2F78 A;  3I3V A;  2V3T A;  4FED A;  4XIG Q;  3CRB A;  3C34 A;  3PPR A;  1MM6 A;  2I3W A;  3UK4 A;  5ICQ A;  1M5C A;  1WOD A;  1ZTY A;  1ZU0 A;  1JW4 A;  2HFB A;  3A09 A;  3MP6 A;  1N76 A;  2XD3 A;  4IY6 A;  4AQ4 A;  1BTJ A;  3IK6 B;  4YKJ A;  1NMU A;  4R6H A;  3MAM A;  2OJT A;  5AA2 B;  4OFL A;  5KCJ A;  2HXW A;  2R6G E;  4NF4 B;  2QS1 A;  1IUD A;  3W9V A;  3MWB A;  3TTM A;  5A5X B;  4NF8 A;  5JEI A;  3AXF A;  4IO5 A;  1B6H A;  1SDX A;  4RK2 A;  1XVY A;  3N6U A;  3G3J A;  3C4M A;  2X7Q A;  5KZT A;  1B4H A;  1MY4 A;  1NH8 A;  1SI0 A;  2OLB A;  4LUB A;  5F7V A;  4ZE9 A;  3T93 B;  2I49 A;  4Q5T A;  2ZYO A;  2VD2 A;  1P99 A;  4FJP A;  3OSQ A;  1ZKB A;  4GL0 A;  4WED A;  4AB6 A;  5FHM A;  4O3B A;  2VOZ A;  3WAF A;  4Q30 B;  4GQO A;  3QUF A;  1Y3P A;  5KDT B;  1H76 A;  2QPQ A;  1EU8 A;  2QMX A;  2A5T B;  1B1H A;  1N7X A;  3PUZ E;  5TPA B;  4QFO A;  2ONR A;  4OQO A;  3GZG A;  3T9X B;  3CG3 A;  1MH4 A;  3E13 X;  1XT8 A;  1MXW A;  4ELO A;  3QUJ A;  3HN0 A;  1EZ9 A;  3VVE A;  4ZZA A;  1SI1 A;  1M5F A;  4R6K A;  2QRY A;  3QYT A;  2XXP A;  4R72 A;  1JNF A;  1LCT A;  1SW5 A;  2QJE A;  4POX A;  3MVZ A;  3IB0 A;  1QKA A;  4F39 A;  3S2V A;  1QUL A;  3RLF E;  3SES A;  2ALU A;  1II5 A;  2HZL A;  1USY H;  4ZEF A;  5CM6 A;  4HCY A;  3CFL A;  2XXU A;  2NXO A;  4PFU A;  3FVK A;  3I5O A;  2O51 A;  2Y7R A;  1YCJ A;  4YKP A;  3TUS A;  4DIG A;  4C0R A;  3FIR A;  2I48 A;  4PE5 B;  4X48 A;  1VFE A;  4Z7E A;  3JZJ A;  3IO4 A;  2DWA A;  4ECF A;  2O1L A;  3MVX A;  1MY2 A;  4NF6 B;  3V5A A;  2F7C A;  3JV9 A;  5I2K A;  5H8H A;  1URG A;  1F9B A;  1MPB A;  4H65 A;  4BDL A;  1Q1K A;  4PFY A;  4KYD A;  1AIV A;  3N5L A;  2A5S A;  4TOZ A;  2ZNU A;  3GBA A;  5FTH A;  4MBP A;  2DYX A;  5FTI A;  4LON B;  3DP4 A;  3K1N A;  2PYY A;  2KLF A;  4BDR A;  3KJ7 A;  1QJM A;  1MXU A;  3N6T A;  3PMX A;  3TFL A;  1UTH A;  3MP1 A;  1IXI A;  4H6D A;  5M2V A;  4F31 B;  4GIZ A;  1MG1 A;  3IOR A;  1FQF A;  1XS5 A;  4R9F A;  3V8X B;  1ELJ A;  4IO2 A;  1M5D A;  3TTK A;  4F22 A;  4RXL A;  3BFT A;  1IQ7 A;  2I3V A;  3MPL A;  4Q0C A;  3S9E A;  1S7Y A;  2XXH A;  4TLM B;  4YMA A;  4H8J A;  3DLN A;  2Z8F A;  1LLS A;  5EYF A;  3EN3 A;  1B7H A;  4OMB A;  1PC3 A;  3PV0 E;  3FXR A;  4EQ7 A;  4JSO A;  5AA2 A;  1WVJ A;  4LP2 B;  1I6Q A;  4G4P A;  5I58 B;  4F2Q A;  3OEK A;  4ELQ A;  1ZBM A;  2XXT A;  4IO3 A;  1D9V A;  4NF4 A;  3JYR A;  4F1Y A;  4ZE8 A;  4X9T A;  1B3F A;  3L6G A;  4EF1 A;  5A5X A;  2FA7 A;  1IXH A;  3CIJ A;  3V83 A;  4IO7 A;  2Q2C A;  1I6A A;  2G93 A;  3C36 A;  5I84 A;  5IKB A;  3KN7 A;  1IZ1 A;  3QIM A;  4C1U A;  3BFU A;  3TCF A;  5ITO A;  3K6V A;  4E0W A;  1OVB A;  1LB8 A;  3DP6 A;  1FTO A;  5DEX B;  1ZJL A;  4H5F A;  3M3L A;  1LAH E;  4YMB A;  3KOT A;  3Q25 A;  3TOD A;  2Q2A A;  3KZG A;  4I8C A;  2DP8 A;  3BKI B;  4JSD A;  4LVQ A;  2X7P A;  1GGG A;  1ZLQ A;  4FIM A;  4U21 A;  1FW0 A;  3IJX B;  4U4X A;  4QSC A;  3PMW A;  5KDT A;  1A8E A;  2QS4 A;  4UA8 A;  1JQF A;  2Q88 A;  2A5T A;  1N7W A;  4EDP A;  2ESN A;  4R9G A;  4OTE A;  5TPA A;  4OES A;  1MQI A;  3U94 A;  2Z22 A;  2D5W A;  3H4Z A;  1NFT A;  4KCC A;  5HBC A;  4JXI A;  2H4I A;  3FAS A;  4QHQ A;  1NL5 A;  3C35 A;  1R9L A;  3DEL B;  1MQH A;  2E1S A;  4QF9 A;  5CMC A;  2O84 X;  1PB9 A;  1FQE A;  5HPQ A;  4GD5 A;  2QS2 A;  3OEM A;  4O3C A;  3OXN A;  3TPA A;  3RTF B;  1JW5 A;  2QMW A;  3C33 A;  4R2F A;  3K1P A;  4NF5 B;  4YB5 A;  2FNC A;  3O2A A;  4NMY A;  4LA9 A;  1O64 A;  4F2O A;  3EPE A;  2F97 A;  1TWY A;  3DP8 A;  1MDQ A;  4XKQ A;  3C32 A;  1IXC A;  5I2N B;  2GFE A;  3B6T A;  2Z23 A;  1SQY A;  2ANJ A;  1FTL A;  3CFX A;  3G3I A;  4GWO A;  4KR5 A;  3FXQ A;  3HPI A;  4RK9 A;  3TCH A;  3LR1 A;  5I57 B;  3PD8 A;  1POY 1;  4NED A;  4WKM A;  4NF6 A;  2NVU B;  3N94 A;  4NE4 A;  2H5Y A;  2RCA A;  3ZSF A;  1BKA A;  2DE4 A;  3VXC A;  4ESW A;  2ZYK A;  2R9J A;  1AH5 A;  1B5J A;  4OYV A;  2VHA A;  4BLA A;  3VLW A;  1NNP A;  3IO6 A;  3TQW A;  3VVF A;  3VXB A;  2B65 A;  3GLB A;  3FVO A;  2CZL A;  1S9T A;  3RNN A;  2REG A;  4OFJ A;  3M8U A;  2F6G A;  2XX9 A;  3B6Q A;  1QUK A;  1B3L A;  5BUU A;  4G68 B;  1WDN A;  2DWJ A;  1AMF A;  3D4G A;  1MS7 A;  1QKB A;  4TLL B;  1FQC A;  4ISU A;  2IEE A;  2F35 A;  3MJN A;  5I56 B;  1MPC A;  4DXB A;  2Q9T A;  1B1X A;  1B9J A;  1N3W A;  2ONS A;  1HSJ A;  3QSL A;  1YTV A;  4EXK A;  5DVI A;  4DLD A;  3K1M A;  2UVJ A;  3S4U A;  3CI8 A;  3O28 A;  4U23 A;  4O3A A;  4RPN A;  4P0G A;  1B05 A;  2XX8 A;  3C31 A;  3T9U A;  4YU0 A;  3ILU B;  1GTK A;  5L9M A;  4FEB A;  3TTN A;  3O9P A;  2V84 A;  5EHM A;  3G3G A;  4L17 A;  3K02 A;  1B58 A;  1SW4 A;  1B4Z A;  3F11 A;  1SBP A;  4F3G A;  5I58 A;  2F5X A;  3EQ1 A;  4H67 A;  3UGW A;  1D3K A;  3UP9 A;  2ZYM A;  3PPP A;  2IA4 A;  5DVF A;  3VV5 A;  3LBS A;  2UVI A;  3UA8 A;  2DQV A;  3OOA A;  4I1D A;  4LQ2 A;  2VP1 A;  5DTB A;  4ZEK A;  3FZV A;  2NUV A;  1MPD A;  2HCA A;  5DEX A;  3W15 C;  4MFI A;  4OXV A;  4UAC A;  4ELR A;  3O6H A;  3FVN A;  4OHN A;  3FD3 A;  2H9B A;  2F6P A;  2G29 A;  3TZA A;  1UTB B;  4R73 A;  1OLC A;  1GV8 A;  5TU0 A;  2P1S A;  2BJJ X;  2GH9 A;  1MRP A;  2WKY A;  4HW8 A;  4OVJ A;  4R2B A;  3VDF A;  1I6B A;  3MQ9 A;  1VE4 A;  2I0C A;  1YPN A;  3USD A;  5JK4 A;  3EHU A;  3U93 A;  2DVC A;  3H3G A;  3GXA A;  4G8N A;  4QFP A;  3M3K A;  5DVJ A;  3FGS A;  3VFJ A;  5H8F B; 
#chains in the Genus database with same CATH topology
 3FVG A;  1B52 A;  4KPT A;  4PCD A;  5CRY A;  4IO6 A;  1HSE A;  4ELP A;  4HE2 A;  2OK2 A;  3ROJ A;  3SET A;  2ZXT A;  3RPL A;  4PF8 A;  4ZEC A;  1IIT A;  1B5I A;  3TAJ A;  1BP5 A;  5B70 A;  1B51 A;  3O66 A;  4G68 C;  1NV0 A;  3KSJ A;  4HS7 A;  1NUX A;  4P3L A;  1SVX B;  5J16 A;  4NF5 A;  1Y4T A;  2DOJ A;  1FTA A;  4QFK A;  1RYX A;  4EQB A;  4X1D A;  4RPO A;  1FBP A;  2PFZ A;  5JTY B;  1N0T A;  1ZIU A;  2H98 A;  1JW1 A;  3RUM A;  3PUV E;  5I2N A;  3VVD A;  2ZZX A;  4ZEI A;  2DWI A;  1QW0 A;  4MIJ A;  2HPG A;  3TYH A;  5I57 A;  3MZB A;  1LFH A;  2H99 A;  1FPI A;  2F7B A;  3U8Q A;  4MEV A;  1DK4 A;  3LSF B;  1FTM A;  1MQJ A;  4YZZ A;  4LZ8 A;  1LB9 A;  4GWU A;  4OZ9 A;  5ITP A;  5CBS A;  5AA2 D;  1FQB A;  3KGC A;  2V93 A;  4I9D A;  4MJO A;  1JEU A;  1BLF A;  5ELV A;  3MVY A;  5IM2 A;  3KJT A;  4DXU A;  3RN8 A;  2UYF A;  1P1W A;  2WYP A;  3U1O A;  1B2H A;  5H8S A;  4GXA A;  3SEW A;  2UVH A;  1OMP A;  1URD A;  4I62 A;  4G68 A;  1FPE A;  1B7U A;  4C1T A;  5AA3 A;  1A54 A;  5L9S A;  4QFN A;  3TEL A;  2FIX A;  1FPF A;  5HM4 B;  4BDN A;  5I56 A;  3U72 A;  4GOT A;  1Y1Z A;  3A3C A;  2PT1 A;  1B3H A;  1IMF A;  3K6W A;  3OO7 A;  1QUJ A;  2RIN A;  1LBC A;  1J1N A;  1ATG A;  1LCF A;  2E0S A;  1PB7 A;  3LUY A;  4JVD A;  3LV0 A;  2V4C A;  1A8F A;  3SEY A;  2LAO A;  4HE1 A;  4DCX A;  3HST A;  4GWS A;  2ABH A;  4U1O A;  3IOV A;  1PDA A;  4GF8 A;  3PU5 A;  3OEN A;  1OIB A;  3KBR A;  5H8N B;  1SW2 A;  3IOW A;  1PEB A;  4XFE A;  1P1Q A;  4XKP A;  5KCJ B;  3HO7 A;  1LST A;  5EQA A;  3SEU A;  5DT6 A;  1IME A;  1RDX A;  4MF3 A;  3CFZ A;  4IB2 A;  3CSG A;  1FPB A;  3B6W A;  2B3B A;  3B7D A;  3CR9 A;  1DPE A;  1NKX A;  1FPK A;  3U92 A;  3RTW B;  1B5H A;  3PD9 A;  1NUY A;  2Y7W A;  2ZNS A;  2DXR A;  3FV2 A;  1M5E A;  2CMO A;  2XXY A;  1LGB C;  1MXY A;  4KYS A;  3RY3 A;  3TKD A;  4U2R A;  2THI A;  5IZ3 A;  2ZMB A;  2Y84 A;  4NQ8 A;  1N84 A;  1FTJ A;  3EHT A;  1UTB A;  1GVC A;  5B7D A;  2RKM A;  3H06 B;  3UN6 A;  4N6P A;  1OQH A;  2DSF A;  5CI5 A;  4P9K A;  2ZNT A;  2YPN A;  4P0I A;  3IOU A;  4XXU A;  1HSL A;  3OSR A;  1Y4C A;  3KN8 A;  1FSA A;  2OWZ A;  1RKM A;  4OFO A;  2PX1 A;  4E0X A;  3K01 A;  4GVO A;  4KQP A;  2YLN A;  4F29 A;  4JVC A;  5I7I A;  5H8F A;  3H7M A;  3QXM A;  3PPN A;  1P1O A;  5ICT A;  1TFD A;  4F3S A;  1NNT A;  2DDK A;  1EYI A;  3IAZ A;  5H8Q B;  5I5P A;  3VE1 B;  4MLV A;  1ZMG A;  4TQU Q;  1DTG A;  4MAG A;  1MXV A;  3A3U A;  4ZS9 A;  3PUX E;  3SKP A;  3FXB A;  1Z7N E;  3RT6 B;  2AYS A;  4RNS A;  1B0H A;  3LSL A;  2NOO A;  3IFC A;  4GWY A;  1BIY A;  3Q28 A;  1XVX A;  2QFL A;  1I69 A;  2XHD A;  4ZDM A;  2VD3 A;  4MNI A;  4MMP A;  3E3K A;  3PGF A;  4IGR A;  4AB5 A;  4PFR A;  3R26 A;  2O6A A;  1DSN A;  3MC2 A;  2P2A A;  5JTY A;  1VSO A;  1IMA A;  2DVZ A;  3MZ1 A;  2XXI A;  4NX1 A;  3MP8 A;  1B0L A;  2AL4 A;  4N07 A;  2Z8E A;  3FJG A;  2RCB A;  1EZP A;  2AIX A;  4KD5 A;  3T9H B;  4H0W A;  4GRK A;  3FXU A;  4ONY A;  2O69 A;  2F3B A;  3N26 A;  5AE4 A;  4F3P A;  1OLA A;  3H6V A;  4DCY A;  2VGQ A;  2PMS A;  3O6I A;  1SW1 A;  2ONK E;  4EF2 A;  1R9Q A;  2XXX A;  3S9N C;  1G0I A;  3HV1 A;  3MPK A;  4YKI A;  4PET A;  4YAH X;  4WEP A;  3K4U A;  4Z0I A;  2XX7 A;  4H8I A;  4LQ5 A;  2DWH A;  1TT1 A;  1UIU A;  2Q8J A;  3KOS A;  1JVY A;  1SYI A;  2PCR A;  3ECR A;  4DE8 A;  4GBW A;  3K6U A;  1NNF A;  1S50 A;  2DE3 A;  3SEX A;  4ZZE A;  3RT8 A;  4N4U A;  3TEP A;  3LSW A;  4JB7 A;  1Y3Q A;  5EQ7 A;  1US4 A;  3E78 A;  5CBR A;  5FHO A;  1B3E A;  1K9Z A;  3FUZ A;  2XXQ A;  4PBH A;  2RC9 A;  1EYJ A;  3H6U A;  2DS9 A;  3ZKL A;  4N6D A;  3T9V A;  1KZ8 A;  4PFW A;  1MXZ A;  3PUW E;  3VLV A;  5ISU A;  2F7A A;  5LOM A;  2HHM A;  2B3F A;  3ODB A;  4KCD A;  3ZKK A;  4FOR A;  1Q35 A;  4HCW A;  3H6T A;  4EUO A;  5CMK A;  1A7L A;  4OEU A;  4JWY A;  1NV5 A;  1R6Z A;  4XTC Q;  3C9H A;  1RDY A;  5H8N A;  4K3F A;  3TTR A;  2Y7K A;  4HXV A;  4QXD A;  3I6V A;  3ONM A;  1LBX A;  1XHY A;  5I59 B;  4DZ1 A;  4G8M A;  1A99 A;  2ZZV A;  1L5T A;  5BWJ A;  3MW0 A;  4U1Z A;  3G3K A;  5IAI A;  1OVT A;  2HAV A;  1KWH A;  3KEI A;  4P47 A;  1MY3 A;  5F1Q A;  3K2D A;  4EXL A;  4RJZ A;  3R6U A;  1NV6 A;  4MX6 A;  3FAT A;  4NGU A;  4PBQ A;  3HHG A;  3PPO A;  1N3X A;  1P1N A;  1AOV A;  1SPI A;  3G7W A;  2Q89 A;  3QAX A;  1M5B A;  2Y7I A;  1B46 A;  1R1N A;  1MXX A;  3PUY E;  3M3F A;  1RYO A;  3UIF A;  5TP9 B;  2PVU A;  4YB6 A;  4O8M A;  1O63 A;  1SYH A;  4NWC A;  2HEU A;  4BDQ A;  4F18 A;  4KFQ A;  3KSX A;  1TXF A;  3P7I A;  5J1D A;  2QVR A;  1AL3 A;  3ZS6 A;  2I4C A;  2YJP A;  2F8D A;  4ZEB A;  1EH3 A;  1MQG A;  5CMM A;  2UXA A;  3IX1 A;  3DM0 A;  1LFI A;  4M4G A;  4R74 A;  4JBZ A;  2I4B A;  1LBZ A;  2H25 A;  2O1M A;  2PT2 A;  1DMB A;  3CVG A;  3UOR A;  4QRZ A;  1FPD A;  4G8H A;  1POT A;  2O7U A;  3S9M C;  2FYI A;  2FIE A;  3TCG A;  4QFL A;  4DDD A;  2ZYN A;  2OBG A;  3SER A;  3OO6 A;  4M1V A;  4F1V A;  4N15 A;  4IR8 A;  1USY E;  2R71 A;  2XD2 A;  3CG1 A;  1T0K A;  2QVV A;  3MUQ A;  1ANF A;  3Q29 A;  3IFA A;  5EHS A;  3KN3 A;  3TQL A;  3T66 A;  1CE2 A;  5AA4 B;  5H8Q A;  2QS3 A;  4GWW A;  3KC1 A;  2GHB A;  4G2Z A;  1DOT A;  2AL5 A;  4FEC A;  1IMC A;  1MM7 A;  1IIW A;  1P1U A;  5A5L A;  3S9L C;  2REJ A;  1IMB A;  1QUI A;  4HTG A;  1H45 A;  3PPQ A;  3W9W A;  4POW A;  3KFM A;  1MY0 A;  3CSB A;  4R75 A;  1A40 A;  3E9X A;  3CHG A;  1NV1 A;  2Y5K A;  4F19 A;  4LZ7 A;  4XKR A;  3O6G A;  1LAF E;  4YB7 A;  5I3S A;  1DPP A;  2RC8 A;  4QSE A;  4FAT A;  4AS4 A;  3R7X A;  1B40 A;  4N13 A;  3LSX A;  4RY1 A;  3K0V A;  3L6H A;  4NWD A;  2XXV A;  4XF5 A;  4IO4 A;  1URS A;  2P0S A;  4BDO A;  1D9Y A;  3WAE A;  4H5G A;  5ET8 A;  1N04 A;  3VLU A;  4FE8 A;  4OEV A;  4PDD A;  3HHF A;  3SDF A;  1JVX A;  3MYU A;  1H3D A;  1SD3 A;  1FBH A;  1MQD A;  2NWJ A;  5ET6 A;  2X26 A;  3G3F A;  5CMB A;  4WXJ A;  1IXG A;  3T0J A;  5CC2 A;  1LBB A;  1PBP A;  2Y7P A;  3OMB A;  4JDF A;  3MVW A;  2DXY A;  1QVS A;  4F1U A;  3BBR A;  2CZI A;  2V3U A;  4PAF A;  2VPN A;  1UQW A;  1Q9D A;  3Q27 A;  1XC1 A;  1LAG E;  1D4N A;  2UYE A;  3GYY A;  4NTL A;  4PTK A;  4P1L A;  1YAE A;  2HQ0 A;  4U22 A;  4QSD A;  4OWD A;  3RGY A;  1JET A;  4GLI A;  1NV3 A;  2HAU A;  4N6K A;  4XKN A;  1Y20 A;  1NH7 A;  2F36 A;  3ISP A;  2B4L A;  3EF7 A;  1B7Z A;  3TMG A;  5I59 A;  4ND9 A;  4N81 A;  4NN3 A;  1PB8 A;  1QGX A;  4NF8 B;  3K6X A;  3EHS A;  4PQJ A;  4DXC A;  3V89 B;  3PTY A;  1B32 A;  3IOT A;  1OQG A;  3TTL A;  4O94 A;  2XXR A;  2OWS A;  1GR2 A;  1LBW A;  2QSX A;  2I58 A;  2I0B A;  3G3H A;  4RYA A;  4GX4 A;  5IGA A;  1FQD A;  1Y1M A;  1XOC A;  1FTK A;  1LAX A;  5AA1 A;  1MY1 A;  3MBP A;  4IGT A;  2OZZ A;  3IB1 A;  1NV4 A;  1VDW A;  5TP9 A;  4X1B A;  3MST A;  5ET5 A;  2GRV A;  2RC7 A;  1RDZ A;  2OWT A;  3MZ9 A;  4GXS B;  5L9O A;  3B8B A;  2GQ1 A;  3H6W A;  1JEV A;  1FQA A;  1FPL A;  1VFD A;  1Y9U A;  1B3G A;  3FJM A;  3RPW A;  1H43 A;  4H46 A;  2O7I A;  5EQ8 A;  1G0H A;  2KR0 A;  1MH3 A;  3Q26 A;  2DE2 A;  1H44 A;  1EZO A;  4GBV A;  3D4C A;  1NNK A;  4YIC A;  3PMV A;  3HCQ A;  4HE0 A;  3FV1 A;  3T96 B;  2B4M A;  3E4R A;  1LFG A;  3KG2 A;  1DBZ A;  3ILT B;  4DI3 D;  1Y3N A;  1US5 A;  1PBQ A;  4GFR A;  4YKK A;  2QL3 A;  4G77 A;  5L8D A;  5AA4 A;  4I40 A;  1CB6 A;  5K2X A;  1A55 A;  4OER A;  2V3Q A;  1Z7M E;  2O68 A;  2Z8D A;  2W7Y A;  4MCO A;  4OEN A;  4P11 A;  3TDJ A;  2M8C A;  4JWX A;  4OVS A;  2XXW A;  1BK4 A;  1TFA A;  3O97 A;  4FAJ A;  5FHN A;  3O29 A;  4GL8 A;  1FCK A;  2UVG A;  3IJO B;  2OCU A;  4KHZ E;  4LAT A;  4LN5 A;  4OET A;  3K00 A;  4NG7 A;  3THI A;  4Q8R A;  3OEL A;  5I2K B;  5H8H B;  2V25 A;  1O7T A;  3H03 A;  3A29 A;  1AWB A;  2D3I A;  4R6Y A;  3FJ7 A;  2WEF A;  5DYH A;  4GX3 A;  2HZK A;  3IL1 B;  3IB2 A;  3LC8 A;  4KYE A;  2D21 A;  4PF6 A;  3QK6 A;  4F3B A;  3OO9 A;  1K9Y A;  3OO8 A;  1VR5 A;  2GHA A;  2JJK A;  2RF1 A;  3OD7 A;  3GBB A;  4MH5 A;  4KI0 E;  2PBW A;  4U4S A;  3T22 A;  4PFT A;  4IY5 A;  4ZED A;  3SEV A;  4H1X A;  5K2Y A;  2I6E A;  1IEJ A;  4MLQ A;  4N8G A;  3RQT A;  4THI A;  4ESX A;  2F34 A;  1UTH B;  4EQ9 A;  3IR1 A;  2CZH A;  1UIV A;  4RA1 A;  2F3D A;  4BDM A;  3D1R A;  4LZ5 A;  4JWO A;  4PP0 A;  1DTZ A;  1MDP 1;  2F78 A;  5EQ9 A;  3KC0 A;  3I3V A;  2V3T A;  4FED A;  4P1E A;  4XIG Q;  3CRB A;  3C34 A;  3PPR A;  1MM6 A;  4GX6 A;  2I3W A;  3UK4 A;  5ICQ A;  1M5C A;  1LBY A;  1WOD A;  1ZTY A;  1ZU0 A;  1JW4 A;  2HFB A;  3A09 A;  1DCU A;  3MP6 A;  5EYG A;  1N76 A;  2XD3 A;  4IY6 A;  4XEQ A;  1XI6 A;  1BTJ A;  4AQ4 A;  1FRP A;  3IK6 B;  4YKJ A;  1NMU A;  5IZ1 A;  1FBG A;  4R6H A;  3MAM A;  2OJT A;  5AA2 B;  2PFY A;  4OFL A;  1FPG A;  5KCJ A;  2HXW A;  2R6G E;  4UAB A;  4NF4 B;  2QS1 A;  1IUD A;  2Q8M A;  3W9V A;  3MWB A;  3TTM A;  5A5X B;  4NF8 A;  4DI4 B;  5JEI A;  2WYK A;  3AXF A;  2VT5 A;  4IO5 A;  1B6H A;  1SDX A;  4RK2 A;  1XVY A;  3N6U A;  3G3J A;  3C4M A;  2X7Q A;  4GWX A;  3U65 A;  5KZT A;  1B4H A;  1MY4 A;  1NH8 A;  1SI0 A;  2OLB A;  4LUB A;  5F7V A;  4ZE9 A;  3T93 B;  2I49 A;  4FBP A;  4Q5T A;  2ZYO A;  2VD2 A;  1P99 A;  4FJP A;  3OSQ A;  1ZKB A;  4GL0 A;  4WED A;  4AB6 A;  5FHM A;  4NHB A;  4O3B A;  2VOZ A;  3WAF A;  4Q30 B;  2QVU A;  1YXI A;  4GQO A;  2BJI A;  3QUF A;  1Y3P A;  5KDT B;  1H76 A;  4N91 A;  2QPQ A;  1EU8 A;  2QMX A;  2A5T B;  1B1H A;  2OX3 A;  1N7X A;  3PUZ E;  5TPA B;  4QFO A;  2ONR A;  4OVQ A;  1FBF A;  4OQO A;  3GZG A;  3LUZ A;  2ZZW A;  3T9X B;  3CG3 A;  1MH4 A;  2XA5 A;  3E13 X;  1XT8 A;  1MXW A;  4ELO A;  3QUJ A;  3HN0 A;  1EZ9 A;  1KA1 A;  3VVE A;  4ZZA A;  1SI1 A;  1M5F A;  4R6K A;  2QRY A;  3QYT A;  5DW8 A;  2XXP A;  4R72 A;  1NUW A;  1JNF A;  3EKI A;  1LCT A;  1SW5 A;  2QJE A;  4POX A;  3MVZ A;  3IB0 A;  1QKA A;  4F39 A;  3S2V A;  1QUL A;  3RLF E;  4N17 A;  3SES A;  2ALU A;  1II5 A;  2CZK A;  2HZL A;  1USY H;  4ZEF A;  5CM6 A;  4HCY A;  3CFL A;  2XXU A;  2Y5L A;  2NXO A;  4PFU A;  5F24 A;  3FVK A;  3I5O A;  2FVZ A;  2O51 A;  2Y7R A;  1YCJ A;  4YKP A;  3TUS A;  4DIG A;  4QBA A;  4MNP A;  4C0R A;  3FIR A;  2I48 A;  4PE5 B;  4X48 A;  1VFE A;  4Z7E A;  3JZJ A;  3FBP A;  3IO4 A;  2DWA A;  4ECF A;  2O1L A;  3MVX A;  1MY2 A;  4NF6 B;  4OAN A;  2FHY A;  3V5A A;  2F7C A;  3JV9 A;  5I2K A;  5H8H A;  1URG A;  1F9B A;  1MPB A;  4H65 A;  4X8R A;  4BDL A;  4I3Y A;  1Q1K A;  4PFY A;  4KYD A;  1AIV A;  3N5L A;  2A5S A;  1LEV A;  4TOZ A;  2ZNU A;  3GBA A;  5FTH A;  4MBP A;  2DYX A;  5FTI A;  4LON B;  3DP4 A;  3K1N A;  2PYY A;  2KLF A;  4BDR A;  3KJ7 A;  2CEY A;  1QJM A;  1MXU A;  3N6T A;  4PDH A;  3PMX A;  3TFL A;  1UTH A;  1YYZ A;  3BIH A;  3MP1 A;  1IXI A;  4H6D A;  1NV2 A;  5M2V A;  4F31 B;  4GIZ A;  1MG1 A;  3IOR A;  1FQF A;  1XS5 A;  4R9F A;  3V8X B;  1ELJ A;  4IO2 A;  1M5D A;  4MHF A;  5ESY A;  4OVP A;  3TTK A;  4F22 A;  4PGP A;  4PC9 A;  4RXL A;  3BFT A;  1IQ7 A;  4X04 A;  2I3V A;  3MPL A;  4Q0C A;  3S9E A;  1S7Y A;  2XXH A;  4TLM B;  4YMA A;  4H8J A;  5LDZ A;  3DLN A;  1CNQ A;  2Z8F A;  1LLS A;  4GWZ A;  3B50 A;  4P56 A;  5EYF A;  3EN3 A;  1B7H A;  4OMB A;  1PC3 A;  3QMF A;  3PV0 E;  3FXR A;  4EQ7 A;  4JSO A;  1INP A;  5FBP A;  5AA2 A;  1WVJ A;  4LP2 B;  1I6Q A;  4G4P A;  4O7M A;  5I58 B;  4F2Q A;  3OEK A;  4G61 A;  2CEX A;  2HXR A;  4ELQ A;  1ZBM A;  2XXT A;  4IO3 A;  1D9V A;  4NF4 A;  3JYR A;  4F1Y A;  4ZE8 A;  4X9T A;  1B3F A;  4PGN A;  3E79 A;  3L6G A;  4EF1 A;  5A5X A;  2FA7 A;  1NUZ A;  1IXH A;  3CIJ A;  1NV7 A;  3V83 A;  4IO7 A;  2Q2C A;  1I6A A;  2G93 A;  3C36 A;  5I84 A;  5IKB A;  3KN7 A;  1IZ1 A;  3KBZ A;  3QIM A;  4I3E A;  4C1U A;  2P3V A;  3BFU A;  3TCF A;  4NF0 A;  5ITO A;  3K6V A;  4E0W A;  1OVB A;  1LB8 A;  3DP6 A;  1FTO A;  5DEX B;  1ZJL A;  2KQZ A;  4H5F A;  3M3L A;  1LAH E;  4YMB A;  4OVR A;  1YZ0 A;  3KOT A;  3Q25 A;  3TOD A;  1NI9 A;  2Q2A A;  3KZG A;  4I8C A;  2DP8 A;  4O7I A;  5LTC A;  3BKI B;  4JSD A;  4LVQ A;  2X7P A;  3BIG A;  1GGG A;  1ZLQ A;  4FIM A;  4U21 A;  1FW0 A;  3IJX B;  4U4X A;  4QSC A;  3PMW A;  5KDT A;  3HFU A;  1A8E A;  2QS4 A;  4UA8 A;  1JQF A;  2Q88 A;  2A5T A;  1N7W A;  4EDP A;  2ESN A;  4P8B A;  4R9G A;  4OTE A;  5TPA A;  4OES A;  1MQI A;  3U94 A;  2Z22 A;  4PAI A;  2D5W A;  3H4Z A;  1NFT A;  4KCC A;  2WBD A;  5HBC A;  3SZP A;  1FBE A;  4JXI A;  2H4I A;  3FAS A;  4QHQ A;  1NL5 A;  3C35 A;  3NOH A;  1R9L A;  3DEL B;  1MQH A;  2E1S A;  3RPL B;  4QF9 A;  3T1B A;  5CMC A;  2O84 X;  1PB9 A;  1FQE A;  5HPQ A;  4PFI A;  4GD5 A;  2QS2 A;  3OEM A;  4O3C A;  3OXN A;  3TPA A;  3RTF B;  1IMD A;  1JW5 A;  2QMW A;  3C33 A;  4R2F A;  3K1P A;  4NF5 B;  4YB5 A;  2FNC A;  3O2A A;  2XWI A;  4NMY A;  1FJ6 A;  4LA9 A;  1O64 A;  4F2O A;  5T3J A;  3EPE A;  2F97 A;  1TWY A;  3DP8 A;  1MDQ A;  4XKQ A;  2VPO A;  3C32 A;  1IXC A;  5I2N B;  2GFE A;  3B6T A;  2Z23 A;  1SQY A;  2ANJ A;  1FTL A;  4H45 A;  3CFX A;  3G3I A;  4GWO A;  4KR5 A;  3FXQ A;  1EYK A;  3HPI A;  4RK9 A;  3TCH A;  3LR1 A;  5I57 B;  3PD8 A;  4PAK A;  4JVI A;  1POY 1;  4NED A;  4WKM A;  4NF6 A;  4OVT A;  2NVU B;  3N94 A;  1FBC A;  4NE4 A;  2H5Y A;  4NAP A;  4KXP A;  2RCA A;  3ZSF A;  2XWK A;  1BKA A;  2DE4 A;  3VXC A;  4ESW A;  2ZYK A;  2R9J A;  1AH5 A;  1B5J A;  4OYV A;  4N8Y A;  2VHA A;  4BLA A;  3VLW A;  3RYD A;  1NNP A;  3IO6 A;  3TQW A;  3VVF A;  3VXB A;  2B65 A;  3GLB A;  3FVO A;  2CZL A;  1S9T A;  3RNN A;  4OA4 A;  2REG A;  4OFJ A;  3M8U A;  2F6G A;  2XX9 A;  3B6Q A;  1QUK A;  1B3L A;  5BUU A;  4G68 B;  1FPJ A;  1WDN A;  2DWJ A;  1AMF A;  3D4G A;  1MS7 A;  1QKB A;  4TLL B;  1FQC A;  4ISU A;  2IEE A;  2F35 A;  5ET7 A;  3MJN A;  5I56 B;  1MPC A;  2MKZ A;  4DXB A;  2Q9T A;  1B1X A;  1B9J A;  1N3W A;  2ONS A;  1HSJ A;  3QSL A;  1YTV A;  5DVI A;  4EXK A;  4DLD A;  3K1M A;  2UVJ A;  3S4U A;  3CI8 A;  3O28 A;  4PFB A;  4U23 A;  4O3A A;  2R8T A;  4RPN A;  4P0G A;  1B05 A;  2XWV A;  1KA0 A;  2XX8 A;  3C31 A;  2Q74 A;  3T9U A;  4YU0 A;  2P3N A;  3ILU B;  2WBB A;  2WX9 A;  1GTK A;  5L9M A;  4FEB A;  3TTN A;  3O9P A;  2V84 A;  5EHM A;  3G3G A;  4L17 A;  3K02 A;  1B58 A;  1SW4 A;  1B4Z A;  3F11 A;  1SBP A;  4F3G A;  5I58 A;  2F5X A;  3EQ1 A;  4H67 A;  1FBD A;  3UGW A;  1D3K A;  3UP9 A;  2ZYM A;  4PE3 A;  3PPP A;  2IA4 A;  5DVF A;  5EYH A;  3VV5 A;  3LBS A;  2UVI A;  3UA8 A;  2DQV A;  2FBP A;  3OOA A;  4I1D A;  4LQ2 A;  2VP1 A;  5DTB A;  4ZEK A;  3FZV A;  2NUV A;  1LBV A;  1MPD A;  2HCA A;  5DEX A;  2XWO A;  3W15 C;  4MFI A;  4OXV A;  1JP4 A;  4UAC A;  4ELR A;  2XXK A;  3O6H A;  3FVN A;  5IZ3 B;  4OHN A;  3FD3 A;  2H9B A;  2F6P A;  2G29 A;  3TZA A;  1UTB B;  4R73 A;  1OLC A;  1GV8 A;  5TU0 A;  2P1S A;  2BJJ X;  2GH9 A;  1MRP A;  2WKY A;  4MNC A;  4HW8 A;  5IZZ A;  4OVJ A;  4R2B A;  3VDF A;  1I6B A;  3MQ9 A;  1VE4 A;  2I0C A;  2L5V A;  1YPN A;  3USD A;  5JK4 A;  3EHU A;  4AS5 A;  1D9Q A;  3U93 A;  2DVC A;  1FJ9 A;  3H3G A;  3GXA A;  4G8N A;  4QFP A;  3M3K A;  5DVJ A;  3FGS A;  3VFJ A;  5H8F B; 
#chains in the Genus database with same CATH homology
 3FVG A;  1B52 A;  4KPT A;  5CRY A;  4IO6 A;  1HSE A;  4ELP A;  2OK2 A;  3SET A;  2ZXT A;  4ZEC A;  1IIT A;  1B5I A;  3TAJ A;  1BP5 A;  5B70 A;  1B51 A;  3O66 A;  4G68 C;  3KSJ A;  4HS7 A;  1SVX B;  4NF5 A;  1Y4T A;  2DOJ A;  4QFK A;  1RYX A;  4EQB A;  4X1D A;  4RPO A;  5JTY B;  1N0T A;  1ZIU A;  2H98 A;  1JW1 A;  3RUM A;  3PUV E;  5I2N A;  3VVD A;  4ZEI A;  2DWI A;  1QW0 A;  3TYH A;  5I57 A;  3MZB A;  1LFH A;  2H99 A;  2F7B A;  3U8Q A;  3LSF B;  1FTM A;  1MQJ A;  4YZZ A;  4LZ8 A;  1LB9 A;  4OZ9 A;  5ITP A;  5CBS A;  5AA2 D;  1FQB A;  3KGC A;  2V93 A;  4I9D A;  1JEU A;  5ELV A;  1BLF A;  3MVY A;  3KJT A;  4DXU A;  3RN8 A;  2UYF A;  1P1W A;  3U1O A;  1B2H A;  5H8S A;  4GXA A;  3SEW A;  2UVH A;  1OMP A;  1URD A;  4I62 A;  4G68 A;  1B7U A;  4C1T A;  5AA3 A;  1A54 A;  5L9S A;  4QFN A;  3TEL A;  5HM4 B;  4BDN A;  5I56 A;  3U72 A;  4GOT A;  1Y1Z A;  3A3C A;  2PT1 A;  1B3H A;  3K6W A;  3OO7 A;  1QUJ A;  2RIN A;  1LBC A;  1J1N A;  1ATG A;  1LCF A;  2E0S A;  1PB7 A;  3LUY A;  1A8F A;  3SEY A;  2LAO A;  4DCX A;  3HST A;  2ABH A;  4U1O A;  3IOV A;  1PDA A;  4GF8 A;  3PU5 A;  3OEN A;  1OIB A;  3KBR A;  5H8N B;  1SW2 A;  3IOW A;  1PEB A;  1P1Q A;  4XKP A;  5KCJ B;  3HO7 A;  1LST A;  3SEU A;  5DT6 A;  4MF3 A;  3CFZ A;  4IB2 A;  3CSG A;  3B6W A;  2B3B A;  3B7D A;  3CR9 A;  1DPE A;  1NKX A;  3U92 A;  3RTW B;  1B5H A;  3PD9 A;  2Y7W A;  2ZNS A;  2DXR A;  3FV2 A;  1M5E A;  2CMO A;  2XXY A;  1LGB C;  1MXY A;  4KYS A;  3RY3 A;  3TKD A;  4U2R A;  2THI A;  2ZMB A;  2Y84 A;  1N84 A;  1FTJ A;  3EHT A;  1UTB A;  1GVC A;  5B7D A;  2RKM A;  3H06 B;  3UN6 A;  4N6P A;  1OQH A;  2DSF A;  5CI5 A;  2ZNT A;  2YPN A;  4P0I A;  3IOU A;  4XXU A;  1HSL A;  3OSR A;  1Y4C A;  3KN8 A;  1RKM A;  4OFO A;  2PX1 A;  4E0X A;  3K01 A;  4GVO A;  4KQP A;  2YLN A;  4F29 A;  5H8F A;  3H7M A;  3QXM A;  3PPN A;  1P1O A;  5ICT A;  1TFD A;  4F3S A;  1NNT A;  3IAZ A;  5H8Q B;  3VE1 B;  4MLV A;  1ZMG A;  4TQU Q;  1DTG A;  1MXV A;  3A3U A;  4ZS9 A;  3PUX E;  3SKP A;  1Z7N E;  3RT6 B;  2AYS A;  4RNS A;  1B0H A;  3LSL A;  2NOO A;  1BIY A;  3Q28 A;  1XVX A;  1I69 A;  2XHD A;  4ZDM A;  2VD3 A;  3E3K A;  3PGF A;  4IGR A;  4AB5 A;  3R26 A;  2O6A A;  1DSN A;  3MC2 A;  2P2A A;  5JTY A;  1VSO A;  2DVZ A;  3MZ1 A;  2XXI A;  3MP8 A;  1B0L A;  2AL4 A;  4N07 A;  2Z8E A;  3FJG A;  2RCB A;  1EZP A;  2AIX A;  4KD5 A;  3T9H B;  4H0W A;  4GRK A;  3FXU A;  4ONY A;  2O69 A;  3N26 A;  5AE4 A;  4F3P A;  1OLA A;  3H6V A;  4DCY A;  2VGQ A;  2PMS A;  3O6I A;  1SW1 A;  2ONK E;  4EF2 A;  1R9Q A;  2XXX A;  3S9N C;  3HV1 A;  3MPK A;  4YKI A;  4PET A;  4YAH X;  4WEP A;  3K4U A;  4Z0I A;  2XX7 A;  4H8I A;  4LQ5 A;  2DWH A;  1TT1 A;  1UIU A;  2Q8J A;  3KOS A;  1JVY A;  1SYI A;  3ECR A;  4DE8 A;  3K6U A;  1NNF A;  1S50 A;  2DE3 A;  3SEX A;  4ZZE A;  3RT8 A;  3TEP A;  3LSW A;  4JB7 A;  1Y3Q A;  1US4 A;  5CBR A;  5FHO A;  1B3E A;  3FUZ A;  2XXQ A;  2RC9 A;  3H6U A;  2DS9 A;  3ZKL A;  3T9V A;  4PFW A;  1MXZ A;  3PUW E;  3VLV A;  5ISU A;  2F7A A;  5LOM A;  2B3F A;  3ODB A;  4KCD A;  3ZKK A;  4FOR A;  1Q35 A;  4HCW A;  3H6T A;  4EUO A;  5CMK A;  1A7L A;  4OEU A;  4JWY A;  1R6Z A;  4XTC Q;  3C9H A;  5H8N A;  4K3F A;  3TTR A;  2Y7K A;  3I6V A;  3ONM A;  1XHY A;  5I59 B;  4DZ1 A;  4G8M A;  1A99 A;  1L5T A;  5BWJ A;  3MW0 A;  4U1Z A;  3G3K A;  5IAI A;  1OVT A;  2HAV A;  1KWH A;  3KEI A;  1MY3 A;  5F1Q A;  3K2D A;  4EXL A;  4RJZ A;  3R6U A;  3FAT A;  3HHG A;  3PPO A;  1N3X A;  1P1N A;  1AOV A;  3G7W A;  2Q89 A;  3QAX A;  1M5B A;  2Y7I A;  1B46 A;  1R1N A;  1MXX A;  3PUY E;  3M3F A;  1RYO A;  3UIF A;  5TP9 B;  2PVU A;  4YB6 A;  1O63 A;  1SYH A;  4NWC A;  2HEU A;  4BDQ A;  4F18 A;  4KFQ A;  3KSX A;  1TXF A;  3P7I A;  5J1D A;  1AL3 A;  3ZS6 A;  2I4C A;  2YJP A;  2F8D A;  4ZEB A;  1EH3 A;  1MQG A;  5CMM A;  2UXA A;  3IX1 A;  3DM0 A;  1LFI A;  4M4G A;  4R74 A;  4JBZ A;  2I4B A;  2H25 A;  2O1M A;  2PT2 A;  1DMB A;  3CVG A;  3UOR A;  4QRZ A;  4G8H A;  1POT A;  2O7U A;  3S9M C;  2FYI A;  3TCG A;  4QFL A;  4DDD A;  2ZYN A;  2OBG A;  3SER A;  3OO6 A;  4M1V A;  4F1V A;  1USY E;  2R71 A;  2XD2 A;  3CG1 A;  1T0K A;  3MUQ A;  1ANF A;  3Q29 A;  5EHS A;  3KN3 A;  3TQL A;  3T66 A;  1CE2 A;  5AA4 B;  5H8Q A;  2QS3 A;  2GHB A;  4G2Z A;  1DOT A;  2AL5 A;  4FEC A;  1MM7 A;  1IIW A;  1P1U A;  3S9L C;  2REJ A;  1QUI A;  4HTG A;  1H45 A;  3PPQ A;  3W9W A;  4POW A;  3KFM A;  1MY0 A;  3CSB A;  4R75 A;  1A40 A;  3E9X A;  4F19 A;  4LZ7 A;  4XKR A;  3O6G A;  1LAF E;  4YB7 A;  1DPP A;  2RC8 A;  4QSE A;  4FAT A;  3R7X A;  1B40 A;  4N13 A;  3LSX A;  4RY1 A;  3K0V A;  3L6H A;  4NWD A;  2XXV A;  4IO4 A;  1URS A;  2P0S A;  4BDO A;  1D9Y A;  3WAE A;  4H5G A;  1N04 A;  3VLU A;  4FE8 A;  4OEV A;  3HHF A;  3SDF A;  1JVX A;  1H3D A;  1SD3 A;  1MQD A;  2NWJ A;  2X26 A;  3G3F A;  5CMB A;  4WXJ A;  1IXG A;  5CC2 A;  1LBB A;  1PBP A;  2Y7P A;  3OMB A;  4JDF A;  3MVW A;  2DXY A;  1QVS A;  4F1U A;  3BBR A;  2V3U A;  1UQW A;  3Q27 A;  1XC1 A;  1LAG E;  1D4N A;  2UYE A;  4NTL A;  1YAE A;  2HQ0 A;  4U22 A;  4QSD A;  4OWD A;  3RGY A;  1JET A;  4GLI A;  2HAU A;  4XKN A;  1Y20 A;  1NH7 A;  2F36 A;  3EF7 A;  1B7Z A;  3TMG A;  5I59 A;  4ND9 A;  1PB8 A;  4NF8 B;  3K6X A;  3EHS A;  4PQJ A;  4DXC A;  3V89 B;  1B32 A;  3IOT A;  1OQG A;  3TTL A;  2XXR A;  2OWS A;  1GR2 A;  2QSX A;  2I58 A;  2I0B A;  3G3H A;  4RYA A;  1FQD A;  1Y1M A;  1XOC A;  1FTK A;  1LAX A;  5AA1 A;  1MY1 A;  3MBP A;  4IGT A;  2OZZ A;  3IB1 A;  5TP9 A;  4X1B A;  2GRV A;  2RC7 A;  2OWT A;  3MZ9 A;  4GXS B;  5L9O A;  3H6W A;  1JEV A;  1FQA A;  1VFD A;  1Y9U A;  1B3G A;  3FJM A;  3RPW A;  1H43 A;  2O7I A;  1MH3 A;  3Q26 A;  2DE2 A;  1H44 A;  1EZO A;  3D4C A;  1NNK A;  4YIC A;  3PMV A;  3HCQ A;  3FV1 A;  3T96 B;  3E4R A;  1LFG A;  3KG2 A;  3ILT B;  1Y3N A;  1US5 A;  1PBQ A;  4GFR A;  4YKK A;  2QL3 A;  4G77 A;  5L8D A;  5AA4 A;  1CB6 A;  5K2X A;  1A55 A;  4OER A;  2V3Q A;  1Z7M E;  2O68 A;  2Z8D A;  2W7Y A;  4OEN A;  4P11 A;  3TDJ A;  2M8C A;  4JWX A;  2XXW A;  1TFA A;  3O97 A;  4FAJ A;  5FHN A;  3O29 A;  4GL8 A;  1FCK A;  2UVG A;  3IJO B;  2OCU A;  4KHZ E;  4LAT A;  4OET A;  3K00 A;  3THI A;  4Q8R A;  3OEL A;  5I2K B;  5H8H B;  2V25 A;  1O7T A;  3H03 A;  4R6Y A;  2D3I A;  3FJ7 A;  5DYH A;  2HZK A;  3IL1 B;  3IB2 A;  3LC8 A;  4KYE A;  2D21 A;  3QK6 A;  4F3B A;  3OO9 A;  3OO8 A;  1VR5 A;  2GHA A;  2RF1 A;  3OD7 A;  3GBB A;  4MH5 A;  4KI0 E;  2PBW A;  4U4S A;  3T22 A;  4PFT A;  4IY5 A;  4ZED A;  3SEV A;  4H1X A;  5K2Y A;  2I6E A;  1IEJ A;  4MLQ A;  3RQT A;  4THI A;  4ESX A;  2F34 A;  1UTH B;  4EQ9 A;  3IR1 A;  1UIV A;  4RA1 A;  4BDM A;  4LZ5 A;  4JWO A;  4PP0 A;  1DTZ A;  1MDP 1;  2F78 A;  3I3V A;  2V3T A;  4FED A;  4XIG Q;  3CRB A;  3C34 A;  3PPR A;  1MM6 A;  2I3W A;  3UK4 A;  5ICQ A;  1M5C A;  1WOD A;  1ZTY A;  1ZU0 A;  1JW4 A;  2HFB A;  3A09 A;  3MP6 A;  1N76 A;  2XD3 A;  4IY6 A;  4AQ4 A;  1BTJ A;  3IK6 B;  4YKJ A;  1NMU A;  4R6H A;  3MAM A;  2OJT A;  5AA2 B;  4OFL A;  5KCJ A;  2HXW A;  2R6G E;  4NF4 B;  2QS1 A;  1IUD A;  3W9V A;  3MWB A;  3TTM A;  5A5X B;  4NF8 A;  5JEI A;  3AXF A;  4IO5 A;  1B6H A;  1SDX A;  4RK2 A;  1XVY A;  3N6U A;  3G3J A;  3C4M A;  2X7Q A;  5KZT A;  1B4H A;  1MY4 A;  1NH8 A;  1SI0 A;  2OLB A;  4LUB A;  5F7V A;  4ZE9 A;  3T93 B;  2I49 A;  4Q5T A;  2ZYO A;  2VD2 A;  1P99 A;  4FJP A;  3OSQ A;  1ZKB A;  4GL0 A;  4WED A;  4AB6 A;  5FHM A;  4O3B A;  2VOZ A;  3WAF A;  4Q30 B;  4GQO A;  3QUF A;  1Y3P A;  5KDT B;  1H76 A;  2QPQ A;  1EU8 A;  2QMX A;  2A5T B;  1B1H A;  1N7X A;  3PUZ E;  5TPA B;  4QFO A;  2ONR A;  4OQO A;  3GZG A;  3T9X B;  3CG3 A;  1MH4 A;  3E13 X;  1XT8 A;  1MXW A;  4ELO A;  3QUJ A;  3HN0 A;  1EZ9 A;  3VVE A;  4ZZA A;  1SI1 A;  1M5F A;  4R6K A;  2QRY A;  3QYT A;  2XXP A;  4R72 A;  1JNF A;  1LCT A;  1SW5 A;  2QJE A;  4POX A;  3MVZ A;  3IB0 A;  1QKA A;  4F39 A;  3S2V A;  1QUL A;  3RLF E;  3SES A;  2ALU A;  1II5 A;  2HZL A;  1USY H;  4ZEF A;  5CM6 A;  4HCY A;  3CFL A;  2XXU A;  2NXO A;  4PFU A;  3FVK A;  3I5O A;  2O51 A;  2Y7R A;  1YCJ A;  4YKP A;  3TUS A;  4DIG A;  4C0R A;  3FIR A;  2I48 A;  4PE5 B;  4X48 A;  1VFE A;  4Z7E A;  3JZJ A;  3IO4 A;  2DWA A;  4ECF A;  2O1L A;  3MVX A;  1MY2 A;  4NF6 B;  3V5A A;  2F7C A;  3JV9 A;  5I2K A;  5H8H A;  1URG A;  1F9B A;  1MPB A;  4H65 A;  4BDL A;  1Q1K A;  4PFY A;  4KYD A;  1AIV A;  3N5L A;  2A5S A;  4TOZ A;  2ZNU A;  3GBA A;  5FTH A;  4MBP A;  2DYX A;  5FTI A;  4LON B;  3DP4 A;  3K1N A;  2PYY A;  2KLF A;  4BDR A;  3KJ7 A;  1QJM A;  1MXU A;  3N6T A;  3PMX A;  3TFL A;  1UTH A;  3MP1 A;  1IXI A;  4H6D A;  5M2V A;  4F31 B;  4GIZ A;  1MG1 A;  3IOR A;  1FQF A;  1XS5 A;  4R9F A;  3V8X B;  1ELJ A;  4IO2 A;  1M5D A;  3TTK A;  4F22 A;  4RXL A;  3BFT A;  1IQ7 A;  2I3V A;  3MPL A;  4Q0C A;  3S9E A;  1S7Y A;  2XXH A;  4TLM B;  4YMA A;  4H8J A;  3DLN A;  2Z8F A;  1LLS A;  5EYF A;  3EN3 A;  1B7H A;  4OMB A;  1PC3 A;  3PV0 E;  3FXR A;  4EQ7 A;  4JSO A;  5AA2 A;  1WVJ A;  4LP2 B;  1I6Q A;  4G4P A;  5I58 B;  4F2Q A;  3OEK A;  4ELQ A;  1ZBM A;  2XXT A;  4IO3 A;  1D9V A;  4NF4 A;  3JYR A;  4F1Y A;  4ZE8 A;  4X9T A;  1B3F A;  3L6G A;  4EF1 A;  5A5X A;  2FA7 A;  1IXH A;  3CIJ A;  3V83 A;  4IO7 A;  2Q2C A;  1I6A A;  2G93 A;  3C36 A;  5I84 A;  5IKB A;  3KN7 A;  1IZ1 A;  3QIM A;  4C1U A;  3BFU A;  3TCF A;  5ITO A;  3K6V A;  4E0W A;  1OVB A;  1LB8 A;  3DP6 A;  1FTO A;  5DEX B;  1ZJL A;  4H5F A;  3M3L A;  1LAH E;  4YMB A;  3KOT A;  3Q25 A;  3TOD A;  2Q2A A;  3KZG A;  4I8C A;  2DP8 A;  3BKI B;  4JSD A;  4LVQ A;  2X7P A;  1GGG A;  1ZLQ A;  4FIM A;  4U21 A;  1FW0 A;  3IJX B;  4U4X A;  4QSC A;  3PMW A;  5KDT A;  1A8E A;  2QS4 A;  4UA8 A;  1JQF A;  2Q88 A;  2A5T A;  1N7W A;  4EDP A;  2ESN A;  4R9G A;  4OTE A;  5TPA A;  4OES A;  1MQI A;  3U94 A;  2Z22 A;  2D5W A;  3H4Z A;  1NFT A;  4KCC A;  5HBC A;  4JXI A;  2H4I A;  3FAS A;  4QHQ A;  1NL5 A;  3C35 A;  1R9L A;  3DEL B;  1MQH A;  2E1S A;  4QF9 A;  5CMC A;  2O84 X;  1PB9 A;  1FQE A;  5HPQ A;  4GD5 A;  2QS2 A;  3OEM A;  4O3C A;  3OXN A;  3TPA A;  3RTF B;  1JW5 A;  2QMW A;  3C33 A;  4R2F A;  3K1P A;  4NF5 B;  4YB5 A;  2FNC A;  3O2A A;  4NMY A;  4LA9 A;  1O64 A;  4F2O A;  3EPE A;  2F97 A;  1TWY A;  3DP8 A;  1MDQ A;  4XKQ A;  3C32 A;  1IXC A;  5I2N B;  2GFE A;  3B6T A;  2Z23 A;  1SQY A;  2ANJ A;  1FTL A;  3CFX A;  3G3I A;  4GWO A;  4KR5 A;  3FXQ A;  3HPI A;  4RK9 A;  3TCH A;  3LR1 A;  5I57 B;  3PD8 A;  1POY 1;  4NED A;  4WKM A;  4NF6 A;  2NVU B;  3N94 A;  4NE4 A;  2H5Y A;  2RCA A;  3ZSF A;  1BKA A;  2DE4 A;  3VXC A;  4ESW A;  2ZYK A;  2R9J A;  1AH5 A;  1B5J A;  4OYV A;  2VHA A;  4BLA A;  3VLW A;  1NNP A;  3IO6 A;  3TQW A;  3VVF A;  3VXB A;  2B65 A;  3GLB A;  3FVO A;  2CZL A;  1S9T A;  3RNN A;  2REG A;  4OFJ A;  3M8U A;  2F6G A;  2XX9 A;  3B6Q A;  1QUK A;  1B3L A;  5BUU A;  4G68 B;  1WDN A;  2DWJ A;  1AMF A;  3D4G A;  1MS7 A;  1QKB A;  4TLL B;  1FQC A;  4ISU A;  2IEE A;  2F35 A;  3MJN A;  5I56 B;  1MPC A;  4DXB A;  2Q9T A;  1B1X A;  1B9J A;  1N3W A;  2ONS A;  1HSJ A;  3QSL A;  1YTV A;  4EXK A;  5DVI A;  4DLD A;  3K1M A;  2UVJ A;  3S4U A;  3CI8 A;  3O28 A;  4U23 A;  4O3A A;  4RPN A;  4P0G A;  1B05 A;  2XX8 A;  3C31 A;  3T9U A;  4YU0 A;  3ILU B;  1GTK A;  5L9M A;  4FEB A;  3TTN A;  3O9P A;  2V84 A;  5EHM A;  3G3G A;  4L17 A;  3K02 A;  1B58 A;  1SW4 A;  1B4Z A;  3F11 A;  1SBP A;  4F3G A;  5I58 A;  2F5X A;  3EQ1 A;  4H67 A;  3UGW A;  1D3K A;  3UP9 A;  2ZYM A;  3PPP A;  2IA4 A;  5DVF A;  3VV5 A;  3LBS A;  2UVI A;  3UA8 A;  2DQV A;  3OOA A;  4I1D A;  4LQ2 A;  2VP1 A;  5DTB A;  4ZEK A;  3FZV A;  2NUV A;  1MPD A;  2HCA A;  5DEX A;  3W15 C;  4MFI A;  4OXV A;  4UAC A;  4ELR A;  3O6H A;  3FVN A;  4OHN A;  3FD3 A;  2H9B A;  2F6P A;  2G29 A;  3TZA A;  1UTB B;  4R73 A;  1OLC A;  1GV8 A;  5TU0 A;  2P1S A;  2BJJ X;  2GH9 A;  1MRP A;  2WKY A;  4HW8 A;  4OVJ A;  4R2B A;  3VDF A;  1I6B A;  3MQ9 A;  1VE4 A;  2I0C A;  1YPN A;  3USD A;  5JK4 A;  3EHU A;  3U93 A;  2DVC A;  3H3G A;  3GXA A;  4G8N A;  4QFP A;  3M3K A;  5DVJ A;  3FGS A;  3VFJ A;  5H8F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...