4LUBA

X-ray structure of prephenate dehydratase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
275
structure length
188
Chain Sequence
TMKIAYLGPSGSFTHNVALHAFPAADLLPFENITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYLFHQAKIEAVAEIILENYTRFWVLGDETPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFIIDFENHNEKLVSFALEELTSIGIHYKILGKYAVYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of prephenate dehydratase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Lyase
molecule keywords Putative prephenate dehydratase
total genus 54
structure length 188
sequence length 275
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lubA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lubA01
3MWBA 2DSFA 3T9HB 1BLFA 3CG3A 3VVDA 2H98A 3H6TA 5IAIA 3LBSA 2UVIA 4GFRA 5CRYA 2Q88A 4YKJA 1M5EA 1PEBA 1S9TA 3UGWA 4PQJA 3FV1A 1IZ1A 1UTBA 3S9LC 1B4HA 5FTIA 2PBWA 3ZS6A 4ND9A 3VE1B 4R2BA 1B5JA 2HZKA 3IORA 4MFIA 1SW2A 2OZZA 1N3XA 1OVTA 3K1MA 4IO4A 1RWUA 2IA4A 2O69A 4K3FA 1TFAA 2I49A 1CB6A 1GTKA 5AA4B 4PFUA 2DT9A 4XTCQ 4NE4A 3DP6A 1D9YA 3O1LA 1MH4A 4QFNA 1JEVA 2LQJA 3B6TA 3K1NA 1NH8A 3MVZA 1ZTYA 3GXAA 3U93A 2QJEA 1M0SA 3CFLA 4F3PA 3CVGA 3OXNA 1FQEA 2XXPA 1SW5A 4GO7X 1H45A 2LVWA 5TP9B 4NF5A 4C1TA 3W9WA 1MQJA 3OD7A 3MAMA 3A3UA 2XXRA 1FTOA 3KOTA 1MQHA 3GBBA 3PPRA 1LCTA 3W15C 3DP4A 4Q5TA 3AAWB 4G77A 4MF3A 5AA2A 3VFJA 3CFXA 2PX1A 3DC2A 3K5PA 5CMCA 2DE4A 1ZU0A 4G4PA 1Y9UA 2OK2A 2D5WA 2X7QA 2ZHOA 4IO1A 3FVGA 5KDTB 1YCJA 1UTHA 4QFPA 1URDA 1JVXA 2CZLA 5FHNA 1MXZA 3KZGA 2O68A 2Z23A 2GH9A 3IB2A 1HSLA 3C32A 3DM0A 1A40A 2DWAA 1B3FA 2KLFA 1N7XA 1O63A 2RQMA 2Q8JA 2R71A 3VVFA 1MXWA 1QKAA 3N6TA 1EZ9A 3QIMA 3TTKA 4GMKA 1QKBA 4FEBA 4NF4A 3OOAA 1IUDA 2VGQA 3C4MA 2FYIA 4EF1A 3F11A 1NNFA 2F8DA 1P1NA 4M8LA 4QFOA 5ITPA 4ZE9A 2ZNUA 3QXMA 3IOTA 3C31A 4TOZA 3O6GA 4M4GA 4GOTA 1R6ZA 4YAHX 3S9EA 1Y4TA 1LLSA 4H5FA 3L7OA 3R7XA 4R9FA 3JV9A 3EF7A 4YB7A 3VLWA 2QMWA 2V3TA 3AB4B 4ZEKA 3FJGA 4H5GA 5DT6A 3VVEA 2XD3A 5I59B 4ZECA 3KSXA 2D3IA 3PUXE 1B2HA 4U23A 2I3VA 1P1QA 5HPQA 2J0WA 4JSOA 2F1FA 3HHEA 3TKDA 1WVJA 4U4XA 3QYTA 3TTRA 1IXHA 1AIVA 3S4UA 1MH3A 4L17A 2DXRA 3O6IA 5ICQA 1GR2A 4YMAA 3Q25A 4FATA 1IITA 4OXVA 4OESA 1LBCA 2F7AA 3LUYA 3PMXA 1XOCA 4QF9A 3NRBA 3OO8A 4GLIA 2O84X 4TLMB 3LSXA 2HAVA 3U72A 2PA3A 4G68A 2HZLA 2KO1A 4X84A 1Y3QA 2YJPA 3ECRA 4F1VA 2Q2AA 1UJ4A 1EH3A 3TELA 2X7PA 1DPEA 4ELRA 5H8HB 3G7WA 2HAUA 3PUYE 4ISUA 3FD3A 1UJ6A 4KQPA 3O97A 1R9QA 4OWDA 1S50A 3CI8A 2RC9A 3I3VA 4I62A 1B1XA 2ANJA 3CEDA 4FAJA 5H8NB 3LSFB 5I2NA 4ZEDA 3IOUA 2RKMA 2QPQA 2GFEA 1OLAA 4ZDMA 3S9MC 3IO4A 1ZPVA 3QUFA 4R72A 3H3GA 2PT2A 2QS2A 4F1UA 1XTZA 2QL3A 4OERA 1DMBA 2H5YA 1F9BA 4GD5A 2Z8FA 5I57A 3TTMA 2Z8EA 5H8FB 1O7TA 2OCUA 5CMKA 1MDP1 4DZ1A 2O7IA 1POY1 5EHSA 4EF2A 1I69A 3PD9A 3H06B 3JYRA 4KCCA 1B4ZA 4I9DA 4X48A 1B0HA 3PU5A 1LKZA 5ICTA 4KHZE 1MG1A 4E0XA 5CC2A 4LVQA 4POWA 2F78A 1LAHE 2QS1A 3Q28A 4RY1A 2DVZA 4QSEA 3VXBA 4F39A 1B3GA 4THIA 4AQ4A 4OFLA 3MPKA 1FTKA 3N26A 5AA2B 4IGTA 3V8XB 3FV2A 1SYIA 4XKRA 1BP5A 3O28A 1N04A 1B52A 3TFLA 2DE2A 5L8DA 4X1DA 4H67A 1TFDA 1HSJA 4IO5A 4NF8B 4EQ7A 3K6XA 1ZKBA 4GVOA 1Z7ME 4BDLA 4IB2A 2VD2A 3ENVA 5TP9A 4BLAA 4X1BA 2GRVA 3LOUA 5FIIA 3HHFA 4Q0CA 3TTLA 3TCGA 4Q8RA 3PGFA 5L9SA 5JTYA 2QS4A 2RCBA 3HSTA 3C34A 5FTHA 2DYXA 5AA4A 1UTBB 3A09A 3H03A 3OO7A 5F1QA 3Q26A 3BBRA 2YLNA 4GIZA 3IB0A 3TEPA 4JBZA 1QW0A 1SW1A 4OVJA 3VDFA 4PETA 1NNTA 4PFTA 3E4RA 3T96B 4JXIA 4GXSB 3N94A 3H6WA 1Y3NA 1USYH 4GL0A 5L9MA 1CE2A 1VFEA 1YBAA 4PWUA 1XT8A 1OLCA 4U1OA 2DTJA 2R9JA 4OQOA 2PC6A 4WEDA 1USYE 1QJMA 4FJPA 4R6KA 3TYHA 5JTYB 1MY1A 2RQKA 3B6QA 4DXUA 4Z7EA 2ZXTA 1MDQA 2HCAA 4OEVA 3TUIC 1PDAA 1QUJA 3TQLA 3CFZA 2J0XA 5ELVA 3BFTA 3MUQA 4U22A 1VR5A 5DEXA 3USDA 1MPCA 3SETA 3N5LA 1LB8A 5A5XA 1H3DA 5DEXB 1R1NA 3KN8A 1M5BA 1LCFA 4GWOA 5EYFA 1FQFA 3MC2A 3W9VA 3PUWE 2O51A 3O29A 3DELB 1KWHA 3K01A 5F7VA 1DTZA 1YPNA 3UP9A 2Y84A 3V89B 1QUIA 3L6GA 1PB9A 4JB7A 2DVCA 2P2AA 1O8BA 3ENWA 3MP6A 1YGYA 4RK2A 1SYHA 1H76A 2H4IA 2ZYNA 2DE3A 3KJ7A 4F3GA 3G3IA 3S1TA 4DXCA 4RPOA 2XX7A 3PUVE 2Y7PA 2DS9A 3BFUA 3P96A 1JW4A 1SDXA 3T9XB 5KCJA 4H0WA 3VLVA 1Y1MA 5I57B 1PBQA 1M5FA 2F34A 4F22A 3OO9A 1FCKA 3OEMA 3EN3A 3T22A 4G68B 1XS5A 2DQVA 4KCDA 3K1PA 3H6VA 4H6DA 4NWDA 1ZLQA 1NNKA 1AOVA 4N13A 3ENQA 4RJZA 3OFFA 3I5OA 1Z7NE 2V84A 1PSDA 1FQBA 1MXVA 1LBBA 3E3KA 4OTEA 4ONYA 3FVNA 2F6GA 2HFBA 4YB5A 3MP8A 3E13X 4NMLA 1EU8A 4AB6A 3FUZA 3TAJA 3G3GA 2Y7WA 2A5TB 3RT8A 3SEWA 3IOVA 1JQFA 1Y20A 5JK4A 1VE4A 1XHYA 2B3BA 2V25A 3MVWA 1Q35A 3V83A 1L5TA 5L9OA 4ZZAA 1YAEA 2NWJA 2PMSA 1IQ7A 1DPPA 1TWYA 2R6GE 4DDDA 3TUZC 3TQWA 4YICA 4O3AA 4JWYA 5I59A 4AB5A 1URGA 4ECFA 1OQGA 2H9BA 2VP1A 3HPIA 5I58A 4DCYA 4DLDA 4KYSA 2VD3A 4KI0E 1UTHB 1US5A 2B3FA 1D3KA 4HTGA 2GHBA 4FEDA 1UQWA 4F29A 5B7DA 3EHUA 1II5A 4JDFA 1PC3A 3K2DA 1I6AA 2XXQA 1SBPA 2UVHA 1LFIA 1VFDA 4JSDA 2RC8A 1O64A 3SESA 1XVXA 4H65A 4ZZEA 3ZSFA 3T9UA 1A8EA 3RTFB 4LONB 1EZOA 2P9CA 5AA1A 2AIXA 3CRBA 5LOMA 1EZPA 1IXCA 2XX9A 1B0LA 4R2FA 3TODA 2FA7A 3FVKA 5I2KA 2ZYKA 1N84A 4OETA 2G93A 4ZE8A 3KWMA 2Y7KA 5I2NB 1LAFE 1MM7A 3O9PA 4WXJA 1YTVA 1POTA 4YKKA 1BTJA 3K00A 1OQHA 3TCFA 2NYIA 1B6HA 1OMPA 3ONMA 3IBWA 1H43A 1QVSA 2ZNTA 3UORA 3IB1A 2UVJA 2OJTA 3K6WA 2ESNA 5H8SA 5ISUA 2ALUA 3LR1A 3M3KA 1SC6A 4ESXA 2F6PA 2OBGA 3U7JA 4QFKA 2Y7RA 1ELJA 4G8NA 4GL8A 4NF8A 3M8UA 2H99A 1NKXA 2QRRA 2F7CA 4Z0IA 4JWXA 5DTBA 4FE8A 3PPPA 4U4SA 3EHTA 1UIUA 3DLNA 4RPNA 2Z22A 2F35A 1BIYA 2PYYA 1TT1A 5KCJB 5H8QB 5JJBA 1N3WA 4WKMA 3SDFA 1IIWA 1P99A 3CSBA 1S7YA 1B05A 4F19A 3IOWA 3RQTA 3UA8A 3TUJC 4X9TA 4RA1A 4P0IA 3FVOA 1IXIA 1MXYA 1ATGA 3LC8A 4XKNA 3FASA 3PMVA 3HV1A 5FHMA 3KSJA 4KFQA 4IY5A 2ZNSA 3ILTB 1VSOA 2I48A 3PPNA 1B58A 1N76A 3RGYA 3RT6B 1JETA 3S9NC 3RY3A 5CBRA 3DHWC 4IGRA 3EQ1A 4IO3A 2E0SA 2Y7IA 1MQIA 3C33A 3ODBA 4DXBA 3SEVA 1Q1KA 3OO6A 4ZS9A 4TQUQ 4IY6A 1FQCA 2V93A 4M1VA 2A5SA 3VV5A 1LGBC 2I0CA 2UYFA 3QK6A 1US4A 1JW5A 3C9HA 4RXLA 3SERA 3MJNA 3UN6A 5FHOA 3E9XA 3UW1A 1A99A 4EDPA 3MTJA 3WAEA 2REJA 3G3KA 1B3LA 5DVFA 3IK6B 3MW0A 4C1UA 2REGA 3U94A 2I9SA 2XXHA 3M3LA 3C35A 3KG2A 1LSTA 4NEDA 2QRYA 4BDQA 3D4GA 5H8NA 1XC1A 3CIJA 3MVXA 2IEEA 1B7HA 1B51A 4QFLA 2BJJX 3K4UA 4YU0A 4TLLB 3I6VA 2F97A 3O6HA 4LZ8A 3DP8A 2QMXA 2ONKE 2PT1A 1PB7A 5HM4B 1B5IA 5H8QA 1IEJA 4BDMA 3SEXA 3RLFE 3H7MA 2Q89A 4LUBA 3IJXB 2P0SA 4NF4B 1SI1A 4EUOA 3T9VA 1MXUA 4NF5B 4HS7A 4HCYA 1LK7A 1B46A 2WKYA 2OWTA 4MLQA 3KGCA 2I0BA 3CSGA 3QSLA 5IT4A 1OVBA 5T41A 1WODA 4FORA 2DWIA 4P11A 1MQGA 4BDOA 5IT0A 2AL4A 2H25A 2DWHA 1FTMA 3U8QA 1B9JA 3B7DA 1PB8A 1LFGA 1BKAA 4YKPA 3R26A 1AMFA 3HHGA 5I2KB 1U8SA 5KDTA 3G3JA 3RN8A 2XD2A 3MBPA 3ZKKA 3P7IA 1IXGA 4R6HA 2XXUA 5EHMA 3CR9A 4G8MA 4ELQA 1MPDA 3UK4A 4LQ2A 4IO2A 3VLUA 5CM6A 4KPTA 3MZ1A 2XXXA 3OMBA 2RINA 3PPQA 3Q27A 4GO5X 3O2AA 5AE4A 5IKBA 4G8HA 2F36A 3LSWA 4GQOA 2I4BA 1A55A 4OFOA 4XXUA 2F5XA 2RF1A 4ELOA 1HSEA 1B7ZA 1FQDA 3HO7A 3KBRA 1A7LA 1ZJLA 1SVXB 3MZBA 2HQ0A 4O3CA 4PP0A 3ZKLA 1URSA 4R74A 4F2OA 3OFHA 4YZZA 1UIVA 3TCHA 3THIA 3IL1B 2CMOA 1MRPA 3OBIA 3OEKA 4E0WA 3DDNA 2H9ZA 2NXOA 2YPNA 2AL5A 1ANFA 3T93B 3KN3A 3MVYA 5B70A 4PFWA 4RK9A 3M3FA 3FIRA 3FJ7A 4MLVA 4QRZA 3PMWA 2NVUB 1N0TA 4FECA 2I3WA 2D21A 3TDJA 1QUKA 1AL3A 3OENA 3IO6A 2P1SA 2XXIA 2CDQA 3U1OA 3RNNA 2A5TA 3TZAA 4H8JA 4XKPA 3DHXA 1FQAA 4LZ5A 4IO7A 4RYAA 2V3UA 2OLBA 1FTLA 2M8CA 4JWOA 4I1DA 3FZVA 1QULA 3IAZA 1NMUA 4LATA 1MQDA 3IR1A 3N0VA 5ITOA 1TXFA 3SEYA 3SKPA 4G2ZA 3GLBA 3GBAA 1ZBMA 2NOOA 3HN0A 4NMYA 3CG1A 2I58A 1B1HA 3BKIB 2UYEA 2RCAA 3K6VA 1NNPA 1MY2A 5CI5A 3FXRA 3V5AA 3MAHA 1UJ5A 3PUZE 3WAFA 2OWSA 5JEIA 3G3HA 4UACA 4F2QA 3RPWA 4U2RA 1SW4A 1DSNA 3UIFA 4OMBA 2AYSA 1B32A 4EXLA 1J1NA 2XHDA 1MY4A 4PE5B 2LAOA 5DVIA 2DWJA 3C36A 1GGGA 1NFTA 2HEUA 4LQ5A 4LZ7A 4R73A 3AB2B 3FATA 4PFYA 5TPAB 2FNCA 1XVYA 1JW1A 4NTLA 4EQ9A 3KEIA 4HCWA 3EPEA 1SQYA 4POXA 2THIA 3GZGA 1M5CA 3A3CA 2ZMBA 2PVUA 1R9LA 3QAXA 1Y1ZA 1P1UA 3OSQA 3RTWB 1GVCA 3D4CA 4YB6A 4N07A 5TU0A 1FW0A 4GF8A 4OHNA 2O7UA 1GV8A 4ELPA 2XXTA 4Q30B 5H8HA 2QS3A 4OEUA 5AA3A 3VXCA 2FGCA 4UA8A 1D4NA 1KS2A 1B3HA 4KYEA 1MY0A 2DP8A 1D9VA 2Q2CA 2ZYOA 3H6UA 1NL5A 5BWJA 4NF6A 1JEUA 2F8MA 3KJTA 2ZYMA 4N6PA 4R75A 4LP2B 3PD8A 1I6BA 4I8CA 2O1LA 2MDAA 1LK5A 1DOTA 2ABHA 4F3BA 4QSDA 2I4CA 4DIGA 3IX1A 1NH7A 5AA2D 4MH5A 1A54A 1MM6A 4O3BA 4DCXA 4GXAA 3TUSA 2Q9TA 4C0RA 3TPAA 2RE1A 3K6UA 5I56A 2ONRA 3KN7A 1N7WA 3PPOA 1M5DA 4NF6B 2B65A 3KOSA 4MBPA 2ONSA 1OIBA 1LAGE 4P0GA 3MPLA 3IJOB 3T66A 5BUUA 5CBSA 1JVYA 1LAXA 3O66A 4QHQA 1A8FA 3S2VA 1MY3A 4QSCA 3K02A 3EHSA 1Y7PA 1RYXA 4R9GA 3G3FA 3IXQA 4KD5A 4F18A 4FIMA 2W7YA 4WEPA 4ZEFA 1LFHA 2O1MA 3R6UA 2JOQA 1RKMA 5J1DA 4H1XA 3MP1A 3FXQA 5DVJA 3OFGA 5A5XB 5HBCA 4DE8A 5M2VA 4F3SA 1MPBA 1B7UA 2QSWA 4RNSA 4EQBA 3LSLA 4G68C 5TPAA 4NWCA 1B3EA 3OELA 1JNFA 5IS2A 5K2YA 4BDNA 1SI0A 5DYHA 2VHAA 1Y4CA 3MZ9A 1B40A 4ZEBA 4XIGQ 3TTNA 1MS7A 4EXKA 4YKIA 4ZEIA 1AH5A 2P9EA 4U1ZA 3AXFA 3HCQA 1P1WA 4GRKA 4OENA 3JZJA 2XXYA 2V3QA 2QSXA 3SEUA 3ILUB 1P1OA 3RUMA 2X26A 3MQ9A 2GHAA 3U92A 2O6AA 2DXYA 4BDRA 1H44A 5CMMA 2XXVA 3KFMA 3TMGA 4KR5A 4OYVA 1RYOA 4OZ9A 5KZTA 5H8FA 1I6QA 2VOZA 1SD3A 2P9GA 2Z8DA 4HW8A 4H8IA 4KYDA 2F7BA 1LB9A 1ZMGA 4YMBA 1ZIUA 3B6WA 4U21A 5I84A 4F31B 1MXXA 4ESWA 3FXUA 2UXAA 2DOJA 3K0VA 4F1YA 5I58B 3L6HA 1FTJA 4IO6A 3N6UA 2UVGA 2XX8A 4OFJA 1WDNA 5CMBA 1DTGA 4LA9A 3FJMA 3OSRA 2G29A 2XXWA 2I6EA 3FGSA 1Y3PA 1B5HA 2RC7A 3PV0E 5I56B 3QUJA 3OFEA 2JHEA 3W7BA 2E1SA 5K2XA 2HXWA 1T0KA 3H4ZA 4R6YA 2NUVA 3Q29A 1PBPA 4XKQA
chains in the Genus database with same CATH superfamily
4IH6A 2F8EX 3TZXA 3EJMA 4N7TA 4E2FB 1JIHA 2DCUB 4OYZA 3ET6A 5IAIA 1ULRA 3VGUA 3GG1A 4GFRA 3BV8A 2KB2A 2QE5A 1PEBA 1FTCA 3ISNC 4WJBA 2W25A 2C2OB 4PQJA 2C2NA 3T5JA 1IZ1A 3VGSA 5D3GB 2RUSA 2I8EA 3R5AA 3PW4A 2JEFA 1TK0A 3IORA 4DL3A 4WWSA 4O23A 1OVTA 2VL1A 3EGNA 1TKDA 2B6AA 1ZM9A 1YRTA 2IA4A 2J7WA 3NGRA 2V50A 4F04B 4PTKA 4XTCQ 3TQ1A 1D9YA 3ZZYA 3O1LA 5EUHA 1H7WA 4CLTA 4OYBA 1FHTA 1JEVA 4HVZA 2DGOA 2IJNA 2LQJA 1H38A 4CNZA 5F8JA 3K1NA 2PMHA 9RUBA 2L5VA 1X60A 3K5MA 3GXAA 2QJEA 3CFLA 2L48A 1SW5A 5CYQA 2HAIA 5I3SA 5KFGA 2FGOA 2LVWA 2IMWP 3PTYA 3UN3A 2EFOA 3GFYA 1N5SA 3W5XA 3A3UA 4BHQA 4LFBJ 3KOTA 1XMQF 3DLEA 2W2MP 3MM9B 3KLGB 4WE1A 2H54B 1KRPA 3OTOJ 3W15C 4Q5TA 3AAWB 3DYAA 2R8JA 4G77A 4MF3A 3D1QA 3VFJA 2HYIB 1U6BA 4EBDA 1VRTB 4WKYA 2WBMA 2DE4A 2W2PP 1TKTA 2X7QA 1K0TA 3JQJA 2E7XA 2CQ1A 3G2XA 4FZVA 1PIEA 2CUYA 4P75A 3VAJA 2BQUA 5FBPA 4ES3A 2BW7A 4CT8A 1URDA 3RB6A 1OSCA 1HMVA 4HHHA 2AZ3A 2HBQB 2CZLA 4OZNA 1CJTA 1MXZA 4LF7J 1S49A 4H45A 2GH9A 3IB2A 5B0DA 2PSZA 4JI4J 1HSLA 3C32A 4DF8A 1U1LA 1FEEA 1N5VA 1IMEA 5EQ9A 4WFZA 1O6XA 3I0SB 4WP3A 5D15A 2Q8JA 4RW9A 3K2YA 1QKAA 1RHQB 5CYQB 5A6WA 2F3BA 2NXNA 5HVGA 4DL5A 1FFGB 2ILYA 3GFHA 3TTKA 1HHSA 4KPYA 2W2NP 3ENAA 2NXCA 4F3MA 4QWDA 3OR1A 3C4MA 1N5YB 2FYIA 4EF1A 2EVZA 2KXNB 3F11A 2DCLA 3O6QA 2HZCA 1N36J 3Q0AA 4N47A 2Y8WA 2P3NA 4URQU 3UNYA 4K50A 3QXMA 1A0OB 4PKDB 3FC9A 1NDPA 3VQSA 3RJMB 5DZ6A 4TOZA 4ECUA 2CPXA 1FCAA 3O6GA 4GOTA 1XQIA 5AE3A 3DXSX 4H5FA 3EF7A 3VLWA 4TLRA 2XCPA 2QIFA 1J5EJ 2F9DA 2ADCA 3TJ9A 3X3UA 3MUTP 4OLOA 4H5GA 5I59B 1WEYA 2L3MA 2GS8A 1DTQA 4MIBA 2E5IA 2NXJA 3T1BA 4JYAF 1B2HA 2PFZA 3PEJA 3QRQA 4ZVTB 3G8TA 1CJKA 3M30A 2F1FA 1EB0A 2YQ1A 6FDRA 2YKNA 5GAEU 3WC0A 3P8BB 3OQ2A 2DGTA 3QLHA 3OLBA 1RBAA 2NPFA 3D68A 3N6LA 3IS9A 3Q25A 4DV5J 2CQ4A 2HSEB 4OXVA 3UPFA 1FKPB 4NLRA 5ITHA 3VAMA 2LU1A 2CZ4A 1YLXA 1LBCA 3KTQA 3LUYA 1VHFA 3MEKA 3NRBA 1IKVB 4MK8A 3D2WA 1XR6A 4GLIA 2ZZTA 2NCKL 4NXNF 4R8UA 2O84X 1SH3A 5D4LA 1LW2A 1SKUB 1NK8A 2XTJP 1YI2S 3M2UB 3ECRA 4PF6A 5D0GA 3JSBA 1UJ4A 5DM7Q 4X4RA 2ALZA 4URGA 4ELRA 1IN0A 3S6EA 2P5VA 5H8HB 1HNZF 2QMUB 3O2IA 2J9CA 4ISUA 2Q6BA 5EWGA 1YJUA 1Q9DA 1UJ6A 2MTLA 4MAKA 3O97A 3ZC4A 1FPDA 3VV2B 3MR6A 1DBDA 3CI8A 4I62A 1DARA 3KUHA 3RTVA 2CFXA 4RUCA 5BR8F 1KSPA 2AGOA 1WWHA 4ZEDA 1XMQJ 2HMIA 2BJ1A 2B4VA 4KGXB 4ETXA 3I0RA 4KGKA 3S9MC 4ZVGA 1ZPVA 2VT5A 3V6DB 1FBDA 2ASDA 3IR5B 2ZH1A 4OERA 3JSMB 5DRKA 4RBUA 2DPIA 3K17A 2EXUA 1QM9A 3CIZA 1FRIA 5F41A 4ZPBA 3TTMA 5H8FB 2HHTA 3CCSS 2OPQB 1NV1A 3GIMA 3H0PA 1RTDB 3VTIA 2CPJA 3HLUA 3OTDA 1I69A 3JYRA 5K20B 1N4LA 2DNRA 5EN1A 2GVZB 2MKZA 4I9DA 3UN5A 1B0HA 5ICTA 3ISPA 1MROB 2HBRB 5I5PA 1IMAA 2AJ2A 1FK9A 2N82B 4I2PA 3R7NB 4THIA 1SYIA 1YZ0A 1NO8A 3O28A 1N04A 4ED2A 4RW8B 1UWBA 1QTNB 4ILRA 2DE2A 5L8DA 1TFDA 5A0YB 3C6UB 5I3UB 1HSJA 1BGXT 3IR7B 4NF8B 2CPEA 1SIWB 1PCAA 4L74A 4P2SA 4BDLA 4FYVB 4F25A 3BDEA 1RQ0A 2VD2A 1Y5NB 2V94A 4X1BA 4V1Ak 1NSAA 1U24A 1CJVB 3MAAA 5CHCB 2EWHA 1IMCA 1NZ8A 2E5LJ 3M1VB 4OVPA 2J7KA 1L3TA 1CC8A 3ZZTA 2QS4A 3CIMA 3HSTA 1SQFA 2UZAA 2YY3A 2DYXA 2KVIA 2DNPA 1RTDA 1GMVA 3FJ2A 3T5KA 4IH5A 5AA4A 3E79A 4DCJB 3H03A 3OO7A 5F1QA 1VCTA 1Y9OA 4PWWA 1PYOB 4DPXA 2V6AA 3KJFB 5A8KB 4GWSA 1NZAA 3BSNA 5ETPA 4Z2XA 3H6WA 1Y3NA 4C8OA 1S6QB 2CNOB 3PYEA 4J9RA 5C2GA 3I4HX 2YXLA 4UY85 3HDSA 1NHVA 1GH8A 2R9JA 1PAEX 4WEDA 4DV1F 1QJMA 1VMBA 4FJPA 5DS7A 3TYHA 3R5JB 5JTYB 2RQ4A 4FXDA 1S59A 4KBIA 2UV8A 3NL0A 3G6YA 2JSXA 5GAGI 4NYPA 1N52B 2QVRA 4M5DB 1KQKA 1QUJA 2VG7B 2KHDA 5F8HA 2AGQA 4ECYA 3U1MA 3USDA 1MPCA 3G8QA 4FYXB 1LXJA 2HGLA 3CJSA 5DEXB 4YR2A 1R1NA 4RPFA 3KN8A 1ITPA 4ZVSB 4GWYA 2EFVA 1HYSB 3NLCA 1UFLA 4NZ7A 1CVJA 3PKYA 3PUWE 1IJEB 4PAFA 2IDEA 2E5JA 2KG1A 2DXFA 4MNIA 3L4BC 4C8ZA 3UP9A 4WK1A 1WOPA 2Y84A 2QGFB 2CPFA 1M1GA 1PB9A 1UTAA 2FDNA 1O8BA 5ET6A 3ENWA 2UUWA 2BE7D 1V3ZA 3AODA 2G2YA 2VG7A 1H76A 5HL7Q 2ZBCA 2Q79A 5IM2A 3RW6A 1T0TV 4B3MJ 3JAMY 1ZETA 2RD5C 2HPGA 4RWXA 1NRKA 4DXCA 4RPOA 2XX7A 4KY3A 3P96A 1X4EA 2CJKA 3T9XB 2D74B 5HI7A 3SDEB 5ETOA 1HQEB 5I57B 4C8YA 1D1UA 4ZS6A 3GYNA 4QBAA 1M5FA 4F22A 2AJ0A 3BREA 2KU7A 4D3GA 5J2MB 4Y2KA 4JI3J 3NGKA 3OO9A 4YY3F 3T22A 3D0GE 2DISA 1HW8A 5L1JA 3T6BA 4LSLB 4C4WA 1LBXA 2G2ZA 4HT7A 3J7YI 2BJ9A 3GPAA 3MM9A 1AOVA 3ENQA 2DGQA 3TJAA 5E3PA 1IKYB 1Y3JA 2XLIA 4RBVA 1MXVA 2W4DA 5L46A 2ZVSA 4YQWA 4KYZA 3E3KA 4A8YA 4CI0B 4DSJA 3TA0A 3KKFA 2F6GA 5GVQA 5K5MA 3UD3P 5CZVA 3OR2B 2FJAB 3E13X 1N5TA 1HBNA 4ED0A 2PN6A 3GB0A 5B0GA 3LV0A 1YZ6A 4C3LA 4NMLA 2R42A 3G3GA 2HEKA 3DLBA 4HH1A 2Y7WA 2QX0A 3MAQA 4DV5F 2DXEA 5L8RC 2DIUA 3MTKA 4U95A 5JK4A 1X5SA 4KXPA 1VE4A 1XHYA 3PRBA 4I2QA 2C2EA 2GQQA 1F0XA 3FXBA 4LF4F 1Q35A 4FKXA 2PEHA 4GKJJ 1EETA 3N6NA 2PMSA 2C3PA 5J1PA 1DPPA 3RR8A 3MM6B 4DDDA 4DR6J 3I5AA 3TQWA 4ECTA 4O3AA 1YBTA 4J90A 3MPWA 1NAQA 5IFMA 3BS9A 3J80U 2H9BA 2MQMA 3KUGA 4RW7B 3D6TB 1U1OA 3MM5A 3DDKA 2U2FA 5K8PA 2N3OA 1AFIA 2V0NA 4KI0E 4JB8B 1GMWA 1UTHB 2PA8D 2IC3A 5GADU 2XHWA 1NJWA 4DR7F 2GHBA 3CJKB 1UQWA 1EAYC 5B7DA 1ZA2B 2HG4A 2XEXA 3AH6A 5I42A 2ZE2A 4DUYJ 2XXQA 4WYLA 5HMZA 2UUAF 3LP0A 1PYSB 5LM7E 5JMNA 4J9VA 2FIEA 3M8PA 4CLFA 4C3KA 2K1RB 1HNVA 4ZITA 4B3RF 1YXIA 4LONB 2P9CA 3EUNA 1P9YA 1WG5A 5AA1A 3VAGA 5EX0A 1EZPA 2WTFA 1VGYA 3BPDA 3PVXA 4R2FA 3GSDA 4MYTA 1RACB 1CLFA 4FVMA 2LA6A 4PEOA 1HNXF 3QNWB 3J81U 3CJ2A 2WVCA 1WC6A 1SUQA 1D9QA 2BX6A 1GMUA 2E7WA 5CZXA 2GHWA 5GMDA 5H9FJ 1N84A 4ZE8A 2Y7KA 3TAMB 3UFCX 1PILA 3HSDA 2QL7B 3EX7B 1JKHB 4OA4A 3O9PA 3H42A 4WXJA 1V3SA 2AX0A 1BTJA 2FTRA 1OQHA 3W9JA 3TCFA 2YBVA 1Q53A 3SZPA 5C2CA 1CULB 2FBPA 1KZ8A 3NEKA 4P10A 4K4WA 1S1VB 3NWRA 4MIWA 2MGZB 3DRSB 3EICA 2NZ4A 2EC2A 1QVSA 3F0NA 3UORA 3TZZA 2B9WA 2PFDA 4KV8B 3ILJA 2OJTA 5H8SA 5ISUA 3LR1A 3M3KA 2RT3A 4F02A 1SC6A 1RKJA 2QFJA 1XR7A 1HNIA 3EE3A 2DYAA 1Y0HA 4DV1J 2QLWA 1ELJA 3R5GA 3AD9C 3HT3A 2JFKA 4WTOB 2H99A 4ZVPB 2V4RA 3PACA 1O0PA 4JWXA 1BWVA 4DV0J 2CZHA 3EHTA 4CH0S 5KFCA 1UIUA 4NF0A 1R8CA 2Z22A 3MOZA 1HIYA 5FD1A 5ETQA 1S9FA 1XMBA 1B0VA 4KFBB 1EQMA 2UVVA 4Q2MA 4O3OA 3H7HB 4DX8H 2CXEA 3GFXA 1GX5A 1NJYA 4RL1A 1P99A 1B05A 5KG0A 3P5TL 3RQTA 3UA8A 4YDXA 2WB1D 4X9TA 1RT4B 4RA1A 3FVOA 2RB7A 1MXYA 1U0HA 2RRAA 3VAFA 1U2CA 4HE1A 2OELA 2HXRA 2V34A 3W2WB 2Z2YB 2YKNB 3KSJA 4KFQA 3D6HB 3T1YF 4IY5A 3ZZRA 1FJ7A 3HHLB 2BQ3A 3NOHA 2WOMA 2ROPA 2I48A 1TKZA 3J7YU 4M5MA 1RT2A 4NHBA 3RT6B 1FBHA 3VR1A 4F2RA 2QG9B 3S9NC 3RY3A 3US5A 3UR3C 4O0IA 4IO3A 2C3OA 4LRDA 3D9BA 2CJAA 4OI3A 5EWEA 1W25A 3ODBA 1T11A 2UXBJ 3CJQA 1Q1KA 1ZZFA 1IVZA 4IY6A 4DWIA 2V93A 2VFTA 3DLEB 2D3OR 5I3UA 3MFIA 1QJHA 2CVIA 4JYAJ 3QK6A 3DU6A 2OPPB 4X4TA 4PABA 3C9HA 2W01A 1WC4A 2MKCA 2V68A 3KG0A 4EBEA 1JJCB 4LBPA 3SERA 3IWXA 3C3LA 2IDLA 3E9XA 4PAAA 4J9KA 3IMQJ 5HAOA 2XS2A 3UW1A 1A99A 5HO4A 2LFVA 2REJA 2HNYA 3NBPA 2R7XA 1RBLA 4JV1A 4W98A 2BJ3A 2YPYA 3FZ2A 3KG2A 4ZLLA 1EYJA 4FF1A 3EVWA 1CJTB 3D4GA 1JB0C 4LJMA 1MWQA 2KM8C 2R7UA 1PYTA 4I7FB 2R2TA 3CIJA 4P47A 1B7HA 4K4TA 2BJJX 1X9WA 4LF2A 1B3TA 2QSFA 3V4IA 3I6VA 3O6HA 4C8NA 2QMXA 4QYZJ 2ONKE 2IYIA 3H2LA 2ZH3A 5CXTA 3I55S 5H8QA 5D3GA 2D3ZA 4ZVRB 2LEAA 2Q89A 4NOHA 2P0SA 2KYZA 3BR8A 3SSQA 2QV6A 2VJVA 3VZHA 5CH7B 2QVUA 4NF5B 4HS7A 3BO3A 4HCYA 1KLNA 2FLNA 1WI8A 1B46A 2FZKB 3CD7A 3T1HJ 4NLVA 4GBWA 4HI2A 2WKYA 3DOLA 3RYLA 1FX2A 3KGCA 2BANB 3BSAA 4LIWA 2OFHX 4KKOB 5GMEA 3LPYA 3E51A 2ZH8A 4ZPCA 1FDDA 1BQMA 1FTMA 3U8QA 2FLPA 2FY1A 2V2QA 4X62F 3IAM9 4WKRA 2XMMA 5E7OB 4IRKA 3DU5A 3GYXB 3L3CA 1KA0A 3TVYA 5KDTA 1IBMF 1X4FA 2QL9B 2X51A 1KQGB 4TQSA 2J6SA 1CJUB 4C2MA 3TEHB 4J9SA 4WBFA 4JI1J 2CZKA 1SVDA 8ATCB 1QE1B 2ZD1A 2MY7A 3NNCA 3UK4A 4JUZA 4LQ2A 4O94A 4YR0A 4DR1F 2AGPA 4I3EA 4IO2A 2WZ1A 1L3KA 3C2PA 2XXXA 3PPQA 1N34F 2FYXA 4PYDA 3VAIA 3O2AA 1C1BB 3QRRA 3IP0A 1VQMS 1ZH5A 5H9EK 1IKXA 4GQOA 1EKRA 4OFOA 4ECQA 4XXUA 2F5XA 1B0PA 4FXWA 3GIKA 4FF4A 5KG5A 2JLGA 2AP6A 4RW4B 4A8SA 4DV0F 2BRLA 2ERRA 1B7ZA 3BBBA 3Q8PB 3EVMA 2W9BA 3HVWA 3WDOA 3P6YC 2VPXB 1RTZA 1RA6A 3RB4A 1DFDA 3NMRA 1JJ2R 1U47A 1OIAA 4O3CA 4OVQA 4PP0A 3CTRA 5HQMA 2ZHAA 1KTQA 3BN4A 4LMZA 1FPLA 2B9YA 1YTYA 3P4UB 2RKIA 1C1BA 4XIUA 3W2VB 3CE8A 1IKYA 2DEIA 3KN3A 1XN9A 3PJ9A 4L75A 3FIRA 3E8OA 4Z7YA 2NVUB 3GZ7A 3FQLA 3GMGA 1JLCB 2KYXA 1D9FA 3U1OA 2Y1JA 5KFIA 4HYKA 4JI5F 4RYAA 5DDRC 4F4KA 2OLBA 5I3QA 3SBMA 2PIIA 2QFLA 3K58A 2AQ4A 1TL1B 3QFHA 2J6TA 3SEYA 4G2ZA 2HHQA 4CNYA 3OTCA 3GLBA 1ZBMA 1EJ7L 3CG1A 1ZTTA 1M5SA 1VOMA 1UAWA 2KT3A 2N7CA 1B1HA 3BKIB 4QU6A 5L9NA 2BACA 2MJNA 4QIFA 3FXRA 2DIVA 2NS1B 1UJ5A 4CH7A 4B3TF 3G3HA 2AEJA 3KK3A 4U2RA 4CO3A 4ILLA 3UIFA 4OMBA 5HJXA 1FPKA 1VS3A 4XFEA 2O5DA 5HSPA 1J1NA 1H73A 4RX6A 5H1SV 4USWA 4PE5B 2DWJA 1NFTA 1R6YA 2JWNA 4R73A 3FCWA 2GNKA 5KFPA 3IWLA 4PFYA 4EQ9A 5EYGA 4QYRA 1BXNA 1VK3A 3EPEA 2JC0A 3CGIA 1M90T 4OJ3A 2M9KA 4RBTA 4POXA 1JJ4A 4KO0B 2AD9A 2MXYA 1M5CA 4B9SA 2YVSA 1J27A 3QAXA 3DRRB 1MSWD 1GFWB 1GVCA 3A3OB 5DQIA 1HQ2A 4GF8A 2E1MC 2R7OA 4DV4J 2DR7A 4DZDA 4IG0B 2AF6A 4Q30B 1C2PA 4WFYA 4UZCA 5AA3A 3VXCA 1SV5B 2BABA 1CS4A 2FGCA 1D4NA 3PYDA 1MY0A 3KLHB 4HE2A 4R0JA 3A12A 2DP8A 1JKHA 1ZM3A 1PKUA 3CC7S 3MDFA 2ZYOA 1U02A 1NL5A 3QT7A 2F40A 2YWKA 2XG8A 4YEAA 4MKAA 1IKWA 1JJHA 1JNZB 4FYDA 3IFAA 4YY3J 4MKYA 3BSOA 3CB4A 2IA0A 2K06A 2MQQA 1S0OA 3SZ2A 1RT3B 1Q8LA 1RA7A 2FHOB 2NQPA 4PGNA 5A8WA 4KO0A 1MM6A 4NEYA 2ZH4A 4X62J 4O3BA 4ED3A 2J8SA 4DL7A 4B3RJ 1TKXA 4KJIA 1S1UB 2BA9A 2RF2A 1FKOA 2CRLA 4FYYB 2RE1A 4B3OA 1ZAWA 2CYYA 3TA1A 3HULA 5I56A 3H2VE 2IVFB 5THWA 1Y10A 1SKSA 4KR0B 1LAGE 3T66A 5F8NA 5BUUA 1S0VA 4DV2F 3O66A 4W4MA 4ZPWR 4CRJA 2ZM6F 3J7Z5 5A8RB 3D67A 1Q5YA 1RT3A 4R9GA 4S0MA 1UZHA 4J9NA 1K1SA 1AT1B 4C97A 4DSEA 3U65A 1TVRB 1LFHA 5CYJA 3R6UA 2JOQA 1RKMA 4PPZA 4YMEA 5EQ7A 3IWNC 3MP1A 2POKA 1VJQA 2CQDA 1JLEB 1CEZA 4LF5J 3OFGA 3N01A 2KR0A 5A5XB 3KLFA 5KFSA 4RNOA 5M2VA 4AFFA 1HARA 3A3PB 4N6DA 2QSWA 1H0HB 4ZMMA 3LSLA 4XEQA 1X4HA 2CWXA 1SPIA 1R3NA 1SI0A 4BDNA 3MZ9A 1SH0A 1B40A 6FD1A 4ZEBA 4N8NA 2OX3A 1N32F 2CZ9A 3QJLA 4OHVA 4CLSA 3KNAA 4I6WA 3CJ0A 2X3GA 4PC9A 2FPHX 2QJ3A 4QWBA 2F65A 4DXLA 1FJ9A 2DK2A 2NZCA 2E1PA 3DDIA 4H46A 4OENA 2DJWA 2LDYA 1FE0A 3HSJA 2P6SA 3JS9A 1SKWA 2UXBF 1GK8A 1S4FA 3CNQP 3DRYA 2C42A 1QSSA 3N4WA 2KJVA 1D9DA 4ANDA 4KH1B 5E33A 3FMWA 5JXSA 4PUOB 2D9PA 3TMGA 3GTYX 4LFAF 4M5DA 1NV6A 1Z2ZA 1VQNS 2MLZA 3VAKA 2E5LF 2KVQE 3UE2A 3SV4A 2M8HA 2F4VJ 2P9GA 3KK2B 4H8IA 2F7BA 4FVCA 4PWDA 2AJQA 4NYZA 3ZTQA 1LB9A 3TNVA 2ZUGA 4MX6A 4QPXA 1ZIUA 1IQZA 1YJRA 1U26A 5I84A 5F3ZA 2LQ5A 1AUSL 4F31B 1EP4B 3IAS9 2CPHA 3A8IA 4DR5J 2DOJA 1O5JA 3GU0A 4PBHA 1FTJA 3ZZZA 4OI4A 2BBEA 4IO6A 2UVGA 2XX8A 2VBXA 2B4OA 5DM6Q 4A48A 1S6PA 1RT5B 5B08A 1XI6A 1Y3PA 4IRCA 3OL8A 2B5JA 5KFMA 2E1SA 2JHEA 2GHPA 7FD1A 3HO1A 3KDNA 1FRPA 4K4SA 4LFBF 2KKHA 4D3HA 4IO9Q 4F67A 3ZZPA 3G82A 4I2PB 2Q74A 2RU9A 2OMLA 3LANA 3MWBA 4K4XA 2DSFA 4B3SF 2QYCA 2DRDA 3KC0A 2ZJRQ 2H98A 3H6TA 3LBSA 2ZFHA 1YJTA 4IQXA 2MKIA 1QDUB 3UWTA 1PJ5A 2HHHJ 4Y3CA 2A2CA 5E3RA 3M8ZA 4IOBA 5J2MA 3W65A 4RZRA 4EO8A 3ICLA 3ZS6A 5IZ3A 1N33J 4R2BA 3FSIA 5H9FK 2DHAA 1B5JA 2HZKA 3B50A 4JV5F 3QSIA 4MAGA 2PMZD 4GWXA 2E7VA 2RRBA 4IO4A 3V4MA 2O69A 5G0RA 3AQPA 4K3FA 2L08A 2XY5A 2I49A 2XGQA 2GCFA 1T3OA 1GTKA 5AA4B 4PFUA 4K0KF 1SL2A 2BKOA 1T7PA 2ALYB 3FBBA 1RBOB 3PR4A 1R0AB 4IR9A 4RR5A 5HK4A 2EBEA 3MVZA 1UEUA 1ZTYA 3DM2B 1M0SA 2AV5A 3CVGA 1FQEA 2R8TA 4QJVA 4NLOA 5IC4B 2LQ8A 1CJKB 1NV0A 4P9KA 5TP9B 2XY7A 3JTOA 5HVFA 4NF5A 4C1TA 2CJQA 4AD6A 1TU0B 3M30B 3OD7A 3MAMA 3S01A 2FJDB 3QYYA 1G3OA 4RKUC 1RTIB 4MTPA 3GBBA 1R43A 1RHUB 5ESYA 4M5HA 2GVZA 1LCTA 1A6LA 2Z4PA 3DP4A 4LSNB 4YN3B 3R9LA 3TJ8A 3PHTA 5CMCA 3BGUA 1IM6A 1ZU0A 3OVBA 1H98A 3H25A 1LFWA 2D5WA 2QO3A 3HVRA 1JXVA 1DLOA 3N5BA 3FVGA 2QTWA 2BM1A 1M1KT 1U1MA 5KDTB 3ADAC 1YCJA 2XMKA 2ZE2B 2YKAA 4NXMF 4CTAB 4PCQA 2EFNA 5CABA 3GQCA 3TZYA 5FHNA 2ZOGA 2O68A 3MF5A 2Z23A 2PFFB 2K1RA 3DM0A 1B3FA 3HHNB 1AA1B 4G3IA 4K2JA 2RQMA 3VVFA 5E3CA 1RWNB 2NREA 2CPIA 3MD3A 8AT1B 1FF2A 2HWTA 1CPZA 1HBMA 1YWXA 3PCOB 3KLVA 1N48A 1HBOA 3GG0A 3QWPA 4DQPA 4GMKA 4ZP8A 4OV6A 3GILA 4NF4A 2HHWA 3LPEA 3CCJS 4C7QA 5E2QA 4OVTA 3OR2A 4XO0A 1SJFA 1IMFA 3Q23A 4CH1A 5A8KA 2D41A 2F8DA 1NNFA 5CCMA 3RAXA 4QFOA 1EHWA 2AEFA 4ZE9A 1TL4A 2OP5A 3SFUA 1OSDA 1TR0A 3JV9A 4YB7A 2F4FA 3ITHB 3IRXB 4OHZA 5EQ8A 2YH1A 4O4GA 4ZEKA 5DDQC 5ET8A 3FJGA 3M9MB 4PZVA 2VU5A 4GVBB 5B0CA 3PUXE 5HBMB 4ES2A 5C24B 4RW7A 2DB1A 1B64A 2W4CA 1NBEB 1I5OB 4JSOA 5BYRA 2MKYA 2CEXA 4N8GA 3TANA 3TTRA 3S4UA 1PJ7A 1NM2A 1QAIA 2CQIA 2PGCA 2DXRA 4L17A 1UA1A 1W7WA 1GR2A 4I68A 5IM0A 2Y0SD 4FATA 1IITA 1K44A 2AX1A 3CDWA 1ZAXA 1RT1B 4I56A 1S1WA 1VQ9S 3QSYB 3T19A 3RUBL 4I0WA 2HQDA 5LMNJ 3FNNA 2C2RA 1TTHB 1Q4RA 2XNRA 3LSXA 2HAVA 3ROJA 2OH2A 3HVAA 1LOUA 2ASJA 2PA3A 3NOGA 4OHXA 3DXBA 5EQAA 1WC0A 3KXDA 4X84A 1G7CB 1Y3QA 4X4QA 2CKWA 4KHPJ 4F1VA 3AT1B 3FMBA 5IQQA 3TELA 3B54A 4MEVA 1IMDA 1SJ4P 1NLKL 3G7WA 2C3MA 2LLZA 1FD8A 3PUYE 4ZP6A 2DR8A 2RHQB 3HT0A 3H20A 2J6UA 4KQPA 2EFQA 1S50A 2HRUA 3LP2B 1LW0B 2W7OA 2ZJPQ 3W9HA 3KJQB 1B1XA 1SPBP 1IR1A 3TVKA 5H8NB 3PRDA 4B3OB 4JI0F 3KLEA 5C7PA 2APOA 3QT8A 2ZOMA 3NCPA 5E3AA 5ETNA 1OLAA 1JXEA 1RTJB 4ZDMA 3IO4A 2PT2A 2QS2A 4F1UA 3QZ7A 5J2QB 4LVOP 2KFNA 3C6TB 3F56A 3MFHA 4P1LA 5GAHU 3MXHP 3M2VA 4M5LA 2H5YA 2ZHBA 1KN6A 1S6OA 3J7ZT 2Z8FA 2OGUA 2Z8EA 2MQ8A 2E1RA 1OY9A 2OCUA 2KXHA 3NMAA 4P3LA 2JJ4D 4LVNP 1MDP1 4DZ1A 2O7IA 4AS5A 4WF9Q 5IGAA 1WI6A 1L3SA 5EGYA 2JC1A 3PD9A 3DLGB 1B4ZA 1MROA 3MCNA 2DXDA 4X48A 1MG1A 4LVQA 3LGHA 2QS1A 4RY1A 2K2PA 1HPZA 1LBVA 2VKRA 3KUEA 1B3GA 5IT9Y 2YX7A 1VQ4S 4Q43A 4A8QA 3MPKA 5GAGU 1XNRJ 4XKRA 1WOOA 4N41A 2Y0BB 3TFLA 2WK4A 2XM3A 4NGUA 4EQ7A 1KWMA 4QWEA 1Z7ME 3DOLB 4AL7A 1VDWA 4IB2A 3T5LA 5DG9A 1S1TA 3OTOF 3ENVA 4IFYB 3PRVA 4OZLA 4UUWA 2GRVA 1H2TZ 2UXDJ 1OPZA 4X65J 5KFJA 1YJNS 1IKWB 4K4ZA 4MK9A 3HHFA 2A10A 1FERA 2GJFA 2HHSA 3PGFA 1N5QA 4WYWA 5L9SA 1SL1A 2X7IA 3SDEA 4O7IA 1HPZB 2VBYA 2IM0A 5KG1A 2VV5A 4Y34A 1JQGA 3KG4A 4DU8A 3Q26A 4FF3A 3QO9A 3IB0A 2DR6A 3CD5A 1TMMA 3TEPA 4JBZA 4OVJA 2FJVA 3T96B 1TUGB 4U7UK 4JXIA 1YRXA 3N94A 3CF5Q 4GL0A 1V9OA 5L9MA 3HVTB 1CE2A 2BM0A 4M95A 3OT9A 4J91A 1VFEA 1YBAA 2GVDA 1XT8A 4U1OA 2M7SA 4IFVB 3M32A 4LQ9A 2H1YA 5D0HA 4FBUA 1UL3A 2PC6A 2YKMA 4WIIA 1S1VA 1RTHA 1VQ5S 4LFAJ 2HWIA 3T9NA 1RHRB 1U48A 2Q8MA 2GAHC 1NKEA 4Z7EA 3TI0A 4UOCA 3H5XA 1BQNB 4GRSA 4U22A 5DEXA 4GKKJ 3WX8A 3AOAA 1W2BR 1FXDA 1H3DA 2FJBB 3R2DJ 2DR5A 4E8UA 1M5BA 4R25A 5EYFA 1FQFA 5E41A 1MN7A 2IVMA 1WC3A 2N4CA 2JDJA 3O29A 3GSIA 2Z57B 4IOCQ 2Z30B 3DELB 4USIA 2HNZA 3RRGA 4UOHA 3RG6A 3L6GA 1AW0A 2P2AA 4KHPF 4Q8FA 2E5GA 4L73A 4FP9A 3PEHA 4DU7A 3MP6A 3MMJA 1FRMA 4OJGA 3CCRS 1JLCA 1MWYA 2B8PA 3MR2A 2HBYB 1HHTP 2ZYNA 3Q8YA 5IQ6A 1RTHB 3NS6A 3M05A 4QXDA 4ECVA 1RT6B 5KG6A 1SDXA 4FYWB 4OZJA 4X66F 4RU9A 1H7XA 4YOEA 2XYGB 4ED1A 5KCJA 2YKQA 4DV6J 4OYIA 1Y1MA 2ZC3A 3VCDA 2RMLA 2UUTA 5AXKA 4NX1A 4ZDNA 4P1EA 4NLYA 4X64F 2FY8A 3KJVB 2LMIA 3MAAB 3OEMA 3FRYA 2R8GA 3J81j 4G68B 3LUZA 1XS5A 2DQVA 1AWBA 3K1PA 4LF9J 3H6VA 5HN0A 1ZLQA 3SYZA 4N13A 5LSRA 3K89A 2Z58B 3OFFA 2OAUA 3I5OA 4HE0A 2V84A 1FQBA 3VZIA 5FLXU 4ONYA 1WHVA 2HS3A 3FVNA 2MGZA 3AJDA 1FDNA 2HFBA 4YB5A 4MYUA 1V3RA 3HSGA 4X8RA 1DCUA 5LXYA 1N6QA 2CQ2A 1MMNA 4O44B 2UVRA 4NA2A 3TAJA 3G87A 2UXCF 1LWEB 3IOVA 1JQFA 3Q8UA 4IFYA 4P9SA 2OHDA 5ADZA 2V67A 2B3BA 1NKBA 3MVWA 3V83A 3G71S 2UUCJ 4JI4F 3AD7C 2WAQD 2G0CA 1JX4A 1F6TA 1DBZA 4PQUB 3R5BA 3LAKA 5D0EA 3TUZC 4YICA 4JWYA 1RU1A 3HP6A 4AB5A 2CWKA 2F5GA 1N56A 2XWXA 3UCUP 1OMSA 5AE1A 5I58A 2IPOB 1YQHA 4DCYA 4DR2J 3UDLA 3PIPQ 2DKOB 1PC4A 1RU2A 2VD3A 3DRXA 4CM2A 1D3KA 1YKWA 4AQYJ 1OQ6A 2D9OA 4DZ6A 2V5HG 4WP9A 3DMJA 4JDFA 3R1HA 1D0EA 3RZAA 4ENOA 2V8HA 1A9NB 2RC8A 4UY8T 2HFVA 4PG4A 4KKOA 3VQTA 3ZSFA 3T9UA 1RDXA 2B56A 3ZNJ1 3L7PA 3K5NA 3PW0A 2AIXA 2VG6A 3CRBA 1NV5A 4C0BA 5LOMA 1RI7A 3B82A 4PXCA 3M8QB 2BE2A 1FPJA 2ZBIA 2XWYA 2ZYKA 1ELOA 4OETA 1PC5A 1ZPWX 4L72B 3ET6B 4DN9A 1YTVA 1POTA 3K00A 1WC5A 4ECRA 1DTTB 2YWHA 3M8YA 5KFVA 2J7UA 2O3DA 3W64A 2ZNTA 2OEKA 3IB1A 2ZDPA 4K5RA 2OPQA 2L9WA 3M8QA 2RQCA 2YNGA 5C42B 3U7JA 3W60A 4GL8A 4DQSA 4N8OA 3THVA 1DY3A 1NKXA 2IMOA 2R7RA 3OLAA 1KTVA 1CS4B 2W1BA 3ILLA 2V4JA 2MZQA 4H4MA 3PPPA 2XMJA 4KFBA 3WIVA 5DGAA 1BIYA 4AUKA 3ZZ0A 2PYYA 1TT1A 5KCJB 2XZWA 2RIJA 5H8QB 4USHA 1RWXB 4DI6A 3DKDA 3SDFA 1IIWA 4FBTA 5K8NA 4O8MA 1S7YA 3OJSA 3AY0A 5A76A 3PO5A 5BJRA 2MLYA 4ZJQA 1NU4A 4P0IA 1E6YA 1XMOJ 1T9TA 5KFLA 2VQEJ 2FLOA 1HKAA 4RUBA 4XKNA 4ZVFA 3PMVA 1JLFA 4HTJA 4O4RA 1K73T 1QAXA 2AYBA 1GTEA 2ZZNA 2CAJA 5J2QA 2MB0B 3ILTB 1VSOA 2NUUG 3PPNA 1N76A 3NWGA 3KBZA 3BEGB 2OKQA 1HMVB 3B4DA 3BGLA 4EFAC 1IKVA 1VIXA 2GFFA 1N0VC 3S7RA 4DFPA 1HD0A 3DHWC 5CBRA 5A6PA 4IGRA 3LTOA 4ELUA 2Y7IA 1MQIA 3C33A 3HHKA 4AS4A 1WHXA 3BM7A 4LF6F 1NB7A 4CWBA 4ZS9A 4TQUQ 2KFZA 3VV5A 1RWPB 2N3LA 3HHLA 4JI2J 2UYFA 2XI2A 1US4A 1S6QA 1P8GA 4UQTA 4HDHA 1F5BA 4RXLA 2V2VA 4X4VA 2V8GA 5FHOA 4HACA 4BS2A 1RT2B 5KFEA 3H4DA 4EDPA 2H5JB 2M70A 4C1UA 4B9MA 5F8IA 2YX1A 3U94A 1CC7A 2I9SA 1FD2A 2ZZMA 5AXMA 2UVWA 3N6MA 3SIPB 2GQCA 4J9OA 3C35A 1HBNB 2E29A 3NNAA 4NZ0A 4NEDA 3U02A 4BDQA 5KFXA 2LYVA 3HKZD 5H8NA 2X3DA 4USJC 4K2XA 4EZ9A 4E0DA 2ROGA 5M2UA 4QFLA 4DR4F 3DI6B 3LP1B 2WSFC 2COLA 3HD1A 4TLLB 1QSYA 2ZH2A 2PT1A 2QA1A 2WYKA 4ZVOB 2JL9A 1T05B 4HACB 1CBKA 3C6UA 4LUBA 4KTQA 3IJXB 4N5SA 1FTRA 4NF4B 4EMDA 2HVZA 3HHLD 4NLPA 1RWVB 4TNOA 1MXUA 5J2NB 1TKZB 3CCZA 5KT3A 3PJWA 2OWTA 3EDRB 1J2VA 2I0BA 3CSGA 3QSLA 5IT4A 1OVBA 5T41A 1WODA 2I5JB 1JXLA 4FORA 1YSJA 4P11A 3KLIA 3CT9A 5IT0A 2H25A 2XWIA 3TA2A 2FJWA 4RUAA 1B9JA 2B8QA 1GMWD 2GZOA 4HLBA 1PB8A 2CJ9A 4HHJA 1N32J 4L3NA 2CQGA 4J9QA 2KH9A 1FPEA 3KNGA 4AL6A 2FVQA 3C14A 2MKHA 3HHGA 5I2KB 2YNGB 4Y28C 2ZWPA 3AJ2A 3P7IA 2XXUA 2ILZA 2NXUA 3R5CA 4G8MA 3W3SA 1MPDA 1IBLF 3OD2A 1XMOF 1Q8IA 1ZBTA 4H4MB 4XPCA 3LA0A 2VBZA 4PQAA 4KPTA 2OMOA 3MZ1A 1U7LA 2GIQA 3OMBA 2CPYA 1NK6A 2WW4A 4OVSA 1FPIA 2DNKA 3G82B 5IKBA 2KTQA 4EYIB 3BKUA 3POTA 4LR7A 3RRHA 1A55A 3HFUA 2DD8S 1RADB 2DNGA 5GAHI 5ETMA 3ETOA 1BK4A 1RAOA 2FLLA 4I64A 2HK2A 1X4GA 4ELOA 3M9NB 1HSEA 2XLKA 1FQDA 4EK2A 5LL6d 1H72C 3D3BJ 1A7LA 4PG8A 4RNMA 2HQ0A 1AFJA 4PG6A 4X4OA 1FJCA 2NSBA 4DCPB 3JYTA 1S12A 1UIVA 4CCHA 3THIA 3IL1B 4TQRA 3TR5A 5I3PA 3NBPB 3J7AN 1S6PB 1FXLA 1J5OA 3MECA 2VFSA 1B0TA 3MMCB 1IKXB 1Q5VA 3KC1A 1MRPA 4N4UA 4OYOA 2YPNA 2AL5A 5KOWA 4DPWA 3X1LB 1FSAA 4J9MA 3MVYA 2AW0A 3GCXP 2KFYA 4DCOB 1B4SA 3T1YJ 4F8RA 4MLVA 1U25A 3PMWA 1NV7A 3A3NB 3A8JA 4FECA 3OL6A 2D21A 2I3WA 2CG4A 1RGVA 4ZCLA 2ASLA 1WOSA 2DGWA 2ZZXA 3DM2A 2XZTB 4F50A 1AL3A 3OENA 3IO6A 4FN5A 2P1SA 1DQAA 2V8DA 2JH3A 3QT5A 1UCNA 2AJFE 1NPPA 4WXWA 1NUXA 3TAQA 1FQAA 2YNFB 2I6WA 2HQGA 1TV6B 5KFAA 4OHYA 3BIGA 4I1DA 4QBUA 3FZVA 2DNQA 1KOOA 2YKMB 1HL6A 2ABYA 1NMUA 3H4BA 3N0VA 2E9ZA 3VHQA 1M5OC 5A8WB 3PNIA 4NMYA 3HCXA 1HWIA 1RKIA 4OYPA 3PYFA 2UYEA 3K6VA 2GIRA 1QGXA 4TU9A 1NNPA 1MY2A 4K59A 1X7VA 3QWUA 2VICA 3MAHA 2B9EA 3WAFA 2IFXA 4U6PA 4PDDA 2CZIA 4LQ3A 2D69A 1DSNA 2AYSA 4W92B 1MU2A 2CA9A 2WBRA 4NL5A 2DRBA 2CPZA 2LAOA 3C36A 2RSQA 1TK8A 1OY8A 2DR9A 4G6VB 1P27B 3FATA 4N8YA 1XVYA 3B78A 4NTLA 4B9UA 3KJVA 2W24A 3W62A 2KZMA 1RZMA 4Y2AA 1EARA 1RK8A 3GZGA 4JVIA 3A3CA 3FK4A 5HQLA 2VODA 3E2EA 3RGIA 2PVUA 5KT2A 3ZZUA 3ZTSA 4DS4A 3TAPA 1VQLS 1KR4A 1NK5A 4DMZA 2PD1A 5KT6A 5KFQA 5AJ3J 4G1QB 1GV8A 2J0QD 2XXTA 2HW3A 4CM0A 2QS3A 3MR3A 5KOXA 2IM2A 2LKZA 5C25B 4YDDB 4B9LA 4UA8A 3KHHA 1KS2A 3KLEB 4UABA 1KFSA 3UDCA 4OHWA 2UUAJ 1R89A 2W9CB 5KFNA 2VF3A 1JEUA 3KJTA 2ZKUA 4R75A 2F8HA 3LO3A 1BC6A 2O1LA 3I82A 3NGUA 4CLPA 1LK5A 3DLJA 1DOTA 2D1CA 4XPEA 4QSDA 2I4CA 3LWMA 1UPMB 1BQNA 1U1NA 3IX1A 3G96A 4DFJA 1A54A 1N34J 5K8MA 4NCGA 2WEFA 2DGXA 1S1WB 5J1NA 3V2UC 4R5PA 5F3TA 4LRAA 4H4KA 2XMUA 3BO2A 2G1HA 1U1PA 3I0SA 1N7WA 1T95A 2B65A 1VBYA 4MBPA 4BC7A 1OIBA 1JP4A 5CBSA 1JVYA 1LAXA 4QHQA 1VHIA 3UO0A 2JEIA 3K02A 2D7SA 4QIEA 1WF0A 1RYXA 3IXQA 4GX6A 4Q8EA 3TUPA 2W7YA 4IG0A 1REVA 1F2GA 3L09A 2UV8G 5J1DA 2OPSB 5L9XA 3LGMA 4OYWA 2XSJB 5KFTA 2YWGA 3ONQA 4MKBA 2EEYA 4OANA 3MEGB 2XZDB 1MPBA 6AT1B 1K47A 2FHKA 2GJIA 1KOHA 4EQBA 2QA4S 3K7RA 4TU7A 1F2HA 2R7SA 4DV4F 5IS2A 4USKA 3EYZA 1S0NA 4EUVA 1Y4CA 1TL3B 5KT4A 1X0FA 4YKIA 4ZEIA 4B02A 4PG7A 1S72S 1AH5A 2BOAA 1R7IA 2MHNA 4U1ZA 3DYAB 5D78A 2MZ1A 5LSOA 5A5LA 4GRKA 4J9LA 3AQOA 2XXYA 4MCOA 2V3QA 2QSXA 1S79A 2ZC4A 1TKTB 1P1OA 2X26A 3WQPA 4FF2A 5GADI 4NQ8A 4Q0BB 1VR6A 2BMBA 2GHAA 3IGNA 4TLQA 1VISA 2VJUA 3CULA 4BDRA 1H44A 2XXVA 5L39A 4OYVA 3PXGa 2FC8A 1RYOA 5KZTA 2VOZA 4WP8A 2V4QA 2Y5LA 1M5KC 1SD3A 3EGWB 1QE1A 2QVVA 3FUYA 4PAKA 4P71A 4N17A 3AOCA 3OW2R 1HI0P 1G2EA 1HNWF 2ZNZA 1X8DA 1WEXA 1YZ7A 4Q7AA 3Q8QB 3TWZA 3HKWA 3DCAA 3CWJA 1ZYQA 3CJTA 3PFEA 5I58B 3L6HA 1KA1A 3W9IA 4M94A 4F4ZA 3L7UA 4OFJA 1VQYA 3TQEA 5CMBA 2Q6CA 3QGPA 4LA9A 1YHQS 3Q89A 4OI6A 5J2NA 5IZZA 1VQ6S 4C11B 2RC7A 3NNHA 3PV0E 5I56B 4X2BA 2B0GA 2DHGA 1RWOB 1VC6A 3OFEA 3W7BA 2R8HA 4ELVA 5DETA 5IWAJ 4ZPAA 3QMFA 1NK7A 4OLPA 3UD4P 1GXTA 3O5TB 4R6YA 4MMOA 4UTGA 3UDEA 1C0UA 4XKQA 4E98A 1IR0A 3E01B 3T9HB 5KFZA 1BLFA 5J1EB 1NI9A 3CG3A 2JX2A 2VC1A 3GLJA 2O1PA 1IBKF 1KDNA 5CRYA 3R7BB 1GTHA 1B7FA 4GWZA 1X4AA 2O66A 1M5EA 2GQ2A 2Z2LA 4ICLB 3FV1A 1UTBA 3S9LC 1B4HA 4K0KJ 4OZ3A 2HHHF 4KH0B 5FTIA 2WRMA 4P2MA 2Q43A 3VE1B 2JRSA 4RWWA 1NUWA 3BH6B 4MFIA 1SW2A 3G86A 2MPUA 1RJJA 4A8FA 3SI8A 3LALA 1FRHA 4JI0J 2AIRB 4DDFA 3EVOA 3GWCA 2M88A 1Y5LB 1WG4A 1UP1A 3AA9A 4DR7J 3FKBA 1S9GA 4UW2A 2DT9A 4JV0A 3DP6A 3IRXA 2X1BA 5ETSA 1R0AA 1MH4A 1DAXA 4QFNA 4ED8A 4QW8A 1WUUA 1S77D 3GIJA 1WC1A 1S9EB 3AD8C 2O67A 4LF1A 2VQFF 1NH8A 3HSZA 2FHMA 4ZJOA 4MHFA 1TL1A 4OX9F 1FBPA 3OXNA 1GQEA 2XXPA 4GO7X 1H45A 1T94A 2QEXS 2VOPA 4OI1A 3W9WA 1T9YA 1RLCL 4X65F 1T3NA 2E9RX 1MQHA 3UVJB 2RU3A 2CQ3A 1Q8KA 5HROA 1UVNA 2V4CA 1JK9B 5HP1A 3BGOP 2ZBPA 5AA2A 1IMBA 1TELA 1AYEA 3A8KA 1OQ3A 3DC2A 3NCRA 3K5PA 3ZXWA 4CO1A 2XMTA 4G4PA 1Y9UA 2FHYA 3OJUA 2ZHOA 3PW7A 4IO1A 4EGLA 1S9EA 2AMCB 4DR2F 2AEMA 4DL2A 1REGX 2HNDB 4M5KA 1FPGA 2BV3A 4OI2A 3I87A 1F5CA 1R0CB 2B43A 1RTIA 3TYTA 4B9TA 2V2KA 5HMWA 3DRRA 2DWAA 4ZN1A 2KLFA 1N7XA 2ATLA 3LQVA 1O63A 1FBEA 1NUYA 2R71A 1VLYA 2UXCJ 3N6TA 1EZ9A 3KHGA 3QIMA 3D4JA 3HF5A 3MCOA 1RDZA 1U8WA 1HNZJ 5J2PA 1HI1A 2NPIA 1QKBA 4FEBA 1PBUA 2A0FB 3OOAA 1ROFA 2I1RA 4B08A 2VGQA 4WFNQ 1U1QA 4QU7A 4DSLA 4A8MP 1C4AA 2Q1LA 1P1NA 4QIVA 4M8LA 4AYBD 4XTTA 2ZNUA 5HANA 1HWJA 4X04A 1DURA 3IOTA 2HQ3A 3C31A 1C0TB 1VQPS 2Z56B 4YAHX 1Y4TA 3L7OA 3R7XA 4KC5A 1RAGB 1HBMB 4AXJA 3AB4B 2XSFA 3MMCA 1EIYB 4PQUA 5DT6A 2XD3A 1BUXA 4ZECA 1D3WA 2RNEA 5D8HB 3ZNUA 3KSXA 5C5JA 4DI3D 5J2PB 4U23A 4K4VA 2I3VA 4NA1A 1YIJS 1P1QA 5H9EJ 2J0WA 3HHEA 1WVJA 1FRKA 1KLMA 4PWDB 1B7YB 4U4XA 3VF0B 2X1GA 4UOFA 1YJ7A 4LRBA 4ZA1A 3O44A 4CTAA 2UUBF 5ICQA 2SXLA 5M2PA 3AXKA 1L5UA 1TV6A 1UWAA 4OESA 4NN3A 1LXNA 3R8YA 4F3OA 4QOTA 4OJHA 3EWGA 4X4PA 3KK1A 1XOCA 3CCLS 1I51B 3OO8A 3R97A 1RT5A 4DHVA 2A6MA 3IBCB 3MEDB 5ETLA 2F7VA 4TLMB 1A7GE 4F3QA 2FVZA 2CNNB 1RWMB 1U09A 3ETMA 4G68A 4XDDA 3KLFB 3M6VA 2YJPA 2VPNA 2HHUA 1EH3A 1DPEA 3R5DA 1VQSA 3G6VA 4OX7A 3CJ5A 2GJ2A 4P56A 2W9BB 2W9AA 1NDKA 4M63A 3KLGA 3I9ZA 4B9NA 1SI9A 4OWDA 2VB6A 2VDIA 1BLUA 2ADBA 3I3VA 4C9DA 4JI2F 1TL7B 2ANJA 3CEDA 3CCMS 3Q2SC 3L9ZA 3M6WA 2WHOA 3LP0B 2C22A 3K8VA 3LSFB 3DOMB 5I2NA 2BEFA 2DGUA 2UP1A 2VA2A 4C6AA 2OUGA 4ALZA 4I1TA 2GFEA 1SCJB 2LXIA 4IFVA 1P9QC 2H5EA 1TUVA 3H3GA 3NY0A 3K57A 3POTB 1PG5B 3JB9k 3AA8A 4PUOA 2QL3A 3I5CA 1DMBA 1DRZA 3GYYA 1D9AA 4NEZA 4YHHJ 5AXLA 4HTIA 5I57A 1Y00A 4FDFA 1O7TA 2HQFA 3GR1A 2M5YA 3GFZA 5F24A 4EF2A 5B0AA 3FBCA 4TY9A 2H65B 3KFWX 2VQEF 2Z0GA 4NLWA 4KCCA 2QYGA 4FNHA 2UXDF 2WBDA 2XCAA 3R27A 4CO0A 3MM8B 4KHZE 2B9XA 3GCWP 3DOKB 4E0XA 2PDAA 5CC2A 3Q28A 2DVZA 4F39A 5G4DA 2HNZB 3EXCX 4ED6A 1R8AA 1FTAA 4L76A 1TZ0A 3K5LA 3V8XB 4PE3A 2Y1LB 1JWWA 2OD6A 1RWWB 1FWKA 4K8RA 1BY9A 4DLEA 3S8SA 3BZQA 4J9PA 3W63A 4C3MA 5L1KA 2FVRA 3MEEB 1SJRA 3W5YA 5HMXA 3SQGA 5FIIA 2QLJB 3TTLA 4QWCA 4Q8RA 1LV5A 3T9ZA 4JOUA 4KGMA 5JTYA 4K4UA 3SXLA 3C34A 1VC0A 1ZTWA 3TEGA 1NV2A 3RW7A 1BMQB 3QBCA 4IKAA 5T3JA 1O51A 2MHEA 3IFCA 3A09A 4DR6F 3BBRA 2YLNA 4GIZA 2DNMA 4MFBA 4U8YA 1Y4ZB 4CYUA 2VPOA 2DY9A 3D1RA 4DL6A 1SW1A 4PFTA 3BBCA 3E4RA 3B8BA 4GXSB 1YJVA 5K14B 1X9MA 4CT9A 4DV7J 4JVDA 1OLCA 3V6HA 4PBQA 1KC8T 4OQOA 1KVIA 1EX8A 1USYE 3RYDA 2XC9A 1MY1A 2OI2A 5KFBA 4C11A 2ZXTA 2HURA 2XBPA 1MDQA 4ED4A 2PI5A 2HCAA 4OEVA 1PDAA 4A47A 2MJUA 4F4WA 3OTBA 1VQKS 2J0XA 4LF5F 1CNQA 3BFTA 3MUQA 1VR5A 3DGPA 3CSKA 5B09A 3N5LA 1LB8A 2GVDB 2ROEA 3NOCA 1G0IA 1W26A 1Y11A 3BR9A 2B4LA 4DUZF 4GWOA 4ATNA 1RT7B 1YJ9S 5IZHA 1XEZA 3W9VA 4P73A 4U9RA 2O51A 3NXZA 3RU0A 3KHLA 4Y65A 3K01A 2ZUAA 2VFVA 5F7VA 1DTZA 1YPNA 3J7A1 4FS1A 1QUIA 1DZ5A 3ILIA 3MI7X 4CLUA 1M5PC 2QLXA 1H6KX 4JB7A 1FX4A 4DL4A 4I6AA 2CIMA 3JSMA 2QL5B 1YGYA 3QRPA 1HWLA 4DR5F 2EFPA 1SYHA 1KHVA 2PE8A 2DNLA 3EPIA 3DLKA 5ET7A 2KRRA 2H4IA 3NKYA 2KI2A 1KEKA 1U2RA 3KJ7A 4KRWA 1DHMA 1NSPA 1Q82T 4DUYF 2DGSA 3T1HF 2Y7PA 1NUZA 2DS9A 1JW4A 3PTWA 4UT4A 3IS9B 3ZO7A 4DSKA 1RSCA 1TVRA 1WD6A 1YRUA 1CQMA 1PBQA 2J9DE 4Q5VA 2F34A 1HBOB 3FZBA 1JLQB 1VLOA 1V6HA 2CQ0A 3WHIA 1FCKA 1PBAA 4L6V3 5F8LA 4DQRA 3NG8A 4AL5A 2HVEA 2IM1A 4NWDA 4DX5A 2KT2A 1HBUA 4ZJLA 4P7VA 2WX9A 1IBLJ 1BQXA 1V5IB 2OWZA 3W2WA 3CDAA 5CAAA 3M9OB 4N6KA 1RE1B 3IG1B 1RP5A 5DG8A 3Q8VA 4KT0C 3MP8A 4LRFA 1TFYA 4MT1A 1MW7A 1TQLA 1WF1A 3OUYA 4IG3B 3R6LB 3PM9A 3FQKA 1EU8A 3FUZA 2A5TB 3GE9A 1Y20A 1NK0A 1X31C 2LQ9A 1F5AA 1M1HA 1L5TA 5L9OA 1Q8BA 2HIQA 3OVSA 4DN0A 4PG5A 4ZZAA 1YAEA 1SC3B 1IQ7A 1TWYA 5IT9U 1R0BG 3FEXB 1URGA 4NLDA 2VP1A 1FNMA 3HPIA 4KYSA 2PO4A 2ZM6J 2ASYA 3M8SA 4F7VA 3P5BP 4WFAQ 2B3FA 2BJ7A 3V6KA 4HTGA 1F9EB 4WZQA 2DO4A 3OXFA 3JYTB 4ZKAA 1JLGB 3V6JA 1G0HA 3K2DA 3IO1A 1I6AA 4TU8A 1SBPA 2UVHA 4Y2IA 3BO4A 2WVEA 1LFIA 1VFDA 2WVDA 3HMJG 2HMIB 2KL8A 1UEKA 3SV3A 1U4BA 1A8EA 3RTFB 1WSVA 4OZ1A 1BD6A 4DL0C 3M2RB 3P45B 2DEJA 3C15B 2FHJD 1IXCA 4P2XA 2FD2A 4OX6A 2BE2B 1HYSA 2CNLB 1HNIB 4OYMA 5KFFA 2E1AA 2FA7A 1UVMA 2Y3YA 1WF2A 3ELHA 5DQHA 5I2KA 2KM8B 3GIRA 3CMAS 5L1LA 1FA0A 1LAFE 3C66A 3MURP 4EO6A 1NJZA 2QT7A 2YTCA 3QLHB 2NYIA 1GT8A 1CJVA 2HLUA 4O0NA 2XMAA 1FDAA 2HFUA 2ATCB 1H43A 4USUA 2HGNA 3MMBA 2G2OA 1FK9B 1C4CA 3ISZA 2EG2A 2E44A 2ESNA 2G13A 4EBCA 4P74A 2PFYA 4DFMA 4ESXA 2BANA 5IZ1A 1TL5A 3D6FB 2OBGA 3OSPA 3NGSA 4LBIA 2OPSA 2Y7RA 4G8NA 1FRXA 2DO0A 2J0SD 3BQ2A 4NF8A 1NHKL 5SUHA 4WZMA 3F41A 2PCRA 3NGDA 3T0JA 4FKYA 2VKZG 2EPIA 3M2UA 4DJBA 2F7CA 1JMTA 1ZAVA 1M5HA 4Z0IA 2W8LA 4U4SA 3DLNA 4DOZA 5HVHA 4NWBA 1S48A 3NCQA 3QATA 4NI2A 3D1HA 1N3WA 3BIHA 1S57A 1T05A 1FJ6A 2HRYA 4HEA9 2MZSA 1Q78A 5A2QU 5KFRA 3THTA 3OHAA 2EFGA 3CSBA 3H5SA 3PDNA 5KG2A 3MCMA 4F19A 2YQ0A 4K4YA 3I56S 1FJEB 4BLGA 3UDVA 3HZGA 1S0MA 4G1PA 2AYEA 3FGVA 2JLFA 3DRPA 1F1BB 2KQZA 3LC8A 3KLIB 3KYLA 3I0RB 3MM7B 2EK6A 3RRKA 1NV4A 5K9FA 1EKSA 4LFCF 2JEGA 5JVGQ 5B0FA 1FDBA 4NI2B 2HHPA 1DTTA 4RNNA 1UVIA 1JETA 2GV1A 2YNHA 4IR8A 5J16A 5HATA 3THPA 4NMXA 3EQ1A 2XQCA 5E5NA 5B0EA 2L41A 2E0SA 3N28A 1E6YB 2IA6A 3SEVA 3DGVA 2FC9A 2GMHA 1T8EA 2HFOA 3HD2A 1FQCA 4M1VA 2A5SA 1LGBC 4YUDA 4N15A 5ETKA 4K7QA 1RYRA 4X64J 4ZCIA 1T9UA 4C8LA 3MM7A 2XGPA 2ZKTA 5LJ5Y 3MJNA 3OL9A 2WOMB 3TP2A 2UU9J 1VIOA 2IJFA 3U27A 1B3LA 3MEGA 3LP2A 2C1EB 3H5YA 5ETVA 3OTEA 4OL8A 2XXHA 2MQLA 3M3LA 1UFWA 2BRKA 2YNHB 3AJ1A 2ZBQA 1WELA 1R8PA 2DHHA 2CJXB 1VC5A 2BKNA 2M52A 2I2YA 1N36F 2ZH5A 1YG0A 3DI6A 3LP1A 1XC1A 4GX4A 3MVXA 3RAQA 1X5PA 2Q3PA 4Z37A 3VWSA 3C16B 4O3RA 2F97A 3DNCA 3B6BA 3CMQA 3DP8A 1AXQA 4NZ6A 1GNKA 3MCSA 1PB7A 5HM4B 3PJXA 3A1YG 1IEJA 2BXJA 4BDMA 3SEXA 3RLFE 3H7MA 2EC0A 3PO4A 2A6OA 2LQBA 3C8YA 4CLLA 4EUOA 3CD6S 3MYUA 2V4JB 2EBGA 2K3IA 2FVCA 3PZPA 3H2UB 2MQNA 4ZOSA 4MLQA 4F4XA 4UZBA 2DWIA 1S9GB 3VVUA 3CJ4A 2HS0A 2MKJA 3FSXA 4ER8A 2VPWB 3VAHA 2DWHA 1S4EA 5IXUA 2ZBRA 4PXDA 2C3UA 3HJFA 2YPZA 2B4MA 4JI6J 5A2QY 4NAPA 4CQ1A 1LFGA 1VDHA 4YKPA 1L3UA 4H4OB 4LFCJ 1KQFB 3N5FA 1RDYA 1U8SA 3QQCD 2NLWA 2XD2A 4JI6F 1JLFB 2CJYB 4DPTA 3MBPA 3HXMA 1IXGA 3G4SS 3JXOA 4OV1A 4UF4A 1Z1ZA 5EHMA 1I1GA 4ELQA 2BZ2A 3UVJA 3MUVP 3RBEA 3F44A 5CA5A 1RCXB 3I5BA 4BCAA 4GO5X 3U1LA 3ZTOA 2B51A 2DH8A 4IDKA 3LSWA 1LWFB 2I4BA 1B99A 1LBYA 1WNEA 1GEHA 1SQGA 3CO9A 3FVYA 2RILA 1YJWS 2E66A 4BDPA 1ZJLA 1I3OB 3RPLB 3KHRA 1SVXB 3MZBA 1U1KA 1RDRA 5D4NA 3ZKLA 4USVA 1URSA 4NXMJ 4R74A 4LR9A 4PR6A 2ZVIA 3OFHA 3FFIB 1QAYA 4F0KA 3A29A 3NS5A 2CEYA 1SC1B 2R2SA 5KT7A 3OEKA 1FKAF 4E0WA 2OTLS 3IC1A 3H90A 2YQ3A 3H98A 3T93B 5B70A 2W7AA 4CO4A 3I32A 3FJ7A 3HJVA 2VIHA 3TDJA 2WCXA 2XXIA 3EZUA 1QLNA 2CDQA 2R8IA 1I94J 2IAJA 2XYPB 3GIIA 2A5TA 2CQCA 3W1YC 4XKPA 4ZP9A 5ETTA 1ZA1B 2C28A 4GKKF 4HR2A 1ZM4A 1RAAB 4A8OA 1CSJA 5KFOA 1OYDA 2MKSA 1GXLA 1QULA 2R7TA 5D4PA 2XNQA 2GQ1A 3T5HA 3IAZA 1IXKA 2U1AA 3IR1A 5T7LA 5ITOA 1OO0B 4DPYA 1S7HA 5I7IA 1NKCA 2GO8A 4LF8J 3GBAA 1R27B 3HN0A 1NSKL 2OFGX 3BGRA 3BQ1A 3FBPA 5JUMA 2XI3A 2I58A 4NPOA 3SFGA 5A0YA 1F3FA 4BBYA 3C16A 5CI5A 1SKRA 3V5AA 3M7VA 1Q79A 1Q81T 3E01A 5AXNA 4N77A 3EXYA 4UACA 2OJ3A 1VQ7S 4I40A 1SW4A 2IJRA 1FE4A 4EI2A 4EYHB 4HHUA 1SBRA 4YHHF 2XHDA 3SEOA 1MY4A 5DVIA 3MPYA 2R7QA 3BKTA 2IC3B 4LQ5A 1KQSR 1RXOB 1CQNA 3AB2B 5TPAB 1JW1A 4DF4A 1Q86T 4OFZA 4GX3A 2VOOA 1SL0A 2THIA 2WONB 2ZMBA 1HWUA 1K1QA 4GBVA 2R7VA 2XSJA 1R9LA 1M5VC 4CZCA 1Y1ZA 1P1UA 3OSQA 3RTWB 2ZD1B 5T7LB 4AXIA 3D4CA 4IUFA 3SCKE 3R6GB 4YB6A 1IQTA 4N07A 1FW0A 5TU0A 4OHNA 4XF5A 4RW9B 4RUHA 1VQ8S 4ELPA 1YDLA 5H8HA 4ERDA 1N6QB 1RAFB 4U8VA 3PFOA 4ETZA 4NLQA 4KPCA 4JP8A 2VONA 4OEUA 4MMPA 2Y9HA 3OVAA 2YWWA 4USTA 3BKFA 1B3HA 4NYOA 5DO2A 1TKXB 4KYEA 1D9VA 1VK8A 1WACA 1MN9A 1IWAA 1F3VA 2Q2CA 3DN9A 2Y8YA 3B4MA 1EYKA 3BSCA 4DQIA 3ZZOA 4RW4A 4NF6A 2F8MA 1Y5IB 3UCGA 2WONA 3LAMA 4Y00A 4C98A 4I8CA 1X9SA 3CJRA 4ZVUB 1N54B 4Y2MA 2HS4A 1HBUB 3CDEA 4G1QA 3I6PA 2ABHA 2NUHA 4EU0A 3WBZA 2JFDA 4DIGA 1QD1A 1VBZA 4PFIA 1WEZA 4WFBQ 1DTQB 4U7CA 1NH7A 1HR0F 1AUDA 1SC4B 4MH5A 4DCXA 1JLBA 4K5SA 5HLFA 2ZDOA 5DG7A 3QO9B 3TUSA 4JI7F 3KJNB 3TPAA 3K6UA 1K8AT 3FFIA 2ONRA 2VFRA 3PPOA 4LF9F 1M5DA 4NF6B 3KOSA 2CQBA 2A2DA 1LBZA 4ZPTR 5L38A 2ONSA 1NEEA 4P0GA 2HIYA 4ZCMA 3IJOB 4HT5A 2VH7A 1ACMB 1MY3A 3C6TA 4MNPA 4QSCA 4ID8A 5C42A 3BJYA 4F4YA 2QN6B 3G3FA 1DJ0A 4F18A 4FIMA 3IM8A 1XC9A 2ZH9A 4WEPA 1EZZB 1WKKA 2YKOA 3MMAB 5DZ7A 4ZEFA 3UR0A 2O1MA 3PYGA 5BXIA 4GVLA 1OPIA 1JLGA 2B3TB 4H1XA 1FBCA 1T9XA 4DX6A 5DVJA 1FJGJ 4DE8A 1MU2B 4YB1P 2B7CB 4F3SA 1B7UA 4A8WA 4OQJA 5LMUF 5FJ4A 2VPYB 4G68C 3MEDA 4HL9A 1B3EA 1JNFA 2R9LA 1X4BA 1JLQA 5DYHA 2VHAA 1VBKA 2VZ9A 4XIGQ 4NRUA 3TTNA 1FNXH 3W61A 1MS7A 4EXKA 4TYBA 1VJWA 2VA3A 2P9EA 3JSYA 3QAUA 4NRTA 1X4DA 1S1TB 1WKJA 4P6QA 3JZJA 4LF7F 1Q7YT 2P3VA 3SEUA 3ILUB 3OL7A 1YK9A 2HLTA 4ZP7A 3RUMA 4YP3A 2AJ4A 2V8VA 1P6TA 3FBFA 2LP4A 2DXYA 4QR1A 4KR5A 3GJSB 3EM1A 3FCVA 4WE1B 1YITS 2V8PA 2OEMA 4OZ9A 5H8FA 1I6QA 3GV8B 3HX9A 3TO8A 5AJ3F 3DGPB 2BQRA 2QLBB 5D6GA 2C2DA 1OWXA 5DW8A 3GV5B 2LECA 1ZMGA 4WTYA 3B6WA 2KRBA 1MXXA 4CO5A 2JVOA 4DLGA 3EZOA 4KSEB 1MG7A 3FXUA 2UXAA 1H2VZ 3CCUS 3K0VA 4F1YA 2DNOA 2QZ8A 3ITHA 3O3LA 2J9EA 1DTGA 1NV3A 2H5IB 2D3O1 2G29A 3FGSA 4JVCA 1B5HA 2DVIA 2BJIA 2XY6A 1V5VA 1WJ9A 1TAUA 2CZVC 4I67A 3FCHA 4DG1A 4BC9A 2NUVA 2I0XA 1PBPA 3SQOP 3K0JA 3VVDA 3F73A 3BDPA 3EMTA 2VASA 4HDGA 2UVIA 5C24A 2A1BA 5GAEI 2Q88A 4YKJA 3NGTA 4QIGA 1LNQA 1S9TA 3UGWA 2BOPA 4CIOA 4UUXA 3GJTB 3MPUB 2HHVA 2PBWA 5HQ8A 4ND9A 5DQGA 4AE5A 2YH0A 2PMWA 3PR5B 2R2RA 4L3KA 2K7JA 2MZTA 1N3XA 4KV8A 2OZZA 3EPGA 2Y5KA 5KG4A 3K1MA 4LN5A 1RWUA 4AT1B 3CCTA 5ET5A 4YFUA 1TFAA 1C0TA 1RT1A 4LF8F 1CB6A 2GGPB 2LA4A 2K3KA 4NX9A 2HZAA 4NE4A 1XNQF 2LEBA 2G0IA 1LWFA 1SJQA 2V9KA 2K8GA 4XAKA 3Q8SB 1SXLA 1UVKA 1DLOB 3B6TA 5LDZA 2GC8A 3U93A 4F3PA 4I6YA 2FZCB 4ES1A 1YX2A 4N76A 3FSYA 1FWPA