4LUBA

X-ray structure of prephenate dehydratase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
275
structure length
188
Chain Sequence
TMKIAYLGPSGSFTHNVALHAFPAADLLPFENITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYLFHQAKIEAVAEIILENYTRFWVLGDETPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFIIDFENHNEKLVSFALEELTSIGIHYKILGKYAVYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of prephenate dehydratase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Lyase
molecule keywords Putative prephenate dehydratase
total genus 54
structure length 188
sequence length 275
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lubA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lubA01
5EHSA 2Y84A 1TXFA 1LFGA 3PPRA 1B4ZA 4ZEDA 3KN7A 1FTKA 4G4PA 2CDQA 4YKIA 1DSNA 1FQAA 3C9HA 3IR1A 1QUIA 3CFLA 4NF8A 4DXBA 3MPKA 1Q35A 4OFJA 4GLIA 1XS5A 2ZYMA 4N6PA 2XX9A 5I56B 1B9JA 1UIVA 4F29A 5M2VA 1M5EA 3TKDA 3FXQA 2REJA 4NF8B 3K6UA 5K2YA 2B3FA 3A3CA 3ECRA 1SYHA 5AA1A 4G8NA 3SKPA 3H6WA 1AOVA 2DSFA 3M3LA 2W7YA 3PUXE 1QKAA 2PT1A 1B4HA 2V25A 4JWYA 3FZVA 4XXUA 5I58A 4ELOA 2NWJA 4AQ4A 1FCKA 2DXRA 1OQHA 5HBCA 3A09A 3DELB 4FORA 3RTWB 4X1DA 1JW1A 2DT9A 4QSCA 4XKPA 1B7UA 2QPQA 1Y4TA 5TU0A 3T93B 1H45A 2ONKE 3LBSA 3OBIA 3TMGA 3N94A 2NVUB 3MZBA 5I57A 5DVJA 5FTHA 3P7IA 4G2ZA 1SC6A 3LSLA 4F31B 2Z22A 1NMUA 1FTOA 4QF9A 3USDA 1QVSA 1D3KA 5H8NA 5ICTA 4PP0A 3HSTA 4BDQA 2O6AA 4ZS9A 4K3FA 4TLMB 2F8DA 3PV0E 4JDFA 4N13A 2F97A 1FQBA 3MW0A 1UTHB 1TT1A 2V93A 2Q2AA 1OVBA 5TP9B 3OSQA 3TUSA 2R6GE 3SESA 3WAEA 1ATGA 3FUZA 1N76A 2QMXA 3VXCA 1MQIA 2DWAA 3S9NC 1B3LA 3V8XB 1B3HA 4MH5A 4F39A 4QFPA 5TPAB 2O68A 1WODA 3T9UA 1SBPA 2Z8EA 2RINA 3MPLA 2ZYNA 1NKXA 1SW1A 3MVZA 3SEVA 1B6HA 2VHAA 1XVYA 1FTJA 5EYFA 2XXPA 3L7OA 1OMPA 4P0IA 3V83A 1LAHE 4XTCQ 1MXZA 4TOZA 3LUYA 3MP6A 2H98A 2I0CA 3Q26A 3OFHA 3N6TA 1UJ4A 3CFXA 1D4NA 3GZGA 3B6QA 1GV8A 1RYXA 5I59B 3ONMA 5I59A 1POY1 1BTJA 1IITA 5J1DA 3UIFA 3QXMA 4KR5A 3RGYA 3FVNA 5A5XA 1N3XA 1MG1A 3IJOB 3ENWA 3G3JA 1ANFA 5KCJA 3HHFA 4R9FA 1SD3A 2PT2A 3MP8A 1IXCA 5CRYA 4MBPA 1ZBMA 2QRYA 3H3GA 3TAJA 5CBSA 4ZEBA 2O7UA 2V3TA 4GMKA 3EN3A 1I69A 3EHUA 3CRBA 3TYHA 3UW1A 4H0WA 3MVXA 2A5TB 3RNNA 4R6HA 2IEEA 3IO6A 3G3IA 2DE3A 4ELQA 2GHBA 5BWJA 5CBRA 4PFYA 4JWXA 1H43A 3TODA 4X48A 4THIA 3TPAA 3VLVA 4M1VA 3KN8A 2DE2A 2F7AA 4N07A 4YKPA 1SDXA 3V89B 1LB9A 3K00A 3OMBA 4ISUA 4LVQA 3E4RA 1FTMA 3EPEA 3KZGA 4OMBA 1URSA 1SW4A 2I3VA 1IZ1A 4GL8A 2P0SA 1ZTYA 3DHXA 1N04A 3BKIB 4DZ1A 3DLNA 4KI0E 4YAHX 1JETA 1GTKA 1PEBA 1ELJA 1F9BA 3ENQA 2P2AA 2DQVA 1DMBA 4IB2A 3MZ1A 2UVHA 3UK4A 4EQ7A 1WDNA 1MDQA 4IO6A 1Y1ZA 4NE4A 4GD5A 2QRRA 3RQTA 2AIXA 3K01A 3SDFA 4C1TA 2PA3A 1P1QA 3H6VA 2HZKA 4P0GA 2O7IA 1Y7PA 5AA2B 1NH8A 3IORA 1R9LA 3PMVA 5CC2A 4L17A 1N0TA 3TTRA 1LLSA 2I3WA 3O97A 3SEWA 1LCTA 2R71A 3U72A 1I6BA 4OHNA 4U21A 3W7BA 4ZE9A 3IOUA 3K1PA 2Z8FA 1NL5A 1MXVA 3W15C 2HZLA 5T41A 1LBBA 2XXIA 4DDDA 3VVFA 4G8MA 3IOTA 1JQFA 2DOJA 1A8FA 3MP1A 5DEXB 3MC2A 1A55A 2F7CA 3EHTA 1IQ7A 4GWOA 2OWTA 3PD8A 3KFMA 1Y3QA 2ZYOA 4OESA 4R2FA 3OFGA 1DPPA 4KQPA 3HPIA 3K4UA 3HN0A 3TUIC 3HO7A 2HEUA 2MDAA 4ECFA 4F2OA 3H6TA 3KSJA 3B6TA 5CMMA 1IXHA 2LVWA 2A5TA 2UXAA 3JZJA 2HFBA 3TQWA 4YU0A 1JVXA 3TTLA 2UYEA 4MLQA 1LSTA 3OD7A 4KYEA 3FJGA 4DXCA 4HCWA 4LQ2A 3DDNA 1UQWA 5TP9A 4O3BA 1B2HA 2I49A 1SW2A 3CG1A 4H67A 3E3KA 3G3KA 3IOVA 4H65A 3O6IA 4NTLA 3O29A 4BLAA 5F1QA 4IGRA 2QS2A 1O8BA 3THIA 3KJTA 3QYTA 2VP1A 2P9GA 3PMWA 2D3IA 3AB2B 4AB5A 4DXUA 3U7JA 4DLDA 4F3SA 1TFAA 1URGA 4NF6B 2AL5A 4NWDA 3FGSA 2DTJA 4BDRA 4KPTA 4RK2A 3M8UA 4MLVA 3VVEA 1Y20A 3IXQA 1PC3A 1NNKA 4FEBA 2D21A 4IY6A 2P1SA 1FQEA 4U1ZA 2XXTA 4YKKA 1CB6A 4Z7EA 3U8QA 2PX1A 1N7XA 5AA2A 1LGBC 3C33A 3GBAA 1QULA 3HHGA 4OEUA 3Q27A 1JVYA 2OCUA 4F3BA 1YCJA 2QJEA 3VXBA 3FJMA 5B70A 2XX8A 3N5LA 3VV5A 5ITPA 1T0KA 2NUVA 4EUOA 3CVGA 2RCAA 3FXUA 2QL3A 5CMKA 2RC8A 3D4CA 1MQDA 3CFZA 4NEDA 1I6AA 1ZLQA 2H9ZA 3TTMA 4I9DA 4R72A 1M5CA 4EQ9A 3T22A 3W9WA 4FECA 1GVCA 4OTEA 3FVOA 2VD2A 3LSFB 1CE2A 3EHSA 2PVUA 1DPEA 4NMLA 2NXOA 5KDTA 3QSLA 1L5TA 1NNPA 3B7DA 3MTJA 5DT6A 1LFIA 2ZNUA 4OVJA 2DWJA 4PWUA 3BBRA 3VLUA 3K6VA 1BIYA 1RYOA 3TUZC 4R6YA 3T9XB 1DTZA 5DVFA 1IUDA 3H03A 1Z7ME 2KO1A 4RPOA 1VFEA 3PGFA 1B0HA 1ZKBA 4R9GA 4H6DA 1P1WA 3L6HA 1H76A 2DWIA 4HS7A 4NWCA 4QSDA 1AMFA 1VR5A 2D5WA 1I6QA 2LQJA 3OO8A 4WEDA 1BLFA 1Y3PA 4HTGA 4ZEKA 4LZ5A 3MVYA 5H8HB 2XX7A 4OXVA 5IS2A 1ZMGA 4IO5A 3C35A 4LZ7A 5CMCA 2FA7A 1YAEA 4YB6A 5JTYB 4RK9A 3VE1B 1YPNA 3PUYE 2GHAA 3W9VA 3QK6A 4IO2A 1OQGA 1IXGA 5I2NB 3JV9A 4I8CA 3ZKKA 3IO4A 2QMWA 3PUZE 1Y4CA 3OOAA 2V3QA 4XKQA 3FD3A 1UIUA 4U23A 1VSOA 3GXAA 5I84A 3IK6B 1BP5A 2I4CA 2UYFA 3N0VA 5JJBA 4XKNA 1B52A 4QFOA 3IOWA 1PBQA 3CSBA 4QFNA 4KCDA 4I62A 3DP6A 3I5OA 1O7TA 3ILTB 5H8QB 3S9MC 4ONYA 3MUQA 2H25A 1USYH 4DIGA 1FW0A 3G7WA 2ALUA 2DE4A 2IA4A 2XD2A 1P1NA 2ESNA 5L9SA 1QUJA 4LONB 4IO7A 3T96B 1PB8A 2PBWA 4Q0CA 5ELVA 1B3GA 4ZEFA 2XXWA 3MQ9A 2J0XA 4EXKA 3T9HB 3SEYA 2I48A 3C36A 3PD9A 2JOQA 3G3GA 3KGCA 2O84X 1UTBA 4G68A 4F22A 2F1FA 4U4XA 1Z7NE 2QSWA 1UJ5A 4ELRA 3KG2A 5DYHA 5ITOA 1VE4A 3UGWA 2O51A 2DYXA 5I58B 3GLBA 2HAVA 4YB5A 1AH5A 2B3BA 4FE8A 4KYSA 1LAXA 4GOTA 3DP4A 4H1XA 3Q25A 3I6VA 3VFJA 1MY3A 1MH3A 3IB2A 3OENA 4RXLA 1VFDA 1UTHA 4HCYA 5H8QA 2XD3A 1EZOA 5FHOA 3U1OA 2RF1A 1B1XA 4RY1A 1II5A 4BDLA 4IO4A 3WAFA 2RQMA 2Y7KA 3LSXA 4OFOA 5HM4B 4C1UA 3K6WA 4KFQA 4NMYA 4RJZA 3SEXA 1R9QA 2ZYKA 2Q8JA 3TZAA 4U22A 5KZTA 4R74A 3TTKA 3U93A 1XHYA 2H4IA 3D4GA 3KBRA 2Q9TA 1H3DA 2F34A 2H9BA 3C31A 4DE8A 4F1YA 1B5HA 1MM7A 4MFIA 5H8SA 4F1UA 3B6WA 1MXXA 1D9YA 1DOTA 4RNSA 2BJJX 4YB7A 4JBZA 3TELA 1XVXA 2RQKA 2VGQA 5L9MA 3JYRA 1H44A 3PPOA 4KD5A 3GBBA 5ISUA 4X9TA 2M8CA 2QSXA 3MWBA 1KS2A 4H8IA 2HQ0A 4Q5TA 2ONSA 4PFUA 3TCHA 5I2KB 4BDNA 5TPAA 3OXNA 4LATA 4GL0A 4OZ9A 2JHEA 2O69A 2G93A 5DTBA 2X7PA 3T9VA 2PC6A 4GIZA 1PB9A 2I4BA 3MJNA 3LR1A 3FV1A 1FQDA 1SI0A 3UP9A 3RPWA 1Y1MA 3FJ7A 4G68C 2OBGA 2Z23A 4XKRA 2YJPA 5L8DA 2Y7WA 2ANJA 3ZSFA 3FVGA 1JW5A 2X26A 4PE5B 2H5YA 4LUBA 3PPQA 5IT4A 1Y9UA 4PQJA 3ZKLA 1LFHA 5AA2D 1SVXB 2OJTA 3N6UA 1MPBA 4OQOA 2O1LA 2E0SA 1EU8A 1FQFA 3C4MA 1O64A 2GH9A 5H8HA 3OEKA 3UORA 2Q89A 4IO1A 1PB7A 1O63A 1A40A 4IO3A 3H7MA 2NYIA 3RUMA 2ONRA 1A7LA 1RWUA 4GVOA 3BFTA 2UVIA 1NFTA 1LKZA 4H5GA 1POTA 5AA4B 4WKMA 3K1MA 5BUUA 2AYSA 3KJ7A 1MY0A 3O6HA 3IL1B 2HCAA 1SYIA 1B40A 4POXA 4TLLB 1MH4A 3M3KA 3UN6A 1ZJLA 1NNFA 1QUKA 4QSEA 4Q8RA 4R75A 1ZU0A 3OFFA 3RN8A 1S7YA 2UVGA 1PSDA 3FVKA 2Z8DA 2ZMBA 3M3FA 1EH3A 2ZXTA 4F18A 3FXRA 1OIBA 3O1LA 3TUJC 1ZIUA 4ZEIA 2FNCA 1GR2A 5FHNA 1B05A 5A5XB 2GFEA 3O28A 1M5BA 3CIJA 2F8MA 1Q1KA 4OERA 2V3UA 3VVDA 3DHWC 1IIWA 1UTBB 3Q29A 4Q30B 2XXQA 3PU5A 1JNFA 4ZZEA 1IXIA 1HSLA 3S9EA 2Y7PA 2DP8A 3PUWE 1US4A 4DCXA 1HSEA 4R6KA 4TQUQ 2QS3A 4F1VA 4YMBA 2P9EA 1XT8A 2Q88A 3MBPA 1MDP1 3IB1A 1FQCA 3E9XA 4H5FA 1PDAA 1TWYA 1B0LA 4JSDA 5I2NA 4NF4B 5H8FB 3OEMA 2XXHA 3LC8A 4O3AA 5IAIA 1BKAA 1SW5A 1MXUA 3O9PA 3FIRA 4G68B 3QUJA 1B3FA 2Q2CA 1QW0A 3TCFA 2YLNA 4OWDA 2F6PA 5JEIA 3K2DA 2RCBA 5L9OA 1OVTA 3I3VA 3R7XA 3RY3A 4GQOA 3KOSA 5I57B 1LAFE 4GF8A 3TCGA 1MPDA 3K6XA 2REGA 4ESXA 1B51A 4WXJA 3MAHA 5FHMA 3QUFA 5JK4A 1US5A 4BDOA 2XXVA 2E1SA 4U2RA 3K1NA 4Z0IA 1B46A 4JSOA 3KWMA 4EF2A 2OWSA 3TTNA 1OLAA 3G3HA 3CEDA 2V84A 4EF1A 4NF6A 4M4GA 4E0WA 1URDA 4YKJA 4YICA 3NRBA 3RTFB 5IKBA 3PPPA 2R9JA 1MY2A 3PMXA 4GXSB 1D9VA 4LA9A 1TFDA 1B32A 3HHEA 1P1OA 2Y7RA 4ZZAA 4EXLA 4U4SA 2AL4A 4POWA 3P96A 3CG3A 4ND9A 4F19A 2RE1A 1S50A 1N3WA 4ZECA 1M0SA 3IAZA 3TDJA 5FTIA 1NH7A 4GO5X 3S9LC 3N26A 3K02A 3SERA 2RC7A 3PUVE 3VDFA 3OSRA 4G8HA 1LK5A 4LP2B 2DS9A 2O1MA 4UA8A 2YPNA 1YTVA 3LSWA 1MQJA 2RKMA 4KHZE 3FV2A 2F6GA 3HCQA 1MRPA 4FIMA 3TEPA 2FYIA 3EQ1A 3C32A 3ENVA 4OFLA 4EDPA 5DEXA 4C0RA 3SETA 2XHDA 1P1UA 2WKYA 3EF7A 1M5DA 2DXYA 4M8LA 3IB0A 3U94A 4ELPA 4GXAA 3AAWB 3H4ZA 1GGGA 3SEUA 2HAUA 1AL3A 1SQYA 3DP8A 1QKBA 2ZHOA 3QIMA 1SI1A 4OENA 4HW8A 3FASA 1B5IA 2XXRA 4R2BA 1MY4A 4P11A 2F35A 1MS7A 3H06B 4AB6A 2I9SA 4WEPA 4OEVA 1A54A 2RC9A 2PYYA 1B7ZA 5ICQA 4YZZA 1LCFA 3RLFE 3OO9A 4FATA 1B1HA 4DCYA 2XXUA 4LQ5A 3UA8A 5IT0A 5HPQA 3QAXA 4BDMA 2DVZA 1MXWA 3O2AA 3PPNA 1A99A 3FATA 3G3FA 4JB7A 3TQLA 2G29A 2OZZA 4ZDMA 2CMOA 3KOTA 1KWHA 1MM6A 4E0XA 4G77A 1XC1A 1EZ9A 1MY1A 5KDTB 3OFEA 1MQGA 4F2QA 1MPCA 1YBAA 2DWHA 3IBWA 3CI8A 5EHMA 5K2XA 3U92A 4X84A 2QS1A 2FGCA 4MF3A 3S4UA 1N84A 5JTYA 1IEJA 1Y3NA 4LZ8A 2I0BA 3OELA 3R26A 5LOMA 2B65A 3TFLA 3IX1A 3MZ9A 3V5AA 1RKMA 2CZLA 1XOCA 1XTZA 5F7VA 1B58A 1FTLA 2KLFA 4X1BA 4PFTA 2HXWA 1PBPA 3OO7A 2QS4A 4UACA 5DVIA 1OLCA 1JEVA 4I1DA 1P99A 1M5FA 2OK2A 4FJPA 3A3UA 1WVJA 3ODBA 1N7WA 4QFKA 3S1TA 4ESWA 5FIIA 4EQBA 3DC2A 2NOOA 2F7BA 2I6EA 3CR9A 4KCCA 2X7QA 3C34A 1J1NA 3ILUB 4U1OA 2H99A 2UVJA 1U8SA 1QJMA 1A8EA 3IJXB 2XXXA 4R73A 3CSGA 5AA4A 3K5PA 4IY5A 4QHQA 1DTGA 3E13X 3RT8A 3BFUA 3AB4B 4PETA 4RPNA 3DM0A 5AE4A 4O3CA 1NNTA 4ZE8A 1UJ6A 3RT6B 5B7DA 3S2VA 2ZNTA 4GRKA 5I56A 3MVWA 2OLBA 3MAMA 5AA3A 2THIA 1MXYA 1MQHA 1AIVA 4OETA 1EZPA 3T66A 3L6GA 3K0VA 2GRVA 1R1NA 5I2KA 2LAOA 2F5XA 1S9TA 1USYE 1JEUA 5KCJB 4NF5B 2I58A 2VD3A 2VOZA 4JXIA 5H8FA 4NF4A 3ZS6A 1B3EA 3LOUA 2Y7IA 3O6GA 4FEDA 3Q28A 1LAGE 2PMSA 4GO7X 2J0WA 4PFWA 4F3GA 5H8NB 3H6UA 4NF5A 2F36A 4QFLA 1ZPVA 4OYVA 4F3PA 3KSXA 4QRZA 3O66A 4H8JA 2XXYA 4XIGQ 3R6UA 4FAJA 3KN3A 4KYDA 2DVCA 1B7HA 3F11A 1R6ZA 4RYAA 1LB8A 1YGYA 3KEIA 1JW4A 1LK7A 2P9CA 5CM6A 3VLWA 4YMAA 3HV1A 3OO6A 4JWOA 2F78A 4IGTA 3AXFA 2A5SA 5CMBA 5CI5A 1LBCA 1B5JA 4GFRA 4RA1A 2ABHA 1HSJA 2ZNSA
chains in the Genus database with same CATH superfamily
4ZVUB 1NHVA 1RT6A 2KXFA 2RKIB 3NNAA 1TXFA 1RAFB 4OV6A 1T05A 4X64J 4LF1A 4P73A 2OAUA 3QRRA 3N5FA 4UUXA 1YJ9S 1I94J 4NF8A 2BXJA 1U26A 3MPKA 1RAGB 2OEMA 4OFJA 4RO0A 1XEZA 1SJFA 1XS5A 1Q0NA 3O6QA 3KK1B 2DVIA 3W3SA 4CDIA 4N6PA 4ED8A 4PAFA 1FKPB 3HCXA 2XX9A 3B8HA 2MSTA 1B9JA 3A3OB 5M2VA 1M5EA 3MFHA 5K2YA 2R42A 2ASLA 2XMTA 4G8NA 2D1CA 2VH7A 1L3KA 3W60A 1CJUA 3O2IA 4ED1A 1SL2A 2W7YA 1EZZB 4DMZA 2BJEA 5L46A 3I5BA 1QKAA 2DPJA 4USMA 4ZJLA 3MD3A 3J7Z5 4J9PA 3A8KA 4PF8A 4XXUA 4ELOA 4AQ4A 5CCLA 2WYPA 3MM6B 1WI8A 1RA6A 1OQHA 1R31A 4CYUA 4QSCA 2BE2B 1VK8A 5H9EK 1Y4TA 5TU0A 8ATCB 2MGZA 3T93B 4DPWA 1H45A 1UFLA 2KFNA 1T9YA 2ZJQQ 3N94A 3KHHA 3E2EA 1VQOS 2PEHA 1ZA2B 4G2ZA 3H5YA 4DL6A 4UY8T 1SH3A 1NK4A 4LF2A 5KFNA 2Y8WA 2KR0A 1NMUA 1FTOA 4QF9A 1QVSA 1HQUB 5ICTA 2HFNA 3Q8PB 2O6AA 4HE2A 1B7FA 4ZS9A 2YWKA 2R2TA 1FJEB 2F8DA 5KFLA 3LWLA 2UVVA 2OFGX 4CQ1A 1GEHA 3MW0A 4NG7A 3CO9A 4TQSA 2V93A 3EVMA 4G3IA 4KTQA 3HT3A 4NEYA 2W9AA 2DNMA 1NHKL 2Z2YB 4RL1A 1ATGA 4H54A 1BWEA 4P9KA 4CIOA 4JI6F 2DNGA 3EGVA 4NLUA 5KFDA 2M4MA 2B51A 4DR6F 5GAGU 2YKOA 1VQKS 4F04B 3IM9A 3CF5Q 4ED2A 4PXEA 1SC3B 2KT5A 4P2SA 3K5OA 5BJRA 1PAEX 2W24A 3ZZYA 3OJSA 2LU2A 1PJ5A 1D8YA 5D0GA 1HA1A 1DQ9A 1NKXA 3FEZA 2GO8A 3SEVA 2MB0B 4ZPDA 3Q8YA 3MPVA 5KFIA 1Q95G 2QLBB 5D6GA 3DXSX 1RT4B 3KUGA 4Q8EA 4XTCQ 4IG0A 1DHMA 4K4VA 3LUYA 1VQ7S 2C2DA 3I4PA 3MP6A 1UW4A 3CFXA 4J9UE 5HROA 3GZGA 2V63A 3WZ0A 1T0TV 3N6MA 5J1PA 5I59B 2HSEB 5I59A 1KRPA 2ZD1A 1POY1 3C15A 2MXYA 5C24B 3NKYA 1BQMA 3QXMA 3GJTB 2CQBA 1EHWA 5A5XA 1N3XA 4LN5A 2J0SD 2FGOA 1OYDA 5KCJA 3HHFA 5CRYA 4RU9A 2QRYA 2RRNA 3K5NA 2AQ4A 2O7UA 5DGAA 2CQIA 3L7PA 4HI1A 4JYAJ 3BSOA 1YBUA 3OLBA 2DISA 4ECUA 4HXVA 4U9RA 2BABA 4ELQA 2GHBA 4PQAA 4PFYA 5K8MA 1WHVA 4M1VA 2F7AA 4N07A 2Q74A 1TP7A 2H5IB 5DDQC 1SDXA 4X62J 4LRBA 3K00A 4JV5J 3EM1A 4ZLJA 3ZZRA 4KHRA 3E4RA 4P47A 3KG0A 5DZ7A 3T1BA 2G2ZA 2I3VA 2UUAF 3I9ZA 2P0SA 1ZTYA 2DY1A 3KJFB 2H65B 2VG6B 5J2QB 3IMQJ 5E5NA 3FSIA 4M5JA 1S1UA 1JETA 2BQRA 2GC8A 1Y11A 2C2OB 1NB7A 2KHDA 1UTAA 3ENQA 4ED6A 2P2AA 3DLKA 3WX4A 4ZPCA 4IB2A 1H72C 2HK2A 4DEZA 4PG8A 3PJWA 2WVFA 2BE7D 3UK4A 1WDNA 4F4YA 4LFBJ 3J7ZT 2FVRA 1HPZA 5J1EA 2F4VJ 4N47A 1FE4A 5F8LA 3EPGA 4KO0B 4U67Q 4USIA 2HZKA 1REGX 5AA2B 1RT3A 4QWAA 4L17A 1NNDA 3NAHA 4ZPTR 1LLSA 1FKOB 2BA9A 2I3WA 3DLGB 2KU7A 3O97A 1AWBA 6AT1B 3U72A 3D54A 1RT2A 4ZE9A 4CP5A 1XR6A 3M8QB 3VALA 1HI8A 2IHR1 1MXVA 2DH8A 3DRSA 1IXKA 3M6XA 2V8GA 4YHHF 2XWVA 4GVBB 8RUCA 4I7FB 1KD1T 2K3IA 2ZBCA 3EHTA 3IFEA 1DTQB 2OWTA 2JLGA 5E3AA 2ZYOA 4R2FA 4PAKA 2W25A 3OFGA 2DGVA 2LYVA 2OIHA 2H5JB 2NCKL 1FDBA 3HPIA 2AU0A 5EUHA 2HEKA 4N17A 1OY6A 1VQYA 3RB3A 1NV1A 1RI7A 3VQSA 2FJVA 2U2FA 1IXHA 1C4CA 3GSDA 3R7BB 3G6XA 4PWDB 4FVMA 3PCOB 1TMMA 4YU0A 5DLGA 4PTKA 4JI4J 2UYEA 4MLQA 4GKJF 4UW2A 1ZA1B 1D9DA 4IFVB 4EUVA 1FJ6A 3DDNA 2YKAA 1C0TB 5TP9A 2QFIA 4DR7F 2I49A 1SW2A 3TW0A 5CD4A 4MK7A 1VQPS 3ZZPA 3G3KA 4J9SA 1TKXA 3G8SA 2RJZA 4KRWA 5AT1B 3O29A 3O6IA 5B0CA 2QL5B 4ILMA 2K7KA 3HDSA 2M3DA 3U7JA 3QAEA 2CZ4A 2RHQB 2YKQA 1TUVA 3A8EA 4ES2A 2GVDB 4U1ZA 2QLFB 2XXTA 3N4WA 1NUEA 2XMAA 3U8QA 2LXIA 2HZCA 3BBCA 4I3YA 1ZM2A 1N7XA 4ZPWR 2Y5KA 1LGBC 4O0IA 3CDBA 5F24A 5AE1A 5H9FJ 2HHPA 3PRDA 3HLUA 2DIVA 2MKJA 4MJKA 1U1MA 3VXBA 4QIVA 5FDLB 5ITPA 2ZH7A 5L1KA 4EUOA 3CVGA 2VOOA 3FXUA 3KHRA 5CYMA 3LP0B 5KG4A 2JRSA 3BKTA 1Y3KA 1DQAA 3UDLA 2NXJA 3SV3A 3OT9A 4LF9J 2PFFB 4FXDA 2W2OP 4OI0A 3CB4A 5CMKA 2RC8A 4I1TA 2IDLA 4YDXA 2RSQA 1RBOB 4FYWB 3V6DB 3CFZA 2ZE2A 3D3CJ 4K5RA 1KEKA 3UNYA 4ZVRB 4DUYF 4I9DA 4EQ9A 3FVOA 1TL3B 2ZZTA 2NLWA 4YUDA 4DG1B 4RUCA 2VQEF 2NXOA 2ZKTA 2AX1A 2XI2A 4KPCA 2V2VA 1FPKA 1R3NA 1G1XA 5IQ6A 4HL9A 2ZH6A 1X4BA 4GVBA 4PWUA 1JQGA 1JLFA 3ENAA 1J5EJ 5A8WB 2NR0A 3VLUA 3DOMA 1BIYA 1RU1A 5A8RA 1H7WA 2ADCA 5DVFA 2HRYA 3OTOF 5HLFB 4IQMA 3CCWA 3H03A 4IFYA 1N33J 3Q2TC 3RR8A 4DQIA 2VPYB 3PGFA 4OHZA 2QE5A 4R9GA 1X60A 2R2SA 3L6HA 2DWIA 4PG5A 4GWZA 4NWCA 4QSDA 1VR5A 2FIEA 3H98A 5KT6A 2CUYA 2UXBF 1FJGF 1IUJA 4PXDA 2IJFA 1U2RA 1IBCB 2G0JA 3PEJA 1WJ9A 1LBVA 2Y0BB 4HTGA 3TEHB 1N88A 5LSLA 4AUKA 2HHUA 4EI2A 3TZXA 4JI8F 2ASJA 5CMCA 3W64A 1H74A 1F9EB 1MMLA 3T1YJ 4RK9A 3PUYE 4DFMA 2GHAA 3W9VA 2MKYA 1TK0A 2UV8A 3QK6A 4IO2A 5ETVA 4RW7A 1PO6A 4NYZA 5KFFA 2K1RA 1EETA 3MM6A 5L1IA 1K1QA 2QMWA 3PUZE 4MKBA 1S97A 2XMWA 4OLOA 3A12A 3C8YA 5L38A 4HHHA 2UUBF 3GE9A 1BP5A 5EDWA 3OXLA 4QBUA 2UUTA 2KM8C 4X8RA 3R5DA 3V4MA 2PA8D 2I8EA 4KCDA 2HFOA 4QU6A 5ETRA 2RS8A 3DP6A 2WHOA 1FDDA 3I5OA 1O7TA 1A9NB 2MZTA 1SKRA 5H8QB 4YHHJ 4LVOP 4NE9C 2IA4A 2ESNA 4ZVHA 2DRDA 5IZZA 2ZITA 3R5BA 1I6JA 5HMZA 2DNNA 2DO0A 2FHYA 1PB8A 1VYAA 2PBWA 2C2RA 2MQQA 2HRUA 3MQ9A 3QATA 2PFYA 4OHXA 3IS9A 3TVKA 1HD1A 1SPBP 4QXDA 5HVFA 1HBMB 2I48A 5E41A 2MLZA 2EKYA 3G3GA 1CJVB 3KGCA 4ZMMA 3BO4A 2ASYA 2YWHA 4TLRA 4B3MF 1G3OA 1KVKA 1UPPA 3L95X 5DYHA 4XDDA 4EO6A 1IKVB 2MGZB 5CYQA 4Q2MA 2J7KA 1FT8A 3UGWA 2O51A 3LPEA 3V4IA 3VAKA 2IBKA 4LF4J 1Q7LB 2P5VA 4USHA 2HAVA 3CW2C 5KFHA 2IAJB 5E3RA 3ETMA 1RHKB 4YB5A 4K2JA 2DO4A 5KFSA 4LQ3A 2RQCA 3D0GE 3S6EA 4DQSA 3KG1A 3PX4A 2XSJA 3CXCR 1RAIB 2CQ1A 3HI9A 3TWZA 3OXGA 2AHOB 1RADB 4OZJA 4RXLA 1HQEB 1UTHA 1S99A 2VG7A 4NF0A 2PCRA 1EZOA 3U1OA 2PIIA 5DO2A 2ROGA 2ZH3A 1F5AA 1YLXA 4DS5A 1HFEL 5B0DA 1BLUA 1ZM3A 1Q8BA 4C8KA 4OFOA 1VC0A 3M2UA 4C1UA 4K0KJ 3K6WA 2YKNA 3ZZZA 4U8VA 4IOCQ 1XMOF 4KFQA 5GAGI 4NMYA 4OYBA 1U24A 2YY3A 3GV7B 2Q8JA 2HIYA 3CULA 4U22A 1BK4A 4PAAA 2MQMA 9ATCB 4U7UD 3KBRA 3BSCA 3QIPB 2O66A 1RSCA 3DMJB 1QVGR 4L6V3 3ZZ0A 2O5DA 3D3BJ 2V4JB 5KFQA 4MFIA 4F1UA 2F3BA 3W9IA 1DOTA 1VCTA 4RNSA 4A8MP 3UE2A 4YB7A 2MLXA 3MGJA 3M8ZA 1UZHA 4TU9A 5L9MA 5T7LA 1VMBA 3PPOA 2G1DA 2DR8A 3TANA 2BOAA 2J9EA 4KH0B 5KT3A 1FJ7A 5C25A 4HVZA 2LQ9A 2ONSA 3I0RA 2YKMA 5TPAA 3OXNA 1WSRA 2X1GA 1NK6A 2E66A 4EYIB 2O69A 2WVEA 4RW6B 2AYBA 2X7PA 5KT7A 4DV1J 4LF6F 1FNXH 5D0EA 3FV1A 3FJ7A 3AD8C 3RPWA 4G68C 3BZQA 3J81j 1UMJA 5I7IA 1JW5A 2GHVC 3U02A 5IT4A 3ILOA 1EAYC 3RW7A 2M0GB 1N56A 3B50A 3MMBB 3RPLB 1M5OC 1MPBA 2CFXA 1K8AT 3PZPA 2WRMA 1BY9A 4LFCJ 2E0SA 3RJMB 1EU8A 2QVUA 3NBPA 2ZHAA 2GCFA 3HSZA 4ZVGA 1IWGA 1O64A 2KKHA 4TQRA 2GH9A 4L3NA 4B3SJ 4YFUA 4TKTA 1M1HA 2Q89A 3UORA 1S1TB 4Q7AA 2NYIA 2ONRA 2PMHA 5ETTA 2KG0A 2H4YB 3RB6A 2B8PA 2WOMA 2DNLA 3M6UA 4CO2A 4B3SF 2X1BA 3T0JA 2KYZA 1XMQF 3M2RB 3GQCA 3HHNB 4WKMA 4DCJB 4BLGA 3VGVA 2KZMA 3O6HA 4N5SA 2CVIA 1TAUA 4USJC 4MK9A 3CDEA 2J7UA 2EPIA 4F25A 2XY6A 4DV0J 1WKKA 3M3KA 5HATA 3M6WA 1WKJA 1S0NA 1NNFA 3CCUS 4QSEA 1IBMJ 4ELVA 5ETSA 4GKKF 2ASDA 2LU1A 4R75A 3GILA 4OYIA 1WKLA 1JK9B 4U96A 4DV6J 4O7IA 1PSDA 2OTJS 4C9DA 3OVAA 2JFDA 2PN6A 2EC2A 5A8RB 3T5KA 1OS5A 3FVKA 1HQ2A 2E9ZA 4G1IA 4NZ6A 4WPAA 3M3FA 2Q79A 1EH3A 2QZ8A 3NNCA 5CHCB 4EBEA 3RAMA 1FI4A 3Q83A 2VFSA 1UCNA 4Y2AA 4DV4F 3ITHA 1TFYA 1JJ4A 2VB6A 3EXYA 1F5CA 5FHNA 1N54B 1P1LA 5EHHA 4OERA 4UOGA 2SXLA 1NKCA 1IIWA 1UTBB 2P3VA 4Q30B 3BV8A 1JNFA 4ZZEA 1IJEB 4PDDA 5AXKA 2OP5A 2M9KA 4DHVA 3PUWE 4B17A 2C2MB 1US4A 3Q8QB 1R8CA 3DU6A 4R6KA 3CUNA 4TQUQ 4DUZF 4MKVA 4YMBA 3DI6B 2Q88A 3IB1A 2ERRA 1FQCA 4GX4A 1M5HA 2PO4A 3EVWA 1B0LA 5I2NA 1HHSA 4OANA 3OEMA 3G82B 3LC8A 3J7A1 2OPQB 2VG7B 4LF4F 3O9PA 2AJQA 3LP1A 4G68B 2AGQA 2JDJA 2A3JA 3EMTA 3FUYA 3I6PA 3TCFA 4H4OA 4X4VA 3D28A 5DG8A 3AD9C 3P49B 3Q8VA 5SZTA 4K50A 5L9OA 1OVTA 1V6HA 3I3VA 1EP4B 2UUAJ 3RY3A 1RKJA 2MKSA 4JVIA 4DV2J 1LAFE 4GF8A 1T95A 1MPDA 3HFUA 2REGA 3MAHA 2BKPA 5JK4A 3OR1A 4BDOA 1S1XA 5F0WA 4LF8F 2A10A 4OVRA 4JSOA 2WZ1A 3TOQA 2XSJB 3MURP 2E5HA 4NLDA 3PACA 3VV2B 1R0AA 2CEYA 3M30B 4EF2A 2OWSA 1UWBA 1VJQA 3C6TA 4ECTA 5EN1A 3GFXA 2KDOA 4A8WA 1NJXA 2UV8G 1SB6A 3DOLA 2F4VF 4OI2A 1FXRA 3NEKA 1SIWB 3VZHA 2BANA 1IMEA 3RTFB 3HF5A 4PUOB 3PPPA 4X4SA 3AH6A 2BW7A 3PMXA 4WZMA 2CWXA 4NLSA 1KQFB 2QYGA 3J81Y 4LA9A 4X4UA 3MM7B 4OVQA 2YQ3A 1P1OA 2FHKA 3FQKA 3IRWP 1LV5A 2OPPA 4ZVSB 3MR3A 4POWA 5A76A 1ELOA 1FWKA 3QFWA 5IQQA 3M1VB 4ECWA 3TDJA 1YBTA 1YRUA 3A3PB 1PBAA 5AE2A 1SH0A 2PI5A 4ID8A 4GO5X 2B9YA 3SERA 4G8HA 2DR6A 4LP2B 1VQMS 5I3QA 1FBEA 3G8TA 4IH6A 2E5LJ 2YPNA 2HVDA 1IR2A 1LWCA 3FV2A 2PGCA 2F6GA 3R7SB 3KK3B 3BPDA 4MIJA 2A18A 3CJTA 2N3OA 1U48A 4OFLA 2GW8A 1SPIA 3AXKA 1QGXA 2J8SA 2Z30B 5HSPA 2J9DA 5IV3A 4XPEA 3GSIA 2EVZA 1TVRB 1XJWB 4ZJQA 2CQHA 4KY3A 1BQNB 4DCPB 4DQPA 3DRPB 1AL3A 2ZOMA 3W66A 4PGPA 1ZM4A 3UDCA 3DP8A 4DX7A 3QIMA 4A47A 2XLKA 1JLQB 2R8HA 2IY5B 1QUVA 2XXRA 1FDAA 5E3CA 3S7RA 2YWGA 3LA0A 4JI7F 4ZPAA 1VC6A 2E29A 1MN9A 2C3OA 2EFVA 2MKZA 3H0PA 2LLZA 1SUQB 2AX0A 2RRBA 1QM9A 2WBRA 3IFCA 1DFDA 3RLFE 1Y10A 4XTTA 2HVIA 4KHPF 1YYZA 2XYGB 3RR7A 2DGXA 1LQ9A 1URNA 3CCES 2FY8A 2YBVA 3ZNJ1 3O2AA 4PG6A 2GJ2A 2RF2A 3FATA 2XM3A 2E1MC 5FJ4A 3TQLA 2OZZA 4C0BA 1J5OB 2MY7A 1RWOB 1KWHA 3IRXB 5ETPA 4G77A 3IRXA 3EZ5A 5IXUA 1FEEA 2JEGA 4RWXA 5GMEA 3HHDA 5IZ3A 3H4BA 1FRJA 2XBPA 1LXJA 5KT2A 3IBWA 5DGBA 1SVDA 1Q4RA 2VODA 2QS1A 2FGCA 4MF3A 1N84A 2BV3A 1LWFB 1RP5A 5C2GA 3MZ9A 1I1GA 1XTZA 1RZMA 4J7CA 5F7VA 4ES1A 5DQHA 1SJ4P 1KDNA 2VONA 2HGMA 3IWXA 4J9VA 3TAMB 2B4MA 1RAEB 3PR5B 2ZH8A 3L09A 1JEVA 4L74A 3NS7B 3SIPB 4I1DA 2J6TA 2D9PA 1M5FA 2IM3A 4FNHA 3P4UB 3ZTOA 2R7UA 3KLIA 1C1BA 4NRUA 3ODBA 3RU0A 1IBLF 4C3LA 4EQBA 3DOKB 4UUWA 3ONQA 2HFZA 2AEMA 4A48A 2I6EA 4KCCA 3C34A 3BPSP 2ZWOA 2I5JB 5T3JA 4OZ2A 2E5JA 2ZH2A 4MNCA 3HHLD 4O23A 2H99A 4NLTA 1A8EA 1RABB 4PEOA 4QHQA 3HVTB 3ZXWA 2X1FA 4C8YA 4QOTA 1DTGA 4ZPBA 3RT8A 3IAM9 2F9DA 3L9ZA 3THTA 4ZKAA 4RPNA 3G82A 1TKXB 1URRA 3KUEA 4WKYA 5AXNA 3HO1A 1HWIA 4O3CA 3CJ3A 2UUCJ 4QIFA 1FA0A 5B7DA 4RJVA 1AA1B 2W2QP 2RD5C 5CQGA 1U6FA 1JLAA 1HMVB 3QMFA 4IFVA 2V69A 3I32A 2G13A 1CLFA 1RT7B 2KXNB 4C3MA 1FD2A 4P8BA 2QA4G 2UVWA 4MFBA 5RUBA 1D1UA 1DARA 1NSQA 2HS3A 3OTDA 2W4PA 3K0VA 2HYIB 2GRVA 3LWMA 5I2KA 3RZAA 3QIDA 3AJ2A 1QLNA 1O5JA 2MHEA 1N0VC 3OTEA 1USYE 2YNFB 3GWCA 2VOZA 3KK2A 4A8YA 4PYAA 4JXIA 4NF4A 3LOUA 1QUPA 4P3LA 1U09A 5L1JA 2YKPA 4P9SA 1GNKA 1K0TA 4FN5A 4M5MA 4O44A 4F3GA 3R5CA 4O94A 4QFLA 2GX8A 4ZITA 1OWXA 4WP3A 3KSXA 3TA2A 1P1TA 2XXYA 4HACA 4KYDA 1S9GB 1H38A 1RHJB 2CJQA 2BW2A 1JXVA 1E6VB 2CZ9A 1BUXA 3VGTA 1LB8A 2DNOA 4IKAA 4DCOB 3IM8A 5ETOA 3M32B 4YMAA 3JQKA 2FVPA 3OO6A 4JWOA 2BYCA 1Q5YA 4FKXA 2A5SA 3AY0A 4ZIWA 2DYAA 3BBBA 3MEDB 3B4DA 4RA1A 2HHXA 4NYPA 4ILLA 2YQ1A 2IMOA 2MKCA 1R8BA 4P72A 2Y84A 2FQQB 4B9VA 2XYHB 5CYQB 2G2OA 2ZC3A 1LFGA 2FIXA 5IOLA 4X4RA 5T7LB 2UXCJ 4YKIA 2Y8YA 2C22A 4PF6A 1VBZA 3IR1A 1QUIA 4N76A 1B0VA 4V19X 5EQAA 2FZGB 1Q35A 4NAPA 2IA0A 3GJSB 1CVJA 2UXCF 1NV3A 2ZYMA 2WSCC 5MAOA 3ILJA 3E8OA 2QTWA 4DPTA 4KGVB 4C8ZA 4UQTA 3GTYX 5I56B 2DCUB 3TKDA 5HANA 1U7LA 2B3FA 2HURA 2DGOA 5M2PA 4OMFG 3IA0A 5ET7A 2IVMA 2M88A 3M3LA 3G96A 4O4GB 1Q9DA 2QX0A 4AXJA 3PUXE 1U0HA 1I51B 3PIPQ 2XQCA 3NBPB 4RW6A 1NBEB 4C3KA 3H40A 5I58A 2K06A 4D3GA 5HBCA 3A09A 1JW1A 1DBZA 2DT9A 2WBDA 3HHLC 3CVKA 1OQ3A 4OYZA 3LGNA 3KBZA 3NP5A 3OBIA 5KG6A 3TMGA 5I57A 2OPQA 3C46A 3P7IA 1TL5A 4LF6J 1IMBA 4WE1A 1SC6A 2OFHX 3FSYA 4DPOA 2Z22A 3MI7X 4FXVA 3UR3C 1D3KA 5H8NA 2LXUA 4YN3B 4FPRA 3AHPA 2DB1A 1B7YB 3K57A 4K3FA 2C2ZB 3LQVA 4CLUA 3HD2A 4WU2A 3UPFA 1S57A 1RKIA 2QL7B 2QLWA 4LBIA 1WUUA 4OZ5A 2BBEA 1TT1A 1ZYQA 4KXPA 2Q2AA 1NK9A 4DR6J 2DK2A 2YTCA 2J9CA 3CDWA 4DR2F 1Q81T 3TUSA 3M2VB 2R6GE 4IDKB 4AQYF 2KXHA 5LL6d 3WAEA 3FUZA 3TX0A 4UT4A 2XGQA 1W2BR 5HBMB 2DKOB 2IRYA 3GG0A 3KLEB 3S9NC 4JI3F 4OV1A 4A8KA 2GQ1A 1B3HA 2LA6A 4CM2A 2O68A 2OMLA 4MYTA 3T9UA 3NY0A 4IG0B 4WFNQ 3DFEA 1SBPA 4NXMJ 4UF4A 5GAHI 2F3DA 3H25A 1FRPA 1PYSB 1B6HA 4EZ6A 1K44A 1F60B 4DUYJ 3W2VB 4YMEA 2XXPA 4LQ9A 4AT1B 3K17A 1MXZA 4BCAA 4QCLA 1UKUA 1FERA 4TOZA 4A4JA 1VRTA 2H98A 2PT0A 3OFHA 3N6TA 3NWRA 1D4NA 1TL1A 2F5GA 1S6OA 4IO9Q 1GX6A 5KFGA 1HIYA 2XTJP 4TLQA 1NSPA 3TEGA 4ZP8A 2AKWB 3PO4A 1ANFA 2IFXA 1KQSR 3PX0A 1SD3A 2WBMA 1ZBMA 3H3GA 1DBDA 3KKFA 1GT8A 4QW8A 3ZTPA 2HVEA 3CO0P 4GMKA 3EN3A 1I69A 1VIXA 2CRLA 1SH2A 3EHUA 3THVA 2QC3A 5SUHA 3RNNA 4R6HA 1HI0P 3HJFA 3D6MB 3ZTRA 3IO6A 3G3IA 3DMJA 2UUCF 5BWJA 1IKVA 1X31C 1LWEA 2V0NA 4JWXA 4ECSA 1FK9A 4THIA 1OYEA 3CJQA 4PPDA 3MZIA 2LCWA 5KTQA 3TI0A 2LXFA 4ZIVA 3OMBA 4ISUA 4LVQA 4QR2A 3TA1A 3EPEA 3KZGA 3W62A 5LT5A 3OUYB 1SW4A 3M32A 1DK4A 1RAJA 4GL8A 3CD5A 2VDHA 2C28A 4Y34A 4Z2XA 3HFVA 1N04A 3BKIB 1AUSL 2NZ4A 4ZCMA 3MR7A 4ES3A 2YWWA 1RBAA 3DLNA 4KI0E 3FBPA 4J9KA 4RNOA 1PEBA 1ELJA 1B0PA 3AOBA 4P2XA 5HQMA 2D69A 3R6GB 1FRHA 1RWNB 4LR8A 1PAUB 2HFSA 3VQTA 5CCMA 5KFCA 4IRCA 2Z2MA 4ANDA 3ILLA 2AIXA 5LJ3Y 3QYYA 2BMBA 1XMBA 1PYOB 2XS7A 1WOSA 2FHMA 3H6VA 4P0GA 1T7PA 3BGLA 4QYZJ 3H42A 3PMVA 1XWLA 4YP3A 1WI6A 1YKWA 3TTRA 2BKNA 3HZEA 3R2DJ 1FBGA 1UETA 1YJUA 4LRAA 3QLHA 2R7TA 1M5SA 4DZ6A 3V5RA 2QGFB 2ZD1B 1UEUA 1QVFR 2XO7A 3PV8A 1MWQA 2P2CB 3NGSA 4PUOA 3G6YA 2YNIA 2MZQA 3AT1B 4DDDA 2R8KA 1IR0A 2BRLA 3VVFA 1FESA 3MM5A 2LDIA 2DOJA 4I7FA 1A8FA 2BDPA 3DOMB 3FRZA 4CH0S 2EFOA 3MP1A 4ZA1A 3MC2A 1A55A 1UWBB 1S9EA 2F7CA 2A6OA 3I31A 3KFMA 4OESA 2V8HA 4NA1A 3CJKB 1DPPA 1ZBTA 4KQPA 2WTFA 1RJJA 2W1BA 1UL3A 5HMXA 3HN0A 1RTIB 1NV6A 4PDHA 4KYZA 3W5XA 1VHFA 4GBVA 3B6TA 1FPIA 4YB1P 5CMMA 1YJWS 3SCJE 4PXCA 2I0XA 3D1QA 4F36A 3JZJA 2YH1A 1FWPA 1QDUB 4MAGA 3TQWA 1IR1A 1CNQA 3JSBA 3E78A 3T5JA 3KLIB 4ICLB 3DGPA 3I4HX 2WCXA 4LT6A 2V34A 3D5MA 4PXBA 3K89A 3FJGA 4DXCA 2DR9A 4LQ2A 1VOMA 3PYFA 5ETNA 4O3BA 2E9TA 1JLQA 4H67A 4K0KF 4DSKA 4DG1A 2MQNA 1ITPA 4H65A 4F4AA 4NTLA 4O3OA 4CLZA 5GADU 2YNHB 2CPDA 4JI2F 4USUA 3LTOA 3THIA 3HPOA 1JJCB 4DXUA 1E6YB 4F3SA 3TR5A 1TFAA 1URGA 2AL5A 1HNWJ 4QIGA 3SYZA 4P7TA 2OUGA 2FLNA 4K4YA 4RK2A 3M8UA 2B6AA 1KFSA 4CNYA 3IXQA 1PC3A 1NNKA 2D21A 4IY6A 5IZ3B 3N5BA 2JC1A 2V2KA 2P1SA 3U27A 4ELTA 3V81B 1NV5A 3GCXP 1FTRA 2FLLA 2OMOA 4Z7EA 1XI6A 1SIZA 4OHVA 4DR7J 3VAMA 1KVJA 4B02A 1WG4A 5K8OA 1YG0A 4URSA 4CO0A 3GBAA 4M63A 4OEUA 4C2MA 4F4XA 2XHCA 1JVYA 4MHFA 2OCUA 4OVPA 1C0UB 2G2YA 3FFIA 1F0XA 1YCJA 5B70A 4AL5A 3VV5A 1T0KA 5F8MA 2CNNB 2RCAA 2EXUA 3ICLA 1HYSB 5L9XA 4O3SA 4O0NA 1T9TA 4JVDA 4NI2B 3D66A 5L8RC 3G2XA 1KLMB 4DZDA 3R3TA 2WSFC 4H4KA 4NEDA 2Q8MA 3V6DA 3M2RA 2G0IA 4OQJA 1ZLQA 3TTMA 4F4KA 4QWBA 3K58A 2OPPB 3EGNA 1CE2A 2C3PA 4DFJA 4DV6F 1K1SA 3EHSA 2YWEA 5ESYA 2ZOGA 4WIQA 4NI2A 4BC9A 2HXRA 5ETMA 3PKMA 1DPEA 4NMLA 2I6WA 4RLEA 1VQ4S 5KDTA 3QSLA 1FX4A 5LMUF 1S1XB 1P8GA 4DV0F 1LFIA 2ZNUA 5DT6A 2LQ8A 2K8GA 4M5NA 5F8JA 4KKOB 2HW3A 3QPIA 3BBRA 3K6VA 1JXEA 4WJBA 1RU2A 5D4LA 4YQWA 4R6YA 3Q8SB 1U1RA 3MEEA 5J1NA 4DFPA 1L3UA 4RPOA 3AFGA 1VFEA 1J5EF 2DXDA 3A8IA 4Z7CA 1ZKBA 1P1WA 4J9MA 1Z2ZA 2BZ2A 2U1AA 3LP2B 4LJMA 2DEJA 4J5OA 2ILZA 1AMFA 5HMYA 2D5WA 2NUHA 3CMAS 1JJ2R 3T9ZA 4WEDA 3LAKA 2LA4A 3DU5A 1Y3PA 4Y2CA 1K9MT 2KL8A 2WONB 4LSNA 1F1BB 3TQEA 1P9YA 5K20B 4LZ5A 3SZ2A 1YK9A 5H8HB 1N5VA 5KOXA 4OXVA 4N77A 5IS2A 2HMIB 3I9V9 4B9MA 4KHMA 4QWCA 2ZBRA 4LZ7A 4LF5J 3W63A 5JTYB 2B43A 1YPNA 1UAWA 4DFKA 1IXGA 2PE8A 1LNQA 2FPHX 4IR9A 3ZKKA 3IO4A 2Z58B 4DPUA 3O3LA 4ZDNA 3WDOA 1Y4CA 4HEA9 2R7VA 1HNIB 4WYWA 2QA2A 3FD3A 1UIUA 1VSOA 1NXIA 4TY9A 1RBLA 4A8FA 4URGA 4J9OA 2UYFA 3QGHA 1FPJA 3N0VA 2K7JA 1UFWA 4QFOA 2J8AA 4QFNA 1R8PA 2OI2A 2OEJA 3UQSA 1N5QA 3ILTB 2WAQD 2Z2LA 3S9MC 2H25A 3D6TB 4DR1F 2ZUGA 2ZNZA 4DIGA 1MU2B 2D3OR 2ALUA 3M2UB 2DE4A 2XD2A 1IMFA 2M70A 1GMUA 4I2PA 1SI9A 1T9VA 4PAIA 2WVBA 3QWPA 4HTJA 3DCAA 1R89A 1FF2A 5ELVA 4NX9A 2J0XA 2P6SA 1FTAA 1FPDA 3TRGA 4LRCA 2YNGB 2FZCB 4F2RA 3C36A 3KK2B 4PCQA 2F1FA 4U4XA 1Z7NE 3M8WA 3UI3A 2CQ2A 3N28A 4C98A 3A13A 1BWVA 4FP9A 2C3MA 4DPYA 2B9XA 1VE4A 2DYXA 3QLHB 4OYXA 2XNRA 1HKAA 2W01A 2EK1A 1UVJA 1AH5A 3QJJA 4FE8A 1F2HA 4KYSA 2CQPA 1FPLA 3VZIA 3OL9A 2ZVIA 3UN3A 5KFAA 3MMBA 1QSYA 1MH3A 2VA3A 1A0OB 4DV2F 4J9LA 3MFIA 4ECZA 3N6LA 2QLJB 4HCYA 5H8QA 2B7BB 5FHOA 1B1XA 1RYSA 2LQBA 2N82B 2GAHC 2MKHA 4WK3A 4DOZA 3FRYA 2RQMA 1F9FA 2KN4A 3J7YI 4B3RJ 2DH7A 2VV5A 4RNMA 1WNEA 4KGXB 3IR6B 2EW9A 4RJZA 3SEXA 1R9QA 1H6KX 3RAXA 1EJ7L 5KFKA 3LGMA 2AYGA 4R74A 1IKYA 3U93A 2W4CA 3DYAA 3D4GA 1I3OB 5D8HB 2H9BA 2ZBPA 3TARA 3J80Y 3M6VA 4M5DA 1TMJA 3KJQB 4F0KA 1MM7A 1HL6A 2F63A 5H8SA 1D9YA 4EBCA 2HAIA 4Y0FA 3ET6A 4P71A 4JBZA 3BDEA 3TELA 3VF0B 4ED4A 3PW5A 2RQKA 5HP1B 5AJ3F 2BX6A 3JYRA 3LAMA 3J81U 3K0JA 2W9BA 4KO0A 3Q86A 5KFJA 1RT6B 1R27B 1KS2A 1V5IB 4H4KC 1T8EA 4Q5TA 1T9XA 1N5YA 2WBBA 4QIWD 4CYUB 1R7IA 1JLGB 2AZ1A 4PFUA 2GIQA 3B8BA 2NSBA 1IM6A 4LATA 1YJRA 1X5OA 1WTFA 2G93A 3UN2A 4ITSA 3CCJS 1H98A 3T9VA 2PC6A 4GIZA 4NRTA 1PB9A 5CAAA 2I4BA 3LR1A 1FQDA 3EGZA 2RAQA 2XWOA 3UP9A 4UQGA 1KSPA 4C4WA 1C1CB 4XKRA 1X0FA 5IM0A 3G86A 1HBUA 1MROA 5KT4A 1ZTTA 2WX9A 2Y7WA 4AYBD 3RRGA 2ANJA 1CJTB 3ZSFA 2X26A 1CG2A 1IQZA 3DLJA 5GAHU 2XXKA 4RW8A 2DY9A 5ADZA 1LFHA 5AA2D 2XLJA 2KZZA 3BO3A 1SVXB 2OJTA 1KA1A 3N6UA 4U7UK 2O1LA 2VG5B 1FQFA 1XQIA 3EPIA 1HQUA 3KUHA 1H2UX 4I67A 5J2MB 3C4MA 4I40A 4G65A 4R5PB 5GAEI 2BJIA 4P2FA 3B78A 4MNPA 4HACB 1YRTA 2HZAA 5L39A 3RUMA 1FWLA 1GXUA 3L4BC 1A7LA 1RWUA 4AXIA 3BFTA 1XIQA 2UVIA 1FKOA 2V50A 1JLCA 1LKZA 2OD4A 2LP4A 4H5GA 1Q53A 4DLGA 1Q8LA 3PX6A 5AA4B 1BXNA 2C2KB 2HLUA 1REVA 4G61A 4WTOB 2XO6A 3IL1B 1FPBA 2A0FB 1B40A 3TZZA 2E9RX 2PFZA 3NOGA 3OL7A 4DQRA 2MYFA 4TLLB 2WONA 1MH4A 2AZ3A 1F6TA 3UN6A 2KVIA 2HQDA 2OPSB 5KG5A 2AMCB 2NYHA 1T05B 1YIJS 1LWCB 4Y2MA 1X5TA 1VR6A 3MPDA 2VBXA 3DDKA 2HHQA 1IBMF 4QR0A 3BBFA 4DSEA 2ZXTA 3FZ2A 4F18A 1WF1A 3BN7A 3TUJC 4ZEIA 3UFCX 1P6TA 4MKAA 3FZBA 1KP6A 1GR2A 1RTJB 3OTOJ 3TP2A 2JX2A 5IZ1A 1EQMA 4O4GA 3DHWC 4NOHA 4Q0BA 3Q29A 4ECXA 3PRBA 3UDVA 2IPOB 3G71S 2YX1A 4M5GA 1X5SA 3T1YF 4CO4A 2FJBB 2YXLA 4B08A 5H9FK 1N34J 3S9EA 1F3FA 2Y7PA 5HO4A 2D74B 3BO2A 3TVYA 2FHOB 2VQFJ 1HSEA 4DCXA 3RRHA 1IBLJ 1X9WA 4F1VA 1YITS 2P9EA 4XAKA 2YNIB 4OX8A 4OFZA 5C2CA 3AD7C 4HH1A 3NG8A 4K4ZA 4NXNF 1TWYA 1RTZA 4JSDA 1YHQS 5H8FB 1GTEA 3BH6B 4X66F 1MXUA 5K8NA 2V8DA 1VQ8S 2PI4A 4GX3A 3MUVP 3SSSA 2IC3B 2YLNA 4G1PA 5GADI 4ECQA 4OWDA 1Q8IA 2YH0A 2PMWA 1J2VA 4FF4A 4ZVOB 1IMAA 3FSXA 1M1KT 2GNKA 2DRAA 3ZZOA 2VPXB 5LXRA 2EG1A 4B9LA 1G4CA 2LMIA 4M94A 3MMAB 5I57B 2GAGC 3TCGA 3X1LB 3VR1A 4ESXA 2Y0SD 1KVIA 2DBBA 1B51A 4WXJA 5FHMA 5KFOA 3QUFA 8AT1B 2E1SA 3K1NA 5J16A 4Z0IA 2F3JA 1B46A 5IM2A 1YJNS 1JLBB 3QSYB 3TTNA 2CJBA 1OLAA 3CEDA 2QL9B 2KM8B 3PYDA 3KLFA 2GMLA 4EF1A 4E0WA 1URDA 1QTMA 4DF4A 2JLEA 4YICA 5IKBA 4WIIA 1YTYA 1MY2A 2XMMA 5K9FA 5EX3A 2R4FA 1TQLA 2DHAA 2QT7A 1V3ZA 1TFDA 1VK3A 3AJDA 3NLCA 3HP6A 1EQ0A 3CC4S 1R43A 3HHEA 5E3PA 2Y7RA 4I68A 4EXLA 4U4SA 2AL4A 2NXUA 3CG3A 1INPA 3KNGA 4K4XA 3DLKB 4K59A 2N7CA 1N3WA 4ZECA 4X4QA 3IAZA 4FKYA 4PABA 1ZH5A 3GYGA 3IGNA 2OO4A 2HMIA 3V2UC 1QJHA 2B9WA 1MG7A 2XB2D 1NH7A 3R9LA 1EYIA 3N26A 4X65F 4F67A 3K02A 3OSRA 5F9LA 2FJEB 4RW8B 2O1MA 4UA8A 4YR0A 4OVSA 4KHZE 4ZK7M 1MRPA 5J2PA 1SJRA 4FS2A 3C32A 1Z2LA 5EYHA 2VKRA 4W92B 4R5PA 1KQGB 4RW4B 3KC0A 3I0SA 1FTCA 4IG3A 5DG7A 2V68A 2NXCA 4N56A 2QMUB 2DNKA 2CZKA 2RDDA 3K59A 2JL9A 4OX6A 4NA3A 5E2QA 2GA7A 4ECYA 1E6VA 2RNEA 4ELPA 3U94A 3G8QA 4GXAA 2AW0A 1VI7A 2IM0A 3SEUA 3OHBA 2HAUA 1X4EA 4RBUA 3OPKA 2HG4A 2CJ9A 2R8GA 2IC3A 1SI1A 1ZS6A 3FASA 3PDNA 1B5IA 4R2BA 2W9BB 1X5PA 2CNKB 5C42B 1VDHA 2F35A 1SCJB 3KLEA 2X7IA 4CO1A 1HBNA 4DV7J 1XNRJ 2I9SA 3LPYA 1HBNB 4KKOA 4WEPA 5E33A 2RC9A 3HD1A 4IDKA 1R6YA 5C7PA 4YZZA 4DCYA 3Q23A 2MKKA 5LMUJ 4DV7F 1M5PC 3BGOP 3UA8A 4ENOA 5IT0A 4IR1A 1KOOA 3QAXA 2B3TB 3R27A 4BDMA 2XYPB 4NCGB 5GVQA 2LEAA 3QSIA 3G3FA 2BEFA 1IKWB 5FBPA 5I5PA 4OJ1A 1UVLA 4GC7A 4ZDMA 1Q5VA 1DTQA 1S79A 4TU8A 1FE0A 2IIHA 1MY1A 3M4XA 4ETXA 5KFTA 4JI3J 1MQGA 4F2QA 4TVAB 1WHXA 2DWHA 3CI8A 4ZP6A 4LVNP 4LFCF 5C5JA 5EHMA 3U92A 1VRUA 2FD2A 2VPWB 3OQ2A 2C3YA 1RT2B 2GV1A 2FLOA 5ET6A 5EQ9A 5IM0B 2M8HA 2NQPA 1RKMA 2CZLA 1XOCA 2DGSA 1B58A 4I2QA 1Y3JA 4X1BA 3C16B 2ZVSA 2HBYB 4DS4A 1TL7A 1IKXB 2HXWA 1EYJA 3UCZP 2DDKA 2I1RA 3DOKA 4UACA 3HKWA 2CG8A 3TJ8A 5KFYA 4CTAA 2ZUAA 1OLCA 1P99A 3IG1A 1Y00A 3JQJA 3D1OA 4NXMF 2JNJA 3W9HA 1N34F 2HPUA 4M1KA 5LMNF 1YJVA 3KFWX 1N7WA 4QFKA 4DUZJ 3WX8A 4WBFA 3O8WA 2AJ1A 3OL6A 3CR9A 4CTAB 2XY7A 1J1NA 4TY8B 4OA4A 3TQ1A 5JXSA 1IKXA 1SKUB 2UVJA 2KFYA 4B3OA 2LDYA 1U2FA 3IJXB 1S7IA 2APOA 1YSJA 2CPXA 1M90T 2XMUA 4IY5A 2JEIA 3BFUA 2UXDJ 2O67A 4CLSA 1AZSA 4ZP9A 1NNTA 2Q66A 2W2MP 3RT6B 3S2VA 1IMDA 4GRKA 2VIHA 4HHJA 3MVWA 1VRTB 5AA3A 4DL3A 1G2EA 1RHQB 1ZOTA 1UVNA 4O8MA 1MQHA 4MK8A 3EX7B 4CWBA 4OETA 1EZPA 5G4DA 4I2PB 3T66A 3PIOQ 4LF8J 1MU2A 2BM0A 5LM7E 4YR2A 2M8DB 2VFVA 5IC4B 1L5UA 2L3MA 4NWBA 3C3LA 2OLWA 4NCGA 4Y2IA 2HVHA 2VL1A 3JAMY 1S9TA 1JKHB 5KFRA 5KCJB 3KHLA 5DJBA 2I58A 4LSLA 2RUSA 2KTQA 3QJPA 2LEPA 5H8FA 1B3EA 2NPFA 2Y7IA 1VC5A 4K4WA 3Q28A 1X0PA 1SUQA 4N6KA 1LAGE 2GQQA 2ATLA 1X7VA 3NWGA 1YXIA 4PFIA 2Q6CA 5H8NB 3POTA 4G1QB 4GWWA 3GV5B 4F3PA 4WE1B 4QRZA 2VPOA 1Y0HA 4N8NA 3SCLE 4KC5A 4HLBA 5I3UA 2V94A 2GZOA 3WC0A 3E51A 2DVCA 2DHGA 1B7HA 3F11A 1VBKA 4RYAA 1FD8A 1NRKA 3W1YC 3CD7A 2KJVA 3KEIA 1JW4A 2NUUG 3K2YA 5CM6A 4RZRA 3MM9A 1NPKA 3HV1A 2DHSA 3G6ES 3KOAA 4JI0F 5CMBA 5H1SV 1LBCA 3D68A 4DU8A 3F73A 5KG3A 4GFRA 3JSRA 2OHDA 3GBBA 3IBCB 2ZNSA 1N32F 2MQPA 5EHSA 5DQIA 4UABA 4G4PA 2CDQA 3AOCA 5KFPA 1XNQF 3RRKA 3C9HA 1RWXB 5D3GA 2XC9A 1G0HA 3PYEA 4FXWA 4DXBA 3VAFA 1JNZB 4QW9A 1DURA 1RTHA 1BQXA 2ILYA 4GLIA 2R8IA 2ZJRQ 4MEVA 1X4FA 2RUGA 4KJIA 3UO0A 5KT5A 3IBFB 2P8IA 2OH2A 1CBKA 3VGUA 5DS7A 1RHUB 4A8QA 4F7VA 4F29A 2PD1A 1B99A 2B4UA 2MZJA 1X4HA 3FXQA 2C3UA 2REJA 3CE8A 5B09A 4RX6A 1JX4A 3HT0A 2CDRB 1U1PA 3FQLA 4XO0A 4JV2A 2DSFA 2HKEA 3BR8A 3F56A 2EK6A 2RMLA 2ROEA 4Q2LA 4N4UA 1BHNA 1QAJA 2PT1A 2OWZA 1J27A 1D9FA 2DNQA 2OPRB 5JVHQ 2V25A 5IT9U 4JWYA 2FC8A 2KT3A 4DWIA 3IFAA 2NWJA 3BGFA 4Y6IA 2ZHBA 1WG5A 4U8YA 2AV5A 1S6PB 3SFUA 3GP9A 1FCKA 2DXRA 3KHGA 2VG5A 3RTWB 4X1DA 5I3SA 1I5OB 1B7UA 1PG5B 2HNZB 2B4OA 2M2BA 4GKJJ 4L3KA 2XMJA 2AJ0A 4X4NA 1LBZA 4NLQA 3CMQA 2NVUB 3MZBA 2D7SA 5DVJA 1VJWA 5DDPC 2HRTA 2WB1D 5DETA 4F31B 5HI7A 3BGRA 3BGRB 3HSTA 4RNNA 2GQCA 4HE0A 1RWPB 4PGNA 4QPXA 4KE5A 1X4GA 1RYRA 1SKSA 4JDFA 4N13A 5BYRA 2F97A 1UTHB 4LRFA 5ITHA 2R3VA 4HT5A 1AXQA 1NDCA 1OVBA 1VLYA 3MMCB 5KFBA 1N76A 1CQMA 2DGTA 3VXCA 2BE9B 2QA4S 1LEVA 2V5HG 3DGPB 2XCAA 1FSAA 5DM6Q 2HBZB 1B3LA 3JB9k 2VBYA 5HK4A 2PSZA 2JEJA 1F5BA 2VQEJ 4F3OA 1TL7B 5A5LA 2Y9HA 2ZZNA 1D9AA 1IKWA 3DRRB 1N48A 4TYAA 2Z8EA 3QMQA 2RINA 1MW7A 3MPLA 3K7RA 4DX8H 4ZPVR 3IR7B 2VHAA 3QBCA 1S77D 5CH7B 5CYMB 3WBZA 1DLOB 2BJ3A 1BQNA 1OMPA 4P0IA 3V83A 1SBRA 1LAHE 4JB8B 3EJMA 5GMKa 3NCQA 3Q26A 1TU0B 3LW5C 3VAHA 2D41A 1N0UA 2JC0A 3B6QA 3FFIB 2CJKA 1GV8A 1RYXA 1PCAA 1BTJA 5J1DA 4KR5A 2V67A 2CIMA 4CLPA 3FVNA 1JXLA 3FEYB 3M1VA 1N5TA 2E5IA 2MQLA 5D0RA 1JWWA 3ENWA 5J2NB 4ZVEA 3G3JA 3CDAA 3THPA 1VISA 3QO9A 5BR8J 1RK8A 1TAQA 2PT2A 3MP8A 4MBPA 3BR9A 1FFSB 2HNYB 3HK2A 1XN9A 1ICEB 2P6TA 1KKHA 3D4JA 4N81A 3BM7A 1WD6A 1Y9OA 3CRBA 2Q43A 3UW1A 4RUHA 4H0WA 3MVXA 2HWTA 1H2VZ 3SDEB 3MMJA 1NI9A 4F2SA 3SSRA 4U95A 2V4JA 2KB2A 2MTLA 4X48A 3TPAA 3VLVA 1WEXA 2DE2A 5BXIA 4BS2A 2AJ2A 1T3OA 3U1NA 2XNQA 1LBYA 1G7CB 1FTMA 4NLXA 2VPNA 3EXCX 1KFDA 2VUGA 4DI6A 2HBQB 1RGVA 2XS2A 4DZ1A 1VGYA 2DD8S 1YJ7A 2C42A 3KNAA 3HKZD 2HAFA 1F9BA 4NCBA 3BGUA 1VBYA 1JLBA 1U2CA 3EZUA 4MIWA 1RTIA 2EI5A 3MZ1A 1SL1A 1N4LA 1MDQA 4IO6A 2ZKUA 1Y1ZA 1LW2B 4NE4A 4NHBA 4JI0J 2QRRA 2FHJA 3K01A 2RVJA 2JLFA 4WFXA 2JVOA 4C1TA 2PA3A 4JV5F 1UW9A 1Y7PA 4PG7A 4DX6A 1NH8A 1R0BG 3HSDA 4CLWA 5CC2A 5JVGQ 1N0TA 1PJ6A 4GWXA 1OQ6A 4BHQA 1C4AA 4XIUA 2YNFA 3SEWA 3H2VE 1LCTA 2GVZA 3I55S 3C14A 2R2RA 1MMNA 2HFVA 2B6AB 3GYNA 1VIOA 1NL5A 1LWEB 3GIMA 3VAIA 4C8NA 3W15C 2HZLA 5ET5A 4DR3J 1LBBA 1D0EA 3HFKA 1RT3B 3MMAA 1GXTA 3M9NB 5DZ6A 1HNIA 4G8MA 5E3QA 4OX9F 5DEXB 2BJ1A 3SXLA 2B5JB 2OJ3A 1IQ7A 5HBMA 3DM2B 2Q6BA 3PD8A 1FBCA 4FPIA 4IRKA 2BM1A 2G1HA 2QSFA 4DI3D 2GIFA 4DBQA 2FTRA 3HVRA 2L48A 4ZHRA 3K4UA 3WIVA 2R7RA 4OVTA 3HO7A 2HEUA 2MDAA 2NXEA 1YX2A 4DQQA 3FK4A 3I5CA 4XPCA 2UXAA 3NCRA 2MJNA 1ZAWA 4ZCIA 2HFBA 3O5TB 4F0HA 1JVXA 1FFGB 3TTLA 4JBCA 1HQEA 2E7VA 1LSTA 3OD7A 4KYEA 4HCWA 4K4TA 1UQWA 5KG2A 1DJ0A 3W8GA 5MLCV 1TTHB 3CG1A 5DDRC 4U6PA 4FBPA 2KI2A 4RW7B 2Z56B 3IOVA 3VVTA 3FKBA 1WDTA 4K7QA 4IQXA 4USTA 5I3UB 2QS2A 4Y2KA 1O8BA 3KLVA 3KJTA 3QYTA 2VP1A 3PMWA 2EFPA 3AB2B 4ANCA 4DLDA 3GV8B 4F4WA 3IWNC 4C97A 4DN0A 1U0HB 4NWDA 5C42A 4BDRA 3JYTB 3FC9A 3JSMA 4JI7J 2CPZA 2V4QA 1C0TA 3QNWB 4FEBA 4HHUA 1HYSA 3HM9A 2W7AA 3C14B 4YKKA 1CB6A 3HZGA 4ZVTB 3ET6B 3MCOA 4N6DA 1BQMB 2PX1A 4F3MA 1F2GA 3QT7A 1JLEA 1HW8A 1KLMA 2H51B 2IDEA 1EP4A 1CJKB 3DLEB 3RPLA 3HHGA 3H7HB 3FGVA 2JEFA 3PNIA 1Z1ZA 4QJVA 4F3BA 4J91A 2VFTA 3FJMA 4JI6J 2XX8A 3OL8A 2NUVA 4JOUA 1YI2S 1AFIA 4I3EA 2OSQA 4RKUC 1OY8A 2H48B 3W65A 4P1LA 4OLPA 2QL3A 1QY7A 1NZ8A 4CLYA 3LF0A 3GB0A 1W25A 1MQDA 3B6BA 2B5JA 1NZAA 1I6AA 4XK8C 3AXMA 4R72A 1M5CA 2E1AA 4GKKJ 3W9WA 3JSYA 4FECA 2JFKA 4OTEA 1RT1A 4JI5J 2VD2A 3LSFB 1M1GA 1X4DA 1M5KC 3H2UB 1UA0A 1L3TA 3GU0A 4KHPJ 4JV1A 2RDJA 1L5TA 5LSRA 1NNPA 3B7DA 3MTJA 4WK1A 2BUNA 3MOJB 4OVJA 3KLGB 2DWJA 1PKUA 1XR7A 3VWSA 3PXGa 5ETQA 3PFEA 1WOPA 4NL5A 2XZDB 1NUZA 1RYOA 2B8QA 3CC2S 3T9XB 1RTDB 1IUDA 5B08A 5J1EB 1NB2A 1Z7ME 1RXOB 3EUNA 1TL1B 1A7GE 1IWAA 3LGHA 4ZJOA 2GS8A 2VASA 4FYVB 1B0HA 4U7CA 1H7XA 4H6DA 2XWXA 1JMTA 2DXEA 4R0EA 2EKNA 3ETOA 3FNNA 2XLIA 3OR2A 1X8DA 1I6QA 1SJQA 1XK8A 1FJCA 2FVZA 3Q0AA 3P5TL 2W8LA 1FBFA 1BD6A 1BLFA 3MPUB 2B9EA 4H4MA 1NCLA 3MM8B 4O44B 1SC1B 1VQLS 2Y5LA 2NREA 4CNZA 1CJKA 1HW9A 2GJIA 3MM9B 3C35A 2FA7A 4RBVA 4X66J 1YAEA 2ZEJA 4OX7A 4AFFA 5I3PA 1KA0A 4NEZA 2DR5A 3R97A 2VHGA 1NMEB 3SCKE 5ETLA 5F8GA 1OQGA 2FC9A 4DV5F 4I8CA 1S6PA 4F26A 1B3TA 1UWAA 3MPWA 2WB4A 2DHHA 4WXOA 4XKQA 2JSXA 4NLVA 5I84A 4DR4J 3IK6B 3FBEA 2OKQA 1FJGJ 1ACMB 2AWZA 2I4CA 3BEGB 5F41A 5JJBA 4XKNA 4TNOA 1T03B 3IOWA 1PBQA 2QJ3A 1QAYA 2WVDA 1DZ5A 2C2EA 3DYAB 1CS4B 1S5ZA 4ID5A 3A3NB 2MZ1A 1FKAF 2BOPA 4P74A 4ONYA 3MUQA 1HBMA 1FXLA 3PRVA 3OR1B 1VDWA 3LANA 3I82A 4W4MA 1USYH 2IRUA 4ZVFA 1FW0A 3G7WA 4QYRA 4NXNJ 1NO8A 4Q5VA 4OYPA 4DR5J 1P1NA 4XF5A 5L9SA 5DQGA 5CABA 4LONB 4IO7A 2FYXA 5CZXA 5ET8A 4RUAA 4Q0CA 1B3GA 3VGSA 1S1VA 1HI1A 2XXWA 2FJWA 4C11A 3JAMU 5CD4H 4EXKA 2XCPA 3T9HB 3TA0A 4YY3F 2IVYA 2YQ0A 4NLOA 3P8BB 4HH0A 3PD9A 2JOQA 4G68A 2O84X 1EKRA 1KTQA 1OSDA 3PHTA 2QSWA 4PRFA 3D1RA 3T5HA 3MEEB 3Q2SC 2UP1A 2QFLA 4ELRA 4WU3A 5ITOA 2AGPA 3UDEA 2XZWA 4KV8B 4DSIA 2HHWA 5I58B 4QZVB 1YVFA 3OHAA 4OI3A 4QIEA 3DRSB 4EYHB 3V81A 3ZZUA 5F8NA 1U1KA 4EK2A 5J2PB 4H1XA 3I6VA 3VFJA 3Q24A 3CCQS 4FVCA 3ILIA 2VFRA 3IB2A 3BREA 4OZ0A 1VFDA 2X3GA 2XD3A 1H2TZ 2RF1A 2V9WA 1S49A 3ITHB 4RY1A 2ZWPA 3PVXA 3BKFA 3TZWA 1FNMA 4BDLA 4IO4A 3WAFA 2LECA 3OTBA 1IN0A 3RBEA 1KHWA 5HM4B 4XFEA 1HBOB 1FO1A 3KG4A 1HHTP 3P5BP 4HYKA 2PDAA 5KZTA 3NNHA 3TTKA 1XHYA 2CZIA 5HLFA 2CEXA 1S48A 5J2QA 4KFBA 2F34A 1HARA 1JP4A 2CQ3A 4NYOA 4CO5A 4F1YA 2R9LA 3LUZA 3FCWA 1PGZA 4TXSA 3CTRA 1MXXA 4GX6A 1GX5A 4K4SA 4DUTA 2N4CA 1XVXA 3BIGA 2VGQA 4Y65A 3HXMA 3CCLS 2CAJA 3ISZA 4IRDA 4IH5A 2HHTA 4KD5A 2KHCA 4B3RF 5LJ5Y 2M8CA 2GQ2A 1U45A 2P3NA 4EWTA 1QTNB 2QSXA 1NEEA 3MWBA 4OYOA 4H8IA 2HQ0A 1LW0A 4JP8A 5IWAJ 2FVSA 3TCHA 1WHYA 2KFZA 5I2KB 4BDNA 4I6AA 4OI4A 2GHWA 4K5SA 2EC0A 5DTBA 2K3KA 4DR2J 1H73A 4ALZA 1TL4A 1NJYA 4DL0C 5HROB 1SI0A 4OHYA 3RUBL 2OBGA 5IFMA 4ID5B 3TO8A 2DNRA 3LALA 2HZVA 1R0CB 2YJPA 1U6BA 5U47A 1PC4A 3FVGA 1Q78A 2H5YA 4LUBA 1Y9UA 4EZ9A 4PQJA 2EG2A 3GFHA 3ZKLA 3EYZA 3QT6A 2RU9A 4W90B 3MEKA 4OZNA 4Q44A 1OPIA 2GHPA 1RDYA 4KB7A 4OQOA 3VAJA 1RT5B 5M2RA 3IP0A 1ZAXA 3MCSA 1SC4B 2JJ4D 4RW9A 2DNHA 4IO1A 1OJ4A 2A2CA 1PB7A 1O63A 5FLXU 4IO3A 1HWJA 1YJTA 4NLRA 3NGKA 3RBXA 3PO5A 2NS1B 4FS1A 2HK3A 2AD9A 3R5GA 4QBAA 2W9CA 3ZC4A 3FEXB 1FBDA 1NK0A 3GIKA 4KT0C 1N6QB 1K0VA 2AYSA 5DW8A 5BUUA 3KJ7A 1EARA 2KT2A 1D8ZA 1XR5A 2YPYA 2HCAA 2C1EB 1XC9A 4POXA 3BQ2A 3MEGB 4DV3J 1ZJLA 3LP1B 1P27B 5G0RA 1RAOA 1KOHA 4UZBA 1NHUA 1U49A 4ECRA 2GMJA 4NPOA 4Q8RA 3IN5A 3OFFA 5EWFA 1U1NA 3A1YG 3IO1A 3KLHA 1S7YA 2UVGA 1OPZA 2HS4A 2H3EB 4WP9A 4BBYA 4ICLA 5F8HA 4GBWA 2Z8DA 2ZMBA 2OTLS 1NV0A 2KVQE 5LOQA 2OELA 4PCDA 2OEKA 2NPIA 1S59A 3FXRA 3GYXB 1RISA 1ZIUA 1RA7A 2M52A 4B3TF 3D0IE 2MLYA 3RGIA 1VQSA 1R0AB 3D2WA 1GMWD 3CIJA 4MIAA 4ED5A 3VVDA 3HHLB 4PWWA 2XXQA 1VFJA 5DRKA 3PU5A 1T3NA 1C1CA 3M8RA 3EDQB 3CJSA 1NDPA 4OZ1A 2J6SA 2CA9A 1QAIA 3MBPA 4ED7A 2E7WA 1WDDA 4C8OA 1RCXB 2W7PA 3U1MA 4H5FA 2CWKA 2XA5A 1PDAA 1CJTA 1KR4A 1JLEB 4NF4B 2W2PP 2XXHA 5A6WA 3WIUA 4EFAC 4O3AA 3QFHA 1BKAA 1SW5A 1N5YB 2ZZMA 3FIRA 3R1HA 2ZE2B 2Q2CA 2F6PA 5JEIA 3VHQA 3RBDA 4ELUA 3MEGA 4JI1J 4QPTA 4PKDB 4OZLA 4MFBB 3GJRB 3BN4A 1TZ0A 5DG9A 1KC8T 4HT7A 3QJLA 3TUPA 3F0NA 5HJYA 3K6XA 2VBZA 1L3SA 1XNQJ 4X4PA 1TUWA 4OIXA 2COLA 2RIJA 1ZM9A 1US5A 2XXVA 4NZ7A 3UVJB 2FBPA 3CPWR 2MZRA 2BJ7A 3DRPA 4FYXB 3GR0A 4I64A 4PR6A 3W2WB 4E98A 2DRBA 3CT9A 5HP1A 1VLOA 1JNRB 1UEVA 4DSLA 3BQ0A 2HIQA 4KPYA 3BKUA 3FXBA 4M4GA 1H0HB 5CA5A 3NGRA 2J5AA 2M7SA 1DRZA 2R9JA 4HDGA 4ZN3A 4NX1A 2VBWA 4H4MB 3QO9B 2UUWA 2GFFA 2V2QA 4ZZAA 1KBRA 3Q8UA 2IYGA 2Z8QA 1NKEA 3K8VA 4F19A 4WKRA 2CZVC 4C48A 6FD1A 1N36J 2HQCA 3EGWB 4MMOA 2ZZXA 4L75A 5I42B 3D67A 4UOCA 5KG7A 1RDRA 3S9LC 2RC7A 3PUVE 1QD1A 1TK8A 1LK5A 4OX9J 4PG4A 2BR0A 4O4RA 2B56A 1FRIA 1EETB 1YTVA 1MQJA 2RKMA 4AS5A 5K5MA 1LWFA 3BQ1A 3U1LA 1ZETA 2Z57B 5IZHA 2VFUA 3TEPA 2FYIA 4BWJA 3ENVA 2FDNA 3DRRA 4EDPA 5DEXA 4C0RA 3SETA 2XHDA 3NOHA 1N36F 4NLPA 2FJAB 3ULHA 1P1UA 2WKYA 3OLAA 1LW0B 2HBRB 3EF7A 2CADA 3QGGA 1M5DA 2V8PA 2MPUA 5D77A 3H4ZA 5GAEU 4FZVA 1SQYA 4F02A 3T19A 1QKBA 1FRLA 1S1WB 1FCAA 1XMOJ 3OD2A 1CJUB 1HNWF 4OENA 4HW8A 5AJ3J 1S76D 2YNGA 4WXWA 2X3DA 3GJQB 4J37A 3FVYA 3T5LA 2WSEC 2AYEA 1Y5IB 3PW4A 1V3SA 1J5OA 5IC6B 2HS0A 1FKPA 1MS7A 4QYZK 1DTTB 3PW2A 3H06B 3W2WA 3MXHP 1FDNA 4ETZA 1TELA 2YKMB 2KQZA 1X4CA 4OEVA 1A54A 4C0HA 4B9NA 5ICQA 1LCFA 3OO9A 1B1HA 2DITA 2XXUA 4LQ5A 5B7WA 3M9MB 1T9UA 3P3DA 4K8RA 5HPQA 1GAOA 2DVZA 3SCIE 1MXWA 1NUYA 1Q8KA 4PFBA 3PPNA 3Q89A 3N01A 4DF8A 4WFAQ 1GQEA 4JB7A 3AQPA 3MAAA 1ZTWA 3KOTA 1MM6A 1S4EA 1DTTA 1EZ9A 1WC0A 3OVSA 1T11A 1HWKA 4EMDA 1HNXF 3OFEA 3B82A 3CWJA 1WOOA 1FPFA 1YBAA 4DU7A 2YWFA 5EYGA 1WF2A 2ACMA 3V6JA 3CC7S 1OO0B 2O01C 3MECA 4X84A 1VRUB 1RAHB 2XWYA 1CJVA 5JTYA 3CDUA 4LZ8A 2UZAA 1FVSA 2QIFA 3R26A 1TKZB 5LOMA 2BQ3A 3PG9A 3EKIA 2ZC4A 3HVAA 2Y1IA 4LR7A 1D09B 2MEWA 4PZVA 4KGMA 2JZ5A 2PFDA 3JXOA 3OO7A 2QS4A 5IGAA 4LMZA 1LWXA 4EO8A 4KGZB 1IKYB 4BDPA 3GLJA 1RWVB 4ZCLA 2GJFA 1FRXA 1Q82T 3PJXA 1LXNA 1NAQA 2OK2A 2V2ZA 3A3UA 5AXLA 2PEBA 3S1TA 4ESWA 2UUBJ 5FIIA 4NQ8A 4B3TJ 4G1QA 3PW0A 2F7BA 2X7QA 3FJ2A 4MYUA 2EBEA 4QQBA 3ILUB 4IOAQ 2W8KA 3SQOP 1NK5A 1NV4A 3E01B 1QJMA 2LKZA 2XXXA 5AA4A 3TVZA 2F8HA 1WG1A 4CLTA 2Y1LB 4Y00A 3PHEA 5THWA 4X4OA 2VKZG 2M5YA 4PETA 3BDPA 5AE4A 3GIIA 1FJ9A 3L3CA 5BYQA 4FBTA 2HQIA 2EEYA 4PBHA 4ZE8A 2V4RA 2XS5A 2DR7A 2HHHJ 4J9RA 4JI1F 2A6MA 5I56A 1RB0A 1WTBA 1IBKF 3MEDA 3DLBA 4PQUB 1YZ0A 3MDFA 3SSQA 2UXBJ 1MXYA 5A2QU 3KJVA 1AIVA 1S9FA 1PILA 3BS9A 3H59A 1PC5A 3A29A 1RHMB 3H5XA 2J76E 2LEBA 3HHLA 1R1NA 1NUXA 1LW2A 2LAOA 4ATNA 1WC1A 1S6QA 1JEUA 4LR9A 4DL5A 4ECVA 2VD3A 3AQOA 2XZTB 1CEZA 3NMRA 3NOCA 3VAGA 3PW7A 3O6GA 2JJKA 2EFGA 1N5SA 4ANEA 4NLWA 2J0WA 3ISNC 2AIRB 3OVBA 3OXFA 3OW2R 4WYLA 1SQGA 3LO3A 3H6UA 3H5UA 1TKZA 1T02A 4NF5A 2F36A 3CHGA 4B9SA 1ZPVA 3T41A 4OYVA 5HL7Q 3H8YA 5F9NA 1AFJA 2KRBA 4ED0A 3AOAA 3UR0A 4IOBA 4P56A 3MF5A 4PYDA 4C8LA 2DEIA 4USWA 3QIPA 2RS2A 4F3QA 3IGVA 4L73A 4GRSA 4Q43A 1DY3A 4DI4B 2R7OA 1YGYA 2L9DA 4B3OB 2G4BA 2EFQA 5A2QY 1APSA 1TVRA 4IGTA 3S01A 3AXFA 4X64F 2A2DA 5CI5A 1WC5A 4O3NA 3GYYA 4DR3F 1HMVA 2EWHA 2ZH1A 2ABHA 4KGKA 1Y5NB 2ALYB 3OJUA 5A0YA 2VJVA 3MMCA 3T3FA 2GVZB 1HHQA 3PPRA 1R8AA 1B4ZA 4ZEDA 3KN7A 1FTKA 1KTVA 4AS4A 3PJ9A 5A6PA 4LBHA 1DSNA 5D0HA 3SMZA 1FQAA 1UEKA 5EQ7A 1KONA 4WCEQ 3CFLA 4DXLA 2VDIA 4IFYB 2WK4A 1ROFA 3NL0A 2FZKB 1V5VA 1P9QC 2W4DA 4KFBB 2J0QD 1HD0A 3H2LA 2W7OA 4NASA 1S9EB 3GZ7A 4ER8A 2G9OA 5HMWA 3R8YA 1UIVA