4LUBA

X-ray structure of prephenate dehydratase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
275
structure length
188
Chain Sequence
TMKIAYLGPSGSFTHNVALHAFPAADLLPFENITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYLFHQAKIEAVAEIILENYTRFWVLGDETPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFIIDFENHNEKLVSFALEELTSIGIHYKILGKYAVYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative prephenate dehydratase
publication title X-ray structure of prephenate dehydratase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 54
structure length 188
sequence length 275
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lubA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lubA01
2LQJA 1D9VA 1UTBA 2I0BA 3EQ1A 2VGQA 1QKBA 1LB8A 1POTA 3MJNA 4X48A 5JJBA 3UORA 2F5XA 1JW5A 5K2YA 2DYXA 3TKDA 2QJEA 2Z8DA 3H03A 3VLUA 3UA8A 1JEVA 1TWYA 1ZTYA 2QS1A 3I3VA 3MTJA 1IXCA 2PMSA 2Y7PA 1XOCA 5FHOA 3I5OA 4KYSA 3S9MC 3TAJA 1DPPA 3OELA 4OEVA 1S50A 2DT9A 1ZU0A 5L9SA 3CR9A 3FXUA 3PUXE 2QRYA 1SW4A 5CMMA 4IO2A 1M5DA 1UQWA 2IEEA 3OO8A 3VXBA 2RQMA 1MPDA 1MDQA 2GH9A 3MP1A 1I69A 2I4CA 3DP4A 3KJ7A 4Q5TA 4F2OA 3HO7A 1EU8A 4LVQA 4X1DA 3C36A 3KG2A 3MAHA 3PPNA 1B9JA 4MLQA 3VE1B 5EYFA 1EZOA 3FGSA 4ECFA 3S9EA 3O6HA 4JSOA 3UP9A 2WKYA 1B40A 5HPQA 2DWHA 2D3IA 3TELA 2RINA 4TLMB 1LSTA 3K4UA 3DM0A 3B6QA 2BJJX 2NYIA 3TQWA 4DCYA 2Q2AA 4IO1A 4OESA 3OXNA 4N13A 1SVXB 1MQHA 2I9SA 1A99A 1P1UA 1L5TA 3MAMA 4AB6A 4NF4B 3IOVA 2V3QA 4U1OA 3IOUA 4NF4A 3N6TA 2F97A 3DP6A 3O29A 4GXSB 3DDNA 4OMBA 5AA2D 1AL3A 2DQVA 4F39A 1H44A 2XHDA 2F6GA 4ZZEA 3ILTB 3TCHA 3I6VA 1MH4A 3TUJC 3TEPA 3EHUA 1MXWA 5L9OA 1N04A 2DP8A 3K00A 2V25A 4OTEA 3N0VA 4IO6A 2F8DA 4OZ9A 2GHBA 3FUZA 5A5XB 4KHZE 1Y1MA 3OFGA 3O6GA 3TUIC 4NF5B 5A5XA 4EQ7A 1ATGA 3O28A 1MM7A 3ENQA 4NF5A 4PWUA 1SI1A 4RXLA 4U2RA 1JETA 2CMOA 1B3FA 4F1UA 4PP0A 4HCWA 3S9NC 4OEUA 1CE2A 4FATA 4RJZA 3OFEA 4Z7EA 2H99A 3HHFA 3WAEA 1LAGE 3ODBA 2JOQA 1GV8A 3PPOA 1SI0A 4DXUA 5I84A 2Y7RA 4YB6A 5DYHA 1LK7A 2FA7A 4FAJA 3GBAA 3IB0A 1B05A 4JSDA 2DWAA 4F3BA 2H25A 3A3UA 2O7UA 3EN3A 2OWTA 2ONRA 4MH5A 1DMBA 4QFOA 1P1WA 3RGYA 3TFLA 3IK6B 3VLVA 2X7QA 3TTLA 4YKKA 2LAOA 3A09A 1Z7ME 4GO5X 1MM6A 4IO4A 3OEKA 3H4ZA 3B6TA 3KFMA 2ANJA 4BDOA 1H76A 5JEIA 4KD5A 3ZKKA 3MP8A 2UYFA 4F2QA 2PA3A 4BDQA 4DCXA 5BUUA 2REJA 1OLCA 2RKMA 3IB1A 1NNTA 4PQJA 4F3PA 4Q30B 4BLAA 1PB8A 4G4PA 1H43A 3W15C 5DVFA 4RY1A 1M5EA 1OVBA 1R6ZA 1VFDA 3HCQA 4FIMA 2VP1A 1XC1A 2CDQA 3CRBA 4M8LA 2I4BA 2IA4A 2GHAA 4ONYA 4Q8RA 4F1YA 4YICA 5FHMA 2G93A 5IS2A 1H3DA 2M8CA 3MW0A 4OETA 4R9GA 3CSBA 3RQTA 4OFJA 1JEUA 1N84A 3FASA 4QFPA 4FEBA 2Z8EA 1HSJA 1Y1ZA 3FJMA 1A54A 3FVGA 3IORA 4DE8A 3TCFA 4XKNA 3MP6A 4H8JA 3KGCA 1SW2A 1US4A 3O1LA 2B3BA 3OBIA 2YPNA 4XIGQ 4DIGA 1HSEA 1MPCA 2H9BA 3U1OA 4PFTA 3S4UA 2REGA 4QF9A 1JW1A 1TXFA 1US5A 1JVYA 5ITPA 4DZ1A 3KWMA 4TOZA 3CI8A 4R72A 4X84A 2OZZA 5FTIA 1ANFA 3EHSA 3IR1A 5CM6A 3MVYA 3PD9A 3IJXB 4XXUA 2FGCA 1QKAA 2I58A 4FORA 1EZPA 1MY3A 2UVJA 2Y7WA 2H5YA 4YB5A 2ONKE 4R75A 2PC6A 1D4NA 4WXJA 4C1UA 2D21A 3LBSA 5CMBA 4NEDA 1O64A 4LZ5A 5ELVA 3K6WA 4MFIA 2ZMBA 4H0WA 5DTBA 5L9MA 4F18A 4LZ7A 1AMFA 4EF1A 2ZHOA 4IGTA 2F78A 1CB6A 3BFUA 1SW1A 4H5FA 3U94A 2ZNSA 1B4ZA 5IT0A 4R2FA 3L6HA 3K1NA 5DT6A 3DLNA 4MF3A 3QUJA 5B70A 5HM4B 4BDLA 1SW5A 2I3VA 4R74A 3KN3A 3LSXA 3FVNA 2DTJA 3SEYA 3PUYE 1QW0A 5ICQA 3RUMA 2GRVA 3PGFA 3PMWA 5F7VA 3TZAA 2PT1A 2HZLA 3SEUA 1B51A 1YCJA 1LGBC 4R6HA 2VOZA 4GOTA 2XXIA 4YKPA 4YKJA 4FE8A 1NH8A 3FATA 3MVXA 2OK2A 4LQ2A 2R6GE 3T93B 3K01A 3E3KA 1LBBA 3LSFB 3O2AA 2Q2CA 3T22A 1M5BA 1I6QA 2DE4A 4X1BA 5B7DA 4KYEA 5CBSA 4QSEA 4N07A 1DSNA 1M5CA 1ZPVA 4ZEIA 1MXZA 4JB7A 1LFIA 3TPAA 3HV1A 2AYSA 4DXCA 4ZE9A 3M8UA 1PEBA 3W9WA 4EF2A 4ZDMA 1DTZA 3H3GA 5IAIA 3Q29A 1TFDA 4R73A 1UIUA 3N26A 2OBGA 2XXHA 2XXXA 3CG1A 1HSLA 4O3BA 4ISUA 1PDAA 1LCTA 2O51A 3N6UA 2OLBA 3RTFB 4WEPA 5CRYA 2DWIA 5AA4B 1ZJLA 3U92A 4BDMA 3DC2A 3UW1A 5AA4A 2JHEA 3G3JA 3QIMA 3B7DA 3FV2A 2I3WA 4ZEFA 1LLSA 3F11A 2NXOA 2RE1A 3TTMA 2UYEA 3C9HA 4N6PA 3PU5A 1J1NA 2DXYA 2OJTA 3MZ9A 1IXIA 4MLVA 4ZZAA 2V3TA 1AH5A 2RQKA 4YAHX 3D4GA 3KSJA 3FZVA 2MDAA 3IB2A 1SYHA 2AL4A 4NTLA 1B5JA 1FTJA 3THIA 1OQHA 4Q0CA 1XT8A 5I59B 4GO7X 5FIIA 1VE4A 3R6UA 3E4RA 2RC9A 2QL3A 5I58B 5I59A 3LC8A 1FCKA 3TCGA 5I58A 4UACA 2D5WA 3K2DA 1A8FA 5IT4A 3AB2B 3C33A 1VSOA 1PBPA 1KWHA 4H67A 3TUZC 4JWOA 2B3FA 2DE3A 2UVIA 4KFQA 5CMCA 2NOOA 4F1VA 3JV9A 4NWCA 4GL8A 3TDJA 3OO7A 1RKMA 4HS7A 3IX1A 4FECA 3M3FA 2DSFA 2HFBA 3HHGA 4C0RA 2HCAA 2ZXTA 4IB2A 2V84A 4M4GA 2P9EA 3BKIB 3H06B 4GRKA 4Z0IA 5H8FB 4LONB 2HEUA 5DEXB 1P1NA 1T0KA 1FQEA 5H8FA 3BBRA 3IO4A 5DEXA 4HW8A 4PE5B 3KOSA 3V5AA 3CFZA 1USYE 4P0GA 2X26A 3KBRA 1JNFA 4GL0A 3VVDA 3MZ1A 4L17A 1ZIUA 3G3IA 4ESWA 2KLFA 3V8XB 3O97A 4YMAA 4U22A 3A3CA 3SESA 1FQAA 1Y4CA 3KSXA 2F36A 3HSTA 2DWJA 2J0WA 1UTHB 3UGWA 4ESXA 3HPIA 4YMBA 4OFLA 4FEDA 3OMBA 3ENWA 1UTHA 4GFRA 3TYHA 1UJ5A 1MXYA 5KCJB 1FQBA 4GVOA 1B58A 4U23A 3RNNA 1H45A 5KCJA 4G2ZA 5FTHA 3TMGA 3T96B 3VV5A 4TLLB 4PFUA 3MUQA 2NVUB 1SBPA 3KJTA 3N94A 4HTGA 3B6WA 1RYXA 3ECRA 4XKPA 3S1TA 2H98A 2ESNA 2HZKA 2RC8A 3PUZE 3D4CA 2ZNTA 4IO5A 2P1SA 4U4XA 5AA3A 1MQDA 3K6VA 5JK4A 3K02A 4FJPA 2P2AA 1BP5A 5H8HB 1LFGA 5CMKA 1MG1A 5EHMA 1UJ6A 4LP2B 3MQ9A 3G3GA 5H8HA 3H6WA 3T9VA 1B3EA 3JYRA 2J0XA 1B3LA 1B6HA 1B52A 3QXMA 1FTMA 3U72A 1DPEA 3EPEA 3CEDA 4OFOA 3C32A 1NFTA 2LVWA 2RC7A 3SETA 1OVTA 3U93A 5K2XA 4GXAA 1B46A 3V83A 3WAFA 3UIFA 4F3SA 3GBBA 1PB9A 3PMVA 2PT2A 1USYH 3OSRA 2H9ZA 4ZEDA 1M0SA 4P0IA 4ZS9A 2ALUA 2DS9A 4YU0A 5H8SA 2R71A 1O63A 4R9FA 3KZGA 4G77A 3FJ7A 1Y4TA 3TQLA 4KCCA 5KDTB 2Q88A 1Y3QA 3DELB 3M3LA 1EH3A 5ICTA 3VXCA 3C34A 4XKRA 5KDTA 1WDNA 2V93A 4POXA 3U8QA 3AB4B 3H6UA 4RPOA 1B3HA 5J1DA 1SC6A 3H6TA 5CI5A 2FYIA 3SEVA 3SERA 3PV0E 3K0VA 1O7TA 2F6PA 3QYTA 3LR1A 5CBRA 3SDFA 3O66A 3RT6B 3QK6A 2O1MA 4EDPA 1ZMGA 4NMYA 1OMPA 3Q26A 5TPAB 2H4IA 3LUYA 3G3FA 3K1PA 3FVKA 1N3XA 3PPPA 4LA9A 5TPAA 4H65A 3GLBA 2P9GA 4RK9A 2I0CA 1FW0A 3MVWA 1FQFA 3RT8A 1QUJA 2P9CA 2HAVA 2DOJA 3E13X 3PPRA 5LOMA 1U8SA 1PBQA 2O68A 3O6IA 5IKBA 3SEWA 2I6EA 1N76A 5I2KB 3Q28A 3MBPA 1I6BA 1ZKBA 2ZNUA 3ENVA 5I2KA 3W9VA 2A5SA 4I8CA 4ZEBA 4LUBA 5T41A 1OLAA 3CVGA 1R9QA 3FV1A 1MY4A 1URSA 3T9HB 4KPTA 1I6AA 1TFAA 2W7YA 3KEIA 2F1FA 1MRPA 4R6KA 3U7JA 2PBWA 1B0HA 5TU0A 1Q1KA 1YGYA 3FXQA 1Z7NE 3Q27A 1EZ9A 1FQCA 3C31A 3FXRA 3G3HA 2YJPA 4F3GA 5M2VA 1XS5A 2O69A 3ZS6A 5ISUA 4UA8A 1XVYA 1MXVA 1MPBA 1B5IA 1DTGA 3SEXA 3JZJA 2QSXA 1S7YA 2O7IA 5I57B 3K5PA 4JWXA 5I57A 1MXUA 4IO3A 4I1DA 3TODA 5ITOA 1LAHE 2I48A 4EQBA 3QUFA 1N3WA 4NF8B 4JDFA 3LSLA 2F35A 3PUWE 4WEDA 3RTWB 3QSLA 2I49A 4NF8A 3IOWA 1FTLA 1LCFA 4O3AA 2XXRA 3HHEA 1N0TA 4QFNA 4TQUQ 2QS2A 1AOVA 1LBCA 3IO6A 3FD3A 4PFWA 4YKIA 1PB7A 1SD3A 1MDP1 3SKPA 4F22A 2QSWA 5L8DA 1PSDA 1YBAA 3C35A 4OXVA 3USDA 4ELOA 2Y7IA 1MQGA 3P96A 1GGGA 2F8MA 2F34A 1NNFA 1Y20A 4GD5A 1IIWA 3OOAA 3OENA 3Q25A 5BWJA 3R7XA 4PFYA 4MBPA 4P11A 3PMXA 3NRBA 5TP9B 3RY3A 1QUIA 3FIRA 1P1OA 1MY0A 5TP9A 1N7WA 2NUVA 2Q89A 3MWBA 2V3UA 4EXKA 2XXYA 1XTZA 4U1ZA 4WKMA 5CC2A 1ZLQA 2XXWA 2Y7KA 2O1LA 1URDA 3KOTA 3RPWA 3CFXA 3QAXA 2DE2A 4YZZA 2Y84A 4AB5A 1JQFA 2KO1A 4RNSA 2CZLA 4RA1A 1WVJA 4NWDA 1B7HA 1MQIA 1URGA 1S9TA 4XTCQ 1MH3A 1QJMA 4KQPA 1BLFA 4C1TA 5AA2B 3TTRA 2DXRA 4ELRA 4GQOA 1MY1A 2F7CA 5AA2A 4G68C 4F29A 1QULA 1RYOA 1VFEA 4AQ4A 1JW4A 1ELJA 1IEJA 3MPLA 2AIXA 1TT1A 1IXGA 2OCUA 4LATA 3TUSA 2O6AA 3GZGA 2XXQA 2RF1A 1NNPA 1UJ4A 2HXWA 4QFLA 3T66A 3OFFA 3IJOB 4GLIA 1LK5A 2GFEA 4G68B 2G29A 2O84X 1BKAA 2QRRA 1B1XA 2ZYNA 1P99A 4G68A 4ZEKA 1Y3PA 3VFJA 1MQJA 3AXFA 2XD3A 4GF8A 4KCDA 1SDXA 2UXAA 1GR2A 3VVFA 2E1SA 3RN8A 4G8MA 1WODA 3MZBA 4IGRA 4R6YA 1NH7A 2F7AA 1FTKA 4OVJA 3N5LA 3HN0A 2XXVA 2Q8JA 4KI0E 2PX1A 1B32A 2R9JA 5H8NB 5I56B 1R9LA 4NE4A 2QMXA 4JXIA 5H8NA 5I56A 3RLFE 4QSCA 2NWJA 2VD2A 2ZYKA 1UIVA 1LB9A 1N7XA 3K6XA 4DXBA 1AIVA 1ZBMA 4QSDA 4M1VA 3VDFA 3MC2A 4KYDA 1B7UA 1B4HA 1LAFE 2ZYOA 2PVUA 3EHTA 5AE4A 2F7BA 1BTJA 1Q35A 3OO9A 3CIJA 4RK2A 3K6UA 4H8IA 3PD8A 1IZ1A 2YLNA 4ND9A 3ONMA 2QS4A 4QRZA 4ELQA 2XX9A 1A8EA 2OWSA 3IAZA 3VVEA 4JBZA 5KZTA 2UVGA 1B7ZA 4OHNA 2ABHA 1IITA 1IQ7A 4R2BA 1MY2A 1GVCA 4KR5A 1NKXA 3G3KA 3T9UA 4QFKA 2THIA 3BFTA 2DVCA 2HAUA 2XX7A 1Y3NA 1XHYA 4U4SA 1NL5A 3C4MA 4U21A 2X7PA 4H5GA 4EUOA 3CFLA 5EHSA 4OYVA 3P7IA 2ONSA 4QHQA 4G8HA 1DOTA 2VD3A 1PC3A 4IY5A 4DDDA 4ZE8A 1II5A 4I62A 5DVJA 1OIBA 2E0SA 3OFHA 2ZYMA 1XVXA 4RPNA 4POWA 2RCBA 4LZ8A 4RYAA 4EXLA 2FNCA 1FQDA 1MS7A 3IBWA 3TTNA 1LFHA 3OSQA 1BIYA 5FHNA 3OEMA 1SQYA 4BDNA 3ZSFA 1Y9UA 3OO6A 1R1NA 4BDRA 3DP8A 3ZKLA 3H6VA 1NNKA 1GTKA 1POY1 3K1MA 5AA1A 3DHXA 4E0WA 3S9LC 1D3KA 1OQGA 3EF7A 4OENA 4H6DA 4K3FA 1O8BA 1D9YA 2PYYA 2UVHA 3GXAA 5DVIA 1FTOA 3ILUB 1VR5A 3AAWB 4NF6B 2QPQA 3MVZA 1F9BA 1IUDA 3CSGA 4H1XA 4NF6A 1IXHA 2Z22A 2DVZA 3T9XB 4OQOA 2Q9TA 4IO7A 3TTKA 3FJGA 4GWOA 3LOUA 4X9TA 1QUKA 1RWUA 1YTVA 1QVSA 2P0SA 1B2HA 1LAXA 4GIZA 1MXXA 3UN6A 4F31B 3VLWA 4THIA 1B3GA 1A40A 2A5TB 3V89B 1SYIA 1Y7PA 4OWDA 2XXTA 2A5TA 3LSWA 2QMWA 2RCAA 2XXUA 4YB7A 2Z8FA 3CG3A 1KS2A 1B0LA 4GMKA 3MPKA 2Z23A 4I9DA 2B65A 2XX8A 3IOTA 3E9XA 5JTYB 4ZECA 1YPNA 3OD7A 4PETA 4F19A 2VHAA 1A7LA 3KN7A 5H8QB 3O9PA 3PPQA 4XKQA 3G7WA 2AL5A 5JTYA 1JVXA 4IY6A 3UK4A 1M5FA 4JWYA 2XXPA 1YAEA 5H8QA 4E0XA 4HCYA 4EQ9A 3IXQA 5I2NB 1A55A 4OERA 3PUVE 3H7MA 3IL1B 5I2NA 4O3CA 2QS3A 3W7BA 2XD2A 2HQ0A 4LQ5A 3FVOA 3L7OA 1B1HA 3L6GA 3R26A 3M3KA 5HBCA 4DLDA 3KN8A 1LKZA 5F1QA 1NMUA 1P1QA 3DHWC 4ELPA 1B5HA 4NMLA 4G8NA 3S2VA 1UTBB
chains in the Genus database with same CATH superfamily
1UETA 2LQJA 1SVDA 4IR8A 1EJ7L 1W26A 2UUCJ 3BO4A 1UTBA 4FNHA 2I0BA 2HGNA 5F41A 2MZTA 1B7FA 2KU7A 4XF5A 4DZDA 4PEOA 1HNIB 4NEZA 3UORA 1JW5A 2DYXA 3HHLB 1HNIA 2W2PP 4AXIA 3HHLA 3R5CA 2QJEA 2Z30B 1S48A 1NLKL 5KG3A 1FJ6A 3HFUA 1JEVA 2IJNA 1Q4RA 3EE3A 1IXCA 4U95A 1UKUA 2NPFA 2CEXA 3HHDA 2HAFA 2FJXA 1NDLA 2JFKA 2GJIA 3CIMA 1RGVA 1NUXA 3J7ZT 3FSXA 4P9KA 1DPPA 2DRDA 2U2FA 2F4FA 2JNJA 1OPZA 3QT5A 3CR9A 2GO8A 5DS7A 3VGSA 1YWXA 1X60A 5K8NA 1SW4A 4LF4J 3TUPA 3C46A 4DF4A 2RQMA 1EKSA 1MDQA 1MPDA 2GH9A 4USJC 4WPAA 1N36F 4NLTA 4GX3A 1ITPA 3DU6A 2OP5A 3ONQA 2YVSA 2C2OB 1KLNA 4CWBA 4LVQA 4X1DA 3MR5A 4DPYA 1HL6A 1WI6A 1B9JA 2W9BB 1GK8A 3L9ZA 3VZIA 2WHOA 4QBAA 3BGRB 2W9BA 3FGSA 3KBZA 1Y9OA 5A6PA 3S9EA 3BGRA 1XMBA 1FJGJ 3DDIA 4DFJA 2WKYA 4C8ZA 3PYFA 1LSTA 1BLUA 2ZBCA 2APOA 3M8YA 4IUFA 4N6DA 3TQWA 5B0GA 2AWZA 4OESA 4U6PA 5J1EB 4NL5A 5D4LA 1CS4B 2R8HA 5J1EA 4DV1F 1NPRA 2UVUA 3NEKA 1CS4A 5K5MA 1GTEA 1QY7A 3PYGA 5T3JA 4U1OA 2XLJA 3N6TA 2CQ0A 1SH2A 1YBTA 2BOAA 2B56A 4B3RF 3DP6A 5DW8A 3PW5A 4CDIA 4X4UA 3H2LA 1G2EA 2EK1A 4GRSA 5L1KA 1VQYA 4F39A 1H44A 4OZJA 4ZZEA 1XJWB 5CYJA 3SZ2A 1YRUA 9ATCB 1MXWA 4OHYA 1YJUA 3IWLA 3FUYA 2DVIA 2DP8A 3AHPA 4A8YA 4LRDA 3H25A 3N0VA 3SCLE 5C42B 2DIVA 5HQLA 2E7VA 2VG7A 5C42A 2XCAA 3O6GA 4NF5B 1U2FA 4F0MA 3O28A 1LW0B 1MM7A 3ENQA 3ZO7A 3ZTRA 4NF5A 4X4NA 3A29A 3W3SA 1FPBA 1LW0A 3TRGA 2AIRB 4U2RA 1B3FA 5J2NB 2ZBPA 1SH0A 2IVFB 5J2NA 4HCWA 4JI7F 4OEUA 5I3PA 4FATA 3IAS9 3KHLA 3RGIA 1SUQB 2NXUA 3ZC4A 4CO2A 4IFYB 4QOTA 2JOQA 3ODBA 1SUQA 1SJRA 4IFYA 1Y3JA 1EHWA 1LBWA 4ZVTB 1RU1A 3TI0A 3M8ZA 1EARA 3ENAA 2FA7A 4LF6J 1EKRA 4FAJA 2VKRA 4WP3A 2L9WA 1ACMB 3IB0A 4JSDA 1S7IA 2DWAA 3CDWA 3OLAA 4DR3F 3EN3A 1VK8A 1ROFA 2OGUA 5FBPA 3IK6B 1YZ7A 3BO2A 4O8MA 2HVHA 4PE3A 3H5SA 3BKUA 3BSOA 4GO5X 4FF2A 2WCXA 4LRCA 2OO4A 1U25A 1JLFB 4LN5A 2WSCC 4UQTA 1C4AA 1H76A 1KBRA 4F2QA 1JLFA 2PA3A 2D3UA 1LBYA 1S72S 5IQ6A 2AYEA 2X1GA 3GLJA 3IB1A 1NNTA 4FPRA 3FEXB 4NZ6A 5ETQA 1ZH5A 4J9UE 4J9PA 4Q30B 2P6TA 2CZ4A 4BLAA 3NAHA 3AQPA 1PB8A 4G4PA 1HW9A 3TO8A 2DNHA 2LQ8A 1B3TA 1R6ZA 3E79A 5KFUA 1KDNA 3CRBA 2HQDA 2J5AA 4M8LA 2YPZA 3UI3A 1FWPA 1FO1A 4ONYA 2L48A 1YX2A 3KJQB 1NZ8A 4Q8RA 4PPDA 4RNHA 5DGBA 1L3SA 3VWSA 4C8LA 2V63A 2GQ2A 3DM2B 2KKHA 3IMQJ 1EQ0A 4L3KA 1ZM9A 1VQ6S 4QWBA 3DM2A 4OFJA 1N84A 5KG2A 4DR6J 4M63A 1X5OA 3NGSA 1KTQA 3VQSA 4QR1A 4DE8A 3MP6A 1GXTA 2ZZXA 2A2DA 1SW2A 1US4A 3PKYA 2MKKA 1HPZB 2B3BA 4LF8J 4DIGA 3TVZA 1HPZA 1U26A 4F0KA 2IRUA 5A2QY 1FKAF 2X1BA 3KUEA 3HKZD 2MQPA 4R72A 4X84A 2OZZA 2B7CB 1FXDA 4DCOB 1SC3B 3EHSA 4I3YA 4DR7F 3IR1A 5CM6A 1NCLA 3IG1B 4NI2B 1Q0NA 2FGCA 3IG1A 3T6JA 1QKAA 2HWIA 2I58A 4NI2A 2FQQB 4I4BA 5E41A 3GIJA 3CCES 3LWLA 1X0PA 3M2VB 2GNKA 5HMYA 1NSKL 3PTYA 5B09A 3M2VA 4N76A 2D21A 3LBSA 4DX6A 1S6UA 4XEQA 3K6WA 2KH9A 3CSKA 1HIYA 4H0WA 4USHA 4CLYA 5HBMB 3UDCA 1AMFA 3ISNC 3BFUA 5HBMA 3ZXWA 1SW1A 1X9WA 4WCEQ 4TYAA 1KLMB 2AKWB 5E3CA 3NXZA 3DLLQ 4R2FA 2R7XA 1KLMA 3JTPA 3QUJA 2VB6A 1R0AB 4EUVA 1DK4A 5ETLA 1C0TB 3LSXA 1R0AA 4FVMA 2HRUA 2VBYA 4DR4J 1TR0A 1C0TA 3L95X 1U7LA 2GRVA 1GFWB 3MI7X 1O51A 4DV6F 2VF3A 4QQBA 2BM0A 1HBMB 1LGBC 1HQ2A 4UZBA 4Q8EA 3QT6A 4ID8A 2QLBB 5D0EA 4R6HA 4RW4B 2GV1A 1HBMA 1NBEB 3FQLA 4YKPA 2KT3A 4RW4A 4YKJA 4FE8A 3MVXA 4I7FB 1RT1B 2O3DA 5AJ3F 2CEYA 2R6GE 2IC3B 4I7FA 1RT1A 4NLXA 1OPIA 4ED1A 5D3GB 1LBBA 3T22A 2IC3A 3W64A 1M5BA 2VFVA 5D3GA 3SIPB 1I94J 5B7DA 4AXJA 2WBMA 4UOCA 4DLEA 4KSEB 4ZCLA 2LYVA 1FEHA 5B0EA 1MXZA 3ISND 3HV1A 2DXDA 4OYPA 4DXCA 5DDQC 4RUHA 2E5JA 4O44B 2RDIA 1PEBA 3DDKA 5F0WA 2PMZD 2VKZG 4ZDMA 4O44A 4UOFA 3MPYA 3H3GA 3GYYA 4NXNJ 3ZZTA 3BBFA 4G6VB 3R6GB 1JMTA 2XXHA 2N7CA 3HHLD 4IYQA 1HSLA 2H1YA 2DCUB 4K50A 5HANA 3OV7A 2R8GA 1Q86T 2O51A 1B0PA 2EBEA 4WEPA 5CRYA 1UVIA 3CMAS 3VZHA 1ZJLA 3DC2A 3CDBA 1S12A 4K4XA 3G3JA 2HRTA 2OTJS 2QT7A 4MX6A 2HHWA 1AXQA 3ETMA 3FNNA 2C2KB 3F11A 1AROP 2ROEA 3JAMU 1WELA 1QAYA 3D28A 3A8IA 1LNQA 3KJVB 2C2MB 1N5YB 1FWLA 4IDKB 3PU5A 1C1CB 4IOCQ 1YJWS 3KJVA 1N5YA 3P4UB 4IDKA 1C1CA 1GMVA 4ZZAA 3D6HB 4QYZK 4CLPA 3HXMA 3BIHA 2A3JA 3TR5A 4X2BA 4USUA 3TAQA 1ZZNA 3V4MA 3EWGA 2EBGA 4RBVA 4NTLA 2H4YB 2BRLA 1XERA 4WYWA 1OQHA 4Q0CA 5I59B 1UW9A 5HK4A 5A8KB 4TQSA 2OAUA 2QL3A 1TFYA 3C8YA 5I59A 3RU0A 4FS1A 2CQBA 5A8KA 2WRMA 2Z56B 2AX0A 2D5WA 3AA8A 2HQFA 5D77A 4H4KA 2C2NA 1FX2A 3AB2B 3C33A 5IZ3B 4ZJOA 3HHKA 4PXEA 1TUVA 5IZ3A 3M6XA 4PTKA 1KOHA 2IM1A 1VBZA 3LF0A 1TK0A 1FBEA 4NX9A 1RA7A 1RZMA 2UVIA 4KFQA 3RBDA 3PFOA 3JV9A 4GWXA 1FRPA 4B9VA 3U02A 4JI3F 4IH6A 2FVQA 3OO7A 1RKMA 1NHUA 2VG5B 4FECA 4W4MA 2VG5A 2W4DA 3BKIB 3H06B 2MHEA 2RIJA 2EFOA 5H8FB 4LONB 2HEUA 5IWAJ 3VGUA 5DEXB 4DV4J 1P1NA 3WX4A 5H8FA 2EKNA 3BDPA 5K8MA 4DV5J 5BXIA 5DEXA 4N91A 3D0HE 4PE5B 4KC5A 3KOSA 3V5AA 2QA1A 4YR3A 4P0GA 4K0KF 1JXLA 2H48B 3WZ0A 3H98A 4L17A 1RK8A 2LA6A 1U49A 2BW2A 5E3RA 3V8XB 3R2DJ 3D66A 1FD8A 1N0VC 2B4VA 4UTGA 4CLUA 1MLAA 3HFVA 3HFZB 3UGWA 2R7RA 5DLGA 1DLOB 4Y2IA 4KQZA 1IBCB 4FEDA 3OMBA 3ENWA 4WE1B 1DLOA 4E98A 1UFKA 2BW7A 1YLXA 5LM7E 4WE1A 2G2YA 3TQEA 1MXYA 1T94A 2BBEA 2V2VA 4B08A 1YYZA 4OHWA 2UP1A 3TMGA 3MUQA 4QU6A 1NJIT 3SCIE 4X04A 2Z2LA 3S1TA 3R8YA 2WBBA 2HZKA 2QYGA 4YY3J 4O3RA 2P1SA 5B08A 4DUYJ 4ATNA 4U4XA 2MKHA 4K4YA 2YWGA 1TVRB 1U8WA 2M4MA 3K6VA 3N6MA 4WF9Q 1YK9A 1TVRA 2F40A 3IFAA 3R97A 4FJPA 5H8HB 3OL9A 4RLEA 2GHVC 3BPSP 5H8HA 1MROB 2MZQA 1C0UB 3IBFB 2XWVA 1MROA 1RT4B 3W63A 5C5JA 4CM2A 2WVFA 2KTQA 3QXMA 1KN6A 1C0UA 2JSXA 1RT4A 5F3ZA 2HFVA 1DTTB 3DYAB 4QW8A 4DPUA 3OL6A 2E44A 1NPPA 1NFTA 1DTTA 3DYAA 3AT1B 3U93A 5BR8J 1VIOA 1VLOA 2KM8B 3QRPA 5K2XA 1B46A 2M8DB 3KK2B 4EK2A 3UIFA 3GPAA 2H65B 3P8BB 3KK2A 3UCZP 2PT2A 1YHQS 3QZ7A 2HK3A 4ZEDA 3KNGA 3BSCA 4C8KA 1N5SA 1FPIA 1X4EA 2Y3YA 1RHRB 3G71S 2Z8QA 5DG9A 3M3LA 1EH3A 3VXCA 3C34A 1HNWF 1WDNA 4UZCA 3I31A 1HYSB 1XBWA 2CPZA 4RX6A 1JJ4A 1HYSA 5EQ7A 5E3PA 3TZYA 2FYIA 1A7GE 3H5UA 2PEBA 2ZC4A 4F2RA 1DARA 4TN2A 1O7TA 5ETMA 3Q24A 4CLWA 2ATLA 3K5MA 1SC4B 5IGAA 3QK6A 4EDPA 1ZMGA 5KFQA 1U45A 2F3DA 2GZOA 3JQKA 4RWWA 3Q26A 2NCKL 3K1PA 3G3FA 3RW7A 1NK6A 4LA9A 3D68A 2P9GA 3GLBA 5C24B 1TL4A 2DY1A 4NZ0A 3HCXA 7FD1A 1RTHB 1QUJA 5C24A 4X4OA 4ANEA 4J9KA 2DOJA 4O4GB 3E13X 2DDKA 1RTHA 5LOMA 4OZNA 1U8SA 2CJBA 1PBQA 2O68A 3VAGA 5EYGA 4ZVFA 4O4GA 2I6EA 1N52B 3SMZA 4IKAA 4JYAF 4USWA 2E1CA 4DV2F 5E33A 4N7TA 4LF5F 3BYRA 4LUBA 1IM4A 3KLIB 3SCJE 4GWUA 2V94A 3Q86A 3CVGA 4YR2A 1R9QA 1URSA 4NG7A 3KLIA 4KPTA 5LMUJ 1RCOB 2OEMA 4ZIWA 5B0DA 4NLVA 1B0HA 5TU0A 3W8PA 1X31C 3Q27A 1EZ9A 1FQCA 3C31A 3G3HA 4C98A 2XSJB 5ISUA 3IN5A 1XVYA 1MXVA 3G4SS 4FYWB 1RADB 1B5IA 1DTGA 3SEXA 3JZJA 1CJVB 2XSJA 2W1BA 2LMIA 1S7YA 3B8HA 4LF9J 4LFAJ 1CJVA 4JWXA 1U4BA 3NGKA 4IG0B 1M5OC 4IG0A 2O67A 4C8NA 1X4FA 3I4PA 2OKQA 5H9FJ 4P2XA 2GCFA 1VDWA 3J7Z5 1Z2LA 2I49A 2KFYA 1JLCB 1T02A 4NXMJ 1LCFA 2UUWA 4FXDA 1E6YB 4QFNA 4TQUQ 1JLCA 2QS2A 2Y5KA 1S0MA 4Q0BB 5DDOC 1E6YA 1PB7A 4Q0BA 3VCDA 4J37A 1ZOTA 2RMLA 4OXVA 4JI8F 3CF5Q 2Y7IA 4KGXB 2DR8A 1IVZA 4O3PA 3OOAA 4ILMA 3Q25A 5MLCV 1ZBTA 2KG1A 2XY6A 3G6ES 2UXDJ 4PKDB 1V3RA 3TP2A 3IA0A 3RY3A 4N4UA 3J81Y 2I2YA 4LT6A 3HX9A 2HBQB 2Q89A 2CZVC 2IA0A 1ZM3A 2YH0A 2XY5A 2V3UA 2CA9A 2FPHX 1M1GA 1XTZA 4U1ZA 3OXLA 2YNGB 5I3QA 1ZLQA 2RDJA 2YNGA 2Y7KA 1BC6A 4IH7A 3KOTA 3RPWA 3QAXA 2RAQA 2DE2A 3PHTA 1RBLA 4YZZA 2E5GA 1YZ0A 1JQFA 1S1VB 3D5MA 4AT1B 1WNEA 1S1VA 2CZLA 3W5ZA 3W62A 1KP6A 3BGFA 3AODA 1RDZA 2FVRA 2AJQA 2AEJA 2FGOA 2IA6A 1BHNA 1AYEA 4IRCA 1KR4A 1NZAA 4Z7CA 4MIJA 5KFGA 4XTCQ 2LDIA 3OHAA 3X1LB 2GQ1A 4Y2MA 2CNKB 1BLFA 4UW2A 3H2UB 3GJTB 2C2DA 2KZZA 3MEGB 1F3VA 1N48A 3QIPB 3MEGA 2K8GA 3DRRB 2J7KA 3T1HJ 1JP4A 4QU7A 3QIPA 3DRRA 2LEAA 3FCVA 4P9SA 1MMDA 2AQ4A 1IEJA 4DMZA 3HULA 4P52A 2MYFA 2OLWA 3MDFA 1N88A 1TAUA 2VJVA 2OCUA 4N47A 2O6AA 3QATA 2XXQA 3DLJA 4MIAA 3VAKA 1HHSA 4QFLA 2HFZA 3MUMP 3UD5A 1PJ6A 3TYTA 5IV4A 3OFFA 2F4VJ 1K1QA 1RT5B 2OMOA 1FF2A 4B3SJ 2DNNA 2J7WA 1UZDA 2AGPA 1RT5A 2Z2ZA 2WK4A 1LFWA 2DXEA 2P3NA 2Y0SD 1VQ9S 3OTDA 1MQJA 3AXFA 3UNYA 2CQDA 3QAEA 2BE2B 1CBKA 3NGUA 2PE8A 2YWWA 3CNQP 4KCDA 1ELOA 2BE2A 2FDNA 3VVFA 1HR0J 4ZPAA 1APSA 1QDUB 2XO6A 2J6UA 2HFNA 3M9NB 2VPXB 5GAEU 3UD4P 2UXCJ 2BUNA 3C15B 1NSPA 4ZLNA 3ILIA 5H8NB 3TW0A 3C15A 4NE4A 2NQPA 4PF8A 2A6MA 4JXIA 4DX5A 5H8NA 3SYZA 5KFPA 5KFXA 4J7CA 1AIVA 2P6SA 4I68A 3VDFA 4OJGA 2QYCA 3LAMA 1OYEA 1KKHA 2DHSA 1B4HA 4FBPA 3HSZA 1Y10A 2ZYOA 3DOLB 2OH2A 5AE4A 2F7BA 2CJAA 4K4UA 3MMJA 3MCOA 2HHUA 1BTJA 1A0OB 1Q35A 3DOLA 2Z57B 1KRPA 3OO9A 3QT8A 4OVSA 4H8IA 3LTOA 3H59A 1IZ1A 4NX1A 4OI1A 2XO7A 2ABYA 3MUTP 3ONMA 1M5PC 3HLUA 2ZZNA 2CQGA 3K5OA 1RHUB 3BPDA 4OQJA 4QRZA 3CCLS 2VG6B 2XX9A 1BWVA 4WTOB 5JMNA 2OWSA 2DGTA 4F4ZA 4PCQA 4OHNA 2VG6A 2DNLA 1TFWA 2ABHA 1IITA 1RISA 1GVCA 2YNIB 2ACMA 4NLOA 2ZH8A 3T5KA 2YNIA 2CZIA 1TL1B 3LP2B 4PR6A 2THIA 1IQZA 3BZQA 1NK4A 1IBKF 1TL1A 3LP2A 2IRYA 4LFBF 2HAUA 1N5TA 2BYCA 2DPIA 3AOAA 1J5EJ 5AE2A 3GFYA 2XZTB 4F3MA 1NK5A 3RB3A 1ZPWX 2V34A 1OY6A 1IMDA 1NL5A 4Y2CA 3NBPB 4NLYA 5HMWA 1IWAA 4R8UB 1QLNA 3NBPA 4P2FA 4NRTA 4L6V3 3P7IA 4R8UA 1DOTA 2FHMA 1I51B 4DDDA 1II5A 5DVJA 3MSTA 3W2WB 4RJVA 1R43A 3AQOA 1S4FA 2RCBA 3W2WA 1DURA 5ET7A 1QE1B 2FNCA 1HBUB 4ZS6A 1U1LA 4OZ5A 1QE1A 1HBUA 3OEMA 5IXUA 4BDNA 5ETTA 3SV3A 2IY5B 3NKYA 5C2CA 3I4HX 3DP8A 2K1RB 4F3OA 4ZHRB 4GKJJ 3H6VA 3CDEA 1GTKA 1POY1 1Q81T 2K1RA 4ZHRA 2ZVIA 4OENA 3E2EA 1JXVA 2NYHA 2LEPA 4DPXA 2HBYB 2KRBA 1YJ9S 1FTOA 3HJFA 3ILUB 1BQMB 1EYJA 2XMTA 3MOZA 2XWIA 1IUDA 1BQMA 2F5GA 2HNYB 3T9XB 3H0PA 4B02A 4IO7A 2ZM6J 2XQCA 2HNYA 4ZVUB 1S0OA 3CCUS 5KG0A 1KHVA 1YTVA 1T9TA 2UUBJ 1UTAA 1B2HA 4M5GA 3QZ8A 2B4UA 4JI1J 3UN6A 1S59A 3M1VB 4ED8A 3VLWA 2FIUA 4ZVPB 1B3GA 3M1VA 4KGKA 4TKTA 4CNYA 5LMNJ 3Q2TC 3V89B 3DU5A 1SYIA 1Y7PA 3V6KA 1RWKB 4YR0A 5KFDA 4DV7J 5D8HB 1HQEB 2FZCB 2QMWA 5E2QA 4YB7A 4CQ1A 5MAOA 3GFXA 3CCZA 3CG3A 1HQEA 1MN9A 4BDPA 1B0LA 3FMBA 2HHMA 4ZECA 3OD7A 4PETA 3G7WA 4LRAA 1JVXA 4ZVGA 1VDHA 3OJUA 1M5FA 2VPOA 1YAEA 2E9TA 4HCYA 3QJJA 4QXDA 3FBFA 2XMKA 3MYUA 2BABA 3PEJA 1A55A 3PUVE 2AEMA 3KK1B 3AXKA 2VQEJ 2RUSA 2HRYA 3W7BA 3Q8SB 3KK1A 2MKIA 4LF4F 4LQ5A 3L7OA 4PFRA 3L6GA 1WC5A 3M3KA 4DLDA 1LKZA 1B64A 3ZZRA 3I56S 2FHJD 4NOHA 2BOPA 1NMUA 1PAEX 3DHWC 3I5AA 5B0AA 3OTCA 2QLJB 4W92B 4G8NA 3HVWA 1R27B 4FN5A 2DGQA 4XDCA 1QKBA 2RRAA 2XEXA 4ZIVA 3GIIA 3NG8A 3QGHA 2F5XA 5RUBA 4WJBA 3AOCA 3GU0A 1KQFB 3TKDA 2M88A 2CPFA 3FK4A 2RHQB 1IBLF 2Z8DA 4PBHA 2ZEJA 2IJFA 3H03A 4LSNB 3UA8A 4C3KA 1TWYA 1FTAA 3I3VA 2PA8D 2MQQA 4LSNA 1KZ8A 3MM8B 2ASJA 1V3SA 1CPZA 5F8MA 3MM8A 1FK9B 2HHQA 5I3UB 1NO8A 3I5OA 1FK9A 1KOOA 1B99A 3AD9C 5I3UA 3WIVA 3S9MC 4WIIA 4DEZA 3OELA 4P10A 3PEHA 2DH7A 1S50A 2DT9A 1V3ZA 1SJ4P 1YTYA 4CO5A 4NWBA 2VBZA 4ZJLA 4K4VA 2VPWB 3PUXE 2QRYA 1V6HA 2ZOMA 2FIEA 5KFNA 1TTHB 4KYZA 4LIRA 4IO2A 1M5DA 1UQWA 3OO8A 1VQ5S 3SSRA 3OLBA 4MK9A 4F0HA 4CLFA 4MYTA 1ZS6A 3HO7A 1TUGB 3J7A1 2QFLA 3HT3A 4A8WA 4L75A 1H7XA 2HHVA 1WDTA 1F9FA 5CA5A 3KG2A 1CJTB 3N4WA 3PPNA 1RT6B 1NM2A 2WVBA 2GHWA 1CJTA 2HW3A 5EYFA 3KK3B 1RT6A 1EZOA 3S6EA 2R7SA 1FD2A 1RCXB 3KK3A 4ECFA 3O6HA 4JSOA 2HGLA 2XMVA 2DWHA 4ANCA 2B9WA 3VGVA 3K4UA 1GH8A 1NUEA 4B9NA 5IQQA 4DHVA 3J7AN 2OTLS 4DV0F 3R1LA 4I6AA 1MQHA 4EEYA 2XXKA 2OELA 3GZ7A 4PAFA 3NS7B 1LWEB 1IJEB 4DR1J 1P1UA 1RDYA 2CPJA 1L5TA 2JVRA 2M0GB 1FDDA 4AB6A 1LWEA 4ITSA 5ETKA 4XO0A 2H4WB 3CPWR 2V3QA 4LF6F 4EBCA 2HURA 4PBQA 4OZ0A 1K9ZA 1KQSR 2MQNA 1IJFB 3UVJB 2D9PA 3O29A 4GXSB 1X4AA 3UVJA 4UY8T 2DHHA 4BC7A 3QGPA 4QWDA 3A8JA 2XHDA 3ILTB 2DCLA 2JEGA 1MH4A 4P8BA 2KVQE 1NK7A 4Q44A 5L9OA 3K17A 3D1QA 4DR5J 3OSNA 2V25A 4OTEA 3C19A 2F8DA 1NKBA 4JV5J 5L38A 1U1PA 2GJ2A 5A5XB 2QLXA 1Y1MA 3OFGA 5A5XA 4EQ7A 2PI5A 3D0IE 4MIWA 4J9SA 1Y5LB 2J9DA 2FLPA 3EXYA 4HI2A 2DGOA 1UVJA 3WQPA 4PP0A 3A12A 4JV2A 2NLWA 1UMJA 1D0EA 1Y3KA 2KT2A 1CE2A 4RJZA 2VUGA 2WBRA 3DRPB 2H99A 4CNZA 3DOKB 3HVAA 3C2PA 3DRPA 2U1AA 1GXUA 5LXRA 4M1KA 3DOKA 2YQ0A 4NAPA 3FBBA 4X66J 4X65F 2CG8A 3GG0A 2CQCA 1KQKA 2CJKA 2IBOA 2ZVSA 1D1UA 4F3BA 5ETNA 3OXFA 2H25A 3PX0A 4YOEA 5E3AA 4NYPA 4JVIA 2KXNB 3RR8A 4DR6F 3D6MB 4USKA 2ONRA 2D9OA 4MH5A 1DMBA 4QFOA 2DR6A 4OX8A 1WTBA 3VLVA 1Q7YT 2X7QA 3RTVA 4YKKA 3I87A 3KKFA 2L3MA 2LAOA 3T41A 2NSBA 4WKRA 1Q78A 1Z7ME 5A2QU 2PFFB 5A5LA 4ZP9A 2BQUA 2XNQA 4IO4A 3QT7A 4IR9A 3OL8A 3OSPA 1HFEL 1U47A 3KFMA 4MKBA 5HVGA 2IBKA 4WKYA 1SJQA 4HT7A 4QIVA 5KAKA 1TP7A 1XQIA 3T5LA 3ZZYA 4N6KA 3OQ2A 4P73A 2E5IA 4QCLA 1B0VA 1EYKA 3FQKA 3KOAA 3M30B 5JVHQ 4PQJA 3KYLA 2Y1IA 8ATCB 2DR9A 2HS3A 1H43A 4WWSA 3M30A 5HQMA 3THTA 3X3UA 4O23A 2MLXA 1VFDA 2X3GA 3THVA 1MW7A 1XC1A 1JNRB 4CRJA 1GMWD 3U1NA 4GWSA 2IA4A 1Y5NB 1FJ7A 2V68A 3TANA 4F1YA 3H20A 2M8CA 3MW0A 3MR3A 1V5IB 3PJWA 1UEVA 2H5IB 1XMQJ 4G61A 2W2QP 4GC7A 4OETA 1CC8A 2UU9F 4OV6A 1QSYA 3CSBA 5GAGI 1YI2S 5LXYA 3FASA 3WX8A 1Y1ZA 3FVGA 1VC0A 3CE8A 4WIQA 4Q43A 3IORA 1RLCL 1BE4A 5I4MA 4DR4F 4DL3A 3OBIA 2L9DA 1DZ5A 2YPNA 2DRBA 4DQPA 4HACB 2LQBA 3HSJA 4PAAA 1CQNA 4PFTA 3IAM9 3S4UA 1EIYB 4QF9A 1TXFA 1QTMA 4HACA 2EC0A 4C8YA 3PZPA 5ITPA 2CJYB 3QAUA 1D09B 4TOZA 4W90B 2ZD1B 3DGPB 1WKKA 1VQ7S 2FBPA 2ZD1A 1NK8A 2VODA 2GA7A 4DI3D 3DGPA 3PD9A 3IJXB 2POKA 4FORA 3CJ4A 1EZPA 2B7BB 4XFEA 4ZP6A 1GT8A 4P72A 5EDWA 2Y7WA 4R75A 4GWWA 3BDEA 2PC6A 4U9RA 1I94F 2V5HG 5LL6d 3ZNUA 4FP9A 3EVMA 2JH3A 1FNMA 4LZ5A 5ELVA 3HHNB 4MFIA 3Q22A 5DTBA 4F18A 4LZ7A 1UP1A 3T6BA 3TEGA 2ZHOA 3JXOA 2F78A 3R27A 2D41A 2G0JA 1JWWA 2V69A 2VU5A 3U94A 3CJ3A 2QA4G 3KG0A 5DT6A 4N77A 2DNYA 3DLNA 4F04B 3O3LA 4MAKA 2QX0A 1REGX 4BDLA 5DZ6A 2DJWA 2ZBQA 4MKVA 4H54A 4R74A 2JC0A 3TOQA 1R8PA 4YB1P 2G1DA 1IXKA 2ZH7A 3SEYA 4EYIB 3PUYE 4NLGA 2FJEB 4USIA 4GWYA 1U24A 4I0WA 3PMWA 2COLA 4B3MJ 5F7VA 4B9UA 3JSYA 4J90A 2HZLA 4KY3A 5BYQA 3ZNJ1 3SEUA 1B51A 2QL5B 2JC1A 1KNZA 4H4MB 2QO3A 4MHFA 1H98A 1JLBB 2XXIA 1YRTA 4H4MA 4ZA1A 1NH8A 1JLBA 3FATA 2NXJA 2W7OA 2LKZA 3K01A 2AT1B 1LFPA 2UXBF 2FUG9 2VZ9A 4KYEA 5CBSA 5J2PB 2ASDA 1B0TA 3DLKB 5J2PA 3LUZA 4ZEIA 3MGJA 2YPYA 3DLKA 1CEZA 1W25A 4J9MA 4LF7J 3E3XA 3T5JA 3HK2A 4EF2A 4ZDNA 5DQGA 4DL7A 1FKOB 5DO2A 3DOMB 4YFUA 1N0UA 1TFDA 3Q29A 2G0CA 3KLHB 1EETB 1FKOA 3KHGA 5H1SV 3DOMA 2A6OA 3KLHA 1EETA 4O3BA 3CD5A 5HATA 4E8UA 2CWKA 1F3FA 4PC9A 1UEUA 2OLBA 5JVGQ 3RTFB 4QIGA 4Y0FA 2C3YA 2AHOB 2Y0BB 4I2QB 3F41A 1FPJA 4I2QA 5KFOA 3JS9A 4LMZA 1NHKL 1NI9A 3NGTA 2OD6A 3ISZA 2I3WA 1LLSA 3G2XA 4PDHA 4NCAA 1YXIA 4FF4A 1VIXA 3RG6A 5IWAF 1NK0A 3V6JA 2AP6A 4CLZA 4CLSA 2ASLA 4N6PA 4DN0A 1K73T 1I3OB 2MMYA 3CT9A 3NY0A 4V1Ak 2OJTA 5HVFA 4PPZA 1FRXA 2GMHA 2V8VA 3MECB 2V3TA 1AH5A 1K44A 2RQKA 4YAHX 3N28A 3MECA 3D4GA 5EQ8A 3EICA 2IAJB 3BO3A 3IB2A 2W8KA 1B5JA 1FTJA 2IAJA 1SKSA 1X9MA 2DKOB 2R2TA 4J9VA 2O66A 1KTVA 1NPKA 1HHTP 1NDCA 4ED6A 3TARA 1WUUA 1FCKA 3K2YA 4AD6A 4MNPA 1PKUA 1RWVB 4EI2A 3G82B 1FJEB 2PD1A 2YY3A 3G82A 4F4XA 1PBPA 1KA1A 1G4CA 3P45B 3M8RA 5K9FA 3K8WA 1RTDB 3CXCR 1VI7A 1HWJA 2CQIA 1RTDA 3QGIA 1GQEA 3C6TB 2NOOA 4NWCA 4QW9A 4GL8A 3C6TA 4LF1A 1EP4B 4NHBA 3J7YI 4HS7A 1VK3A 4HHHA 3IX1A 2HFBA 3HHGA 4YY3F 1EP4A 2ZXTA 4IB2A 2P9EA 4DUYF 2CWXA 3OVBA 2NXEA 1LOUA 1T8EA 1FQEA 3IO4A 4XTTA 1X4GA 3CFZA 1RYSA 5D4OA 2W2NP 4A8KA 2JLEA 3IGNA 2UUAF 1JNFA 3RAQA 1Y0HA 3MZ1A 4AL7A 1T05B 2QMUB 2AMCB 3K58A 1T05A 1HW8A 2KL8A 2LU2A 4IQXA 1R6YA 1OY9A 1T9XA 3SESA 1Y4CA 3H4DA 1HNZJ 5GMDA 2WVCA 5BR8F 4RNOA 2HXRA 1UTHB 4N81A 3HPIA 4YMBA 4OFLA 2MY7A 4WBFA 1UTHA 1WF0A 4GFRA 1VRTB 2E5LF 3TYHA 1WF1A 4ES1A 3KLGB 1INPA 5F8HA 1VRTA 2W2OP 1B58A 2YH1A 3KLGA 4B3RJ 4U96A 5FTHA 3ZZOA 5HMXA 3ZZZA 1QD1A 4DR2J 4TLLB 3EZUA 1RLDA 5KFSA 1RJJA 1H0HB 4TU9A 3N94A 4HTGA 3B6WA 2UVRA 2QA2A 3KC1A 2QA4S 1XK8A 4RBUA 3Q8RB 2RC8A 3UCGA 1VR6A 3PUZE 2XWXA 5CABA 1SJ1A 1ZA2B 4IO5A 3AFGA 1UFLA 3D7SB 4KGVB 2QFIA 3UE2A 3M6VA 2NUHA 5JK4A 1G7CB 2C2ZB 4LRBA 3RB6A 3K02A 1DFDA 2QE5A 1WACA 1D8ZA 3G87A 3MPUB 1UJ6A 3MQ9A 3G3GA 1TUWA 3CJQA 1KONA 3T9VA 5J2QB 1B3LA 5J2QA 1FTMA 3HP6A 1DPEA 2PI4A 3EPEA 4Y65A 3FZBA 2RC7A 2YWHA 2XGQA 4OV1A 5IOLA 3WAFA 1HBOB 1U1MA 2C42A 3CJKB 3W9JA 4KFBB 4F3SA 1HBOA 3GBBA 1PB9A 3CJKA 5D0RA 4KFBA 4ZCIA 2ILZA 1GAOA 1M0SA 2M52A 4P0IA 4ZS9A 2DS9A 1S6OA 5A0YB 2VFSA 2R71A 5H8SA 2XSFA 1O63A 3EM1A 1KC8T 5A0YA 2X1AA 1Z4UA 1SV5B 1OSDA 3NCQA 3CDUA 3LANA 1Y4TA 3TQLA 1SV5A 4KCCA 2HLUA 4DI4B 5LMUF 2CUYA 1Y3QA 5ICTA 3HF5A 2W9CB 2YKAA 4DQRA 2W9CA 2GX8A 5D78A 1JJ2R 4RPOA 3H6TA 4TNOA 3S7RA 3KG1A 2XI2A 2JX2A 1VQLS 1D9FA 2NR0A 3PV0E 3EPIA 4LFAF 5DLFA 2OI2A 1ZETA 2F6PA 3QYTA 4RW7B 3LR1A 2XY7A 1UL3A 1LXNA 2HHHJ 4RW7A 3PTWA 4KXPA 2Y8YA 1NV6A 1FRIA 5EQAA 2WB1D 5TPAB 2FJVA 3P5BP 4G1PA 2WVEA 2IDEA 5TPAA 4G3IA 2W7AA 2I0CA 2Y1JA 1FW0A 3NL0A 1MNEA 2GIQA 4U8VA 2P9CA 5EHHA 3NP5A 2HAVA 5A6WA 3M6UA 2MZSA 2C3OA 5IKBA 3SEWA 3MBPA 4KAIA 2ZDOA 2ZNUA 3RYDA 1WG4A 3Q83A 3SFUA 3J81U 2A5SA 3ILJA 4I8CA 4ZEBA 2XMMA 5T41A 2E66A 3FV1A 4PG5A 3SDEB 5ETVA 1TL5A 1FPEA 2ROGA 1G6BA 4DSLA 3SDEA 4CH7A 1P27B 2W7YA 2F1FA 2DK2A 4R6KA 1CC7A 2P2CB 2PBWA 2R8TA 2DHXA 2O01C 1Z7NE 2WONB 3G8QA 2I6WA 4M5DB 4DFMA 2YJPA 2NUUG 5M2VA 2QTWA 2WONA 4M5DA 4MAGA 3JYTB 1FE0A 2NZ4A 2HVIA 1VISA 2XNRA 3K5PA 4PYAA 2ZHBA 3JYTA 3OT9A 4DR7J 3GG1A 2UV8A 3WIUA 3RBZA 2QL7B 2VH7A 2I48A 5LT5A 1XWLA 4HTIA 4K59A 2G4BA 2FVSA 1T03B 3DLHA 4L3NA 4JDFA 3ZTOA 2F35A 4QR0A 4WEDA 2V8PA 4HDHA 3CVKA 3QSLA 2QLWA 1T03A 5KT5A 4O3AA 2I5JB 1WEXA 3HHEA 1N0TA 4NQ8A 3OJSA 1RKIA 2W25A 3Q8QB 1LBCA 2I5JA 3IO6A 4PFWA 4YKIA 3SKPA 4N17A 3RYLA 4F22A 5CAAA 2DO4A 2DHGA 5L8DA 1TK8A 1AFJA 1MQGA 4ZP8A 4H45A 2F8MA 1X8DA 1Y20A 4GD5A 2GO9A 3NMRA 1IKXB 1IIWA 1RWMB 1AUDA 1IKXA 3CC4S 1TL7B 3KG4A 2CDRB 3VVUA 3S8SA 3M2RB 3ZFVA 1TL7A 1RAGB 4KRWA 4MBPA 3DLEA 2DH9A 1T7PA 2IYIA 3M2RA 3PMXA 4AUKA 5TP9B 1QUIA 2VT5A 3M05A 5B0FA 2FC8A 3W9IA 3DLGB 1IKWB 5TP9A 1S4EA 3I9V9 5A76A 4X8RA 3DLGA 3HD1A 1IKWA 5GAEI 1UW4A 1RT3B 3T3FA 2MPUA 3KTQA 2RU9A 1RT3A 5GVQA 4PCDA 4PGNA 4O3NA 1U1KA 3QPIA 4LSZB 4QWEA 2CG4A 2F4VF 2KB2A 2K7KA 3G9CA 2OJ3A 2QV6A 1XI6A 4LBIA 2XULA 2AGQA 2CRLA 3MHYA 2HNZB 2ZBRA 2PFYA 3CFXA 5AJ3J 2HNZA 1OJ4A 4AB5A 1L3VA 2IVMA 4RNSA 5B0BA 1PGZA 3MUVP 1SB6A 2XLKA 2ZH1A 4RA1A 2R8KA 1JJHA 4JI4F 2B4PA 2XM3A 4PUOB 1NHVA 4WXWA 1HR0F 2DEJA 5EUHA 1D8YA 4OX9J 4PUOA 4JVDA 2DNMA 1URGA 2RS2A 1S9TA 4UY85 1SC1B 1OS5A 2UXCF 4C1TA 1RDXA 3NCPA 2DXRA 4ELRA 3H8YA 5CYMB 1RU2A 1DTQB 1R8BA 2MKZA 4G68C 2H5EA 4TU8A 2XLIA 5CYMA 2HPUA 1EZZB 5JXSA 1DTQA 3L7UA 1QULA 2RH3A 4DV3J 4BS2A 1VFEA 1S76D 1ELJA 3GYXB 1G3OA 2LP4A 3T9ZA 2B8QA 4PG8A 4CTAB 1TT1A 4ETXA 4CTAA 3PRDA 4V19J 5F9NA 1UJ4A 2HXWA 3T66A 4Q8FA 1UVMA 1S77D 3MURP 2HZVA 2CQ3A 4P6QA 4GLIA 2GFEA 4TY9A 2AYMA 3CGIA 3SFGA 2O84X 2GMLA 2D74B 4CI0B 1OQ3A 1Y3PA 1FNOA 3NWRA 2CJXB 2RUGA 1RWPB 4KPCA 4OL8A 5D0GA 2XD3A 3KDNA 2VG7B 1JK9B 4ECTA 1SDXA 1MU2B 4JI2J 1VLYA 2MKSA 2E1SA 3C16B 2CAJA 1MU2A 5L1IA 4IGRA 2ZNYA 3C16A 4Y34A 1J5EF 2F7AA 4N8OA 5H9EJ 2XXVA 4KI0E 1NV5A 4KTQA 1B32A 1BY9A 2QMXA 3VTIA 4QSCA 4HXVA 4F26A 3KLVA 2ZYKA 2FVZA 4DXBA 2IVYA 3EUNA 5M2UA 3I55S 1AWBA 1RABB 2PSZA 2ZZWA 1C2PA 3MC2A 4NPOA 2AYBA 2BDPA 1R7IA 4NN3A 4URQU 5I3SA 2PVUA 4MJOA 4FNIA 2DR5A 4C9DA 4B3TF 3A3OB 4JI3J 3RW6A 1OQ6A 4EBDA 2ADCA 3NMAA 4RK2A 1X4CA 3PD8A 2E29A 3K59A 4ND9A 4ELQA 1A8EA 1URNA 2J0QD 1FERA 1ZAWA 6FD1A 2V8DA 4FYYB 1IMEA 4KR5A 3U65A 4BCAA 5B7WA 1WHYA 1NKXA 4KH0B 3MCMA 3BSNA 2ZM6F 3BFTA 2DVCA 2R3VA 2AJ4A 2XA5A 3V4IB 3B82A 4JI1F 1Y3NA 3V4IA 4C0BA 2AZ1A 2BM1A 1S1UB 2C28A 3C4MA 4U21A 3HKWA 1KEKA 2X7PA 3JSMB 1S1UA 2RSQA 1RB0A 5EHSA 5LMNF 2HVDA 3RRKA 2VFTA 3JSMA 1H7WA 4QHQA 3TJAA 2ZH5A 4DV7F 2GFFA 2VD3A 4IY5A 1GXLA 4I62A 3RRHA 5D4PA 4DZ6A 3OFHA 5EX0A 4WFNQ 4RPNA 4ECXA 1P6TA 4POWA 5CD4A 1RAOA 2HLTA 4CO3A 4EXLA 3PXGa 4QIWD 1U2RA 4ZJQA 1JXEA 3MD1A 4YN3B 1LFHA 2QVVA 4LVOP 4I67A 3OO6A 2CIMA 1DQAA 1RHKB 3MAAB 4DSFA 3ZKLA 2RNEA 3BS9A 3MAAA 2A0FB 4ZPCA 3EGZA 1OQGA 3UDLA 3EF7A 1OSCA 2RD5C 3A3NB 1O8BA 4TY8B 2DGVA 4WU3A 2PYYA 2UVHA 1WC3A 4GBVA 4TY8A 2OWZA 3IRWP 2QPQA 3MVZA 3MCSA 4FF1A 1W2IA 4H1XA 4XPEA 1VBKA 2Q66A 2Z22A 2DVZA 5AXMA 4OQOA 4PZVA 2Q9TA 3FJGA 3M32B 2W2MP 3GJRB 2BJ3A 2K3IA 3M32A 2RVJA 3POTB 2GW8A 3MM7B 1JLGB 4GIZA 2OSRA 2HK2A 3POTA 1QVFR 1FFGB 5DG8A 2WYKA 3MM7A 3ZZPA 1JLGA 3TQ1A 3OPKA 1A40A 1SL2A 2A5TB 2FHOB 5K8PA 4QIFA 2YKPA 1SPIA 4X4RA 4OWDA 4DL2A 2XXTA 3CCQS 2A5TA 4RO0A 1OYDA 4OYXA 4DOZA 2NZCA 4ZVRB 4X64J 2QN6B 8RUCA 1KS2A 1IKYB 1SBRA 2ZH9A 4GMKA 1BQNB 4WYLA 1IKYA 1QAIA 5JTYB 3VF0B 3UD3P 2VHAA 1BQNA 5K14B 5H8QB 4XKQA 4MKAA 5JTYA 4M95A 3PO4A 4IY6A 3UK4A 4ECWA 5K14A 1VC5A 1FPKA 4JWYA 5H8QA 1D3WA 3I0SB 2A2CA 1NJYA 4ZVOB 7FDRA 3IXQA 1WHXA 3I0SA 5I2NB 4OERA 5HVHA 4C6AA 2PMWA 4OLPA 5I2NA 2EFVA 2DNKA 3CO0P 3HHLC 1B1HA 2V4RA 1CNQA 6AT1B 1P1QA 3DI6B 3TJ8A 3DXBA 1B5HA 3UNGC 4K5RA 3DI6A 4ENOA 4CO1A 1F60B 3G86A 1BGXT 1DRZA 1D9VA 4JP8A 3EQ1A 2VGQA 3I6PA 2AJ0A 2DIUA 3WBZA 1LB8A 4X48A 5JJBA 1F2HA 3D1RA 1T95A 4A8MP 2ZH3A 5THWA 2W4PA 4NASA 4IR1A 5GAGU 4DCJB 2HFSA 2V2KA 4DS4A 1RAJA 2QS1A 4X62J 1HWKA 4KHRA 3PFEA 4HHUA 2BJ9A 4OJ3A 3GYNA 1IQTA 2QEXS 2PMSA 2DGXA 4PG6A 1UA1A 1XOCA 3G8TA 4KYSA 1NSQA 1RTIB 4DR1F 1JKHB 4ZK7M 3D6FB 2RQ4A 1RUSA 1RTIA 1JKHA 1H38A 1HI0P 3QWPA 4Z2XA 5L9SA 1R0BG 2BJEA 1N56A 3D54A 3IFCA 1ICEB 2YWKA 3GFZA 4DCPB 5CMMA 4EO8A 2IEEA 5ITHA 4OYWA 1SJ3P 1R31A 1FBCA 3VQTA 2BJ7A 3UN5A 1LQ9A 3US5A 4ECVA 3DP4A 3KJ7A 4Q5TA 1RAEB 4F2OA 2Q79A 1H2VZ 3BV8A 4C11B 4YQWA 4DN9A 1YKWA 3TAMB 1S1WB 4DR5F 4YS2A 3Q89A 2C3UA 4C11A 2XZWA 5IZ1A 3TAMA 1S1WA 4JV5F 2CQ1A 4MK7A 3U1MA 3LGHA 4RW8B 3QSIA 4RW8A 2GJFA 1JLEA 4DWIA 3Q23A 3PIPQ 5EN1A 3UP9A 2YQ3A 1X5TA 4JI8J 2UVWA 1GNKA 4Y2KA 4USMA 1QAJA 4C8MA 2RINA 2DNZA 1S1XB 3DM0A 1TKZB 2G1HA 5E7OB 1IKVB 2K06A 3RAMA 1S1XA 3B6QA 3MOJB 2NYIA 4DCYA 1P8GA 1TKZA 4O3OA 1IKVA 3T1AA 2UVVA 1A99A 1U0SA 1QUVA 3MAMA 4UOHA 4EMDA 4N8NA 4WK3A 4L73A 3IOUA 1TU0B 2F97A 2X7IA 5HJYA 2XWKA 4U67Q 4P1LA 3OTEA 3AA9A 2ROPA 3PR5B 4YEAA 5EYHA 4OMBA 1JIHA 1HLWA 2FJDB 3MMBB 1AL3A 3HO1A 3MMBA 2F6GA 3M8SA 4OZLA 4C4WA 3TCHA 3TUJC 1XNQF 3BF4A 2C1EB 3FKBA 1I6JA 4XK8C 2E1RA 1RWXB 1N04A 2NS1B 2KQZA 4OVTA 4F4KA 4OZ9A 5D4NA 3IR6B 3V5RA 3PACA 4Z37A 2VJUA 1SQFA 3FSYA 2HQ3A 2CZ9A 3EDRB 1R8AA 2HYIB 4PWUA 4F67A 5BYSA 1SI1A 3OVAA 1Z1ZA 2CMOA 3VAHA 3QSYB 4F1UA 3EX7B 3L3CA 2FLLA 4Z7EA 3QIDA 3WAEA 2KN4A 4R5PB 3PPOA 1SI0A 4XDDA 4ZITA 4GKKJ 4DXUA 4YB6A 2Y7RA 4R5PA 2EXUA 5DYHA 2ZDPA 1LK7A 1X9SA 3U27A 1P9YA 3N01A 2FJWA 2Q8MA 2KFZA 3GBAA 2HBRB 1XMQF 4MEVA 1FXLA 1XNRJ 1N34F 2IYGA 2ZNZA 1TMMA 3ZTPA 4OI3A 3BIGA 1TZ0A 4DX7A 2VOPA 4FS2A 1IN0A 2GQQA 4CLTA 4O7IA 3GFHA 5KOWA 3FEZA 2X51A 3BGUA 3RGYA 3TFLA 3OR2B 4NZ7A 4DL6A 1Y00A 1HBNB 3OR2A 3A09A 4PRFA 1HBNA 4M5KA 2RRBA 2XTJP 3MEKA 1CJUB 4LIWA 1Q16B 2PN6A 1CJUA 2FVCA 5JEIA 4KD5A 4Q2LA 5E3QA 3MP8A 2MJNA 4ZVEA 4DL4A 1BXNA 4ZOSA 4BDQA 5FDLB 5BUUA 2N82B 3OUYB 2RKMA 1UEKA 3C6UB 2IM3A 3N6LA 5FDLA 3KXDA 3OUYA 3Q8VA 2OEKA 1UAWA 1UPPA 3C6UA 1M5VC 5DVFA 2F7VA 4ICLB 2GMJA 1OVBA 3PYEA 4Z7YA 4ICLA 3HCQA 4FIMA 2R7WA 3ROJA 2D7SA 4F2SA 2VP1A 2WW4A 4ZVQB 1AW0A 3PRBA 2JLFA 1BMQB 1M5SA 3J7YU 2GHAA 3GV8B 4O94A 2QC3A 4OZ2A 4ZPWR 3CCSS 5FHMA 1IR1A 4PYDA 2RILA 1NK9A 2LLZA 1H3DA 3AH6A 5CCMA 2JLGA 2RDDA 4ED3A 1FVQA 5E5NA 5HO4A 4QFPA 3HZGA 4HTJA 3VGTA 1AUSL 1N5VA 1NJZA 1HSJA 1OO0B 3A3PB 1FBFA 3FJMA 4F7VA 3P6YC 2E9RX 2FD2A 3TCFA 2E9ZA 1RA6A 5GAHI 4H8JA 3KGCA 3OD2A 2ZJPQ 2R7UA 3PW4A 3PVXA 3BR8A 3DKDA 4XIGQ 5M2PA 1MPCA 2VICA 2H9BA 2EFGA 4YHHF 2Q1LA 2REGA 2V67A 1US5A 2ZZMA 2DISA 3KWMA 3CI8A 1U02A 1RACB 4JB8B 1HWUA 1N6QB 4KGZB 3R5BA 4AFFA 4HDGA 1N6QA 3M8WA 4XXUA 1HNXJ 5LSOA 2XG8A 2YNFB 3HSDA 3CCRS 3DCAA 4FXWA 2RF2B 2YNFA 2AZ3A 3IWXA 2RF2A 2FZKB 1NMEB 4WXJA 4C1UA 4FBUA 2R4FA 3IBCB 1WD6A 1HD1A 1O64A 1BK4A 1RWWB 3FVYA 5L9MA 3N9UC 3Q2SC 4HR2A 2D3O1 4EF1A 4LF7F 5F24A 3IS9B 1CB6A 3SV4A 4F02A 1Q5VA 4H5FA 2W24A 3IS9A 5HAOA 4BHQA 5IT0A 4AE5A 3W8GA 4TXSA 1M1KT 3M9MB 1SKUB 2R2RA 5B70A 3JSBA 5HM4B 3ETOA 1SW5A 2I3VA 4RR5A 5KFMA 2DTJA 3GR1A 4Q45A 5IM0B 3EGWB 1IBMF 4JV1A 2OX3A 2WYPA 5ICQA 1CLFA 2FJBB 2GAGC 3PV8A 5IM0A 3O5TB 1B4SA 4OI4A 3TZAA 4ZCMA 4CP5A 3M4XA 5KFWA 3NCRA 4IG3B 5HMZA 2OK2A 1S5ZA 2B0GA 4LQ2A 2FYXA 4IG3A 2Q74A 2HSEB 3LSFB 1X7VA 2Q2CA 3FZ2A 4KPYA 1I6QA 1P1LA 4O4RA 2DE4A 4MNIA 1WI8A 1U0HB 1Q8LA 5KFBA 1M5CA 2BJIA 1ZPVA 3R7BB 3AOBA 1U0HA 4JI6J 2ZFHA 2K2PA 4KH1B 1NSAA 1U48A 4JB7A 2DR7A 1LFIA 4DUZF 2AYSA 4JOUA 4DJBA 4M5JA 3M8UA 1S10A 2EFNA 2OPPB 3W9WA 4W98A 2OPPA 2CPHA 2CPIA 1S9EB 5IAIA 2WB4A 1RT7B 4M5LA 3NGRA 4UUWA 5BJRA 4R73A 3AD7C 1UIUA 4KHPJ 2XGPA 4HI1A 1S9EA 3N26A 4WFAQ 1RT7A 4N56A 2LXUA 5J16A 3C3LA 3CG1A 2OUGA 2EVZA 5LSLA 3OTOJ 4ISUA 3RBXA 2VIHA 5DDRC 1LCTA 1LW2B 2MSSA 4LSLB 2V9WA 3FDSA 1H6KX 1LW2A 2DWIA 2J0SD 5CHCB 4LSLA 3R9LA 3U92A 3UW1A 4R0JA 2JHEA 3FCWA 4ZEFA 2NXOA 3KMQA 1S49A 2VHGA 3TTMA 2UYEA 2B6AB 4FKYA 4H4KC 1FI4A 3C9HA 1FRKA 2B6AA 4ZVHA 2BVZA 2M3DA 2YTCA 3FC9A 1J1NA 3MZ9A 4ZMMA 3BQ1A 1IXIA 4A8SA 1RAIB 4MLVA 1WORA 4GVBB 5ET8A 1IBLJ 4DXLA 2Y9HA 2CNLB 2KT5A 1M5HA 4GVBA 1VRUB 3FZVA 2MDAA 4ANDA 1SYHA 1T9YA 1NJXA 2AL4A 1VRUA 2CQHA 3HJVA 2LEBA 3M6WA 3EVOA 1HNZF 5FIIA 1FRLA 3R6UA 2VQFJ 3G6XA 1N4LA 2Y5LA 2AYGA 4CZCA 3K2DA 3BB5A 3QFWA 1A8FA 2B8PA 3LAKA 1S9FA 1IMFA 2OEJA 1N32J 3CD6S 1VSOA 1SKWA 1HNVB 5SUHA 4DR2F 3N79A 3W5YA 1HNVA 2FHYA 3BGOP 3CJ0A 3TUZC 2B3FA 3PDNA 4ED5A 5CMCA 2V6AA 5KG6A 1R8HA 4O0IA 4F1VA 2HS4A 4J9LA 4TLRA 1S99A 2DO0A 2CJQA 1V5VA 1MMLA 2OD4A 2DSFA 4C0RA 2HCAA 1SH3A 3MR6A 2QJ3A 3RRGA 1ZM2A 5HROB 4Z0IA 5GMEA 4MCOA 5HROA 2VDHA 3BEGB 3I32A 2FC9A 3BBRA 2Z58B 3K0JA 1QUPA 2N4CA 4HW8A 4ETZA 1YJVA 1PJ5A 1LEOA 3BH6B 2Y1LB 4UQGA 1XMOJ 1FX4A 1USYE 2KDOA 1L3UA 3KBRA 1YRXA 1LBXA 2XMWA 2E5HA 1QJHA 4YDDB 3VVDA 2BE9B 3TA0A 1FBPA 2KLFA 1MWZA 4ECSA 3O97A 2GQCA 4U22A 1PYSB 1AZSB 3EYZA 4X4VA 1FQAA 1T9UA 3KSXA 4DV0J 1AZSA 2F36A 3HSTA 3IP0A 2DWJA 1PBUA 4ESXA 4UT4A 2BJDA 4O7MA 4B3OB 4IRKA 1UJ5A 4ILLA 4B3OA 1F9EB 2PCRA 1JLQB 1FQBA 4GVOA 4PFBA 2GHPA 4U23A 1ZZFA 2DGSA 3O6QA 1R6VA 1H45A 1JLQA 2RU3A 4J9QA 2RS8A 3C66A 3T96B 1S6QB 1IMAA 2B9EA 1S6QA 5KT6A 1JLAB 2NVUB 4CYUB 4EWTA 4OVQA 1RHQB 2J8AA 1OMSA 1JLAA 1FBHA 3ECRA 1RT2B 4CYUA 4I69A 2H98A 3MEDB 2IFXA 2KXFA 5KG5A 4WFBQ 4TVAB 3FXBA 2V8GA 1RT2A 3DXSX 1EQMA 3MEDA 3TVYA 1FFSB 2I0XA 4DUTA 3EZ5A 1QSLA 2YKOA 2KM8C 5AA3A 5LSRA 4A46A 1E6VB 3EXCX 2R7TA 1RSCA 3ILOA 4KB7A 1ZTTA 1E6VA 2OFHX 2QG9B 1BP5A 1PC5A 5CMKA 3GJQB 1MG1A 5EHMA 2HHHF 4LP2B 1GX5A 3H6WA 4TYBA 2QIFA 4PAKA 1F5BA 2BACA 3K5NA 3JYRA 3BREA 2V4QA 4C2MA 1B6HA 4JI0J 5F8IA 1B52A 3KMSA 2XYGB 2CPYA 3U72A 3SQOP 3U1LA 2BRKA 4O0NA 2E1PA 2EKYA 4WFXA 1PYOB 4L74A 2LVWA 3SETA 3LV0A 1N33F 2XI3A 3BM7A 2IMWP 5L9NA 4ECQA 4GXAA 3HFKA 3W1YC 5HJXA 4RNFA 2HWHA 4X65J 2HBZB 4IOBA 1F6TA 3OSRA 4CO4A 2FLNA 2UV8G 4NLPA 4DDFA 4I6YA 1GEHA 1KHWA 4LVNP 3K89A 3SEOA 3SQGB 1HHQA 5LOQA 4GX4A 2BE7D 3W2VB 3CJTA 3MM6B 3P3DA 3KZGA 4NRUA 3SQGA 4G77A 4A8QA 2R7VA 2LXFA 1T3NA 3W2VA 4WZMA 3MM6A 5KDTB 2Q88A 4H46A 3A8EA 1OIAA 2KJWA 1S9GB 4XKRA 5KDTA 5KFRA 3I0RB 4NA1A 2G2ZA 2P3VA 1S9GA 3O44A 2V93A 3HI9A 3I0RA 5SZTA 4IH5A 1B3HA 3I5CA 2NXNA 2DPJA 5J1DA 1DBZA 4AQYJ 2E1AA 3SEVA 1EB0A 3KHRA 3SERA 5ETOA 3M9OB 3D3BJ 3RJMB 4AS5A 5HSPA 1MWYA 3CIZA 3IR7B 1I1GA 2L08A 1UVNA 2F9JA 3SDFA 2F3BA 4ID5B 3BN7A 1HI1A 3GQCA 3RT6B 5F0UA 2WEFA 2I38A 4WP9A 4ID5A 4N15A 4DQQA 2MEWA 1DQ9A 3BQ0A 3LWMA 4NMYA 2UUCF 1IMBA 4FYDA 1OMPA 2AD9A 3LUYA 3FVKA 5D6GA 1N3XA 1NV4A 1H2UX 4H65A 5EWEA 5KFTA 1YJRA 2ZWPA 4ECZA 4PQUB 3Q0AA 2ZUGA 5DETA 3PPRA 3RPLB 2XMJA 3DGVA 2AJ2A 3BN4A 1S0NA 3QQCD 4ER8A 4PQUA 3RPLA 1N76A 2JRSA 5I2KB 2UU9J 4DF8A 5I2KA 3W9VA 4I40A 3L4BC 5HLFB 4PGPA 4ZPBA 2Z4PA 4F8RA 2E7WA 1MY4A 5HLFA 1XR6A 4FKXA 4DX8H 1VHIA 2KFNA 1I6AA 2EG1A 3JTNA 2ZKTA 1TFAA 1O6XA 1X0FA 2J76E 3U7JA 2ILYA 4FYXB 1Q1KA 1YGYA 3FXQA 4LBHA 2ZH2A 2CJ9A 4PXBA 5EX3A 2Q6BA 5M2RA 4F3GA 3VR1A 1XS5A 2O69A 1S7HA 3H40A 3BBBA 4UA8A 5GADI 1MPBA 5ESYA 3MF5A 3KUGA 4NE9C 3GV5B 5I57B 2IM2A 1SCJB 3CD7A 5I57A 4I1DA 4B9LA 4RW6B 1LAHE 2VV5A 1FJCA 1M5KC 4EQBA 2EWHA 1NKEA 2Y1RI 1N3WA 4RW6A 4NF8B 5IT9Y 5AXKA 1DCUA 3T1YJ 3HSGA 2ATCB 4A47A 4NF8A 1T9WA 8AT1B 3CMES 2W8LA 4EZ9A 3I9ZA 3QJLA 2XXRA 5KFCA 2ZBIA 1AOVA 4OX9F 3VAFA 1FPLA 1NJWA 1MDP1 1DBDA 1FJGF 2GAHC 1W2BR 1L3TA 3L7PA 4Q7AA 1YBAA 3BKTA 1YJ7A 5AE3A 1EX8A 3USDA 4QWAA 3TA1A 2D3ZA 4ZLPA 2ZZVA 4P75A 2F34A 1NNFA 3RB0A 3CCWA 3DRXA 3MD3A 3OENA 4PG7A 2PIIA 5LJ3Y 3J81j 2HMIB 2N3OA 4GBWA 2KHCA 3R7XA 2HHPA 4B9MA 2HMIA 4DV3F 2CQ2A 4J9NA 2LQ9A 4P11A 2EFPA 3TJ9A 1J2VA 3BBCA 4LQ3A 2M8HA 1MY0A 5L1JA 2NUVA 5IM2A 3MWBA 3CCTA 1PIEA 4F25A 4C0OC 2XXYA 4F36A 4K4ZA 3CCMS 4LRFA 3CD0A 2ALYB 4WKMA 5CC2A 1MMNA 2LECA 2AGOA 2XXWA 1FNXH 1S79A 1ZTWA 3JTOA 2FLOA 4C3LA 4BWMA 2F63A 3MM5B 2AU0A 4E2FB 3LO3A 1WG5A 3A1YG 2GVZB 4QYRA 2QSFA 3MM5A 1K0TA 2Y84A 2KO1A 3KLEB 1BUXA 2GVZA 4ILRA 3PX4A 1KD1T 5ET6A 4J9OA 3TX8A 3KLEA 3PCOB 2UXBJ 4C3MA 3PIOQ 2I1RA 3R2CJ 1WVJA 4JI2F 2RQCA 2IMOA 1MQIA 1NV0A 1WC1A 3EVWA 2ZZTA 4LFCJ 1VQOS 1MH3A 2FZGB 1QJMA 4C0HA 4MMPA 3TZWA 1YJNS 5AA2B 3TTRA 5CXTA 2LDYA 2ZE2B 2EW9A 2D3OR 1GTHA 4GQOA 1MY1A 1P1TA 2F7CA 4QZVB 3GTYX 5AA2A 2ZE2A 3J80U 1KVJA 4OYZA 1RYOA 1FPDA 5J1PA 2XWOA 3FEYB 4LATA 3LP0B 3PR4A 3BYPA 4HL9A 3GZGA 2KR0A 4LF2A 3LP0A 1NNPA 1YG0A 5ETSA 4DPWA 1QTNB 1VQ8S 3CJSA 4KV8B 2B4OA 1KVKA 1B1XA 1ZM4A 4KV8A 1FBGA 4QPTA 1A6LA 4FF3A 1YJTA 3VFJA 3I5BA 4FXVA 3HT0A 4GF8A 4PFIA 4USTA 4C48A 4NF0A 3N6NA 2ZC3A 1GR2A 3AJ1A 2V0NA 3D0GE 2PO4A 3TAPA 3RN8A 4G8MA 2RJZA 3MZBA 4OYBA 4DU8A 1NH7A 3QLHB 2Q8JA 3QLHA 1HI8A 5I56B 1R9LA 2Y8WA 3FRZA 1EAYC 5AE1A 5I56A 3RLFE 1NB2A 2NWJA 1UIVA 1N7XA 3HDSA 3K6XA 4ZPVR 2XCPA 4S0MA 1ZBMA 4QSDA 1O5JA 3QYYA 1NRKA 4HVZA 4KYDA 4IO9Q 3ULHA 1VC6A 1NDKA 2ZJQQ 1J27A 3E78A 3T19A 3EHTA 1IR2A 3JB9k 3AXMA 3UO0A 1AA1B 3PRVA 3CIJA 4ED2A 1K9YA 5IZHA 1SPBP 3K6UA 2FTRA 3DRYA 2F65A 2YQ1A 5F8NA 3NAIA 5L39A 3M8QB 4QJVA 1WKJA 4ZP7A 3M8PB 3M8QA 1FKPB 4U7UK 3VVEA 3GJSB 3M8PA 1B7ZA 2FIXA 3E8OA 4X4PA 1XR5A 2YBVA 1FKPA 4R2BA 4LF8F 3M7VA 1Q9DA 2VPYB 4CCHA 5KFZA 1WEZA 1WHWA 4IRDA 5KOXA 3G3KA 2KHDA 3T9UA 2UUAJ 2ZOGA 4QFKA 2B4MA 1U2CA 3IO1A 1UWAA 2HIYA 1FE4A 1VQSA 3QRRA 4MT1A 1DJ0A 2K7JA 2MZ1A 2ALZA 5ET5A 4U4SA 1WOSA 2KVIA 3E01B 4P71A 3E01A 4OHZA 4CT8A 1U6BA 2V50A 1L5UA 3SCKE 2ONSA 4G8HA 3NOGA 2E5LJ 1PC3A 2DXFA 2PMHA 4ZE8A 5KFYA 4Q2MA 3WDOA 4X64F 1OIBA 2CFXA 2ZYMA 1XVXA 1AT1B 4OVRA 3SSSA 2EK6A 4LZ8A 2IHR1 4RYAA 1K9MT 4OA4A 4K5SA 1T3OA 5FHNA 3W61A 2XC9A 2KXHA 1Y9UA 3B8BA 2DNGA 4N41A 3CJ2A 3KDOA 2BXJA 2DB1A 3K1MA 4E0WA 3LQVA 1WEYA 1D3KA 4P2SA 1F2GA 4H6DA 4QYZJ 1WC4A 4ECUA 4K3FA 2DRAA 1D9YA 3GWCA 5DVIA 3Q8PB 1RHMB 4ZLLA 3AD8C 3F73A 5KTQA 3WC2A 1NV7A 2H3EB 1FHTA 1FT8A 5T14A 1ULRA 1Z2ZA 4ZVSB 1FESA 3CSGA 1IXHA 2G13A 2XS5A 3JSRA 3TTKA 4GWOA 3R5AA 3GONA 1SL0A 3B4DA 4X9TA 5KFIA 5IV3A 1QUKA 1RWUA 4QR2A 1QVSA 2P0SA 5C7PA 1ZA1B 2KYZA 1PYTA 1MXXA 1TELA 4PABA 2YWEA 3AY0A 4F31B 2CPXA 2KRRA 5JUMA 2VPZB 1XN9A 5CQGA 1X4DA 3VALA 3DNCA 3LSWA 2DYAA 2HQGA 2VC1A 4A8XA 3V6HA 2RCAA 4GWZA 4P56A 3MPWA 1B7YB 4QBUA 3OXGA 4X62F 2BQRA 2ZHAA 3MPVA 3PM9A 1NV2A 2BZ2A 2QVRA 1UFWA 1RHJB 3MPKA 2FHJA 2Z23A 2B65A 2XX8A 1HMVB 3AJDA 3NNCA 3ICLA 2WSEC 2JVOA 1QAXA 3KN7A 1HMVA 4KR0B 1TAQA 1FBDA 5IFMA 4E0XA 5DJBA 4ED4A 5B0CA 4ELVA 4EQ9A 2ZKUA 4NXNF 3H7MA 4JI5J 1SQGA 4NLRA 3IL1B 3IWNC 2IRXA 4O3CA 2A1BA 1FFWB 1QSSA 2QS3A 3QWUA 2HQ0A 2L5VA 1LBVA 3R26A 3RBEA 2HVEA 5DGAA 2J8SA 5F1QA 4ZLJA 4KBIA 2MGZB 4RUBA 2WAQD 1HARA 1C1BB 4LR9A 2CVIA 3OHBA 3FBPA 2MGZA 1F5CA 3UN3A 1C1BA 4NMLA 3D3CJ 3BJYA 4MIBA 3I96A 3LA0A 4BWJA 2R9LA 2AJFE 2QL9B 1NDPA 1POTA 3MJNA 2PT0A 4URSA 2G9OA 5K2YA 3NLCA 3H5XA 4OYAA 2M9KA 3T0JA 1H2TZ 4OHXA 3VLUA 2JFDA 2MKJA 3RZAA 1ZTYA 4DQSA 1VJWA 2J9EA 3MTJA 1TV6B 5GAHU 5KFHA 3M2UB 1VBYA 4OI6A 1TV6A 2RRNA 1IWGA 2HG4A 3M2UA 3PW0A 2Y7PA 4I64A 5FHOA 4UOGA 4DL5A 2AX1A 5IZZA 4JBCA 4WFZA 3OR1B 2