4LUBA

X-ray structure of prephenate dehydratase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
275
structure length
188
Chain Sequence
TMKIAYLGPSGSFTHNVALHAFPAADLLPFENITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYLFHQAKIEAVAEIILENYTRFWVLGDETPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFIIDFENHNEKLVSFALEELTSIGIHYKILGKYAVYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative prephenate dehydratase
publication title X-ray structure of prephenate dehydratase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 54
structure length 188
sequence length 275
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lubA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lubA01
4PFYA 1LFIA 3EQ1A 4OERA 2UYFA 3TUIC 2XXQA 4YU0A 4DIGA 4KYSA 1MXUA 1MM6A 3KOSA 3KBRA 4LQ5A 3N94A 2X7QA 4R6KA 3TODA 4I62A 1MXWA 3DHXA 3G3HA 4ZS9A 5CRYA 1H3DA 1B05A 4G4PA 5K2YA 4EXKA 4KQPA 1MXXA 5JK4A 3KN8A 4ONYA 3MVZA 3L6GA 4ECFA 4ZDMA 2UYEA 5H8HB 5B7DA 4DE8A 3E13X 5H8FA 3TZAA 2I0BA 3UN6A 4GD5A 3CIJA 5CBRA 1B4ZA 1N84A 1SC6A 4F31B 3RN8A 4EDPA 3BFTA 4JDFA 4QRZA 3C36A 2I4BA 4G8HA 4POWA 3IB2A 3SEUA 1Y4TA 3VXBA 1L5TA 4QHQA 4LVQA 3H7MA 1UTBB 3TPAA 4N13A 3K6VA 4LATA 3OSQA 5IS2A 1I6QA 4DLDA 2Q89A 3HCQA 4DZ1A 2Z22A 3THIA 3O97A 1FTKA 2O6AA 1FQEA 3E3KA 1A55A 1BKAA 3H3GA 4PFTA 4C1UA 4RK2A 3C9HA 2NWJA 4F1UA 3N26A 1EZ9A 1KWHA 4EQBA 1QKAA 3O6GA 4EF2A 3V8XB 1NNPA 3OXNA 3T9HB 5ITOA 2QSXA 4IO5A 3WAFA 1LB9A 3UIFA 3ENQA 4WEPA 4AB6A 3G3GA 4F1VA 2QPQA 3K1PA 3ZS6A 1GGGA 2A5SA 4WXJA 2H4IA 4QF9A 1TXFA 3TQWA 2F6PA 3IJOB 3TFLA 5HM4B 1PDAA 4FEDA 4X48A 5IT0A 3FVNA 4PWUA 2HFBA 4QSEA 1SYHA 4IO4A 2PX1A 1JQFA 1JW4A 3OOAA 4EUOA 1B3HA 3K01A 2VOZA 4XKRA 2DWJA 4F3GA 5JTYA 2DWHA 3S9NC 2DXYA 3G3JA 5DVIA 4RJZA 3W15C 4KHZE 2ZNSA 3SEWA 3TEPA 1B0HA 4X1BA 2F1FA 2DOJA 4ZEBA 4F2QA 1B6HA 4RY1A 1TFDA 1LGBC 4KD5A 2VHAA 2X7PA 3N5LA 2LQJA 3USDA 3VVDA 1XT8A 2R9JA 3U7JA 2ZYNA 4BDNA 2OZZA 5AA2D 5TPAA 1Y1MA 4BDLA 5FIIA 1LKZA 5H8QB 4IO1A 2G29A 1DMBA 3IOWA 1NNKA 2PYYA 3K6UA 1LK7A 3EHSA 4H5GA 1PEBA 1P1WA 2F6GA 3RT6B 3VDFA 3IORA 3D4GA 2X26A 2I9SA 1VE4A 1US4A 4C0RA 1B4HA 2D3IA 1MPDA 5H8SA 1FTOA 4XXUA 2O69A 1OLCA 3TTNA 2QL3A 1Y3PA 4G8MA 3DDNA 1POY1 2LVWA 2V84A 4RYAA 4POXA 2Y84A 3MTJA 3IXQA 3LR1A 4QFOA 3UK4A 2F7BA 1D3KA 2E0SA 4H8JA 2UVHA 1WODA 4U4SA 3T96B 4XKNA 1B3GA 1B32A 3KOTA 3MZBA 3IO6A 1B3LA 2RQKA 4WKMA 1RYOA 2ESNA 2I48A 3OFHA 2O1LA 4R72A 4LZ7A 2VGQA 4G68B 5I59B 2GFEA 4N6PA 2HZKA 3TAJA 1QKBA 2G93A 1M0SA 1RWUA 3U8QA 1YCJA 5DVJA 4HCWA 3G7WA 3HV1A 3PGFA 1POTA 1FQCA 2IEEA 2CDQA 2DWIA 3MZ1A 3O6HA 4JWXA 3IOUA 3T22A 1ZU0A 2RKMA 3SERA 2CZLA 4F19A 2E1SA 4RPNA 3H4ZA 4Q5TA 1DPEA 2XXYA 3ZKKA 4NMYA 4OFJA 4R9GA 4Q0CA 3K02A 1LB8A 2ZMBA 5I2KA 1P1UA 3V5AA 3KGCA 2H9BA 5AA3A 2M8CA 4JXIA 4BDQA 2P9GA 3U93A 1UJ6A 3KJTA 3OO7A 4TLLB 5ICTA 1T0KA 4MLQA 3MAMA 4G2ZA 3ONMA 3EHUA 2H5YA 3DM0A 5AA1A 3R6UA 1QUKA 4TOZA 4ELOA 5I57A 1B0LA 1H76A 3MWBA 3TTLA 1FTJA 2AL5A 3HHFA 3KWMA 1UTHB 5FTIA 5TP9B 2XXPA 1FCKA 1UQWA 2ZNTA 4LZ8A 1MXZA 4I8CA 2F5XA 4ZEFA 1XTZA 4QFPA 1M5CA 3IL1B 2NYIA 1NNFA 1USYE 3CI8A 4DDDA 3LSLA 3FASA 2UVJA 3TDJA 3QAXA 1SYIA 1CE2A 1SDXA 4KCCA 2PT1A 2DS9A 4IO2A 4OTEA 3VE1B 3G3FA 3PMVA 3W9WA 1RKMA 2DWAA 2PA3A 4GLIA 3BBRA 2P0SA 3I3VA 3Q27A 3VXCA 1ZPVA 4XTCQ 4THIA 4NF6A 4JSDA 2QSWA 2AYSA 3P96A 5KDTA 4OEVA 4PFWA 1OVBA 1H43A 3O2AA 2V3UA 3QSLA 3T93B 3VVFA 1MPBA 4ZEKA 2I0CA 3A3CA 3RTFB 3GBBA 3QK6A 4DXUA 2F7AA 3MP1A 4IY6A 3A09A 1Q1KA 3QXMA 2B3BA 4ELQA 2Z8DA 1OMPA 3H06B 4U1OA 3PPOA 3SKPA 3Q26A 5BWJA 3C35A 3K00A 2D5WA 3OENA 2NOOA 3GBAA 3D4CA 1B7UA 4YB5A 2XXUA 1EZOA 1XHYA 1ZJLA 4FEBA 3TCHA 2QS2A 3O29A 4EXLA 1B2HA 3CVGA 3S9LC 2XXRA 2YLNA 4AB5A 2XHDA 3N6TA 1HSJA 1MQIA 4X84A 3FVKA 1N04A 1SQYA 2F7CA 2XX7A 2KO1A 4YKPA 1Y9UA 3OD7A 3DP4A 2H99A 3B6WA 5EHMA 1FW0A 4H6DA 5FHOA 3KSXA 3FJGA 2BJJX 1QJMA 5CMBA 1N7XA 1ATGA 4MFIA 2HEUA 1Z7NE 2ZYMA 2QRYA 1U8SA 3K5PA 1DPPA 1FTMA 3QYTA 4JSOA 3VFJA 2F35A 2QJEA 3OO9A 1N7WA 4FE8A 4H67A 3CFLA 5H8HA 4NTLA 1IQ7A 3IB0A 4FECA 4ELRA 3PV0E 2XXWA 2I3VA 1P1NA 4LQ2A 1GTKA 1NH8A 3AB4B 3TTRA 4NF4B 4R2BA 3OFGA 1A99A 3JV9A 2GHBA 1UTBA 2DE3A 4GF8A 3M3LA 3K4UA 5BUUA 4ZEDA 3V83A 1Y3QA 2V3TA 1ANFA 3RLFE 1B5HA 2RINA 4H65A 4ZZEA 1RYXA 3C31A 3SESA 4JWOA 4YMAA 1LAXA 5CMMA 2I3WA 4E0WA 1BLFA 2V25A 3CG1A 3BKIB 3U1OA 3RUMA 4QSDA 1PB8A 1BIYA 3IK6B 1MY3A 5H8NB 5I58B 1ZLQA 3G3IA 4OHNA 5ITPA 2ZYOA 4ESWA 3U92A 1PC3A 1FQAA 3KZGA 4QFKA 5FTHA 4M8LA 1JEVA 1MH4A 4GO5X 5I58A 1JEUA 3M8UA 3KEIA 4JWYA 4YKJA 3K0VA 3ECRA 3GLBA 4OXVA 2Y7IA 3TCGA 1YGYA 1VSOA 2RC8A 1TT1A 3KFMA 4R2FA 1PB7A 1LCTA 2P1SA 3ZKLA 3AB2B 2DXRA 3MC2A 4OETA 4IGRA 4HS7A 4JBZA 4XKPA 4ESXA 4OVJA 3PD9A 4O3AA 2RF1A 2ZHOA 3SEXA 3I6VA 3FV1A 3FATA 3ILUB 2PMSA 5IT4A 1A54A 4LP2B 4BDOA 1B1XA 2O84X 4GFRA 1MH3A 2Q8JA 2OWTA 4NMLA 5DEXB 1JW5A 4ZZAA 5CMCA 1EU8A 3CR9A 2XXTA 4BDRA 5CBSA 4GIZA 4OEUA 1FTLA 3PPPA 2RCAA 3MP6A 5TU0A 5H8QA 2DYXA 1MQGA 1VFDA 3N6UA 3CFXA 3F11A 4QFLA 2PVUA 1P99A 3RTWB 3HSTA 4R75A 2QS4A 2KLFA 5LOMA 4H5FA 3VLUA 1VR5A 4KPTA 3MUQA 3C32A 4F22A 1S9TA 2UXAA 4YKIA 1IIWA 2O51A 4R6YA 1MQJA 3IAZA 1LFGA 1OQGA 3S1TA 3PUXE 5IAIA 1J1NA 4BLAA 3Q29A 4IO7A 4KYDA 2FGCA 3FVOA 1B58A 4GXAA 4FATA 1MY0A 4YB7A 3FXRA 1PBPA 1OIBA 3S9EA 4YB6A 3MP8A 3S4UA 2CMOA 1P1OA 1AMFA 1LCFA 4NWCA 3K2DA 2FYIA 3KN7A 4BDMA 1OVTA 2R6GE 2RQMA 1N3WA 1Y7PA 5KZTA 2JOQA 4KCDA 1ZMGA 4P0GA 1IXHA 1LK5A 3L7OA 3R7XA 1B7ZA 1I6BA 4OFOA 5F7VA 3IO4A 1IZ1A 2QRRA 1WVJA 3FJMA 1QW0A 3SETA 3KSJA 3ENWA 3MZ9A 3MQ9A 2Y7RA 3KJ7A 3OSRA 4G68A 4OWDA 5I59A 3PPRA 3LSXA 2Z8FA 4U2RA 4EF1A 1IXGA 1ZKBA 4NWDA 3IOTA 4DXBA 2H25A 1B3EA 3T9VA 4U23A 1USYH 1SI0A 2QMWA 4NF8B 3W9VA 1M5FA 1ZIUA 2H98A 1PB9A 4M1VA 2F36A 4ELPA 2I49A 2NVUB 5CC2A 4GXSB 1B9JA 3U72A 1MS7A 1MDP1 3RGYA 2P2AA 2I4CA 4NF5B 4RXLA 3UP9A 4NF8A 2V93A 3LSFB 1D9YA 2I58A 3P7IA 3ILTB 2XX9A 2ZNUA 2W7YA 4YKKA 2OJTA 3MAHA 4PQJA 5KCJB 2H9ZA 4HTGA 4NF5A 3LSWA 3TKDA 2Z8EA 2HCAA 1HSEA 4GWOA 2RCBA 2PC6A 1N3XA 2ZXTA 3C4MA 1QUIA 2QS1A 1ELJA 4IO3A 2B3FA 3M3KA 1Y20A 2AL4A 2Q2AA 1JVYA 4N07A 4F18A 4U21A 1LSTA 2XD2A 4K3FA 1UTHA 4EQ7A 1Y4CA 4Z0IA 3IBWA 3VLVA 1PSDA 4GMKA 2PT2A 5TP9A 2DE4A 4F3PA 4ZECA 1ZBMA 3FXQA 5ELVA 4DCYA 4JB7A 1N76A 4LZ5A 2FNCA 4YAHX 4ISUA 1JETA 3RPWA 3OEKA 3OO6A 4RPOA 4PFUA 3MPLA 1MY1A 3FJ7A 2ZYKA 3W7BA 2P9CA 2XXXA 1VFEA 2A5TB 3CSBA 1LLSA 4QFNA 3FXUA 1UJ5A 2HAUA 2I6EA 2XXVA 2UVGA 5L9SA 3QUJA 4F3SA 1H44A 1YBAA 1D9VA 4ND9A 1IXCA 1B52A 3U94A 2Y7WA 2WKYA 4FJPA 4Z7EA 1O8BA 1B7HA 3TMGA 4H8IA 1P1QA 4GL0A 4EQ9A 3LUYA 4ZEIA 2OWSA 1B5IA 2JHEA 2P9EA 1UIUA 4OENA 3DC2A 4OESA 1MM7A 4ZE9A 1TWYA 4YMBA 5H8FB 3OFFA 3SEYA 1Z7ME 4HW8A 1ZTYA 3TTMA 3T9XB 2HAVA 1O7TA 3SEVA 5CM6A 3VV5A 2Q2CA 4G68C 1DSNA 3EN3A 2DT9A 2PBWA 4U22A 4IO6A 2AIXA 3WAEA 2F97A 1M5BA 3FIRA 1NL5A 4FAJA 1AL3A 2F8MA 3VLWA 3MVXA 1B5JA 1MY2A 3A3UA 5DT6A 1FQBA 1R6ZA 4XIGQ 3B6QA 3Q25A 2O68A 3T9UA 4IGTA 1R1NA 3MVYA 2DVCA 4GOTA 5AE4A 1YAEA 1QULA 2F78A 4KR5A 3MW0A 4NF4A 4PETA 3JYRA 5EYFA 1GVCA 4O3CA 3OEMA 2ALUA 4GQOA 3TYHA 3H6UA 1YPNA 3NRBA 4F29A 5L9OA 3TUZC 3H03A 2DP8A 1BP5A 1II5A 2REGA 1WDNA 3DP6A 3H6WA 4MLVA 1NMUA 3RY3A 4XKQA 3FGSA 1OLAA 1A8EA 3UA8A 5J1DA 1QUJA 5B70A 1B1HA 3R26A 4RA1A 4M4GA 2O1MA 5H8NA 2Q88A 1A7LA 4I9DA 5HPQA 1O64A 4X9TA 1LBCA 3DELB 3TTKA 3PPNA 3RNNA 4HCYA 2THIA 2DQVA 3B7DA 2XD3A 5JTYB 3CSGA 1SW5A 4OQOA 2Y7KA 5F1QA 3K1NA 1XS5A 1BTJA 4GO7X 3G3KA 3PMWA 3CEDA 4F1YA 3DP8A 1XVYA 3TELA 1LAGE 3S2VA 3TQLA 3O28A 2XX8A 2YPNA 4OZ9A 3B6TA 2J0XA 1MQHA 1N0TA 2HQ0A 3MPKA 1M5EA 1SW4A 4KI0E 1B40A 2VD2A 3K1MA 5FHNA 5TPAB 4R6HA 3N0VA 3O66A 2REJA 1UIVA 5M2VA 4GL8A 3PMXA 1LBBA 4C1TA 3IB1A 3HO7A 1UJ4A 2J0WA 3AAWB 4PP0A 3I5OA 3GZGA 1HSLA 1Y3NA 3OELA 1NNTA 4R73A 1LFHA 1IUDA 1I69A 2F8DA 3JZJA 3PUYE 1A8FA 1US5A 3CFZA 1SW2A 3HHEA 3BFUA 3SDFA 1URSA 3ODBA 4RK9A 4H1XA 1AOVA 5DEXA 3DLNA 3LOUA 1NFTA 2IA4A 2RC9A 5L8DA 4RNSA 3UW1A 4YZZA 1B3FA 3QIMA 1XC1A 2OCUA 3HN0A 2R71A 5I56B 1EZPA 4TLMB 4GVOA 1LAHE 1DTZA 2GHAA 1JVXA 2D21A 1XVXA 2ONSA 3MBPA 4UA8A 1DOTA 3M3FA 5K2XA 3V89B 3E9XA 3O9PA 2O7UA 4KYEA 5I56A 3FZVA 3K6WA 1SVXB 2DTJA 4QSCA 1MDQA 4F2OA 4Q8RA 1NKXA 1B51A 4IB2A 5I2NB 5HBCA 1MXVA 5ISUA 3FV2A 3RT8A 3MJNA 3H6TA 2ABHA 3PU5A 2XXHA 2O7IA 2VD3A 4MH5A 4X1DA 3ENVA 3PPQA 5JEIA 2Y7PA 4P11A 5I2NA 3IOVA 2DSFA 3TCFA 5EHSA 4Q30B 4OMBA 4UACA 1TFAA 4OYVA 4TQUQ 3IR1A 4LA9A 2OLBA 2DVZA 3ZSFA 5FHMA 3K6XA 5ICQA 2ANJA 3CRBA 1NH7A 1FQFA 3OFEA 2DE2A 3FD3A 1B46A 3C34A 2XXIA 4R74A 4E0XA 3MVWA 2NUVA 1F9BA 2FA7A 1I6AA 3DHWC 1MG1A 2UVIA 4FORA 1O63A 1MQDA 4OFLA 4LONB 5T41A 1GR2A 3PUWE 4ZE8A 1LAFE 4U1ZA 4U4XA 5I2KB 1M5DA 1DTGA 1R9LA 2OK2A 4FIMA 1AIVA 1IEJA 1PBQA 3FVGA 3HPIA 5DTBA 3EHTA 1OQHA 3O6IA 3TUJC 2MDAA 2ONRA 1R9QA 3UORA 3CG3A 3LBSA 1IXIA 3EPEA 1SI1A 1Q35A 2VP1A 2V3QA 3PUZE 5AA4B 3AXFA 3O1LA 2GH9A 3IX1A 1JNFA 5JJBA 2Z23A 1SBPA 5I57B 3TUSA 1YTVA 1S50A 4NE4A 1S7YA 4WEDA 3KN3A 4I1DA 2QS3A 1A40A 4G77A 2HXWA 5AA4A 2HZLA 4R9FA 5KCJA 1GV8A 5DVFA 4O3BA 1KS2A 2YJPA 4P0IA 2RC7A 3OO8A 3C33A 3L6HA 3Q28A 1JW1A 3FUZA 4DXCA 4KFQA 3EF7A 1Y1ZA 2Q9TA 1SW1A 2B65A 5CMKA 4L17A 4PE5B 3UGWA 1MY4A 3OMBA 2RE1A 3E4RA 3LC8A 3RQTA 5A5XB 3GXAA 4IY5A 1D4NA 2ONKE 5DYHA 2NXOA 1IITA 4MF3A 4AQ4A 5AA2B 4GRKA 2QMXA 1EH3A 4NF6B 1QVSA 1FQDA 5KDTB 1MRPA 2GRVA 5A5XA 3PD8A 3QUFA 3VVEA 4DCXA 2LAOA 4F3BA 4NEDA 2OBGA 2F34A 5AA2A 3PUVE 1URDA 3OBIA 4G8NA 4MBPA 4LUBA 4F39A 3KG2A 1CB6A 1H45A 3H6VA 3T66A 4YICA 5I84A 5IKBA 5L9MA 2A5TA 3HHGA 1AH5A 3S9MC 4H0WA 1SD3A 1URGA 5CI5A 1XOCA 1MPCA 3IJXB 1MXYA
chains in the Genus database with same CATH superfamily
5KT2A 1LFIA 1HHTP 4FPRA 2UYFA 4KT0C 4IR8A 2XXQA 4YU0A 1YITS 1X4CA 4N41A 4DIGA 2DR6A 3N01A 3QWUA 4X4NA 3N94A 2DGTA 2X7QA 1TL3A 2AJFE 4DG1B 4R6KA 4JVDA 3FC9A 3BQ1A 5J1EB 3M6XA 4ETZA 2DPIA 1H72C 2XZTB 1GK8A 1H3DA 1VQ8S 2ILYA 5LM7E 5B0CA 4LF5J 3KHGA 5KFLA 5JK4A 2AEFA 4WFYA 5JVHQ 3MVZA 3L6GA 1G0HA 2UYEA 5H8HB 2IAJB 3E13X 1XC9A 5HBMA 5IWAJ 3OL9A 1BC6A 1SH2A 5H8FA 2I0BA 1N84A 1S6UA 1VRUB 4OX9J 4OX6A 3KMQA 4QRZA 2YPYA 3MECA 3OL8A 2I4BA 5HATA 4POWA 6FD1A 3SEUA 1SUQA 2D7SA 3VXBA 1SQFA 1DY3A 3W5XA 4QHQA 2JH3A 4DL2A 3H7MA 5LJ5Y 2MZRA 1S1UA 1V3ZA 2VZ9A 2Y0SD 1MU2B 1OY9A 4EU0A 2BJIA 3OSQA 4FYYB 1TKTB 2Z2MA 3S01A 1C1BA 2RUGA 2OJ3A 3O97A 4C2MA 3MM6B 1FPJA 2HS4A 4KSEB 1YJNS 3A4TA 4A8OA 2XBPA 2E5LF 4HT7A 3IA0A 3PEJA 4C1UA 2NWJA 5E3PA 3N26A 1EZ9A 4EQBA 2RKIB 3UVJB 5F8NA 3M7VA 1NNPA 3RZAA 2MKIA 4F0MA 3T9HB 5ITOA 5RUBA 4WK3A 4IG0A 1LB9A 2X1FA 1JJCB 2PA8D 4PQUA 1KD1T 1JLGA 1R8HA 4B9LA 4RWWA 4UOHA 2KTQA 3HPOA 5KG3A 3HFVA 5DZ7A 3VZHA 2ZC4A 4L6V3 2C2KB 1S7IA 2MMYA 4QF9A 2RMLA 5J2QB 1MMDA 2N4CA 3J7YU 3CTRA 1F9HA 4CH7A 3IJOB 3TFLA 4DJBA 5AT1B 3GG1A 4RNHA 2B4MA 4FEDA 4LSNA 3MM9B 2QLJB 3H2LA 1RT4A 4JV5F 4RPFA 4X62J 3SCJE 2VOZA 2DWJA 2ZBIA 5JTYA 2DPJA 1X9MA 2DXDA 3G3JA 4AYBD 5DVIA 4RJZA 4KFBB 3SEWA 1B0HA 2FLPA 2F1FA 1KLNA 3FSYA 1B6HA 1LGBC 2LEBA 3N5LA 2K1RA 3FSXA 2LQJA 2CQHA 4BDPA 4B08A 2FD2A 3U7JA 2DR7A 2XMVA 1N32J 3A8KA 4MIAA 4O0IA 1IMCA 1NZAA 4HXVA 5FIIA 2XCAA 4ER8A 1LKZA 3ZZUA 5H8QB 2MTLA 5D6GA 3DLHA 1YBUA 4UY85 2G29A 5C42B 1DMBA 3J81U 3GIIA 1T7PA 1NJZA 4FF4A 1T9TA 1UFLA 2ZH5A 1IUJA 1GXLA 2AEJA 4DU7A 1CEZA 3CCQS 2YH0A 3D4GA 3R1HA 2UVUA 4QW8A 1URRA 4JI6J 4WU2A 4ID5A 1HNWF 1X5SA 1VDWA 4IR1A 1MW7A 2D3IA 1MPDA 5H8SA 4Y2CA 4DR4F 1Y5IB 2FJEB 2YKMA 1QY7A 3S7RA 1KLMA 1HWUA 4JI0F 4KHPJ 2O69A 3B82A 4ES2A 2PFZA 1YJVA 1G2EA 3C14B 1Y3PA 4G8MA 4YY3F 2UVRA 2M4MA 1UW4A 4J90A 3R2DJ 2QLXA 2CPYA 1CULA 4TXSA 1MROB 3UK4A 4C7QA 2E0SA 3DXSX 5HL7Q 1WODA 2VBYA 2UVHA 1VBKA 1Q0NA 2HGLA 3VAKA 4QOTA 3QJPA 2KFYA 1HNXF 4CO5A 4A8FA 2B8QA 1B64A 4WKMA 2C2EA 5F9NA 1AA1B 2B4UA 2VICA 2ESNA 4QR1A 1SC1B 2DXFA 3NGDA 3R1LA 2GFEA 4N6PA 4PGPA 3VAMA 1QKBA 2AYBA 2G93A 3F73A 1RWUA 4JYAJ 3BGRB 1PJ5A 2KRBA 3DRRB 5DVJA 3PNIA 2ZZWA 4CWBA 4FYWB 5F8JA 2WONB 1FBDA 2ZJRQ 2PCRA 1SPIA 2IEEA 1RTIB 2V0NA 4K5RA 3O6HA 3IOUA 4W4MA 3Q83A 4RR5A 3VALA 1FRPA 2RKMA 4GKJF 5A76A 2E1SA 2A18A 4RPNA 3H4ZA 2XXYA 5IQ6A 5D0HA 4NMYA 3HD2A 2ASDA 3W2WA 4F2RA 1VR6A 1LB8A 5DRKA 2B43A 5CYQB 4DF4A 2HGMA 4EFAC 1P1UA 4LT6A 4DSKA 3QMQA 5KFPA 4V19X 3E78A 2P9GA 2DH7A 4L73A 3KJTA 4TLLB 3MEGA 4NEYA 1PCAA 2UXBF 2KKHA 2EC2A 1E6VB 2LU2A 2VUGA 4S0MA 2DNLA 1OQ3A 3ONMA 2F8EX 4C8KA 4UOGA 3T3FA 4CYUA 3BKUA 3CCRS 3DM0A 3OLAA 1FTAA 4ELOA 5I57A 2HHPA 9RUBA 2BDPA 3HSGA 3DDKA 2KT2A 3MWBA 3TTLA 2EG2A 3IMQJ 3BGOP 2AL5A 3KHRA 3HHFA 3DLKB 2B8PA 1IMEA 4JI5F 4XF5A 4NCGA 2ZITA 3A13A 3RB0A 2XXPA 1FCKA 1NSQA 2YWFA 3KUHA 1FESA 1MXZA 4I8CA 2F5XA 1K1QA 4WIQA 1IR2A 1TUWA 3PFEA 2VQFJ 1CJTB 3IL1B 4OJGA 3MMCA 1NNFA 3CI8A 3TJAA 4L3KA 1JXVA 3FASA 1K73T 1RT5A 2UVJA 3TDJA 2AYEA 3QAXA 3D6MB 1GH8A 1GX6A 1SDXA 4KCCA 4AQYF 3HHKA 2J76E 3NAHA 4OTEA 3G3FA 1LEOA 3HXMA 5IC6B 3PMVA 4QIGA 5IZ1A 3SZ2A 3ULHA 4X4PA 1TQLA 2BV3A 3QT5A 4XTCQ 4THIA 3KUEA 1LFPA 5E41A 1GT8A 2P6TA 1H43A 1FVSA 1X7VA 5GMKa 2UXCJ 4LF7J 3T93B 5D4LA 2YNFA 3M6UA 2DY9A 2Y9HA 1SC4B 3GBBA 3QK6A 3W9IA 1BK4A 3A09A 1TU0B 4I40A 2B3BA 4ELQA 3PO5A 3PEHA 2AJQA 3SYZA 4C11B 2A10A 4C0OC 1D9FA 2XGPA 3PPOA 3QGHA 1U0HB 5F3TA 2D5WA 1T3NA 3GFYA 1GEHA 3I55S 3U27A 1HNZJ 1HPZB 3KC1A 1NUYA 2XXUA 1EZOA 4WFNQ 4MIJA 5CZVA 4LRBA 2CNLB 3CVGA 4RW6B 2XXRA 2CJKA 4X84A 4WJBA 2DGOA 1N04A 1NO8A 2Z2YB 4DG1A 3OD7A 1FPKA 5AJ3J 4R8UB 3B6WA 5EHMA 1FW0A 4GBVA 4H6DA 4FZVA 1ZA1B 1V5IB 5J1EA 1VIOA 3KK3B 4J7CA 2B7BB 2R42A 2HEUA 2ZBRA 3NGTA 4H4OB 1EB0A 4ZPDA 2Z57B 1JJ2R 1RAAB 3SQOP 2F8HA 2K8GA 4D3GA 2ZH6A 1DBDA 2ZYMA 1WOOA 2QRYA 3W60A 1U8SA 3K5PA 3Q89A 2NCKL 4ZJOA 3T1HJ 5KOWA 2WCXA 1N7WA 5H8HA 2IAJA 8AT1B 1FO1A 2DHSA 4FECA 2OSRA 4MFBA 4NPOA 4QWEA 3PV0E 2IVMA 2V69A 3SEOA 3OR2A 1VRUA 5HK4A 3VCDA 2VL1A 2DCLA 3TTRA 2OFGX 4CH0S 3TA2A 3WX4A 2GQCA 2XSFA 5EN1A 1A99A 1S99A 1X0FA 5IV4A 2DE3A 4OJ1A 4GF8A 4DUZF 3M3LA 2CPIA 3N79A 4Q0BA 2GO9A 3I5CA 3K4UA 5BUUA 1HARA 3ZC4A 2B3TB 1TKTA 2V3TA 3RYDA 1U4BA 4H65A 3K17A 4ZZEA 2EKYA 4CO0A 1G4CA 1INPA 4DPXA 4DR7F 3JAMY 4ED5A 1BLFA 3NCQA 3UCUP 1BIYA 3IK6B 2HVHA 1G7CB 4U67Q 3GIKA 5I58B 3DGPB 3I56S 1HBNB 1NZ8A 2FJWA 4OHNA 2RKIA 5ITPA 2EVZA 2ZYOA 3UVJA 1L5UA 5KTQA 2QA4G 2J6SA 1QAIA 5KFNA 3UDEA 3KZGA 5FTHA 2VPWB 1WORA 2XYGB 1YDLA 4ZVGA 3KUGA 4JWYA 4YKJA 1DURA 2WW4A 3TZYA 1MWZA 3MPDA 1UTAA 4KB7A 2XYHB 2MKZA 5J2QA 1JLEB 4ZVFA 3EMTA 3TANA 4ZLJA 2CPJA 3THTA 5DLFA 4OYWA 5LSOA 3MM9A 2IY5B 4OETA 5EQ9A 1RYSA 1T9UA 3D0GE 1HD1A 3FEZA 3G87A 4ESXA 4ZPAA 4LQ3A 5KOXA 3IWLA 4NLGA 1IKYB 2RF1A 1TL4A 2DISA 2DGVA 3J7ZT 4CT8A 2V5HG 4YN3B 3M9OB 3O8WA 1RP5A 4KFBA 2JEIA 4RUBA 1B0PA 1SC3B 3TZZA 4BDOA 4ZP7A 2ZOMA 2BMBA 1B1XA 2O84X 4ZPVR 4MIWA 1H0HB 1MH3A 2Q8JA 3FQLA 2QL9B 2KQZA 3SV4A 4NMLA 1O0PA 1T05B 4ZZAA 2CPDA 2OHDA 1LBZA 2EC0A 3BSOA 3G2XA 1SJ4P 4PXDA 3HSJA 2GQQA 3PPPA 3MP6A 4CLSA 5H8QA 3I0SB 1MQGA 1X0PA 3FCHA 1FPFA 3F11A 4WYLA 1N6QA 2CZIA 1VBZA 2O66A 1WHWA 4FXVA 2KLFA 1MG7A 4H5FA 4Z7YA 4K0KF 5D3GB 4WP3A 1DTTA 1QD1A 4ZJLA 4A47A 1SH3A 3QRQA 4RW8B 4UT4A 3NNCA 2DGUA 2VPZB 4ZIVA 2BJ9A 3WDOA 2ADCA 3KJVB 2C22A 1TP7A 3PO4A 2FGCA 1JJ4A 4NLWA 5EHHA 4YHHJ 1V3RA 2D3ZA 4FATA 4NLQA 4K4YA 1DQ8A 4YB7A 4CLPA 5FLXY 2X51A 3S9EA 1FA0A 4Y6IA 4N77A 1P1OA 3PJXA 3SI8A 1UFKA 1UEKA 4ZPWR 1LCFA 1R31A 2Z8QA 4J9SA 5L1LA 3CCZA 3G71S 1MROA 4DUYF 1OVTA 2HHTA 1PYOB 1N3WA 1U1NA 2ACMA 3RPLB 1ZMGA 1D09B 1IXHA 2RB7A 4NCAA 1LK5A 3GPAA 3L7OA 2AYGA 3RGIA 4JI5J 3HHLB 1E6YB 3IO4A 2QRRA 2R7XA 3SETA 1K1SA 1S1TA 3KSJA 3ENWA 3MZ9A 2LCWA 3VGSA 1JJHA 3IOTA 1B99A 2H25A 2YH1A 2W1BA 2QVRA 1NBEB 3BGRA 2J0QD 1HI8A 2HAIA 3DRRA 3KHLA 1SI0A 4GC6A 2WONA 1ZIUA 3TRGA 4MIBA 1HHSA 1PB9A 1RTIA 4M1VA 1M90T 2F36A 1YQHA 1B9JA 1I6JA 1MS7A 5ETVA 4GKKF 3ENAA 3C46A 2P2AA 5IM2A 1WELA 5M2PA 2IJRA 2CZKA 1XR7A 5IQQA 4U7UK 2HNYB 4N6DA 1Y10A 1RT7A 3IBFB 3P7IA 3R5GA 3ILTB 1VI7A 4YKKA 2OJTA 4OANA 4O4RA 4ZLLA 5KCJB 2H9ZA 4HTGA 1VRTA 4GWOA 3T1AA 2RCBA 3MXHP 1FX4A 2ZXTA 3CF5Q 4N4UA 4Y2IA 4ZPCA 1R8PA 2B3FA 1QVFR 2HRYA 3VQSA 2NXUA 1JMTA 3WQPA 1IVZA 1BHNA 5HO4A 2H4WB 3RAQA 4F8RA 5DDRC 3D6HB 2GX8A 3HVTB 2NREA 1RISA 2HS0A 2CJ9A 4K3FA 1Y4CA 3IBWA 2W25A 1PSDA 1XIQA 4XEQA 4UUWA 2CNNB 2HW3A 5AE1A 2XI2A 1X5OA 3CPWR 4HE0A 1CJTA 2NR0A 2NXCA 2F40A 3QYYA 1RKIA 2IM0A 2VG7B 1M5KC 4ISUA 4YOEA 2WYKA 2LEPA 1BE4A 3M32B 2ZH4A 3OO6A 1EKRA 4Q2LA 2VA3A 3PR5B 3MPLA 4UZBA 2ZYKA 3BF4A 3D54A 3W7BA 1LW2B 3PACA 1H6KX 1EARA 3HFZB 4DCOB 3CSBA 1IBCB 2VKZG 1UFWA 2QA4S 1S1XB 2XA5A 2HAUA 2BBEA 1OYEA 4DI3D 2XXVA 1Q5VA 2CAJA 3UN5A 2GC8A 5J16A 4OFZA 1SJ1A 5L9SA 2RT3A 3QUJA 1JLFA 5EQ8A 1YBAA 1S72S 4ND9A 2EPIA 1ULRA 2HZVA 4NN3A 4USTA 1Z2ZA 2K06A 1B52A 4NLVA 2WKYA 5KAKA 4TLRA 2GQ2A 1QAYA 3TMGA 1S1VB 4C11A 1SCJB 5A8WB 4GL0A 2XO6A 4PF6A 4LBHA 3LUYA 2BJDA 1B5IA 3AHPA 1KTQA 4C8MA 2WBDA 2JHEA 2G4BA 5EQ7A 1NV7A 4K8RA 3TEGA 3DU5A 4ZE9A 1RT6B 3FMWA 1TWYA 2XCPA 2IRYA 3SEYA 2ILZA 4O3RA 3FBPA 3FBFA 3TO8A 4RW6A 3NMAA 1Z7ME 4PR6A 3R6LB 3RRKA 3BGFA 3L7PA 1Y5LB 3BSAA 2V8DA 2YPZA 3T9XB 3Q24A 4OZJA 3NNAA 1YRUA 4QU7A 4R8UA 1S9FA 4G68C 2MYFA 1DFDA 2DT9A 1Q4RA 2XWKA 1RT1A 1M5BA 5D78A 2F8MA 1IR0A 4PG8A 2UUCJ 4RW9B 2GMJA 1R6ZA 3DLLQ 2XYPB 4XIGQ 3B6QA 4DV3J 4MKVA 2O68A 2Q74A 4IGTA 2DHGA 2LDYA 1FK9A 3C3LA 3LP2B 1HWLA 4O23A 1Q86T 1VQPS 1QULA 4RW7B 4KR5A 3CCUS 4ED0A 5D0RA 3PW5A 2JRSA 3MEEB 4QYZJ 1DQAA 5E5NA 4FYVB 2RAQA 2ALUA 1V9OA 4GQOA 1X4FA 4R0EA 1YPNA 2ZUGA 3UDVA 4F29A 3HZEA 3V2UC 3BH6B 4PABA 4C3KA 2KM8B 5J2PB 1F60B 1VJWA 3H03A 2DP8A 3OV7A 4ZS6A 3OJSA 3ZTOA 4U7CA 3RY3A 1WEZA 4KJIA 5J1DA 1RWVB 3O2IA 1B1HA 1VIXA 4IQXA 4WZMA 2O1MA 2OGUA 3DGPA 4MHFA 1HBNA 5KFVA 3M2UB 2EFOA 3J81Y 1S6OA 1FRKA 4X9TA 1SVDA 1BQNB 1LBCA 2FY1A 1CC8A 1RYRA 2N3LA 1VQ6S 3R7NB 2BM0A 2QO3A 1NSPA 4G1IA 2OELA 3CSGA 2U1AA 4RW4A 1RTDB 1BXNA 2QE5A 1FJGJ 2W2OP 1DARA 4ZK7M 3AD9C 3K1NA 2M8DB 4X64J 2BE2A 4GO7X 3PMWA 2LQBA 2W4CA 3CEDA 2I38A 2PDAA 3DP8A 1JLEA 2ZM6F 1LW0B 1W7WA 4BC9A 3M1VB 1X8DA 5KT7A 3TQLA 1D9QA 3B6TA 2K7JA 1MQHA 1C0TB 4P75A 5KT5A 1OYDA 4CLKA 2FYXA 2HMIA 3DOLA 2DO4A 3CHGA 5DG9A 3K1MA 4P2SA 1YX2A 1GMWA 5FHNA 5TPAB 5CABA 3D28A 3HFKA 3DNCA 4BCAA 1OPZA 4ZVTB 2HHHJ 1IKYA 1W2IA 3HO7A 1UJ4A 5G0RA 5EX0A 1VCTA 4USJC 2DIVA 1Y3NA 1NNTA 4R73A 2BANA 3EGVA 1IUDA 4GWUA 2GMHA 2UV8G 2E7VA 2HGNA 4NE9C 4KRWA 2ZJQQ 3T1YJ 2CQGA 3M6VA 3BFUA 2ZFHA 3SDFA 2L9WA 1URSA 3ODBA 4LBIA 2V9KA 4DCPB 2ZHBA 5HQ8A 4NEZA 2D69A 4HI1A 3UW1A 3GG0A 4YZZA 2OCUA 3HN0A 2R71A 4NX1A 2HKEA 2Y1RI 5EX3A 4TLMB 2Q79A 1ZA2B 1LAHE 1DTZA 3UFCX 3SSQA 1KKHA 1FT8A 3I0SA 1JVXA 5B08A 2PFYA 3OL7A 4UA8A 1DOTA 5K2XA 1LWCB 3V89B 1T8EA 4Z37A 3MR3A 4DR1F 4KYEA 5I56A 3HSZA 3MYUA 3K6WA 1O6XA 2GJFA 3N9UC 3C6UB 1EZZB 3MPWA 1TVRB 2QA1A 3SIPB 3A3PB 1NM2A 3IRXA 4RW8A 1S59A 5C24B 4IRKA 5LMNF 4MMPA 3MD1A 3RT8A 3MJNA 4PG6A 2AJ1A 4LRDA 3V6KA 4WPAA 1RDXA 5ETNA 3AT1B 2O7IA 1TAUA 2VD3A 3KJVA 4QWBA 2UVVA 2DRBA 1UEUA 3MCNA 1Y0HA 3GIMA 3VGTA 3IOVA 4HI2A 4OMBA 4OV1A 1FI4A 2RSQA 3HO1A 1TFAA 2Z2ZA 4EBDA 4MKYA 2ZH9A 3ZSFA 1UA0A 3KTQA 5FHMA 3K6XA 5L38A 5ICQA 4F25A 2QGFB 3GONA 2MHEA 2LA4A 1FKPB 2CPZA 5GAHU 4KHMA 4KYZA 4CRJA 2W9BB 3R2CJ 4WIIA 1WUUA 3BEGB 4OYAA 3T5HA 2D74B 2JC0A 1M5HA 3DM2B 3RPLA 3C34A 2XXIA 2UZAA 1N48A 3KKFA 3OL6A 4HE1A 3SCIE 1F9BA 2FA7A 2NUVA 3LH2S 1WKJA 3PCOB 3DHWC 1MG1A 4N7TA 1E6YA 4FORA 2DDKA 1TFYA 4CQ1A 2EFVA 1D9DA 1HI1A 4GRSA 4DQPA 1SV5B 3BB5A 1ZS6A 2A6MA 5I2KB 2CJAA 4PCQA 5KFHA 1WDDA 1AIVA 4WWSA 1PBQA 4ED7A 3HPIA 5F8LA 3NS7B 4EUVA 3VF0B 3FFIB 2CG8A 1A9NB 3A29A 2ONRA 2GGPB 1IMFA 5A6WA 5A8RA 2V3QA 5AA4B 1YRXA 4OYIA 4I68A 1P9YA 1SBPA 3B6BA 2ZZMA 3GWCA 3TYTA 2C3YA 4DFJA 4NE4A 1O51A 2NPIA 2ZC3A 3IAS9 4I1DA 1A40A 4ED1A 3HX9A 2HZLA 2GMLA 1F5AA 5KCJA 1GV8A 2R8HA 2XWXA 4ZP8A 3T19A 4DI4B 2YJPA 3MD3A 4OYXA 2OI2A 2HAFA 3FCVA 4CLZA 1SH0A 3UN2A 3C33A 3FUZA 3EF7A 1Y1ZA 2Q9TA 5FD1A 3H2VE 5CMKA 1FJ6A 3UGWA 1XR6A 3THPA 4Y00A 2WK4A 2QX0A 4N76A 3E4RA 4K4TA 1HR0J 2XO7A 1R8AA 4M5DA 2HLUA 5K8NA 5I3PA 5C25B 1D4NA 4I4BA 2ONKE 3OQ2A 2LFVA 2IM2A 5KFOA 2V8VA 1CLFA 4AQ4A 1GMWD 3C16B 5HVGA 2DHHA 4G1PA 2YKNB 4LFAF 4K4ZA 4LFBF 4NF6B 1NRKA 1FPLA 3OHAA 5A5XA 3KNAA 2FVZA 3OT9A 2WTFA 4DR3F 2HQGA 3Q0AA 2F34A 5AA2A 2ZZTA 4AS4A 2WHOA 2HHXA 3MM8A 4G8NA 2YNGB 3VGUA 2GAGC 1I1GA 1AUDA 4F39A 2DJWA 1R8CA 3KG2A 2IJFA 1CB6A 1RU1A 1EKSA 5E2QA 3T66A 2RS2A 2VPYB 3DI6B 3AXKA 4FXDA 1OY6A 3CJRA 2OSQA 3SBMA 1XOCA 2YTCA 1MPCA 4DOZA 3CCVS 3PJWA 3PR4A 3NNHA 1VFJA 3LP0B 4OERA 1XK8A 3NEKA 1MLAA 1MXUA 1MM6A 1F5BA 1KQFB 2R2SA 3ZFVA 4P10A 4LQ5A 4K4UA 4Q43A 3TODA 2BE9B 1S10A 3DHXA 3G3HA 2ASYA 4LF8J 4NMXA 4FDFA 2IRXA 1S1VA 3W65A 5A8WA 3MZIA 2WVDA 2XGQA 4G4PA 4X4RA 4EXKA 2VONA 3A1YG 2PMWA 3DDIA 3J81j 3I6PA 1IKXA 4KQPA 1U24A 4TKTA 1R0BG 2FJVA 3G8QA 3Q8PB 1LBYA 3K8WA 5CCLA 3CT9A 4ECFA 5IM0B 4DE8A 3QSYB 3UD4P 4RNOA 1JLBB 4J5OA 4P6QA 3UN6A 5CQGA 2JSXA 3CIJA 1SC6A 4C8YA 1UL3A 3RN8A 1S57A 4EDPA 3BFTA 3C8YA 2R7SA 1HBUB 4FF3A 3ZZPA 3IB2A 4X66J 2AD9A 4Q44A 2ASLA 2CZHA 1OS5A 2MQ8A 3BZQA 5EUHA 3VAGA 4LVQA 1F3VA 2UXDF 4L74A 4N13A 2MKCA 4ECUA 1N33F 5IS2A 3D2WA 1XMOF 1I6QA 3F44A 3HCQA 1LOUA 2B4PA 5KFZA 1RTZA 1HWKA 3GQCA 4DPOA 1FPDA 1FTKA 2O6AA 2DNQA 1FQEA 3E3KA 4PAFA 3WC0A 1BKAA 4F2SA 1TR0A 1NK4A 5LDZA 1FFWB 1KC8T 4F1UA 3HSDA 3FRYA 2AWZA 1KWHA 1RKJA 4DL5A 3MEEA 4H4KC 4CIOA 4DV6F 1TFWA 1WF0A 1R89A 4KTQA 1O5JA 3JXOA 2QSXA 1FTRA 3UIFA 3ENQA 4AB6A 3MUMP 4F1VA 1GFWB 1RZMA 4QYZK 2FQQB 3ZS6A 3DU6A 1JNZB 1VC5A 1HQUA 2CQPA 3D6TB 2GIQA 4DV1F 4HYKA 1XJWB 2R2RA 4BS2A 2MLZA 5LXRA 5HM4B 4UOFA 4O3NA 4DPUA 1CJKB 4DN0A 3BPSP 3FVNA 3VAHA 4PWUA 2HFBA 1BQNA 4OL8A 1SYHA 2YY3A 3PX6A 2PX1A 1X4DA 2UU9F 4JI4F 1KVJA 3Q8RB 4F4WA 1NJWA 3T9NA 1N5QA 4H54A 3KK2B 2DWHA 4YMEA 2DXYA 1RTDA 5HJYA 1FHTA 3W15C 4KHZE 1YJTA 2E9ZA 2ZNSA 2FJBB 1VLOA 1UWAA 4P47A 3ZZRA 1HNVB 1QSLA 4ZEBA 4F2QA 2QG9B 2VHAA 4WZQA 2MZTA 3M1VA 2X7PA 2D9PA 3EVOA 4OV6A 5CZXA 4OMFG 1C0TA 4RUCA 2OEMA 2ZDOA 2UUWA 3KHHA 1MWYA 5AA2D 3G6XA 5TPAA 3U1NA 3GR0A 4EZ9A 3PW0A 2IBKA 1U1OA 4IO1A 2XULA 3KYLA 2FZKB 1LK7A 3N6LA 5DG8A 3RR8A 2KVIA 4W98A 3IR5B 4AXIA 5B0GA 2ROGA 1SL1A 4DU8A 1G1XA 1P1WA 1NPPA 2F6GA 1KN6A 4K4SA 2NUUG 3VDFA 2G13A 5K9FA 2X26A 1VE4A 2HFNA 3KLFA 4WBFA 1IBMF 2O01C 2P2CB 4C0RA 1B4HA 3Q23A 2VA2A 1JLQB 4NLUA 2LXUA 4A4JA 2XTJP 1KNZA 2GIFA 3IFAA 1REVA 1KOOA 2OEKA 3QGPA 4KBIA 2DITA 1RBOB 3TTNA 2QL3A 3A8EA 4G61A 4P1LA 4NYOA 3C6UA 4M5KA 2V84A 1TVRA 2G2YA 4P3LA 4POXA 2AX1A 1X60A 1IKVB 2PMHA 4DXLA 3IXQA 3AOAA 3LR1A 4QFOA 3CCES 4H8JA 4RU2A 3CC7S 2NS1B 2HPUA 1B32A 3MCOA 3CDUA 3TWZA 2XLIA 2OH2A 5CXTA 2EI5A 5MLCV 4PDDA 4X65J 2G0CA 3GV8B 4DSEA 1BLUA 3M8PB 3BDPA 3D67A 1PC4A 2HZKA 4GX3A 3F56A 3TAJA 3MM5B 2FBPA 3AD8C 2WAQD 1YCJA 1FKPA 4YQWA 2WSCC 3UD5A 1T9YA 4JVCA 1TAQA 2W9BA 2KR0A 3HV1A 4WTOB 2CNKB 3EWGA 2C3OA 3NOHA 2CDQA 4KV8B 3PX4A 1DZ5A 3H42A 4C8LA 1LBVA 4DR6F 1ZU0A 5HN0A 4YUDA 2CZLA 5T14A 2IMOA 4ELVA 3GIRA 2HHUA 2VG6A 3I4HX 1DPEA 4IFYB 4ERDA 4OFJA 1XBWA 2VBWA 3H4DA 1SV5A 4MYTA 3W1YC 4CT9A 5I2KA 3UNGC 4USHA 3JQJA 2W24A 3KBZA 1WI8A 2MKHA 2R7OA 1XNQF 1U02A 4DSJA 2N7YA 4O44B 1N52B 3FFIA 3Q8UA 2XC9A 2GGPA 3GMGA 4CI0B 4G2ZA 1XMQJ 4JI2J 1EAYC 4PTKA 4LF2A 4PWWA 2DNKA 2HK3A 1RWKB 2N3OA 5GAEI 3GP9A 2R7RA 1UTHB 2XWIA 2GJIA 1QVGR 2B56A 1IMAA 3B78A 4NXMJ 2N82B 4Y2AA 4NI2B 3NGUA 4JP8A 4RLEA 4TQSA 5K8MA 5I5PA 2ZNTA 4P9SA 3GJTB 4LF1A 1QLNA 1XTZA 2H48B 1FEHA 4QFPA 3TARA 3AQPA 5BR8J 3BGUA 1USYE 4K59A 3BR8A 3QO9A 1M1KT 4F3OA 4V19J 2NUHA 4MJKA 1CE2A 1AT1B 3UR3C 2DNRA 3PV8A 3CCSS 2PT1A 3VE1B 4WFBQ 2XG8A 3W9WA 1IBKF 5IFMA 2JWNA 5C25A 1RKMA 4NYPA 4A8QA 3BS9A 2PA3A 3M8ZA 2J6TA 4GLIA 4JOUA 2P0SA 3C16A 1VS3A 3Q27A 3VXCA 3DLEB 2YKNA 4NF6A 4DQIA 1RAHB 4Y2MA 1SJ3P 2W8LA 1U7LA 1WOPA 1S49A 4QWDA 1NJYA 1LEVA 1IQTA 2V3UA 4Z2XA 2N7CA 4DV7F 3QSLA 4AUKA 2IA0A 2XXKA 1IBLF 4P52A 2Q6CA 3UCGA 3POTB 3D6FB 4N47A 4UTGA 3RTFB 1NB7A 2F7AA 3DRPA 4IY6A 1SQGA 2YNGA 5EYHA 1K0TA 1FWPA 2R3VA 4EZ6A 5FDLB 2RDJA 1Q95G 2MSTA 3H06B 4BWJA 2ZUAA 3B54A 3SKPA 2A3JA 3DI6A 3Q26A 5BWJA 3M2RB 2UUBF 3C35A 1SKRA 3MAAA 4ECXA 1P8GA 2HHWA 3VTIA 3GBAA 3RBXA 3J7A1 3E3XA 2CJXB 2WZ1A 3MHYA 1B7UA 3DMJB 3L09A 1ZJLA 1JXEA 3G6YA 3TCHA 3B8HA 1PIEA 3AOCA 2KHDA 1FKOA 2QS2A 3O29A 1VQKS 2W4PA 2CJBA 5J2MA 3S9LC 2YLNA 2XHDA 3N6TA 4GWYA 1VLYA 1HSJA 1NJXA 2XX7A 2F7CA 4RNFA 4EBEA 1N54B 2H99A 1WC3A 4USIA 3KSXA 3FJGA 2BJJX 1QJMA 5CMBA 2DKOB 4ALZA 4MFIA 3RU0A 2VDIA 3CO0P 1Z7NE 4ZVEA 4CZCA 4ECYA 4RX6A 2W8KA 2K7KA 3QJJA 1N56A 4JSOA 2HFUA 1S4EA 1WKKA 5IM0A 4XFEA 3HJVA 1QE1B 1N5TA 3JYTB 2ZD1B 4NTLA 4MCOA 2WW8A 2KG1A 1QM9A 1JLBA 2KZMA 4ELRA 1PG5B 2XXWA 1FPEA 4LQ2A 2DEJA 4LF6J 3AB4B 4R2BA 1HBUA 2H1YA 3HKWA 2XMUA 3DOMA 4ZP6A 4MK8A 2VPNA 5IT9U 3U1MA 3DGVA 2FC9A 3ZTQA 2RIJA 4M5JA 3RLFE 3VGVA 1RYXA 3SESA 4JWOA 2QIFA 4PF8A 4I64A 4YMAA 4PBQA 1LAXA 4ZA1A 5CMMA 1Y3KA 2BRKA 3CG1A 2WVCA 4QSDA 3GE9A 3D0HE 4N8NA 5H8NB 4CNZA 3PKYA 5EYGA 2CQ3A 1WDTA 1FJ7A 2C2RA 4DPYA 2POKA 5ADZA 1H98A 2FB0A 3C6TB 1KONA 4QFKA 3I9V9 4LREA 4HEA9 4EO8A 1JEVA 2HBYB 2QTWA 1JEUA 3M8UA 2B4VA 4OVRA 1RQ0A 5LMUJ 4A46A 1LXNA 2QN6B 4B9MA 4M94A 1FPIA 5B09A 1YBTA 2ZZXA 4ED8A 3D3CJ 1VSOA 1RAOA 1TT1A 2DCUB 2IDEA 3KFMA 2ZBQA 3BKTA 2EBGA 4LFCJ 2OPRB 1YJ9S 2P1SA 2M2BA 4XTTA 2DXRA 5L1KA 2ALYB 2BEFA 3JSRA 3BN7A 2J9DA 1HBOA 3THVA 1RJJA 4RUHA 1EX8A 2QLFB 5E3RA 2XS2A 1JB0C 1EYJA 1T11A 4ED6A 2YNIB 4NLRA 2UUAJ 3TNVA 3OLBA 2PMSA 5IT4A 2FHKA 1V5VA 2KFZA 3NKYA 1S1WB 2L9DA 4CLLA 1HNVA 3KDOA 1IJFB 4DQRA 4DFPA 5ETRA 2RRBA 2WBMA 2RDIA 1VK8A 4H46A 3HT0A 1KQKA 4OA4A 1TMMA 2BQUA 1EU8A 3KFWX 2LDIA 3I0RB 3AH6A 1U1MA 4JUZA 4BDRA 3IG1B 1YKWA 2BX6A 5DZ6A 4WFZA 3W8GA 1OIAA 2RCAA 1N36F 3FEYB 2IDLA 4M5LA 3N6UA 1C4CA 4DBQA 3CFXA 4C0BA 2D9OA 3HSTA 2IYIA 3PIOQ 2QS4A 1RA7A 4ZVUB 2P3VA 3M6WA 2PEHA 3MUQA 3C32A 5KFBA 4C98A 4LR9A 1TK8A 1FJEB 3ET6B 1S9TA 5HROB 1KFSA 2FLLA 2O51A 2Y8YA 1MQJA 4NX9A 1CQNA 1LFGA 3AODA 1HMVB 1OQGA 3PUXE 5IAIA 1J1NA 3Q29A 1G0IA 4A48A 4P9KA 4GXAA 4YEAA 4NWBA 3D5MA 2EK6A 1HL6A 5CAAA 5IZ3B 4ILMA 2CQBA 2C3UA 1OIBA 4XDDA 4YB6A 2YWWA 3MP8A 2HVZA 2QFLA 1S6QB 2XNRA 2DYAA 1A0OB 4DR2F 2PT0A 2BJ7A 2FYIA 2P8IA 4QXDA 4IKAA 1HKAA 1IKVA 3D1HA 3HF5A 2BXJA 2RQMA 5KZTA 4OJ3A 3QRRA 1C1CB 4KCDA 4M5NA 3RBEA 1QSSA 2BYCA 1NLKL 4QJVA 1UVIA 1WF1A 1B7ZA 3GYYA 2HFSA 2WRMA 1WVJA 1H7WA 3BBCA 2Y7RA 1L3KA 2DIUA 3M8PA 4OWDA 2XMWA 3LSXA 2Z8FA 1RBAA 4U2RA 4Q7AA 4QZVB 2GJ2A 4NWDA 3MM5A 4ZKAA 4DXBA 2WBRA 5HI7A 3GV5B 1OPIA 1Q7YT 2BM1A 3DYAB 4U23A 1HQ2A 2XWVA 3BIHA 4KV8A 1VBYA 4ELPA 2E5IA 4N56A 3MAQA 1IMBA 5CC2A 3RAXA 4GXSB 3CJQA 2CG4A 4QIEA 4H45A 3I32A 2YKQA 4NF5B 5B0BA 5F8GA 1T94A 4NF8A 3CIMA 3DLJA 2GHPA 5ESYA 4MTPA 1I94F 2WVFA 2ZNUA 4ANEA 1VJQA 2W7YA 4M95A 3JTPA 4PQJA 3EJMA 2PN6A 1IXKA 3T5KA 4K4XA 3TKDA 5I42A 4O44A 3ETMA 1TKZB 2APOA 4ID8A 1ZM2A 3KC0A 4N15A 3G4SS 3QIPA 4I2QA 4IO3A 2X3GA 3R5DA 1W25A 1WC6A 2R2TA 1PBUA 1RHUB 3G86A 2YNHA 4U21A 1LSTA 4JI7F 1UTHA 3ZTPA 2F4VF 4EQ7A 4WKYA 5KFJA 4GMKA 2G1HA 3ISPA 1J5EF 3D1QA 4NI2A 3BBBA 2A6OA 2EKNA 2VOPA 1F2HA 3QMFA 2NPFA 3RRGA 4TYBA 1ZBMA 3R97A 1ZM4A 3CJ0A 3RB6A 4LF9F 4O0NA 4FXWA 4DCYA 4LZ5A 1RHMB 1EP4A 4YAHX 2DR8A 2O5DA 4HH1A 1FERA 2V2ZA 3WIVA 3JTNA 1T03B 4G3IA 4DV0F 3AY0A 2P9CA 2QFIA 3PTYA 2ZKUA 3GJSB 4OZ5A 4L75A 4B3TJ 1LLSA 4QFNA 2NXEA 3OPKA 3AJ2A 2GS8A 4YS2A 3FXUA 2CQ4A 3P5TL 4ZDNA 1AB8A 5IZHA 1U8WA 1RTJB 2Z30B 1B0VA 2K3IA 5HAOA 4B3MJ 3V4IB 5L46A 4P1EA 2OLWA 4PFBA 4IH7A 2FHYA 1X9SA 1D9VA 1I5OB 4OLOA 5L1JA 1PJ7A 2FVRA 4JI3F 3POTA 5LSRA 4PG5A 5L9NA 2Y7WA 4FJPA 2R8TA 1KQGB 1N5SA 2V8HA 1O8BA 4N8OA 2ZBPA 5FDLA 3M2VB 4H8IA 4BC7A 2DH8A 2W2QP 3M2RA 2CZ4A 3BSNA 4B3RF 4MJOA 4ZEIA 2MQMA 3DMJA 4OESA 3HHNB 1MM7A 4U7UD 2HRUA 4YMBA 1YRTA 2DNNA 3ZNUA 3TAMA 4HW8A 3NBPA 3MTKA 1SKSA 2MHNA 2BJ3A 5D77A 2M88A 1APSA 3Q2SC 2Q2CA 3TQ1A 1DSNA 1T0TV 1FBFA 3PX0A 3EZUA 4OZLA 3FIRA 1NL5A 1FFSB 3VLWA 5B0AA 1JLCB 3A3UA 1FQBA 1RUSA 3GJQB 1VDHA 1EETB 7FDRA 2KZZA 1TKXB 2GVDB 1QE1A 2JFDA 2GQ1A 1R1NA 3MVYA 1WTBA 2CEXA 3H5SA 4GVBB 5E3CA 4GOTA 5AE4A 1YAEA 2E1PA 1TV6A 3F0NA 2AQ4A 2QLWA 3TVZA 3JYRA 3H0PA 4OZNA 5EYFA 4O3CA 1RDZA 5GAEU 2KXFA 5J1NA 1NDLA 2XY6A 1NSAA 5M2RA 2FLOA 2DK2A 3E51A 4LF4J 5KG1A 3NRBA 5EGYA 3NS5A 1U49A 2XS5A 3CD6S 4J9UE 5L9OA 3PFOA 3TUZC 3GV7B 4NLXA 4U8VA 3R9LA 1WDNA 4RBVA 4KPYA 3DP6A 3ZO7A 1GXUA 2CQCA 1K0VA 1A8EA 2DXEA 5B70A 4C8ZA 4DR5F 5H8NA 4B9NA 4QW9A 2W7OA 1PC5A 1O64A 4Y2KA 2GNKA 1WC5A 3C6TA 3PPNA 4TY8B 1RAEB 2MJUA 2THIA 4OJHA 4URGA 4F3QA 3B7DA 2XD3A 3CUNA 1U2CA 1NDCA 1SW5A 1Z1ZA 4OQOA 4PGNA 4X4TA 3B8BA 2Y0BB 4MT1A 1FCAA 5DM7Q 2P3NA 2BJ8A 2HXRA 3V6DB 1ZH5A 4O7IA 3QT6A 4IOAQ 3TELA 1YXIA 2H51B 1S97A 3O28A 2J7KA 2XX8A 1PYSB 2OPRA 1AXQA 1N0TA 2FHOB 4O3PA 4DV2F 1SW4A 3SFGA 4DCJB 1B40A 3CD7A 3N0VA 2YQ3A 4GVLA 2CA9A 1ZAXA 4ECVA 2Z56B 3UDLA 3PMXA 4XDCA 4DL0C 1LBBA 4OLPA 3VZIA 4ZHRB 2QYGA 1NSKL 2V2VA 3IB1A 2NZ4A 2YNIA 2J0WA 4QIWD 3TR5A 4PP0A 2HPGA 3GZGA 1HSLA 2EXUA 2C2OB 4QQBA 1S1WA 3PUYE 3KLEA 1KOHA 4EBCA 2CQ2A 2OUGA 4N5SA 2KG0A 5L9XA 4RK9A 2OMOA 3CJ4A 4B3OB 3DLNA 1RT2B 2C2MB 5L8DA 4RNSA 2EW9A 4F4ZA 1B3FA 1EZPA 1A7GE 1X4GA 4JBCA 3BBFA 3IG1A 1XI6A 2H5JB 3TUPA 2D21A 5AE2A 3M3FA 3N5FA 3C66A 3E9XA 3ADAC 3FZVA 1CJVB 1DHMA 2FVQA 1MDQA 4Q8RA 1AROP 3RJMB 1B51A 3KG1A 3EVWA 3ET6A 3CJ5A 2VB6A 2J8AA 1MXVA 4CLUA 2QV6A 5D4PA 2R8JA 1N8RT 3KOAA 1HMVA 4LQ9A 4TY9A 3LWLA 1N34J 3CDBA 3KLVA 4QIFA 3H6TA 2XXHA 3SZPA 1BWEA 4F02A 4MH5A 5BXIA 4X1DA 3ENVA 5DG7A 4L3NA 4X2BA 5LJ3Y 1B4SA 5I2NA 1FE0A 4HVZA 3UPFA 5KFWA 2WBBA 3TCFA 4XK8C 5IZ3A 3EVMA 4Q30B 4IUFA 3GLJA 4OYVA 2HURA 2PO4A 2I0XA 2LP4A 2DVZA 4JI1F 4JI8J 1U1KA 3ITHB 5C2GA 4J9NA 3DXBA 1VOMA 1U25A 1KVKA 3CRBA 1QTMA 1K44A 3I82A 5T7LB 3OFEA 4DV5J 2DE2A 4CCHA 4F26A 3FD3A 3HKZD 5M2UA 2OIHA 1L3SA 1WEYA 2Q66A 1YZ0A 2MKYA 3N6NA 4DV4F 3SDEB 4ED3A 3JSMB 2VQEJ 3QAUA 4B9SA 1J5EJ 1MQDA 1VK3A 3UCZP 5T41A 4KPCA 2E1CA 4IH5A 5CA5A 5DDPC 3QT8A 2EFGA 1LAFE 4NA3A 2DNYA 2DNOA 4U4XA 2OAUA 2ACYA 1NB2A 1RWWB 3DKDA 1IEJA 3WX8A 3FVGA 5B0EA 3DYAA 4G6VB 3W62A 1WC0A 4ZVRB 2FVCA 2LECA 3D66A 2MDAA 1FDBA 2XLJA 1F2GA 1R9QA 1IXIA 3U02A 4X04A 4F4YA 2VP1A 5EWEA 2W9CB 1UPMB 3O1LA 2GH9A 3IX1A 2Z23A 1YTVA 1YJUA 2DVIA 4UQGA 3AA9A 2QS3A 4MK7A 4PDHA 4R25A 4EGLA 2GIRA 2F9DA 3LALA 4HT5A 2ZH7A 3FZBA 3MR2A 3PW2A 2GO8A 2MKKA 2EEYA 3UWTA 4O4GB 3IR6B 3OO8A 4C48A 1XNRF 3Q28A 2RU9A 3MFHA 2KXHA 1U45A 2RUSA 1SW1A 2B65A 2PE8A 2NYHA 1FWKA 2RE1A 3GYNA 4H4MA 2Y5KA 2KJVA 4B3SF 3LC8A 3ILIA 3MM7B 4PRFA 4YFUA 1YI2S 3JB9k 2R7VA 2VC0A 3EPGA 3TZXA 4P73A 3EGWB 3GCWP 1M5PC 3J7YI 4NXNF 2RQCA 2QLBB 3G82B 1MRPA 4NCBA 3PHEA 1AZSB 4DCXA 2LAOA 2HEKA 4F3BA 2IA6A 5HMYA 2OBGA 4GWWA 2VFRA 3PUVE 1URDA 2XMAA 3OTOF 3FQKA 1QTNB 4MBPA 4LUBA 3K57A 2VH7A 1RAIB 1T03A 4AL5A 1Q53A 5I84A 4YDXA 3TJ9A 5A5LA 3HHGA 1KFDA 3S9MC 1URGA 4NASA 1YYZA 3IJXB 3CJ2A 3Q8YA 2B9WA 4IG3A 4ZN1A 1NUZA 3HVAA 4YP3A 3EQ1A 2XSJA 3KJFB 3V4IA 5IT9Y 2B7CB 2E5LJ 3KOSA 1WSRA 1JXLA 1HQEA 2CNOB 1RACB 4EYHB 2QSFA 2E9RX 1JLAB 3BN4A 3M2VA 5HBMB 2ZZNA 4AL6A 4LRAA 1KTVA 3KXDA 1B05A 2HWIA 3KJQB 4ZVPB 5K2YA 1ZM3A 4M63A 2BABA 2MZSA 1MXXA 2QL7B 2BW7A 3LPYA 5B7DA 1SUQB 4A8SA 2KL8A 3TZAA 3N6MA 5KFRA 1PJ6A 1R0AB 3QLHB 3MMJA 3KG4A 4RBTA 1S1UB 2PD1A 4ZJQA 5CBRA 1B4ZA 1NUXA 4F31B 5SZTA 4JDFA 3KDNA 2BKNA 3EZOA 4G8HA 4NA1A 2P6SA 3N4WA 1SIWB 2YWHA 1UTBB 2CPXA 3TPAA 2E29A 3AA8A 3PW7A 4C8OA 3K6VA 4LATA 4JV5J 5K5MA 6FDRA 4F67A 3PY8A 2Q89A 2Z22A 1EETA 1TKXA 3THIA 1TK5A 2MY8A 3AQOA 1A55A 2HFVA 4LVOP 4GVBA 3H3GA 4PFTA 1FKAF 1S79A 1MU2A 1GAOA 3NG8A 1HIYA 3MPYA 2GA7A 3EM1A 1UP1A 4P7VA 4PQUB 1NV3A 1JLGB 1U48A 1D8YA 3O6GA 4DX5A 3MM6A 2UVWA 3V8XB 2VT5A 3H90A 5DQHA 3OXNA 1URNA 3IWNC 4LF5F 2Q6BA 3PW4A 3CO9A 3MURP 1VRQC 4OYPA 4PAAA 3G3GA 3FCWA 1H74A 2QPQA 3PVXA 3K1PA 1Y4ZB 1PO6A 2IRUA 4DZ6A 3H40A 5IWAF 3LV0A 1GGGA 3RW6A 2MQNA 2KT3A 2H4IA 4UF4A 2DHAA 3FZ2A 4ECRA 4MEVA 5DQGA 1L3VA 3E79A 2E7WA 3PRBA 4OX9F 2ZHAA 1TXFA 2EFNA 1OY8A 1DJ0A 2V68A 2F6PA 2XHWA 2VPOA 1PDAA 1RE1B 4X48A 2G2OA 5IT0A 3B4DA 4QSEA 2C2ZB 5C7PA 1HNWJ 4TY8A 3OOAA 4EUOA 2FIXA 4AS5A 3K01A 5ET6A 4XIUA 4XKRA 3V81B 4F3GA 2MKJA 2XMMA 4DR4J 1OQ6A 2JLGA 1XMBA 3LO3A 4DL6A 4JI0J 1ROFA 2DOJA 1U2FA 3CCJS 4YY3J 4KXPA 4RY1A 1TFDA 2LEAA 4ED4A 4KD5A 3GIJA 3C2PA 3NWRA 3USDA 3VVDA 2ZYNA 4HTJA 4CTAB 4BDNA 2OZZA 1SIZA 1HNXJ 4DI6A 1SJRA 4J9MA 4C3MA 1KWMA 1C2PA 2H5IB 2PYYA 4ZMMA 3K6UA 3DRSB 4DL4A 4H5GA 1PEBA 2JVRA 3M9NB 2YWKA 1XQIA 1OMSA 3FK4A 3IORA 2GCFA 5C42A 3N28A 2KDOA 4B3OA 4W92B 3MCMA 1RBLA 2PIIA 4FKYA 3FGVA 2I9SA 4WCEQ 1AW0A 1KDNA 3M8RA 4X62F 4MKAA 2DRAA 2YBVA 3IFEA 3QZ7A 3NP5A 4DS5A 2LQ9A 4GKJJ 1FTOA 4V1Ak 2W4DA 5CYMB 1F1BB 1S0VA 3OVSA 2H65B 5B0FA 3C15B 2Y84A 3MTJA 2F7BA 4N17A 4F4KA 4U4SA 1N32F 3T96B 4XKNA 4K50A 1B3GA 3C14A 3PZPA 3KOTA 4UY8T 2UXBJ 3MZBA 3IO6A 1HYSB 1B3LA 2HHQA 1DQ9A 2OPPB 2R7WA 1RYOA 4EWTA 1NK0A 5HVHA 1RSCA 2F3JA 4JV0A 2VGQA 3CIZA 1Q8BA 4AL7A 1RWOB 2IMWP 3VWSA 3AJDA 4RNMA 1M0SA 3BKFA 3D1OA 3NCRA 1F9FA 2B4LA 1RLCL 2GZOA 3RAMA 2XWYA 4HCWA 4JI6F 5T7LA 3BR9A 5THWA 2QJ3A 1POTA 3FJ2A 2OD4A 2DWIA 3CDEA 3EE3A 4FVMA 3W2WB 3MZ1A 3BSCA 5HQMA 2O1PA 4JWXA 4FBTA 5KG2A 3JSMA 4OHXA 4AT1B 1LXJA 4F19A 4MX6A 3JSYA 4K2XA 4AQYJ 4KR0B 4KHPF 4Q5TA 3ICLA 1A6LA 5C5JA 2AIRB 1YJ7A 3CXCR 1FFGB 5D0GA 3KGCA 2H9BA 4JV2A 2XLKA 4GWSA 1YVFA 4F36A 1B70B 3W5ZA 4NG7A 3U93A 1UJ6A 4M5GA 3D9BA 4F50A 1ACMB 3MUTP 3EYZA 4MLQA 4DDFA 4MMOA 3MAMA 5CYQA 3EKIA 4DMZA 2ZH3A 4DSFA 1CQMA 1CPZA 2YQ0A 4PQAA 2W9CA 3K7RA 2H5YA 2FLNA 5AA1A 3R6UA 3EZ5A 4TOZA 4XPEA 1B0LA 2M9KA 1RWPB 2IFXA 3GB0A 1DCUA 2VG5B 3BGLA 2QVVA 1FTJA 2MJNA 2BOAA 1E6VA 4MNIA 1RT5B 4JYAF 4CLTA 5TP9B 1R8BA 2ZVSA 3T5LA 2BUNA 5F0UA 5DDOC 3UE2A 3MPVA 4O4GA 4J9RA 3K2YA 1M5CA 2VC1A 4X4UA 4KGXB 4CO1A 4DDDA 1SL2A 3DLKA 4BWMA 3I96A 2HHMA 4F4XA 1MMLA 3GU0A 3TVYA 2DS9A 5KFUA 2D1CA 2W7AA 4NLYA 3BQ0A 1DLOB 3X3UA 1SL0A 3NY0A 1IM4A 4Y3CA 3I3VA 3TX0A 3PYEA 4ZIWA 2YNFB 4CLWA 1UZHA 2QSWA 4WK1A 3P96A 2AYSA 2AW0A 3G82A 4OEVA 1C4AA 1D9AA 1OVBA 1NK9A 1AZSA 2V2QA 2HIQA 4NLTA 2AGQA 3VVFA 2I0CA 2QZ8A 3TJ8A 3L7UA 2Z8DA 1OMPA 5JXSA 1QUVA 4CM2A 3K00A 3OENA 3SQGB 2NOOA 1FRJA 4DUZJ 2VODA 3ILLA 4OYZA 4ZCLA 2V2KA 3NGSA 1XHYA 1WD6A 2AV5A 2VQFF 1M1HA 4J9KA 1P6TA 4JVIA 3CE8A 4DFMA 4ED2A 1SI9A 2Q8MA 5A8KB 4HHUA 4AB5A 1U0HA 1YWXA 4DR7J 3CVKA 3LPEA 4NLOA 3ILJA 3RBDA 1MQIA 1SQYA 1Y9UA 1HPZA 1S0OA 3DP4A 3QGIA 1JLAA 4MH8A 4DLEA 4J9PA 4P8BA 4B9VA 4WU3A 2IPOB 1ATGA 3RR7A 4MFBB 4ZVHA 3L95X 5HANA 4CLYA 2HZCA 1EYIA 2KU7A 2FDNA 3OR2B 4HACB 2W2PP 3P3DA 3QYTA 1FTMA 4ZPBA 2NSCA 4H67A 3CNQP 2UXCF 2B4OA 3U65A 4LF7F 3KK3A 2PEBA 3B50A 4H4OA 1R0AA 3QLHA 2E1AA 4Q0BB 1S77D 1FBGA 1B3TA 2MY7A 4O3OA 2IVFB 4NF4B 5AXLA 3EDRB 1T9VA 2Y5LA 2F65A 2H4YB 3H59A 1CSJA 4C4WA 2GHBA 1UTBA 3CCTA 1D8ZA 2Z58B 3ISZA 1HNZF 2GVZB 1YZ6A 2CZVC 1ANFA 2RQ4A 4WFAQ 2RINA 3C31A 4W90B 2MEWA 4DZDA 3P8BB 2I3WA 3J7Z5 2MZ1A 4E0WA 3H20A 2L48A 2F63A 2V25A 1FRXA 3BKIB 3K58A 3RUMA 1PB8A 2WYPA 3H7HB 5AJ3F 5ET8A 2QT7A 5D4NA 1MY3A 2VF3A 2MGZB 3R5BA 3U92A 3GILA 2R7QA 3VAJA 1FQAA 4NYZA 2EK1A 2FY8A 2HLTA 4P71A 3UR0A 2BW2A 3T1HF 1MH4A 6AT1B 2LLZA 2Y1LB 4B02A 4LSZB 5I58A 3VAFA 2HZAA 3K0VA 3EX7B 2BQRA 4FNIA 4J9VA 5KG7A 2XMKA 3ECRA 2HWHA 2ZBCA 3BPDA 1Y5NB 3TCGA 4K0KJ 1NEEA 1BMQB 2ZH8A 3TX8A 1JNRB 1NNDA 4R2FA 3OTDA 2OD6A 4A8XA 2ZWPA 3MC2A 3VQTA 4IGRA 4X8RA 4XKPA 5E33A 4FKXA 3IS9B 1HHQA 3DN9A 2I2YA 2GV1A 1NDPA 3KG0A 3V81A 4OVJA 2MSSA 4O3AA 3FV1A 3G8SA 3FATA 1QDUB 1NK6A 2E7XA 1A54A 4GWZA 2F4FA 4LP2B 3W2VB 2OWTA 3OXLA 2AJ0A 1JW5A 5E3QA 4FBPA 4DUYJ 1N6QB 1UW9A 2I5JB 4CTAA 2XXTA 5CBSA 4GIZA 1Z4UA 3H5UA 3B4MA 1RAFB 4NA2A 1DTTB 4OZ0A 1VQMS 1BGXT 3GTYX 1T05A 3K5LA 1X4EA 1VFDA 4QFLA 1P99A 4LRCA 4CP5A 4R75A 2R7UA 3DRSA 5LOMA 4C3LA 3BH7B 4DSIA 1VR5A 1L3TA 4KPTA 1UAWA 4F22A 3VVUA 3PHTA 1Q5YA 4YKIA 1RABB 4WYWA 1EIYB 4R6YA 3IAZA 3NLCA 2KB2A 2W01A 5KFDA 4IH6A 1IQZA 3S1TA 1SKUB 4BLAA 1OJ4A 4KYDA 2ZWOA 2ATLA 1R3NA 2JEGA 2E9TA 5D3GA 3O44A 1B58A 4GKKJ 4UOCA 3OHBA 3NMRA 2VIHA 3FXRA 2IVYA 4ILLA 3TOQA 4CNYA 3R6GB 3IC1A 5ETKA 1BWVA 2V4RA 5CYMA 1AMFA 2FJAB 4UQTA 1ZZFA 2NLWA 5EQAA 2F9JA 2M7SA 3K2DA 3EXCX 3C15A 3UDCA 1UCNA 3KN7A 1FBPA 2CJYB 1S1TB 2VFUA 1U26A 2XZWA 3FBCA 2R6GE 3HJFA 1XR5A 3UD3P 7FD1A 2CQDA 3R7XA 1HBMB 4FBUA 4FF1A 1HYSA 1F5CA 2OTJS 4OFOA 1MSWD 5F7VA 5KFEA 2OPPA 4DL7A 1QW0A 4G1QB 2HQFA 1U1RA 3MQ9A 3RW7A 3R8YA 3KJ7A 1CJUB 3OSRA 1UETA 3PPRA 4EF1A 1ZKBA 1FVQA 4RZRA 1B3EA 3HHLA 2V94A 2GW8A 1YJRA 1USYH 2QMWA 3W9VA 1NXIA 3P45B 1M5FA 2H98A 2V4JB 2ZNYA 1RT7B 1OWXA 2A2CA 3CJKB 2I49A 4LRFA 2FHJA 4B17A 1FXLA 1MDP1 4TVAB 5ET5A 2R8IA 4YHHF 2FTRA 4ICLB 4RXLA 1ZYQA 4CH1A 3UP9A 2QYCA 2M8HA 1VRTB 3MF5A 1DRZA 4PXBA 4EMDA 1D9YA 2Z4PA 4DUTA 2XX9A 1YIJS 3AOBA 1UZDA 5SUHA 4ECWA 4PG7A 3LSWA 1NU4A 2YWEA 3BYRA 2PFDA 2Z8EA 4ECSA 3TEHB 1HSEA 4ZVOB 2CFXA 2PC6A 1N3XA 2BVZA 2L08A 2HNYA 4LVNP 3ISND 1VGYA 2QS1A 2RJZA 4J37A 5D4OA 1OSDA 2I1RA 2AL4A 3HULA 3LGNA 4M1KA 2Q2AA 1JVYA 4N07A 4F18A 1RT3B 3LP1B 4U8YA 3KK1B 1JK9B 4PBHA 3I31A 2VG5A 2CWXA 2XD2A 4TU9A 1WHXA 2YKAA 3OTCA 1R43A 3IR7B 2PT2A 2MQOA 5TP9A 4DFKA 2UP1A 2DE4A 2HQ3A 1K9MT 3HVTA 4MAGA 1KBRA 1JWWA 3D1RA 3F41A 1WG5A 3LANA 3FXQA 1CS4B 2DNPA 5ELVA 4JB7A 3NL0A 1N76A 2FNCA 4PEOA 3DRYA 1JETA 3RPWA 3LW5C 3OEKA 2A0FB 4PFUA 4J9LA 4G65A 3FJ7A 1DLOA 2XXXA 5KFMA 1IR1A 1VFEA 2A5TB 1LBWA 1JLFB 1R6YA 3V6JA 2VG7A 1P1TA 1RTHB 1X4AA 1UJ5A 3M32A 2C42A 4D3HA 1NV5A 2I6EA 2GHWA 2UVGA 5IZZA 2HRTA 1REGX 2D41A 4DHVA 1KR4A 1LW2A 5KFGA 1RU2A 2PGCA 3TA1A 2F5GA 3G96A 2RDDA 2DH9A 4RBUA 1G6BA 4N6KA 1S1XA 2XMTA 5DM6Q 2L5VA 5JMNA 1B7HA 3UQSA 1YJWS 3QT7A 1KEKA 5KFFA 1P1QA 1YG0A 4EQ9A 1LV5A 1FPBA 3SQGA 2KJWA 1BQMB 1UIUA 4OENA 1U09A 5U47A 3DC2A 3QAEA 3TP2A 2WOMB 3FBBA 1NDKA 1X5PA 2DHXA 5L1IA 1RT1B 5A8KA 2R7TA 1ZTYA 3ILOA 3W3SA 3IAM9 4WF9Q 3RG6A 4E8UA 1VC6A 1VQSA 1HNIB 4FN5A 2PSZA 3VV5A 1VQYA 1RT6A 2XMJA 1HI0P 3EN3A 2QC3A 1RHRB 4IO6A 2AIXA 1PBAA 1FK9B 2KXNB 4HR2A 4FAJA 3FDSA 3D0IE 3FUYA 2BE7D 2W9AA 3MVXA 3M8WA 5DT6A 1CVJA 3GFXA 4HACA 1ELOA 3VR1A 1KRPA 2AX0A 2FPHX 2B0GA 2DVCA 3HVRA 3LF0A 2DD8S 1RHKB 4RW9A 3QFWA 2X3DA 2ZNZA 4NGUA 3HHLD 3HHDA 3TI0A 5BYQA 4MNPA 3CDWA 3T6JA 2XI3A 1SB6A 2F78A 2HFOA 2ZM6J 2JEFA 1YTYA 4NF4A 4PETA 1UPPA 3OEMA 2V8PA 4N8YA 3TYHA 3LP2A 2FHJD 1VQ5S 2GVZA 3CSKA 4A8YA 5EWFA 4RW7A 5GAHI 1QJHA 1FJCA 4PFRA 2ZH1A 1II5A 2ZEJA 1LBXA 3ZTRA 3BJYA 2XY7A 5IV3A 3LAMA 4YDDB 4DWIA 1TL7B 4KKOB 1T9XA 5D8HB 4MLVA 4XKQA 3TQEA 1Q9DA 4I1TA 3FGSA 3RBZA 4QWAA 4ECQA 3UA8A 3FMBA 5GMEA 5DS7A 2ZVIA 4K4VA 4M4GA 5J2PA 1RLDA 4RW4B 1HWJA 1A7LA 5HPQA 2C3MA 1WJ9A 2MGZA 2X1GA 5DW8A 3VVTA 1KA0A 4ES1A 4B9UA 2H5EA 4MK9A 5HLFB 2BE2B 2UUCF 3RNNA 2M52A 2J5AA 2DQVA 4DV3F 1U6BA 4OVSA 5CCMA 4WE1B 3E8OA 1NV2A 1RWNB 1R6VA 3M2UA 2Y7KA 2LMIA 5BYRA 1XS5A 4IQMA 2HQDA 3PG9A 1L3UA 5I4MA 1NUEA 2HMIB 1BTJA 3DOLB 3G3KA 4DR1J 4LSLB 5H1SV 3LA0A 3SXLA 3NWGA 1LAGE 1OSCA 3S2VA 1NKEA 3M05A 4ZLPA 2KRRA 4OZ9A 2J0XA 5G0RB 5LMNJ 2HQ0A 4YR3A 3IGVA 1I51B 4KI0E 2VD2A 1WSVA 3KLGB 4I6YA 2BANB 3IP0A 4R6HA 3IS9A 4AXJA 5CD4H 5GVQA 1LW0A 2IJNA 5HSPA 5M2VA 1IMDA 1KQSR 5J2NB 4GL8A 3G8TA 3D4JA 4C1TA 1XEZA 3LTOA 1M5OC 3IN5A 1QUPA 1TKDA 1U1LA 2XZDB 3CC2S 1CG2A 1N0UA 1LFHA 2F8DA 3JZJA 1A8FA 4ZLNA 1US5A 3W8PA 3CFZA 3PKMA 3W2VA 1WC1A 4HTIA 5DDQC 3HHEA 2GFFA 2CVEA 2HSEB 4NZ6A 4RUAA 1AOVA 3JQKA 2FIUA 2HS3A 2YKOA 1Y11A 1NFTA 3W9JA 2LXIA 2RC9A 2I5JA 3QIMA 3MMBB 5I56B 4ZVSB 5E0OA 3CULA 4QR2A 4GVOA 3GZ7A 3ZZOA 3IRXB 1FJGF 1HD0A 5DGAA 4IR9A 1WF2A 5KT4A 1XVXA 2ONSA 3EUNA 5ETLA 2G0JA 1JP4A 4X64F 3DOKB 1VQ9S 2MQPA 3R7SB 2RHQB 1SQEA 1FDDA 2J8SA 4BLGA 4NF0A 1W2BR 4F2OA 1LNQA 3WZ0A 2V67A 4I3EA 4OHYA 5HBCA 4O3SA 5DQIA 2ADBA 2QA2A 2BJEA 1LWCA 2BQ3A 2ABHA 3PU5A 1VQ7S 1T3OA 4TU7A 1T9WA 3G9CA 4IOCQ 2HHHF 3M30B 2F7VA 3FKBA 4DSLA 4QWCA 5EHSA 2XWOA 5C24A 2CQIA 4P2FA 5F8HA 1QAJA 4PAKA 4PWDB 2OLBA 3G6VA 4WTYA 3PRDA 4USUA 2XY5A 4RL1A 5KFXA 3H8YA 3T1YF 1X31C 5B7WA 2ANJA 1NH7A 3AFGA 2NXJA 2P5VA 2E44A 1LWFB 1FQFA 1WG1A 4OI3A 2ZJPQ 3EDQB 2FZCB 4GX6A 3H4BA 1B46A 2VHGA 4R74A 2Q43A 4E0XA 4CDIA 2DEIA 1XN9A 3FEXB 1I6AA 1HBMA 1K47A 1N5YB 2UVIA 3NOGA 1O63A 4PPZA 4KY3A 4PXCA 3HDSA 4G1QA 4LONB 2F3BA 1GR2A 2R4FA 1CJUA 1WWHA 2CZ9A 3DM2A 2WVEA 4KHRA 2CXEA 2EFQA 4K4WA 5A8RB 1M5DA 1DTGA 4A8KA 1R9LA 2OK2A 1XWLA 4FIMA 1NI9A 4LFAJ 4KAIA 5KFSA 4LFBJ 4DQSA 2OX3A 3TVKA 1WG4A 3H25A 3EHTA 1OQHA 4DF8A 1UEVA 3TUJC 3O6IA 3T0JA 2V4JA 1D0EA 3AJ1A 2HNZB 3UORA 3LBSA 4DR3J 3EPEA 3CJKA 1SI1A 1NJIT 2V50A 1DBZA 2CIMA 2HNDB 3PUZE 5HMWA 2YQ1A 3AXFA 1JNFA 2DY1A 4C8NA 1R7IA 4ICLA 3TUSA 1S50A 4UZCA 2BACA 1YSJA 5AE3A 3KNGA 2BRLA 4IYQA 4E0DA 1WHYA 2BZ2A 5AA4A 1MN7A 4FYXB 4I6AA 4ATNA 4PKDB 2AGPA 3KMSA 3R5JB 5DVFA 3OSNA 1NCLA 4RNNA 3DCAA 4M5DB 1U2RA 1FXRA 3QBCA 2OPQB 4DXCA 1S6PB 1YZ7A 4KE5A 2E5GA 1RDRA 1MY4A 2ROEA 5A5XB 3RQTA 4DL3A 1KA1A 4OZ2A 1IWGA 2Y1IA 1RT3A 3LP1A 3CC4S 3KK1A 1GX5A 4IY5A 4NHBA 2HVIA 2CVIA 4MF3A 4UUXA 4B9TA 4FVCA 5AA2B 4GRKA 2QMXA 1FQDA 3MM8B 2CADA 4LR8A 5KDTB 2DRDA 8ATCB 2GRVA 3PD8A 2KH9A 4ZVQB 1KZ8A 3VVEA 4PG4A 1CS4A 1ICEB 3MOZA 3MCSA 3NGRA 1S0NA 1VHIA 4Q2MA 3OBIA 3PYGA 1ZM9A 5I3UB 2G9OA 5ETOA 2ALZA 3T1BA 4YICA 3MSTA 5L9MA 2A5TA 3BQ2A 4IFVB 4XO0A 3MFIA 3P5BP 2UXDJ 5KFKA 3EICA 1N33J 1RTHA 2R8GA 3U1LA 1XMOJ 3GSDA 4PFYA 4NLDA 1B0TA 4IO9Q 1ZOTA 3KLIB 5AXKA 3OD2A 3TUIC 4PUOB 3TA0A 2JZ5A 2HFZA 4KYSA 2EG1A 2KI2A 2KVQE 2RRAA 3KBRA 3ZNJ1 2MQQA 1IKXB 2VFSA 1HR0F 4HH0A 4I62A 1MXWA 4I7FB 3R3TA 3LP0A 4ZS9A 2CPEA 1MN9A 5CYJA 5CRYA 3UN3A 3T6BA 1XERA 4