4LUBA

X-ray structure of prephenate dehydratase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
275
structure length
188
Chain Sequence
b'TMKIAYLGPSGSFTHNVALHAFPAADLLPFENITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYLFHQAKIEAVAEIILENYTRFWVLGDETPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFIIDFENHNEKLVSFALEELTSIGIHYKILGKYAVYRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative prephenate dehydratase
publication title X-ray structure of prephenate dehydratase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 54
structure length 188
sequence length 275
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lubA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lubA01
2Q2AA 1PC3A 1OLCA 4IO1A 3DELB 3C31A 3LSWA 1II5A 3H6VA 3QUFA 4EXLA 2QRYA 3G3HA 3UK4A 4AB5A 4OFOA 3UP9A 3RGYA 4OETA 5KCJA 2R71A 3P7IA 1NNFA 4R2FA 4GOTA 4JWYA 1OVBA 1YBAA 4IO2A 3MPLA 4L17A 2P9GA 1A54A 2XXVA 2YJPA 4IO5A 4EQ7A 4EXKA 2IEEA 4ZE8A 1TFDA 2AYSA 3RNNA 2I0BA 3B6TA 1QKAA 1TXFA 2QSWA 3DHWC 1FQBA 4PFWA 1B7ZA 4M4GA 3SESA 1LFHA 4BDQA 1LLSA 1UTBA 1Y9UA 2ONKE 4ZDMA 4E0WA 2Y7WA 3FVGA 2H99A 4ELPA 3S9LC 3OO8A 1MS7A 2RF1A 1B3EA 4MBPA 4R73A 3HPIA 1VE4A 5I58B 2DXYA 4HS7A 4ZEBA 1DPEA 4F3GA 1M5EA 3EN3A 1I6BA 4XIGQ 3JYRA 3JZJA 1D9YA 4MLVA 4R72A 2CMOA 4N6PA 2QS4A 2HFBA 5FHNA 1YGYA 5FHMA 1NL5A 2I0CA 5KCJB 2F5XA 4U2RA 1PB8A 2XXTA 4ONYA 4GXAA 1UIVA 1ZPVA 2OJTA 3DHXA 3U7JA 4U23A 4QFOA 2Y84A 4XKNA 1SQYA 4G68A 2H98A 3IO6A 4LP2B 4ZEKA 1UTBB 4LZ5A 3OMBA 4JDFA 4EF2A 1MM7A 4OEUA 2PT2A 2HXWA 2OWTA 4N13A 3SEXA 4KQPA 5EYFA 1O8BA 4R9FA 1IEJA 1PBQA 4DCXA 2DWAA 1OMPA 3UORA 4F18A 1QJMA 1SD3A 4NF6B 5FHOA 2PMSA 1R9QA 3NRBA 1SI1A 4EQ9A 3D4GA 5DEXA 4RA1A 3KN3A 1URDA 4IO3A 1ZLQA 4M1VA 4F31B 1MH4A 1S50A 4GXSB 2Q9TA 4RPOA 1XS5A 3N6UA 3TQWA 1B3LA 2A5TA 3EQ1A 2O51A 1QUKA 3RTWB 4KFQA 4XTCQ 3LR1A 5DVIA 3P96A 4QF9A 3G3GA 3E13X 4EF1A 2DWHA 1SW1A 3TZAA 4PE5B 3TQLA 4PFYA 4HW8A 3LC8A 3LSLA 2ONSA 3PMWA 1B5JA 4FEBA 3T93B 3DM0A 2I49A 3TUJC 1P1QA 1B1HA 5CMCA 3V89B 1ZMGA 3PUYE 3AB2B 2XX8A 2QMWA 3U93A 1FQFA 2F34A 1LCTA 2HZKA 3KGCA 4ELOA 2ZXTA 3EHUA 4F1UA 1MDQA 1OIBA 3CRBA 2O7UA 3H6TA 3T96B 3WAEA 3TKDA 3KJTA 1B5IA 3ZKKA 3SEVA 3O6HA 5TP9B 2F97A 3FD3A 3H3GA 5H8FA 1SDXA 4P11A 1KS2A 2RCAA 2X26A 1UJ6A 5DEXB 4FE8A 4X9TA 3ZSFA 4RK9A 5JTYA 4QSDA 1R6ZA 1TFAA 2G93A 1VFDA 4FAJA 4U21A 4MH5A 4ESWA 3PUWE 2A5TB 3O6GA 3QAXA 2UVIA 4YU0A 2XD2A 1MY0A 2UVJA 2NYIA 3OOAA 2O84X 2Y7RA 1ZTYA 1OLAA 4O3BA 2R9JA 2ZHOA 2AIXA 5I2NA 1M5DA 5DYHA 1JEUA 3OXNA 3VE1B 1EU8A 3ONMA 3H03A 1DTGA 3USDA 4ZEIA 3TTRA 1EH3A 1QUIA 4ZEFA 1FTOA 3TYHA 1A55A 3FJMA 1RKMA 2XXWA 4OXVA 3DLNA 3TTLA 3RY3A 3LSFB 3TCHA 2DWIA 2PC6A 3A09A 4UACA 4EUOA 2QS1A 4POXA 3M3FA 2I3WA 2HAVA 4AQ4A 3QSLA 4QRZA 3RQTA 1UQWA 2F78A 5H8FB 3L6HA 2HZLA 2I3VA 2NUVA 2XHDA 4PETA 3E9XA 3QK6A 3KFMA 3U72A 3E4RA 5IKBA 3IJXB 1FTLA 3H6UA 3LBSA 2P9EA 4NMLA 4YKIA 4F1YA 4PP0A 2ZNSA 2ZYOA 1I6QA 1RYXA 3R6UA 3QXMA 4JB7A 1L5TA 4ESXA 4GL0A 3OFGA 3MZBA 1DOTA 3L6GA 3S4UA 3IOVA 4NF8A 1BKAA 2Z8EA 3OSRA 2UYFA 3CSBA 4R6KA 3TFLA 2YPNA 1NNPA 1B2HA 1H45A 3PU5A 4Q30B 1LAXA 1H76A 4NWDA 1D4NA 1GTKA 4BLAA 4F2QA 3TMGA 3IXQA 1N84A 1RYOA 4K3FA 1ANFA 2XX7A 3CFZA 4Q5TA 1M0SA 3CSGA 4FJPA 3O1LA 3LUYA 4HTGA 3CR9A 1MG1A 4M8LA 1N7WA 4GLIA 1XVYA 5L8DA 5CMKA 2GH9A 4YB5A 1ZU0A 2NVUB 2F7AA 4ZE9A 1B32A 2V3QA 5JJBA 2REGA 3FV1A 1B0HA 4HCWA 1DTZA 4LUBA 3TCFA 1ZJLA 1Z7NE 4LZ7A 3OFEA 3U1OA 1BIYA 2P0SA 1Y4TA 3V5AA 2DP8A 1B4HA 4F39A 1QVSA 5HPQA 4TOZA 1B05A 1B5HA 1WDNA 4C0RA 1Y3QA 3H7MA 4NMYA 5JEIA 3KOTA 3I3VA 1LSTA 4KYDA 4LA9A 1M5BA 1UJ5A 5I58A 2KLFA 3CIJA 3KEIA 3BFTA 2XXIA 2XXXA 3SERA 1B7UA 3TCGA 4ND9A 4DDDA 3K6XA 1POY1 2V84A 2JOQA 3CEDA 3EHTA 3OSQA 3O9PA 2XXPA 2XXUA 3FASA 1PB9A 4XXUA 3MZ9A 4ECFA 5I2KB 4DXBA 1GV8A 1B46A 2VP1A 2ZYKA 2VHAA 1XTZA 4MFIA 3EF7A 1NKXA 3TUIC 4TQUQ 3TTNA 1J1NA 1LCFA 2DQVA 1D3KA 2F36A 4GO5X 1B58A 4TLMB 3UGWA 3MUQA 3T9HB 4O3AA 1JVYA 2NWJA 4KCDA 5ICQA 3C4MA 3RTFB 1YCJA 5IT0A 3K1PA 2V93A 2OZZA 4NTLA 3TDJA 4NF6A 3SEYA 4C1TA 1URGA 2QJEA 1SW2A 2I58A 3FZVA 2M8CA 3G3KA 1CE2A 1AMFA 5CBRA 3PMVA 3MQ9A 5EHSA 1A40A 1LAFE 2HEUA 3B6QA 5H8NB 2QRRA 3OO7A 2H9ZA 2P2AA 3C36A 1A8EA 3AB4B 1GR2A 3W7BA 3N0VA 1Y3NA 1Y1ZA 4WKMA 5L9SA 4PQJA 3MPKA 2DOJA 5ELVA 4U4XA 3PD8A 3VV5A 4JSOA 1XC1A 4DXUA 2E0SA 1USYH 1XT8A 2GRVA 2D3IA 1PB7A 3S2VA 3VLUA 1U8SA 2GHBA 4KR5A 3S1TA 4U4SA 1A8FA 1MXVA 5HM4B 4GD5A 4F3SA 1Q1KA 4LATA 3C33A 3FIRA 2A5SA 5H8SA 4QHQA 1MY2A 4GO7X 3G3FA 5TP9A 2RE1A 1BLFA 3GBBA 5JK4A 3RN8A 1LK5A 3CFXA 1AOVA 3Q25A 4ZECA 3H06B 3K6UA 3IL1B 4BDLA 4JSDA 1MQIA 3T9VA 5I59B 3L7OA 1AH5A 5CRYA 5AA2D 3K0VA 2I9SA 2RC7A 3W15C 2QL3A 2ZYMA 1DSNA 4P0GA 5F7VA 4FIMA 3VLWA 2NXOA 1POTA 4QSEA 4F3BA 3MJNA 2B3BA 2I6EA 2PX1A 3K4UA 4LVQA 1NH8A 1VR5A 3MVXA 2O69A 3O6IA 2R6GE 1NFTA 2X7QA 4RJZA 1IXHA 2OBGA 3D4CA 4EQBA 2OK2A 1HSLA 3R7XA 4X84A 3N5LA 1LFGA 1CB6A 4WXJA 1GVCA 4Z0IA 1LAGE 2Z8FA 3T9UA 2UXAA 3T9XB 3MP6A 4JBZA 2O68A 3C35A 3HCQA 1FTKA 1IXCA 4G8NA 4BDNA 4G8MA 1QUJA 1TWYA 5CMBA 1M5CA 1US5A 1NH7A 5FIIA 2H5YA 3FVKA 1ZKBA 1N04A 3M3LA 4RPNA 1D9VA 2DVCA 1B1XA 3SKPA 1US4A 2UVGA 4IGRA 3PPQA 3Q26A 3V83A 4P0IA 1QW0A 1H44A 4Z7EA 2RC9A 1P99A 3PPNA 3GLBA 2RKMA 3UIFA 3F11A 1JW1A 4OZ9A 2XXYA 4GWOA 3BFUA 5F1QA 4H5GA 3PUZE 3SEUA 2Q88A 1Y3PA 1F9BA 3FUZA 1XOCA 1TT1A 5I84A 3O97A 5AA1A 2P1SA 3FVOA 4G77A 3PUVE 3FV2A 2KO1A 3K6VA 3OELA 1HSJA 2ABHA 4DZ1A 3B7DA 5CM6A 4GIZA 4DLDA 3SEWA 1OQGA 3K1MA 3Q27A 1MQDA 3A3CA 3UA8A 4DIGA 3MC2A 3RLFE 1O64A 3PD9A 4NF5A 1RWUA 2AL4A 4BDOA 4U1ZA 2WKYA 3FXUA 1MQGA 3OENA 2QSXA 5L9OA 5LOMA 1FTMA 2HQ0A 5A5XA 4Q0CA 5TU0A 4ZZAA 2OWSA 3MAHA 3GZGA 5CI5A 4JWXA 4PWUA 2P9CA 3K5PA 4NF4A 3MBPA 1SW5A 3PPPA 4G8HA 4XKRA 4KD5A 1N3XA 1BTJA 4FECA 3JV9A 1MY4A 1GGGA 3G3IA 4XKPA 3FXRA 1LB8A 2V25A 1MXYA 1LK7A 4JWOA 1H3DA 1MXWA 1OQHA 1ELJA 2HCAA 4NEDA 2V3UA 2XXRA 1MXZA 4RNSA 3C9HA 3M3KA 4MLQA 3SDFA 4ELRA 1Z7ME 4DCYA 3TAJA 2DSFA 2ONRA 5I2KA 3W9WA 2CZLA 3CG1A 1MM6A 4GF8A 3QIMA 5AA4A 3RT8A 2VOZA 4TLLB 3IBWA 4G68C 3MZ1A 4NF5B 4H1XA 4H0WA 4YB7A 1BP5A 1IZ1A 3K2DA 2RINA 3H4ZA 1N3WA 2F6PA 3HSTA 3SETA 1LAHE 3S9NC 3CVGA 3OFFA 1FW0A 4F1VA 5A5XB 3IB2A 1UIUA 1O63A 1B7HA 2CDQA 3O2AA 5DVFA 4DXCA 5KDTB 4IO6A 1OVTA 2YLNA 1S9TA 4IB2A 4YZZA 3KN8A 4NF4B 1NNKA 2DXRA 3K00A 1SVXB 5ITOA 3FVNA 2QS3A 4X1BA 1UJ4A 1ZIUA 2PVUA 1B6HA 1NNTA 3A3UA 5H8HA 1JW5A 1B3HA 3IORA 1DMBA 4OHNA 4U1OA 2GHAA 2QS2A 5CBSA 4BDMA 4YAHX 2NOOA 3M8UA 5H8NA 3HHGA 3THIA 2B65A 2Y7IA 2PBWA 4H67A 2H25A 3GXAA 2ALUA 4AB6A 4OEVA 1KWHA 1T0KA 2RQMA 2DE2A 3RPWA 5I57A 3RT6B 2MDAA 1PDAA 1VFEA 4HCYA 3U94A 1Y1MA 3HHFA 3OO6A 5AA4B 3KWMA 4X48A 5TPAA 1JQFA 2O6AA 2VD3A 3K01A 3IB1A 3QUJA 2HAUA 4IGTA 5IAIA 4ZEDA 3FJGA 3K02A 3AXFA 3PUXE 1FQEA 2XX9A 1QKBA 4G4PA 3HHEA 3MP1A 1P1OA 1QULA 1B40A 3V8XB 1FQAA 3EPEA 2Y7KA 4R6YA 4QFPA 1MPBA 1LBBA 3O66A 4GVOA 2XXHA 1MQJA 1M5FA 5CMMA 4KI0E 3AAWB 2I48A 4UA8A 3I5OA 3C32A 1B52A 2BJJX 4ZS9A 5B70A 4ELQA 2RC8A 5H8HB 5IS2A 5I59A 2OLBA 1MXUA 2B3FA 1B3FA 1MH3A 3KOSA 3TUSA 3Q29A 2V3TA 3G3JA 1VSOA 2QMXA 4Q8RA 1SYIA 5CC2A 3UW1A 4R9GA 4GMKA 5ICTA 4JXIA 5K2XA 3T66A 1B4ZA 5I57B 3DP8A 1ATGA 3VFJA 4LZ8A 3VLVA 4BDRA 3Q28A 5B7DA 1PSDA 4C1UA 2DYXA 3ZS6A 2THIA 5H8QA 5TPAB 4FORA 3OFHA 3MVZA 1SW4A 4H65A 3KZGA 4H6DA 3MTJA 4OWDA 3VVFA 3HV1A 4I8CA 4YKPA 2I4CA 4OYVA 1Y20A 3C34A 4IO7A 3U8QA 5KZTA 4ISUA 2O1MA 3IK6B 2ESNA 1LBCA 3N26A 3KSXA 2LQJA 2XXQA 2UYEA 3RUMA 1SBPA 3K1NA 1MY1A 3OO9A 4H8IA 3VVDA 3O29A 4R75A 2G29A 1N76A 2F6GA 1P1NA 3R26A 1XHYA 1LGBC 3KSJA 4OVJA 4PFTA 4YMBA 3MVYA 3VXCA 4FATA 2O7IA 5AE4A 2ZYNA 1B3GA 4YMAA 1I6AA 2Z22A 4G2ZA 1FTJA 3VXBA 2VGQA 4IY6A 2DS9A 5FTHA 2J0XA 3PV0E 2Q89A 5AA2A 5H8QB 4YICA 4THIA 4KCCA 3MAMA 2VD2A 3IOUA 3UN6A 1H43A 1MPDA 5T41A 2DE3A 3MVWA 1JW4A 4QFKA 3DC2A 2H9BA 4LONB 5DT6A 4GRKA 5AA3A 4XKQA 1JETA 2DT9A 1PBPA 3KN7A 3N6TA 4OTEA 2JHEA 1MPCA 3WAFA 4G68B 3IOWA 3ILUB 4H8JA 1FQDA 1WODA 2J0WA 1O7TA 2REJA 2QPQA 4YKJA 3MWBA 2DWJA 3ECRA 3OEMA 3VVEA 4LQ5A 1YTVA 5FTIA 2OCUA 4KHZE 1LB9A 4GL8A 5ISUA 2UVHA 2Y7PA 2W7YA 1DPPA 3BBRA 2F8DA 5L9MA 3MW0A 5BWJA 1S7YA 4N07A 3OBIA 2F8MA 1A7LA 1USYE 2XD3A 4I9DA 2F7BA 1LKZA 2IA4A 4YKKA 2ZNUA 1MY3A 3PGFA 3H6WA 4OMBA 5HBCA 5AA2B 4RXLA 1B0LA 4FEDA 3BKIB 4OFJA 1SYHA 2D21A 2I4BA 4X1DA 3PPOA 4GQOA 3HN0A 3IB0A 2FGCA 5DVJA 3G7WA 4NWCA 3K6WA 5J1DA 4WEPA 3TELA 3ENWA 2PA3A 4I62A 4PFUA 1I69A 3IX1A 1JEVA 1UTHA 5I56A 2FYIA 3IO4A 1IXIA 5ITPA 1Y7PA 3FATA 1HSEA 4OQOA 2Z23A 2DVZA 3I6VA 4KPTA 4H5FA 2FNCA 1P1UA 4F19A 3OD7A 1N0TA 1LFIA 3IR1A 1EZPA 3TODA 1P1WA 2F7CA 5IT4A 3FXQA 1YPNA 3N94A 2F1FA 3FGSA 5KDTA 4RYAA 2Z8DA 3TEPA 1MDP1 1IITA 3S9MC 5JTYB 3KBRA 4KYEA 2RQKA 3U92A 4POWA 1R1NA 4F29A 1JVXA 4RK2A 3CFLA 3VDFA 3ILTB 3E3KA 3TPAA 1EZOA 4R6HA 3S9EA 4RY1A 2D5WA 3TTMA 3ZKLA 4KYSA 2LVWA 1Q35A 3KJ7A 3IAZA 4NE4A 1FCKA 1Y4CA 4F22A 1MRPA 2LAOA 2E1SA 4IO4A 4F3PA 4ZZEA 1PEBA 2X7PA 2GFEA 5I2NB 3GBAA 3PMXA 4I1DA 4QSCA 3DP4A 3LOUA 3EHSA 3DP6A 2ZNTA 2Q8JA 1IUDA 1AL3A 1IQ7A 4F2OA 4OENA 1UTHB 2AL5A 5I56B 2ANJA 3CI8A 1B51A 1YAEA 3LSXA 5M2VA 4YB6A 3IOTA 3IJOB 4LQ2A 2FA7A 3ENVA 4OERA 1N7XA 4OESA 1EZ9A 3MP8A 2Q2CA 3W9VA 3PPRA 3ODBA 4WEDA 2ZMBA 4IY5A 4QFNA 3OEKA 1URSA 4R2BA 3TTKA 2F35A 1MQHA 1SI0A 3TUZC 4E0XA 4DE8A 5DTBA 1FQCA 3CG3A 3B6WA 2O1LA 3KG2A 3T22A 3O28A 4OFLA 4GFRA 1MXXA 5K2YA 4MF3A 1ZBMA 1R9LA 5EHMA 4R74A 3DDNA 1SC6A 2DE4A 2H4IA 2RCBA 5BUUA 1IXGA 1WVJA 1IIWA 1B9JA 1XVXA 4EDPA 3FJ7A 4NF8B 4QFLA 3HO7A 4U22A 3ENQA 2PYYA 1AIVA 3QYTA 1A99A 2PT1A 4O3CA 1JNFA 2DTJA 1NMUA
chains in the Genus database with same CATH superfamily
4I7FB 1N6QB 4EFAC 4IO1A 3C31A 1N4LA 3G8TA 3NMRA 1GXTA 1KTVA 1R6YA 1UW9A 3K8WA 3G3HA 5KAKA 2V8DA 1F3FA 3HHDA 2W7PA 4OFOA 1QAJA 3J80Y 3RGYA 4LFAF 1NNFA 1KLMA 2G1HA 1OVBA 1LQ9A 4IO2A 3MPLA 1A54A 4IO5A 2DGQA 1TL7A 2EG1A 4MJOA 2AYSA 3RNNA 2I0BA 3MURP 1Y10A 1QKAA 2QSWA 2V94A 4RW7B 5L1IA 4A8QA 2V67A 1B7ZA 4M4GA 4URQU 1UTBA 2GIRA 1TKTA 4M5NA 3BQ2A 4MJKA 4B9UA 3JYTA 1S6UA 4M5MA 3M6UA 2DHXA 3OO8A 2MQLA 2WVFA 1WD6A 4CLZA 4WTOB 3QATA 4RU9A 1SJ4P 4DV1J 1NO8A 1VE4A 2RDIA 2YXLA 2JLGA 2PD1A 4ZEBA 4BHQA 5D3GB 4KHPF 4F3GA 5KG5A 3OUYA 3OTOJ 4NLXA 4XIGQ 1F3VA 2YNFA 3JYRA 3JZJA 3BH6B 2CNNB 1D9YA 3DYAB 1W26A 2R3VA 4R72A 5G0RB 2QS4A 4IG0B 4WFAQ 4F4YA 5A0YB 5F41A 4GX3A 4M5DA 3PYEA 4U2RA 2XXTA 2FZGB 3G8SA 1SVDA 4ZVTB 1TKZB 2OJTA 2CPYA 1X5TA 3VAGA 4MFBB 2XWVA 5B0FA 4QFOA 2E44A 1T11A 2R42A 1G7CB 3R97A 2H98A 3JQJA 4LF2A 4HACB 3MEKA 1SH3A 1PKUA 1Z4UA 1T05B 2HNZB 2BKPA 4NG7A 2XMUA 2OWTA 2B0GA 1SH0A 1JJ4A 1K0VA 2XMAA 4LFAJ 2PEHA 5KFWA 1A9NB 2PE8A 5EYFA 1X9SA 2YNIA 4P75A 1PBQA 4O3PA 1OMPA 1QJMA 2MKYA 3FSXA 3N6MA 1YRXA 4PG5A 1F5BA 1JMTA 1G6BA 1JLCA 2ASJA 1ZLQA 4F31B 1K9ZA 2QA4G 2FJXA 4TVAB 5GAEI 2LXFA 2ROGA 2V8HA 1FT8A 2XBPA 2A5TA 2HHPA 3EQ1A 2O51A 2N4DA 3RTWB 2K06A 3BR8A 3LR1A 2ZBPA 3NCPA 3G3GA 3TZAA 3IC1A 4PE5B 2M2BA 5GMDA 4KHPJ 3GYYA 4HW8A 1TL3B 3V81B 2O5DA 3LSLA 3PMWA 4F2RA 1MWQA 2I49A 1ACMB 1RHQB 3MM6B 3TUJC 2XC9A 2XGQA 4N17A 2XNQA 2KN4A 2CZVC 1S1UA 3PUYE 4YQWA 1SH2A 2XX8A 3LWLA 2QMWA 3U93A 3A8KA 3PW2A 2YNHA 1LCTA 4U7CA 2W8LA 3KGCA 3CULA 2J0QD 5AT1B 1OIBA 3CRBA 5F8MA 2ZWPA 1FBDA 2I0XA 3SEVA 3VAJA 1UW4A 1FRLA 5H8FA 4P11A 5KG3A 1IQTA 3R2DJ 4DV5J 3MEGA 3DCAA 1UAWA 3FRZA 2N7CA 2YKNA 4FVMA 1QD1A 2HMIB 5DEXB 2G0JA 4OX9F 3H2UB 3RZAA 3NOCA 1VCTA 2HQCA 4QSDA 3AY0A 3HMJG 1U1KA 1R6ZA 1VFDA 2ZEJA 4FAJA 3VGTA 1N54B 4ESWA 3VAIA 1EHWA 1U1QA 3PUWE 1J5OA 2HURA 2HWTA 3JSYA 2WCXA 1PJ7A 1LXJA 3K5MA 4KXPA 1MNEA 2VG7A 3MSTA 2R8GA 2F40A 3AQPA 4NLYA 2XD2A 4LF4J 3OOAA 3A12A 2M8HA 3M8RA 2LQ8A 3IAM9 3IFEA 1HIYA 1S10A 2X1BA 2APOA 3E79A 2IJNA 2BE7D 1SBRA 2VQEJ 1U1RA 2HNDA 1M5DA 1L3KA 3OXNA 1EU8A 1UTAA 2YKMB 2F3JA 3ISNC 3AJDA 3OVSA 4ZEFA 2E1MC 3DLNA 1KA0A 3PFEA 3TCHA 1VQSA 2PC6A 3A09A 1F5CA 4WTYA 5HI7A 4LR9A 2CQDA 1YZ0A 1TR0A 2DHGA 1A6LA 2JNJA 2HAVA 4AQ4A 2IA6A 4OYIA 3RQTA 4A47A 4O7IA 4N41A 4DR2F 3L6HA 3A8JA 4PBHA 2I3VA 2XHDA 3QK6A 5KFVA 3MM7B 3QMQA 3U72A 5IKBA 3IJXB 4EK2A 1FTLA 3NS6A 4A8KA 3P4UB 3LBSA 4ICLA 2E7XA 4PP0A 2RRAA 1O6XA 1VK3A 5U47A 3HFVA 1IKWB 4X66J 3QXMA 4JI7J 4JB7A 1L5TA 3SMZA 4H46A 4F67A 1IQZA 3IFCA 3S4UA 3M30A 2W2NP 4NF8A 1UPPA 1BKAA 3P5TL 3D28A 2B6AA 2QTWA 2YPNA 4M5HA 4OX9J 3IBFB 4Q30B 4RZRA 4B3RF 1DCUA 1D4NA 4BLAA 3TMGA 2DR5A 4Q2MA 3W2WA 1UZHA 1ANFA 5L9NA 5DG8A 3CSGA 3D66A 1S0NA 3LUYA 4MIWA 3CR9A 4DX8H 1U6BA 4Z7CA 3GQCA 2F4VJ 4M8LA 2HZVA 3QRRA 1P9QC 5K14A 3QIPA 1XVYA 2EC2A 2B3TB 2AT1B 2VH7A 2NVUB 1HBMB 1B32A 2GJIA 1Q8IA 3CCZA 2Z56B 4F4WA 2REGA 3L09A 3FV1A 5KT6A 1B0HA 3Q8YA 2MKIA 3TCFA 4DSIA 1I94F 5I7IA 3AOBA 4C48A 2PMHA 2OPSB 1BIYA 4OI1A 4AS4A 3LAMA 2D69A 2E5LF 3D67A 2O3DA 5HPQA 4TOZA 2RRNA 1B5HA 5CYQB 1FPLA 4AXIA 5JEIA 4DX5A 3KOTA 4NLVA 1M5BA 1UJ5A 4ED7A 4CRJA 4OYZA 2CQHA 4NASA 3I9V9 4C11B 3T41A 1V5IB 2DNZA 3KLHA 3Q8RB 4TKTA 2ZJRQ 4DU7A 1CVJA 3R9LA 4DDDA 5M2UA 4KFBB 1RADB 1N5TA 2JOQA 3O9PA 2C3UA 1TK5A 4AL5A 4F26A 4OX6A 2BX6A 3GYXB 4Y6IA 5C25B 1U48A 3CDBA 1U09A 4ZCLA 4ED8A 4OL8A 4KJIA 3MZ9A 4LRCA 4IH6A 1BE4A 4DXBA 1GV8A 4K4TA 2ZVSA 2VP1A 3KNGA 2ZYKA 2K8GA 5B0AA 4MFIA 1NKXA 1ULRA 5I5PA 3TUIC 4QW8A 2BVZA 4TQUQ 3MZIA 2MQPA 1P1LA 1IWGA 5GAHI 3UN2A 2RJZA 3NS7B 4I40A 3FGVA 2ZJQQ 1QAYA 5BJRA 2V2ZA 1VIOA 3T9HB 2UXCJ 1UWAA 4ID8A 3LP1A 2QL9B 4KCDA 5ICQA 2BDPA 4XFEA 2RQCA 4FN5A 5HVFA 4MKYA 3HKZD 3SEYA 2XS7A 5I3SA 4EU0A 5KFFA 1I94J 2SXLA 2I58A 3FXBA 1NAQA 3ICLA 1QDUB 3FC9A 3OTBA 4DFJA 3BGFA 3MQ9A 4OI2A 1G1XA 5EHSA 4ZN1A 1UVNA 2B4PA 5LM7E 4DUTA 4X62F 3B6QA 2UUCJ 3JTPA 1BQNA 4F0HA 1A8EA 2D9OA 4QCLA 1GR2A 2FHJD 3N0VA 2Q3PA 1RAIB 4PQJA 1LBVA 1C4CA 3MPKA 2LECA 5ELVA 3QFWA 4U4XA 1HQUB 2OPPB 4YP3A 3BBBA 2GFFA 3OXGA 2C3YA 4ES3A 4JSOA 1XC1A 4BDPA 1YSJA 1HNZJ 1UMJA 3IG1B 4DCJB 4DXUA 1X5PA 3ZTQA 1USYH 3M32A 1U02A 3S2VA 1U8SA 4DQIA 2B9EA 2HS3A 3MAAB 2MEWA 3S1TA 3DMJB 3ILIA 3ADAC 4WU2A 4DL6A 3GR1A 4I2QA 5HMXA 5HM4B 2Y1RI 4F3SA 4URSA 1ZETA 4QBAA 4B9VA 1K9YA 2I1RA 3UD5A 2DGUA 1MY2A 5J2MA 3G3FA 2BA9A 2FZKB 1PILA 5TP9A 2A1BA 1BLFA 1CJVB 2X3DA 3KLEA 2R2SA 2BBEA 3D6TB 1BQXA 1RT4A 3IMQJ 4ZECA 3H06B 1R43A 2R8HA 4BDLA 3M2UA 2IPOB 4U7UD 2J7WA 2GMHA 4OHXA 4YR2A 1IVZA 1VISA 4DL2A 2CQ0A 2DXDA 3QNWB 5CRYA 1X4HA 3J7AN 4C6AA 4LT6A 2RC7A 2IMWP 4IG3A 4B17A 3W15C 1R31A 4DR1F 5F9LA 2QL3A 3CC4S 1NLKL 2ZYMA 4P0GA 5A8KA 3VLWA 2BABA 4OYWA 3CTRA 1RWOB 3DLEB 4ZCMA 1KDNA 4ITSA 3B6BA 2I6EA 2PX1A 4ILRA 2BJDA 4RW8B 3I0RB 5C7PA 1WC1A 4KE5A 2R6GE 1NFTA 2AJ0A 1Y5IB 3KUHA 3DRYA 2ZH3A 4ZHRB 3K89A 2KI2A 4X84A 1PC5A 4FNHA 1LFGA 2DNQA 1GVCA 2OFHX 3FEZA 1MSWD 1IKXA 2PFDA 3VAKA 3R5JB 2UXAA 1PYSB 4Y28C 4JBZA 4PQUB 1FESA 4K4UA 4R8UB 3HCQA 3AOCA 1NI9A 1F60B 5M2RA 4DF8A 4G1QA 1IXCA 4BDNA 4G8MA 1QUJA 4CO1A 1FFWB 3DKDA 1S1XA 4J7CA 3AA8A 3FVKA 1WEYA 4A8XA 1D9VA 4F4KA 1INPA 1B1XA 2VL1A 1US4A 2XSJA 3MEDA 3Q26A 3TAPA 3K5LA 1C4AA 2H54B 2B4VA 3O3LA 5F8LA 2GO9A 2UV8A 4EWTA 1TVRA 2QO3A 4USWA 5CZXA 3ZZUA 2RKMA 4FXVA 5HBMB 2D7SA 2ALYB 4P52A 3K59A 1M5SA 3R3TA 3PUZE 4KQZA 1Y3PA 1VQNS 2Q88A 1OJ4A 2M3DA 5ETSA 1F9BA 1NSQA 1HQ2A 1R89A 2MGZB 4EBCA 4MTPA 1FVQA 5C24A 2DPJA 4DR1J 3FVOA 4RR5A 1FBEA 3MEEA 1PAEX 3US5A 3DLGB 1ZTTA 3NGRA 2CZIA 1HSJA 4F50A 5CM6A 4PYAA 4GIZA 4WXWA 1Q95G 4GWSA 3OL8A 4EO8A 3KJNB 1N5VA 3ZZ0A 2MKKA 3K1MA 1U26A 4YN3B 3A3CA 3UA8A 1EYJA 4ETXA 2YQ1A 4DV6F 3RLFE 3PD9A 4OZ2A 2UP1A 4U1ZA 4CZCA 2QSXA 4GWUA 2J0SD 1R8HA 5HMWA 5KG4A 2B8QA 3N5FA 4BS2A 1NDPA 3MOZA 5A5XA 5TU0A 1XNRJ 1RLDA 4ZZAA 1KN6A 3SZPA 2EFOA 1FEEA 4DBQA 4B9NA 3GZGA 5HL7Q 3K5PA 4QPTA 5CAAA 2HBRB 2IJRA 3SZ2A 3MCSA 1L3UA 4RW9A 4XKRA 5BYSA 1Q5VA 3RR7A 1VBYA 1BTJA 1HARA 3RAMA 4FECA 3NLCA 2X51A 2H4WB 1GGGA 4J9KA 2WBDA 3FXRA 3HZGA 5T3JA 2ZKUA 3NMAA 2HZCA 1HNVA 1OQHA 4NEDA 5DLFA 1T8EA 1MXZA 2OPRA 1V5VA 1HWUA 2WONB 1HBNA 3K8VA 4JI8F 1UA0A 4MLQA 1Z7ME 5FDLA 3BS9A 3DDKA 1TK8A 1SB6A 4DPXA 4CLTA 3NGUA 4OZ1A 1MM6A 5AA4A 2KL8A 2LA4A 4DR3J 4IR9A 3L95X 4UQGA 4DR5F 4NF5B 3DM2B 3OTCA 2NXJA 1VC5A 2RINA 1OYEA 1N3WA 2UXBF 2EKNA 4F1VA 1S9FA 3RPLB 2PFYA 2JVRA 3MMCB 5KDTB 2E5JA 5A8WA 4CLLA 1RAGB 4IRCA 3T5KA 3EYZA 3LH2S 3M05A 4C8MA 2YLNA 1S9TA 3PJXA 2Z2LA 3KN8A 2G0IA 1N34J 4R5PB 1YJWS 4WKRA 2E1RA 4RPFA 2ADCA 1DTQB 2D3OR 1SVXB 1U1PA 1FKAF 4X1BA 1UJ4A 5IWAF 1S1VB 2Q66A 3IR5B 2QLFB 2PVUA 3IA0A 3UE2A 1VRUB 1B6HA 1S5ZA 4KGKA 3C14A 5LXYA 4OHNA 4DDFA 2MQQA 3PVXA 2GHAA 1RHKB 4O3RA 1ZA1B 4BDMA 1FI4A 3M8UA 1S72S 3HHGA 1UETA 5HP1B 2UVUA 2JX2A 2BYCA 3GMGA 3KLIB 2XMTA 3GXAA 5CD4H 1EKSA 1RT5A 1M1KT 1YWXA 5HANA 3GFHA 2RQMA 2DE2A 1MMNA 2HQDA 3R5DA 1LNQA 2MDAA 2B9YA 2KG0A 4HCYA 4ED2A 1LW0A 1R0AA 3HHFA 1IBMF 4N5SA 4X48A 3I4PA 3UCZP 2B5JB 4JV1A 2IVFB 5HJXA 1M1HA 3QUJA 2YBVA 1UFKA 4KB7A 4R0EA 4KV8A 4OVQA 4DQQA 3AXFA 2RT3A 3PUXE 1QKBA 4G4PA 3Q83A 2HS0A 5M2PA 3TANA 1JLAB 3KK1A 4JI8J 2GC8A 2QIFA 2J6TA 1AZSA 4B02A 3O66A 1HI8A 2MKCA 2AU0A 5CMMA 3TAMA 4CYUA 1E6YB 3OL6A 1TKXB 4UW2A 4MHFA 1SUQA 1REVB 1B52A 2HLTA 4LF5F 1Q9DA 2UXBJ 4ELQA 2QC3A 2VOOA 1S59A 1YZ7A 5H8HB 3OD2A 2O66A 2OLBA 4MAKA 1HWLA 1MXUA 2WSCC 4U95A 5I3QA 4M5GA 4IRDA 2VBXA 1B3FA 2V3TA 1BMQB 2FJBB 4DQRA 5ICTA 4F04B 4H4MA 5K2XA 1FPEA 2Z30B 3I5AA 2FVSA 5I57B 5EQ9A 3GFXA 4QWAA 5K20B 4ILMA 2CEXA 3M6XA 3VLVA 1ZTWA 2MPUA 3Q28A 5B7DA 1PSDA 3CPWR 4C1UA 1U7LA 1WOOA 2BJ9A 4FORA 1R3NA 2B4MA 3DDIA 4TN2A 1Z1ZA 3OFHA 1YQHA 3MVZA 3PW7A 2ZZVA 1P9YA 5FD1A 2HKEA 2JZ5A 4RW6B 1KLMB 4MEVA 3VVFA 3Q0AA 4CLKA 3NEKA 4WFNQ 4J9OA 3MECB 1TL7B 4ZLJA 4KO0A 4OIXA 2GIFA 4IFYB 1XR5A 4ISUA 4PFIA 3A4TA 5ESYA 3IK6B 1LBCA 1U2CA 3N26A 4CLPA 1PAUB 4DV0F 4CH7A 5IC4B 2QE5A 1IBMJ 4EBDA 4DX6A 3I0SB 1JLGB 3AT1B 3THTA 2GMLA 3OO9A 1RDYA 2DY9A 5KFKA 3QJLA 2GGPB 4YFUA 2OMOA 4R75A 4ETZA 3KTQA 2AV5A 2VHGA 1U1MA 1FPIA 1FVSA 2CQ2A 3CJRA 3FDSA 3RTVA 1FJEB 4HLBA 3WHIA 1LGBC 3KSJA 4PFTA 1RWMB 2FY8A 2MY7A 1OQ3A 5E0OA 5CABA 1Q86T 2R7RA 2O7IA 5AE4A 1S6PB 5H9EK 1YJUA 2ZYNA 1B3GA 1QAXA 4YMAA 1I6AA 1N36F 1RTJB 2DS9A 4LF5J 4I56A 3BEGB 4OHZA 2J0XA 3BB5A 2JEGA 4I69A 2OUGA 2BJ7A 4PBQA 4DL7A 1CBKA 3HO1A 2HAIA 2EC0A 5EX3A 2VD2A 3IOUA 3MR2A 4XPEA 3KXDA 4OX7A 2DE3A 4QFKA 3G71S 3Q8UA 2LXIA 2H9BA 4LONB 1JNZB 3CCRS 4GRKA 4ZLLA 1D9FA 1YLXA 2W8KA 3KN7A 1REGX 1VC6A 5EX0A 2YKAA 3WAFA 3ILUB 1CJUA 3DGPB 3ZNUA 1KHWA 2QYCA 3M1VB 3BREA 5C42A 1YJTA 2NUUG 3MWBA 4V1Ak 3SCKE 1VJQA 3ZTSA 1NNDA 3SV3A 5D78A 4JI1F 4PCQA 4MIBA 1OSDA 4KHZE 3UDLA 4ZP8A 2V2VA 1E6VB 1EZZB 1RUSA 4CO4A 2RS8A 1U6FA 2Y7PA 2RD5C 5AJ3F 1JLQB 4O3SA 5EDWA 2F8DA 3M2RA 3MW0A 4ZCIA 1XR6A 2HHHF 2MHEA 4DV0J 5D4LA 3OBIA 2F8MA 2HXRA 1JLCB 2J7UA 4OV1A 4L73A 1USYE 2XD3A 3SQOP 5HO4A 2ZH2A 3PGFA 3HFKA 2MQ8A 2MZSA 3H6WA 4BWJA 1G2EA 1S49A 4A8WA 2IDEA 4HHHA 4PKDB 3KLVA 3VCDA 3G4SS 2R2UA 5HMYA 3BKIB 4ES1A 2YX1A 1M5KC 4NLOA 1SYHA 2HNYA 4CO2A 5D0EA 4X1DA 1O51A 4O3QA 1GTEA 3KKFA 4RLEA 1G3OA 2D3O1 2R7UA 3JTOA 1NDCA 4NLDA 1SV5B 1HI1A 4Q44A 4ZKAA 3G7WA 4JI5F 5C5JA 1DQ9A 1QTNB 4F8RA 1S1UB 4WEPA 4ECZA 2DGOA 2I6WA 2LA6A 4M5JA 3UNYA 2I8EA 1H73A 1JEVA 3HK2A 1WOPA 3LW5C 2YNGB 1VQ7S 3IO4A 3NS5A 2MJUA 4LSLB 1N5YB 2QA2A 1HSEA 3U1MA 3I6VA 4KPTA 3KJFB 3LANA 3EICA 1Q8KA 2VA3A 2LU1A 1FPJA 5CZVA 2W9BB 2NR0A 3EGZA 4CP5A 5GAGU 1P1UA 2ZE2B 3OD7A 4IH7A 1NSAA 5IGAA 5DG9A 1EZPA 1P1WA 2ZWOA 1VQMS 2OX3A 3FXQA 1FK9B 5HJYA 4Y65A 1OY9A 4NLSA 3OHAA 4QWDA 2Z8DA 3TEPA 1MDP1 2VJVA 2COLA 4QIWD 1IBLF 4JI1J 4POWA 1RKJA 4F29A 1JVXA 4W98A 2NPIA 3TVZA 3Q22A 6FDRA 3TPAA 1EZOA 2XNRA 1HW8A 2NREA 2VG7B 3TTMA 2XWKA 2WEFA 1RSCA 3H40A 1CC7A 4KYSA 1HQEA 5KT4A 2VFUA 1Q35A 1AT1B 3IAZA 1NV6A 3D5MA 1FCKA 2HHHJ 1XR7A 1ZA2B 4F22A 2Z57B 4F3PA 3ZZZA 2HNDB 1EX8A 3GBAA 1DLOB 2IRYA 4I7FA 4I1DA 1N6QA 3NBPB 1F9EB 4B9MA 1SXLA 2HWHA 4Y2KA 2CPXA 4RO0A 4LVOP 3EHSA 3NGDA 3TQEA 2AW0A 3UWTA 2XLJA 1AL3A 1LW2B 2KRRA 4NPOA 3W60A 4X4PA 1UTHB 2AL5A 3ENAA 2ANJA 1QUPA 4H4OB 4HXVA 4GVLA 3IJOB 3KHGA 1TUWA 1YITS 2FA7A 1FRHA 3UR3C 3ENVA 4OERA 1R8BA 5ETPA 3C15B 1XC9A 1RWPB 2Q2CA 3W9VA 4P10A 1RCXB 2DR7A 3MXHP 9ATCB 1URSA 4R2BA 1JKHB 2VG5A 4X4VA 2ZFHA 1PC4A 4V19J 3TZYA 4GFRA 1VFJA 3Q8QB 3WIUA 2HHTA 1PG5B 5K2YA 2PI5A 5KFZA 3POTB 2H4IA 2RCBA 4ZVQB 3K7RA 2C2DA 3TJ8A 4NF8B 4QFLA 2M7SA 3S7RA 5D3GA 1B64A 2ZC3A 4ELTA 2OH2A 3PX4A 2B6AB 2PT1A 2A10A 2WAQD 4DLGA 1JNFA 2DTJA 1GFWB 4OFZA 5CH7B 2FC8A 1N33F 2Q2AA 1FX2A 3T19A 4CH1A 2LXUA 4I2PA 5G0RA 4IG0A 3FKBA 2CWKA 4PTKA 2ASLA 4KGVB 4JVCA 1SPIA 4AB5A 3DU6A 2R71A 5F8JA 3T1HF 5K14B 3QIPB 5K5MA 1YBAA 2GZOA 1TKZA 4LFBF 4EQ7A 3RUBL 4EXKA 3MR3A 1PJ6A 4MFBA 2XYPB 3B6TA 1TXFA 4GBVA 3DHWC 1FQBA 3AH6A 3CJ0A 4FPIA 2H3EB 1LFHA 4BDQA 3B82A 3H5UA 4ZDMA 2EFVA 2UU9F 4MCOA 2W7OA 1I51B 1T05A 4WPAA 4ELPA 3S9LC 2JEIA 4CO5A 2RF1A 3PG9A 1J5EF 5I3UB 2L41A 4R73A 3I6PA 2IAJB 1WUUA 1BQMA 2M70A 4NLUA 2AGPA 3PHTA 4HTIA 1LBWA 4WKYA 1I6BA 1DQAA 4DQSA 3WQPA 4LSZB 5E7OB 4MLVA 4ZP9A 1EYIA 2DR6A 2CMOA 2BV3A 2EWHA 2ZKTA 7FDRA 4CLYA 2HFBA 1RBLA 2AQ4A 1SI9A 3H4DA 1WI6A 2HHQA 5HN0A 2E5GA 1YGYA 1D9QA 4GWXA 3TYTA 1RAFB 4HHJA 2CNKB 2F5XA 1PB8A 4ONYA 1ZPVA 1TL3A 4TU8A 3V81A 3DHXA 3U7JA 5DDQC 1H7XA 2XO6A 1N33J 5A8RB 5JXSA 1CPZA 1VMBA 3HVAA 2JFDA 2Y84A 1SQYA 4Q7AA 4G68A 3IO6A 1AB8A 4LP2B 3E8OA 3JSMA 4LZ5A 3OMBA 1H7WA 1UA1A 4JDFA 4EF2A 3FFIB 2PT2A 2HXWA 3GIIA 1DARA 3DRSA 3LP2B 4NAPA 4DI4B 1R8AA 3NNAA 3PYGA 2NXNA 4MK8A 4FS2A 3LP1B 2C3PA 4DFMA 3E01B 1XQIA 1H38A 3UQSA 4LIWA 5EYGA 4LFBJ 4DCXA 2GJ2A 3UORA 3NWGA 2EI5A 4EEYA 1SD3A 5FHOA 4P2MA 1S76D 3HT3A 1R9QA 1G0IA 5EWEA 2HMIA 5DEXA 2ZBCA 4RA1A 2X3GA 3KN3A 1URDA 1MH4A 4JB8B 5DGBA 3HULA 3KOAA 3DU5A 1BQNB 1RZMA 5F8NA 1RT3B 3N6UA 3J7YI 1Q81T 1FTRA 2RUSA 3C16A 1U0SA 4YS2A 4JP8A 1YJ7A 1WDDA 4N56A 3KC0A 3OSNA 4KSEB 2DISA 2L9DA 4OI0A 2ZZXA 4A48A 4FEBA 3DM0A 1JWWA 3MFIA 1P1QA 1B1HA 1TL4A 5CMCA 5LMNF 1W7WA 2RILA 3KBZA 4NZ6A 4U7UK 1ZMGA 5DW8A 2AX1A 3AB2B 3TAQA 2YKMA 4P73A 2F34A 3UCGA 2HZKA 2DY1A 4JI4F 2V5HG 2K3KA 3EHUA 3V5RA 3GIRA 1YZ6A 2O7UA 3H6TA 1FX4A 2LDYA 3T96B 3H20A 1JLBB 2YQ3A 4IQXA 4DG1A 3TKDA 3ZKKA 3SQGA 5TP9B 4PRFA 3ZTPA 1BWVA 4C8ZA 1N0UA 3PHEA 1SDXA 4K0KJ 1RTDA 2AEMA 4WP3A 3M2UB 4NA1A 1VK8A 3MM7A 3MR5A 2Y1IA 4OJ3A 4CI0B 4X9TA 1NK7A 3FBFA 5JTYA 2F9JA 2IVYA 1VRQC 3B78A 4JOUA 1IKWA 1TFAA 3OQ2A 1WTFA 1VQLS 1N56A 1IMFA 4QBUA 3TZZA 2UVIA 5A8KB 3RB6A 2O84X 2F4FA 2Y7RA 1KRPA 2YY3A 2YWHA 4ZPBA 2FDNA 2W4CA 4NL5A 2FLPA 1KOOA 8ATCB 1X4FA 2HIYA 1HL6A 3H42A 1NV4A 2OAUA 5D0RA 2ZHOA 1KP6A 4M63A 1JEUA 2VDHA 4X4UA 4OQJA 4B3TJ 3AOAA 3H03A 4ZEIA 5HMZA 3TTRA 5F3ZA 3BJYA 5AE2A 3FJMA 3TTLA 5IM0B 4Z2XA 2KT2A 1PO6A 2HS4A 2KYXA 1QVGR 1NV0A 2DR9A 2YH1A 4M94A 1FF2A 1NK4A 1KVIA 1XMQF 1RU2A 5EUHA 2R9LA 1UQWA 1HBMA 1KTQA 1QLNA 3HP6A 5LMNJ 2H65B 5KFMA 5J1PA 4ECWA 3IRXA 3A8IA 2QG9B 3E9XA 3KFMA 1HMVB 3E4RA 5I3PA 1RT1A 2LKZA 1CQNA 2OPSA 4JI4J 2I5JB 3MCNA 3MPYA 1I6QA 1RAEB 1TAQA 3R6UA 4N81A 2UUBF 2DH8A 2CVIA 4RUCA 4I67A 2Y8WA 2ZUGA 4PUOB 2HLUA 5IZ3A 3LP0B 1DOTA 4DMZA 4IQMA 2ZM6J 4EBEA 2Z2MA 1OPIA 3IOVA 3T1BA 2UYFA 1I5OB 4M5KA 4C11A 2ZH7A 4RKUC 2GVDB 4R6KA 2KM8B 1NNPA 1B2HA 4HT5A 2Z58B 1Q53A 1TU0B 2GQQA 1FJCA 1LAXA 2HAFA 4B3OB 3B8BA 1PIEA 4NWDA 3Q86A 4KFBA 1RYOA 2DRBA 1RK8A 3GONA 2ZJPQ 2XX7A 3T0JA 3Q8PB 3M8ZA 3PEJA 1M0SA 5C25A 2VASA 1NUZA 3H4BA 1MG1A 4B9TA 1N0VC 2XGPA 1N7WA 2DNNA 1XNQF 1TKDA 1LWFB 2E29A 5JJBA 1NPPA 1D3WA 1DTZA 1ZJLA 1Z7NE 2UVWA 3SSQA 1Y11A 5DG7A 3CCLS 3O2IA 4ECTA 3Q8VA 3U1OA 4FF4A 3L7UA 4AUKA 4X4NA 4F39A 5KFJA 2M4MA 4O23A 1HNXF 1PCAA 5LJ5Y 1GX5A 5KFSA 5AE1A 2NSCA 4NI2B 1YJRA 2JFKA 4PGPA 1B0PA 1XMQJ 4NA3A 4NMYA 2VODA 3N28A 3I3VA 4KYDA 2ZD1B 1FA0A 1OMSA 4NE9C 4OZ5A 4FYDA 3O44A 3CIJA 3BIGA 1DY3A 4FYWB 4ECYA 3BFTA 2XXIA 3C2PA 1VDWA 4WK1A 3QGPA 1IR1A 1B7UA 1X4EA 4NEZA 2V84A 3CEDA 2K2PA 5EGYA 1HNVB 3T5JA 3OSQA 2XXUA 1SJRA 4TY8B 1NK5A 1X8DA 3MUMP 1S9GB 2EFPA 1R7IA 2AP6A 3KG1A 2IRXA 4ECFA 3CCQS 2J8SA 2WYKA 3BKUA 3G6VA 3EF7A 2VFVA 1L3SA 4DV3F 4P56A 3GZ7A 3NL0A 2C2KB 4J90A 4JV2A 3IG1A 3PCOB 1KZ8A 1EETB 3WC2A 2L9NA 2XULA 2BM0A 2PI4A 2F36A 2B7CB 3MAAA 3CJSA 3HFUA 3UGWA 3MUQA 1U1NA 1WKLA 1P6TA 2HVEA 5A8WB 5CCMA 3CF5Q 5KFQA 2DEJA 2C1EB 1RHMB 2QLBB 5E3RA 2NWJA 3P8BB 3H25A 2QVRA 1GTHA 1CSJA 5CD4A 3RTFB 4PWWA 1ZOTA 2CXEA 1CJVA 3TDJA 4ELUA 1WSVA 3EVOA 2EFGA 1SW2A 3FZVA 2M8CA 2JC1A 1AMFA 4A46A 4ILLA 1UVLA 1VQ4S 3PMVA 2KTQA 4HR2A 2H48B 4HE1A 4WE1B 1FBCA 1YRTA 1A40A 3LAKA 4DOZA 2HEUA 2KM8C 4JVDA 3OO7A 2P2AA 3AB4B 4Q2LA 3BYRA 4YY3J 3PRVA 4ZP6A 2FGOA 1Y3NA 4WKMA 4IOCQ 5L9SA 4ZVFA 3UNGC 3DI6B 4KRWA 2HPUA 5CHCB 2FC9A 3DLEA 3SCLE 1LW0B 2DCLA 5F8GA 1T02A 3I0RA 3V6DB 3HFZB 3T3FA 2GRVA 4KV8B 2EEYA 4PAKA 1PB7A 3DXBA 4LFCF 2KG1A 2GHBA 3MUVP 2MQMA 3BO4A 2HW3A 3KK2B 2EVZA 2JH3A 3KK1B 5IXUA 1F2GA 3TJAA 1Q1KA 4LATA 1AZSB 3J81j 2VKRA 3DOMA 4UOHA 4FF1A 3PNIA 4LRAA 2O67A 4PQUA 3FIRA 2A5SA 1BHNA 5H8SA 3W63A 4R8UA 2HIQA 4GO7X 1YK9A 4DV3J 4ANDA 4N8GA 1SUQB 3GFYA 3R8YA 1LK5A 2CQGA 3QGHA 3IL1B 1HD0A 1S7HA 2HBYB 1AH5A 1AFJA 4FKXA 3QWPA 2ZHBA 4WFZA 5JVGQ 3ZZRA 4K50A 4OLPA 4FIMA 4JI2J 2OEJA 2NXOA 4XIUA 1D8ZA 4OYAA 4F3BA 3MJNA 1NV5A 3MMJA 3ULHA 2MGZA 1NH8A 1VR5A 2O69A 3EM1A 2KRBA 3W65A 4OYOA 2X7QA 4GWYA 4ZVHA 2H5IB 2XZDB 3D4CA 3EXCX 1RBOB 1HSLA 3AXMA 2HBQB 1CB6A 4WXJA 1K1QA 4JYAF 2VFSA 3QSYB 3DLGA 4KO0B 4EO6A 3NP5A 1M90T 4OHVA 2DVIA 4DX7A 2WK4A 2JJKA 1JXLA 4MK9A 1A0OB 1H98A 1WNEA 4B08A 1F2HA 3T9XB 3M8QB 4DUYJ 3QT6A 2Y5LA 2L48A 4J9PA 1FTKA 1FWLA 2B9XA 3MMAB 4NOHA 1M5PC 2HQFA 5CYMB 5KFTA 1US5A 1NH7A 4DCOB 3GV5B 2C2OB 2CYYA 3W66A 5RUBA 2EK1A 1N04A 1VS3A 4RPNA 1F9HA 2FIUA 2AX0A 1S1TA 4H4KA 3LALA 4IGRA 3PPQA 4PXBA 3KYLA 2V4QA 4FZVA 4QYZK 1NMEB 2XLKA 1GT8A 1H44A 1HHSA 2DIUA 5HK4A 4OA4A 4IRKA 4C97A 3NGKA 5HAOA 3R1HA 2GNKA 3SDEB 6FD1A 4MYUA 2AJQA 3UIFA 3W5XA 1RDZA 2FUG9 3BFUA 2E9RX 1VHIA 3M6WA 4P9KA 3SEUA 4FNIA 1FKOB 2EW9A 3IP0A 3UCUP 3GSIA 1FBFA 1XOCA 4NX1A 2ROPA 1FBHA 2VPXB 5I84A 2ZHAA 3OL7A 5AA1A 1ZM3A 4LREA 1Q8BA 1S97A 2HWIA 3J81U 3FV2A 3FCWA 1FJ7A 2KO1A 1MMDA 2BZ2A 1GMWD 3ELHA 3DXSX 4UUXA 2WONA 2R7SA 3CD5A 4OVRA 4DSKA 2B4UA 2ABHA 4DZ1A 4I6WA 1TFWA 2V9WA 1WG1A 2OTLS 3SEWA 1ROFA 4X8RA 1NK8A 4PAIA 5ETVA 4RWWA 1TAUA 1MQDA 4DIGA 4LBHA 4B3MJ 2XY6A 1O64A 2UVVA 4NF5A 1RWUA 3DM2A 2AL4A 4BDOA 3FXUA 1MQGA 3G6YA 1NKBA 4N4UA 1SKUB 5L9OA 5LTCA 5LOMA 2ZZNA 3R5BA 4UZCA 1Y5LB 4JYAJ 2OWZA 3P3DA 4ZPTR 1YXIA 1RDRA 2HQ0A 3OR2A 4Q0CA 4N8NA 3KC1A 3P6YC 2C3MA 3M2RB 1WC6A 5CI5A 1BXNA 4JWXA 5ADZA 5KT5A 4R5PA 4R0JA 1DTQA 1FO1A 3T1AA 1ZYQA 4X2BA 1S1VA 1TL5A 1GMUA 1VRUA 1DBZA 4ECRA 5A6PA 4RL1A 4NF0A 1MY4A 3G87A 4HH1A 1Y0HA 4XKPA 2DXFA 2ROEA 2A3JA 2HQ3A 2XMWA 4JWOA 1H3DA 5HP1A 3KLIA 1KFSA 4RNSA 4DZDA 2ONRA 1S0VA 3M8SA 3AFGA 5I2KA 2Y1JA 3PZPA 1RU1A 4OZJA 4EYHB 5ET7A 1YRUA 3JAMU 3PIOQ 4W4MA 3IBWA 2CPIA 3GWCA 3MF5A 1BP5A 2Q79A 3NCRA 3PJWA 4FBUA 3NXZA 1T03A 3CNQP 1KSPA 1F5AA 1LAHE 3S9NC 5T7LA 3RBXA 3OFFA 1S0MA 3IB2A 1XMOF 1JLAA 1B7HA 2CDQA 5DVFA 4DXCA 5DQHA 4IO6A 1OVTA 2P8IA 3JTNA 3D6FB 4WYWA 5KFAA 1X9WA 1EP4B 4YZZA 3HSZA 2HK3A 4LSNB 1NNKA 2VT5A 1LV5A 4PR6A 4FF2A 1M1GA 1TKXA 1HHTP 4ZPWR 3MPWA 2QS3A 3NAHA 3MI7X 1REVA 3HI9A 1ZIUA 2GVZB 4O0NA 4K5SA 3C46A 2FJDB 4QWEA 3T6BA 1TZ0A 4ID5B 3B4DA 5H8HA 1Y4ZB 2VQFJ 1DMBA 3A8EA 2QS2A 1SQFA 4LRBA 2HGLA 2KU7A 1VI7A 5CBSA 2MKJA 4B9SA 2NOOA 4ECQA 5H8NA 2EK6A 3HHNB 2B65A 2WTFA 4JI0F 2ALUA 2XHWA 4AB6A 1FPGA 1T9TA 2QMUB 3PFOA 1KWHA 2IYIA 3X1LB 2ABYA 5I57A 3KLFB 3D1RA 3RT6B 2XG8A 1Z2ZA 1BGXT 3TVKA 1U49A 4QOTA 2A18A 4NA2A 4USKA 1SPBP 1JB0C 2J76E 2BKOA 3FNNA 3D6HB 1FNMA 4IGTA 2XMJA 1VBXA 4OVTA 1VDHA 4RW6A 3FMWA 3HF5A 3MMBA 2CJKA 3K02A 3PIPQ 2K7KA 3T1YF 1B40A 3V8XB 3MECA 1FQAA 5EQ7A 3EPEA 2B43A 4R6YA 1RWWB 4PPDA 3QQCD 4IFYA 4Y0FA 4PXCA 3CJ8A 1MQJA 2VG5B 4WIQA 3Q2TC 2VU5A 3BGLA 2POKA 3SSSA 3WBZA 1S9EB 1WEXA 3I0SA 1JLGA 4PAAA 2FHMA 2A6OA 2GGPA 4NLPA 2FVRA 2HFUA 3CO0P 2BJJX 4USHA 5B70A 4GKJF 1KD1T 1IJEB 1RT2A 1QAIA 5I59A 5KG1A 2JWNA 3OTEA 5FJ4A 2FLLA 1Q78A 1MH3A 3Q29A 2QMXA 4Q8RA 1X4DA 3RB3A 2BMBA 4R9GA 4ZPCA 4X4QA 1S6PA 1AFIA 1RHRB 2AHOB 3T66A 4QW9A 4QIFA 1RTJA 2W25A 4I2PB 4K8RA 4BDRA 4QQBA 5K8PA 3ZS6A 2THIA 4ZK7M 1HPZA 7FD1A 5MAOA 1SKSA 3CWJA 4LBIA 2BJ3A 1VR6A 1UWBA 3FBCA 1QSSA 4NX9A 3R2CJ 4XTTA 4DHVA 3BSOA 4DPTA 3C34A 3U8QA 2JEFA 5KZTA 2NXEA 5KG2A 3F73A 3QT7A 4LQ9A 4LJMA 4PXDA 3KSXA 3DGPA 4RNNA 2XLIA 2JDJA 2EBEA 3W9IA 2UYEA 1VQ9S 1SJ1A 5KFNA 3OVBA 3M1VA 2CQCA 5D15A 3K1NA 2VC1A 4X4TA 3EZUA 4H8IA 1QY7A 3O29A 3QRPA 5F0UA 3SFUA 3M9OB 1Q0NA 3D7SB 3NWRA 2G29A 1FE0A 1NPKA 5AXNA 5KTQA 2CAJA 1E6VA 2R7QA 4NWBA 1XHYA 4JI3F 4AYBD 4LF9F 1X0PA 4L6V3 2ZZMA 1BQMB 5DGAA 1KVJA 1S6QA 1WG4A 1JLQA 2PO4A 5GMEA 3I55S 4OVJA 4YMBA 3CSKA 2KJVA 1NJXA 4YDDB 4DSEA 5J16A 2IJFA 3BIHA 4CLSA 1KVKA 3VXBA 4ELVA 1V3RA 5J2QA 1QGXA 4Y2MA 3PV0E 4GKJJ 1U1LA 4THIA 2YKPA 4J9NA 2V0NA 4O44A 1D1UA 3MAMA 4QYRA 4ER8A 4Z7YA 1MPDA 5T41A 1FRMA 2G4BA 1ZM4A 2W2MP 2F5GA 4LF7F 4XKQA 1JETA 2DT9A 1SV5A 1LWXA 2G2YA 3PR5B 1RI7A 2QVVA 4PCDA 2L9WA 3N6TA 1MPCA 2DRDA 4G68B 1RAJA 5KFGA 4WJBA 4C9DA 1RAOA 5L46A 2CKWA 3JSMB 1BC6A 8AT1B 4IYQA 3DLBA 2DRAA 3DRSB 3OEMA 1HA1A 2YNGA 3VVEA 2MZRA 4LSLA 4LQ5A 1N5YA 1YTVA 2OCUA 4KBIA 1LB9A 4HE2A 3W64A 1KQFB 2W9BA 3VQSA 4URGA 1ELOA 1JNRB 5LL6d 4H45A 2ZE2A 1RACB 3BPDA 1SL0A 2ATCB 3WX8A 4C7QA 3R7BB 1DPPA 3PRDA 1FK9A 5EQ8A 4DPOA 3KK3B 3GU0A 2IRUA 2DBBA 2W1BA 4DN0A 2F7BA 2ZNUA 4FDFA 4U6PA 3O5TB 2F3DA 5I42B 3DRXA 4OMBA 5AA2B 3D3CJ 2RH3A 1JLEB 3E78A 1MN9A 3A29A 4DQPA 1RHJB 3HT0A 3EVMA 3C16B 2CVEA 3R1LA 1RWNB 2D21A 4CO3A 1AYEA 3H8YA 2HHXA 4WZQA 3PPOA 4GQOA 3I56S 2CJAA 4KPYA 3H7HB 2ASDA 3DNCA 1DLOA 1V3ZA 3NBPA 5EYHA 3SCIE 3TELA 1U6ZA 2VC0A 2IM2A 1X4CA 3UI3A 1WI8A 2AWZA 1VQ8S 4I62A 1LW2A 4JI6F 1UTHA 2HHSA 3T9ZA 4NMXA 5ITPA 1HFEL 4H4OA 1Y7PA 3DRPB 3H5SA 3FATA 4OQOA 3M7VA 4F36A 4DG1B 3U65A 4MKAA 2DGSA 1GMWA 3SQGB 3K58A 3J7A1 4F19A 4LF7J 3C15A 1N0TA 3TODA 2OJ3A 4P2FA 4ERDA 2I2YA 1YPNA 4FKYA 1FXDA 4JVIA 1HWIA 3FGSA 3VTIA 1RTDB 3MR6A 2OEKA 1JKHA 4USTA 1MU2B 4RYAA 1CJTB 1WJ9A 3H90A 4QIEA 3R5GA 4EMDA 5JTYB 1R1NA 1HLWA 4RK2A 3POTA 3QBCA 5DO2A 2FVZA 3ZKLA 4Q8EA 1LWEB 1H72C 3TJ9A 3KJ7A 1GK8A 2AJ1A 5AE3A 2ZVIA 3D1OA 2X1FA 1IR0A 4JV5F 1MRPA 3W5ZA 2E1AA 1A7GE 2X7PA 4I3YA 3HKWA 1NBEB 2PIIA 5C2GA 4Q8FA 4TQSA 3LOUA 3ZFVA 1FE4A 5IT9U 2OSRA 4ED0A 4O4GB 4DL4A 3OLBA 1RYRA 1B51A 3FZ2A 1YJ9S 3LSXA 5M2VA 4PG8A 4IFVB 2RS2A 2CPJA 2A2DA 5J1EA 1EZ9A 4KY3A 4MH8A 1I3OB 4QWBA 2MQOA 2V63A 3OEKA 3IRXB 3D9BA 1SI0A 3TUZC 4GX4A 5DTBA 1RT1B 1AUSL 2CIMA 2MZ1A 3DRRA 5KT3A 1LBZA 4DV7F 4UZBA 3MM9B 4F3QA 1FQCA 1UVIA 3B6WA 2LQ5A 3O28A 4B3SF 1QSLA 4C3LA 2KB2A 3OR1A 4MF3A 4V19X 2R7VA 5I3UA 3QT5A 4R74A 4QZVB 1YJVA 5BUUA 5ET6A 4Z37A 5IZ3B 2IAJA 1UPMB 4DR2J 1EAYC 5KFPA 4U22A 1NDLA 3THVA 1IKYB 4F3OA 3QYTA 4RX6A 1A99A 1B70B 4O3CA 3J81Y 2B8PA 5LJ3Y 2YWFA 1FD8A 4MIJA 3PX6A 4M1KA 5BR8F 1WF2A 5FLXU 1UKUA 1KWMA 2JLFA 2KHCA 4HI1A 2FIXA 2QRYA 1RTIB 2VV5A 1WORA 5HVHA 3UK4A 3LPEA 3UP9A 3P7IA 1JX4A 4R2FA 1Z2LA 3CMAS 1W25A 4GOTA 4JWYA 2DNLA 1T9WA 2IEEA 4ZE8A 3X3UA 5A8RA 4B3RJ 2WSEC 3I32A 1PJ5A 4C0OC 2DIVA 2DK2A 2RSQA 1LLSA 1U2FA 1U24A 3FFIA 3G6XA 1Y00A 3LP2A 2H99A 1RHUB 1MS7A 2BUNA 4MBPA 3E01A 4NXMF 3CT9A 3T5LA 4X4SA 1FDBA 3TARA 1B7FA 2Q74A 3B4MA 4ZOSA 2JJ4D 5LMUF 1DPEA 4K2XA 5KFUA 4PF6A 1ZS6A 2DR8A 2FLNA 1GQEA 1HWJA 3GB0A 3RB0A 2E5LJ 2CA9A 4QR0A 4ZVUB 4WF9Q 4AT1B 1URRA 2GJFA 3LGMA 3DLHA 1RT3A 2X7IA 1LWCB 4DWIA 5FHNA 3JAMY 1OSCA 2D41A 2XTJP 1NL5A 1F1BB 2BM1A 4ZITA 3FJ2A 2I0CA 5KCJB 4ZJQA 2YWEA 4GXAA 1MW7A 5J2PA 1YX2A 2YX4A 3FEYB 1NM2A 1S4EA 2EFNA 3H5YA 4HH0A 5E33A 5KT7A 4RBTA 4XKNA 3G2XA 4PWDB 3MM8B 4QIVA 5HLFB 4ZEKA 1GX6A 1XK8A 3UN5A 4PE3A 5GVQA 1IJFB 5CYJA 3QRQA 1CC8A 1FHTA 1OIAA 1KBRA 3U1NA 4N13A 4DV4F 2K1RB 4KQPA 1K8AT 1JLBA 1O8BA 2QSFA 4MKVA 2DWAA 1SJ3P 2LEPA 1N48A 4F18A 3D1HA 4LBPA 1IM4A 3GLJA 1GXUA 4DU8A 2E1CA 3H98A 3QIDA 3NRBA 1SI1A 4EQ9A 2RB7A 4C2MA 2V6AA 3D4GA 3PW4A 1XJWB 4J91A 4IO3A 1TTHB 4M1VA 1S50A 4GXSB 2Q9TA 2QFLA 2HQIA 2R4FA 4E8UA 1HD1A 3VHQA 3U1LA 4NXMJ 1B3LA 4A8YA 3N6LA 3NY0A 3CD6S 1QUKA 1IUJA 4CNZA 5LMUJ 3P96A 4XAKA 4QF9A 4EF1A 4I0WA 2DWHA 2NLWA 4X4RA 2Z8QA 3TQLA 2MSTA 4PFYA 5D0GA 2CZHA 2M5YA 2ONSA 1KQGB 3TUPA 2ALZA 2KVQE 2MLYA 2PFZA 1RKIA 3F0NA 2PA8D 1JXEA 3DLKB 3V89B 4X62J 4KGXB 4G1PA 4DXLA 3QAEA 4LN5A 1FQFA 2NS1B 3V4MA 1YI2S 5IM0A 3D68A 1MDQA 1RB0A 5DRKA 3MTKA 3UD3P 3DOMB 3IWXA 3I9ZA 3AJ1A 3KG4A 2MKSA 2HBZB 2H51B 1B5IA 4OYBA 2F97A 3FD3A 4FS1A 1YIJS 1FPKA 4O4RA 5HROB 2ZOGA 2X26A 2FHKA 1HMVA 4LF6F 2KDOA 4FE8A 3LUZA 2OPQA 3ZSFA 3VGSA 5E2QA 4E2FB 3LV0A 2I5JA 4DV4J 1RWVB 2G93A 3TO8A 4MH5A 3CO9A 1FJGF 4F3MA 3O6GA 3QAXA 3CVKA 3C66A 4PUOA 2ZC4A 1MY0A 2UVJA 1XERA 3LP0A 4X64F 1P27B 4L74A 1ZTYA 1OLAA 3CC7S 2Q1LA 1LFWA 4DSFA 2DHSA 3CIZA 5J2NA 2GVDA 1JK9B 5DDRC 3NG8A 3RB4A 2AIXA 5I2NA 3HCXA 4B3OA 2P5VA 3GSDA 1DK4A 4OVSA 5DYHA 3EDQB 3GR0A 5E3QA 2J8AA 3A3PB 3HDSA 3ONMA 1OWXA 2G0CA 3CCSS 2G13A 2DH7A 4ZVRB 1I6JA 1RKMA 4OXVA 2JLEA 1GEHA 2CQBA 3RY3A 3LSFB 3T9NA 2DWIA 3ZNJ1 4UACA 1RJJA 2OMLA 1NZ8A 3B8HA 2QS1A 2QA4S 3GILA 5KFIA 2I3WA 3RBDA 1LWFA 3EGNA 3QSLA 3ZTRA 4QRZA 1R27B 3D0IE 3M4XA 2KXFA 2W7AA 2YH0A 2NUVA 5SZTA 2KXHA 4PG6A 2UUWA 4KKOA 2R2RA 4ZVOB 2EKYA 1S1TB 3D6MB 4CLWA 5LXRA 3KUEA 4NMLA 4KHRA 2ZNSA 5EQAA 5GADU 2Y0SD 1RYXA 3QSIA 2ZH5A 4NI2A 2BE9B 3EPGA 4GL0A 1W2BR 2VIHA 5K8OA 4OYMA 3L6GA 3RGIA 4IOBA 3LWMA 2ZNZA 1N88A 2ZD1A 2Z8EA 3OSRA 2EPIA 3OSPA 4LF6J 3IWLA 2MY8A 2BE2B 3W62A 1H45A 3PU5A 2MMYA 1NKCA 2FTRA 1SC1B 1GTKA 1FDNA 2FVCA 2DGVA 1N84A 4K3FA 3MD3A 2ACYA 4TY8A 3NNHA 2FJEB 5KOWA 4G61A 3W2VA 1KFDA 2YPZA 2G2OA 1S9GA 4FJPA 2AJFE 1S12A 3BQ1A 4X64J 4ECUA 4HTGA 3GIMA 2JRSA 2DNOA 5DETA 3H59A 3EVWA 3J7Z5 4KTQA 4GLIA 4L75A 5L8DA 5CMKA 2OD4A 4YB5A 1TQLA 2W4PA 3PYDA 1S4FA 1X4BA 2WZ1A 4DR4F 1VLOA 2WVCA 2UV8G 3W8PA 3VGVA 1EETA 4HCWA 3ILLA 5EWFA 2RDDA 1APSA 2C2MB 4ECXA 2HHVA 2K3IA 2R8IA 3QJJA 3HVTB 1Y4TA 3OR2B 2DP8A 1B4HA 3CMQA 3U02A 1RISA 1QVSA 2DYAA 2MJNA 4UTGA 2KT3A 4C0RA 2OGUA 2C2ZB 2QV6A 3H7MA 4DV6J 1S48A 1B0TA 5I58A 3IRWP 4DI6A 3DOKB 4OJ1A 3TEGA 1N5QA 3BBCA 3KEIA 4IR1A 2XXXA 4P1EA 3H5XA 4WFBQ 3SERA 3BGRA 2ZUAA 1T9YA 3TCGA 4ND9A 4WE1A 4NRTA 2FJAB 2KFNA 3EHTA 5ETLA 4O94A 1PB9A 3BDEA 3DI6A 2CJBA 4ZPVR 3U27A 2BR0A 4XXUA 2CRLA 2BQ3A 5I2KB 2DGWA 1B46A 2NZ4A 2UUTA 2XMKA 3M8WA 2VHAA 4G6VB 1NV1A 2V68A 3W3SA 3V6DA 3A3NB 1LCFA 3KMSA 2W01A 2B9WA 3IS9A 5ETTA 1T03B 2UZAA 4GO5X 2NPFA 3TP2A 5T7LB 5EWGA 2IC3B 4PF8A 2DJWA 3KK2A 2VICA 4TLMB 2Q43A 3HHLA 3BH7B 3E2EA 5D6GA 1S6OA 3UO0A 2MSSA 4O3AA 2ZZTA 4PZVA 3IGVA 2CZ4A 4H4KC 4BC7A 4AFFA 4NLQA 4OHWA 3MAQA 4FF3A 1YCJA 4DR4J 5ETQA 5IT0A 2RAQA 4DZ6A 2V93A 4DR5J 2J9CA 4NTLA 4OVPA 4NF6A 2W9AA 5LSOA 1URGA 1NDKA 2IHR1 2XEXA 1IBCB 1FBGA 2IM3A 1PYTA 2P6SA 2AF6A 3BM7A 1IKVA 1CE2A 3G3KA 1FTAA 3BZQA 5LSRA 1RE1B 5CBRA 3KJQB 1PYOB 1MN7A 3OHBA 1QVFR 2FVPA 2MXYA 2VA2A 4L72B 1LAFE 5H8NB 3RR8A 3VGUA 3G9CA 5IT9Y 1R8PA 3W7BA 2GAGC 4OI4A 3HLUA 5ETOA 1X5OA 3ILJA 1TUGB 5IWAJ 3QAUA 5A6WA 3PD8A 5GAGI 1AA1B 5B0CA 5ETMA 1QUVA 3D1QA 1KQSR 3ILOA 4LRDA 4ZPDA 3I82A 4P7TA 3V4IB 2E0SA 2C2RA 4NYPA 1G0HA 1CG2A 3MMBB 1X7VA 3VLUA 4DV5F 3V6JA 2XY5A 3N5BA 4YEAA 4KR5A 4U4SA 3CJTA 1TP7A 4RBUA 3ZZPA 4GD5A 3HJVA 4RNOA 2OKQA 3C33A 3A13A 4C8LA 3M8QA 1HBOB 4L3NA 5DDOC 4QHQA 1KEKA 4NZ7A 1T9VA 4M5IA 4QXDA 3MMAA 2RE1A 4LF4F 4IR8A 2Z2ZA 4YMEA 2B56A 5CYMA 3CFXA 1AOVA 3Q25A 3VVTA 1RWKB 4HEA9 4L3KA 1MQIA 1C1CA 3T9VA 3FSIA 3BSAA 1RT2B 5I59B 2VQEF 4BC9A 3MHYA 4KC5A 3IFAA 5AA2D 4CCHA 4DV2F 5FLXY 2R2TA 2I9SA 2PDAA 1RDXA 3ZZOA 3QLHB 2R8JA 4RNHA 3Q2SC 2MTLA 4TXSA 1DSNA 1H2TZ 3SDEA 1O0PA 2XSFA 3OXLA 5THWA 4DF4A 2RMLA 3CJ5A 1X5SA 3ITHA 2B3BA 1VRTA 1TL1B 3K4UA 2NZCA 3M9MB 1HPZB 1FKOA 4WU3A 1RP5A 3QGGA 3MVXA 3GPAA 3O6IA 1WHWA 2XWXA 1UWBB 5KFOA 1OQ6A 4LQ3A 2DPIA 2OK2A 2M0GB 1TK0A 2QX0A 4PQAA 2H1YA 4Z0IA 5T14A 3T9UA 1MLAA 4X66F 2HZAA 2O68A 4LVNP 2HFZA 4OHYA 2ATLA 4JI7F 3M9NB 2VG6B 1CS4A 1QM9A 2FZCB 2VPZB 1SJQA 1M5CA 3GJSB 3QYYA 2LLZA 3SFGA 4LR7A 1ZKBA 1F0XA 3M3LA 3ETMA 2UVGA 1VQ5S 1S6QB 4GVBB 3HPOA 4P0IA 1QW0A 1U4BA 2BJ8A 3GYGA 3JQKA 4Z7EA 4C98A 2RC9A 3PPNA 2HEKA 3KJVB 4PFBA 3F11A 1JW1A 4C8NA 2F4VF 2XXYA 5J2QB 2GS8A 5F1QA 4WK3A 2QEXS 2XMVA 1RBAA 4GC6A 3NKYA 1WDTA 1FRJA 4O44B 1IM6A 3DN9A 2CUYA 4DV2J 3RW7A 4OX8A 1C2PA 4OZ0A 1UEVA 4K4XA 4DL3A 2P1SA 4G77A 3PUVE 5H9EJ 2ZDOA 4O3NA 5LOQA 2RU3A 1HNIB 2ZOFA 3K6VA 1VQKS 1ZM9A 3OELA 2V8VA 1N36J 2XS2A 1U2RA 3K5OA 4DLDA 2VPNA 1ZAVA 3QO9A 3PV8A 2Y3YA 4RNFA 3Q27A 2AKWB 3CC2S 2WVBA 1OPZA 2UVRA 2JL9A 3K17A 3MC2A 1NRKA 1YTYA 2J7KA 3VALA 3PM9A 4ZVSB 3OENA 4MNPA 2MZQA 4U8VA 4FP9A 2GO8A 4UOCA 1FTMA 5DJBA 5A2QU 4USUA 2OWSA 3LGNA 2ZH4A 4ZDNA 2BOAA 1EP4A 3R5CA 3M8PB 4PWUA 4N8YA 4LSNA 1SW5A 2ILYA 2ZZWA 4G8HA 2HK2A 1Q79A 4PG4A 4CLFA 2GVZA 1BD6A 4KD5A 5IM2A 3NOHA 4ID5A 3EUNA 2CQPA 2ZH8A 4NLTA 3JV9A 2AIRB 2HFVA 1QSYA 3QPIA 5AJ3J 3M2VB 1LB8A 1MXYA 4WZMA 1LK7A 3HM9A 2G1DA 5F0WA 3C19A 2XS5A 2A2CA 3RRHA 3CCMS 2XXRA 1D9DA 1U0HB 4CWBA 1DRZA 3M3KA 4ELRA 2HRTA 1WHXA 1L5UA 2UXCF 4DCYA 2DSFA 3QMFA 3KLFA 3W9WA 2BW2A 2QL5B 2OI2A 2UUAF 3CG1A 5GAEU 3QIMA 1NUWA 2VOZA 4TLLB 2CZ9A 2E5IA 3MZ1A 4H1XA 4H0WA 2H5JB 4YB7A 5C2CA 2B4OA 3OTDA 1FFGB 2YKOA 1DTTB 3HSTA 1FSAA 4UOGA 3SETA 4LRFA 4BWMA 2BKNA 4FYXB 2ZBRA 3N01A 4JI5J 2VPYB 4C0HA 3C6UB 2HHUA 2CQ1A 2D74B 2UUCF 4O3OA 2OTJS 3RBZA 2WX9A 2GX8A 4NF4B 2DXRA 2U2FA 1S9EA 2ADBA 4Q43A 1HKAA 2WBRA 4NQ8A 2M52A 5ITOA 3FVNA 2V4JB 1UVKA 1RTHA 4QR1A 5KG0A 3QGIA 4LMZA 1ZBTA 3VR1A 2KHDA 3TA0A 1HNZF 4PAFA 3IORA 4F4XA 4U1OA 1T3OA 2C3OA 2PFFB 3VV2B 1FCAA 1WOSA 2V69A 5D8HB 2MLXA 1Q5YA 2XHCA 2Y7IA 2DGTA 1TELA 3ET6B 2H25A 4Y3CA 4I6YA 3JQMA 1FXLA 4QR2A 2JEJA 4OEVA 1IBLJ 1IBKF 1T0KA 5B0EA 3RPWA 2CNLB 2RVJA 2L3MA 3KWMA 2J6UA 2PT0A 4OMFG 2OSQA 1JQFA 4NYZA 3K01A 3IB1A 2HAUA 2MKHA 3TI0A 1M5VC 2G2ZA 4MAGA 3FJGA 4AE5A 1KNZA 1FQEA 2XX9A 5J1EB 3MP1A 1WKJA 1QULA 4ZS6A 3TEHB 5H9FK 3OPKA 4HL9A 2Y7KA 5LDZA 2MYFA 4WIIA 3R7NB 4GVOA 2V2KA 1M5FA 3PXGa 2FBPA 4Y2AA 2UUAJ 4N91A 3DRRB 1HHQA 1DQ8A 3AAWB 2MHNA 3PO5A 2AGOA 4GWWA 4UA8A 2VFTA 2C2NA 3I5OA 3C32A 1LOUA 2PSZA 4MNCA 4EZ9A 1NB2A 3KLGB 1PBUA 3OR1B 4ZJLA 2AYBA 2IVMA 5HSPA 2HFSA 2DB1A 2RC8A 1WC0A 3E3XA 1GAOA 2RF2A 3AJ2A 3BO2A 1B4SA 4USJC 2OD6A 3HVWA 4CH0S 4ANEA 2E9TA 2CFXA 2ZH9A 3KOSA 1WC3A 3TUSA 3G3JA 1JIHA 1VSOA 1NK0A 3V2UC 1SYIA 4P8BA 5CC2A 3UW1A 4YOEA 2RRBA 3CDEA 2IYGA 1DURA 1NU4A 4JXIA 1VIXA 4OV6A 2M8DB 1UVJA 3R5AA 4XPCA 1ATGA 3MR7A 3VFJA 1ICEB 4HE0A 2H4YB 2YWWA 2DYXA 4BCAA 5TPAB 3TNVA 1S7IA 2FHOB 1CQMA 4H65A 4H6DA 3G8QA 4OWDA 3HV1A 1C0TB 4I8CA 3N9UC 4YKPA 1WKKA 4OYVA 1IBKJ 1B7YB 3ETOA 3PTWA 3I31A 2O1MA 2CQ4A 3KFWX 1CJKA 2LQJA 4NGUA 3EZ5A 3ZXWA 2KXNB 4F25A 2XXQA 3RUMA 4EUVA 4E0DA 1HYSB 4KAIA 4QU7A 3VVDA 4RU2A 1DJ0A 4Y34A 5DM7Q 1PBAA 3T1HJ 4U9RA 1N76A 4I6AA 4G1IA 5DQGA 3R26A 2XM3A 4F0KA 3LA0A 4RW4B 5FBPA 1RT6A 5H9FJ 5KFBA 1GMVA 2W24A 1T7PA 4WXOA 3BSCA 2CQ3A 2FQQB 1WF1A 4K59A 5A76A 1SJFA 4PEOA 1FTCA 3NOGA 5EHHA 3MM5B 3GYNA 4USVA 3KK3A 3VXCA 2FY1A 2P6TA 3TZWA 2LEBA 5E3PA 2UU9J 4CTAB 4I68A 1FTJA 1NXIA 2KFZA 3TA1A 2VGQA 4IY6A 2DO0A 5I42A 5FTHA 4ED6A 1J5EJ 2Q89A 1FKPB 5AA2A 5H8QB 4YICA 1JLEA 3G96A 3AD7C 2XB2D 2OIHA 2Q6BA 1SC4B 2V2QA 9RUBA 1NV2A 3FBEA 4J9UE 1EB0A 2RHSB 1TV6A 5J2PB 3CIMA 2FVQA 1JW4A 4NCBA 5DT6A 1OO0B 4OZNA 5AA3A 3G82B 4X4OA 5K9FA 1W2IA 3TW0A 2KT5A 5AXLA 2Y0BB 3C6TB 1XNRF 3EXYA 4OTEA 2JHEA 1FXRA 5EN1A 4H8JA 1FQDA 2AJ4A 2J0WA 1O7TA 2REJA 2NQPA 2W9CB 1AROP 2QPQA 4YKJA 3ZO7A 2DWJA 3TWZA 3ECRA 2BXJA 3NAIA 1Y9OA 3WZ0A 1NUYA 1HW9A 3L3CA 4D3HA 3DRPA 3LGHA 3FRYA 5DZ7A 1SKRA 5ISUA 4DEZA 1J27A 2UVHA 3CJKB 4Q0BB 4FVCA 3PO4A 1C0UA 1HWKA 2DXEA 2XZWA 5CXTA 3K2YA 1EYKA 5L9MA 2N7YA 1MU2A 1S7YA 1CJTA 3T5HA 4N07A 1SCJB 3BR9A 2EG2A 1A7LA 2DNGA 4IO9Q 5GAHU 3DGVA 4I9DA 4UQTA 2IA4A 4YKKA 4DCPB 4PGNA 1MY3A 4H54A 5KFYA 4ED3A 2OEMA 4GBWA 4RXLA 1H2VZ 3EX7B 2IMOA 2D9PA 3EMTA 4DR3F 1B0LA 4FEDA 3I87A 3FK4A 1LWEA 4OFJA 2XXKA 2I4BA 2QN6B 4ES2A 3IBCB 5B08A 3I4HX 2N4CA 2FGCA 5DVJA 2FYXA 2QT7A 3R6GB 4NWCA 3K6WA 2DKOB 3CDWA 5SUHA 4DPYA 3BO3A 5J1DA 1FWKA 3FMBA 2Z0GA 4U8YA 4PDHA 5L38A 4MIAA 1IMEA 3ENWA 3KUGA 4FPRA 4PFUA 5KFRA 4KYZA 2O1PA 3PY8A 3BKTA 3IX1A 3CJ3A 4O4GA 5CA5A 1N34F 2FYIA 1IXIA 3CD0A 4PDDA 1Y5NB 2Z23A 1UVMA 5B7WA 2FNCA 2X1GA 4IFVA 1AXQA 2WYPA 2GHWA 5F8IA 2QYGA 2F7CA 3N94A 2BOPA 1DFDA 5BXIA 4ZVPB 1KONA 2KKHA 3AQOA 4NCAA 1N32F 3SEOA 2W2PP 5J1NA 2IFXA 2OPQB 3S9MC 3MM9A 4DS4A 3KBRA 2RQKA 2R7OA 1VOMA 4MMPA 2BACA 3ILTB 3GIJA 2XWOA 4R6HA 2VZ9A 4OYXA 2BQUA 4K4YA 1UP1A 4NE4A 1N52B 2CPZA 3SBMA 1IKYA 2P3NA 5J2NB 2VUGA 4K4VA 2HYIB 3RRKA 2LAOA 2FLOA 1PEBA 4TNOA 2DHAA 4JV0A 5I2NB 2UXDF 1NUEA 2PGCA 3CD7A 4QSCA 4G65A 1D09B 2Q8JA 4MMOA 4X04A 4F2OA 4IDKA 3UR0A 4OENA 3QJPA 1RTIA 4C8YA 5I56B 1VQYA 1NK9A 3CI8A 2V8PA 2BJIA 2RKIB 1YAEA 3IOTA 1OY8A 1FPBA 3BGUA 4LQ2A 2BANA 4USIA 2YKQA 3MP8A 1NSPA 1NEEA 3PPRA 3DLJA 3ONQA 1RT7B 1UZDA 2LFVA 4BLGA 4QFNA 2F35A 4KH0B 4N6KA 4TLQA 4A8MP 4E0XA 1S79A 4KKOB 2VPWB 4DE8A 1D0EA 1WACA 5D4NA 3CG3A 3NNCA 2O1LA 3AXKA 3MFHA 3A3OB 1EQMA 2QJ3A 1MXXA 3FQKA 2C28A 2A6MA 1R9LA 4GC7A 4PABA 4DSJA 2CJQA 3GFZA 4EDPA 3FJ7A 5E41A 1U1OA 4ZP7A 3HO7A 5ETRA 2XYGB 2FPHX 3ENQA 2PYYA 1AIVA 1N32J 2AJ2A 2R7TA 2VFRA 2CJ9A 1NMUA 3DOLB 2DNRA 1SQGA 4DFPA 4NLWA 4FBTA 4J9QA 1PC3A 3K5NA 4TLRA 1OLCA 3B50A 3ISND 3LQVA 1U45A 3DELB 3WC0A 1X0FA 2UUBJ 2KZMA 3LSWA 1II5A 3H6VA 3QUFA 4EXLA 1RWXB 1LWCA 3W2VB 4I4BA 1EJ7L 3SCJE 1SKWA 1ZZNA 2DDKA 4OZ3A 4OETA 5KCJA 1JLFB 4L17A 2P9GA