4LUBA

X-ray structure of prephenate dehydratase from streptococcus mutans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
275
structure length
188
Chain Sequence
TMKIAYLGPSGSFTHNVALHAFPAADLLPFENITEVIKAYESKQVCFAIVPVENSIEGSVHETFDYLFHQAKIEAVAEIILENYTRFWVLGDETPTIHLKEEDQKISLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTILGEYFFIIDFENHNEKLVSFALEELTSIGIHYKILGKYAVYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative prephenate dehydratase
publication title X-ray structure of prephenate dehydratase from Streptococcus mutans
rcsb
source organism Streptococcus mutans
total genus 54
structure length 188
sequence length 275
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lubA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lubA01
2Y7PA 3H06B 2V3TA 2GH9A 3MJNA 1D4NA 4DE8A 3P96A 3IK6B 2RQKA 1PB9A 3QIMA 2PVUA 3K4UA 3FD3A 5H8QB 1P1NA 2Z8FA 1B58A 3L6HA 3DHXA 4WKMA 5EHSA 1EZOA 3I3VA 4G68B 1M5CA 5A5XB 2V93A 2Y84A 3RTWB 3QSLA 1I69A 3CG1A 2H9ZA 1LBCA 5K2YA 1A8EA 1M5DA 4Z7EA 5CMKA 2CDQA 5I2KA 4N6PA 5I59A 3KSJA 1QVSA 5JK4A 5AA2D 2O1LA 2P9GA 3B6QA 4GXSB 4ZEFA 1O63A 4NF6B 1QKBA 2NOOA 3PUWE 2DS9A 1OLAA 1I6QA 4JDFA 4ZEKA 1JEUA 3LSWA 3PU5A 1GTKA 3PPRA 5KCJB 1FTLA 4YB5A 3MVZA 1N7WA 3ENVA 1RYXA 5FHOA 1S7YA 3U7JA 3LC8A 4H6DA 2DVCA 3K6WA 4XKNA 3S2VA 3JYRA 1Y4TA 4AB5A 1TXFA 1M5FA 2AYSA 2XHDA 1ZU0A 3EN3A 2VP1A 3OENA 2NUVA 2X26A 4OWDA 1LCFA 5AA2A 3FIRA 1B6HA 2E1SA 2FA7A 3HHGA 4PWUA 2DTJA 4ISUA 5I84A 4KI0E 5TP9B 2DE4A 3IR1A 4IY6A 3IL1B 1P1OA 3GLBA 4ZZAA 5AE4A 1Y9UA 5IT0A 1U8SA 4PFYA 4NF5B 1IEJA 1LK7A 3O29A 1IXHA 4G8HA 1Q1KA 5AA4A 3CR9A 2PA3A 1EH3A 2XX9A 3S4UA 3G3JA 1P1UA 5KDTA 4EF2A 2HEUA 4X1DA 3CFLA 3OMBA 1UIUA 1SYHA 4H67A 1H3DA 3D4CA 4XXUA 5I2NB 1ANFA 1YTVA 1SVXB 4LA9A 1DSNA 3IO6A 1EZPA 1B3FA 1XT8A 3ZSFA 1GR2A 2F8MA 1HSEA 4DXBA 1SI0A 3FASA 1XS5A 3O6HA 5B70A 1UQWA 3TUZC 4FAJA 2O7UA 5AA2B 4IO1A 3T66A 1F9BA 3KN3A 3CEDA 5BUUA 4ELPA 3O6IA 4E0XA 1SC6A 2H4IA 3N6TA 1BIYA 3H6VA 1ZBMA 5J1DA 1SI1A 3G7WA 1MDQA 1MQJA 3K1NA 5KZTA 4R6KA 3OD7A 1Y3NA 2Q88A 5I57A 3TPAA 4U23A 3FV2A 4JBZA 2THIA 3MP6A 2O84X 2QSWA 1OVTA 5H8FB 3ZKLA 2V3UA 3KFMA 4PFTA 4RA1A 4RXLA 4DLDA 2XX8A 2PMSA 2G29A 1PBPA 1DPPA 1FQFA 4LQ2A 3KN8A 4PP0A 4GD5A 4QFKA 2UYFA 1PB8A 4OEVA 1Y1MA 3PV0E 4POXA 3N26A 1JVYA 4WXJA 3PPPA 2DP8A 3FJGA 1LLSA 1POY1 1LB8A 2Y7IA 2X7PA 1PSDA 1Y4CA 1I6AA 3UN6A 2F78A 1J1NA 3PMXA 2KO1A 3KWMA 2IEEA 2RF1A 2Z8DA 1XOCA 2HZLA 4XIGQ 4IO4A 2UXAA 1LAGE 1DTGA 5FHNA 2Z23A 2QS3A 3MVYA 4BDOA 5DT6A 1M5EA 3BFTA 1MH3A 2UVHA 2I58A 1SW1A 3W9WA 1SQYA 1FTJA 2I49A 3MPKA 3BBRA 2GHAA 4C0RA 3VVDA 4EXLA 3UP9A 3OEMA 3A3CA 2MDAA 3TUSA 4GVOA 2ZNUA 4LONB 4QSDA 4K3FA 3M3FA 2HFBA 1A40A 2DOJA 1NKXA 4KCCA 1MS7A 5DEXB 2PT1A 1A8FA 3TTKA 2NYIA 1NNFA 2QJEA 2FYIA 5CRYA 2A5TB 1N76A 3M8UA 3TQWA 2B3FA 3SESA 2QS2A 2H98A 3KSXA 2DYXA 1B51A 1OQHA 2DWJA 1H44A 4X84A 4G2ZA 1CB6A 4IB2A 4OERA 1LBBA 2ANJA 3EHUA 4WEPA 5DVJA 3OO6A 4U21A 1MQGA 3ZS6A 3LUYA 3T9UA 1DPEA 1LB9A 1L5TA 1NFTA 3G3HA 2YJPA 3FVGA 4OEUA 2NVUB 2DSFA 2IA4A 2ZNTA 4KFQA 1MXWA 3QUJA 2F36A 4XKRA 4FORA 2DWIA 2G93A 1N0TA 2PT2A 2XXVA 3FVNA 1BP5A 5BWJA 1N3WA 3T9VA 2LQJA 3R6UA 1IQ7A 1MXZA 3ZKKA 4YMAA 4X1BA 3IJXB 1MXYA 3B7DA 5CM6A 2QL3A 1EU8A 3UW1A 1RYOA 4L17A 3TAJA 3TUJC 1AOVA 3TKDA 3S9MC 4EF1A 1B5HA 3U94A 1FCKA 4KR5A 3TTMA 4AB6A 3S9LC 1WDNA 1XVXA 1H45A 1URGA 1SBPA 3FATA 2UYEA 4IGRA 1B3HA 2F1FA 2ABHA 2HAUA 1DOTA 3DP4A 3PD9A 3DC2A 1JVXA 2ALUA 3PPOA 3W15C 4G68A 1QKAA 1DTZA 5A5XA 1D9VA 3SETA 1B3EA 3G3GA 2P1SA 4I8CA 3WAFA 1JEVA 3K6VA 3RN8A 4Z0IA 2Z22A 2O68A 4JWXA 4U4SA 2XXUA 3FXUA 5DYHA 3HCQA 2O51A 2OWTA 4NF6A 4X48A 4KD5A 1NMUA 1USYH 1MY3A 2XD2A 4RK2A 2XXQA 3U8QA 4GFRA 4OYVA 3CG3A 2R9JA 3E13X 4JSDA 4F3SA 2DVZA 1HSJA 1LAHE 5KCJA 2KLFA 3I5OA 4YMBA 2B3BA 2V25A 4R74A 3DP6A 4IO3A 1MY2A 1PEBA 3Q28A 2OLBA 3QAXA 3KOSA 5B7DA 1H76A 2ZXTA 3UGWA 3LR1A 2X7QA 4IY5A 3K6XA 3USDA 2VD2A 2RE1A 3H6WA 5L9OA 5CMBA 1B1HA 3DM0A 1D3KA 2FNCA 3MVXA 4JB7A 1RWUA 1JQFA 4QSEA 5TP9A 3U93A 3ECRA 4ESWA 4MF3A 2RC9A 4H0WA 1B7UA 1MQDA 4FE8A 3AXFA 4NF5A 2UVIA 4DZ1A 3V5AA 3PUZE 3W7BA 2D5WA 2P2AA 3E4RA 3ILUB 4M1VA 1B32A 1YCJA 1ZJLA 5T41A 3KOTA 4Q30B 3EPEA 3FJMA 2QS1A 1BTJA 1AH5A 3TTRA 3M3KA 3SERA 5I2NA 1QUKA 2VD3A 4F31B 4BDLA 2M8CA 3KJTA 4YKPA 4ELRA 3B6TA 1JETA 2QMWA 1LFIA 1YBAA 1XVYA 1BLFA 3TYHA 1JW4A 4QRZA 3RLFE 3TCGA 3TEPA 3ONMA 3C31A 5FTHA 3OFGA 1PDAA 2NWJA 3ILTB 3JZJA 1GV8A 4Q8RA 1IIWA 4H1XA 3OO7A 4YKKA 4POWA 4LP2B 1AL3A 2F6GA 3W9VA 1TWYA 5H8NB 1MXXA 4N07A 4QHQA 4OQOA 3K01A 4I9DA 3K00A 4ZEDA 4OZ9A 4ECFA 3N6UA 3PPQA 1OIBA 5H8FA 3DP8A 3FXQA 2LAOA 3VVFA 3DELB 1IXIA 4F19A 2YLNA 4GL8A 4UACA 1ZTYA 1JW5A 4IO5A 5TPAB 1Y3PA 3U92A 1NNPA 4MLQA 4RY1A 3KZGA 5HM4B 4Q0CA 1AIVA 1B7HA 2ZYMA 3GZGA 3C32A 4ZDMA 4DDDA 2JHEA 2ONSA 1N84A 3EHSA 2B65A 1RKMA 1M5BA 2GHBA 1YGYA 3CSGA 1QJMA 1NNTA 1LKZA 1MM6A 4NTLA 5CI5A 4YKIA 2I0CA 4RPOA 4FJPA 2ONKE 4ZECA 4PFWA 1Y20A 1EZ9A 1Z7ME 4NWCA 1FQAA 2F35A 3OSRA 2Y7KA 4XKQA 3Q29A 1B40A 3D4GA 2HXWA 3F11A 5I58B 3DDNA 1QUJA 5HBCA 4G68C 3VFJA 2Z8EA 2I3WA 3DHWC 4P0IA 1TT1A 4KYSA 4G8MA 2F7AA 4MFIA 3MQ9A 4ZS9A 4NWDA 3TCFA 5DEXA 3FVOA 1SW2A 3IB1A 4OTEA 3HSTA 5H8HB 2F97A 2A5TA 2P9EA 2OK2A 4BLAA 3T93B 3AAWB 3T22A 3N5LA 4R6YA 2E0SA 4THIA 5FHMA 4R72A 4R2FA 3KEIA 1QW0A 4F29A 3H4ZA 3FJ7A 1UIVA 1VFDA 1SW5A 1VR5A 3IO4A 4F3GA 1UJ5A 3QK6A 1MPCA 4R9FA 2PBWA 4YAHX 3TCHA 3O97A 3GXAA 1PBQA 4YZZA 3MAHA 1XC1A 1UJ6A 5H8SA 2DXYA 2REJA 3IBWA 3MUQA 2H9BA 2ZMBA 2P0SA 5I56B 1VSOA 4QFLA 2O6AA 2GRVA 4EQ7A 1YAEA 3OELA 1NL5A 3E9XA 4H8IA 4JWOA 3VXCA 2D21A 3G3FA 3FXRA 1ATGA 4M4GA 1A99A 1OLCA 2Q8JA 1LSTA 1B05A 2HCAA 3LBSA 4JXIA 2QRYA 5CMCA 3NRBA 3MW0A 4GXAA 1NNKA 1QUIA 3LSFB 1UTBA 4LVQA 4EQBA 1A55A 5ISUA 3OFEA 3QYTA 3MPLA 4H8JA 3OO8A 4JWYA 3TTLA 5IKBA 3CRBA 4EXKA 1B4HA 5ICQA 1LFGA 3OFHA 4YU0A 4NE4A 1MY4A 4E0WA 4OMBA 1SD3A 1FTMA 3A3UA 3T96B 3VXBA 3PUYE 1MQIA 4RPNA 3CSBA 4N13A 4GWOA 3IOVA 5AA1A 2OJTA 2RC8A 3O9PA 3GBAA 2AL5A 3TDJA 4GLIA 1B3LA 3PUXE 4LQ5A 3P7IA 1URSA 1SW4A 1MDP1 3G3KA 4MBPA 3TELA 3U72A 4NF8A 2LVWA 2GFEA 4EUOA 1ZLQA 4OENA 3TMGA 4LZ8A 3MP8A 2ZYOA 1M0SA 3LOUA 1FQDA 1R1NA 4G77A 1B4ZA 5JEIA 3AB2B 4H5GA 3EHTA 1A7LA 3OSQA 1S9TA 4U4XA 3FGSA 1DMBA 3N0VA 4OFLA 3AB4B 3BFUA 4FIMA 4ZE9A 1LGBC 4NEDA 1B46A 2V84A 1ZPVA 2ZYKA 3MTJA 1BKAA 4BDMA 1UTBB 1B9JA 2H25A 4YB6A 2O1MA 4WEDA 2XXIA 3BKIB 1B1XA 4DXCA 2F7CA 1KWHA 3C34A 3UA8A 4MLVA 4X9TA 3IOTA 3CVGA 2QRRA 3HN0A 1R9LA 2VGQA 3PPNA 1VE4A 2PX1A 4UA8A 4DXUA 4GQOA 1PC3A 2DE3A 3RT8A 2UVJA 4ZEBA 4NF8B 4GF8A 4C1UA 1O64A 3HPIA 4I62A 1YPNA 3Q26A 3OO9A 4OVJA 4FECA 4ONYA 4IO6A 3IOUA 3OEKA 5JTYB 3K2DA 4BDQA 2XXXA 5IAIA 3O6GA 5F7VA 5ELVA 3RQTA 3RTFB 3PMVA 2F6PA 2Q2CA 1XTZA 4HTGA 4YB7A 2XXPA 4DCYA 4H5FA 4GL0A 3K1PA 4PE5B 2RINA 3JV9A 4DIGA 3V89B 3FVKA 4LZ7A 3IAZA 2RCBA 2XXRA 4BDRA 4QFOA 4PQJA 2DWAA 1B2HA 4PFUA 3H7MA 4HS7A 2I9SA 3G3IA 4U1OA 1Q35A 5H8NA 5L9SA 4KPTA 1FQBA 3IX1A 4NF4B 3SKPA 3KBRA 2PC6A 3O66A 5DTBA 3A09A 3H03A 1LAXA 5CBSA 3VV5A 1D9YA 1MXVA 3FUZA 4XTCQ 3S9EA 3O28A 4F2OA 3MWBA 5TPAA 2P9CA 2ESNA 3MP1A 3E3KA 3UIFA 1SYIA 4I1DA 4PETA 1Y7PA 3Q27A 4RYAA 4GRKA 2Q9TA 4KHZE 3THIA 1URDA 1LCTA 3LSLA 4ESXA 4P11A 2XXHA 2RQMA 5FIIA 2I3VA 1ZIUA 1ZMGA 3R7XA 3FV1A 1SDXA 4KQPA 2I4BA 3C35A 3MBPA 1GGGA 4HCWA 1S50A 3KJ7A 3RGYA 1TFDA 3UORA 5I2KB 3IB0A 5I59B 4TQUQ 4H65A 3T9XB 3VLWA 1OVBA 3I6VA 2HZKA 3C4MA 4ELOA 1OQGA 3S9NC 5I58A 1UTHA 3DLNA 3VE1B 1AMFA 3CI8A 4R2BA 3C33A 3VVEA 4R73A 5IS2A 1B0LA 5CC2A 2PYYA 4DCXA 5AA3A 4QFNA 3TFLA 1LFHA 1KS2A 1IZ1A 4M8LA 3VLVA 4KYEA 1IXCA 3TTNA 4F3PA 3L6GA 2O7IA 5H8HA 3V8XB 2DXRA 2ZYNA 3H3GA 2RKMA 5TU0A 1MXUA 1US5A 3ODBA 2FGCA 3TQLA 3MAMA 3O2AA 3OOAA 1GVCA 2DT9A 1NH7A 3QUFA 2JOQA 1MQHA 4BDNA 4TLMB 5CBRA 1IUDA 2AIXA 1MPBA 5L8DA 4HW8A 1R9QA 4NMYA 1P1WA 1LK5A 4EQ9A 3PGFA 3GBBA 1O7TA 4GOTA 4LUBA 4OFJA 4AQ4A 2V3QA 3K5PA 4YICA 2J0WA 1P1QA 1USYE 4F2QA 5K2XA 3V83A 3Q25A 1MY1A 1WVJA 5ITOA 1UTHB 2QPQA 2F5XA 4NMLA 1FTKA 5I56A 4GO5X 4ZZEA 5AA4B 4QF9A 1PB7A 2A5SA 4MH5A 4EDPA 4F1YA 1QULA 4R9GA 2RC7A 5KDTB 2CZLA 5FTIA 4ZEIA 1JW1A 3TUIC 1NH8A 4F39A 3IORA 5F1QA 2UVGA 1MH4A 2I4CA 2OZZA 3MVWA 2QMXA 4KYDA 1N7XA 4GMKA 3M3LA 1WODA 4ZE8A 3MZBA 3B6WA 2XXYA 4YKJA 5ITPA 3IB2A 3HO7A 1H43A 1MY0A 2ZHOA 1CE2A 5DVFA 3TODA 4F1VA 2F7BA 3SEUA 1A54A 2VOZA 4OXVA 4F1UA 3VDFA 3CFXA 1IXGA 1I6BA 4OHNA 3HHEA 3RUMA 2H5YA 5I57B 4KCDA 1N3XA 2OBGA 2XXWA 3LSXA 3UK4A 2R6GE 1ELJA 1POTA 3RY3A 3H6UA 4TOZA 3RNNA 3RPWA 4P0GA 3C36A 3QXMA 2AL4A 2REGA 4F3BA 3K6UA 1O8BA 1II5A 4U1ZA 1MM7A 2Y7RA 1VFEA 3PD8A 4U2RA 3KN7A 3WAEA 3U1OA 4LATA 3L7OA 4IO2A 1US4A 3EF7A 3R26A 3ENWA 3RT6B 5ICTA 1OMPA 3OBIA 4O3CA 1MG1A 2ONRA 1P99A 3MZ9A 2HQ0A 5EYFA 4GIZA 2NXOA 2ZNSA 1Y1ZA 1B52A 2D3IA 3C9HA 3MZ1A 2DWHA 2OCUA 3EQ1A 3TZAA 3CIJA 4O3BA 3VLUA 4RNSA 2XX7A 4XKPA 4OESA 2DE2A 3OFFA 3KG2A 3HHFA 4R6HA 4GO7X 3SDFA 4QFPA 4F22A 4ND9A 2Q89A 3O1LA 2I48A 4IO7A 1HSLA 1ZKBA 2J0XA 2O69A 1LAFE 1Y3QA 1B5IA 4HCYA 4Q5TA 5EHMA 1B5JA 3FZVA 4G8NA 2Q2AA 2VHAA 4TLLB 3SEYA 1Z7NE 2DQVA 3ENQA 1B0HA 5JTYA 2HAVA 2I6EA 3MC2A 3PMWA 2WKYA 4O3AA 1FQCA 3HV1A 2RCAA 4ELQA 3SEVA 2BJJX 3K02A 3IJOB 1N04A 5LOMA 2F34A 3T9HB 3IXQA 3K0VA 1IITA 1XHYA 2XXTA 2R71A 1FW0A 1B3GA 1R6ZA 5DVIA 2F8DA 4RJZA 2YPNA 5IT4A 2I0BA 1B7ZA 3CFZA 1JNFA 3IOWA 5H8QA 1MRPA 4FEBA 1MPDA 1UJ4A 2H99A 5CMMA 2Y7WA 4OFOA 4FEDA 2XD3A 4OETA 3S1TA 4FATA 4U22A 3H6TA 2W7YA 3SEXA 1TFAA 3OXNA 4NF4A 4R75A 5L9MA 4JSOA 4QSCA 5JJBA 3SEWA 2QSXA 4LZ5A 4IGTA 3KGCA 5M2VA 3N94A 1T0KA 1FQEA 4C1TA 2CMOA 2OWSA 4RK9A 4F18A 3PUVE 5HPQA 2QS4A 1FTOA 3K1MA 4G4PA
chains in the Genus database with same CATH superfamily
3OXLA 3H06B 1JQGA 2V3TA 4ZVHA 2JLEA 2QG9B 1ZS6A 4RLEA 2EFGA 3FEXB 3FD3A 5H8QB 3PNIA 1SQGA 5A0YB 2CJYB 3RB4A 5EHSA 4QW8A 4ECWA 1O6XA 2V93A 4I2QA 1KDNA 3VAHA 2FLNA 5DW8A 3RTWB 2HRUA 2H9ZA 4AXIA 3C3LA 1LBCA 1TL5A 5K2YA 1M5DA 2HRYA 2BM1A 5CMKA 2CDQA 3KSJA 4FPIA 4M5LA 5K14A 2RAQA 4GWSA 4HT7A 2AD9A 1D9FA 4GXSB 4F0HA 3MR5A 4NF6B 1TL4A 4OJHA 1VMBA 2DS9A 3L7PA 1PAUB 2ADCA 4Q0BB 3UNYA 4DDFA 4M63A 3PPRA 1T3NA 3CJTA 5HJXA 1FTLA 3GG1A 1FTAA 4YB5A 3MVZA 1L3UA 1RYXA 5FHOA 3K89A 2HWHA 3LC8A 2ZH6A 1U4BA 5AXMA 2X3GA 4DL3A 4OHYA 3S2VA 2OFGX 1Y4TA 4N6KA 1NNDA 1RXOB 1FO1A 3IBCB 4AB5A 3CC7S 4MFBB 4NLGA 3DLBA 1TXFA 1S0NA 5DLFA 1M90T 4J9SA 4ELUA 1Q5VA 3M8WA 2B4PA 1KLNA 4R8UA 4CCHA 1KOHA 1S0VA 2NUVA 1WTBA 1LCFA 1WOPA 2KXHA 2FY8A 1B6HA 3FIRA 1K73T 1DK4A 2NSBA 3E79A 2RIJA 1QTMA 2UXDJ 2IRXA 5I84A 4KI0E 2CJ9A 5TP9B 3IRXA 3H90A 5ETLA 4F7VA 2HHVA 1P1OA 1VK8A 5J1NA 5A8WA 1PILA 4DSIA 4FF2A 2F9DA 5KFTA 4XEQA 1S7HA 3OXFA 4ZVTB 1V3RA 1FD2A 3ISND 4G8HA 1FKPA 2X1FA 1PYTA 3CR9A 2Y1RI 4ZITA 2HHWA 2FHOB 4WYWA 1YBTA 5CYQA 2XX9A 1P1UA 5KDTA 2W9BA 4EF2A 2OELA 4DLEA 2A18A 3CFLA 3MM9A 1CS4A 4RW7A 3D54A 4C8ZA 4XXUA 1ANFA 3BF4A 3MPUB 2K06A 1YJNS 4B17A 1NV1A 2P3VA 1EZPA 1XT8A 4DN0A 3DRSA 4DU8A 3GIJA 3KHLA 4R5PB 2ZJPQ 5B70A 3C6TB 2ZE2B 2VOOA 2LEPA 3E78A 5IWAF 3TYTA 3MUVP 1LBVA 1WF2A 4K4YA 5BUUA 1KNZA 2H4IA 4URSA 3EM1A 3ITHB 2R7RA 3H6VA 4FBUA 2AU0A 3EVWA 1WJ9A 4RZRA 2QL9B 4W4MA 2LXUA 1Y3NA 4LF1A 4V19J 3FJ2A 4BBYA 3TPAA 3JTOA 3FEYB 4WFNQ 3MP6A 3QAUA 2ZH3A 4M1KA 3DMJB 2QSWA 1KHWA 1BXNA 2C28A 4F04B 3V5RA 3A12A 2XX8A 1QUPA 2PMSA 4Q8FA 2G29A 1C0UB 3EZ5A 1FQFA 1YJ9S 3KN8A 5K8MA 4QFKA 3GG0A 4GVBB 2VPZB 1SKRA 1PB8A 3THVA 1NHUA 2R7QA 3PW2A 4WXJA 1JXLA 2AEFA 1LLSA 1R3NA 1POY1 1T03A 3UI3A 2MQLA 2QV6A 3R5JB 4Q8EA 3I56S 2EC2A 3CCJS 1FJ9A 4ECQA 3UN6A 1J1NA 1FDNA 3NAIA 3IS9A 4ECVA 5L1IA 2V68A 5E7OB 1LAGE 4X4OA 3MEEB 5KT7A 2AV5A 5C24B 1ZM9A 2BKPA 1ZA1B 4MT1A 4DV3J 4DL0C 4NL5A 3GV5B 4FYWB 2MKYA 3LP1B 1N56A 2GV1A 3T1YJ 2XCPA 3O3LA 2SXLA 1LWFB 4JI2J 4TKTA 1SQYA 3GIIA 3I55S 2OJ3A 2GHAA 2CG4A 3IRWP 4IRDA 4X4RA 3UP9A 2VFRA 3PW7A 3OEMA 4CP5A 3A3CA 4GVOA 1HHSA 1G3OA 3E3XA 1I6JA 3Q2SC 1IKYB 2Y1LB 4A8QA 3QJPA 2F40A 5IT9U 4HT5A 2AT1B 7AT1B 2ZVSA 1VBKA 2VASA 4HDGA 4RBTA 3WDOA 4K3FA 1S1WA 2HFBA 3QFWA 2LDIA 4RKUC 4G61A 5DEXB 2AZ3A 1KHVA 3TTKA 2NYIA 1RT4B 4DSLA 1B7YB 2XGQA 5DDOC 2BJIA 1KONA 1FFWB 2KT2A 4WP8A 3M8UA 4HLBA 1LEVA 2H98A 3KSXA 3C14B 3R5AA 2DWJA 2FIEA 4X84A 5CYMB 4ZPDA 5T3JA 3PRDA 2VT5A 3M9NB 4OLOA 3BQ0A 3DFEA 1TQLA 1PC5A 3IR5B 4DX5A 3OO6A 3CJ3A 2KRRA 2J8SA 3FUYA 1C1BA 3GR1A 4CM2A 2GVZB 2XLIA 3ZS6A 1VBYA 4QU6A 2HBZB 2J6UA 1NUEA 1MMLA 3MTKA 1URRA 1M5PC 2YJPA 3FVGA 4A46A 1GFWB 1CQNA 1TTHB 2MQQA 1RT7A 4KHRA 4CLKA 2YPZA 1X9MA 1MXWA 2KR0A 2PI4A 2CQCA 2CZ4A 4MIAA 1KP6A 3T41A 1ZAVA 4E8UA 1VQLS 4XKRA 4FORA 1N0TA 2PT2A 2XXVA 3FVNA 1BP5A 2CPIA 1T05A 2W4DA 4GWYA 1MXZA 3ZKKA 1S1VB 4YMAA 1UVJA 4X1BA 1N33J 4YN3B 4U67Q 3CCQS 3CO0P 2QL3A 2J8AA 1S7IA 3UW1A 3KMQA 3TAJA 1SC4B 1VJQA 4EF1A 4QYRA 3TTMA 1WF0A 3D9BA 1RGVA 1X9WA 2D74B 4QOTA 4UY85 2QYGA 3VWSA 4DL2A 4X04A 1B3HA 3A3NB 3IWNC 3J7YU 2G2ZA 3DP4A 5A0YA 4NRTA 4F3OA 3PPOA 1IVZA 3RRKA 1NSPA 3EMTA 4HHUA 3CCSS 2CQPA 2H51B 3RBDA 4I8CA 1JEVA 3RN8A 2BUNA 2VIHA 2O68A 4P73A 3RR8A 2XWYA 3DN9A 4KO0B 3VTIA 2XXUA 5DYHA 3B50A 3R2CJ 2O51A 4YOEA 3BR9A 4NF6A 3I87A 4KD5A 1USYH 1TFYA 1MY3A 4JBCA 1UVKA 2XD2A 2U2FA 3UDLA 4Q0BA 3CG3A 2R9JA 2O3DA 1MROB 5KFVA 1T9XA 4N76A 1LAHE 3V6HA 4PAAA 5KFUA 4YMBA 2VH7A 2NZCA 4AFFA 4R74A 3DP6A 3ETOA 3QSYB 2K3IA 1SJ4P 4NWBA 1TKTB 5CAAA 4MFBA 3CDWA 3A8JA 2WVCA 1AWBA 1JX4A 4IY5A 2GNKA 4LJMA 2BA9A 4NLYA 5G0RB 2VPOA 1VIXA 4MIWA 1G6BA 4IOBA 3H4BA 5D4NA 4ZP9A 3DM0A 1JQFA 4QWAA 5TP9A 1IR0A 2XTJP 4TNOA 4ESWA 4XDCA 3SCLE 2RC9A 3SCKE 1GTEA 2PDAA 1WACA 3QFHA 3J7ZT 3AXFA 4I64A 4A8MP 3R9LA 4GC7A 3HSDA 3FBEA 3V5AA 1KFSA 2D5WA 4TY9A 3HKZD 2L5VA 1B32A 3W8PA 1QJHA 1YCJA 1H2UX 1ZJLA 5T41A 4J9KA 3M7VA 2ZUGA 4DV3F 2R42A 4N6DA 2EW9A 1UFKA 2C22A 1FPJA 4LVNP 3TTRA 4NLUA 3M3KA 2VC0A 3DOLB 3T1YF 1HBOA 3UN5A 2LECA 4O3NA 1MWYA 4OX8A 1FPKA 2OD4A 4R25A 2W2PP 3P5TL 3HLUA 1SQFA 2DH8A 3H20A 1JETA 4TQRA 1JMTA 1XVYA 4R5PA 2XWIA 1BLFA 1LWCB 2B7CB 3C6TA 2ZE2A 4QRZA 2B4LA 3ONMA 1CJKB 3MZIA 4FYVB 3OFGA 3D1OA 3MXHP 1HNZJ 2DXFA 3I9ZA 4WU2A 3ILTB 5CD4A 1RT6B 3ITHA 4BWMA 1IIWA 4H1XA 2BABA 3CIMA 1VDWA 4YKKA 3IBFB 3LA0A 3T5LA 4KE5A 2HFVA 1MXXA 4N07A 2HPUA 4IQMA 3K01A 4I9DA 3R27A 3DMJA 3PPQA 2YNGB 2CPZA 4DXLA 3VVFA 1QY7A 5HBMB 1JW5A 1IR2A 4DR5J 1FNXH 2BQUA 3CULA 4IO5A 1YKWA 1FBDA 1C0UA 2BE9B 1OY6A 4NLRA 4YB1P 2UUCF 3H40A 2DK2A 2DGWA 3CCES 3KG0A 1NV5A 1VQ9S 2DHAA 2AX1A 5IC6B 1AIVA 2BJ3A 2GHPA 4Q43A 3DRPB 4HI2A 4WBFA 3RBXA 1QSLA 3DGVA 3C32A 3PX6A 4ANCA 2ONSA 3BO4A 3CCTA 4CLUA 1NZ8A 4I3YA 2JZ5A 2OPQA 3Q8UA 2B65A 1REGX 3CJRA 4DUTA 1T8EA 1RKMA 2YKMB 4P7VA 3VAKA 1X4EA 2WZ1A 2GHBA 3MEEA 5C24A 2UUAJ 6FD1A 4USMA 5U47A 4K7QA 1FDBA 1AB8A 4HACB 2D41A 4NTLA 2CPYA 3K8WA 3LP1A 1N33F 4ZJOA 4WFYA 3LPYA 1SJ1A 1LWFA 4M5GA 1EZ9A 1FRJA 2F35A 4OI3A 1U6FA 4XKQA 5DM6Q 1B40A 2D69A 2CRLA 2DVIA 3HSZA 4F3QA 4DL5A 3OPKA 5E33A 4NAPA 3VAMA 2UVRA 2R7SA 1D8ZA 3DDNA 3AQPA 2OWZA 2CA9A 3VFJA 4ZLPA 2ERRA 4RW9B 5CXTA 1TT1A 1H38A 2ZNZA 2WBMA 2F7AA 2MLZA 5DEXA 3FVOA 1SW2A 1RT4A 3IB1A 4MAKA 1VS3A 1XMQJ 2OK2A 4BLAA 1RWOB 1GH8A 2HQIA 2H54B 3GPAA 2QA2A 1TV6B 4R6YA 3R5DA 1ZBTA 3CMQA 5F8HA 4WK1A 1WORA 4WFBQ 4NZ0A 4F29A 3D5MA 3C14A 4FVCA 4I6YA 4ES3A 4WIQA 3J7YI 2XYPB 5ETNA 1H0HB 1WHYA 3IFEA 1FX2A 3TI0A 3MCSA 2CQ3A 3MPYA 4R9FA 4WXOA 2PBWA 4YAHX 3TCHA 2GVZA 3O97A 1PJ5A 4L3KA 1PBQA 4QW9A 5JUMA 3NBPB 3S01A 2DXYA 3OSNA 2OPSB 1H2TZ 1HWJA 4J9OA 1IWAA 1FF2A 3U1LA 4WWSA 3MUQA 2H9BA 3BN7A 2P0SA 5HVFA 2IY5B 2HHPA 4QFLA 2CPXA 2M3DA 2GRVA 4ZVEA 1OSDA 3OELA 1VBZA 4ERDA 2CZVC 3E9XA 4PF6A 1Q8IA 2ASJA 4JWOA 2DEJA 4A8XA 4WKYA 3G3FA 2LEBA 1S1VA 3SFGA 5HMYA 4X64J 4DR3J 2Q8JA 1X9SA 1BGXT 1FJ6A 3VGUA 4JI7J 3QLHB 5CMCA 2MLXA 3VV2B 4X65F 4ES1A 4ED6A 1NNKA 1FKOB 4DFPA 4L74A 3LSFB 2XYGB 3OFEA 3MPLA 4YY3F 1UAWA 3CCUS 1VOMA 3OO8A 3I5BA 3AD7C 2MKKA 2JWNA 4LF5J 4EXKA 4FVMA 2RSQA 4DPYA 2QLWA 1LFGA 2Z2ZA 3OFHA 1YZ0A 2Q66A 1SJQA 4OMBA 3FMWA 2J7WA 1FTMA 2BACA 2DDKA 3VXBA 4RPNA 3FEZA 2OMOA 4GWOA 2OJTA 2DNOA 3O9PA 2O67A 3TDJA 3T3FA 3TJAA 3NGDA 4GLIA 3D1RA 4J90A 2G1HA 4LQ5A 4KO0A 3Q86A 4XO0A 5IT9Y 4MBPA 3TELA 3U72A 4NF8A 2EFVA 2ZJRQ 2GFEA 4ED2A 4EUOA 4OENA 1C0TB 3TMGA 3KC0A 4OYIA 1B4ZA 4H5GA 3EXYA 1HNZF 3OSQA 1QD1A 3KK2B 5C2GA 1NDLA 4N56A 2HZVA 3CB4A 3M8QB 1SBRA 3RYDA 2IVMA 1B46A 4O0IA 2EBEA 5HI7A 4DL7A 3N9UC 1N88A 5I42B 4BDMA 3ZNJ1 1RTDB 4YB6A 3G6YA 3F0NA 3H2LA 2O1MA 1WSRA 4USKA 2LDYA 1Q7LB 3R7NB 1D3WA 1B1XA 2P5VA 3LAMA 2YQ1A 3EVMA 2ATCB 3BM7A 5I3UA 3JQKA 5F8NA 1TR0A 1VBXA 4DR5F 3RBZA 1HHQA 3IOTA 2MQOA 1PBAA 4NCAA 5G0RA 3GYYA 2HHSA 4MMPA 2K1RB 4GKJJ 1HD0A 4UW2A 4DXUA 1TMJA 2MQ8A 4KFBB 4C97A 2MZJA 1FVQA 4KAIA 1NM2A 3OTOF 4K4ZA 2VKZG 2MY7A 2DPJA 3BO2A 2E1MC 4ZEBA 1D0EA 3IWXA 5K8PA 4LT6A 1FTCA 1F5BA 2YKOA 5ETPA 2LYVA 2UUAF 3KUHA 3GCWP 2CZIA 4ONYA 2CZKA 4IO6A 4WTYA 3M6XA 2R7TA 4BDQA 5IAIA 4B3MJ 1V5VA 2WK4A 3DOLA 1S4FA 5F7VA 5ELVA 1MN9A 2KT5A 4AUKA 2YH0A 3OLBA 3RRGA 1KLMB 2EFQA 2XXPA 3DI6B 3TZYA 3W2VB 3PKYA 4H5FA 3K1PA 4PE5B 2W7AA 1VQ6S 5KFXA 3JV9A 4DIGA 1X0PA 3IWLA 1LWCA 4FXVA 3FVKA 3L95X 2B4MA 1CJKA 1FWPA 2R8IA 4FPRA 1Q16B 2RCBA 3NCQA 4TLRA 1RT6A 4PQJA 2DWAA 2VJUA 4C9DA 4PFUA 3W63A 4TU9A 4DV5F 4KXPA 3MCMA 4KPTA 3NXZA 3C2PA 4NF4B 1HWKA 3SKPA 3O66A 2YNGA 3D2WA 3FSYA 3GE9A 5HBMA 3MF5A 1YQHA 1D9YA 3S9EA 5AT1B 2O01C 3D4JA 3MP1A 4B3RJ 1QDUB 1SYIA 1BQMB 4I1DA 2QIFA 3S7RA 3P5BP 4ID5B 1Y7PA 2C2MB 1KN6A 3Q27A 4RYAA 4GRKA 3DRPA 1SJ3P 4I40A 2GHWA 4UQTA 3DLLQ 1FDAA 3B6BA 4WFXA 3THIA 1M1GA 4YS2A 4ESXA 1KA0A 2RQMA 1KKHA 2YKMA 1ZMGA 4RNMA 4XIUA 4FBTA 4DPOA 4HACA 2H1YA 1C2PA 5EWFA 1FERA 4E98A 3HHNB 4X64F 1N0VC 3BIGA 5EUHA 2J9DE 2ILYA 4JI7F 2YY3A 3UVJB 3GYXB 3MAAB 4H65A 2AJQA 2EG1A 1OQGA 2YWGA 1UTHA 4ZVRB 2UU9J 3NWRA 1Q95G 2YX7A 4DR7J 4RW9A 3VVEA 1WKKA 4ZVGA 1FRKA 5AJ3J 2EWHA 4LRFA 4O3SA 2JLFA 1LFHA 1KS2A 5ETSA 1IZ1A 4PXCA 3VLVA 1AUSL 4PFIA 4F3PA 1RWMB 4C0BA 3HI9A 3KXDA 4HH1A 2DXRA 3H3GA 2BJDA 3PX0A 3D0IE 4XPCA 1MXUA 4KGVB 1TV6A 3EE3A 3DNCA 1US5A 2UXCJ 3T6JA 1JJCB 4JVIA 3O2AA 2DIUA 3JTNA 3OOAA 2M52A 3T1BA 3RB3A 4ZPCA 4Y3CA 2JOQA 3FZ2A 5CBRA 2CAJA 2AIXA 4MKBA 1MPBA 5L8DA 4HW8A 9RUBA 4FF3A 4AQ4A 1ACMB 4YICA 4YP3A 4RL1A 3MM8B 4WYLA 3NBPA 2UP1A 3V83A 2C2RA 2WYKA 2CKWA 2OPSA 3Q25A 3KFWX 1F9EB 5L1JA 1FFGB 1IUJA 2I38A 3TX0A 4QXDA 5LDZA 4M5IA 4LSZB 5AA4B 1WC1A 4MH5A 1QULA 3RTVA 2NCKL 1NH8A 4B3SJ 1XNQJ 3OL8A 4GKJF 2UVGA 1MH4A 5ETRA 4P74A 2OZZA 4CLLA 3MVWA 3DDKA 2BDPA 1N7XA 4GMKA 3RR7A 4OYBA 1HD1A 4DMZA 4QYZK 2MKHA 1WODA 4N8YA 4AT1B 2C2EA 3MZBA 4G1PA 1BQNB 3QLHA 1YXIA 1XQIA 5I3QA 1FKOA 3IB2A 1NK8A 3HO7A 1H43A 4P7TA 2I5JB 2DPIA 1TP7A 2ZHOA 3K57A 1CE2A 4IR8A 2DO4A 3GLJA 1NU4A 3UNGC 2LP4A 3GV8B 2YKNB 2NXCA 3MURP 3SEUA 1HBUB 4XAKA 1Z2ZA 4B3MF 3VDFA 2QYCA 5E3PA 3N6NA 1XMBA 4N41A 1GXUA 2H5YA 4PG6A 2JC1A 2HGMA 1OJ4A 2Q74A 2OSRA 1B7FA 3NCPA 2V0NA 4LF9J 1RWXB 2HAFA 4LRAA 4P0GA 3C36A 3KC1A 4N47A 1C0TA 1QAYA 1TUWA 1MM7A 3G6XA 2F9JA 2VG6B 4PGPA 3AODA 4R0EA 1H7XA 4XFEA 4NLDA 4HHHA 3U1OA 3KK2A 2KZZA 3OVAA 3M8QA 4IO2A 3KJFB 4IFVB 4ED4A 3PR5B 3RT6B 3QGGA 3OBIA 1JLBA 1OPZA 3ZZUA 5I42A 2NXNA 2RS8A 4PPZA 1RTDA 5EYHA 1Y1ZA 3MUMP 2HXRA 2DWHA 2BKNA 1F6TA 1T3OA 4DX6A 4ZPTR 1CJVB 5HJYA 5JVGQ 3AOCA 3A29A 3V4MA 2DE2A 1IMEA 2Z58B 3SDFA 2GQ1A 2VPNA 3TZZA 2XLJA 5HP1B 2K1RA 3BBFA 3O1LA 2PA8D 2I48A 4KFBA 4FN5A 1HSLA 2FHJD 3DLKB 4ED8A 1FBHA 3LV0A 4NLVA 1LAFE 1Y3QA 2P2CB 4P2FA 1B5IA 4RPFA 4ZDNA 1FDDA 2XB2D 3N28A 3GYNA 2VHAA 4TLLB 1L3KA 1VYAA 3SEYA 3AA9A 1YRTA 3ZTOA 1Z7NE 2DQVA 3A8IA 3KMSA 3M9OB 4DX7A 1HKAA 3MC2A 4O3AA 3I9V9 2V2KA 5IZHA 3HV1A 2HQFA 3GP9A 1P1TA 2RCAA 2HHTA 2BJJX 4O7IA 2ZNYA 3IJOB 3OV7A 3K5LA 3TAPA 2O1PA 4P2XA 1KLMA 1EHWA 3VR1A 2F34A 3MSTA 3DI6A 3W2VA 5EQ8A 3K0VA 4OZ1A 1B3GA 4N8OA 3QATA 5IT4A 5C7PA 2KU7A 2UU9F 5H1SV 4LF8F 5E3QA 4DR7F 1DJ0A 1ZAWA 2XY6A 3CFZA 2K7JA 1LNQA 2JDJA 3BO3A 1V3SA 1AZSB 5AJ3F 1MRPA 5KG1A 3V81A 1OY9A 1S5ZA 4MK8A 4ECZA 1UJ4A 1TL3B 2H99A 1N5TA 3NCRA 2OPRB 1YK9A 5ET8A 1Y10A 4CO4A 2Y7WA 4WXWA 4FEDA 2DR6A 1M1KT 3ZO7A 3DKDA 3TAQA 4FATA 3H6TA 1YIJS 3V6KA 2W7YA 1XIQA 3CCMS 2VOPA 3OXNA 4DV0J 4NF4A 2UXCF 2CWKA 5IC4B 3GJSB 5JJBA 4ZPAA 4F26A 3MFHA 3EICA 3BS9A 3IG1B 1X5OA 1RWWB 1YLXA 2Y5KA 4QQBA 1BQMA 1RBOB 2OWSA 4K4XA 1FBFA 1IM4A 2W8LA 4ID5A 2BVZA 3BYPA 2ZH9A 2Y7PA 3D1HA 1GMVA 2XMKA 3UWTA 1TAQA 3IK6B 4Q2MA 2RQKA 3QIMA 2PVUA 1UW9A 1P1NA 2JFDA 1B58A 5I3PA 3PIPQ 3CXCR 1C1CB 4X4SA 2XYHB 4B3SF 1NJWA 5LSLA 3M6WA 3I3VA 3G96A 1M5CA 2RNEA 1FPIA 2FHMA 3MMBB 2CQHA 1YYZA 1JB0C 4CT9A 1VQ5S 4RNFA 5M2UA 2PN6A 3M1VA 4FBPA 2O66A 1UVMA 3CTRA 4M95A 3UVJA 5JK4A 3MAAA 1ZH5A 2I8EA 2J9EA 1S10A 1CLFA 5AA2D 2KYZA 2P9GA 1VRQC 2XM3A 3B6QA 2MPUA 2NOOA 1S9GB 3QZ8A 2VB6A 2J7UA 5EYGA 5CZXA 2KXFA 3U27A 4U8VA 4X4TA 1R0BG 5LTCA 1I6QA 1JEUA 1Q81T 3PU5A 2H4YB 4MKVA 1NPKA 2LFVA 3ENVA 4PKDB 2PFDA 1JJHA 3KJQB 4LIRA 1U2RA 1RDXA 2DVCA 1MLAA 3K6WA 2G0JA 4LF9F 3QT8A 5F8GA 3AJ2A 5E3AA 2PE8A 5G4DA 2HURA 2XHDA 4KGKA 4PCQA 2FY1A 2B6AA 1NI9A 2FLOA 1JKHB 1NMEB 5HMWA 1XR7A 4OWDA 2YQ0A 1B0VA 3NNAA 1RLCL 1NK9A 2FA7A 3HHGA 2CVEA 4BHQA 2DTJA 2HS0A 3N4WA 3K59A 4A8YA 1FT8A 4C0HA 2QN6B 3IL1B 4A8WA 3D0HE 3MM8A 4ZZAA 1WC6A 1SV5B 5AE4A 1U8SA 2GAGC 2CVIA 2ZJQQ 3MGJA 4MNCA 3O29A 3OJSA 3TR5A 2QZ8A 1FPDA 5AA4A 5KFNA 3KUGA 4Y6IA 5KFSA 1N32J 2A6MA 2LKZA 1S1TB 3ZZRA 3M4XA 4OZ2A 3CGIA 1H3DA 3GIMA 4PYDA 1YTVA 3ZFVA 3T1AA 1IM6A 4LA9A 1BQNA 4OZ5A 2QEXS 1GR2A 3LWLA 4GC6A 1HSEA 3T5JA 2V8VA 3HFZB 4NPOA 1XS5A 2I5JA 2E29A 1SIZA 2E9TA 3HX9A 3GFYA 4HHJA 5AA2B 3N5BA 5D6GA 4KV8B 1S9FA 2G0CA 2YKNA 3TA2A 2HPGA 3CEDA 1HBUA 4E0XA 1UL3A 4KTQA 1SC6A 1HNVB 1ZBMA 4RJVA 3FCVA 5J1DA 1SC3B 1GNKA 3HT3A 4C98A 3K1NA 4DPTA 4KBIA 4IH6A 4DS4A 1X4CA 2GO8A 2GQCA 4J91A 1VRUB 4USHA 4U23A 1QAXA 3NMAA 2O84X 3X3UA 3ZKLA 1M5HA 3KFMA 4DLDA 3J81U 3TVYA 2J9CA 3QAEA 1DPPA 2VG6A 1RKJA 4V19X 4PP0A 4ZP7A 1NO8A 2HYIB 4GD5A 1S79A 4OEVA 3AT1B 1Y1MA 3PV0E 1JVYA 3PPPA 5L38A 1U1LA 2VKRA 2DR8A 4WCEQ 1HFEL 1VR6A 4DF4A 5K8OA 2XS7A 1N4LA 1I6AA 2AZ1A 1JLEB 4DV0F 2HAIA 4PQAA 2H65B 2IEEA 2RF1A 2VG7B 4A8SA 1XOCA 2ZD1B 4XIGQ 3J7AN 4PQUB 1CJVA 1G7CB 5LSOA 4WPAA 2Z23A 3OL6A 5ETQA 1IJFB 4PABA 4BDOA 1CG2A 1UKUA 4C3KA 4DR4J 2AYMA 3M2UA 2F8EX 5DT6A 3HP6A 4NRUA 1M5EA 1NDKA 3BFTA 5HP1A 2DGUA 1UA0A 5L8RC 2DYAA 3GJQB 2IM2A 4LN5A 3HZEA 1RA7A 3M32B 3CD5A 3MPKA 3DLKA 4DV4J 2W2QP 4JOUA 1HQUB 4EXLA 1CULB 1U02A 1RYRA 3TUSA 2NXJA 1DURA 1DY3A 1DQ9A 2VQEJ 4QSDA 4XF5A 2ZDPA 5LMUJ 3HD2A 3DXSX 2JSXA 3O44A 1LQ9A 5F3ZA 4UOGA 3CJ5A 1FXDA 4CO0A 4KCCA 2AEMA 2MQNA 3AQOA 2VZ9A 4JV5J 2VA2A 1HI8A 2PT1A 4KSEB 2HWIA 2HRTA 2FYIA 1T9WA 2ZH1A 3NS6A 3BSAA 4O3PA 1YITS 2HLUA 5HATA 2B3FA 1C4CA 4P3LA 3W5ZA 3CJ4A 4FP9A 4CLYA 1OQHA 5AE2A 3PTYA 2HHQA 1VQMS 1DARA 1OO0B 4IB2A 3A4TA 5KFQA 1AZSA 3O2IA 5DVJA 4ED0A 4B9LA 2DNRA 3PHEA 3KK1A 1K9ZA 1TL3A 5B08A 1CJUB 2QL7B 2OPRA 5I5PA 4PXBA 4CQ1A 5KAKA 3JYTB 1LB9A 2V8DA 2A2DA 3VAIA 3JSYA 3C6UA 3OTDA 4USWA 1S97A 4ZP6A 2NVUB 2CJBA 2IA4A 2ZNTA 1U8WA 2QO3A 4DZDA 2OGUA 2ZOFA 4DPUA 1JNZB 3UR0A 2F36A 2G93A 3MEGB 4B02A 3T9VA 4B9NA 2ADBA 1T0TV 1VRTA 4CLWA 3IJXB 1TKZB 1WEYA 4TN2A 1MXYA 3B7DA 3OSPA 2XS5A 4O23A 1EU8A 2V4JB 4KH0B 2JFKA 3CSKA 1SXLA 2GIQA 4FF1A 5HO4A 2CQDA 2RU3A 1B5HA 1FCKA 4KR5A 4AB6A 3H42A 1XVXA 2EC0A 3FATA 4F4WA 2NUHA 2UYEA 2UUTA 4XK8C 2M2BA 2GMHA 2F1FA 2DGSA 2YWFA 1YJTA 1DOTA 3SEOA 4X4QA 5L46A 2XZTB 1N32F 1C1CA 4DFJA 1EAYC 2ALUA 1B0TA 3W15C 4DN9A 1QKAA 1D9VA 4UUXA 3MMBA 2KB2A 4RUHA 4UZCA 2P1SA 3WAFA 4USTA 4NXNF 4NCGB 1KWMA 3WZ0A 4Z0IA 1BLUA 3IAM9 4DCJB 3MR2A 4MJOA 4N8NA 1DTQB 4LRCA 1N6QB 1NMUA 4URQU 2ZKUA 2WBDA 3ISNC 4F4YA 2Z4PA 1UWBB 3MM5B 3E13X 4JSDA 4F3SA 4PAKA 2DVZA 5DG8A 1KVKA 2DHSA 2Z2YB 4JI0F 1FTRA 3BV8A 4C48A 5DZ7A 3S6EA 4DOZA 1QVFR 1Z4UA 2XZDB 2Q43A 1RT3B 2HEKA 1XR6A 3QNWB 3SCIE 3Q8PB 3R2DJ 2OLBA 3QAXA 3KOSA 1VQOS 3UGWA 3LR1A 2JVOA 3LTOA 4F67A 4ZVPB 2VD2A 2M88A 2RE1A 5DQHA 4CH0S 5L9OA 2BJ7A 1X4AA 1B1HA 4O3OA 2FNCA 3MVXA 3EDRB 1RWUA 3NMRA 5F8LA 2DEIA 3U93A 2ASYA 2CPDA 3N6LA 2F65A 1ZZNA 1XC9A 2HNYB 4H0WA 1R27B 4QWCA 1TVRB 1B7UA 1MQDA 1CC8A 4FE8A 3P8BB 1SVDA 3TRGA 2UVIA 4DZ1A 5EQAA 2UUBF 3MR7A 2JEIA 5HROB 3PUZE 3W7BA 4JV2A 2AQ4A 3THTA 6FDRA 2KXNB 4M1VA 2UVUA 4Q30B 2EPIA 1W7WA 2V8GA 4DR4F 2QS1A 4TY8B 4C0OC 1HQ2A 1BTJA 1AH5A 1S1TA 3GTYX 2OX3A 1DLOB 4TU7A 3SERA 2DIVA 4PRFA 1FJEB 1K47A 1N5VA 4NI2B 3SYZA 3TNVA 3PO5A 2B56A 3RAXA 2MEWA 2VD3A 1QUKA 4PF8A 1TU0B 1N52B 1I5OB 2F3DA 2R8KA 2BKOA 4YKPA 2E5LJ 5LXYA 4N5SA 1H2VZ 2ZZNA 3PKMA 2PMZD 1VQKS 1RDRA 2VQEF 2OD6A 3RLFE 4LRDA 5LMUF 3N01A 3TCGA 3HFKA 4KYZA 3KK3B 1PDAA 4LR8A 3IFCA 4OI1A 1GV8A 3PEHA 1HNVA 4JV5F 4DR2F 1E6VB 2HVEA 1LWXA 3WX8A 4LP2B 2AIRB 1AL3A 2HVIA 3QT7A 1VRUA 1TWYA 4ELVA 4QHQA 1UFLA 1KTVA 4F25A 4QZVB 1N34F 2LQ5A 4OZ9A 2LA4A 4ZCIA 3N6UA 5I3SA 4PEOA 4FXWA 2IYIA 3DP8A 2QLXA 4UABA 4WZMA 4OV1A 3CNQP 2EXUA 1RT5B 4P10A 4JI6F 5TPAB 3F41A 2CEYA 1NJZA 1DCUA 1YTYA 1IKXB 2E5IA 3SZPA 2IJRA 2VG5B 2ZZTA 1B7HA 2HK3A 3GZGA 2UXBJ 2RQ4A 3JSRA 1JLEA 2FJAB 3W65A 4ZDMA 3QBCA 3QRRA 4AL5A 5CH7B 5I7IA 4Y2IA 3QGHA 2VG7A 2ZD1A 5CCMA 4PQUA 3MEDB 4PWWA 5DDPC 3CCWA 3SV4A 1QJMA 2XWXA 1LKZA 3FBFA 4RWWA 3NOHA 4GKKJ 1S1XB 1PIEA 2I0CA 4RPOA 4IG3B 5BXIA 2ONKE 4MX6A 4ZECA 4PFWA 4DQQA 2C2ZB 4U7UK 1GMWD 3M32A 2Y7KA 4RX6A 4OHVA 5HK4A 2RMLA 4NF0A 1HQUA 4PG8A 3RRHA 2HZCA 1CULA 3D4GA 5HSPA 2FJXA 3M8YA 2ZOGA 1FPGA 2GQQA 1WC3A 1QUJA 4G68C 3FVYA 5ETTA 3W62A 4AYBD 4BCAA 2I3WA 3DHWC 2HNDB 4CO5A 4MFIA 2VONA 5J1EB 4XTTA 1G1XA 2XHWA 3OTEA 3EDQB 4ALZA 4C3LA 1MWQA 1L3SA 1KVJA 3D3BJ 2MTLA 3KLFB 2WB4A 1U1QA 2P9EA 2Z2LA 4QIEA 4THIA 5C5JA 3JTPA 1HNXJ 2X1BA 4WF9Q 4R2FA 3KEIA 4R72A 5H9EJ 2POKA 2GVDA 3FJ7A 3SQGB 5IM0B 4W98A 1VFDA 1SW5A 5F3TA 3HSJA 3IO4A 4F3GA 1UJ5A 3H2VE 1GQEA 4P6QA 3QK6A 2YWWA 3O5TB 4ZK7M 4PTKA 1CJUA 4LFCJ 5DRKA 1S49A 3GXAA 5BYRA 3JYTA 4LFBJ 3MAHA 1VC0A 5H8SA 2Y1IA 4O94A 2LA6A 2DNYA 7FD1A 5GMEA 2OEJA 3J81Y 2O6AA 1WTFA 2NSCA 3HVAA 4MIBA 2D3ZA 2EKNA 3MEGA 2D21A 4X4NA 4K5RA 4M4GA 1N8RT 4UOFA 1TKZA 2IJNA 3SSRA 4K0KF 2HCAA 3GU0A 3FRZA 1MNEA 3BEGB 2WEFA 4GXAA 3VZHA 1WDDA 2RD5C 4YHHJ 2NUUG 4P8BA 5ISUA 3QYTA 4H8JA 1HYSA 2KHCA 4P2MA 2PMWA 3UCUP 1FRMA 3E01B 2HQ3A 1RAHB 1UVLA 2Q1LA 5IKBA 2FTRA 3CRBA 3W1YC 2IBKA 2FUG9 4DUYJ 3KLHA 2A2CA 1B4HA 4GBWA 2RILA 3KKFA 4MKAA 1MY4A 1WEXA 2LLZA 5KFMA 1SD3A 2N82B 3T96B 5KFCA 1KQGB 1MQIA 3CSBA 4N13A 4NCGA 2E5LF 3PUXE 1Q7YT 3P7IA 1URSA 4QJVA 2PEBA 1DTQA 1N6QA 1X0FA 5KFFA 1B99A 3JQMA 4LZ8A 4YMEA 3HSGA 2E7VA 3MP8A 1R1NA 4G77A 3AB2B 4P47A 1V5IB 1UWBA 5AE1A 1A7LA 1WHWA 3MM5A 1EQ0A 1S76D 2UVWA 2AJFE 3N0VA 4OFLA 4FIMA 1LGBC 1SQEA 2V84A 1R0AA 1U26A 1SJRA 3HPOA 3MTJA 5ETOA 5LT5A 1O0PA 1UPMB 3G9CA 1BKAA 3CD6S 3V6DB 1JK9B 1UTBB 4DL6A 1AW0A 1RT3A 2VFTA 4WEDA 2OI2A 2XXIA 3T0JA 2IAJB 1WKJA 2HSEB 2F7CA 3ZTPA 2KFZA 4TU8A 2BQRA 3P45B 2NQPA 3ELHA 3M30B 4X8RA 4X9TA 2ACYA 2IRUA 3BQ2A 3HN0A 1HBNB 1R9LA 2VGQA 3PPNA 2XZWA 1UZDA 2PX1A 2FVSA 2HQDA 2BX6A 1BY9A 1FPLA 4ZVQB 1BD6A 1S57A 1PC3A 1HNWJ 4NA1A 5GADU 4AS4A 3TQEA 3RT8A 2UXBF 1M1HA 2OMLA 3I4PA 2H5IB 2GIRA 1TMMA 1NZAA 4GF8A 1TVRA 4C1UA 1U7LA 5HROA 1TL7B 2AW0A 3Q26A 2IHR1 2MJNA 1HWIA 3OEKA 4OVTA 4GKKF 3C46A 4OVSA 4K5SA 4OX9F 4NYOA 3O6GA 3Q8YA 3HJVA 3OTCA 4NI2A 3GV7B 2I2YA 2F6PA 4OZNA 2VV5A 2RRNA 5KT5A 2ASDA 2E5GA 3FZBA 4CM0A 2IMWP 2V8HA 2RINA 2ZBIA 2UZAA 2CNOB 1RHUB 4DPWA 2B5JB 3T9ZA 5KG6A 5E0OA 4Y00A 1D9DA 3KLGB 3KK3A 2XXRA 1QLNA 1FRIA 4OLPA 3WC0A 4ZCMA 1E6VA 4HS7A 4LIWA 3PY8A 4MNPA 1TUVA 4AXJA 3ZZYA 2JEJA 1LV5A 5L9SA 1WOSA 2EK1A 1WWHA 1HNXF 5DTBA 2HFSA 3VF0B 2C3YA 1FJGF 4GBVA 3VGVA 3N79A 2ZM6F 1FFSB 1D8YA 3VV5A 4OI4A 1MXVA 3FUZA 4OHXA 1RT5A 3IP0A 3O28A 1DHMA 1HLWA 1RWNB 1MMDA 2P9CA 5TPAA 1L3VA 2ESNA 1EIYB 2AYEA 3E3KA 3UIFA 2VHGA 4P72A 1OQ3A 3D7SB 4IRCA 1U6BA 4EBCA 2G0IA 2FZCB 1U47A 1IKXA 4F3MA 2VG5A 5LMNF 5IZ1A 3GWCA 4RNHA 5GAHU 3QZ7A 2BZ2A 2HFUA 2Q9TA 1KSPA 1NKBA 4C3MA 4ZOSA 3SCJE 2E5HA 1URDA 2L9DA 1LCTA 3LSLA 4P11A 4Z7CA 3W64A 1H7WA 4ZPBA 1ZIUA 2ZBQA 3NOGA 2XWOA 3CCRS 3MEDA 4MYTA 3GCXP 3FV1A 4Y2AA 1YJWS 3C35A 1BHNA 8AT1B 2COLA 4Q5VA 1FBEA 1IR1A 1YBUA 4H4MA 1NV7A 2YQ3A 4HCWA 3U65A 4C4WA 4F4KA 1TFDA 2ASLA 5I2KB 4D3HA 5I59B 2UV8A 2QFLA 1EKSA 2R7OA 3IGNA 3VLWA 3BSCA 3C4MA 3ET6B 2CXEA 1WG5A 4EZ9A 5J1PA 5D4OA 3T5KA 3DLNA 4MNIA 1PO6A 3H98A 1AMFA 4IYQA 3CI8A 3TQ1A 2MZTA 5CC2A 2HNDA 3SBMA 4PPDA 4OFZA 2CNKB 5AA3A 1RB0A 4CNYA 2KG1A 1XJWB 3Q22A 2WBBA 1YG0A 3OLAA 5J1EA 4C2MA 4DS5A 3H5XA 4KYEA 2ZZXA 3EWGA 2OH2A 2AEJA 3L6GA 2IDEA 3KLFA 2DD8S 1J5OA 2W2OP 3KDNA 1NXIA 4H54A 3ZTRA 1RHMB 3ODBA 3TQLA 2H4WB 3MAMA 2E44A 3I0SB 4ENOA 1A0OB 4NXMF 4GX4A 2J7KA 1SIWB 3SQGA 5IM0A 1VK3A 4YDXA 1IUDA 2GCFA 1R9QA 1RU2A 1LK5A 3GBBA 3DLGB 4DEZA 2V3QA 3K5PA 2CQGA 3R6LB 4OYXA 1IKVB 2HGNA 2J0WA 4CIOA 2W4CA 4OYAA 3HK2A 1KR4A 5J2PB 1MY1A 1WVJA 4X4PA 1NKEA 2ZZVA 1A7GE 2F5XA 4TXSA 1RADB 2Y0BB 1FTKA 1RWKB 2XI3A 4ZZEA 4QF9A 1PB7A 1KTQA 2AJ0A 3Q83A 4R9GA 4J37A 4P71A 3PDNA 4F39A 2XG8A 2DY9A 4X66F 1K9MT 1R8AA 3AY0A 4JI1J 3D0GE 3MAQA 4ZE8A 2N7CA 4DV2F 4I2PB 3B6WA 2DJWA 2NLWA 5ET7A 2VFUA 1J5EJ 2GZOA 3TODA 3DM2B 2HQGA 2V4CA 1S4EA 1NK5A 3QGIA 1A54A 1VIOA 4ETZA 4F1UA 5L9XA 3KNGA 2DXDA 2DNNA 3B8HA 3CFXA 4OHNA 4I56A 1BC6A 5I57B 5GADI 3UK4A 1ELJA 4CZCA 2PI5A 2ZOMA 3LP0B 3RY3A 5KT6A 2FGOA 3P4UB 4QPXA 2N4CA 1RDZA 1GX5A 2YNFB 4Z2XA 2REGA 4F3BA 4HTIA 3K6UA 3KBZA 4DFMA 1O8BA 1RJJA 2V9KA 5A8RB 1II5A 4LFAJ 4IKAA 4LATA 2FZKB 2V94A 2XMAA 3R26A 2KRBA 4O3CA 1FBPA 2ONRA 5KT3A 3K7RA 3V6DA 5EHHA 4GIZA 2XMTA 2NXOA 4HH0A 3POTB 1B52A 2KFYA 2IAJA 4A8OA 3MZ1A 1MN7A 4DR6J 3EQ1A 1VQPS 3VLUA 4KKOB 3M30A 2R2RA 2XX7A 4XKPA 3N5FA 3OFFA 3KG2A 3WX4A 4R6HA 4EBEA 3DOMB 1VLOA 5HL7Q 1HBNA 4KQZA 4QFPA 2DGVA 2Q89A 1UETA 4NGUA 4UT4A 4ZMMA 4IO7A 1U24A 4OANA 4TLQA 4OV6A 2J0XA 1WUUA 2RRAA 3D28A 3VAGA 3SMZA 5T14A 2OO4A 3I6PA 1SL1A 3K0JA 1Y4ZB 3ZZZA 1IBMJ 3EX7B 3FZVA 1U1RA 4G8NA 2QMUB 1SCJB 4USIA 3LWMA 4RW6B 4HEA9 1FRLA 3ENQA 1OS5A 1B0HA 3ZTQA 2HAVA 4FKXA 5D0HA 1IMBA 4OVQA 1RAGB 1FSAA 4MIJA 2UXDF 5T7LB 4BC9A 4PUOB 2D3O1 3DXBA 5GAHI 2OTLS 1IITA 2DNGA 1B70B 2XXTA 3G71S 2R71A 4QU7A 1FW0A 5DVIA 3SQOP 1N5QA 4RJZA 2YPNA 4P9SA 1REVB 1B7ZA 2B5JA 1T11A 2QGFB 4ID8A 2B4VA 5KOXA 1W26A 4WFZA 3KLGA 4CRJA 1JNFA 5H8QA 5ET5A 2BOAA 4FEBA 4MJKA 2M8HA 2BANB 4RNNA 4HXVA 5IQ6A 1TFWA 3UFCX 3VGSA 4OETA 3SEXA 5HANA 2YKAA 3GZ7A 2V6AA 2W1BA 4R75A 1G0HA 4QR2A 5K8NA 4TQSA 1RHQB 2LQBA 1CNQA 3CPWR 4I1TA 3TJ9A 2P6TA 2GC8A 3N94A 3GFZA 1UMJA 1PBUA 4NLOA 2BQ3A 4W92B 3NWGA 4DFKA 4ZP8A 5KG3A 4RK9A 5HPQA 4HTJA 2HW3A 3TX8A 1U1PA 2C2DA 4G4PA 1WHXA 3EGVA 2DNMA 2HFZA 5D4PA 2GH9A 3MJNA 1D4NA 3ENAA 3P96A 1RTHB 2FQQB 5C25B 5ESYA 4X4VA 1PB9A 3K4UA 3AD9C 4F8RA 2Q8MA 4ILRA 2Z8FA 2ZZWA 3L6HA 2RDDA 3DHXA 1E6YB 2NXUA 4WKMA 1FBCA 1EZOA 2PMHA 5IZZA 4G68B 2DBBA 4ATNA 4L6V3 2FLLA 2VODA 4ANEA 1NK6A 3HVWA 4JI1F 1S6OA 2XY7A 3CG1A 4ZN3A 1A8EA 3KLVA 3OD2A 4Z7EA 1TK8A 2DGOA 5I2KA 5I59A 4U8YA 1QVSA 2E7WA 2O1LA 4DQIA 3LANA 1QSSA 1QKBA 3PUWE 3S8SA 1IKWB 3HDSA 4I7FB 3QRPA 2F4VJ 4IUFA 2GJIA 5IZ3B 4WU3A 1OLAA 1U48A 2PEHA 4F4ZA 2IM0A 4CLFA 1AYEA 1F0XA 4P52A 2V69A 3UN2A 5KCJB 1IMCA 4ECTA 4J9VA 2CFXA 2FDNA 2R8GA 1URNA 3W3SA 2B9WA 3LGNA 3MMAB 1S7YA 3U7JA 3QJLA 4JI2F 3W9JA 4H6DA 3W8GA 4XKNA 1OPIA 2QE5A 1UZHA 4GRSA 2F7VA 2CJAA 4GX6A 4OX7A 3I0SA 2J6SA 3UCZP 2AYSA 5IGAA 4RWXA 4KRWA 2DH9A 3FRYA 3OENA 3HCXA 4NE9C 1FXRA 3OVBA 4QR0A 2QVUA 4BLGA 2CPJA 4TYAA 1BWVA 2OEKA 3AOBA 4O3RA 3JSBA 4PWUA 3CJ0A 4PG5A 2DR5A 4ISUA 4JP8A 2HIQA 1Q79A 3SFUA 3DRRB 1IKVA 2GJFA 2DE4A 3IR1A 4IY6A 1N36J 3FQLA 5B0AA 5HLFB 4RO0A 3EXCX 5J2PA 4NOHA 4WTOB 4PFYA 4NF5B 1IEJA 4MKYA 1KOOA 3CJ2A 5KG4A 1QUVA 2R7WA 4DR6F 3GSIA 1MSWD 1LEOA 3FBBA 1X31C 3AD8C 3JB9k 1EH3A 3S4UA 3G3JA 1VQ8S 3IFAA 3KHGA 1B64A 2HEUA 3OQ2A 3ONQA 1TKDA 1UIUA 1SYHA 3D4CA 4Q2LA 4B3TJ 4GVBA 1FXLA 5E3RA 5DDRC 2WYPA 1DQAA 3IO6A 4I2PA 1B3FA 3VHQA 5AXLA 4DXBA 1UTAA 3FASA 1VI7A 2FPHX 3CDUA 3QSIA 4R8UB 1UQWA 3BBCA 3TUZC 1SH3A 4FAJA 1VQYA 3DM2A 2O7UA 1RBAA 4IO1A 3T66A 1F9BA 3KN3A 5A8KB 2R2SA 4YDDB 3N6TA 1BIYA 2G4BA 1SI1A 1BWEA 2JEFA 5KZTA 2CUYA 3PYEA 4R6KA 4PWDB 5I57A 3MM6B 4OHZA 3FV2A 4R0JA 4JBZA 2THIA 2JH3A 3TJ8A 1WI8A 3ZNUA 5H8FB 2DB1A 3BKUA 2ABYA 1XERA 3B78A 4USUA 2V3UA 4PFTA 4RA1A 4RXLA 3OJUA 1ZAXA 3ROJA 2W9BB 1NJYA 1IKYA 4QR1A 2ZBPA 4KY3A 1YDLA 2AGOA 2ZZMA 3EGZA 3N26A 2XS2A 5C2CA 4DSKA 4UY8T 3TVZA 1FI4A 4JUZA 2OAUA 3HT0A 3FJGA 5A2QU 1LB8A 4C8OA 2X7PA 3KNAA 2F78A 3PMXA 3J7A1 2KO1A 3POTA 2ZC4A 4HE0A 2Z8DA 2QA4G 2WONB 4IO4A 4RBUA 2V9WA 5KG7A 1DTGA 5FHNA 4B9UA 2W9AA 3GYGA 4KKOA 3MVYA 2B9YA 1DTTB 2RS2A 5CYMA 2W2NP 4HI1A 2XLKA 2DNPA 1GEHA 1XN9A 3DOMA 2R8HA 4PG7A 2UVHA 5DQGA 3UN3A 3HF5A 4WK3A 2I58A 2XMMA 1UEVA 3EPGA 1MU2B 3BBRA 3K5OA 4U7UD 2D3OR 3VVDA 1RAOA 2MDAA 5LM7E 5EX0A 2CQ0A 3PEJA 4JI3J 2ZNUA 4LONB 1UWAA 3QT5A 1NHVA 4XPEA 5KG0A 5LXRA 4P2SA 3TAMB 2OPPB 3AJ1A 3JXOA 3T5HA 4B9VA 1MS7A 1TAUA 2YNIB 1A8FA 3AJDA 5T7LA 1LW0B 2QJEA 4PUOA 5EQ9A 5SUHA 3IS9B 4PG4A 3ZC4A 3L09A 1N76A 1PGZA 3HKWA 3HJFA 3GILA 2BV3A 3QWPA 2GO9A 1H44A 3W9IA 1L5UA 1CB6A 4OERA 3EHUA 4NHBA 4WEPA 3Q2TC 2MB0B 2XNQA 4U21A 3CWJA 2BJEA 5LL6d 2BANA 1IMDA 3LUYA 2HBQB 2RUGA 4YR3A 4GWUA 3T9UA 4C11B 5EX3A 1A9NB 1JJ2R 1L5TA 1NFTA 4NA2A 2E1PA 3PRVA 3G3HA 4MK9A 2VA3A 2XWVA 4OEUA 4Z37A 1FKAF 1RABB 3UO0A 4MHFA 2MLYA 2BJ9A 7FDRA 3TW0A 1JIHA 2BE7D 2KDOA 4M94A 2BEFA 4OIXA 3LH2S 2RJZA 5BWJA 3BN4A 2Z0GA 2BW2A 4EGLA 2LQJA 3R6UA 3PW4A 1F1BB 3MMJA 4QIFA 1PG5B 1RA6A 4CH1A 1MROA 3IMQJ 1N36F 1JXEA 4AL7A 1RYOA 4L17A 3GONA 2V4RA 4BDPA 3LQVA 3S9MC 4AQYJ 3PCOB 3S9LC 2WVBA 1WDNA 1OY8A 4EEYA 1H45A 2X3DA 3C8YA 1TKTA 1RTHA 1HA1A 4IGRA 5C25A 4JI8J 1HNIB 2VUGA 4G1QB 3DC2A 1KQKA 1E6YA 3M8SA 3IM9A 4G68A 2KT3A 1NBEB 2V63A 1DTZA 1ZM2A 4ER8A 8RUCA 2AWZA 4F2SA 1R6VA 5F8IA 4B3TF 4N17A 1B3EA 3K6VA 3C16B 2NS1B 4LRBA 2DH7A 4JWXA 5J2QB 2CPFA 1RTZA 5FBPA 2Y8WA 3HCQA 1HW9A 1WEZA 2OWTA 4FNIA 1S59A 2HK2A 3GIRA 4FS1A 1IKWA 3NOCA 5HVGA 2B8PA 4I7FA 5IZ3A 4RK2A 3U8QA 4GFRA 3K5MA 3P6YC 4ZCKA 2DITA 1HSJA 2M70A 1HARA 5KCJA 4EBDA 1QSYA 3G8SA 4JI5J 3TEHB 2VBZA 3NY0A 2V25A 3MMAA 2H5EA 4IO3A 3MPWA 1MY2A 1PEBA 3VGTA 2UVVA 5B7DA 1HBMB 1PAEX 2ZXTA 1EYIA 2BRKA 2IYGA 3MOZA 3H25A 3USDA 3K6XA 4I68A 4FYDA 1S9EB 4CYUB 2L08A 2LMIA 3H6WA 1I51B 1VISA 2E1RA 1U1MA 3V2UC 1RAAB 1EARA 4KHMA 2XGPA 1D3KA 1WC0A 4M5JA 2V2ZA 4JB7A 4QSEA 3RYLA 3DRRA 3NGTA 3R1HA 2HWTA 5EGYA 3Q0AA 3ECRA 5HLFA 1EETB 3CHGA 1GXLA 2W2MP 1NUXA 1LBYA 1XMQF 5SZTA 2BRLA 4NF5A 5K5MA 5DLGA 1H74A 2ALZA 3E4RA 1R8BA 4IDKB 3KOTA 3I4HX 2WBRA 3TOQA 1Y0HA 1D9AA 1HMVB 1IQZA 4KT0C 2AYBA 1EYKA 5E3CA 2XI2A 1S0MA 4EI2A 4F31B 4BDLA 3MR6A 1KD1T 1XNRJ 2YX4A 2M8CA 3KJTA 4EWTA 1GK8A 2QMWA 1LFIA 5KTQA 4JI3F 1IBCB 3TYHA 1JW4A 1S99A 5CQGA 3G8TA 4YEAA 2D9OA 3TEPA 3PXGa 4L72B 3TZWA 2AMCB 5FTHA 4W90B 2HFOA 3WHIA 5A8KA 2QSFA 2YH1A 3JZJA 3J81j 4H45A 4Q8RA 4POWA 4DR3F 4PWDA 5KFJA 2CQ1A 2IBOA 3HVTB 3GIKA 2F6GA 3W9VA 3MM6A 5H8NB 4K4WA 4OQOA 4L73A 4MK7A 2OFHX 4ZEDA 5D15A 5H8FA 1WHVA 2BE2B 3FXQA 3ETMA 1IXIA 4F19A 2YLNA 4GL8A 4UACA 1LFWA 3DRYA 2FJDB 4ICLB 1HBOB 4ZKAA 2FVCA 1FHTA 3R97A 3U92A 1Q8LA 4LF7J 4LF5F 1NNPA 1VC6A 4MLQA 4RY1A 5HM4B 4UZBA 2ZYMA 3VAJA 2YPYA 3Q24A 4DQPA 2MZ1A 2JHEA 2RRBA 1RTJB 3EHSA 2WVDA 2ZH2A 2WONA 1M5BA 3NGSA 3I5AA 2EKYA 2IM3A 2ZWPA 1DTTA 4HL9A 3PO4A 3OTBA 5CI5A 4YKIA 3GSDA 4FJPA 2NYHA 5CD4H 4JI4J 2XC9A 2VBXA 2DGXA 2MZSA 1Z7ME 1FQAA 1MU2A 1BUXA 2C1EB 4E0DA 4AQYF 3Q29A 2FVZA 3QWUA 4CH7A 3MOJB 1DZ5A 2HXWA 4KB7A 5I58B 3BR8A 2XY5A 4JI8F 5HBCA 3EGNA 2I1RA 4LBIA 3UDCA 2DNZA 1JLCB 3J7Z5 4P0IA 4K4TA 1Y00A 4KYSA 2G9OA 3TAMA 2OPPA 4PC9A 3HO1A 1X4GA 3MQ9A 3KUEA 3TCFA 1OMSA 2YNIA 2G1DA 4G3IA 2C2NA 3FXBA 5HAOA 1LW0A 4OTEA 3Q23A 3OVSA 2CQ4A 2CZ9A 1KC8T 2OPQB 3T22A 2E0SA 4WJBA 2XWKA 1L3TA 5FHMA 1FNMA 2WSFC 1J2VA 3OR2B 3SDEB 5J2NB 5DDQC 4GWZA 3H4ZA 1UIVA 3F44A 4EMDA 2IA0A 1ZOTA 3CCZA 1VR5A 5E41A 1VJWA 1R7IA 1JWWA 2AJ2A 1NK4A 3BDPA 2DR7A 1RI7A 2RB7A 4JI5F 4J9MA 4C11A 1ZZFA 3ADAC 4IG0B 4NEZA 5A6PA 2MKIA 4YZZA 4ZJLA 4U96A 4GWWA 4P56A 5KFBA 4L3NA 4Z7YA 4OHWA 4KJIA 3RG6A 2LQ8A 4EQ7A 1RWVB 2WRMA 1N5SA 4H8IA 4HE2A 1NUZA 3VXCA 4CTAB 2E1AA 2BOPA 4A8FA 2DHXA 4WE1B 1S1UB 1QE1B 2WHOA 1ATGA 1FE4A 1A99A 4FS2A 2C3PA 1Q86T 1LSTA 3DOKB 5A2QY 1B05A 4JXIA 2QRYA 1LBZA 4N81A 3NRBA 4YR0A 3MW0A 5H9EK 3KDOA 1QUIA 4YR2A 3M2VB 1T94A 4EQBA 4EO6A 3C19A 3QRQA 4M5KA 4I3EA 1HNIA 3KTQA 4JWYA 4EYIB 4ZPVR 4G1QA 2Q6BA 1W2BR 3TTLA 2UUCJ 5RUBA 1MG7A 4YU0A 4NE4A 1MWZA 4B3RF 4RBVA 4NYZA 2WX9A 1YJVA 1WELA 3PUYE 2WW8A 1XNRF 3NKYA 1V9OA 2BJ8A 2FZGB 3C16A 3JSMB 3GBAA 2AL5A 3DYAB 2JNJA 3T1HJ 1X4FA 5B7WA 3AXKA 5J2QA 2HZAA 1X7VA 3E51A 3G3KA 2J6TA 2LVWA 5KG5A 3PW5A 1RTIB 4I6WA 2ZYOA 1M0SA 3LOUA 1WKLA 2DNQA 1FQDA 5JEIA 3PJXA 5DETA 1WD6A 1RK8A 4LF2A 4U4XA 4LF4J 1DMBA 3AB4B 3BFUA 2V5HG 1FWLA 4NZ6A 4ZE9A 2N7YA 5GAEU 2K8GA 3HHDA 2KHDA 3PJWA 4O0NA 1X4BA 2IRYA 4QBAA 3BKIB 4O7MA 4LBPA 4DXCA 1HBMA 2RH3A 2GW8A 1KWHA 2CADA 4TVAB 3RB6A 3FFIB 4NG7A 3KLEB 1RU1A 1S9EA 4CYUA 2R7UA 4MLVA 3M8RA 1CC7A 3CVGA 1YJRA 2QRRA 5AXNA 3AFGA 1GTHA 4LF7F 2MHEA 3UD5A 2XHCA 2ZUAA 4HKQA 4NX1A 3I31A 1EETA 2PSZA 4PXDA 4ECYA 4NF8B 2DNLA 3L4BC 1NSKL 1O64A 3HPIA 3GR0A 4IR9A 2E7XA 1MW7A 3UPFA 3OO9A 1YVFA 4OVJA 2R9LA 2K3KA 4IDKA 4FECA 2D7SA 3IOUA 3OHBA 3K2DA 5JTYB 2R4FA 1KVIA 2OSQA 2EVZA 3UD4P 2XQCA 1HMVA 4JI4F 1FK9B 5DO2A 5MAOA 3HHLD 2Q2CA 4DI3D 2E9RX 4PDDA 4GL0A 1F5CA 5I3UB 3PIOQ 2PGCA 3LAKA 4O44B 5CZVA 4IOAQ 1D09B 1Y5LB 3MPVA 3IAZA 4H4KC 3AHPA 4U6PA 2AHOB 3G6VA 4BDRA 1YX2A 4QFOA 1B2HA 1XNQF 4X62J 3H7MA 4ANDA 4B9TA 3G3IA 3NG8A 4U1OA 1XK8A 1FNOA 3HVTA 4LBHA 3MR3A 2M8DB 4X65J 5H8NA 4C8LA 5GAGU 4EYHB 3IX1A 4N8GA 2WOMB 4NA3A 4ELTA 4YY3J 3A09A 2VQFJ 3BIHA 1R6YA 4J9QA 4RW8B 1N48A 2BE2A 1LAXA 1GX6A 5CBSA 2GMJA 3HMJG 2RVJA 4XTCQ 5H9FJ 1SL0A 4ICLA 4F2OA 3MWBA 2GA7A 4U7CA 4PETA 2ZBCA 3ZZOA 1TKXB 2W7OA 4KHZE 1S77D 3U1NA 2HVHA 2EFPA 5KFWA 9ATCB 1RTJA 2XXHA 3E2EA 4M5MA 4MTPA 2I3VA 4PGNA 3I82A 5HMZA 3EZUA 1SDXA 4F50A 4QIGA 3MBPA 1RHKB 1T02A 2X1AA 1JJ4A 4RU9A 4NEYA 1NK7A 1FA0A 3RGYA 1F9HA 2X7IA 4ECUA 3IB0A 2QX0A 5EQ7A 4TQUQ 3T9XB 1OVBA 4DJBA 2HZKA 3HHLB 3IA0A 3G8QA 4NZ7A 2ZVIA 5I58A 2W9CB 3UR3C 3O8WA 6AT1B 3VE1B 3WIVA 2M5YA 2IM1A 2NXEA 4R2BA 5K9FA 1PC4A 4NASA 3NLCA 2N3OA 1JLCA 1RT1B 5IS2A 1B0LA 2HNZB 3MDFA 4LREA 4DHVA 2PYYA 4QFNA 3TFLA 4ZA1A 1Z2LA 4ZJQA 2WVEA 1CVJA 3OTOJ 1IXCA 1P6TA 4CWBA 3V8XB 2QFIA 2ZYNA 1RT2B 4P75A 2RKMA 4LQ9A 3T1HF 4X4UA 3UDVA 5A5LA 3B8BA 2FGCA 3BDEA 3SI8A 1VLYA 1FJ7A 3F73A 2DGQA 4J5OA 2AGQA 2HHHJ 1GVCA 5J2NA 3OR2A 3SDEA 2DT9A 1EP4B 2KM8B 1MQHA 4BDNA 4TLMB 1F3FA 2ROEA 4HYKA 3IM8A 1UA1A 4EQ9A 4LF4F 1VCTA 4GOTA 2KG0A 3MMCB 3AXMA 3H5YA 4LUBA 4OFJA 1S48A 2K7KA 4CDIA 4NLQA 3W5YA 3GB0A 1USYE 1FE0A 4P9KA 4IG0A 4DSEA 1Q8BA 1OYEA 4ZN1A 5K2XA 3PVXA 3B4MA 1DFDA 1UTHB 2QPQA 2VPWB 4PBHA 3G4SS 4NMLA 1NHKL 5F8MA 4GO5X 4OI6A 4EUVA 4H4OB 2EFOA 4ED7A 2A5SA 1S6UA 4EDPA 2YVSA 4F1YA 1BMQB 4CTAA 3HVRA 2CZLA 5FTIA 2RDIA 4ZEIA 2MQMA 4WE1A 4O4RA 3IORA 4IH7A 1K1QA 1S1UA 4X2BA 2I4CA 1QE1A 3TVKA 4KYDA 4DV5J 1K44A 4DV1J 5IV3A 2GHVC 4OJ3A 5GAEI 2Y0SD 4DI4B 3DOKA 1FEHA 2J0QD 2DO0A 4IFVA 5D4LA 4FZVA 2KJVA 3H0PA 4DF8A 5DG7A 3MI7X 1IXKA 2V50A 3G87A 5DM7Q 1LBWA 3M2VA 3WBZA 1Q4RA 3FSXA 4M5DB 5ETMA 4F1VA 5F0UA 3TA0A 2VOZA 3KG4A 4OXVA 4JV1A 3LO3A 1F2HA 1NAQA 4CNZA 3VVUA 1IXGA 4C8NA 2OIHA 3HHEA 3RUMA 2OHDA 1JNRB 3K17A 1N3XA 1X5TA 3LSXA 4K50A 2ZEJA 5EWGA 3JSMA 3OL9A 3DYAA 3H6UA 4TOZA 3RNNA 4MAGA 1W25A 3AOAA 2MZQA 2BYCA 1SKWA 5KFIA 5DZ6A 3L3CA 1RTIA 1ICEB 4U1ZA 1VHFA 4V1Ak 1VFEA 1EZZB 2WCXA 4C8KA 2JJKA 3KN7A 3WAEA 3BQ1A 2CZHA 4X62F 1US4A 3MD3A 1OMPA 1NUYA 1U0HB 1NPPA 2QTWA 1UCNA 1T9TA 1MG1A 3C66A 1P99A 1FJCA 1S6PB 5DGBA 5DS7A 2WSEC 1Y3JA 2VQFF 1ZPWX 3RJMB 2D3IA 3C9HA 2CWXA 3Q89A 1XWLA 2A10A 2FC8A 2OCUA 3TZAA 4PBQA 3CIJA 3D6FB 3FFIA 3KLEA 4OESA 3THPA 2VDIA 5KFOA 1EKRA 3W9HA 4F22A 2KJWA 2DY1A 2MKZA 3PFEA 3FNNA 3LF0A 2VBWA 4NQ8A 5F9LA 4ED1A 2MMYA 1B3TA 2FYXA 3QIDA 5GAGI 4ILLA 3NNCA 4HCYA 4Q5TA 4B3OB 1I3OB 4QWBA 2B4OA 3FBPA 2QC3A 2J76E 2Q2AA 1NDCA 3US5A 1NUWA 2Z57B 1Y11A 4IH5A 2CQIA 3U02A 1K0TA 2DCUB 5JTYA 1X5PA 1RAFB 4ZHRB 2IDLA 4I6AA 3IG1A 1J27A 1AFJA 3PMWA 2WKYA 2GQ2A 2XSJB 4RR5A 5GMDA 1FQCA 4DUZJ 1JLBB 1WNEA 4ELQA 1FK9A 5L1KA 2RHSB 3K02A 2NPFA 1PKUA 2Y3YA 1T9YA 3TWZA 2NZ4A 3TEGA 1EJ7L 1UW4A 3T9HB 2D9PA 1XHYA 3PV8A 2IVFB 5AE3A 2GS8A 2FJWA 2F8DA 3RZAA 3FSIA 4O44A 1HIYA 1HQEB 2FHJA 3RB0A 4DL4A 2UV8G 2A1BA 2H3EB 2LXFA 2A0FB 1MPDA 3JS9A 1K0VA 2FD2A 2PO4A 4OMFG 5DG9A 3CC4S 4ZIVA 3OT9A 4USJC 3M2RB 3HULA 2ZHAA 2FVRA 3TP2A 2QLFB 5CMMA 2A3JA 2XD3A 1FPEA 1IQTA 4OYPA 3ULHA 1DRZA 2WOMA 3HFVA 5L9MA 3G86A 2HHHF 1QM9A 3IGVA 4RW8A 4O8MA 2QSXA 4LZ5A 3KGCA 2VFSA 5MLCV 1NJIT 1T0KA 1S9GA 2IPOB 3PRBA 1VGYA 3G2XA 3WIUA 3CJQA 4LR7A 4G6VB 2C3OA 3DLHA 4C1TA 4CLSA 2L41A 2CMOA 3BGOP 4ZLJA 3WC2A 4ZVOB 3PUVE 4OI2A 2QS4A 3DCAA 2AGPA 1FTOA 1NDPA 4FXDA 1TKXA 1F9FA 5F41A 1LFPA 5BYQA 2ROPA 3H2UB 1NCLA 2V67A 4DE8A 3X1LB 1GXTA 2ACMA 2M9KA 3PM9A 1S6QB 3VAFA 2HHMA 3V81B 1AROP 1XMOJ 1GT8A 3NGKA 4MH8A 3W61A 1JKHA 1PJ7A 3LP2B 5A5XB 1R89A 4ZVUB 4DV1F 2Y84A 4DSJA 3QSLA 1I69A 2GIFA 2WSCC 4F02A 1GMUA 3DGPB 2DRBA 4N6PA 2Q6CA 2V34A 1G0IA 1ZA2B 3DU5A 3EZOA 1SV5A 3HHLA 1HL6A 3RW6A 1YSJA 1RBLA 1NLKL 4ZEFA 2W9CA 1O63A 1IMAA 1CSJA 3QYYA 2R3VA 1PJ6A 2FJBB 1RT1A 4JDFA 4ZEKA 3LSWA 1UEUA 1OIAA 2HNZA 1GTKA 4DQRA 1AUDA 5F9NA 2OTJS 2AYGA 1NEEA 2VPYB 1N7WA 5EWEA 2C2OB 1PCAA 5JMNA 2OEMA 1V3ZA 1Y5IB 1RT2A 2GAHC