1N7WA

Crystal structure of human serum transferrin, n-lobe l66w mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGWVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Serotransferrin
publication title The Position of Arginine 124 Controls the Rate of Iron Release from the N-lobe of Human Serum Transferrin. A Structural Study
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2002-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n7wA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n7wA01
2GH9A 3RTFB 2R6GE 4FECA 3LR1A 3VLWA 3H4ZA 1ANFA 2HAUA 3IJXB 3Q25A 3K1MA 1MXVA 3FVOA 4H1XA 3H6TA 4H5FA 4LVQA 3G3FA 5J1DA 5KDTB 2Z23A 4EUOA 3TEPA 4QFPA 2RCAA 1NMUA 4R6HA 1TFAA 4KR5A 2F34A 3K00A 1NKXA 1B5HA 1ZBMA 3TTKA 3PPQA 1NL5A 3M3FA 3QK6A 3SEXA 2IEEA 1R1NA 2QMXA 4MBPA 1FTLA 1BKAA 5I59B 5KCJA 4XIGQ 3DLNA 2QL3A 3RGYA 4GXAA 3SEUA 4TLLB 5DYHA 3C36A 4NF6B 4YKIA 5FHOA 3U93A 5AA1A 5BUUA 1B32A 3V8XB 3M3KA 4ZECA 4OENA 5TU0A 3K2DA 4I1DA 4KCDA 1XOCA 4C0RA 2DXRA 4O3CA 3N94A 3BBRA 2Z22A 2GFEA 3B6WA 1A8FA 4NMYA 1LFGA 4IY6A 3DP4A 4OYVA 2I0CA 3I5OA 3SEVA 3DP8A 2GHBA 3S9MC 3TTRA 3VDFA 2BJJX 3FVKA 1B7UA 4GWOA 3GXAA 2QS1A 3OSRA 1ZU0A 1GGGA 4OETA 4HCYA 2F5XA 3PUWE 4MLQA 4ZE8A 4DXBA 2DWHA 1UIUA 3K02A 3PMXA 1JVYA 5JTYA 4R6YA 4GFRA 1N3WA 2KLFA 3FUZA 1MY2A 1Y9UA 5H8FB 3MP1A 2OZZA 2Y7KA 3S9NC 2NOOA 2RCBA 2O68A 1OQHA 4G77A 4QSCA 4UACA 3OOAA 2Q2AA 1MQHA 1TWYA 1US5A 3K4UA 4R2BA 1WDNA 5DVFA 1OMPA 2XD3A 3C34A 1MPCA 1JEUA 3EQ1A 4ELOA 2V3UA 2XX7A 3IB1A 1DPEA 2RF1A 5DEXA 3TTMA 2HZKA 1PC3A 3O9PA 1N3XA 2REGA 3KSXA 3H6UA 4F31B 3KG2A 1OLAA 4YZZA 5H8HB 1PB7A 2DYXA 3SEWA 3E9XA 4RXLA 3OO8A 1XS5A 4YB6A 5TPAB 1B3GA 3G3GA 1N84A 1MS7A 4QFNA 3ECRA 4YAHX 5EHSA 4GOTA 4OEUA 3G3KA 1MPBA 4IGTA 2D21A 2NXOA 1FCKA 3S2VA 3O29A 5DTBA 1UTHA 3VFJA 1PB8A 3ODBA 1UTBB 2OBGA 4KYSA 1N04A 1YCJA 1YPNA 1URGA 2QS3A 2HFBA 1QULA 3KOSA 2H99A 1DPPA 1OQGA 4OXVA 1B1HA 4U4XA 4F3SA 4KFQA 2E0SA 1H76A 3PGFA 4G8HA 2XXWA 4LZ5A 1NNTA 1SI1A 5AA4B 4WKMA 4NWCA 1FQAA 3U8QA 3FIRA 2XXRA 5I56A 2HQ0A 4RYAA 2XXUA 4RA1A 4QF9A 3V89B 3HN0A 4KYEA 4KYDA 1GV8A 5L8DA 2O7IA 1RYXA 1P1OA 4OMBA 2UVJA 1MRPA 4FEBA 1R9LA 4ECFA 4LA9A 3E3KA 2X7QA 1SD3A 5I57B 3KN3A 1XHYA 4OFJA 2ZNSA 4NE4A 3HO7A 1FTOA 4Z0IA 4XKRA 5A5XB 3THIA 3ONMA 5M2VA 1MY4A 3GZGA 4BLAA 4QFOA 5I2KB 2ESNA 4N13A 4R9GA 4ELRA 1AOVA 2P1SA 2B3FA 2DE4A 1B9JA 5I2NA 4F2QA 4EQ7A 1NH7A 3QYTA 1P1QA 4FEDA 2DSFA 3EN3A 3IAZA 3R6UA 4IY5A 4LQ2A 3RPWA 1PDAA 4RJZA 4EDPA 4OVJA 1LGBC 1LAXA 1MQDA 1H43A 4DCXA 4WEPA 4YICA 3TCGA 2X26A 1EZPA 1LFIA 5ITOA 3PUYE 3MZ9A 3LSFB 1FW0A 3PV0E 4IB2A 3FVNA 4IO5A 3OEMA 3KFMA 3M8UA 2OWSA 3VLVA 1ZLQA 4G68A 1FQBA 1I6BA 3B6QA 3D4CA 4EF2A 4H65A 2H5YA 4U23A 2OCUA 3EPEA 4ZEFA 3CFXA 3UK4A 1WVJA 4DXCA 5ELVA 4QHQA 1H45A 2F8DA 4G68C 4RPNA 5IKBA 4Q30B 3CFZA 1B3FA 5HPQA 4XKPA 4IO6A 1XVYA 1H44A 4O3BA 4HW8A 2O69A 2ONRA 1POTA 3PPPA 1KWHA 1AH5A 3PMVA 5AA2B 4U4SA 1A99A 3OXNA 4NEDA 2AYSA 3K1NA 3UGWA 3LUYA 1O63A 5K2YA 3W9VA 4EQ9A 2VP1A 3GLBA 4C1UA 1Y4CA 1YAEA 4NTLA 1S7YA 3IOTA 3TELA 3PMWA 2IA4A 3U94A 3N5LA 2ZNTA 5TP9A 5IAIA 2FA7A 4LATA 3UN6A 1T0KA 3VLUA 4GRKA 4JWYA 4GL0A 1B4ZA 1TFDA 3OO9A 1SW4A 2VD3A 1AMFA 3PD8A 2O51A 1B3LA 1SW5A 4HS7A 2Y84A 1HSJA 1Y3QA 4MF3A 1NH8A 3C32A 2I4BA 5K2XA 4F1YA 2CMOA 5AA2D 3M3LA 3K0VA 3H7MA 1SI0A 3PD9A 4U2RA 4PFUA 4RK2A 1HSEA 3JZJA 2QJEA 2XXVA 4H67A 4JB7A 5H8QA 4G4PA 5I58A 1IZ1A 1USYH 2QS2A 2V3QA 4FIMA 4P0GA 2A5TA 1IUDA 3BKIB 2Y7IA 1D4NA 4POXA 1MY1A 2HAVA 2O6AA 2H4IA 3G3HA 1QKBA 2ABHA 4OZ9A 4DLDA 4XKNA 3MC2A 1UIVA 4R6KA 2ZXTA 3B7DA 2F7BA 3USDA 1D9VA 2ALUA 2F7CA 1N7XA 1I6QA 4G2ZA 1AIVA 1EZOA 3RY3A 4X1DA 2ANJA 3CIJA 1SYIA 4I8CA 2H98A 4I9DA 3TMGA 2P0SA 2DVZA 5EYFA 1B40A 3KSJA 1B46A 3MBPA 3TDJA 2YPNA 1BLFA 5CMBA 1QJMA 1JW4A 4F3PA 3DELB 2PX1A 2Q9TA 3K01A 1B3HA 3G3IA 3O6GA 2HCAA 1M5CA 4H5GA 1GVCA 2DWJA 4NF5A 4QSDA 1USYE 5DT6A 1JVXA 1PBQA 3V83A 1IIWA 1B58A 1J1NA 4ZEIA 3C35A 3T9UA 3LSXA 1I69A 2UVHA 3FGSA 5JK4A 3ZKLA 4N6PA 4DZ1A 3S9EA 3HV1A 4OQOA 4LP2B 3TQLA 3QUFA 2XX8A 3VE1B 1QUJA 4ZEBA 4DE8A 5CMCA 3FJGA 4BDLA 4BDRA 3D4GA 5FHMA 2V93A 4JBZA 1NFTA 3SERA 4ZE9A 3KEIA 3MZ1A 2G29A 2V3TA 1UQWA 3W15C 3E4RA 1Z7ME 2R71A 5CM6A 3CVGA 3FV2A 3S4UA 4L17A 1B7ZA 3QUJA 1B51A 4FORA 3EF7A 1MXXA 2ZYKA 4EXLA 2E1SA 2F97A 3FZVA 3VVDA 4ZZEA 1B5IA 1VFEA 4POWA 5CBSA 4YB5A 1DTZA 3PU5A 3MZBA 2DWIA 2V25A 3IR1A 3JV9A 1II5A 4GXSB 3FXQA 3G3JA 1ATGA 5AE4A 4YMAA 2HEUA 1MPDA 3BFUA 3T9VA 2XXIA 2Z8EA 3O66A 2D5WA 4R2FA 3KN7A 5L9MA 4G8NA 3IX1A 2Q89A 3DM0A 3RQTA 3VXBA 4HTGA 3K6UA 4NF8A 1QUKA 3MVXA 4C1TA 4AQ4A 4LONB 1JETA 2Q8JA 4U22A 1LCTA 3IK6B 5KCJB 3K1PA 4IO7A 3MW0A 3B6TA 3BFTA 4F29A 1Y1ZA 1MQJA 3H03A 1IXHA 4EXKA 1A7LA 4MFIA 3RNNA 3KGCA 4BDOA 1SYHA 4Z7EA 4AB6A 3C31A 3GBBA 1P1UA 1Y3PA 2RINA 1LSTA 3HHGA 1M5EA 1OVBA 3L6GA 4GD5A 2NWJA 4NF4B 1POY1 5AA2A 1M5FA 1R9QA 3O28A 1SQYA 3T22A 3WAFA 5CMKA 2ZYMA 2RKMA 3CR9A 2F35A 4DDDA 1LAFE 4QRZA 4JDFA 3T9HB 3I3VA 4IO2A 2Z8DA 2DVCA 2CZLA 3KOTA 2ZYNA 3F11A 4DXUA 1MM6A 3ZSFA 1B5JA 1DSNA 3OSQA 3IOVA 4N07A 3G7WA 5H8NA 3Q27A 3EHTA 5JTYB 2QPQA 4R74A 1MH4A 4Q5TA 1VFDA 1LAGE 2H25A 4YKKA 2DXYA 4IGRA 3OO6A 5DVJA 2F7AA 3C4MA 4GVOA 2FYIA 3CRBA 4JSOA 4PFWA 4XXUA 3CI8A 3SDFA 2I3VA 3LBSA 1O64A 3Q26A 1BTJA 1MDQA 3VV5A 2WKYA 4KD5A 1TT1A 3V5AA 1ELJA 1MM7A 1A54A 5KDTA 3A3UA 4F1VA 4O3AA 4R75A 1EH3A 2O1MA 4G8MA 4FJPA 4GQOA 1LB8A 3MWBA 3RT8A 3TODA 1NNPA 3R26A 3ILTB 5I59A 1GTKA 3I6VA 1LLSA 3O6IA 1EZ9A 2B65A 4P0IA 1LB9A 4F1UA 3N26A 3ZKKA 1MG1A 3PUZE 4NF6A 3DP6A 4GIZA 1RYOA 4WEDA 3MUQA 3MVWA 3LSLA 1Y20A 1A55A 1UTHB 2OK2A 5FTIA 2V84A 4PP0A 1MY3A 2Z8FA 1N0TA 2XXPA 3S9LC 1SBPA 5BWJA 4QFKA 1CE2A 3HSTA 2I6EA 2P2AA 4GLIA 4KI0E 5AA3A 4OERA 5FHNA 3PPOA 2HZLA 5CC2A 5JEIA 4TOZA 1M5BA 3FVGA 2OLBA 2ONKE 3FD3A 3UIFA 2PVUA 4AB5A 4X1BA 1RKMA 2GHAA 2Y7WA 3IB0A 2R9JA 3FATA 2O7UA 1XC1A 3EHSA 2XX9A 5I56B 1D9YA 3H06B 1VR5A 1SVXB 4MLVA 1VSOA 1FTJA 1JW1A 3OD7A 3MVZA 4KCCA 4FAJA 3RLFE 3K6XA 3CSGA 1MXUA 3SKPA 5H8FA 4JSDA 2UVGA 3SESA 4RNSA 4BDQA 4F19A 4QSEA 2PT1A 5CI5A 5ICQA 2I49A 4F22A 2I3WA 2M8CA 4ND9A 3UORA 1Q35A 2Q2CA 3TFLA 1IITA 3CG3A 3O6HA 2Q88A 3C9HA 3OO7A 2DQVA 5I2NB 1ZTYA 4E0XA 3HPIA 4M1VA 2I48A 1FTKA 3UP9A 2FNCA 1MQIA 5H8HA 4FE8A 4KHZE 3TCHA 1D3KA 4RPOA 4U1OA 4UA8A 3MP8A 1B3EA 1MQGA 4Q8RA 3C33A 2OWTA 4TQUQ 4OTEA 3WAEA 5TPAA 3T93B 2ZNUA 5I84A 4F3BA 1B4HA 4OESA 1Y1MA 3TPAA 2D3IA 3N6UA 4KQPA 4OFOA 1HSLA 4F3GA 2LAOA 2RC8A 2XHDA 5ITPA 1SW2A 5DVIA 1UTBA 4G68B 1CB6A 1ZMGA 3CSBA 1OVTA 2VGQA 3VXCA 2F36A 3RT6B 4ESXA 1XT8A 3RN8A 3TCFA 4ZEKA 4JWOA 1GR2A 4H8JA 4YKJA 3TAJA 4RY1A 2B3BA 4XTCQ 1AL3A 4JXIA 3GBAA 2RC7A 3O2AA 1JQFA 5AA4A 1PBPA 1BIYA 4ZEDA 2I58A 4NF4A 2QMWA 4OWDA 1OIBA 4F18A 3FXRA 1P1WA 4IO4A 4LZ8A 3KZGA 3IOWA 3Q28A 4PFTA 4YMBA 1EU8A 4R73A 4H8IA 1IXCA 4PE5B 3TZAA 4NWDA 1B0HA 4IO3A 1QUIA 5I57A 1Y3NA 2AL4A 5TP9B 2ZYOA 3RTWB 1S50A 1DTGA 5H8SA 5A5XA 4ZS9A 3K6VA 4PETA 5I2KA 4OHNA 4XKQA 2REJA 1JEVA 1B7HA 4GL8A 1US4A 1URSA 1WODA 3IO6A 3QAXA 5B70A 4QFLA 4OEVA 2UYEA 4LQ5A 3IL1B 4ONYA 4F2OA 5HM4B 4P11A 4E0WA 1N7WA 3H3GA 5CRYA 3SEYA 3T66A 5H8QB 5I58B 1P99A 3TUSA 3ILUB 1IXGA 3N6TA 3L6HA 1LCFA 2A5TB 3RUMA 4BDMA 2PBWA 2XXTA 1A8EA 5L9OA 3CFLA 3KBRA 3PPRA 3IORA 4H0WA 1MXYA 5KZTA 1LBCA 3U72A 2AL5A 3EHUA 1QW0A 2XXYA 1ZJLA 5ISUA 2PT2A 3QSLA 2DE3A 1S9TA 1IQ7A 2THIA 4WXJA 1L5TA 1XVXA 3E13X 2GRVA 3MPLA 4DCYA 2W7YA 2I4CA 3IJOB 2VOZA 3U1OA 2PMSA 2DOJA 2A5SA 5HBCA 1FQDA 3PPNA 4M4GA 3O97A 3MPKA 3H6VA 3KJ7A 1PEBA 2YJPA 2O1LA 2Y7PA 5B7DA 4LZ7A 4YKPA 2YLNA 3FXUA 1IXIA 4KPTA 3TQWA 1JNFA 1MXWA 2DP8A 2NUVA 3MVYA 4NF5B 1IEJA 3KN8A 3LC8A 4RK9A 3OEKA 4X48A 2UVIA 3P7IA 2H9BA 4JWXA 1BP5A 1Z7NE 1FQCA 1OLCA 3MAMA 5F1QA 4X9TA 2O84X 4U1ZA 4FATA 4HCWA 4OFLA 4DIGA 3OMBA 4YU0A 1TXFA 1FQFA 4LUBA 2G93A 1R6ZA 1SDXA 3MJNA 1QVSA 2VHAA 1ZKBA 1M5DA 3FJMA 4R9FA 1MXZA 3JYRA 4ISUA 1DMBA 2UYFA 1MH3A 3IB2A 4BDNA 1O7TA 2ONSA 5DEXB 1VE4A 2XXQA 3HCQA 2DWAA 3PUXE 1LAHE 3UA8A 1B52A 1SW1A 3A09A 3R7XA 2F6GA 3KJTA 2UXAA 1FTMA 4EF1A 1P1NA 4K3FA 1QKAA 5LOMA 4R72A 3VVFA 2DE2A 2VD2A 1FQEA 2OJTA 3LSWA 1B0LA 3TYHA 1H3DA 4NF8B 2RC9A 3ZS6A 3A3CA 2Y7RA 1LBBA 4YB7A 1NNFA 3SETA 3PUVE 5FTHA 1JW5A 1B2HA 3U92A 1B1XA 2QRYA 1LFHA 2DS9A 3CG1A 4ELQA 1MY0A 4H6DA 5ICTA 1B6HA 4PQJA 2QS4A 4ESWA 1PB9A 3TTLA 2XD2A 1B05A 5CMMA 4EQBA 4I62A 2XXXA 4U21A 3QXMA 3W9WA 2QSXA 1YTVA 3VVEA 3TKDA 2F78A 3MQ9A 4THIA 3FV1A 3H6WA 3FJ7A 4TLMB 4ZDMA 5EHMA 1ZIUA 1MDP1 1N76A 3TTNA 3Q29A 2ZMBA 4MH5A 1Y4TA 5L9SA 3QIMA 1A40A 2NVUB 3OENA 4ELPA 1DOTA 4PFYA 1NNKA 2PYYA 3HHFA 1I6AA 3IOUA 3FASA 1URDA 2HXWA 2I0BA 5H8NB 2X7PA 2F6PA 4ZZAA 3T9XB 3T96B 3AXFA 3OELA 2AIXA 1F9BA 3K6WA 3MP6A 4Q0CA 5CBRA 3IO4A 1Q1KA 4F39A 4GF8A 5F7VA 2XXHA
chains in the Genus database with same CATH superfamily
2GH9A 1NV1A 3RTFB 2R6GE 4FECA 3LR1A 3VLWA 3H4ZA 1ANFA 2HAUA 3IJXB 3Q25A 3K1MA 1MXVA 3FVOA 4H1XA 3H6TA 4H5FA 4PGPA 3U65A 4LVQA 3G3FA 5J1DA 1RDZA 3GYYA 5KDTB 2Z23A 4EUOA 3TEPA 4QFPA 2RCAA 1NMUA 4R6HA 1TFAA 2F3DA 4KR5A 2F34A 3K00A 1NKXA 1FBPA 1B5HA 1ZBMA 2GQ1A 3TTKA 3PPQA 1NL5A 3M3FA 3QK6A 3SEXA 2IEEA 1R1NA 2QMXA 4MBPA 1FTLA 1BKAA 5I59B 1VDWA 5KCJA 4XIGQ 3DLNA 2QL3A 3RGYA 3PTYA 4GXAA 1IMBA 3SEUA 3RPLA 4TLLB 5DYHA 3C36A 4NF6B 4YKIA 5FHOA 3U93A 3MYUA 5AA1A 5BUUA 1B32A 3V8XB 3M3KA 4ZECA 4O7IA 4OENA 5TU0A 3K2DA 4I1DA 4NX1A 4KCDA 1XOCA 4C0RA 2DXRA 4O3CA 3N94A 3BBRA 2Z22A 2GFEA 3B6WA 1A8FA 4NMYA 1IMEA 1LFGA 4IY6A 5EYHA 2WEFA 4P47A 3DP4A 4OYVA 2I0CA 3I5OA 3SEVA 1FPGA 3DP8A 2GHBA 3S9MC 3TTRA 3VDFA 1DBZA 2BJJX 3FVKA 1B7UA 4GWXA 4GWOA 3GXAA 2QS1A 3OSRA 1ZU0A 1GGGA 4OETA 4HCYA 2R8TA 2F5XA 3PUWE 4MLQA 4MEVA 4ZE8A 4DXBA 2DWHA 1UIUA 3K02A 3PMXA 1JVYA 5JTYA 1FBGA 4R6YA 4GFRA 1N3WA 2KLFA 3FUZA 1MY2A 1Y9UA 5H8FB 3MP1A 2OZZA 2Y7KA 3S9NC 5I5PA 2NOOA 4LN5A 2DDKA 2RCBA 3T0JA 2O68A 1OQHA 4G77A 4QSCA 4UACA 3OOAA 2Q2AA 1MQHA 1FJ9A 1TWYA 1US5A 3K4UA 4R2BA 1WDNA 5DVFA 1OMPA 2XD3A 3C34A 4FBPA 1MPCA 1INPA 1JEUA 3EQ1A 4ELOA 2V3UA 2XX7A 3IB1A 2P3NA 1DPEA 1XI6A 2RF1A 5DEXA 3TTMA 1G0HA 2HZKA 1PC3A 3O9PA 4MAGA 4MIJA 1N3XA 2REGA 3KSXA 3H6UA 4F31B 3KG2A 1OLAA 4YZZA 5IZ1A 5H8HB 1PB7A 1RDXA 1FSAA 2DYXA 2QFLA 3SEWA 5ET7A 3E9XA 4RXLA 3OO8A 1XS5A 4YB6A 5TPAB 1B3GA 3G3GA 1N84A 1MS7A 4QFNA 4P3LA 3ECRA 4YAHX 5EHSA 4GOTA 4OEUA 3G3KA 1MPBA 4IGTA 2D21A 2NXOA 1FCKA 3S2VA 3E78A 3O29A 4PTKA 5DTBA 1UTHA 3VFJA 2VPOA 1PB8A 3ODBA 1UTBB 2OBGA 4KYSA 1N04A 1YCJA 2XWKA 1YPNA 1G0IA 1NV0A 1URGA 4MX6A 2QS3A 2HFBA 3SZPA 1QULA 3KOSA 2H99A 1DPPA 1OQGA 4OXVA 1B1HA 4U4XA 4F3SA 4KFQA 2E0SA 2FIEA 1H76A 3PGFA 4G8HA 2XXWA 4LZ5A 1SI1A 1NNTA 5AA4B 4WKMA 3BIHA 4NWCA 1FQAA 3U8QA 3FIRA 2XXRA 1NV6A 5I56A 5IZ3A 2HQ0A 1FBDA 4RYAA 2XXUA 4RA1A 4QF9A 3V89B 4OVRA 3HN0A 4KYEA 4OANA 4H45A 4KYDA 1GV8A 5L8DA 2O7IA 1RYXA 1P1OA 3EKIA 4OMBA 2UVJA 1MRPA 4FEBA 1R9LA 4PC9A 4ECFA 4LA9A 2CZIA 2WX9A 3E3KA 2X7QA 1SD3A 5I57B 4N15A 3KN3A 1XHYA 4OFJA 2ZNSA 4NE4A 3HO7A 1FTOA 4Z0IA 4XKRA 5A5XB 3THIA 3ONMA 5M2VA 2V4CA 1MY4A 3GZGA 4BLAA 4QFOA 5I2KB 2ESNA 4N13A 1FBEA 4R9GA 4ELRA 1AOVA 2P1SA 2B3FA 2DE4A 1B9JA 5I2NA 4F2QA 1NV4A 4EQ7A 1NH7A 3QYTA 1P1QA 4FEDA 2DSFA 3EN3A 3IAZA 3R6UA 4IY5A 4LQ2A 3RPWA 1PDAA 4RJZA 4EDPA 4OVJA 1LGBC 1LAXA 4NF0A 1YXIA 2CZKA 1MQDA 1H43A 4IR8A 4DCXA 4WEPA 4YICA 3TCGA 4NN3A 2X26A 1EZPA 1LFIA 5ITOA 3PUYE 3MZ9A 3LSFB 1FW0A 3PV0E 4IB2A 3FVNA 1EYKA 4IO5A 3OEMA 4XEQA 3KFMA 3M8UA 2OWSA 3VLVA 1ZLQA 4G68A 1FPFA 1FQBA 1I6BA 3B6QA 4OA4A 2Q74A 3D4CA 4EF2A 4H65A 2H5YA 4NG7A 4U23A 1IMAA 2OCUA 3EPEA 4ZEFA 1NUZA 3CFXA 3UK4A 1WVJA 4DXCA 5ELVA 4QHQA 1H45A 2F8DA 4G68C 4RPNA 5IKBA 4Q30B 2ZZXA 3CFZA 1B3FA 5HPQA 4XKPA 4IO6A 1XVYA 2P3VA 1H44A 4O3BA 4HW8A 2O69A 2ONRA 1POTA 3PPPA 1KWHA 4OVPA 1AH5A 4MNCA 3PMVA 5AA2B 4U4SA 1A99A 3OXNA 4NEDA 2AYSA 3K1NA 3UGWA 3IFAA 3LUYA 4X04A 1O63A 5K2YA 3W9VA 4EQ9A 1FPJA 2VP1A 3GLBA 4C1UA 1Y4CA 1YAEA 4NTLA 1S7YA 3IOTA 4JVDA 4PBQA 3TELA 3PMWA 2IA4A 3U94A 3N5LA 2ZNTA 5TP9A 5IAIA 4GX3A 2FA7A 4LATA 3UN6A 1T0KA 3VLUA 4GRKA 4JWYA 4GL0A 4GBVA 1B4ZA 1TFDA 3OO9A 1SW4A 2VD3A 1LBVA 1AMFA 3PD8A 2O51A 1B3LA 1SW5A 4HS7A 4P9KA 2Y84A 1HSJA 1Y3QA 4MF3A 1NH8A 3C32A 2I4BA 2JJKA 5K2XA 4F1YA 2CMOA 5AA2D 3M3LA 3K0VA 3H7MA 1SI0A 3PD9A 4U2RA 4PFUA 4KXPA 4RK2A 1HSEA 3JZJA 2QJEA 3KC1A 2KQZA 2XXVA 4H67A 2PCRA 4JB7A 5H8QA 4G4PA 5I58A 1IZ1A 1USYH 2QS2A 2V3QA 4FIMA 1K9ZA 4P0GA 2A5TA 4PDDA 1IUDA 3BKIB 5LDZA 2Y7IA 1D4NA 4POXA 4OVQA 1MY1A 4NHBA 2HAVA 2O6AA 2H4IA 3G3HA 1QKBA 5ET8A 2ABHA 4OZ9A 4O7MA 4DLDA 4XKNA 3MC2A 1UIVA 4R6KA 2ZXTA 3B7DA 2F7BA 3USDA 1D9VA 2ALUA 2F7CA 1N7XA 1I6QA 4G2ZA 1AIVA 1EZOA 3RY3A 4X1DA 2ANJA 3CIJA 1SYIA 4I8CA 2H98A 4I9DA 3TMGA 2P0SA 2XA5A 4N91A 2DVZA 5EYFA 1B40A 3KSJA 1B46A 3MBPA 3TDJA 2YPNA 5FBPA 1BLFA 5CMBA 1FRPA 1QJMA 1JW4A 4F3PA 3DELB 4JVIA 2PX1A 2Q9TA 3K01A 1B3HA 3G3IA 4G61A 3KBZA 1FPDA 3O6GA 2HCAA 1M5CA 4H5GA 1GVCA 2DWJA 4NF5A 4QSDA 1USYE 5DT6A 1JVXA 1PBQA 3V83A 1IIWA 1B58A 1J1NA 4ZEIA 3C35A 3T9UA 3LSXA 1I69A 2UVHA 3FGSA 5JK4A 3ZKLA 4N6PA 4DZ1A 3S9EA 3HV1A 4OQOA 4LP2B 3TQLA 3QUFA 4UABA 2XX8A 3VE1B 1QUJA 4ZEBA 4DE8A 5CMCA 4GX4A 3FJGA 4BDLA 4BDRA 3D4GA 5FHMA 2V93A 4JBZA 1NFTA 3SERA 4ZE9A 3KEIA 3MZ1A 2G29A 2V3TA 1UQWA 3W15C 3E4RA 1Z7ME 2R71A 2MKZA 5CM6A 3CVGA 3FV2A 1IMFA 3S4UA 4L17A 4N17A 1B7ZA 3QUJA 1B51A 4FORA 3EF7A 1MXXA 1RDYA 2ZYKA 4EXLA 2E1SA 2F97A 2FVZA 3FZVA 3VVDA 4ZZEA 1B5IA 1VFEA 1NV5A 4POWA 5CBSA 4YB5A 1DTZA 3PU5A 3MZBA 2DWIA 2V25A 3IR1A 3JV9A 1II5A 4GXSB 3FXQA 2ZZVA 3G3JA 1ATGA 5AE4A 4YMAA 2CZHA 2HEUA 1MPDA 3BFUA 3T9VA 1FTAA 2XXIA 2Z8EA 3O66A 2D5WA 4R2FA 3KN7A 5L9MA 4G8NA 3IX1A 4NAPA 2Q89A 3DM0A 3RQTA 3VXBA 4HTGA 3K6UA 4NF8A 1QUKA 3MVXA 4C1TA 1Q9DA 4AQ4A 4LONB 1JETA 2Q8JA 4U22A 4I3YA 1LCTA 3IK6B 5KCJB 3K1PA 4IO7A 3MW0A 3B6TA 4HE2A 3BFTA 2OX3A 3RPLB 4F29A 1Y1ZA 3NOHA 1MQJA 3H03A 1IXHA 2Y5LA 4EXKA 1A7LA 5EYGA 4MFIA 3RNNA 1NV3A 2PFZA 3KGCA 4BDOA 1SYHA 1YYZA 4Z7EA 4AB6A 3C31A 3GBBA 1P1UA 1Y3PA 2RINA 1LSTA 3HHGA 1M5EA 1OVBA 2WYPA 1SPIA 3L6GA 4GD5A 2NWJA 4NF4B 1POY1 5AA2A 3LUZA 1M5FA 1R9QA 3O28A 1SQYA 4PCDA 3T22A 5EQ8A 3WAFA 5CMKA 2ZYMA 2RKMA 3CR9A 2F35A 3T1BA 4DDDA 1LAFE 4QRZA 4JDFA 3T9HB 3I3VA 4IO2A 2Z8DA 2DVCA 2CZLA 1NV7A 3KOTA 2ZYNA 2CEXA 3F11A 4DXUA 1MM6A 3ZSFA 1B5JA 2WBDA 1DSNA 3OSQA 3IOVA 4N07A 3G7WA 5H8NA 3Q27A 4I3EA 3EHTA 5JTYB 2QPQA 1EYIA 4R74A 1MH4A 3BIGA 4Q5TA 1VFDA 1LAGE 2H25A 4YKKA 2DXYA 4IGRA 3OO6A 5DVJA 2F7AA 3C4MA 4GVOA 2ZZWA 2FYIA 4PF6A 3CRBA 4N8YA 4JSOA 2QVRA 4PFWA 4XXUA 3CI8A 3SDFA 2I3VA 3LBSA 1O64A 3Q26A 1BTJA 1MDQA 3VV5A 2WKYA 4KD5A 1TT1A 3V5AA 1ELJA 1MM7A 2QVVA 1A54A 1LBXA 5KDTA 3A3UA 4F1VA 4O3AA 4R75A 1EH3A 2O1MA 4G8MA 4FJPA 4GQOA 1LB8A 3MWBA 3RT8A 2FHYA 3TODA 1NNPA 1NUWA 3R26A 3ILTB 5I59A 1GTKA 3I6VA 1LLSA 3O6IA 5IM2A 1EZ9A 2B65A 4P0IA 1LB9A 2WYKA 4F1UA 4GWYA 3N26A 2FIXA 3ZKKA 1MG1A 3PUZE 4NF6A 3DP6A 4GIZA 1RYOA 4WEDA 4PFIA 3MUQA 3MVWA 3LSLA 1Y20A 1A55A 1UTHB 2OK2A 5FTIA 1FBFA 2V84A 4PP0A 2FBPA 1MY3A 2Z8FA 1N0TA 3ISPA 2XXPA 3S9LC 1SBPA 5BWJA 4QFKA 1CE2A 3HSTA 3IFCA 2I6EA 2P2AA 4GLIA 4KI0E 1FPKA 5AA3A 4OERA 5FHNA 4O8MA 3PPOA 2HZLA 4H46A 5CC2A 5JEIA 4TOZA 1KA0A 1M5BA 4AS4A 3FVGA 2OLBA 2ONKE 3FD3A 3UIFA 2PVUA 4AB5A 4X1BA 1RKMA 2CEYA 2GHAA 2Y7WA 3IB0A 2R9JA 3FATA 2O7UA 1XC1A 3EHSA 2XX9A 4MNPA 5I56B 1D9YA 5IZ3B 3D1RA 3H06B 1VR5A 1SVXB 4MLVA 4GBWA 4PBHA 2B4LA 4HE0A 1VSOA 1FTJA 1JW1A 3OD7A 3MVZA 4KCCA 4FAJA 3RLFE 2WBBA 3CHGA 3K6XA 4HXVA 3CSGA 1MXUA 3SKPA 5H8FA 4JSDA 2UVGA 4PGNA 3SESA 4RNSA 4BDQA 4F19A 4QSEA 2PT1A 5CI5A 2XWVA 5ICQA 2I49A 4F22A 2I3WA 2M8CA 4ND9A 3UORA 1Q35A 2Q2CA 3TFLA 1IMCA 1IITA 3CG3A 5IGAA 2HPGA 3O6HA 2Q88A 3C9HA 3OO7A 2DQVA 5DW8A 5I2NB 1ZTYA 1JP4A 4E0XA 3HPIA 2HHMA 4M1VA 2I48A 1FTKA 3UP9A 2FNCA 1MQIA 5H8HA 4FE8A 4KHZE 3TCHA 1D3KA 4RPOA 4PE3A 4U1OA 4UA8A 3MP8A 1B3EA 1MQGA 4Q8RA 3C33A 5ET5A 2OWTA 4TQUQ 4OTEA 3WAEA 5TPAA 3T93B 2ZNUA 5I84A 4F3BA 2B4MA 2VT5A 1B4HA 4OESA 1Y1MA 3TPAA 4N81A 4AS5A 2D3IA 4PAFA 3N6UA 4KQPA 4OFOA 4HE1A 1HSLA 4F3GA 2LAOA 2RC8A 2XHDA 5ITPA 1SW2A 5DVIA 1UTBA 4G68B 3LV0A 1CB6A 5IZZA 1ZMGA 2KR0A 1YZ0A 4XFEA 3CSBA 4PF8A 1OVTA 2VGQA 3VXCA 2F36A 4PAIA 3RT6B 5LTCA 4ESXA 1XT8A 2F3BA 5EQ9A 4N6DA 3RN8A 3TCFA 4ZEKA 4JWOA 1GR2A 4H8JA 1FPLA 4YKJA 3TAJA 4RY1A 2B3BA 4XTCQ 1AL3A 4JXIA 1LBWA 3GBAA 2RC7A 3O2AA 1JQFA 5AA4A 1PBPA 1BIYA 3A29A 2I58A 4ZEDA 4NF4A 2QMWA 4OWDA 4N6KA 1OIBA 1KA1A 4F18A 2Q8MA 3FXRA 1FBHA 1P1WA 4IO4A 4LZ8A 3KZGA 3IOWA 3Q28A 4PFTA 4MJOA 4YMBA 1EU8A 3RYDA 4R73A 4H8IA 1IXCA 4PE5B 3TZAA 4P8BA 4NWDA 1B0HA 4IO3A 1QUIA 1LEVA 5I57A 1FPEA 1Y3NA 2AL4A 5TP9B 2ZYOA 3RTWB 1S50A 1DTGA 5H8SA 1EYJA 5A5XA 4ZS9A 3K6VA 4PETA 5I2KA 4OHNA 4XKQA 4XF5A 2VPNA 2REJA 1JEVA 1B7HA 4GL8A 1US4A 1URSA 1WODA 3IO6A 3QAXA 5B70A 4QFLA 4NGUA 4OEVA 2UYEA 4LQ5A 3IL1B 1KZ8A 1IMDA 3B8BA 4ONYA 4F2OA 5HM4B 4P11A 4E0WA 1N7WA 3H3GA 5A5LA 5CRYA 3SEYA 1DCUA 3E79A 3T66A 5H8QB 1FPIA 5I58B 5ESYA 1P99A 1QGXA 3TUSA 3ILUB 1IXGA 3N6TA 3L6HA 1LCFA 2A5TB 4QXDA 3KC0A 1FBCA 3RUMA 4BDMA 2L5VA 2PBWA 2XXTA 1A8EA 5L9OA 3CFLA 3KBRA 1DK4A 3PPRA 1BK4A 3IORA 4H0WA 1MXYA 5KZTA 1LBCA 3U72A 1LBZA 2AL5A 3EHUA 4P1LA 1QW0A 2XXYA 1ZJLA 5ISUA 4GX6A 1CNQA 2PT2A 3QSLA 2DE3A 1S9TA 1IQ7A 2THIA 4WXJA 1L5TA 1XVXA 3E13X 2GRVA 3MPLA 4DCYA 2W7YA 2I4CA 3IJOB 2VOZA 4X8RA 3U1OA 2PMSA 2DOJA 2A5SA 5HBCA 1FQDA 3PPNA 4M4GA 1NI9A 3O97A 3MPKA 3H6VA 3KJ7A 1PEBA 2YJPA 1D9QA 2O1LA 2Y7PA 5B7DA 2PFYA 4JVCA 4LZ7A 3FBPA 4YKPA 2YLNA 5EQ7A 4P1EA 3FXUA 1IXIA 4KPTA 3TQWA 1JNFA 1MXWA 2DP8A 2NUVA 3MVYA 4NF5B 1IEJA 4GWWA 3KN8A 3LC8A 4RK9A 3OEKA 4X48A 2UVIA 3P7IA 4DI3D 2H9BA 4JWXA 4O94A 4N8GA 1BP5A 3B50A 1Z7NE 1FQCA 2OWZA 1LBYA 1OLCA 3MAMA 5F1QA 4X9TA 2O84X 4U1ZA 4FATA 4HCWA 4OFLA 4DIGA 3ROJA 3HFUA 3OMBA 4YU0A 1TXFA 3FXBA 1FQFA 4LUBA 2G93A 1R6ZA 1SDXA 4MMPA 3MJNA 1QVSA 4OVSA 2VHAA 4GWZA 1ZKBA 1M5DA 3FJMA 4R9FA 1MXZA 3JYRA 4ISUA 1DMBA 2UYFA 3QMFA 1MH3A 3IB2A 4PFRA 4GWUA 4GWSA 5J16A 4BDNA 1FJ6A 1O7TA 4MCOA 2ONSA 2XWOA 4PDHA 5DEXB 1VE4A 2XXQA 3HCQA 2DWAA 3PUXE 1LAHE 3UA8A 1B52A 1SW1A 3A09A 3R7XA 4P56A 4I40A 2F6GA 3KJTA 5I3SA 2UXAA 1FTMA 4EF1A 1P1NA 4K3FA 1QKAA 5LOMA 1NV2A 4R72A 3VVFA 2DE2A 2VD2A 1FQEA 2OJTA 1NUYA 3LSWA 1B0LA 3TYHA 1H3DA 4NQ8A 4NF8B 2RC9A 3ZS6A 3A3CA 2Y7RA 1LBBA 4YB7A 1NUXA 1NNFA 3SETA 2XWIA 3PUVE 5FTHA 1JW5A 1B2HA 3U92A 1B1XA 2QRYA 1LFHA 2DS9A 3CG1A 4ELQA 1MY0A 4H6DA 5ICTA 1B6HA 4PQJA 2QS4A 4ESWA 1PB9A 3TTLA 2XD2A 1B05A 5CMMA 4EQBA 4I62A 2Y5KA 2XXXA 4U21A 3QXMA 3W9WA 5T3JA 2QSXA 1K9YA 1YTVA 2QVUA 2BJIA 3VVEA 3TKDA 2F78A 3MQ9A 4THIA 3FV1A 3H6WA 3FJ7A 4TLMB 4ZDMA 5EHMA 1ZIUA 4N4UA 1AWBA 1MDP1 2XXKA 1FPBA 1N76A 3TTNA 3Q29A 2ZMBA 4MH5A 4QBAA 1Y4TA 5L9SA 4DI4B 3QIMA 1A40A 5EQAA 2NVUB 5F24A 4OVTA 3MSTA 3OENA 4ELPA 1DOTA 4PFYA 1NNKA 4MNIA 5I7IA 4MHFA 2HXRA 2PYYA 4PAKA 3HHFA 1I6AA 3IOUA 3FASA 1URDA 2HXWA 2I0BA 5H8NB 2X7PA 2F6PA 4PFBA 4ZZAA 3T9XB 3T96B 3AXFA 3OELA 2AIXA 1F9BA 3K6WA 3MP6A 4Q0CA 5CBRA 3IO4A 5ET6A 1Q1KA 4F39A 4GF8A 5F7VA 2XXHA
chains in the Genus database with same CATH topology
2GH9A 3RTFB 2R6GE 4FECA 3LR1A 3VLWA 3H4ZA 1ANFA 2HAUA 3IJXB 3Q25A 3K1MA 1MXVA 3FVOA 4H1XA 3H6TA 4H5FA 4LVQA 3G3FA 5J1DA 5KDTB 2Z23A 4EUOA 3TEPA 4QFPA 2RCAA 1NMUA 4R6HA 1TFAA 4KR5A 2F34A 3K00A 1NKXA 1B5HA 1ZBMA 3TTKA 3PPQA 1NL5A 3M3FA 3QK6A 3SEXA 2IEEA 1R1NA 2QMXA 4MBPA 1FTLA 1BKAA 5I59B 5KCJA 4XIGQ 3DLNA 2QL3A 3RGYA 4GXAA 3SEUA 4TLLB 5DYHA 3C36A 4NF6B 4YKIA 5FHOA 3U93A 5AA1A 5BUUA 1B32A 3V8XB 3M3KA 4ZECA 4OENA 5TU0A 3K2DA 4I1DA 4KCDA 1XOCA 4C0RA 2DXRA 4O3CA 3N94A 3BBRA 2Z22A 2GFEA 3B6WA 1A8FA 4NMYA 1LFGA 4IY6A 3DP4A 4OYVA 2I0CA 3I5OA 3SEVA 3DP8A 2GHBA 3S9MC 3TTRA 3VDFA 2BJJX 3FVKA 1B7UA 4GWOA 3GXAA 2QS1A 3OSRA 1ZU0A 1GGGA 4OETA 4HCYA 2F5XA 3PUWE 4MLQA 4ZE8A 4DXBA 2DWHA 1UIUA 3K02A 3PMXA 1JVYA 5JTYA 4R6YA 4GFRA 1N3WA 2KLFA 3FUZA 1MY2A 1Y9UA 5H8FB 3MP1A 2OZZA 2Y7KA 3S9NC 2NOOA 2RCBA 2O68A 1OQHA 4G77A 4QSCA 4UACA 3OOAA 2Q2AA 1MQHA 1TWYA 1US5A 3K4UA 4R2BA 1WDNA 5DVFA 1OMPA 2XD3A 3C34A 1MPCA 1JEUA 3EQ1A 4ELOA 2V3UA 2XX7A 3IB1A 1DPEA 2RF1A 5DEXA 3TTMA 2HZKA 1PC3A 3O9PA 1N3XA 2REGA 3KSXA 3H6UA 4F31B 3KG2A 1OLAA 4YZZA 5H8HB 1PB7A 2DYXA 3SEWA 3E9XA 4RXLA 3OO8A 1XS5A 4YB6A 5TPAB 1B3GA 3G3GA 1N84A 1MS7A 4QFNA 3ECRA 4YAHX 5EHSA 4GOTA 4OEUA 3G3KA 1MPBA 4IGTA 2D21A 2NXOA 1FCKA 3S2VA 3O29A 5DTBA 1UTHA 3VFJA 1PB8A 3ODBA 1UTBB 2OBGA 4KYSA 1N04A 1YCJA 1YPNA 1URGA 2QS3A 2HFBA 1QULA 3KOSA 2H99A 1DPPA 1OQGA 4OXVA 1B1HA 4U4XA 4F3SA 4KFQA 2E0SA 1H76A 3PGFA 4G8HA 2XXWA 4LZ5A 1NNTA 1SI1A 5AA4B 4WKMA 4NWCA 1FQAA 3U8QA 3FIRA 2XXRA 5I56A 2HQ0A 4RYAA 2XXUA 4RA1A 4QF9A 3V89B 3HN0A 4KYEA 4KYDA 1GV8A 5L8DA 2O7IA 1RYXA 1P1OA 4OMBA 2UVJA 1MRPA 4FEBA 1R9LA 4ECFA 4LA9A 3E3KA 2X7QA 1SD3A 5I57B 3KN3A 1XHYA 4OFJA 2ZNSA 4NE4A 3HO7A 1FTOA 4Z0IA 4XKRA 5A5XB 3THIA 3ONMA 5M2VA 1MY4A 3GZGA 4BLAA 4QFOA 5I2KB 2ESNA 4N13A 4R9GA 4ELRA 1AOVA 2P1SA 2B3FA 2DE4A 1B9JA 5I2NA 4F2QA 4EQ7A 1NH7A 3QYTA 1P1QA 4FEDA 2DSFA 3EN3A 3IAZA 3R6UA 4IY5A 4LQ2A 3RPWA 1PDAA 4RJZA 4EDPA 4OVJA 1LGBC 1LAXA 1MQDA 1H43A 4DCXA 4WEPA 4YICA 3TCGA 2X26A 1EZPA 1LFIA 5ITOA 3PUYE 3MZ9A 3LSFB 1FW0A 3PV0E 4IB2A 3FVNA 4IO5A 3OEMA 3KFMA 3M8UA 2OWSA 3VLVA 1ZLQA 4G68A 1FQBA 1I6BA 3B6QA 3D4CA 4EF2A 4H65A 2H5YA 4U23A 2OCUA 3EPEA 4ZEFA 3CFXA 3UK4A 1WVJA 4DXCA 5ELVA 4QHQA 1H45A 2F8DA 4G68C 4RPNA 5IKBA 4Q30B 3CFZA 1B3FA 5HPQA 4XKPA 4IO6A 1XVYA 1H44A 4O3BA 4HW8A 2O69A 2ONRA 1POTA 3PPPA 1KWHA 1AH5A 3PMVA 5AA2B 4U4SA 1A99A 3OXNA 4NEDA 2AYSA 3K1NA 3UGWA 3LUYA 1O63A 5K2YA 3W9VA 4EQ9A 2VP1A 3GLBA 4C1UA 1Y4CA 1YAEA 4NTLA 1S7YA 3IOTA 3TELA 3PMWA 2IA4A 3U94A 3N5LA 2ZNTA 5TP9A 5IAIA 2FA7A 4LATA 3UN6A 1T0KA 3VLUA 4GRKA 4JWYA 4GL0A 1B4ZA 1TFDA 3OO9A 1SW4A 2VD3A 1AMFA 3PD8A 2O51A 1B3LA 1SW5A 4HS7A 2Y84A 1HSJA 1Y3QA 4MF3A 1NH8A 3C32A 2I4BA 5K2XA 4F1YA 2CMOA 5AA2D 3M3LA 3K0VA 3H7MA 1SI0A 3PD9A 4U2RA 4PFUA 4RK2A 1HSEA 3JZJA 2QJEA 2XXVA 4H67A 4JB7A 5H8QA 4G4PA 5I58A 1IZ1A 1USYH 2QS2A 2V3QA 4FIMA 4P0GA 2A5TA 1IUDA 3BKIB 2Y7IA 1D4NA 4POXA 1MY1A 2HAVA 2O6AA 2H4IA 3G3HA 1QKBA 2ABHA 4OZ9A 4DLDA 4XKNA 3MC2A 1UIVA 4R6KA 2ZXTA 3B7DA 2F7BA 3USDA 1D9VA 2ALUA 2F7CA 1N7XA 1I6QA 4G2ZA 1AIVA 1EZOA 3RY3A 4X1DA 2ANJA 3CIJA 1SYIA 4I8CA 2H98A 4I9DA 3TMGA 2P0SA 2DVZA 5EYFA 1B40A 3KSJA 1B46A 3MBPA 3TDJA 2YPNA 1BLFA 5CMBA 1QJMA 1JW4A 4F3PA 3DELB 2PX1A 2Q9TA 3K01A 1B3HA 3G3IA 3O6GA 2HCAA 1M5CA 4H5GA 1GVCA 2DWJA 4NF5A 4QSDA 1USYE 5DT6A 1JVXA 1PBQA 3V83A 1IIWA 1B58A 1J1NA 4ZEIA 3C35A 3T9UA 3LSXA 1I69A 2UVHA 3FGSA 5JK4A 3ZKLA 4N6PA 4DZ1A 3S9EA 3HV1A 4OQOA 4LP2B 3TQLA 3QUFA 2XX8A 3VE1B 1QUJA 4ZEBA 4DE8A 5CMCA 3FJGA 4BDLA 4BDRA 3D4GA 5FHMA 2V93A 4JBZA 1NFTA 3SERA 4ZE9A 3KEIA 3MZ1A 2G29A 2V3TA 1UQWA 3W15C 3E4RA 1Z7ME 2R71A 5CM6A 3CVGA 3FV2A 3S4UA 4L17A 1B7ZA 3QUJA 1B51A 4FORA 3EF7A 1MXXA 2ZYKA 4EXLA 2E1SA 2F97A 3FZVA 3VVDA 4ZZEA 1B5IA 1VFEA 4POWA 5CBSA 4YB5A 1DTZA 3PU5A 3MZBA 2DWIA 2V25A 3IR1A 3JV9A 1II5A 4GXSB 3FXQA 3G3JA 1ATGA 5AE4A 4YMAA 2HEUA 1MPDA 3BFUA 3T9VA 2XXIA 2Z8EA 3O66A 2D5WA 4R2FA 3KN7A 5L9MA 4G8NA 3IX1A 2Q89A 3DM0A 3RQTA 3VXBA 4HTGA 3K6UA 4NF8A 1QUKA 3MVXA 4C1TA 4AQ4A 4LONB 1JETA 2Q8JA 4U22A 1LCTA 3IK6B 5KCJB 3K1PA 4IO7A 3MW0A 3B6TA 3BFTA 4F29A 1Y1ZA 1MQJA 3H03A 1IXHA 4EXKA 1A7LA 4MFIA 3RNNA 3KGCA 4BDOA 1SYHA 4Z7EA 4AB6A 3C31A 3GBBA 1P1UA 1Y3PA 2RINA 1LSTA 3HHGA 1M5EA 1OVBA 3L6GA 4GD5A 2NWJA 4NF4B 1POY1 5AA2A 1M5FA 1R9QA 3O28A 1SQYA 3T22A 3WAFA 5CMKA 2ZYMA 2RKMA 3CR9A 2F35A 4DDDA 1LAFE 4QRZA 4JDFA 3T9HB 3I3VA 4IO2A 2Z8DA 2DVCA 2CZLA 3KOTA 2ZYNA 3F11A 4DXUA 1MM6A 3ZSFA 1B5JA 1DSNA 3OSQA 3IOVA 4N07A 3G7WA 5H8NA 3Q27A 3EHTA 5JTYB 2QPQA 4R74A 1MH4A 4Q5TA 1VFDA 1LAGE 2H25A 4YKKA 2DXYA 4IGRA 3OO6A 5DVJA 2F7AA 3C4MA 4GVOA 2FYIA 3CRBA 4JSOA 4PFWA 4XXUA 3CI8A 3SDFA 2I3VA 3LBSA 1O64A 3Q26A 1BTJA 1MDQA 3VV5A 2WKYA 4KD5A 1TT1A 3V5AA 1ELJA 1MM7A 1A54A 5KDTA 3A3UA 4F1VA 4O3AA 4R75A 1EH3A 2O1MA 4G8MA 4FJPA 4GQOA 1LB8A 3MWBA 3RT8A 3TODA 1NNPA 3R26A 3ILTB 5I59A 1GTKA 3I6VA 1LLSA 3O6IA 1EZ9A 2B65A 4P0IA 1LB9A 4F1UA 3N26A 3ZKKA 1MG1A 3PUZE 4NF6A 3DP6A 4GIZA 1RYOA 4WEDA 3MUQA 3MVWA 3LSLA 1Y20A 1A55A 1UTHB 2OK2A 5FTIA 2V84A 4PP0A 1MY3A 2Z8FA 1N0TA 2XXPA 3S9LC 1SBPA 5BWJA 4QFKA 1CE2A 3HSTA 2I6EA 2P2AA 4GLIA 4KI0E 5AA3A 4OERA 5FHNA 3PPOA 2HZLA 5CC2A 5JEIA 4TOZA 1M5BA 3FVGA 2OLBA 2ONKE 3FD3A 3UIFA 2PVUA 4AB5A 4X1BA 1RKMA 2GHAA 2Y7WA 3IB0A 2R9JA 3FATA 2O7UA 1XC1A 3EHSA 2XX9A 5I56B 1D9YA 3H06B 1VR5A 1SVXB 4MLVA 1VSOA 1FTJA 1JW1A 3OD7A 3MVZA 4KCCA 4FAJA 3RLFE 3K6XA 3CSGA 1MXUA 3SKPA 5H8FA 4JSDA 2UVGA 3SESA 4RNSA 4BDQA 4F19A 4QSEA 2PT1A 5CI5A 5ICQA 2I49A 4F22A 2I3WA 2M8CA 4ND9A 3UORA 1Q35A 2Q2CA 3TFLA 1IITA 3CG3A 3O6HA 2Q88A 3C9HA 3OO7A 2DQVA 5I2NB 1ZTYA 4E0XA 3HPIA 4M1VA 2I48A 1FTKA 3UP9A 2FNCA 1MQIA 5H8HA 4FE8A 4KHZE 3TCHA 1D3KA 4RPOA 4U1OA 4UA8A 3MP8A 1B3EA 1MQGA 4Q8RA 3C33A 2OWTA 4TQUQ 4OTEA 3WAEA 5TPAA 3T93B 2ZNUA 5I84A 4F3BA 1B4HA 4OESA 1Y1MA 3TPAA 2D3IA 3N6UA 4KQPA 4OFOA 1HSLA 4F3GA 2LAOA 2RC8A 2XHDA 5ITPA 1SW2A 5DVIA 1UTBA 4G68B 1CB6A 1ZMGA 3CSBA 1OVTA 2VGQA 3VXCA 2F36A 3RT6B 4ESXA 1XT8A 3RN8A 3TCFA 4ZEKA 4JWOA 1GR2A 4H8JA 4YKJA 3TAJA 4RY1A 2B3BA 4XTCQ 1AL3A 4JXIA 3GBAA 2RC7A 3O2AA 1JQFA 5AA4A 1PBPA 1BIYA 4ZEDA 2I58A 4NF4A 2QMWA 4OWDA 1OIBA 4F18A 3FXRA 1P1WA 4IO4A 4LZ8A 3KZGA 3IOWA 3Q28A 4PFTA 4YMBA 1EU8A 4R73A 4H8IA 1IXCA 4PE5B 3TZAA 4NWDA 1B0HA 4IO3A 1QUIA 5I57A 1Y3NA 2AL4A 5TP9B 2ZYOA 3RTWB 1S50A 1DTGA 5H8SA 5A5XA 4ZS9A 3K6VA 4PETA 5I2KA 4OHNA 4XKQA 2REJA 1JEVA 1B7HA 4GL8A 1US4A 1URSA 1WODA 3IO6A 3QAXA 5B70A 4QFLA 4OEVA 2UYEA 4LQ5A 3IL1B 4ONYA 4F2OA 5HM4B 4P11A 4E0WA 1N7WA 3H3GA 5CRYA 3SEYA 3T66A 5H8QB 5I58B 1P99A 3TUSA 3ILUB 1IXGA 3N6TA 3L6HA 1LCFA 2A5TB 3RUMA 4BDMA 2PBWA 2XXTA 1A8EA 5L9OA 3CFLA 3KBRA 3PPRA 3IORA 4H0WA 1MXYA 5KZTA 1LBCA 3U72A 2AL5A 3EHUA 1QW0A 2XXYA 1ZJLA 5ISUA 2PT2A 3QSLA 2DE3A 1S9TA 1IQ7A 2THIA 4WXJA 1L5TA 1XVXA 3E13X 2GRVA 3MPLA 4DCYA 2W7YA 2I4CA 3IJOB 2VOZA 3U1OA 2PMSA 2DOJA 2A5SA 5HBCA 1FQDA 3PPNA 4M4GA 3O97A 3MPKA 3H6VA 3KJ7A 1PEBA 2YJPA 2O1LA 2Y7PA 5B7DA 4LZ7A 4YKPA 2YLNA 3FXUA 1IXIA 4KPTA 3TQWA 1JNFA 1MXWA 2DP8A 2NUVA 3MVYA 4NF5B 1IEJA 3KN8A 3LC8A 4RK9A 3OEKA 4X48A 2UVIA 3P7IA 2H9BA 4JWXA 1BP5A 1Z7NE 1FQCA 1OLCA 3MAMA 5F1QA 4X9TA 2O84X 4U1ZA 4FATA 4HCWA 4OFLA 4DIGA 3OMBA 4YU0A 1TXFA 1FQFA 4LUBA 2G93A 1R6ZA 1SDXA 3MJNA 1QVSA 2VHAA 1ZKBA 1M5DA 3FJMA 4R9FA 1MXZA 3JYRA 4ISUA 1DMBA 2UYFA 1MH3A 3IB2A 4BDNA 1O7TA 2ONSA 5DEXB 1VE4A 2XXQA 3HCQA 2DWAA 3PUXE 1LAHE 3UA8A 1B52A 1SW1A 3A09A 3R7XA 2F6GA 3KJTA 2UXAA 1FTMA 4EF1A 1P1NA 4K3FA 1QKAA 5LOMA 4R72A 3VVFA 2DE2A 2VD2A 1FQEA 2OJTA 3LSWA 1B0LA 3TYHA 1H3DA 4NF8B 2RC9A 3ZS6A 3A3CA 2Y7RA 1LBBA 4YB7A 1NNFA 3SETA 3PUVE 5FTHA 1JW5A 1B2HA 3U92A 1B1XA 2QRYA 1LFHA 2DS9A 3CG1A 4ELQA 1MY0A 4H6DA 5ICTA 1B6HA 4PQJA 2QS4A 4ESWA 1PB9A 3TTLA 2XD2A 1B05A 5CMMA 4EQBA 4I62A 2XXXA 4U21A 3QXMA 3W9WA 2QSXA 1YTVA 3VVEA 3TKDA 2F78A 3MQ9A 4THIA 3FV1A 3H6WA 3FJ7A 4TLMB 4ZDMA 5EHMA 1ZIUA 1MDP1 1N76A 3TTNA 3Q29A 2ZMBA 4MH5A 1Y4TA 5L9SA 3QIMA 1A40A 2NVUB 3OENA 4ELPA 1DOTA 4PFYA 1NNKA 2PYYA 3HHFA 1I6AA 3IOUA 3FASA 1URDA 2HXWA 2I0BA 5H8NB 2X7PA 2F6PA 4ZZAA 3T9XB 3T96B 3AXFA 3OELA 2AIXA 1F9BA 3K6WA 3MP6A 4Q0CA 5CBRA 3IO4A 1Q1KA 4F39A 4GF8A 5F7VA 2XXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH9 A;  3RTF B;  2R6G E;  4FEC A;  3LR1 A;  3VLW A;  3H4Z A;  1ANF A;  2HAU A;  3IJX B;  3Q25 A;  3K1M A;  1MXV A;  3FVO A;  4H1X A;  3H6T A;  4H5F A;  4LVQ A;  3G3F A;  5J1D A;  5KDT B;  2Z23 A;  4EUO A;  3TEP A;  4QFP A;  2RCA A;  1NMU A;  4R6H A;  1TFA A;  4KR5 A;  2F34 A;  3K00 A;  1NKX A;  1B5H A;  1ZBM A;  3TTK A;  3PPQ A;  1NL5 A;  3M3F A;  3QK6 A;  3SEX A;  2IEE A;  1R1N A;  2QMX A;  4MBP A;  1FTL A;  1BKA A;  5I59 B;  5KCJ A;  4XIG Q;  3DLN A;  2QL3 A;  3RGY A;  4GXA A;  3SEU A;  4TLL B;  5DYH A;  3C36 A;  4NF6 B;  4YKI A;  5FHO A;  3U93 A;  5AA1 A;  5BUU A;  1B32 A;  3V8X B;  3M3K A;  4ZEC A;  4OEN A;  5TU0 A;  3K2D A;  4I1D A;  4KCD A;  1XOC A;  4C0R A;  2DXR A;  4O3C A;  3N94 A;  3BBR A;  2Z22 A;  2GFE A;  3B6W A;  1A8F A;  4NMY A;  1LFG A;  4IY6 A;  3DP4 A;  4OYV A;  2I0C A;  3I5O A;  3SEV A;  3DP8 A;  2GHB A;  3S9M C;  3TTR A;  3VDF A;  2BJJ X;  3FVK A;  1B7U A;  4GWO A;  3GXA A;  2QS1 A;  3OSR A;  1ZU0 A;  1GGG A;  4OET A;  4HCY A;  2F5X A;  3PUW E;  4MLQ A;  4ZE8 A;  4DXB A;  2DWH A;  1UIU A;  3K02 A;  3PMX A;  1JVY A;  5JTY A;  4R6Y A;  4GFR A;  1N3W A;  2KLF A;  3FUZ A;  1MY2 A;  1Y9U A;  5H8F B;  3MP1 A;  2OZZ A;  2Y7K A;  3S9N C;  2NOO A;  2RCB A;  2O68 A;  1OQH A;  4G77 A;  4QSC A;  4UAC A;  3OOA A;  2Q2A A;  1MQH A;  1TWY A;  1US5 A;  3K4U A;  4R2B A;  1WDN A;  5DVF A;  1OMP A;  2XD3 A;  3C34 A;  1MPC A;  1JEU A;  3EQ1 A;  4ELO A;  2V3U A;  2XX7 A;  3IB1 A;  1DPE A;  2RF1 A;  5DEX A;  3TTM A;  2HZK A;  1PC3 A;  3O9P A;  1N3X A;  2REG A;  3KSX A;  3H6U A;  4F31 B;  3KG2 A;  1OLA A;  4YZZ A;  5H8H B;  1PB7 A;  2DYX A;  3SEW A;  3E9X A;  4RXL A;  3OO8 A;  1XS5 A;  4YB6 A;  5TPA B;  1B3G A;  3G3G A;  1N84 A;  1MS7 A;  4QFN A;  3ECR A;  4YAH X;  5EHS A;  4GOT A;  4OEU A;  3G3K A;  1MPB A;  4IGT A;  2D21 A;  2NXO A;  1FCK A;  3S2V A;  3O29 A;  5DTB A;  1UTH A;  3VFJ A;  1PB8 A;  3ODB A;  1UTB B;  2OBG A;  4KYS A;  1N04 A;  1YCJ A;  1YPN A;  1URG A;  2QS3 A;  2HFB A;  1QUL A;  3KOS A;  2H99 A;  1DPP A;  1OQG A;  4OXV A;  1B1H A;  4U4X A;  4F3S A;  4KFQ A;  2E0S A;  1H76 A;  3PGF A;  4G8H A;  2XXW A;  4LZ5 A;  1NNT A;  1SI1 A;  5AA4 B;  4WKM A;  4NWC A;  1FQA A;  3U8Q A;  3FIR A;  2XXR A;  5I56 A;  2HQ0 A;  4RYA A;  2XXU A;  4RA1 A;  4QF9 A;  3V89 B;  3HN0 A;  4KYE A;  4KYD A;  1GV8 A;  5L8D A;  2O7I A;  1RYX A;  1P1O A;  4OMB A;  2UVJ A;  1MRP A;  4FEB A;  1R9L A;  4ECF A;  4LA9 A;  3E3K A;  2X7Q A;  1SD3 A;  5I57 B;  3KN3 A;  1XHY A;  4OFJ A;  2ZNS A;  4NE4 A;  3HO7 A;  1FTO A;  4Z0I A;  4XKR A;  5A5X B;  3THI A;  3ONM A;  5M2V A;  1MY4 A;  3GZG A;  4BLA A;  4QFO A;  5I2K B;  2ESN A;  4N13 A;  4R9G A;  4ELR A;  1AOV A;  2P1S A;  2B3F A;  2DE4 A;  1B9J A;  5I2N A;  4F2Q A;  4EQ7 A;  1NH7 A;  3QYT A;  1P1Q A;  4FED A;  2DSF A;  3EN3 A;  3IAZ A;  3R6U A;  4IY5 A;  4LQ2 A;  3RPW A;  1PDA A;  4RJZ A;  4EDP A;  4OVJ A;  1LGB C;  1LAX A;  1MQD A;  1H43 A;  4DCX A;  4WEP A;  4YIC A;  3TCG A;  2X26 A;  1EZP A;  1LFI A;  5ITO A;  3PUY E;  3MZ9 A;  3LSF B;  1FW0 A;  3PV0 E;  4IB2 A;  3FVN A;  4IO5 A;  3OEM A;  3KFM A;  3M8U A;  2OWS A;  3VLV A;  1ZLQ A;  4G68 A;  1FQB A;  1I6B A;  3B6Q A;  3D4C A;  4EF2 A;  4H65 A;  2H5Y A;  4U23 A;  2OCU A;  3EPE A;  4ZEF A;  3CFX A;  3UK4 A;  1WVJ A;  4DXC A;  5ELV A;  4QHQ A;  1H45 A;  2F8D A;  4G68 C;  4RPN A;  5IKB A;  4Q30 B;  3CFZ A;  1B3F A;  5HPQ A;  4XKP A;  4IO6 A;  1XVY A;  1H44 A;  4O3B A;  4HW8 A;  2O69 A;  2ONR A;  1POT A;  3PPP A;  1KWH A;  1AH5 A;  3PMV A;  5AA2 B;  4U4S A;  1A99 A;  3OXN A;  4NED A;  2AYS A;  3K1N A;  3UGW A;  3LUY A;  1O63 A;  5K2Y A;  3W9V A;  4EQ9 A;  2VP1 A;  3GLB A;  4C1U A;  1Y4C A;  1YAE A;  4NTL A;  1S7Y A;  3IOT A;  3TEL A;  3PMW A;  2IA4 A;  3U94 A;  3N5L A;  2ZNT A;  5TP9 A;  5IAI A;  2FA7 A;  4LAT A;  3UN6 A;  1T0K A;  3VLU A;  4GRK A;  4JWY A;  4GL0 A;  1B4Z A;  1TFD A;  3OO9 A;  1SW4 A;  2VD3 A;  1AMF A;  3PD8 A;  2O51 A;  1B3L A;  1SW5 A;  4HS7 A;  2Y84 A;  1HSJ A;  1Y3Q A;  4MF3 A;  1NH8 A;  3C32 A;  2I4B A;  5K2X A;  4F1Y A;  2CMO A;  5AA2 D;  3M3L A;  3K0V A;  3H7M A;  1SI0 A;  3PD9 A;  4U2R A;  4PFU A;  4RK2 A;  1HSE A;  3JZJ A;  2QJE A;  2XXV A;  4H67 A;  4JB7 A;  5H8Q A;  4G4P A;  5I58 A;  1IZ1 A;  1USY H;  2QS2 A;  2V3Q A;  4FIM A;  4P0G A;  2A5T A;  1IUD A;  3BKI B;  2Y7I A;  1D4N A;  4POX A;  1MY1 A;  2HAV A;  2O6A A;  2H4I A;  3G3H A;  1QKB A;  2ABH A;  4OZ9 A;  4DLD A;  4XKN A;  3MC2 A;  1UIV A;  4R6K A;  2ZXT A;  3B7D A;  2F7B A;  3USD A;  1D9V A;  2ALU A;  2F7C A;  1N7X A;  1I6Q A;  4G2Z A;  1AIV A;  1EZO A;  3RY3 A;  4X1D A;  2ANJ A;  3CIJ A;  1SYI A;  4I8C A;  2H98 A;  4I9D A;  3TMG A;  2P0S A;  2DVZ A;  5EYF A;  1B40 A;  3KSJ A;  1B46 A;  3MBP A;  3TDJ A;  2YPN A;  1BLF A;  5CMB A;  1QJM A;  1JW4 A;  4F3P A;  3DEL B;  2PX1 A;  2Q9T A;  3K01 A;  1B3H A;  3G3I A;  3O6G A;  2HCA A;  1M5C A;  4H5G A;  1GVC A;  2DWJ A;  4NF5 A;  4QSD A;  1USY E;  5DT6 A;  1JVX A;  1PBQ A;  3V83 A;  1IIW A;  1B58 A;  1J1N A;  4ZEI A;  3C35 A;  3T9U A;  3LSX A;  1I69 A;  2UVH A;  3FGS A;  5JK4 A;  3ZKL A;  4N6P A;  4DZ1 A;  3S9E A;  3HV1 A;  4OQO A;  4LP2 B;  3TQL A;  3QUF A;  2XX8 A;  3VE1 B;  1QUJ A;  4ZEB A;  4DE8 A;  5CMC A;  3FJG A;  4BDL A;  4BDR A;  3D4G A;  5FHM A;  2V93 A;  4JBZ A;  1NFT A;  3SER A;  4ZE9 A;  3KEI A;  3MZ1 A;  2G29 A;  2V3T A;  1UQW A;  3W15 C;  3E4R A;  1Z7M E;  2R71 A;  5CM6 A;  3CVG A;  3FV2 A;  3S4U A;  4L17 A;  1B7Z A;  3QUJ A;  1B51 A;  4FOR A;  3EF7 A;  1MXX A;  2ZYK A;  4EXL A;  2E1S A;  2F97 A;  3FZV A;  3VVD A;  4ZZE A;  1B5I A;  1VFE A;  4POW A;  5CBS A;  4YB5 A;  1DTZ A;  3PU5 A;  3MZB A;  2DWI A;  2V25 A;  3IR1 A;  3JV9 A;  1II5 A;  4GXS B;  3FXQ A;  3G3J A;  1ATG A;  5AE4 A;  4YMA A;  2HEU A;  1MPD A;  3BFU A;  3T9V A;  2XXI A;  2Z8E A;  3O66 A;  2D5W A;  4R2F A;  3KN7 A;  5L9M A;  4G8N A;  3IX1 A;  2Q89 A;  3DM0 A;  3RQT A;  3VXB A;  4HTG A;  3K6U A;  4NF8 A;  1QUK A;  3MVX A;  4C1T A;  4AQ4 A;  4LON B;  1JET A;  2Q8J A;  4U22 A;  1LCT A;  3IK6 B;  5KCJ B;  3K1P A;  4IO7 A;  3MW0 A;  3B6T A;  3BFT A;  4F29 A;  1Y1Z A;  1MQJ A;  3H03 A;  1IXH A;  4EXK A;  1A7L A;  4MFI A;  3RNN A;  3KGC A;  4BDO A;  1SYH A;  4Z7E A;  4AB6 A;  3C31 A;  3GBB A;  1P1U A;  1Y3P A;  2RIN A;  1LST A;  3HHG A;  1M5E A;  1OVB A;  3L6G A;  4GD5 A;  2NWJ A;  4NF4 B;  1POY 1;  5AA2 A;  1M5F A;  1R9Q A;  3O28 A;  1SQY A;  3T22 A;  3WAF A;  5CMK A;  2ZYM A;  2RKM A;  3CR9 A;  2F35 A;  4DDD A;  1LAF E;  4QRZ A;  4JDF A;  3T9H B;  3I3V A;  4IO2 A;  2Z8D A;  2DVC A;  2CZL A;  3KOT A;  2ZYN A;  3F11 A;  4DXU A;  1MM6 A;  3ZSF A;  1B5J A;  1DSN A;  3OSQ A;  3IOV A;  4N07 A;  3G7W A;  5H8N A;  3Q27 A;  3EHT A;  5JTY B;  2QPQ A;  4R74 A;  1MH4 A;  4Q5T A;  1VFD A;  1LAG E;  2H25 A;  4YKK A;  2DXY A;  4IGR A;  3OO6 A;  5DVJ A;  2F7A A;  3C4M A;  4GVO A;  2FYI A;  3CRB A;  4JSO A;  4PFW A;  4XXU A;  3CI8 A;  3SDF A;  2I3V A;  3LBS A;  1O64 A;  3Q26 A;  1BTJ A;  1MDQ A;  3VV5 A;  2WKY A;  4KD5 A;  1TT1 A;  3V5A A;  1ELJ A;  1MM7 A;  1A54 A;  5KDT A;  3A3U A;  4F1V A;  4O3A A;  4R75 A;  1EH3 A;  2O1M A;  4G8M A;  4FJP A;  4GQO A;  1LB8 A;  3MWB A;  3RT8 A;  3TOD A;  1NNP A;  3R26 A;  3ILT B;  5I59 A;  1GTK A;  3I6V A;  1LLS A;  3O6I A;  1EZ9 A;  2B65 A;  4P0I A;  1LB9 A;  4F1U A;  3N26 A;  3ZKK A;  1MG1 A;  3PUZ E;  4NF6 A;  3DP6 A;  4GIZ A;  1RYO A;  4WED A;  3MUQ A;  3MVW A;  3LSL A;  1Y20 A;  1A55 A;  1UTH B;  2OK2 A;  5FTI A;  2V84 A;  4PP0 A;  1MY3 A;  2Z8F A;  1N0T A;  2XXP A;  3S9L C;  1SBP A;  5BWJ A;  4QFK A;  1CE2 A;  3HST A;  2I6E A;  2P2A A;  4GLI A;  4KI0 E;  5AA3 A;  4OER A;  5FHN A;  3PPO A;  2HZL A;  5CC2 A;  5JEI A;  4TOZ A;  1M5B A;  3FVG A;  2OLB A;  2ONK E;  3FD3 A;  3UIF A;  2PVU A;  4AB5 A;  4X1B A;  1RKM A;  2GHA A;  2Y7W A;  3IB0 A;  2R9J A;  3FAT A;  2O7U A;  1XC1 A;  3EHS A;  2XX9 A;  5I56 B;  1D9Y A;  3H06 B;  1VR5 A;  1SVX B;  4MLV A;  1VSO A;  1FTJ A;  1JW1 A;  3OD7 A;  3MVZ A;  4KCC A;  4FAJ A;  3RLF E;  3K6X A;  3CSG A;  1MXU A;  3SKP A;  5H8F A;  4JSD A;  2UVG A;  3SES A;  4RNS A;  4BDQ A;  4F19 A;  4QSE A;  2PT1 A;  5CI5 A;  5ICQ A;  2I49 A;  4F22 A;  2I3W A;  2M8C A;  4ND9 A;  3UOR A;  1Q35 A;  2Q2C A;  3TFL A;  1IIT A;  3CG3 A;  3O6H A;  2Q88 A;  3C9H A;  3OO7 A;  2DQV A;  5I2N B;  1ZTY A;  4E0X A;  3HPI A;  4M1V A;  2I48 A;  1FTK A;  3UP9 A;  2FNC A;  1MQI A;  5H8H A;  4FE8 A;  4KHZ E;  3TCH A;  1D3K A;  4RPO A;  4U1O A;  4UA8 A;  3MP8 A;  1B3E A;  1MQG A;  4Q8R A;  3C33 A;  2OWT A;  4TQU Q;  4OTE A;  3WAE A;  5TPA A;  3T93 B;  2ZNU A;  5I84 A;  4F3B A;  1B4H A;  4OES A;  1Y1M A;  3TPA A;  2D3I A;  3N6U A;  4KQP A;  4OFO A;  1HSL A;  4F3G A;  2LAO A;  2RC8 A;  2XHD A;  5ITP A;  1SW2 A;  5DVI A;  1UTB A;  4G68 B;  1CB6 A;  1ZMG A;  3CSB A;  1OVT A;  2VGQ A;  3VXC A;  2F36 A;  3RT6 B;  4ESX A;  1XT8 A;  3RN8 A;  3TCF A;  4ZEK A;  4JWO A;  1GR2 A;  4H8J A;  4YKJ A;  3TAJ A;  4RY1 A;  2B3B A;  4XTC Q;  1AL3 A;  4JXI A;  3GBA A;  2RC7 A;  3O2A A;  1JQF A;  5AA4 A;  1PBP A;  1BIY A;  4ZED A;  2I58 A;  4NF4 A;  2QMW A;  4OWD A;  1OIB A;  4F18 A;  3FXR A;  1P1W A;  4IO4 A;  4LZ8 A;  3KZG A;  3IOW A;  3Q28 A;  4PFT A;  4YMB A;  1EU8 A;  4R73 A;  4H8I A;  1IXC A;  4PE5 B;  3TZA A;  4NWD A;  1B0H A;  4IO3 A;  1QUI A;  5I57 A;  1Y3N A;  2AL4 A;  5TP9 B;  2ZYO A;  3RTW B;  1S50 A;  1DTG A;  5H8S A;  5A5X A;  4ZS9 A;  3K6V A;  4PET A;  5I2K A;  4OHN A;  4XKQ A;  2REJ A;  1JEV A;  1B7H A;  4GL8 A;  1US4 A;  1URS A;  1WOD A;  3IO6 A;  3QAX A;  5B70 A;  4QFL A;  4OEV A;  2UYE A;  4LQ5 A;  3IL1 B;  4ONY A;  4F2O A;  5HM4 B;  4P11 A;  4E0W A;  1N7W A;  3H3G A;  5CRY A;  3SEY A;  3T66 A;  5H8Q B;  5I58 B;  1P99 A;  3TUS A;  3ILU B;  1IXG A;  3N6T A;  3L6H A;  1LCF A;  2A5T B;  3RUM A;  4BDM A;  2PBW A;  2XXT A;  1A8E A;  5L9O A;  3CFL A;  3KBR A;  3PPR A;  3IOR A;  4H0W A;  1MXY A;  5KZT A;  1LBC A;  3U72 A;  2AL5 A;  3EHU A;  1QW0 A;  2XXY A;  1ZJL A;  5ISU A;  2PT2 A;  3QSL A;  2DE3 A;  1S9T A;  1IQ7 A;  2THI A;  4WXJ A;  1L5T A;  1XVX A;  3E13 X;  2GRV A;  3MPL A;  4DCY A;  2W7Y A;  2I4C A;  3IJO B;  2VOZ A;  3U1O A;  2PMS A;  2DOJ A;  2A5S A;  5HBC A;  1FQD A;  3PPN A;  4M4G A;  3O97 A;  3MPK A;  3H6V A;  3KJ7 A;  1PEB A;  2YJP A;  2O1L A;  2Y7P A;  5B7D A;  4LZ7 A;  4YKP A;  2YLN A;  3FXU A;  1IXI A;  4KPT A;  3TQW A;  1JNF A;  1MXW A;  2DP8 A;  2NUV A;  3MVY A;  4NF5 B;  1IEJ A;  3KN8 A;  3LC8 A;  4RK9 A;  3OEK A;  4X48 A;  2UVI A;  3P7I A;  2H9B A;  4JWX A;  1BP5 A;  1Z7N E;  1FQC A;  1OLC A;  3MAM A;  5F1Q A;  4X9T A;  2O84 X;  4U1Z A;  4FAT A;  4HCW A;  4OFL A;  4DIG A;  3OMB A;  4YU0 A;  1TXF A;  1FQF A;  4LUB A;  2G93 A;  1R6Z A;  1SDX A;  3MJN A;  1QVS A;  2VHA A;  1ZKB A;  1M5D A;  3FJM A;  4R9F A;  1MXZ A;  3JYR A;  4ISU A;  1DMB A;  2UYF A;  1MH3 A;  3IB2 A;  4BDN A;  1O7T A;  2ONS A;  5DEX B;  1VE4 A;  2XXQ A;  3HCQ A;  2DWA A;  3PUX E;  1LAH E;  3UA8 A;  1B52 A;  1SW1 A;  3A09 A;  3R7X A;  2F6G A;  3KJT A;  2UXA A;  1FTM A;  4EF1 A;  1P1N A;  4K3F A;  1QKA A;  5LOM A;  4R72 A;  3VVF A;  2DE2 A;  2VD2 A;  1FQE A;  2OJT A;  3LSW A;  1B0L A;  3TYH A;  1H3D A;  4NF8 B;  2RC9 A;  3ZS6 A;  3A3C A;  2Y7R A;  1LBB A;  4YB7 A;  1NNF A;  3SET A;  3PUV E;  5FTH A;  1JW5 A;  1B2H A;  3U92 A;  1B1X A;  2QRY A;  1LFH A;  2DS9 A;  3CG1 A;  4ELQ A;  1MY0 A;  4H6D A;  5ICT A;  1B6H A;  4PQJ A;  2QS4 A;  4ESW A;  1PB9 A;  3TTL A;  2XD2 A;  1B05 A;  5CMM A;  4EQB A;  4I62 A;  2XXX A;  4U21 A;  3QXM A;  3W9W A;  2QSX A;  1YTV A;  3VVE A;  3TKD A;  2F78 A;  3MQ9 A;  4THI A;  3FV1 A;  3H6W A;  3FJ7 A;  4TLM B;  4ZDM A;  5EHM A;  1ZIU A;  1MDP 1;  1N76 A;  3TTN A;  3Q29 A;  2ZMB A;  4MH5 A;  1Y4T A;  5L9S A;  3QIM A;  1A40 A;  2NVU B;  3OEN A;  4ELP A;  1DOT A;  4PFY A;  1NNK A;  2PYY A;  3HHF A;  1I6A A;  3IOU A;  3FAS A;  1URD A;  2HXW A;  2I0B A;  5H8N B;  2X7P A;  2F6P A;  4ZZA A;  3T9X B;  3T96 B;  3AXF A;  3OEL A;  2AIX A;  1F9B A;  3K6W A;  3MP6 A;  4Q0C A;  5CBR A;  3IO4 A;  1Q1K A;  4F39 A;  4GF8 A;  5F7V A;  2XXH A; 
#chains in the Genus database with same CATH topology
 2GH9 A;  1NV1 A;  3RTF B;  2R6G E;  4FEC A;  3LR1 A;  3VLW A;  3H4Z A;  1ANF A;  2HAU A;  3IJX B;  3Q25 A;  3K1M A;  1MXV A;  3FVO A;  4H1X A;  3H6T A;  4H5F A;  4PGP A;  3U65 A;  4LVQ A;  3G3F A;  5J1D A;  1RDZ A;  3GYY A;  5KDT B;  2Z23 A;  4EUO A;  3TEP A;  4QFP A;  2RCA A;  1NMU A;  4R6H A;  1TFA A;  2F3D A;  4KR5 A;  2F34 A;  3K00 A;  1NKX A;  1FBP A;  1B5H A;  1ZBM A;  2GQ1 A;  3TTK A;  3PPQ A;  1NL5 A;  3M3F A;  3QK6 A;  3SEX A;  2IEE A;  1R1N A;  2QMX A;  4MBP A;  1FTL A;  1BKA A;  5I59 B;  1VDW A;  5KCJ A;  4XIG Q;  3DLN A;  2QL3 A;  3RGY A;  3PTY A;  4GXA A;  1IMB A;  3SEU A;  3RPL A;  4TLL B;  5DYH A;  3C36 A;  4NF6 B;  4YKI A;  5FHO A;  3U93 A;  3MYU A;  5AA1 A;  5BUU A;  1B32 A;  3V8X B;  3M3K A;  4ZEC A;  4O7I A;  4OEN A;  5TU0 A;  3K2D A;  4I1D A;  4NX1 A;  4KCD A;  1XOC A;  4C0R A;  2DXR A;  4O3C A;  3N94 A;  3BBR A;  2Z22 A;  2GFE A;  3B6W A;  1A8F A;  4NMY A;  1IME A;  1LFG A;  4IY6 A;  5EYH A;  2WEF A;  4P47 A;  3DP4 A;  4OYV A;  2I0C A;  3I5O A;  3SEV A;  1FPG A;  3DP8 A;  2GHB A;  3S9M C;  3TTR A;  3VDF A;  1DBZ A;  2BJJ X;  3FVK A;  1B7U A;  4GWX A;  4GWO A;  3GXA A;  2QS1 A;  3OSR A;  1ZU0 A;  1GGG A;  4OET A;  4HCY A;  2R8T A;  2F5X A;  3PUW E;  4MLQ A;  4MEV A;  4ZE8 A;  4DXB A;  2DWH A;  1UIU A;  3K02 A;  3PMX A;  1JVY A;  5JTY A;  1FBG A;  4R6Y A;  4GFR A;  1N3W A;  2KLF A;  3FUZ A;  1MY2 A;  1Y9U A;  5H8F B;  3MP1 A;  2OZZ A;  2Y7K A;  3S9N C;  5I5P A;  2NOO A;  4LN5 A;  2DDK A;  2RCB A;  3T0J A;  2O68 A;  1OQH A;  4G77 A;  4QSC A;  4UAC A;  3OOA A;  2Q2A A;  1MQH A;  1FJ9 A;  1TWY A;  1US5 A;  3K4U A;  4R2B A;  1WDN A;  5DVF A;  1OMP A;  2XD3 A;  3C34 A;  4FBP A;  1MPC A;  1INP A;  1JEU A;  3EQ1 A;  4ELO A;  2V3U A;  2XX7 A;  3IB1 A;  2P3N A;  1DPE A;  1XI6 A;  2RF1 A;  5DEX A;  3TTM A;  1G0H A;  2HZK A;  1PC3 A;  3O9P A;  4MAG A;  4MIJ A;  1N3X A;  2REG A;  3KSX A;  3H6U A;  4F31 B;  3KG2 A;  1OLA A;  4YZZ A;  5IZ1 A;  5H8H B;  1PB7 A;  1RDX A;  1FSA A;  2DYX A;  2QFL A;  3SEW A;  5ET7 A;  3E9X A;  4RXL A;  3OO8 A;  1XS5 A;  4YB6 A;  5TPA B;  1B3G A;  3G3G A;  1N84 A;  1MS7 A;  4QFN A;  4P3L A;  3ECR A;  4YAH X;  5EHS A;  4GOT A;  4OEU A;  3G3K A;  1MPB A;  4IGT A;  2D21 A;  2NXO A;  1FCK A;  3S2V A;  3E78 A;  3O29 A;  4PTK A;  5DTB A;  1UTH A;  3VFJ A;  2VPO A;  1PB8 A;  3ODB A;  1UTB B;  2OBG A;  4KYS A;  1N04 A;  1YCJ A;  2XWK A;  1YPN A;  1G0I A;  1NV0 A;  1URG A;  4MX6 A;  2QS3 A;  2HFB A;  3SZP A;  1QUL A;  3KOS A;  2H99 A;  1DPP A;  1OQG A;  4OXV A;  1B1H A;  4U4X A;  4F3S A;  4KFQ A;  2E0S A;  2FIE A;  1H76 A;  3PGF A;  4G8H A;  2XXW A;  4LZ5 A;  1SI1 A;  1NNT A;  5AA4 B;  4WKM A;  3BIH A;  4NWC A;  1FQA A;  3U8Q A;  3FIR A;  2XXR A;  1NV6 A;  5I56 A;  5IZ3 A;  2HQ0 A;  1FBD A;  4RYA A;  2XXU A;  4RA1 A;  4QF9 A;  3V89 B;  4OVR A;  3HN0 A;  4KYE A;  4OAN A;  4H45 A;  4KYD A;  1GV8 A;  5L8D A;  2O7I A;  1RYX A;  1P1O A;  3EKI A;  4OMB A;  2UVJ A;  1MRP A;  4FEB A;  1R9L A;  4PC9 A;  4ECF A;  4LA9 A;  2CZI A;  2WX9 A;  3E3K A;  2X7Q A;  1SD3 A;  5I57 B;  4N15 A;  3KN3 A;  1XHY A;  4OFJ A;  2ZNS A;  4NE4 A;  3HO7 A;  1FTO A;  4Z0I A;  4XKR A;  5A5X B;  3THI A;  3ONM A;  5M2V A;  2V4C A;  1MY4 A;  3GZG A;  4BLA A;  4QFO A;  5I2K B;  2ESN A;  4N13 A;  1FBE A;  4R9G A;  4ELR A;  1AOV A;  2P1S A;  2B3F A;  2DE4 A;  1B9J A;  5I2N A;  4F2Q A;  1NV4 A;  4EQ7 A;  1NH7 A;  3QYT A;  1P1Q A;  4FED A;  2DSF A;  3EN3 A;  3IAZ A;  3R6U A;  4IY5 A;  4LQ2 A;  3RPW A;  1PDA A;  4RJZ A;  4EDP A;  4OVJ A;  1LGB C;  1LAX A;  4NF0 A;  1YXI A;  2CZK A;  1MQD A;  1H43 A;  4IR8 A;  4DCX A;  4WEP A;  4YIC A;  3TCG A;  4NN3 A;  2X26 A;  1EZP A;  1LFI A;  5ITO A;  3PUY E;  3MZ9 A;  3LSF B;  1FW0 A;  3PV0 E;  4IB2 A;  3FVN A;  1EYK A;  4IO5 A;  3OEM A;  4XEQ A;  3KFM A;  3M8U A;  2OWS A;  3VLV A;  1ZLQ A;  4G68 A;  1FPF A;  1FQB A;  1I6B A;  3B6Q A;  4OA4 A;  2Q74 A;  3D4C A;  4EF2 A;  4H65 A;  2H5Y A;  4NG7 A;  4U23 A;  1IMA A;  2OCU A;  3EPE A;  4ZEF A;  1NUZ A;  3CFX A;  3UK4 A;  1WVJ A;  4DXC A;  5ELV A;  4QHQ A;  1H45 A;  2F8D A;  4G68 C;  4RPN A;  5IKB A;  4Q30 B;  2ZZX A;  3CFZ A;  1B3F A;  5HPQ A;  4XKP A;  4IO6 A;  1XVY A;  2P3V A;  1H44 A;  4O3B A;  4HW8 A;  2O69 A;  2ONR A;  1POT A;  3PPP A;  1KWH A;  4OVP A;  1AH5 A;  4MNC A;  3PMV A;  5AA2 B;  4U4S A;  1A99 A;  3OXN A;  4NED A;  2AYS A;  3K1N A;  3UGW A;  3IFA A;  3LUY A;  4X04 A;  1O63 A;  5K2Y A;  3W9V A;  4EQ9 A;  1FPJ A;  2VP1 A;  3GLB A;  4C1U A;  1Y4C A;  1YAE A;  4NTL A;  1S7Y A;  3IOT A;  4JVD A;  4PBQ A;  3TEL A;  3PMW A;  2IA4 A;  3U94 A;  3N5L A;  2ZNT A;  5TP9 A;  5IAI A;  4GX3 A;  2FA7 A;  4LAT A;  3UN6 A;  1T0K A;  3VLU A;  4GRK A;  4JWY A;  4GL0 A;  4GBV A;  1B4Z A;  1TFD A;  3OO9 A;  1SW4 A;  2VD3 A;  1LBV A;  1AMF A;  3PD8 A;  2O51 A;  1B3L A;  1SW5 A;  4HS7 A;  4P9K A;  2Y84 A;  1HSJ A;  1Y3Q A;  4MF3 A;  1NH8 A;  3C32 A;  2I4B A;  2JJK A;  5K2X A;  4F1Y A;  2CMO A;  5AA2 D;  3M3L A;  3K0V A;  3H7M A;  1SI0 A;  3PD9 A;  4U2R A;  4PFU A;  4KXP A;  4RK2 A;  1HSE A;  3JZJ A;  2QJE A;  3KC1 A;  2KQZ A;  2XXV A;  4H67 A;  2PCR A;  4JB7 A;  5H8Q A;  4G4P A;  5I58 A;  1IZ1 A;  1USY H;  2QS2 A;  2V3Q A;  4FIM A;  1K9Z A;  4P0G A;  2A5T A;  4PDD A;  1IUD A;  3BKI B;  5LDZ A;  2Y7I A;  1D4N A;  4POX A;  4OVQ A;  1MY1 A;  4NHB A;  2HAV A;  2O6A A;  2H4I A;  3G3H A;  1QKB A;  5ET8 A;  2ABH A;  4OZ9 A;  4O7M A;  4DLD A;  4XKN A;  3MC2 A;  1UIV A;  4R6K A;  2ZXT A;  3B7D A;  2F7B A;  3USD A;  1D9V A;  2ALU A;  2F7C A;  1N7X A;  1I6Q A;  4G2Z A;  1AIV A;  1EZO A;  3RY3 A;  4X1D A;  2ANJ A;  3CIJ A;  1SYI A;  4I8C A;  2H98 A;  4I9D A;  3TMG A;  2P0S A;  2XA5 A;  4N91 A;  2DVZ A;  5EYF A;  1B40 A;  3KSJ A;  1B46 A;  3MBP A;  3TDJ A;  2YPN A;  5FBP A;  1BLF A;  5CMB A;  1FRP A;  1QJM A;  1JW4 A;  4F3P A;  3DEL B;  4JVI A;  2PX1 A;  2Q9T A;  3K01 A;  1B3H A;  3G3I A;  4G61 A;  3KBZ A;  1FPD A;  3O6G A;  2HCA A;  1M5C A;  4H5G A;  1GVC A;  2DWJ A;  4NF5 A;  4QSD A;  1USY E;  5DT6 A;  1JVX A;  1PBQ A;  3V83 A;  1IIW A;  1B58 A;  1J1N A;  4ZEI A;  3C35 A;  3T9U A;  3LSX A;  1I69 A;  2UVH A;  3FGS A;  5JK4 A;  3ZKL A;  4N6P A;  4DZ1 A;  3S9E A;  3HV1 A;  4OQO A;  4LP2 B;  3TQL A;  3QUF A;  4UAB A;  2XX8 A;  3VE1 B;  1QUJ A;  4ZEB A;  4DE8 A;  5CMC A;  4GX4 A;  3FJG A;  4BDL A;  4BDR A;  3D4G A;  5FHM A;  2V93 A;  4JBZ A;  1NFT A;  3SER A;  4ZE9 A;  3KEI A;  3MZ1 A;  2G29 A;  2V3T A;  1UQW A;  3W15 C;  3E4R A;  1Z7M E;  2R71 A;  2MKZ A;  5CM6 A;  3CVG A;  3FV2 A;  1IMF A;  3S4U A;  4L17 A;  4N17 A;  1B7Z A;  3QUJ A;  1B51 A;  4FOR A;  3EF7 A;  1MXX A;  1RDY A;  2ZYK A;  4EXL A;  2E1S A;  2F97 A;  2FVZ A;  3FZV A;  3VVD A;  4ZZE A;  1B5I A;  1VFE A;  1NV5 A;  4POW A;  5CBS A;  4YB5 A;  1DTZ A;  3PU5 A;  3MZB A;  2DWI A;  2V25 A;  3IR1 A;  3JV9 A;  1II5 A;  4GXS B;  3FXQ A;  2ZZV A;  3G3J A;  1ATG A;  5AE4 A;  4YMA A;  2CZH A;  2HEU A;  1MPD A;  3BFU A;  3T9V A;  1FTA A;  2XXI A;  2Z8E A;  3O66 A;  2D5W A;  4R2F A;  3KN7 A;  5L9M A;  4G8N A;  3IX1 A;  4NAP A;  2Q89 A;  3DM0 A;  3RQT A;  3VXB A;  4HTG A;  3K6U A;  4NF8 A;  1QUK A;  3MVX A;  4C1T A;  1Q9D A;  4AQ4 A;  4LON B;  1JET A;  2Q8J A;  4U22 A;  4I3Y A;  1LCT A;  3IK6 B;  5KCJ B;  3K1P A;  4IO7 A;  3MW0 A;  3B6T A;  4HE2 A;  3BFT A;  2OX3 A;  3RPL B;  4F29 A;  1Y1Z A;  3NOH A;  1MQJ A;  3H03 A;  1IXH A;  2Y5L A;  4EXK A;  1A7L A;  5EYG A;  4MFI A;  3RNN A;  1NV3 A;  2PFZ A;  3KGC A;  4BDO A;  1SYH A;  1YYZ A;  4Z7E A;  4AB6 A;  3C31 A;  3GBB A;  1P1U A;  1Y3P A;  2RIN A;  1LST A;  3HHG A;  1M5E A;  1OVB A;  2WYP A;  1SPI A;  3L6G A;  4GD5 A;  2NWJ A;  4NF4 B;  1POY 1;  5AA2 A;  3LUZ A;  1M5F A;  1R9Q A;  3O28 A;  1SQY A;  4PCD A;  3T22 A;  5EQ8 A;  3WAF A;  5CMK A;  2ZYM A;  2RKM A;  3CR9 A;  2F35 A;  3T1B A;  4DDD A;  1LAF E;  4QRZ A;  4JDF A;  3T9H B;  3I3V A;  4IO2 A;  2Z8D A;  2DVC A;  2CZL A;  1NV7 A;  3KOT A;  2ZYN A;  2CEX A;  3F11 A;  4DXU A;  1MM6 A;  3ZSF A;  1B5J A;  2WBD A;  1DSN A;  3OSQ A;  3IOV A;  4N07 A;  3G7W A;  5H8N A;  3Q27 A;  4I3E A;  3EHT A;  5JTY B;  2QPQ A;  1EYI A;  4R74 A;  1MH4 A;  3BIG A;  4Q5T A;  1VFD A;  1LAG E;  2H25 A;  4YKK A;  2DXY A;  4IGR A;  3OO6 A;  5DVJ A;  2F7A A;  3C4M A;  4GVO A;  2ZZW A;  2FYI A;  4PF6 A;  3CRB A;  4N8Y A;  4JSO A;  2QVR A;  4PFW A;  4XXU A;  3CI8 A;  3SDF A;  2I3V A;  3LBS A;  1O64 A;  3Q26 A;  1BTJ A;  1MDQ A;  3VV5 A;  2WKY A;  4KD5 A;  1TT1 A;  3V5A A;  1ELJ A;  1MM7 A;  2QVV A;  1A54 A;  1LBX A;  5KDT A;  3A3U A;  4F1V A;  4O3A A;  4R75 A;  1EH3 A;  2O1M A;  4G8M A;  4FJP A;  4GQO A;  1LB8 A;  3MWB A;  3RT8 A;  2FHY A;  3TOD A;  1NNP A;  1NUW A;  3R26 A;  3ILT B;  5I59 A;  1GTK A;  3I6V A;  1LLS A;  3O6I A;  5IM2 A;  1EZ9 A;  2B65 A;  4P0I A;  1LB9 A;  2WYK A;  4F1U A;  4GWY A;  3N26 A;  2FIX A;  3ZKK A;  1MG1 A;  3PUZ E;  4NF6 A;  3DP6 A;  4GIZ A;  1RYO A;  4WED A;  4PFI A;  3MUQ A;  3MVW A;  3LSL A;  1Y20 A;  1A55 A;  1UTH B;  2OK2 A;  5FTI A;  1FBF A;  2V84 A;  4PP0 A;  2FBP A;  1MY3 A;  2Z8F A;  1N0T A;  3ISP A;  2XXP A;  3S9L C;  1SBP A;  5BWJ A;  4QFK A;  1CE2 A;  3HST A;  3IFC A;  2I6E A;  2P2A A;  4GLI A;  4KI0 E;  1FPK A;  5AA3 A;  4OER A;  5FHN A;  4O8M A;  3PPO A;  2HZL A;  4H46 A;  5CC2 A;  5JEI A;  4TOZ A;  1KA0 A;  1M5B A;  4AS4 A;  3FVG A;  2OLB A;  2ONK E;  3FD3 A;  3UIF A;  2PVU A;  4AB5 A;  4X1B A;  1RKM A;  2CEY A;  2GHA A;  2Y7W A;  3IB0 A;  2R9J A;  3FAT A;  2O7U A;  1XC1 A;  3EHS A;  2XX9 A;  4MNP A;  5I56 B;  1D9Y A;  5IZ3 B;  3D1R A;  3H06 B;  1VR5 A;  1SVX B;  4MLV A;  4GBW A;  4PBH A;  2B4L A;  4HE0 A;  1VSO A;  1FTJ A;  1JW1 A;  3OD7 A;  3MVZ A;  4KCC A;  4FAJ A;  3RLF E;  2WBB A;  3CHG A;  3K6X A;  4HXV A;  3CSG A;  1MXU A;  3SKP A;  5H8F A;  4JSD A;  2UVG A;  4PGN A;  3SES A;  4RNS A;  4BDQ A;  4F19 A;  4QSE A;  2PT1 A;  5CI5 A;  2XWV A;  5ICQ A;  2I49 A;  4F22 A;  2I3W A;  2M8C A;  4ND9 A;  3UOR A;  1Q35 A;  2Q2C A;  3TFL A;  1IMC A;  1IIT A;  3CG3 A;  5IGA A;  2HPG A;  3O6H A;  2Q88 A;  3C9H A;  3OO7 A;  2DQV A;  5DW8 A;  5I2N B;  1ZTY A;  1JP4 A;  4E0X A;  3HPI A;  2HHM A;  4M1V A;  2I48 A;  1FTK A;  3UP9 A;  2FNC A;  1MQI A;  5H8H A;  4FE8 A;  4KHZ E;  3TCH A;  1D3K A;  4RPO A;  4PE3 A;  4U1O A;  4UA8 A;  3MP8 A;  1B3E A;  1MQG A;  4Q8R A;  3C33 A;  5ET5 A;  2OWT A;  4TQU Q;  4OTE A;  3WAE A;  5TPA A;  3T93 B;  2ZNU A;  5I84 A;  4F3B A;  2B4M A;  2VT5 A;  1B4H A;  4OES A;  1Y1M A;  3TPA A;  4N81 A;  4AS5 A;  2D3I A;  4PAF A;  3N6U A;  4KQP A;  4OFO A;  4HE1 A;  1HSL A;  4F3G A;  2LAO A;  2RC8 A;  2XHD A;  5ITP A;  1SW2 A;  5DVI A;  1UTB A;  4G68 B;  3LV0 A;  1CB6 A;  5IZZ A;  1ZMG A;  2KR0 A;  1YZ0 A;  4XFE A;  3CSB A;  4PF8 A;  1OVT A;  2VGQ A;  3VXC A;  2F36 A;  4PAI A;  3RT6 B;  5LTC A;  4ESX A;  1XT8 A;  2F3B A;  5EQ9 A;  4N6D A;  3RN8 A;  3TCF A;  4ZEK A;  4JWO A;  1GR2 A;  4H8J A;  1FPL A;  4YKJ A;  3TAJ A;  4RY1 A;  2B3B A;  4XTC Q;  1AL3 A;  4JXI A;  1LBW A;  3GBA A;  2RC7 A;  3O2A A;  1JQF A;  5AA4 A;  1PBP A;  1BIY A;  3A29 A;  2I58 A;  4ZED A;  4NF4 A;  2QMW A;  4OWD A;  4N6K A;  1OIB A;  1KA1 A;  4F18 A;  2Q8M A;  3FXR A;  1FBH A;  1P1W A;  4IO4 A;  4LZ8 A;  3KZG A;  3IOW A;  3Q28 A;  4PFT A;  4MJO A;  4YMB A;  1EU8 A;  3RYD A;  4R73 A;  4H8I A;  1IXC A;  4PE5 B;  3TZA A;  4P8B A;  4NWD A;  1B0H A;  4IO3 A;  1QUI A;  1LEV A;  5I57 A;  1FPE A;  1Y3N A;  2AL4 A;  5TP9 B;  2ZYO A;  3RTW B;  1S50 A;  1DTG A;  5H8S A;  1EYJ A;  5A5X A;  4ZS9 A;  3K6V A;  4PET A;  5I2K A;  4OHN A;  4XKQ A;  4XF5 A;  2VPN A;  2REJ A;  1JEV A;  1B7H A;  4GL8 A;  1US4 A;  1URS A;  1WOD A;  3IO6 A;  3QAX A;  5B70 A;  4QFL A;  4NGU A;  4OEV A;  2UYE A;  4LQ5 A;  3IL1 B;  1KZ8 A;  1IMD A;  3B8B A;  4ONY A;  4F2O A;  5HM4 B;  4P11 A;  4E0W A;  1N7W A;  3H3G A;  5A5L A;  5CRY A;  3SEY A;  1DCU A;  3E79 A;  3T66 A;  5H8Q B;  1FPI A;  5I58 B;  5ESY A;  1P99 A;  1QGX A;  3TUS A;  3ILU B;  1IXG A;  3N6T A;  3L6H A;  1LCF A;  2A5T B;  4QXD A;  3KC0 A;  1FBC A;  3RUM A;  4BDM A;  2L5V A;  2PBW A;  2XXT A;  1A8E A;  5L9O A;  3CFL A;  3KBR A;  1DK4 A;  3PPR A;  1BK4 A;  3IOR A;  4H0W A;  1MXY A;  5KZT A;  1LBC A;  3U72 A;  1LBZ A;  2AL5 A;  3EHU A;  4P1L A;  1QW0 A;  2XXY A;  1ZJL A;  5ISU A;  4GX6 A;  1CNQ A;  2PT2 A;  3QSL A;  2DE3 A;  1S9T A;  1IQ7 A;  2THI A;  4WXJ A;  1L5T A;  1XVX A;  3E13 X;  2GRV A;  3MPL A;  4DCY A;  2W7Y A;  2I4C A;  3IJO B;  2VOZ A;  4X8R A;  3U1O A;  2PMS A;  2DOJ A;  2A5S A;  5HBC A;  1FQD A;  3PPN A;  4M4G A;  1NI9 A;  3O97 A;  3MPK A;  3H6V A;  3KJ7 A;  1PEB A;  2YJP A;  1D9Q A;  2O1L A;  2Y7P A;  5B7D A;  2PFY A;  4JVC A;  4LZ7 A;  3FBP A;  4YKP A;  2YLN A;  5EQ7 A;  4P1E A;  3FXU A;  1IXI A;  4KPT A;  3TQW A;  1JNF A;  1MXW A;  2DP8 A;  2NUV A;  3MVY A;  4NF5 B;  1IEJ A;  4GWW A;  3KN8 A;  3LC8 A;  4RK9 A;  3OEK A;  4X48 A;  2UVI A;  3P7I A;  4DI3 D;  2H9B A;  4JWX A;  4O94 A;  4N8G A;  1BP5 A;  3B50 A;  1Z7N E;  1FQC A;  2OWZ A;  1LBY A;  1OLC A;  3MAM A;  5F1Q A;  4X9T A;  2O84 X;  4U1Z A;  4FAT A;  4HCW A;  4OFL A;  4DIG A;  3ROJ A;  3HFU A;  3OMB A;  4YU0 A;  1TXF A;  3FXB A;  1FQF A;  4LUB A;  2G93 A;  1R6Z A;  1SDX A;  4MMP A;  3MJN A;  1QVS A;  4OVS A;  2VHA A;  4GWZ A;  1ZKB A;  1M5D A;  3FJM A;  4R9F A;  1MXZ A;  3JYR A;  4ISU A;  1DMB A;  2UYF A;  3QMF A;  1MH3 A;  3IB2 A;  4PFR A;  4GWU A;  4GWS A;  5J16 A;  4BDN A;  1FJ6 A;  1O7T A;  4MCO A;  2ONS A;  2XWO A;  4PDH A;  5DEX B;  1VE4 A;  2XXQ A;  3HCQ A;  2DWA A;  3PUX E;  1LAH E;  3UA8 A;  1B52 A;  1SW1 A;  3A09 A;  3R7X A;  4P56 A;  4I40 A;  2F6G A;  3KJT A;  5I3S A;  2UXA A;  1FTM A;  4EF1 A;  1P1N A;  4K3F A;  1QKA A;  5LOM A;  1NV2 A;  4R72 A;  3VVF A;  2DE2 A;  2VD2 A;  1FQE A;  2OJT A;  1NUY A;  3LSW A;  1B0L A;  3TYH A;  1H3D A;  4NQ8 A;  4NF8 B;  2RC9 A;  3ZS6 A;  3A3C A;  2Y7R A;  1LBB A;  4YB7 A;  1NUX A;  1NNF A;  3SET A;  2XWI A;  3PUV E;  5FTH A;  1JW5 A;  1B2H A;  3U92 A;  1B1X A;  2QRY A;  1LFH A;  2DS9 A;  3CG1 A;  4ELQ A;  1MY0 A;  4H6D A;  5ICT A;  1B6H A;  4PQJ A;  2QS4 A;  4ESW A;  1PB9 A;  3TTL A;  2XD2 A;  1B05 A;  5CMM A;  4EQB A;  4I62 A;  2Y5K A;  2XXX A;  4U21 A;  3QXM A;  3W9W A;  5T3J A;  2QSX A;  1K9Y A;  1YTV A;  2QVU A;  2BJI A;  3VVE A;  3TKD A;  2F78 A;  3MQ9 A;  4THI A;  3FV1 A;  3H6W A;  3FJ7 A;  4TLM B;  4ZDM A;  5EHM A;  1ZIU A;  4N4U A;  1AWB A;  1MDP 1;  2XXK A;  1FPB A;  1N76 A;  3TTN A;  3Q29 A;  2ZMB A;  4MH5 A;  4QBA A;  1Y4T A;  5L9S A;  4DI4 B;  3QIM A;  1A40 A;  5EQA A;  2NVU B;  5F24 A;  4OVT A;  3MST A;  3OEN A;  4ELP A;  1DOT A;  4PFY A;  1NNK A;  4MNI A;  5I7I A;  4MHF A;  2HXR A;  2PYY A;  4PAK A;  3HHF A;  1I6A A;  3IOU A;  3FAS A;  1URD A;  2HXW A;  2I0B A;  5H8N B;  2X7P A;  2F6P A;  4PFB A;  4ZZA A;  3T9X B;  3T96 B;  3AXF A;  3OEL A;  2AIX A;  1F9B A;  3K6W A;  3MP6 A;  4Q0C A;  5CBR A;  3IO4 A;  5ET6 A;  1Q1K A;  4F39 A;  4GF8 A;  5F7V A;  2XXH A; 
#chains in the Genus database with same CATH homology
 2GH9 A;  3RTF B;  2R6G E;  4FEC A;  3LR1 A;  3VLW A;  3H4Z A;  1ANF A;  2HAU A;  3IJX B;  3Q25 A;  3K1M A;  1MXV A;  3FVO A;  4H1X A;  3H6T A;  4H5F A;  4LVQ A;  3G3F A;  5J1D A;  5KDT B;  2Z23 A;  4EUO A;  3TEP A;  4QFP A;  2RCA A;  1NMU A;  4R6H A;  1TFA A;  4KR5 A;  2F34 A;  3K00 A;  1NKX A;  1B5H A;  1ZBM A;  3TTK A;  3PPQ A;  1NL5 A;  3M3F A;  3QK6 A;  3SEX A;  2IEE A;  1R1N A;  2QMX A;  4MBP A;  1FTL A;  1BKA A;  5I59 B;  5KCJ A;  4XIG Q;  3DLN A;  2QL3 A;  3RGY A;  4GXA A;  3SEU A;  4TLL B;  5DYH A;  3C36 A;  4NF6 B;  4YKI A;  5FHO A;  3U93 A;  5AA1 A;  5BUU A;  1B32 A;  3V8X B;  3M3K A;  4ZEC A;  4OEN A;  5TU0 A;  3K2D A;  4I1D A;  4KCD A;  1XOC A;  4C0R A;  2DXR A;  4O3C A;  3N94 A;  3BBR A;  2Z22 A;  2GFE A;  3B6W A;  1A8F A;  4NMY A;  1LFG A;  4IY6 A;  3DP4 A;  4OYV A;  2I0C A;  3I5O A;  3SEV A;  3DP8 A;  2GHB A;  3S9M C;  3TTR A;  3VDF A;  2BJJ X;  3FVK A;  1B7U A;  4GWO A;  3GXA A;  2QS1 A;  3OSR A;  1ZU0 A;  1GGG A;  4OET A;  4HCY A;  2F5X A;  3PUW E;  4MLQ A;  4ZE8 A;  4DXB A;  2DWH A;  1UIU A;  3K02 A;  3PMX A;  1JVY A;  5JTY A;  4R6Y A;  4GFR A;  1N3W A;  2KLF A;  3FUZ A;  1MY2 A;  1Y9U A;  5H8F B;  3MP1 A;  2OZZ A;  2Y7K A;  3S9N C;  2NOO A;  2RCB A;  2O68 A;  1OQH A;  4G77 A;  4QSC A;  4UAC A;  3OOA A;  2Q2A A;  1MQH A;  1TWY A;  1US5 A;  3K4U A;  4R2B A;  1WDN A;  5DVF A;  1OMP A;  2XD3 A;  3C34 A;  1MPC A;  1JEU A;  3EQ1 A;  4ELO A;  2V3U A;  2XX7 A;  3IB1 A;  1DPE A;  2RF1 A;  5DEX A;  3TTM A;  2HZK A;  1PC3 A;  3O9P A;  1N3X A;  2REG A;  3KSX A;  3H6U A;  4F31 B;  3KG2 A;  1OLA A;  4YZZ A;  5H8H B;  1PB7 A;  2DYX A;  3SEW A;  3E9X A;  4RXL A;  3OO8 A;  1XS5 A;  4YB6 A;  5TPA B;  1B3G A;  3G3G A;  1N84 A;  1MS7 A;  4QFN A;  3ECR A;  4YAH X;  5EHS A;  4GOT A;  4OEU A;  3G3K A;  1MPB A;  4IGT A;  2D21 A;  2NXO A;  1FCK A;  3S2V A;  3O29 A;  5DTB A;  1UTH A;  3VFJ A;  1PB8 A;  3ODB A;  1UTB B;  2OBG A;  4KYS A;  1N04 A;  1YCJ A;  1YPN A;  1URG A;  2QS3 A;  2HFB A;  1QUL A;  3KOS A;  2H99 A;  1DPP A;  1OQG A;  4OXV A;  1B1H A;  4U4X A;  4F3S A;  4KFQ A;  2E0S A;  1H76 A;  3PGF A;  4G8H A;  2XXW A;  4LZ5 A;  1NNT A;  1SI1 A;  5AA4 B;  4WKM A;  4NWC A;  1FQA A;  3U8Q A;  3FIR A;  2XXR A;  5I56 A;  2HQ0 A;  4RYA A;  2XXU A;  4RA1 A;  4QF9 A;  3V89 B;  3HN0 A;  4KYE A;  4KYD A;  1GV8 A;  5L8D A;  2O7I A;  1RYX A;  1P1O A;  4OMB A;  2UVJ A;  1MRP A;  4FEB A;  1R9L A;  4ECF A;  4LA9 A;  3E3K A;  2X7Q A;  1SD3 A;  5I57 B;  3KN3 A;  1XHY A;  4OFJ A;  2ZNS A;  4NE4 A;  3HO7 A;  1FTO A;  4Z0I A;  4XKR A;  5A5X B;  3THI A;  3ONM A;  5M2V A;  1MY4 A;  3GZG A;  4BLA A;  4QFO A;  5I2K B;  2ESN A;  4N13 A;  4R9G A;  4ELR A;  1AOV A;  2P1S A;  2B3F A;  2DE4 A;  1B9J A;  5I2N A;  4F2Q A;  4EQ7 A;  1NH7 A;  3QYT A;  1P1Q A;  4FED A;  2DSF A;  3EN3 A;  3IAZ A;  3R6U A;  4IY5 A;  4LQ2 A;  3RPW A;  1PDA A;  4RJZ A;  4EDP A;  4OVJ A;  1LGB C;  1LAX A;  1MQD A;  1H43 A;  4DCX A;  4WEP A;  4YIC A;  3TCG A;  2X26 A;  1EZP A;  1LFI A;  5ITO A;  3PUY E;  3MZ9 A;  3LSF B;  1FW0 A;  3PV0 E;  4IB2 A;  3FVN A;  4IO5 A;  3OEM A;  3KFM A;  3M8U A;  2OWS A;  3VLV A;  1ZLQ A;  4G68 A;  1FQB A;  1I6B A;  3B6Q A;  3D4C A;  4EF2 A;  4H65 A;  2H5Y A;  4U23 A;  2OCU A;  3EPE A;  4ZEF A;  3CFX A;  3UK4 A;  1WVJ A;  4DXC A;  5ELV A;  4QHQ A;  1H45 A;  2F8D A;  4G68 C;  4RPN A;  5IKB A;  4Q30 B;  3CFZ A;  1B3F A;  5HPQ A;  4XKP A;  4IO6 A;  1XVY A;  1H44 A;  4O3B A;  4HW8 A;  2O69 A;  2ONR A;  1POT A;  3PPP A;  1KWH A;  1AH5 A;  3PMV A;  5AA2 B;  4U4S A;  1A99 A;  3OXN A;  4NED A;  2AYS A;  3K1N A;  3UGW A;  3LUY A;  1O63 A;  5K2Y A;  3W9V A;  4EQ9 A;  2VP1 A;  3GLB A;  4C1U A;  1Y4C A;  1YAE A;  4NTL A;  1S7Y A;  3IOT A;  3TEL A;  3PMW A;  2IA4 A;  3U94 A;  3N5L A;  2ZNT A;  5TP9 A;  5IAI A;  2FA7 A;  4LAT A;  3UN6 A;  1T0K A;  3VLU A;  4GRK A;  4JWY A;  4GL0 A;  1B4Z A;  1TFD A;  3OO9 A;  1SW4 A;  2VD3 A;  1AMF A;  3PD8 A;  2O51 A;  1B3L A;  1SW5 A;  4HS7 A;  2Y84 A;  1HSJ A;  1Y3Q A;  4MF3 A;  1NH8 A;  3C32 A;  2I4B A;  5K2X A;  4F1Y A;  2CMO A;  5AA2 D;  3M3L A;  3K0V A;  3H7M A;  1SI0 A;  3PD9 A;  4U2R A;  4PFU A;  4RK2 A;  1HSE A;  3JZJ A;  2QJE A;  2XXV A;  4H67 A;  4JB7 A;  5H8Q A;  4G4P A;  5I58 A;  1IZ1 A;  1USY H;  2QS2 A;  2V3Q A;  4FIM A;  4P0G A;  2A5T A;  1IUD A;  3BKI B;  2Y7I A;  1D4N A;  4POX A;  1MY1 A;  2HAV A;  2O6A A;  2H4I A;  3G3H A;  1QKB A;  2ABH A;  4OZ9 A;  4DLD A;  4XKN A;  3MC2 A;  1UIV A;  4R6K A;  2ZXT A;  3B7D A;  2F7B A;  3USD A;  1D9V A;  2ALU A;  2F7C A;  1N7X A;  1I6Q A;  4G2Z A;  1AIV A;  1EZO A;  3RY3 A;  4X1D A;  2ANJ A;  3CIJ A;  1SYI A;  4I8C A;  2H98 A;  4I9D A;  3TMG A;  2P0S A;  2DVZ A;  5EYF A;  1B40 A;  3KSJ A;  1B46 A;  3MBP A;  3TDJ A;  2YPN A;  1BLF A;  5CMB A;  1QJM A;  1JW4 A;  4F3P A;  3DEL B;  2PX1 A;  2Q9T A;  3K01 A;  1B3H A;  3G3I A;  3O6G A;  2HCA A;  1M5C A;  4H5G A;  1GVC A;  2DWJ A;  4NF5 A;  4QSD A;  1USY E;  5DT6 A;  1JVX A;  1PBQ A;  3V83 A;  1IIW A;  1B58 A;  1J1N A;  4ZEI A;  3C35 A;  3T9U A;  3LSX A;  1I69 A;  2UVH A;  3FGS A;  5JK4 A;  3ZKL A;  4N6P A;  4DZ1 A;  3S9E A;  3HV1 A;  4OQO A;  4LP2 B;  3TQL A;  3QUF A;  2XX8 A;  3VE1 B;  1QUJ A;  4ZEB A;  4DE8 A;  5CMC A;  3FJG A;  4BDL A;  4BDR A;  3D4G A;  5FHM A;  2V93 A;  4JBZ A;  1NFT A;  3SER A;  4ZE9 A;  3KEI A;  3MZ1 A;  2G29 A;  2V3T A;  1UQW A;  3W15 C;  3E4R A;  1Z7M E;  2R71 A;  5CM6 A;  3CVG A;  3FV2 A;  3S4U A;  4L17 A;  1B7Z A;  3QUJ A;  1B51 A;  4FOR A;  3EF7 A;  1MXX A;  2ZYK A;  4EXL A;  2E1S A;  2F97 A;  3FZV A;  3VVD A;  4ZZE A;  1B5I A;  1VFE A;  4POW A;  5CBS A;  4YB5 A;  1DTZ A;  3PU5 A;  3MZB A;  2DWI A;  2V25 A;  3IR1 A;  3JV9 A;  1II5 A;  4GXS B;  3FXQ A;  3G3J A;  1ATG A;  5AE4 A;  4YMA A;  2HEU A;  1MPD A;  3BFU A;  3T9V A;  2XXI A;  2Z8E A;  3O66 A;  2D5W A;  4R2F A;  3KN7 A;  5L9M A;  4G8N A;  3IX1 A;  2Q89 A;  3DM0 A;  3RQT A;  3VXB A;  4HTG A;  3K6U A;  4NF8 A;  1QUK A;  3MVX A;  4C1T A;  4AQ4 A;  4LON B;  1JET A;  2Q8J A;  4U22 A;  1LCT A;  3IK6 B;  5KCJ B;  3K1P A;  4IO7 A;  3MW0 A;  3B6T A;  3BFT A;  4F29 A;  1Y1Z A;  1MQJ A;  3H03 A;  1IXH A;  4EXK A;  1A7L A;  4MFI A;  3RNN A;  3KGC A;  4BDO A;  1SYH A;  4Z7E A;  4AB6 A;  3C31 A;  3GBB A;  1P1U A;  1Y3P A;  2RIN A;  1LST A;  3HHG A;  1M5E A;  1OVB A;  3L6G A;  4GD5 A;  2NWJ A;  4NF4 B;  1POY 1;  5AA2 A;  1M5F A;  1R9Q A;  3O28 A;  1SQY A;  3T22 A;  3WAF A;  5CMK A;  2ZYM A;  2RKM A;  3CR9 A;  2F35 A;  4DDD A;  1LAF E;  4QRZ A;  4JDF A;  3T9H B;  3I3V A;  4IO2 A;  2Z8D A;  2DVC A;  2CZL A;  3KOT A;  2ZYN A;  3F11 A;  4DXU A;  1MM6 A;  3ZSF A;  1B5J A;  1DSN A;  3OSQ A;  3IOV A;  4N07 A;  3G7W A;  5H8N A;  3Q27 A;  3EHT A;  5JTY B;  2QPQ A;  4R74 A;  1MH4 A;  4Q5T A;  1VFD A;  1LAG E;  2H25 A;  4YKK A;  2DXY A;  4IGR A;  3OO6 A;  5DVJ A;  2F7A A;  3C4M A;  4GVO A;  2FYI A;  3CRB A;  4JSO A;  4PFW A;  4XXU A;  3CI8 A;  3SDF A;  2I3V A;  3LBS A;  1O64 A;  3Q26 A;  1BTJ A;  1MDQ A;  3VV5 A;  2WKY A;  4KD5 A;  1TT1 A;  3V5A A;  1ELJ A;  1MM7 A;  1A54 A;  5KDT A;  3A3U A;  4F1V A;  4O3A A;  4R75 A;  1EH3 A;  2O1M A;  4G8M A;  4FJP A;  4GQO A;  1LB8 A;  3MWB A;  3RT8 A;  3TOD A;  1NNP A;  3R26 A;  3ILT B;  5I59 A;  1GTK A;  3I6V A;  1LLS A;  3O6I A;  1EZ9 A;  2B65 A;  4P0I A;  1LB9 A;  4F1U A;  3N26 A;  3ZKK A;  1MG1 A;  3PUZ E;  4NF6 A;  3DP6 A;  4GIZ A;  1RYO A;  4WED A;  3MUQ A;  3MVW A;  3LSL A;  1Y20 A;  1A55 A;  1UTH B;  2OK2 A;  5FTI A;  2V84 A;  4PP0 A;  1MY3 A;  2Z8F A;  1N0T A;  2XXP A;  3S9L C;  1SBP A;  5BWJ A;  4QFK A;  1CE2 A;  3HST A;  2I6E A;  2P2A A;  4GLI A;  4KI0 E;  5AA3 A;  4OER A;  5FHN A;  3PPO A;  2HZL A;  5CC2 A;  5JEI A;  4TOZ A;  1M5B A;  3FVG A;  2OLB A;  2ONK E;  3FD3 A;  3UIF A;  2PVU A;  4AB5 A;  4X1B A;  1RKM A;  2GHA A;  2Y7W A;  3IB0 A;  2R9J A;  3FAT A;  2O7U A;  1XC1 A;  3EHS A;  2XX9 A;  5I56 B;  1D9Y A;  3H06 B;  1VR5 A;  1SVX B;  4MLV A;  1VSO A;  1FTJ A;  1JW1 A;  3OD7 A;  3MVZ A;  4KCC A;  4FAJ A;  3RLF E;  3K6X A;  3CSG A;  1MXU A;  3SKP A;  5H8F A;  4JSD A;  2UVG A;  3SES A;  4RNS A;  4BDQ A;  4F19 A;  4QSE A;  2PT1 A;  5CI5 A;  5ICQ A;  2I49 A;  4F22 A;  2I3W A;  2M8C A;  4ND9 A;  3UOR A;  1Q35 A;  2Q2C A;  3TFL A;  1IIT A;  3CG3 A;  3O6H A;  2Q88 A;  3C9H A;  3OO7 A;  2DQV A;  5I2N B;  1ZTY A;  4E0X A;  3HPI A;  4M1V A;  2I48 A;  1FTK A;  3UP9 A;  2FNC A;  1MQI A;  5H8H A;  4FE8 A;  4KHZ E;  3TCH A;  1D3K A;  4RPO A;  4U1O A;  4UA8 A;  3MP8 A;  1B3E A;  1MQG A;  4Q8R A;  3C33 A;  2OWT A;  4TQU Q;  4OTE A;  3WAE A;  5TPA A;  3T93 B;  2ZNU A;  5I84 A;  4F3B A;  1B4H A;  4OES A;  1Y1M A;  3TPA A;  2D3I A;  3N6U A;  4KQP A;  4OFO A;  1HSL A;  4F3G A;  2LAO A;  2RC8 A;  2XHD A;  5ITP A;  1SW2 A;  5DVI A;  1UTB A;  4G68 B;  1CB6 A;  1ZMG A;  3CSB A;  1OVT A;  2VGQ A;  3VXC A;  2F36 A;  3RT6 B;  4ESX A;  1XT8 A;  3RN8 A;  3TCF A;  4ZEK A;  4JWO A;  1GR2 A;  4H8J A;  4YKJ A;  3TAJ A;  4RY1 A;  2B3B A;  4XTC Q;  1AL3 A;  4JXI A;  3GBA A;  2RC7 A;  3O2A A;  1JQF A;  5AA4 A;  1PBP A;  1BIY A;  4ZED A;  2I58 A;  4NF4 A;  2QMW A;  4OWD A;  1OIB A;  4F18 A;  3FXR A;  1P1W A;  4IO4 A;  4LZ8 A;  3KZG A;  3IOW A;  3Q28 A;  4PFT A;  4YMB A;  1EU8 A;  4R73 A;  4H8I A;  1IXC A;  4PE5 B;  3TZA A;  4NWD A;  1B0H A;  4IO3 A;  1QUI A;  5I57 A;  1Y3N A;  2AL4 A;  5TP9 B;  2ZYO A;  3RTW B;  1S50 A;  1DTG A;  5H8S A;  5A5X A;  4ZS9 A;  3K6V A;  4PET A;  5I2K A;  4OHN A;  4XKQ A;  2REJ A;  1JEV A;  1B7H A;  4GL8 A;  1US4 A;  1URS A;  1WOD A;  3IO6 A;  3QAX A;  5B70 A;  4QFL A;  4OEV A;  2UYE A;  4LQ5 A;  3IL1 B;  4ONY A;  4F2O A;  5HM4 B;  4P11 A;  4E0W A;  1N7W A;  3H3G A;  5CRY A;  3SEY A;  3T66 A;  5H8Q B;  5I58 B;  1P99 A;  3TUS A;  3ILU B;  1IXG A;  3N6T A;  3L6H A;  1LCF A;  2A5T B;  3RUM A;  4BDM A;  2PBW A;  2XXT A;  1A8E A;  5L9O A;  3CFL A;  3KBR A;  3PPR A;  3IOR A;  4H0W A;  1MXY A;  5KZT A;  1LBC A;  3U72 A;  2AL5 A;  3EHU A;  1QW0 A;  2XXY A;  1ZJL A;  5ISU A;  2PT2 A;  3QSL A;  2DE3 A;  1S9T A;  1IQ7 A;  2THI A;  4WXJ A;  1L5T A;  1XVX A;  3E13 X;  2GRV A;  3MPL A;  4DCY A;  2W7Y A;  2I4C A;  3IJO B;  2VOZ A;  3U1O A;  2PMS A;  2DOJ A;  2A5S A;  5HBC A;  1FQD A;  3PPN A;  4M4G A;  3O97 A;  3MPK A;  3H6V A;  3KJ7 A;  1PEB A;  2YJP A;  2O1L A;  2Y7P A;  5B7D A;  4LZ7 A;  4YKP A;  2YLN A;  3FXU A;  1IXI A;  4KPT A;  3TQW A;  1JNF A;  1MXW A;  2DP8 A;  2NUV A;  3MVY A;  4NF5 B;  1IEJ A;  3KN8 A;  3LC8 A;  4RK9 A;  3OEK A;  4X48 A;  2UVI A;  3P7I A;  2H9B A;  4JWX A;  1BP5 A;  1Z7N E;  1FQC A;  1OLC A;  3MAM A;  5F1Q A;  4X9T A;  2O84 X;  4U1Z A;  4FAT A;  4HCW A;  4OFL A;  4DIG A;  3OMB A;  4YU0 A;  1TXF A;  1FQF A;  4LUB A;  2G93 A;  1R6Z A;  1SDX A;  3MJN A;  1QVS A;  2VHA A;  1ZKB A;  1M5D A;  3FJM A;  4R9F A;  1MXZ A;  3JYR A;  4ISU A;  1DMB A;  2UYF A;  1MH3 A;  3IB2 A;  4BDN A;  1O7T A;  2ONS A;  5DEX B;  1VE4 A;  2XXQ A;  3HCQ A;  2DWA A;  3PUX E;  1LAH E;  3UA8 A;  1B52 A;  1SW1 A;  3A09 A;  3R7X A;  2F6G A;  3KJT A;  2UXA A;  1FTM A;  4EF1 A;  1P1N A;  4K3F A;  1QKA A;  5LOM A;  4R72 A;  3VVF A;  2DE2 A;  2VD2 A;  1FQE A;  2OJT A;  3LSW A;  1B0L A;  3TYH A;  1H3D A;  4NF8 B;  2RC9 A;  3ZS6 A;  3A3C A;  2Y7R A;  1LBB A;  4YB7 A;  1NNF A;  3SET A;  3PUV E;  5FTH A;  1JW5 A;  1B2H A;  3U92 A;  1B1X A;  2QRY A;  1LFH A;  2DS9 A;  3CG1 A;  4ELQ A;  1MY0 A;  4H6D A;  5ICT A;  1B6H A;  4PQJ A;  2QS4 A;  4ESW A;  1PB9 A;  3TTL A;  2XD2 A;  1B05 A;  5CMM A;  4EQB A;  4I62 A;  2XXX A;  4U21 A;  3QXM A;  3W9W A;  2QSX A;  1YTV A;  3VVE A;  3TKD A;  2F78 A;  3MQ9 A;  4THI A;  3FV1 A;  3H6W A;  3FJ7 A;  4TLM B;  4ZDM A;  5EHM A;  1ZIU A;  1MDP 1;  1N76 A;  3TTN A;  3Q29 A;  2ZMB A;  4MH5 A;  1Y4T A;  5L9S A;  3QIM A;  1A40 A;  2NVU B;  3OEN A;  4ELP A;  1DOT A;  4PFY A;  1NNK A;  2PYY A;  3HHF A;  1I6A A;  3IOU A;  3FAS A;  1URD A;  2HXW A;  2I0B A;  5H8N B;  2X7P A;  2F6P A;  4ZZA A;  3T9X B;  3T96 B;  3AXF A;  3OEL A;  2AIX A;  1F9B A;  3K6W A;  3MP6 A;  4Q0C A;  5CBR A;  3IO4 A;  1Q1K A;  4F39 A;  4GF8 A;  5F7V A;  2XXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...