3VVDA

Crystal structure of ttc0807 complexed with ornithine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
241
structure length
241
Chain Sequence
GGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two ATP-Binding Cassette Transporters Involved in (S)-2-Aminoethyl-Cysteine Uptake in Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, binding protein
total genus 89
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvdA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvdA02
3GZGA 3KJTA 4F3SA 3VXCA 4RXLA 3ZKKA 2ZMBA 1FW0A 1UQWA 1TWYA 3HSTA 4LA9A 4KHZE 4R6YA 5TU0A 3W9VA 4IO2A 2Q89A 4GXAA 4EXKA 3W9WA 5AE4A 3MP1A 1JW4A 3H6TA 3OO8A 3HHGA 4N6PA 4H65A 4OFLA 4G8HA 3QSLA 3L6GA 4G77A 2F5XA 1AIVA 1SQYA 3KG2A 3S9MC 3TZAA 1B58A 2DWIA 3OD7A 3MZ9A 1PBQA 1POTA 1VSOA 1GV8A 1UTHA 4JB7A 1QUJA 1JW5A 1UTBA 1A55A 1Y3QA 2XXXA 1OQHA 2RC9A 4LONB 5DVJA 2B3BA 1MY3A 1O64A 4MLQA 2A5SA 1N3XA 1BIYA 1SW4A 2W7YA 3LSFB 1XOCA 2H98A 2XXYA 4PFUA 5EYFA 2V3QA 1XS5A 3SEXA 3TYHA 4G8NA 3FJ7A 4OFJA 2OK2A 4QFLA 4R9FA 3THIA 1EH3A 5H8FA 3EHUA 4QRZA 3VFJA 1MY1A 4G68A 3K1MA 4P0IA 3PPOA 3MVWA 1XHYA 3DP4A 3UA8A 3GXAA 2OJTA 4OESA 1MXYA 4PETA 4OVJA 1SD3A 2H9BA 1LCFA 4KFQA 4QFNA 3TTNA 4NTLA 3U72A 1IXIA 4QSDA 4JSDA 1YPNA 3M3KA 3IO4A 5ITOA 3PMVA 4KCCA 3H03A 1QKBA 3G7WA 1TT1A 4GLIA 4UA8A 3HO7A 3SESA 3EF7A 2VOZA 4IO5A 2ZNTA 2QMXA 2A5TA 1FTLA 4OZ9A 4IY5A 1ZIUA 1B5HA 2AIXA 5JTYA 1SYIA 3WAEA 3AXFA 3E4RA 3O9PA 3MWBA 4G68C 4YAHX 1L5TA 4FAJA 3S9EA 3FATA 4RYAA 4U2RA 3IOWA 2OCUA 1Q35A 3UIFA 1NNKA 2O1LA 5JTYB 5TP9A 1N7XA 1A40A 2DE2A 3K4UA 5FTIA 2M8CA 3FJMA 4GD5A 2PX1A 1Y9UA 5F7VA 3UORA 4ZECA 4ZEDA 1MXUA 1JEUA 1N0TA 3LUYA 4ONYA 3VDFA 5AA3A 3HN0A 4LUBA 3F11A 1MH3A 2F36A 1P1UA 3C35A 4JSOA 3KSXA 5KDTB 3DLNA 3RN8A 3K2DA 3ILTB 3MP8A 1MXWA 3I5OA 4TQUQ 4NF8B 2V84A 5H8QA 2XXPA 4F2QA 5I58A 2DSFA 3CVGA 3PPRA 3QYTA 2H25A 1MRPA 3O6IA 4GL0A 4XKPA 4BDNA 5ICQA 4OHNA 2RC8A 4AB5A 3CR9A 3K01A 3KJ7A 2ONRA 2RC7A 4U1OA 1P1QA 4GFRA 2UVGA 1ZU0A 3MP6A 4FORA 4IO6A 1URDA 5CBRA 1YTVA 3HHFA 4AQ4A 5I56B 3R26A 4KI0E 1US5A 4EXLA 5AA2A 4U4SA 1SI0A 2I4CA 1B2HA 4THIA 4PFWA 2NWJA 3Q26A 2X26A 4N13A 2B3FA 4RPOA 2F97A 1B3LA 4X1DA 1B3EA 3MC2A 4OENA 4RPNA 4MBPA 1LAXA 4F2OA 1A7LA 1R1NA 3C32A 3KN8A 2P1SA 3MUQA 5EHMA 4G68B 3CI8A 3RPWA 1M5EA 4R75A 5HPQA 4I62A 4BDLA 3FVNA 3PUZE 2Y7IA 1M5DA 4FEBA 4NWCA 5LOMA 2ESNA 1LSTA 4KCDA 2PMSA 2V3UA 3RLFE 4NF4A 1B5IA 5JEIA 3Q25A 5I2KB 1MXVA 1IQ7A 1ATGA 3C31A 3C4MA 1LB8A 3PPQA 4F1YA 1AL3A 5I57A 1GTKA 3C36A 1MQHA 3KFMA 3UGWA 4ELPA 1NNPA 1UTHB 2NVUB 1JNFA 3SEVA 1SI1A 5I2KA 4QFPA 4TLLB 4HS7A 3LR1A 4NF4B 2DWHA 3P7IA 4OTEA 4YB5A 5F1QA 4EF2A 3MVZA 4PFTA 2HXWA 3JZJA 4XTCQ 4ZEFA 5A5XA 1US4A 2I6EA 2QL3A 3MZBA 3TCFA 1OLCA 1QJMA 3K1PA 5HBCA 2ZYNA 2GH9A 3N6UA 2B65A 3E9XA 3FD3A 4ZS9A 3FV2A 3UN6A 1I6BA 3VXBA 3O6GA 4H8JA 2YLNA 2GHAA 3MJNA 3ONMA 3PV0E 1MPCA 1LB9A 4JWOA 1Y4CA 3EHTA 3V83A 1RYOA 2Q88A 4H1XA 4R9GA 3C9HA 4F3BA 4F19A 1ELJA 2AL4A 4H5FA 1MY4A 3VVEA 1PBPA 2VD3A 4E0XA 1IIWA 2REJA 3FV1A 3N5LA 4F39A 5AA2B 4U23A 2LAOA 2I49A 5ELVA 2O69A 4PE5B 3QXMA 1IUDA 4FEDA 4NE4A 4EF1A 2DXYA 1DOTA 5AA4B 3OEMA 1S50A 4NF6B 1MPDA 4BDRA 4FIMA 1R9LA 3IJOB 3TUSA 3LSWA 1FCKA 3EN3A 2H99A 3USDA 3IO6A 1AOVA 1B7ZA 1Z7NE 1B3HA 1FQEA 1TFDA 2ABHA 4R2BA 1H76A 2E0SA 5H8SA 3K6UA 2HZKA 4OEUA 3RT8A 2XHDA 3OSQA 2H5YA 3SERA 3G3IA 4GQOA 4GXSB 3K00A 1SDXA 5H8NA 4F1UA 5I2NA 3L6HA 3MPLA 3CFXA 4Q30B 1BP5A 3TFLA 3VVFA 3QUFA 3U94A 2V3TA 4X9TA 4XKQA 1QUKA 3PUWE 2ZYOA 1LFGA 3TPAA 2HCAA 1JQFA 4RK9A 3TTKA 1D9YA 1WDNA 3Q28A 2PVUA 4DE8A 4KQPA 1DTGA 1MQJA 2REGA 3H06B 3O28A 4NF8A 5KCJB 3GBBA 3HV1A 1VFEA 4FE8A 4NWDA 1LCTA 2DXRA 2GHBA 4G8MA 2V25A 4ZDMA 3O66A 3VVDA 1DPPA 1NFTA 2VHAA 1N84A 2XXVA 4QSCA 1P1NA 1URGA 4RY1A 4M1VA 1WODA 1ZKBA 4R6KA 3RUMA 4YB6A 5TPAA 5I2NB 1VE4A 3OO6A 4LQ5A 2Z8DA 1KWHA 3TCGA 4MLVA 2UXAA 1Z7ME 3H3GA 3KEIA 1POY1 3MQ9A 4U1ZA 4BDQA 1JVYA 1MPBA 1JETA 1BKAA 1A8FA 3IL1B 4K3FA 2RCBA 2XXHA 3BFUA 5KCJA 2X7QA 1NMUA 3RNNA 2VD2A 4NMYA 3OOAA 2XD3A 4MFIA 1MQGA 2CZLA 4IGTA 1MXZA 3SKPA 5CC2A 5ISUA 5FTHA 1QVSA 4ZE9A 3H4ZA 4NF6A 1ZLQA 2PBWA 2V93A 2GRVA 2PT1A 3SETA 3KZGA 5AA4A 5JK4A 4M4GA 3IR1A 2ZXTA 1FTKA 3OXNA 3K02A 3LBSA 4L17A 1B4ZA 1JW1A 4FATA 3M3FA 3RTFB 5L8DA 3U92A 5AA2D 3PPNA 2DWAA 3E3KA 3D4CA 3IB2A 3K0VA 2KLFA 4XKRA 3G3HA 5AA1A 3IOVA 5CI5A 2F78A 4DDDA 2DS9A 1LBBA 1SYHA 2XX9A 2HAVA 1OLAA 4OQOA 2NOOA 4F3PA 2I3WA 1H3DA 4X1BA 2D5WA 3ZS6A 2THIA 1MQIA 1FTMA 1FQDA 2R71A 2OLBA 4DZ1A 3TEPA 1ANFA 1ZBMA 2XXQA 3BBRA 3DM0A 4G2ZA 1PDAA 3T9UA 1NH8A 5H8FB 4F29A 1H44A 1BTJA 1MDQA 3EQ1A 4WEPA 5I58B 5B7DA 1VFDA 3A3CA 1FTJA 1YAEA 3SEUA 1TFAA 1FTOA 2I58A 3CG1A 4ZEIA 2CMOA 4OETA 3TODA 2Y7KA 3OEKA 4YU0A 1H43A 4R2FA 3GLBA 1NNTA 2DYXA 4QHQA 5BWJA 1PEBA 1J1NA 3UK4A 1PB7A 1B7HA 3QIMA 3MVXA 1SVXB 5DVIA 2OBGA 1D3KA 4LQ2A 3TMGA 4JDFA 3UP9A 3I3VA 4ELRA 4EUOA 1LFHA 3N26A 2F7CA 3MVYA 5CRYA 4ZZEA 1FQAA 1FQBA 3CFLA 5FHNA 1UIVA 3BKIB 3S9LC 3VLWA 2P2AA 1DTZA 2PYYA 3EPEA 4ISUA 5CMMA 2XXUA 3RQTA 3U1OA 4E0WA 1LLSA 2UVHA 1T0KA 3B6WA 3KN7A 3IOTA 4YB7A 1M5FA 3G3JA 2QS4A 3O2AA 1B05A 1EZPA 3IOUA 1B1XA 1LGBC 4OWDA 5I56A 1Y4TA 4Q0CA 5L9MA 4Q8RA 1NL5A 1I69A 3RY3A 1MY0A 4JWYA 1NH7A 5CM6A 4C0RA 1FQCA 2R6GE 1Y1MA 3MW0A 4ZEKA 5K2YA 4OERA 3RGYA 3FUZA 2Z23A 4GIZA 5I59B 3BFTA 1NKXA 2QS2A 1LFIA 3ILUB 3QK6A 4RA1A 1JEVA 1I6AA 1ZTYA 4HTGA 3IX1A 3DP8A 4Z7EA 1YCJA 3LC8A 4FJPA 3KSJA 4LVQA 2AYSA 1MH4A 1ZMGA 2DE4A 2UYFA 2IA4A 4H67A 3H6VA 4H0WA 4RNSA 3SDFA 2I0CA 4KPTA 4NEDA 4QFKA 1B7UA 5B70A 3K6WA 4GOTA 4JWXA 1OVBA 4KR5A 1JVXA 2DWJA 4YMAA 1BLFA 4GL8A 5TP9B 1USYE 4LZ5A 2F35A 1B46A 1B6HA 3FXQA 4JBZA 3VV5A 3S2VA 4C1UA 3T9HB 1QKAA 4LZ7A 4IY6A 5I84A 2OZZA 3H6UA 4FECA 1B3GA 2ONKE 2QJEA 3R6UA 4WEDA 2ONSA 2BJJX 3KN3A 4XIGQ 4F1VA 2G29A 5DEXA 4WXJA 4AB6A 2Q9TA 3TAJA 4R72A 1XVYA 2FA7A 3RTWB 3T22A 3PMWA 3CSGA 5DTBA 1MY2A 3K6XA 1GVCA 4IO7A 1B4HA 4QFOA 1B51A 3IB1A 3E13X 4C1TA 3G3GA 2UYEA 1MM6A 3JV9A 1O63A 3IORA 4U21A 2HQ0A 3FXUA 2RF1A 1F9BA 4YKKA 2Q8JA 2O68A 1DPEA 2R9JA 5CMBA 1Y3PA 3OMBA 3T96B 3U8QA 4F31B 1B1HA 4IB2A 1IXHA 2XXRA 1QW0A 3JYRA 4QF9A 3VE1B 4DIGA 3IB0A 2D21A 4ZZAA 5ICTA 3CRBA 3LSLA 4Q5TA 2DOJA 1XC1A 1R9QA 3C33A 2NUVA 4OXVA 3M3LA 5KZTA 2WKYA 4P11A 4R73A 3TQLA 1GGGA 4LATA 4OYVA 1OVTA 1D9VA 2Y84A 5ITPA 4POWA 1VR5A 4YZZA 1B32A 2HFBA 4BDOA 5I59A 2QSXA 2ZNUA 4WKMA 5IKBA 1B52A 1EU8A 3FXRA 1B0LA 3MPKA 2DE3A 1M5CA 2DP8A 3WAFA 3V89B 3I6VA 1I6QA 2F6PA 1ZJLA 3Q29A 4GVOA 4EDPA 1OQGA 3MBPA 4BLAA 1P1WA 1RKMA 4F22A 4I1DA 3H7MA 4H8IA 4DCXA 3DELB 2O51A 2F34A 3ZKLA 1EZ9A 3PUYE 1MDP1 4ELOA 5A5XB 2XX7A 4G4PA 4DCYA 1B0HA 4OFOA 2Y7RA 1MQDA 5DYHA 3O6HA 4YKPA 1MG1A 1B5JA 1SW2A 3KGCA 4ESXA 3TCHA 1UTBB 1XVXA 3DP6A 2F8DA 3ODBA 4O3AA 2D3IA 2DVZA 1Y20A 5CMCA 5K2XA 3SEWA 4I9DA 4HCWA 4YKIA 3VLUA 2ZYKA 4U22A 1GR2A 1AH5A 4R6HA 3PU5A 4GRKA 3IAZA 2PT2A 2I3VA 1N7WA 2O7IA 1MM7A 3N6TA 2Y7PA 1A99A 4KYDA 4TLMB 2O84X 3K1NA 2I48A 2RINA 1AMFA 3TELA 1B9JA 4RJZA 3KBRA 3QUJA 3D4GA 2FNCA 3B7DA 4O3CA 1A54A 1D4NA 4ZE8A 4KYSA 1S7YA 5DT6A 3S4UA 2O6AA 2QS3A 4KYEA 4I8CA 3T9XB 3VLVA 2VGQA 4ESWA 5I57B 3TTRA 2QPQA 4P0GA 3FIRA 4RK2A 5L9SA 3TTLA 1QUIA 3S9NC 1CB6A 1R6ZA 4EQBA 2DVCA 2XXWA 3T93B 3FVKA 1HSJA 1IXCA 5FHMA 2OWSA 1PB8A 3FVGA 3B6TA 1LBCA 2QS1A 3CG3A 3PUXE 1HSLA 5M2VA 3TQWA 4ELQA 2G93A 1OIBA 5FHOA 3M8UA 2XXIA 1MXXA 4XXUA 4Z0IA 2ZNSA 1NNFA 4HCYA 1MS7A 4PFYA 3H6WA 2IEEA 1LAFE 3W15C 2RKMA 4HW8A 4JXIA 4IO4A 4MF3A 4GF8A 4NF5B 2ANJA 1II5A 2I4BA 4EQ9A 3OO7A 3PGFA 4TOZA 3G3FA 2O1MA 3FZVA 1N76A 3QAXA 3N94A 3K6VA 4U4XA 4DLDA 1P99A 1SBPA 1DSNA 4R74A 5HM4B 1EZOA 2I0BA 2ALUA 2E1SA 2XX8A 1TXFA 4LP2B 1B40A 3LSXA 1H45A 3O29A 2UVJA 4GWOA 4BDMA 5H8HA 1DMBA 2OWTA 3ECRA 3PD9A 2HEUA 5H8QB 3T66A 4DXUA 4F3GA 2NXOA 2AL5A 2HZLA 1IEJA 2QMWA 3CSBA 3FGSA 2ZYMA 4OEVA 4XKNA 3FVOA 3HCQA 4OMBA 4IO3A 4X48A 3SEYA 3IK6B 1B3FA 2DQVA 1A8EA 2YJPA 5KDTA 3FJGA 1LAGE 1Y1ZA 2F7BA 2YPNA 3OELA 3ZSFA 5TPAB 4ECFA 3TTMA 4YMBA 3TKDA 3GBAA 3TDJA 1WVJA 4H5GA 5H8NB 5IAIA 5DEXB 1HSEA 1IXGA 1SW1A 1SW5A 2UVIA 1XT8A 1O7TA 3PUVE 3G3KA 4N07A 4PQJA 5EHSA 4ZEBA 4F18A 5CBSA 3OENA 4LZ8A 2FYIA 4MH5A 4ND9A 2F7AA 1N04A 3CFZA 4QSEA 5H8HB 3T9VA 2RCAA 4IGRA 1USYH 1URSA 5DVFA 3IJXB 2XD2A 3MAMA 3PD8A 1P1OA 4KD5A 2XXTA 1M5BA 2A5TB 3A09A 3B6QA 3CIJA 1Q1KA 2Z22A 3A3UA 3O97A 3V5AA 5BUUA 5CMKA 2F6GA 2Y7WA 2X7PA 2H4IA 3R7XA 3U93A 4NF5A 4H6DA 1IITA 3C34A 4YKJA 5L9OA 2GFEA 1RYXA 4YICA 3V8XB 2Q2AA 4EQ7A 1IZ1A 1FQFA 2VP1A 5J1DA 1LAHE 3KOSA 1N3WA 4O3BA 3HPIA 2Z8EA 2O7UA 4PP0A 4UACA 1OMPA 4DXBA 1CE2A 3KOTA 3PPPA 1S9TA 3EHSA 3PMXA 3OSRA 3Q27A 3FASA 2Q2CA 3OO9A 1PB9A 1PC3A 1QULA 2QRYA 3MZ1A 4POXA 1UIUA 3RT6B 4DXCA 2P0SA 1Y3NA 2HAUA 2Z8FA
chains in the Genus database with same CATH superfamily
4PFBA 3ZKKA 4KHZE 5TU0A 3W9VA 4GXAA 4OA4A 3OO8A 4N6PA 3HHGA 4G77A 4NHBA 4DI3D 3TZAA 1NV5A 1PBQA 5DVJA 4NQ8A 5EQAA 1XS5A 5H8FA 2WX9A 3EHUA 5J16A 4PETA 1SD3A 1LCFA 2B4MA 4KFQA 4NTLA 4QSDA 1YPNA 3M3KA 3IO4A 5ITOA 3H03A 2VOZA 2ZNTA 2A5TA 1FTLA 2AIXA 4AS5A 3E4RA 3MWBA 3S9EA 3FATA 4U2RA 2O1LA 4PGNA 1A40A 2DE2A 4OANA 3FJMA 4GWSA 3UORA 1JEUA 3VDFA 5AA3A 3F11A 3C35A 2F36A 1P1UA 3KSXA 1KA1A 3MP8A 2V84A 5I58A 3ROJA 3CVGA 4BDNA 3QYTA 4XKPA 3CR9A 4GFRA 3MP6A 5CBRA 1URDA 4AQ4A 4THIA 2NWJA 4N13A 2B3FA 1B3LA 1B3EA 1A7LA 1R1NA 3KN8A 2P1SA 5EHMA 3FVNA 2Y7IA 4NWCA 3E78A 1LSTA 3RLFE 1MXVA 3C4MA 4F1YA 5I7IA 5I57A 1XI6A 1NNPA 1SI1A 4HS7A 4NF4B 3P7IA 5F1QA 4XEQA 1US4A 1QJMA 5HBCA 3UN6A 2YLNA 2GHAA 3ONMA 3LV0A 3EHTA 4R9GA 4H5FA 2REJA 2LAOA 4FEDA 1DOTA 3OEMA 4BDRA 3IJOB 1AOVA 1K9YA 1FQEA 2ABHA 2E0SA 3K6UA 2HZKA 5LDZA 2XA5A 4GXSB 5I2NA 4Q30B 3U94A 2ZYOA 3TPAA 1JQFA 3TTKA 4N17A 4NF8A 4P47A 5KCJB 3GBBA 4NWDA 4PGPA 3EKIA 2GHBA 3O66A 1DPPA 1NFTA 3NOHA 4LQ5A 3TCGA 3H3GA 1JVYA 4MHFA 2RCBA 4MFIA 5ISUA 1QVSA 2PT1A 5AA4A 1FTKA 4L17A 4FATA 3U92A 5BUUA 5AA2D 3PPNA 3E3KA 3IB2A 2KLFA 2GQ1A 4DDDA 2NOOA 2I3WA 2THIA 1MQIA 2XXQA 4F29A 4G2ZA 5IGAA 1NH8A 2FVZA 1H44A 1FTOA 3TODA 3GLBA 4QHQA 5BWJA 1PEBA 1B7HA 3QIMA 3MVXA 3TMGA 2OBGA 1D3KA 4LQ2A 1LFHA 2F7CA 5IZ3B 3CFLA 5FHNA 3BKIB 2DDKA 1NUYA 1EYJA 3B6WA 4GWWA 4Q8RA 1NL5A 3RY3A 1MY0A 1Y1MA 5K2YA 4GIZA 5ET7A 4RA1A 4HTGA 3DP8A 4FJPA 2UYFA 3SDFA 4MEVA 4H0WA 4H67A 4RNSA 5B70A 3K6WA 1OVBA 2DWJA 4MNPA 4GL8A 4C1UA 2ONKE 2QJEA 3R6UA 3KN3A 4WXJA 3CSGA 1MY2A 4IO7A 1B4HA 1B51A 3IB1A 4C1TA 3G3GA 1MM6A 2Q8JA 3IORA 2PFYA 3T96B 2O68A 1B1HA 1QW0A 3IB0A 3LSLA 1YYZA 1XC1A 2NUVA 3M3LA 4P11A 4LATA 1OVTA 1D9VA 4POWA 1VR5A 2HFBA 2QSXA 3FXRA 1NV4A 3I6VA 1ZJLA 5EQ7A 4BLAA 1RKMA 3H7MA 3DELB 2F34A 3PUYE 1MDP1 4ELOA 4G4PA 2Y7RA 5DYHA 4MNCA 1SW2A 1UTBB 2D3IA 5CMCA 2ZYKA 4U22A 1AH5A 3IAZA 2PT2A 1MM7A 1A99A 3K1NA 2I48A 1AMFA 1B9JA 3KBRA 5DT6A 5I57B 2O6AA 3VLVA 2VGQA 1CB6A 3T93B 1EZPA 2OWSA 3FVGA 4ELQA 2XXIA 4XXUA 1MS7A 3D1RA 3H6WA 2IEEA 1LAFE 3W15C 2RKMA 4FBPA 3PGFA 3N94A 3K6VA 4R74A 1DSNA 4X8RA 2XX8A 4GWOA 2HHMA 2OWTA 4F3GA 2QMWA 3FVOA 3FJGA 2F7BA 2YPNA 3ZSFA 3TKDA 3TDJA 5DEXB 1SW5A 1XT8A 1O7TA 5CBSA 4MH5A 1N04A 3T9VA 2JJKA 3IJXB 3PD8A 2A5TB 3B6QA 4OVPA 3U93A 2OX3A 3C34A 4HE2A 2CEYA 4O7IA 4PP0A 1OMPA 1YXIA 2Q2CA 1PB9A 1PC3A 3MZ1A 4POXA 1UIUA 1Y3NA 2HAUA 3GZGA 2ZMBA 2PCRA 1FTAA 2FIEA 1NUWA 3W9WA 5AE4A 4P9KA 4G8HA 3QSLA 3L6GA 1AIVA 3KG2A 1AWBA 1POTA 1UTHA 1QUJA 1JW5A 1UTBA 4H45A 1OQHA 2RC9A 4LONB 1MY3A 1O64A 4MLQA 1N3XA 3LSFB 2H98A 3SEXA 2V3QA 4G8NA 3FJ7A 4MX6A 4R9FA 3PPOA 1XHYA 4AB6A 4QFNA 3U72A 4KCCA 3G7WA 2Q74A 3HO7A 2QMXA 1ZIUA 4G68C 3O9PA 4YAHX 3KC0A 4RYAA 3IOWA 1Q35A 3UIFA 5JTYB 5FTIA 1Y9UA 4ONYA 3DLNA 3K2DA 4XF5A 3I5OA 2DSFA 2H25A 1MRPA 4GX3A 4OHNA 4AB5A 3K01A 1P1QA 2UVGA 4FORA 4IO6A 1YTVA 5I56B 4KI0E 1US5A 4EXLA 4U4SA 1B2HA 2X26A 4RPOA 3MC2A 3C32A 4G68B 1M5EA 1M5DA 2ESNA 3B8BA 1B5IA 5I2KB 3C31A 2CZKA 1AL3A 1JNFA 4GWUA 3SEVA 5T3JA 2DWHA 3MVZA 5A5XA 2QL3A 3MZBA 4PTKA 3TCFA 3K1PA 2ZYNA 2B65A 3E9XA 4ZS9A 3FV2A 3VXBA 1NUZA 1IMAA 5IM2A 1MPCA 2XWVA 1LB9A 1Y4CA 4H46A 3V83A 1RYOA 2Q88A 4F3BA 4MCOA 2AL4A 1MY4A 3VVEA 4E0XA 5AA2B 4U23A 4GX4A 5I5PA 4NF6B 3TUSA 1FCKA 3IO6A 4PDHA 1Z7NE 1B3HA 4N81A 3G3IA 3MPLA 3CFXA 3VVFA 3TFLA 2V3TA 4X9TA 4N6DA 4RK9A 1MQJA 3O28A 3HV1A 1VFEA 3LUZA 4FE8A 3RYDA 4G8MA 2VHAA 1N84A 4RY1A 3FXBA 4M1VA 3RUMA 4MAGA 1KWHA 4MLVA 2UXAA 1Z7ME 4BDQA 4K3FA 3IL1B 2XXHA 1FJ6A 5KCJA 2X7QA 4N15A 2XD3A 1MXZA 5FTHA 4ZE9A 4NF6A 2WEFA 1ZLQA 2PBWA 1RDYA 2V93A 5JK4A 5L8DA 5AA1A 3D4CA 1FPIA 2XX9A 2HAVA 4F3PA 2QVVA 1FTMA 1FQDA 3TEPA 4P8BA 1PDAA 1BTJA 2I58A 4OETA 2QVRA 2MKZA 4YU0A 1NNTA 4EUOA 3N26A 3MVYA 1FQAA 1FQBA 1UIVA 3VLWA 2PYYA 2XXUA 3RQTA 3U1OA 4E0WA 3KN7A 3IOTA 3G3JA 4GX6A 5I56A 1Y4TA 5L9MA 5IZ1A 1QGXA 1NH7A 4C0RA 3MW0A 4ZEKA 3RGYA 3FUZA 2Z23A 2B4LA 5I59B 1LFIA 1JEVA 1YCJA 4LVQA 2AYSA 1MH4A 1ZMGA 2DE4A 4N8GA 4QFKA 1B7UA 2P3VA 4KR5A 1JVXA 4YMAA 1BLFA 3FXQA 2OZZA 4FECA 3SZPA 4WEDA 5DEXA 2Q9TA 1XVYA 2FA7A 4QFOA 3E13X 5IZZA 1G0IA 1O63A 4U21A 3FXUA 2RF1A 1F9BA 5CMBA 1DPEA 2R9JA 4LN5A 3U8QA 4IB2A 1IXHA 4UABA 4QF9A 2DOJA 2HXRA 5ITPA 4OVQA 4I40A 1EU8A 1B0LA 3RPLA 3WAFA 3V89B 1I6QA 2F6PA 1OQGA 4F22A 4DCXA 1IMFA 1MQDA 4YKPA 1FPBA 4ESXA 3TCHA 1XVXA 4O3AA 5F24A 5K2XA 3VLUA 4R6HA 2I3VA 4TLMB 3TELA 1NV7A 3QUJA 3MSTA 1KZ8A 1DCUA 1S7YA 1FPLA 4I8CA 3T9XB 2QPQA 5L9SA 1QUIA 3S9NC 1R6ZA 4EQBA 4JVCA 3FVKA 5FHMA 1IXCA 1PB8A 3B6TA 1LBCA 5FHOA 4Z0IA 1MXXA 4HCYA 4PFYA 4HW8A 4JXIA 1FBHA 4MF3A 4NF5B 2ANJA 2I4BA 3G3FA 2O1MA 4KXPA 4U4XA 1EZOA 1SBPA 2F3BA 2I0BA 1FJ9A 2ALUA 2E1SA 1TXFA 3LSXA 1H45A 2UVJA 4BDMA 1DMBA 5H8QB 2NXOA 2HZLA 4XKNA 4X48A 2YJPA 1Y1ZA 3OELA 4ECFA 4YMBA 5TPAB 3B50A 5H8NB 1HSEA 4AS4A 1IXGA 3PUVE 4F18A 4N07A 4PQJA 3OENA 4ND9A 5H8HB 2RCAA 1USYH 2XD2A 1M5BA 3A09A 5CMKA 1Q1KA 2X7PA 3R7XA 5FBPA 2GFEA 3KC1A 4YICA 3V8XB 2VP1A 1N3WA 2Z8EA 1Q9DA 4PF6A 1S9TA 2KQZA 3EHSA 3OSRA 3FASA 4MJOA 3RT6B 2Z8FA 4QXDA 1IMDA 3VXCA 1TWYA 4LA9A 4R6YA 4IO2A 1JW4A 2F5XA 3S9MC 1B58A 2DWIA 1IMCA 3OD7A 3MZ9A 3QMFA 2OWZA 1A55A 1Y3QA 2XXXA 2BJIA 2A5SA 1BIYA 2W7YA 3TYHA 4OFJA 1EH3A 4JVIA 1MY1A 2WYKA 3UA8A 2OJTA 4OESA 1MXYA 2H9BA 1IXIA 4JSDA 3PMVA 2WBDA 3SESA 4IO5A 4IY5A 3AXFA 4IR8A 4FAJA 1N7XA 2PFZA 3K4UA 4P3LA 2M8CA 4GD5A 2PX1A 4JVDA 3LUYA 3HN0A 4LUBA 5KDTB 4JSOA 3RN8A 1MXWA 4NF8B 4GL0A 3PPRA 5ICQA 3IFAA 1FPEA 2RC8A 3FBPA 3KJ7A 2RC7A 4U1OA 5AA2A 1SI0A 2I4CA 4PFWA 2HPGA 1RDZA 4X1DA 4RPNA 4OENA 1LAXA 4F2OA 5I3SA 4GBVA 4R75A 4I62A 4FEBA 5LOMA 2V3UA 3Q25A 3PPQA 1LB8A 3C36A 3UGWA 4ELPA 1LBVA 5I2KA 4QFPA 4TLLB 4YB5A 5EQ9A 4P56A 3JZJA 4ZEFA 2GH9A 3MYUA 1I6BA 3O6GA 4H8JA 3PV0E 4H1XA 1ELJA 1PBPA 4F39A 3T0JA 1K9ZA 1FBCA 5ELVA 4PE5B 3QXMA 1IUDA 4NE4A 2DXYA 5AA4B 1S50A 4FIMA 3LSWA 4PAFA 3EN3A 3KBZA 1B7ZA 4OEUA 5A5LA 2XHDA 3OSQA 3SERA 4GQOA 1SDXA 5H8NA 3L6HA 1BP5A 3QUFA 4XKQA 1QUKA 1LFGA 4DE8A 5I58B 1WDNA 4KQPA 1DTGA 4NX1A 3IFCA 4QSCA 1P1NA 3PTYA 5I2NB 1WODA 1ZKBA 4OVTA 4PC9A 5TPAA 1VE4A 2ZZXA 3KEIA 3MQ9A 3BFUA 3RNNA 2VD2A 5CC2A 4IGTA 3SKPA 2CEXA 3SETA 3IR1A 2ZXTA 3K02A 3M3FA 3RTFB 2DWAA 4XKRA 3K0VA 3G3HA 5CI5A 2F78A 1LBBA 1OLAA 4OQOA 4PE3A 2QVUA 4X1BA 3HFUA 3ZS6A 1NV6A 4DZ1A 1ANFA 3DM0A 5H8FB 1INPA 3EQ1A 3GYYA 5B7DA 1VFDA 3A3CA 1FTJA 1YAEA 3SEUA 1TFAA 4ZEIA 2Y7KA 1J1NA 1PB7A 1SVXB 3UP9A 3I3VA 3S9LC 2P2AA 4ISUA 3EPEA 1NI9A 1T0KA 4YB7A 2QS4A 1B05A 3IOUA 1B1XA 4OWDA 1NV1A 1FQCA 1EYIA 3BFTA 3ILUB 1I6AA 3IX1A 4Z7EA 3LC8A 2IA4A 1FBPA 3H6VA 4DI4B 4KPTA 4NEDA 2VPOA 1NV3A 5ET5A 3U65A 1USYE 3VV5A 2XWIA 4GBWA 4IY6A 5I84A 3H6UA 2ONSA 2BJJX 4F1VA 4MIJA 4P1EA 2G29A 3TAJA 3T22A 3PMWA 5DTBA 1GVCA 3K6XA 2UYEA 3JV9A 4YKKA 5I59A 1Y3PA 3OMBA 4F31B 5DW8A 5ICTA 3CRBA 4Q5TA 3C33A 1R9QA 2L5VA 4PFRA 5KZTA 4R73A 4YZZA 2DE3A 2DP8A 1NUXA 3BIGA 2O51A 4DCYA 3O6HA 1MG1A 3KGCA 2KR0A 1VDWA 2QFLA 3DP6A 2F8DA 2DVZA 1Y20A 3SEWA 4HCWA 4YKIA 2XWKA 2CZIA 4GRKA 1N7WA 2O7IA 2Y7PA 2RINA 4RJZA 2FNCA 4PBQA 4O3CA 4ZE8A 2QS3A 4KYEA 4P0GA 4RK2A 1HSJA 2QS1A 3CG3A 2G93A 1OIBA 4PDDA 1NNFA 2ZZWA 4NG7A 4TOZA 2XWOA 3QAXA 5HM4B 4F1UA 1B40A 4GWYA 3O29A 3ECRA 3PD9A 3T66A 3FGSA 1GV8A 2ZYMA 5KDTA 3IK6B 2DQVA 1A8EA 4HE0A 1KA0A 1WVJA 4H5GA 1SW1A 4ZEBA 3G3KA 4HXVA 5EHSA 4LZ8A 2FYIA 1CNQA 1URSA 5DVFA 1P1OA 2XXTA 3A3UA 2Z22A 1FPFA 3O97A 2FBPA 2Y7WA 2H4IA 4H6DA 1IITA 1DBZA 1RYXA 2Q2AA 4XFEA 4EQ7A 1IZ1A 1FQFA 1LAHE 3KOSA 4O3BA 1NV0A 2O7UA 4UACA 3KOTA 3PMXA 3Q27A 4O8MA 2P0SA 3OXNA 3KJTA 4F3SA 4OVRA 4RXLA 1FW0A 1UQWA 3HSTA 2Q89A 4EXKA 3MP1A 4OFLA 3H6TA 4H65A 1SQYA 1VSOA 4JB7A 1FRPA 4N4UA 2B3BA 1SW4A 1XOCA 2XXYA 4PFUA 5EYFA 3THIA 4QFLA 2OK2A 4QRZA 3VFJA 4G68A 3K1MA 4P0IA 3MVWA 3DP4A 3GXAA 1SPIA 4OVJA 3TTNA 1QKBA 4GLIA 1TT1A 4UA8A 3EF7A 4X04A 4OZ9A 4N8YA 1B5HA 1BK4A 5JTYA 1SYIA 3WAEA 1L5TA 2OCUA 1NNKA 3A29A 5TP9A 1D9QA 4GWZA 4HE1A 5F7VA 1FPGA 4ZEDA 1MXUA 1N0TA 1MH3A 2V4CA 3ILTB 4TQUQ 5H8QA 2XXPA 4F2QA 4NAPA 3O6IA 4N6KA 2ONRA 1ZU0A 3HHFA 3R26A 3Q26A 2F97A 4MBPA 3MUQA 3CI8A 3RPWA 1EYKA 5HPQA 4BDLA 3PUZE 2Y5LA 2ZZVA 4KCDA 2PMSA 5ET6A 4NF4A 2Y5KA 5JEIA 1IQ7A 1ATGA 2F3DA 1GTKA 3KFMA 1MQHA 1IMBA 1RDXA 2NVUB 1UTHB 3LR1A 4OTEA 4EF2A 4PFTA 4XTCQ 2HXWA 2VT5A 2I6EA 1OLCA 3N6UA 3FD3A 4I3EA 3RPLB 3MJNA 1FBGA 4JWOA 3C9HA 4F19A 2VD3A 1IIWA 3FV1A 3N5LA 4NGUA 2I49A 2O69A 4EF1A 1LBZA 2FIXA 4P1LA 1MPDA 1R9LA 2H99A 3USDA 1TFDA 4R2BA 1H76A 5H8SA 3RT8A 2H5YA 4QBAA 1G0HA 4NN3A 3PUWE 2HCAA 1D9YA 3Q28A 2PVUA 2REGA 3H06B 1FBFA 1LCTA 2DXRA 2V25A 4ZDMA 3VVDA 2Q8MA 2XXVA 1URGA 4R6KA 4YB6A 3OO6A 2Z8DA 4PF8A 1POY1 4U1ZA 1MPBA 1JETA 1BKAA 1A8FA 1NMUA 4NMYA 3OOAA 1MQGA 2CZLA 3H4ZA 2GRVA 3ISPA 3KZGA 4M4GA 3LBSA 1B4ZA 1JW1A 3IOVA 2DS9A 1SYHA 1H3DA 2D5WA 2R71A 1ZBMA 3BBRA 3T9UA 2XXKA 4G61A 1MDQA 1NV2A 3CG1A 5EYHA 2CMOA 3OEKA 1H43A 1FPDA 4R2FA 2DYXA 3UK4A 5DVIA 4JDFA 5CRYA 1IMEA 4ZZEA 1FBEA 1DTZA 5CMMA 4MMPA 1LLSA 2UVHA 1FPKA 4GWXA 1M5FA 1YZ0A 3O2AA 3BIHA 1LGBC 2R8TA 4Q0CA 1I69A 4JWYA 4PFIA 5CM6A 2R6GE 4OERA 1NKXA 2QS2A 3QK6A 5EYGA 5ESYA 1ZTYA 2VPNA 4O7MA 3KSJA 2I0CA 4GOTA 4JWXA 5TP9B 4LZ5A 2F35A 1B46A 1B6HA 4JBZA 3S2VA 3T9HB 1QKAA 4LZ7A 4PAIA 2FHYA 1B3GA 4NF0A 4XIGQ 2WYPA 4R72A 3RTWB 2HQ0A 4N91A 2XXRA 3JYRA 3VE1B 4DIGA 4ZZAA 2D21A 4OXVA 2WKYA 3TQLA 1GGGA 4OYVA 2Y84A 1FPJA 1B32A 4BDOA 2ZNUA 4WKMA 5IKBA 1B52A 3MPKA 1M5CA 5IZ3A 4GVOA 4ZECA 1LBWA 3Q29A 4EDPA 3MBPA 1P1WA 4I1DA 4H8IA 1LEVA 3ZKLA 1EZ9A 5A5XB 2XX7A 1B0HA 4OFOA 1B5JA 4OVSA 3ODBA 4I9DA 1FSAA 1GR2A 3PU5A 3N6TA 4KYDA 2WBBA 2O84X 3D4GA 3B7DA 3T1BA 1A54A 1D4NA 4KYSA 4ELRA 3S4UA 4ESWA 3TTRA 3FIRA 3TTLA 4PCDA 5EQ8A 4MNIA 2DVCA 2XXWA 1FBDA 3PUXE 1HSLA 5M2VA 3TQWA 3M8UA 5ET8A 2ZNSA 2CZHA 4IO4A 1DK4A 4GF8A 3E79A 1II5A 4EQ9A 3OO7A 4PBHA 3FZVA 1N76A 4DLDA 1P99A 4LP2B 5H8HA 4DXUA 2HEUA 2AL5A 3CSBA 1IEJA 4OEVA 3HCQA 4OMBA 4IO3A 3SEYA 1B3FA 1LAGE 5LTCA 3TTMA 3GBAA 5IAIA 4O94A 2UVIA 3CHGA 2F7AA 3CFZA 4QSEA 4IGRA 3MAMA 4KD5A 3CIJA 3V5AA 2F6GA 2P3NA 4NF5A 4YKJA 5L9OA 4I3YA 5J1DA 1LBXA 3HPIA 1JP4A 4DXBA 1CE2A 3PPPA 4PAKA 3OO9A 1QULA 2QRYA 4DXCA 3K00A 2OLBA 1LBYA 4WEPA
chains in the Genus database with same CATH topology
3GZGA 3KJTA 4F3SA 3VXCA 4RXLA 3ZKKA 2ZMBA 1FW0A 1UQWA 1TWYA 3HSTA 4LA9A 4KHZE 4R6YA 5TU0A 3W9VA 4IO2A 2Q89A 4GXAA 4EXKA 3W9WA 5AE4A 3MP1A 1JW4A 3H6TA 3OO8A 3HHGA 4N6PA 4H65A 4OFLA 4G8HA 3QSLA 3L6GA 4G77A 2F5XA 1AIVA 1SQYA 3KG2A 3S9MC 3TZAA 1B58A 2DWIA 3OD7A 3MZ9A 1PBQA 1POTA 1VSOA 1GV8A 1UTHA 4JB7A 1QUJA 1JW5A 1UTBA 1A55A 1Y3QA 2XXXA 1OQHA 2RC9A 4LONB 5DVJA 2B3BA 1MY3A 1O64A 4MLQA 2A5SA 1N3XA 1BIYA 1SW4A 2W7YA 3LSFB 1XOCA 2H98A 2XXYA 4PFUA 5EYFA 2V3QA 1XS5A 3SEXA 3TYHA 4G8NA 3FJ7A 4OFJA 2OK2A 4QFLA 4R9FA 3THIA 1EH3A 5H8FA 3EHUA 4QRZA 3VFJA 1MY1A 4G68A 3K1MA 4P0IA 3PPOA 3MVWA 1XHYA 3DP4A 3UA8A 3GXAA 2OJTA 4OESA 1MXYA 4PETA 4OVJA 1SD3A 2H9BA 1LCFA 4KFQA 4QFNA 3TTNA 4NTLA 3U72A 1IXIA 4QSDA 4JSDA 1YPNA 3M3KA 3IO4A 5ITOA 3PMVA 4KCCA 3H03A 1QKBA 3G7WA 1TT1A 4GLIA 4UA8A 3HO7A 3SESA 3EF7A 2VOZA 4IO5A 2ZNTA 2QMXA 2A5TA 1FTLA 4OZ9A 4IY5A 1ZIUA 1B5HA 2AIXA 5JTYA 1SYIA 3WAEA 3AXFA 3E4RA 3O9PA 3MWBA 4G68C 4YAHX 1L5TA 4FAJA 3S9EA 3FATA 4RYAA 4U2RA 3IOWA 2OCUA 1Q35A 3UIFA 1NNKA 2O1LA 5JTYB 5TP9A 1N7XA 1A40A 2DE2A 3K4UA 5FTIA 2M8CA 3FJMA 4GD5A 2PX1A 1Y9UA 5F7VA 3UORA 4ZECA 4ZEDA 1MXUA 1JEUA 1N0TA 3LUYA 4ONYA 3VDFA 5AA3A 3HN0A 4LUBA 3F11A 1MH3A 2F36A 1P1UA 3C35A 4JSOA 3KSXA 5KDTB 3DLNA 3RN8A 3K2DA 3ILTB 3MP8A 1MXWA 3I5OA 4TQUQ 4NF8B 2V84A 5H8QA 2XXPA 4F2QA 5I58A 2DSFA 3CVGA 3PPRA 3QYTA 2H25A 1MRPA 3O6IA 4GL0A 4XKPA 4BDNA 5ICQA 4OHNA 2RC8A 4AB5A 3CR9A 3K01A 3KJ7A 2ONRA 2RC7A 4U1OA 1P1QA 4GFRA 2UVGA 1ZU0A 3MP6A 4FORA 4IO6A 1URDA 5CBRA 1YTVA 3HHFA 4AQ4A 5I56B 3R26A 4KI0E 1US5A 4EXLA 5AA2A 4U4SA 1SI0A 2I4CA 1B2HA 4THIA 4PFWA 2NWJA 3Q26A 2X26A 4N13A 2B3FA 4RPOA 2F97A 1B3LA 4X1DA 1B3EA 3MC2A 4OENA 4RPNA 4MBPA 1LAXA 4F2OA 1A7LA 1R1NA 3C32A 3KN8A 2P1SA 3MUQA 5EHMA 4G68B 3CI8A 3RPWA 1M5EA 4R75A 5HPQA 4I62A 4BDLA 3FVNA 3PUZE 2Y7IA 1M5DA 4FEBA 4NWCA 5LOMA 2ESNA 1LSTA 4KCDA 2PMSA 2V3UA 3RLFE 4NF4A 1B5IA 5JEIA 3Q25A 5I2KB 1MXVA 1IQ7A 1ATGA 3C31A 3C4MA 1LB8A 3PPQA 4F1YA 1AL3A 5I57A 1GTKA 3C36A 1MQHA 3KFMA 3UGWA 4ELPA 1NNPA 1UTHB 2NVUB 1JNFA 3SEVA 1SI1A 5I2KA 4QFPA 4TLLB 4HS7A 3LR1A 4NF4B 2DWHA 3P7IA 4OTEA 4YB5A 5F1QA 4EF2A 3MVZA 4PFTA 2HXWA 3JZJA 4XTCQ 4ZEFA 5A5XA 1US4A 2I6EA 2QL3A 3MZBA 3TCFA 1OLCA 1QJMA 3K1PA 5HBCA 2ZYNA 2GH9A 3N6UA 2B65A 3E9XA 3FD3A 4ZS9A 3FV2A 3UN6A 1I6BA 3VXBA 3O6GA 4H8JA 2YLNA 2GHAA 3MJNA 3ONMA 3PV0E 1MPCA 1LB9A 4JWOA 1Y4CA 3EHTA 3V83A 1RYOA 2Q88A 4H1XA 4R9GA 3C9HA 4F3BA 4F19A 1ELJA 2AL4A 4H5FA 1MY4A 3VVEA 1PBPA 2VD3A 4E0XA 1IIWA 2REJA 3FV1A 3N5LA 4F39A 5AA2B 4U23A 2LAOA 2I49A 5ELVA 2O69A 4PE5B 3QXMA 1IUDA 4FEDA 4NE4A 4EF1A 2DXYA 1DOTA 5AA4B 3OEMA 1S50A 4NF6B 1MPDA 4BDRA 4FIMA 1R9LA 3IJOB 3TUSA 3LSWA 1FCKA 3EN3A 2H99A 3USDA 3IO6A 1AOVA 1B7ZA 1Z7NE 1B3HA 1FQEA 1TFDA 2ABHA 4R2BA 1H76A 2E0SA 5H8SA 3K6UA 2HZKA 4OEUA 3RT8A 2XHDA 3OSQA 2H5YA 3SERA 3G3IA 4GQOA 4GXSB 3K00A 1SDXA 5H8NA 4F1UA 5I2NA 3L6HA 3MPLA 3CFXA 4Q30B 1BP5A 3TFLA 3VVFA 3QUFA 3U94A 2V3TA 4X9TA 4XKQA 1QUKA 3PUWE 2ZYOA 1LFGA 3TPAA 2HCAA 1JQFA 4RK9A 3TTKA 1D9YA 1WDNA 3Q28A 2PVUA 4DE8A 4KQPA 1DTGA 1MQJA 2REGA 3H06B 3O28A 4NF8A 5KCJB 3GBBA 3HV1A 1VFEA 4FE8A 4NWDA 1LCTA 2DXRA 2GHBA 4G8MA 2V25A 4ZDMA 3O66A 3VVDA 1DPPA 1NFTA 2VHAA 1N84A 2XXVA 4QSCA 1P1NA 1URGA 4RY1A 4M1VA 1WODA 1ZKBA 4R6KA 3RUMA 4YB6A 5TPAA 5I2NB 1VE4A 3OO6A 4LQ5A 2Z8DA 1KWHA 3TCGA 4MLVA 2UXAA 1Z7ME 3H3GA 3KEIA 1POY1 3MQ9A 4U1ZA 4BDQA 1JVYA 1MPBA 1JETA 1BKAA 1A8FA 3IL1B 4K3FA 2RCBA 2XXHA 3BFUA 5KCJA 2X7QA 1NMUA 3RNNA 2VD2A 4NMYA 3OOAA 2XD3A 4MFIA 1MQGA 2CZLA 4IGTA 1MXZA 3SKPA 5CC2A 5ISUA 5FTHA 1QVSA 4ZE9A 3H4ZA 4NF6A 1ZLQA 2PBWA 2V93A 2GRVA 2PT1A 3SETA 3KZGA 5AA4A 5JK4A 4M4GA 3IR1A 2ZXTA 1FTKA 3OXNA 3K02A 3LBSA 4L17A 1B4ZA 1JW1A 4FATA 3M3FA 3RTFB 5L8DA 3U92A 5AA2D 3PPNA 2DWAA 3E3KA 3D4CA 3IB2A 3K0VA 2KLFA 4XKRA 3G3HA 5AA1A 3IOVA 5CI5A 2F78A 4DDDA 2DS9A 1LBBA 1SYHA 2XX9A 2HAVA 1OLAA 4OQOA 2NOOA 4F3PA 2I3WA 1H3DA 4X1BA 2D5WA 3ZS6A 2THIA 1MQIA 1FTMA 1FQDA 2R71A 2OLBA 4DZ1A 3TEPA 1ANFA 1ZBMA 2XXQA 3BBRA 3DM0A 4G2ZA 1PDAA 3T9UA 1NH8A 5H8FB 4F29A 1H44A 1BTJA 1MDQA 3EQ1A 4WEPA 5I58B 5B7DA 1VFDA 3A3CA 1FTJA 1YAEA 3SEUA 1TFAA 1FTOA 2I58A 3CG1A 4ZEIA 2CMOA 4OETA 3TODA 2Y7KA 3OEKA 4YU0A 1H43A 4R2FA 3GLBA 1NNTA 2DYXA 4QHQA 5BWJA 1PEBA 1J1NA 3UK4A 1PB7A 1B7HA 3QIMA 3MVXA 1SVXB 5DVIA 2OBGA 1D3KA 4LQ2A 3TMGA 4JDFA 3UP9A 3I3VA 4ELRA 4EUOA 1LFHA 3N26A 2F7CA 3MVYA 5CRYA 4ZZEA 1FQAA 1FQBA 3CFLA 5FHNA 1UIVA 3BKIB 3S9LC 3VLWA 2P2AA 1DTZA 2PYYA 3EPEA 4ISUA 5CMMA 2XXUA 3RQTA 3U1OA 4E0WA 1LLSA 2UVHA 1T0KA 3B6WA 3KN7A 3IOTA 4YB7A 1M5FA 3G3JA 2QS4A 3O2AA 1B05A 1EZPA 3IOUA 1B1XA 1LGBC 4OWDA 5I56A 1Y4TA 4Q0CA 5L9MA 4Q8RA 1NL5A 1I69A 3RY3A 1MY0A 4JWYA 1NH7A 5CM6A 4C0RA 1FQCA 2R6GE 1Y1MA 3MW0A 4ZEKA 5K2YA 4OERA 3RGYA 3FUZA 2Z23A 4GIZA 5I59B 3BFTA 1NKXA 2QS2A 1LFIA 3ILUB 3QK6A 4RA1A 1JEVA 1I6AA 1ZTYA 4HTGA 3IX1A 3DP8A 4Z7EA 1YCJA 3LC8A 4FJPA 3KSJA 4LVQA 2AYSA 1MH4A 1ZMGA 2DE4A 2UYFA 2IA4A 4H67A 3H6VA 4H0WA 4RNSA 3SDFA 2I0CA 4KPTA 4NEDA 4QFKA 1B7UA 5B70A 3K6WA 4GOTA 4JWXA 1OVBA 4KR5A 1JVXA 2DWJA 4YMAA 1BLFA 4GL8A 5TP9B 1USYE 4LZ5A 2F35A 1B46A 1B6HA 3FXQA 4JBZA 3VV5A 3S2VA 4C1UA 3T9HB 1QKAA 4LZ7A 4IY6A 5I84A 2OZZA 3H6UA 4FECA 1B3GA 2ONKE 2QJEA 3R6UA 4WEDA 2ONSA 2BJJX 3KN3A 4XIGQ 4F1VA 2G29A 5DEXA 4WXJA 4AB6A 2Q9TA 3TAJA 4R72A 1XVYA 2FA7A 3RTWB 3T22A 3PMWA 3CSGA 5DTBA 1MY2A 3K6XA 1GVCA 4IO7A 1B4HA 4QFOA 1B51A 3IB1A 3E13X 4C1TA 3G3GA 2UYEA 1MM6A 3JV9A 1O63A 3IORA 4U21A 2HQ0A 3FXUA 2RF1A 1F9BA 4YKKA 2Q8JA 2O68A 1DPEA 2R9JA 5CMBA 1Y3PA 3OMBA 3T96B 3U8QA 4F31B 1B1HA 4IB2A 1IXHA 2XXRA 1QW0A 3JYRA 4QF9A 3VE1B 4DIGA 3IB0A 2D21A 4ZZAA 5ICTA 3CRBA 3LSLA 4Q5TA 2DOJA 1XC1A 1R9QA 3C33A 2NUVA 4OXVA 3M3LA 5KZTA 2WKYA 4P11A 4R73A 3TQLA 1GGGA 4LATA 4OYVA 1OVTA 1D9VA 2Y84A 5ITPA 4POWA 1VR5A 4YZZA 1B32A 2HFBA 4BDOA 5I59A 2QSXA 2ZNUA 4WKMA 5IKBA 1B52A 1EU8A 3FXRA 1B0LA 3MPKA 2DE3A 1M5CA 2DP8A 3WAFA 3V89B 3I6VA 1I6QA 2F6PA 1ZJLA 3Q29A 4GVOA 4EDPA 1OQGA 3MBPA 4BLAA 1P1WA 1RKMA 4F22A 4I1DA 3H7MA 4H8IA 4DCXA 3DELB 2O51A 2F34A 3ZKLA 1EZ9A 3PUYE 1MDP1 4ELOA 5A5XB 2XX7A 4G4PA 4DCYA 1B0HA 4OFOA 2Y7RA 1MQDA 5DYHA 3O6HA 4YKPA 1MG1A 1B5JA 1SW2A 3KGCA 4ESXA 3TCHA 1UTBB 1XVXA 3DP6A 2F8DA 3ODBA 4O3AA 2D3IA 2DVZA 1Y20A 5CMCA 5K2XA 3SEWA 4I9DA 4HCWA 4YKIA 3VLUA 2ZYKA 4U22A 1GR2A 1AH5A 4R6HA 3PU5A 4GRKA 3IAZA 2PT2A 2I3VA 1N7WA 2O7IA 1MM7A 3N6TA 2Y7PA 1A99A 4KYDA 4TLMB 2O84X 3K1NA 2I48A 2RINA 1AMFA 3TELA 1B9JA 4RJZA 3KBRA 3QUJA 3D4GA 2FNCA 3B7DA 4O3CA 1A54A 1D4NA 4ZE8A 4KYSA 1S7YA 5DT6A 3S4UA 2O6AA 2QS3A 4KYEA 4I8CA 3T9XB 3VLVA 2VGQA 4ESWA 5I57B 3TTRA 2QPQA 4P0GA 3FIRA 4RK2A 5L9SA 3TTLA 1QUIA 3S9NC 1CB6A 1R6ZA 4EQBA 2DVCA 2XXWA 3T93B 3FVKA 1HSJA 1IXCA 5FHMA 2OWSA 1PB8A 3FVGA 3B6TA 1LBCA 2QS1A 3CG3A 3PUXE 1HSLA 5M2VA 3TQWA 4ELQA 2G93A 1OIBA 5FHOA 3M8UA 2XXIA 1MXXA 4XXUA 4Z0IA 2ZNSA 1NNFA 4HCYA 1MS7A 4PFYA 3H6WA 2IEEA 1LAFE 3W15C 2RKMA 4HW8A 4JXIA 4IO4A 4MF3A 4GF8A 4NF5B 2ANJA 1II5A 2I4BA 4EQ9A 3OO7A 3PGFA 4TOZA 3G3FA 2O1MA 3FZVA 1N76A 3QAXA 3N94A 3K6VA 4U4XA 4DLDA 1P99A 1SBPA 1DSNA 4R74A 5HM4B 1EZOA 2I0BA 2ALUA 2E1SA 2XX8A 1TXFA 4LP2B 1B40A 3LSXA 1H45A 3O29A 2UVJA 4GWOA 4BDMA 5H8HA 1DMBA 2OWTA 3ECRA 3PD9A 2HEUA 5H8QB 3T66A 4DXUA 4F3GA 2NXOA 2AL5A 2HZLA 1IEJA 2QMWA 3CSBA 3FGSA 2ZYMA 4OEVA 4XKNA 3FVOA 3HCQA 4OMBA 4IO3A 4X48A 3SEYA 3IK6B 1B3FA 2DQVA 1A8EA 2YJPA 5KDTA 3FJGA 1LAGE 1Y1ZA 2F7BA 2YPNA 3OELA 3ZSFA 5TPAB 4ECFA 3TTMA 4YMBA 3TKDA 3GBAA 3TDJA 1WVJA 4H5GA 5H8NB 5IAIA 5DEXB 1HSEA 1IXGA 1SW1A 1SW5A 2UVIA 1XT8A 1O7TA 3PUVE 3G3KA 4N07A 4PQJA 5EHSA 4ZEBA 4F18A 5CBSA 3OENA 4LZ8A 2FYIA 4MH5A 4ND9A 2F7AA 1N04A 3CFZA 4QSEA 5H8HB 3T9VA 2RCAA 4IGRA 1USYH 1URSA 5DVFA 3IJXB 2XD2A 3MAMA 3PD8A 1P1OA 4KD5A 2XXTA 1M5BA 2A5TB 3A09A 3B6QA 3CIJA 1Q1KA 2Z22A 3A3UA 3O97A 3V5AA 5BUUA 5CMKA 2F6GA 2Y7WA 2X7PA 2H4IA 3R7XA 3U93A 4NF5A 4H6DA 1IITA 3C34A 4YKJA 5L9OA 2GFEA 1RYXA 4YICA 3V8XB 2Q2AA 4EQ7A 1IZ1A 1FQFA 2VP1A 5J1DA 1LAHE 3KOSA 1N3WA 4O3BA 3HPIA 2Z8EA 2O7UA 4PP0A 4UACA 1OMPA 4DXBA 1CE2A 3KOTA 3PPPA 1S9TA 3EHSA 3PMXA 3OSRA 3Q27A 3FASA 2Q2CA 3OO9A 1PB9A 1PC3A 1QULA 2QRYA 3MZ1A 4POXA 1UIUA 3RT6B 4DXCA 2P0SA 1Y3NA 2HAUA 2Z8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZG A;  3KJT A;  4F3S A;  3VXC A;  4RXL A;  3ZKK A;  2ZMB A;  1FW0 A;  1UQW A;  1TWY A;  3HST A;  4LA9 A;  4KHZ E;  4R6Y A;  5TU0 A;  3W9V A;  4IO2 A;  2Q89 A;  4GXA A;  4EXK A;  3W9W A;  5AE4 A;  3MP1 A;  1JW4 A;  3H6T A;  3OO8 A;  3HHG A;  4N6P A;  4H65 A;  4OFL A;  4G8H A;  3QSL A;  3L6G A;  4G77 A;  2F5X A;  1AIV A;  1SQY A;  3KG2 A;  3S9M C;  3TZA A;  1B58 A;  2DWI A;  3OD7 A;  3MZ9 A;  1PBQ A;  1POT A;  1VSO A;  1GV8 A;  1UTH A;  4JB7 A;  1QUJ A;  1JW5 A;  1UTB A;  1A55 A;  1Y3Q A;  2XXX A;  1OQH A;  2RC9 A;  4LON B;  5DVJ A;  2B3B A;  1MY3 A;  1O64 A;  4MLQ A;  2A5S A;  1N3X A;  1BIY A;  1SW4 A;  2W7Y A;  3LSF B;  1XOC A;  2H98 A;  2XXY A;  4PFU A;  5EYF A;  2V3Q A;  1XS5 A;  3SEX A;  3TYH A;  4G8N A;  3FJ7 A;  4OFJ A;  2OK2 A;  4QFL A;  4R9F A;  3THI A;  1EH3 A;  5H8F A;  3EHU A;  4QRZ A;  3VFJ A;  1MY1 A;  4G68 A;  3K1M A;  4P0I A;  3PPO A;  3MVW A;  1XHY A;  3DP4 A;  3UA8 A;  3GXA A;  2OJT A;  4OES A;  1MXY A;  4PET A;  4OVJ A;  1SD3 A;  2H9B A;  1LCF A;  4KFQ A;  4QFN A;  3TTN A;  4NTL A;  3U72 A;  1IXI A;  4QSD A;  4JSD A;  1YPN A;  3M3K A;  3IO4 A;  5ITO A;  3PMV A;  4KCC A;  3H03 A;  1QKB A;  3G7W A;  1TT1 A;  4GLI A;  4UA8 A;  3HO7 A;  3SES A;  3EF7 A;  2VOZ A;  4IO5 A;  2ZNT A;  2QMX A;  2A5T A;  1FTL A;  4OZ9 A;  4IY5 A;  1ZIU A;  1B5H A;  2AIX A;  5JTY A;  1SYI A;  3WAE A;  3AXF A;  3E4R A;  3O9P A;  3MWB A;  4G68 C;  4YAH X;  1L5T A;  4FAJ A;  3S9E A;  3FAT A;  4RYA A;  4U2R A;  3IOW A;  2OCU A;  1Q35 A;  3UIF A;  1NNK A;  2O1L A;  5JTY B;  5TP9 A;  1N7X A;  1A40 A;  2DE2 A;  3K4U A;  5FTI A;  2M8C A;  3FJM A;  4GD5 A;  2PX1 A;  1Y9U A;  5F7V A;  3UOR A;  4ZEC A;  4ZED A;  1MXU A;  1JEU A;  1N0T A;  3LUY A;  4ONY A;  3VDF A;  5AA3 A;  3HN0 A;  4LUB A;  3F11 A;  1MH3 A;  2F36 A;  1P1U A;  3C35 A;  4JSO A;  3KSX A;  5KDT B;  3DLN A;  3RN8 A;  3K2D A;  3ILT B;  3MP8 A;  1MXW A;  3I5O A;  4TQU Q;  4NF8 B;  2V84 A;  5H8Q A;  2XXP A;  4F2Q A;  5I58 A;  2DSF A;  3CVG A;  3PPR A;  3QYT A;  2H25 A;  1MRP A;  3O6I A;  4GL0 A;  4XKP A;  4BDN A;  5ICQ A;  4OHN A;  2RC8 A;  4AB5 A;  3CR9 A;  3K01 A;  3KJ7 A;  2ONR A;  2RC7 A;  4U1O A;  1P1Q A;  4GFR A;  2UVG A;  1ZU0 A;  3MP6 A;  4FOR A;  4IO6 A;  1URD A;  5CBR A;  1YTV A;  3HHF A;  4AQ4 A;  5I56 B;  3R26 A;  4KI0 E;  1US5 A;  4EXL A;  5AA2 A;  4U4S A;  1SI0 A;  2I4C A;  1B2H A;  4THI A;  4PFW A;  2NWJ A;  3Q26 A;  2X26 A;  4N13 A;  2B3F A;  4RPO A;  2F97 A;  1B3L A;  4X1D A;  1B3E A;  3MC2 A;  4OEN A;  4RPN A;  4MBP A;  1LAX A;  4F2O A;  1A7L A;  1R1N A;  3C32 A;  3KN8 A;  2P1S A;  3MUQ A;  5EHM A;  4G68 B;  3CI8 A;  3RPW A;  1M5E A;  4R75 A;  5HPQ A;  4I62 A;  4BDL A;  3FVN A;  3PUZ E;  2Y7I A;  1M5D A;  4FEB A;  4NWC A;  5LOM A;  2ESN A;  1LST A;  4KCD A;  2PMS A;  2V3U A;  3RLF E;  4NF4 A;  1B5I A;  5JEI A;  3Q25 A;  5I2K B;  1MXV A;  1IQ7 A;  1ATG A;  3C31 A;  3C4M A;  1LB8 A;  3PPQ A;  4F1Y A;  1AL3 A;  5I57 A;  1GTK A;  3C36 A;  1MQH A;  3KFM A;  3UGW A;  4ELP A;  1NNP A;  1UTH B;  2NVU B;  1JNF A;  3SEV A;  1SI1 A;  5I2K A;  4QFP A;  4TLL B;  4HS7 A;  3LR1 A;  4NF4 B;  2DWH A;  3P7I A;  4OTE A;  4YB5 A;  5F1Q A;  4EF2 A;  3MVZ A;  4PFT A;  2HXW A;  3JZJ A;  4XTC Q;  4ZEF A;  5A5X A;  1US4 A;  2I6E A;  2QL3 A;  3MZB A;  3TCF A;  1OLC A;  1QJM A;  3K1P A;  5HBC A;  2ZYN A;  2GH9 A;  3N6U A;  2B65 A;  3E9X A;  3FD3 A;  4ZS9 A;  3FV2 A;  3UN6 A;  1I6B A;  3VXB A;  3O6G A;  4H8J A;  2YLN A;  2GHA A;  3MJN A;  3ONM A;  3PV0 E;  1MPC A;  1LB9 A;  4JWO A;  1Y4C A;  3EHT A;  3V83 A;  1RYO A;  2Q88 A;  4H1X A;  4R9G A;  3C9H A;  4F3B A;  4F19 A;  1ELJ A;  2AL4 A;  4H5F A;  1MY4 A;  3VVE A;  1PBP A;  2VD3 A;  4E0X A;  1IIW A;  2REJ A;  3FV1 A;  3N5L A;  4F39 A;  5AA2 B;  4U23 A;  2LAO A;  2I49 A;  5ELV A;  2O69 A;  4PE5 B;  3QXM A;  1IUD A;  4FED A;  4NE4 A;  4EF1 A;  2DXY A;  1DOT A;  5AA4 B;  3OEM A;  1S50 A;  4NF6 B;  1MPD A;  4BDR A;  4FIM A;  1R9L A;  3IJO B;  3TUS A;  3LSW A;  1FCK A;  3EN3 A;  2H99 A;  3USD A;  3IO6 A;  1AOV A;  1B7Z A;  1Z7N E;  1B3H A;  1FQE A;  1TFD A;  2ABH A;  4R2B A;  1H76 A;  2E0S A;  5H8S A;  3K6U A;  2HZK A;  4OEU A;  3RT8 A;  2XHD A;  3OSQ A;  2H5Y A;  3SER A;  3G3I A;  4GQO A;  4GXS B;  3K00 A;  1SDX A;  5H8N A;  4F1U A;  5I2N A;  3L6H A;  3MPL A;  3CFX A;  4Q30 B;  1BP5 A;  3TFL A;  3VVF A;  3QUF A;  3U94 A;  2V3T A;  4X9T A;  4XKQ A;  1QUK A;  3PUW E;  2ZYO A;  1LFG A;  3TPA A;  2HCA A;  1JQF A;  4RK9 A;  3TTK A;  1D9Y A;  1WDN A;  3Q28 A;  2PVU A;  4DE8 A;  4KQP A;  1DTG A;  1MQJ A;  2REG A;  3H06 B;  3O28 A;  4NF8 A;  5KCJ B;  3GBB A;  3HV1 A;  1VFE A;  4FE8 A;  4NWD A;  1LCT A;  2DXR A;  2GHB A;  4G8M A;  2V25 A;  4ZDM A;  3O66 A;  3VVD A;  1DPP A;  1NFT A;  2VHA A;  1N84 A;  2XXV A;  4QSC A;  1P1N A;  1URG A;  4RY1 A;  4M1V A;  1WOD A;  1ZKB A;  4R6K A;  3RUM A;  4YB6 A;  5TPA A;  5I2N B;  1VE4 A;  3OO6 A;  4LQ5 A;  2Z8D A;  1KWH A;  3TCG A;  4MLV A;  2UXA A;  1Z7M E;  3H3G A;  3KEI A;  1POY 1;  3MQ9 A;  4U1Z A;  4BDQ A;  1JVY A;  1MPB A;  1JET A;  1BKA A;  1A8F A;  3IL1 B;  4K3F A;  2RCB A;  2XXH A;  3BFU A;  5KCJ A;  2X7Q A;  1NMU A;  3RNN A;  2VD2 A;  4NMY A;  3OOA A;  2XD3 A;  4MFI A;  1MQG A;  2CZL A;  4IGT A;  1MXZ A;  3SKP A;  5CC2 A;  5ISU A;  5FTH A;  1QVS A;  4ZE9 A;  3H4Z A;  4NF6 A;  1ZLQ A;  2PBW A;  2V93 A;  2GRV A;  2PT1 A;  3SET A;  3KZG A;  5AA4 A;  5JK4 A;  4M4G A;  3IR1 A;  2ZXT A;  1FTK A;  3OXN A;  3K02 A;  3LBS A;  4L17 A;  1B4Z A;  1JW1 A;  4FAT A;  3M3F A;  3RTF B;  5L8D A;  3U92 A;  5AA2 D;  3PPN A;  2DWA A;  3E3K A;  3D4C A;  3IB2 A;  3K0V A;  2KLF A;  4XKR A;  3G3H A;  5AA1 A;  3IOV A;  5CI5 A;  2F78 A;  4DDD A;  2DS9 A;  1LBB A;  1SYH A;  2XX9 A;  2HAV A;  1OLA A;  4OQO A;  2NOO A;  4F3P A;  2I3W A;  1H3D A;  4X1B A;  2D5W A;  3ZS6 A;  2THI A;  1MQI A;  1FTM A;  1FQD A;  2R71 A;  2OLB A;  4DZ1 A;  3TEP A;  1ANF A;  1ZBM A;  2XXQ A;  3BBR A;  3DM0 A;  4G2Z A;  1PDA A;  3T9U A;  1NH8 A;  5H8F B;  4F29 A;  1H44 A;  1BTJ A;  1MDQ A;  3EQ1 A;  4WEP A;  5I58 B;  5B7D A;  1VFD A;  3A3C A;  1FTJ A;  1YAE A;  3SEU A;  1TFA A;  1FTO A;  2I58 A;  3CG1 A;  4ZEI A;  2CMO A;  4OET A;  3TOD A;  2Y7K A;  3OEK A;  4YU0 A;  1H43 A;  4R2F A;  3GLB A;  1NNT A;  2DYX A;  4QHQ A;  5BWJ A;  1PEB A;  1J1N A;  3UK4 A;  1PB7 A;  1B7H A;  3QIM A;  3MVX A;  1SVX B;  5DVI A;  2OBG A;  1D3K A;  4LQ2 A;  3TMG A;  4JDF A;  3UP9 A;  3I3V A;  4ELR A;  4EUO A;  1LFH A;  3N26 A;  2F7C A;  3MVY A;  5CRY A;  4ZZE A;  1FQA A;  1FQB A;  3CFL A;  5FHN A;  1UIV A;  3BKI B;  3S9L C;  3VLW A;  2P2A A;  1DTZ A;  2PYY A;  3EPE A;  4ISU A;  5CMM A;  2XXU A;  3RQT A;  3U1O A;  4E0W A;  1LLS A;  2UVH A;  1T0K A;  3B6W A;  3KN7 A;  3IOT A;  4YB7 A;  1M5F A;  3G3J A;  2QS4 A;  3O2A A;  1B05 A;  1EZP A;  3IOU A;  1B1X A;  1LGB C;  4OWD A;  5I56 A;  1Y4T A;  4Q0C A;  5L9M A;  4Q8R A;  1NL5 A;  1I69 A;  3RY3 A;  1MY0 A;  4JWY A;  1NH7 A;  5CM6 A;  4C0R A;  1FQC A;  2R6G E;  1Y1M A;  3MW0 A;  4ZEK A;  5K2Y A;  4OER A;  3RGY A;  3FUZ A;  2Z23 A;  4GIZ A;  5I59 B;  3BFT A;  1NKX A;  2QS2 A;  1LFI A;  3ILU B;  3QK6 A;  4RA1 A;  1JEV A;  1I6A A;  1ZTY A;  4HTG A;  3IX1 A;  3DP8 A;  4Z7E A;  1YCJ A;  3LC8 A;  4FJP A;  3KSJ A;  4LVQ A;  2AYS A;  1MH4 A;  1ZMG A;  2DE4 A;  2UYF A;  2IA4 A;  4H67 A;  3H6V A;  4H0W A;  4RNS A;  3SDF A;  2I0C A;  4KPT A;  4NED A;  4QFK A;  1B7U A;  5B70 A;  3K6W A;  4GOT A;  4JWX A;  1OVB A;  4KR5 A;  1JVX A;  2DWJ A;  4YMA A;  1BLF A;  4GL8 A;  5TP9 B;  1USY E;  4LZ5 A;  2F35 A;  1B46 A;  1B6H A;  3FXQ A;  4JBZ A;  3VV5 A;  3S2V A;  4C1U A;  3T9H B;  1QKA A;  4LZ7 A;  4IY6 A;  5I84 A;  2OZZ A;  3H6U A;  4FEC A;  1B3G A;  2ONK E;  2QJE A;  3R6U A;  4WED A;  2ONS A;  2BJJ X;  3KN3 A;  4XIG Q;  4F1V A;  2G29 A;  5DEX A;  4WXJ A;  4AB6 A;  2Q9T A;  3TAJ A;  4R72 A;  1XVY A;  2FA7 A;  3RTW B;  3T22 A;  3PMW A;  3CSG A;  5DTB A;  1MY2 A;  3K6X A;  1GVC A;  4IO7 A;  1B4H A;  4QFO A;  1B51 A;  3IB1 A;  3E13 X;  4C1T A;  3G3G A;  2UYE A;  1MM6 A;  3JV9 A;  1O63 A;  3IOR A;  4U21 A;  2HQ0 A;  3FXU A;  2RF1 A;  1F9B A;  4YKK A;  2Q8J A;  2O68 A;  1DPE A;  2R9J A;  5CMB A;  1Y3P A;  3OMB A;  3T96 B;  3U8Q A;  4F31 B;  1B1H A;  4IB2 A;  1IXH A;  2XXR A;  1QW0 A;  3JYR A;  4QF9 A;  3VE1 B;  4DIG A;  3IB0 A;  2D21 A;  4ZZA A;  5ICT A;  3CRB A;  3LSL A;  4Q5T A;  2DOJ A;  1XC1 A;  1R9Q A;  3C33 A;  2NUV A;  4OXV A;  3M3L A;  5KZT A;  2WKY A;  4P11 A;  4R73 A;  3TQL A;  1GGG A;  4LAT A;  4OYV A;  1OVT A;  1D9V A;  2Y84 A;  5ITP A;  4POW A;  1VR5 A;  4YZZ A;  1B32 A;  2HFB A;  4BDO A;  5I59 A;  2QSX A;  2ZNU A;  4WKM A;  5IKB A;  1B52 A;  1EU8 A;  3FXR A;  1B0L A;  3MPK A;  2DE3 A;  1M5C A;  2DP8 A;  3WAF A;  3V89 B;  3I6V A;  1I6Q A;  2F6P A;  1ZJL A;  3Q29 A;  4GVO A;  4EDP A;  1OQG A;  3MBP A;  4BLA A;  1P1W A;  1RKM A;  4F22 A;  4I1D A;  3H7M A;  4H8I A;  4DCX A;  3DEL B;  2O51 A;  2F34 A;  3ZKL A;  1EZ9 A;  3PUY E;  1MDP 1;  4ELO A;  5A5X B;  2XX7 A;  4G4P A;  4DCY A;  1B0H A;  4OFO A;  2Y7R A;  1MQD A;  5DYH A;  3O6H A;  4YKP A;  1MG1 A;  1B5J A;  1SW2 A;  3KGC A;  4ESX A;  3TCH A;  1UTB B;  1XVX A;  3DP6 A;  2F8D A;  3ODB A;  4O3A A;  2D3I A;  2DVZ A;  1Y20 A;  5CMC A;  5K2X A;  3SEW A;  4I9D A;  4HCW A;  4YKI A;  3VLU A;  2ZYK A;  4U22 A;  1GR2 A;  1AH5 A;  4R6H A;  3PU5 A;  4GRK A;  3IAZ A;  2PT2 A;  2I3V A;  1N7W A;  2O7I A;  1MM7 A;  3N6T A;  2Y7P A;  1A99 A;  4KYD A;  4TLM B;  2O84 X;  3K1N A;  2I48 A;  2RIN A;  1AMF A;  3TEL A;  1B9J A;  4RJZ A;  3KBR A;  3QUJ A;  3D4G A;  2FNC A;  3B7D A;  4O3C A;  1A54 A;  1D4N A;  4ZE8 A;  4KYS A;  1S7Y A;  5DT6 A;  3S4U A;  2O6A A;  2QS3 A;  4KYE A;  4I8C A;  3T9X B;  3VLV A;  2VGQ A;  4ESW A;  5I57 B;  3TTR A;  2QPQ A;  4P0G A;  3FIR A;  4RK2 A;  5L9S A;  3TTL A;  1QUI A;  3S9N C;  1CB6 A;  1R6Z A;  4EQB A;  2DVC A;  2XXW A;  3T93 B;  3FVK A;  1HSJ A;  1IXC A;  5FHM A;  2OWS A;  1PB8 A;  3FVG A;  3B6T A;  1LBC A;  2QS1 A;  3CG3 A;  3PUX E;  1HSL A;  5M2V A;  3TQW A;  4ELQ A;  2G93 A;  1OIB A;  5FHO A;  3M8U A;  2XXI A;  1MXX A;  4XXU A;  4Z0I A;  2ZNS A;  1NNF A;  4HCY A;  1MS7 A;  4PFY A;  3H6W A;  2IEE A;  1LAF E;  3W15 C;  2RKM A;  4HW8 A;  4JXI A;  4IO4 A;  4MF3 A;  4GF8 A;  4NF5 B;  2ANJ A;  1II5 A;  2I4B A;  4EQ9 A;  3OO7 A;  3PGF A;  4TOZ A;  3G3F A;  2O1M A;  3FZV A;  1N76 A;  3QAX A;  3N94 A;  3K6V A;  4U4X A;  4DLD A;  1P99 A;  1SBP A;  1DSN A;  4R74 A;  5HM4 B;  1EZO A;  2I0B A;  2ALU A;  2E1S A;  2XX8 A;  1TXF A;  4LP2 B;  1B40 A;  3LSX A;  1H45 A;  3O29 A;  2UVJ A;  4GWO A;  4BDM A;  5H8H A;  1DMB A;  2OWT A;  3ECR A;  3PD9 A;  2HEU A;  5H8Q B;  3T66 A;  4DXU A;  4F3G A;  2NXO A;  2AL5 A;  2HZL A;  1IEJ A;  2QMW A;  3CSB A;  3FGS A;  2ZYM A;  4OEV A;  4XKN A;  3FVO A;  3HCQ A;  4OMB A;  4IO3 A;  4X48 A;  3SEY A;  3IK6 B;  1B3F A;  2DQV A;  1A8E A;  2YJP A;  5KDT A;  3FJG A;  1LAG E;  1Y1Z A;  2F7B A;  2YPN A;  3OEL A;  3ZSF A;  5TPA B;  4ECF A;  3TTM A;  4YMB A;  3TKD A;  3GBA A;  3TDJ A;  1WVJ A;  4H5G A;  5H8N B;  5IAI A;  5DEX B;  1HSE A;  1IXG A;  1SW1 A;  1SW5 A;  2UVI A;  1XT8 A;  1O7T A;  3PUV E;  3G3K A;  4N07 A;  4PQJ A;  5EHS A;  4ZEB A;  4F18 A;  5CBS A;  3OEN A;  4LZ8 A;  2FYI A;  4MH5 A;  4ND9 A;  2F7A A;  1N04 A;  3CFZ A;  4QSE A;  5H8H B;  3T9V A;  2RCA A;  4IGR A;  1USY H;  1URS A;  5DVF A;  3IJX B;  2XD2 A;  3MAM A;  3PD8 A;  1P1O A;  4KD5 A;  2XXT A;  1M5B A;  2A5T B;  3A09 A;  3B6Q A;  3CIJ A;  1Q1K A;  2Z22 A;  3A3U A;  3O97 A;  3V5A A;  5BUU A;  5CMK A;  2F6G A;  2Y7W A;  2X7P A;  2H4I A;  3R7X A;  3U93 A;  4NF5 A;  4H6D A;  1IIT A;  3C34 A;  4YKJ A;  5L9O A;  2GFE A;  1RYX A;  4YIC A;  3V8X B;  2Q2A A;  4EQ7 A;  1IZ1 A;  1FQF A;  2VP1 A;  5J1D A;  1LAH E;  3KOS A;  1N3W A;  4O3B A;  3HPI A;  2Z8E A;  2O7U A;  4PP0 A;  4UAC A;  1OMP A;  4DXB A;  1CE2 A;  3KOT A;  3PPP A;  1S9T A;  3EHS A;  3PMX A;  3OSR A;  3Q27 A;  3FAS A;  2Q2C A;  3OO9 A;  1PB9 A;  1PC3 A;  1QUL A;  2QRY A;  3MZ1 A;  4POX A;  1UIU A;  3RT6 B;  4DXC A;  2P0S A;  1Y3N A;  2HAU A;  2Z8F A; 
#chains in the Genus database with same CATH topology
 4PFB A;  3ZKK A;  4KHZ E;  5TU0 A;  3W9V A;  4GXA A;  4OA4 A;  3OO8 A;  4N6P A;  3HHG A;  4G77 A;  4NHB A;  4DI3 D;  3TZA A;  1NV5 A;  1PBQ A;  5DVJ A;  4NQ8 A;  5EQA A;  1XS5 A;  5H8F A;  2WX9 A;  3EHU A;  5J16 A;  4PET A;  1SD3 A;  1LCF A;  2B4M A;  4KFQ A;  4NTL A;  4QSD A;  1YPN A;  3M3K A;  3IO4 A;  5ITO A;  3H03 A;  2VOZ A;  2ZNT A;  2A5T A;  1FTL A;  2AIX A;  4AS5 A;  3E4R A;  3MWB A;  3S9E A;  3FAT A;  4U2R A;  2O1L A;  4PGN A;  1A40 A;  2DE2 A;  4OAN A;  3FJM A;  4GWS A;  3UOR A;  1JEU A;  3VDF A;  5AA3 A;  3F11 A;  3C35 A;  2F36 A;  1P1U A;  3KSX A;  1KA1 A;  3MP8 A;  2V84 A;  5I58 A;  3ROJ A;  3CVG A;  4BDN A;  3QYT A;  4XKP A;  3CR9 A;  4GFR A;  3MP6 A;  5CBR A;  1URD A;  4AQ4 A;  4THI A;  2NWJ A;  4N13 A;  2B3F A;  1B3L A;  1B3E A;  1A7L A;  1R1N A;  3KN8 A;  2P1S A;  5EHM A;  3FVN A;  2Y7I A;  4NWC A;  3E78 A;  1LST A;  3RLF E;  1MXV A;  3C4M A;  4F1Y A;  5I7I A;  5I57 A;  1XI6 A;  1NNP A;  1SI1 A;  4HS7 A;  4NF4 B;  3P7I A;  5F1Q A;  4XEQ A;  1US4 A;  1QJM A;  5HBC A;  3UN6 A;  2YLN A;  2GHA A;  3ONM A;  3LV0 A;  3EHT A;  4R9G A;  4H5F A;  2REJ A;  2LAO A;  4FED A;  1DOT A;  3OEM A;  4BDR A;  3IJO B;  1AOV A;  1K9Y A;  1FQE A;  2ABH A;  2E0S A;  3K6U A;  2HZK A;  5LDZ A;  2XA5 A;  4GXS B;  5I2N A;  4Q30 B;  3U94 A;  2ZYO A;  3TPA A;  1JQF A;  3TTK A;  4N17 A;  4NF8 A;  4P47 A;  5KCJ B;  3GBB A;  4NWD A;  4PGP A;  3EKI A;  2GHB A;  3O66 A;  1DPP A;  1NFT A;  3NOH A;  4LQ5 A;  3TCG A;  3H3G A;  1JVY A;  4MHF A;  2RCB A;  4MFI A;  5ISU A;  1QVS A;  2PT1 A;  5AA4 A;  1FTK A;  4L17 A;  4FAT A;  3U92 A;  5BUU A;  5AA2 D;  3PPN A;  3E3K A;  3IB2 A;  2KLF A;  2GQ1 A;  4DDD A;  2NOO A;  2I3W A;  2THI A;  1MQI A;  2XXQ A;  4F29 A;  4G2Z A;  5IGA A;  1NH8 A;  2FVZ A;  1H44 A;  1FTO A;  3TOD A;  3GLB A;  4QHQ A;  5BWJ A;  1PEB A;  1B7H A;  3QIM A;  3MVX A;  3TMG A;  2OBG A;  1D3K A;  4LQ2 A;  1LFH A;  2F7C A;  5IZ3 B;  3CFL A;  5FHN A;  3BKI B;  2DDK A;  1NUY A;  1EYJ A;  3B6W A;  4GWW A;  4Q8R A;  1NL5 A;  3RY3 A;  1MY0 A;  1Y1M A;  5K2Y A;  4GIZ A;  5ET7 A;  4RA1 A;  4HTG A;  3DP8 A;  4FJP A;  2UYF A;  3SDF A;  4MEV A;  4H0W A;  4H67 A;  4RNS A;  5B70 A;  3K6W A;  1OVB A;  2DWJ A;  4MNP A;  4GL8 A;  4C1U A;  2ONK E;  2QJE A;  3R6U A;  3KN3 A;  4WXJ A;  3CSG A;  1MY2 A;  4IO7 A;  1B4H A;  1B51 A;  3IB1 A;  4C1T A;  3G3G A;  1MM6 A;  2Q8J A;  3IOR A;  2PFY A;  3T96 B;  2O68 A;  1B1H A;  1QW0 A;  3IB0 A;  3LSL A;  1YYZ A;  1XC1 A;  2NUV A;  3M3L A;  4P11 A;  4LAT A;  1OVT A;  1D9V A;  4POW A;  1VR5 A;  2HFB A;  2QSX A;  3FXR A;  1NV4 A;  3I6V A;  1ZJL A;  5EQ7 A;  4BLA A;  1RKM A;  3H7M A;  3DEL B;  2F34 A;  3PUY E;  1MDP 1;  4ELO A;  4G4P A;  2Y7R A;  5DYH A;  4MNC A;  1SW2 A;  1UTB B;  2D3I A;  5CMC A;  2ZYK A;  4U22 A;  1AH5 A;  3IAZ A;  2PT2 A;  1MM7 A;  1A99 A;  3K1N A;  2I48 A;  1AMF A;  1B9J A;  3KBR A;  5DT6 A;  5I57 B;  2O6A A;  3VLV A;  2VGQ A;  1CB6 A;  3T93 B;  1EZP A;  2OWS A;  3FVG A;  4ELQ A;  2XXI A;  4XXU A;  1MS7 A;  3D1R A;  3H6W A;  2IEE A;  1LAF E;  3W15 C;  2RKM A;  4FBP A;  3PGF A;  3N94 A;  3K6V A;  4R74 A;  1DSN A;  4X8R A;  2XX8 A;  4GWO A;  2HHM A;  2OWT A;  4F3G A;  2QMW A;  3FVO A;  3FJG A;  2F7B A;  2YPN A;  3ZSF A;  3TKD A;  3TDJ A;  5DEX B;  1SW5 A;  1XT8 A;  1O7T A;  5CBS A;  4MH5 A;  1N04 A;  3T9V A;  2JJK A;  3IJX B;  3PD8 A;  2A5T B;  3B6Q A;  4OVP A;  3U93 A;  2OX3 A;  3C34 A;  4HE2 A;  2CEY A;  4O7I A;  4PP0 A;  1OMP A;  1YXI A;  2Q2C A;  1PB9 A;  1PC3 A;  3MZ1 A;  4POX A;  1UIU A;  1Y3N A;  2HAU A;  3GZG A;  2ZMB A;  2PCR A;  1FTA A;  2FIE A;  1NUW A;  3W9W A;  5AE4 A;  4P9K A;  4G8H A;  3QSL A;  3L6G A;  1AIV A;  3KG2 A;  1AWB A;  1POT A;  1UTH A;  1QUJ A;  1JW5 A;  1UTB A;  4H45 A;  1OQH A;  2RC9 A;  4LON B;  1MY3 A;  1O64 A;  4MLQ A;  1N3X A;  3LSF B;  2H98 A;  3SEX A;  2V3Q A;  4G8N A;  3FJ7 A;  4MX6 A;  4R9F A;  3PPO A;  1XHY A;  4AB6 A;  4QFN A;  3U72 A;  4KCC A;  3G7W A;  2Q74 A;  3HO7 A;  2QMX A;  1ZIU A;  4G68 C;  3O9P A;  4YAH X;  3KC0 A;  4RYA A;  3IOW A;  1Q35 A;  3UIF A;  5JTY B;  5FTI A;  1Y9U A;  4ONY A;  3DLN A;  3K2D A;  4XF5 A;  3I5O A;  2DSF A;  2H25 A;  1MRP A;  4GX3 A;  4OHN A;  4AB5 A;  3K01 A;  1P1Q A;  2UVG A;  4FOR A;  4IO6 A;  1YTV A;  5I56 B;  4KI0 E;  1US5 A;  4EXL A;  4U4S A;  1B2H A;  2X26 A;  4RPO A;  3MC2 A;  3C32 A;  4G68 B;  1M5E A;  1M5D A;  2ESN A;  3B8B A;  1B5I A;  5I2K B;  3C31 A;  2CZK A;  1AL3 A;  1JNF A;  4GWU A;  3SEV A;  5T3J A;  2DWH A;  3MVZ A;  5A5X A;  2QL3 A;  3MZB A;  4PTK A;  3TCF A;  3K1P A;  2ZYN A;  2B65 A;  3E9X A;  4ZS9 A;  3FV2 A;  3VXB A;  1NUZ A;  1IMA A;  5IM2 A;  1MPC A;  2XWV A;  1LB9 A;  1Y4C A;  4H46 A;  3V83 A;  1RYO A;  2Q88 A;  4F3B A;  4MCO A;  2AL4 A;  1MY4 A;  3VVE A;  4E0X A;  5AA2 B;  4U23 A;  4GX4 A;  5I5P A;  4NF6 B;  3TUS A;  1FCK A;  3IO6 A;  4PDH A;  1Z7N E;  1B3H A;  4N81 A;  3G3I A;  3MPL A;  3CFX A;  3VVF A;  3TFL A;  2V3T A;  4X9T A;  4N6D A;  4RK9 A;  1MQJ A;  3O28 A;  3HV1 A;  1VFE A;  3LUZ A;  4FE8 A;  3RYD A;  4G8M A;  2VHA A;  1N84 A;  4RY1 A;  3FXB A;  4M1V A;  3RUM A;  4MAG A;  1KWH A;  4MLV A;  2UXA A;  1Z7M E;  4BDQ A;  4K3F A;  3IL1 B;  2XXH A;  1FJ6 A;  5KCJ A;  2X7Q A;  4N15 A;  2XD3 A;  1MXZ A;  5FTH A;  4ZE9 A;  4NF6 A;  2WEF A;  1ZLQ A;  2PBW A;  1RDY A;  2V93 A;  5JK4 A;  5L8D A;  5AA1 A;  3D4C A;  1FPI A;  2XX9 A;  2HAV A;  4F3P A;  2QVV A;  1FTM A;  1FQD A;  3TEP A;  4P8B A;  1PDA A;  1BTJ A;  2I58 A;  4OET A;  2QVR A;  2MKZ A;  4YU0 A;  1NNT A;  4EUO A;  3N26 A;  3MVY A;  1FQA A;  1FQB A;  1UIV A;  3VLW A;  2PYY A;  2XXU A;  3RQT A;  3U1O A;  4E0W A;  3KN7 A;  3IOT A;  3G3J A;  4GX6 A;  5I56 A;  1Y4T A;  5L9M A;  5IZ1 A;  1QGX A;  1NH7 A;  4C0R A;  3MW0 A;  4ZEK A;  3RGY A;  3FUZ A;  2Z23 A;  2B4L A;  5I59 B;  1LFI A;  1JEV A;  1YCJ A;  4LVQ A;  2AYS A;  1MH4 A;  1ZMG A;  2DE4 A;  4N8G A;  4QFK A;  1B7U A;  2P3V A;  4KR5 A;  1JVX A;  4YMA A;  1BLF A;  3FXQ A;  2OZZ A;  4FEC A;  3SZP A;  4WED A;  5DEX A;  2Q9T A;  1XVY A;  2FA7 A;  4QFO A;  3E13 X;  5IZZ A;  1G0I A;  1O63 A;  4U21 A;  3FXU A;  2RF1 A;  1F9B A;  5CMB A;  1DPE A;  2R9J A;  4LN5 A;  3U8Q A;  4IB2 A;  1IXH A;  4UAB A;  4QF9 A;  2DOJ A;  2HXR A;  5ITP A;  4OVQ A;  4I40 A;  1EU8 A;  1B0L A;  3RPL A;  3WAF A;  3V89 B;  1I6Q A;  2F6P A;  1OQG A;  4F22 A;  4DCX A;  1IMF A;  1MQD A;  4YKP A;  1FPB A;  4ESX A;  3TCH A;  1XVX A;  4O3A A;  5F24 A;  5K2X A;  3VLU A;  4R6H A;  2I3V A;  4TLM B;  3TEL A;  1NV7 A;  3QUJ A;  3MST A;  1KZ8 A;  1DCU A;  1S7Y A;  1FPL A;  4I8C A;  3T9X B;  2QPQ A;  5L9S A;  1QUI A;  3S9N C;  1R6Z A;  4EQB A;  4JVC A;  3FVK A;  5FHM A;  1IXC A;  1PB8 A;  3B6T A;  1LBC A;  5FHO A;  4Z0I A;  1MXX A;  4HCY A;  4PFY A;  4HW8 A;  4JXI A;  1FBH A;  4MF3 A;  4NF5 B;  2ANJ A;  2I4B A;  3G3F A;  2O1M A;  4KXP A;  4U4X A;  1EZO A;  1SBP A;  2F3B A;  2I0B A;  1FJ9 A;  2ALU A;  2E1S A;  1TXF A;  3LSX A;  1H45 A;  2UVJ A;  4BDM A;  1DMB A;  5H8Q B;  2NXO A;  2HZL A;  4XKN A;  4X48 A;  2YJP A;  1Y1Z A;  3OEL A;  4ECF A;  4YMB A;  5TPA B;  3B50 A;  5H8N B;  1HSE A;  4AS4 A;  1IXG A;  3PUV E;  4F18 A;  4N07 A;  4PQJ A;  3OEN A;  4ND9 A;  5H8H B;  2RCA A;  1USY H;  2XD2 A;  1M5B A;  3A09 A;  5CMK A;  1Q1K A;  2X7P A;  3R7X A;  5FBP A;  2GFE A;  3KC1 A;  4YIC A;  3V8X B;  2VP1 A;  1N3W A;  2Z8E A;  1Q9D A;  4PF6 A;  1S9T A;  2KQZ A;  3EHS A;  3OSR A;  3FAS A;  4MJO A;  3RT6 B;  2Z8F A;  4QXD A;  1IMD A;  3VXC A;  1TWY A;  4LA9 A;  4R6Y A;  4IO2 A;  1JW4 A;  2F5X A;  3S9M C;  1B58 A;  2DWI A;  1IMC A;  3OD7 A;  3MZ9 A;  3QMF A;  2OWZ A;  1A55 A;  1Y3Q A;  2XXX A;  2BJI A;  2A5S A;  1BIY A;  2W7Y A;  3TYH A;  4OFJ A;  1EH3 A;  4JVI A;  1MY1 A;  2WYK A;  3UA8 A;  2OJT A;  4OES A;  1MXY A;  2H9B A;  1IXI A;  4JSD A;  3PMV A;  2WBD A;  3SES A;  4IO5 A;  4IY5 A;  3AXF A;  4IR8 A;  4FAJ A;  1N7X A;  2PFZ A;  3K4U A;  4P3L A;  2M8C A;  4GD5 A;  2PX1 A;  4JVD A;  3LUY A;  3HN0 A;  4LUB A;  5KDT B;  4JSO A;  3RN8 A;  1MXW A;  4NF8 B;  4GL0 A;  3PPR A;  5ICQ A;  3IFA A;  1FPE A;  2RC8 A;  3FBP A;  3KJ7 A;  2RC7 A;  4U1O A;  5AA2 A;  1SI0 A;  2I4C A;  4PFW A;  2HPG A;  1RDZ A;  4X1D A;  4RPN A;  4OEN A;  1LAX A;  4F2O A;  5I3S A;  4GBV A;  4R75 A;  4I62 A;  4FEB A;  5LOM A;  2V3U A;  3Q25 A;  3PPQ A;  1LB8 A;  3C36 A;  3UGW A;  4ELP A;  1LBV A;  5I2K A;  4QFP A;  4TLL B;  4YB5 A;  5EQ9 A;  4P56 A;  3JZJ A;  4ZEF A;  2GH9 A;  3MYU A;  1I6B A;  3O6G A;  4H8J A;  3PV0 E;  4H1X A;  1ELJ A;  1PBP A;  4F39 A;  3T0J A;  1K9Z A;  1FBC A;  5ELV A;  4PE5 B;  3QXM A;  1IUD A;  4NE4 A;  2DXY A;  5AA4 B;  1S50 A;  4FIM A;  3LSW A;  4PAF A;  3EN3 A;  3KBZ A;  1B7Z A;  4OEU A;  5A5L A;  2XHD A;  3OSQ A;  3SER A;  4GQO A;  1SDX A;  5H8N A;  3L6H A;  1BP5 A;  3QUF A;  4XKQ A;  1QUK A;  1LFG A;  4DE8 A;  5I58 B;  1WDN A;  4KQP A;  1DTG A;  4NX1 A;  3IFC A;  4QSC A;  1P1N A;  3PTY A;  5I2N B;  1WOD A;  1ZKB A;  4OVT A;  4PC9 A;  5TPA A;  1VE4 A;  2ZZX A;  3KEI A;  3MQ9 A;  3BFU A;  3RNN A;  2VD2 A;  5CC2 A;  4IGT A;  3SKP A;  2CEX A;  3SET A;  3IR1 A;  2ZXT A;  3K02 A;  3M3F A;  3RTF B;  2DWA A;  4XKR A;  3K0V A;  3G3H A;  5CI5 A;  2F78 A;  1LBB A;  1OLA A;  4OQO A;  4PE3 A;  2QVU A;  4X1B A;  3HFU A;  3ZS6 A;  1NV6 A;  4DZ1 A;  1ANF A;  3DM0 A;  5H8F B;  1INP A;  3EQ1 A;  3GYY A;  5B7D A;  1VFD A;  3A3C A;  1FTJ A;  1YAE A;  3SEU A;  1TFA A;  4ZEI A;  2Y7K A;  1J1N A;  1PB7 A;  1SVX B;  3UP9 A;  3I3V A;  3S9L C;  2P2A A;  4ISU A;  3EPE A;  1NI9 A;  1T0K A;  4YB7 A;  2QS4 A;  1B05 A;  3IOU A;  1B1X A;  4OWD A;  1NV1 A;  1FQC A;  1EYI A;  3BFT A;  3ILU B;  1I6A A;  3IX1 A;  4Z7E A;  3LC8 A;  2IA4 A;  1FBP A;  3H6V A;  4DI4 B;  4KPT A;  4NED A;  2VPO A;  1NV3 A;  5ET5 A;  3U65 A;  1USY E;  3VV5 A;  2XWI A;  4GBW A;  4IY6 A;  5I84 A;  3H6U A;  2ONS A;  2BJJ X;  4F1V A;  4MIJ A;  4P1E A;  2G29 A;  3TAJ A;  3T22 A;  3PMW A;  5DTB A;  1GVC A;  3K6X A;  2UYE A;  3JV9 A;  4YKK A;  5I59 A;  1Y3P A;  3OMB A;  4F31 B;  5DW8 A;  5ICT A;  3CRB A;  4Q5T A;  3C33 A;  1R9Q A;  2L5V A;  4PFR A;  5KZT A;  4R73 A;  4YZZ A;  2DE3 A;  2DP8 A;  1NUX A;  3BIG A;  2O51 A;  4DCY A;  3O6H A;  1MG1 A;  3KGC A;  2KR0 A;  1VDW A;  2QFL A;  3DP6 A;  2F8D A;  2DVZ A;  1Y20 A;  3SEW A;  4HCW A;  4YKI A;  2XWK A;  2CZI A;  4GRK A;  1N7W A;  2O7I A;  2Y7P A;  2RIN A;  4RJZ A;  2FNC A;  4PBQ A;  4O3C A;  4ZE8 A;  2QS3 A;  4KYE A;  4P0G A;  4RK2 A;  1HSJ A;  2QS1 A;  3CG3 A;  2G93 A;  1OIB A;  4PDD A;  1NNF A;  2ZZW A;  4NG7 A;  4TOZ A;  2XWO A;  3QAX A;  5HM4 B;  4F1U A;  1B40 A;  4GWY A;  3O29 A;  3ECR A;  3PD9 A;  3T66 A;  3FGS A;  1GV8 A;  2ZYM A;  5KDT A;  3IK6 B;  2DQV A;  1A8E A;  4HE0 A;  1KA0 A;  1WVJ A;  4H5G A;  1SW1 A;  4ZEB A;  3G3K A;  4HXV A;  5EHS A;  4LZ8 A;  2FYI A;  1CNQ A;  1URS A;  5DVF A;  1P1O A;  2XXT A;  3A3U A;  2Z22 A;  1FPF A;  3O97 A;  2FBP A;  2Y7W A;  2H4I A;  4H6D A;  1IIT A;  1DBZ A;  1RYX A;  2Q2A A;  4XFE A;  4EQ7 A;  1IZ1 A;  1FQF A;  1LAH E;  3KOS A;  4O3B A;  1NV0 A;  2O7U A;  4UAC A;  3KOT A;  3PMX A;  3Q27 A;  4O8M A;  2P0S A;  3OXN A;  3KJT A;  4F3S A;  4OVR A;  4RXL A;  1FW0 A;  1UQW A;  3HST A;  2Q89 A;  4EXK A;  3MP1 A;  4OFL A;  3H6T A;  4H65 A;  1SQY A;  1VSO A;  4JB7 A;  1FRP A;  4N4U A;  2B3B A;  1SW4 A;  1XOC A;  2XXY A;  4PFU A;  5EYF A;  3THI A;  4QFL A;  2OK2 A;  4QRZ A;  3VFJ A;  4G68 A;  3K1M A;  4P0I A;  3MVW A;  3DP4 A;  3GXA A;  1SPI A;  4OVJ A;  3TTN A;  1QKB A;  4GLI A;  1TT1 A;  4UA8 A;  3EF7 A;  4X04 A;  4OZ9 A;  4N8Y A;  1B5H A;  1BK4 A;  5JTY A;  1SYI A;  3WAE A;  1L5T A;  2OCU A;  1NNK A;  3A29 A;  5TP9 A;  1D9Q A;  4GWZ A;  4HE1 A;  5F7V A;  1FPG A;  4ZED A;  1MXU A;  1N0T A;  1MH3 A;  2V4C A;  3ILT B;  4TQU Q;  5H8Q A;  2XXP A;  4F2Q A;  4NAP A;  3O6I A;  4N6K A;  2ONR A;  1ZU0 A;  3HHF A;  3R26 A;  3Q26 A;  2F97 A;  4MBP A;  3MUQ A;  3CI8 A;  3RPW A;  1EYK A;  5HPQ A;  4BDL A;  3PUZ E;  2Y5L A;  2ZZV A;  4KCD A;  2PMS A;  5ET6 A;  4NF4 A;  2Y5K A;  5JEI A;  1IQ7 A;  1ATG A;  2F3D A;  1GTK A;  3KFM A;  1MQH A;  1IMB A;  1RDX A;  2NVU B;  1UTH B;  3LR1 A;  4OTE A;  4EF2 A;  4PFT A;  4XTC Q;  2HXW A;  2VT5 A;  2I6E A;  1OLC A;  3N6U A;  3FD3 A;  4I3E A;  3RPL B;  3MJN A;  1FBG A;  4JWO A;  3C9H A;  4F19 A;  2VD3 A;  1IIW A;  3FV1 A;  3N5L A;  4NGU A;  2I49 A;  2O69 A;  4EF1 A;  1LBZ A;  2FIX A;  4P1L A;  1MPD A;  1R9L A;  2H99 A;  3USD A;  1TFD A;  4R2B A;  1H76 A;  5H8S A;  3RT8 A;  2H5Y A;  4QBA A;  1G0H A;  4NN3 A;  3PUW E;  2HCA A;  1D9Y A;  3Q28 A;  2PVU A;  2REG A;  3H06 B;  1FBF A;  1LCT A;  2DXR A;  2V25 A;  4ZDM A;  3VVD A;  2Q8M A;  2XXV A;  1URG A;  4R6K A;  4YB6 A;  3OO6 A;  2Z8D A;  4PF8 A;  1POY 1;  4U1Z A;  1MPB A;  1JET A;  1BKA A;  1A8F A;  1NMU A;  4NMY A;  3OOA A;  1MQG A;  2CZL A;  3H4Z A;  2GRV A;  3ISP A;  3KZG A;  4M4G A;  3LBS A;  1B4Z A;  1JW1 A;  3IOV A;  2DS9 A;  1SYH A;  1H3D A;  2D5W A;  2R71 A;  1ZBM A;  3BBR A;  3T9U A;  2XXK A;  4G61 A;  1MDQ A;  1NV2 A;  3CG1 A;  5EYH A;  2CMO A;  3OEK A;  1H43 A;  1FPD A;  4R2F A;  2DYX A;  3UK4 A;  5DVI A;  4JDF A;  5CRY A;  1IME A;  4ZZE A;  1FBE A;  1DTZ A;  5CMM A;  4MMP A;  1LLS A;  2UVH A;  1FPK A;  4GWX A;  1M5F A;  1YZ0 A;  3O2A A;  3BIH A;  1LGB C;  2R8T A;  4Q0C A;  1I69 A;  4JWY A;  4PFI A;  5CM6 A;  2R6G E;  4OER A;  1NKX A;  2QS2 A;  3QK6 A;  5EYG A;  5ESY A;  1ZTY A;  2VPN A;  4O7M A;  3KSJ A;  2I0C A;  4GOT A;  4JWX A;  5TP9 B;  4LZ5 A;  2F35 A;  1B46 A;  1B6H A;  4JBZ A;  3S2V A;  3T9H B;  1QKA A;  4LZ7 A;  4PAI A;  2FHY A;  1B3G A;  4NF0 A;  4XIG Q;  2WYP A;  4R72 A;  3RTW B;  2HQ0 A;  4N91 A;  2XXR A;  3JYR A;  3VE1 B;  4DIG A;  4ZZA A;  2D21 A;  4OXV A;  2WKY A;  3TQL A;  1GGG A;  4OYV A;  2Y84 A;  1FPJ A;  1B32 A;  4BDO A;  2ZNU A;  4WKM A;  5IKB A;  1B52 A;  3MPK A;  1M5C A;  5IZ3 A;  4GVO A;  4ZEC A;  1LBW A;  3Q29 A;  4EDP A;  3MBP A;  1P1W A;  4I1D A;  4H8I A;  1LEV A;  3ZKL A;  1EZ9 A;  5A5X B;  2XX7 A;  1B0H A;  4OFO A;  1B5J A;  4OVS A;  3ODB A;  4I9D A;  1FSA A;  1GR2 A;  3PU5 A;  3N6T A;  4KYD A;  2WBB A;  2O84 X;  3D4G A;  3B7D A;  3T1B A;  1A54 A;  1D4N A;  4KYS A;  4ELR A;  3S4U A;  4ESW A;  3TTR A;  3FIR A;  3TTL A;  4PCD A;  5EQ8 A;  4MNI A;  2DVC A;  2XXW A;  1FBD A;  3PUX E;  1HSL A;  5M2V A;  3TQW A;  3M8U A;  5ET8 A;  2ZNS A;  2CZH A;  4IO4 A;  1DK4 A;  4GF8 A;  3E79 A;  1II5 A;  4EQ9 A;  3OO7 A;  4PBH A;  3FZV A;  1N76 A;  4DLD A;  1P99 A;  4LP2 B;  5H8H A;  4DXU A;  2HEU A;  2AL5 A;  3CSB A;  1IEJ A;  4OEV A;  3HCQ A;  4OMB A;  4IO3 A;  3SEY A;  1B3F A;  1LAG E;  5LTC A;  3TTM A;  3GBA A;  5IAI A;  4O94 A;  2UVI A;  3CHG A;  2F7A A;  3CFZ A;  4QSE A;  4IGR A;  3MAM A;  4KD5 A;  3CIJ A;  3V5A A;  2F6G A;  2P3N A;  4NF5 A;  4YKJ A;  5L9O A;  4I3Y A;  5J1D A;  1LBX A;  3HPI A;  1JP4 A;  4DXB A;  1CE2 A;  3PPP A;  4PAK A;  3OO9 A;  1QUL A;  2QRY A;  4DXC A;  3K00 A;  2OLB A;  1LBY A;  4WEP A; 
#chains in the Genus database with same CATH homology
 3GZG A;  3KJT A;  4F3S A;  3VXC A;  4RXL A;  3ZKK A;  2ZMB A;  1FW0 A;  1UQW A;  1TWY A;  3HST A;  4LA9 A;  4KHZ E;  4R6Y A;  5TU0 A;  3W9V A;  4IO2 A;  2Q89 A;  4GXA A;  4EXK A;  3W9W A;  5AE4 A;  3MP1 A;  1JW4 A;  3H6T A;  3OO8 A;  3HHG A;  4N6P A;  4H65 A;  4OFL A;  4G8H A;  3QSL A;  3L6G A;  4G77 A;  2F5X A;  1AIV A;  1SQY A;  3KG2 A;  3S9M C;  3TZA A;  1B58 A;  2DWI A;  3OD7 A;  3MZ9 A;  1PBQ A;  1POT A;  1VSO A;  1GV8 A;  1UTH A;  4JB7 A;  1QUJ A;  1JW5 A;  1UTB A;  1A55 A;  1Y3Q A;  2XXX A;  1OQH A;  2RC9 A;  4LON B;  5DVJ A;  2B3B A;  1MY3 A;  1O64 A;  4MLQ A;  2A5S A;  1N3X A;  1BIY A;  1SW4 A;  2W7Y A;  3LSF B;  1XOC A;  2H98 A;  2XXY A;  4PFU A;  5EYF A;  2V3Q A;  1XS5 A;  3SEX A;  3TYH A;  4G8N A;  3FJ7 A;  4OFJ A;  2OK2 A;  4QFL A;  4R9F A;  3THI A;  1EH3 A;  5H8F A;  3EHU A;  4QRZ A;  3VFJ A;  1MY1 A;  4G68 A;  3K1M A;  4P0I A;  3PPO A;  3MVW A;  1XHY A;  3DP4 A;  3UA8 A;  3GXA A;  2OJT A;  4OES A;  1MXY A;  4PET A;  4OVJ A;  1SD3 A;  2H9B A;  1LCF A;  4KFQ A;  4QFN A;  3TTN A;  4NTL A;  3U72 A;  1IXI A;  4QSD A;  4JSD A;  1YPN A;  3M3K A;  3IO4 A;  5ITO A;  3PMV A;  4KCC A;  3H03 A;  1QKB A;  3G7W A;  1TT1 A;  4GLI A;  4UA8 A;  3HO7 A;  3SES A;  3EF7 A;  2VOZ A;  4IO5 A;  2ZNT A;  2QMX A;  2A5T A;  1FTL A;  4OZ9 A;  4IY5 A;  1ZIU A;  1B5H A;  2AIX A;  5JTY A;  1SYI A;  3WAE A;  3AXF A;  3E4R A;  3O9P A;  3MWB A;  4G68 C;  4YAH X;  1L5T A;  4FAJ A;  3S9E A;  3FAT A;  4RYA A;  4U2R A;  3IOW A;  2OCU A;  1Q35 A;  3UIF A;  1NNK A;  2O1L A;  5JTY B;  5TP9 A;  1N7X A;  1A40 A;  2DE2 A;  3K4U A;  5FTI A;  2M8C A;  3FJM A;  4GD5 A;  2PX1 A;  1Y9U A;  5F7V A;  3UOR A;  4ZEC A;  4ZED A;  1MXU A;  1JEU A;  1N0T A;  3LUY A;  4ONY A;  3VDF A;  5AA3 A;  3HN0 A;  4LUB A;  3F11 A;  1MH3 A;  2F36 A;  1P1U A;  3C35 A;  4JSO A;  3KSX A;  5KDT B;  3DLN A;  3RN8 A;  3K2D A;  3ILT B;  3MP8 A;  1MXW A;  3I5O A;  4TQU Q;  4NF8 B;  2V84 A;  5H8Q A;  2XXP A;  4F2Q A;  5I58 A;  2DSF A;  3CVG A;  3PPR A;  3QYT A;  2H25 A;  1MRP A;  3O6I A;  4GL0 A;  4XKP A;  4BDN A;  5ICQ A;  4OHN A;  2RC8 A;  4AB5 A;  3CR9 A;  3K01 A;  3KJ7 A;  2ONR A;  2RC7 A;  4U1O A;  1P1Q A;  4GFR A;  2UVG A;  1ZU0 A;  3MP6 A;  4FOR A;  4IO6 A;  1URD A;  5CBR A;  1YTV A;  3HHF A;  4AQ4 A;  5I56 B;  3R26 A;  4KI0 E;  1US5 A;  4EXL A;  5AA2 A;  4U4S A;  1SI0 A;  2I4C A;  1B2H A;  4THI A;  4PFW A;  2NWJ A;  3Q26 A;  2X26 A;  4N13 A;  2B3F A;  4RPO A;  2F97 A;  1B3L A;  4X1D A;  1B3E A;  3MC2 A;  4OEN A;  4RPN A;  4MBP A;  1LAX A;  4F2O A;  1A7L A;  1R1N A;  3C32 A;  3KN8 A;  2P1S A;  3MUQ A;  5EHM A;  4G68 B;  3CI8 A;  3RPW A;  1M5E A;  4R75 A;  5HPQ A;  4I62 A;  4BDL A;  3FVN A;  3PUZ E;  2Y7I A;  1M5D A;  4FEB A;  4NWC A;  5LOM A;  2ESN A;  1LST A;  4KCD A;  2PMS A;  2V3U A;  3RLF E;  4NF4 A;  1B5I A;  5JEI A;  3Q25 A;  5I2K B;  1MXV A;  1IQ7 A;  1ATG A;  3C31 A;  3C4M A;  1LB8 A;  3PPQ A;  4F1Y A;  1AL3 A;  5I57 A;  1GTK A;  3C36 A;  1MQH A;  3KFM A;  3UGW A;  4ELP A;  1NNP A;  1UTH B;  2NVU B;  1JNF A;  3SEV A;  1SI1 A;  5I2K A;  4QFP A;  4TLL B;  4HS7 A;  3LR1 A;  4NF4 B;  2DWH A;  3P7I A;  4OTE A;  4YB5 A;  5F1Q A;  4EF2 A;  3MVZ A;  4PFT A;  2HXW A;  3JZJ A;  4XTC Q;  4ZEF A;  5A5X A;  1US4 A;  2I6E A;  2QL3 A;  3MZB A;  3TCF A;  1OLC A;  1QJM A;  3K1P A;  5HBC A;  2ZYN A;  2GH9 A;  3N6U A;  2B65 A;  3E9X A;  3FD3 A;  4ZS9 A;  3FV2 A;  3UN6 A;  1I6B A;  3VXB A;  3O6G A;  4H8J A;  2YLN A;  2GHA A;  3MJN A;  3ONM A;  3PV0 E;  1MPC A;  1LB9 A;  4JWO A;  1Y4C A;  3EHT A;  3V83 A;  1RYO A;  2Q88 A;  4H1X A;  4R9G A;  3C9H A;  4F3B A;  4F19 A;  1ELJ A;  2AL4 A;  4H5F A;  1MY4 A;  3VVE A;  1PBP A;  2VD3 A;  4E0X A;  1IIW A;  2REJ A;  3FV1 A;  3N5L A;  4F39 A;  5AA2 B;  4U23 A;  2LAO A;  2I49 A;  5ELV A;  2O69 A;  4PE5 B;  3QXM A;  1IUD A;  4FED A;  4NE4 A;  4EF1 A;  2DXY A;  1DOT A;  5AA4 B;  3OEM A;  1S50 A;  4NF6 B;  1MPD A;  4BDR A;  4FIM A;  1R9L A;  3IJO B;  3TUS A;  3LSW A;  1FCK A;  3EN3 A;  2H99 A;  3USD A;  3IO6 A;  1AOV A;  1B7Z A;  1Z7N E;  1B3H A;  1FQE A;  1TFD A;  2ABH A;  4R2B A;  1H76 A;  2E0S A;  5H8S A;  3K6U A;  2HZK A;  4OEU A;  3RT8 A;  2XHD A;  3OSQ A;  2H5Y A;  3SER A;  3G3I A;  4GQO A;  4GXS B;  3K00 A;  1SDX A;  5H8N A;  4F1U A;  5I2N A;  3L6H A;  3MPL A;  3CFX A;  4Q30 B;  1BP5 A;  3TFL A;  3VVF A;  3QUF A;  3U94 A;  2V3T A;  4X9T A;  4XKQ A;  1QUK A;  3PUW E;  2ZYO A;  1LFG A;  3TPA A;  2HCA A;  1JQF A;  4RK9 A;  3TTK A;  1D9Y A;  1WDN A;  3Q28 A;  2PVU A;  4DE8 A;  4KQP A;  1DTG A;  1MQJ A;  2REG A;  3H06 B;  3O28 A;  4NF8 A;  5KCJ B;  3GBB A;  3HV1 A;  1VFE A;  4FE8 A;  4NWD A;  1LCT A;  2DXR A;  2GHB A;  4G8M A;  2V25 A;  4ZDM A;  3O66 A;  3VVD A;  1DPP A;  1NFT A;  2VHA A;  1N84 A;  2XXV A;  4QSC A;  1P1N A;  1URG A;  4RY1 A;  4M1V A;  1WOD A;  1ZKB A;  4R6K A;  3RUM A;  4YB6 A;  5TPA A;  5I2N B;  1VE4 A;  3OO6 A;  4LQ5 A;  2Z8D A;  1KWH A;  3TCG A;  4MLV A;  2UXA A;  1Z7M E;  3H3G A;  3KEI A;  1POY 1;  3MQ9 A;  4U1Z A;  4BDQ A;  1JVY A;  1MPB A;  1JET A;  1BKA A;  1A8F A;  3IL1 B;  4K3F A;  2RCB A;  2XXH A;  3BFU A;  5KCJ A;  2X7Q A;  1NMU A;  3RNN A;  2VD2 A;  4NMY A;  3OOA A;  2XD3 A;  4MFI A;  1MQG A;  2CZL A;  4IGT A;  1MXZ A;  3SKP A;  5CC2 A;  5ISU A;  5FTH A;  1QVS A;  4ZE9 A;  3H4Z A;  4NF6 A;  1ZLQ A;  2PBW A;  2V93 A;  2GRV A;  2PT1 A;  3SET A;  3KZG A;  5AA4 A;  5JK4 A;  4M4G A;  3IR1 A;  2ZXT A;  1FTK A;  3OXN A;  3K02 A;  3LBS A;  4L17 A;  1B4Z A;  1JW1 A;  4FAT A;  3M3F A;  3RTF B;  5L8D A;  3U92 A;  5AA2 D;  3PPN A;  2DWA A;  3E3K A;  3D4C A;  3IB2 A;  3K0V A;  2KLF A;  4XKR A;  3G3H A;  5AA1 A;  3IOV A;  5CI5 A;  2F78 A;  4DDD A;  2DS9 A;  1LBB A;  1SYH A;  2XX9 A;  2HAV A;  1OLA A;  4OQO A;  2NOO A;  4F3P A;  2I3W A;  1H3D A;  4X1B A;  2D5W A;  3ZS6 A;  2THI A;  1MQI A;  1FTM A;  1FQD A;  2R71 A;  2OLB A;  4DZ1 A;  3TEP A;  1ANF A;  1ZBM A;  2XXQ A;  3BBR A;  3DM0 A;  4G2Z A;  1PDA A;  3T9U A;  1NH8 A;  5H8F B;  4F29 A;  1H44 A;  1BTJ A;  1MDQ A;  3EQ1 A;  4WEP A;  5I58 B;  5B7D A;  1VFD A;  3A3C A;  1FTJ A;  1YAE A;  3SEU A;  1TFA A;  1FTO A;  2I58 A;  3CG1 A;  4ZEI A;  2CMO A;  4OET A;  3TOD A;  2Y7K A;  3OEK A;  4YU0 A;  1H43 A;  4R2F A;  3GLB A;  1NNT A;  2DYX A;  4QHQ A;  5BWJ A;  1PEB A;  1J1N A;  3UK4 A;  1PB7 A;  1B7H A;  3QIM A;  3MVX A;  1SVX B;  5DVI A;  2OBG A;  1D3K A;  4LQ2 A;  3TMG A;  4JDF A;  3UP9 A;  3I3V A;  4ELR A;  4EUO A;  1LFH A;  3N26 A;  2F7C A;  3MVY A;  5CRY A;  4ZZE A;  1FQA A;  1FQB A;  3CFL A;  5FHN A;  1UIV A;  3BKI B;  3S9L C;  3VLW A;  2P2A A;  1DTZ A;  2PYY A;  3EPE A;  4ISU A;  5CMM A;  2XXU A;  3RQT A;  3U1O A;  4E0W A;  1LLS A;  2UVH A;  1T0K A;  3B6W A;  3KN7 A;  3IOT A;  4YB7 A;  1M5F A;  3G3J A;  2QS4 A;  3O2A A;  1B05 A;  1EZP A;  3IOU A;  1B1X A;  1LGB C;  4OWD A;  5I56 A;  1Y4T A;  4Q0C A;  5L9M A;  4Q8R A;  1NL5 A;  1I69 A;  3RY3 A;  1MY0 A;  4JWY A;  1NH7 A;  5CM6 A;  4C0R A;  1FQC A;  2R6G E;  1Y1M A;  3MW0 A;  4ZEK A;  5K2Y A;  4OER A;  3RGY A;  3FUZ A;  2Z23 A;  4GIZ A;  5I59 B;  3BFT A;  1NKX A;  2QS2 A;  1LFI A;  3ILU B;  3QK6 A;  4RA1 A;  1JEV A;  1I6A A;  1ZTY A;  4HTG A;  3IX1 A;  3DP8 A;  4Z7E A;  1YCJ A;  3LC8 A;  4FJP A;  3KSJ A;  4LVQ A;  2AYS A;  1MH4 A;  1ZMG A;  2DE4 A;  2UYF A;  2IA4 A;  4H67 A;  3H6V A;  4H0W A;  4RNS A;  3SDF A;  2I0C A;  4KPT A;  4NED A;  4QFK A;  1B7U A;  5B70 A;  3K6W A;  4GOT A;  4JWX A;  1OVB A;  4KR5 A;  1JVX A;  2DWJ A;  4YMA A;  1BLF A;  4GL8 A;  5TP9 B;  1USY E;  4LZ5 A;  2F35 A;  1B46 A;  1B6H A;  3FXQ A;  4JBZ A;  3VV5 A;  3S2V A;  4C1U A;  3T9H B;  1QKA A;  4LZ7 A;  4IY6 A;  5I84 A;  2OZZ A;  3H6U A;  4FEC A;  1B3G A;  2ONK E;  2QJE A;  3R6U A;  4WED A;  2ONS A;  2BJJ X;  3KN3 A;  4XIG Q;  4F1V A;  2G29 A;  5DEX A;  4WXJ A;  4AB6 A;  2Q9T A;  3TAJ A;  4R72 A;  1XVY A;  2FA7 A;  3RTW B;  3T22 A;  3PMW A;  3CSG A;  5DTB A;  1MY2 A;  3K6X A;  1GVC A;  4IO7 A;  1B4H A;  4QFO A;  1B51 A;  3IB1 A;  3E13 X;  4C1T A;  3G3G A;  2UYE A;  1MM6 A;  3JV9 A;  1O63 A;  3IOR A;  4U21 A;  2HQ0 A;  3FXU A;  2RF1 A;  1F9B A;  4YKK A;  2Q8J A;  2O68 A;  1DPE A;  2R9J A;  5CMB A;  1Y3P A;  3OMB A;  3T96 B;  3U8Q A;  4F31 B;  1B1H A;  4IB2 A;  1IXH A;  2XXR A;  1QW0 A;  3JYR A;  4QF9 A;  3VE1 B;  4DIG A;  3IB0 A;  2D21 A;  4ZZA A;  5ICT A;  3CRB A;  3LSL A;  4Q5T A;  2DOJ A;  1XC1 A;  1R9Q A;  3C33 A;  2NUV A;  4OXV A;  3M3L A;  5KZT A;  2WKY A;  4P11 A;  4R73 A;  3TQL A;  1GGG A;  4LAT A;  4OYV A;  1OVT A;  1D9V A;  2Y84 A;  5ITP A;  4POW A;  1VR5 A;  4YZZ A;  1B32 A;  2HFB A;  4BDO A;  5I59 A;  2QSX A;  2ZNU A;  4WKM A;  5IKB A;  1B52 A;  1EU8 A;  3FXR A;  1B0L A;  3MPK A;  2DE3 A;  1M5C A;  2DP8 A;  3WAF A;  3V89 B;  3I6V A;  1I6Q A;  2F6P A;  1ZJL A;  3Q29 A;  4GVO A;  4EDP A;  1OQG A;  3MBP A;  4BLA A;  1P1W A;  1RKM A;  4F22 A;  4I1D A;  3H7M A;  4H8I A;  4DCX A;  3DEL B;  2O51 A;  2F34 A;  3ZKL A;  1EZ9 A;  3PUY E;  1MDP 1;  4ELO A;  5A5X B;  2XX7 A;  4G4P A;  4DCY A;  1B0H A;  4OFO A;  2Y7R A;  1MQD A;  5DYH A;  3O6H A;  4YKP A;  1MG1 A;  1B5J A;  1SW2 A;  3KGC A;  4ESX A;  3TCH A;  1UTB B;  1XVX A;  3DP6 A;  2F8D A;  3ODB A;  4O3A A;  2D3I A;  2DVZ A;  1Y20 A;  5CMC A;  5K2X A;  3SEW A;  4I9D A;  4HCW A;  4YKI A;  3VLU A;  2ZYK A;  4U22 A;  1GR2 A;  1AH5 A;  4R6H A;  3PU5 A;  4GRK A;  3IAZ A;  2PT2 A;  2I3V A;  1N7W A;  2O7I A;  1MM7 A;  3N6T A;  2Y7P A;  1A99 A;  4KYD A;  4TLM B;  2O84 X;  3K1N A;  2I48 A;  2RIN A;  1AMF A;  3TEL A;  1B9J A;  4RJZ A;  3KBR A;  3QUJ A;  3D4G A;  2FNC A;  3B7D A;  4O3C A;  1A54 A;  1D4N A;  4ZE8 A;  4KYS A;  1S7Y A;  5DT6 A;  3S4U A;  2O6A A;  2QS3 A;  4KYE A;  4I8C A;  3T9X B;  3VLV A;  2VGQ A;  4ESW A;  5I57 B;  3TTR A;  2QPQ A;  4P0G A;  3FIR A;  4RK2 A;  5L9S A;  3TTL A;  1QUI A;  3S9N C;  1CB6 A;  1R6Z A;  4EQB A;  2DVC A;  2XXW A;  3T93 B;  3FVK A;  1HSJ A;  1IXC A;  5FHM A;  2OWS A;  1PB8 A;  3FVG A;  3B6T A;  1LBC A;  2QS1 A;  3CG3 A;  3PUX E;  1HSL A;  5M2V A;  3TQW A;  4ELQ A;  2G93 A;  1OIB A;  5FHO A;  3M8U A;  2XXI A;  1MXX A;  4XXU A;  4Z0I A;  2ZNS A;  1NNF A;  4HCY A;  1MS7 A;  4PFY A;  3H6W A;  2IEE A;  1LAF E;  3W15 C;  2RKM A;  4HW8 A;  4JXI A;  4IO4 A;  4MF3 A;  4GF8 A;  4NF5 B;  2ANJ A;  1II5 A;  2I4B A;  4EQ9 A;  3OO7 A;  3PGF A;  4TOZ A;  3G3F A;  2O1M A;  3FZV A;  1N76 A;  3QAX A;  3N94 A;  3K6V A;  4U4X A;  4DLD A;  1P99 A;  1SBP A;  1DSN A;  4R74 A;  5HM4 B;  1EZO A;  2I0B A;  2ALU A;  2E1S A;  2XX8 A;  1TXF A;  4LP2 B;  1B40 A;  3LSX A;  1H45 A;  3O29 A;  2UVJ A;  4GWO A;  4BDM A;  5H8H A;  1DMB A;  2OWT A;  3ECR A;  3PD9 A;  2HEU A;  5H8Q B;  3T66 A;  4DXU A;  4F3G A;  2NXO A;  2AL5 A;  2HZL A;  1IEJ A;  2QMW A;  3CSB A;  3FGS A;  2ZYM A;  4OEV A;  4XKN A;  3FVO A;  3HCQ A;  4OMB A;  4IO3 A;  4X48 A;  3SEY A;  3IK6 B;  1B3F A;  2DQV A;  1A8E A;  2YJP A;  5KDT A;  3FJG A;  1LAG E;  1Y1Z A;  2F7B A;  2YPN A;  3OEL A;  3ZSF A;  5TPA B;  4ECF A;  3TTM A;  4YMB A;  3TKD A;  3GBA A;  3TDJ A;  1WVJ A;  4H5G A;  5H8N B;  5IAI A;  5DEX B;  1HSE A;  1IXG A;  1SW1 A;  1SW5 A;  2UVI A;  1XT8 A;  1O7T A;  3PUV E;  3G3K A;  4N07 A;  4PQJ A;  5EHS A;  4ZEB A;  4F18 A;  5CBS A;  3OEN A;  4LZ8 A;  2FYI A;  4MH5 A;  4ND9 A;  2F7A A;  1N04 A;  3CFZ A;  4QSE A;  5H8H B;  3T9V A;  2RCA A;  4IGR A;  1USY H;  1URS A;  5DVF A;  3IJX B;  2XD2 A;  3MAM A;  3PD8 A;  1P1O A;  4KD5 A;  2XXT A;  1M5B A;  2A5T B;  3A09 A;  3B6Q A;  3CIJ A;  1Q1K A;  2Z22 A;  3A3U A;  3O97 A;  3V5A A;  5BUU A;  5CMK A;  2F6G A;  2Y7W A;  2X7P A;  2H4I A;  3R7X A;  3U93 A;  4NF5 A;  4H6D A;  1IIT A;  3C34 A;  4YKJ A;  5L9O A;  2GFE A;  1RYX A;  4YIC A;  3V8X B;  2Q2A A;  4EQ7 A;  1IZ1 A;  1FQF A;  2VP1 A;  5J1D A;  1LAH E;  3KOS A;  1N3W A;  4O3B A;  3HPI A;  2Z8E A;  2O7U A;  4PP0 A;  4UAC A;  1OMP A;  4DXB A;  1CE2 A;  3KOT A;  3PPP A;  1S9T A;  3EHS A;  3PMX A;  3OSR A;  3Q27 A;  3FAS A;  2Q2C A;  3OO9 A;  1PB9 A;  1PC3 A;  1QUL A;  2QRY A;  3MZ1 A;  4POX A;  1UIU A;  3RT6 B;  4DXC A;  2P0S A;  1Y3N A;  2HAU A;  2Z8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...