3VVDA

Crystal structure of ttc0807 complexed with ornithine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
241
structure length
241
Chain Sequence
GGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, binding protein
publication title Two ATP-Binding Cassette Transporters Involved in (S)-2-Aminoethyl-Cysteine Uptake in Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 89
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvdA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vvdA02
1OVBA 3V89B 2I4BA 2RC9A 4GOTA 4YB7A 2Q88A 1UQWA 4I1DA 1I6QA 3TCGA 5L9OA 4QF9A 1IZ1A 4H67A 4X1BA 4XXUA 2VD2A 4GLIA 3MC2A 5H8HA 4RYAA 1RYXA 3OD7A 4GVOA 4U2RA 4RPNA 3H4ZA 1FQAA 3K00A 4Q5TA 4R2FA 4OWDA 4ELOA 4ISUA 1IXGA 3FVNA 2UVJA 1HSLA 1A8FA 3ONMA 4IY5A 2AL4A 1LBBA 3Q28A 3ZSFA 4ZEBA 3SEUA 1YAEA 2XXIA 2F34A 1LLSA 2UYEA 3O6GA 2PT1A 3UORA 3G3GA 3HN0A 4F2QA 1Q1KA 4AB6A 3RTFB 3T9VA 3L6GA 4G2ZA 4X1DA 3MBPA 1AL3A 4MBPA 1EZOA 3H7MA 1H44A 1VR5A 1H45A 3G3HA 4LUBA 3FATA 3GLBA 4P0GA 1DPEA 4DCXA 5KCJB 1CE2A 2F5XA 3I3VA 2O1MA 1OLCA 1UIVA 3H6WA 3KEIA 3USDA 1JW1A 1FTJA 2Y7WA 4R73A 1SD3A 2XXVA 4IGRA 3R7XA 1A40A 3CRBA 5AA4B 1GTKA 2XXQA 4MH5A 3K4UA 1MY0A 3SETA 3VXCA 3HHFA 5H8SA 1P1WA 2UVHA 3OENA 3UIFA 4TLMB 2BJJX 3KZGA 3O28A 2OLBA 4KD5A 3K6WA 5CMKA 4NE4A 2ZMBA 5I56A 1Y3QA 4RXLA 2E1SA 4JWYA 4H65A 2I49A 4ESWA 1B4ZA 2XD2A 1Z7ME 3C4MA 4LA9A 3RT6B 4F19A 2F78A 4GIZA 4F3SA 3TMGA 1MQIA 4H0WA 4JBZA 4BDLA 1B46A 2PMSA 3CIJA 2DE3A 3O6HA 4N07A 3OOAA 4FATA 4G8HA 2I0CA 3I6VA 3U94A 2M8CA 4KFQA 4F2OA 3FV1A 1B1XA 1BP5A 2QL3A 1S7YA 4FE8A 2V93A 1B5IA 3K02A 5AE4A 1FTKA 3CSGA 4JSOA 1LGBC 4OFOA 5H8NB 3VLUA 4XKRA 1B5HA 2XXWA 5BWJA 4ELQA 4C0RA 3OEKA 1H76A 5J1DA 2D5WA 4YZZA 2PBWA 3PPPA 4XIGQ 3QXMA 3VXBA 4F39A 3KN8A 4R9FA 3T93B 3JV9A 3LSXA 1B3HA 3EF7A 3HPIA 1B9JA 3UK4A 2XXTA 3HV1A 1RKMA 4WEDA 3DP8A 5TPAA 1A7LA 1MS7A 2CMOA 3KFMA 3H6TA 2O6AA 5H8FA 1I6AA 1URSA 1N3WA 3M8UA 4HCWA 4KCDA 1SW4A 3Q26A 4BDQA 4YICA 4F22A 2I48A 1FW0A 1OMPA 3QK6A 2V3UA 4BDNA 4QFKA 2A5TB 4N6PA 3DLNA 4F29A 3VE1B 3BFUA 3S9MC 2UYFA 5I57B 3OELA 5DEXB 1XT8A 3CFZA 1YCJA 4LZ8A 1FTOA 1POY1 1SYHA 3THIA 4Q0CA 4GF8A 3V8XB 1OQHA 3MPKA 4FJPA 4KPTA 1II5A 2GHAA 2P1SA 3TTMA 3EHTA 1B0HA 3MQ9A 4ZZEA 4GFRA 2PVUA 3O9PA 3A3UA 2F7CA 3QUJA 2Y7PA 4PE5B 3FGSA 4QSDA 1D9VA 3RTWB 1ZTYA 1Q35A 3BFTA 3EN3A 1B7UA 3ZKKA 3H6VA 1XC1A 3OXNA 3FJMA 1OIBA 3IOVA 4DXCA 3H03A 2O51A 5KZTA 4PFWA 4H5GA 3FJGA 1A99A 1SQYA 1T0KA 3EHUA 3PUWE 1VSOA 2H5YA 3PU5A 4KYEA 1O7TA 2B3BA 1IUDA 3PV0E 2VD3A 1URGA 4THIA 3T22A 4IO6A 2Z22A 2GRVA 2XXHA 1JW5A 2HZLA 5I2KB 1IXHA 4KHZE 3Q29A 1MXUA 2DQVA 2F6PA 5DVIA 5EHSA 2DWIA 5JTYB 1P1UA 1B32A 3C32A 2HXWA 3FJ7A 1USYE 3TAJA 4E0WA 4QHQA 2AL5A 4ONYA 2OWSA 4DCYA 5M2VA 3L6HA 4O3CA 2AIXA 4BDOA 2Q89A 1JQFA 4NF6A 1PDAA 2F8DA 4G4PA 5H8QB 1SW2A 4NWCA 1UTBA 3O29A 2DXRA 2ZNTA 4G77A 2XXRA 1EZPA 2O69A 4I8CA 1VFDA 1AIVA 1MQHA 4LONB 4UACA 1GR2A 1FQEA 1MDQA 2ANJA 3C33A 3RQTA 5EHMA 4WEPA 1ZBMA 4X48A 4UA8A 1YPNA 4OEUA 4PP0A 2Q2CA 2ZNUA 3CSBA 3KG2A 2RC7A 2DWJA 3VVDA 3CR9A 4C1UA 4PFUA 5ITOA 4PQJA 5IKBA 3Q25A 1Y4CA 3RUMA 2DVCA 4IO5A 2QS4A 3SDFA 5I84A 1DSNA 2Y7KA 1HSJA 2RF1A 1P99A 1FQDA 4PETA 4G8NA 1ZU0A 3MUQA 5ISUA 1O64A 3MP8A 4XTCQ 1VFEA 4NEDA 2D21A 4U23A 5AA2A 3K1PA 1PC3A 3MVZA 5DVFA 3TODA 3I5OA 3DP4A 1B2HA 2DWHA 1LSTA 1PEBA 2XX8A 4GQOA 3MVYA 4QRZA 1ZKBA 3OO7A 4NF4B 4U4XA 4KCCA 1MXZA 4ZEKA 4I62A 3IOWA 1B40A 4WKMA 1US5A 1MQDA 2H9BA 3U93A 4XKNA 5F1QA 5B7DA 3HSTA 1ZLQA 3IB1A 3WAFA 1CB6A 2RC8A 2NOOA 1B7ZA 2HAVA 4NF5B 4GD5A 5ICTA 1MH4A 4YU0A 2XXUA 3W9VA 4WXJA 4C1TA 4R74A 3A3CA 4JDFA 3E4RA 1UTHA 2PT2A 2QS3A 3IL1B 5FTHA 3IR1A 1A8EA 1MQJA 3KSJA 5CRYA 1BKAA 2UXAA 4FECA 4U22A 1OLAA 2R71A 2H99A 2ONRA 3PUXE 1TXFA 5L8DA 1MXYA 4FEBA 1PBPA 4NF8B 3RY3A 2DSFA 2I6EA 2XXYA 2Z8DA 3SERA 4ELPA 4OETA 1TFDA 4F1VA 5IAIA 4O3AA 2X7PA 2HAUA 2OZZA 5KDTB 3TKDA 1QKAA 2VP1A 3LR1A 4TQUQ 1FTLA 2FA7A 5FHNA 2DE4A 2ZYMA 2REJA 4RY1A 3OO9A 4KR5A 1XS5A 2Z8EA 3S9LC 3E9XA 2QPQA 5TP9B 4Q8RA 1Y9UA 4YKKA 5I59B 5CBRA 1QJMA 5F7VA 3B6QA 4F3BA 5I58A 1D4NA 2RKMA 2F7AA 5EYFA 2Z23A 3FVGA 1RYOA 2F6GA 3LSWA 4EQBA 3C35A 3O2AA 3VVEA 3G3FA 2V3TA 1Y1MA 2Z8FA 1P1OA 1SDXA 4YB5A 1FQCA 3FXQA 5KCJA 2F36A 1SI1A 2O68A 4ZZAA 5A5XB 2ZNSA 4GXSB 1Y3PA 1AOVA 4FAJA 1LCFA 3DELB 1MDP1 2YLNA 4G8MA 3TQWA 5CMBA 1DPPA 3U92A 1TWYA 4IGTA 3OMBA 3KOTA 4ESXA 4OVJA 3U72A 3VDFA 4M4GA 1GVCA 3MW0A 4MLVA 1LCTA 3IK6B 4H8IA 4R72A 2YJPA 4OENA 3TTRA 3VLWA 1MM6A 1HSEA 3PD9A 3IO4A 3DM0A 3P7IA 4BDRA 4U1ZA 1MY2A 3G3JA 3IOUA 4H1XA 1PB8A 3TTNA 4DLDA 2I0BA 1MXXA 3TDJA 3ZKLA 4JWOA 1PBQA 4Z0IA 3RT8A 1D9YA 4LZ7A 3ODBA 3FXRA 1NNTA 1B3LA 1AMFA 4GWOA 5H8NA 2DWAA 1BIYA 4EXKA 3O66A 1SW1A 1QKBA 4KI0E 4IO7A 2NXOA 1NNFA 4XKPA 5DYHA 3MVWA 5LOMA 2GFEA 2R6GE 2ONKE 2QMWA 3A09A 4IO3A 3KJTA 4EF2A 4RJZA 3FXUA 1IEJA 4BDMA 1JVYA 5BUUA 1ZJLA 1IITA 1Z7NE 2Y84A 4POXA 1MXVA 3N26A 4OTEA 3FD3A 5FHOA 3VV5A 4G68B 3PPNA 5I2NB 1FTMA 4XKQA 2WKYA 1EZ9A 4PFYA 2OCUA 1KWHA 3DP6A 4DDDA 1B4HA 3TELA 2OWTA 4EDPA 5CMCA 3LSFB 4ZEIA 3MJNA 2A5TA 3H6UA 4OESA 3MPLA 3MWBA 4YAHX 3UN6A 3M3FA 2O7IA 1H43A 3IORA 4TOZA 3IX1A 5I57A 2DVZA 5DEXA 3TTLA 1R9LA 2F7BA 1TT1A 4RNSA 2P2AA 3LSLA 4KQPA 4OYVA 3PMVA 4TLLB 1J1NA 1MM7A 1R1NA 3B6TA 3GZGA 3HO7A 1L5TA 3TEPA 4K3FA 4LATA 1JW4A 5DT6A 3TYHA 4OMBA 1S9TA 3CVGA 3T9UA 1LBCA 4R6YA 3S4UA 2O7UA 2NWJA 2H98A 3KGCA 4U1OA 4I9DA 2HQ0A 1N0TA 3GXAA 5AA1A 2UVIA 1USYH 4H6DA 2E0SA 1P1QA 3TTKA 4AB5A 2THIA 2RCBA 3M3LA 3VVFA 3K1MA 2ONSA 5I2KA 4FORA 5H8HB 4YB6A 4QFLA 5JTYA 4LP2B 2IEEA 2DS9A 2QMXA 2PX1A 3TCFA 1FQFA 1URDA 1PB7A 1SBPA 1NMUA 2VGQA 4OFLA 1B0LA 4F18A 1M5BA 2QSXA 3M3KA 2V3QA 1MG1A 3D4GA 2I58A 4KYDA 2W7YA 1LB9A 4IY6A 5H8QA 4R6HA 2QS1A 3Q27A 3C36A 1NKXA 1SVXB 2O1LA 4EQ9A 4OEVA 4EQ7A 4HW8A 3VFJA 3RN8A 1DOTA 1N04A 4RK2A 4QFPA 3ILUB 4EF1A 3T96B 4R6KA 4YKPA 1Y1ZA 4GXAA 2DE2A 1I6BA 4DZ1A 1R9QA 2DXYA 3HHGA 3N6UA 2ZXTA 2OK2A 4F3PA 3MZ1A 3EHSA 3T9XB 1WODA 4ECFA 2A5SA 3E13X 4NWDA 1NFTA 2Y7RA 1QUIA 2H4IA 5DTBA 1OVTA 1B3GA 3MP6A 4OERA 3PUVE 4OXVA 5AA2D 2RINA 4JWXA 1FQBA 3G3KA 3AXFA 2Q9TA 4YKIA 5I56B 4ZDMA 4ELRA 4RA1A 2ZYOA 2P0SA 5CBSA 2O84X 3CFXA 3UA8A 2DP8A 4POWA 1B05A 3PUYE 2HZKA 3K01A 5I58B 2FNCA 2F35A 3MZBA 1B6HA 2ABHA 3S2VA 1Y20A 3W9WA 3FIRA 2I3VA 4ZEFA 4NF4A 4N13A 2NVUB 4F1YA 4JXIA 3FUZA 3ILTB 3PPOA 1R6ZA 3OO6A 2G29A 4AQ4A 3IO6A 4PFTA 1ANFA 3MVXA 1MY3A 3KBRA 3C9HA 4EUOA 4FEDA 3OO8A 4QSEA 4EXLA 3R6UA 2FYIA 3EPEA 4LZ5A 1LB8A 3K6XA 4LQ5A 5JK4A 3FV2A 4NF5A 1JETA 4DXUA 4JSDA 1B3EA 1POTA 1LFHA 2LAOA 2D3IA 4F3GA 2Y7IA 3D4CA 1N7WA 3EQ1A 5TPAB 1QVSA 4MF3A 3UGWA 3V83A 3CFLA 1A55A 5H8FB 3B7DA 1YTVA 2PYYA 3E3KA 1QULA 4E0XA 2XHDA 4QFNA 3K0VA 4HS7A 4H5FA 2UVGA 4NF8A 1DMBA 3K2DA 1XHYA 2AYSA 3G3IA 2GHBA 4ZEDA 4YMAA 5AA4A 2X26A 4OQOA 1MRPA 5CC2A 3JYRA 3MP1A 2VHAA 3PPRA 1B58A 4MFIA 5KDTA 1B1HA 2B65A 3TFLA 1S50A 1Y4TA 1LFIA 1BTJA 5AA3A 2XXXA 3PMWA 3PGFA 2VOZA 4RK9A 2I3WA 1US4A 4BLAA 4NMYA 5FHMA 3N5LA 3SKPA 2HFBA 3SEXA 1MPDA 4G68C 3B6WA 2GH9A 2B3FA 5TP9A 1H3DA 5I59A 3IAZA 4ZE9A 5CM6A 3N94A 1EH3A 1NNKA 5HPQA 1NNPA 1LAGE 2XD3A 4F1UA 4F31B 4GL8A 3FVKA 3K6UA 2H25A 4DXBA 3PUZE 2HCAA 5HBCA 1NL5A 2QJEA 1AH5A 1IXIA 3BKIB 1N7XA 1JEVA 1O63A 4DE8A 3IOTA 5B70A 1LAFE 5A5XA 4GRKA 1SYIA 2IA4A 3KJ7A 2NUVA 1P1NA 1PB9A 1A54A 2ZYKA 4MLQA 1TFAA 1M5DA 3GBAA 3KSXA 3TQLA 5L9SA 1GGGA 4LVQA 2DOJA 1WDNA 3QIMA 2HEUA 4IB2A 5L9MA 1NH8A 1LFGA 4ND9A 4OHNA 2OJTA 1MH3A 4NTLA 4IO2A 3RNNA 5JEIA 1F9BA 3R26A 3KN7A 2F97A 1XVYA 1ELJA 1LAXA 3PD8A 2XX7A 3KOSA 4M1VA 1SI0A 3K6VA 4RPOA 1MQGA 3PMXA 1EU8A 3SEYA 4OFJA 1MPCA 4GL0A 3QYTA 3BBRA 1B5JA 1IXCA 1XOCA 4QSCA 1WVJA 2ZYNA 5K2YA 4YMBA 1ZIUA 2X7QA 2V25A 3U1OA 3C34A 3T9HB 4NF6B 3FASA 2XX9A 3N6TA 3T66A 3H06B 1UTBB 1M5FA 2QS2A 4KYSA 4U4SA 4IO4A 1MY4A 1BLFA 2I4CA 3F11A 3C31A 3LBSA 1QUKA 4FIMA 3RPWA 5ELVA 4Q30B 2R9JA 1M5CA 4P0IA 2REGA 1IIWA 1XVXA 3K1NA 4R2BA 1UIUA 3VLVA 3ECRA 1SW5A 3H3GA 3TPAA 5CI5A 1QW0A 2V84A 1B51A 3CG1A 1N84A 4R75A 1DTZA 3U8QA 5K2XA 3GBBA 3QUFA 2XXPA 1D3KA 3CI8A 3O97A 5FTIA 1I69A 4P11A 1N76A 5ICQA 2CZLA 4HTGA 2G93A 4G68A 5I2NA 1B52A 3TCHA 5CMMA 3QAXA 1N3XA 3KN3A 1OQGA 2Q2AA 4OZ9A 4YKJA 2KLFA 2ALUA 3TUSA 5ITPA 3WAEA 3OEMA 1ZMGA 4DIGA 4QFOA 3RGYA 4ZE8A 4H8JA 1MY1A 3OSQA 4JB7A 3ZS6A 4X9TA 3PPQA 5DVJA 5AA2B 4Z7EA 1DTGA 4O3BA 3MZ9A 1B7HA 4ZECA 1M5EA 1MXWA 2YPNA 3O6IA 3OSRA 3G7WA 4LQ2A 3IB2A 3FVOA 1IQ7A 1FCKA 3S9EA 4HCYA 3RLFE 1Y3NA 3LC8A 3JZJA 3MAMA 1LAHE 1MPBA 1JEUA 3SESA 1JVXA 3S9NC 3W15C 2OBGA 3V5AA 1ATGA 5TU0A 3QSLA 4ZS9A 1JNFA 3IB0A 3TZAA 1NH7A 2RCAA 3SEVA 3UP9A 4U21A 3IJXB 3IJOB 3LUYA 2DYXA 3HCQA 3FZVA 4R9GA 2Q8JA 1B3FA 4L17A 2QRYA 3CG3A 1QUJA 1UTHB 1GV8A 3SEWA 2ESNA 1VE4A 5HM4B
chains in the Genus database with same CATH superfamily
1OVBA 3V89B 2I4BA 2RC9A 4GOTA 4YB7A 2Q88A 1UQWA 4FBPA 4I1DA 1I6QA 4I3EA 3TCGA 5L9OA 4QF9A 1IZ1A 4H67A 4X1BA 4XXUA 2VD2A 4GLIA 3MC2A 1KA0A 5H8HA 4RYAA 1RYXA 3OD7A 4GVOA 4OVRA 4U2RA 4MMPA 4RPNA 3H4ZA 1FQAA 1FBHA 3K00A 4Q5TA 4R2FA 4OWDA 4ELOA 4ISUA 1NI9A 1IXGA 3FVNA 2UVJA 1HSLA 1A8FA 3ONMA 4IY5A 2AL4A 1LBBA 3Q28A 3ZSFA 4ZEBA 3SEUA 1YAEA 2XXIA 2F34A 1LLSA 2UYEA 4MJOA 3O6GA 2PT1A 3UORA 3G3GA 4PCDA 3HN0A 4F2QA 1Q1KA 4AB6A 3RTFB 1SPIA 3T9VA 3L6GA 4G2ZA 4X1DA 3MBPA 1AL3A 4MBPA 1EZOA 4DI4B 3H7MA 1H44A 1VR5A 1H45A 3G3HA 4LUBA 3FATA 3GLBA 4P0GA 1DPEA 4DCXA 5KCJB 1CE2A 2F5XA 3I3VA 2O1MA 1OLCA 1UIVA 3H6WA 3KEIA 3USDA 1JW1A 1FTJA 2Y7WA 4R73A 1SD3A 2XXVA 4I40A 4IGRA 3R7XA 1A40A 3CRBA 5AA4B 1GTKA 2XXQA 4MH5A 3K4UA 1MY0A 3SETA 3VXCA 3HHFA 5H8SA 1P1WA 2UVHA 3OENA 3UIFA 4TLMB 2BJJX 2FHYA 3KZGA 2OLBA 3O28A 4N17A 4KD5A 3K6WA 5CMKA 4NE4A 2ZMBA 4MNIA 3KBZA 5I56A 2VPNA 1Y3QA 2XA5A 4RXLA 2E1SA 2HHMA 4JWYA 4H65A 2I49A 4ESWA 1B4ZA 2XD2A 4NX1A 1Z7ME 3C4MA 4LA9A 3RT6B 4F19A 2F78A 4GIZA 4F3SA 3TMGA 4QBAA 1MQIA 4H0WA 4JBZA 4BDLA 1B46A 2PMSA 3CIJA 2DE3A 3O6HA 4N6KA 4N07A 3OOAA 4FATA 4G8HA 2I0CA 3I6VA 3U94A 2M8CA 4KFQA 2CEYA 4O7MA 4F2OA 3FV1A 1B1XA 1BP5A 2QL3A 1S7YA 4FE8A 2V93A 1B5IA 3K02A 4N15A 3RPLA 5AE4A 4HE0A 1FTKA 1NUZA 3CSGA 4JSOA 1LGBC 4MIJA 4N91A 1EYIA 4LN5A 4OFOA 5H8NB 3VLUA 3U65A 4XKRA 1B5HA 2XXWA 5BWJA 4ELQA 2FBPA 4C0RA 3OEKA 1H76A 5J1DA 2D5WA 4YZZA 2PBWA 3PPPA 4MX6A 2R8TA 1NUXA 4XIGQ 3QXMA 1D9QA 4GBVA 3VXBA 4F39A 3KN8A 4R9FA 2XXKA 3T93B 3JV9A 3LSXA 1B3HA 3EF7A 3HPIA 1B9JA 5IZ3A 3UK4A 2XXTA 3HV1A 1RKMA 4WEDA 3DP8A 5TPAA 1A7LA 1NV7A 1MS7A 2CMOA 5F24A 3KFMA 3PTYA 3H6TA 4NHBA 2O6AA 1FBDA 5H8FA 4NQ8A 1I6AA 1URSA 1N3WA 3M8UA 4HCWA 4KCDA 1K9YA 1SW4A 3Q26A 4BDQA 4YICA 4F22A 2I48A 1FW0A 1OMPA 3IFCA 2V3UA 3QK6A 4BDNA 5I7IA 4QFKA 2A5TB 3KC0A 2F3DA 4N6PA 3DLNA 4F29A 3VE1B 3BFUA 3S9MC 2UYFA 5I57B 3OELA 5DEXB 1XT8A 3CFZA 1YCJA 4LZ8A 1FTOA 2P3VA 1POY1 1SYHA 3THIA 3KC1A 4Q0CA 4GF8A 3V8XB 1OQHA 3MPKA 4FJPA 4KPTA 1II5A 2GHAA 5ET7A 2P1SA 2P3NA 3TTMA 1LBVA 3EHTA 1B0HA 3MQ9A 1KA1A 4ZZEA 2Q74A 4GFRA 2PVUA 3O9PA 3A3UA 2F7CA 3QUJA 2BJIA 2Y7PA 4PE5B 2F3BA 3FGSA 4IR8A 4QSDA 1D9VA 3RTWB 1ZTYA 1Q35A 3BFTA 3EN3A 1B7UA 3ZKKA 3H6VA 1XC1A 1K9ZA 3OXNA 3FJMA 1OIBA 3IOVA 3FXBA 4MEVA 4DXCA 2B4LA 3H03A 2O51A 5KZTA 4OVSA 4PFWA 4H5GA 1LEVA 3FJGA 1A99A 1SQYA 1T0KA 3EHUA 4PBHA 3PUWE 1VSOA 2H5YA 2XWIA 3PU5A 4KYEA 1O7TA 2B3BA 4GWUA 1IUDA 3PV0E 2VD3A 1URGA 4THIA 3T22A 4IO6A 2Z22A 2GRVA 2XXHA 1JW5A 2HZLA 5I2KB 1IXHA 4KHZE 3Q29A 1MXUA 2DQVA 2F6PA 5DVIA 5EHSA 2DWIA 5JTYB 1P1UA 1B32A 3C32A 2HXWA 3FJ7A 1USYE 3TAJA 4E0WA 4QHQA 2AL5A 4ONYA 2OWSA 4DCYA 5M2VA 3L6HA 4O3CA 2AIXA 4BDOA 2Q89A 1JQFA 4NF6A 1PDAA 2F8DA 4G4PA 5H8QB 1SW2A 4NWCA 4PAFA 1UTBA 3O29A 5IZZA 2DXRA 2ZNTA 4G77A 2XXRA 5FBPA 4X04A 1EZPA 2O69A 4I8CA 1VFDA 1AIVA 1MQHA 4LONB 4UACA 1GR2A 1FQEA 1MDQA 5A5LA 2ANJA 3C33A 3RQTA 5EHMA 4WEPA 4GWWA 1ZBMA 4X48A 4UA8A 1YPNA 1LBWA 4OEUA 4PP0A 2Q2CA 2ZNUA 3CSBA 3KG2A 2RC7A 2DWJA 3VVDA 4NGUA 3T1BA 2DDKA 3CR9A 4G61A 4O94A 4C1UA 4PFUA 3BIGA 5ITOA 4XFEA 3MYUA 1FPBA 4PQJA 5IKBA 2JJKA 2Q8MA 4JVCA 2XWVA 4MNPA 3Q25A 1Y4CA 3RUMA 2DVCA 4IO5A 2QS4A 3SDFA 5I84A 1DSNA 2Y7KA 5I3SA 1HSJA 2RF1A 1P99A 1FQDA 4PETA 4G8NA 1INPA 1ZU0A 3MUQA 5ISUA 1O64A 4JVDA 3MP8A 1FRPA 4XTCQ 3NOHA 1VFEA 4NEDA 2D21A 4PGNA 4U23A 5AA2A 3K1PA 1PC3A 3MVZA 5DVFA 4PDHA 3TODA 3IFAA 3I5OA 1FTAA 3DP4A 1B2HA 2DWHA 1LSTA 1PEBA 2XX8A 4GQOA 3MVYA 4QRZA 1ZKBA 3OO7A 4NF4B 4U4XA 4KCCA 1MXZA 4ZEKA 4I62A 3IOWA 1B40A 4WKMA 5ET8A 2ZZWA 1US5A 1MQDA 4JVIA 2H9BA 1FPKA 3U93A 4XKNA 1CNQA 5F1QA 1NV2A 5B7DA 4OVPA 3HSTA 1ZLQA 4PF6A 2ZZVA 3IB1A 3WAFA 1CB6A 2RC8A 2NOOA 1B7ZA 1NUYA 2HAVA 2XWOA 4NF5B 2PCRA 4GD5A 5ICTA 1MH4A 4YU0A 2XXUA 3W9VA 4WXJA 4C1TA 4R74A 3A3CA 5EYHA 4JDFA 5IM2A 3E4RA 1UTHA 2PT2A 2QS3A 3IL1B 2WBBA 1NV4A 5FTHA 3IR1A 1A8EA 1DCUA 1MQJA 3MSTA 3KSJA 5CRYA 4OVTA 1BKAA 2UXAA 4FECA 4U22A 1OLAA 2R71A 2H99A 2ONRA 1NV6A 3PUXE 4MNCA 1TXFA 5L8DA 1MXYA 4FEBA 1PBPA 4NF8B 3RY3A 2DSFA 2WYPA 2I6EA 2XXYA 1FSAA 2Z8DA 3SERA 4ELPA 4OETA 1TFDA 3LV0A 4F1VA 5IAIA 4O3AA 2X7PA 2HAUA 2OZZA 5KDTB 3TKDA 1QKAA 2VP1A 3LR1A 4TQUQ 3FBPA 1FTLA 2FA7A 1FPFA 5FHNA 2DE4A 4P1LA 2ZYMA 2REJA 4RY1A 3OO9A 4KR5A 4N6DA 1XS5A 2Z8EA 5EYGA 3S9LC 3E9XA 4PF8A 2QPQA 5TP9B 2PFZA 4Q8RA 1Y9UA 4YKKA 5I59B 5CBRA 1QJMA 5F7VA 3B6QA 4F3BA 5I58A 1D4NA 2RKMA 2F7AA 5EYFA 2Z23A 3FVGA 1RYOA 2F6GA 3LSWA 4EQBA 3C35A 3O2AA 3VVEA 3G3FA 2V3TA 1Y1MA 2Z8FA 1P1OA 1SDXA 4YB5A 1FQCA 3FXQA 5KCJA 2F36A 1SI1A 2O68A 4ZZAA 5A5XB 2ZNSA 4GXSB 1Y3PA 1NV0A 1AOVA 4FAJA 1LCFA 3DELB 1MDP1 2YLNA 4G8MA 3TQWA 5CMBA 1DPPA 1LBXA 3U92A 1TWYA 4IGTA 3OMBA 1FBEA 3KOTA 4ESXA 4OVJA 3U72A 3VDFA 4M4GA 3B8BA 1GVCA 3MW0A 4MLVA 1RDZA 1LCTA 3IK6B 4H8IA 4R72A 2YJPA 4OENA 3TTRA 3VLWA 4H46A 1MM6A 2CEXA 1HSEA 1NV1A 3PD9A 3IO4A 3DM0A 3P7IA 4BDRA 5ET5A 4U1ZA 1MY2A 3G3JA 3IOUA 4H1XA 1QGXA 1PB8A 3TTNA 4DLDA 2I0BA 4DI3D 1MXXA 3TDJA 3ZKLA 4JWOA 4GWSA 1PBQA 4Z0IA 3RT8A 4GX4A 5IGAA 1FPGA 1D9YA 5DW8A 4LZ7A 3ODBA 3FXRA 1NNTA 1B3LA 1AMFA 1BK4A 4GWOA 5H8NA 2DWAA 1BIYA 4EXKA 3O66A 4MAGA 1SW1A 1QKBA 4KI0E 4PFBA 4IO7A 2NXOA 1NNFA 4XKPA 5DYHA 3MVWA 5LOMA 2GFEA 2R6GE 2ONKE 4O8MA 2QMWA 3A09A 4IO3A 3KJTA 4EF2A 4RJZA 3FXUA 1IEJA 4BDMA 1JVYA 5BUUA 3SZPA 1ZJLA 1EYJA 2WBDA 1IITA 1Q9DA 1Z7NE 4PGPA 2Y84A 4OANA 4POXA 1LBZA 1MXVA 3N26A 4OTEA 3FD3A 5FHOA 3ROJA 3VV5A 5LTCA 4MCOA 4G68B 3PPNA 5I2NB 1FTMA 4XKQA 2WKYA 1EZ9A 3EKIA 4PFYA 2OCUA 1KWHA 4P9KA 3DP6A 4DDDA 1B4HA 3TELA 2OWTA 4EDPA 5CMCA 3LSFB 4QXDA 4ZEIA 3MJNA 2A5TA 1YXIA 3H6UA 4OESA 3MPLA 3MWBA 4YAHX 3UN6A 3M3FA 5LDZA 2O7IA 1H43A 4XF5A 1FPLA 3IORA 4TOZA 3IX1A 5I57A 2DVZA 5DEXA 3TTLA 1DBZA 1R9LA 4NAPA 1IMFA 4UABA 2F7BA 1TT1A 4RNSA 1IMCA 2P2AA 3LSLA 4KQPA 2XWKA 1FPJA 4OYVA 2WEFA 4GWZA 3ISPA 3PMVA 4TLLB 1J1NA 1MM7A 1R1NA 3B6TA 3GZGA 3HO7A 1L5TA 3TEPA 4K3FA 4LATA 1JW4A 5DT6A 3TYHA 4OMBA 1S9TA 3CVGA 3T9UA 2PFYA 4PE3A 1LBCA 4R6YA 3S4UA 1NUWA 2O7UA 2NWJA 1IMDA 4N8YA 2H98A 3KGCA 4U1OA 4I9DA 4GWYA 2HQ0A 4I3YA 1N0TA 3GXAA 5AA1A 2UVIA 1USYH 4H6DA 2E0SA 1P1QA 3TTKA 5I5PA 4AB5A 2THIA 2RCBA 3M3LA 3VVFA 3K1MA 4PAKA 2ONSA 5I2KA 4FORA 5H8HB 3E79A 3RYDA 4YB6A 4QFLA 5JTYA 4LP2B 2IEEA 2DS9A 2WYKA 2QMXA 2PX1A 3TCFA 1FQFA 4PC9A 1URDA 1PB7A 1SBPA 1FBCA 2CZHA 1NMUA 2V4CA 2VGQA 4OFLA 1B0LA 4F18A 1M5BA 2QSXA 4PFIA 1JP4A 3M3KA 2V3QA 1MG1A 2VPOA 3D4GA 2I58A 4KYDA 2W7YA 1LB9A 4IY6A 5H8QA 4R6HA 2QS1A 1FBFA 3Q27A 3C36A 1NKXA 4P1EA 4OA4A 1IMEA 1LBYA 1SVXB 2O1LA 4EQ9A 4OEVA 4EQ7A 4HW8A 5ESYA 3VFJA 3RN8A 1DOTA 1N04A 1FJ9A 4RK2A 4QFPA 4N8GA 3ILUB 1FJ6A 4EF1A 5EQ7A 3T96B 4R6KA 4YKPA 1Y1ZA 4PBQA 4GXAA 2DE2A 1I6BA 4DZ1A 1R9QA 2DXYA 3HHGA 1IMBA 3N6UA 4GX3A 2VT5A 2ZXTA 2OK2A 3B50A 4GWXA 4F3PA 3MZ1A 3EHSA 3T9XB 1AWBA 1WODA 2QVUA 4ECFA 2A5SA 1DK4A 3E13X 4NWDA 1NFTA 2Y7RA 1QUIA 2H4IA 4PDDA 5DTBA 1OVTA 1B3GA 3MP6A 4OERA 3PUVE 4OXVA 4PAIA 2RINA 5AA2D 4JWXA 1FQBA 3G3KA 4NN3A 3AXFA 2Q9TA 2FVZA 2KQZA 4YKIA 5I56B 4ZDMA 4ELRA 4RA1A 2ZYOA 2P0SA 3BIHA 5CBSA 2O84X 3CFXA 3LUZA 4P47A 3UA8A 2DP8A 4POWA 4N4UA 1B05A 3PUYE 2HZKA 3K01A 5I58B 2FNCA 2F35A 4O7IA 4GBWA 3MZBA 1B6HA 2ABHA 3S2VA 3T0JA 1Y20A 3W9WA 3FIRA 2I3VA 3A29A 4ZEFA 4NF4A 3RPLB 4P3LA 4N13A 2NVUB 4F1YA 4JXIA 3FUZA 3ILTB 3PPOA 1R6ZA 3OO6A 2G29A 4AQ4A 3IO6A 4GX6A 4PFTA 3QMFA 2ZZXA 1ANFA 3MVXA 1MY3A 3KBRA 3C9HA 1YZ0A 4EUOA 4FEDA 3OO8A 4QSEA 4EXLA 3R6UA 2FYIA 3EPEA 4LZ5A 1LB8A 3K6XA 4LQ5A 5JK4A 3FV2A 4NF5A 1FBPA 1JETA 4DXUA 4JSDA 5T3JA 1B3EA 1POTA 1LFHA 4P8BA 5IZ3B 2LAOA 2D3IA 4F3GA 2Y7IA 3D4CA 1N7WA 3EQ1A 5TPAB 1QVSA 2OWZA 4MF3A 1RDYA 3UGWA 3V83A 3CFLA 1A55A 5H8FB 3B7DA 1YTVA 4P56A 2PYYA 4X8RA 3E3KA 1QULA 4E0XA 2XHDA 4QFNA 4MHFA 3K0VA 2Y5LA 4H5FA 4HS7A 2UVGA 4N81A 4OVQA 4NF8A 1DMBA 3K2DA 1XHYA 2AYSA 3G3IA 2GHBA 4ZEDA 4YMAA 5AA4A 2X26A 4OQOA 1MRPA 4HE1A 5CC2A 3JYRA 3MP1A 2VHAA 3PPRA 1B58A 4MFIA 5KDTA 1B1HA 2B65A 3TFLA 1S50A 1Y4TA 1LFIA 1BTJA 5AA3A 2XXXA 3PMWA 3PGFA 2VOZA 3E78A 4RK9A 2I3WA 1US4A 4BLAA 4NMYA 5FHMA 3N5LA 3SKPA 2HFBA 3SEXA 1MPDA 4G68C 3B6WA 2GH9A 2B3FA 5TP9A 2B4MA 1H3DA 5I59A 3IAZA 4ZE9A 5CM6A 3N94A 1EH3A 1NNKA 5HPQA 1NNPA 1LAGE 2XD3A 4F1UA 4F31B 4GL8A 3FVKA 3K6UA 2H25A 4DXBA 3PUZE 2HCAA 5HBCA 1NL5A 2QJEA 1AH5A 4AS4A 1IXIA 3BKIB 1N7XA 1JEVA 1O63A 3D1RA 4DE8A 3IOTA 5B70A 1LAFE 2HPGA 5A5XA 4GRKA 1SYIA 2IA4A 3KJ7A 2NUVA 1P1NA 1PB9A 1A54A 2ZYKA 4MLQA 1TFAA 5EQ9A 1M5DA 2WX9A 3GBAA 3KSXA 3TQLA 5J16A 5L9SA 1GGGA 4LVQA 4NG7A 2L5VA 2DOJA 1WDNA 3QIMA 2HEUA 4IB2A 5L9MA 1NH8A 1LFGA 4ND9A 1RDXA 4OHNA 2OJTA 1MH3A 4NTLA 4IO2A 3RNNA 5JEIA 1F9BA 3R26A 3KN7A 2F97A 1XVYA 1ELJA 1LAXA 3PD8A 4PFRA 1G0HA 2QFLA 2XX7A 3KOSA 4M1VA 1SI0A 3K6VA 4RPOA 1MQGA 3PMXA 1EU8A 3SEYA 4OFJA 1XI6A 2Y5KA 1MPCA 2QVRA 4GL0A 3QYTA 3BBRA 1B5JA 2GQ1A 1IXCA 1XOCA 4QSCA 1WVJA 2ZYNA 5K2YA 5ET6A 4YMBA 1ZIUA 2X7QA 2V25A 1IMAA 3U1OA 5EQAA 3C34A 3T9HB 4NF6B 3FASA 2XX9A 3N6TA 3T66A 2QVVA 3H06B 4HXVA 1UTBB 1M5FA 2QS2A 4KYSA 4U4SA 4IO4A 1MY4A 1BLFA 2I4CA 3F11A 3C31A 3LBSA 4NF0A 1FBGA 1QUKA 4FIMA 4XEQA 3RPWA 5ELVA 4Q30B 2R9JA 1M5CA 4P0IA 2REGA 1IIWA 3CHGA 1XVXA 3K1NA 4R2BA 1UIUA 3VLVA 3ECRA 1SW5A 3H3GA 3TPAA 5CI5A 1QW0A 2V84A 1B51A 3CG1A 1N84A 4R75A 1DTZA 3U8QA 5K2XA 3GBBA 3QUFA 2XXPA 1D3KA 3CI8A 3O97A 5FTIA 1I69A 4P11A 2KR0A 1N76A 5ICQA 2CZLA 4HTGA 5EQ8A 2G93A 4G68A 5I2NA 1B52A 3TCHA 5CMMA 3QAXA 1N3XA 3KN3A 1OQGA 5IZ1A 2Q2AA 4OZ9A 4YKJA 2KLFA 3HFUA 2ALUA 3TUSA 5ITPA 3WAEA 1NV5A 3OEMA 1ZMGA 4DIGA 4QFOA 3RGYA 4ZE8A 4H8JA 1MY1A 3OSQA 2MKZA 4JB7A 3ZS6A 1G0IA 4X9TA 3PPQA 2FIXA 3GYYA 2CZKA 5DVJA 1FPDA 5AA2B 4Z7EA 1DTGA 4O3BA 3MZ9A 1B7HA 4KXPA 4ZECA 1M5EA 1MXWA 2YPNA 1NV3A 3O6IA 4H45A 3OSRA 3G7WA 4LQ2A 3IB2A 3FVOA 1IQ7A 1FCKA 3S9EA 4HCYA 2OX3A 3RLFE 2HXRA 1FPEA 1Y3NA 3LC8A 3JZJA 3MAMA 1LAHE 1MPBA 2FIEA 1JEUA 4HE2A 3SESA 1JVXA 3S9NC 3W15C 1FPIA 2OBGA 1VDWA 3V5AA 1ATGA 5TU0A 3QSLA 4ZS9A 1JNFA 3IB0A 3TZAA 1NH7A 2RCAA 3SEVA 3UP9A 4U21A 3IJXB 3IJOB 3LUYA 2DYXA 3HCQA 4AS5A 2CZIA 3FZVA 4R9GA 1EYKA 1YYZA 2Q8JA 1B3FA 4L17A 2QRYA 1KZ8A 3CG3A 4PTKA 1QUJA 1UTHB 1GV8A 3SEWA 2ESNA 1VE4A 5HM4B
chains in the Genus database with same CATH topology
1OVBA 3V89B 2I4BA 2RC9A 4GOTA 4YB7A 2Q88A 1UQWA 4I1DA 1I6QA 3TCGA 5L9OA 4QF9A 1IZ1A 4H67A 4X1BA 4XXUA 2VD2A 4GLIA 3MC2A 5H8HA 4RYAA 1RYXA 3OD7A 4GVOA 4U2RA 4RPNA 3H4ZA 1FQAA 3K00A 4Q5TA 4R2FA 4OWDA 4ELOA 4ISUA 1IXGA 3FVNA 2UVJA 1HSLA 1A8FA 3ONMA 4IY5A 2AL4A 1LBBA 3Q28A 3ZSFA 4ZEBA 3SEUA 1YAEA 2XXIA 2F34A 1LLSA 2UYEA 3O6GA 2PT1A 3UORA 3G3GA 3HN0A 4F2QA 1Q1KA 4AB6A 3RTFB 3T9VA 3L6GA 4G2ZA 4X1DA 3MBPA 1AL3A 4MBPA 1EZOA 3H7MA 1H44A 1VR5A 1H45A 3G3HA 4LUBA 3FATA 3GLBA 4P0GA 1DPEA 4DCXA 5KCJB 1CE2A 2F5XA 3I3VA 2O1MA 1OLCA 1UIVA 3H6WA 3KEIA 3USDA 1JW1A 1FTJA 2Y7WA 4R73A 1SD3A 2XXVA 4IGRA 3R7XA 1A40A 3CRBA 5AA4B 1GTKA 2XXQA 4MH5A 3K4UA 1MY0A 3SETA 3VXCA 3HHFA 5H8SA 1P1WA 2UVHA 3OENA 3UIFA 4TLMB 2BJJX 3KZGA 3O28A 2OLBA 4KD5A 3K6WA 5CMKA 4NE4A 2ZMBA 5I56A 1Y3QA 4RXLA 2E1SA 4JWYA 4H65A 2I49A 4ESWA 1B4ZA 2XD2A 1Z7ME 3C4MA 4LA9A 3RT6B 4F19A 2F78A 4GIZA 4F3SA 3TMGA 1MQIA 4H0WA 4JBZA 4BDLA 1B46A 2PMSA 3CIJA 2DE3A 3O6HA 4N07A 3OOAA 4FATA 4G8HA 2I0CA 3I6VA 3U94A 2M8CA 4KFQA 4F2OA 3FV1A 1B1XA 1BP5A 2QL3A 1S7YA 4FE8A 2V93A 1B5IA 3K02A 5AE4A 1FTKA 3CSGA 4JSOA 1LGBC 4OFOA 5H8NB 3VLUA 4XKRA 1B5HA 2XXWA 5BWJA 4ELQA 4C0RA 3OEKA 1H76A 5J1DA 2D5WA 4YZZA 2PBWA 3PPPA 4XIGQ 3QXMA 3VXBA 4F39A 3KN8A 4R9FA 3T93B 3JV9A 3LSXA 1B3HA 3EF7A 3HPIA 1B9JA 3UK4A 2XXTA 3HV1A 1RKMA 4WEDA 3DP8A 5TPAA 1A7LA 1MS7A 2CMOA 3KFMA 3H6TA 2O6AA 5H8FA 1I6AA 1URSA 1N3WA 3M8UA 4HCWA 4KCDA 1SW4A 3Q26A 4BDQA 4YICA 4F22A 2I48A 1FW0A 1OMPA 3QK6A 2V3UA 4BDNA 4QFKA 2A5TB 4N6PA 3DLNA 4F29A 3VE1B 3BFUA 3S9MC 2UYFA 5I57B 3OELA 5DEXB 1XT8A 3CFZA 1YCJA 4LZ8A 1FTOA 1POY1 1SYHA 3THIA 4Q0CA 4GF8A 3V8XB 1OQHA 3MPKA 4FJPA 4KPTA 1II5A 2GHAA 2P1SA 3TTMA 3EHTA 1B0HA 3MQ9A 4ZZEA 4GFRA 2PVUA 3O9PA 3A3UA 2F7CA 3QUJA 2Y7PA 4PE5B 3FGSA 4QSDA 1D9VA 3RTWB 1ZTYA 1Q35A 3BFTA 3EN3A 1B7UA 3ZKKA 3H6VA 1XC1A 3OXNA 3FJMA 1OIBA 3IOVA 4DXCA 3H03A 2O51A 5KZTA 4PFWA 4H5GA 3FJGA 1A99A 1SQYA 1T0KA 3EHUA 3PUWE 1VSOA 2H5YA 3PU5A 4KYEA 1O7TA 2B3BA 1IUDA 3PV0E 2VD3A 1URGA 4THIA 3T22A 4IO6A 2Z22A 2GRVA 2XXHA 1JW5A 2HZLA 5I2KB 1IXHA 4KHZE 3Q29A 1MXUA 2DQVA 2F6PA 5DVIA 5EHSA 2DWIA 5JTYB 1P1UA 1B32A 3C32A 2HXWA 3FJ7A 1USYE 3TAJA 4E0WA 4QHQA 2AL5A 4ONYA 2OWSA 4DCYA 5M2VA 3L6HA 4O3CA 2AIXA 4BDOA 2Q89A 1JQFA 4NF6A 1PDAA 2F8DA 4G4PA 5H8QB 1SW2A 4NWCA 1UTBA 3O29A 2DXRA 2ZNTA 4G77A 2XXRA 1EZPA 2O69A 4I8CA 1VFDA 1AIVA 1MQHA 4LONB 4UACA 1GR2A 1FQEA 1MDQA 2ANJA 3C33A 3RQTA 5EHMA 4WEPA 1ZBMA 4X48A 4UA8A 1YPNA 4OEUA 4PP0A 2Q2CA 2ZNUA 3CSBA 3KG2A 2RC7A 2DWJA 3VVDA 3CR9A 4C1UA 4PFUA 5ITOA 4PQJA 5IKBA 3Q25A 1Y4CA 3RUMA 2DVCA 4IO5A 2QS4A 3SDFA 5I84A 1DSNA 2Y7KA 1HSJA 2RF1A 1P99A 1FQDA 4PETA 4G8NA 1ZU0A 3MUQA 5ISUA 1O64A 3MP8A 4XTCQ 1VFEA 4NEDA 2D21A 4U23A 5AA2A 3K1PA 1PC3A 3MVZA 5DVFA 3TODA 3I5OA 3DP4A 1B2HA 2DWHA 1LSTA 1PEBA 2XX8A 4GQOA 3MVYA 4QRZA 1ZKBA 3OO7A 4NF4B 4U4XA 4KCCA 1MXZA 4ZEKA 4I62A 3IOWA 1B40A 4WKMA 1US5A 1MQDA 2H9BA 3U93A 4XKNA 5F1QA 5B7DA 3HSTA 1ZLQA 3IB1A 3WAFA 1CB6A 2RC8A 2NOOA 1B7ZA 2HAVA 4NF5B 4GD5A 5ICTA 1MH4A 4YU0A 2XXUA 3W9VA 4WXJA 4C1TA 4R74A 3A3CA 4JDFA 3E4RA 1UTHA 2PT2A 2QS3A 3IL1B 5FTHA 3IR1A 1A8EA 1MQJA 3KSJA 5CRYA 1BKAA 2UXAA 4FECA 4U22A 1OLAA 2R71A 2H99A 2ONRA 3PUXE 1TXFA 5L8DA 1MXYA 4FEBA 1PBPA 4NF8B 3RY3A 2DSFA 2I6EA 2XXYA 2Z8DA 3SERA 4ELPA 4OETA 1TFDA 4F1VA 5IAIA 4O3AA 2X7PA 2HAUA 2OZZA 5KDTB 3TKDA 1QKAA 2VP1A 3LR1A 4TQUQ 1FTLA 2FA7A 5FHNA 2DE4A 2ZYMA 2REJA 4RY1A 3OO9A 4KR5A 1XS5A 2Z8EA 3S9LC 3E9XA 2QPQA 5TP9B 4Q8RA 1Y9UA 4YKKA 5I59B 5CBRA 1QJMA 5F7VA 3B6QA 4F3BA 5I58A 1D4NA 2RKMA 2F7AA 5EYFA 2Z23A 3FVGA 1RYOA 2F6GA 3LSWA 4EQBA 3C35A 3O2AA 3VVEA 3G3FA 2V3TA 1Y1MA 2Z8FA 1P1OA 1SDXA 4YB5A 1FQCA 3FXQA 5KCJA 2F36A 1SI1A 2O68A 4ZZAA 5A5XB 2ZNSA 4GXSB 1Y3PA 1AOVA 4FAJA 1LCFA 3DELB 1MDP1 2YLNA 4G8MA 3TQWA 5CMBA 1DPPA 3U92A 1TWYA 4IGTA 3OMBA 3KOTA 4ESXA 4OVJA 3U72A 3VDFA 4M4GA 1GVCA 3MW0A 4MLVA 1LCTA 3IK6B 4H8IA 4R72A 2YJPA 4OENA 3TTRA 3VLWA 1MM6A 1HSEA 3PD9A 3IO4A 3DM0A 3P7IA 4BDRA 4U1ZA 1MY2A 3G3JA 3IOUA 4H1XA 1PB8A 3TTNA 4DLDA 2I0BA 1MXXA 3TDJA 3ZKLA 4JWOA 1PBQA 4Z0IA 3RT8A 1D9YA 4LZ7A 3ODBA 3FXRA 1NNTA 1B3LA 1AMFA 4GWOA 5H8NA 2DWAA 1BIYA 4EXKA 3O66A 1SW1A 1QKBA 4KI0E 4IO7A 2NXOA 1NNFA 4XKPA 5DYHA 3MVWA 5LOMA 2GFEA 2R6GE 2ONKE 2QMWA 3A09A 4IO3A 3KJTA 4EF2A 4RJZA 3FXUA 1IEJA 4BDMA 1JVYA 5BUUA 1ZJLA 1IITA 1Z7NE 2Y84A 4POXA 1MXVA 3N26A 4OTEA 3FD3A 5FHOA 3VV5A 4G68B 3PPNA 5I2NB 1FTMA 4XKQA 2WKYA 1EZ9A 4PFYA 2OCUA 1KWHA 3DP6A 4DDDA 1B4HA 3TELA 2OWTA 4EDPA 5CMCA 3LSFB 4ZEIA 3MJNA 2A5TA 3H6UA 4OESA 3MPLA 3MWBA 4YAHX 3UN6A 3M3FA 2O7IA 1H43A 3IORA 4TOZA 3IX1A 5I57A 2DVZA 5DEXA 3TTLA 1R9LA 2F7BA 1TT1A 4RNSA 2P2AA 3LSLA 4KQPA 4OYVA 3PMVA 4TLLB 1J1NA 1MM7A 1R1NA 3B6TA 3GZGA 3HO7A 1L5TA 3TEPA 4K3FA 4LATA 1JW4A 5DT6A 3TYHA 4OMBA 1S9TA 3CVGA 3T9UA 1LBCA 4R6YA 3S4UA 2O7UA 2NWJA 2H98A 3KGCA 4U1OA 4I9DA 2HQ0A 1N0TA 3GXAA 5AA1A 2UVIA 1USYH 4H6DA 2E0SA 1P1QA 3TTKA 4AB5A 2THIA 2RCBA 3M3LA 3VVFA 3K1MA 2ONSA 5I2KA 4FORA 5H8HB 4YB6A 4QFLA 5JTYA 4LP2B 2IEEA 2DS9A 2QMXA 2PX1A 3TCFA 1FQFA 1URDA 1PB7A 1SBPA 1NMUA 2VGQA 4OFLA 1B0LA 4F18A 1M5BA 2QSXA 3M3KA 2V3QA 1MG1A 3D4GA 2I58A 4KYDA 2W7YA 1LB9A 4IY6A 5H8QA 4R6HA 2QS1A 3Q27A 3C36A 1NKXA 1SVXB 2O1LA 4EQ9A 4OEVA 4EQ7A 4HW8A 3VFJA 3RN8A 1DOTA 1N04A 4RK2A 4QFPA 3ILUB 4EF1A 3T96B 4R6KA 4YKPA 1Y1ZA 4GXAA 2DE2A 1I6BA 4DZ1A 1R9QA 2DXYA 3HHGA 3N6UA 2ZXTA 2OK2A 4F3PA 3MZ1A 3EHSA 3T9XB 1WODA 4ECFA 2A5SA 3E13X 4NWDA 1NFTA 2Y7RA 1QUIA 2H4IA 5DTBA 1OVTA 1B3GA 3MP6A 4OERA 3PUVE 4OXVA 5AA2D 2RINA 4JWXA 1FQBA 3G3KA 3AXFA 2Q9TA 4YKIA 5I56B 4ZDMA 4ELRA 4RA1A 2ZYOA 2P0SA 5CBSA 2O84X 3CFXA 3UA8A 2DP8A 4POWA 1B05A 3PUYE 2HZKA 3K01A 5I58B 2FNCA 2F35A 3MZBA 1B6HA 2ABHA 3S2VA 1Y20A 3W9WA 3FIRA 2I3VA 4ZEFA 4NF4A 4N13A 2NVUB 4F1YA 4JXIA 3FUZA 3ILTB 3PPOA 1R6ZA 3OO6A 2G29A 4AQ4A 3IO6A 4PFTA 1ANFA 3MVXA 1MY3A 3KBRA 3C9HA 4EUOA 4FEDA 3OO8A 4QSEA 4EXLA 3R6UA 2FYIA 3EPEA 4LZ5A 1LB8A 3K6XA 4LQ5A 5JK4A 3FV2A 4NF5A 1JETA 4DXUA 4JSDA 1B3EA 1POTA 1LFHA 2LAOA 2D3IA 4F3GA 2Y7IA 3D4CA 1N7WA 3EQ1A 5TPAB 1QVSA 4MF3A 3UGWA 3V83A 3CFLA 1A55A 5H8FB 3B7DA 1YTVA 2PYYA 3E3KA 1QULA 4E0XA 2XHDA 4QFNA 3K0VA 4HS7A 4H5FA 2UVGA 4NF8A 1DMBA 3K2DA 1XHYA 2AYSA 3G3IA 2GHBA 4ZEDA 4YMAA 5AA4A 2X26A 4OQOA 1MRPA 5CC2A 3JYRA 3MP1A 2VHAA 3PPRA 1B58A 4MFIA 5KDTA 1B1HA 2B65A 3TFLA 1S50A 1Y4TA 1LFIA 1BTJA 5AA3A 2XXXA 3PMWA 3PGFA 2VOZA 4RK9A 2I3WA 1US4A 4BLAA 4NMYA 5FHMA 3N5LA 3SKPA 2HFBA 3SEXA 1MPDA 4G68C 3B6WA 2GH9A 2B3FA 5TP9A 1H3DA 5I59A 3IAZA 4ZE9A 5CM6A 3N94A 1EH3A 1NNKA 5HPQA 1NNPA 1LAGE 2XD3A 4F1UA 4F31B 4GL8A 3FVKA 3K6UA 2H25A 4DXBA 3PUZE 2HCAA 5HBCA 1NL5A 2QJEA 1AH5A 1IXIA 3BKIB 1N7XA 1JEVA 1O63A 4DE8A 3IOTA 5B70A 1LAFE 5A5XA 4GRKA 1SYIA 2IA4A 3KJ7A 2NUVA 1P1NA 1PB9A 1A54A 2ZYKA 4MLQA 1TFAA 1M5DA 3GBAA 3KSXA 3TQLA 5L9SA 1GGGA 4LVQA 2DOJA 1WDNA 3QIMA 2HEUA 4IB2A 5L9MA 1NH8A 1LFGA 4ND9A 4OHNA 2OJTA 1MH3A 4NTLA 4IO2A 3RNNA 5JEIA 1F9BA 3R26A 3KN7A 2F97A 1XVYA 1ELJA 1LAXA 3PD8A 2XX7A 3KOSA 4M1VA 1SI0A 3K6VA 4RPOA 1MQGA 3PMXA 1EU8A 3SEYA 4OFJA 1MPCA 4GL0A 3QYTA 3BBRA 1B5JA 1IXCA 1XOCA 4QSCA 1WVJA 2ZYNA 5K2YA 4YMBA 1ZIUA 2X7QA 2V25A 3U1OA 3C34A 3T9HB 4NF6B 3FASA 2XX9A 3N6TA 3T66A 3H06B 1UTBB 1M5FA 2QS2A 4KYSA 4U4SA 4IO4A 1MY4A 1BLFA 2I4CA 3F11A 3C31A 3LBSA 1QUKA 4FIMA 3RPWA 5ELVA 4Q30B 2R9JA 1M5CA 4P0IA 2REGA 1IIWA 1XVXA 3K1NA 4R2BA 1UIUA 3VLVA 3ECRA 1SW5A 3H3GA 3TPAA 5CI5A 1QW0A 2V84A 1B51A 3CG1A 1N84A 4R75A 1DTZA 3U8QA 5K2XA 3GBBA 3QUFA 2XXPA 1D3KA 3CI8A 3O97A 5FTIA 1I69A 4P11A 1N76A 5ICQA 2CZLA 4HTGA 2G93A 4G68A 5I2NA 1B52A 3TCHA 5CMMA 3QAXA 1N3XA 3KN3A 1OQGA 2Q2AA 4OZ9A 4YKJA 2KLFA 2ALUA 3TUSA 5ITPA 3WAEA 3OEMA 1ZMGA 4DIGA 4QFOA 3RGYA 4ZE8A 4H8JA 1MY1A 3OSQA 4JB7A 3ZS6A 4X9TA 3PPQA 5DVJA 5AA2B 4Z7EA 1DTGA 4O3BA 3MZ9A 1B7HA 4ZECA 1M5EA 1MXWA 2YPNA 3O6IA 3OSRA 3G7WA 4LQ2A 3IB2A 3FVOA 1IQ7A 1FCKA 3S9EA 4HCYA 3RLFE 1Y3NA 3LC8A 3JZJA 3MAMA 1LAHE 1MPBA 1JEUA 3SESA 1JVXA 3S9NC 3W15C 2OBGA 3V5AA 1ATGA 5TU0A 3QSLA 4ZS9A 1JNFA 3IB0A 3TZAA 1NH7A 2RCAA 3SEVA 3UP9A 4U21A 3IJXB 3IJOB 3LUYA 2DYXA 3HCQA 3FZVA 4R9GA 2Q8JA 1B3FA 4L17A 2QRYA 3CG3A 1QUJA 1UTHB 1GV8A 3SEWA 2ESNA 1VE4A 5HM4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVB A;  3V89 B;  2I4B A;  2RC9 A;  4GOT A;  4YB7 A;  2Q88 A;  1UQW A;  4I1D A;  1I6Q A;  3TCG A;  5L9O A;  4QF9 A;  1IZ1 A;  4H67 A;  4X1B A;  4XXU A;  2VD2 A;  4GLI A;  3MC2 A;  5H8H A;  4RYA A;  1RYX A;  3OD7 A;  4GVO A;  4U2R A;  4RPN A;  3H4Z A;  1FQA A;  3K00 A;  4Q5T A;  4R2F A;  4OWD A;  4ELO A;  4ISU A;  1IXG A;  3FVN A;  2UVJ A;  1HSL A;  1A8F A;  3ONM A;  4IY5 A;  2AL4 A;  1LBB A;  3Q28 A;  3ZSF A;  4ZEB A;  3SEU A;  1YAE A;  2XXI A;  2F34 A;  1LLS A;  2UYE A;  3O6G A;  2PT1 A;  3UOR A;  3G3G A;  3HN0 A;  4F2Q A;  1Q1K A;  4AB6 A;  3RTF B;  3T9V A;  3L6G A;  4G2Z A;  4X1D A;  3MBP A;  1AL3 A;  4MBP A;  1EZO A;  3H7M A;  1H44 A;  1VR5 A;  1H45 A;  3G3H A;  4LUB A;  3FAT A;  3GLB A;  4P0G A;  1DPE A;  4DCX A;  5KCJ B;  1CE2 A;  2F5X A;  3I3V A;  2O1M A;  1OLC A;  1UIV A;  3H6W A;  3KEI A;  3USD A;  1JW1 A;  1FTJ A;  2Y7W A;  4R73 A;  1SD3 A;  2XXV A;  4IGR A;  3R7X A;  1A40 A;  3CRB A;  5AA4 B;  1GTK A;  2XXQ A;  4MH5 A;  3K4U A;  1MY0 A;  3SET A;  3VXC A;  3HHF A;  5H8S A;  1P1W A;  2UVH A;  3OEN A;  3UIF A;  4TLM B;  2BJJ X;  3KZG A;  3O28 A;  2OLB A;  4KD5 A;  3K6W A;  5CMK A;  4NE4 A;  2ZMB A;  5I56 A;  1Y3Q A;  4RXL A;  2E1S A;  4JWY A;  4H65 A;  2I49 A;  4ESW A;  1B4Z A;  2XD2 A;  1Z7M E;  3C4M A;  4LA9 A;  3RT6 B;  4F19 A;  2F78 A;  4GIZ A;  4F3S A;  3TMG A;  1MQI A;  4H0W A;  4JBZ A;  4BDL A;  1B46 A;  2PMS A;  3CIJ A;  2DE3 A;  3O6H A;  4N07 A;  3OOA A;  4FAT A;  4G8H A;  2I0C A;  3I6V A;  3U94 A;  2M8C A;  4KFQ A;  4F2O A;  3FV1 A;  1B1X A;  1BP5 A;  2QL3 A;  1S7Y A;  4FE8 A;  2V93 A;  1B5I A;  3K02 A;  5AE4 A;  1FTK A;  3CSG A;  4JSO A;  1LGB C;  4OFO A;  5H8N B;  3VLU A;  4XKR A;  1B5H A;  2XXW A;  5BWJ A;  4ELQ A;  4C0R A;  3OEK A;  1H76 A;  5J1D A;  2D5W A;  4YZZ A;  2PBW A;  3PPP A;  4XIG Q;  3QXM A;  3VXB A;  4F39 A;  3KN8 A;  4R9F A;  3T93 B;  3JV9 A;  3LSX A;  1B3H A;  3EF7 A;  3HPI A;  1B9J A;  3UK4 A;  2XXT A;  3HV1 A;  1RKM A;  4WED A;  3DP8 A;  5TPA A;  1A7L A;  1MS7 A;  2CMO A;  3KFM A;  3H6T A;  2O6A A;  5H8F A;  1I6A A;  1URS A;  1N3W A;  3M8U A;  4HCW A;  4KCD A;  1SW4 A;  3Q26 A;  4BDQ A;  4YIC A;  4F22 A;  2I48 A;  1FW0 A;  1OMP A;  3QK6 A;  2V3U A;  4BDN A;  4QFK A;  2A5T B;  4N6P A;  3DLN A;  4F29 A;  3VE1 B;  3BFU A;  3S9M C;  2UYF A;  5I57 B;  3OEL A;  5DEX B;  1XT8 A;  3CFZ A;  1YCJ A;  4LZ8 A;  1FTO A;  1POY 1;  1SYH A;  3THI A;  4Q0C A;  4GF8 A;  3V8X B;  1OQH A;  3MPK A;  4FJP A;  4KPT A;  1II5 A;  2GHA A;  2P1S A;  3TTM A;  3EHT A;  1B0H A;  3MQ9 A;  4ZZE A;  4GFR A;  2PVU A;  3O9P A;  3A3U A;  2F7C A;  3QUJ A;  2Y7P A;  4PE5 B;  3FGS A;  4QSD A;  1D9V A;  3RTW B;  1ZTY A;  1Q35 A;  3BFT A;  3EN3 A;  1B7U A;  3ZKK A;  3H6V A;  1XC1 A;  3OXN A;  3FJM A;  1OIB A;  3IOV A;  4DXC A;  3H03 A;  2O51 A;  5KZT A;  4PFW A;  4H5G A;  3FJG A;  1A99 A;  1SQY A;  1T0K A;  3EHU A;  3PUW E;  1VSO A;  2H5Y A;  3PU5 A;  4KYE A;  1O7T A;  2B3B A;  1IUD A;  3PV0 E;  2VD3 A;  1URG A;  4THI A;  3T22 A;  4IO6 A;  2Z22 A;  2GRV A;  2XXH A;  1JW5 A;  2HZL A;  5I2K B;  1IXH A;  4KHZ E;  3Q29 A;  1MXU A;  2DQV A;  2F6P A;  5DVI A;  5EHS A;  2DWI A;  5JTY B;  1P1U A;  1B32 A;  3C32 A;  2HXW A;  3FJ7 A;  1USY E;  3TAJ A;  4E0W A;  4QHQ A;  2AL5 A;  4ONY A;  2OWS A;  4DCY A;  5M2V A;  3L6H A;  4O3C A;  2AIX A;  4BDO A;  2Q89 A;  1JQF A;  4NF6 A;  1PDA A;  2F8D A;  4G4P A;  5H8Q B;  1SW2 A;  4NWC A;  1UTB A;  3O29 A;  2DXR A;  2ZNT A;  4G77 A;  2XXR A;  1EZP A;  2O69 A;  4I8C A;  1VFD A;  1AIV A;  1MQH A;  4LON B;  4UAC A;  1GR2 A;  1FQE A;  1MDQ A;  2ANJ A;  3C33 A;  3RQT A;  5EHM A;  4WEP A;  1ZBM A;  4X48 A;  4UA8 A;  1YPN A;  4OEU A;  4PP0 A;  2Q2C A;  2ZNU A;  3CSB A;  3KG2 A;  2RC7 A;  2DWJ A;  3VVD A;  3CR9 A;  4C1U A;  4PFU A;  5ITO A;  4PQJ A;  5IKB A;  3Q25 A;  1Y4C A;  3RUM A;  2DVC A;  4IO5 A;  2QS4 A;  3SDF A;  5I84 A;  1DSN A;  2Y7K A;  1HSJ A;  2RF1 A;  1P99 A;  1FQD A;  4PET A;  4G8N A;  1ZU0 A;  3MUQ A;  5ISU A;  1O64 A;  3MP8 A;  4XTC Q;  1VFE A;  4NED A;  2D21 A;  4U23 A;  5AA2 A;  3K1P A;  1PC3 A;  3MVZ A;  5DVF A;  3TOD A;  3I5O A;  3DP4 A;  1B2H A;  2DWH A;  1LST A;  1PEB A;  2XX8 A;  4GQO A;  3MVY A;  4QRZ A;  1ZKB A;  3OO7 A;  4NF4 B;  4U4X A;  4KCC A;  1MXZ A;  4ZEK A;  4I62 A;  3IOW A;  1B40 A;  4WKM A;  1US5 A;  1MQD A;  2H9B A;  3U93 A;  4XKN A;  5F1Q A;  5B7D A;  3HST A;  1ZLQ A;  3IB1 A;  3WAF A;  1CB6 A;  2RC8 A;  2NOO A;  1B7Z A;  2HAV A;  4NF5 B;  4GD5 A;  5ICT A;  1MH4 A;  4YU0 A;  2XXU A;  3W9V A;  4WXJ A;  4C1T A;  4R74 A;  3A3C A;  4JDF A;  3E4R A;  1UTH A;  2PT2 A;  2QS3 A;  3IL1 B;  5FTH A;  3IR1 A;  1A8E A;  1MQJ A;  3KSJ A;  5CRY A;  1BKA A;  2UXA A;  4FEC A;  4U22 A;  1OLA A;  2R71 A;  2H99 A;  2ONR A;  3PUX E;  1TXF A;  5L8D A;  1MXY A;  4FEB A;  1PBP A;  4NF8 B;  3RY3 A;  2DSF A;  2I6E A;  2XXY A;  2Z8D A;  3SER A;  4ELP A;  4OET A;  1TFD A;  4F1V A;  5IAI A;  4O3A A;  2X7P A;  2HAU A;  2OZZ A;  5KDT B;  3TKD A;  1QKA A;  2VP1 A;  3LR1 A;  4TQU Q;  1FTL A;  2FA7 A;  5FHN A;  2DE4 A;  2ZYM A;  2REJ A;  4RY1 A;  3OO9 A;  4KR5 A;  1XS5 A;  2Z8E A;  3S9L C;  3E9X A;  2QPQ A;  5TP9 B;  4Q8R A;  1Y9U A;  4YKK A;  5I59 B;  5CBR A;  1QJM A;  5F7V A;  3B6Q A;  4F3B A;  5I58 A;  1D4N A;  2RKM A;  2F7A A;  5EYF A;  2Z23 A;  3FVG A;  1RYO A;  2F6G A;  3LSW A;  4EQB A;  3C35 A;  3O2A A;  3VVE A;  3G3F A;  2V3T A;  1Y1M A;  2Z8F A;  1P1O A;  1SDX A;  4YB5 A;  1FQC A;  3FXQ A;  5KCJ A;  2F36 A;  1SI1 A;  2O68 A;  4ZZA A;  5A5X B;  2ZNS A;  4GXS B;  1Y3P A;  1AOV A;  4FAJ A;  1LCF A;  3DEL B;  1MDP 1;  2YLN A;  4G8M A;  3TQW A;  5CMB A;  1DPP A;  3U92 A;  1TWY A;  4IGT A;  3OMB A;  3KOT A;  4ESX A;  4OVJ A;  3U72 A;  3VDF A;  4M4G A;  1GVC A;  3MW0 A;  4MLV A;  1LCT A;  3IK6 B;  4H8I A;  4R72 A;  2YJP A;  4OEN A;  3TTR A;  3VLW A;  1MM6 A;  1HSE A;  3PD9 A;  3IO4 A;  3DM0 A;  3P7I A;  4BDR A;  4U1Z A;  1MY2 A;  3G3J A;  3IOU A;  4H1X A;  1PB8 A;  3TTN A;  4DLD A;  2I0B A;  1MXX A;  3TDJ A;  3ZKL A;  4JWO A;  1PBQ A;  4Z0I A;  3RT8 A;  1D9Y A;  4LZ7 A;  3ODB A;  3FXR A;  1NNT A;  1B3L A;  1AMF A;  4GWO A;  5H8N A;  2DWA A;  1BIY A;  4EXK A;  3O66 A;  1SW1 A;  1QKB A;  4KI0 E;  4IO7 A;  2NXO A;  1NNF A;  4XKP A;  5DYH A;  3MVW A;  5LOM A;  2GFE A;  2R6G E;  2ONK E;  2QMW A;  3A09 A;  4IO3 A;  3KJT A;  4EF2 A;  4RJZ A;  3FXU A;  1IEJ A;  4BDM A;  1JVY A;  5BUU A;  1ZJL A;  1IIT A;  1Z7N E;  2Y84 A;  4POX A;  1MXV A;  3N26 A;  4OTE A;  3FD3 A;  5FHO A;  3VV5 A;  4G68 B;  3PPN A;  5I2N B;  1FTM A;  4XKQ A;  2WKY A;  1EZ9 A;  4PFY A;  2OCU A;  1KWH A;  3DP6 A;  4DDD A;  1B4H A;  3TEL A;  2OWT A;  4EDP A;  5CMC A;  3LSF B;  4ZEI A;  3MJN A;  2A5T A;  3H6U A;  4OES A;  3MPL A;  3MWB A;  4YAH X;  3UN6 A;  3M3F A;  2O7I A;  1H43 A;  3IOR A;  4TOZ A;  3IX1 A;  5I57 A;  2DVZ A;  5DEX A;  3TTL A;  1R9L A;  2F7B A;  1TT1 A;  4RNS A;  2P2A A;  3LSL A;  4KQP A;  4OYV A;  3PMV A;  4TLL B;  1J1N A;  1MM7 A;  1R1N A;  3B6T A;  3GZG A;  3HO7 A;  1L5T A;  3TEP A;  4K3F A;  4LAT A;  1JW4 A;  5DT6 A;  3TYH A;  4OMB A;  1S9T A;  3CVG A;  3T9U A;  1LBC A;  4R6Y A;  3S4U A;  2O7U A;  2NWJ A;  2H98 A;  3KGC A;  4U1O A;  4I9D A;  2HQ0 A;  1N0T A;  3GXA A;  5AA1 A;  2UVI A;  1USY H;  4H6D A;  2E0S A;  1P1Q A;  3TTK A;  4AB5 A;  2THI A;  2RCB A;  3M3L A;  3VVF A;  3K1M A;  2ONS A;  5I2K A;  4FOR A;  5H8H B;  4YB6 A;  4QFL A;  5JTY A;  4LP2 B;  2IEE A;  2DS9 A;  2QMX A;  2PX1 A;  3TCF A;  1FQF A;  1URD A;  1PB7 A;  1SBP A;  1NMU A;  2VGQ A;  4OFL A;  1B0L A;  4F18 A;  1M5B A;  2QSX A;  3M3K A;  2V3Q A;  1MG1 A;  3D4G A;  2I58 A;  4KYD A;  2W7Y A;  1LB9 A;  4IY6 A;  5H8Q A;  4R6H A;  2QS1 A;  3Q27 A;  3C36 A;  1NKX A;  1SVX B;  2O1L A;  4EQ9 A;  4OEV A;  4EQ7 A;  4HW8 A;  3VFJ A;  3RN8 A;  1DOT A;  1N04 A;  4RK2 A;  4QFP A;  3ILU B;  4EF1 A;  3T96 B;  4R6K A;  4YKP A;  1Y1Z A;  4GXA A;  2DE2 A;  1I6B A;  4DZ1 A;  1R9Q A;  2DXY A;  3HHG A;  3N6U A;  2ZXT A;  2OK2 A;  4F3P A;  3MZ1 A;  3EHS A;  3T9X B;  1WOD A;  4ECF A;  2A5S A;  3E13 X;  4NWD A;  1NFT A;  2Y7R A;  1QUI A;  2H4I A;  5DTB A;  1OVT A;  1B3G A;  3MP6 A;  4OER A;  3PUV E;  4OXV A;  5AA2 D;  2RIN A;  4JWX A;  1FQB A;  3G3K A;  3AXF A;  2Q9T A;  4YKI A;  5I56 B;  4ZDM A;  4ELR A;  4RA1 A;  2ZYO A;  2P0S A;  5CBS A;  2O84 X;  3CFX A;  3UA8 A;  2DP8 A;  4POW A;  1B05 A;  3PUY E;  2HZK A;  3K01 A;  5I58 B;  2FNC A;  2F35 A;  3MZB A;  1B6H A;  2ABH A;  3S2V A;  1Y20 A;  3W9W A;  3FIR A;  2I3V A;  4ZEF A;  4NF4 A;  4N13 A;  2NVU B;  4F1Y A;  4JXI A;  3FUZ A;  3ILT B;  3PPO A;  1R6Z A;  3OO6 A;  2G29 A;  4AQ4 A;  3IO6 A;  4PFT A;  1ANF A;  3MVX A;  1MY3 A;  3KBR A;  3C9H A;  4EUO A;  4FED A;  3OO8 A;  4QSE A;  4EXL A;  3R6U A;  2FYI A;  3EPE A;  4LZ5 A;  1LB8 A;  3K6X A;  4LQ5 A;  5JK4 A;  3FV2 A;  4NF5 A;  1JET A;  4DXU A;  4JSD A;  1B3E A;  1POT A;  1LFH A;  2LAO A;  2D3I A;  4F3G A;  2Y7I A;  3D4C A;  1N7W A;  3EQ1 A;  5TPA B;  1QVS A;  4MF3 A;  3UGW A;  3V83 A;  3CFL A;  1A55 A;  5H8F B;  3B7D A;  1YTV A;  2PYY A;  3E3K A;  1QUL A;  4E0X A;  2XHD A;  4QFN A;  3K0V A;  4HS7 A;  4H5F A;  2UVG A;  4NF8 A;  1DMB A;  3K2D A;  1XHY A;  2AYS A;  3G3I A;  2GHB A;  4ZED A;  4YMA A;  5AA4 A;  2X26 A;  4OQO A;  1MRP A;  5CC2 A;  3JYR A;  3MP1 A;  2VHA A;  3PPR A;  1B58 A;  4MFI A;  5KDT A;  1B1H A;  2B65 A;  3TFL A;  1S50 A;  1Y4T A;  1LFI A;  1BTJ A;  5AA3 A;  2XXX A;  3PMW A;  3PGF A;  2VOZ A;  4RK9 A;  2I3W A;  1US4 A;  4BLA A;  4NMY A;  5FHM A;  3N5L A;  3SKP A;  2HFB A;  3SEX A;  1MPD A;  4G68 C;  3B6W A;  2GH9 A;  2B3F A;  5TP9 A;  1H3D A;  5I59 A;  3IAZ A;  4ZE9 A;  5CM6 A;  3N94 A;  1EH3 A;  1NNK A;  5HPQ A;  1NNP A;  1LAG E;  2XD3 A;  4F1U A;  4F31 B;  4GL8 A;  3FVK A;  3K6U A;  2H25 A;  4DXB A;  3PUZ E;  2HCA A;  5HBC A;  1NL5 A;  2QJE A;  1AH5 A;  1IXI A;  3BKI B;  1N7X A;  1JEV A;  1O63 A;  4DE8 A;  3IOT A;  5B70 A;  1LAF E;  5A5X A;  4GRK A;  1SYI A;  2IA4 A;  3KJ7 A;  2NUV A;  1P1N A;  1PB9 A;  1A54 A;  2ZYK A;  4MLQ A;  1TFA A;  1M5D A;  3GBA A;  3KSX A;  3TQL A;  5L9S A;  1GGG A;  4LVQ A;  2DOJ A;  1WDN A;  3QIM A;  2HEU A;  4IB2 A;  5L9M A;  1NH8 A;  1LFG A;  4ND9 A;  4OHN A;  2OJT A;  1MH3 A;  4NTL A;  4IO2 A;  3RNN A;  5JEI A;  1F9B A;  3R26 A;  3KN7 A;  2F97 A;  1XVY A;  1ELJ A;  1LAX A;  3PD8 A;  2XX7 A;  3KOS A;  4M1V A;  1SI0 A;  3K6V A;  4RPO A;  1MQG A;  3PMX A;  1EU8 A;  3SEY A;  4OFJ A;  1MPC A;  4GL0 A;  3QYT A;  3BBR A;  1B5J A;  1IXC A;  1XOC A;  4QSC A;  1WVJ A;  2ZYN A;  5K2Y A;  4YMB A;  1ZIU A;  2X7Q A;  2V25 A;  3U1O A;  3C34 A;  3T9H B;  4NF6 B;  3FAS A;  2XX9 A;  3N6T A;  3T66 A;  3H06 B;  1UTB B;  1M5F A;  2QS2 A;  4KYS A;  4U4S A;  4IO4 A;  1MY4 A;  1BLF A;  2I4C A;  3F11 A;  3C31 A;  3LBS A;  1QUK A;  4FIM A;  3RPW A;  5ELV A;  4Q30 B;  2R9J A;  1M5C A;  4P0I A;  2REG A;  1IIW A;  1XVX A;  3K1N A;  4R2B A;  1UIU A;  3VLV A;  3ECR A;  1SW5 A;  3H3G A;  3TPA A;  5CI5 A;  1QW0 A;  2V84 A;  1B51 A;  3CG1 A;  1N84 A;  4R75 A;  1DTZ A;  3U8Q A;  5K2X A;  3GBB A;  3QUF A;  2XXP A;  1D3K A;  3CI8 A;  3O97 A;  5FTI A;  1I69 A;  4P11 A;  1N76 A;  5ICQ A;  2CZL A;  4HTG A;  2G93 A;  4G68 A;  5I2N A;  1B52 A;  3TCH A;  5CMM A;  3QAX A;  1N3X A;  3KN3 A;  1OQG A;  2Q2A A;  4OZ9 A;  4YKJ A;  2KLF A;  2ALU A;  3TUS A;  5ITP A;  3WAE A;  3OEM A;  1ZMG A;  4DIG A;  4QFO A;  3RGY A;  4ZE8 A;  4H8J A;  1MY1 A;  3OSQ A;  4JB7 A;  3ZS6 A;  4X9T A;  3PPQ A;  5DVJ A;  5AA2 B;  4Z7E A;  1DTG A;  4O3B A;  3MZ9 A;  1B7H A;  4ZEC A;  1M5E A;  1MXW A;  2YPN A;  3O6I A;  3OSR A;  3G7W A;  4LQ2 A;  3IB2 A;  3FVO A;  1IQ7 A;  1FCK A;  3S9E A;  4HCY A;  3RLF E;  1Y3N A;  3LC8 A;  3JZJ A;  3MAM A;  1LAH E;  1MPB A;  1JEU A;  3SES A;  1JVX A;  3S9N C;  3W15 C;  2OBG A;  3V5A A;  1ATG A;  5TU0 A;  3QSL A;  4ZS9 A;  1JNF A;  3IB0 A;  3TZA A;  1NH7 A;  2RCA A;  3SEV A;  3UP9 A;  4U21 A;  3IJX B;  3IJO B;  3LUY A;  2DYX A;  3HCQ A;  3FZV A;  4R9G A;  2Q8J A;  1B3F A;  4L17 A;  2QRY A;  3CG3 A;  1QUJ A;  1UTH B;  1GV8 A;  3SEW A;  2ESN A;  1VE4 A;  5HM4 B; 
#chains in the Genus database with same CATH topology
 1OVB A;  3V89 B;  2I4B A;  2RC9 A;  4GOT A;  4YB7 A;  2Q88 A;  1UQW A;  4FBP A;  4I1D A;  1I6Q A;  4I3E A;  3TCG A;  5L9O A;  4QF9 A;  1IZ1 A;  4H67 A;  4X1B A;  4XXU A;  2VD2 A;  4GLI A;  3MC2 A;  1KA0 A;  5H8H A;  4RYA A;  1RYX A;  3OD7 A;  4GVO A;  4OVR A;  4U2R A;  4MMP A;  4RPN A;  3H4Z A;  1FQA A;  1FBH A;  3K00 A;  4Q5T A;  4R2F A;  4OWD A;  4ELO A;  4ISU A;  1NI9 A;  1IXG A;  3FVN A;  2UVJ A;  1HSL A;  1A8F A;  3ONM A;  4IY5 A;  2AL4 A;  1LBB A;  3Q28 A;  3ZSF A;  4ZEB A;  3SEU A;  1YAE A;  2XXI A;  2F34 A;  1LLS A;  2UYE A;  4MJO A;  3O6G A;  2PT1 A;  3UOR A;  3G3G A;  4PCD A;  3HN0 A;  4F2Q A;  1Q1K A;  4AB6 A;  3RTF B;  1SPI A;  3T9V A;  3L6G A;  4G2Z A;  4X1D A;  3MBP A;  1AL3 A;  4MBP A;  1EZO A;  4DI4 B;  3H7M A;  1H44 A;  1VR5 A;  1H45 A;  3G3H A;  4LUB A;  3FAT A;  3GLB A;  4P0G A;  1DPE A;  4DCX A;  5KCJ B;  1CE2 A;  2F5X A;  3I3V A;  2O1M A;  1OLC A;  1UIV A;  3H6W A;  3KEI A;  3USD A;  1JW1 A;  1FTJ A;  2Y7W A;  4R73 A;  1SD3 A;  2XXV A;  4I40 A;  4IGR A;  3R7X A;  1A40 A;  3CRB A;  5AA4 B;  1GTK A;  2XXQ A;  4MH5 A;  3K4U A;  1MY0 A;  3SET A;  3VXC A;  3HHF A;  5H8S A;  1P1W A;  2UVH A;  3OEN A;  3UIF A;  4TLM B;  2BJJ X;  2FHY A;  3KZG A;  2OLB A;  3O28 A;  4N17 A;  4KD5 A;  3K6W A;  5CMK A;  4NE4 A;  2ZMB A;  4MNI A;  3KBZ A;  5I56 A;  2VPN A;  1Y3Q A;  2XA5 A;  4RXL A;  2E1S A;  2HHM A;  4JWY A;  4H65 A;  2I49 A;  4ESW A;  1B4Z A;  2XD2 A;  4NX1 A;  1Z7M E;  3C4M A;  4LA9 A;  3RT6 B;  4F19 A;  2F78 A;  4GIZ A;  4F3S A;  3TMG A;  4QBA A;  1MQI A;  4H0W A;  4JBZ A;  4BDL A;  1B46 A;  2PMS A;  3CIJ A;  2DE3 A;  3O6H A;  4N6K A;  4N07 A;  3OOA A;  4FAT A;  4G8H A;  2I0C A;  3I6V A;  3U94 A;  2M8C A;  4KFQ A;  2CEY A;  4O7M A;  4F2O A;  3FV1 A;  1B1X A;  1BP5 A;  2QL3 A;  1S7Y A;  4FE8 A;  2V93 A;  1B5I A;  3K02 A;  4N15 A;  3RPL A;  5AE4 A;  4HE0 A;  1FTK A;  1NUZ A;  3CSG A;  4JSO A;  1LGB C;  4MIJ A;  4N91 A;  1EYI A;  4LN5 A;  4OFO A;  5H8N B;  3VLU A;  3U65 A;  4XKR A;  1B5H A;  2XXW A;  5BWJ A;  4ELQ A;  2FBP A;  4C0R A;  3OEK A;  1H76 A;  5J1D A;  2D5W A;  4YZZ A;  2PBW A;  3PPP A;  4MX6 A;  2R8T A;  1NUX A;  4XIG Q;  3QXM A;  1D9Q A;  4GBV A;  3VXB A;  4F39 A;  3KN8 A;  4R9F A;  2XXK A;  3T93 B;  3JV9 A;  3LSX A;  1B3H A;  3EF7 A;  3HPI A;  1B9J A;  5IZ3 A;  3UK4 A;  2XXT A;  3HV1 A;  1RKM A;  4WED A;  3DP8 A;  5TPA A;  1A7L A;  1NV7 A;  1MS7 A;  2CMO A;  5F24 A;  3KFM A;  3PTY A;  3H6T A;  4NHB A;  2O6A A;  1FBD A;  5H8F A;  4NQ8 A;  1I6A A;  1URS A;  1N3W A;  3M8U A;  4HCW A;  4KCD A;  1K9Y A;  1SW4 A;  3Q26 A;  4BDQ A;  4YIC A;  4F22 A;  2I48 A;  1FW0 A;  1OMP A;  3IFC A;  2V3U A;  3QK6 A;  4BDN A;  5I7I A;  4QFK A;  2A5T B;  3KC0 A;  2F3D A;  4N6P A;  3DLN A;  4F29 A;  3VE1 B;  3BFU A;  3S9M C;  2UYF A;  5I57 B;  3OEL A;  5DEX B;  1XT8 A;  3CFZ A;  1YCJ A;  4LZ8 A;  1FTO A;  2P3V A;  1POY 1;  1SYH A;  3THI A;  3KC1 A;  4Q0C A;  4GF8 A;  3V8X B;  1OQH A;  3MPK A;  4FJP A;  4KPT A;  1II5 A;  2GHA A;  5ET7 A;  2P1S A;  2P3N A;  3TTM A;  1LBV A;  3EHT A;  1B0H A;  3MQ9 A;  1KA1 A;  4ZZE A;  2Q74 A;  4GFR A;  2PVU A;  3O9P A;  3A3U A;  2F7C A;  3QUJ A;  2BJI A;  2Y7P A;  4PE5 B;  2F3B A;  3FGS A;  4IR8 A;  4QSD A;  1D9V A;  3RTW B;  1ZTY A;  1Q35 A;  3BFT A;  3EN3 A;  1B7U A;  3ZKK A;  3H6V A;  1XC1 A;  1K9Z A;  3OXN A;  3FJM A;  1OIB A;  3IOV A;  3FXB A;  4MEV A;  4DXC A;  2B4L A;  3H03 A;  2O51 A;  5KZT A;  4OVS A;  4PFW A;  4H5G A;  1LEV A;  3FJG A;  1A99 A;  1SQY A;  1T0K A;  3EHU A;  4PBH A;  3PUW E;  1VSO A;  2H5Y A;  2XWI A;  3PU5 A;  4KYE A;  1O7T A;  2B3B A;  4GWU A;  1IUD A;  3PV0 E;  2VD3 A;  1URG A;  4THI A;  3T22 A;  4IO6 A;  2Z22 A;  2GRV A;  2XXH A;  1JW5 A;  2HZL A;  5I2K B;  1IXH A;  4KHZ E;  3Q29 A;  1MXU A;  2DQV A;  2F6P A;  5DVI A;  5EHS A;  2DWI A;  5JTY B;  1P1U A;  1B32 A;  3C32 A;  2HXW A;  3FJ7 A;  1USY E;  3TAJ A;  4E0W A;  4QHQ A;  2AL5 A;  4ONY A;  2OWS A;  4DCY A;  5M2V A;  3L6H A;  4O3C A;  2AIX A;  4BDO A;  2Q89 A;  1JQF A;  4NF6 A;  1PDA A;  2F8D A;  4G4P A;  5H8Q B;  1SW2 A;  4NWC A;  4PAF A;  1UTB A;  3O29 A;  5IZZ A;  2DXR A;  2ZNT A;  4G77 A;  2XXR A;  5FBP A;  4X04 A;  1EZP A;  2O69 A;  4I8C A;  1VFD A;  1AIV A;  1MQH A;  4LON B;  4UAC A;  1GR2 A;  1FQE A;  1MDQ A;  5A5L A;  2ANJ A;  3C33 A;  3RQT A;  5EHM A;  4WEP A;  4GWW A;  1ZBM A;  4X48 A;  4UA8 A;  1YPN A;  1LBW A;  4OEU A;  4PP0 A;  2Q2C A;  2ZNU A;  3CSB A;  3KG2 A;  2RC7 A;  2DWJ A;  3VVD A;  4NGU A;  3T1B A;  2DDK A;  3CR9 A;  4G61 A;  4O94 A;  4C1U A;  4PFU A;  3BIG A;  5ITO A;  4XFE A;  3MYU A;  1FPB A;  4PQJ A;  5IKB A;  2JJK A;  2Q8M A;  4JVC A;  2XWV A;  4MNP A;  3Q25 A;  1Y4C A;  3RUM A;  2DVC A;  4IO5 A;  2QS4 A;  3SDF A;  5I84 A;  1DSN A;  2Y7K A;  5I3S A;  1HSJ A;  2RF1 A;  1P99 A;  1FQD A;  4PET A;  4G8N A;  1INP A;  1ZU0 A;  3MUQ A;  5ISU A;  1O64 A;  4JVD A;  3MP8 A;  1FRP A;  4XTC Q;  3NOH A;  1VFE A;  4NED A;  2D21 A;  4PGN A;  4U23 A;  5AA2 A;  3K1P A;  1PC3 A;  3MVZ A;  5DVF A;  4PDH A;  3TOD A;  3IFA A;  3I5O A;  1FTA A;  3DP4 A;  1B2H A;  2DWH A;  1LST A;  1PEB A;  2XX8 A;  4GQO A;  3MVY A;  4QRZ A;  1ZKB A;  3OO7 A;  4NF4 B;  4U4X A;  4KCC A;  1MXZ A;  4ZEK A;  4I62 A;  3IOW A;  1B40 A;  4WKM A;  5ET8 A;  2ZZW A;  1US5 A;  1MQD A;  4JVI A;  2H9B A;  1FPK A;  3U93 A;  4XKN A;  1CNQ A;  5F1Q A;  1NV2 A;  5B7D A;  4OVP A;  3HST A;  1ZLQ A;  4PF6 A;  2ZZV A;  3IB1 A;  3WAF A;  1CB6 A;  2RC8 A;  2NOO A;  1B7Z A;  1NUY A;  2HAV A;  2XWO A;  4NF5 B;  2PCR A;  4GD5 A;  5ICT A;  1MH4 A;  4YU0 A;  2XXU A;  3W9V A;  4WXJ A;  4C1T A;  4R74 A;  3A3C A;  5EYH A;  4JDF A;  5IM2 A;  3E4R A;  1UTH A;  2PT2 A;  2QS3 A;  3IL1 B;  2WBB A;  1NV4 A;  5FTH A;  3IR1 A;  1A8E A;  1DCU A;  1MQJ A;  3MST A;  3KSJ A;  5CRY A;  4OVT A;  1BKA A;  2UXA A;  4FEC A;  4U22 A;  1OLA A;  2R71 A;  2H99 A;  2ONR A;  1NV6 A;  3PUX E;  4MNC A;  1TXF A;  5L8D A;  1MXY A;  4FEB A;  1PBP A;  4NF8 B;  3RY3 A;  2DSF A;  2WYP A;  2I6E A;  2XXY A;  1FSA A;  2Z8D A;  3SER A;  4ELP A;  4OET A;  1TFD A;  3LV0 A;  4F1V A;  5IAI A;  4O3A A;  2X7P A;  2HAU A;  2OZZ A;  5KDT B;  3TKD A;  1QKA A;  2VP1 A;  3LR1 A;  4TQU Q;  3FBP A;  1FTL A;  2FA7 A;  1FPF A;  5FHN A;  2DE4 A;  4P1L A;  2ZYM A;  2REJ A;  4RY1 A;  3OO9 A;  4KR5 A;  4N6D A;  1XS5 A;  2Z8E A;  5EYG A;  3S9L C;  3E9X A;  4PF8 A;  2QPQ A;  5TP9 B;  2PFZ A;  4Q8R A;  1Y9U A;  4YKK A;  5I59 B;  5CBR A;  1QJM A;  5F7V A;  3B6Q A;  4F3B A;  5I58 A;  1D4N A;  2RKM A;  2F7A A;  5EYF A;  2Z23 A;  3FVG A;  1RYO A;  2F6G A;  3LSW A;  4EQB A;  3C35 A;  3O2A A;  3VVE A;  3G3F A;  2V3T A;  1Y1M A;  2Z8F A;  1P1O A;  1SDX A;  4YB5 A;  1FQC A;  3FXQ A;  5KCJ A;  2F36 A;  1SI1 A;  2O68 A;  4ZZA A;  5A5X B;  2ZNS A;  4GXS B;  1Y3P A;  1NV0 A;  1AOV A;  4FAJ A;  1LCF A;  3DEL B;  1MDP 1;  2YLN A;  4G8M A;  3TQW A;  5CMB A;  1DPP A;  1LBX A;  3U92 A;  1TWY A;  4IGT A;  3OMB A;  1FBE A;  3KOT A;  4ESX A;  4OVJ A;  3U72 A;  3VDF A;  4M4G A;  3B8B A;  1GVC A;  3MW0 A;  4MLV A;  1RDZ A;  1LCT A;  3IK6 B;  4H8I A;  4R72 A;  2YJP A;  4OEN A;  3TTR A;  3VLW A;  4H46 A;  1MM6 A;  2CEX A;  1HSE A;  1NV1 A;  3PD9 A;  3IO4 A;  3DM0 A;  3P7I A;  4BDR A;  5ET5 A;  4U1Z A;  1MY2 A;  3G3J A;  3IOU A;  4H1X A;  1QGX A;  1PB8 A;  3TTN A;  4DLD A;  2I0B A;  4DI3 D;  1MXX A;  3TDJ A;  3ZKL A;  4JWO A;  4GWS A;  1PBQ A;  4Z0I A;  3RT8 A;  4GX4 A;  5IGA A;  1FPG A;  1D9Y A;  5DW8 A;  4LZ7 A;  3ODB A;  3FXR A;  1NNT A;  1B3L A;  1AMF A;  1BK4 A;  4GWO A;  5H8N A;  2DWA A;  1BIY A;  4EXK A;  3O66 A;  4MAG A;  1SW1 A;  1QKB A;  4KI0 E;  4PFB A;  4IO7 A;  2NXO A;  1NNF A;  4XKP A;  5DYH A;  3MVW A;  5LOM A;  2GFE A;  2R6G E;  2ONK E;  4O8M A;  2QMW A;  3A09 A;  4IO3 A;  3KJT A;  4EF2 A;  4RJZ A;  3FXU A;  1IEJ A;  4BDM A;  1JVY A;  5BUU A;  3SZP A;  1ZJL A;  1EYJ A;  2WBD A;  1IIT A;  1Q9D A;  1Z7N E;  4PGP A;  2Y84 A;  4OAN A;  4POX A;  1LBZ A;  1MXV A;  3N26 A;  4OTE A;  3FD3 A;  5FHO A;  3ROJ A;  3VV5 A;  5LTC A;  4MCO A;  4G68 B;  3PPN A;  5I2N B;  1FTM A;  4XKQ A;  2WKY A;  1EZ9 A;  3EKI A;  4PFY A;  2OCU A;  1KWH A;  4P9K A;  3DP6 A;  4DDD A;  1B4H A;  3TEL A;  2OWT A;  4EDP A;  5CMC A;  3LSF B;  4QXD A;  4ZEI A;  3MJN A;  2A5T A;  1YXI A;  3H6U A;  4OES A;  3MPL A;  3MWB A;  4YAH X;  3UN6 A;  3M3F A;  5LDZ A;  2O7I A;  1H43 A;  4XF5 A;  1FPL A;  3IOR A;  4TOZ A;  3IX1 A;  5I57 A;  2DVZ A;  5DEX A;  3TTL A;  1DBZ A;  1R9L A;  4NAP A;  1IMF A;  4UAB A;  2F7B A;  1TT1 A;  4RNS A;  1IMC A;  2P2A A;  3LSL A;  4KQP A;  2XWK A;  1FPJ A;  4OYV A;  2WEF A;  4GWZ A;  3ISP A;  3PMV A;  4TLL B;  1J1N A;  1MM7 A;  1R1N A;  3B6T A;  3GZG A;  3HO7 A;  1L5T A;  3TEP A;  4K3F A;  4LAT A;  1JW4 A;  5DT6 A;  3TYH A;  4OMB A;  1S9T A;  3CVG A;  3T9U A;  2PFY A;  4PE3 A;  1LBC A;  4R6Y A;  3S4U A;  1NUW A;  2O7U A;  2NWJ A;  1IMD A;  4N8Y A;  2H98 A;  3KGC A;  4U1O A;  4I9D A;  4GWY A;  2HQ0 A;  4I3Y A;  1N0T A;  3GXA A;  5AA1 A;  2UVI A;  1USY H;  4H6D A;  2E0S A;  1P1Q A;  3TTK A;  5I5P A;  4AB5 A;  2THI A;  2RCB A;  3M3L A;  3VVF A;  3K1M A;  4PAK A;  2ONS A;  5I2K A;  4FOR A;  5H8H B;  3E79 A;  3RYD A;  4YB6 A;  4QFL A;  5JTY A;  4LP2 B;  2IEE A;  2DS9 A;  2WYK A;  2QMX A;  2PX1 A;  3TCF A;  1FQF A;  4PC9 A;  1URD A;  1PB7 A;  1SBP A;  1FBC A;  2CZH A;  1NMU A;  2V4C A;  2VGQ A;  4OFL A;  1B0L A;  4F18 A;  1M5B A;  2QSX A;  4PFI A;  1JP4 A;  3M3K A;  2V3Q A;  1MG1 A;  2VPO A;  3D4G A;  2I58 A;  4KYD A;  2W7Y A;  1LB9 A;  4IY6 A;  5H8Q A;  4R6H A;  2QS1 A;  1FBF A;  3Q27 A;  3C36 A;  1NKX A;  4P1E A;  4OA4 A;  1IME A;  1LBY A;  1SVX B;  2O1L A;  4EQ9 A;  4OEV A;  4EQ7 A;  4HW8 A;  5ESY A;  3VFJ A;  3RN8 A;  1DOT A;  1N04 A;  1FJ9 A;  4RK2 A;  4QFP A;  4N8G A;  3ILU B;  1FJ6 A;  4EF1 A;  5EQ7 A;  3T96 B;  4R6K A;  4YKP A;  1Y1Z A;  4PBQ A;  4GXA A;  2DE2 A;  1I6B A;  4DZ1 A;  1R9Q A;  2DXY A;  3HHG A;  1IMB A;  3N6U A;  4GX3 A;  2VT5 A;  2ZXT A;  2OK2 A;  3B50 A;  4GWX A;  4F3P A;  3MZ1 A;  3EHS A;  3T9X B;  1AWB A;  1WOD A;  2QVU A;  4ECF A;  2A5S A;  1DK4 A;  3E13 X;  4NWD A;  1NFT A;  2Y7R A;  1QUI A;  2H4I A;  4PDD A;  5DTB A;  1OVT A;  1B3G A;  3MP6 A;  4OER A;  3PUV E;  4OXV A;  4PAI A;  2RIN A;  5AA2 D;  4JWX A;  1FQB A;  3G3K A;  4NN3 A;  3AXF A;  2Q9T A;  2FVZ A;  2KQZ A;  4YKI A;  5I56 B;  4ZDM A;  4ELR A;  4RA1 A;  2ZYO A;  2P0S A;  3BIH A;  5CBS A;  2O84 X;  3CFX A;  3LUZ A;  4P47 A;  3UA8 A;  2DP8 A;  4POW A;  4N4U A;  1B05 A;  3PUY E;  2HZK A;  3K01 A;  5I58 B;  2FNC A;  2F35 A;  4O7I A;  4GBW A;  3MZB A;  1B6H A;  2ABH A;  3S2V A;  3T0J A;  1Y20 A;  3W9W A;  3FIR A;  2I3V A;  3A29 A;  4ZEF A;  4NF4 A;  3RPL B;  4P3L A;  4N13 A;  2NVU B;  4F1Y A;  4JXI A;  3FUZ A;  3ILT B;  3PPO A;  1R6Z A;  3OO6 A;  2G29 A;  4AQ4 A;  3IO6 A;  4GX6 A;  4PFT A;  3QMF A;  2ZZX A;  1ANF A;  3MVX A;  1MY3 A;  3KBR A;  3C9H A;  1YZ0 A;  4EUO A;  4FED A;  3OO8 A;  4QSE A;  4EXL A;  3R6U A;  2FYI A;  3EPE A;  4LZ5 A;  1LB8 A;  3K6X A;  4LQ5 A;  5JK4 A;  3FV2 A;  4NF5 A;  1FBP A;  1JET A;  4DXU A;  4JSD A;  5T3J A;  1B3E A;  1POT A;  1LFH A;  4P8B A;  5IZ3 B;  2LAO A;  2D3I A;  4F3G A;  2Y7I A;  3D4C A;  1N7W A;  3EQ1 A;  5TPA B;  1QVS A;  2OWZ A;  4MF3 A;  1RDY A;  3UGW A;  3V83 A;  3CFL A;  1A55 A;  5H8F B;  3B7D A;  1YTV A;  4P56 A;  2PYY A;  4X8R A;  3E3K A;  1QUL A;  4E0X A;  2XHD A;  4QFN A;  4MHF A;  3K0V A;  2Y5L A;  4H5F A;  4HS7 A;  2UVG A;  4N81 A;  4OVQ A;  4NF8 A;  1DMB A;  3K2D A;  1XHY A;  2AYS A;  3G3I A;  2GHB A;  4ZED A;  4YMA A;  5AA4 A;  2X26 A;  4OQO A;  1MRP A;  4HE1 A;  5CC2 A;  3JYR A;  3MP1 A;  2VHA A;  3PPR A;  1B58 A;  4MFI A;  5KDT A;  1B1H A;  2B65 A;  3TFL A;  1S50 A;  1Y4T A;  1LFI A;  1BTJ A;  5AA3 A;  2XXX A;  3PMW A;  3PGF A;  2VOZ A;  3E78 A;  4RK9 A;  2I3W A;  1US4 A;  4BLA A;  4NMY A;  5FHM A;  3N5L A;  3SKP A;  2HFB A;  3SEX A;  1MPD A;  4G68 C;  3B6W A;  2GH9 A;  2B3F A;  5TP9 A;  2B4M A;  1H3D A;  5I59 A;  3IAZ A;  4ZE9 A;  5CM6 A;  3N94 A;  1EH3 A;  1NNK A;  5HPQ A;  1NNP A;  1LAG E;  2XD3 A;  4F1U A;  4F31 B;  4GL8 A;  3FVK A;  3K6U A;  2H25 A;  4DXB A;  3PUZ E;  2HCA A;  5HBC A;  1NL5 A;  2QJE A;  1AH5 A;  4AS4 A;  1IXI A;  3BKI B;  1N7X A;  1JEV A;  1O63 A;  3D1R A;  4DE8 A;  3IOT A;  5B70 A;  1LAF E;  2HPG A;  5A5X A;  4GRK A;  1SYI A;  2IA4 A;  3KJ7 A;  2NUV A;  1P1N A;  1PB9 A;  1A54 A;  2ZYK A;  4MLQ A;  1TFA A;  5EQ9 A;  1M5D A;  2WX9 A;  3GBA A;  3KSX A;  3TQL A;  5J16 A;  5L9S A;  1GGG A;  4LVQ A;  4NG7 A;  2L5V A;  2DOJ A;  1WDN A;  3QIM A;  2HEU A;  4IB2 A;  5L9M A;  1NH8 A;  1LFG A;  4ND9 A;  1RDX A;  4OHN A;  2OJT A;  1MH3 A;  4NTL A;  4IO2 A;  3RNN A;  5JEI A;  1F9B A;  3R26 A;  3KN7 A;  2F97 A;  1XVY A;  1ELJ A;  1LAX A;  3PD8 A;  4PFR A;  1G0H A;  2QFL A;  2XX7 A;  3KOS A;  4M1V A;  1SI0 A;  3K6V A;  4RPO A;  1MQG A;  3PMX A;  1EU8 A;  3SEY A;  4OFJ A;  1XI6 A;  2Y5K A;  1MPC A;  2QVR A;  4GL0 A;  3QYT A;  3BBR A;  1B5J A;  2GQ1 A;  1IXC A;  1XOC A;  4QSC A;  1WVJ A;  2ZYN A;  5K2Y A;  5ET6 A;  4YMB A;  1ZIU A;  2X7Q A;  2V25 A;  1IMA A;  3U1O A;  5EQA A;  3C34 A;  3T9H B;  4NF6 B;  3FAS A;  2XX9 A;  3N6T A;  3T66 A;  2QVV A;  3H06 B;  4HXV A;  1UTB B;  1M5F A;  2QS2 A;  4KYS A;  4U4S A;  4IO4 A;  1MY4 A;  1BLF A;  2I4C A;  3F11 A;  3C31 A;  3LBS A;  4NF0 A;  1FBG A;  1QUK A;  4FIM A;  4XEQ A;  3RPW A;  5ELV A;  4Q30 B;  2R9J A;  1M5C A;  4P0I A;  2REG A;  1IIW A;  3CHG A;  1XVX A;  3K1N A;  4R2B A;  1UIU A;  3VLV A;  3ECR A;  1SW5 A;  3H3G A;  3TPA A;  5CI5 A;  1QW0 A;  2V84 A;  1B51 A;  3CG1 A;  1N84 A;  4R75 A;  1DTZ A;  3U8Q A;  5K2X A;  3GBB A;  3QUF A;  2XXP A;  1D3K A;  3CI8 A;  3O97 A;  5FTI A;  1I69 A;  4P11 A;  2KR0 A;  1N76 A;  5ICQ A;  2CZL A;  4HTG A;  5EQ8 A;  2G93 A;  4G68 A;  5I2N A;  1B52 A;  3TCH A;  5CMM A;  3QAX A;  1N3X A;  3KN3 A;  1OQG A;  5IZ1 A;  2Q2A A;  4OZ9 A;  4YKJ A;  2KLF A;  3HFU A;  2ALU A;  3TUS A;  5ITP A;  3WAE A;  1NV5 A;  3OEM A;  1ZMG A;  4DIG A;  4QFO A;  3RGY A;  4ZE8 A;  4H8J A;  1MY1 A;  3OSQ A;  2MKZ A;  4JB7 A;  3ZS6 A;  1G0I A;  4X9T A;  3PPQ A;  2FIX A;  3GYY A;  2CZK A;  5DVJ A;  1FPD A;  5AA2 B;  4Z7E A;  1DTG A;  4O3B A;  3MZ9 A;  1B7H A;  4KXP A;  4ZEC A;  1M5E A;  1MXW A;  2YPN A;  1NV3 A;  3O6I A;  4H45 A;  3OSR A;  3G7W A;  4LQ2 A;  3IB2 A;  3FVO A;  1IQ7 A;  1FCK A;  3S9E A;  4HCY A;  2OX3 A;  3RLF E;  2HXR A;  1FPE A;  1Y3N A;  3LC8 A;  3JZJ A;  3MAM A;  1LAH E;  1MPB A;  2FIE A;  1JEU A;  4HE2 A;  3SES A;  1JVX A;  3S9N C;  3W15 C;  1FPI A;  2OBG A;  1VDW A;  3V5A A;  1ATG A;  5TU0 A;  3QSL A;  4ZS9 A;  1JNF A;  3IB0 A;  3TZA A;  1NH7 A;  2RCA A;  3SEV A;  3UP9 A;  4U21 A;  3IJX B;  3IJO B;  3LUY A;  2DYX A;  3HCQ A;  4AS5 A;  2CZI A;  3FZV A;  4R9G A;  1EYK A;  1YYZ A;  2Q8J A;  1B3F A;  4L17 A;  2QRY A;  1KZ8 A;  3CG3 A;  4PTK A;  1QUJ A;  1UTH B;  1GV8 A;  3SEW A;  2ESN A;  1VE4 A;  5HM4 B; 
#chains in the Genus database with same CATH homology
 1OVB A;  3V89 B;  2I4B A;  2RC9 A;  4GOT A;  4YB7 A;  2Q88 A;  1UQW A;  4I1D A;  1I6Q A;  3TCG A;  5L9O A;  4QF9 A;  1IZ1 A;  4H67 A;  4X1B A;  4XXU A;  2VD2 A;  4GLI A;  3MC2 A;  5H8H A;  4RYA A;  1RYX A;  3OD7 A;  4GVO A;  4U2R A;  4RPN A;  3H4Z A;  1FQA A;  3K00 A;  4Q5T A;  4R2F A;  4OWD A;  4ELO A;  4ISU A;  1IXG A;  3FVN A;  2UVJ A;  1HSL A;  1A8F A;  3ONM A;  4IY5 A;  2AL4 A;  1LBB A;  3Q28 A;  3ZSF A;  4ZEB A;  3SEU A;  1YAE A;  2XXI A;  2F34 A;  1LLS A;  2UYE A;  3O6G A;  2PT1 A;  3UOR A;  3G3G A;  3HN0 A;  4F2Q A;  1Q1K A;  4AB6 A;  3RTF B;  3T9V A;  3L6G A;  4G2Z A;  4X1D A;  3MBP A;  1AL3 A;  4MBP A;  1EZO A;  3H7M A;  1H44 A;  1VR5 A;  1H45 A;  3G3H A;  4LUB A;  3FAT A;  3GLB A;  4P0G A;  1DPE A;  4DCX A;  5KCJ B;  1CE2 A;  2F5X A;  3I3V A;  2O1M A;  1OLC A;  1UIV A;  3H6W A;  3KEI A;  3USD A;  1JW1 A;  1FTJ A;  2Y7W A;  4R73 A;  1SD3 A;  2XXV A;  4IGR A;  3R7X A;  1A40 A;  3CRB A;  5AA4 B;  1GTK A;  2XXQ A;  4MH5 A;  3K4U A;  1MY0 A;  3SET A;  3VXC A;  3HHF A;  5H8S A;  1P1W A;  2UVH A;  3OEN A;  3UIF A;  4TLM B;  2BJJ X;  3KZG A;  3O28 A;  2OLB A;  4KD5 A;  3K6W A;  5CMK A;  4NE4 A;  2ZMB A;  5I56 A;  1Y3Q A;  4RXL A;  2E1S A;  4JWY A;  4H65 A;  2I49 A;  4ESW A;  1B4Z A;  2XD2 A;  1Z7M E;  3C4M A;  4LA9 A;  3RT6 B;  4F19 A;  2F78 A;  4GIZ A;  4F3S A;  3TMG A;  1MQI A;  4H0W A;  4JBZ A;  4BDL A;  1B46 A;  2PMS A;  3CIJ A;  2DE3 A;  3O6H A;  4N07 A;  3OOA A;  4FAT A;  4G8H A;  2I0C A;  3I6V A;  3U94 A;  2M8C A;  4KFQ A;  4F2O A;  3FV1 A;  1B1X A;  1BP5 A;  2QL3 A;  1S7Y A;  4FE8 A;  2V93 A;  1B5I A;  3K02 A;  5AE4 A;  1FTK A;  3CSG A;  4JSO A;  1LGB C;  4OFO A;  5H8N B;  3VLU A;  4XKR A;  1B5H A;  2XXW A;  5BWJ A;  4ELQ A;  4C0R A;  3OEK A;  1H76 A;  5J1D A;  2D5W A;  4YZZ A;  2PBW A;  3PPP A;  4XIG Q;  3QXM A;  3VXB A;  4F39 A;  3KN8 A;  4R9F A;  3T93 B;  3JV9 A;  3LSX A;  1B3H A;  3EF7 A;  3HPI A;  1B9J A;  3UK4 A;  2XXT A;  3HV1 A;  1RKM A;  4WED A;  3DP8 A;  5TPA A;  1A7L A;  1MS7 A;  2CMO A;  3KFM A;  3H6T A;  2O6A A;  5H8F A;  1I6A A;  1URS A;  1N3W A;  3M8U A;  4HCW A;  4KCD A;  1SW4 A;  3Q26 A;  4BDQ A;  4YIC A;  4F22 A;  2I48 A;  1FW0 A;  1OMP A;  3QK6 A;  2V3U A;  4BDN A;  4QFK A;  2A5T B;  4N6P A;  3DLN A;  4F29 A;  3VE1 B;  3BFU A;  3S9M C;  2UYF A;  5I57 B;  3OEL A;  5DEX B;  1XT8 A;  3CFZ A;  1YCJ A;  4LZ8 A;  1FTO A;  1POY 1;  1SYH A;  3THI A;  4Q0C A;  4GF8 A;  3V8X B;  1OQH A;  3MPK A;  4FJP A;  4KPT A;  1II5 A;  2GHA A;  2P1S A;  3TTM A;  3EHT A;  1B0H A;  3MQ9 A;  4ZZE A;  4GFR A;  2PVU A;  3O9P A;  3A3U A;  2F7C A;  3QUJ A;  2Y7P A;  4PE5 B;  3FGS A;  4QSD A;  1D9V A;  3RTW B;  1ZTY A;  1Q35 A;  3BFT A;  3EN3 A;  1B7U A;  3ZKK A;  3H6V A;  1XC1 A;  3OXN A;  3FJM A;  1OIB A;  3IOV A;  4DXC A;  3H03 A;  2O51 A;  5KZT A;  4PFW A;  4H5G A;  3FJG A;  1A99 A;  1SQY A;  1T0K A;  3EHU A;  3PUW E;  1VSO A;  2H5Y A;  3PU5 A;  4KYE A;  1O7T A;  2B3B A;  1IUD A;  3PV0 E;  2VD3 A;  1URG A;  4THI A;  3T22 A;  4IO6 A;  2Z22 A;  2GRV A;  2XXH A;  1JW5 A;  2HZL A;  5I2K B;  1IXH A;  4KHZ E;  3Q29 A;  1MXU A;  2DQV A;  2F6P A;  5DVI A;  5EHS A;  2DWI A;  5JTY B;  1P1U A;  1B32 A;  3C32 A;  2HXW A;  3FJ7 A;  1USY E;  3TAJ A;  4E0W A;  4QHQ A;  2AL5 A;  4ONY A;  2OWS A;  4DCY A;  5M2V A;  3L6H A;  4O3C A;  2AIX A;  4BDO A;  2Q89 A;  1JQF A;  4NF6 A;  1PDA A;  2F8D A;  4G4P A;  5H8Q B;  1SW2 A;  4NWC A;  1UTB A;  3O29 A;  2DXR A;  2ZNT A;  4G77 A;  2XXR A;  1EZP A;  2O69 A;  4I8C A;  1VFD A;  1AIV A;  1MQH A;  4LON B;  4UAC A;  1GR2 A;  1FQE A;  1MDQ A;  2ANJ A;  3C33 A;  3RQT A;  5EHM A;  4WEP A;  1ZBM A;  4X48 A;  4UA8 A;  1YPN A;  4OEU A;  4PP0 A;  2Q2C A;  2ZNU A;  3CSB A;  3KG2 A;  2RC7 A;  2DWJ A;  3VVD A;  3CR9 A;  4C1U A;  4PFU A;  5ITO A;  4PQJ A;  5IKB A;  3Q25 A;  1Y4C A;  3RUM A;  2DVC A;  4IO5 A;  2QS4 A;  3SDF A;  5I84 A;  1DSN A;  2Y7K A;  1HSJ A;  2RF1 A;  1P99 A;  1FQD A;  4PET A;  4G8N A;  1ZU0 A;  3MUQ A;  5ISU A;  1O64 A;  3MP8 A;  4XTC Q;  1VFE A;  4NED A;  2D21 A;  4U23 A;  5AA2 A;  3K1P A;  1PC3 A;  3MVZ A;  5DVF A;  3TOD A;  3I5O A;  3DP4 A;  1B2H A;  2DWH A;  1LST A;  1PEB A;  2XX8 A;  4GQO A;  3MVY A;  4QRZ A;  1ZKB A;  3OO7 A;  4NF4 B;  4U4X A;  4KCC A;  1MXZ A;  4ZEK A;  4I62 A;  3IOW A;  1B40 A;  4WKM A;  1US5 A;  1MQD A;  2H9B A;  3U93 A;  4XKN A;  5F1Q A;  5B7D A;  3HST A;  1ZLQ A;  3IB1 A;  3WAF A;  1CB6 A;  2RC8 A;  2NOO A;  1B7Z A;  2HAV A;  4NF5 B;  4GD5 A;  5ICT A;  1MH4 A;  4YU0 A;  2XXU A;  3W9V A;  4WXJ A;  4C1T A;  4R74 A;  3A3C A;  4JDF A;  3E4R A;  1UTH A;  2PT2 A;  2QS3 A;  3IL1 B;  5FTH A;  3IR1 A;  1A8E A;  1MQJ A;  3KSJ A;  5CRY A;  1BKA A;  2UXA A;  4FEC A;  4U22 A;  1OLA A;  2R71 A;  2H99 A;  2ONR A;  3PUX E;  1TXF A;  5L8D A;  1MXY A;  4FEB A;  1PBP A;  4NF8 B;  3RY3 A;  2DSF A;  2I6E A;  2XXY A;  2Z8D A;  3SER A;  4ELP A;  4OET A;  1TFD A;  4F1V A;  5IAI A;  4O3A A;  2X7P A;  2HAU A;  2OZZ A;  5KDT B;  3TKD A;  1QKA A;  2VP1 A;  3LR1 A;  4TQU Q;  1FTL A;  2FA7 A;  5FHN A;  2DE4 A;  2ZYM A;  2REJ A;  4RY1 A;  3OO9 A;  4KR5 A;  1XS5 A;  2Z8E A;  3S9L C;  3E9X A;  2QPQ A;  5TP9 B;  4Q8R A;  1Y9U A;  4YKK A;  5I59 B;  5CBR A;  1QJM A;  5F7V A;  3B6Q A;  4F3B A;  5I58 A;  1D4N A;  2RKM A;  2F7A A;  5EYF A;  2Z23 A;  3FVG A;  1RYO A;  2F6G A;  3LSW A;  4EQB A;  3C35 A;  3O2A A;  3VVE A;  3G3F A;  2V3T A;  1Y1M A;  2Z8F A;  1P1O A;  1SDX A;  4YB5 A;  1FQC A;  3FXQ A;  5KCJ A;  2F36 A;  1SI1 A;  2O68 A;  4ZZA A;  5A5X B;  2ZNS A;  4GXS B;  1Y3P A;  1AOV A;  4FAJ A;  1LCF A;  3DEL B;  1MDP 1;  2YLN A;  4G8M A;  3TQW A;  5CMB A;  1DPP A;  3U92 A;  1TWY A;  4IGT A;  3OMB A;  3KOT A;  4ESX A;  4OVJ A;  3U72 A;  3VDF A;  4M4G A;  1GVC A;  3MW0 A;  4MLV A;  1LCT A;  3IK6 B;  4H8I A;  4R72 A;  2YJP A;  4OEN A;  3TTR A;  3VLW A;  1MM6 A;  1HSE A;  3PD9 A;  3IO4 A;  3DM0 A;  3P7I A;  4BDR A;  4U1Z A;  1MY2 A;  3G3J A;  3IOU A;  4H1X A;  1PB8 A;  3TTN A;  4DLD A;  2I0B A;  1MXX A;  3TDJ A;  3ZKL A;  4JWO A;  1PBQ A;  4Z0I A;  3RT8 A;  1D9Y A;  4LZ7 A;  3ODB A;  3FXR A;  1NNT A;  1B3L A;  1AMF A;  4GWO A;  5H8N A;  2DWA A;  1BIY A;  4EXK A;  3O66 A;  1SW1 A;  1QKB A;  4KI0 E;  4IO7 A;  2NXO A;  1NNF A;  4XKP A;  5DYH A;  3MVW A;  5LOM A;  2GFE A;  2R6G E;  2ONK E;  2QMW A;  3A09 A;  4IO3 A;  3KJT A;  4EF2 A;  4RJZ A;  3FXU A;  1IEJ A;  4BDM A;  1JVY A;  5BUU A;  1ZJL A;  1IIT A;  1Z7N E;  2Y84 A;  4POX A;  1MXV A;  3N26 A;  4OTE A;  3FD3 A;  5FHO A;  3VV5 A;  4G68 B;  3PPN A;  5I2N B;  1FTM A;  4XKQ A;  2WKY A;  1EZ9 A;  4PFY A;  2OCU A;  1KWH A;  3DP6 A;  4DDD A;  1B4H A;  3TEL A;  2OWT A;  4EDP A;  5CMC A;  3LSF B;  4ZEI A;  3MJN A;  2A5T A;  3H6U A;  4OES A;  3MPL A;  3MWB A;  4YAH X;  3UN6 A;  3M3F A;  2O7I A;  1H43 A;  3IOR A;  4TOZ A;  3IX1 A;  5I57 A;  2DVZ A;  5DEX A;  3TTL A;  1R9L A;  2F7B A;  1TT1 A;  4RNS A;  2P2A A;  3LSL A;  4KQP A;  4OYV A;  3PMV A;  4TLL B;  1J1N A;  1MM7 A;  1R1N A;  3B6T A;  3GZG A;  3HO7 A;  1L5T A;  3TEP A;  4K3F A;  4LAT A;  1JW4 A;  5DT6 A;  3TYH A;  4OMB A;  1S9T A;  3CVG A;  3T9U A;  1LBC A;  4R6Y A;  3S4U A;  2O7U A;  2NWJ A;  2H98 A;  3KGC A;  4U1O A;  4I9D A;  2HQ0 A;  1N0T A;  3GXA A;  5AA1 A;  2UVI A;  1USY H;  4H6D A;  2E0S A;  1P1Q A;  3TTK A;  4AB5 A;  2THI A;  2RCB A;  3M3L A;  3VVF A;  3K1M A;  2ONS A;  5I2K A;  4FOR A;  5H8H B;  4YB6 A;  4QFL A;  5JTY A;  4LP2 B;  2IEE A;  2DS9 A;  2QMX A;  2PX1 A;  3TCF A;  1FQF A;  1URD A;  1PB7 A;  1SBP A;  1NMU A;  2VGQ A;  4OFL A;  1B0L A;  4F18 A;  1M5B A;  2QSX A;  3M3K A;  2V3Q A;  1MG1 A;  3D4G A;  2I58 A;  4KYD A;  2W7Y A;  1LB9 A;  4IY6 A;  5H8Q A;  4R6H A;  2QS1 A;  3Q27 A;  3C36 A;  1NKX A;  1SVX B;  2O1L A;  4EQ9 A;  4OEV A;  4EQ7 A;  4HW8 A;  3VFJ A;  3RN8 A;  1DOT A;  1N04 A;  4RK2 A;  4QFP A;  3ILU B;  4EF1 A;  3T96 B;  4R6K A;  4YKP A;  1Y1Z A;  4GXA A;  2DE2 A;  1I6B A;  4DZ1 A;  1R9Q A;  2DXY A;  3HHG A;  3N6U A;  2ZXT A;  2OK2 A;  4F3P A;  3MZ1 A;  3EHS A;  3T9X B;  1WOD A;  4ECF A;  2A5S A;  3E13 X;  4NWD A;  1NFT A;  2Y7R A;  1QUI A;  2H4I A;  5DTB A;  1OVT A;  1B3G A;  3MP6 A;  4OER A;  3PUV E;  4OXV A;  5AA2 D;  2RIN A;  4JWX A;  1FQB A;  3G3K A;  3AXF A;  2Q9T A;  4YKI A;  5I56 B;  4ZDM A;  4ELR A;  4RA1 A;  2ZYO A;  2P0S A;  5CBS A;  2O84 X;  3CFX A;  3UA8 A;  2DP8 A;  4POW A;  1B05 A;  3PUY E;  2HZK A;  3K01 A;  5I58 B;  2FNC A;  2F35 A;  3MZB A;  1B6H A;  2ABH A;  3S2V A;  1Y20 A;  3W9W A;  3FIR A;  2I3V A;  4ZEF A;  4NF4 A;  4N13 A;  2NVU B;  4F1Y A;  4JXI A;  3FUZ A;  3ILT B;  3PPO A;  1R6Z A;  3OO6 A;  2G29 A;  4AQ4 A;  3IO6 A;  4PFT A;  1ANF A;  3MVX A;  1MY3 A;  3KBR A;  3C9H A;  4EUO A;  4FED A;  3OO8 A;  4QSE A;  4EXL A;  3R6U A;  2FYI A;  3EPE A;  4LZ5 A;  1LB8 A;  3K6X A;  4LQ5 A;  5JK4 A;  3FV2 A;  4NF5 A;  1JET A;  4DXU A;  4JSD A;  1B3E A;  1POT A;  1LFH A;  2LAO A;  2D3I A;  4F3G A;  2Y7I A;  3D4C A;  1N7W A;  3EQ1 A;  5TPA B;  1QVS A;  4MF3 A;  3UGW A;  3V83 A;  3CFL A;  1A55 A;  5H8F B;  3B7D A;  1YTV A;  2PYY A;  3E3K A;  1QUL A;  4E0X A;  2XHD A;  4QFN A;  3K0V A;  4HS7 A;  4H5F A;  2UVG A;  4NF8 A;  1DMB A;  3K2D A;  1XHY A;  2AYS A;  3G3I A;  2GHB A;  4ZED A;  4YMA A;  5AA4 A;  2X26 A;  4OQO A;  1MRP A;  5CC2 A;  3JYR A;  3MP1 A;  2VHA A;  3PPR A;  1B58 A;  4MFI A;  5KDT A;  1B1H A;  2B65 A;  3TFL A;  1S50 A;  1Y4T A;  1LFI A;  1BTJ A;  5AA3 A;  2XXX A;  3PMW A;  3PGF A;  2VOZ A;  4RK9 A;  2I3W A;  1US4 A;  4BLA A;  4NMY A;  5FHM A;  3N5L A;  3SKP A;  2HFB A;  3SEX A;  1MPD A;  4G68 C;  3B6W A;  2GH9 A;  2B3F A;  5TP9 A;  1H3D A;  5I59 A;  3IAZ A;  4ZE9 A;  5CM6 A;  3N94 A;  1EH3 A;  1NNK A;  5HPQ A;  1NNP A;  1LAG E;  2XD3 A;  4F1U A;  4F31 B;  4GL8 A;  3FVK A;  3K6U A;  2H25 A;  4DXB A;  3PUZ E;  2HCA A;  5HBC A;  1NL5 A;  2QJE A;  1AH5 A;  1IXI A;  3BKI B;  1N7X A;  1JEV A;  1O63 A;  4DE8 A;  3IOT A;  5B70 A;  1LAF E;  5A5X A;  4GRK A;  1SYI A;  2IA4 A;  3KJ7 A;  2NUV A;  1P1N A;  1PB9 A;  1A54 A;  2ZYK A;  4MLQ A;  1TFA A;  1M5D A;  3GBA A;  3KSX A;  3TQL A;  5L9S A;  1GGG A;  4LVQ A;  2DOJ A;  1WDN A;  3QIM A;  2HEU A;  4IB2 A;  5L9M A;  1NH8 A;  1LFG A;  4ND9 A;  4OHN A;  2OJT A;  1MH3 A;  4NTL A;  4IO2 A;  3RNN A;  5JEI A;  1F9B A;  3R26 A;  3KN7 A;  2F97 A;  1XVY A;  1ELJ A;  1LAX A;  3PD8 A;  2XX7 A;  3KOS A;  4M1V A;  1SI0 A;  3K6V A;  4RPO A;  1MQG A;  3PMX A;  1EU8 A;  3SEY A;  4OFJ A;  1MPC A;  4GL0 A;  3QYT A;  3BBR A;  1B5J A;  1IXC A;  1XOC A;  4QSC A;  1WVJ A;  2ZYN A;  5K2Y A;  4YMB A;  1ZIU A;  2X7Q A;  2V25 A;  3U1O A;  3C34 A;  3T9H B;  4NF6 B;  3FAS A;  2XX9 A;  3N6T A;  3T66 A;  3H06 B;  1UTB B;  1M5F A;  2QS2 A;  4KYS A;  4U4S A;  4IO4 A;  1MY4 A;  1BLF A;  2I4C A;  3F11 A;  3C31 A;  3LBS A;  1QUK A;  4FIM A;  3RPW A;  5ELV A;  4Q30 B;  2R9J A;  1M5C A;  4P0I A;  2REG A;  1IIW A;  1XVX A;  3K1N A;  4R2B A;  1UIU A;  3VLV A;  3ECR A;  1SW5 A;  3H3G A;  3TPA A;  5CI5 A;  1QW0 A;  2V84 A;  1B51 A;  3CG1 A;  1N84 A;  4R75 A;  1DTZ A;  3U8Q A;  5K2X A;  3GBB A;  3QUF A;  2XXP A;  1D3K A;  3CI8 A;  3O97 A;  5FTI A;  1I69 A;  4P11 A;  1N76 A;  5ICQ A;  2CZL A;  4HTG A;  2G93 A;  4G68 A;  5I2N A;  1B52 A;  3TCH A;  5CMM A;  3QAX A;  1N3X A;  3KN3 A;  1OQG A;  2Q2A A;  4OZ9 A;  4YKJ A;  2KLF A;  2ALU A;  3TUS A;  5ITP A;  3WAE A;  3OEM A;  1ZMG A;  4DIG A;  4QFO A;  3RGY A;  4ZE8 A;  4H8J A;  1MY1 A;  3OSQ A;  4JB7 A;  3ZS6 A;  4X9T A;  3PPQ A;  5DVJ A;  5AA2 B;  4Z7E A;  1DTG A;  4O3B A;  3MZ9 A;  1B7H A;  4ZEC A;  1M5E A;  1MXW A;  2YPN A;  3O6I A;  3OSR A;  3G7W A;  4LQ2 A;  3IB2 A;  3FVO A;  1IQ7 A;  1FCK A;  3S9E A;  4HCY A;  3RLF E;  1Y3N A;  3LC8 A;  3JZJ A;  3MAM A;  1LAH E;  1MPB A;  1JEU A;  3SES A;  1JVX A;  3S9N C;  3W15 C;  2OBG A;  3V5A A;  1ATG A;  5TU0 A;  3QSL A;  4ZS9 A;  1JNF A;  3IB0 A;  3TZA A;  1NH7 A;  2RCA A;  3SEV A;  3UP9 A;  4U21 A;  3IJX B;  3IJO B;  3LUY A;  2DYX A;  3HCQ A;  3FZV A;  4R9G A;  2Q8J A;  1B3F A;  4L17 A;  2QRY A;  3CG3 A;  1QUJ A;  1UTH B;  1GV8 A;  3SEW A;  2ESN A;  1VE4 A;  5HM4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...