3MP1A

Complex structure of sgf29 and trimethylated h3k4
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
517
structure length
509
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
total genus 136
structure length 509
sequence length 517
ec nomenclature
pdb deposition date 2010-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp1A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp1A01
3T66A 3CI8A 3P8DA 3HHFA 4YAHX 4HCZA 4NF4A 2HEUA 4M4GA 4MFIA 2DXYA 1IQ7A 3KFMA 3ODBA 2L89A 1FQBA 3OMBA 1O7TA 3QK6A 2Q2AA 1TXFA 4GY5A 4E7JA 4NMYA 1NH7A 2ONKE 2DWHA 2FNCA 5HPQA 4C5GA 4U1ZA 3TFLA 3O6IA 3M9QA 2RINA 2XXPA 4PLIA 3OYHA 1BIYA 3IB1A 3LSXA 4LVQA 2RJCA 3TTLA 3NTKA 2VHAA 1LAFE 4H5FA 5AE4A 4BDRA 1MM7A 4U22A 4BD3A 2QJEA 4N6PA 4ZE8A 3OEMA 5H8FA 4P11A 3PFSA 3QSLA 4IO6A 1WGSA 4B9WA 1PBPA 3L2VA 3GBBA 3PUXE 2HAUA 4OHNA 2DE2A 5I59B 4Z02A 1HSEA 3FV2A 1H43A 3TPAA 1FTJA 4LQ2A 2HZLA 2Z8EA 3R26A 3S9LC 4N07A 4NF8A 4OETA 1N76A 3PMXA 1TFDA 4ESXA 5KCOA 4MLVA 3PD8A 3KUFA 5L9SA 4E7KA 1QKAA 5ICTA 2ZYNA 4B9XA 5KDTA 3OSQA 3L2UA 4R2FA 3IOUA 2PT2A 3T22A 4XTCQ 2HQ0A 1D9YA 2XXUA 2XHDA 1JETA 4RK9A 4TOZA 4JDFA 1KHCA 2QS3A 4OEVA 1OVBA 3C9HA 3PUVE 2RO0A 2HXWA 3OYJA 1TWYA 3K0VA 4ZECA 1JVXA 2OBGA 4QQ6A 1FQDA 2B65A 2Z8FA 5FRNA 3OEKA 3VLWA 1A99A 1H76A 4C5EA 3PUYE 3H06B 5HM4B 1B9JA 3OMGA 1B7ZA 1IZ1A 3UA8A 4R73A 1R9QA 4U2RA 3MP6A 2V3QA 3MVWA 1AIVA 3CSGA 3MP1A 2WACA 4THIA 4E7LA 3H8ZA 3EHSA 2MWOA 2ZYMA 2L8DA 1IXHA 4HS7A 4ZEDA 2HFBA 3V89B 2YRVA 2XK0A 3MC2A 3TQLA 5K2YA 3BFTA 1GR2A 4YKJA 5HBCA 1AH5A 4YB7A 1P1OA 2Y7RA 2OLBA 3MEWA 3BBRA 1S9TA 2DP8A 2ZYKA 3W9WA 2XXQA 1OQHA 1SBPA 2G93A 5KDTB 4XKPA 3UWNA 5B70A 5I59A 3MZ1A 4IUPA 2ZYOA 3IK6B 2O69A 3ZKLA 1FQCA 5M9OA 3RLFE 4TLMB 3RT6B 2IG0A 4KR5A 4ZEFA 2RI5A 4G2ZA 2F7AA 3HCQA 3LUYA 1DMBA 1URGA 3WAFA 4HCWA 1GGGA 4QRZA 3H6UA 4UA8A 4C1TA 2YLNA 2ABHA 1POTA 3KGCA 2VOZA 2B8AA 1A54A 3O29A 4A4EA 3TDJA 3H3GA 3PMVA 3R7XA 2I4BA 3HO7A 2M0OA 4EXKA 1MXYA 1VFDA 1SYIA 1B32A 2HZKA 3CFXA 4H6DA 5J26A 5DTBA 2H4IA 4G77A 2XXHA 3K2DA 2XXXA 1GV8A 4IO5A 1FQFA 1I6BA 4QQDA 1LB8A 4II1A 3L2QA 3ASKA 3CFLA 5I58A 4ELQA 3SKPA 3ONMA 2NOOA 2QPQA 1R9LA 1DOTA 1I69A 1POY1 5J39A 3N5LA 4FU6A 2HAVA 3B6TA 1JW5A 1EU8A 3FD3A 3MVXA 3MO8A 3LX7A 4TLLB 4BDNA 2X4WA 1B6HA 4WEDA 2OJTA 1MXXA 3K6VA 5JTYB 2QL3A 4RA1A 4P0GA 3KN8A 4FAJA 3M8UA 4YU0A 2V93A 3OB9A 3E9XA 3C35A 2E0SA 4H5GA 5DVIA 4G68C 3Q29A 4ZZEA 4KYDA 1DTZA 2R9JA 4ZS9A 4BACA 2QRYA 3A09A 1H44A 4YZZA 1EZPA 2UVGA 4ZZAA 3JV9A 2NXOA 4Q5WA 2DS9A 3MZBA 2RCBA 2DWJA 3KOTA 3EF7A 4ZDMA 2H5YA 3SD4A 1A8FA 5K2XA 4FORA 1M5FA 2YJPA 4QW2A 3TUSA 4BE1A 4GVOA 2O68A 3K4UA 1EZOA 2MWPA 1M5BA 1NNPA 4IY6A 1Y1MA 1YAEA 2Z8DA 5I2NA 3S3NA 3C33A 1GVCA 1B05A 1A7LA 1B58A 5CI5A 3OQ5A 4OENA 1Y4CA 2VD3A 2UXAA 1MM6A 4PP0A 4H1XA 3PPPA 4FIMA 3VV5A 1OI1A 1FW0A 4KFQA 3PUWE 1Y20A 1OYXA 2HQEA 3OXNA 1LBBA 4OWDA 1ZMGA 4OERA 3DB4A 2F5XA 2UVIA 3USDA 4DCXA 4XXUA 4POXA 3U1OA 5F7VA 3CIJA 3SEUA 4FE8A 3S9NC 1B51A 2X7QA 5AA1A 4ESWA 3L6HA 3Q27A 3ILUB 2ESNA 5CMCA 5L9OA 4ISUA 2DQVA 2F35A 3KSJA 3OO7A 3FIRA 1IUDA 3HN0A 2G29A 5AA4A 2H99A 3SESA 3TMGA 3G3JA 3VXBA 4F1YA 3IOVA 4LQ5A 2A5TA 2XX9A 3PGFA 2NWJA 4X1DA 4XIGQ 4OTEA 4OZ9A 3RN8A 3IAZA 3U72A 3BDLA 5KCJA 2BKDN 4RY1A 3IORA 4F3GA 4O3AA 1URSA 3G3GA 2V84A 2RI2A 1B7UA 2Q9TA 1LFGA 1UTBA 3FXUA 4NF8B 5LOMA 1JW1A 3QJ6A 3M3FA 4QFKA 5AA2A 4IUVA 4NWCA 4WXJA 2THIA 1WDNA 2O4XB 4R9FA 3R6UA 5M2VA 1H3ZA 4F39A 4NF5A 1JVYA 2XXTA 3FJ7A 3UGWA 4U23A 1B0LA 4PQJA 1D3KA 2QSXA 3D4GA 4TQUQ 2BIVA 3CFZA 4ZEIA 2H98A 4WEPA 2X26A 3MBPA 4E0XA 3KJ7A 1HSLA 5H8QB 3IR1A 4F19A 4Q8RA 3MQ9A 1ZJLA 2M1HA 1R1NA 4GXAA 1II5A 4DCYA 3LSFB 2Q2CA 1N0TA 3DP6A 1B5IA 1B4ZA 5CMMA 1UIVA 4WKMA 2X7PA 3SETA 3ILTB 4QHQA 3TELA 2Y7PA 4XKQA 3PD9A 3RTWB 2I49A 3V83A 2OWSA 2ONSA 4JB7A 4KPTA 2F8DA 2X35A 4GQOA 4Q30B 4G4PA 2Y7IA 3M3LA 4F3PA 2QS1A 2ZNUA 4IO7A 3E3KA 1S7YA 3KG2A 3QIIA 1LLSA 2OZZA 3MP8A 3RY3A 2GRVA 2GF7A 2R5AA 3MEAA 5AA4B 2O51A 1ZIUA 1UIUA 3OENA 1DTGA 2I58A 1LAXA 2XD2A 2RHIA 2DIQA 5I57A 3NTHA 3QAXA 3H6VA 1XVXA 3SDFA 2ALUA 4XKNA 2X4XA 4X34A 3N94A 3T9HB 4L17A 5TPAA 3RUMA 4BE2A 1DPEA 4LZ7A 2B3BA 3FUZA 3FATA 3VE1B 1WJQA 3OYAA 4DXCA 2IEEA 2Y7WA 1S50A 4LP2B 1US5A 2PYYA 3K6XA 1LCFA 4GXSB 3RTFB 5KE2A 4IO3A 1M5CA 4IURA 3G3HA 4IB2A 3KJTA 3IB2A 3PPNA 4KYSA 1LSTA 4LUBA 4BE0A 3U93A 4BDLA 1JEUA 3OY9A 2F34A 3QIMA 1LAHE 3DLNA 5J1DA 1SI0A 1AMFA 4IGRA 2LRQA 1IEJA 1R6ZA 4QVZA 5AA3A 2I48A 4FEDA 3HV1A 3IL1B 2LAOA 2EKOA 2BUDA 3TCFA 2F6PA 1SW5A 4G8MA 3VVEA 4EDUA 1B3LA 3W9VA 2AL5A 3OD7A 3VLUA 1XVYA 3ECRA 1QVSA 4YMAA 2P0SA 1SD3A 3C4MA 4A4FA 5I2KB 5ISUA 3LGFA 2GFUA 4KI0E 3MVZA 3O97A 3KBRA 3FJMA 3GBAA 1EZ9A 1UTHB 3S2VA 3P7IA 4AQ4A 5I84A 3P8HA 5TP9A 3PV0E 2UYFA 5H8FB 5JEIA 3OYIA 1Q1KA 3OYKA 4X1BA 4PLLA 1KWHA 4N13A 4KYEA 1OLCA 4OVAA 2DYXA 1NMUA 1PC3A 1H3DA 4OYVA 4RG2A 4IKFA 2DWAA 4AB6A 2D9TA 4LD6A 2E5QA 4H65A 5JK4A 2GFEA 3DM0A 4IGTA 5DYHA 4N4IA 4KHZE 3TCHA 5FROA 2Y84A 3LLRA 4F2OA 2R58A 2CZLA 1M5EA 2XDPA 5H8HA 1ZLQA 3TQWA 3OYGA 1QUIA 3OS0A 3PMWA 1SYHA 2O1MA 1JQFA 1LCTA 2ZNSA 4QSDA 2R57A 1B1XA 3FASA 3MEUA 1BKAA 3IJOB 1O64A 3FVKA 4M1VA 2I3VA 3FVOA 4G68A 3THIA 4IUQA 4YKKA 3MPKA 5DEXB 2D3IA 4MH5A 1B0HA 1JW4A 2EQJA 4NS5A 1B1HA 1FTKA 1LFIA 4R6KA 3O66A 4KCDA 3FC3A 3H03A 4OESA 2QMXA 2B3FA 3OYNA 3RT8A 3IO4A 2D21A 3S9MC 2Q8JA 3LYIA 2UYEA 2DE3A 3KZGA 1PBQA 5I2NB 2DAQA 3FJGA 3G3IA 3EHTA 1QUJA 4LZ8A 3MWBA 4U4XA 4JWYA 4RYAA 1MPDA 3UT1A 1O63A 1MS7A 4QF9A 1UQWA 2HCAA 4IO2A 1US4A 4RPNA 2CKKA 1MRPA 4Z0IA 1B5JA 1NFTA 1ZKBA 4I1DA 4U21A 3OO6A 4NF6A 3SEYA 2RKMA 3K00A 1DSNA 5CIUA 5BWJA 4GFRA 4YKIA 1NNTA 2QQRA 3TZAA 3H6WA 2L3RA 4GL0A 1LFHA 3PPQA 3EAEA 2AYSA 1IXGA 4ELRA 1YPNA 3FEOA 5CRYA 3S9EA 4EQ7A 2O6AA 3N6TA 4IUTA 3N6UA 4OFJA 1LBCA 3B6WA 3FXQA 4R2BA 2M16A 3TAJA 5D6WA 3PNWC 2F97A 3META 4HCYA 4NF5B 4F31B 5DEXA 1QKBA 3OYMA 4DZ1A 3GXAA 5ELVA 3DP4A 2Y7KA 5I56A 1LAGE 2PT1A 4K3FA 2O84X 3VDFA 4R6YA 2F5KA 1VSOA 4YB5A 1FTOA 4OEUA 1B3HA 1Y3NA 4GD5A 3QUFA 1ANFA 5H8SA 3L42A 4N4GA 4F22A 2GHAA 1T0KA 1EH3A 2Z22A 4GOTA 4EF2A 4NE4A 4ZTJA 1XT8A 3VFJA 3PPOA 4KD5A 4O3CA 4BDZA 1Q35A 3LC8A 2RC8A 2OK2A 5L8DA 3QBYA 3LH0A 4RK2A 4DIGA 1P1NA 3OYCA 3SEXA 5F1QA 4ONYA 2F6GA 1N27A 5CC2A 4E7IA 3T96B 4AB5A 2PBWA 4QQGA 1B2HA 3KSXA 1N84A 4F1UA 2PQWA 4MLQA 3SERA 3L2RA 3CG1A 3SEWA 5EHSA 1SI1A 1MQHA 2DE4A 1FCKA 4FECA 3OS1A 3TKDA 4A4HA 3MAMA 1SSFA 4LZ5A 1OQGA 1IITA 4O3BA 3LBSA 4FJPA 2ANJA 1D9VA 5FTIA 5EHMA 3U92A 4E7HA 1DPPA 2PMSA 3E13X 3KEIA 1MXUA 4I9DA 3ZKKA 1WJSA 4X48A 4X9TA 3EPEA 2H25A 2DVCA 2RJFA 3H6ZA 1I6AA 2O7UA 1NH8A 5H8NA 5CM6A 3T9VA 3V5AA 3VXCA 1YCJA 4LONB 1RYXA 4PFUA 3UIFA 5C0MA 1NNFA 4EXLA 4EF1A 5H8NB 2RJDA 1USYE 4PL6A 3E4RA 4I8CA 5KCHA 4DDDA 4NF4B 1VR5A 2E1SA 1RYOA 1SW2A 1SW1A 2ZMBA 1Z7ME 3BKIB 2UVHA 5A5XB 2F78A 2I4CA 3CEYA 2QS2A 3TTKA 2LTOA 4ZEKA 4EQ9A 4G8NA 3IJXB 5C6SA 1B5HA 3K6WA 1MXVA 4GWOA 5H8HB 3O28A 3OOAA 1MY0A 4YMBA 1N3WA 2D5WA 3N26A 1MXZA 4XKRA 3HPIA 4FL6A 4GRKA 1MY3A 1B40A 3KN3A 1MXWA 2P1SA 4R72A 4ND9A 3PPRA 4I62A 2GFAA 3O6GA 1ZU0A 1IXCA 2GHBA 3DELB 1PB8A 3C36A 2XX8A 3C34A 4RNSA 3E9FA 2RHUA 2V3UA 3PMTA 3T9UA 1B3FA 3O2AA 4FEBA 4N4HA 2ZNTA 4G8HA 4EQBA 1VE4A 2RC9A 3IOTA 1MH3A 5DVFA 3BFUA 2H9BA 2P0KA 3GLBA 5L9MA 2RHXA 1ZTYA 4EUOA 2XXRA 2RI3A 3VVFA 1UTHA 1MPBA 3GZGA 3RNNA 2Z23A 1IIWA 4G68B 3K1MA 1N7WA 2Q88A 5I2KA 3I5OA 1BLFA 4L59A 5TU0A 4ELOA 5TP9B 1WODA 2DOJA 1OZ3A 3OSRA 1RKMA 3O8VA 3DP8A 3FZVA 1B3EA 4KQPA 3L2WA 1MDP1 3E9GA 5FHNA 4OFOA 1USYH 1TT1A 3ZEHA 3EHUA 4MBPA 1M5DA 1OMPA 4H0WA 4E0WA 3CR9A 3IB0A 2BJJX 3T9XB 1AL3A 5H8QA 2R6GE 1MY1A 1LGBC 5CBSA 2NVUB 4PFTA 1QJMA 1XOCA 1N7XA 3W15C 4JBZA 1HSJA 2G3RA 3K1PA 3FXRA 3UORA 1MY2A 1PEBA 1OIBA 3JYRA 2LVMA 1MQGA 4OVJA 2UVJA 3DB3A 4RXLA 1QW0A 4RPOA 1MQDA 3A3CA 4F3BA 5FHMA 1WJRA 2V25A 4C5HA 3M3KA 1JNFA 4NWDA 3TTNA 4F2QA 2KLFA 2LDMA 3G3KA 2REGA 3LSLA 3QYTA 4H8IA 4OXVA 3K1NA 3EQ1A 2PVUA 4NTLA 1OVTA 3S4UA 3O9PA 4OMBA 5KCJB 1WVJA 2DVZA 3H4ZA 2I3WA 5B7DA 2F7CA 1FQAA 4LATA 3IOWA 3QXMA 4BDOA 2PX1A 4QSEA 3I3VA 2XXIA 3FDRA 4P0IA 3TCGA 1MG1A 4PETA 4U4SA 4U1OA 4ELPA 4CRIA 3OMCA 2DIGA 4JSOA 3V8XB 2P2AA 2I0BA 5ITPA 2DWIA 5KZTA 1Z7NE 2K3YA 3OO8A 4PFYA 3OYLA 1XS5A 3I6VA 1YTVA 2EQMA 3H7MA 4Q5TA 4POWA 4ZEBA 3ME9A 4YKPA 4FATA 2NUVA 4F18A 3MZ9A 4Q0CA 3MVYA 1MY4A 4DE8A 1PDAA 1VFEA 2FHDA 2RC7A 2FYIA 3SEVA 2F7BA 4JSDA 4QFOA 2OWTA 5CBRA 4IY5A 2WKYA 2IA4A 1L5TA 3FGSA 4UACA 5IAIA 3PUZE 4KCCA 3OS2A 3TTRA 3LR1A 3ZSFA 2A5SA 2VP1A 3OO9A 2NLUA 3FLGA 5ITOA 2QMWA 2O1LA 1BTJA 2O4XA 5A5XA 3D4CA 1Y9UA 2I0CA 4IO4A 3Q28A 3OYDA 3L6GA 4C1UA 2XXWA 1J1NA 3F11A 2W7YA 4QSCA 4BDQA 4HW8A 4PFWA 3H6TA 3AXFA 2X4YA 4Z7EA 3Q26A 1OLAA 2RHYA 1H45A 4EDPA 1F9BA 2O7IA 4PE5B 3HHGA 4HTGA 2F36A 1SW4A 3MPLA 1P1WA 3B6QA 1FTLA 4R6HA 3KOSA 2QS4A 4OQOA 1P99A 5IAYA 5DVJA 3IO6A 3CSBA 4BLAA 3U8QA 2A5TB 3MJNA 3MW0A 2DSFA 3TODA 3S3OA 3FV1A 3HSTA 2XD3A 4QFPA 3FVGA 2XX7A 3OYEA 5IKBA 1A40A 3UK4A 2REJA 5JTYA 3VLVA 2LCCA 3MUQA 2VD2A 4H8JA 4F1VA 1MQJA 1B46A 4NEDA 1ELJA 2RCAA 5FRMA 2JTFA 3S3MA 2E6NA 2YPNA 5AA2B 2XXYA 1CB6A 2V3TA 1URDA 4QFNA 5EYFA 4ECFA 3MEVA 1XC1A 2ZXTA 3EN3A 4BDYA 1MH4A 3T93B 1ZBMA 4ZE9A 3F70A 1FTMA 1I6QA 4JXIA 2QQSA 3OYFA 2Q89A 1LB9A 1G5VA 3IX1A 3RGYA 3FVNA 3KN7A 2AIXA 3VVDA 4JWOA 4R74A 3LGLA 1NKXA 2ONRA 4H67A 2EQUA 1QULA 3CVGA 4GIZA 3A3UA 4DXBA 5D6YA 4C0RA 3PMIA 2OCUA 1AOVA 2XXVA 1D4NA 3PU5A 1FQEA 5I58B 5I56B 1Y3PA 3CG3A 1XNIA 3QKJA 3U94A 3G7WA 5FHOA 2RJEA 2R5MA 1MDQA 3C32A 3JZJA 2VGQA 2VYTA 2FA7A 4ZTFA 1MHNA 5AA2D 2CMOA 1RI0A 4UC4A 4NF6B 1B52A 2AL4A 3OELA 5BUUA 5IN1A 4A4GA 3Q25A 3B7DA 3LSWA 3GOXA 3CRBA 5ICQA 4DXUA 4GLIA 4YB6A 3NTIA 3QUJA 4QFLA 1SDXA 2DXRA 3ZS6A 2M8CA 3S6WA 4LA9A 1ATGA 5KH6A 1NL5A 2RF1A 5KE3A 3DLMA 1P1QA 2JZ2A 1Y1ZA 4IUUA 1B4HA 1PB9A 5D6XA 5FTHA 1MPCA 1B3GA 5CMKA 3O6HA 1UTBB 2GH9A 1N3XA 3WAEA 3G3FA 5TPAB 1MQIA 3OYBA 3TTMA 1Y4TA 2EQKA 1JEVA 1QUKA 1BP5A 3TYHA 3K02A 4OFLA 4JWXA 4R9GA 3OA6A 1Y3QA 2I6EA 2RHZA 5CMBA 3Q1JA 1N04A 4DLDA 3K6UA 4RJZA 3RPWA 1SQYA 2R71A 1P1UA 1CE2A 3TEPA 4GL8A 2EFIA 4F29A 2HQXA 1OZ2A 1XHYA 4YICA 1A8EA 1NNKA 4GF8A 3K01A 4C5IA 1B7HA 3UP9A 1PB7A 2K3XA 5I57B 1GTKA 3C4SA 5DT6A 3RQTA 1SVXB 4R75A 4MF3A 4BDMA 1TFAA 3UN6A 4F3SA 1A55A 3C31A 1IXIA
chains in the Genus database with same CATH superfamily
1IGQA 4J83A 3T66A 3EH2A 3CI8A 3CCJQ 5GAMg 3P8DA 3HHFA 4YAHX 3VUZA 5GAN2 4HCZA 3G6ET 1VQNT 4NF4A 2LJ0A 2HEUA 4M4GA 4MFIA 2DXYA 4P1EA 4AG2C 1IQ7A 3KFMA 3ODBA 2L89A 1BIBA 1FQBA 1AZGB 3OMBA 1O7TA 4PJLA 1HK9A 1BU1A 2KYMA 3QK6A 2O9VA 2Q2AA 1YNZA 2KDSA 1Q82C 4N15A 2ZZVA 1TXFA 1S1NA 2CGHA 2LNHB 4GY5A 4E7JA 1I5LA 1NH7A 2ONKE 4NMYA 2DWHA 3HRUA 2FNCA 3QHSA 4NQ8A 5HPQA 4C5GA 4U1ZA 1FBGA 1VQLT 5GAOm 3TFLA 1YI2T 3O6IA 4MEVA 5DY9A 3M9QA 5L8RE 5KYWA 2RINA 1E7OA 4C92E 2XXPA 4PLIA 3OYHA 1BIYA 3IB1A 4M7AD 2KXCA 3LSXA 5HKCA 4LVQA 1KQSS 2RJCA 2VPNA 3NHNA 3TTLA 3NTKA 5EYHA 2V1RA 1B7TA 1OU9A 4F14A 2VHAA 1LAFE 4H5FA 4XQ3A 5AE4A 4BDRA 3JAME 1NYGA 1MM7A 4U22A 2P4RA 2RQUA 1KK7A 4BD3A 2QJEA 5AT1B 2CUBA 4N6PA 4ZE8A 2D6FA 2HBWA 3OEMA 2EJFA 5H8FA 4P11A 4PE3A 2XWIA 3PFSA 1KQSP 3SHWA 1ZA1B 2OTLQ 4N4UA 3QSLA 4IO6A 1VQOQ 1NV4A 4AS4A 1FWZA 1Y96B 3M58A 5LJ5e 2OWZA 1WGSA 3CC4A 4B9WA 1LOJA 1PBPA 1KD1U 1NZ9A 3TU4K 3L2VA 3GBBA 2DTIA 3PUXE 4XF5A 3EG9A 3VS0A 2HAUA 4OHNA 2LQWA 2DE2A 5I59B 1VYTA 4Z02A 2GTOA 1K73C 1N8RR 1GXIE 1G0IA 2JTEA 1Z9ZA 1HSEA 2J6OA 3FV2A 4JJNK 1H43A 3TPAA 4KGVB 1FTJA 4LQ2A 2HZLA 2Z8EA 3R26A 2LC4A 5GAOl 5ET5A 1UGVA 4FYVB 3S9LC 1H641 4N07A 4NF8A 4OETA 1N76A 1YJ9T 3CC7Q 1FBPA 1TFDA 3PMXA 2KT1A 4ESXA 2XMFA 4PDDA 1U5SA 5KCOA 1X27A 4MLVA 1JO8A 3PD8A 2GCXA 3KUFA 1VQ5A 5L9SA 1TUGB 2NUZA 4E7KA 4EMHA 1YJNQ 1QKAA 3MJXA 5ICTA 2ZYNA 4B9XA 3R6NA 3OSQA 5KDTA 3L2UA 4R2FA 1FX7A 3IOUA 4AFUC 2PT2A 4HE1A 3T22A 4HCKA 4XTCQ 1VQ6T 2HQ0A 5GAMf 1RDYA 1D9YA 2XXUA 1IHVA 1WHMA 3H0HA 2XHDA 1JETA 3ZBDA 4RK9A 3TREA 4TOZA 2DM1A 4JDFA 1KHCA 2QS3A 2RD1A 1OVBA 4OEVA 1PD1A 1VQ4Q 1HYOA 1Q86U 3C9HA 4JJCA 1QVGA 3PUVE 2RO0A 4PJOG 2E3IA 2HXWA 3OYJA 1TWYA 1BK2A 3K0VA 4ZECA 4A53A 3I35A 1JVXA 4XU0A 5CQXA 4QQ6A 3CCRA 1FQDA 2B65A 2OBGA 5FRNA 2Z8FA 4RTVA 3OEKA 3VLWA 1OPKA 1N5ZA 1A99A 1H76A 4C5EA 3PUYE 2CP5A 3H06B 5HM4B 2CP3A 2RQTA 1B9JA 2R8TA 3OMGA 3OW2P 2KAFA 1B7ZA 1IZ1A 2CZKA 3UA8A 3BY7A 4R73A 1R9QA 4U2RA 3MP6A 1FPIA 2V3QA 4RTZA 3MVWA 1AIVA 2PU9B 3U23A 3CSGA 1X6OA 3MP1A 2RQWA 2WACA 4THIA 2GQIA 4E7LA 4MCOA 4M78G 3QDFA 3H8ZA 3EHSA 2MWOA 4J8OA 2ZYMA 2L8DA 1IXHA 4HS7A 4ZEDA 2HFBA 3V89B 2YRVA 2XK0A 5HK0A 5GMKj 2E10A 3MC2A 3TQLA 2ZPEB 5K2YA 3BFTA 1GR2A 2KE9A 1KA0A 4MDWA 1SRMA 2O9SA 4YKJA 3C94A 3EGXB 4PNOA 1D1CA 2RA2A 2XI9A 1BCOA 5HBCA 2A36A 1AH5A 1AOJA 4YB7A 1P1OA 2Y7RA 3SWNB 1N9RA 5KYYB 4P3LA 2OLBA 4NGUA 2ED0A 1GCQC 2P84A 3MEWA 4J7IA 3BBRA 1S9TA 2OTLA 2OTJA 2DP8A 2J6KA 2ZYKA 2AZVA 4I3EA 3W9WA 3G4SQ 2XXQA 2KEAA 1OQHA 1SBPA 2G93A 5KDTB 4XKPA 3BE3A 2K79A 3UWNA 2VVKA 2QA4Q 1IMAA 5B70A 5I59A 1QCNA 3MZ1A 4IUPA 2ZYOA 3IK6B 2ZPGB 2O69A 1WHHA 3ZKLA 4M75B 4PFZA 1Q86C 1FQCA 5M9OA 3RLFE 4TLMB 2DXCA 3RT6B 2AK5A 3CCMA 2IG0A 4RTTA 4KR5A 4ZEFA 2RI5A 4G2ZA 2F7AA 4FBPA 3HCQA 3LUYA 4HCCA 3RESA 2V26A 2LJ3A 1DMBA 1URGA 3INZA 3TQ7P 3CCLA 3WAFA 1VOMA 4HCWA 2WYPA 2AHJB 1GGGA 2AT1B 4KGZB 1WFWA 4QRZA 3H6UA 3BW1A 4UA8A 4C1TA 3OW2A 3G4SA 1Q7YC 2HKQB 2KR3A 2YLNA 2ABHA 1POTA 3KGCA 1FBHA 1YHQQ 4L5GA 4PJOB 1IMCA 3CCUA 2VOZA 4C0FA 2EGAA 4OVRA 2F2WA 4C8QF 2B8AA 1A54A 3O29A 3HSBA 4FW2A 4M75A 4A4EA 2CZ1B 4PFRA 2MPXC 2FRWA 1MNDA 2CZ7B 3VS2A 2DILA 3CPWA 3NOHA 3TDJA 3H3GA 3PMVA 1O9SA 3V8LA 5CK9A 2I4BA 3R7XA 4C92D 3HO7A 2O2OA 2K4YA 4PJMA 2M0OA 4EXKA 1OPLA 1MXYA 1VFDA 1WIEA 2ESWA 1SYIA 4PC9A 1B32A 2HZKA 3CFXA 4PGNA 1OULA 4H6DA 5J26A 1HSQA 2LT4A 4D8DA 2WEFA 1U1TA 2KNBB 5DTBA 2H4IA 2VV5A 4DEYA 1IREB 3I55T 4ZN3A 1KZ8A 4E7ZA 1FPFA 4G77A 5LJ3j 2IIMA 2XXHA 3JCMc 1K0SA 3K2DA 2XXXA 1GV8A 4IO5A 1B34B 3AT1B 2Y4XA 4X9CA 2L5VA 5LL6S 2CZ0B 2HCKA 1FQFA 5GJVB 3CCEA 2EYXA 4Z88A 4ESRA 4QQDA 1I6BA 1YI2A 5CVIA 4EMGA 2MAMA 5EQAA 1LB8A 3TSZA 4II1A 1ZSZC 2COYA 1BI1A 3ROJA 4ORZA 2D0QB 3L2QA 2ZZXA 3ASKA 1Y07A 3QWYA 2K5IA 2KRMA 3CFLA 5I58A 1J3TA 2CEYA 4ELQA 3DKMA 1ZHIA 2KVQG 3SKPA 4GWYA 3ONMA 1ZSZA 2NOOA 2QPQA 4PF6A 1R9LA 1DOTA 2Y5LA 3EG0A 1AWOA 1NUYA 2PUOB 1I69A 3RERA 5J39A 1POY1 1UHFA 1MV3A 2AKLA 2NYSA 3N5LA 4PJOD 2DNUA 3A8MB 4FU6A 2HAVA 3B6TA 1JW5A 1KSWA 2KRSA 1EU8A 3FD3A 5GANf 3MVXA 8AT1B 5LTCA 3MO8A 1R0CB 3LX7A 2GQ1A 4TLLB 4BDNA 2X3XD 2QEXT 1QQJA 4JJBA 2X4WA 1LVKA 2MF2A 1B6HA 4WEDA 2OJTA 3VRYA 1QCOA 3MYUA 5FU6C 4OGCA 1MXXA 3K6VA 3J80E 5JTYB 2EYZA 1E6GA 2QL3A 1W2BP 1RAEB 4RA1A 2Q74A 4P0GA 3KN8A 4C8QB 4XTVA 2YUOA 2HDAA 3HHTB 4FAJA 1SRLA 3M8UA 3JB9I 4YU0A 2V93A 3EG9B 3OB9A 4M7DA 3E9XA 5IXBA 3C35A 2E0SA 4H5GA 5DVIA 4G68C 1UE9A 2K57A 3GP8A 2KSSA 3Q29A 5GJWB 4ZZEA 4KYDA 3PT9A 1DTZA 2R9JA 4ZS9A 3GPLA 4WCIA 4BACA 2QRYA 3A09A 1H44A 4YZZA 1EZPA 2YXYA 2UVGA 3GLXA 4ZZAA 2F3BA 3TSWA 2JMCA 5LJ3d 3JV9A 4GWXA 2NXOA 2EQIA 2K2VA 4Q5WA 2DS9A 1VQ8A 2DK3A 4RTXA 5GMKm 3CCET 3MZBA 4GX4A 4GWWA 3MSTA 2K3BA 2RCBA 1EIFA 4QVDA 1VUBA 4OGEA 3TVTA 2DWJA 3KOTA 1I07A 2VXEA 1ZBXA 3EF7A 4ZDMA 2M02A 2L3QA 4NOYA 2H5YA 3SD4A 3RUXA 1A8FA 2DZCA 1LPLA 1W6XA 4RCBA 5K2XA 1MNEA 2OI3A 1VIFA 4FORA 3UPUA 1VQ4T 2M9UA 2DYBA 4QW2A 3MHXA 2MOXA 2Y90A 4BE1A 1M5FA 2YJPA 3TUSA 1IRXA 5CO7A 3UATA 1VQ8T 4GVOA 1PCXA 2CT3A 1Y96A 2O68A 3K4UA 1EZOA 2MWPA 1K8AR 2X9HA 1M5BA 1NNPA 4IY6A 1UGRB 1Y1MA 1YAEA 2Z8DA 5I2NA 1AVZC 3S3NA 4J9GA 3C33A 3RPLB 1GVCA 1TS9A 2I2LA 3QPHA 2ROLA 1B05A 3SZPA 4EPCA 4HCBA 2YUQA 1A7LA 1UJYA 1W70A 4GLKA 4AT1B 3OQ5A 1B58A 5CI5A 1BI0A 1K73U 1GL5A 4OENA 1Y4CA 2DETA 5CCAA 2VD3A 2UXAA 4KUDK 2XWKA 1MM6A 4KXPA 4PP0A 4JS4A 3CC7T 4H1XA 3PPPA 4FIMA 1WHLA 2DBKA 4F7UF 3VV5A 4PJOF 4A63B 1OI1A 3A1PA 1FW0A 3PUWE 4KFQA 4I3YA 2FZKB 2DJQA 1QMCA 3M59A 1Y20A 4JRIA 1PHTA 1OYXA 3G7ZA 2HQEA 3OXNA 4BI8B 2WYKA 1ZSGA 1U06A 1LBBA 4OWDA 1ZMGA 4FSSA 4KH0B 3DB4A 2F5XA 3SEMA 4DOWA 2HHMA 4JJDA 2UVIA 4NHBA 4OERA 3USDA 4DCXA 2QDLA 2GBQA 4FT4A 1KC8U 3CQTA 4XXUA 4POXA 3U1OA 5F7VA 3OBWA 3SWNA 3JCMf 3CIJA 3SEUA 5LJ5h 1M2VA 1I8FA 2HNIA 4FE8A 3S9NC 1B51A 5LJ5f 2X7QA 5AA1A 1TU0B 3VS5A 4ESWA 3L6HA 4KBMB 3Q27A 1Q81R 3E19A 2OTLT 5IHIA 3ILUB 2ESNA 5CMCA 5L9OA 4ISUA 2ED1A 2DQVA 3EGDB 1QVPA 1E6HA 1YIJQ 1JXMA 2QEXQ 2X3WD 1BB9A 2BTTA 2F35A 3KSJA 2AKKA 2H3EB 3CD6T 3OO7A 1S72A 3FIRA 1IUDA 4M75F 3VS7A 3HN0A 3LW5E 2G29A 2H99A 1OV3A 3FIFA 5AA4A 2DBMA 3SESA 3TMGA 3G3JA 3VXBA 4F1YA 2DL8A 2NUTB 3IOVA 4LQ5A 4LE9A 2A5TA 2VASA 2XX9A 1RAAB 1GFDA 3PGFA 2E12A 2NWJA 1FMVA 2JJ9A 4X1DA 4XIGQ 4OTEA 4OZ9A 3RN8A 3VUBA 4XAXB 4JRQA 1YI2Q 3CC4T 1C1AA 3IAZA 2EJGA 3U72A 3BDLA 2HL3A 5KCJA 2BKDN 4RY1A 1W4SA 3IORA 4F3GA 4O3AA 3BIHA 1URSA 1RAIB 1FPJA 1OOTA 2HL5C 3G3GA 4IIMA 2HSEB 3PVLA 5GMKe 4R56A 1AWXA 1FPEA 2V84A 3PTAA 1W1FA 2RI2A 1M1KU 3HPWA 1B7UA 1K1ZA 2Q9TA 2PCRA 1LFGA 1UTBA 4HA8A 4OMPA 3FXUA 4OB3B 4NF8B 5LOMA 1D09B 5GAN6 1JW1A 3QJ6A 2DX1A 1M1FA 1QKWA 3H0FA 3M3FA 3JCMJ 4N0AC 3M56A 4M77B 4QFKA 5AA2A 4IUVA 3M0QA 5GAN4 1FPBA 4NWCA 2DZ9A 4WXJA 3EFOA 4ZGJB 2D1XA 3ER0A 3G6EA 1VQNA 4J6WA 2O4XB 1WDNA 4M75C 2THIA 4X04A 4OA4A 2F5TX 2FRYA 4R9FA 4RTYA 3R6UA 1UUEA 5M2VA 2CH4A 1R0BG 1H3ZA 3URGA 3REBB 1DJ7B 4F39A 4NF5A 1JVYA 2XXTA 2DTOA 4N0AA 1C6VX 2LQKA 2L0AA 2OAWA 3FJ7A 3UGWA 2F2XA 1Q7YR 4U23A 1B07A 1XI6A 3HTRA 3ZL7C 2F3DA 1B0LA 4PQJA 1D3KA 2QSXA 3D4GA 4TQUQ 2FPDA 2KXDA 5I21A 2BIVA 3CFZA 3CCLQ 4ZEIA 3ZFJA 2EW3A 2EJ9A 2H98A 4H45A 4FW1A 1KJWA 4WEPA 4JZ4A 4P5NA 2X26A 3MBPA 4E0XA 4C8QC 5CKHA 3KJ7A 1HSLA 5H8QB 4LUEA 4NL2A 3M53A 1S72T 1VQKT 4AFQC 3IR1A 4F19A 3CD6A 2Y4YA 2LJ1A 2VKNA 2LX7A 5GMKl 4C92G 3WVDB 4Q8RA 3RIRA 2H8HA 2JTMA 3MQ9A 1ZJLA 1WX6A 3PVQA 5CQYA 5KYWB 2M1HA 1G3TA 1R1NA 1HD3A 1II5A 4GXAA 5LJ5g 4DCYA 3LSFB 2Q2CA 1N0TA 3DP6A 1B5IA 1B4ZA 5CMMA 1VQ9Q 5KYYA 4N6DA 3CCVT 2YRDA 1UIVA 4WKMA 2ZCFB 2X7PA 4GWSA 3C95A 3SETA 4JUVA 1NEGA 3ILTB 2YLCA 4KH1B 4QHQA 3RDVA 4BI3A 4PKCC 3GYYA 3TELA 2Y7PA 1T0JA 4M78C 4XKQA 3PD9A 3I56A 2I49A 3KC0A 3RTWB 3V83A 2J05A 2OWSA 4C92B 1PRLC 1ZSZB 3CCST 2XICA 4KT0E 2ONSA 3A8OB 3CCRQ 4JB7A 4KPTA 2F8DA 4E7SA 2X35A 3L2ZA 2RQVA 2EYWA 2JM8A 4ME7A 4GQOA 4Q30B 4RTWA 2CZ6B 3EHQA 4G4PA 2Y7IA 3M3LA 4F3PA 2QS1A 2ZNUA 4IO7A 1KQ2A 1M5Q1 5GAMh 3VU3C 1D3BB 1T3LA 3E3KA 1JP4A 2NUPA 1JXOA 1S7YA 2LQNA 3CCVA 3KG2A 3QIIA 1LLSA 2OZZA 1LCKA 3MP8A 3RY3A 2GRVA 2GF7A 3JCMQ 2DEUA 1X75C 2R5AA 4NF0A 2HBPA 3MEAA 5AA4B 2O51A 1WQWA 2XDBA 2DLPA 1ZIUA 1X01A 1CKAA 2CEXA 1VQ4A 1UIUA 3L1AA 4P8BA 1OQKA 1Z9QA 1D0ZA 3KXTA 4M75D 3OENA 1KG1A 1DTGA 1N9SA 4JVIA 3LWIA 2I58A 5A5LA 1LAXA 2XD2A 4HE0A 2RHIA 2DPPB 1YCYA 2DIQA 5I57A 3NTHA 3QAXA 1I4K1 3H6VA 1XVXA 3SDFA 2ALUA 4XKNA 2X4XA 4X34A 3N94A 3N5BB 4L17A 1RUWA 3T9HB 2JS0A 2VC8A 1NV6A 4N91A 2A28A 5TPAA 1NEBA 4BE2A 4E6RA 3RUMA 1DPEA 4LZ7A 1EFNA 1VQ6Q 2B3BA 1FJ9A 1YJ9A 1EYJA 3FUZA 3FATA 3VE1B 2C0IA 1I1JA 3LWHA 1WJQA 3OYAA 4DXCA 3GNFB 3SDZA 3NFCA 2E65A 2IEEA 2Y7WA 1S50A 1QLYA 3M0RA 1US5A 4LP2B 2PYYA 2CREA 3K6XA 4XFEA 1LCFA 1UECA 4GXSB 3RTFB 1JJ2A 5KE2A 4IO3A 2XG8D 3OS5A 3E79A 1M5CA 4IURA 4M75E 1PWTA 3G3HA 4IB2A 3CBMA 3KJTA 3IB2A 3PPNA 4KYSA 1LSTA 4LUBA 4BE0A 3U93A 4BDLA 3VS1A 1JEUA 3OY9A 2KK4A 4OMOA 2F34A 3QIMA 1QGXA 2HQHA 1LAHE 3DLNA 5J1DA 2MIOA 2C0TA 1SI0A 1AMFA 4IGRA 1D1AA 4C0DB 4HXVA 4XTYA 2LRQA 2PZ1A 1YHQA 5I11A 1IEJA 1R6ZA 4QVZA 5AA3A 2I48A 2PUKB 4FEDA 3HV1A 3IL1B 2LAOA 4JRKA 3VYGA 3GIBA 3HFNA 5IZ1A 2EKOA 4CI0C 2VB6A 2BUDA 3HRTA 3TCFA 2QDYB 2F6PA 2HZYA 1SW5A 4G8MA 3VVEA 4EDUA 1B3LA 3CCUT 3W9VA 2AL5A 3OD7A 3VLUA 2D8HA 1XVYA 1VQOT 3ECRA 1QVSA 4YMAA 2P0SA 1WYXA 1SD3A 2AZSA 5I2SA 3C4MA 3EGXA 4A4FA 5GAOn 5I2KB 3M0PA 2ENMA 4XU2A 4J9IA 5ISUA 2KBTA 4XEQA 3LGFA 4JRPA 2GFUA 4KI0E 3MVZA 1YITT 1MMDA 3B8BA 3KBRA 4OMLA 3FJMA 3O97A 3E2UA 3GBAA 1EZ9A 1U1SA 2K2MA 3OSSC 5IHKA 4PJOE 1UTHB 2PFZA 3BIGA 3S2VA 1CKBA 3P7IA 1UGQB 4MMPA 4JLIA 4AQ4A 2DL4A 3CXCA 2CDTA 1SEMA 2X4JA 1VQ9A 3A98A 5I84A 3P8HA 4OANA 1UGSB 2YHTA 1SPKA 2VWFA 2XKOC 5TP9A 3PV0E 3J7AF 4J9DA 2RF0A 2UYFA 4NG7A 5H8FB 5JEIA 2EKHA 3FRNA 3OYIA 4GLMA 2ABLA 1Q1KA 1Q7YU 1VQLQ 3OYKA 4ZGDB 2BE9B 2OTJT 4RKUE 2MCNA 1GBRA 2V4CA 4X1BA 1PD0A 4PLLA 4XK8E 2QA4A 1VA7A 1ZA2B 1OX9A 1JJ2P 4O7IA 2FVUA 1WPYA 2M0YA 1KWHA 4IR8A 3JV3A 2GTJA 2J06A 4OB1B 4N13A 4KYEA 3G71A 1NPPA 1QCFA 3QZ9B 1UHCA 2HKNA 4AFZC 3M0SA 5GAN7 1QP3A 1OLCA 4Y28E 4Y92A 5KYUA 5GANd 4OVAA 1YIJA 4MZMA 2DYXA 4P1LA 1NMUA 3HFUA 1PC3A 5GAMd 1YP5A 1PKSA 1H3DA 1VQ7Q 2PVOB 1CNQA 4OYVA 4RG2A 3CCQA 4PFBA 3G6EQ 1VQNQ 3QYHB 3HRSA 4IKFA 2DWAA 4AB6A 1PRMC 2D9TA 2E5QA 2F1LA 4LD6A 3JCMb 1FSAA 3VRZA 4H65A 1IMFA 2QVRA 5CKEA 2FIXA 5JK4A 2GFEA 3DM0A 4IGTA 3I9QA 5DYHA 4F7UB 4M4ZA 1WQ7A 4N4IA 4KHZE 3TCHA 5FROA 2Y84A 2A0FB 3LLRA 4F2OA 2R58A 1H92A 2CSIA 1NPRA 1BYMA 1NV0A 2FHYA 2CZLA 1M5EA 4O6JA 1PG5B 2XDPA 5H8HA 5HCKA 1ZLQA 2HPGA 2P3VA 2DFUA 4J6YA 4C0GA 4PAIA 3TQWA 3OYGA 1QUIA 2ECZA 2JNGA 5CKBA 1FPGA 3OS0A 3PMWA 4XU1A 1SYHA 5GMKi 2O1MA 1JQFA 1EX4A 1G3YA 1LCTA 2ZNSA 2B86A 4QSDA 1VQMT 4Y91A 1M4ZA 3CCJA 2R57A 3VKIA 1B1XA 3FASA 3MEUA 1BKAA 3IJOB 4QT7A 4HVUA 3A8HB 3QYGB 1O64A 3FVKA 1WHJA 2YRCA 4M1VA 2E41A 2I3VA 3FVOA 4LXCA 4G68A 2YUNA 3JCMg 3THIA 4FIBA 4BB7A 4G61A 4IUQA 4YKKA 5GAMj 3MPKA 5DEXB 5GANj 5J3BA 2D3IA 4M77D 2XWOA 4M7DE 4MH5A 2KMTA 1B0HA 1JW4A 2EQJA 4M77C 4LN2A 4NS5A 1B1HA 2ROTA 1NLPC 4KULA 5IT9E 1LFIA 1FTKA 4R6KA 3O66A 4F7UA 3M55A 2DL7A 4KCDA 2FO0A 1Y71A 1SHFA 3FC3A 4BY6C 3H03A 2D8JA 2WSFE 4OESA 2QMXA 2B3FA 4M78F 3OYNA 2E6ZA 5GANg 2QTVA 3RT8A 3IO4A 2D21A 3S9MC 1KC8R 1FBFA 1XTDA 2Q8JA 3LYIA 1NUZA 2V8IA 1TH7A 2UYEA 1U8RA 2DE3A 3WVEB 1MMAA 2VUBA 3KZGA 1PBQA 2A7YA 5I2NB 1NJIR 3G71T 2FL7A 3SB2A 5IXFA 2DAQA 5EQ8A 3I5RA 3FJGA 3CCVQ 3G3IA 4UABA 3EHTA 1QUJA 4LZ8A 3MWBA 3V7SA 1Q81U 4JWYA 4PFIA 4I40A 1MPDA 3UT1A 4RYAA 4U4XA 1O63A 4C8QD 1OEBA 1MS7A 4QF9A 3CC2A 3THKA 2XDDA 1QWFA 1UQWA 2HCAA 4IO2A 1AZEA 2E64A 1WLPB 1US4A 7AT1B 4RPNA 2CKKA 1MRPA 4Z0IA 1B5JA 1NFTA 3VS4A 1X6BA 1ZKBA 5LJ5d 4PDHA 4I1DA 1GCPA 4U21A 2HAXA 3OO6A 1G0HA 4NF6A 2FIEA 3RNJA 4C92A 2E1HA 1M3AA 3SEYA 1YWPA 2RKMA 1DSNA 3K00A 2XD0A 4GWZA 5CIUA 2JT4A 5BWJA 4GFRA 1K9AA 4HXJA 2EWNA 4NL3A 2JUFA 1EYKA 4YKIA 1Q95G 2YDLA 1NNTA 2QQRA 3TZAA 4JS5A 4R55A 2L3RA 3H6WA 4GL0A 5GAOp 1LFHA 4O7MA 3PPQA 2SEMA 1NG2A 3CCLT 3EAEA 2AYSA 4P47A 1IXGA 4OMQA 1UGPB 4FSXA 3QDRB 4ELRA 3CC2Q 2E5KA 1YPNA 3FEOA 5FW9A 1CSKA 5CRYA 3S9EA 2VGMA 4C92C 4EQ7A 2O6AA 3N6TA 2W10A 4JPBW 2ATCB 2KRNA 2L2PA 4C8QE 4IUTA 3HL8A 3N6UA 4OFJA 1LBCA 1RAHB 3B6WA 1SHGA 2C0OA 3FXQA 1JQQA 3UDCA 4R2BA 3O5ZA 2DD5A 2FEIA 2M16A 2VT5A 3JCMe 3QO3A 1Q9DA 3TAJA 3QXEB 3RR6A 2DRKA 5D6WA 3EFRA 3REAB 4M77F 3J81E 3PNWC 2F97A 3META 3FBPA 2QVVA 4DI4B 3X26B 4HCYA 4NF5B 5DEXA 4J6XA 4F31B 1FRPA 3UA6A 2JMAA 4O5VA 4X1VA 1QKBA 3OYMA 4DZ1A 3GXAA 4PFOA 5ELVA 4CC4B 2CYZB 3DP4A 2Y7KA 5I56A 1LAGE 1NYFA 4MNCA 4AS5A 2PT1A 2V1QA 4K3FA 4LNPA 5IH2A 2O84X 5EQ7A 3VDFA 2EBPA 5DM7R 4R6YA 2F5KA 1VSOA 4YB5A 5LJ5j 1FTOA 1Y7XA 1TSFA 4OEUA 2GGRA 4E2FB 1K9MC 1B3HA 1Y3NA 1VYUA 3JCMW 4GD5A 2E4HA 3QUFA 1ANFA 4J9CA 2FBPA 1BI3A 2HXRA 4JDSA 5H8SA 3BDUA 3M5AA 3L42A 4N4GA 2KR0A 4F22A 2GHAA 3EH1A 1T0KA 4Z89A 2DL3A 1EH3A 2Z22A 4GOTA 4EF2A 4NE4A 3E1SA 1UJ0A 1AWWA 4ZTJA 1XT8A 2CZIA 5EC7A 4C0ZA 1O75A 3VFJA 5A2QE 4X9DA 3KBGA 3PPOA 2YT6A 1YITQ 4KD5A 4FCYA 5ET7A 4J7FA 3VV0A 4GX3A 5GAOq 4O3CA 1N8RU 4BDZA 1YIJT 1Q35A 3LC8A 3V7RA 5KYXA 5ET8A 2QVUA 2FVZA 2RC8A 2OK2A 4M77E 4MNPA 5L8DA 3QBYA 3LH0A 4GX6A 1IB8A 4RK2A 4N17A 3CCUQ 4DIGA 2OJ2A 1P1NA 1K8AC 3OYCA 3SEXA 5F1QA 5IZ3A 2QI2A 4OF1A 1QVGS 4ONYA 2F6GA 1N27A 3JSCA 5CC2A 4E7IA 1OX8A 3UF4A 1ZX6A 1G8XA 3D1RA 1WHGA 3T96B 4AB5A 2PBWA 4QQGA 1Q81C 1B2HA 3KSXA 4AG1C 1N84A 4F1UA 2PQWA 2O88A 4MLQA 2DJZA 4C0DC 2LQ8A 1D9QA 3SERA 2ZZWA 3L2RA 3CG1A 5GANh 3CPFA 3RMQA 1T0HA 3SEWA 1K9MU 5EHSA 1SI1A 1MQHA 2DE4A 4EIKA 2P0PA 4BUGA 1FCKA 4FECA 3OS1A 3QMFA 4M7AC 3TKDA 1PSEA 2WSCE 4A4HA 3MAMA 1SSFA 1IZ6A 4LZ5A 1OQGA 1IXDA 3I56T 3EG3A 5GAOr 4V2SA 1SSHA 1IITA 2MKZA 1RABB 3VS3A 3EG2A 4O3BA 3LBSA 1M8MA 1GBQA 2LMJA 4FJPA 2ANJA 5FBPA 1AEYA 1D9VA 3CMAQ 1FYNA 2O31A 5EHMA 5FTIA 3U92A 1NV7A 5IZZA 4E7HA 1DPPA 2PMSA 1QVFP 3E13X 3KEIA 2KQZA 1DBZA 3JCMh 4PK4A 1MXUA 4XTUA 2DRMA 4I9DA 1K0XA 3ZKKA 1WJSA 1YJWT 4X48A 2VXFA 2C06A 1FBDA 4X9TA 3EPEA 2H25A 5GANe 2JN0A 1VQ8Q 2DVCA 2RJFA 3H6ZA 1I6AA 1JU5C 1YFNA 1UTIA 2O7UA 1FMKA 1NH8A 1R77A 5H8NA 5CM6A 3T9VA 4JVCA 3V5AA 4PAKA 1GCQA 2BZYA 4LDUA 3VXCA 1X2QA 1YCJA 2E3HA 3X20B 5IGAA 4M78A 4LONB 1RYXA 4PFUA 4B6MA 3RYDA 1RADB 2A3LA 3EHRA 2YSQA 9ATCB 4LD9K 3CBPA 3UIFA 5C0MA 2LNVA 3C12A 4M78E 1NNFA 4EXLA 3M0TA 4EF1A 2FZCB 2WBBA 5H8NB 3M57A 2RJDA 2CP7A 1USYE 4PL6A 3RBBB 2QGFB 2LX9A 4O94A 2OX3A 4F17A 3E4RA 4I8CA 2YUPA 5KCHA 2QASA 2EYQA 1NLOC 3MCAB 4QBAA 2EGCA 2PTKA 3FB9A 4PJOA 5GMKh 2CZHA 2QXFA 1PKTA 4DDDA 4NF4B 3OW2S 1NE8A 1VR5A 1TUDA 2E1SA 1RYOA 1SW2A 1SW1A 2ZMBA 1Z7ME 3BKIB 2UVHA 2MK5A 5A5XB 5GAN3 4N8GA 2F78A 3CMEQ 2I4CA 2DD4A 4OB0B 5A0GA 3CEYA 3CCSQ 4DBFA 2XIDA 2QS2A 3TTKA 2LTOA 4PJNA 3NPFA 3CHGA 4ZEKA 2L5QA 4EQ9A 4G8NA 3IJXB 4X8RA 5C6SA 1B5HA 3K6WA 1QVGP 4JVDA 4C92F 4MAGA 5DW8A 1VQ6A 1MXVA 4N81A 1LBVA 4ATOA 1AT1B 4GWOA 5H8HB 3O28A 1WXUA 2JXBA 1MY0A 3OOAA 1M2OA 2K7AA 4YMBA 1F1BB 3M4GA 1N3WA 4FT2A 1RL2A 2D5WA 4A54A 3JB9G 5T3JA 4R0KA 1TTHB 2BZ8A 3N26A 2J6FA 5HK3A 1MXZA 4QXDA 4XKRA 3B50A 3HPIA 3ULRB 4FL6A 2YWWA 3SWNC 2JVVA 4GRKA 1MY3A 1VQKA 4DA4A 2CUDA 1B40A 1IO6A 1S72Q 3KN3A 2P0QA 2RPNA 1MXWA 3QUIA 2P1SA 3V8JA 4ND9A 2GFAA 3O6GA 5KYXB 3PPRA 4I62A 4R72A 5ESYA 1RAGB 5CR2A 4LDWA 4HT9A 3NMZC 2DF6A 1ZU0A 1IXCA 2GHBA 3T1BA 1Y0MA 2OX7A 5KYNA 3DELB 5A0DA 1PB8A 3C36A 2XX8A 3C34A 4RNSA 2NWMA 4OVSA 3E9FA 2RHUA 2V3UA 3PMTA 3T9UA 5IZ3B 1B3FA 3O2AA 4FEBA 1YJWQ 4N4HA 2ZNTA 4G8HA 4EQBA 2HEQA 2I0NA 1VE4A 2RC9A 1K9ZA 3SFMA 3WXMB 2RB6A 2AIRB 5EQ9A 3G1JA 4NN3A 4O8MA 1UFFA 3IOTA 4HVVA 4M7DF 1MH3A 5DVFA 3BFUA 2H9BA 2P0KA 3GLBA 3VS6A 5L9MA 2RHXA 1ZTYA 4EUOA 3PE0A 5I22A 3TCJA 2XXRA 2LCSA 2RI3A 3I56Q 1UTHA 3VVFA 1MPBA 1BCMA 1DK4A 3GZGA 5HY6A 3RNNA 1LBXA 2Z23A 1IIWA 4G68B 4DQ2A 3K1MA 4P56A 3QJYA 4D8KA 1N7WA 5LJ3h 1Y57A 2Q88A 1Q86R 5I2KA 3I5OA 1BLFA 4L59A 5TU0A 4ELOA 5TP9B 3JCMX 1VQ7A 1WODA 2QTXA 2QFLA 4H46A 1VDWA 3GBQA 2P4TA 2DOJA 1OZ3A 4MIJA 3OSRA 2F2VA 1RKMA 3JB9J 3O8VA 1X6GA 3DP8A 1VQOA 3FZVA 1M90U 3JRZA 5IHNA 1B3EA 4KQPA 2RK1A 4J9FA 3L2WA 5I7IA 1MDP1 3LV0A 4DEXA 3E9GA 5FHNA 4M75G 1NUXA 4OFOA 1USYH 1TT1A 1PC0A 1PNJA 2CH4W 3ZEHA 3EHUA 1YHQT 1HJDA 4MBPA 1M5DA 1OMPA 4JZ3A 2FZGB 4H0WA 2KGTA 3CC4Q 3CR9A 4E0WA 1M30A 3IB0A 2BJJX 3T9XB 4FYYB 1I0CA 1AWJA 1AL3A 2R6GE 4PGPA 5FWBA 1QKXA 3CCSA 5H8QA 4OB2B 2MYSA 2XA5A 1QWEA 1RLQC 1MY1A 1LGBC 4XTXA 1SF9A 5CBSA 4L6V5 2RNAA 2NVUB 3CXCP 3CPWS 1VQPQ 4N6KA 4OMMA 4M78B 4PFTA 1QJMA 1ABQA 1XOCA 1LBYA 1ACMB 1N7XA 3W15C 4JBZA 2PFYA 4A4KA 2QAZA 2JM9A 3X24B 1HSJA 2G3RA 2PVDB 1PSFA 3K1PA 1YBYA 3FXRA 4VUBA 3CD6Q 2O01E 3UORA 2SRCA 1VQPT 1MY2A 4M77A 2KI7A 1PEBA 2ZAEA 1OIBA 2ZPBB 1M9SA 3JYRA 2LVMA 2QA4T 5LJ3e 2JS2A 1MQGA 3LUZA 4OVJA 1YWOA 5LJ3g 4LDXA 4M7DD 2UVJA 3DB3A 2DE0X 4RXLA 2EAYA 3QG1A 4MMLA 2QGGA 2XXKA 5EYGA 1QW0A 4RUGA 1XQHA 2A08A 3V7CA 1MQDA 4RPOA 1M90R 3HP9A 1NJIC 3A3CA 4CC2A 4F3BA 1NBEB 1M90C 5FHMA 1WJRA 2V25A 1MGQA 3EKIA 4C5HA 3M3KA 3DLLA 1JNFA 1SPIA 4NWDA 1ZLMA 3TTNA 4F2QA 1BBZA 3PTYA 2KLFA 3IQLA 4BY6B 2K9GA 4RCCA 2LDMA 3G3KA 1TG0A 1ZUKA 1K4US 2COZA 2REGA 3M0UA 1UB4A 2A37A 3LSLA 3QYTA 4H8IA 4N8YA 4OXVA 3K1NA 3EQ1A 5GAN8 1M27C 2PVUA 1ZUUA 2RN8A 3VYHB 5CAIA 4NTLA 1OVTA 3S4UA 2QQ9A 4HT8A 4OP0A 3O9PA 4OMBA 2DEQA 5KCJB 2KQWA 1WVJA 2DVZA 3H4ZA 2I3WA 2F69A 5B7DA 1WXTA 2F7CA 1FQAA 4LATA 3IOWA 1I81A 2FYKA 2B4LA 3QXMA 2DKGA 2CP0A 1FJ6A 1B3QA 4BDOA 2PX1A 4M7DB 4QSEA 3P8BB 3I3VA 2XXIA 1W2BA 4D6WA 2LZ6B 3CC2T 2WBDA 3FDRA 4P0IA 5IM2A 2DDKA 3TCGA 2YLBA 1MG1A 2D0NA 4PETA 4U4SA 4M7AE 3HFOA 3A8GB 3CC7A 1RDZA 2CP6A 4M78D 4U1OA 1X69A 2LCLA 1RACB 4ELPA 1WZOA 4FM4B 4CRIA 1KFZA 1ZQ1A 3OMCA 2DIGA 2KYBA 4LDVA 4JSOA 3V8XB 3EG1A 2XHCA 2P2AA 1YJNT 4BI4A 2I0BA 5ITPA 3CCEQ 1C0MA 3M4YA 2DWIA 3IFAA 5KZTA 1Z7NE 1R8OB 2K3YA 3OO8A 4PFYA 4TVRA 1BKBA 2RH2A 1HXDA 3OYLA 1XS5A 3I6VA 4GBWA 1YTVA 2EQMA 1WDXA 3H7MA 2BJIA 4Q5TA 4POWA 4ZEBA 1YJNA 3ME9A 4AMCA 1IMBA 1TUCA 4YKPA 4FATA 3A29A 3CMEA 3G71Q 5A0LA 2NUVA 4F18A 3I55A 4WF2A 3MZ9A 4Q0CA 2DVEA 3MVYA 4XTZA 4NX1A 3JB9F 1YN8A 1MY4A 4DE8A 2BE7D 1SKUB 1PDAA 1VFEA 2FHDA 1D3BA 2RC7A 4ELZC 4F7UG 1FPLA 2FYIA 3CBOA 5CKFA 3SEVA 1WHKA 2H3JA 4OMFB 3CMET 2F7BA 4JSDA 2OWTA 4QFOA 5CBRA 2ZPFB 1BI2A 5KYUB 4MHFA 3MPUB 4YTLA 3RMSA 5LDZA 2LP5A 1K73R 1N8RC 4IY5A 2WKYA 1KIKA 3BFMA 1EYIA 2IA4A 1U3OA 1FBCA 2WX9A 1YXIA 1Q82R 1ABOA 2DA9A 4PFPA 2GQVA 2DMOA 2EYYA 5FU6B 4HVWA 1L5TA 4JLGA 4XTWA 3U65A 2QEXA 2MMPA 3FGSA 1PM3A 4UACA 3TEEA 1M3CA 3PUZE 5IAIA 3JCMV 1Q82U 4KCCA 3OS2A 3TTRA 3LR1A 3ZSFA 3KFVA 5CKDA 4ZN1A 2A5SA 3GNGA 3EFSA 4F16A 2VP1A 3OO9A 4DI3D 2NLUA 3FLGA 5ITOA 1VQPA 2QMWA 2O1LA 4KRTA 1JBMA 2O4XA 2VGNA 1BTJA 5A5XA 2FPFA 4EMKB 1IMDA 4OVPA 3FJPA 1M8VA 3D4CA 1WXBA 2OAUA 2KY9A 1Y9UA 3OSVA 1NV3A 1IHWA 3I5SA 2I0CA 4IO4A 1AD5A 4OVTA 3Q28A 1LBZA 5J16A 3OYDA 3L6GA 4C1UA 2JW4A 5ECAA 3X28B 1J1NA 2XXWA 3F11A 4M77G 3AHUA 2W7YA 2QK0A 4QSCA 2Z0WA 3KC1A 4BDQA 4HW8A 6AT1B 4PFWA 4IIOA 3H6TA 4M7AG 2CT4A 3FXBA 3AXFA 2X4YA 5I2MA 2P3NA 1KA1A 4Z7EA 1RI9A 3Q26A 1OLAA 1RLPC 3RKXA 4AFSC 4PJJA 2RHYA 4ELYC 1H3HA 1H45A 1F9BA 2O7IA 3CMAT 4PE5B 4EDPA 2E70A 4WTOB 3HHGA 4HTGA 2DL5A 4CC3A 2NUTA 2F36A 4PAFA 3I55Q 1SW4A 1VYVA 1VQ7T 3MPLA 1P1WA 3JB9D 4RMOA 3B6QA 1FTLA 4R6HA 4C8QG 3KOSA 2QS4A 4OQOA 3M54A 1P99A 4MZTA 2QYZA 3CCJT 1FMWA 5IAYA 4M7AF 1GRIA 5DVJA 3H9NA 4M7AB 3IO6A 1NV1A 1YITA 3CSBA 4BLAA 1NM7A 3U8QA 1FBEA 2A5TB 1VIEA 3MJNA 4FYXB 3MW0A 3CMAA 2DSFA 3H0IA 2OTJQ 3S3OA 3TODA 3FV1A 3HSTA 2XD3A 2LT1A 4QFPA 4KUIA 2RMOA 3FVGA 2XX7A 1TOVA 3T9NA 1LEVA 4CC7A 3OYEA 4MDXA 2VPOA 5IKBA 1A40A 3UK4A 2REJA 5JTYA 1I5OB 1MUZA 2GNCA 3VLVA 2CS7A 4MX6A 2LCCA 4PCDA 4GWUA 3MUQA 4DBQA 2VD2A 4H8JA 4F1VA 1V76A 1B46A 1MQJA 4NEDA 1ELJA 2RCAA 5FRMA 3CCQT 4P9KA 2CP2A 2COWA 2JTFA 3S3MA 3JCMd 2E6NA 2YPNA 1G3SA 1VQMA 5AA2B 3C0CA 4J5YA 4DBHA 2XXYA 1CB6A 1NV2A 2V3TA 1URDA 3EGUA 4QFNA 1LJOA 5EYFA 2K5FA 4ANJA 1K9MR 4ECFA 3MEVA 2DO3A 2XU8A 4M7AA 1XC1A 1X2KA 2J7IA 2ZXTA 1AHJB 4FYWB 1LBWA 4LN5A 1WA7A 1FPKA 1XJWB 1T3SA 3HKSA 2PNIA 1K9YA 3EN3A 1JJ2S 2DXUA 2JJKA 4BDYA 4M7DC 1MMGA 4EMKC 1MH4A 4C8QA 1MV0B 4MMKA 3T93B 2QG9B 3G4ST 1ZBMA 1G2BA 2DYIA 4ZE9A 4LDYA 1QP2A 3F70A 1VQLA 1FTMA 3FJ5A 1I6QA 4JXIA 4XU3A 2QQSA 3QSUA 3OYFA 1UEBA 1QW1A 2ZPIB 1W2BS 2Q89A 3QZ5B 1LB9A 1K8AU 1NI9A 1D1BA 1G5VA 3IX1A 3D7SB 4HKEA 3RGYA 1NJIU 2JOYA 3FVNA 4J9EA 5ET6A 1YZ0A 2AIXA 3KN7A 4JWOA 3VVDA 3VJPA 3H41A 4MZPA 4R74A 3LGLA 1NKXA 2ONRA 4H67A 1M2VB 2RM4A 2EQUA 1QULA 3CVGA 4GIZA 1QVFA 3A3UA 5FWCA 4DXBA 5D6YA 4C0RA 3PMIA 1M1KC 2OCUA 1AOVA 1NV5A 2EVRA 4OMNA 1VQ5Q 1IGUA 2IPOB 2NUPB 4MNIA 3CCMT 1D0XA 3EGDA 4LUDA 4QVCA 3A8LB 2XXVA 1D4NA 3PIPA 3PU5A 1FQEA 1P92A 2FB7A 5I58B 4E47A 1SG5A 3JB9H 5GAN5 2V8JA 5I56B 1Y3PA 3CG3A 1JB0E 1GFCA 2CSQA 5F24A 1WI7A 1XNIA 3QKJA 3U94A 4PBHA 3G7WA 5FHOA 1EZZB 2RJEA 2HD0A 5AYFA 2PVGB 3KBZA 2R5MA 2Q8MA 1MDQA 1X43A 3C32A 2X51A 3JZJA 2VGQA 2VYTA 2Y5KA 2FA7A 4ZTFA 1N6AA 5EG2A 3V8KA 1MHNA 5FU7B 4MJOA 2QQBA 2CMOA 1RI0A 5AA2D 4UC4A 4RTUA 4NF6B 1AWBA 4GBQA 1B52A 2AL4A 3GF5A 1FTAA 3OELA 2L3PA 4NAPA 1B34A 5BUUA 2L3SA 5IN1A 4A4GA 2DVJA 3RPLA 4F7UE 1XOVA 1IMEA 1DCUA 3Q25A 3B7DA 4EMKA 1FXXA 3LSWA 2IVWA 4GBVA 2ZPHB 1V1CA 1KD1C 2ZGWA 3R6OA 2V8KA 3MKDA 3GOXA 3CRBA 2FPEA 1MMNA 4RG8A 3X25B 5ICQA 4DXUA 4GLIA 4YB6A 4ZNXA 3NTIA 2DXBA 3UA7A 3QUJA 3T0JA 4QFLA 2K6DA 1SDXA 2DXRA 3ZS6A 2M8CA 3S6WA 4LA9A 1KD1R 3CCMQ 1ATGA 2W0ZA 1QVFS 5KH6A 1NL5A 1BIAA 1V29B 4J9BA 1VQ5T 2RK2A 1K76A 2RF1A 5KE3A 1G3WA 1KQ1A 1ARKA 4DBRA 4J9HA 1INPA 4OVQA 4PJOC 3LH5A 3DLMA 2MI6A 1P1QA 2JZ2A 4M7DG 2KT8A 5DLQE 3CXCS 3CPWP 1YJ9Q 1Y1ZA 4IUUA 1B4HA 1PB9A 2M51A 5D6XA 1TWBA 5FTHA 1MPCA 1B3GA 2G6FX 5CMKA 1KC8C 3A5ZB 3O6HA 3ISPA 1LNXA 1YCSB 1BK4A 1UTBB 3QWXX 2GH9A 2EPDA 3CCRT 2DERA 1N3XA 3WAEA 3NGPA 3G3FA 5TPAB 3RKWA 2EGEA 1MQIA 1H8KA 4QKUA 3OYBA 1M3BA 1JEGA 2BZXA 1Y4TA 5LJ3f 5I3SA 3TTMA 5FLXE 3EFOB 1OU8A 2HSPA 3PIOA 4HE2A 2QQAA 1G83A 2EQKA 1JEVA 1QUKA 1JRIA 1BP5A 3TYHA 1YJWA 3K02A 1M1KR 3OBYA 4OFLA 1YYZA 4JWXA 4R9GA 1VQ9T 1WNLA 3OA6A 1Y3QA 4Z8AA 2I6EA 2WSEE 1TXQA 1D0YA 2RHZA 4KGXB 5CMBA 3Q1JA 1N04A 4DLDA 3K6UA 5DLOA 4K11A 4RJZA 8ATCB 4DOVA 1RDXA 3RPWA 4PBQA 1SQYA 2R71A 1ZUYA 2XWVA 2DTHA 1RAFB 2B4MA 1UG1A 2FG0A 4PTKA 1VQKQ 4PF8A 1P1UA 1ZBJA 1NUWA 1CE2A 2EIFA 3OYYA 1A0NB 3TEPA 3CCQQ 4GL8A 2EFIA 3JCMP 4F29A 1KHIA 2HQXA 2DXTA 5GAMe 1OZ2A 2ZZDA 1XHYA 4YICA 1VQMQ 1A8EA 1NNKA 4GF8A 2RQRA 5D7UA 5L23A 3K01A 3RKYA 4C5IA 1B7HA 3UP9A 1UDLA 1PB7A 2K3XA 5I57B 1GTKA 4ZGEB 3C4SA 2K5LA 5DT6A 3RQTA 3IFCA 4F04B 2HMAA 3PGGA 1SVXB 5FU7C 4R75A 4MF3A 1KQSA 4BDMA 1TFAA 3UN6A 4F3SA 1FPDA 2KROA 1A55A 1IXIA 3C31A 5I5PA 3E78A 1M1GA
chains in the Genus database with same CATH topology
4J83A 3T66A 3CI8A 5GAMg 3P8DA 3HHFA 4YAHX 3VUZA 5GAN2 4HCZA 3G6ET 1VQNT 4NF4A 2HEUA 4M4GA 4MFIA 2DXYA 1IQ7A 3KFMA 3ODBA 2L89A 1BIBA 1FQBA 3OMBA 1O7TA 1HK9A 3QK6A 2Q2AA 1Q82C 2KDSA 1TXFA 2CGHA 4GY5A 4E7JA 1I5LA 1NH7A 2ONKE 4NMYA 2DWHA 3HRUA 2FNCA 3QHSA 5HPQA 4C5GA 4U1ZA 1VQLT 5GAOm 3TFLA 1YI2T 3O6IA 5DY9A 3M9QA 5L8RE 2RINA 4C92E 2XXPA 4PLIA 3OYHA 1BIYA 3IB1A 4M7AD 3LSXA 5HKCA 4LVQA 1KQSS 2RJCA 3TTLA 3NTKA 2VHAA 1LAFE 4H5FA 4XQ3A 5AE4A 4BDRA 3JAME 1MM7A 4U22A 4BD3A 2QJEA 4N6PA 4ZE8A 2D6FA 3OEMA 2EJFA 5H8FA 4P11A 3PFSA 3QSLA 4IO6A 1FWZA 1Y96B 3M58A 5LJ5e 1WGSA 3CC4A 4B9WA 1LOJA 1PBPA 1KD1U 1NZ9A 3TU4K 3L2VA 3GBBA 2DTIA 3PUXE 2HAUA 4OHNA 2DE2A 5I59B 4Z02A 1K73C 1GXIE 1HSEA 3FV2A 4JJNK 1H43A 3TPAA 1FTJA 4LQ2A 2HZLA 2Z8EA 3R26A 2LC4A 5GAOl 3S9LC 1H641 4N07A 4NF8A 4OETA 1N76A 1YJ9T 3PMXA 1TFDA 4ESXA 5KCOA 4MLVA 3PD8A 2GCXA 3KUFA 1VQ5A 5L9SA 4E7KA 4EMHA 1QKAA 5ICTA 2ZYNA 4B9XA 5KDTA 3OSQA 3L2UA 4R2FA 1FX7A 3IOUA 2PT2A 3T22A 4XTCQ 1VQ6T 2HQ0A 5GAMf 1D9YA 2XXUA 2XHDA 1JETA 3ZBDA 4RK9A 3TREA 4TOZA 4JDFA 1KHCA 2QS3A 2RD1A 1OVBA 4OEVA 1Q86U 3C9HA 1QVGA 3PUVE 2RO0A 4PJOG 2HXWA 3OYJA 1TWYA 3K0VA 4ZECA 4A53A 1JVXA 4XU0A 5CQXA 4QQ6A 3CCRA 1FQDA 2B65A 2OBGA 5FRNA 2Z8FA 3OEKA 3VLWA 1A99A 1H76A 4C5EA 3PUYE 3H06B 5HM4B 1B9JA 3OMGA 2KAFA 1B7ZA 1IZ1A 3UA8A 3BY7A 4R73A 1R9QA 4U2RA 3MP6A 2V3QA 3MVWA 1AIVA 2PU9B 3CSGA 1X6OA 3MP1A 2WACA 4THIA 4E7LA 4M78G 3H8ZA 3EHSA 2MWOA 4J8OA 2ZYMA 2L8DA 1IXHA 4HS7A 4ZEDA 2HFBA 3V89B 2YRVA 2XK0A 5HK0A 5GMKj 2E10A 3MC2A 3TQLA 2ZPEB 5K2YA 3BFTA 1GR2A 4MDWA 4YKJA 3C94A 4PNOA 2RA2A 2XI9A 5HBCA 1AH5A 4YB7A 1P1OA 2Y7RA 3SWNB 1N9RA 2OLBA 3MEWA 4J7IA 3BBRA 1S9TA 2OTLA 2OTJA 2DP8A 2ZYKA 3W9WA 2XXQA 1OQHA 1SBPA 2G93A 5KDTB 4XKPA 3UWNA 5B70A 5I59A 3MZ1A 4IUPA 2ZYOA 3IK6B 2ZPGB 2O69A 3ZKLA 4M75B 1Q86C 1FQCA 5M9OA 3RLFE 4TLMB 2DXCA 3RT6B 3CCMA 2IG0A 4KR5A 4ZEFA 2RI5A 4G2ZA 2F7AA 3HCQA 3LUYA 4HCCA 3RESA 1DMBA 1URGA 3INZA 3CCLA 3WAFA 4HCWA 2AHJB 1GGGA 4QRZA 3H6UA 3BW1A 4UA8A 4C1TA 3OW2A 3G4SA 1Q7YC 2YLNA 2ABHA 1POTA 3KGCA 4L5GA 4PJOB 3CCUA 2VOZA 4C0FA 4C8QF 2B8AA 1A54A 3O29A 3HSBA 4M75A 4A4EA 2CZ1B 2CZ7B 3CPWA 3TDJA 3H3GA 3PMVA 1O9SA 3V8LA 5CK9A 2I4BA 3R7XA 4C92D 3HO7A 2K4YA 2M0OA 4EXKA 1MXYA 1VFDA 1SYIA 1B32A 2HZKA 3CFXA 4H6DA 5J26A 2LT4A 1U1TA 5DTBA 2H4IA 2VV5A 3I55T 1IREB 4ZN3A 4G77A 5LJ3j 2XXHA 3JCMc 3K2DA 2XXXA 1GV8A 4IO5A 1B34B 2Y4XA 4X9CA 5LL6S 2CZ0B 1FQFA 3CCEA 1I6BA 4QQDA 1YI2A 5CVIA 4EMGA 2MAMA 1LB8A 4II1A 1BI1A 2D0QB 3L2QA 3ASKA 1Y07A 2K5IA 3CFLA 5I58A 4ELQA 3DKMA 1ZHIA 2KVQG 3SKPA 3ONMA 2NOOA 2QPQA 1R9LA 1DOTA 2PUOB 1I69A 3RERA 5J39A 1POY1 3N5LA 4PJOD 4FU6A 3A8MB 2HAVA 3B6TA 1JW5A 1EU8A 3FD3A 5GANf 3MVXA 3MO8A 3LX7A 4TLLB 4BDNA 2QEXT 2X4WA 2MF2A 1B6HA 4WEDA 2OJTA 5FU6C 4OGCA 1MXXA 3K6VA 3J80E 5JTYB 2QL3A 4RA1A 4P0GA 3KN8A 4C8QB 4XTVA 3HHTB 4FAJA 3M8UA 3JB9I 4YU0A 2V93A 3OB9A 3E9XA 4M7DA 3C35A 2E0SA 4H5GA 5DVIA 4G68C 2K57A 3GP8A 2KSSA 3Q29A 4ZZEA 4KYDA 3PT9A 1DTZA 2R9JA 4ZS9A 3GPLA 4BACA 2QRYA 3A09A 1H44A 4YZZA 1EZPA 2UVGA 3GLXA 4ZZAA 5LJ3d 3JV9A 2NXOA 2K2VA 4Q5WA 2DS9A 1VQ8A 2DK3A 5GMKm 3CCET 3MZBA 2RCBA 1EIFA 4QVDA 1VUBA 4OGEA 2DWJA 3KOTA 2VXEA 1ZBXA 3EF7A 4ZDMA 4NOYA 2H5YA 3SD4A 3RUXA 1A8FA 2DZCA 4RCBA 5K2XA 1VIFA 4FORA 1M5FA 3UPUA 2M9UA 1VQ4T 4QW2A 2Y90A 3MHXA 2YJPA 4BE1A 3TUSA 5CO7A 1VQ8T 4GVOA 1Y96A 2O68A 3K4UA 1EZOA 2MWPA 1M5BA 1NNPA 4IY6A 1UGRB 1Y1MA 1YAEA 2Z8DA 5I2NA 3S3NA 3C33A 1GVCA 2I2LA 3QPHA 1B05A 4EPCA 4HCBA 1A7LA 4GLKA 1B58A 5CI5A 3OQ5A 1BI0A 1K73U 4OENA 1Y4CA 5CCAA 2VD3A 2UXAA 4KUDK 1MM6A 4PP0A 4JS4A 3CC7T 4H1XA 3PPPA 4FIMA 4F7UF 3VV5A 4PJOF 1OI1A 1FW0A 4KFQA 3PUWE 3M59A 1Y20A 4JRIA 1OYXA 3G7ZA 2HQEA 3OXNA 4BI8B 1LBBA 4OWDA 1ZMGA 4OERA 3DB4A 2F5XA 4DOWA 2UVIA 3USDA 4DCXA 4FT4A 1KC8U 4XXUA 4POXA 3U1OA 5F7VA 3OBWA 3SWNA 3JCMf 3CIJA 3SEUA 5LJ5h 1I8FA 2HNIA 4FE8A 3S9NC 1B51A 5LJ5f 2X7QA 5AA1A 4ESWA 3L6HA 4KBMB 3Q27A 3E19A 2OTLT 3ILUB 2ESNA 5CMCA 5L9OA 4ISUA 2DQVA 1QVPA 2F35A 3KSJA 3CD6T 3OO7A 1S72A 3FIRA 1IUDA 4M75F 3HN0A 3LW5E 2G29A 2H99A 3FIFA 5AA4A 3SESA 3TMGA 3G3JA 3VXBA 4F1YA 3IOVA 4LQ5A 2A5TA 2XX9A 3PGFA 2E12A 2NWJA 4X1DA 4XIGQ 4OTEA 4OZ9A 3RN8A 3VUBA 4XAXB 4JRQA 3CC4T 3IAZA 2EJGA 3U72A 3BDLA 5KCJA 2BKDN 4RY1A 1W4SA 3IORA 4F3GA 4O3AA 1URSA 3G3GA 5GMKe 4R56A 2V84A 3PTAA 2RI2A 1M1KU 3HPWA 1B7UA 2Q9TA 1LFGA 1UTBA 4HA8A 3FXUA 4OB3B 4NF8B 5LOMA 5GAN6 1JW1A 3QJ6A 1M1FA 3M3FA 3JCMJ 4N0AC 3M56A 4M77B 4QFKA 5AA2A 4IUVA 5GAN4 4NWCA 2DZ9A 4WXJA 4ZGJB 3ER0A 1VQNA 3G6EA 1WDNA 4J6WA 2O4XB 4M75C 2THIA 2F5TX 4R9FA 3R6UA 5M2VA 1H3ZA 3URGA 1DJ7B 4F39A 4NF5A 1JVYA 2XXTA 2DTOA 4N0AA 2LQKA 3FJ7A 3UGWA 4U23A 1B0LA 4PQJA 1D3KA 2QSXA 3D4GA 4TQUQ 5I21A 2BIVA 3CFZA 4ZEIA 3ZFJA 2EJ9A 2H98A 4WEPA 4P5NA 2X26A 3MBPA 4E0XA 4C8QC 5CKHA 3KJ7A 1HSLA 5H8QB 4NL2A 3M53A 1S72T 1VQKT 3IR1A 4F19A 3CD6A 2Y4YA 5GMKl 4C92G 3WVDB 4Q8RA 3RIRA 2JTMA 3MQ9A 1ZJLA 5CQYA 2M1HA 1G3TA 1R1NA 4GXAA 1II5A 5LJ5g 4DCYA 3LSFB 2Q2CA 1N0TA 3DP6A 1B5IA 1B4ZA 5CMMA 3CCVT 1UIVA 4WKMA 2ZCFB 2X7PA 3C95A 3SETA 4JUVA 3ILTB 2YLCA 4QHQA 4BI3A 4PKCC 3TELA 2Y7PA 4M78C 4XKQA 3PD9A 3I56A 2I49A 3RTWB 3V83A 2OWSA 4C92B 2ONSA 3CCST 2XICA 4KT0E 3A8OB 4JB7A 4KPTA 2F8DA 2X35A 3L2ZA 4ME7A 4GQOA 4Q30B 4G4PA 2CZ6B 2Y7IA 3M3LA 4F3PA 2QS1A 2ZNUA 4IO7A 1KQ2A 1M5Q1 5GAMh 3VU3C 1D3BB 3E3KA 1S7YA 3CCVA 3KG2A 3QIIA 1LLSA 2OZZA 3MP8A 3RY3A 2GRVA 2GF7A 3JCMQ 1X75C 2R5AA 2HBPA 3MEAA 5AA4B 2O51A 1WQWA 2XDBA 1ZIUA 1X01A 1VQ4A 1UIUA 3L1AA 3KXTA 4M75D 3OENA 1KG1A 1DTGA 1N9SA 3LWIA 2I58A 1LAXA 2XD2A 2RHIA 2DPPB 1YCYA 2DIQA 5I57A 3NTHA 3QAXA 1I4K1 3H6VA 1XVXA 3SDFA 2ALUA 4XKNA 2X4XA 4X34A 3N94A 3N5BB 4L17A 3T9HB 2VC8A 5TPAA 3RUMA 4BE2A 1DPEA 4LZ7A 2B3BA 1YJ9A 3FUZA 3FATA 3VE1B 3LWHA 1WJQA 3OYAA 4DXCA 3GNFB 3SDZA 3NFCA 2E65A 2IEEA 2Y7WA 1S50A 4LP2B 1US5A 2PYYA 3K6XA 1LCFA 4GXSB 3RTFB 1JJ2A 5KE2A 4IO3A 2XG8D 3OS5A 1M5CA 4IURA 4M75E 3G3HA 4IB2A 3CBMA 3KJTA 3IB2A 3PPNA 4KYSA 1LSTA 4LUBA 4BE0A 3U93A 4BDLA 1JEUA 3OY9A 2KK4A 2F34A 3QIMA 1LAHE 3DLNA 5J1DA 1SI0A 1AMFA 4IGRA 4C0DB 4XTYA 2LRQA 1YHQA 1IEJA 1R6ZA 4QVZA 5AA3A 2I48A 2PUKB 4FEDA 3HV1A 3IL1B 2LAOA 4JRKA 3VYGA 3GIBA 3HFNA 2EKOA 4CI0C 3HRTA 2BUDA 3TCFA 2QDYB 2F6PA 1SW5A 4G8MA 3VVEA 4EDUA 1B3LA 3CCUT 3W9VA 2AL5A 3OD7A 3VLUA 1XVYA 1VQOT 3ECRA 1QVSA 4YMAA 2P0SA 1SD3A 5I2SA 3C4MA 4A4FA 5GAOn 5I2KB 5ISUA 4XU2A 3LGFA 4JRPA 2GFUA 4KI0E 3MVZA 1YITT 3O97A 3KBRA 3FJMA 3GBAA 1EZ9A 1U1SA 4PJOE 3OSSC 1UTHB 3S2VA 3P7IA 1UGQB 4JLIA 4AQ4A 3CXCA 2X4JA 1VQ9A 5I84A 3P8HA 1UGSB 2YHTA 2XKOC 5TP9A 3PV0E 3J7AF 2UYFA 5H8FB 5JEIA 3OYIA 3FRNA 1Q1KA 1Q7YU 3OYKA 4ZGDB 2OTJT 4RKUE 4X1BA 4PLLA 4XK8E 2QA4A 2FVUA 1WPYA 1KWHA 4OB1B 4N13A 4KYEA 3G71A 1NPPA 3QZ9B 5GAN7 1QP3A 1OLCA 4Y28E 5GANd 1YIJA 4OVAA 2DYXA 4MZMA 1NMUA 1PC3A 5GAMd 1H3DA 2PVOB 4OYVA 4RG2A 3CCQA 3QYHB 3HRSA 4IKFA 2DWAA 4AB6A 2D9TA 4LD6A 2E5QA 3JCMb 4H65A 5CKEA 5JK4A 2GFEA 3DM0A 4IGTA 5DYHA 4F7UB 1WQ7A 4N4IA 4KHZE 3TCHA 5FROA 2Y84A 3LLRA 4F2OA 2R58A 1NPRA 1BYMA 2CZLA 1M5EA 4O6JA 2XDPA 5H8HA 1ZLQA 4J6YA 4C0GA 3TQWA 3OYGA 1QUIA 2JNGA 5CKBA 3OS0A 3PMWA 4XU1A 1SYHA 5GMKi 2O1MA 1JQFA 1G3YA 1LCTA 2ZNSA 4QSDA 1VQMT 4Y91A 1M4ZA 3CCJA 2R57A 3VKIA 1B1XA 3FASA 3MEUA 1BKAA 3IJOB 3A8HB 3QYGB 1O64A 3FVKA 4M1VA 2E41A 2I3VA 3FVOA 4G68A 3JCMg 3THIA 4FIBA 4BB7A 4IUQA 4YKKA 5GAMj 3MPKA 5DEXB 5GANj 5J3BA 2D3IA 4M77D 4M7DE 4MH5A 2KMTA 1B0HA 1JW4A 2EQJA 4M77C 4NS5A 1B1HA 4KULA 5IT9E 1LFIA 1FTKA 4R6KA 3O66A 4F7UA 3M55A 4KCDA 1Y71A 3FC3A 4BY6C 3H03A 4OESA 2WSFE 2QMXA 2B3FA 4M78F 3OYNA 2E6ZA 5GANg 3RT8A 3IO4A 2D21A 3S9MC 1XTDA 2Q8JA 3LYIA 2V8IA 1TH7A 2UYEA 1U8RA 2DE3A 3WVEB 2VUBA 3KZGA 1PBQA 2A7YA 5I2NB 3G71T 2FL7A 3SB2A 2DAQA 3FJGA 3G3IA 3EHTA 1QUJA 4LZ8A 3MWBA 3V7SA 1Q81U 4JWYA 4RYAA 4U4XA 1MPDA 3UT1A 1O63A 4C8QD 1MS7A 4QF9A 3CC2A 2XDDA 1UQWA 2HCAA 4IO2A 2E64A 1US4A 4RPNA 2CKKA 1MRPA 4Z0IA 1B5JA 1NFTA 1ZKBA 5LJ5d 4I1DA 4U21A 2HAXA 3OO6A 4NF6A 4C92A 2E1HA 3SEYA 2RKMA 3K00A 1DSNA 2XD0A 5CIUA 5BWJA 4GFRA 2EWNA 4NL3A 2JUFA 4YKIA 1NNTA 2QQRA