3MP1A

Complex structure of sgf29 and trimethylated h3k4
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
517
structure length
509
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 136
structure length 509
sequence length 517
ec nomenclature
pdb deposition date 2010-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp1A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp1A01
1Q35A 1JEVA 4M4GA 4KD5A 3L2QA 4R6HA 4Z7EA 1FQAA 2E6NA 3OYDA 1JETA 2UYFA 4AB5A 2OK2A 5DTBA 3OYFA 1POTA 4TOZA 2ESNA 1MXVA 3PUWE 4L59A 3KUFA 1P99A 1B3LA 1B7ZA 1IUDA 2O69A 4ZZEA 4Q0CA 1YAEA 3TZAA 1LCFA 4XTCQ 3BFUA 1OLAA 5IN1A 2ONSA 4GXSB 2Y7KA 1S9TA 4AQ4A 2V25A 4JB7A 3SEXA 3WAEA 1MQGA 1HSJA 1DTGA 2UVIA 5I2NA 5KZTA 3O29A 2DVCA 3PUVE 2XXUA 2Z8EA 2QMWA 2NXOA 1LSTA 2DWIA 3VLUA 4OFOA 3C9HA 5IAYA 4IGRA 1D9VA 1SI0A 3FLGA 4BDQA 4Q5WA 2ANJA 2LAOA 4FIMA 2XXWA 4R6KA 3OOAA 2V3UA 1BTJA 4IURA 1A54A 3R26A 2F5KA 1MXWA 2RHXA 5FHOA 3GBBA 2DYXA 1DPEA 3OO7A 4YKIA 2Y7IA 3VDFA 1LLSA 3DB4A 4ZEFA 1DPPA 4JDFA 5ICQA 4X48A 3K6UA 3IOVA 4JSDA 1MY2A 1OZ2A 2X4YA 4Z0IA 4QFNA 4EUOA 1B1HA 1SQYA 2QQSA 2Z8FA 1TFDA 1XS5A 4H1XA 1M5CA 4PP0A 5ITPA 4I8CA 2I3WA 5AA3A 2UYEA 3MW0A 3A3CA 1H76A 4BDZA 4MH5A 3L42A 4OHNA 3E9XA 4B9XA 3U92A 2HAVA 2HQXA 2DOJA 1NH7A 4LD6A 4RXLA 4YICA 3VV5A 2BUDA 3FIRA 3RTFB 3W15C 2DQVA 1LBBA 4KCCA 3MP8A 4U4SA 4PFTA 1Y20A 2RHUA 1FTMA 1LCTA 5BWJA 2X26A 2Y84A 1QW0A 2XD3A 1AOVA 3LGFA 2HZKA 4GF8A 2QS1A 4NF8B 4TLLB 1HSLA 4NF6B 4XKRA 1QKAA 1FTLA 3IOWA 2YLNA 1NNFA 1KWHA 4EQ9A 5D6YA 4WEDA 1B1XA 1O7TA 1MXYA 4ZE8A 3IL1B 2GFUA 1GVCA 4QFPA 3OYNA 3SERA 3LGLA 1Y4CA 2DWHA 3PPPA 4NWDA 1DTZA 2B3BA 5I84A 3N5LA 1L5TA 3LLRA 4MBPA 1OYXA 4THIA 4AB6A 3BDLA 1B7HA 4DIGA 3MP6A 5JTYA 4QHQA 1A8EA 1B7UA 3LSFB 4QSEA 4RY1A 5H8NA 4FEBA 5I2KB 3G7WA 4EQ7A 1A55A 4HCWA 4QQGA 1RI0A 3O28A 1OZ3A 3FXUA 3S3NA 1M5BA 1XNIA 2RI2A 3OELA 3EAEA 2I58A 4IB2A 5DEXB 4BE1A 4KYEA 2X4XA 2RINA 3FGSA 4BDLA 3OQ5A 5K2XA 4FECA 2Q8JA 4F3BA 2F6GA 3TMGA 4U2RA 2QS4A 1FQFA 1B3GA 4YU0A 4G68B 3EHSA 1TWYA 5AE4A 2RO0A 1Y3QA 4R2FA 1QJMA 4GXAA 4UACA 3MPKA 4P0IA 4JWYA 1B05A 3BKIB 3W9VA 3LSXA 5KE3A 4GY5A 2PMSA 4XKQA 3EHUA 2HQ0A 3B7DA 4EQBA 3LR1A 4U4XA 4H65A 1S50A 3KBRA 2QS3A 2ONRA 4F18A 4C0RA 3UN6A 2THIA 3DM0A 2WACA 2F36A 4JWOA 5CI5A 2DE4A 2Y7WA 2B3FA 3K0VA 3KN8A 3M3FA 2JTFA 2Y7PA 1H44A 1LB9A 3SEVA 1FQEA 4LATA 4ZS9A 3PPNA 4U22A 3UA8A 1MM7A 4OFLA 3VLVA 1ZJLA 2M16A 3L2WA 3TODA 4YMBA 3KFMA 1RKMA 1LBCA 3RGYA 3FVKA 3H3GA 3QUFA 2CZLA 2HZLA 4H5FA 3KN7A 1QKBA 3PUXE 4E0XA 4ZTFA 1H43A 3DP6A 4LQ5A 2M1HA 1MXXA 4YAHX 1WGSA 2XXRA 1IITA 2XXPA 1H3ZA 4GOTA 3H6ZA 1P1NA 2V3TA 5CM6A 1PDAA 3HHGA 1I6QA 2PBWA 4QRZA 1NMUA 1MRPA 1OQGA 4ELPA 2ONKE 2O1LA 3SETA 3QUJA 3IX1A 1N3WA 1AIVA 2VHAA 5K2YA 4U1ZA 4II1A 1URGA 3HPIA 2OLBA 2GHAA 1MQDA 1LAHE 5D6XA 4IUVA 3S4UA 1ZIUA 3PMWA 2R9JA 3OYCA 1FW0A 5J39A 3FASA 3BBRA 4Q8RA 1US4A 3Q27A 1SYIA 2FYIA 2QL3A 3G3KA 4EF2A 4RG2A 1CE2A 5FTIA 3IOTA 1NNKA 2ALUA 3GXAA 3SD4A 2LRQA 2F7BA 4R73A 1QUKA 1VFDA 3OYBA 1M5EA 3DLMA 4HW8A 2AIXA 1B32A 3OSQA 3MVYA 4E0WA 4TLMB 4BE2A 4NE4A 2RJEA 2HAUA 3G3IA 2BIVA 2RKMA 1PEBA 4LA9A 3KJTA 3MZBA 3U94A 3IK6B 1SDXA 5ISUA 4RPOA 3M3KA 5FTHA 1RYOA 1F9BA 2XD2A 4LZ5A 2GFAA 4E7HA 3S3OA 4E7KA 1EZ9A 4WXJA 5ELVA 3OO6A 5KH6A 2AYSA 3QAXA 4QF9A 5FRNA 3GBAA 4IO6A 2Q2AA 5JTYB 3K6VA 1A8FA 1PB7A 3PNWC 1MY0A 2A5TB 3K1PA 4Q5TA 4Z02A 1IXGA 3G3FA 2I4CA 3P8HA 2XXVA 1MS7A 1B3HA 2R6GE 3E3KA 3OYJA 4XXUA 3IB2A 4LZ8A 1ATGA 4NS5A 5FRMA 3CG1A 4JSOA 4ND9A 3W9WA 4RNSA 1R6ZA 2O51A 3PUYE 1D9YA 4F3SA 3ZKLA 4NF5A 3ME9A 4WEPA 3DLNA 2G93A 1M5FA 2RCAA 4B9WA 3HSTA 4PQJA 4IUUA 4I62A 3C34A 3WAFA 4POWA 1P1WA 3O6HA 3TQLA 3ZSFA 4ESWA 2VGQA 3N94A 2D9TA 2E0SA 4DLDA 1B0HA 2F6PA 1FQCA 1PC3A 3RLFE 2DWJA 4BD3A 3KSXA 1MQJA 2GF7A 3MVWA 1WODA 5I59A 3LBSA 3CI8A 2RJFA 1XOCA 3IB1A 1USYE 2F8DA 1MPBA 4X1DA 3PMIA 5C6SA 3E4RA 2XK0A 1N84A 2M0OA 1JEUA 5H8QA 4DCYA 1GV8A 2FNCA 3K02A 4OXVA 3IR1A 3D4GA 3ILTB 1LB8A 3IJOB 3O97A 3CFLA 5LOMA 5B70A 1IZ1A 5JEIA 4OMBA 4ELRA 2PT2A 1NNPA 3OYMA 4EF1A 1LAFE 4FATA 5BUUA 1AL3A 4F29A 2A5SA 4H5GA 1UQWA 2I0BA 4GVOA 1QULA 4KYDA 3KG2A 4FJPA 1BP5A 2XHDA 1ELJA 3FJ7A 4M1VA 4G2ZA 4O3AA 1MY1A 4JXIA 1UTBA 1IEJA 1MQHA 1OI1A 1LFHA 2MWOA 1MPCA 3E9FA 4DCXA 2DE2A 3BFTA 5CC2A 2DIGA 3OYAA 3T22A 3K6XA 4A4FA 3H6VA 3RN8A 5CIUA 3LC8A 4OYVA 4EDUA 1MXZA 2REJA 4H6DA 1R1NA 3EQ1A 1XC1A 2V84A 3QBYA 4ZDMA 2UVHA 3PPRA 2HCAA 2CMOA 5FHNA 4ZEDA 4LVQA 5H8SA 4YB5A 2UXAA 2ZNSA 2D3IA 3C32A 1S7YA 1T0KA 1NNTA 5KE2A 3MBPA 4ELQA 3MC2A 3MAMA 2O68A 1SI1A 1RYXA 3V5AA 5IKBA 2IG0A 2O4XB 3IAZA 5A5XB 1URSA 3ILUB 4XKPA 1P1QA 4GL8A 4G8HA 3G3JA 3OEKA 1B5IA 1VE4A 3SEUA 1MPDA 1VR5A 4R2BA 2O7UA 3RPWA 5IAIA 4U1OA 1XHYA 2Q9TA 2XXXA 3P7IA 2ABHA 1PBQA 3I6VA 3CVGA 1FQDA 3O2AA 4GIZA 1ZKBA 4MF3A 4EDPA 4KPTA 4FU6A 1SW1A 3RUMA 2RHIA 4OVAA 4A4GA 4BDOA 4X9TA 3MZ1A 4R75A 4NWCA 2F78A 4H8IA 2E1SA 4IKFA 4E7LA 4X1BA 2Z8DA 2A5TA 1ZLQA 3H8ZA 3QYTA 2H98A 4IO7A 4F19A 4PLIA 4R6YA 3TCFA 2OJTA 4TQUQ 2DAQA 2I49A 3KN3A 4PFWA 2W7YA 3N6TA 3C36A 3H6UA 4PFYA 4BDRA 4NMYA 4L17A 3ONMA 4N6PA 3PPOA 2ZMBA 4C1TA 1ZTYA 1MXUA 4ZE9A 2B8AA 4IY5A 1FQBA 1P1UA 4QFLA 3CIJA 2QRYA 3TCGA 3H03A 2EFIA 5C0MA 2XX7A 4OENA 2RHZA 1LGBC 3NTHA 2QSXA 2NWJA 3HHFA 4U23A 3TTMA 4OEVA 3LH0A 3CSGA 5I57A 2QJEA 2AL5A 3EN3A 3N26A 1ANFA 2RF1A 2D21A 2X4WA 1O63A 5TU0A 5I56A 1UIVA 4NF5B 3U1OA 3TTKA 4F2OA 2VD3A 4WKMA 3IO4A 2JZ2A 4DXCA 3S9NC 4DXBA 3UP9A 3U72A 2P0SA 3M9QA 3LSWA 3OD7A 3VFJA 3EF7A 1GGGA 2DXRA 1N3XA 2F35A 4EXKA 3DP4A 4BACA 3DP8A 3DB3A 4ZECA 2VYTA 3M8UA 2X7QA 4FL6A 4R74A 2X35A 3CFXA 1SSFA 2QMXA 2I4BA 5I59B 3GLBA 1B52A 3T96B 4IUQA 1LFIA 4GL0A 1OVTA 5H8QB 4BDMA 5L9OA 3E13X 4DE8A 2UVGA 4K3FA 5HPQA 1JNFA 3FATA 4RJZA 2IEEA 3C4SA 3TELA 1B3EA 1ZBMA 4PETA 3LUYA 4QFKA 1TXFA 2F5XA 3MP1A 2DIQA 1MH4A 1SW4A 1WJQA 1A40A 4C5GA 2YPNA 5H8FA 2G3RA 1JQFA 2AL4A 3JZJA 2E5QA 2P2AA 3ZS6A 3L6HA 3VLWA 2Q2CA 2EQMA 5CBRA 2HQEA 1EU8A 3MZ9A 2R57A 3OO9A 3OYKA 1Y9UA 1Z7NE 2ZNTA 4R72A 1UTBB 3N6UA 4O3BA 1FTOA 2LVMA 1OIBA 3UGWA 3UK4A 2O4XA 5A5XA 2XDPA 1MY3A 3UORA 5KCJB 2EKOA 2NUVA 3QIMA 5TP9A 3HV1A 3MUQA 3OYLA 2IA4A 1WDNA 2DS9A 2GH9A 4KCDA 4DZ1A 2R5MA 3TTNA 2H5YA 1MDQA 1UIUA 1FTJA 1Y3NA 1MDP1 1SW2A 3H6TA 5F1QA 3L2UA 3OYHA 1B3FA 4LONB 1GTKA 2WKYA 5DT6A 1BLFA 2KLFA 4PFUA 2DWAA 4ONYA 2XX8A 1B4ZA 2XXTA 4NTLA 3OY9A 3V8XB 1DMBA 2P0KA 1YTVA 1Y4TA 3PFSA 3KSJA 3LYIA 4G8MA 4YZZA 3FXRA 1G5VA 3T9HB 4G4PA 5J26A 2XX9A 4QFOA 2M8CA 5AA4A 1B46A 3QSLA 4P11A 4C1UA 1N7XA 3FJGA 3B6WA 4IY6A 4BDNA 2LTOA 3SKPA 3ECRA 4OERA 5CBSA 3TYHA 3IOUA 2B65A 3K2DA 3V83A 1PB9A 2RJCA 3MQ9A 2ZYNA 3OB9A 1B40A 3GZGA 2NVUB 3NTIA 4HS7A 3FJMA 3S9EA 1Z7ME 3B6TA 1XVYA 4OETA 3TTRA 4I9DA 2REGA 5F7VA 4QVZA 3TDJA 3VE1B 1SD3A 2ZYMA 3T9VA 3Q28A 5CRYA 2F7CA 2BJJX 1MM6A 4F2QA 3VXCA 4KYSA 2HFBA 3PMTA 3O6GA 4DDDA 3OA6A 3ASKA 5KCOA 2MWPA 3QIIA 4YKJA 4GD5A 1D4NA 3TAJA 4ESXA 4ECFA 4IUPA 2PQWA 3USDA 1BKAA 5CMKA 1IXHA 1JVYA 4QSCA 3PGFA 1IQ7A 2Z23A 3IJXB 4N13A 3VXBA 2DSFA 3H6WA 1H3DA 3RTWB 4QW2A 4E7IA 4N4HA 5I57B 4MLQA 4E7JA 3OS2A 3TQWA 2H9BA 4O3CA 5L9MA 1QVSA 2OCUA 4PLLA 2G29A 4OZ9A 5J1DA 3K6WA 3GOXA 5I58A 5I56B 2RJDA 5DVFA 1LFGA 5TPAA 3MPLA 2Q89A 5KCHA 3F70A 1IIWA 4IO2A 4U21A 4IO5A 2GHBA 3PD8A 2EQUA 3PD9A 4C5EA 4H67A 3VVDA 2O84X 3D4CA 2H99A 1MHNA 1MY4A 3E9GA 3OO8A 2QQRA 4FAJA 1PBPA 3FV1A 4RK9A 2Y7RA 3UT1A 3C33A 2L89A 2LCCA 3KGCA 3OENA 3K01A 1FTKA 4N07A 2GFEA 3FVNA 3SEYA 3HO7A 3FUZA 3M3LA 4N4IA 3CFZA 5AA2B 3KOSA 3R7XA 4G77A 2HXWA 4F1UA 4OWDA 3DELB 1P1OA 4KQPA 4KFQA 1BIYA 1B0LA 1EZPA 2EQKA 4PL6A 3Q29A 3JYRA 5KCJA 1I6BA 4C5IA 2I3VA 3TFLA 5EYFA 5H8FB 1LAGE 4YMAA 4UC4A 4Q30B 1A7LA 2OWSA 2LDMA 3OMBA 2BKDN 4KI0E 4NEDA 5DYHA 1HSEA 3OMGA 4FE8A 3A3UA 3SEWA 1H45A 3Q26A 3RT8A 1QUIA 1SYHA 1I6AA 2RI3A 2DP8A 5ICTA 4F3PA 3A09A 4YKKA 5FHMA 3NTKA 5TP9B 2XXIA 3U93A 2K3YA 1URDA 1OVBA 1DOTA 4A4HA 4R9GA 2RCBA 5DVJA 3KEIA 4OFJA 3K4UA 3B6QA 4OTEA 2F34A 1GR2A 1Y1MA 3MVZA 1JW5A 2RC7A 1JVXA 3Q25A 1OLCA 3C35A 4NF4A 3KOTA 3IO6A 2RHYA 1N04A 4YKPA 1B2HA 4IO4A 1YPNA 1SVXB 1B5HA 3QK6A 4RA1A 3ZEHA 3PU5A 4RYAA 3PPQA 3TPAA 3VVEA 4IGTA 5L9SA 3QKJA 5D6WA 1OMPA 2OWTA 3O6IA 5AA4B 5KDTA 3T66A 1UTHB 4F3GA 5B7DA 4XIGQ 1XVXA 3C31A 1CB6A 4BLAA 3QJ6A 2PVUA 4JBZA 4HTGA 1B4HA 1TFAA 4YB6A 5CMBA 5H8HB 5CMMA 3UWNA 5L8DA 2OZZA 1IXCA 1NH8A 2O6AA 2R5AA 3PMXA 1TT1A 2F7AA 3MEAA 4LUBA 3THIA 3P8DA 2PT1A 4UA8A 3ZKKA 1KHCA 4GWOA 5AA2D 3KJ7A 3UIFA 1SBPA 2VD2A 3T9XB 3TKDA 1POY1 4MLVA 3Q1JA 3FZVA 1O64A 1N76A 4CRIA 1B6HA 3CG3A 3KZGA 3PV0E 4LQ2A 3K1NA 5CMCA 4P0GA 3ODBA 1OQHA 4HCYA 3SESA 3RNNA 1I69A 5ITOA 4ISUA 4QSDA 4I1DA 1QUJA 3R6UA 3O9PA 4F31B 1B5JA 3T93B 2RC8A 2P1SA 4GQOA 3FVOA 2CKKA 4GLIA 2ZYKA 3FXQA 3LX7A 3MO8A 1PB8A 4F22A 3G3GA 2L8DA 1Y1ZA 2YJPA 1A99A 3I5OA 3TEPA 3TTLA 1VFEA 3OS1A 2V93A 2OBGA 5M2VA 4OESA 3G3HA 1WJRA 3FD3A 2Q88A 1ZU0A 3S9LC 4G8NA 1LAXA 1EZOA 1NKXA 4ZEKA 5I58B 3OSRA 1II5A 3H7MA 3O66A 5TPAB 2PYYA 2H25A 2UVJA 2ZYOA 5I2NB 4BE0A 1XT8A 2VP1A 3OYGA 3T9UA 1J1NA 3IB0A 2D5WA 1NFTA 3RT6B 3L2VA 4F1YA 1JW1A 3RQTA 2RI5A 1Y3PA 1N7WA 5AA2A 3TCHA 2I0CA 3O8VA 2FA7A 1JW4A 3MEVA 4FORA 4ZEIA 3FC3A 1EH3A 2H4IA 5DVIA 5AA1A 3HN0A 3MVXA 4PE5B 1AMFA 2QPQA 4OVJA 3L6GA 4G68C 4H0WA 3K1MA 4X34A 2EQJA 2VOZA 4BDYA 4ZEBA 4DXUA 1B51A 4ZZAA 4EXLA 4YB7A 4HCZA 3C4MA 3META 4N4GA 5EHMA 3PMVA 2ZNUA 3MWBA 1USYH 4LP2B 4OQOA 5HM4B 2XXYA 3S6WA 2DVZA 4H8JA 1FCKA 1D3KA 2NOOA 1MQIA 4LZ7A 2DE3A 1AH5A 2HEUA 3OEMA 2NLUA 4IO3A 4POXA 1MG1A 3F11A 4F39A 4JWXA 3MJNA 3CSBA 1VSOA 3CR9A 1IXIA 2V3QA 4RPNA 4KHZE 3FDRA 1YCJA 2I48A 4NF8A 4F1VA 3MEWA 4NF6A 4QQDA 2YRVA 1DSNA 2F97A 3OYIA 4QQ6A 4GRKA 1M5DA 4ZTJA 2I6EA 4FEDA 1N0TA 3U8QA 1ZMGA 4R9FA 3QXMA 1N27A 2R58A 3V89B 4KR5A 3OS0A 3SDFA 2Z22A 3TUSA 1MH3A 4C5HA 2K3XA 2QS2A 2X7PA 2ZXTA 3OYEA 3HCQA 3EHTA 3CRBA 2XXQA 1B9JA 1WJSA 3PUZE 5HBCA 1UTHA 4NF4B 3H06B 3FVGA 2FHDA 4MFIA 1US5A 3S2VA 3AXFA 1SW5A 3LSLA 3OMCA 1WVJA 4ELOA 4OEUA 5H8HA 5JK4A 5I2KA 1Q1KA 3EPEA 4A4EA 1NL5A 1R9LA 3CEYA 4IUTA 1R9QA 3S9MC 5M9OA 2L3RA 3L2RA 3MEUA 5KDTB 3JV9A 2RC9A 5FROA 2O1MA 3FV2A 3IORA 1B58A 3H4ZA 2XXHA 3S3MA 2GRVA 3I3VA 3RY3A 5DEXA 4XKNA 2R71A 3K00A 4GFRA 3VVFA 2DXYA 5H8NB 4RK2A 3OXNA 2O7IA 2PX1A 4G68A 3FEOA 5EHSA
chains in the Genus database with same CATH superfamily
1Q35A 2J05A 1JEVA 2CUBA 4MHFA 2KYBA 4M4GA 2KEAA 3EKIA 4KD5A 1WI7A 1VIFA 3L2QA 4R6HA 4P3LA 4Z7EA 1FQAA 2E6NA 3OYDA 1JETA 1LOJA 4AFSC 2UYFA 1OULA 4AB5A 1VQ7T 2OK2A 1YWPA 2B4LA 5DTBA 2X51A 3OYFA 1IMCA 3SB2A 1POTA 4TOZA 2ESNA 1MXVA 1YITQ 3PUWE 5GAN5 4L59A 3KUFA 2DD4A 2QYZA 1P99A 1B3LA 1B7ZA 2FPDA 1IUDA 2O69A 5LJ3f 2OTLQ 4ZZEA 2EGEA 4M7AA 4XFEA 1H92A 1YAEA 2VKNA 4Q0CA 3TZAA 3QZ9B 1LCFA 4JRQA 2NUTA 4XTCQ 3BFUA 3SFMA 1UJ0A 1OLAA 2RQTA 5IN1A 4KBMB 1PWTA 2E3IA 2ONSA 4GXSB 2Y7KA 1S9TA 1OPLA 4M7DD 2Q74A 2V25A 5IHNA 3HFUA 4JB7A 3SEXA 4AQ4A 3WAEA 1NEBA 1MQGA 2EJ9A 4JJDA 1KHIA 4E7ZA 3HFOA 1HSJA 3NHNA 1DTGA 1U1TA 1QLYA 3FJPA 3CCVQ 2UVIA 5I2NA 4KRTA 3O29A 5KZTA 1C0MA 2DVCA 2XXUA 2PVDB 2Z8EA 3PUVE 2QMWA 1XQHA 4XU2A 4N91A 2NXOA 1LSTA 4EMKA 2DWIA 3VLUA 4OFOA 3C9HA 1G2BA 4F7UB 2CT4A 4KUIA 5IAYA 1ABOA 2PTKA 1D9VA 2COZA 1SI0A 4IGRA 3FLGA 2EJGA 1K73C 4BDQA 2K6DA 4Q5WA 1ZLMA 1O75A 2RK2A 1Q86C 2ANJA 4D8KA 2LAOA 1RDYA 3M59A 4FIMA 4XTWA 2JXBA 2XXWA 1VQ9T 4R6KA 4DOVA 3OOAA 3EFSA 1G3WA 4J6WA 2V3UA 1BTJA 2DEUA 4IURA 1A54A 3R26A 2F5KA 1MXWA 2ZCFB 1LVKA 1NYFA 1D09B 2FRWA 2QI2A 2RHXA 4PDDA 5FHOA 3V7SA 3CCMT 3GBBA 2C0TA 4P1EA 1UGRB 2DYXA 1NBEB 1DPEA 3OO7A 4YKIA 5LJ3e 2O9VA 4NOYA 4RCCA 2Y7IA 2DYBA 2ZPHB 3VDFA 1LLSA 3DB4A 4ZEFA 1M8VA 1DPPA 4JDFA 5ICQA 3CC7Q 2MF2A 1D0XA 4M75C 3A8LB 4PKCC 4X48A 3K6UA 4HE1A 3R6OA 3TVTA 3IOVA 4JSDA 1MY2A 1OZ2A 4XF5A 2X4YA 4Z0IA 4ZN3A 4IIMA 2ECZA 4F7UE 4QFNA 4PFZA 2HSEB 2DA9A 4EUOA 1C1AA 1GBRA 3A5ZB 1B1HA 3QYGB 3RMQA 1SHGA 3RKYA 5LJ3d 1Q9DA 1SQYA 2QQSA 2Z8FA 2FVUA 3LWIA 3CCSQ 2FRYA 1TFDA 2VT5A 2KRMA 1XS5A 4HCCA 1G3SA 4H1XA 1M5CA 2L3QA 4C92F 1VQ7A 4PP0A 5ITPA 4I8CA 4WCIA 2I3WA 2GTJA 1BYMA 1FPJA 5AA3A 2UYEA 1UHFA 2HZYA 2KI7A 3MW0A 2EAYA 3A3CA 3CPWA 3HKSA 3M0QA 1H76A 1R8OB 4NF0A 4BDZA 4MH5A 3L42A 4OHNA 3QWYA 3CC4A 3E9XA 1JXOA 4B9XA 1IGUA 4XTXA 4M7DA 3U92A 2HAVA 2VV5A 2HQXA 4J9HA 3X28B 2DOJA 1NH7A 2EGCA 4LD6A 4H46A 3L1AA 4RXLA 2VUBA 2EVRA 4XQ3A 1E6HA 4YICA 1N8RU 3GLXA 2EIFA 2SRCA 3VV5A 2X4JA 4NQ8A 2BUDA 2BTTA 1K9ZA 3FIRA 1YI2T 3RTFB 3W15C 2DQVA 1LBBA 3C12A 4KCCA 2WSCE 3MP8A 3OSSC 3MYUA 4U4SA 1FMVA 1PKTA 4XU0A 4PFTA 4OB3B 3JRZA 1QKWA 1Y20A 1X6BA 2PVGB 1YCYA 2RHUA 4C0GA 1FTMA 3REAB 1LCTA 1EZZB 2CSIA 1Q82U 4XEQA 3EH2A 5BWJA 5EG2A 2X26A 2Y84A 1QW0A 2XD3A 1AOVA 1NUXA 3LGFA 3LH5A 5GMKl 1AWBA 2HZKA 3MJXA 1VQ9A 1YCSB 2FEIA 4GF8A 1S72Q 2QS1A 4NF8B 4M77B 1PKSA 2DBMA 2KVQG 2GGRA 3WVEB 2JT4A 2ZPEB 4AFUC 4TLLB 2QG9B 1HSLA 1BK4A 3RNJA 4NF6B 1WHMA 1UTIA 3JB9F 4NGUA 4M7AF 3SZPA 4P5NA 4MJOA 4XKRA 1QKAA 1MMNA 2QAZA 1FTLA 3IOWA 5EC7A 2YLNA 1NNFA 1SPKA 4KGZB 1QVGP 1MMGA 2DERA 5D6YA 2E70A 1KWHA 4WEDA 4EQ9A 1KSWA 2PU9B 1B1XA 1VQNQ 4HXJA 2QXFA 3IFCA 4Y91A 1WYXA 1O7TA 3G1JA 1MXYA 2CZHA 5CO7A 4LUDA 1Z9QA 1LBVA 1Q81R 4A54A 1FBEA 4N6DA 2DXUA 4LXCA 3NOHA 4ZE8A 1JJ2A 2DTHA 1QCOA 2GFUA 1TWBA 3IL1B 1GVCA 2Z0WA 3BDUA 2JS2A 3TREA 4PE3A 4QFPA 5ET8A 3V7RA 3I56T 3OYNA 3SERA 3ZL7C 4XAXB 3LGLA 1Y4CA 2DWHA 4UABA 3I5RA 2KRNA 2D0QB 4M77E 2LCLA 4IIOA 3JCMW 3PPPA 4NWDA 2I0NA 5HY6A 1DTZA 3UDCA 2B3BA 2VC8A 5L8RE 4JRPA 5I84A 3N5LA 4O7MA 1IZ6A 3LLRA 1M1KU 3GYYA 4MBPA 5HCKA 1L5TA 1OYXA 4OANA 4THIA 4A53A 1SG5A 1IXDA 1FBDA 3CBOA 3CCRT 1JBMA 4AB6A 3BDLA 1B7HA 4DIGA 3MP6A 1PSEA 5JTYA 1B7TA 4QHQA 1A8EA 5ET6A 2FO0A 1B7UA 3LSFB 1M1GA 4QSEA 4F16A 1E7OA 1YJ9Q 4RY1A 5H8NA 4QVCA 1FBHA 3CHGA 3QDFA 4FEBA 4P1LA 5I2KB 1LNXA 1PM3A 1ZUYA 3G7WA 4GWSA 3SHWA 4EQ7A 1EYJA 1K0SA 4JLGA 1A55A 2GQVA 4HCWA 4PJOC 4QQGA 1RI0A 1D9QA 3O28A 1OZ3A 3FXUA 4A63B 3M57A 3HSBA 1YI2A 1V1CA 1VQKQ 3S3NA 5GJWB 2VVKA 3THKA 5CQXA 4JDSA 4F7UG 5A2QE 1OQKA 1XNIA 2RI2A 1LPLA 5CKFA 1VQPQ 1M5BA 3OELA 1MUZA 3EAEA 3CMAT 2J6FA 2I58A 4XK8E 4IB2A 5CK9A 5FW9A 2F3DA 3KC0A 2CH4A 5GAOr 5DEXB 4BE1A 2X3WD 4N8GA 2XKOC 2YUOA 4OMQA 4KYEA 2X4XA 4FT2A 1RAFB 2RINA 3FGSA 4GBVA 4BDLA 3NFCA 3OQ5A 4J6XA 4JJBA 4JS4A 4GWWA 4JPBW 1VQ6Q 5K2XA 4FECA 2Q8JA 3JB9J 4F3BA 2F6GA 2WBBA 3EG9B 3TMGA 1ZBXA 4U2RA 1BBZA 1YIJQ 2QS4A 3TEEA 2J7IA 3TSZA 1B3GA 1FQFA 4YU0A 1VQ8T 3EG2A 5FLXE 3EHSA 2FPFA 2RF0A 5IHKA 1TWYA 4G68B 1WIEA 2DKGA 4M7DF 4FT4A 2DPPB 5AE4A 1FBPA 3KBZA 1MMDA 2RO0A 1Q7YR 1Y3QA 4PNOA 4R2FA 5FU7C 1QJMA 1KD1R 4GXAA 4C8QC 4UACA 3MPKA 2YUQA 5CVIA 4MNCA 4P0IA 4Z88A 2YRDA 4JWYA 5GAN2 1B05A 3BKIB 3W9VA 3LSXA 5KE3A 1AWWA 4GY5A 2PMSA 4XKQA 5FU6B 3EHUA 4N15A 5GAMh 2HQ0A 2DX1A 3B7DA 1I5OB 3OBWA 4M7AB 2P84A 5GAMj 1FWZA 4EQBA 3LR1A 4U4XA 2CP7A 4H65A 4NG7A 1S50A 3KBRA 2KRSA 2QS3A 2ONRA 2NUTB 4F18A 4C0RA 3UN6A 2THIA 4PJOD 2KXDA 3DM0A 2HBPA 5GANh 2K9GA 3LUZA 2WACA 2BE9B 2F36A 4JWOA 3EFOA 5A0DA 5GMKh 2QQAA 5CI5A 1TS9A 2L2PA 4NL2A 1M1FA 4J5YA 2DE4A 3OO9A 2Y7WA 2M0YA 2B3FA 3C0CA 1LEVA 4M77D 3K0VA 3KN8A 5GANe 3M3FA 2JTFA 4Z89A 2JJ9A 3CCRA 1K9MR 1QKXA 2DJZA 2LT1A 2E1HA 2Y7PA 1H44A 2DEQA 1LB9A 4NX1A 5KYYA 2JTEA 2K5IA 3SEVA 1FQEA 3VUBA 3QUIA 4LATA 2LC4A 1M90R 4ZS9A 1K0XA 3PPNA 4U22A 3UA8A 1OX8A 1YNZA 1MM7A 4OFLA 3CCJT 2DBKA 2RN8A 3VLVA 1ZJLA 3EG0A 2M16A 1Y07A 3L2WA 3HRUA 1YJWQ 3TODA 3X25B 3M4YA 4FYWB 1FTAA 4YMBA 4M78B 3KFMA 1RKMA 1LBCA 3MPUB 2E10A 3RGYA 3FVKA 3JCMJ 3H3GA 3QUFA 1D0ZA 2CZLA 3CMAA 3G71Q 2HZLA 4H5FA 1VQMA 4LDWA 5EQ9A 3KN7A 1E6GA 4FW2A 1QKBA 3PUXE 2DYIA 5CCAA 2QFLA 4GX4A 4E0XA 2ZAEA 4LDYA 4ZTFA 1H43A 3JSCA 3P8BB 3DP6A 4LQ5A 2M1HA 1VQOT 1MXXA 3J7AF 4YAHX 1WGSA 1X2QA 4BI3A 5GAN4 1UGVA 1IITA 3C95A 1H3ZA 2XXRA 2FPEA 4XU1A 5GAN6 2XXPA 4GOTA 1GFDA 4I40A 2ZPIB 1TG0A 1H641 3H6ZA 1P1NA 2DDKA 3RUXA 3RR6A 4HVVA 2Y4YA 1DBZA 2V3TA 4OVSA 5CM6A 2QK0A 4KGVB 1AHJB 2QQBA 2XI9A 1PDAA 1JRIA 3HHGA 1I6QA 1Y0MA 4JJCA 4ZGJB 2PBWA 4QRZA 1QVGA 3FB9A 1NMUA 4M78E 3LBSA 3CBPA 4FCYA 1MRPA 1OQGA 1HSQA 1PHTA 3TU4K 2O1LA 2ONKE 3SETA 4ELPA 3QUJA 3IX1A 1N3WA 4BUGA 1UEBA 1AIVA 2VHAA 1NV5A 4GX3A 5K2YA 5IZ1A 4U1ZA 2O2OA 2ABLA 4II1A 2L3SA 4BY6B 1URGA 3HPIA 4PJOA 4DA4A 1MQDA 2GHAA 1LAHE 2OLBA 2L0AA 1U06A 1NLOC 1IGQA 3JCMf 5D6XA 4IUVA 1K8AC 4KUDK 1G0IA 3I5SA 2QTVA 3S4UA 1FYNA 2E41A 1NV6A 3D7SB 2CZIA 5ESYA 1ZIUA 3A1PA 3PMWA 2R9JA 4O94A 3OYCA 4CC2A 1T3LA 1FW0A 4M77A 5J39A 2P4TA 2RPNA 4OB2B 1NV2A 3FASA 1WZOA 3BBRA 4Q8RA 1K4US 4KT0E 5CR2A 1NPPA 3SDZA 1US4A 3Q27A 1SYIA 2A7YA 2FYIA 2QL3A 3G3KA 1QMCA 1Y96B 2JUFA 4EF2A 4RG2A 1N8RR 1CE2A 5FTIA 3IOTA 1NNKA 2JW4A 2ALUA 3GXAA 1U1SA 1UGPB 2A08A 2KQZA 1KZ8A 2OX3A 3SD4A 2LRQA 1T0HA 1HD3A 2P0PA 4C0DC 2F7BA 4R73A 1IB8A 1QUKA 1VFDA 3H9NA 3BW1A 3OYBA 2JM8A 1M5EA 4F7UF 3DLMA 1JB0E 4HW8A 1NPRA 3JCMh 2AIXA 5L23A 3RIRA 1B32A 1DK4A 3LW5E 3OSQA 1M30A 3MVYA 4E0WA 4TLMB 4OGCA 1KQ2A 1R0BG 4BE2A 2ROLA 4NE4A 2P3VA 2RJEA 3GIBA 2HAUA 2O31A 3G3IA 2BIVA 3JCMe 1JP4A 2RKMA 1PEBA 4LA9A 2EQIA 3KJTA 3MZBA 3U94A 4HT8A 3IK6B 1T3SA 2AZSA 1SDXA 5GAOl 1XTDA 1VQOA 1ZQ1A 3B50A 1WQ7A 3CBMA 3QHSA 1K8AR 5ISUA 2ZPBB 4RPOA 5I2MA 3V8JA 3M3KA 5FTHA 1RYOA 2Y5KA 1F9BA 3QMFA 1R77A 5I7IA 1QW1A 2XD2A 4N4UA 1T0JA 2K79A 2MMPA 3H0HA 4LZ5A 1QQJA 2G6FX 3JCMb 2GFAA 4E7HA 2LMJA 3S3OA 3I55T 4E7KA 2F3BA 2MK5A 4FSSA 1EZ9A 2DM1A 4A4KA 4WXJA 4OB1B 3CC7A 5ELVA 3OO6A 3R6NA 5KH6A 2AYSA 3QAXA 4QF9A 3ULRB 4VUBA 3SWNC 5FRNA 2J6KA 1PG5B 2CP5A 3GBAA 3G7ZA 1VQLQ 4IO6A 1JU5C 2E3HA 3NPFA 1UB4A 4M78D 4DOWA 4TVRA 3JB9G 4M7AG 2QDLA 2GCXA 2Q2AA 2QVRA 2RH2A 5DW8A 4LN5A 5JTYB 3K6VA 4KH1B 1A8FA 4J83A 2EBPA 1PB7A 2NUZA 4PK4A 3PNWC 1MY0A 2A5TB 3CCSA 3K1PA 4Q5TA 4Z02A 1IXGA 3G3FA 2I4CA 3CPWS 1TSFA 1YHQQ 3P8HA 2XXVA 1RAIB 1MS7A 1B3HA 2K7AA 2R6GE 3E3KA 3EG9A 2FZKB 1X01A 3KBGA 3OYJA 4XXUA 3IB2A 3RESA 1ZSZC 2KAFA 3CD6Q 4LZ8A 3A8MB 4M75B 1ATGA 4NS5A 3PE0A 5FRMA 3CG1A 4FBPA 1WPYA 4JSOA 4OVQA 3CCUQ 2A3LA 5IXFA 1ZUUA 4LNPA 4HE2A 4ND9A 3W9WA 4RNSA 5CKEA 2EW3A 1R6ZA 2DTOA 1PC0A 2DL7A 2O51A 1Y7XA 5EQ8A 2HSPA 3PUYE 3VYGA 1D9YA 4E7SA 4F3SA 2IIMA 1IO6A 1VQKT 1X75C 3ZKLA 4NF5A 1UECA 3ME9A 4WEPA 1D3BA 3CC4T 2JNGA 3DLNA 2G93A 1M5FA 2RCAA 4B9WA 2EWNA 4PJOF 3HSTA 3ER0A 3SEMA 1WDXA 4PQJA 1AD5A 4IUUA 1IMEA 4I62A 3C34A 1N5ZA 4L5GA 3WAFA 4POWA 1RADB 1P1WA 3FRNA 4M77F 3O6HA 1M3AA 3TQLA 3ZSFA 4ESWA 1ZA2B 2VGQA 3N94A 3OW2P 4M75E 2LQKA 2D9TA 2E0SA 4BI8B 1EYIA 1YWOA 4DLDA 3IFAA 3VUZA 1B0HA 4P8BA 2JMAA 4G61A 2F6PA 1FQCA 4J9DA 1PC3A 1WXBA 1QGXA 3RLFE 2XWKA 2F5TX 4ZGEB 3I55A 2DWJA 2LNHB 4BD3A 3KSXA 1MQJA 5I11A 2ESWA 2QVVA 2FIEA 2GF7A 3MVWA 3GNGA 1WODA 5LJ3h 5I59A 4JVCA 3EFOB 3M58A 5LJ3j 3CI8A 2RJFA 4M78A 1XOCA 2ATCB 1USYE 3IB1A 2F8DA 1AWOA 1I1JA 1MPBA 1JJ2S 5DLQE 4X1DA 2IPOB 3PMIA 9ATCB 5C6SA 3E4RA 2XK0A 5HKCA 1N84A 4PFPA 2M0OA 1RABB 2P0QA 2K5LA 1JEUA 5H8QA 4OMPA 4M7DG 1GV8A 4DCYA 1YN8A 2AIRB 4HVWA 2FNCA 3K02A 4OXVA 5KYYB 3VS2A 4QT7A 3IR1A 1FMWA 3D4GA 3ILTB 4OMOA 1VQ5T 3EGUA 1M2VB 2CZ7B 1LB8A 3IJOB 3O97A 3CFLA 3VS0A 5LOMA 3O5ZA 5B70A 1IZ1A 2EPDA 5JEIA 4OMBA 4GWXA 5EYHA 4ELRA 2PT2A 1NNPA 3OYMA 4EF1A 1LAFE 1K9AA 4FATA 2EJFA 5BUUA 1AL3A 4F29A 2A5SA 4H5GA 1UQWA 2I0BA 2DFUA 2H3EB 4GVOA 3N5BB 3CXCP 1LJOA 1QULA 3GBQA 3GNFB 1PD1A 4KYDA 1BU1A 3KG2A 4FW1A 4FJPA 4GBWA 1J3TA 1BP5A 2XHDA 4AT1B 1ELJA 3EGDA 1FBCA 3FJ7A 4M1VA 2RK1A 3M55A 4G2ZA 2R8TA 4O3AA 2YXYA 1MY1A 1VQKA 5LTCA 4JXIA 3X20B 3RERA 1UTBA 3CMEQ 1IEJA 1MQHA 1OI1A 4OMMA 2CYZB 1LFHA 2MWOA 1MPCA 3E9FA 4DCXA 2DE2A 3BFTA 5CC2A 2DIGA 3UA7A 3OYAA 3T22A 3K6XA 1Q81C 1NZ9A 4A4FA 4FM4B 3H6VA 3RN8A 4N0AC 2V26A 5CIUA 3LC8A 4OYVA 1BI3A 4EDUA 1KC8U 1MXZA 1GBQA 2REJA 4H6DA 1R1NA 4J9GA 3ZFJA 1XC1A 3EQ1A 1CKBA 1P92A 2V84A 1JEGA 1Y96A 3VS5A 3QBYA 4ZDMA 2UVHA 2KDSA 1VQ6A 4DEXA 2HCAA 3PPRA 3NGPA 1VQ4Q 2CMOA 2FIXA 4MX6A 5FHNA 4ZEDA 5I22A 4M75D 2ED0A 4LVQA 5H8SA 4YB5A 3UPUA 4PJOB 2UXAA 1XI6A 2D3IA 2ZNSA 3C32A 3CCLQ 1S7YA 1T0KA 1NNTA 2KR0A 5KE2A 4OGEA 3MBPA 1I07A 4ELQA 3MC2A 5J16A 3MAMA 2O68A 2KSSA 4PDHA 1RDZA 3VRYA 5F24A 1SI1A 1RYXA 4RKUE 3V5AA 5GJVB 2IG0A 5IKBA 1BIBA 2O4XB 3IAZA 1K1ZA 4DQ2A 5A5XB 1URSA 3ILUB 4J7IA 4XKPA 1P1QA 4GL8A 4G8HA 4X1VA 3G3JA 4CC3A 4EPCA 1I5LA 3OEKA 1RI9A 1B5IA 3RDVA 2DO3A 3FBPA 5IGAA 4C0ZA 1VE4A 4LD9K 4DBFA 3SEUA 1MPDA 4C0FA 1VR5A 3CXCS 4R2BA 2O7UA 3RPWA 2FG0A 4RTZA 1KQSP 1VQ5A 3BE3A 5IAIA 3VU3C 2V1RA 4U1OA 1SRMA 1XHYA 2Q9TA 1IRXA 3ISPA 1OV3A 1SKUB 2XXXA 3P7IA 2ABHA 1PBQA 3I6VA 2E5KA 3CVGA 2DXTA 5LJ5g 1OPKA 1LCKA 4PJOE 1FQDA 3O2AA 5I21A 2Y4XA 1K9YA 2ZZWA 3RKWA 1K76A 1ZKBA 2YDLA 4GIZA 4MF3A 4EDPA 2P3NA 5FU7B 4KPTA 4FU6A 4C8QB 4DEYA 4HA8A 4CC4B 1SW1A 3RUMA 2RHIA 1OEBA 4OVAA 4A4GA 2VGMA 4BDOA 2DNUA 2LNVA 4X9TA 4J6YA 3MZ1A 4R75A 4NAPA 4NWCA 5GAOp 2H8HA 2F78A 4H8IA 5IH2A 3VYHB 4J9EA 4M78F 2D8HA 4Y92A 1Q7YC 2E1SA 3G6EQ 4IKFA 1KD1C 4JS5A 4E7LA 4X1BA 3J81E 2Z8DA 2RB6A 1EFNA 4N81A 3M0TA 2A5TA 1ZLQA 3H8ZA 3QYTA 2H98A 4IO7A 2FZGB 4F19A 4PLIA 5T3JA 3G71A 1BI2A 1KJWA 4R6YA 4AFQC 1HJDA 1YJNT 3TCFA 2Q8MA 2OJTA 4MMKA 2M02A 1TUDA 2DAQA 4FYVB 4TQUQ 1UG1A 2I49A 2EKHA 4PAFA 1O9SA 3JCMQ 3KN3A 4PFWA 3UATA 4M75A 2W7YA 4C8QE 1NJIU 3N6TA 4RUGA 3C36A 4JZ4A 1VQ7Q 5EQ7A 2KK4A 3H6UA 3OW2A 4PFYA 5GAOn 7AT1B 2DTIA 2FL7A 4BDRA 2FZCB 3H0IA 2QA4T 3WVDB 4NMYA 2HNIA 1G3YA 1VQMT 1QVGS 4L17A 3ONMA 4N6PA 1FBFA 3PPOA 4XTVA 5I2SA 2ZMBA 4PJNA 1WHJA 4C1TA 3M56A 1K9MC 3EG1A 1ZTYA 1MXUA 4ZE9A 2B8AA 4IY5A 1FQBA 1P1UA 1VYTA 4JJNK 4F04B 1KQSS 2BJIA 1QVFP 3CIJA 1C6VX 2QRYA 4QFLA 3TCGA 3H03A 2PUKB 1I0CA 1M90C 2EFIA 5C0MA 2XX7A 4OENA 4WF2A 1KA0A 2RHZA 5ECAA 1LGBC 2AK5A 2KQWA 2RMOA 1W1FA 2E12A 2COYA 3JV3A 3NTHA 4HT9A 2QSXA 3T0JA 4PAKA 2K57A 3M5AA 2NWJA 1N9SA 3HHFA 4U23A 2GQ1A 3TTMA 4OEVA 4RTWA 1D0YA 3RKXA 3ZBDA 3LH0A 1X43A 3CSGA 1OOTA 5DLOA 5I57A 4OF1A 2QJEA 3BY7A 1RAAB 3CCQT 2AL5A 3EN3A 5LJ5f 4AFZC 5CKHA 3N26A 1RAGB 2EYZA 1ANFA 2RF1A 2D21A 1Z9ZA 3L2ZA 1M8MA 2X4WA 1O63A 1ZHIA 2LQ8A 5TU0A 5I56A 5KYNA 1UIVA 1HYOA 1NYGA 4RTXA 4NF5B 3C94A 1D3BB 4P47A 2FYKA 3TTKA 3U1OA 1VQ9Q 4F2OA 1PRLC 1LBXA 1ACMB 2VD3A 1SF9A 4WKMA 3H41A 3CCUT 3IO4A 2JZ2A 1LBWA 5GANj 4DXCA 4DBHA 8AT1B 3S9NC 3CCMQ 5GMKj 3CXCA 4DXBA 3UP9A 4GWUA 3U72A 2O01E 1YITT 2P0SA 3M9QA 3LSWA 3OD7A 3VFJA 3EF7A 1GGGA 1F1BB 1N3XA 3I35A 4J9CA 2DXRA 3MKDA 2F35A 4EXKA 2OTLT 3M0SA 2MPXC 4HVUA 3DP4A 2BZXA 2LT4A 4BACA 3T1BA 2YUNA 4RTVA 1MV3A 3DP8A 3DB3A 3QWXX 4I3YA 4ZECA 1PCXA 2VYTA 1M2VA 2X7QA 4FL6A 3M8UA 2DL5A 1YJNA 4R74A 2KY9A 2VASA 2X35A 3CFXA 3QYHB 4J9FA 4C92C 1NV3A 1SSFA 2DRMA 3AT1B 2MIOA 1UGSB 2QMXA 3QG1A 1RAEB 4GBQA 4J7FA 2I4BA 4OVPA 5I59B 1QVFS 4MZPA 4OP0A 4RTUA 4O5VA 5LJ5e 3CCVT 3GLBA 2EYWA 2RQUA 2DVEA 1B52A 2LJ3A 1VDWA 2QA4A 3T96B 4IUQA 3INZA 1LFIA 4GL0A 2J6OA 4PJOG 4C8QD 4RG8A 2M9UA 3HRTA 4C0DB 1OVTA 5H8QB 4BDMA 5L9OA 3E13X 4L6V5 4DE8A 2CH4W 2UVGA 2A37A 3CC2Q 4K3FA 1N8RC 1RUWA 1K73U 4M77G 5HPQA 4R56A 2YWWA 1TXQA 1JNFA 1SPIA 1SHFA 1NI9A 3FATA 1B07A 5LJ5d 1BI0A 3A8HB 1Q86U 4RJZA 2IEEA 2COWA 1XJWB 1OX9A 3C4SA 4QXDA 3TELA 2YUPA 1B3EA 4DBQA 2D6FA 1ZBMA 1TUCA 4PETA 3LUYA 1YI2Q 4QFKA 2QVUA 4LDVA 2ZZDA 1TXFA 2D8JA 2F5XA 3MP1A 3CC7T 2DIQA 2VB6A 1MH4A 2KT1A 1SW4A 1WJQA 2A28A 1A40A 4C5GA 2YPNA 1VYVA 3CCQA 1Q82C 5H8FA 2G3RA 1JQFA 4RTTA 2O88A 1BB9A 2AL4A 3JZJA 2E5QA 2P2AA 3ZS6A 6AT1B 3EGDB 5IXBA 1KQSA 3L6HA 3NMZC 2Q2CA 3VLWA 2EQMA 5CBRA 4M75F 1FXXA 2HCKA 2HQEA 3OSVA 2R57A 5IHIA 3VJPA 1EU8A 3OYKA 1Y9UA 3MZ9A 1Z7NE 4OMLA 1ZA1B 2RNAA 2ZNTA 4PFOA 2V8IA 4R72A 2B86A 4M7AC 1UTBB 3N6UA 4C8QG 5A0LA 2KR3A 3QSUA 3CCST 1M3BA 3SWNB 4O3BA 2XICA 1FTOA 3E1SA 2LVMA 3CCUA 1OIBA 3UGWA 2HEQA 1IREB 2DILA 4FSXA 1QWEA 3UK4A 2CZKA 2O4XA 4ZGDB 3CCEQ 1FPFA 5A5XA 2XDPA 1MY3A 3UORA 1FSAA 5KCJB 1HK9A 1NV0A 1YITA 1X69A 2EKOA 2WYPA 2NUVA 2XA5A 4CI0C 3QIMA 5TP9A 3HV1A 3V8LA 2QQ9A 3VRZA 3OYLA 3MUQA 2IA4A 2OTLA 1WDNA 2AHJB 2DS9A 2GH9A 4EMKC 4KCDA 4DZ1A 2R5MA 4PFIA 3TTNA 4HCBA 3M0RA 1X6OA 4O8MA 3JAME 2H5YA 1MDQA 2ENMA 2SEMA 1QP2A 3G4SQ 1AEYA 1UIUA 1FTJA 1Y3NA 1MDP1 4MNPA 2KMTA 1I81A 5IT9E 1SW2A 3H6TA 5F1QA 3L2UA 3JCMP 3OYHA 1ZSZB 1B3FA 4PAIA 2OI3A 4LONB 3HFNA 1VUBA 2HAXA 3I56Q 3J80E 2K5FA 2LX9A 1FJ9A 3CCVA 1GTKA 4H45A 4C8QA 2WKYA 5DT6A 1BIAA 4WTOB 1Q82R 1BLFA 2KLFA 4PFUA 2EGAA 1VQ4T 1W70A 3T9NA 2DWAA 8ATCB 4ONYA 2XX8A 1B4ZA 2XXTA 4GLMA 4NTLA 3OY9A 2O9SA 3V8XB 3CCLT 1DMBA 2P0KA 3CCRQ 1YTVA 1Y4TA 3PFSA 3KSJA 3LYIA 4G8MA 4YZZA 3E2UA 3FXRA 1G5VA 4DBRA 4F17A 2WX9A 4G4PA 4KXPA 5J26A 1S72T 3T9HB 4O7IA 2XX9A 1UJYA 3JCMX 4QFOA 1QVFA 4OVTA 5FWCA 1FPGA 2HMAA 2ZPGB 2PUOB 2M8CA 5AA4A 3VS3A 1B46A 3QSLA 4P11A 4C1UA 1N7XA 3FJGA 1GCQC 3PT9A 3B6WA 4IY6A 5DM7R 3H0FA 4N8YA 3D1RA 1VQNT 4BDNA 2LTOA 3V8KA 3SKPA 3ECRA 1I8FA 4M4ZA 4PC9A 4OERA 5CBSA 2NWMA 3RPLA 3TYHA 3IOUA 2B65A 2JM9A 3K2DA 1PB9A 2RJCA 5AT1B 1NUWA 3MQ9A 3V83A 2ZYNA 3OB9A 1B40A 2PNIA 1EYKA 4MNIA 2DK3A 2HKQB 2P4RA 3GZGA 2NVUB 2VWFA 4ANJA 3NTIA 4HS7A 4GWZA 1DCUA 1GCPA 3VV0A 3FJMA 3S9EA 1WNLA 1Z7ME 3B6TA 4M7DC 1TOVA 1M1KR 4NL3A 1WHLA 1XVYA 4OETA 3TTRA 4I9DA 2REGA 3UA6A 1VQ8Q 5F7VA 2YRCA 1W6XA 4QVZA 1Y71A 4ZNXA 3TDJA 3PVQA 4ZN1A 1B3QA 3VE1B 5CKDA 1SD3A 2ZYMA 2RM4A 5ET7A 1G3TA 3G6ET 3T9VA 2KBTA 1ZUKA 3Q28A 5CRYA 2F7CA 3A98A 3CMEA 2BJJX 1MM6A 4OA4A 1Q7YU 1YJ9T 4F2QA 4K11A 3VXCA 4KYSA 4CC7A 2HFBA 2DL4A 1EX4A 4PJJA 3VS4A 2FBPA 3PMTA 4JVIA 4HCKA 1UGQB 1FRPA 3O6GA 4DDDA 3OA6A 3ASKA 5KCOA 1RLQC 2MWPA 1U5SA 3QIIA 4YKJA 4GD5A 2GBQA 1WHGA 3JCMc 2Y90A 4ATOA 3X26B 4M78G 1D4NA 4P9KA 3TAJA 4ESXA 4ECFA 4IUPA 2PQWA 3USDA 1BKAA 1IMDA 3LV0A 5CMKA 3EGXA 2RQWA 1IMAA 1IXHA 1JVYA 5GAN3 3PGFA 2DRKA 4QSCA 1IQ7A 1VQPT 4PGNA 2Z23A 4HKEA 1VQ4A 3IJXB 4N13A 1AOJA 2DD5A 3U23A 1NLPC 1CNQA 3VXBA 2YT6A 2DSFA 3H6WA 2X3XD 2XWOA 1TH7A 3QZ5B 1ZX6A 1H3DA 3CCLA 2LZ6B 3RTWB 4QW2A 4XTZA 4E7IA 1VA7A 4N4HA 3BFMA 2BZYA 4N6KA 2XXKA 4MLQA 5I57B 4X9CA 2ZZXA 1TUGB 4E7JA 4PF8A 3OS2A 3TQWA 1S72A 1VQ6T 2H9BA 1NV4A 1K9MU 4O3CA 3FXBA 5L9MA 1QVSA 2OCUA 4PLLA 2G29A 1M5Q1 1OU8A 4OZ9A 5J1DA 4LUEA 3PVLA 4EMHA 3GOXA 1YIJT 3K6WA 5I58A 5I56B 1UDLA 3HP9A 1V29B 2RJDA 3CCJQ 4LDUA 4GWYA 5DVFA 1LFGA 5TPAA 1M90U 3MPLA 2OJ2A 1VQNA 2Q89A 2M51A 5KCHA 3F70A 1IIWA 4IO2A 2C0OA 1H3HA 4U21A 2V8KA 4IO5A 1Q95G 1AZGB 4D6WA 2CP3A 1WHKA 2QGGA 2GHBA 3PD8A 2EQUA 2B4MA 4B6MA 1RAHB 2HL3A 1LBYA 3PD9A 4C5EA 4H67A 3VVDA 4C8QF 2O84X 5FWBA 2OTJQ 3D4CA 2H99A 1MHNA 1MY4A 3E9GA 3OO8A 3FIFA 1VOMA 1VQOQ 2QQRA 4FAJA 2E4HA 3A8OB 2MOXA 3I9QA 4JUVA 1NG2A 1PBPA 3UF4A 3FV1A 4RK9A 2DF6A 1QWFA 3M53A 1RLPC 3UT1A 2Y7RA 3C33A 3V7CA 2J06A 2L89A 3CQTA 2LCCA 3KGCA 2CREA 3OENA 3K01A 4PBQA 5I5PA 4AS5A 2AKKA 2WSFE 2L3PA 1GXIE 3G6EA 1FTKA 1XOVA 4N07A 3PGGA 2GFEA 3FVNA 2L5QA 4KH0B 3SEYA 3JB9I 4MDXA 1G8XA 2A36A 3FUZA 3HO7A 3PIPA 1YJ9A 1G83A 2VPNA 3M3LA 1M27C 1KA1A 4N4IA 1KFZA 4R55A 3CFZA 5AA2B 1KK7A 3KOSA 3R7XA 3PTAA 1B34A 2NYSA 4G77A 2NUPA 2HXWA 2DZCA 3OW2S 4F1UA 1GCQA 4OWDA 4KGXB 3DELB 3GPLA 4MZMA 1YJWT 1P1OA 4KQPA 4FYXB 4RCBA 4KFQA 1W2BP 2F2VA 1BIYA 1B0LA 2LJ1A 3SWNA 1GRIA 1VQPA 3GP8A 3HL8A 1EZPA 2XMFA 2EQKA 1AZEA 4MIJA 4PL6A 2YHTA 3G71T 3Q29A 2E6ZA 1K73R 2QEXQ 1MV0B 1IMFA 2CEYA 3JYRA 5KCJA 3QDRB 2MYSA 2JS0A 1DJ7B 4C5IA 2CP6A 1I6BA 2I3VA 2EYQA 1KG1A 3QXEB 3MHXA 3TFLA 1MNDA 2LX7A 1Q86R 2ROTA 2FB7A 4LE9A 3CC2T 5EYFA 1WFWA 5H8FB 1LAGE 4YMAA 1D1CA 4UC4A 4HE0A 3JB9H 1FPEA 1YZ0A 1A7LA 2OWSA 4Q30B 1YIJA 3QJYA 1YXIA 2LDMA 3OMBA 2BKDN 4Y28E 3TSWA 4KI0E 4NEDA 4QKUA 5DYHA 2HBWA 5GAOm 3OMGA 1HSEA 1MMAA 3HPWA 4FE8A 3A3UA 4MMPA 3SEWA 1ZSZA 1H45A 5HK3A 3Q26A 1D1BA 3RT8A 1QUIA 1SYHA 2LJ0A 1I6AA 2DXCA 2RI3A 1CSKA 2DP8A 4AS4A 5ICTA 2DVJA 4F3PA 4RMOA 2V4CA 2K2VA 1N9RA 3A09A 3M0PA 4YKKA 5FHMA 2BZ8A 4JVDA 5LL6S 1BCOA 4KULA 3NTKA 5TP9B 2XXIA 2XHCA 2V8JA 3U93A 2K3YA 1URDA 1OVBA 2HHMA 5GAMg 1DOTA 2D0NA 2LP5A 4A4HA 1M9SA 4R9GA 3HHTB 1TTHB 4I3EA 2CDTA 4QBAA 1SSHA 3TQ7P 2RCBA 5DVJA 3EFRA 3KEIA 4OFJA 4LDXA 3K4UA 5GANg 1U8RA 3B6QA 1K8AU 3CCMA 2CP2A 4OTEA 2F34A 4F14A 3CCET 1GR2A 1Y1MA 2E65A 3MVZA 2W0ZA 1JW5A 2RC7A 4ME7A 1JVXA 3I55Q 2JJKA 3Q25A 2HPGA 4J9BA 4M75G 1OLCA 3C35A 4NF4A 3KOTA 1GL5A 5CQYA 1W2BS 3IO6A 5DY9A 1OU9A 2RHYA 1N04A 1ZBJA 2DLPA 5KYWB 4J9IA 1NV1A 4OVRA 1BCMA 2KYMA 2F69A 4YKPA 3X24B 1B2HA 1FPLA 1UHCA 1FJ6A 4IO4A 1YPNA 1UFFA 1QP3A 4PJMA 3G4ST 3VS7A 4PBHA 1X27A 1FBGA 1SVXB 1B5HA 3QK6A 1WXUA 4RA1A 2AZVA 3ZEHA 3PU5A 2C0IA 2QTXA 2XG8D 1GFCA 4RYAA 2AT1B 3PPQA 4AG2C 1ZSGA 1YJWA 4X04A 3TPAA 2HL5C 1NUYA 3VVEA 5A5LA 4IGTA 3U65A 5L9SA 3QKJA 5D6WA 5IZ3B 2XU8A 1OMPA 2OWTA 3O6IA 5AA4B 5KDTA 4LN2A 2MKZA 4PGPA 3T66A 1UTHB 1M3CA 5EYGA 4F3GA 5B7DA 2Y5LA 4XIGQ 1XVXA 1WHHA 4ORZA 3C31A 4BB7A 4MDWA 5EHSA 1CB6A 1M4ZA 4BLAA 1PSFA 3QJ6A 3CC2A 3E78A 3RPLB 2H3JA 2PVUA 4BI4A 4HTGA 4JBZA 1B4HA 1TFAA 4NHBA 4YB6A 3MSTA 2JN0A 5CMBA 5H8HB 5CMMA 3UWNA 5L8DA 2OZZA 4DI4B 1IXCA 2C06A 4YTLA 1I4K1 1PNJA 2JOYA 1NH8A 4EMGA 2O6AA 4C92B 3DLLA 2DZ9A 2R5AA 4MEVA 4D8DA 3PMXA 1TT1A 2F7AA 5KYXA 3MEAA 4LUBA 2HKNA 3P8DA 5KYUA 3THIA 2PT1A 4UA8A 2VGNA 4ESRA 2GQIA 4FYYB 2LQWA 2PFZA 3CC4Q 3ZKKA 4R0KA 1KHCA 4GWOA 1YYZA 5AA2D 4N17A 2GTOA 3KJ7A 1S1NA 1SBPA 3UIFA 4M77C 2VD2A 3T9XB 2DL3A 3TKDA 1POY1 4GX6A 5GAN7 3QO3A 4MLVA 1VQLT 3Q1JA 3FZVA 5GAMf 4Z8AA 1O64A 1N76A 4CRIA 1B6HA 4DI3D 3CG3A 3KZGA 1AWJA 1QCNA 3GF5A 4AG1C 4MCOA 3PV0E 4LQ2A 3K1NA 1ABQA 5CMCA 2BE7D 5GANf 4P0GA 3ODBA 1KIKA 1OQHA 4HCYA 1NE8A 1QVPA 3QPHA 1IHWA 3SESA 3RBBB 1NUZA 4O6JA 2WBDA 3RNNA 1YHQT 1RL2A 1I69A 5ITOA 4ISUA 4QSDA 4I1DA 2XD0A 2OX7A 5IM2A 3CCEA 1QUJA 3R6UA 3O9PA 2CZ0B 4F31B 2RQRA 1B5JA 1SRLA 3T93B 2RC8A 2I2LA 4C92E 2P1SA 4GQOA 1RACB 1JQQA 1FX7A 4N0AA 3FVOA 2CKKA 4GLIA 2XWIA 5J3BA 2ZYKA 3CD6T 3FXQA 2XDDA 1X6GA 3E79A 3EGXB 1BK2A 1W4SA 3LX7A 3MO8A 2WSEE 4AMCA 1WLPB 4QVDA 1PB8A 4F22A 1AWXA 2FHYA 3G3GA 2L8DA 2OAUA 5CAIA 3REBB 2DMOA 3G4SA 4F7UA 4PCDA 2A0FB 2KE9A 1Y1ZA 2YJPA 2AKLA 1A99A 3I5OA 4P56A 3TEPA 3TTLA 3ROJA 2VXEA 1VFEA 3OS1A 2V93A 2OBGA 5M2VA 1X2KA 1WQWA 4RTYA 1FPDA 1WJRA 3FD3A 2Q88A 3G3HA 4OESA 5LDZA 4XTUA 1VIEA 3I56A 1NV7A 1ZU0A 4G8NA 3S9LC 1LAXA 1MNEA 1RDXA 3PTYA 3FJ5A 1EZOA 2QGFB 2MCNA 1VQ5Q 1NKXA 2PFYA 1AVZC 4ZEKA 5GAMe 5I58B 3JCMg 2JMCA 1FPIA 3OSRA 5LJ5h 1M2OA 1II5A 1W2BA 4ELZC 3H7MA 3O66A 5LJ5j 5TPAB 2PYYA 2H25A 2MAMA 2YLCA 2UVJA 1WX6A 2ZYOA 5I2NB 4BE0A 1XT8A 2VP1A 3EG3A 5GMKe 4J8OA 3OYGA 3T9UA 4EMKB 3BIGA 1J1NA 4JLIA 4GLKA 4XTYA 3IB0A 2D5WA 4FIBA 1NFTA 2CEXA 4EIKA 3RT6B 3L2VA 2GNCA 4PTKA 4F1YA 2WYKA 1JW1A 3M54A 5GAMd 2RD1A 3RQTA 2F2WA 2RI5A 3CPFA 1Y3PA 3EHQA 1N7WA 5AA2A 3TCHA 2I0CA 4PFBA 2KXCA 3O8VA 2FA7A 1JW4A 3M0UA 4M7AE 3MEVA 1IHVA 4OMFB 3OS5A 5GANd 2HD0A 4FORA 4ZEIA 1YFNA 3FC3A 1EH3A 2H4IA 5DVIA 1KC8C 3URGA 2EYXA 3RMSA 3HN0A 1VQLA 3MVXA 4PE5B 5AA1A 1AMFA 3EH1A 2QPQA 3VS6A 4OVJA 1BKBA 5I3SA 3L6GA 4E6RA 3DKMA 4G68C 1V76A 5GMKm 3IQLA 2OTJT 3K1MA 4X34A 4H0WA 2EQJA 2VOZA 1Y57A 2DL8A 4PF6A 4BDYA 5EQAA 4ZEBA 4DXUA 2OWZA 5IZZA 2PZ1A 4HXVA 1B51A 2E64A 1UE9A 1YHQA 4ZZAA 2YSQA 1PRMC 4YB7A 4EXLA 4HCZA 2VPOA 1N6AA 3C4MA 3META 5GAN8 2HDAA 2DXBA 1B34B 5GMKi 1VQ8A 2NUPB 4N4GA 5EHMA 3PMVA 2ZNUA 1UUEA 3MWBA 1USYH 1LBZA 4LP2B 5FU6C 1FPKA 2F1LA 1MGQA 4OQOA 5HM4B 2K2MA 3S6WA 2XXYA 3OBYA 2DVZA 4H8JA 1FCKA 1WA7A 3CD6A 1D3KA 2CT3A 1R0CB 2NOOA 1MQIA 4LZ7A 4C92D 2OAWA 4MAGA 1EIFA 2DE3A 1AH5A 2HEUA 2L5VA 2JVVA 3OEMA 2NLUA 4IO3A 1HXDA 1MG1A 3F11A 4POXA 4F39A 1INPA 4JWXA 3MJNA 3KFVA 3CSBA 3LWHA 1VSOA 3CR9A 1QCFA 1IXIA 2QASA 4M7DB 2V3QA 4KHZE 4RPNA 3FDRA 1YCJA 3B8BA 3OYYA 3CMET 2I48A 2K3BA 3E19A 3AHUA 3KC1A 3A8GB 4NF8A 2D1XA 4F1VA 2XDBA 3MEWA 1KC8R 2EYYA 2IVWA 5FBPA 4NF6A 3A29A 4QQDA 1VYUA 2YRVA 2QEXT 1DSNA 1U3OA 2F97A 2ZZVA 3BIHA 3OYIA 4XU3A 5AYFA 3HTRA 4X8RA 4QQ6A 1FPBA 2DE0X 1Q81U 2QDYB 1M1KC 1BI1A 4M78C 4ZTJA 1M5DA 4GRKA 2I6EA 4FEDA 4MZTA 1N0TA 3U8QA 2JTMA 1ZMGA 5KYWA 3CPWP 4R9FA 2CZ1B 2CP0A 4C92G 3VS1A 3QXMA 1N27A 2X9HA 3CCJA 2R58A 2F2XA 3V89B 2DETA 4KR5A 3OS0A 2K4YA 3SDFA 1JXMA 2KT8A 5GAOq 2Z22A 3TUSA 4ELYC 2KNBB 4PFRA 2CZ6B 1MH3A 2VXFA 4C5HA 1YBYA 2K3XA 1A0NB 4E2FB 4M7DE 2QS2A 2X7PA 3TCJA 2KROA 5LJ3g 1CKAA 1YP5A 3JB9D 4M7AD 2ZXTA 3OYEA 4JRIA 3HCQA 3EHTA 2RA2A 2MI6A 4OMNA 4V2SA 1NEGA 3CRBA 5IZ3A 2XWVA 1YJNQ 3VKIA 2XXQA 1B9JA 1NJIC 1NM7A 1WJSA 2HQHA 3PUZE 5HBCA 2OTJA 1UTHA 4NF4B 3H06B 3FVGA 2FHDA 4X9DA 4MFIA 4MMLA 1US5A 3S2VA 3AXFA 4PJLA 2DJQA 2ZPFB 3HRSA 1SW5A 3LSLA 2FVZA 3OMCA 1PD0A 3CMAQ 2QA4Q 1WVJA 1SEMA 1WXTA 1VQMQ 4OB0B 1AT1B 4OEUA 4ELOA 5H8HA 5JK4A 2CUDA 5I2KA 1Q1KA 3PIOA 2ZGWA 3EPEA 4A4EA 4BY6C 2LQNA 2RQVA 4C92A 1NL5A 1R9LA 3JCMd 2CGHA 4E47A 5CKBA 1JO8A 3CEYA 4IUTA 2PVOB 1R9QA 3S9MC 3JCMV 2WEFA 4JZ3A 5M9OA 2L3RA 3L2RA 3MEUA 3KXTA 5KDTB 3JV9A 2XIDA 3MCAB 2RC9A 5FROA 2O1MA 3FV2A 3IORA 5ET5A 1B58A 3RYDA 2KGTA 3H4ZA 5A0GA 3S3MA 2XXHA 4NN3A 2GRVA 4IR8A 3I3VA 3RY3A 5DEXA 4XKNA 2YLBA 1ARKA 1IMBA 2R71A 3K00A 2HXRA 4GFRA 3WXMB 3VVFA 2DXYA 5HK0A 5H8NB 1H8KA 2CS7A 2ED1A 3CCQQ 4RK2A 3OXNA 2CSQA 2O7IA 2PCRA 4JRKA 2PX1A 3M4GA 2W10A 5D7UA 1FMKA 1KD1U 1G0HA 1JJ2P 1TU0B 2LCSA 5KYXB 3EHRA 1D1AA 5KYUB 2QEXA 1NJIR 4G68A 3FEOA 2V1QA 1KQ1A
chains in the Genus database with same CATH topology
1Q35A 1JEVA 4M4GA 4KD5A 1VIFA 3L2QA 4R6HA 4Z7EA 1FQAA 2E6NA 3OYDA 1JETA 1LOJA 2UYFA 4AB5A 1VQ7T 2OK2A 5DTBA 3OYFA 1POTA 3SB2A 4TOZA 2ESNA 1MXVA 3PUWE 5GAN5 4L59A 3KUFA 2DD4A 1P99A 1B3LA 1B7ZA 1IUDA 2O69A 5LJ3f 4ZZEA 4M7AA 4Q0CA 1YAEA 3TZAA 3QZ9B 1LCFA 4JRQA 4XTCQ 3BFUA 3SFMA 1OLAA 5IN1A 4KBMB 2ONSA 4GXSB 2Y7KA 1S9TA 4AQ4A 4M7DD 2V25A 4JB7A 3SEXA 3WAEA 1MQGA 2EJ9A 1KHIA 3HFOA 1HSJA 1DTGA 1U1TA 3FJPA 2UVIA 5I2NA 5KZTA 3O29A 2DVCA 3PUVE 2XXUA 2PVDB 2Z8EA 2QMWA 1XQHA 4XU2A 2NXOA 1LSTA 4EMKA 2DWIA 3VLUA 4OFOA 3C9HA 4F7UB 4KUIA 5IAYA 4IGRA 1D9VA 1SI0A 3FLGA 2EJGA 1K73C 4BDQA 4Q5WA 1O75A 2RK2A 1Q86C 2ANJA 2LAOA 3M59A 4FIMA 4XTWA 2XXWA 1VQ9T 4R6KA 4DOVA 3OOAA 3EFSA 1G3WA 4J6WA 2V3UA 1BTJA 4IURA 1A54A 3R26A 2F5KA 1MXWA 2ZCFB 2QI2A 2RHXA 5FHOA 3V7SA 3CCMT 3GBBA 1UGRB 2DYXA 1DPEA 3OO7A 4YKIA 5LJ3e 4NOYA 4RCCA 2Y7IA 2ZPHB 3VDFA 1LLSA 3DB4A 4ZEFA 1M8VA 1DPPA 4JDFA 5ICQA 2MF2A 4M75C 3A8LB 4PKCC 4X48A 3K6UA 3R6OA 3IOVA 4JSDA 1MY2A 1OZ2A 2X4YA 4Z0IA 4ZN3A 4F7UE 4QFNA 4EUOA 3A5ZB 1B1HA 3QYGB 3RMQA 3RKYA 5LJ3d 1SQYA 2QQSA 2Z8FA 2FVUA 3LWIA 1TFDA 1XS5A 4HCCA 1G3SA 4H1XA 1M5CA 1VQ7A 4C92F 4PP0A 5ITPA 4I8CA 2I3WA 1BYMA 5AA3A 2UYEA 3MW0A 2EAYA 3A3CA 3CPWA 3HKSA 1H76A 1R8OB 4BDZA 4MH5A 3L42A 4OHNA 3CC4A 3E9XA 4B9XA 4XTXA 4M7DA 3U92A 2HAVA 2VV5A 2HQXA 3X28B 2DOJA 1NH7A 4LD6A 4RXLA 3L1AA 4YICA 2VUBA 4XQ3A 1N8RU 3GLXA 2EIFA 3VV5A 2X4JA 2BUDA 3FIRA 1YI2T 3RTFB 3W15C 2DQVA 1LBBA 3C12A 4KCCA 2WSCE 3MP8A 3OSSC 4U4SA 4XU0A 4PFTA 4OB3B 3JRZA 1Y20A 2PVGB 1YCYA 2RHUA 4C0GA 1FTMA 1LCTA 1Q82U 5BWJA 5EG2A 2X26A 2Y84A 1QW0A 2XD3A 1AOVA 3LGFA 5GMKl 2HZKA 1VQ9A 4GF8A 2QS1A 4NF8B 4M77B 2KVQG 3WVEB 2ZPEB 4TLLB 1HSLA 4NF6B 3JB9F 4M7AF 4P5NA 4XKRA 1QKAA 1FTLA 3IOWA 2YLNA 1NNFA 1KWHA 4EQ9A 5D6YA 2E70A 4WEDA 2PU9B 1B1XA 2QXFA 4Y91A 1O7TA 1MXYA 5CO7A 4A54A 2DXUA 4ZE8A 1JJ2A 2DTHA 3IL1B 2GFUA 1GVCA 4QFPA 3BDUA 3TREA 3V7RA 3I56T 3OYNA 3SERA 4XAXB 3LGLA 1Y4CA 2DWHA 3JCMW 2D0QB 2LCLA 4M77E 3PPPA 4NWDA 5HY6A 1DTZA 3UDCA 2B3BA 2VC8A 5L8RE 4JRPA 5I84A 3N5LA 1IZ6A 3LLRA 1M1KU 4MBPA 1L5TA 1OYXA 4THIA 4A53A 3CBOA 3CCRT 1JBMA 4AB6A 3BDLA 1B7HA 4DIGA 3MP6A 1PSEA 5JTYA 4QHQA 1A8EA 1B7UA 3LSFB 1M1GA 4QSEA 4RY1A 5H8NA 4QVCA 4FEBA 5I2KB 1LNXA 3G7WA 4EQ7A 4JLGA 1A55A 2GQVA 4HCWA 4PJOC 4QQGA 1RI0A 3O28A 1OZ3A 3FXUA 3M57A 3HSBA 1YI2A 3S3NA 5CQXA 4JDSA 4F7UG 5A2QE 1M5BA 1XNIA 2RI2A 5CKFA 3OELA 3EAEA 3CMAT 2I58A 4XK8E 4IB2A 5CK9A 5GAOr 5DEXB 4BE1A 2XKOC 4KYEA 2X4XA 4FT2A 2RINA 3FGSA 4BDLA 3NFCA 3OQ5A 4J6XA 4JS4A 5K2XA 4FECA 2Q8JA 3JB9J 4F3BA 2F6GA 3TMGA 1ZBXA 4U2RA 2QS4A 3TEEA 1FQFA 1B3GA 4YU0A 1VQ8T 5FLXE 4G68B 3EHSA 1TWYA 2DKGA 4M7DF 4FT4A 2DPPB 5AE4A 2RO0A 1Y3QA 4PNOA 4R2FA 5FU7C 1QJMA 4GXAA 4C8QC 4UACA 3MPKA 5CVIA 4P0IA 4JWYA 5GAN2 1B05A 3BKIB 3W9VA 3LSXA 5KE3A 4GY5A 2PMSA 4XKQA 5FU6B 3EHUA 5GAMh 2HQ0A 3B7DA 3OBWA 4M7AB 5GAMj 1FWZA 4EQBA 3LR1A 4U4XA 4H65A 1S50A 3KBRA 2QS3A 2ONRA 4F18A 4C0RA 3UN6A 2THIA 4PJOD 3DM0A 2HBPA 5GANh 2WACA 2F36A 4JWOA 5A0DA 5GMKh 2QQAA 5CI5A 4NL2A 1M1FA 4J5YA 2DE4A 2Y7WA 2B3FA 3K0VA 4M77D 3KN8A 5GANe 3M3FA 2JTFA 3CCRA 2DJZA 2LT1A 2E1HA 2Y7PA 1H44A 2DEQA 1LB9A 2K5IA 3SEVA 1FQEA 3VUBA 3QUIA 4LATA 2LC4A 4ZS9A 3PPNA 4U22A 3UA8A 1MM7A 4OFLA 3CCJT 3VLVA 1ZJLA 2M16A 1Y07A 3L2WA 3HRUA 3TODA 3X25B 3M4YA 4YMBA 4M78B 3KFMA 1RKMA 1LBCA 2E10A 3RGYA 3FVKA 3JCMJ 3H3GA 3QUFA 2CZLA 3CMAA 2HZLA 4H5FA 1VQMA 4LDWA 3KN7A 1QKBA 3PUXE 5CCAA 4E0XA 4LDYA 4ZTFA 1H43A 3JSCA 3P8BB 3DP6A 4LQ5A 2M1HA 1VQOT 1MXXA 3J7AF 4YAHX 1WGSA 4BI3A 5GAN4 2XXRA 1IITA 3C95A 1H3ZA 2XXPA 4XU1A 4GOTA 5GAN6 2ZPIB 1H641 3H6ZA 1P1NA 3RUXA 2V3TA 2Y4YA 5CM6A 1AHJB 2QQBA 2XI9A 1PDAA 1JRIA 3HHGA 1I6QA 4ZGJB 2PBWA 4QRZA 1QVGA 3FB9A 1NMUA 4M78E 3CBPA 1MRPA 1OQGA 3TU4K 2ONKE 4ELPA 2O1LA 3SETA 3QUJA 3IX1A 1N3WA 4BUGA 1UEBA 1AIVA 2VHAA 5K2YA 4U1ZA 4BY6B 4II1A 1URGA 3HPIA 4PJOA 4DA4A 1MQDA 2GHAA 1LAHE 2OLBA 3JCMf 5D6XA 4IUVA 1K8AC 4KUDK 3S4UA 2E41A 1ZIUA 3PMWA 2R9JA 3OYCA 1FW0A 4M77A 5J39A 2P4TA 4OB2B 3FASA 3BBRA 4Q8RA 4KT0E 5CR2A 1NPPA 3SDZA 1US4A 3Q27A 1SYIA 2A7YA 2FYIA 2QL3A 3G3KA 1Y96B 2JUFA 4EF2A 4RG2A 1CE2A 5FTIA 3IOTA 1NNKA 2ALUA 3GXAA 1U1SA 1UGPB 3SD4A 2LRQA 2P0PA 4C0DC 2F7BA 4R73A 1QUKA 1VFDA 3BW1A 3OYBA 1M5EA 4F7UF 3DLMA 1JB0E 4HW8A 1NPRA 3JCMh 2AIXA 3RIRA 1B32A 3LW5E 3OSQA 3MVYA 4E0WA 4TLMB 4OGCA 1KQ2A 4BE2A 4NE4A 2RJEA 3GIBA 2HAUA 3G3IA 2BIVA 3JCMe 2RKMA 1PEBA 4LA9A 3KJTA 3MZBA 3U94A 4HT8A 3IK6B 1SDXA 5GAOl 1XTDA 1VQOA 1ZQ1A 1WQ7A 3CBMA 3QHSA 5ISUA 2ZPBB 4RPOA 5I2MA 3V8JA 3M3KA 5FTHA 1RYOA 1F9BA 1QW1A 2XD2A 2MMPA 4LZ5A 3JCMb 2GFAA 4E7HA 3S3OA 3I55T 4E7KA 1EZ9A 4A4KA 4WXJA 4OB1B 3CC7A 5ELVA 3OO6A 5KH6A 2AYSA 3QAXA 4QF9A 4VUBA 3SWNC 5FRNA 3GBAA 3G7ZA 4IO6A 1UB4A 4M78D 4DOWA 4TVRA 3JB9G 4M7AG 2GCXA 2Q2AA 2RH2A 5JTYB 3K6VA 1A8FA 4J83A 1PB7A 3PNWC 1MY0A 2A5TB 3CCSA 3K1PA 4Q5TA 4Z02A 1IXGA 3G3FA 2I4CA 3CPWS 3P8HA 2XXVA 1MS7A 1B3HA 2R6GE 3E3KA 3KBGA 1X01A 3OYJA 4XXUA 3IB2A 3RESA 2KAFA 4LZ8A 3A8MB 4M75B 1ATGA 4NS5A 5FRMA 3CG1A 4JSOA 1WPYA 2A3LA 4ND9A 3W9WA 4RNSA 5CKEA 1R6ZA 2DTOA 2O51A 1Y7XA 3PUYE 3VYGA 1D9YA 4F3SA 1VQKT 1X75C 3ZKLA 4NF5A 3ME9A 4WEPA 1D3BA 3CC4T 2JNGA 3DLNA 2G93A 1M5FA 2RCAA 4B9WA 2EWNA 4PJOF 3HSTA 3ER0A 4PQJA 4IUUA 4I62A 3C34A 4L5GA 3WAFA 4POWA 1P1WA 3FRNA 4M77F 3O6HA 3TQLA 3ZSFA 4ESWA 2VGQA 3N94A 4M75E 2LQKA 2D9TA 2E0SA 4BI8B 4DLDA 3VUZA 1B0HA 2F6PA 1FQCA 1PC3A 3RLFE 2F5TX 4ZGEB 3I55A 2DWJA 4BD3A 3KSXA 1MQJA 2GF7A 3MVWA 3GNGA 1WODA 5LJ3h 5I59A 3M58A 5LJ3j 3CI8A 2RJFA 4M78A 1XOCA 3IB1A 1USYE 3LBSA 2F8DA 1MPBA 1JJ2S 5DLQE 4X1DA 3PMIA 5C6SA 3E4RA 2XK0A 5HKCA 1N84A 2M0OA 2P0QA 2K5LA 1JEUA 5H8QA 4M7DG 1GV8A 4DCYA 2FNCA 3K02A 4OXVA 3IR1A 3D4GA 3ILTB 1VQ5T 2CZ7B 1LB8A 3IJOB 3O97A 3CFLA 5LOMA 5B70A 1IZ1A 5JEIA 4OMBA 4ELRA 2PT2A 1NNPA 3OYMA 4EF1A 1LAFE 4FATA 5BUUA 2EJFA 1AL3A 4F29A 2A5SA 4H5GA 1UQWA 2I0BA 4GVOA 3N5BB 1LJOA 1QULA 3GNFB 4KYDA 3KG2A 4FJPA 1BP5A 2XHDA 1ELJA 3FJ7A 4M1VA 2RK1A 3M55A 4G2ZA 4O3AA 1MY1A 1VQKA 4JXIA 3X20B 3RERA 1UTBA 1IEJA 1MQHA 1OI1A 2CYZB 1LFHA 2MWOA 1MPCA 3E9FA 4DCXA 2DE2A 3BFTA 5CC2A 2DIGA 3OYAA 3T22A 3K6XA 1Q81C 1NZ9A 4A4FA 4FM4B 3H6VA 3RN8A 4N0AC 5CIUA 3LC8A 4OYVA 1BI3A 4EDUA 1KC8U 1MXZA 2REJA 4H6DA 1R1NA 3ZFJA 1XC1A 3EQ1A 1P92A 2V84A 1Y96A 3QBYA 4ZDMA 2UVHA 2KDSA 1VQ6A 2HCAA 3PPRA 2CMOA 5FHNA 4ZEDA 4M75D 4LVQA 5H8SA 4YB5A 3UPUA 4PJOB 2UXAA 2D3IA 2ZNSA 3C32A 1S7YA 1T0KA 1NNTA 5KE2A 4OGEA 3MBPA 4ELQA 3MC2A 3MAMA 2O68A 2KSSA 1SI1A 1RYXA 4RKUE 3V5AA 5IKBA 2IG0A 1BIBA 2O4XB 3IAZA 4DQ2A 5A5XB 1URSA 3ILUB 4J7IA 4XKPA 1P1QA 4GL8A 4G8HA 3G3JA 4EPCA 1I5LA 3OEKA 1B5IA 2DO3A 4C0ZA 1VE4A 4LD9K 3SEUA 1MPDA 4C0FA 1VR5A 3CXCS 4R2BA 2O7UA 3RPWA 1VQ5A 5IAIA 3VU3C 4U1OA 1XHYA 2Q9TA 2XXXA 3P7IA 2ABHA 1PBQA 3I6VA 3CVGA 2DXTA 5LJ5g 4PJOE 1FQDA 3O2AA 5I21A 2Y4XA 4GIZA 3RKWA 1ZKBA 4MF3A 4EDPA 5FU7B 4KPTA 4FU6A 4C8QB 4HA8A 1SW1A 3RUMA 2RHIA 4OVAA 4A4GA 2VGMA 4BDOA 2LNVA 4X9TA 4J6YA 3MZ1A 4R75A 4NWCA 5GAOp 2F78A 4H8IA 3VYHB 4M78F 1Q7YC 2E1SA 4IKFA 1KD1C 4JS5A 4E7LA 4X1BA 3J81E 2Z8DA 2RB6A 2A5TA 1ZLQA 3H8ZA 3QYTA 2H98A 4IO7A 4F19A 4PLIA 3G71A 1BI2A 4R6YA 1YJNT 3TCFA 2OJTA 4MMKA 4TQUQ 2DAQA 2I49A 1O9SA 3JCMQ 3KN3A 4PFWA 4M75A 2W7YA 4C8QE 1NJIU 3N6TA 3C36A 2KK4A 3H6UA 3OW2A 4PFYA 5GAOn 2DTIA 2FL7A 4BDRA 2QA4T 3WVDB 4NMYA 2HNIA 1G3YA 1VQMT 1QVGS 4L17A 3ONMA 4N6PA 3PPOA 4XTVA 5I2SA 2ZMBA 4C1TA 3M56A 1K9MC 1ZTYA 1MXUA 4ZE9A 2B8AA 4IY5A 1FQBA 1P1UA 4JJNK 1KQSS 4QFLA 3CIJA 2QRYA 3TCGA 3H03A 2PUKB 1M90C 5C0MA 2EFIA 2XX7A 4OENA 4WF2A 2RHZA 1LGBC 2KQWA 4HT9A 2E12A 3NTHA 2QSXA 2K57A 3M5AA 2NWJA 1N9SA 3HHFA 4U23A 3TTMA 4OEVA 3RKXA 3ZBDA 3LH0A 3CSGA 5DLOA 5I57A 4OF1A 2QJEA 3BY7A 2AL5A 3CCQT 3EN3A 5LJ5f 5CKHA 3N26A 1ANFA 2RF1A 2D21A 3L2ZA 2X4WA 1O63A 1ZHIA 2LQ8A 5TU0A 5I56A 1UIVA 4NF5B 3C94A 1D3BB 3U1OA 2FYKA 3TTKA 4F2OA 2VD3A 4WKMA 3CCUT 3IO4A 2JZ2A 5GANj 4DXCA 3S9NC 5GMKj 3CXCA 4DXBA 3UP9A 3U72A 2O01E 1YITT 2P0SA 3M9QA 3LSWA 3OD7A 3VFJA 3EF7A 1GGGA 2DXRA 1N3XA 2F35A 4EXKA 2OTLT 3DP4A 2LT4A 4BACA 3DP8A 3DB3A 4ZECA