3MP1A

Complex structure of sgf29 and trimethylated h3k4
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
517
structure length
509
Chain Sequence
b'MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
molecule tags Histone binding protein
source organism Escherichia coli k-12
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
total genus 136
structure length 509
sequence length 517
ec nomenclature
pdb deposition date 2010-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp1A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp1A01
1IITA 1JETA 5I57A 2PVUA 3FEOA 3E13X 1F9BA 5CRYA 2CZLA 3PPRA 4LP2B 3K6UA 3TODA 1SI0A 5D6YA 4HCYA 3H6ZA 1KWHA 1VR5A 3UT1A 1XOCA 3OD7A 1LAFE 4YKPA 1HSJA 1FW0A 3P8DA 4YB7A 3OXNA 1LAGE 3B6WA 4H8JA 4F1VA 2QMWA 2O1LA 4X1DA 1AMFA 3CR9A 3E3KA 2H4IA 5DVIA 1YTVA 3LUYA 3HCQA 5ICTA 3M8UA 1OYXA 3QBYA 4KCDA 1NH7A 3LSFB 2XX7A 2H5YA 3PUVE 1LGBC 1B1HA 3KUFA 2Y7PA 3DLNA 1I6BA 1MM7A 1Y1MA 2KLFA 4R6KA 1ZLQA 4E0XA 1XVYA 4BE2A 2UXAA 4BE0A 1B52A 3G3IA 2F5XA 4IO4A 2DE3A 1MHNA 3L42A 3BFTA 3JYRA 3META 2I4CA 2RJCA 5CMCA 3FVGA 5CMKA 4PETA 3C36A 2RKMA 4U4XA 2AIXA 1MH3A 4Q30B 5KDTB 1JEVA 1MXUA 3ECRA 1ZU0A 4LVQA 4RXLA 4C1TA 4F29A 2XDPA 4DLDA 3DELB 5I2NB 2RJFA 2F8DA 3IB2A 4RJZA 2HAUA 4DDDA 5HPQA 5HBCA 1M5DA 3H6WA 1ZBMA 5H8HA 4U23A 3RUMA 4BD3A 2NWJA 3SEYA 2XX8A 4YKJA 3R26A 2DWHA 1B58A 2NVUB 5I56B 3QAXA 2B8AA 3MW0A 3QYTA 2HEUA 3VE1B 2Z22A 4OFJA 4NEDA 5B7DA 4MLVA 4C5HA 3MP6A 1MQGA 1H45A 3H6VA 4PFYA 1IQ7A 4MH5A 3IOTA 5TPAA 3FC3A 2XHDA 4XKRA 2AYSA 3ILTB 2Z8FA 3C9HA 2EFIA 4G8MA 4RYAA 1LFIA 3VDFA 4OERA 4DCXA 1LFGA 2ONRA 1B6HA 4ZEDA 4CRIA 4ZTFA 4KYSA 4UC4A 3OO7A 1FTJA 1QJMA 3OA6A 4YMBA 3L2QA 3H03A 4NF4A 3H7MA 4FATA 2QRYA 3O97A 5KCJB 4EXKA 1FQFA 3DB3A 5I59B 4OEVA 2QMXA 1NKXA 3GOXA 4BDMA 2M0OA 3FUZA 1L5TA 3OMBA 5EHSA 2X4YA 1ZKBA 5EHMA 1JEUA 5D6WA 3VXCA 1DPPA 3L2VA 2F6PA 3D4CA 2F78A 1UTHA 4H8IA 3QJ6A 2O4XB 3FASA 4NS5A 5AA2D 4ZE9A 2K3XA 1IXGA 3SEVA 1US5A 5JTYA 2NUVA 2QJEA 3UP9A 3B6QA 3FDRA 2IA4A 2DAQA 2OWSA 1MY1A 1OI1A 2W7YA 4FIMA 4HS7A 3O8VA 4DXUA 3Q28A 2YRVA 4N4HA 4E7KA 3SD4A 3LBSA 5DEXA 4PLIA 2QQRA 4H6DA 1OZ2A 3S3NA 3RT6B 4B9XA 4YZZA 5H8NA 1Y3PA 1B7UA 1BKAA 1ZTYA 2HZLA 1H3DA 3G3KA 4Z7EA 2XXRA 2QQSA 4F19A 2FNCA 5KDTA 5IN1A 5FRNA 2B3FA 2ZYKA 1VFDA 5AA1A 5I57B 4GVOA 2DQVA 3TUSA 4U2RA 4FL6A 1LBCA 3I3VA 4X48A 5B70A 3PPOA 1USYE 5FHMA 1MPDA 2G29A 4NF6A 1MXVA 4IUQA 4I62A 4I9DA 1D3KA 3QUJA 4XIGQ 4OVJA 4PP0A 3OS1A 4NF8A 5H8HB 1N7XA 4G68B 3I6VA 5FHNA 1FTLA 4PFTA 4TQUQ 3P8HA 3N5LA 3MJNA 5DVFA 3FJGA 4U22A 1LLSA 4PL6A 4YU0A 2HQEA 1LSTA 1HSEA 1QKAA 3A3CA 3IOWA 1USYH 2UYEA 5DTBA 1MDQA 3T22A 3RGYA 4EQ9A 2V3TA 3UN6A 1XNIA 5I59A 2QS1A 2RHIA 3KFMA 3O29A 3OMGA 1MXWA 5HM4B 4GOTA 3USDA 3RLFE 4ZS9A 2E0SA 3KZGA 4G4PA 4LZ5A 4EF2A 3JZJA 4FEDA 3S9NC 4YKKA 1B3FA 1H3ZA 2RF1A 1UQWA 2ZMBA 3UK4A 3HHGA 1PB9A 3T9VA 2R58A 5FHOA 4M1VA 3SETA 3LSLA 1PDAA 4RY1A 3U72A 4XKNA 3KEIA 3ZEHA 1H76A 3IOUA 1JQFA 3C32A 3UORA 3K00A 4GRKA 3G3FA 2DVZA 2PMSA 2DSFA 1US4A 3ZKLA 3CFXA 2L8DA 3OSRA 3RT8A 4KCCA 3S3MA 3PMIA 4LQ5A 3TTRA 3W9WA 1SYHA 3R7XA 2BJJX 2YPNA 4QFLA 1Z7ME 1GGGA 4OFOA 1NNTA 1SW2A 2OCUA 1A7LA 1NH8A 4FORA 1URGA 1POTA 4GWOA 4GIZA 4DCYA 4IY6A 1EZOA 1B7HA 4LUBA 3G3GA 4E7JA 1DTGA 3L6HA 4U1OA 1TFDA 2I3VA 2Z8EA 5F7VA 5K2YA 2A5TB 4QSEA 1IIWA 4H1XA 4BDZA 4ND9A 5CBRA 2EKOA 2DS9A 2B3BA 3TQWA 5L9SA 1RKMA 1IEJA 3U1OA 4EDPA 3TCHA 1Y3NA 4MLQA 4YKIA 4UA8A 1R9LA 3ZKKA 1N76A 4ZZEA 4DIGA 1MXYA 2MWOA 2O51A 2R71A 1MPBA 1I6AA 4YICA 5IAIA 1J1NA 3L2RA 1Y20A 2EQJA 1A8FA 2XXUA 4KFQA 2LRQA 1SI1A 1LB8A 1IXIA 4KQPA 2LVMA 3GXAA 5AA2B 2O4XA 5DYHA 2OBGA 4NTLA 3KN7A 2L3RA 1GTKA 2UYFA 2H98A 2X4WA 5IAYA 1PB7A 3K6WA 2Y84A 3MVWA 1MY0A 2DE2A 3MPKA 2X26A 2GHBA 1OLCA 1P1OA 5IKBA 3LYIA 3PFSA 2P0SA 4KI0E 5A5XA 1PBQA 1B0LA 4RPNA 1S50A 2X35A 4G8HA 3LH0A 2XXIA 5J26A 1EH3A 4E7LA 1O63A 4U21A 3L2WA 3GBBA 2Q8JA 4G2ZA 3THIA 3MAMA 1DPEA 4F31B 3FXRA 3IB1A 3QUFA 3B7DA 1FCKA 3T66A 3H4ZA 4F39A 4JWOA 3W9VA 4QQ6A 4R74A 3LSWA 1JVYA 4IO7A 2F36A 3LR1A 3S3OA 3IL1B 3H8ZA 3PPNA 2LTOA 4AB5A 5AA4A 2G93A 3FIRA 3M3KA 1XHYA 2GFEA 2F6GA 1SW5A 4F22A 3S9LC 1S7YA 2VP1A 4QFOA 4F1YA 3CFZA 1NNPA 2DVCA 4M4GA 1MY4A 2RC9A 2QL3A 1WJRA 2L89A 2LDMA 3FATA 1WJSA 2Y7KA 3QIIA 1B0HA 1DOTA 1A8EA 4C5GA 1B05A 3PMVA 5JTYB 3N26A 4XKQA 5FTHA 1ATGA 1FTOA 3KN3A 5H8FB 2QPQA 3B6TA 3CVGA 4K3FA 4HCZA 2PQWA 5I58B 3OO6A 4NF6B 5KCJA 3OYBA 3S4UA 1UTBA 3TKDA 3MQ9A 3GBAA 3O6HA 2JTFA 4OZ9A 2K3YA 4O3BA 4TOZA 1ANFA 2RCAA 3BKIB 4KR5A 4P0GA 1WGSA 4JXIA 5BUUA 1G5VA 5KZTA 4P11A 2XXTA 1JW1A 4LZ8A 4GL8A 3QKJA 2ZNUA 3FJ7A 2I4BA 1EZ9A 2Q89A 3K1MA 3RY3A 3M3FA 3K6VA 2PBWA 3LGFA 2A5TA 3HV1A 5LOMA 5L8DA 4IUPA 2BKDN 1LBBA 3PMXA 3DM0A 3TMGA 3IK6B 2RHYA 3FD3A 4FAJA 2RJDA 2I48A 4P0IA 4IGRA 2QS3A 2XD2A 1JNFA 3T9UA 3FXUA 2DIQA 4HCWA 4QSDA 5CMMA 5I56A 3EN3A 4TLMB 1SQYA 4EXLA 1KHCA 1N84A 3M9QA 1FQEA 3KSJA 3MZBA 1GVCA 3NTHA 3FV1A 1P1UA 2HQXA 3K0VA 4ESXA 3F70A 3RPWA 4BDQA 3MBPA 4IUUA 1A55A 1FQCA 2F35A 4F3GA 3OYDA 2OWTA 1MQIA 3MEWA 4OTEA 1NNFA 5I2NA 1MM6A 3N94A 5ICQA 3MVXA 3KGCA 4F2OA 1XC1A 1B4HA 2GHAA 5TU0A 1B4ZA 2O1MA 5ELVA 2V84A 4WEDA 3PGFA 3ONMA 4THIA 4C5EA 4PFWA 4OETA 2ALUA 2YLNA 3C35A 1B3HA 3JV9A 1QUJA 4L59A 4GLIA 3FVNA 1IUDA 3N6UA 2EQUA 2AL5A 5AA4B 1LFHA 1B3LA 3MC2A 4U4SA 4EDUA 2F7BA 4XKPA 1N27A 4ISUA 4QFPA 5AA2A 4R2BA 3H06B 4QVZA 3OYEA 3RNNA 2Q2AA 5FROA 5TP9A 1MRPA 4E7IA 4GQOA 3E9FA 3RTFB 1O7TA 2XXWA 4LZ7A 1MPCA 2WACA 3OQ5A 2ZXTA 4HTGA 1PB8A 3GLBA 5H8SA 2ZNTA 5M9OA 4KD5A 3Q27A 1XT8A 3OYNA 3WAFA 3PUWE 2P2AA 4WXJA 3PPPA 3HPIA 3T93B 4BDNA 4HW8A 1TFAA 4IO2A 1CB6A 1TT1A 2G3RA 3PU5A 4QSCA 1HSLA 2Y7IA 4NWDA 4E0WA 3PV0E 2YJPA 1WVJA 4Q5TA 3MVYA 5F1QA 4PLLA 3V5AA 3SESA 3BFUA 4QHQA 3C31A 1Y3QA 3MWBA 1QUKA 1NNKA 3T96B 2X7PA 1QW0A 4NF8B 1M5BA 5DVJA 5H8FA 1R6ZA 1UTHB 3SERA 4IKFA 2V3UA 5KH6A 3VVFA 4AB6A 2LCCA 3VLUA 3MZ9A 2Q9TA 4QW2A 4F3PA 4IB2A 2R5MA 5JK4A 3ZSFA 5KCOA 5DEXB 3S9MC 3IOVA 3TAJA 4GXAA 2HQ0A 4G68A 4WEPA 3MP8A 2D21A 3P7IA 4ZEIA 4H5FA 3TCFA 2RI2A 1M5EA 2RC7A 3MEAA 1PEBA 4BDLA 1QUIA 4RA1A 4Z02A 4R72A 1OMPA 4LQ2A 3IORA 2PT2A 4ELQA 4Q8RA 4RPOA 1Q1KA 3OEMA 3OEKA 1CE2A 3SEWA 1OVTA 4DZ1A 1SYIA 1MH4A 4RG2A 2THIA 3OSQA 1N3WA 3TYHA 5H8QA 3VVDA 3ASKA 2XXHA 1WDNA 4F3SA 4IO5A 2XK0A 1II5A 1IXHA 3E9XA 2XXQA 3IR1A 3RN8A 2NOOA 4F1UA 3FXQA 3TFLA 3EQ1A 2I0CA 1VFEA 3KOTA 4MFIA 1YAEA 1Z7NE 4OEUA 2F5KA 5EYFA 4WKMA 1BP5A 1P99A 2R9JA 3KBRA 1EU8A 2O69A 2HZKA 2XXYA 2O6AA 1LAXA 4JWXA 1A54A 4ELOA 3CG1A 2XXPA 2H99A 3L6GA 3O6GA 1WODA 4BDRA 2PYYA 2RINA 3CFLA 4GXSB 3QXMA 3UGWA 2V3QA 1QULA 2RJEA 1BIYA 5FRMA 4R2FA 4QQDA 1TWYA 3V89B 4F2QA 3HO7A 1B3GA 1T0KA 3SEUA 1POY1 3CSBA 1BLFA 2ABHA 2M16A 1N3XA 3KOSA 2DWJA 1A40A 1GR2A 1TXFA 4ECFA 4H5GA 4MF3A 1VE4A 1SW1A 3H3GA 2RCBA 3MEVA 3HN0A 4GFRA 3U92A 3O9PA 3CG3A 2OK2A 3MUQA 2ANJA 1LB9A 5CI5A 3BDLA 4JSDA 2IG0A 3VXBA 4NF4B 1ZMGA 2E6NA 3A09A 4BE1A 1B2HA 3MO8A 4OHNA 3R6UA 2NLUA 2BUDA 3TTMA 1LCFA 1MQJA 5JEIA 3LC8A 4IO6A 4F18A 4JDFA 1B1XA 3LGLA 2F7AA 4ZEBA 4A4HA 2Z8DA 4YB5A 3VLVA 3OENA 3OY9A 2REGA 1Y4CA 1B5JA 4ZTJA 1PC3A 1NL5A 4LA9A 2RHXA 3TELA 1MG1A 2F7CA 3K02A 1MQHA 1B5HA 1MXZA 3VV5A 1I6QA 2RHUA 1OQHA 2DXYA 4X9TA 5C6SA 2REJA 4ZEKA 3DP8A 2GF7A 3RTWB 4GF8A 5DT6A 3DLMA 3C4MA 3VLWA 3OOAA 3NTKA 3MZ1A 4N07A 2GRVA 1FTMA 2Z23A 2UVHA 3GZGA 4OFLA 3CI8A 2DWIA 4NMYA 4R9GA 5I2KB 4ZEFA 4YAHX 3UIFA 3QIMA 2D5WA 3G3JA 5K2XA 2I0BA 1IXCA 4I1DA 3K2DA 4RK2A 4OMBA 1JW5A 1UIVA 3TPAA 1OIBA 3T9XB 2VD3A 3CRBA 3A3UA 2I3WA 2VOZA 3DP6A 1DSNA 4UACA 4BDYA 3ODBA 1N0TA 4YB6A 2NXOA 5CBSA 3S2VA 1RYOA 3HHFA 2ZYMA 5BWJA 4PQJA 3Q29A 1UIUA 3OYGA 2OLBA 4ZDMA 1MS7A 4A4EA 4O3AA 2Y7WA 4OESA 2R57A 2FA7A 2P1SA 1M5CA 3ZS6A 2Q2CA 4XXUA 2E5QA 1M5FA 3K4UA 1SDXA 3WAEA 2H9BA 2VD2A 2O7UA 2CKKA 4PFUA 2RHZA 3OYFA 1SSFA 3TDJA 3U94A 3KJ7A 2BIVA 2PX1A 2ZYOA 2HFBA 3PPQA 1DTZA 4MBPA 3OYMA 4EUOA 4JWYA 3W15C 1OQGA 2RI5A 4KYDA 4FJPA 3OYCA 4BLAA 4ZECA 2VYTA 4KHZE 3S9EA 1IZ1A 1Y9UA 2UVIA 1YPNA 4FE8A 4ELPA 3ILUB 2X4XA 3E4RA 1D4NA 3RQTA 3SKPA 4BDOA 2ESNA 1LCTA 1ZJLA 2DE4A 4II1A 4ZZAA 3K6XA 3C33A 1MY2A 1A99A 2QS4A 2MWPA 3FV2A 4OYVA 2WKYA 4QQGA 1N7WA 4POWA 3L2UA 3U93A 3PMTA 4ZE8A 2DWAA 4IO3A 4QRZA 3CIJA 4IUTA 3KSXA 1B5IA 3PD8A 5C0MA 5ISUA 1WJQA 3FGSA 3G7WA 1R9QA 1B51A 3C34A 3K01A 1NMUA 4EQBA 2UVGA 4Z0IA 2AL4A 4QFKA 1AOVA 3O28A 2R6GE 3BBRA 2M1HA 2GFAA 3KN8A 4IGTA 3S6WA 2H25A 3AXFA 4C1UA 4G77A 2P0KA 5TP9B 1S9TA 1B9JA 3V8XB 1Q35A 1MXXA 2DYXA 3EHSA 5L9OA 2DOJA 2QSXA 3LX7A 2B65A 1RI0A 3OYKA 3IAZA 4OQOA 1I69A 3PUXE 4A4GA 2IEEA 3FJMA 4JBZA 5H8NB 2VHAA 2R5AA 3HSTA 2I6EA 3H6UA 3SEXA 2JZ2A 3TTNA 3TEPA 2UVJA 4DXBA 5KE2A 1JVXA 3LSXA 4R73A 4B9WA 4FECA 3OS0A 3OS2A 5J39A 3EAEA 2O68A 1AH5A 4GL0A 4EF1A 4U1ZA 4IURA 1FQAA 4IY5A 1AIVA 2QS2A 1B3EA 4ONYA 4NWCA 1BTJA 2I49A 2LAOA 2I58A 4QFNA 1SD3A 4Q0CA 4NF5A 4F3BA 4E7HA 1JW4A 1B32A 4L17A 4NF5B 3O66A 2EQKA 4R75A 3MVZA 3MPLA 1QKBA 5CIUA 1Y1ZA 2V25A 3TTKA 1OLAA 1O64A 4LD6A 3IO6A 5I2KA 2ZYNA 2D3IA 4A4FA 1D9VA 4G68C 2EQMA 4BACA 3EF7A 4OENA 1Y4TA 1ZIUA 3OYLA 1XVXA 1YCJA 2DIGA 3ME9A 3NTIA 1H44A 3N6TA 3T9HB 3FVKA 1B46A 3QSLA 2DXRA 2FHDA 2VGQA 5ITPA 2Q88A 2O7IA 5ITOA 1LAHE 3D4GA 5FTIA 1SVXB 2XXVA 4YMAA 3Q25A 5A5XB 4G8NA 4OXVA 3SDFA 2GFUA 2OZZA 3UWNA 2X7QA 3OYAA 3FLGA 3V83A 4N6PA 4XTCQ 4DXCA 1MQDA 3VFJA 1UTBB 3KG2A 4POXA 4N13A 4N4GA 3H6TA 4X1BA 3TCGA 2A5SA 2RC8A 4PE5B 4LATA 4TLLB 3UA8A 5M2VA 3IX1A 4H65A 1P1WA 3CSGA 3O6IA 4RNSA 2PT1A 3OELA 1MDP1 1ELJA 2F34A 3PMWA 2E1SA 4H67A 3G3HA 5AA3A 2ONSA 1D9YA 1B7ZA 1URSA 3EHTA 1GV8A 3F11A 1FQBA 4IUVA 3Q1JA 5D6XA 3MEUA 4KYEA 1SW4A 4R6YA 3OMCA 2O84X 3CEYA 2FYIA 1QVSA 2GH9A 4GD5A 3I5OA 3C4SA 1R1NA 5KCHA 5TPAB 3IJXB 2ONKE 5L9MA 1FQDA 3E9GA 4LONB 3DB4A 3FVOA 4EQ7A 3OYHA 4C5IA 2HCAA 2CMOA 5J1DA 3U8QA 3TQLA 4N4IA 4AQ4A 2XXXA 3PNWC 4GY5A 3QK6A 1MY3A 4Q5WA 1XS5A 3DP4A 1EZPA 3K1NA 1DMBA 2HXWA 2V93A 4FEBA 4OWDA 4FU6A 2XD3A 3IO4A 2HAVA 1SBPA 2D9TA 3IB0A 4O3CA 3EHUA 3M3LA 2RO0A 3LLRA 5AE4A 5I58A 2ZNSA 3Q26A 1RYXA 2RI3A 1VSOA 4R6HA 4RK9A 3OO8A 5CMBA 1N04A 3EPEA 1FTKA 2M8CA 4NE4A 4H0WA 4JSOA 3PUYE 4ELRA 3K1PA 1AL3A 3IJOB 4X34A 4QF9A 3MP1A 3OB9A 2OJTA 1H43A 1URDA 2DP8A 4OVAA 2Y7RA 3PD9A 5CM6A 1NFTA 1OVBA 5I84A 4R9FA 3O2AA 3TZAA 4JB7A 3OYJA 5H8QB 5CC2A 2XX9A 1P1NA 3OYIA 2F97A 3OO9A 4ESWA 1OZ3A 4KPTA 3KJTA 3FZVA 3VVEA 4I8CA 5KE3A 4DE8A 1B40A 3TTLA 1PBPA 4C0RA 1P1QA 3PUZE
chains in the Genus database with same CATH superfamily
3LWHA 1IITA 3EFOA 1FPLA 1N8RC 1JETA 2L5QA 2ED0A 2YUQA 5I57A 2PVUA 5CO7A 2C06A 3FEOA 3E13X 3RYDA 5EG2A 1F9BA 2CZLA 3RKXA 3PPRA 5LJ3f 4LP2B 5CRYA 2GGRA 3K6UA 5KYUB 3TODA 4LD9K 5GAMh 1KD1C 1SI0A 4LDUA 2EJFA 3UF4A 5DM7R 2FB7A 5D6YA 4HCYA 3H6ZA 2O9VA 3V7SA 3ZL7C 1KQSP 4LUDA 4AFQC 1VQKT 1KWHA 2CEXA 3P8BB 1VR5A 2VGNA 3UT1A 1XOCA 4RMOA 3OD7A 1YIJT 1LAFE 1GCPA 4YKPA 4FYWB 1HSJA 4PAIA 1AVZC 2DFUA 2RPNA 1FW0A 4XTZA 3P8DA 4J8OA 2DDKA 4YB7A 3OXNA 1LAGE 3B6WA 4H8JA 2YXYA 4F1VA 2QMWA 4WCIA 2O1LA 4IR8A 1YBYA 4FT4A 4OVTA 4XAXB 5GAN8 4I3EA 3CMEQ 4I3YA 4X1DA 1AMFA 3CR9A 3E3KA 4DI3D 2H4IA 5DVIA 4QT7A 3VV0A 3QZ9B 1YTVA 3CCLA 4GX3A 1VQ8A 3LUYA 4LE9A 2MAMA 3NOHA 3HCQA 1RI9A 4M75B 5ICTA 1WPYA 3RBBB 3M8UA 1Q7YU 1OYXA 3OS5A 3ER0A 3QBYA 4KCDA 1D1CA 1NH7A 2DILA 2Y4YA 2VPOA 5GAOn 3LSFB 2XX7A 1W1FA 2M9UA 3WXMB 2H5YA 3PUVE 4LDWA 1WQ7A 4JJCA 1LGBC 1B1HA 3KUFA 2CDTA 2Y7PA 1IMBA 3DLNA 5LJ5j 4M78C 3HFNA 1VYVA 2E3HA 1I6BA 1X2KA 1YIJA 1MM7A 1ZUYA 1N8RR 1Y1MA 2KLFA 4R6KA 4PJOE 1TUGB 1X6GA 1K9AA 1ZLQA 1WFWA 1NV7A 2Q74A 1XVYA 4E0XA 4BE2A 1JJ2S 2UXAA 4BE0A 1LBXA 1B52A 3G3IA 3J80E 2KRSA 2F5XA 3FJ7A 2HEQA 2MI6A 1Q86U 3G1JA 5FLXE 1ZUUA 1H641 2DXUA 4IO4A 1RADB 2RQVA 3EGUA 2DE3A 2MPXC 1MHNA 1NE8A 3L42A 3BFTA 3CHGA 2XD0A 4M7DE 1UJ0A 3JYRA 3G4SA 3META 2I4CA 2F2WA 2RJCA 1TWBA 2DNUA 5CMCA 3FVGA 5LTCA 1GL5A 2FRYA 1KK7A 4FCYA 3C95A 3J7AF 5CMKA 4PETA 2KXCA 3C36A 4PF6A 3I56T 2RKMA 4U4XA 3ZBDA 2AIXA 1G0HA 1MH3A 2E64A 4Q30B 5KDTB 4HVWA 1HD3A 3QPHA 2KSSA 1I4K1 1JEVA 1MXUA 3ECRA 1ZU0A 2WYPA 4LVQA 2CZ0B 4F7UF 1KIKA 1NUZA 4RXLA 4C1TA 4F29A 3CXCS 2XDPA 4PFOA 4DLDA 4OB3B 4H46A 3DELB 2WSCE 1Q81R 1UDLA 1AHJB 3G71Q 5I2NB 1V76A 3ISPA 1CSKA 4PTKA 2RJFA 3CPWA 1NBEB 2F8DA 3H41A 3IB2A 2FL7A 3HKSA 4DBRA 5KYNA 2HAUA 4RJZA 4J83A 4DDDA 5HPQA 5HBCA 1AWOA 4F7UB 2A08A 1M5DA 3H6WA 1JEGA 3EKIA 4AMCA 1KQSS 1ZBMA 5H8HA 3CPFA 3AHUA 4U23A 3RUMA 4HT9A 4BD3A 2NWJA 4P1EA 1PSEA 2XX8A 1AZGB 2DPPB 4YKJA 3V8LA 3SEYA 2HHMA 3H0HA 2NUPB 1BK4A 1AWJA 4NGUA 4JZ4A 1KQSA 4O7MA 3R26A 2FIEA 1XI6A 4MNIA 2ROTA 1G3YA 2WSFE 1HJDA 1B58A 2DWHA 4JVDA 2NVUB 5I56B 3CCJQ 3QAXA 2B8AA 3MW0A 3PGGA 3QYTA 2HEUA 2JVVA 3VE1B 4M7AG 2Z22A 1ACMB 4P5NA 4OFJA 4Y92A 2LQ8A 1K8AU 4NEDA 4DI4B 5B7DA 1BU1A 4WF2A 4MLVA 3ULRB 2X3XD 4C5HA 1NUXA 3MP6A 4NQ8A 1MQGA 1H45A 3H6VA 2RH2A 4PFYA 2P4TA 1IQ7A 2BTTA 1KA0A 2E70A 1KG1A 4MH5A 3CMET 4Z8AA 4C0FA 3LWIA 2GTOA 3IOTA 7AT1B 1N5ZA 4PJOG 1RL2A 5TPAA 4FIBA 1K4US 3FC3A 2HKNA 1AWBA 2XHDA 1QWFA 4XKRA 5EQ8A 3HL8A 3SDZA 4HXJA 1JB0E 2AYSA 3ILTB 4N91A 1DK4A 3TU4K 2PNIA 2Z8FA 3C9HA 1ZBXA 4M78A 3JSCA 2EFIA 1AEYA 5DLOA 4G8MA 4RG8A 1UEBA 4ELZC 1LFIA 4RYAA 1NLOC 2HAXA 1WHLA 1NPRA 1VQ8Q 3VDFA 4OERA 4DCXA 1LFGA 2ONRA 2DZCA 3VS0A 1B6HA 4ZEDA 4CRIA 4ZTFA 4KYSA 2ZCFB 4UC4A 1SHGA 3OO7A 1FTJA 1QJMA 2HSPA 3OA6A 1M90R 2DBKA 4YMBA 3L2QA 3H03A 1K8AR 2WBBA 5CQXA 3VS2A 4NF4A 3H7MA 4BI8B 2QRYA 5IM2A 3O97A 4FATA 1B07A 2BE7D 3CCUQ 4EXKA 1NUYA 5KCJB 1FQFA 1PKTA 2K57A 1U3OA 3DB3A 5I59B 1IXDA 3PIOA 2QQBA 4OEVA 4PJOD 3X25B 4FM4B 4HCBA 2QMXA 1NKXA 3MCAB 3GOXA 4BDMA 3VYHB 2M0OA 3MKDA 9ATCB 2V1QA 1NEGA 3CD6T 2QG9B 3FUZA 2QVVA 3QWYA 1L5TA 3OMBA 4M4ZA 2KRMA 1MMDA 4J6YA 5IZZA 2XG8D 5EHSA 2X4YA 1ZKBA 5EHMA 4KGXB 3FJPA 1JEUA 2JXBA 5D6WA 1R8OB 3VXCA 4EMKA 3KXTA 2OTJQ 1DPPA 3L2VA 3CCJA 2F6PA 3V7CA 3R6NA 5IZ3B 3D4CA 3PIPA 2F78A 1UTHA 2FRWA 4H8IA 4UABA 1ZA1B 3QJ6A 4M77F 2O4XB 3EG9A 5CKHA 3OW2P 4AS5A 3BDUA 3FASA 4NS5A 1VQLQ 5AA2D 1K8AC 1WYXA 3EFRA 4M78B 4M78F 4MZTA 1FWZA 1WNLA 1QW1A 1JBMA 2K3XA 4FW2A 4ZE9A 1IXGA 4OVPA 3SEVA 1CKBA 2EIFA 1US5A 5JTYA 2NUVA 1KSWA 4F7UE 2QJEA 3UP9A 1K9MR 2F2VA 1PC0A 3B6QA 3KBZA 3FDRA 4MIJA 1R0CB 2IA4A 3M56A 2DAQA 1NV3A 2M51A 2QGFB 3THKA 4M7DC 2CZIA 2B4MA 2OWSA 1MY1A 1B34B 1OI1A 2W7YA 2YLBA 4FIMA 1M4ZA 3CCUA 4HS7A 2F69A 3O8VA 4DXUA 2KEAA 3SWNC 4DQ2A 3I56A 3Q28A 2NUTB 1YITT 2LQKA 4JPBW 3FXBA 4GLMA 2YRVA 4C92D 4N4HA 4E7KA 3SD4A 4PJOC 2ZZWA 3LBSA 1GCQA 4QVDA 5DEXA 4PLIA 4CC7A 2QQRA 2MK5A 5A0GA 4H6DA 1OZ2A 3T9NA 5IHKA 3S3NA 4JVIA 3RT6B 4B9XA 3CQTA 2HQHA 4YZZA 5H8NA 1Y3PA 3NHNA 4D8KA 2DETA 1PSFA 4HVUA 1G3SA 3N5BB 1B7UA 2K2VA 1C0MA 2ZZVA 1BKAA 1ZTYA 4AG1C 2HZLA 5HY6A 1H3DA 4J9BA 3G3KA 4Z7EA 1NJIR 2XXRA 4M75D 1RABB 5GAN2 2QQSA 4AFUC 5IXFA 2LQNA 4F19A 2FNCA 5KDTA 4PKCC 4MZMA 2K4YA 4MNCA 1MNDA 5IN1A 4M77A 5FRNA 2B3FA 2ZYKA 4N6DA 1VFDA 4AG2C 3RDVA 5GAOm 2O01E 1PM3A 5AA1A 5I57B 4GVOA 2QQ9A 2DQVA 2VT5A 4PFBA 2CGHA 1DJ7B 3CC7Q 2J6OA 2VPNA 3TUSA 4U2RA 4FL6A 2PCRA 3C94A 1LBCA 3I3VA 4JVCA 5CCAA 4X48A 5B70A 3MYUA 3PPOA 5D7UA 2ZPBB 5LJ3h 1USYE 4F7UG 1MPDA 2G29A 1Q7YC 4NF6A 5FHMA 1MXVA 4M77E 4IUQA 3CC2Q 4PFZA 1ZSGA 4I62A 1VQ8T 4I9DA 3CCLT 1D3KA 1QMCA 2J7IA 1M90C 3QUJA 4P1LA 4C92E 1BKBA 1WLPB 4XIGQ 1FPGA 2EYYA 1I81A 2GQIA 2B4LA 4OVJA 4PP0A 3M4GA 1FBEA 3OS1A 4NF8A 5H8HB 3CMAT 1N7XA 2DL8A 4G68B 1X69A 2CT4A 3RIRA 1WXBA 3TREA 1QKXA 3I6VA 4G61A 5FHNA 1FTLA 5A2QE 4R56A 1QVPA 1T3SA 4PFTA 4TQUQ 3P8HA 1FPJA 3N5LA 3MJNA 2QQAA 4ZNXA 5DVFA 2VUBA 3FJGA 4U22A 2PUOB 2JT4A 4PL6A 1LLSA 2HQEA 4YU0A 1LSTA 1IMDA 1ZSZA 1JO8A 5A0DA 1VOMA 4KBMB 5I21A 3CCVQ 3KC1A 1HSEA 1VQ5T 5GMKi 1QKAA 1D1BA 1FMKA 3QYHB 3A3CA 3IOWA 4PF8A 3RMQA 1USYH 2UYEA 4GX4A 5DTBA 1MDQA 3T22A 3RGYA 3VRZA 4EQ9A 2V3TA 3HFUA 3UN6A 1XNIA 4JRPA 3BFMA 5I59A 2QS1A 2RHIA 3PE0A 3KFMA 2LC4A 3O29A 2IIMA 2MMPA 1VQ5Q 3OMGA 1FXXA 1U8RA 1MXWA 1MUZA 4PDHA 1TH7A 3GNGA 5HM4B 2JMCA 4GOTA 3USDA 1FTAA 4J7IA 3RLFE 4ZS9A 2E0SA 3KZGA 3BW1A 4G4PA 4LZ5A 4EF2A 2X4JA 3JZJA 3UATA 4FEDA 3S9NC 4YKKA 1B3FA 1H3ZA 2RF1A 1UQWA 4PJOA 2ZMBA 3HHGA 3UK4A 2LNVA 4RTWA 3M53A 1PB9A 3T9VA 1MMAA 1PHTA 2JJKA 3X28B 3RKWA 2EKHA 2R58A 4GBWA 2EPDA 3G71A 4M1VA 5FHOA 3SETA 4M78E 3LSLA 1YNZA 1PDAA 1G2BA 2BZXA 4RY1A 3U72A 4XKNA 3KEIA 4XU3A 1UGQB 1M8VA 2EVRA 3ZEHA 1H76A 3IOUA 1NUWA 1JQFA 3C32A 3UORA 3K00A 3NFCA 5F24A 4GRKA 3G3FA 2DVZA 4F14A 1JJ2A 4JUVA 2DSFA 2PMSA 1MNEA 1MMNA 3M0QA 1VQLA 1US4A 3ZKLA 4RTZA 1X27A 1VQLT 3CFXA 1NLPC 1YWPA 1FPKA 4OMOA 2L8DA 3H0IA 3HRTA 5IHNA 3OSRA 3RT8A 1GRIA 4PDDA 4KCCA 3S3MA 4PJMA 3CCEA 3PMIA 1RAFB 3PVLA 1ARKA 4LQ5A 3TTRA 4BB7A 1SYHA 3R7XA 1QP3A 3W9WA 5EQAA 2BJJX 2YPNA 3HFOA 4NOYA 4QFLA 1MV0B 1Z7ME 5DW8A 1GGGA 4OFOA 2Z0WA 4Z89A 1D09B 1NNTA 1NZ9A 1SW2A 2OCUA 1A7LA 1NH8A 4FORA 1RAEB 1URGA 3G6EA 1POTA 4GWOA 4GIZA 4DCYA 4IY6A 2BE9B 1B7HA 2FHYA 1EZOA 4LUBA 1QVGA 3G3GA 3QJYA 4E7JA 4D8DA 2RK2A 4RCCA 1EIFA 1DTGA 3L6HA 2JTEA 1LEVA 1RDXA 1CNQA 4U1OA 3GBQA 4J9GA 4RTYA 1TFDA 2P3NA 1ZQ1A 1LBWA 2I3VA 3HRSA 1B7TA 2Z8EA 1VQOT 5F7VA 2RQUA 3RPLB 4D6WA 5K2YA 4OMPA 1Y71A 2A5TB 1YCYA 4OMMA 2KY9A 1FPIA 3H9NA 4QSEA 1IIWA 3CPWS 4M78G 3B50A 4BDZA 4H1XA 4ND9A 5CBRA 2EKOA 3QDRB 2DS9A 3PVQA 1VIEA 2B3BA 3TQWA 2DK3A 5CKFA 2KQWA 1RKMA 5L9SA 1IEJA 3U1OA 4EDPA 2L5VA 3TCHA 1O63A 1Y3NA 2Y90A 2JMAA 4C92B 4MLQA 3C12A 1SF9A 4YKIA 1O75A 2RMOA 2O88A 1R9LA 4UA8A 3CCET 4AS4A 3ZKKA 1N76A 4ZZEA 4DIGA 4ESRA 4CC2A 1MXYA 3A1PA 2MWOA 2RM4A 3I56Q 2O51A 2K9GA 2R71A 2DEQA 4JRIA 1OPKA 4I40A 2C0IA 1M3BA 1MPBA 2DE0X 1I6AA 2R8TA 4YICA 4MAGA 2VVKA 8ATCB 2CZ7B 5IAIA 1BIBA 3VS4A 1K9MU 3IFAA 5GMKl 1J1NA 3L2RA 1Y20A 2EQJA 1A8FA 1W2BA 2XXUA 1YJ9T 4KFQA 4X8RA 2EJGA 1RAIB 2LRQA 3J81E 3OW2S 1SI1A 3I5SA 4MEVA 1LB8A 5A5LA 2C0OA 1S72T 1FBHA 5CK9A 2DLPA 2SEMA 1IXIA 5EC7A 4C8QE 4KQPA 4OANA 2LVMA 2QEXQ 3GXAA 5AA2B 4NHBA 2O4XA 2E4HA 5DYHA 2P0QA 3EGXA 2OBGA 4NTLA 3E79A 2AK5A 1YJ9Q 4HCKA 3KN7A 2L3RA 1GTKA 2UYFA 1YFNA 2H98A 1WDXA 2X4WA 3X20B 3RKYA 5IAYA 1PB7A 5AT1B 3K6WA 2CH4W 1GBRA 4RKUE 1QCNA 2Y84A 2FG0A 1BI2A 3MVWA 2DTHA 1MY0A 2DE2A 3MPKA 2X26A 2NWMA 1VQKQ 2GHBA 1FPBA 1OLCA 1P1OA 5IKBA 3LYIA 3PFSA 3QDFA 2P0SA 2HPGA 1JXOA 5HK3A 4KI0E 5A5XA 4HKEA 1PBQA 2VXEA 1B0LA 4RPNA 1S50A 2X35A 4G8HA 3LH0A 2XXIA 1IO6A 3E1SA 5J26A 4E7LA 1EH3A 3RMSA 5GAOl 1NJIU 1WHKA 3L2WA 1FBDA 1FSAA 2E10A 8AT1B 3GBBA 4U21A 4DEYA 1FBGA 3CCQT 4G2ZA 2Q8JA 3THIA 1VQMQ 2PVOB 1ZSZB 4E2FB 3MAMA 1DPEA 4M75G 4F31B 1TXQA 2D8HA 3WVEB 3FXRA 1NV4A 3IB1A 3QUFA 4OVRA 3B7DA 1FBPA 1FCKA 3T66A 4M7DG 3H4ZA 4F39A 4JWOA 3W9VA 4VUBA 1VQPT 4QQ6A 1UHFA 2EW3A 1YJNQ 1UUEA 1VQ6A 1YITA 2MKZA 3I9QA 2VV5A 2BJIA 1Q7YR 4R74A 1WIEA 1BCOA 3LSWA 1JVYA 1ABOA 4IO7A 1K76A 2F36A 1UHCA 3LR1A 3CBOA 3CMAA 3VUZA 3S3OA 3IL1B 3H8ZA 2HMAA 5IZ3A 4ZGJB 1FPDA 3PPNA 1YJNT 2LTOA 4AB5A 5AA4A 5GMKj 2G93A 1K73R 3FIRA 1N8RU 3M3KA 1XHYA 1B3QA 2GFEA 2F6GA 1FMWA 1BI1A 2XDDA 1SW5A 4F22A 3G4SQ 2JN0A 1M3CA 1VQ9A 2K2MA 4GWYA 3S9LC 1H8KA 4OMQA 3ZFJA 1SRMA 1S7YA 2VP1A 5T3JA 4V2SA 4J9FA 1M1KC 2XICA 2EYXA 2F3DA 4IIOA 4PJOF 4H45A 4QFOA 4F1YA 3CFZA 3M0UA 1NNPA 1NV0A 2DVCA 4M4GA 3A8MB 4CI0C 1MY4A 2RC9A 3SB2A 5I22A 1KQ1A 5HCKA 2QL3A 4XEQA 3RUXA 1WJRA 1YHQQ 2L89A 1WI7A 2LDMA 3TQ7P 2DYBA 2Y4XA 3DKMA 3M0RA 3FATA 5KYXA 1WJSA 2W0ZA 2Y7KA 3QIIA 1B0HA 1DOTA 1YP5A 1A8EA 2ABLA 1QP2A 4C5GA 2GQ1A 1B05A 3PMVA 5JTYB 4PFIA 2D0NA 3QYGB 2NUPA 2OTLA 3N26A 2KYMA 3CD6A 4XKQA 1YYZA 2OTJA 1LBYA 4MCOA 5FTHA 4RUGA 1ATGA 1FTOA 4HVVA 4N0AC 3KN3A 5H8FB 2QPQA 3B6TA 3CVGA 2KGTA 1WXTA 4K3FA 4OB2B 3B8BA 4HCZA 2PQWA 5I58B 1UB4A 4GBVA 1EYKA 3OO6A 1K9MC 4HT8A 4NF6B 1C6VX 5KCJA 3OYBA 3S4UA 5LJ3e 1UTBA 3TKDA 1S72Q 2CEYA 3CCUT 3NMZC 3MQ9A 3CC4A 1M1GA 2EAYA 1VIFA 3M55A 2HL5C 1KA1A 3GBAA 4BI4A 5A0LA 3O6HA 2JTFA 4GWZA 4OZ9A 3EGXB 2CP2A 5IXBA 4MHFA 2K3YA 1X2QA 3REAB 4JRKA 4O3BA 4TOZA 1ANFA 2DRKA 2M02A 2RCAA 3BKIB 3RR6A 4KR5A 4P0GA 4FYXB 1QKWA 1WGSA 4JXIA 5BUUA 3RESA 1G5VA 2KR0A 4IIMA 1YI2Q 5KZTA 4P11A 2XXTA 5GJWB 1JW1A 4LZ8A 4GL8A 3QKJA 1FX7A 2ZNUA 1VYTA 5GAN6 1VQOA 1HYOA 2FPFA 1GCQC 1EZ9A 1V29B 3TSZA 2VKNA 2I4BA 2Q89A 3K1MA 1NYFA 3I55T 3M3FA 3K6VA 3RY3A 3CCMQ 2PBWA 3CMEA 1VA7A 3LGFA 4DBFA 2A5TA 4PJLA 3HV1A 5LOMA 4LDYA 4J5YA 4OB1B 4IUPA 1QWEA 2CUDA 5L8DA 2CZ6B 5GAN7 2BKDN 2L3PA 5LJ5h 1LBBA 3PMXA 1QLYA 3AT1B 3DM0A 1IGUA 3TMGA 5DY9A 3IK6B 2RHYA 3FD3A 4FAJA 3ROJA 2GTJA 4C92F 1QCFA 5LL6S 5LJ5e 2RJDA 2I48A 3QSUA 1BCMA 1G8XA 4P0IA 3CCLQ 2YRCA 4IGRA 2QS3A 2XD2A 3CD6Q 4GWWA 1JNFA 3T9UA 1JU5C 1SEMA 2DA9A 3FXUA 2DIQA 4HCWA 5CKDA 2MF2A 4QSDA 4HE0A 5CMMA 4OVSA 3M58A 5I56A 3EN3A 4TLMB 2YRDA 3EG1A 1SQYA 4EXLA 4EPCA 1YHQA 1VDWA 1KHCA 2K5IA 1IHVA 2EWNA 2IPOB 2QASA 2AT1B 3GP8A 4C0DB 1N84A 2PFYA 3M9QA 1TOVA 1KC8C 4E6RA 2DMOA 1FQEA 3KSJA 2J6FA 3MZBA 1NJIC 1GVCA 1IB8A 3NTHA 1MV3A 4C8QC 3FV1A 1TS9A 1P1UA 2HQXA 3K0VA 3MHXA 1LCKA 3F70A 3EG9B 4M75A 3JCMb 3RPWA 2VXFA 4ESXA 3I35A 4BDQA 2VC8A 3MBPA 3CCVT 4IUUA 1NG2A 1A55A 1FQCA 2F35A 3KBGA 4MMLA 4F3GA 5GMKh 3OYDA 2K5LA 2OWTA 1MQIA 3CPWP 3MEWA 4O5VA 4OTEA 1SPIA 3EG0A 1NNFA 5I2NA 1MM6A 3N94A 2OX3A 5ICQA 3MVXA 3KGCA 4F2OA 1XC1A 1YJWQ 1B4HA 2GHAA 3LH5A 5TU0A 1B4ZA 2O1MA 2JNGA 1K0SA 3EG3A 5ELVA 3OBYA 4M75C 2V84A 4WEDA 3PGFA 1I1JA 3ONMA 4THIA 4B6MA 4C5EA 4PFWA 1Q9DA 4OETA 4A63B 4LDVA 2ALUA 5LJ3g 2YLNA 1GFCA 1QVGP 1YITQ 3C35A 4J9DA 4GX6A 1DCUA 1B3HA 2QAZA 4XTUA 2ZPHB 3JV9A 1QUJA 4L59A 4GLIA 5GAN4 3TSWA 2XXKA 3FVNA 4P8BA 2D1XA 1IUDA 3N6UA 4QXDA 2EQUA 2GBQA 2DM1A 1D0XA 2LX7A 3CCRT 2AL5A 2PU9B 5AA4B 2QI2A 1LFHA 1B3LA 3MC2A 3GF5A 4U4SA 2CZKA 2GCXA 3G4ST 3M59A 2G6FX 1WXUA 5CVIA 4RTTA 4EDUA 2F7BA 1VQ4T 4XKPA 3KFVA 1N27A 3FB9A 4M75F 4ISUA 2WEFA 4QFPA 5AA2A 2L3SA 1T0JA 2BZ8A 4R2BA 2FZKB 3H06B 4QVZA 4LN5A 3OYEA 3RNNA 2Q2AA 2PTKA 5FROA 5KYUA 3T0JA 4N8GA 5TP9A 2CH4A 4BI3A 1MRPA 4E7IA 4GQOA 1I0CA 2F5TX 3E9FA 5I2SA 3KC0A 3RTFB 4XTWA 1NV2A 1O7TA 4ZGEB 2K6DA 4EMKC 1LVKA 2XXWA 1PD1A 1U1TA 4LZ7A 1MPCA 2WACA 2V8JA 1OQKA 3OQ5A 5LJ5g 2ZXTA 4P9KA 5EQ7A 4HTGA 1PB8A 3GLBA 5H8SA 2PUKB 2ZNTA 4Z88A 5M9OA 3JCMV 2XHCA 4GBQA 4KD5A 3Q27A 1XT8A 5GANg 3UPUA 3OYNA 3WAFA 4JJBA 4TVRA 1G0IA 2P84A 1TU0B 2P2AA 3PUWE 4BUGA 1M30A 4WXJA 3PPPA 5IGAA 4C92A 3VYGA 4BY6C 3HPIA 1A0NB 3T93B 1LPLA 1K1ZA 4BDNA 4HW8A 3PTAA 4N4UA 3M0TA 1TFAA 4IO2A 1CB6A 1TT1A 2G3RA 5EYHA 3PU5A 4QSCA 2F1LA 1HSLA 1E7OA 2Y7IA 3U23A 3MSTA 4NWDA 2LX9A 1RLPC 4E0WA 3CXCA 2E41A 3PV0E 2YJPA 2LJ3A 1OPLA 1WVJA 4Q5TA 3MVYA 5F1QA 2YUPA 3JRZA 4PLLA 3V5AA 1VQOQ 3SESA 2FYKA 3BFUA 3FIFA 3C31A 4QHQA 1SSHA 1Y3QA 5IH2A 3MWBA 1QUKA 1NNKA 1T3LA 3CCSQ 3T96B 2X7PA 1QW0A 4NF8B 1MMGA 4X04A 2ZZDA 1M5BA 5DVJA 5HKCA 1D0ZA 5H8FA 2QDYB 1R6ZA 1UTHB 3SERA 4IKFA 2V3UA 2KT8A 2RQRA 5KH6A 5KYYA 4C8QF 1V1CA 2XU8A 2QA4Q 3VVFA 2HBWA 1T0HA 4M75E 3CCMT 4AB6A 3I55Q 4FT2A 2ZZXA 3GYYA 1D3BB 2LCCA 3VLUA 1M27C 3MZ9A 2Q9TA 1I5OB 4QW2A 5KYWB 4NF0A 1Y7XA 4F3PA 2LP5A 4IB2A 2R5MA 3HP9A 5JK4A 1GFDA 3OW2A 1VUBA 3ZSFA 5KCOA 5DEXB 3S9MC 1RAGB 4BY6B 2DEUA 4JLGA 1NM7A 3IOVA 3TAJA 4GXAA 2HQ0A 2JM8A 4G68A 1OULA 3QZ5B 4N81A 4WEPA 4OGEA 2WBDA 3MP8A 2D21A 4M77D 3P7IA 3CC7A 2I0NA 3VUBA 4ZEIA 3EGDB 4H5FA 3TCFA 4A53A 1KFZA 2RI2A 4MNPA 2ZPIB 1X6OA 1M5EA 2FVUA 3MEAA 2RC7A 1PEBA 1AWWA 4FBPA 2DJZA 1OU9A 2LMJA 4BDLA 2SRCA 1QUIA 2O2OA 4WTOB 4RA1A 4Z02A 3A8HB 1QVFP 4R72A 1OMPA 4LQ2A 2E6ZA 3IORA 1WHMA 2PT2A 4ELQA 4Q8RA 4RPOA 2YDLA 2QVRA 2QYZA 1Q1KA 3OEMA 1QVFS 2JM9A 5FU7C 2O9SA 4AFZC 3OEKA 4GWUA 4XFEA 1CE2A 3SEWA 1OVTA 4DZ1A 3M4YA 1SYIA 1MH4A 4RG2A 3G6EQ 4N8YA 3CMAQ 4LUEA 4NG7A 2THIA 1GXIE 3EHRA 3OSQA 2NUZA 1U5SA 1WHHA 3OYYA 4JJNK 1N3WA 5H8QA 3ASKA 3TYHA 3VVDA 1FPFA 2XXHA 1WDNA 4F3SA 4IO5A 1EFNA 3LW5E 2XK0A 4M77G 1II5A 1Y96A 4QBAA 1YJWT 1IXHA 2IVWA 2XXQA 3RNJA 4JRQA 2YSQA 3E9XA 3JB9F 3IR1A 3RN8A 4C92G 1EYIA 1BYMA 1P92A 2NOOA 1XOVA 2HL3A 2KVQG 2KRNA 2QDLA 4KUIA 4XQ3A 3FXQA 4OA4A 2RD1A 3TFLA 4F1UA 2E3IA 4PFPA 1ZUKA 3UA6A 1M1KR 3EQ1A 2I0CA 2A37A 1VFEA 4HA8A 3KOTA 3R6OA 4OB0B 4MFIA 4KUDK 2K7AA 1XTDA 3V8JA 3CCRA 1W6XA 4M7AE 1YAEA 1Z7NE 4OEUA 2F5KA 2RNAA 3CCST 5EYFA 2XKOC 4WKMA 1MGQA 1BP5A 1Q81U 1UG1A 2LT1A 3A8LB 1P99A 2R9JA 4C8QD 4K11A 3KBRA 3GPLA 1D9QA 1EU8A 2O69A 2KMTA 1PRLC 4P3LA 1IHWA 2HZKA 1W4SA 2XXYA 2O6AA 4PJNA 5FBPA 2LZ6B 4EMKB 1LAXA 3INZA 5GANd 4JWXA 2QA4A 1A54A 4ELOA 4NN3A 2V8IA 4DBHA 3CG1A 2XXPA 2H99A 1R77A 2KQZA 3L6GA 3O6GA 1Y96B 2JS0A 3UDCA 2YHTA 1KZ8A 1BI0A 2X9HA 1WODA 4PAKA 2PYYA 2RINA 1N9SA 1Z9QA 4BDRA 4L5GA 1RDZA 3CFLA 4GXSB 4GWSA 5GAMf 2DD5A 1OV3A 3QXMA 4ANJA 4C8QB 3UGWA 1OOTA 2V3QA 1QULA 5FU7B 4PGPA 2RJEA 2FBPA 1BIYA 4PBHA 5FRMA 1VQ7Q 3JCMe 1Y57A 4R2FA 4JZ3A 4QQDA 1TWYA 5FU6C 3V89B 4F2QA 3HO7A 4KXPA 2I2LA 1IGQA 2XA5A 3TCJA 1Q82R 1B3GA 1T0KA 3SEUA 1POY1 3CSBA 1BLFA 1VQPQ 1KC8U 3CCJT 2M16A 4J6XA 2ABHA 1N3XA 3KOSA 2DWJA 2EYQA 1YN8A 1TTHB 4P56A 1A40A 1GR2A 1TXFA 3CCRQ 1G3WA 2F2XA 4ECFA 4H5GA 4MF3A 1VE4A 1SW1A 2VWFA 2EYZA 3H3GA 4XTYA 3JAME 1YHQT 2RCBA 3MEVA 2V1RA 1ZLMA 3HN0A 4GFRA 1G83A 3U92A 2DXTA 3O9PA 2DXCA 3CG3A 3QWXX 2OK2A 2A36A 5FWCA 4OF1A 2W10A 3EG2A 1W2BS 4O8MA 4M7DF 3MUQA 1SG5A 3MPUB 2ANJA 1LB9A 2OTLT 2LJ0A 5CI5A 1IZ6A 3BDLA 3LV0A 3URGA 4JSDA 1RACB 4DA4A 2IG0A 1SKUB 3EFSA 1RDYA 3VXBA 2L3QA 4NF4B 1ZMGA 2E6NA 2LNHB 5CKEA 1IRXA 5ET5A 2FPDA 5GAOr 2EQIA 3JCMW 1D3BA 3A09A 4KH0B 4BE1A 3OSVA 1BIAA 1GBQA 5KYYB 4PBQA 1B2HA 2J06A 3MO8A 4JJDA 2NLUA 2P4RA 3R6UA 4OHNA 2D0QB 4NL2A 3CBPA 1W2BP 2BUDA 3TTMA 1LCFA 1MQJA 1X75C 5JEIA 3LC8A 4IO6A 4J7FA 4C0DC 2MYSA 1FRPA 4F18A 4ORZA 1BB9A 4JDFA 4N0AA 1B1XA 2KROA 4FSXA 4M7AF 3JCMh 3LGLA 2F7AA 4ZEBA 4A4HA 6AT1B 2Z8DA 4YB5A 2P0PA 1JQQA 3JB9J 3JCMX 4QVCA 3OENA 3VLVA 2LJ1A 3CC7T 1RAAB 2J05A 4XU2A 2PFZA 3OY9A 4O94A 2REGA 1Y4CA 2RQWA 1B5JA 2KXDA 4ZTJA 1PC3A 1KHIA 2KI7A 1LJOA 4GWXA 1HK9A 1NL5A 4LA9A 2RHXA 5CR2A 2KAFA 3TELA 4ATOA 3EGDA 1HSQA 1X43A 4RTXA 2QGGA 1I07A 1MG1A 2F7CA 3K02A 2RN8A 4XTXA 4ZGDB 3CCEQ 2DTIA 1MQHA 1VQPA 3CCSA 4RCBA 1B5HA 4M7AA 1MXZA 1I6QA 3VV5A 2CP7A 2ECZA 2RHUA 2V8KA 2GQVA 2LT4A 2PVDB 2OTJT 1OQHA 5CQYA 2DXYA 4X9TA 5C6SA 1YJWA 2REJA 4ZEKA 2CSIA 1PCXA 1UGPB 1UJYA 3CCQA 3DP8A 4CC3A 1OU8A 2GF7A 3JCMJ 3RTWB 3I5RA 2ATCB 5GAMj 3VU3C 1YIJQ 4GF8A 5DT6A 1JJ2P 3DLMA 4ME7A 4Y28E 3C4MA 4M7AC 5GANh 3VLWA 1PG5B 2DF6A 3OOAA 4DOWA 3NTKA 3MZ1A 4N07A 4C8QA 2GRVA 3SHWA 2CREA 2FO0A 2HSEB 4F7UA 1FTMA 1AD5A 1WA7A 4MX6A 2Y5LA 4HCCA 1FBFA 5KYWA 2Z23A 2UVHA 3GZGA 4OFLA 4J9CA 4E7ZA 1WHGA 3QO3A 2DWIA 3CI8A 1RLQC 4XU1A 4NMYA 4R9GA 5ET7A 5I2KB 3RPLA 4ZEFA 2DL5A 4YAHX 1K9YA 3UIFA 2KK4A 3QIMA 2D5WA 3FJ5A 3A8GB 2ENMA 3G3JA 5K2XA 4LNPA 4JS4A 2I0BA 3GIBA 2FPEA 1IXCA 4I1DA 3K2DA 4KH1B 1YJNA 4RK2A 4OMBA 1JW5A 1UIVA 4NL3A 2AKKA 3TPAA 2COWA 1OIBA 3T9XB 2VD3A 1TSFA 1ZHIA 3E2UA 1FMVA 1SRLA 3CRBA 3A3UA 2I3WA 2VOZA 2HCKA 1DSNA 3DP6A 4UACA 4BDYA 4PFRA 3ODBA 1K73U 5ET6A 1N0TA 1VQ6T 4YB6A 2NXOA 5CBSA 5L23A 1F1BB 1WHJA 2DVJA 3S2VA 2K5FA 2ZPEB 1RYOA 3HHFA 2ZYMA 5BWJA 3D7SB 4PQJA 4EMHA 3Q29A 2DJQA 5GAMg 1UIUA 2L0AA 3OYGA 2OLBA 3CCMA 2O31A 5AYFA 5FW9A 5GANj 4HE1A 2GNCA 4F04B 2CZ1B 4ZDMA 1VQ4A 1MS7A 5GAMe 4A4EA 1H3HA 4O3AA 4LXCA 3FBPA 3JB9G 2Y7WA 4OESA 2R57A 2FA7A 1IMCA 3GLXA 2A7YA 2P1SA 1UGRB 1M5CA 3ZS6A 3QG1A 4PK4A 4JS5A 3VS1A 2Q2CA 4XXUA 2RK1A 2E5QA 5EYGA 1EX4A 1QGXA 3D1RA 1M5FA 3K4UA 1SDXA 1PD0A 3WAEA 2H9BA 4MMKA 2VD2A 2ZPFB 2O7UA 2CKKA 4PFUA 2RHZA 3OYFA 3T1BA 1SSFA 3MJXA 1RAHB 1M2VB 3TDJA 3U94A 3KJ7A 2BIVA 4M7DD 2PX1A 2M0YA 4AFSC 1M1KU 2ZYOA 1UGSB 2DL4A 2HFBA 3PPQA 3HRUA 1DTZA 2CT3A 1QVGS 4MBPA 3OYMA 2JS2A 4EUOA 2OTLQ 4JWYA 3W15C 1J3TA 1OQGA 2KE9A 2JOYA 2RI5A 4CC4B 4KYDA 3LUZA 4FJPA 3OYCA 2CZHA 1JP4A 3EFOB 4BLAA 3JV3A 2Q8MA 4ZECA 2VYTA 1NPPA 4KHZE 3S9EA 1TUCA 1IZ1A 1Y9UA 2UVIA 2DD4A 1S72A 2CYZB 1YPNA 4FE8A 4ELPA 1NV5A 2CUBA 3ILUB 2KYBA 3VS3A 2X4XA 4KRTA 2ZGWA 3E4RA 3E78A 2JTMA 1WZOA 5GANe 2LCSA 3H0FA 2WYKA 4PCDA 1D4NA 4O7IA 2L2PA 2EBPA 2K3BA 1VQKA 3RQTA 3SKPA 1W70A 3O5ZA 3JCMQ 3M0SA 4BDOA 1QQJA 5GAOq 2ESNA 1LCTA 1ZJLA 2EGCA 2DVEA 2DE4A 4II1A 4O6JA 4LDXA 2OAUA 4ZZAA 3K6XA 3SEMA 4MJOA 3C33A 1MY2A 1A99A 5ET8A 1B34A 2QS4A 4OVQA 5EQ9A 3JCMd 4GLKA 2MWPA 3CC2A 4MDWA 3FV2A 2WKYA 4OYVA 2LCLA 1LBVA 4QQGA 2VASA 1VQ9Q 1N7WA 4POWA 3L2UA 2LQWA 3U93A 3PMTA 3G71T 4ZE8A 2CP0A 2DWAA 4IO3A 4QRZA 3CIJA 4IUTA 3KSXA 1B5IA 1M2OA 1FYNA 2K79A 3A8OB 1YI2A 1VQMT 3PD8A 2H3JA 5C0MA 5ISUA 1WJQA 3FGSA 3G7WA 3CXCP 3PTYA 5I5PA 1R9QA 2NYSA 4MZPA 2ROLA 1KD1U 1B51A 3C34A 3K01A 1ZX6A 3WVDB 1NMUA 1K9ZA 4EQBA 2HNIA 2UVGA 4Z0IA 2AL4A 4X9CA 1Q86C 4QFKA 1X6BA 2FZCB 1PNJA 4LN2A 1EYJA 2DKGA 2CP5A 3FRNA 3GNFB 1VQMA 1AOVA 2JJ9A 4ELYC 3O28A 2R6GE 4AT1B 3HSBA 3SWNA 3BBRA 2M1HA 1TUDA 2GFAA 1I5LA 1NI9A 2DERA 3KN8A 3S6WA 4IGTA 4XF5A 4OGCA 2H25A 3AXFA 1N9RA 1XJWB 4C1UA 3JB9I 4G77A 3EHQA 2P0KA 1M3AA 5I3SA 5GANf 3VKIA 1ZBJA 3RERA 2EJ9A 5TP9B 4M7DA 1H92A 1S9TA 1OX8A 1B9JA 3CCVA 5ECAA 3V8XB 3DLLA 1N6AA 3CC4T 1Q35A 4DEXA 1ZA2B 1NEBA 4XU0A 1VQ5A 1MXXA 4YTLA 2DYXA 3EHSA 1BI3A 5L9OA 1ABQA 3REBB 2DOJA 2QSXA 3LX7A 2B65A 1PWTA 1RI0A 4PNOA 3OYKA 3QUIA 1M9SA 2Y5KA 4OMLA 4R0KA 1BK2A 3IAZA 4OQOA 5DLQE 1I69A 3PUXE 4PGNA 4A4GA 2CS7A 2IEEA 3FJMA 1IMFA 2XIDA 4JBZA 5H8NB 3A5ZB 1IMEA 1HXDA 3VRYA 2VHAA 2R5AA 3HSTA 2I6EA 3H6UA 3SEXA 3M57A 2JZ2A 3TTNA 3TEPA 2DRMA 4C8QG 2HD0A 2UVJA 4DXBA 5LJ3j 3HPWA 5KE2A 1JVXA 1Y0MA 4J6WA 3LSXA 4R73A 1CKAA 4J9IA 4B9WA 4FECA 3OS0A 1YCSB 2ED1A 3OS2A 5J39A 1VQNA 2DBMA 3EAEA 1K0XA 4KGVB 4EIKA 2DZ9A 2D6FA 2JW4A 2OWZA 2O68A 1AH5A 4GL0A 2KBTA 4U1ZA 4EF1A 4IURA 1FQAA 4IY5A 1AIVA 5GAOp 2QS2A 3JCMg 1B3EA 1WX6A 4NWCA 4ONYA 3TVTA 3I55A 1Q82U 3L1AA 1BTJA 2I49A 2AZVA 3NGPA 2LAOA 4MDXA 1Y07A 2QK0A 2I58A 4A4KA 2RF0A 1XQHA 4QFNA 1SD3A 4NF5A 4Q0CA 1QCOA 3OBWA 4F16A 4F3BA 3UA7A 4E7HA 1ZSZC 1JW4A 1B32A 1BBZA 3EH1A 3VS6A 4L17A 3BIGA 4N17A 4NF5B 3O66A 2EQKA 3EH2A 4F17A 4R75A 3MVZA 1E6HA 4R55A 3MPLA 1QKBA 5CIUA 1Y1ZA 2DXBA 2YWWA 1DBZA 3V7RA 2V25A 3TTKA 1OLAA 1O64A 4LD6A 3IO6A 2F3BA 5I2KA 1C1AA 2A28A 1FBCA 4DOVA 2XWOA 2ZYNA 3HHTB 2D3IA 2EYWA 4A4FA 5LJ5f 1VQ6Q 2WSEE 4OP0A 5LJ5d 1D9VA 3U65A 1U06A 2JUFA 5I11A 4JDSA 4G68C 4HE2A 2ESWA 1AWXA 3PT9A 5HK0A 2EQMA 5I2MA 2QEXT 4BACA 3EF7A 1LOJA 4P47A 4OENA 1LNXA 1Y4TA 5CAIA 1ZIUA 3OYLA 2XDBA 1XVXA 4OMNA 4KT0E 1D1AA 1YCJA 5GMKm 2DIGA 3M0PA 3ME9A 3A98A 4J9HA 3NTIA 1H44A 2P3VA 1Q95G 3N6TA 1UE9A 1VQ7A 3T9HB 2B86A 3FVKA 2OX7A 1B46A 1Z9ZA 2A0FB 3QSLA 2J6KA 5FWBA 3VS7A 2FEIA 2DXRA 1IREB 1YZ0A 2COYA 2FHDA 1INPA 1AT1B 1UTIA 1M1FA 1LBZA 2VGQA 3E19A 3G7ZA 5ITPA 3JCMc 2XWIA 2Q88A 5FU6B 2O7IA 5ITOA 3QXEB 1QVFA 1M5Q1 4M7AB 1LAHE 1M8MA 3M5AA 3D4GA 1VQNQ 5FTIA 1SVXB 2XXVA 4PE3A 4YMAA 4OMFB 1RUWA 4XTVA 2EGAA 3CCQQ 3Q25A 1X01A 5A5XB 2V4CA 4G8NA 4OXVA 2QTVA 3SDFA 2FZGB 4QKUA 2GFUA 2MOXA 4C92C 2OZZA 3UWNA 4M7AD 2X7QA 5GAMd 3FLGA 3OYAA 3V83A 1VQ9T 4M77C 2HKQB 2HZYA 1SHFA 5IT9E 4N6PA 4XTCQ 4E7SA 3JCMP 4DXCA 3C0CA 2QVUA 2H3EB 3M54A 1MQDA 3A29A 1UTBB 3VFJA 2BZYA 4J9EA 2E12A 3SZPA 2DO3A 2AIRB 3KG2A 4POXA 2E5KA 3IQLA 2XI9A 4FSSA 4FW1A 4N13A 2D8JA 2QXFA 4N4GA 3H6TA 4X1BA 3TCGA 2CP3A 4XK8E 4C0GA 1VQ7T 2A5SA 4N6KA 2RC8A 2NUTA 4PE5B 4LATA 1YJ9A 4TLLB 3UA8A 5M2VA 1KC8R 3IX1A 4H65A 1FPEA 1P1WA 2XWKA 5I7IA 3CSGA 3O6IA 3QMFA 4RNSA 2PT1A 3OELA 1MDP1 3IFCA 1PRMC 2QEXA 1ELJA 2WX9A 2F34A 2A3LA 2VGMA 2KDSA 1I8FA 4ZN3A 2E1SA 3PMWA 1YWOA 4PJJA 4H67A 2YUNA 3G3HA 5AA3A 2ONSA 2OJ2A 1D9YA 3VJPA 4DBQA 1NV1A 1B7ZA 2DYIA 3SFMA 1URSA 3EHTA 2HBPA 2XMFA 1GV8A 3F11A 1FQBA 3L2ZA 4M77B 4IUVA 1UECA 5LJ3d 2DX1A 5LDZA 3CC4Q 3Q1JA 5GAN3 5D6XA 4JLIA 3MEUA 4KYEA 1SW4A 2HDAA 2RB6A 2ZAEA 5GAN5 4R6YA 3OMCA 3X26B 2O84X 5IHIA 4RTVA 3CEYA 2FYIA 5L8RE 3BY7A 1QVSA 2AHJB 3JB9H 4ZN1A 2GH9A 3I5OA 2EGEA 4L6V5 3C4SA 4GD5A 2V26A 1R1NA 5KCHA 2KNBB 5KYXB 2FIXA 5TPAB 4EMGA 2H8HA 3JB9D 3IJXB 2ONKE 5L9MA 1FQDA 3E9GA 5CKBA 1YXIA 4LONB 3DB4A 3FVOA 2OI3A 1VYUA 1O9SA 4EQ7A 2ZPGB 3OYHA 2E65A 2MIOA 4C5IA 4X1VA 2HCAA 2CMOA 2COZA 5J1DA 3U8QA 1YI2T 2DL7A 3OSSC 4M78D 3TQLA 4N4IA 1OX9A 3G6ET 2XXXA 3PNWC 4GY5A 4AQ4A 2CSQA 1JRIA 1VQNT 4HXVA 3QK6A 1MY3A 4Q5WA 4M7DB 1Q86R 4PJOB 4A54A 1XS5A 2AZSA 3DP4A 3K1NA 1EZPA 3CC2T 3HTRA 1KD1R 1DMBA 2HXWA 2V93A 1G3TA 4C0ZA 4FEBA 4OWDA 1M2VA 2E1HA 2FVZA 4FU6A 1R0BG 3SWNB 1D0YA 2XD3A 1Q82C 3IO4A 2HAVA 1UGVA 2HXRA 1SBPA 3JCMf 2D9TA 3IB0A 1KJWA 1JXMA 2PVGB 4O3CA 3VS5A 1SPKA 1PKSA 1OEBA 3EHUA 3M3LA 2RO0A 3NPFA 3LLRA 5AE4A 4N15A 1K73C 2CP6A 5I58A 2ZNSA 3Q26A 1S1NA 1AOJA 4NX1A 1Q81C 5GMKe 1RYXA 2DTOA 4X9DA 4KULA 2RI3A 1VSOA 2YLCA 4MMPA 4R6HA 4RK9A 1E6GA 1IMAA 2QTXA 3OO8A 2RQTA 5CMBA 1N04A 3EPEA 4RTUA 4Y91A 1FTKA 5J3BA 2M8CA 4NE4A 4H0WA 4JSOA 1M90U 3PUYE 4ELRA 3K1PA 5GJVB 1AL3A 1KQ2A 1EZZB 3IJOB 4X34A 2YUOA 4QF9A 4PAFA 1FJ6A 3MP1A 3OB9A 2OJTA 3X24B 1H43A 1URDA 2X3WD 4FYVB 3BE3A 2DP8A 1U1SA 1UFFA 2C0TA 2YT6A 4OVAA 2Y7RA 3PD9A 5CM6A 1NFTA 1FJ9A 1OVBA 5I84A 4R9FA 3O2AA 2PZ1A 2VB6A 3TZAA 4JB7A 2X51A 3OYJA 5H8QB 1NV6A 2DL3A 3BIHA 3V8KA 2QA4T 2XWVA 4FYYB 2XX9A 5CC2A 1TG0A 1P1NA 3OYIA 4KGZB 2F97A 4PC9A 1VQ4Q 3OO9A 4ESWA 1OZ3A 3CBMA 4KPTA 2OAWA 5IZ1A 5J16A 3KJTA 3FZVA 3VVEA 4I8CA 2QFLA 2RA2A 5KE3A 4DE8A 1NYGA 2KR3A 1AZEA 2AKLA 1B40A 4NAPA 2MCNA 3QHSA 3TTLA 1WQWA 1PBPA 4C0RA 1P1QA 3TEEA 5ESYA 2KT1A 4E47A 3PUZE
chains in the Genus database with same CATH topology
3LWHA 1IITA 1N8RC 1JETA 2L5QA 5I57A 2PVUA 5CO7A 2C06A 3FEOA 3E13X 5EG2A 1F9BA 2CZLA 3RKXA 3PPRA 5LJ3f 4LP2B 5CRYA 3K6UA 3TODA 4LD9K 5GAMh 1KD1C 1SI0A 4LDUA 2EJFA 5DM7R 2FB7A 5D6YA 4HCYA 3H6ZA 1VQKT 3V7SA 1KWHA 3P8BB 1VR5A 2VGNA 3UT1A 1XOCA 4RMOA 3OD7A 1YIJT 1LAFE 4YKPA 1HSJA 1FW0A 4XTZA 3P8DA 4J8OA 4YB7A 3OXNA 1LAGE 3B6WA 4H8JA 4F1VA 2QMWA 2O1LA 1YBYA 4FT4A 4XAXB 5GAN8 4X1DA 1AMFA 3CR9A 3E3KA 2H4IA 5DVIA 3VV0A 3QZ9B 1YTVA 3CCLA 1VQ8A 3LUYA 2MAMA 3HCQA 4M75B 5ICTA 1WPYA 3M8UA 1Q7YU 1OYXA 3OS5A 3ER0A 3QBYA 4KCDA 1NH7A 2Y4YA 5GAOn 3LSFB 2XX7A 3WXMB 2M9UA 2H5YA 3PUVE 4LDWA 1WQ7A 1LGBC 1B1HA 3KUFA 2Y7PA 3DLNA 5LJ5j 4M78C 3HFNA 1I6BA 1MM7A 1YIJA 1Y1MA 2KLFA 4R6KA 4PJOE 1ZLQA 4E0XA 1XVYA 4BE2A 1JJ2S 2UXAA 4BE0A 1B52A 3G3IA 3J80E 2F5XA 2MI6A 1Q86U 5FLXE 1H641 2DXUA 4IO4A 2DE3A 1MHNA 1NE8A 3L42A 3BFTA 2XD0A 4M7DE 3JYRA 3G4SA 3META 2I4CA 2RJCA 5CMCA 3FVGA 3J7AF 3C95A 5CMKA 4PETA 3C36A 3I56T 2RKMA 4U4XA 3ZBDA 2AIXA 1MH3A 2E64A 4Q30B 5KDTB 3QPHA 2KSSA 1I4K1 1JEVA 1MXUA 3ECRA 1ZU0A 4LVQA 2CZ0B 4F7UF 4RXLA 4C1TA 4F29A 3CXCS 2XDPA 4DLDA 4OB3B 3DELB 2WSCE 1AHJB 5I2NB 2RJFA 3CPWA 2F8DA 3IB2A 2FL7A 3HKSA 4RJZA 2HAUA 4J83A 4DDDA 5HPQA 5HBCA 4F7UB 1M5DA 3H6WA 1KQSS 1ZBMA 5H8HA 3CPFA 3AHUA 4U23A 3RUMA 4HT9A 4BD3A 2NWJA 3SEYA 1PSEA 2XX8A 4YKJA 2DPPB 3V8LA 1KQSA 3R26A 2WSFE 1G3YA 1B58A 2DWHA 2NVUB 5I56B 3QAXA 2B8AA 3MW0A 3PGGA 3QYTA 2HEUA 2JVVA 3VE1B 4M7AG 2Z22A 4P5NA 4OFJA 2LQ8A 1K8AU 4NEDA 5B7DA 4WF2A 4MLVA 4C5HA 3MP6A 1MQGA 1H45A 3H6VA 2RH2A 4PFYA 2P4TA 1IQ7A 2E70A 1KG1A 4MH5A 3CMET 4C0FA 3LWIA 3IOTA 4PJOG 1RL2A 5TPAA 4FIBA 3FC3A 2XHDA 4XKRA 3HL8A 3SDZA 1JB0E 2AYSA 3ILTB 3TU4K 2Z8FA 3C9HA 1ZBXA 4M78A 3JSCA 2EFIA 5DLOA 4G8MA 4RG8A 1UEBA 4ELZC 1LFIA 4RYAA 2HAXA 1NPRA 3VDFA 4OERA 4DCXA 1LFGA 2ONRA 2DZCA 1B6HA 4ZEDA 4CRIA 4ZTFA 4KYSA 2ZCFB 4UC4A 3OO7A 1FTJA 1QJMA 3OA6A 4YMBA 3L2QA 3H03A 5CQXA 4NF4A 3H7MA 4BI8B 2QRYA 4FATA 3O97A 5KCJB 4EXKA 1FQFA 2K57A 3DB3A 5I59B 3PIOA 2QQBA 4OEVA 4PJOD 3X25B 4FM4B 4HCBA 2QMXA 1NKXA 3MCAB 3GOXA 4BDMA 3VYHB 2M0OA 3CD6T 3FUZA 1L5TA 3OMBA 4J6YA 2XG8D 5EHSA 2X4YA 1ZKBA 5EHMA 3FJPA 1JEUA 5D6WA 1R8OB 3VXCA 4EMKA 3KXTA 1DPPA 3L2VA 3CCJA 2F6PA 3V7CA 3D4CA 3PIPA 2F78A 1UTHA 4H8IA 3QJ6A 4M77F 2O4XB 5CKHA 3BDUA 3FASA 4NS5A 5AA2D 1K8AC 3EFRA 4M78B 4M78F 4MZTA 1FWZA 1WNLA 1QW1A 1JBMA 2K3XA 4ZE9A 1IXGA 3SEVA 1US5A 2EIFA 5JTYA 2NUVA 4F7UE 2QJEA 3UP9A 3B6QA 3FDRA 2IA4A 3M56A 2DAQA 4M7DC 2OWSA 1MY1A 1B34B 1OI1A 2W7YA 2YLBA 4FIMA 1M4ZA 3CCUA 4HS7A 2F69A 3O8VA 4DXUA 3SWNC 4DQ2A 3I56A 3Q28A 1YITT 2LQKA 2YRVA 4C92D 4N4HA 4E7KA 3SD4A 4PJOC 3LBSA 4QVDA 5DEXA 4PLIA 2QQRA 5A0GA 4H6DA 1OZ2A 3T9NA 3S3NA 3RT6B 4B9XA 4YZZA 5H8NA 1Y3PA 1PSFA 1G3SA 3N5BB 1B7UA 2K2VA 1BKAA 1ZTYA 2HZLA 5HY6A 1H3DA 3G3KA 4Z7EA 2XXRA 4M75D 5GAN2 2QQSA 4F19A 2FNCA 5KDTA 4PKCC 4MZMA 2K4YA 5IN1A 5FRNA 4M77A 2B3FA 2ZYKA 1VFDA 5GAOm 2O01E 5AA1A 5I57B 4GVOA 2QQ9A 2DQVA 2CGHA 1DJ7B 3TUSA 4U2RA 4FL6A 3C94A 1LBCA 3I3VA 5CCAA 4X48A 5B70A 3PPOA 2ZPBB 5LJ3h 1USYE 4F7UG 1MPDA 2G29A 1Q7YC 4NF6A 5FHMA 1MXVA 4M77E 4IUQA 4I62A 4I9DA 1VQ8T 3CCLT 1D3KA 1M90C 3QUJA 4XIGQ 4C92E 1BKBA 1I81A 4OVJA 4PP0A 3M4GA 3OS1A 4NF8A 5H8HB 3CMAT 1N7XA 4G68B 3RIRA 3TREA 3I6VA 5FHNA 1FTLA 5A2QE 4R56A 1QVPA 4PFTA 4TQUQ 3P8HA 3N5LA 3MJNA 2QQAA 5DVFA 2VUBA 3FJGA 4U22A 2PUOB 1LLSA 4PL6A 2HQEA 4YU0A 1LSTA 5A0DA 4KBMB 5I21A 1HSEA 1VQ5T 5GMKi 1QKAA 3QYHB 3A3CA 3IOWA 3RMQA 1USYH 2UYEA 5DTBA 1MDQA 3T22A 3RGYA 4EQ9A 2V3TA 3UN6A 1XNIA 4JRPA 3BFMA 5I59A 2QS1A 2RHIA 3KFMA 2LC4A 3O29A 2MMPA 3OMGA 1FXXA 1U8RA 1MXWA 1TH7A 3GNGA 5HM4B 4GOTA 3USDA 4J7IA 3RLFE 4ZS9A 2E0SA 3KZGA 3BW1A 4G4PA 4LZ5A 4EF2A 2X4JA 3JZJA 4FEDA 3S9NC 4YKKA 1B3FA 1H3ZA 2RF1A 1UQWA 4PJOA 2ZMBA 3HHGA 3UK4A 2LNVA 3M53A 1PB9A 3T9VA 3X28B 3RKWA 2R58A 3G71A 4M1VA 5FHOA 3SETA 4M78E 3LSLA 1PDAA 4RY1A 3U72A 4XKNA 3KEIA 4XU3A 1UGQB 1M8VA 3ZEHA 1H76A 3IOUA 1JQFA 3C32A 3UORA 3K00A 3NFCA 4GRKA 3G3FA 2DVZA 1JJ2A 4JUVA 2DSFA 2PMSA 1VQLA 1US4A 3ZKLA 1VQLT 3CFXA 2L8DA 3HRTA 3OSRA 3RT8A 4KCCA 3S3MA 3CCEA 3PMIA 4LQ5A 3TTRA 4BB7A 1SYHA 3R7XA 1QP3A 3W9WA 2BJJX 2YPNA 3HFOA 4NOYA 4QFLA 1Z7ME 1GGGA 4OFOA 1NNTA 1NZ9A 1SW2A 2OCUA 1A7LA 1NH8A 4FORA 1URGA 3G6EA 1POTA 4GWOA 4GIZA 4DCYA 4IY6A 1EZOA 1B7HA 4LUBA 1QVGA 3G3GA 3QJYA 4E7JA 2RK2A 4RCCA 1EIFA 1DTGA 3L6HA 4U1OA 1TFDA 1ZQ1A 2I3VA 3HRSA 2Z8EA 1VQOT 5F7VA 4D6WA 5K2YA 1Y71A 2A5TB 1YCYA 2KY9A 4QSEA 1IIWA 3CPWS 4M78G 4H1XA 4BDZA 4ND9A 5CBRA 2EKOA 3QDRB 2DS9A 1VIEA 2B3BA 3TQWA 2DK3A 5CKFA 2KQWA 1RKMA 5L9SA 1IEJA 3U1OA 4EDPA 3TCHA 1Y3NA 2Y90A 4MLQA 4C92B 3C12A 4YKIA 1O75A 4UA8A 1R9LA 3CCET 3ZKKA 1N76A 4ZZEA 4DIGA 1MXYA 2MWOA 2RM4A 2O51A 2R71A 2DEQA 4JRIA 1MPBA 1I6AA 4YICA 2CZ7B 5IAIA 1BIBA 1K9MU 5GMKl 1J1NA 3L2RA 1Y20A 2EQJA 1A8FA 1W2BA 2XXUA 1YJ9T 4KFQA 2EJGA 2LRQA 3J81E 3OW2S 1SI1A 1LB8A 1S72T 5CK9A 1IXIA 4C8QE 4KQPA 2LVMA 3GXAA 5AA2B 2O4XA 5DYHA 2P0QA 2OBGA 4NTLA 3KN7A 2L3RA 1GTKA 2UYFA 2H98A 2X4WA 3X20B 3RKYA 5IAYA 1PB7A 3K6WA 4RKUE 2Y84A 1BI2A 3MVWA 2DTHA 1MY0A 2DE2A 3MPKA 2X26A 2GHBA 1OLCA 1P1OA 5IKBA 3LYIA 3PFSA 2P0SA 5HK3A 4KI0E 5A5XA 4HKEA 1PBQA 2VXEA 1B0LA 4RPNA 1S50A 2X35A 4G8HA 3LH0A 2XXIA 3E1SA 5J26A 1O63A 4E7LA 1EH3A 3RMSA 5GAOl 1NJIU 3L2WA 4U21A 3GBBA 2E10A 2Q8JA 4G2ZA 3CCQT 3THIA 2PVOB 3MAMA 1DPEA 4M75G 4F31B 3WVEB 3FXRA 3IB1A 3QUFA 3B7DA 1FCKA 3T66A 4M7DG 3H4ZA 4F39A 4JWOA 3W9VA 4VUBA 1VQPT 4QQ6A 1VQ6A 1YITA 2VV5A 4R74A 3LSWA 1JVYA 4IO7A 2F36A 3LR1A 3CBOA 3CMAA 3VUZA 3S3OA 3IL1B 3H8ZA 4ZGJB 3PPNA 1YJNT 2LTOA 4AB5A 5AA4A 5GMKj 2G93A 3FIRA 1N8RU 3M3KA 1XHYA 2GFEA 2F6GA 1BI1A 2XDDA 1SW5A 4F22A 2JN0A 1VQ9A 3S9LC 3ZFJA 1S7YA 2VP1A 4V2SA 1M1KC 2XICA 4PJOF 4QFOA 4F1YA 3CFZA 1NNPA 2DVCA 4M4GA 3A8MB 4CI0C 1MY4A 2RC9A 3SB2A 1KQ1A 2QL3A 3RUXA 1WJRA 2L89A 2LDMA 2Y4XA 3DKMA 3FATA 1WJSA 2Y7KA 3QIIA 1B0HA 1DOTA 1A8EA 1QP2A 4C5GA 1B05A 3PMVA 5JTYB 2OTLA 3QYGB 3N26A 3CD6A 4XKQA 2OTJA 5FTHA 1ATGA 1FTOA 4N0AC 3KN3A 5H8FB 2QPQA 3B6TA 3CVGA 4K3FA 4OB2B 4HCZA 2PQWA 5I58B 1UB4A 3OO6A 1K9MC 4HT8A 4NF6B 5KCJA 3OYBA 3S4UA 5LJ3e 1UTBA 3TKDA 3CCUT 3MQ9A 3CC4A 1M1GA 2EAYA 1VIFA 3M55A 3GBAA 4BI4A 5A0LA 3O6HA 2JTFA 4OZ9A 2K3YA 4JRKA 4O3BA 4TOZA 1ANFA 2RCAA 3BKIB 4KR5A 4P0GA 1WGSA 4JXIA 5BUUA 3RESA 1G5VA 5KZTA 4P11A 2XXTA 1JW1A 4LZ8A 4GL8A 3QKJA 1FX7A 2ZNUA 5GAN6 1VQOA 3FJ7A 2I4BA 1EZ9A 1V29B 2Q89A 3K1MA 3I55T 3RY3A 3M3FA 3K6VA 2PBWA 3CMEA 3LGFA 2A5TA 3HV1A 5LOMA 4LDYA 4J5YA 4OB1B 4IUPA 5L8DA 2CZ6B 5GAN7 2BKDN 5LJ5h 1LBBA 3PMXA 3DM0A 3TMGA 5DY9A 3IK6B 2RHYA 3FD3A 4FAJA 4C92F 5LL6S 5LJ5e 2RJDA 2I48A 3QSUA 4P0IA 4IGRA 2QS3A 2XD2A 1JNFA 3T9UA 3FXUA 2DIQA 4HCWA 5CKDA 2MF2A 4QSDA 5CMMA 3M58A 5I56A 3EN3A 4TLMB 1SQYA 4EXLA 4EPCA 1YHQA 1KHCA 2K5IA 2EWNA 3GP8A 1N84A 4C0DB 3M9QA 1KC8C 1FQEA 3KSJA 3MZBA 1NJIC 1GVCA 3NTHA 4C8QC 3FV1A 1P1UA 2HQXA 3K0VA 3MHXA 4M75A 3F70A 3JCMb 3RPWA 4ESXA 2VXFA 4BDQA 2VC8A 3MBPA 3CCVT 4IUUA 1A55A 1FQCA 2F35A 3KBGA 4MMLA 4F3GA 5GMKh 3OYDA 2K5LA 2OWTA 1MQIA 3MEWA 4O5VA 4OTEA 1NNFA 5I2NA 1MM6A 3N94A 5ICQA 3MVXA 3KGCA 4F2OA 1XC1A 1B4HA 2GHAA 5TU0A 1B4ZA 2O1MA 2JNGA 5ELVA 3OBYA 4M75C 2V84A 4WEDA 3PGFA 3ONMA 4THIA 4C5EA 4PFWA 4OETA 4LDVA 2ALUA 5LJ3g 2YLNA 3C35A 1B3HA 4XTUA 2ZPHB 3JV9A 1QUJA 4L59A 4GLIA 5GAN4 3FVNA 1IUDA 3N6UA 2EQUA 3CCRT 2AL5A 2PU9B 5AA4B 2QI2A 1LFHA 1B3LA 3MC2A 3GF5A 4U4SA 3G4ST 2GCXA 3M59A 5CVIA 4EDUA 2F7BA 1VQ4T 4XKPA 1N27A 3FB9A 4M75F 4ISUA 4QFPA 5AA2A 4R2BA 3H06B 4QVZA 3OYEA 3RNNA 2Q2AA 5FROA 5TP9A 4BI3A 1MRPA 4E7IA 4GQOA 2F5TX 3E9FA 5I2SA 3RTFB 4XTWA 1O7TA 4ZGEB 4EMKC 2XXWA 1U1TA 4LZ7A 1MPCA 2WACA 2V8JA 3OQ5A 5LJ5g 2ZXTA 4HTGA 1PB8A 3GLBA 5H8SA 2PUKB 2ZNTA 5M9OA 3JCMV 2XHCA 4KD5A 3Q27A 1XT8A 5GANg 3UPUA 3OYNA 3WAFA 4TVRA 3PUWE 2P2AA 4BUGA 4WXJA 3PPPA 4C92A 3VYGA 4BY6C 3HPIA 3T93B 4BDNA 4HW8A 3PTAA 1TFAA 4IO2A 1CB6A 1TT1A 2G3RA 3PU5A 4QSCA 1HSLA 2Y7IA 4NWDA 2LX9A 4E0WA 3CXCA 2E41A 3PV0E 2YJPA 1WVJA 4Q5TA 3MVYA 5F1QA 3JRZA 4PLLA 3V5AA 3SESA 2FYKA 3BFUA 3FIFA 3C31A 4QHQA 1Y3QA 3MWBA 1QUKA 1NNKA 3T96B 2X7PA