3MP1A

Complex structure of sgf29 and trimethylated h3k4
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
517
structure length
509
Chain Sequence
b'MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 136
structure length 509
sequence length 517
ec nomenclature
pdb deposition date 2010-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp1A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp1A01
3U72A 3PUVE 4RK9A 2F7AA 3CSGA 1BIYA 1B46A 1YTVA 2OJTA 5TP9B 3V89B 4XXUA 5D6YA 3O66A 4OYVA 5I84A 5I2NA 4G68A 3VLWA 5KE2A 1MY1A 2XD2A 1XS5A 2DVZA 2FNCA 1JETA 2HFBA 4RYAA 4DDDA 1LB8A 4F2QA 3RTFB 3JV9A 1N04A 3PNWC 3TQLA 2LCCA 3D4GA 2R6GE 4IO5A 2LTOA 3KG2A 2QSXA 2XX8A 3H6VA 4QW2A 1WJQA 1HSLA 4N13A 2RJEA 1MQJA 3Q28A 3L2UA 3OMBA 4XKNA 1CE2A 3MJNA 2RHXA 2H98A 5TP9A 3PFSA 1IXHA 2G3RA 4OWDA 4YKJA 1XHYA 2Z8FA 1SI0A 4I62A 1URDA 1P1NA 4ZZAA 2V84A 2Z23A 5AA3A 3MP8A 3V8XB 1OLAA 2M1HA 5J39A 1FQAA 1QVSA 2NOOA 1B58A 3SD4A 4NTLA 5HM4B 2O1LA 4B9WA 4E7HA 1GTKA 4F3GA 5CRYA 2X7QA 1NNFA 3IOUA 3VFJA 3QSLA 3FJGA 1MXZA 5DVIA 4I1DA 5L9OA 3DLMA 4C1UA 2HZLA 3KOSA 4NF6B 3QXMA 1FQCA 4GF8A 2O51A 4IO2A 4U23A 4FATA 3PD9A 4OESA 5FRNA 3G3JA 3I5OA 3RY3A 4RXLA 4YKKA 2DWAA 4JWYA 3Q27A 2XXQA 1UQWA 1EZOA 5ITOA 3OYHA 3KN3A 1MXWA 3T93B 1QKAA 2F35A 1DOTA 3IOTA 3OYKA 1B6HA 2RJDA 2PBWA 2F6GA 1LFIA 3PUWE 5ITPA 2ANJA 3DP6A 4GY5A 3O29A 2VP1A 3ZSFA 2B65A 1IEJA 1WVJA 2R5MA 4QFNA 4IGTA 2RC8A 4K3FA 3VVDA 3S2VA 3U92A 3QUFA 3RT8A 4U1OA 3K6UA 3EPEA 3KJTA 4NF6A 3UK4A 1A54A 2PT1A 3FVGA 4U1ZA 3IJXB 2DIGA 5KE3A 4X1DA 1JW5A 4F2OA 4EQBA 5FHOA 3OXNA 1B0HA 2DS9A 4WXJA 5AA1A 3S4UA 4FE8A 2AL5A 1FQFA 4DXCA 2DQVA 4WEPA 3EF7A 4QHQA 5EYFA 2QMWA 1LSTA 5L8DA 4ELRA 1FW0A 2FYIA 3S9NC 3BFTA 5HPQA 4Q30B 1DSNA 1BTJA 2Q88A 3S9MC 1MRPA 1I6AA 4EDUA 4RY1A 3MEVA 1MM6A 3THIA 3ASKA 4ZEDA 2XX9A 2HAUA 1DMBA 5H8QA 2VGQA 1NNTA 4PFUA 4R9FA 1VE4A 1IIWA 4F1YA 3FJ7A 3A3CA 2ZNUA 1B9JA 1M5BA 2QS4A 3WAEA 5DEXB 5FRMA 1MH3A 2F5XA 3LUYA 3PUZE 4KYEA 3P8DA 3LBSA 4ZEBA 2BUDA 5IKBA 1D9VA 2GF7A 2X26A 2DAQA 3Q29A 3B6TA 4ZE9A 3MVZA 4GL8A 3SEYA 2B3BA 4XKQA 2ZYNA 2DSFA 1IXIA 1FTJA 1O7TA 2F8DA 4MBPA 4TLMB 3TPAA 3B6QA 1GR2A 1II5A 1SI1A 1USYH 3L6HA 4LZ8A 1OYXA 4XTCQ 1MDP1 1B3EA 4YZZA 5DEXA 1EZPA 2XDPA 2H99A 2BIVA 3PPQA 2RJFA 2FHDA 1H44A 1OMPA 2VD2A 1VR5A 3OD7A 3ME9A 3MC2A 2YLNA 3UGWA 1B7UA 2K3XA 3FLGA 4OXVA 1IXCA 3UP9A 5H8SA 2M8CA 2QS3A 1NNPA 4FORA 1VFDA 3H6UA 2R9JA 4H8IA 4DCXA 1JEUA 5FHNA 3L6GA 1B51A 1TXFA 4OENA 3SDFA 3NTHA 1JW4A 2PX1A 3FIRA 2I0CA 2O4XB 3TTRA 3FD3A 3MZ1A 4H0WA 4NWCA 4RG2A 3RNNA 5DT6A 3NTIA 4M1VA 4NS5A 3VLUA 3FVOA 4NE4A 1MXXA 4LQ5A 3T22A 1Y9UA 1UIUA 3T66A 2GHAA 2O84X 1MDQA 4R6KA 2G93A 3OYFA 2DVCA 3U94A 4F1VA 1PBPA 1I69A 4KYSA 4LONB 3MVYA 4QF9A 3OO7A 4GRKA 4U21A 4PL6A 4CRIA 3K1NA 2THIA 2XX7A 2Q2CA 1FTLA 5L9SA 3TCHA 1MHNA 3OYAA 3PU5A 1SW4A 4P0GA 4QFOA 2OK2A 1IZ1A 2HCAA 2REJA 3N94A 1P99A 2RC7A 2I49A 4ZDMA 2PMSA 4NF4A 5I2KB 3GLBA 5I59B 4C0RA 1SYIA 4KCDA 4OETA 3I6VA 3ECRA 3OMCA 3OYEA 3BKIB 2HAVA 4N6PA 4BDZA 3N6TA 5EHMA 2R58A 4A4HA 1P1UA 1M5DA 2QS2A 4DZ1A 4BE1A 1PB8A 1FTOA 1N3WA 3KSXA 3HHFA 1PB9A 4JSOA 2F7BA 4DE8A 3S9EA 1A40A 3KBRA 3SKPA 1Z7NE 1DPEA 1QJMA 4X9TA 5JK4A 3PMIA 3KN7A 3KGCA 3PPOA 4HCWA 1UTHB 2I4CA 3HCQA 3OYCA 1WJRA 3Q1JA 3KOTA 4KCCA 1PC3A 1IXGA 2EQKA 3QYTA 2UVHA 4JBZA 1SD3A 5I59A 3T9VA 3SEWA 1RYXA 3KFMA 3GBBA 3O6GA 3FEOA 2DE4A 3MEWA 3ILUB 1GV8A 5FTHA 4Z7EA 2GHBA 5I2NB 2WACA 1OZ3A 3C4MA 1VSOA 1JVYA 3IB1A 3HV1A 2P0KA 2EQMA 1B5IA 4R72A 3OS2A 3HSTA 4LATA 3VVFA 3IOVA 1UTHA 1KWHA 4F1UA 3OYIA 3B7DA 1SSFA 4FECA 1QUJA 4IUQA 2UXAA 4E7IA 1JW1A 2I4BA 3RT6B 1VFEA 2RCBA 1YCJA 2LAOA 1A8FA 4ZS9A 2CZLA 4LZ5A 2E6NA 2AL4A 3M8UA 4KQPA 2NLUA 1H76A 2O7UA 3OELA 1LGBC 3L2RA 1GGGA 1LCTA 2ABHA 4FJPA 1POY1 3FGSA 4E0WA 1NFTA 3C4SA 3R6UA 1BLFA 1EU8A 4C5EA 3BFUA 3MWBA 1LAGE 3LR1A 1QUKA 4G8MA 2NXOA 4H8JA 5M9OA 4JWXA 3SETA 1IITA 1Y3QA 4QRZA 2IG0A 5KDTB 2X4YA 3TDJA 5KZTA 4C5HA 3CR9A 2PVUA 3PGFA 3OO9A 5IAYA 3FUZA 3MP6A 1L5TA 1SDXA 2EQJA 3T96B 1ANFA 4OVJA 2F5KA 1GVCA 4PLLA 4ELOA 4IUVA 4P11A 5TPAA 2X35A 1LAXA 1S50A 3OOAA 1FQEA 3QIMA 2QL3A 2RJCA 5KCHA 1JVXA 3DLNA 1Y1ZA 3PMXA 4WEDA 4X48A 2QS1A 5KDTA 4R2FA 5TU0A 2UVIA 4ZEKA 1N0TA 3C32A 3G3FA 2ESNA 4JWOA 3DB3A 2DXRA 1DTGA 1SQYA 3GZGA 2DE2A 4LQ2A 5KCJB 3QUJA 3MVWA 2Z22A 4LP2B 4YKIA 3SEXA 4E7JA 4R2BA 1OI1A 1Y3NA 5D6XA 5IN1A 2WKYA 4AB6A 2UVGA 4UACA 4N4IA 1LBCA 1XVXA 1B32A 4OFJA 2NVUB 4Q0CA 4RJZA 1DPPA 4IUTA 3PMTA 2LVMA 4LUBA 3OS0A 1SBPA 3EAEA 4ECFA 5M2VA 4A4GA 3GOXA 3M9QA 1FQBA 3TCFA 1TFDA 2B8AA 3TFLA 5KCJA 3LSXA 3H6TA 5BWJA 1B5HA 5H8QB 3OYBA 3H3GA 2D9TA 2GFAA 1BKAA 1O63A 4KD5A 4R75A 1P1WA 1FTMA 3LSWA 3ONMA 3V5AA 2DWIA 1H45A 3MEAA 3OSRA 4EXLA 2UYFA 4OEUA 4F3PA 1N27A 2O6AA 3JYRA 3PUXE 1N84A 2ONKE 1G5VA 1MQIA 3RN8A 3EHUA 1WGSA 3OA6A 1AIVA 4LD6A 3JZJA 2ZYOA 3L2QA 2H4IA 5KH6A 1H3ZA 4QSDA 4H5GA 1M5CA 1B5JA 3QK6A 4G2ZA 3RTWB 4N4HA 4FU6A 2XXVA 2IA4A 2QPQA 3RUMA 4G8HA 3HN0A 2XXIA 2GH9A 1NKXA 4GD5A 4OEVA 3E9FA 4GXSB 2RF1A 3S9LC 1ZJLA 2NWJA 3O6IA 4R6HA 5DYHA 4F39A 3W9WA 3IR1A 1Y4TA 3H06B 3L2VA 1N76A 3TTNA 4N4GA 3UA8A 3KSJA 3TTMA 2RI3A 3IK6B 3RLFE 3LH0A 2AYSA 4KR5A 3P7IA 2RHUA 5F7VA 2DXYA 3BDLA 1WODA 4H67A 2UVJA 1WDNA 5I57B 1T0KA 3O2AA 4KHZE 4E0XA 4F22A 2BKDN 2F7CA 1XOCA 1D3KA 4MLQA 4POXA 3FXUA 1MH4A 3MPLA 5A5XA 1RI0A 3H4ZA 4EQ9A 4IB2A 2MWPA 1P1QA 1B0LA 2BJJX 3C35A 5F1QA 4PETA 3QAXA 3BBRA 3DP4A 3OQ5A 5CMKA 4G77A 1OIBA 1Z7ME 2GFEA 1B4ZA 3HPIA 3MBPA 3MO8A 2G29A 1ZTYA 2KLFA 5L9MA 3QIIA 4YB5A 2I3VA 4P0IA 2RINA 3CFZA 3H7MA 1Y3PA 1Q35A 5I57A 4DXUA 3MQ9A 1B3HA 1IUDA 4ZTJA 1Y1MA 4QFLA 3LGFA 3FXQA 3CFXA 2RKMA 3PPRA 3MAMA 3TEPA 5C0MA 4IKFA 3VV5A 3HHGA 1FTKA 3OYMA 3LSLA 4H5FA 4U22A 2V25A 1NH8A 4YMBA 5I56B 4NF4B 1B3FA 1B3LA 4Q5WA 4DCYA 1XVYA 3OO6A 2GRVA 2RC9A 4A4EA 4L17A 3SEUA 4O3CA 2D21A 2E5QA 3NTKA 3IL1B 1RKMA 3O8VA 2Q89A 4X34A 2HQEA 4E7KA 1D4NA 5D6WA 4WKMA 3IJOB 3G3HA 5CC2A 2OWTA 1B4HA 4F29A 2JZ2A 2A5TB 4B9XA 4QSEA 3OEMA 5I56A 3L2WA 4F19A 3S6WA 4Z0IA 4QQDA 5AA2B 2A5SA 4BE2A 3MEUA 1EH3A 3IO6A 2PQWA 2I6EA 2Y7WA 1XC1A 3S3OA 1MY0A 3CEYA 2O1MA 2E0SA 1S9TA 3Q26A 1YPNA 1LFHA 5H8FB 3DELB 3K02A 2VOZA 1I6BA 3FZVA 2DIQA 3UIFA 2DOJA 1XNIA 1FCKA 1SVXB 2OLBA 2ZYMA 3B6WA 2L3RA 4IO3A 1F9BA 1QULA 1S7YA 3FV2A 2DWHA 4GWOA 3PMWA 1Y20A 3O6HA 4G8NA 4LVQA 2A5TA 4GQOA 3UT1A 5LOMA 4OZ9A 1PB7A 1QUIA 1UTBA 3K00A 4ESWA 3FJMA 1B40A 2I48A 5AA2A 4IO4A 3P8HA 4OFLA 2Y7KA 5ICTA 1LAHE 2QJEA 2RHIA 3OY9A 1TT1A 3TYHA 3PMVA 5H8FA 4ELPA 2Y7PA 4HS7A 3E4RA 3S3NA 4I9DA 2OZZA 2P1SA 4QQ6A 3MZ9A 3HO7A 3IB2A 5EHSA 4L59A 1B3GA 5FROA 5CBSA 4QQGA 5AE4A 2H9BA 4ESXA 4G68C 1US5A 3UORA 1QKBA 4ONYA 4MFIA 4PFTA 5H8HB 4TQUQ 2YPNA 4PLIA 2ZNSA 2NUVA 4RNSA 4C5IA 1MM7A 3IOWA 3QBYA 2UYEA 1MXVA 3FVKA 4QFKA 1NL5A 2HXWA 4IUUA 3CSBA 1NNKA 5CMCA 3C9HA 4ZEFA 3ZKKA 2I0BA 2IEEA 2REGA 3K6VA 3MW0A 3VLVA 5TPAB 3K6XA 1URGA 3ZEHA 3META 2ZYKA 2Y84A 2VHAA 2RO0A 1PEBA 3H6WA 1QW0A 1BP5A 4GL0A 3M3KA 2R57A 3FC3A 2R5AA 3ZKLA 4IUPA 2XXXA 1MG1A 4BDMA 1N7XA 5H8HA 5J1DA 3IO4A 1ZIUA 3EHTA 3K01A 2RI2A 3LC8A 3PV0E 4HTGA 3H03A 5I58B 4PQJA 5ELVA 3OYLA 2PYYA 3LGLA 1JQFA 1AH5A 3V83A 2ZXTA 3CG3A 4RPNA 5KCOA 2ZNTA 1UIVA 3IB0A 2X7PA 4R9GA 1ZBMA 1CB6A 2O68A 4F31B 4YICA 5BUUA 1ELJA 4KYDA 1M5FA 5DTBA 4FEBA 3E3KA 4F3BA 2HEUA 1MPDA 1AMFA 3C34A 2Z8EA 1I6QA 1NMUA 1MQGA 4MH5A 4FL6A 3UWNA 2HQ0A 1IQ7A 4BLAA 3DM0A 1M5EA 2Q8JA 2MWOA 3G7WA 1MS7A 3VXCA 4IGRA 4TOZA 4OTEA 3FASA 2Q9TA 2H5YA 5I58A 3EN3A 3OENA 4DIGA 1OLCA 4H65A 4II1A 2XD3A 4OMBA 1OQHA 2V3TA 4H6DA 2H25A 1O64A 3FVNA 3OYDA 4EDPA 4EUOA 4JDFA 3VVEA 4UC4A 5CMMA 4BDYA 4U4SA 3OMGA 4XKPA 4NWDA 4PFWA 3K0VA 2V93A 5CIUA 1HSJA 2DE3A 2VYTA 3K2DA 1URSA 2F6PA 1AL3A 1LBBA 4LA9A 3C33A 1SW2A 4KI0E 3LYIA 3H8ZA 4BDQA 4YB7A 2ALUA 5K2XA 1R9QA 2RHZA 1EZ9A 3TMGA 3PPNA 4M4GA 4QVZA 2Y7IA 3L42A 3KUFA 3CIJA 4KPTA 3IORA 5JEIA 3TCGA 3TELA 3ZS6A 3IAZA 3W15C 3TAJA 2F97A 2M0OA 2W7YA 1R1NA 4IY5A 5FHMA 2XXPA 3G3IA 4BE0A 4BDNA 4TLLB 1A55A 4Z02A 3DB4A 3RQTA 4EXKA 3U93A 2LRQA 3LX7A 2CMOA 3ODBA 3S3MA 3LSFB 1B1XA 3VDFA 1JEVA 4RK2A 4NF5B 1LAFE 3OSQA 4AQ4A 2XHDA 1B7ZA 3K6WA 4FAJA 3N26A 2YJPA 3AXFA 3K1PA 1WJSA 4ZE8A 3KN8A 3O28A 2AIXA 3TZAA 3CI8A 4QFPA 1PBQA 4BDRA 1H43A 3OO8A 2F34A 2ONSA 2HZKA 3M3LA 3USDA 3TKDA 4GFRA 3OYNA 1LFGA 5H8NB 1A8EA 3KEIA 4FIMA 4GIZA 5CBRA 2L8DA 5A5XB 1Y4CA 4OVAA 2EKOA 1FQDA 4JXIA 3PPPA 4HCYA 4F18A 3O97A 4XKRA 1OVBA 4IY6A 4YMAA 4ELQA 2D5WA 3T9UA 2OBGA 3PUYE 1NH7A 4NF5A 3R26A 4GXAA 1B2HA 5CMBA 4R6YA 3H6ZA 1A7LA 1MPBA 1ZLQA 2F36A 3CRBA 2YRVA 4QSCA 3N5LA 3SERA 1OZ2A 3A3UA 5FTIA 1MQHA 2K3YA 1MY3A 2GFUA 2QRYA 1D9YA 3DP8A 5H8NA 3OYJA 2XK0A 3MZBA 4JSDA 4RPOA 4Q5TA 5ISUA 4ZTFA 1MY4A 4KFQA 3KZGA 5B7DA 2QMXA 4O3AA 1AOVA 2CKKA 1MPCA 3OB9A 3SEVA 4N07A 4DXBA 1OQGA 2O69A 2FA7A 5K2YA 4NMYA 4THIA 4NF8B 4YAHX 3SESA 1SYHA 1SW5A 3T9HB 3C31A 1POTA 2QQSA 3A09A 4IO7A 3VXBA 1LCFA 2X4XA 5AA4B 3FATA 1ZKBA 1XT8A 5AA2D 4G4PA 2P2AA 4MLVA 3MVXA 3WAFA 1PDAA 4YKPA 4YU0A 2ONRA 3QKJA 4MF3A 4DLDA 4OQOA 1B1HA 2I58A 4BDOA 2XXUA 4HW8A 5DVFA 3LLRA 2LDMA 1LLSA 3TODA 4FEDA 4Q8RA 3FDRA 4ND9A 4YB6A 3D4CA 3RPWA 5JTYB 2DYXA 3TQWA 4O3BA 3C36A 2QQRA 4NF8A 1ZMGA 2Z8DA 4BD3A 2V3QA 2XXYA 2OCUA 4C5GA 4ZEIA 1R6ZA 2RI5A 4R73A 3VE1B 3OYGA 2HQXA 1SW1A 1KHCA 1R9LA 5AA4A 3TUSA 4I8CA 3MPKA 3CVGA 4X1BA 3G3GA 2Y7RA 4OFOA 3RGYA 3FV1A 2I3WA 5B70A 3ILTB 3E9GA 5CI5A 5IAIA 1HSEA 4XIGQ 4UA8A 2VD3A 1H3DA 3T9XB 3F70A 5JTYA 1OVTA 4GLIA 3N6UA 1LB9A 3M3FA 5C6SA 1USYE 5DVJA 3Q25A 2EQUA 1UTBB 3MUQA 3EQ1A 2O4XA 1US4A 4EF1A 2RHYA 3OEKA 4EQ7A 3KJ7A 1DTZA 4GVOA 4EF2A 3E13X 2X4WA 1MY2A 4HCZA 4ISUA 3G3KA 1JNFA 2RCAA 2B3FA 4BDLA 3K1MA 2L89A 3OS1A 4PP0A 1TFAA 5CM6A 3CFLA 1MQDA 1Q1KA 1ZU0A 2O7IA 5HBCA 4H1XA 2M16A 2DWJA 1YAEA 5ICQA 1MXYA 4JB7A 3IX1A 2Q2AA 4U4XA 1N7WA 1RYOA 1ATGA 4F3SA 4R74A 2DP8A 3U1OA 3QJ6A 4PFYA 1MXUA 3PD8A 4C1TA 2OWSA 2R71A 3F11A 4IURA 1P1OA 3E9XA 1J1NA 2F78A 2ZMBA 3UN6A 4PE5B 3R7XA 5I2KA 3EHSA 4AB5A 3U8QA 4U2RA 5J26A 4OERA 3O9PA 4E7LA 4RA1A 2JTFA 2D3IA 4G68B 4ZZEA 2XXWA 4GOTA 3GXAA 2V3UA 2XXHA 1A99A 2XXRA 3CG1A 1B05A 1B7HA 3GBAA 3TTLA 4POWA 4BACA 2EFIA 3I3VA 4LZ7A 2XXTA 2P0SA 4A4FA 4OHNA 2E1SA 1TWYA 1N3XA 1B52A 3W9VA 3TTKA 4IO6A 4NEDA 3FXRA 4ZECA 3K4UA 2PT2A 3MP1A
chains in the Genus database with same CATH superfamily
4M77C 3U72A 3JCMh 1JXOA 3PVLA 3PUVE 2ZZXA 4MEVA 4RK9A 1AZGB 2F7AA 3CSGA 1QKXA 1RADB 3CCVT 3BIGA 3VYHB 2CP6A 1B46A 1BIYA 4J7FA 1YTVA 2OJTA 3OSVA 5TP9B 5J16A 1BBZA 3M4YA 3V89B 1OU8A 1XJWB 5D6YA 3O66A 3G6EA 1JJ2S 4XXUA 4XEQA 4OYVA 2DL5A 1LOJA 1MMAA 5I84A 1M1GA 3C94A 5I2NA 4G68A 3VLWA 1ZSGA 5GAOm 5KE2A 1MY1A 2XD2A 2XA5A 4N6DA 2DL8A 1XS5A 1Q82C 2DVZA 2FNCA 1HD3A 1JETA 1LBVA 2HFBA 1UB4A 4RYAA 4DDDA 1LB8A 1SHFA 2M0YA 4F2QA 3RTFB 4NL3A 1QWFA 2EJ9A 3JV9A 1VYTA 1N04A 3PNWC 3OW2P 3TQLA 2LCCA 5DW8A 1K0SA 1EYIA 3DKMA 1Y96A 3D4GA 1YJNA 4M77E 2R6GE 4IO5A 3HPWA 2LTOA 3CMEA 3KG2A 1QMCA 1VQ5T 1IMAA 2QSXA 2XX8A 3H6VA 3GYYA 1LVKA 2CZ0B 1QQJA 1SRLA 4QW2A 3FJ5A 1WJQA 3GP8A 2QK0A 2VPOA 3RPLA 4KT0E 1HSLA 1MMDA 4HCKA 4N13A 1WPYA 1UHFA 2RJEA 2KGTA 1MQJA 2PVGB 1HXDA 3Q28A 3L2UA 2LJ3A 1FX7A 1M1KR 3JRZA 2RB6A 3PTYA 1YN8A 3OMBA 4XKNA 3IFCA 1GCPA 2VT5A 3LUZA 1CE2A 1T0HA 4C0DC 1LJOA 3MJNA 2RHXA 2H98A 5TP9A 2YDLA 1UGVA 4LUEA 3PFSA 1IXHA 2G3RA 4OWDA 1ZSZB 4YKJA 2DXTA 1XHYA 1SI0A 2E5KA 2Z8FA 4I62A 4X8RA 2E70A 4FYWB 2CREA 1URDA 2BZ8A 1P1NA 4DBFA 5IXBA 5KYNA 4ZZAA 2V84A 2CZ6B 2Z23A 4KUDK 1GBRA 3HFUA 3MP8A 3V8XB 5AA3A 2AZSA 1OLAA 2M1HA 5J39A 4J9HA 4PFPA 1WI7A 1FQAA 3CC7A 1QVSA 2NOOA 4PJLA 1LCKA 3SD4A 3CCEA 1B58A 1YIJT 4NTLA 5HM4B 5IXFA 2M02A 4C8QF 5IT9E 2O1LA 4B9WA 1KIKA 4E7HA 1GTKA 4F3GA 2LMJA 2GQ1A 2X7QA 5CRYA 1NNFA 3IOUA 3VFJA 1D09B 3QSLA 2E64A 3KXTA 3OSSC 3EGDB 5LJ3e 1MXZA 3FJGA 4JVDA 2ROTA 5DVIA 4I1DA 1MV3A 2D8JA 5L9OA 2JJ9A 4LDVA 4NL2A 3DLMA 4FW2A 3CXCS 4C1UA 5GAN5 1BK4A 2HZLA 2JOYA 3CCLQ 3E79A 3KOSA 3V7CA 4BY6C 1W2BP 2LQKA 4ZGJB 1Q81C 2QA4A 4AT1B 2OTJQ 3A1PA 2FVZA 2EYXA 4NF6B 3QXMA 1FQCA 4RMOA 2BTTA 4GF8A 2O51A 4IO2A 4U23A 5L23A 4FATA 3PD9A 3TCJA 5FRNA 4OESA 3G3JA 4G61A 3I5OA 3RY3A 4D8KA 4RXLA 4YKKA 4C8QE 2ZZVA 2HDAA 1QVFA 2DWAA 2EYQA 4JWYA 1M2OA 2JT4A 8ATCB 3Q27A 2XXQA 1VQ6Q 1FTAA 4DBHA 1FPFA 1UQWA 2DXCA 1EZOA 5ITOA 3QYHB 1R0BG 3OYHA 1D1AA 3GBQA 3KN3A 1U5SA 2XI9A 1MXWA 3T93B 4C8QA 1YJ9A 1QKAA 2A3LA 2F35A 1DOTA 3IOTA 3OYKA 1B6HA 4LDXA 2V1RA 2RJDA 2PBWA 2F6GA 1LFIA 3PUWE 5ITPA 2ANJA 3DP6A 2WYKA 2YRDA 2YUOA 4C0ZA 4GY5A 4GWSA 2VWFA 2SRCA 3O29A 1ZQ1A 5FU7C 2VP1A 3ZSFA 2B65A 1IEJA 1UEBA 1VIFA 2R5MA 2PVOB 1WVJA 4QFNA 2KR0A 4IGTA 3EGDA 2P3VA 2H8HA 3A8GB 1QVGP 1N8RC 2RC8A 4K3FA 3VVDA 3S2VA 5I2MA 3U92A 3QUFA 3CCQQ 3G71Q 3RT8A 4U1OA 1C6VX 3K6UA 3EPEA 3KJTA 4NF6A 3SWNA 2QGGA 3UK4A 1X6GA 4ZN3A 1A54A 1R77A 3CC2T 2PT1A 4HXJA 2PUKB 3FVGA 1LEVA 3CBPA 4U1ZA 4JLGA 4XTXA 4F7UF 3IJXB 2F2WA 4LE9A 3JAME 1B3QA 4DI4B 1WXBA 1PM3A 2CGHA 2DIGA 5KE3A 4X1DA 1JW5A 4F2OA 1OEBA 2G6FX 3VS2A 1Q81U 5FHOA 4EQBA 3OXNA 1B0HA 2DS9A 2ZPHB 1IRXA 1X69A 1RUWA 2I0NA 4WXJA 5AA1A 1K73U 3S4UA 4FE8A 4M75C 2AL5A 5GAOq 2JN0A 3H41A 1FQFA 4DXCA 1S72A 2COYA 1U1TA 2DQVA 4E6RA 4WEPA 2ZPFB 3ZFJA 2F3BA 2XG8D 3EF7A 4QHQA 5EYFA 2DK3A 3QWYA 1RLQC 2PU9B 3G6EQ 2QMWA 4JVIA 1G3WA 1U3OA 1LSTA 4F7UE 5L8DA 4ELRA 2CT4A 1FW0A 2FYIA 1VIEA 3S9NC 1NM7A 3BFTA 2LQNA 5HPQA 4Q30B 2GQVA 4PTKA 4JDSA 4C8QG 3X25B 1DSNA 1BTJA 1D1BA 2Q88A 3L2ZA 3UDCA 3S9MC 1MRPA 1I6AA 1VQ8A 4A53A 4EDUA 1VQ4T 4GBVA 4GX6A 2KQZA 4F7UA 4RY1A 1FMVA 1BCOA 3MEVA 1VQPA 1MM6A 3E2UA 4J9FA 1N8RU 3U23A 4M75E 2CZ1B 3ASKA 3THIA 3CMEQ 4ZEDA 2E1HA 4GLMA 2E10A 2XX9A 2HAUA 1VA7A 2BE9B 4PDHA 4ANJA 1DMBA 1PHTA 4FM4B 5H8QA 2VGQA 1NNTA 1X27A 2YXYA 4PFUA 4OVQA 4R9FA 4GX4A 1VE4A 1KG1A 1IIWA 1QP3A 4F1YA 2QI2A 3FJ7A 3A3CA 2MMPA 2ZNUA 1B9JA 1M5BA 2QS4A 3CHGA 1C0MA 5EQAA 1UG1A 2CZHA 4AFSC 4BUGA 5GAMj 1Q7YR 3E1SA 3WAEA 1W70A 5DEXB 5FRMA 1MH3A 2F5XA 1YI2A 1AT1B 3LUYA 3PUZE 5GAN2 2DTIA 4KYEA 1MNDA 3P8DA 3LBSA 4ZEBA 2BUDA 5IKBA 3CCMT 3JCMc 4AFQC 1UGRB 1D9VA 2VGMA 2GF7A 2X26A 2DAQA 2FO0A 3Q29A 4J6XA 2P4RA 3B6TA 4I3YA 2FRYA 4ZE9A 1O75A 2FPFA 3MVZA 4N0AC 5GAN6 1C1AA 3H0IA 2ZPEB 3X28B 5CK9A 4GL8A 3SEYA 4MZPA 2B3BA 4XKQA 5ECAA 1RDYA 3CXCP 2ZYNA 2EQIA 2WBBA 3VUZA 3CCEQ 1H641 3MJXA 2DSFA 1IXIA 3QMFA 4JJBA 1FTJA 3G4ST 1NUYA 1AZEA 1O7TA 5CKBA 2F8DA 4MBPA 4TLMB 3TPAA 3B6QA 1JBMA 1GR2A 1II5A 2DTOA 1SI1A 5J3BA 1RAIB 1USYH 3L6HA 4LZ8A 3RDVA 2VASA 4C92E 2K57A 1OYXA 4XTCQ 2QA4Q 1FRPA 1PKSA 2KRSA 1UTIA 4F7UG 2LQWA 4JPBW 1VQ7A 4XU2A 2DLPA 1MDP1 1B3EA 3I56T 3CMAA 1H3HA 4YZZA 5DEXA 1EZPA 2XDPA 2H99A 2Y5KA 2Y4XA 3REBB 3EG1A 4C92A 3QG1A 1S1NA 3EG2A 2BIVA 4J6WA 1PSFA 3REAB 3PPQA 5KYXB 3E19A 5CKHA 5D7UA 2RJFA 2FHDA 1H44A 1OMPA 2VD2A 3M0QA 1VR5A 1SSHA 1YNZA 3OD7A 2YHTA 3ME9A 4O5VA 2BZYA 3MC2A 2YLNA 1YJ9Q 4NAPA 3UGWA 1B7UA 1SKUB 2EKHA 2K3XA 3FLGA 1K8AR 4OXVA 3IQLA 2WSCE 4PCDA 1IXCA 3UP9A 5H8SA 2J05A 3T1BA 2KYMA 2M8CA 2QS3A 3OW2A 5EYGA 1NNPA 4FORA 3VJPA 2EYZA 4KXPA 1BCMA 3R6NA 1VFDA 2ROLA 3H6UA 2R9JA 2HZYA 3CBMA 4H8IA 2MKZA 2JM8A 2AKKA 4DCXA 1OX9A 1JEUA 1OULA 1K9MR 2XMFA 4M7AD 5FHNA 3CCJA 2CP2A 3HRSA 3D1RA 3L6GA 1B51A 3RBBB 2B4MA 3PIOA 4M7DB 1TXFA 1JP4A 4OENA 1Q95G 3M53A 4HA8A 1WQWA 1ZBJA 3HTRA 3NHNA 3SDFA 1YJWT 3NTHA 2LP5A 4M7DF 1JW4A 2PX1A 5GANh 1NLPC 1V29B 2L5QA 5KYXA 2I0CA 3FIRA 2O4XB 2NYSA 2FB7A 3TTRA 3FD3A 2X3WD 3CCRA 3MZ1A 4H0WA 4NWCA 4RG2A 3RNNA 3CD6T 1OQKA 4O6JA 5FU6C 5DT6A 3NTIA 4HT9A 1VQMT 4M1VA 2OWZA 3J80E 1ZX6A 1TUCA 4NS5A 1D9QA 3VLUA 2L3QA 1O9SA 1ZUKA 3FVOA 1MXXA 4NE4A 4C92G 1YXIA 4LQ5A 3T22A 1N9RA 3LW5E 1UIUA 1Y9UA 3T66A 2OJ2A 2VB6A 3INZA 3UF4A 2XWVA 4OVRA 5CCAA 4JS4A 5CQYA 1TXQA 2F3DA 2GHAA 2O84X 1MDQA 4R6KA 2EBPA 2G93A 2O9VA 3OYFA 4PJNA 3LWIA 2DVCA 3U94A 3JCMQ 4F1VA 1PBPA 2KBTA 3SFMA 1VQ8Q 1K76A 1W2BA 1I69A 4KYSA 4LONB 3MVYA 4QF9A 1NV1A 3OO7A 1VQPQ 4GRKA 4HE0A 4U21A 1NI9A 4PL6A 3KC1A 4CRIA 4M7DA 3K1NA 5L8RE 2DF6A 2THIA 2K6DA 4PFOA 2XX7A 2Q2CA 1NZ9A 3RERA 3CCUT 4OGEA 1FTLA 4OA4A 1RAGB 5L9SA 3TCHA 1MHNA 3EG3A 3OYAA 4LNPA 3PU5A 4J9GA 1SW4A 5I22A 4K11A 2HSEB 2EWNA 4O8MA 4NF0A 4P0GA 4KH0B 4QFOA 2OK2A 1IZ1A 3I55A 3VRYA 1KC8R 2HCAA 1MMNA 2JNGA 2REJA 4PGNA 3N94A 2LX7A 3R6OA 1YI2Q 3CC4T 1P99A 2DFUA 2RC7A 2I49A 4ZDMA 2PMSA 1KD1R 4NF4A 5I2KB 3GLBA 5IHNA 3A8HB 3TSZA 5I59B 4HXVA 4C0RA 1SYIA 1U06A 4KCDA 4OETA 3I6VA 2A37A 3ECRA 3OMCA 3OYEA 3BKIB 4GLKA 1FPLA 2QGFB 4O7IA 1AWBA 2HAVA 1GXIE 5LDZA 5CQXA 1ZUYA 1QVGA 4GWWA 4N6PA 4LUDA 1R8OB 4BDZA 2AKLA 2QASA 1NYFA 4HVUA 3N6TA 2EYYA 5EHMA 2R58A 4QXDA 4A4HA 1P1UA 1M5DA 2LT4A 2B86A 4LDYA 2QS2A 2HNIA 3FXBA 3U65A 1AHJB 4DZ1A 4BE1A 1H92A 3CPWA 1PB8A 1FTOA 1N3WA 3KSXA 4M7AC 2IPOB 3HHFA 3CCLA 1PB9A 4JSOA 2F7BA 3JCMJ 1FBPA 1Y7XA 3AT1B 4DE8A 4NN3A 2WX9A 3S9EA 1A40A 3KBRA 4QVDA 3SKPA 2DBMA 4PJOC 1Q86C 1DPEA 1QJMA 1Z7NE 4MNCA 4X9TA 1JJ2A 5JK4A 3PMIA 1VQ7Q 3IFAA 3KN7A 3KGCA 4LD9K 2XWIA 3PPOA 1NV0A 4HCWA 1UTHB 2CEYA 2I4CA 5GAMf 3HCQA 2KQWA 3OYCA 4M7DG 4PAFA 1LBXA 1WJRA 3Q1JA 3KOTA 4KCCA 2QTXA 4OMLA 1PC3A 3BW1A 1JB0E 1IXGA 2EQKA 3QYTA 1M3BA 2JMAA 3FJPA 1YITA 2UVHA 4JBZA 3PVQA 2EJFA 3FIFA 3TEEA 4AFUC 4B6MA 5CKDA 1U8RA 1FBEA 1SD3A 5I59A 2HKQB 2ZGWA 3RKWA 3PT9A 5GAN4 1VQNA 4GBWA 3T9VA 3SEWA 1RYXA 1VQOA 4MNPA 3KFMA 3GBBA 3O6GA 1UGQB 5ET5A 1FPEA 1H8KA 3A8LB 4MZTA 2FZCB 3FEOA 1MV0B 2DILA 2FRWA 2DE4A 4ESRA 4JRQA 2XKOC 1BKBA 3MEWA 1YHQA 3ILUB 2ZAEA 3JCMV 1GV8A 2EGEA 2KT1A 5FTHA 4Z7EA 5LJ5h 2GHBA 1AWJA 5I2NB 1WA7A 4PJOE 2WACA 1NJIU 1OZ3A 1YZ0A 3C4MA 2GQIA 4ZGEB 1VSOA 1NLOC 1JVYA 2K2MA 3CCQA 3IB1A 3HV1A 2P0KA 2FIEA 1K4US 2EQMA 1B5IA 4R72A 2XIDA 3OS2A 2NUTA 3HSTA 4C8QD 4GWXA 4XTZA 1UDLA 4QBAA 4LATA 1Y96B 4J8OA 3CCJQ 2XD0A 1RAHB 3VVFA 3IOVA 1WHLA 1PSEA 1UTHA 1KWHA 4F1UA 3OYIA 3B7DA 1SSFA 3VYGA 4FECA 2RF0A 1QUJA 2CH4A 4C0FA 1VQ9A 4IUQA 3ER0A 2UXAA 4E7IA 4F17A 1JW1A 2I4BA 2X3XD 3RT6B 1VFEA 1Q86U 1YP5A 2RCBA 1YCJA 2LAOA 2DVEA 3EGXB 1G3SA 5ET7A 4M77B 1A8FA 2JTMA 4ZS9A 2CZLA 4LZ5A 2E6NA 4J5YA 2AL4A 1P92A 3CCRQ 2NLUA 4HKEA 3M8UA 4KQPA 2OTLA 1H76A 1A0NB 2O7UA 1CNQA 4M77F 3OELA 4Y28E 1LGBC 1M90U 4P56A 3L2RA 1GGGA 1LCTA 4D8DA 4JJNK 4M78C 3CXCA 5IGAA 4KGZB 2ABHA 1BYMA 4FJPA 1POY1 1ABOA 3FGSA 1SF9A 1QP2A 2RK1A 3CPFA 4E0WA 2KR3A 1NFTA 1FBGA 3C4SA 1I07A 3KBGA 1BLFA 3R6UA 2C0IA 1EU8A 1RLPC 4C5EA 2CSQA 2HBPA 2KNBB 1M1KC 3BFUA 1LAGE 3MWBA 3LR1A 2V8KA 2F5TX 1IHWA 5CR2A 1QUKA 1BU1A 3UA6A 1BIBA 4G8MA 2J7IA 2NXOA 4H8JA 3RYDA 4FYVB 2OX7A 3EG9B 3OBWA 4ELYC 5M9OA 1M8VA 4JWXA 1IITA 4PBHA 1Y3QA 4JZ4A 3SETA 4QRZA 2L3SA 1KZ8A 2IG0A 5KDTB 1IMFA 4Y91A 2X4YA 4KBMB 5FWBA 1HSQA 3TDJA 5KZTA 4C5HA 4FSXA 3CR9A 4E2FB 4HVVA 5LL6S 2PVUA 3EGXA 4OMMA 5LJ5g 4M78E 3VU3C 3PGFA 4M77A 4M4ZA 3OO9A 2MK5A 5IAYA 1WHHA 5DLOA 4BDMA 1FPDA 3FUZA 2JS0A 3MP6A 5GAMg 2DD5A 4XTUA 1L5TA 1SDXA 1VQ4A 2EQJA 3T96B 1ANFA 2Q8MA 4OVJA 3I55Q 2F5KA 2DYBA 2DEQA 1GVCA 4J83A 8AT1B 1XI6A 1VQKA 4PLLA 3HRTA 4ELOA 3I9QA 4IUVA 4P11A 4E7ZA 4HCCA 5TPAA 2X35A 4C8QB 2MYSA 4F04B 2PFZA 3QO3A 1LAXA 5GAMd 2KK4A 2ATCB 1S50A 4O7MA 1KQ2A 1UHCA 4R55A 1D1CA 2AHJB 3LH5A 3OOAA 2J6FA 2FBPA 3M0RA 1FQEA 3QIMA 1IHVA 1IO6A 3HFNA 3JCMg 2QL3A 2RJCA 1ZSZC 5KCHA 5GANj 1QKWA 1UGSB 1QWEA 1JVXA 2L5VA 4XF5A 4NOYA 3EG9A 1KA0A 3DLNA 5GJWB 1Q82U 1Y1ZA 3PMXA 4WEDA 4X48A 2QS1A 2OTJT 5KDTA 1B7TA 2DXBA 2ECZA 2RH2A 3VS0A 2VUBA 4R2FA 3ISPA 3RKYA 1QGXA 2UVIA 4DQ2A 4ZEKA 5TU0A 2OX3A 1N0TA 4RUGA 3C32A 4BY6B 3G3FA 5CKFA 4DOVA 2EVRA 3SWNB 3M0TA 2ESNA 1RI9A 4JWOA 2JTEA 4IIMA 2QVRA 3DB3A 1I81A 2DXRA 2KXDA 1DTGA 2CYZB 3JCMd 3M59A 4EMKC 2LNHB 2HAXA 2EGCA 1SQYA 3GZGA 2DE2A 4LQ2A 2QQBA 5KCJB 1VQ6T 3QUJA 3MVWA 1V1CA 1PRLC 2Z22A 4LP2B 4YKIA 1WHJA 3SEXA 1YITQ 2LX9A 3EFSA 4M77G 4E7JA 4R2BA 1OI1A 2GNCA 1Y3NA 2D6FA 1VQNQ 2X9HA 1VQOQ 4GX3A 5D6XA 5IN1A 2WKYA 4FYYB 4AB6A 4RTYA 3JB9I 4CC2A 2ZZDA 2DO3A 3VRZA 2UVGA 2AIRB 2DJQA 3EFOB 4UACA 4N4IA 3H9NA 1YHQQ 4OVTA 5GJVB 1LBCA 1XVXA 2E41A 4RTZA 1B32A 5KYUB 2DDKA 2IVWA 1ZUUA 2PCRA 3G71T 3RNJA 2LJ0A 4OFJA 3I35A 3T9NA 2RQRA 1G3YA 3JCMX 1AVZC 4Q0CA 4CC3A 2NVUB 4RJZA 1Q81R 4BI4A 1DPPA 4IUTA 3SZPA 3PMTA 5IM2A 2JXBA 2JUFA 2LVMA 1JXMA 2J6KA 1K73R 4OB0B 4F7UB 3OS0A 1SBPA 4LUBA 3EAEA 4MMLA 4ECFA 5M2VA 4A4GA 3JV3A 2F69A 3GOXA 3M9QA 4YTLA 1FQBA 3TCFA 1IMCA 1TFDA 5LJ3h 2B8AA 4JJDA 3TFLA 5KCJA 5KYWB 3LSXA 5AT1B 1VQ9Q 3H6TA 5BWJA 1B5HA 1NV5A 5H8QB 3OYBA 4RCCA 1GRIA 3H3GA 2D9TA 2GFAA 1BKAA 1O63A 1YWPA 2VXEA 4M75B 4KD5A 4R75A 2DBKA 2V8JA 4ZNXA 2C0TA 4F16A 1D0YA 2FL7A 2OTLQ 1P1WA 1FTMA 3LSWA 3ONMA 1UJYA 4M75F 1OPKA 3V5AA 3EFOA 2DWIA 2F1LA 1H45A 3MEAA 3UATA 3B8BA 1NEBA 3KBZA 5KYUA 1YCYA 2L3PA 4KH1B 2MIOA 2RM4A 3OSRA 4EXLA 2D0NA 2UYFA 4IR8A 4OEUA 3VS1A 5A0GA 1RABB 1FMWA 4F3PA 3PE0A 1N27A 3VV0A 2O6AA 1YJNT 3JYRA 1FWZA 1N84A 1PNJA 2XWOA 3PUXE 3EH2A 3MHXA 2EGAA 2ONKE 1G5VA 4GBQA 1MQIA 1Q7YC 3QZ9B 3RN8A 3O5ZA 3EHUA 4LN2A 1WGSA 3OA6A 1AIVA 1D0XA 4LD6A 3JZJA 2QVUA 2K5LA 5CKEA 2ZYOA 3G7ZA 3WVEB 5KYWA 1KK7A 3L2QA 2H4IA 1FPKA 5KH6A 1H3ZA 4QSDA 4H5GA 1M5CA 1Y07A 2VXFA 3V7RA 1VQLA 1B5JA 3QK6A 3HP9A 4WF2A 1HJDA 2PTKA 4G2ZA 1VDWA 3RTWB 4N4HA 4M75A 5LJ5j 4Z8AA 4FU6A 2XXVA 2IA4A 2QPQA 3RUMA 4JRKA 4G8HA 1XOVA 4P1EA 5GAOr 1VQ4Q 3HN0A 2XXIA 3B50A 3G1JA 1NKXA 2GH9A 4GD5A 4OEVA 4N4UA 1KQSP 4PFRA 3E9FA 3NMZC 1AWOA 4C92B 3J7AF 2PNIA 2RF1A 4GXSB 1XTDA 1VYVA 4M7DD 1QCOA 1VQKQ 3S9LC 3THKA 1UFFA 2RNAA 2O88A 1RDXA 1FBHA 2BJIA 3BIHA 1BI3A 1WX6A 2CDTA 1ZJLA 2K2VA 2YRCA 3O6IA 2NWJA 4C92F 3X24B 4R6HA 3CC7T 2QDYB 4PJMA 5DYHA 4F39A 4LDWA 3CCET 3W9WA 3NPFA 1NV4A 3IR1A 1XQHA 2DL4A 1Y4TA 2EW3A 2J06A 3H06B 2H3EB 3CCSA 3L2VA 1GBQA 5EQ7A 1N76A 2CEXA 3TTNA 4N4GA 5HKCA 5CAIA 1DBZA 1FPJA 1LPLA 4P1LA 3UA8A 4TVRA 2COZA 3TQ7P 3KSJA 3OYYA 1GFCA 5GAN3 3TTMA 2RI3A 2QA4T 3J81E 3IK6B 3RLFE 3M54A 2K3BA 3LH0A 2AYSA 4LXCA 1R0CB 3RR6A 4KR5A 2AT1B 3EGUA 3P7IA 4DEYA 2RHUA 5F7VA 5I11A 2DXYA 3BDLA 1WODA 4H67A 3HL8A 5GMKe 2UVJA 1WDNA 5I57B 2V1QA 4RCBA 1T0KA 3O2AA 2XXKA 4KHZE 4E0XA 2GCXA 2XWKA 3BE3A 4F22A 2BKDN 4OVPA 4XU0A 2F7CA 1XOCA 1D3KA 3G4SQ 4MLQA 4POXA 3FXUA 1AWXA 1MH4A 2K9GA 3MPLA 5A5XA 5DY9A 1RI0A 4PFBA 3EHRA 1YJ9T 4J9EA 3H4ZA 4EQ9A 4IB2A 2MWPA 1P1QA 1B0LA 2BJJX 1FSAA 3C35A 4M75G 2LJ1A 5F1QA 4N0AA 4P3LA 4PETA 4PFIA 1K9MC 4C0GA 3QAXA 3BBRA 1CKAA 2K7AA 1G3TA 4FIBA 3DP4A 3OQ5A 5CMKA 4G77A 1M5Q1 4HE1A 4N15A 5GANf 4MDXA 1OIBA 3V8KA 4E47A 1Z7ME 2GFEA 4J9IA 1B4ZA 3HPIA 3MBPA 4XQ3A 4L6V5 3MO8A 2LCSA 3V8LA 1ZTYA 2G29A 2KLFA 2BZXA 1Z9QA 5I2SA 4RTXA 1I0CA 4OMNA 2DE0X 1G83A 4PDDA 5L9MA 3QIIA 1N9SA 2QEXT 1JEGA 3VS7A 4YB5A 2I3VA 4P0IA 2RINA 3CFZA 3H7MA 1Y3PA 1K0XA 2WSEE 1QCNA 1Q35A 4QT7A 5I57A 3BY7A 2LQ8A 4DXUA 3MQ9A 1B3HA 4F14A 2CZ7B 1IUDA 4ZTJA 1PD0A 1Y1MA 4QFLA 3LGFA 4PE3A 2QAZA 2CSIA 1PG5B 2P0PA 1S72T 2YUQA 1G2BA 4OP0A 3FXQA 1AD5A 3PGGA 1KQ1A 5GMKh 2ZZWA 5FU6B 2RKMA 3CFXA 3MAMA 3PPRA 5C0MA 3TEPA 5EG2A 4IKFA 4RKUE 3VV5A 3HHGA 1FTKA 3OYMA 3LSLA 4ZN1A 4H5FA 1RDZA 4U22A 2VKNA 2VV5A 1RAFB 4OB2B 3NFCA 2E6ZA 1NH8A 2V25A 4H46A 4NF4B 4YMBA 1B3FA 5I56B 1B3LA 4Q5WA 4DCYA 1XVYA 2DL7A 4PNOA 3OO6A 1I1JA 2GRVA 3MCAB 2RC9A 3RMSA 4A4EA 1E6HA 1K9MU 4FW1A 2FYKA 4L17A 2DZ9A 3TSWA 3SEUA 1NG2A 4O3CA 2D21A 2E5QA 3NTKA 5HY6A 1VQPT 3IL1B 1RKMA 2MCNA 1FYNA 3O8VA 2Q89A 3CCVA 1G0HA 3OS5A 5FBPA 3JB9J 4X34A 1K9YA 2HQEA 1I8FA 1W4SA 2YSQA 4E7KA 5IH2A 2NUZA 1KD1C 1D4NA 2O2OA 5D6WA 1VQLQ 4WKMA 5EQ8A 3DLLA 3IJOB 3G3HA 5CC2A 2OWTA 3M0UA 1YI2T 2D8HA 3M4GA 1WQ7A 5GMKl 1B4HA 4P8BA 4F29A 3GNFB 3FBPA 1OU9A 2JZ2A 4N6KA 2A5TB 4B9XA 4CC4B 4QSEA 5IZ1A 4QVCA 3OEMA 4E7SA 3QYGB 1VQ5A 5I56A 4OF1A 5FW9A 2JVVA 4JVCA 3L2WA 4F19A 1EFNA 1JRIA 1Y71A 1ZLMA 1NV2A 3S6WA 4Z0IA 4XTYA 5DLQE 4DBQA 4MHFA 4QQDA 5AA2B 2A5SA 4BE2A 5LJ3j 3MEUA 7AT1B 2D1XA 2FPEA 4M77D 1EH3A 2GTOA 3IO6A 1NEGA 2PQWA 3GLXA 3E78A 2I6EA 5GANg 2Y7WA 1XC1A 2X51A 3S3OA 3QHSA 2K4YA 5GAN7 3CCSQ 3CEYA 1MY0A 2O1MA 3ULRB 2E0SA 1S9TA 1NYGA 4EIKA 3Q26A 1YPNA 3UPUA 1AWWA 1LFHA 5H8FB 3DELB 2Q74A 3K02A 2VOZA 1I6BA 4NG7A 3FZVA 4J9CA 3CC4Q 1SG5A 2DIQA 3CBOA 5GAMe 4O94A 2CH4W 2KY9A 2QXFA 4MDWA 1GCQC 3UIFA 2DOJA 3BFMA 1XNIA 1VQ7T 1FCKA 1SVXB 2OLBA 2JW4A 2ZYMA 2L3RA 2NUTB 2QQAA 2HHMA 3B6WA 4PJOB 4IO3A 1F9BA 2W0ZA 5LJ5f 5GANd 3KFVA 3CMAT 2ABLA 4PC9A 1IREB 1QULA 1S7YA 3FV2A 2DWHA 1X75C 1ZA2B 1YIJA 4GWOA 3PMWA 4PJJA 4PJOF 1Y20A 4FCYA 2XDBA 3O6HA 3HRUA 4G8NA 4LVQA 4XFEA 5GAOn 2A5TA 1FXXA 4OB3B 1TSFA 4GQOA 3UT1A 2DD4A 1LNXA 5LOMA 2SEMA 4PFZA 4OZ9A 1PB7A 1NJIR 4N17A 5IHIA 1QUIA 1UTBA 3MKDA 3K00A 2EJGA 4ESWA 3FJMA 1B40A 2I48A 4EMHA 4WTOB 5AA2A 4IO4A 5IHKA 3P8HA 4OFLA 1WHKA 2Y7KA 2HD0A 5ICTA 1LAHE 2QJEA 1EIFA 4M7AE 4P47A 1NPRA 2RHIA 1TTHB 3JSCA 1GFDA 5I3SA 4FT2A 3OY9A 1BI0A 2CP0A 1TT1A 3JCMf 2LZ6B 3TYHA 2HL3A 3PMVA 5H8FA 2OAUA 1VYUA 4ELPA 4AFZC 2Y7PA 1WFWA 2HBWA 3QPHA 4HS7A 3E4RA 3PIPA 2QFLA 3S3NA 4I9DA 2OZZA 2P1SA 4QQ6A 4Z88A 3MZ9A 2D0QB 4FSSA 1Q86R 3HO7A 3IB2A 4M7AA 3CCJT 5F24A 4N91A 1FPIA 5EHSA 2L2PA 4L59A 5GAOl 1B3GA 4PJOA 5FROA 5CBSA 4QQGA 1IMBA 2ZPIB 1QVPA 5AE4A 4PAKA 2H9BA 2HKNA 4ESXA 4G68C 5I5PA 1US5A 1M90R 3UORA 1QKBA 4ONYA 4AMCA 2F2XA 1HK9A 4MFIA 4PFTA 5H8HB 4TQUQ 2DNUA 3CCRT 2YPNA 4PLIA 1X2KA 2ZNSA 3QXEB 1NBEB 4RTVA 1LBWA 2NUVA 1G8XA 2M51A 4RNSA 3JB9H 4C5IA 4X04A 1YFNA 2K5IA 1MM7A 3ROJA 3IOWA 3P8BB 3QBYA 4FYXB 2UYEA 2DVJA 2HXRA 3D7SB 1MXVA 1X6BA 1FBDA 4PK4A 4HCBA 3FVKA 4QFKA 2ZPGB 1NL5A 3CC2A 2NWMA 4PF6A 4M78B 2HXWA 4IUUA 3SHWA 1NNKA 3CSBA 5CMCA 3C9HA 4ZEFA 2W10A 3ZKKA 2I0BA 4OGCA 5KYYA 2IEEA 2REGA 3K6VA 1DJ7B 2KVQG 3MW0A 3VLVA 1PWTA 4M78F 5TPAB 3JCMb 1UJ0A 4HE2A 3K6XA 1URGA 3ZEHA 3META 3CPWS 1BB9A 2ZYKA 2Y84A 2VHAA 2RO0A 4QKUA 1PEBA 3RIRA 3H6WA 3EKIA 3QUIA 1I5OB 1QW0A 1BP5A 3CCVQ 3GPLA 4GL0A 2X4JA 3M3KA 1D3BB 1X2QA 2R57A 1NV3A 3FC3A 1DCUA 2E3IA 2DPPB 2R5AA 3T0JA 4KGXB 3URGA 3ZKLA 2KEAA 3MYUA 4IUPA 5IZ3B 2XXXA 2P4TA 1NPPA 4NQ8A 1MG1A 5A0LA 4R0KA 1K9AA 1N7XA 4LN5A 4I3EA 4OANA 4M7AG 2V8IA 5H8HA 2E4HA 5J1DA 2RQTA 3IO4A 1K1ZA 1PKTA 1ZIUA 3EHTA 1QLYA 4AG2C 3FRNA 3K01A 2RI2A 3LC8A 4Z89A 4PJOG 3I55T 4OMOA 3ZL7C 1E7OA 3AHUA 1KA1A 3H03A 3PV0E 4HTGA 2HL5C 4N8GA 5GAOp 5I58B 4PQJA 2C0OA 5ELVA 3TVTA 2YUNA 2RA2A 4C0DB 2ENMA 3OYLA 2PYYA 3LGLA 4XTWA 1NE8A 2DX1A 1JQFA 4MAGA 1AH5A 1EX4A 1FBFA 3V83A 2ZXTA 3CG3A 4M78A 2K79A 4RPNA 5KCOA 2ZNTA 1G0IA 1VQ5Q 1UIVA 3IB0A 1Q82R 2X7PA 4R9GA 1ZBMA 3WVDB 5LJ5d 2KI7A 1CB6A 2HPGA 5EYHA 2O68A 4F31B 2CT3A 3NOHA 3OBYA 1UE9A 4YICA 5BUUA 1ELJA 4GWUA 4KYDA 1M5FA 5DTBA 2QVVA 4FEBA 3E3KA 4F3BA 1KQSS 4M75D 5DM7R 2HEUA 2CP7A 1MPDA 4JRPA 2DRMA 1AMFA 3C34A 2Z8EA 1N6AA 3QDFA 1D3BA 2A36A 4KULA 2Z0WA 2E12A 4HT8A 1I6QA 3CCLT 1NMUA 5A5LA 1SEMA 3JB9F 1TUDA 5GMKj 1MQGA 4MH5A 4FL6A 3UWNA 4C8QC 5IZ3A 3CCMA 3M0PA 2HQ0A 1IQ7A 4BLAA 1TG0A 3DM0A 1M1KU 1M5EA 2Q8JA 2YWWA 3C12A 3SEMA 2MWOA 2DJZA 1RAAB 4J9DA 3HSBA 1MS7A 2HEQA 2EAYA 3G7WA 2CP3A 4IGRA 4TOZA 3VXCA 4PF8A 1GL5A 2PFYA 4OTEA 2PUOB 4EMKB 3FASA 2Q9TA 5CVIA 1WHMA 2H5YA 5I58A 1YIJQ 2R8TA 2QG9B 2P0QA 5HK0A 3NGPA 4JS5A 3EN3A 3OENA 1YITT 4DIGA 1OLCA 2EPDA 3G4SA 4H65A 4II1A 2XD3A 4OMBA 1OQHA 2V3TA 1VQNT 2RQVA 1VQOT 2VC8A 4H6DA 4OVSA 3KC0A 2H25A 5ET8A 2ED1A 2KSSA 1O64A 3FVNA 3A5ZB 3SWNC 3OYDA 1YWOA 4EDPA 2WEFA 5LJ3f 4EUOA 1NV6A 4JDFA 3VS4A 1YHQT 3VVEA 1K73C 4X9DA 4UC4A 1X43A 3JCMW 4BDYA 4U4SA 5CMMA 3OMGA 3QZ5B 4XKPA 4NWDA 4PFWA 3HHTB 1CKBA 3WXMB 3K0VA 4M78G 5FU7B 3I56A 5EC7A 5CIUA 2V93A 1ZSZA 1HSJA 2KXCA 3VS6A 2DE3A 2VYTA 3K2DA 1URSA 2F6PA 3CCQT 1AL3A 1LBBA 1M8MA 4LA9A 4C92D 1SW2A 3C33A 4KI0E 2ZPBB 1NUXA 4RTUA 3LYIA 3H8ZA 5CO7A 3QSUA 4BDQA 1M27C 2A0FB 4YB7A 1D0ZA 2ALUA 5K2XA 1R9QA 2HCKA 2RHZA 1EZ9A 3TMGA 5A2QE 3PPNA 4M4GA 4MIJA 1TH7A 1VQ9T 1BI2A 2P84A 4QVZA 2LNVA 4EMKA 2Y7IA 1JU5C 3L42A 2COWA 3KUFA 3I5SA 4AG1C 3CIJA 4KPTA 2FHYA 1JO8A 4KUIA 2DETA 3M55A 3IORA 2OTLT 4UABA 3TELA 2AZVA 3TCGA 5JEIA 2JMCA 3ZS6A 1V76A 2DM1A 4FBPA 1SHGA 1ZHIA 3UA7A 3BDUA 2QEXA 3IAZA 2KAFA 2RD1A 5T3JA 4XK8E 3W15C 3TAJA 3G6ET 2QQ9A 2F97A 2M0OA 3VS5A 2W7YA 3CPWP 4MCOA 1R1NA 4IY5A 5FHMA 1IB8A 2XHCA 3LV0A 3L1AA 2XXPA 3CC2Q 3G3IA 4KGVB 4IIOA 4BE0A 4BDNA 1M2VB 1N8RR 4TLLB 1M9SA 1A55A 4Z02A 1JJ2P 3DB4A 3RQTA 4EXKA 2WYPA 4PAIA 3U93A 4PBQA 4Y92A 1YJWA 2LRQA 2LCLA 2MI6A 3LX7A 2CMOA 3ODBA 4JUVA 3S3MA 3LSFB 3V8JA 1B1XA 3CQTA 1AOJA 1VUBA 3VDFA 3C95A 1QCFA 3CMET 1JEVA 5GAN8 4RK2A 4DBRA 3CD6A 4NF5B 1IMDA 1VQMA 1LAFE 3OSQA 1EZZB 4AQ4A 4H45A 4A63B 3JB9G 2XHDA 1B7ZA 4HVWA 3K6WA 4FAJA 3N26A 2YJPA 3AXFA 4N81A 2GGRA 2LT1A 3K1PA 1WJSA 2DA9A 1CSKA 4ZE8A 3KN8A 3O28A 2DEUA 1QVFS 2AIXA 3CI8A 3TZAA 4QFPA 1M4ZA 3PTAA 1PBQA 4BDRA 1W1FA 2CP5A 1WLPB 1H43A 3OO8A 3RMQA 2B4LA 2RMOA 2F34A 2ONSA 3LWHA 3M56A 1WXTA 2CZIA 2HZKA 3M3LA 4NGUA 1YJNQ 3USDA 1VQKT 2RK2A 3HKSA 3TKDA 1U1SA 4P5NA 1J3TA 4GFRA 5HK3A 4OMPA 3OYNA 1LFGA 2WBDA 5H8NB 1A8EA 1YBYA 3KEIA 4OMQA 4FIMA 4GIZA 5CBRA 4JZ3A 2L8DA 5A5XB 1Y4CA 2GTJA 4OVAA 3M57A 1M2VA 3HFOA 2EKOA 1FQDA 4JXIA 2EYWA 4JRIA 1NUWA 3PPPA 4HCYA 4F18A 5LJ3g 3O97A 2KROA 4XKRA 2VPNA 3CCUA 1LBZA 1OVBA 5IZZA 4IY6A 2EIFA 4YMAA 2C06A 4ELQA 2D5WA 3T9UA 2O9SA 4J7IA 3M58A 2AK5A 2OBGA 3PUYE 4AS4A 1ZBXA 3QWXX 4C92C 1NH7A 2KE9A 2P3NA 4NF5A 1M1FA 3R26A 2XU8A 4GXAA 3TREA 2L0AA 2ZCFB 3CC4A 4PKCC 2XDDA 1KHIA 5LJ3d 1B2HA 5CMBA 1WIEA 4R6YA 1FJ6A 3CCMQ 1T0JA 1JQQA 3H6ZA 2F2VA 1A7LA 1Q7YU 2O01E 3CC7Q 1MPBA 2KMTA 1M30A 3RESA 1ZLQA 2F36A 3CRBA 2YRVA 1PC0A 3FB9A 3N5LA 4RTWA 4GWZA 1K8AC 4QSCA 3SERA 1OZ2A 2KRMA 4EMGA 3A3UA 5FTIA 1MQHA 2K3YA 1MY3A 1SRMA 2GFUA 1TWBA 2QRYA 2RQWA 1TS9A 1D9YA 3DP8A 4NHBA 1PCXA 5H8NA 1Q9DA 3OYJA 2XK0A 3MZBA 1OX8A 4JSDA 1PD1A 4DOWA 5GANe 4RPOA 4Q5TA 4MX6A 5ISUA 5I7IA 4ZTFA 2XICA 2HSPA 1MY4A 4KFQA 4ME7A 3KZGA 5B7DA 2QMXA 4O3AA 1BK2A 1IXDA 1AOVA 2CKKA 1MPCA 3OB9A 5FWCA 4FT4A 4R56A 3SEVA 4N07A 4WCIA 1W6XA 4DXBA 1OQGA 2O69A 2FA7A 5K2YA 2A7YA 3A29A 4NMYA 4THIA 1WZOA 4NF8B 4YAHX 1ZA1B 3SESA 3I56Q 1SYHA 3H0FA 4MMKA 1SW5A 3T9HB 3C31A 4BB7A 1POTA 4VUBA 2QQSA 2YLBA 3RKXA 3A09A 5AYFA 4IO7A 3VXBA 1LCFA 2NUPB 2X4XA 4D6WA 5AA4B 1BI1A 3FATA 1ZKBA 1LBYA 1M3CA 2H3JA 1UGPB 1XT8A 5AA2D 1Y57A 1F1BB 4OB1B 4G4PA 2CZKA 2P2AA 4MLVA 3MVXA 3WAFA 2DXUA 4ZGDB 4I40A 5EQ9A 4BI8B 4CI0C 1PDAA 4YKPA 4YU0A 1I4K1 2ONRA 3QKJA 4MF3A 6AT1B 4DLDA 2IIMA 4OQOA 2V26A 1IZ6A 3H0HA 4XU3A 3X20B 1FBCA 1B1HA 2I58A 4PGPA 2KT8A 1T3SA 2K5FA 5HCKA 2V4CA 2XXUA 4BDOA 1BIAA 3VKIA 1UUEA 4HW8A 5DVFA 3LLRA 2LDMA 2FVUA 2DZCA 1K8AU 1LLSA 3TODA 4FEDA 4Q8RA 4J6YA 2I2LA 3FDRA 4ND9A 2QEXQ 4YB6A 3ZBDA 4X1VA 4PJOD 2QTVA 1WHGA 3M0SA 3EFRA 3TU4K 4M7DC 3D4CA 3RPWA 5JTYB 2DYXA 2HQHA 1FPGA 2GBQA 4DA4A 3MSTA 3TQWA 1FPBA 3C36A 4O3BA 2QQRA 4NF8A 1ZMGA 2Z8DA 4BI3A 2QYZA 1HYOA 2FZKB 4BD3A 2V3QA 2XXYA 2OCUA 4C5GA 4ZEIA 1R6ZA 2CS7A 1YJWQ 1VQ8T 2RI5A 4R73A 1KSWA 4A54A 3VUBA 3OYGA 3VE1B 2KRNA 2MPXC 2HQXA 1QVFP 1S72Q 1SW1A 1OV3A 1KHCA 2DERA 1R9LA 2NUPA 2M9UA 2JS2A 5AA4A 3TUSA 4I8CA 2ED0A 3MPKA 3CD6Q 1EYKA 2DKGA 1DK4A 1VQMQ 3CVGA 1KC8C 2FZGB 4X1BA 4OMFB 3G3GA 1VQLT 2DRKA 2HMAA 2VGNA 1NV7A 1QW1A 1VOMA 2Y7RA 4X9CA 4OFOA 5ET6A 1SPKA 1KJWA 4M7DE 3RGYA 3FV1A 2I3WA 5B70A 1WYXA 3ILTB 3E9GA 5CI5A 1IGQA 2JJKA 5IAIA 2O31A 3VS3A 2KYBA 1HSEA 4XIGQ 1ACMB 4ATOA 1WNLA 4UA8A 1MMGA 4XAXB 2FG0A 2VD3A 1OPLA 1H3DA 3A8OB 3F70A 3T9XB 1E6GA 2MOXA 2QDLA 5JTYA 4XTVA 1OVTA 4GLIA 1IMEA 3N6UA 3RUXA 1LB9A 4GWYA 3M3FA 5C6SA 3GIBA 1USYE 5DVJA 3Q25A 2EQUA 3OW2S 3X26B 1UTBB 4ELZC 3MUQA 3EQ1A 2O4XA 1RL2A 2MAMA 1US4A 4EF1A 1WXUA 3SB2A 5A0DA 2RHYA 3CCST 2PVDB 3CCUQ 3OEKA 1T3LA 4AS5A 4EQ7A 3KJ7A 1TOVA 1DTZA 4GVOA 5FLXE 4EF2A 2FPDA 4MZMA 2YT6A 1SPIA 3E13X 2X4WA 1MY2A 4HCZA 4ISUA 5LTCA 2E3HA 3G3KA 1PRMC 2CUBA 3EHQA 5LJ5e 4MNIA 1JNFA 2RCAA 1MNEA 2B3FA 4MMPA 1N5ZA 4BDLA 4M78D 3K1MA 2L89A 2LC4A 3OS1A 4PP0A 1TFAA 2RPNA 1NJIC 4M7AB 3CFLA 1MQDA 1Q1KA 5CM6A 2FEIA 2ESWA 1IGUA 2DMOA 1ZU0A 4EPCA 1RAEB 1KC8U 4JJCA 3GF5A 4M7AF 2MF2A 2A28A 2O7IA 5HBCA 4H1XA 1MGQA 2M16A 2DWJA 1KD1U 2KDSA 3QDRB 1YAEA 5ICQA 2JM9A 1YCSB 4RG8A 1MXYA 2FIXA 4A4KA 4JB7A 3IX1A 2Q2AA 3JCMP 4U4XA 1N7WA 1RYOA 9ATCB 5GMKm 1ATGA 4F3SA 4R74A 2DP8A 1B07A 3GNGA 2OTJA 3U1OA 3QJ6A 4PFYA 4CC7A 2DYIA 3JCMe 2RN8A 1TUGB 1MXUA 4P9KA 3PD8A 4C1TA 2OWSA 1B34B 2YLCA 2R71A 3F11A 3CMAQ 3EH1A 1YYZA 4IURA 4L5GA 4DI3D 1K9ZA 1W2BS 1M90C 1P1OA 3E9XA 1J1NA 2F78A 1VQ6A 4N8YA 5KYYB 1UECA 2ZMBA 3UN6A 4PE5B 3R7XA 5I2KA 3MPUB 3N5BB 3EHSA 1NUZA 4MJOA 2DTHA 4AB5A 4ORZA 3U8QA 1ABQA 2Y5LA 4U2RA 5J26A 4J9BA 1GCQA 2J6OA 4NX1A 4OERA 3SDZA 3O9PA 3A98A 4E7LA 1FMKA 2PZ1A 1I5LA 1AEYA 4RA1A 1Y0MA 1MUZA 2OI3A 2JTFA 1OOTA 3I5RA 1M3AA 4V2SA 2D3IA 3V7SA 1RACB 4G68B 4RTTA 4ZZEA 2XXWA 4GOTA 3GXAA 2Y90A 2BE7D 2V3UA 2XXHA 1A99A 5GAMh 2XXRA 3CG1A 3JB9D 2OAWA 4XU1A 5GMKi 1B05A 3G71A 1KQSA 1B7HA 1WDXA 3GBAA 3TTLA 4POWA 4BACA 1TU0B 1FJ9A 4KRTA 2EFIA 1ARKA 4DEXA 3I3VA 1X6OA 1EYJA 4LZ7A 2RQUA 2XXTA 3EG0A 2CUDA 1X01A 2WSFE 2Y4YA 1INPA 4A4FA 2VVKA 3M5AA 3QJYA 1QVGS 2P0SA 2E1SA 1B34A 4OHNA 1TWYA 1N3XA 4JLIA 1B52A 3TTKA 3W9VA 4IO6A 2YUPA 3A8MB 4NEDA 2A08A 1KFZA 1Z9ZA 3FXRA 5ESYA 4LDUA 3C0CA 4ZECA 3K4UA 3RPLB 2PT2A 5I21A 3MP1A 2DL3A 2E65A
chains in the Genus database with same CATH topology
4M77C 3U72A 3JCMh 3PUVE 4RK9A 2F7AA 3CSGA 3CCVT 3VYHB 1BIYA 1B46A 4J7FA 1YTVA 2OJTA 3OSVA 5TP9B 3M4YA 3V89B 4XXUA 5D6YA 3O66A 3G6EA 1JJ2S 4OYVA 1LOJA 5I84A 1M1GA 3C94A 5I2NA 4G68A 3VLWA 5GAOm 5KE2A 1MY1A 2XD2A 1XS5A 1Q82C 2DVZA 2FNCA 1JETA 2HFBA 1UB4A 4RYAA 4DDDA 1LB8A 4F2QA 3RTFB 4NL3A 2EJ9A 3JV9A 1N04A 3PNWC 3TQLA 2LCCA 3DKMA 1Y96A 3D4GA 1YJNA 4M77E 2R6GE 4IO5A 3HPWA 2LTOA 3CMEA 3KG2A 2QSXA 1VQ5T 2XX8A 3H6VA 2CZ0B 4QW2A 1WJQA 3GP8A 4KT0E 1HSLA 4N13A 1WPYA 2RJEA 1MQJA 2PVGB 1HXDA 3Q28A 3L2UA 1FX7A 3JRZA 2RB6A 3OMBA 4XKNA 1CE2A 4C0DC 1LJOA 3MJNA 2RHXA 2H98A 5TP9A 3PFSA 1IXHA 2G3RA 4OWDA 4YKJA 2DXTA 1XHYA 1SI0A 2Z8FA 4I62A 2E70A 1URDA 1P1NA 4ZZAA 2V84A 2CZ6B 2Z23A 4KUDK 5AA3A 3MP8A 3V8XB 1OLAA 2M1HA 5J39A 1FQAA 3CC7A 1QVSA 2NOOA 1B58A 3SD4A 3CCEA 1YIJT 4NTLA 5HM4B 2O1LA 4C8QF 5IT9E 4B9WA 4E7HA 1GTKA 4F3GA 5CRYA 2X7QA 1NNFA 3IOUA 3VFJA 3QSLA 2E64A 3KXTA 3OSSC 5LJ3e 1MXZA 3FJGA 5DVIA 4I1DA 5L9OA 4NL2A 4LDVA 3DLMA 3CXCS 4C1UA 5GAN5 2HZLA 2JOYA 3KOSA 3V7CA 4BY6C 2LQKA 4ZGJB 1Q81C 2QA4A 4NF6B 3QXMA 1FQCA 4RMOA 4GF8A 2O51A 4IO2A 4U23A 4FATA 3PD9A 3TCJA 5FRNA 4OESA 3G3JA 3I5OA 3RY3A 4RXLA 4YKKA 4C8QE 1QVFA 2DWAA 2EYQA 4JWYA 3Q27A 2XXQA 1UQWA 2DXCA 1EZOA 5ITOA 3QYHB 3OYHA 3KN3A 2XI9A 1MXWA 3T93B 4C8QA 1YJ9A 1QKAA 2A3LA 2F35A 1DOTA 3IOTA 3OYKA 1B6HA 4LDXA 2RJDA 2PBWA 2F6GA 1LFIA 3PUWE 5ITPA 2ANJA 3DP6A 4C0ZA 4GY5A 3O29A 1ZQ1A 5FU7C 2VP1A 3ZSFA 2B65A 1IEJA 1UEBA 1VIFA 2R5MA 2PVOB 1WVJA 4QFNA 4IGTA 3A8GB 1N8RC 2RC8A 4K3FA 3VVDA 3S2VA 5I2MA 3U92A 3QUFA 3RT8A 4U1OA 3K6UA 3EPEA 3KJTA 4NF6A 3SWNA 3UK4A 4ZN3A 1A54A 3CC2T 2PT1A 2PUKB 3FVGA 4U1ZA 3CBPA 4JLGA 4XTXA 4F7UF 3IJXB 3JAME 2CGHA 2DIGA 5KE3A 4X1DA 1JW5A 4F2OA 1Q81U 4EQBA 5FHOA 3OXNA 1B0HA 2DS9A 2ZPHB 4WXJA 5AA1A 1K73U 3S4UA 4FE8A 4M75C 2AL5A 5GAOq 1FQFA 2JN0A 4DXCA 1S72A 1U1TA 2DQVA 4WEPA 2ZPFB 3ZFJA 2XG8D 3EF7A 4QHQA 5EYFA 2DK3A 2QMWA 2PU9B 1G3WA 1LSTA 4F7UE 5L8DA 4ELRA 1FW0A 2FYIA 1VIEA 3S9NC 3BFTA 5HPQA 4Q30B 2GQVA 4JDSA 4C8QG 3X25B 1DSNA 1BTJA 2Q88A 3L2ZA 3UDCA 3S9MC 1MRPA 1I6AA 1VQ8A 4A53A 4EDUA 1VQ4T 4F7UA 4RY1A 3MEVA 1VQPA 1MM6A 1N8RU 4M75E 2CZ1B 3ASKA 3THIA 4ZEDA 2E1HA 2E10A 2XX9A 2HAUA 1DMBA 4FM4B 5H8QA 2VGQA 1NNTA 4PFUA 4R9FA 1VE4A 1IIWA 1KG1A 1QP3A 4F1YA 2QI2A 3FJ7A 3A3CA 2MMPA 2ZNUA 1B9JA 1M5BA 2QS4A 4BUGA 5GAMj 3E1SA 3WAEA 5DEXB 5FRMA 1MH3A 2F5XA 1YI2A 3LUYA 3PUZE 5GAN2 2DTIA 4KYEA 3P8DA 3LBSA 4ZEBA 2BUDA 5IKBA 3CCMT 3JCMc 1UGRB 1D9VA 2VGMA 2GF7A 2X26A 2DAQA 3Q29A 4J6XA 3B6TA 4ZE9A 1O75A 3MVZA 4N0AC 5GAN6 5CK9A 2ZPEB 3X28B 4GL8A 3SEYA 4MZPA 2B3BA 4XKQA 2ZYNA 3VUZA 1H641 2DSFA 1IXIA 1FTJA 3G4ST 1O7TA 2F8DA 5CKBA 4MBPA 4TLMB 3TPAA 3B6QA 1JBMA 1GR2A 1II5A 2DTOA 1SI1A 5J3BA 1USYH 3L6HA 4LZ8A 4C92E 2K57A 1OYXA 4XTCQ 4F7UG 1VQ7A 4XU2A 1MDP1 1B3EA 3I56T 3CMAA 4YZZA 5DEXA 1EZPA 2XDPA 2H99A 2Y4XA 4C92A 3QG1A 2BIVA 4J6WA 1PSFA 3PPQA 3E19A 5CKHA 2RJFA 2FHDA 1H44A 1OMPA 2VD2A 1VR5A 3OD7A 2YHTA 3ME9A 4O5VA 3MC2A 2YLNA 3UGWA 1B7UA 2K3XA 3FLGA 4OXVA 2WSCE 1IXCA 3UP9A 5H8SA 2M8CA 2QS3A 3OW2A 1NNPA 4FORA 3VJPA 1VFDA 3H6UA 2R9JA 3CBMA 4H8IA 4DCXA 1JEUA 4M7AD 5FHNA 3CCJA 3HRSA 3L6GA 1B51A 3PIOA 4M7DB 1TXFA 4OENA 3M53A 4HA8A 1WQWA 3SDFA 1YJWT 3NTHA 1JW4A 4M7DF 2PX1A 5GANh 1V29B 2L5QA 3FIRA 2I0CA 2O4XB 2FB7A 3TTRA 3FD3A 3CCRA 3MZ1A 4H0WA 4NWCA 4RG2A 3RNNA 3CD6T 4O6JA 5FU6C 5DT6A 3NTIA 4HT9A 1VQMT 4M1VA 3J80E 4NS5A 3VLUA 1O9SA 3FVOA 1MXXA 4NE4A 4C92G 4LQ5A 3T22A 1N9RA 3LW5E 1UIUA 1Y9UA 3T66A 3INZA 5CCAA 4JS4A 5CQYA 2GHAA 2O84X 1MDQA 4R6KA 2G93A 3OYFA 2DVCA 3U94A 3LWIA 4F1VA 3JCMQ 1PBPA 3SFMA 1W2BA 1I69A 4KYSA 4LONB 3MVYA 4QF9A 3OO7A 4GRKA 4U21A 4PL6A 4CRIA 4M7DA 3K1NA 5L8RE 2THIA 2XX7A 2Q2CA 1NZ9A 3RERA 3CCUT 4OGEA 1FTLA 5L9SA 3TCHA 1MHNA 3OYAA 3PU5A 1SW4A 2EWNA 4P0GA 4QFOA 2OK2A 1IZ1A 3I55A 2HCAA 2REJA 2JNGA 3N94A 3R6OA 3CC4T 1P99A 2RC7A 2I49A 4ZDMA 2PMSA 4NF4A 5I2KB 3GLBA 3A8HB 5I59B 4C0RA 1SYIA 4KCDA 4OETA 3I6VA 3ECRA 3OMCA 3OYEA 3BKIB 4GLKA 2HAVA 1GXIE 5CQXA 1QVGA 4N6PA 1R8OB 4BDZA 3N6TA 5EHMA 2R58A 4A4HA 1P1UA 1M5DA 2LT4A 4LDYA 2QS2A 2HNIA 1AHJB 4DZ1A 4BE1A 3CPWA 1PB8A 1FTOA 1N3WA 3KSXA 4M7AC 3HHFA 3CCLA 1PB9A 4JSOA 2F7BA 3JCMJ 4DE8A 1Y7XA 3S9EA 1A40A 3KBRA 4QVDA 3SKPA 1Z7NE 4PJOC 1Q86C 1DPEA 1QJMA 4X9TA 1JJ2A 5JK4A 3PMIA 3KN7A 3KGCA 4LD9K 3PPOA 4HCWA 1UTHB 2I4CA 5GAMf 3HCQA 2KQWA 3OYCA 4M7DG 1WJRA 3Q1JA 3KOTA 4KCCA 2QTXA 1PC3A 3BW1A 1JB0E 1IXGA 2EQKA 3QYTA 2UVHA 3FJPA 1YITA 4JBZA 3TEEA 2EJFA 3FIFA 1U8RA 1SD3A 5I59A 5CKDA 2ZGWA 3RKWA 3PT9A 5GAN4 1VQNA 3T9VA 3SEWA 1RYXA 1VQOA 3KFMA 3GBBA 3O6GA 1UGQB 3A8LB 4MZTA 3FEOA 2DE4A 4JRQA 2XKOC 1BKBA 3MEWA 1YHQA 3ILUB 3JCMV 1GV8A 5FTHA 4Z7EA 5LJ5h 2GHBA 5I2NB 4PJOE 2WACA 1NJIU 1OZ3A 3C4MA 4ZGEB 1VSOA 1JVYA 3CCQA 3IB1A 3HV1A 2P0KA 2EQMA 1B5IA 4R72A 2XIDA 3OS2A 3HSTA 4C8QD 4XTZA 4LATA 1Y96B 4J8OA 2XD0A 3VVFA 3IOVA 1PSEA 1UTHA 1KWHA 4F1UA 3OYIA 3B7DA 1SSFA 3VYGA 4FECA 1QUJA 4C0FA 1VQ9A 4IUQA 3ER0A 2UXAA 4E7IA 1JW1A 2I4BA 3RT6B 1VFEA 1Q86U 2RCBA 1YCJA 2LAOA 2DVEA 1G3SA 4M77B 1A8FA 2JTMA 4ZS9A 2CZLA 4LZ5A 2E6NA 4J5YA 2AL4A 1P92A 3M8UA 2NLUA 4HKEA 4KQPA 2OTLA 1H76A 2O7UA 4M77F 3OELA 4Y28E 1LGBC 1M90U 3L2RA 1GGGA 1LCTA 4JJNK 4M78C 3CXCA 2ABHA 1BYMA 4FJPA 1POY1 3FGSA 1QP2A 2RK1A 3CPFA 4E0WA 1NFTA 3C4SA 3KBGA 1BLFA 3R6UA 1EU8A 4C5EA 2HBPA 3BFUA 1M1KC 3MWBA 1LAGE 3LR1A 2V8KA 2F5TX 5CR2A 1QUKA 4G8MA 1BIBA 2NXOA 4H8JA 1M8VA 3OBWA 4ELYC 5M9OA 4JWXA 3SETA 1IITA 1Y3QA 4QRZA 2IG0A 5KDTB 4Y91A 2X4YA 4KBMB 3TDJA 5KZTA 4C5HA 4FSXA 3CR9A 5LL6S 2PVUA 5LJ5g 4M78E 3VU3C 3PGFA 4M77A 3OO9A 5IAYA 5DLOA 3FUZA 3MP6A 5GAMg 2DD5A 4XTUA 1L5TA 1SDXA 1VQ4A 2EQJA 3T96B 1ANFA 4OVJA 2F5KA 2DEQA 1GVCA 4J83A 1VQKA 4PLLA 3HRTA 4ELOA 4IUVA 4P11A 4HCCA 5TPAA 2X35A 4C8QB 3QO3A 1LAXA 5GAMd 2KK4A 1S50A 1KQ2A 4R55A 3OOAA 2AHJB 1FQEA 3QIMA 3HFNA 2QL3A 3JCMg 2RJCA 5KCHA 5GANj 1UGSB 1JVXA 4NOYA 3DLNA 1Q82U 1Y1ZA 3PMXA 4WEDA 4X48A 2QS1A 2OTJT 5KDTA 2DXBA 2RH2A 4R2FA 2VUBA 5TU0A 3RKYA 2UVIA 4DQ2A 4ZEKA 1N0TA 3C32A 4BY6B 3G3FA 5CKFA 4DOVA 3SWNB 2ESNA 4JWOA 3DB3A 1I81A 2DXRA 1DTGA 2CYZB 3JCMd 3M59A 4EMKC 2HAXA 1SQYA 3GZGA 2DE2A 4LQ2A 2QQBA 5KCJB 1VQ6T 3QUJA 3MVWA 2Z22A 4LP2B 4YKIA 3SEXA 2LX9A 3EFSA 4M77G 4E7JA 4R2BA 1OI1A 1Y3NA 2D6FA 5D6XA 5IN1A 2WKYA 4AB6A 3JB9I 2ZZDA 2DO3A 2UVGA 4UACA 4N4IA 1LBCA 1XVXA 2E41A 1B32A 2IVWA 3G71T 4OFJA 3T9NA 3JCMX 1G3YA 2NVUB 4Q0CA 4RJZA 1DPPA 4BI4A 4IUTA 3PMTA 2JUFA 2LVMA 4OB0B 4F7UB 3OS0A 1SBPA 4LUBA 3EAEA 4MMLA 4ECFA 5M2VA 4A4GA 2F69A 3GOXA 3M9QA 4YTLA 1FQBA 3TCFA 1TFDA 5LJ3h 2B8AA 3TFLA 5KCJA 3LSXA 3H6TA 5BWJA 1B5HA 5H8QB 3OYBA 4RCCA 3H3GA 2GFAA 2D9TA 1BKAA 1O63A 2VXEA 4M75B 4KD5A 4R75A 2V8JA 2FL7A 1P1WA 1FTMA 3LSWA 3ONMA 4M75F 3V5AA 2DWIA 1H45A 3MEAA 1YCYA 2RM4A 3OSRA 4EXLA 2UYFA 4OEUA 5A0GA 4F3PA 1N27A 3VV0A 2O6AA 1YJNT 3JYRA 1FWZA 1N84A 3PUXE 3MHXA 2ONKE 1G5VA 1MQIA 1Q7YC 3QZ9B 3RN8A 3EHUA 1WGSA 3OA6A 1AIVA 4LD6A 3JZJA 2K5LA 5CKEA 2ZYOA 3G7ZA 3WVEB 3L2QA 2H4IA 5KH6A 1H3ZA 4QSDA 4H5GA 1M5CA 1Y07A 2VXFA 1VQLA 3V7RA 1B5JA 3QK6A 3HP9A 4WF2A 4G2ZA 3RTWB 4N4HA 4M75A 5LJ5j 4FU6A 2XXVA 2IA4A 2QPQA 3RUMA 4JRKA 4G8HA 1XOVA 5GAOr 3HN0A 2XXIA 2GH9A 1NKXA 4GD5A 4OEVA 3E9FA 4GXSB 4C92B 3J7AF 2RF1A 1XTDA 4M7DD 3S9LC 1BI3A 1ZJLA 2K2VA 3O6IA 2NWJA 4C92F 3X24B 4R6HA 3CC7T 2QDYB 5DYHA 4F39A 4LDWA 3CCET 3W9WA 3IR1A 1XQHA 1Y4TA 3H06B 3CCSA 3L2VA 1N76A 3TTNA 4N4GA 5HKCA 5CAIA 3UA8A 4TVRA 3KSJA 3OYYA 5GAN3 3TTMA 2RI3A 2QA4T 3J81E 3IK6B 3RLFE 3M54A 3LH0A 2AYSA 4KR5A 3P7IA 2RHUA 5F7VA 2DXYA 3BDLA 1WODA 4H67A 3HL8A 5GMKe 2UVJA 1WDNA 5I57B 4RCBA 1T0KA 3O2AA 4KHZE 4E0XA 2GCXA 4F22A 2BKDN 4XU0A 2F7CA 1XOCA 1D3KA 4MLQA 4POXA 3FXUA 1MH4A 3MPLA 5A5XA 5DY9A 1RI0A 1YJ9T 3H4ZA 4EQ9A 4IB2A 2MWPA 1P1QA 1B0LA 2BJJX 3C35A 4M75G 5F1QA 4N0AA 4PETA 1K9MC 4C0GA 3QAXA 3BBRA 1G3TA 4FIBA 3DP4A 3OQ5A 5CMKA 4G77A 1M5Q1 5GANf 4MDXA 1OIBA 3V8KA 4E47A 1Z7ME 2GFEA 1B4ZA 3HPIA 3MBPA 4XQ3A 4L6V5 3MO8A 3V8LA 1ZTYA 2G29A 2KLFA 5I2SA 5L9MA 3QIIA 1N9SA 2QEXT 4YB5A 2I3VA 4P0IA 2RINA 3CFZA 3H7MA 1Y3PA 2WSEE 1Q35A 5I57A