3MP1A

Complex structure of sgf29 and trimethylated h3k4
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
517
structure length
509
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 136
structure length 509
sequence length 517
ec nomenclature
pdb deposition date 2010-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp1A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp1A01
4ELPA 3AXFA 3PD8A 1B4HA 2OBGA 3K4UA 2H25A 4I62A 4X48A 3H3GA 3LSWA 1SI0A 4P11A 4H5GA 3K02A 2DXYA 3FASA 3DLMA 2PMSA 4OXVA 4IKFA 4KYEA 1M5FA 1MDP1 1A7LA 3S2VA 1MY2A 3OYIA 4E0WA 4I8CA 1B5JA 1OQHA 3HCQA 3S6WA 3UK4A 4BE0A 2F7AA 2VOZA 1HSJA 5ICQA 2E1SA 4KCDA 3U92A 4R75A 1XHYA 5F1QA 2EQJA 3BFTA 2E0SA 2IG0A 2GHBA 4IUUA 3L42A 4PFTA 2UVJA 1II5A 2XXUA 4R9FA 2PBWA 2PQWA 2PYYA 3OY9A 3TZAA 2D21A 4KPTA 1UTHB 3OYMA 3IJXB 3LUYA 3TTMA 3LGLA 2DS9A 2R58A 2EFIA 4ESWA 1MQHA 5CBRA 4R72A 3T9UA 2QMWA 2P0SA 3H6TA 3M8UA 2W7YA 4WKMA 3RNNA 3PNWC 1MY4A 3FVGA 2DVCA 3BKIB 4ZEIA 1PB9A 4ZEBA 2I3WA 3PMWA 5I59B 4BDYA 3MZ1A 3OSRA 1UQWA 3ZS6A 5A5XA 4DZ1A 2Q2CA 4BLAA 2RI5A 4G68B 3K6UA 2G3RA 1QW0A 1MY0A 2CMOA 4XTCQ 3B7DA 2Y7WA 2H98A 4TOZA 2YPNA 2DWAA 3FV1A 3QJ6A 4OZ9A 1IXIA 4QFKA 3KGCA 5L9OA 3O29A 4YKKA 3W9WA 4C0RA 1PB7A 1OZ3A 1YTVA 4IUTA 2VD2A 1PC3A 2AYSA 3MVWA 4QQDA 3PFSA 3T9HB 1A99A 1EH3A 2Q9TA 2QQRA 1SQYA 3PD9A 2YJPA 2RHYA 1H44A 2OCUA 3MP6A 4NF5A 5BUUA 3TKDA 2IA4A 4RY1A 1N27A 3HV1A 1CB6A 3RLFE 2P0KA 5ICTA 4WEDA 2X4XA 2RJEA 2DSFA 5FHNA 4XXUA 3Q28A 2RHXA 1SYIA 3KG2A 2F8DA 4NF8A 4ESXA 2F36A 4R2BA 5FRNA 3U72A 3KOTA 3S3NA 2B3BA 1N0TA 3MBPA 3WAEA 5BWJA 4UA8A 2DOJA 1PDAA 4RG2A 2H99A 3OO9A 2O4XB 3LLRA 4X1DA 2Q2AA 1B0LA 1Y3PA 2Q89A 1YAEA 4U21A 5ITOA 2HQEA 3TTLA 5C0MA 2QS2A 4C5IA 1H3DA 1POY1 3HHFA 2VGQA 4R9GA 4FAJA 1MH4A 2O7IA 5CMCA 5H8SA 4KQPA 3SERA 4F39A 4A4HA 4II1A 3HPIA 3PU5A 3OYBA 4E7KA 4BDNA 3OEKA 2RHIA 1Y4TA 2M8CA 2O84X 1NMUA 1HSLA 3B6QA 2VD3A 1LBBA 2V3TA 1MPCA 2NUVA 1H3ZA 5EYFA 5H8NA 3CRBA 3QUFA 2LDMA 4Q0CA 1OVTA 4U4XA 2JZ2A 4H8JA 3DP8A 4F3PA 4AB6A 5B7DA 3VV5A 5EHMA 5J39A 4E7HA 3TYHA 4OENA 2XXTA 3OYAA 4F1VA 1XC1A 5M2VA 4F22A 4JDFA 3OYHA 1DTGA 1SYHA 1LAGE 3BFUA 4IO3A 4JWOA 4B9WA 2I0BA 2V93A 3LBSA 5I57A 2R6GE 2O68A 3LGFA 4GXSB 1TWYA 3UA8A 2X7QA 4FJPA 4U23A 1NH8A 4BE1A 2XXVA 4PQJA 1IXGA 3MEVA 4GD5A 3O28A 3HO7A 4GXAA 1OQGA 1AOVA 4BDRA 1P1UA 3FLGA 1PBPA 4LA9A 4N4HA 4OHNA 3GBAA 4DXBA 2I48A 1A8EA 1JNFA 2V3QA 3ODBA 3T66A 3MZ9A 4ZEDA 3EHSA 5FHOA 3DP6A 1Q35A 2MWPA 5ITPA 5CMMA 1IZ1A 5I58B 1EZ9A 1MQJA 4F1UA 4TLLB 5TU0A 2REJA 1OMPA 4F29A 3IOUA 1SI1A 3G3IA 2RC9A 3DLNA 3RUMA 3KJ7A 4C5GA 2FA7A 3Q25A 2ONSA 3E9FA 4HCZA 1A54A 1PB8A 4LQ2A 2LTOA 1O63A 1MY3A 2QSXA 4IO5A 1SW2A 1XNIA 1RI0A 3S9LC 4PLLA 2M0OA 1SDXA 1WJQA 3C4MA 4POWA 1OZ2A 4GFRA 2XXIA 3ECRA 2H4IA 1ATGA 4F31B 3L2WA 4LUBA 2Z22A 1BKAA 3NTHA 3U8QA 4THIA 2DAQA 3FVOA 1ZBMA 3QIIA 5CC2A 3PV0E 5KCJB 3G3JA 2V25A 1AH5A 2ZYKA 4H1XA 1DOTA 3MJNA 3KZGA 3T22A 5JTYA 1FQDA 3MEWA 2D5WA 4WXJA 5CI5A 2F5XA 3SKPA 1UTBB 2V84A 4YZZA 1NNTA 3VLVA 4E7LA 3D4CA 4O3CA 1AIVA 2Z8FA 4PP0A 1BTJA 3CI8A 2A5TA 4R2FA 3TPAA 4QHQA 3EF7A 5DT6A 2HFBA 3ILUB 4U2RA 4MF3A 4Z7EA 4PFUA 1FTLA 2ZXTA 4PETA 1MPDA 3I6VA 4OFLA 1P1WA 2D9TA 1WJRA 1MM7A 2OJTA 1GR2A 1US5A 4POXA 3P7IA 5AA2A 2BJJX 3OYNA 2F5KA 1POTA 4IUVA 1T0KA 4OFOA 3FXUA 4N4GA 4OVAA 4F2OA 1F9BA 2ANJA 5I2NA 4MLQA 1S9TA 4ZE8A 3C9HA 3KSJA 3DB4A 4NF4A 1B46A 1Y3NA 4C5EA 1USYE 3OO7A 1S7YA 2R5AA 1TT1A 4LP2B 3MZBA 1A40A 3Q1JA 3H8ZA 4NF4B 1H43A 3KJTA 4RJZA 2O51A 2RJCA 1NFTA 3S9NC 3SD4A 3GZGA 3TTKA 2WACA 3WAFA 4U1OA 3FATA 3MQ9A 3IO6A 2E5QA 2ZYOA 2ZMBA 2HQ0A 5D6WA 1D4NA 3K1PA 4KCCA 4FECA 1P99A 1QUIA 1TFDA 5KCOA 1LCTA 1HSEA 3UORA 4YU0A 2O7UA 2OWSA 3ASKA 1URDA 1MQIA 1NH7A 2CKKA 3USDA 2GF7A 4PL6A 1PBQA 3E9GA 3OMBA 4QRZA 2Z8EA 3EPEA 4NF6B 4U22A 4ELRA 5DVJA 3OOAA 3NTKA 4QSEA 2Y7PA 1SW5A 2B3FA 2I0CA 3G3KA 3VLUA 4BDLA 1LB8A 5H8QB 2EKOA 3IOTA 3MP1A 5FROA 1D9VA 1ZLQA 1B0HA 2XXXA 4HCYA 3MO8A 3VFJA 3MEAA 4F3GA 2GFAA 1YPNA 3PMTA 3E13X 3H6ZA 4KHZE 3K2DA 3MW0A 4ECFA 1EU8A 1US4A 3O66A 1FTOA 1UTHA 3FJ7A 5L9SA 1QUJA 4A4EA 3FZVA 2XK0A 4RA1A 4TLMB 5JK4A 2DWHA 4L59A 3QSLA 2Z8DA 1MM6A 4G4PA 2EQKA 3O6HA 2QL3A 4DCXA 5CMKA 2L3RA 2HZKA 3LH0A 3U1OA 4I9DA 2QQSA 2Y7IA 1TXFA 2AL4A 2R5MA 1IITA 5FTHA 4DDDA 2VHAA 1GVCA 3T9VA 3T9XB 5I59A 3ME9A 2NXOA 3TTRA 2YLNA 3F11A 2OLBA 2CZLA 2VP1A 3A09A 4R6YA 4G68A 4QFPA 3IB2A 4JSDA 1B58A 4FEBA 3K1MA 3KN7A 2XHDA 1B5IA 4IO4A 4DIGA 3H7MA 4GF8A 1DTZA 2ALUA 2OZZA 2XXHA 3I5OA 5TP9B 1ZU0A 4BDOA 1EZOA 4NE4A 1S50A 4EDUA 1KWHA 3PUWE 3N5LA 1J1NA 3M3FA 4QVZA 1TFAA 2XXPA 1N76A 4DLDA 3EN3A 3LC8A 3RTFB 4F1YA 2REGA 3SEXA 3FUZA 1IIWA 1B52A 1OI1A 3KSXA 3C35A 3PUVE 3SEVA 3CG1A 4OVJA 3MPKA 5CIUA 3CG3A 1ZKBA 1A8FA 5FTIA 2UVGA 3C33A 5DTBA 5KE2A 1LAFE 2F78A 4ZS9A 4NTLA 4F3BA 3C4SA 4BDZA 1MPBA 4F19A 2PT2A 5KDTB 3OYFA 4IY6A 4N07A 2O4XA 1M5CA 2IEEA 3GBBA 4G68C 2XDPA 4WEPA 4GLIA 3VVEA 2RCBA 3PUXE 1WVJA 3O97A 3CEYA 3TCFA 3PPPA 3ZEHA 3N6TA 1B5HA 5HPQA 3OMGA 5DVFA 3MWBA 1ZIUA 5K2XA 4Z02A 3LSXA 2LVMA 3LSFB 1L5TA 3MVXA 2QPQA 3FJMA 3P8HA 4ONYA 4M4GA 3QBYA 4IUPA 3IORA 1G5VA 2I58A 4YB7A 3FD3A 2XD2A 1XVXA 3OENA 4RK2A 3E9XA 1SD3A 1GGGA 2ESNA 2P2AA 3K6XA 3RPWA 1OYXA 3S9MC 3K1NA 3CR9A 3N6UA 3O6GA 4GRKA 4YMAA 2HCAA 1LFIA 2GFEA 4G8HA 4OYVA 4EF1A 3MC2A 3META 5C6SA 1MXYA 2OWTA 4QFLA 3THIA 2RF1A 1NNFA 3O8VA 3KFMA 3V5AA 2ZNSA 3FXQA 2RJFA 4YAHX 5B70A 3H4ZA 2UYFA 2Y7KA 3SDFA 1SBPA 3U93A 2R9JA 4EXKA 2M1HA 3PPNA 3C31A 4LD6A 5TPAB 3SETA 4O3BA 2RO0A 4YKIA 1N84A 2QMXA 3HHGA 3IJOB 1IXCA 1JQFA 3RGYA 3SEUA 3QXMA 4GQOA 4Q30B 2ABHA 5I2KB 4R6HA 3QYTA 4EUOA 4H67A 2DYXA 1DPEA 1N3WA 3EQ1A 3OMCA 4IB2A 2RI3A 2Q88A 4QSCA 4YKPA 2R71A 3CSGA 3Q29A 2DIGA 4H5FA 1R6ZA 1QKBA 1XOCA 4DXUA 4QFNA 3C34A 2AL5A 1JW1A 5I58A 2G93A 2DQVA 4X9TA 2ZNUA 3S3MA 1R9QA 3UIFA 1BP5A 4N13A 2Z23A 4QSDA 3ZSFA 3IR1A 1IXHA 3MP8A 5KH6A 2PX1A 2HXWA 5D6YA 3FVNA 4AB5A 3OYKA 3FV2A 3IX1A 3K0VA 4OTEA 1B2HA 3OS0A 1N7WA 4IGTA 5CRYA 4GL8A 1B32A 1ZMGA 2ZNTA 5KZTA 3IL1B 2XX8A 5K2YA 1LBCA 3V83A 3U94A 3TQWA 4KYSA 4F18A 4H8IA 1MG1A 2P1SA 2LRQA 4ISUA 3KN3A 4IO6A 4ZZAA 5CBSA 3TCGA 4NMYA 1N3XA 3OYDA 4DE8A 5KCJA 3PPOA 4ND9A 3W9VA 1M5EA 4LQ5A 3K01A 3C36A 1DPPA 3RQTA 3RY3A 5I56B 5KE3A 4RYAA 3MEUA 4GVOA 1UTBA 4MH5A 1B7UA 4H0WA 1URGA 4QF9A 2QJEA 5AA4B 3IOVA 1GV8A 3MVYA 2NVUB 3LYIA 4LVQA 4GL0A 4ELQA 3LSLA 2QRYA 2GFUA 3OQ5A 5D6XA 3C32A 4IUQA 4BACA 4PE5B 1VSOA 2HEUA 4Q8RA 2F7BA 3O6IA 1FQAA 1NL5A 3BDLA 4OMBA 2UXAA 3QK6A 2RCAA 3PPQA 4K3FA 5DVIA 1OIBA 2GH9A 2WKYA 1VFDA 1N04A 2Q8JA 2GRVA 1NNPA 2R57A 1LCFA 3H6UA 2I6EA 5JEIA 4FIMA 3VE1B 3SEYA 3MVZA 4KYDA 3F70A 3M3LA 3QUJA 1OLAA 4HW8A 4QFOA 1XVYA 3SEWA 2X4WA 2KLFA 3R6UA 4XKNA 3TFLA 3CSBA 3H6WA 2BKDN 5H8HB 3PUYE 4MFIA 3KEIA 1MXZA 1WJSA 3P8DA 2RI2A 3IAZA 1BIYA 4IGRA 4A4GA 1AMFA 1EZPA 2I4BA 3CVGA 4C1TA 3SESA 4TQUQ 3VXBA 2ONRA 5H8FB 2Y7RA 4M1VA 3EHTA 2QS4A 2O69A 3HN0A 4EDPA 4P0GA 3TEPA 3S3OA 1R1NA 1JVYA 4G8NA 3RT6B 2Y84A 1MS7A 4IY5A 2L8DA 2DP8A 3PPRA 3FIRA 4C1UA 1D9YA 1Z7NE 3OELA 3IOWA 2RC8A 3OYEA 3ILTB 3Q27A 1WODA 4NF6A 5FRMA 3UN6A 4ZECA 4DCYA 3JYRA 3PGFA 2HQXA 5H8QA 1MRPA 5AA3A 1SSFA 3L2RA 1WDNA 3UWNA 4C5HA 4BD3A 3FXRA 3BBRA 1FTKA 2M16A 1RYXA 1B3HA 4NWDA 1NKXA 1B3FA 1QVSA 4I1DA 5IN1A 4YKJA 1SW4A 3H06B 1SVXB 3OS1A 2RJDA 4ZE9A 5EHSA 3OXNA 3W15C 3OYLA 3K6VA 3PMVA 4G2ZA 2FNCA 4QQGA 1JW5A 1JEVA 3H03A 2FHDA 2OK2A 2DE3A 1Y1ZA 2O1LA 4GWOA 3L6HA 1B51A 3OO8A 1ZTYA 2I4CA 3LR1A 1VE4A 3TTNA 3E3KA 1D3KA 3H6VA 4LONB 3MAMA 1Y20A 4HS7A 3QAXA 2DVZA 3KN8A 1M5BA 3IK6B 4JWXA 5J26A 3PMXA 5LOMA 5HBCA 5FHMA 2HAUA 3OA6A 4XKPA 2XXWA 2FYIA 3Q26A 5TP9A 5AE4A 4HCWA 3PUZE 3UP9A 4ELOA 4F2QA 3OD7A 4PFYA 5AA1A 1FQCA 1H45A 4UC4A 3DB3A 3E4RA 5ELVA 1JEUA 1JVXA 4ZZEA 2F6PA 4Q5WA 2D3IA 4R74A 3S4UA 4OESA 5A5XB 3B6TA 3OYCA 4ZTFA 2F97A 3G3FA 3T96B 1USYH 3LX7A 1B7HA 3CIJA 1B05A 1VR5A 2H9BA 1FCKA 2XXYA 3DM0A 4N4IA 3IO4A 2K3XA 3GLBA 2DE4A 2QS1A 3HSTA 2PT1A 1CE2A 3ONMA 4X1BA 2XXQA 1RYOA 2E6NA 2UYEA 3TELA 1QJMA 4U1ZA 4H6DA 5KDTA 4NS5A 4RK9A 2RHZA 2K3YA 1MQGA 2RKMA 4NF5B 4IO2A 1ELJA 1P1NA 3FGSA 3N94A 1I6AA 4BDMA 4A4FA 1VFEA 1GTKA 4F3SA 4KD5A 1FQFA 4JB7A 1B7ZA 4EXLA 3VDFA 1P1OA 2V3UA 3FVKA 4CRIA 1LSTA 4PLIA 1Y1MA 2NWJA 4NF8B 4JXIA 2DWJA 3GXAA 2EQUA 1NNKA 3OB9A 1UIUA 4XKRA 1B3LA 3CFXA 2ZYMA 1LFGA 5AA2D 1LLSA 3TDJA 1O64A 4OWDA 1LB9A 4BDQA 2X4YA 3R26A 4R6KA 4E7IA 4OEUA 4UACA 4FU6A 1ANFA 3VXCA 3KBRA 4ZEKA 4H65A 4ZDMA 1JETA 1DSNA 3D4GA 2BUDA 1B6HA 4FE8A 5ISUA 1N7XA 1ZJLA 4JSOA 4OERA 1MHNA 4RPNA 3V8XB 1LAHE 5TPAA 1UIVA 4FEDA 2L89A 2VYTA 3ZKKA 4B9XA 4KR5A 1B4ZA 1FQEA 2XX7A 4AQ4A 1QUKA 2BIVA 2LCCA 2XX9A 1Y9UA 5H8NB 4JBZA 3MUQA 4YB5A 5I2KA 3TCHA 2HAVA 2I3VA 4E0XA 2O1MA 3K00A 4OFJA 3QIMA 3B6WA 1MXXA 4LZ5A 3OYJA 4FATA 3I3VA 1YCJA 2H5YA 3G7WA 4GOTA 3FC3A 2XD3A 2LAOA 1Q1KA 3OS2A 3L2UA 3JZJA 3V89B 1B1HA 3R7XA 5M9OA 2RC7A 1MXVA 3L2QA 4IURA 1LGBC 2B65A 4G8MA 3TUSA 3IB1A 4N6PA 3A3UA 5I84A 2THIA 2A5SA 5I57B 4L17A 4EF2A 1QULA 3UT1A 4RNSA 1MDQA 1B1XA 3CFLA 2F6GA 1URSA 3S9EA 2F35A 4P0IA 4HTGA 3EHUA 4GY5A 1DMBA 3G3GA 2X35A 1H76A 3VLWA 2X26A 4LZ8A 2X7PA 4O3AA 2GHAA 2ONKE 1M5DA 1P1QA 3DELB 2QS3A 2XXRA 3OSQA 2O6AA 3OO6A 2I49A 3A3CA 2UVHA 1IEJA 1Y4CA 4IO7A 4Q5TA 5DYHA 1FW0A 3L2VA 1PEBA 4E7JA 2F34A 4GIZA 4QQ6A 2UVIA 4FL6A 2YRVA 5CM6A 3RTWB 4BE2A 1B40A 2DXRA 3TAJA 4RXLA 2AIXA 4JWYA 5I56A 2NLUA 5KCHA 1MXWA 3O2AA 3OYGA 2MWOA 5DEXA 5IKBA 1SW1A 4EQBA 5AA4A 4PFWA 1I6QA 4EQ9A 5DEXB 3G3HA 4ZEFA 4ZTJA 4LZ7A 4YMBA 3JV9A 2ZYNA 4MLVA 3ZKLA 1LAXA 3TODA 4FORA 2B8AA 1JW4A 3L6GA 3VVFA 3DP4A 4KI0E 5IAYA 5JTYB 2NOOA 4EQ7A 4MBPA 2RINA 1IQ7A 3UGWA 3N26A 3TQLA 5L9MA 4NEDA 4OETA 4NWCA 1FTMA 3FEOA 1WGSA 4R73A 5HM4B 2G29A 1LFHA 4XKQA 2A5TB 2F7CA 2PVUA 5H8HA 3IB0A 2DE2A 3O9PA 3VVDA 1Z7ME 5CMBA 1O7TA 2DIQA 1MXUA 1XT8A 2RHUA 5J1DA 5H8FA 1FQBA 1B9JA 3KOSA 4QW2A 1IUDA 1AL3A 1OVBA 3RT8A 3NTIA 1B3EA 2DWIA 4U4SA 3CFZA 2JTFA 4X34A 3TMGA 2EQMA 4G77A 3QKJA 4OEVA 5AA2B 3FDRA 4Z0IA 1KHCA 1RKMA 1XS5A 1I69A 1QKAA 3EAEA 3T93B 3RN8A 4OQOA 3M9QA 1MQDA 4LATA 1A55A 4DXCA 5I2NB 3GOXA 3FJGA 1R9LA 3OEMA 1MH3A 4RPOA 4YICA 3MPLA 4YB6A 1B3GA 3K6WA 1BLFA 4XIGQ 4KFQA 2HZLA 1FTJA 5F7VA 1Y3QA 3M3KA 3PMIA 5IAIA 5L8DA 3KUFA 1OLCA 1I6BA 1MY1A
chains in the Genus database with same CATH superfamily
4ELPA 3UF4A 2WBDA 3AXFA 4M77B 3VS3A 2C06A 3I5SA 3PD8A 4GWXA 1B4HA 2OBGA 1LBXA 3K4UA 2H25A 4I62A 4MMPA 4X48A 3H3GA 3V8KA 3LSWA 1SI0A 4P11A 2AHJB 1YYZA 4H5GA 3PIOA 3K02A 2KQZA 2DXYA 3FASA 1ZUYA 2EPDA 3DLMA 2PMSA 4OXVA 4IKFA 4KYEA 4HE2A 1M5FA 2CGHA 5A0DA 1QVFS 4M7AD 2VWFA 2HBWA 3MCAB 3TSZA 1MDP1 2CSIA 2VUBA 1A7LA 3S2VA 1MY2A 2DX1A 3OYIA 4HCCA 3UA7A 2OTLT 1IO6A 4I8CA 4E0WA 1NYFA 2A37A 5GAN4 1B5JA 1OQHA 3HCQA 3AT1B 2EKHA 3M55A 3S6WA 2FZKB 3CD6Q 3UK4A 1RABB 4BE0A 3O5ZA 2HSPA 4OGCA 2F7AA 7AT1B 2VOZA 1HSJA 4H46A 5ICQA 1FBHA 3R6OA 1VQOT 2E1SA 4KCDA 3U92A 5FLXE 4R75A 4JVIA 3I35A 1XHYA 5F1QA 2EQJA 4N17A 1M27C 5GAMe 3BFTA 2FL7A 2E0SA 1I07A 2IG0A 4MDXA 1FPGA 4OMLA 2QASA 4OMOA 4JS5A 1Q86R 2GHBA 4IUUA 2DL4A 3L42A 4MJOA 4PFTA 2UVJA 1II5A 2XXUA 4R9FA 2COYA 2PBWA 4AS4A 2PQWA 2PYYA 2K2MA 2YSQA 2COWA 1INPA 5GAN7 3OY9A 2NUPA 4FW1A 4GLMA 4C92D 3TZAA 2D21A 1M1FA 3VUZA 4KPTA 1UTHB 3OYMA 3IJXB 3LUYA 3HPWA 1Q86U 3TEEA 3TTMA 2LC4A 2LNVA 1E7OA 3LGLA 5IT9E 2DS9A 3CCRT 1M2VB 1WXUA 3H0FA 4PJOA 2R58A 2EFIA 4ESWA 1W1FA 1IMAA 1MQHA 5CBRA 4R72A 2LJ1A 1FWZA 1LOJA 5IXFA 4C8QE 2DETA 3T9UA 4CC2A 3B50A 2QMWA 2P0SA 3H6TA 3M8UA 5GJVB 2W7YA 4WKMA 1PD0A 3RNNA 4EMHA 3CC4Q 3PNWC 3CC7A 1RDXA 3FB9A 3SWNA 1MY4A 4DEYA 3FVGA 2DVCA 3BKIB 4KGZB 1AZGB 4ZEIA 2K6DA 2LQ8A 3A98A 1PB9A 2I3WA 4ZEBA 1QCFA 4KUDK 3PMWA 5I59B 4BDYA 3MZ1A 1NEBA 3OSRA 1UQWA 3ZS6A 4RG8A 3EG3A 4MZPA 5A5XA 4DZ1A 2Q2CA 4BLAA 2RI5A 4N81A 4G68B 1NUYA 1M9SA 4JRKA 2RM4A 3HKSA 3K6UA 5I11A 2G3RA 1QW0A 1MY0A 1VYVA 2CMOA 4XTCQ 3B7DA 2Y7WA 2H98A 2RNAA 2YPNA 4TOZA 2DWAA 3FV1A 3QJ6A 3RMSA 1A0NB 4OZ9A 1IXIA 2XG8D 1VQ5T 2P0QA 4FBPA 3KGCA 4QFKA 1WZOA 5L9OA 2PVDB 3O29A 4YKKA 4E7SA 1VQLQ 3W9WA 4AFUC 4X9CA 2LP5A 2EGCA 4C0RA 1UGRB 1PB7A 2YLBA 2O9SA 1Y0MA 4R55A 4PGPA 2MF2A 1OZ3A 1YTVA 4IUTA 2VD2A 4KBMB 1MMAA 1YN8A 2QA4T 1X6GA 2F3DA 4BB7A 1PC3A 4E2FB 2AYSA 3MVWA 1IHVA 4QQDA 3PFSA 3T9HB 1A99A 5ET7A 1R0BG 2QVVA 1K9YA 1EH3A 2Q9TA 2QQRA 3QDFA 1WHLA 1SQYA 1M5Q1 3PD9A 2YJPA 2RHYA 1H44A 2OCUA 2WBBA 1ZBXA 3MP6A 4NF5A 1UGQB 4JRQA 5BUUA 2WSFE 1YITT 1HYOA 3TKDA 2IA4A 1U1TA 1FPJA 4RY1A 2K57A 4MMKA 1N27A 3HV1A 3VRZA 4C8QD 1CB6A 3RLFE 2P0KA 4M77F 5ICTA 2F2WA 5GAOq 4XQ3A 2WYPA 3TVTA 4WEDA 3HTRA 2X4XA 1MV0B 2VKNA 1JO8A 3RMQA 2RJEA 2DSFA 4XU1A 4PJOC 5FHNA 4XXUA 4KULA 1FYNA 4M77G 2CREA 1QVFP 3Q28A 2RHXA 1Q81U 1SYIA 3KG2A 3SEMA 5FU7C 2F8DA 4NF8A 3M53A 5LJ3f 4Z88A 1GBRA 2Y5LA 3JAME 4ESXA 1PNJA 2F36A 4R2BA 3SWNC 4PK4A 5FRNA 3U72A 2DILA 2JMCA 3KOTA 2A0FB 1QP2A 5AT1B 3G4SA 5DM7R 3S3NA 2B3BA 4FM4B 4J9GA 1N0TA 3MBPA 4N4UA 4JJCA 3PTAA 4O8MA 4UA8A 3WAEA 2D8JA 2DOJA 5BWJA 4DBRA 3TREA 5KYWB 2LX9A 1PDAA 1WA7A 4RG2A 2KAFA 2H99A 3OO9A 2O4XB 2L3QA 3LLRA 2Q2AA 4X1DA 1TG0A 1B0LA 2EJGA 3KBGA 2BJIA 3EGDA 4M75B 1Y3PA 2Q89A 2Y4XA 1PHTA 1YAEA 4U21A 5ITOA 2FZGB 3CCUQ 1ZA2B 4M7DE 2GQVA 2HQEA 1FRPA 3SZPA 3TTLA 5IM2A 1ABQA 5C0MA 1GRIA 2QS2A 4C5IA 2BTTA 3M0TA 1H3DA 4NN3A 1POY1 3HHFA 4E47A 2VGQA 4R9GA 1D3BA 1M3CA 3EG9A 1AWOA 4FAJA 2AZSA 1MH4A 2HEQA 2O7IA 1SF9A 5CMCA 2FG0A 5H8SA 2GQIA 4ELYC 4J7IA 4KQPA 3JCMJ 1RLPC 3SERA 1I8FA 4F39A 4A4HA 4II1A 3HPIA 3VS4A 3PU5A 3OYBA 4E7KA 4BDNA 3OEKA 3FXBA 2C0IA 3EG2A 4KH1B 2QFLA 3U23A 2HAXA 2RHIA 1Y4TA 2VV5A 2M8CA 3I55T 1JXMA 3CC7T 2O84X 2P4RA 3OSVA 1NMUA 2D0NA 1HSLA 3B6QA 4XU0A 3RUXA 2JMAA 2VD3A 1LBBA 2V3TA 2KVQG 1MPCA 2NUVA 1H3ZA 5EYFA 3KC0A 1D0YA 1UTIA 5IHNA 1Y57A 1LNXA 3CCST 5H8NA 3CRBA 3QUFA 2LDMA 1K9MC 4Q0CA 1OVTA 2EYXA 4YTLA 2JZ2A 2F3BA 4U4XA 4H8JA 4JS4A 4N6KA 3DP8A 4PKCC 4F3PA 4R0KA 4AB6A 1VOMA 5B7DA 4RCCA 3VV5A 3H9NA 1W4SA 5EHMA 5J39A 1YJNT 5EC7A 2J6FA 3FBPA 4E7HA 2CZ0B 3TYHA 4OENA 2XXTA 3OYAA 4MZTA 2DXUA 1UHFA 2O2OA 1XC1A 1IMDA 4GBVA 5M2VA 2A7YA 4F1VA 4OVTA 5IZ3B 4F22A 4JDFA 2HQHA 5GAOm 4P5NA 5CR2A 3OYHA 1DTGA 4NX1A 3CC7Q 1SYHA 5IGAA 4XAXB 1LAGE 3BFUA 3NFCA 4IO3A 4M7DD 2WX9A 2FYKA 5GMKm 2SEMA 4JWOA 4B9WA 1PRMC 2I0BA 2V93A 1AWJA 2CUBA 2KMTA 3LBSA 4EMKA 2HMAA 1NI9A 1MUZA 1G0HA 2R6GE 5I57A 2YT6A 3UPUA 2O68A 5CKBA 3LGFA 3CCJT 2KXDA 2ZZVA 4J7FA 3EFRA 4GXSB 2DL7A 1TWYA 4JVDA 3UA8A 2X7QA 4FJPA 4U23A 3V8JA 2JXBA 2RF0A 2QGFB 5I2MA 1GCQA 4M7AB 4BE1A 1NH8A 1M30A 2XXVA 1IXGA 1GCPA 4OANA 4PQJA 4OGEA 3MEVA 1VQNT 4GD5A 3M4YA 3O28A 3HO7A 2EYYA 4GXAA 1OQGA 2V8KA 4PJLA 3EHRA 4A4KA 1FBFA 1Y07A 1AOVA 4BDRA 4LDWA 4B6MA 1P1UA 5IXBA 5L23A 3FLGA 1D1AA 1PBPA 4LA9A 1YI2T 5HY6A 4N4HA 4OHNA 3GBAA 2SRCA 3M57A 4DXBA 4M78B 2I48A 3VU3C 2DYBA 1B7TA 1A8EA 1JNFA 2V3QA 2O9VA 3ODBA 3T66A 3MZ9A 4PF6A 4ELZC 1KK7A 5KYYA 1VQ7T 4ZEDA 3EHSA 3CCMT 2J6KA 4DBFA 5FHOA 1JP4A 3DP6A 1Q35A 2MWPA 4GWYA 2F69A 3G4ST 2VXFA 2XI9A 3JB9D 2HDAA 5ITPA 1TS9A 5CMMA 1IZ1A 2DL3A 5I58B 2YRCA 1EZ9A 1MQJA 4WF2A 4N15A 2PTKA 2EYQA 3QWXX 4TLLB 5TU0A 2REJA 4F1UA 1OMPA 4F29A 1SPIA 4NG7A 2F5TX 4PBQA 2NUTB 4CC7A 3CCQA 1SI1A 2R8TA 3IOUA 1Q9DA 2KNBB 3G3IA 2RC9A 3DLNA 2RK2A 3FIFA 3QXEB 3RUMA 3G71A 3KJ7A 3INZA 4FYVB 2KRSA 3X28B 4C5GA 1W2BP 2FA7A 1K9MR 3MHXA 2ONSA 1YNZA 3Q25A 3E9FA 4HCZA 1SG5A 5GAMh 3VV0A 4PJOD 1A54A 1PB8A 3QMFA 4LQ2A 1SRLA 2A28A 2D0QB 1FBEA 2LTOA 2RPNA 4OA4A 2MYSA 1O63A 1MY3A 2DD5A 2QSXA 4NL2A 1UB4A 2CYZB 4M75G 4IO5A 4FT2A 4RTZA 1XNIA 2CP2A 1RI0A 1SW2A 2E1HA 1NV2A 3S9LC 1JB0E 1K9MU 4PLLA 1QLYA 3CMEA 2M0OA 2ZPGB 4OMFB 2PFZA 1SDXA 1WJQA 3JCMP 2ENMA 3C4MA 4POWA 2EBPA 1OZ2A 2EIFA 3BDUA 3M59A 4EMKC 3IFAA 3WVDB 4GFRA 3EGXB 2XXIA 2QQ9A 2QEXA 3ECRA 1CKBA 1ACMB 2MOXA 2H4IA 1ATGA 1IGQA 2QAZA 4F31B 3L2WA 4LUBA 2DVEA 1EIFA 3QPHA 2Z22A 1BKAA 1GCQC 3NTHA 3U8QA 4THIA 2DAQA 2V1RA 3FVOA 3RPLA 1VQKA 1ZBMA 4HXJA 3LW5E 3QIIA 2K7AA 4M78C 5GAN5 5CC2A 2DO3A 3PV0E 5KCJB 2DA9A 1S72Q 3G3JA 3UA6A 2EGEA 1XQHA 2MIOA 9ATCB 2V25A 3UDCA 2DRMA 1AH5A 2ZYKA 3GF5A 2OTLA 1AHJB 2JJKA 3JV3A 4H1XA 2K4YA 2X3XD 1DOTA 2CZIA 3MJNA 3KZGA 3T22A 1PSFA 5JTYA 1FQDA 1G3WA 3MEWA 2D5WA 4WXJA 5CI5A 4J9EA 3HSBA 2F5XA 1VQOA 8ATCB 4O94A 3SKPA 1X6OA 1UTBB 4P3LA 2HNIA 4RTWA 1AZEA 3LH5A 5D7UA 3JB9I 2V84A 3NMZC 1NUZA 4KXPA 4YZZA 1NNTA 4F7UF 3VLVA 4E7LA 1BIBA 1C0MA 3D4CA 4HA8A 4O3CA 3T0JA 2COZA 3E79A 1AIVA 2Z8FA 1R8OB 4PP0A 5KYUB 1K0XA 4PDHA 1BTJA 3CI8A 2A5TA 4R2FA 3TPAA 3H0HA 2DBKA 4C8QB 1KJWA 4F7UG 1OPKA 2OI3A 3FJ5A 1XI6A 3EF7A 4QHQA 2HFBA 4HXVA 5DT6A 4AFSC 4N8YA 2KQWA 3ILUB 1OULA 3NOHA 5ECAA 1QCOA 4U2RA 4A54A 1TH7A 4BI3A 4MF3A 2H3EB 4Z7EA 4PFUA 5EG2A 1FTLA 4NHBA 2ZXTA 4PETA 3GIBA 1MPDA 3OW2A 3QG1A 5LJ3d 4DQ2A 1IMBA 4M7AF 3I6VA 4OFLA 1P1WA 2D9TA 3EH2A 1WJRA 1MM7A 2HPGA 2Y5KA 1X2KA 1ZQ1A 2OJTA 1GR2A 1US5A 3ISPA 2P0PA 4M7AG 4POXA 2IPOB 3P7IA 3EKIA 5AA2A 2BJJX 3OYNA 1O9SA 2F5KA 1POTA 4IUVA 1T0KA 1BI3A 4OFOA 3FXUA 4N4GA 1VQMT 5LJ3j 3VS1A 4OVAA 1RAHB 1I0CA 4F2OA 1LVKA 1F9BA 4PJJA 2EWNA 3EHQA 4M78G 2ANJA 4MLQA 4DBQA 1S9TA 3CCQT 4ZE8A 5I2NA 3C9HA 1LPLA 3KSJA 3DB4A 1JBMA 4NOYA 1WHHA 1X01A 4LDUA 3G71T 1B46A 4NF4A 1ZSZB 4C92F 4C5EA 1Y3NA 1YFNA 5LJ3g 1USYE 3OO7A 1S7YA 2R5AA 2QQAA 4KGVB 4XTYA 1TT1A 3MZBA 4LP2B 2DJQA 2M02A 2L2PA 1NJIC 1A40A 3QDRB 3Q1JA 4P9KA 3VS0A 3J7AF 3HFNA 1VQ5A 1N6AA 3H8ZA 4NF4B 1H43A 5CCAA 4C92E 3KJTA 3RKXA 4RJZA 2O51A 5FU6C 4JRPA 2RJCA 1NFTA 2XHCA 3S9NC 3SD4A 1NV1A 3GZGA 5LJ5h 3TTKA 2WACA 2QA4A 2E6ZA 3WAFA 3FATA 3CMET 4ATOA 3MQ9A 4U1OA 1WQ7A 5CKFA 1ZLMA 3IO6A 2E5QA 2ZYOA 3QZ5B 4M77A 1NV3A 2ZMBA 2HQ0A 1UECA 1WQWA 2C0OA 2PZ1A 5D6WA 1D4NA 2YUQA 2QI2A 1IZ6A 1FTAA 2Y90A 2DD4A 4PNOA 3G7ZA 5HCKA 3K1PA 3CCQQ 1K73C 4KCCA 2ECZA 4FECA 1HJDA 1M1KC 3CBMA 1YITA 1P99A 1QUIA 1TFDA 5KCOA 3G71Q 1LCTA 1Y71A 2DF6A 2OX7A 1AOJA 1HSEA 3UORA 4YU0A 2CZ7B 2O7UA 2LZ6B 2NWMA 2OWSA 4PC9A 1P92A 2X9HA 2EQIA 2YXYA 4LDVA 2DTHA 3ASKA 4C0ZA 1T0JA 3CCEA 1K0SA 1MQIA 2CKKA 1NH7A 2GF7A 3USDA 1KC8C 1VQKT 2MKZA 2FIXA 5LJ5f 1JRIA 1MNDA 4PL6A 1PBQA 3E9GA 1Y7XA 3OMBA 2FRWA 3C94A 1BU1A 4QRZA 3JCMW 2Z8EA 4RTTA 3EPEA 4NF6B 4U22A 4ELRA 5DVJA 1BCMA 1WHKA 3OOAA 3NTKA 1W70A 4QSEA 1FSAA 2Y7PA 2M0YA 5ESYA 4M7DB 1KQSA 4PCDA 1SW5A 2B3FA 3CMEQ 2I0CA 3G3KA 3VLUA 4BDLA 2MPXC 2VXEA 1LB8A 5H8QB 2EKOA 1D0XA 4RTXA 3MP1A 1URDA 3IOTA 2CP0A 5FROA 1D9VA 1ZLQA 4LNPA 4XU3A 1BI2A 1WNLA 1B0HA 2XXXA 4HCYA 3MO8A 3VFJA 3MEAA 2E10A 2JM8A 2QEXQ 2BZYA 2KRMA 3EGUA 4F3GA 3J81E 2GFAA 2JN0A 4C0FA 1YPNA 4J9CA 1D1BA 3BE3A 2PU9B 3OW2S 3PMTA 4NAPA 1IXDA 3E13X 3H6ZA 4KHZE 3K2DA 3MW0A 2RH2A 4ECFA 1D09B 2DEUA 1EU8A 1US4A 3O66A 1FTOA 2MAMA 1UTHA 3FJ7A 2E65A 1Q81C 2PUOB 5L9SA 3M56A 1QUJA 2OX3A 2L0AA 4A4EA 3CHGA 3FZVA 2XK0A 4RA1A 4TLMB 5JK4A 3SDZA 2DWHA 5FBPA 3JRZA 1M2VA 4L59A 6AT1B 3QSLA 3E78A 2Z8DA 1MM6A 4G4PA 5GAN8 2EQKA 1G3SA 1K9ZA 2GGRA 3O6HA 2QL3A 4DCXA 2OTLQ 1KA1A 5CMKA 2L3RA 4C8QF 5GAOr 1KHIA 2LNHB 4BY6B 1NJIR 4I3EA 2HZKA 3LH0A 3U1OA 3VS2A 4I9DA 2QQSA 2JUFA 2Y7IA 2OTJT 1VQOQ 1TXFA 4C8QG 2P84A 2AL4A 2R5MA 1IITA 2EGAA 1IB8A 5FTHA 1NEGA 4DDDA 4M77C 4JZ3A 2VHAA 1GVCA 3X20B 3T9VA 3T9XB 4NF0A 3I55A 5I59A 1IRXA 3ME9A 1AWBA 1RACB 2DDKA 1NJIU 2NXOA 5IHKA 2QTXA 1NV4A 5EQAA 3TTRA 2YLNA 1TUCA 2OLBA 4OB3B 2CZLA 2HHMA 2VP1A 3A09A 3F11A 3OBYA 2AZVA 4G68A 4QFPA 4R6YA 3IB2A 4JSDA 5EQ9A 1B58A 3SB2A 1FMKA 1FPLA 3CCSA 4FEBA 3K1MA 4LDYA 3KN7A 1UGVA 2XHDA 1B5IA 4IO4A 1KQ2A 1K73R 3H7MA 1W2BA 4DIGA 3CPWS 3JCMh 1M3BA 2FB7A 1M1KR 1RLQC 2JS2A 1DTZA 2ALUA 4GF8A 2OZZA 3CCLA 4F14A 1QWFA 4PE3A 2AIRB 2RMOA 1H8KA 2XXHA 2ED0A 3GPLA 3CCRQ 3I5OA 1YJNA 5TP9B 1ZU0A 4GX3A 1KC8R 4BDOA 3KBZA 2XWIA 1EZOA 1K73U 2E41A 1S1NA 5CKEA 4NE4A 1M1KU 1S50A 4EDUA 1KWHA 5I22A 2WEFA 1SPKA 1J1NA 3N5LA 3PUWE 2JOYA 3M3FA 2HBPA 2OWZA 3PGGA 4QVZA 4XTVA 1KC8U 3JCMf 2ZCFB 1TFAA 2XXPA 1N76A 2J6OA 4DLDA 3EN3A 3LC8A 4DBHA 3RTFB 4F1YA 5I2SA 2REGA 1RDYA 1AT1B 3FUZA 3SEXA 4GBWA 1IIWA 1B52A 3CCJA 1OI1A 1G8XA 1KQSS 3KSXA 2CEXA 2VT5A 3C35A 3PUVE 3SEVA 3CG1A 4OVJA 1UE9A 3MPKA 5CIUA 4RMOA 3CG3A 3A1PA 1ZKBA 1QKWA 2KROA 1Q81R 4QSCA 2LCSA 4BY6C 1VQNA 1A8FA 3JB9J 1JJ2A 4QVDA 4N91A 5FTIA 3CCET 1M90C 4AFQC 2UVGA 4WTOB 2MI6A 1VQ5Q 3B8BA 1MGQA 3C33A 5DTBA 1QMCA 4O6JA 5KE2A 2WSEE 3CXCA 1LAFE 2F78A 3RR6A 2VVKA 2DTOA 8AT1B 4ZS9A 1WX6A 4NTLA 1YI2A 4F3BA 3C4SA 2XDDA 4X9DA 2W10A 4BDZA 2KR0A 4GX6A 2FPFA 1MPBA 4F19A 3A5ZB 5CKHA 4OMMA 1YJWT 4JJBA 1RAGB 5CK9A 2QA4Q 2PT2A 2AK5A 2DBMA 2E70A 3X26B 2KEAA 1VQ7A 5KDTB 5KYWA 3OYFA 3CCMA 4IY6A 4N07A 2O4XA 1M5CA 1GBQA 1NUWA 1Y96A 1X2QA 1PC0A 4M75A 5CVIA 1M1GA 2HL3A 2XICA 2IEEA 2ED1A 2K79A 2EVRA 1QVGA 4M7DF 3GBBA 4G68C 2VPOA 1YCYA 2XDPA 4OVPA 4WEPA 1YCSB 4C0DB 1YITQ 1NM7A 1Y96B 4GLIA 3VVEA 2RCBA 5EYHA 3PUXE 1WVJA 4O7IA 3O97A 3CEYA 4M7DG 3TCFA 4AG1C 4TVRA 3ZEHA 3N6TA 3PPPA 5GANh 1B5HA 5HPQA 2GTJA 3OMGA 2RQUA 4H45A 5DVFA 2CH4W 4IIOA 3MWBA 1N9SA 2FVUA 5CQYA 1ZIUA 2QVUA 4Z02A 5K2XA 3LSXA 2LVMA 3LSFB 1L5TA 4HVWA 3MVXA 2QPQA 1VQ4T 1UDLA 3P8HA 1K1ZA 3FJMA 4RTYA 3QBYA 5CO7A 4M4GA 4ONYA 1WXBA 2F2XA 2GCXA 1HSQA 4IUPA 3IORA 3EFSA 1G5VA 2I58A 1I6BA 2OJ2A 1LBVA 2V4CA 2CZHA 4YB7A 3FD3A 1Q95G 2XD2A 4ZGJB 1XVXA 2DRKA 3CCVT 1B07A 3OENA 4RK2A 3E9XA 4M4ZA 1SD3A 1GGGA 2ESNA 2P2AA 4P1LA 2J7IA 4P1EA 5GANf 1Q82C 4ANJA 2FZCB 3K6XA 3VJPA 3RPWA 1OYXA 3S9MC 2BE7D 3K1NA 1SRMA 5GAN2 3VS6A 3CR9A 3N6UA 3JB9F 3O6GA 4GRKA 2P4TA 4YMAA 4XTZA 1MMNA 2HCAA 1LFIA 5GMKi 2GFEA 4G8HA 2ZPBB 4OYVA 1KA0A 4EF1A 3MC2A 2DVJA 3CC2T 1V76A 2Z0WA 3META 5C6SA 3QHSA 1MXYA 5GMKh 2OWTA 4QFLA 3THIA 2RF1A 1NNFA 3D7SB 4J6YA 3O8VA 1XJWB 3WXMB 3REBB 3KFMA 1YBYA 2RK1A 3V5AA 3CPWP 2ZNSA 3VRYA 2V8JA 2RJFA 3CCLT 2XWOA 3FXQA 4YAHX 5ET6A 5I3SA 4PDDA 5A2QE 5IZ3A 4OB0B 2QDYB 5B70A 4F7UA 2XWVA 3H4ZA 1M90R 1GFDA 2UYFA 2Y7KA 3SDFA 2FPDA 1SBPA 1OV3A 3U93A 1H92A 2QDLA 2R9JA 4DI4B 3HRSA 1O75A 4EXKA 2M1HA 4LN2A 4F7UB 3PPNA 3C31A 4LD6A 5TPAB 3I55Q 4PJMA 3SETA 1VQ8A 1N8RC 4PJOE 2CS7A 4M75C 4O3BA 4D8KA 2RO0A 3OSSC 2XWKA 3PTYA 2F2VA 4YKIA 1M90U 5T3JA 4PFIA 4QBAA 1N84A 2QMXA 3AHUA 4XK8E 4D8DA 2A36A 4OVSA 3HHGA 3IJOB 3URGA 3CCSQ 1IXCA 1UG1A 2BZXA 4M7AA 1JQFA 3RGYA 3SEUA 4J9BA 3QXMA 4GQOA 4Q30B 4IIMA 1HD3A 4PFOA 2ABHA 4F17A 5I2KB 2Q8MA 4R6HA 4FYYB 1U3OA 2Q74A 4LN5A 4P47A 3QYTA 4EUOA 4BUGA 4H67A 2DYXA 1YJNQ 1DPEA 1N3WA 3M0PA 3EQ1A 3OMCA 3GBQA 4IB2A 2RI3A 1VDWA 2Q88A 3PVLA 3CMAT 2R71A 4M78A 1FMWA 3V7SA 3CSGA 3Q29A 4KRTA 4YKPA 2DIGA 1NUXA 5I5PA 4H5FA 1R6ZA 1QKBA 1XOCA 1TTHB 1QQJA 2DPPB 2DZCA 4DXUA 2KT8A 4QFNA 2XA5A 3C34A 1B34A 1UGSB 2AL5A 1JW1A 2KBTA 2CP6A 4ZN3A 4MNIA 5LJ5j 1BK2A 1VQPT 4L5GA 5I58A 2G93A 2DQVA 1VQ9A 4X9TA 2JVVA 1B34B 3J80E 2ZNUA 3S3MA 1R9QA 2NUTA 3UIFA 1VQMA 3CCJQ 1BP5A 4N13A 2Z23A 1RDZA 4QSDA 3ZSFA 5LJ5g 4C92B 1Q82R 1V29B 3IR1A 2CSQA 2DZ9A 5GJWB 1IXHA 3KXTA 4GLKA 1PM3A 4EMGA 4FW2A 3MP8A 1UJYA 2YHTA 4J6XA 1SEMA 2WSCE 2IIMA 5KH6A 3RKYA 1VQNQ 2PX1A 2MMPA 1IHWA 2HXWA 1ZUKA 5D6YA 1PKSA 2GBQA 1AEYA 3FVNA 4ZN1A 1WI7A 4AB5A 3OYKA 2LQWA 3FV2A 5ET8A 3BFMA 1NZ9A 2D8HA 4J6WA 2L3PA 1XTDA 3RESA 3IX1A 2KT1A 1Q82U 3JCMb 1FBCA 4FYXB 3K0VA 1B2HA 3OS0A 4FSSA 1YI2Q 1N7WA 4OTEA 4IGTA 5CRYA 3HRTA 2KSSA 4GL8A 1M3AA 1B32A 2P3VA 1ZMGA 2ZNTA 3LV0A 5KZTA 1LCKA 3IL1B 1VQ7Q 2XX8A 5K2YA 1LBCA 3V83A 3CCMQ 1M2OA 3U94A 4XTXA 3EGXA 3PE0A 1X27A 3TQWA 3G4SQ 5LL6S 3G6ET 4D6WA 4KYSA 3EH1A 4AMCA 5DY9A 1WDXA 1IMFA 4F18A 4H8IA 1N8RR 4BI4A 1MG1A 2P1SA 2LRQA 4M7AC 4JRIA 4ISUA 2K2VA 3ZFJA 3KN3A 2EYWA 5GAMf 5LJ3e 4IO6A 4FIBA 1XOVA 4ZZAA 5CBSA 2ZPHB 3TCGA 4F04B 4NMYA 1N3XA 3OYDA 4DE8A 5KCJA 1VIFA 3PPOA 4ND9A 2DTIA 1EYJA 1PD1A 3W9VA 1M5EA 4LQ5A 1N8RU 3K01A 3OYYA 3C36A 1RADB 1DPPA 3RQTA 4Y28E 1ARKA 2E12A 3RY3A 5I56B 4J9DA 4JVCA 5KE3A 2K5LA 4PFRA 4RYAA 1PRLC 3QWYA 3MEUA 4GVOA 1UTBA 4MH5A 4ME7A 3E19A 1W6XA 1B7UA 4H0WA 1URGA 2EAYA 4QF9A 2KK4A 3JCMd 4MDWA 2QJEA 2HXRA 5AA4B 3IOVA 2FHYA 3MVYA 1GV8A 2NVUB 1VQ8T 3LYIA 4LVQA 4GL0A 4ELQA 4XFEA 5KYUA 3LSLA 1D0ZA 4NL3A 3U65A 5EYGA 2QRYA 4C8QA 1T0HA 1G3YA 3KFVA 1VQ6T 2GFUA 3OQ5A 5D6XA 3R6NA 3QUIA 3C32A 4IUQA 4BACA 4PE5B 1VSOA 2HEUA 4Q8RA 4J9FA 2F7BA 3A8OB 3O6IA 1FQAA 3SHWA 1DBZA 4I3YA 1NL5A 3BDLA 3EG1A 4OMBA 2QXFA 5CKDA 2A3LA 4A63B 4KT0E 2UXAA 5IH2A 3QK6A 2RCAA 1X75C 3PT9A 3PPQA 2D6FA 1QVFA 1LEVA 4K3FA 1OIBA 4MHFA 3JCMg 2GH9A 5DVIA 3JCMc 4ORZA 3GP8A 2WKYA 1NBEB 3VS7A 1N04A 1VFDA 2Q8JA 2GRVA 1NNPA 2R57A 1LCFA 3H6UA 2LJ0A 2I6EA 1MNEA 2OTJA 5JEIA 1T3LA 4FIMA 3VE1B 3SEYA 2DM1A 1VQ8Q 4JJNK 3MVZA 4KYDA 4XF5A 3F70A 3H41A 4M75D 3M3LA 4OVQA 2QK0A 3QZ9B 3QUJA 1OLAA 1VQ9T 4HW8A 2YWWA 1BI0A 1UGPB 1Z9QA 4MZMA 4QFOA 1XVYA 3SEWA 2X4WA 2KLFA 2KR3A 3R6UA 1JU5C 2E3IA 2DJZA 3REAB 4XKNA 4RTUA 3TFLA 1BBZA 2D1XA 3CSBA 4CC3A 3H6WA 2BKDN 5H8HB 3PUYE 1Z9ZA 4HVVA 1ZSZA 4MFIA 3KEIA 1MXZA 1WJSA 3P8DA 2RI2A 3IAZA 4CI0C 1VQLA 1BIYA 4IGRA 4A4GA 1FPKA 1OEBA 1AMFA 1EZPA 2I4BA 1YJ9T 2DEQA 3CVGA 4MAGA 4C1TA 2XIDA 3SESA 4TQUQ 2E3HA 3FRNA 3VXBA 1FXXA 2ONRA 3WVEB 5H8FB 2Y7RA 4M1VA 5GAOn 3EHTA 2XDBA 4GX4A 2QS4A 2O69A 3HN0A 4EDPA 4C92G 1K8AC 4P0GA 1X6BA 3TEPA 3S3OA 1R1NA 1WPYA 2X51A 4KGXB 1NYGA 5GANd 1VQ9Q 4C0GA 1JVYA 2L3SA 4PAIA 1OX9A 2BZ8A 5GMKl 4G8NA 3RT6B 3ER0A 2H3JA 2Y84A 4HE0A 1MS7A 4IY5A 2JTEA 2L8DA 1M4ZA 4C8QC 1VQMQ 2DP8A 2GQ1A 3PPRA 4J9IA 5I7IA 3FIRA 4C1UA 4JZ4A 5LTCA 1ZBJA 4PJNA 5IZ1A 1D9YA 1J3TA 2ZZXA 2QGGA 1Z7NE 3QYGB 3OELA 3IOWA 2XMFA 4LD9K 4F16A 2KXCA 1TOVA 5GANj 2RC8A 3OYEA 3ILTB 2J06A 2B4MA 2KY9A 3EG0A 1NV7A 3Q27A 1WODA 4J83A 4P56A 4JPBW 5HK0A 1IMEA 3CD6T 4NF6A 1EYKA 3X24B 2CZ6B 4Z8AA 2PUKB 5FRMA 3UN6A 3HFOA 4ZECA 3C95A 4DCYA 2M9UA 4M7DA 3JYRA 5KYXB 3V7CA 3PGFA 2HQXA 5H8QA 5GANg 1BYMA 1MRPA 5AA3A 1SSFA 3L2RA 1WDNA 2V8IA 3UWNA 1R77A 1FX7A 4C5HA 4BD3A 3A8LB 1YJWA 3FXRA 3BBRA 1FTKA 2M16A 1RYXA 1B3HA 1TWBA 2DXCA 3CCUA 4MMLA 1N5ZA 4NWDA 1I4K1 1NKXA 4AFZC 1B3FA 4GWWA 4MEVA 2M51A 1QVSA 3NHNA 2VC8A 4I1DA 5IN1A 1WLPB 4YKJA 1MMDA 2QVRA 1SW4A 1ZA1B 1U1SA 2L5QA 1KD1C 3H06B 5GAN3 1ZSZC 2ROTA 3OS1A 4HVUA 2RJDA 1SVXB 1PG5B 5EQ7A 4ZE9A 5EHSA 3OXNA 2YDLA 2O88A 3W15C 4N0AA 1K4US 4EIKA 5GMKj 3OYLA 3K6VA 3PMVA 4G2ZA 2B86A 1K9AA 1VQKQ 4E6RA 2FNCA 4QQGA 1JW5A 1JEVA 3H03A 2FHDA 4M78D 2GTOA 2NUZA 3M0UA 2OK2A 2MK5A 2CEYA 2DE3A 3QO3A 1Y1ZA 3VYGA 3CC4T 3VUBA 1NV6A 2O1LA 4GWOA 1VQ4A 4BI8B 2FIEA 3L6HA 1B51A 3OO8A 1ZTYA 2I4CA 3LR1A 2HL5C 4EPCA 2FBPA 1VE4A 1I5OB 3TTNA 1WXTA 3E3KA 3IFCA 1D3KA 1OX8A 3H6VA 4OMNA 1K8AR 3THKA 3CCVA 3MAMA 4LONB 5FWBA 1LBWA 4MCOA 1Y20A 1YWOA 4HS7A 3QAXA 2NUPB 1MMGA 2DVZA 3KN8A 4PFZA 1NV5A 4FT4A 3DKMA 1M5BA 1NPPA 1OPLA 3TCJA 2RA2A 5J26A 2P3NA 3IK6B 1DCUA 4JWXA 1Q7YC 3PMXA 5LOMA 1YIJA 5HBCA 5FHMA 1K8AU 3L2ZA 2HAUA 3OA6A 4XKPA 1BI1A 4AG2C 1KZ8A 1D9QA 2XXWA 4R56A 2FYIA 4HE1A 1WIEA 3CC2A 1VQLT 3Q26A 5TP9A 5AE4A 4HCKA 4DA4A 4PJOB 4HCWA 3PUZE 1AD5A 4OMQA 5LDZA 2CUDA 3UP9A 4ELOA 4F2QA 3OD7A 2CP3A 1JEGA 4PFYA 1UFFA 4M7DC 5AA1A 1C6VX 1SKUB 5FU7B 1FQCA 4J5YA 1H45A 1RUWA 3A8HB 2PVGB 4UC4A 2ZPFB 3DB3A 4PBHA 3E4RA 2OTJQ 3SWNB 2VASA 5AYFA 3BW1A 4Z89A 5ELVA 1JEUA 1JVXA 2F1LA 2LQKA 2PNIA 1UEBA 4ZZEA 4JDSA 1SHGA 1NV0A 2F6PA 4Q5WA 3P8BB 3TU4K 2D3IA 4R74A 3S4UA 1C1AA 3M0RA 4OESA 2O01E 5A5XB 3B6TA 1HXDA 3OYCA 5GAMd 4ZTFA 2F97A 3G3FA 4PTKA 3T96B 1T3SA 2K3BA 1USYH 2K5IA 1RAIB 3LX7A 4GWZA 1B7HA 3CIJA 1B05A 2RQWA 3QJYA 1VR5A 1QKXA 2H9BA 1X69A 2FRYA 4N0AC 1FCKA 1EFNA 2XXYA 3DM0A 3M58A 4N4IA 1KD1R 2A08A 3IO4A 4HCBA 2K3XA 3GLBA 2DE4A 3DLLA 4GWSA 1UHCA 2QS1A 3HSTA 2PT1A 1CE2A 3ONMA 4X1BA 3RBBB 2KI7A 2XXQA 1RYOA 2E6NA 5GAMj 2UYEA 3CMAA 3TELA 1QJMA 4U1ZA 1PKTA 3LWHA 5GAN6 1KD1U 2G6FX 4H6DA 5KDTA 1LBYA 5LJ3h 4NS5A 5DLOA 4LXCA 1SHFA 4GBQA 2ROLA 2RHZA 4RK9A 2FEIA 2K3YA 1YHQA 3MSTA 2CDTA 2DKGA 1MQGA 1VQPA 5GAMg 2RKMA 2YUOA 5HK3A 5J3BA 4JLGA 4JJDA 4FYWB 3CCUT 4J9HA 1KFZA 4NF5B 4IO2A 5F24A 1ELJA 2DERA 1P1NA 3FGSA 3N94A 3C12A 2CZKA 1I6AA 1AVZC 4BDMA 4K11A 4A4FA 4DEXA 1EYIA 1VFEA 5J16A 1GTKA 4PAFA 2LX7A 3GLXA 4MNPA 4N8GA 4XEQA 3MKDA 2EYZA 4F3SA 4KD5A 4M77E 4ZNXA 1FQFA 1QGXA 1PWTA 4IR8A 3OW2P 3C0CA 4XU2A 2EJFA 4JB7A 2KYMA 1B7ZA 1Q7YR 5DW8A 4EXLA 3VDFA 1CSKA 1P1OA 3CCEQ 2ZGWA 2V3UA 3FVKA 3QSUA 4CRIA 4OMPA 4RTVA 4QT7A 1LSTA 4PLIA 1Y1MA 2PVOB 2NWJA 4NF8B 2CT4A 2DWJA 4JXIA 4PAKA 3GXAA 3V7RA 2EQUA 1NNKA 3GYYA 3QYHB 2L5VA 3OB9A 2QYZA 3LWIA 1UIUA 1YJWQ 1VIEA 1Q7YU 4XKRA 1B3LA 4ZGDB 3CFXA 2ZYMA 2DK3A 1LFGA 3TSWA 3M54A 1HK9A 1W2BS 3T9NA 5CAIA 5AA2D 1LLSA 3JSCA 5LJ5e 3TDJA 1O64A 4OWDA 3EGDB 3G6EA 1LB9A 4BDQA 2KGTA 3A29A 2X4YA 2LT1A 3R26A 4R6KA 1G3TA 2QG9B 3CQTA 4E7IA 2X3WD 2XU8A 3A8MB 2PCRA 4OEUA 4UACA 4LUEA 2XXKA 3L1AA 2RQVA 1S72A 2DMOA 1UJ0A 5IHIA 4FU6A 1ANFA 3VXCA 2O31A 1D3BB 3EG9B 1R0CB 2DXTA 3KBRA 4ZEKA 1NLOC 1B3QA 4H65A 1YIJT 2EW3A 4MNCA 2OAWA 3M5AA 1KG1A 2CZ1B 4ZDMA 2LCLA 2DL5A 4QKUA 1JETA 3CBOA 3JB9G 3GNGA 2DE0X 3RERA 1DSNA 3D4GA 1WHGA 2BUDA 2CP7A 1B6HA 4FE8A 1RAAB 2X4JA 5CQXA 5ISUA 3MJXA 3T1BA 4GWUA 3NGPA 3D1RA 1VQ4Q 1OQKA 4A53A 1N7XA 4O5VA 1ZJLA 4JSOA 4OERA 1MHNA 4N6DA 2HCKA 4RPNA 4FSXA 3V8XB 4LDXA 1LAHE 4V2SA 5TPAA 1UIVA 4FEDA 4PJOF 2L89A 2VYTA 5A0GA 3PIPA 3ZKKA 2AKLA 2FO0A 2DLPA 3H0IA 4B9XA 4KR5A 1B4ZA 1FQEA 3CCVQ 2XX7A 4AQ4A 4UABA 1QUKA 2BIVA 2ZPEB 2LCCA 1WYXA 4LE9A 4M77D 4C0DC 2DFUA 4PJOG 1JJ2S 2XX9A 2LQNA 2JW4A 2RQTA 1KQ1A 2VGMA 1Y9UA 5H8NB 1FPIA 2DXBA 4JBZA 3MUQA 3CXCS 4YB5A 1VQ6A 5I2KA 2LJ3A 1RI9A 4MIJA 1YIJQ 3TCHA 1PCXA 3SFMA 2HAVA 2JM9A 3HP9A 1EZZB 2I3VA 2O1MA 4PGNA 4E0XA 4NQ8A 3CC2Q 3K00A 4OFJA 2JNGA 1I1JA 2VB6A 3QIMA 3B6WA 3RDVA 1MXXA 3UATA 4LZ5A 3OYJA 2HSEB 4FATA 2AT1B 5LJ5d 1KQSP 3CCLQ 3I3VA 5A5LA 1YCJA 3VS5A 2H5YA 3G7WA 4GOTA 3ZL7C 3FC3A 3EFOA 3RNJA 1FPFA 2XD3A 5DLQE 2LAOA 1Q1KA 3OS2A 1RL2A 4OP0A 3L2UA 1WHJA 2ZZWA 3BIHA 3JZJA 3V89B 1QVGS 3MPUB 2KYBA 1MV3A 1B1HA 1FPBA 3R7XA 1TUDA 2RQRA 5M9OA 1WHMA 4HKEA 2RC7A 1MXVA 3L2QA 4IURA 2LT4A 1U06A 1LGBC 2B65A 2KRNA 4G8MA 2CH4A 3EFOB 2HKQB 3TUSA 3IQLA 4DOVA 3IB1A 2IVWA 4N6PA 4DI3D 1EX4A 3A8GB 3A3UA 2J05A 3JCMQ 4EMKB 2THIA 5I84A 2A5SA 5I57B 4LUDA 1K76A 4L17A 1YHQT 4EF2A 2YLCA 2HKNA 1QULA 1FJ6A 3UT1A 4RNSA 1MDQA 1B1XA 3CFLA 2F6GA 1VYTA 4C92A 2KE9A 1URSA 3RKWA 4RUGA 2QTVA 2F35A 4P0IA 3S9EA 1QP3A 5KYNA 3JCMX 2RD1A 4HTGA 2JTMA 4GY5A 3EHUA 3KC1A 1E6GA 1DMBA 5EQ8A 3G3GA 2X35A 1H76A 3VLWA 3OS5A 2X26A 3JCMe 4LZ8A 4VUBA 1E6HA 1YJ9A 3HFUA 1ZHIA 2X7PA 4O3AA 4RCBA 3I56A 4OB1B 2GHAA 3CMAQ 2KDSA 5IZZA 2ONKE 2BE9B 3VKIA 1M5DA 4Y92A 3VYHB 5KYYB 1P1QA 3DELB 2QS3A 4X1VA 3M0QA 2XXRA 4FCYA 3OSQA 2O6AA 3LUZA 1YHQQ 3BY7A 2I49A 3JCMV 3A3CA 3OO6A 2QQBA 1VQPQ 2UVHA 1OU8A 4XTWA 1IEJA 1RAFB 1Y4CA 4IO7A 5GAOp 2VGNA 4JUVA 1FBPA 4Q5TA 5DYHA 1FW0A 3M4GA 1PSEA 2RN8A 3HHTB 4OB2B 1BKBA 2DL8A 3L2VA 1PEBA 1YZ0A 4E7JA 2DNUA 4HT8A 2F34A 4GIZA 1ZX6A 4M75F 4QQ6A 2JT4A 2K5FA 4HT9A 1NG2A 1G2BA 2UVIA 4G61A 1H641 4FL6A 1AWWA 1S72T 2YRVA 4QXDA 2GNCA 5CM6A 3RTWB 1LJOA 4M75E 4BE2A 4OVRA 1B40A 1BK4A 2RB6A 3G1JA 2DXRA 3TAJA 4RXLA 5L8RE 2AIXA 4JWYA 5I56A 3CD6A 1RAEB 2NLUA 5KCHA 1QWEA 1MXWA 1U8RA 3O2AA 1G0IA 3OYGA 1JXOA 2CT3A 2LMJA 4J8OA 2MWOA 5DEXA 1QW1A 5IKBA 1SW1A 1U5SA 4EQBA 5AA4A 3N5BB 2B4LA 4PFWA 1I6QA 2HZYA 4WCIA 4EQ9A 1GXIE 3CPFA 3G6EQ 5DEXB 2PFYA 4X8RA 4JLIA 3TQ7P 4AT1B 4C92C 3PVQA 1YXIA 3G3HA 2VPNA 3JB9H 3X25B 2ZAEA 4ZEFA 4ZTJA 1BIAA 2E64A 4LZ7A 2W0ZA 4PF8A 4YMBA 1JJ2P 3JV9A 2I0NA 3RYDA 3RPLB 2ZYNA 4MLVA 3ZKLA 1LAXA 3TODA 3CXCP 4FORA 1ZUUA 2B8AA 2K9GA 3RIRA 1OOTA 3ROJA 1TSFA 2ZPIB 1GL5A 1JW4A 3L6GA 5GANe 3VVFA 1M8MA 1D1CA 1NE8A 3DP4A 4KI0E 1QCNA 5IAYA 5JTYB 2FPEA 2NOOA 1UUEA 1DK4A 1KSWA 5FU6B 3CC4A 1KIKA 2C0TA 4EQ7A 4PFBA 4MBPA 2RINA 4NGUA 1IQ7A 3UGWA 2V1QA 3N26A 3TQLA 1QVGP 2CP5A 3MYUA 5L9MA 2ATCB 1WFWA 4NEDA 4OETA 1VYUA 2YUPA 3E1SA 3I5RA 1QVPA 3V8LA 4NWCA 2AKKA 4RKUE 1ZSGA 1FTMA 3FEOA 4F7UE 1WGSA 4DOWA 4R73A 5HM4B 2G29A 1LFHA 3HL8A 1JQQA 4XKQA 1BB9A 2MCNA 4OF1A 2ABLA 2A5TB 1YP5A 3FJPA 2F7CA 1VQ6Q 2PVUA 1LBZA 5H8HA 3IB0A 2DE2A 1M8VA 2XKOC 4CC4B 3O9PA 3VVDA 1Z7ME 3ZBDA 3BIGA 3CCRA 5CMBA 4ZGEB 1O7TA 5FW9A 1V1CA 2DIQA 1FBDA 2H8HA 1I81A 2YRDA 1MXUA 3CBPA 3NPFA 3OBWA 1XT8A 2RHUA 1FPEA 2E4HA 4I40A 2E5KA 3GNFB 4AS5A 1BCOA 1IMCA 5J1DA 5GMKe 4XTUA 5A0LA 1TXQA 5H8FA 1FBGA 1FQBA 1B9JA 2WYKA 4QW2A 2JS0A 4M7AE 1IUDA 3KOSA 1AL3A 1OVBA 3RT8A 3NTIA 3ULRB 1B3EA 1X43A 3I56T 2DWIA 1Q86C 4U4SA 4KUIA 2EJ9A 2NYSA 3CFZA 2JTFA 4X34A 1CNQA 3M0SA 4M78F 3TMGA 1N9RA 5ET5A 2EQMA 5I21A 1YWPA 3QKJA 4G77A 3I9QA 4OEVA 4P8BA 5AA2B 4KH0B 3FDRA 4Z0IA 1KHCA 1RKMA 1VA7A 1XS5A 1I69A 5GAOl 1QKAA 1I5LA 3EAEA 3T93B 3RN8A 4M78E 4OQOA 3M9QA 1FPDA 1MQDA 4PFPA 4O7MA 4LATA 4E7ZA 1A55A 1VUBA 2Y4YA 2FVZA 1SSHA 1G83A 4QVCA 2YUNA 4DXCA 4ESRA 1GFCA 5I2NB 3GOXA 3FJGA 2OAUA 1R9LA 3HRUA 1H3HA 3OEMA 1MH3A 4RPOA 2I2LA 1IGUA 1FMVA 4YICA 1F1BB 3MPLA 4YB6A 1TUGB 1NPRA 4Y91A 1YJ9Q 1B3GA 1CKAA 2JJ9A 1DJ7B 3I56Q 2HD0A 4X04A 3K6WA 3CPWA 1NLPC 1OU9A 5KYXA 1BLFA 1FJ9A 4XIGQ 4KFQA 2HZLA 1TU0B 1IREB 2DYIA 1FTJA 5F7VA 1Y3QA 3M3KA 2V26A 4L6V5 3PMIA 5HKCA 5IAIA 3E2UA 1AWXA 5L8DA 2ZZDA 3KUFA 2QEXT 1ABOA 2ESWA 1OLCA 2XD0A 4MX6A 5FWCA 1MY1A
chains in the Genus database with same CATH topology
4ELPA 3AXFA 4M77B 2C06A 3PD8A 1B4HA 2OBGA 3K4UA 2H25A 4I62A 4X48A 3H3GA 3V8KA 3LSWA 1SI0A 4P11A 2AHJB 4H5GA 3PIOA 3K02A 2DXYA 3FASA 3DLMA 2PMSA 4OXVA 4IKFA 4KYEA 1M5FA 2CGHA 5A0DA 1QVFS 4M7AD 3MCAB 1MDP1 2VUBA 1A7LA 3S2VA 1MY2A 3OYIA 4HCCA 4E0WA 2OTLT 4I8CA 5GAN4 1B5JA 1OQHA 3HCQA 3M55A 3S6WA 3UK4A 4BE0A 2F7AA 4OGCA 2VOZA 1HSJA 5ICQA 3R6OA 1VQOT 2E1SA 4KCDA 3U92A 5FLXE 4R75A 1XHYA 5F1QA 2EQJA 5GAMe 3BFTA 2FL7A 2E0SA 2IG0A 4MDXA 2GHBA 4JS5A 4IUUA 3L42A 4PFTA 2UVJA 1II5A 2XXUA 4R9FA 2PBWA 2PQWA 2PYYA 5GAN7 3OY9A 4C92D 3TZAA 2D21A 1M1FA 3VUZA 4KPTA 1UTHB 3OYMA 3IJXB 3LUYA 3HPWA 1Q86U 3TEEA 3TTMA 2LC4A 2LNVA 3LGLA 5IT9E 2DS9A 3CCRT 4PJOA 2R58A 2EFIA 4ESWA 1MQHA 5CBRA 4R72A 1FWZA 1LOJA 4C8QE 3T9UA 2QMWA 2P0SA 3H6TA 3M8UA 2W7YA 4WKMA 3RNNA 4EMHA 3PNWC 3CC7A 3FB9A 3SWNA 1MY4A 3FVGA 2DVCA 3BKIB 4ZEIA 2LQ8A 1PB9A 2I3WA 4ZEBA 4KUDK 3PMWA 5I59B 4BDYA 3MZ1A 3OSRA 1UQWA 3ZS6A 4RG8A 5A5XA 4MZPA 4DZ1A 2Q2CA 4BLAA 2RI5A 4G68B 1M9SA 4JRKA 2RM4A 3HKSA 3K6UA 2G3RA 1QW0A 1MY0A 2CMOA 4XTCQ 3B7DA 2Y7WA 2H98A 4TOZA 2YPNA 2DWAA 3FV1A 3QJ6A 3RMSA 4OZ9A 1IXIA 2XG8D 1VQ5T 2P0QA 4QFKA 3KGCA 5L9OA 2PVDB 3O29A 4YKKA 3W9WA 4X9CA 4C0RA 1UGRB 1PB7A 2YLBA 4R55A 2MF2A 1OZ3A 1YTVA 4IUTA 2VD2A 4KBMB 2QA4T 4BB7A 1PC3A 2AYSA 3MVWA 4QQDA 3PFSA 3T9HB 1A99A 1EH3A 2Q9TA 2QQRA 1SQYA 1M5Q1 3PD9A 2YJPA 2RHYA 1H44A 2OCUA 1ZBXA 3MP6A 4NF5A 1UGQB 4JRQA 5BUUA 2WSFE 1YITT 3TKDA 2IA4A 1U1TA 4RY1A 2K57A 4MMKA 1N27A 3HV1A 1CB6A 4C8QD 3RLFE 2P0KA 4M77F 5ICTA 5GAOq 4XQ3A 4WEDA 2X4XA 3RMQA 2RJEA 2DSFA 4XU1A 4PJOC 5FHNA 4XXUA 4KULA 4M77G 3Q28A 2RHXA 1Q81U 1SYIA 3KG2A 5FU7C 2F8DA 4NF8A 3M53A 5LJ3f 4ESXA 3JAME 2F36A 4R2BA 3SWNC 5FRNA 3U72A 3KOTA 3G4SA 1QP2A 3S3NA 2B3BA 5DM7R 4FM4B 1N0TA 3MBPA 3PTAA 3WAEA 4UA8A 5BWJA 2DOJA 3TREA 1PDAA 2LX9A 4RG2A 2H99A 2KAFA 3OO9A 2O4XB 3LLRA 4X1DA 2Q2AA 1B0LA 2EJGA 3KBGA 4M75B 1Y3PA 2Q89A 2Y4XA 1YAEA 4U21A 5ITOA 4M7DE 2GQVA 2HQEA 3TTLA 5C0MA 2QS2A 4C5IA 1H3DA 1POY1 3HHFA 4E47A 2VGQA 4R9GA 1D3BA 4FAJA 1MH4A 2O7IA 5CMCA 5H8SA 4ELYC 4J7IA 4KQPA 3JCMJ 3SERA 1I8FA 4F39A 4A4HA 4II1A 3HPIA 3PU5A 3OYBA 4E7KA 4BDNA 3OEKA 2HAXA 2RHIA 1Y4TA 2VV5A 2M8CA 3I55T 3CC7T 2O84X 3OSVA 1NMUA 1HSLA 3B6QA 4XU0A 3RUXA 2VD3A 1LBBA 2V3TA 2KVQG 1MPCA 2NUVA 1H3ZA 5EYFA 1LNXA 3CCST 5H8NA 3CRBA 3QUFA 2LDMA 1K9MC 4Q0CA 1OVTA 4U4XA 4YTLA 2JZ2A 4H8JA 4JS4A 3DP8A 4PKCC 4F3PA 4AB6A 5B7DA 4RCCA 3VV5A 5EHMA 1W4SA 5J39A 1YJNT 4E7HA 2CZ0B 3TYHA 4OENA 2XXTA 3OYAA 4MZTA 2DXUA 4F1VA 1XC1A 5M2VA 2A7YA 4F22A 4JDFA 5GAOm 4P5NA 5CR2A 3OYHA 1DTGA 1SYHA 4XAXB 1LAGE 3BFUA 3NFCA 4IO3A 4M7DD 2FYKA 5GMKm 4JWOA 4B9WA 2I0BA 2V93A 2KMTA 3LBSA 4EMKA 5I57A 2R6GE 3UPUA 2O68A 5CKBA 3LGFA 3CCJT 4J7FA 3EFRA 4GXSB 1TWYA 3UA8A 2X7QA 4FJPA 4U23A 3V8JA 5I2MA 1NH8A 4M7AB 4BE1A 2XXVA 4PQJA 1IXGA 4OGEA 3MEVA 1VQNT 4GD5A 3M4YA 3O28A 3HO7A 4GXAA 1OQGA 2V8KA 4A4KA 1Y07A 1AOVA 4BDRA 4LDWA 1P1UA 3FLGA 1PBPA 4LA9A 1YI2T 5HY6A 4N4HA 4OHNA 3GBAA 3M57A 4DXBA 4M78B 2I48A 3VU3C 1A8EA 1JNFA 2V3QA 3ODBA 3T66A 3MZ9A 4ELZC 4ZEDA 1VQ7T 3EHSA 3CCMT 5FHOA 3DP6A 1Q35A 2MWPA 2F69A 3G4ST 2VXFA 2XI9A 3JB9D 5ITPA 5CMMA 1IZ1A 5I58B 1EZ9A 1MQJA 4WF2A 4F1UA 2EYQA 4TLLB 5TU0A 2REJA 1OMPA 4F29A 2F5TX 3CCQA 1SI1A 3IOUA 3G3IA 2RC9A 3DLNA 2RK2A 3FIFA 3QXEB 3RUMA 3G71A 3KJ7A 3INZA 3X28B 4C5GA 2FA7A 3MHXA 2ONSA 3Q25A 3E9FA 4HCZA 5GAMh 3VV0A 4PJOD 1A54A 1PB8A 4LQ2A 2D0QB 2LTOA 1O63A 1MY3A 2DD5A 2QSXA 4NL2A 1UB4A 2CYZB 4M75G 4IO5A 4FT2A 1SW2A 1XNIA 1RI0A 2E1HA 3S9LC 1JB0E 1K9MU 4PLLA 3CMEA 2M0OA 2ZPGB 4OMFB 1SDXA 1WJQA 3JCMP 3C4MA 4POWA 2EIFA 1OZ2A 3BDUA 4EMKC 3M59A 4GFRA 3WVDB 2XXIA 2QQ9A 2QEXA 3ECRA 2H4IA 1ATGA 4F31B 3L2WA 4LUBA 2DVEA 1EIFA 3QPHA 2Z22A 1BKAA 3NTHA 3U8QA 4THIA 2DAQA 3FVOA 1VQKA 1ZBMA 3LW5E 3QIIA 4M78C 5GAN5 5CC2A 2DO3A 3PV0E 5KCJB 3G3JA 1XQHA 2V25A 3UDCA 1AH5A 2ZYKA 3GF5A 2OTLA 1AHJB 4H1XA 2K4YA 1DOTA 3MJNA 3KZGA 3T22A 1PSFA 5JTYA 1FQDA 1G3WA 3MEWA 2D5WA 4WXJA 5CI5A 3HSBA 2F5XA 1VQOA 3SKPA 1X6OA 1UTBB 2HNIA 3JB9I 2V84A 4YZZA 1NNTA 4F7UF 3VLVA 4E7LA 1BIBA 3D4CA 4HA8A 4O3CA 1AIVA 2Z8FA 1R8OB 4PP0A 1BTJA 3CI8A 2A5TA 4R2FA 3TPAA 4C8QB 4F7UG 4QHQA 3EF7A 5DT6A 2HFBA 2KQWA 3ILUB 4U2RA 4A54A 1TH7A 4BI3A 4MF3A 4Z7EA 4PFUA 5EG2A 1FTLA 2ZXTA 4PETA 3GIBA 1MPDA 3OW2A 3QG1A 5LJ3d 4DQ2A 4M7AF 3I6VA 4OFLA 1P1WA 2D9TA 1WJRA 1MM7A 1ZQ1A 2OJTA 1GR2A 1US5A 2P0PA 4M7AG 4POXA 3P7IA 5AA2A 2BJJX 3OYNA 1O9SA 2F5KA 1POTA 4IUVA 1T0KA 1BI3A 4OFOA 3FXUA 4N4GA 1VQMT 5LJ3j 4OVAA 4F2OA 1F9BA 2EWNA 2ANJA 4M78G 5I2NA 4MLQA 1S9TA 4ZE8A 3CCQT 3C9HA 3KSJA 3DB4A 1JBMA 4NOYA 1X01A 4LDUA 3G71T 1B46A 4NF4A 4C92F 4C5EA 1Y3NA 5LJ3g 1USYE 3OO7A 1S7YA 2R5AA 2QQAA 4XTYA 1TT1A 3MZBA 4LP2B 1NJIC 1A40A 3QDRB 3Q1JA 3J7AF 3HFNA 1VQ5A 1N6AA 3H8ZA 4NF4B 1H43A 5CCAA 4C92E 3KJTA 3RKXA 4RJZA 2O51A 5FU6C 4JRPA 2RJCA 1NFTA 2XHCA 3S9NC 3SD4A 3GZGA 5LJ5h 3TTKA 2WACA 2QA4A 2E6ZA 3WAFA 3FATA 3CMET 4ATOA 3MQ9A 4U1OA 1WQ7A 5CKFA 3IO6A 2E5QA 2ZYOA 3QZ5B 4M77A 2ZMBA 2HQ0A 1WQWA 5D6WA 1D4NA 2QI2A 1IZ6A 2Y90A 2DD4A 4PNOA 3G7ZA 3K1PA 1K73C 4KCCA 4FECA 1M1KC 3CBMA 1YITA 1P99A 1QUIA 1TFDA 5KCOA 1LCTA 1Y71A 1HSEA 3UORA 4YU0A 2CZ7B 2O7UA 2OWSA 1P92A 4LDVA 2DTHA 3ASKA 4C0ZA 1MQIA 3CCEA 1URDA 1NH7A 2CKKA 3USDA 2GF7A 1KC8C 1VQKT 5LJ5f 1JRIA 4PL6A 1PBQA 3E9GA 1Y7XA 3OMBA 3C94A 4QRZA 3JCMW 2Z8EA 3EPEA 4NF6B 4U22A 4ELRA 5DVJA 3OOAA 3NTKA 4QSEA 2Y7PA 4M7DB 1KQSA 1SW5A 2B3FA 2I0CA 3G3KA 3VLUA 4BDLA 2VXEA 1LB8A 5H8QB 2EKOA 3IOTA 3MP1A 5FROA 1D9VA 1ZLQA 1B0HA 4XU3A 1BI2A 1WNLA 2XXXA 4HCYA 3MO8A 3VFJA 3MEAA 2E10A 4F3GA 3J81E 2GFAA 2JN0A 4C0FA 1YPNA 2PU9B 3OW2S 3PMTA 3E13X 3H6ZA 4KHZE 3K2DA 3MW0A 2RH2A 4ECFA 1EU8A 1US4A 3O66A 1FTOA 2MAMA 1UTHA 3FJ7A 2E65A 1Q81C 2PUOB 5L9SA 3M56A 1QUJA 4A4EA 3FZVA 2XK0A 4RA1A 4TLMB 5JK4A 3SDZA 2DWHA 3JRZA 4L59A 3QSLA 2Z8DA 1MM6A 4G4PA 5GAN8 2EQKA 1G3SA 3O6HA 2QL3A 4DCXA 5CMKA 2L3RA 4C8QF 5GAOr 1KHIA 4BY6B 2HZKA 3LH0A 3U1OA 4I9DA 2QQSA 2JUFA 2Y7IA 2OTJT 1TXFA 4C8QG 2AL4A 2R5MA 1IITA 5FTHA 4DDDA 4M77C 2VHAA 1GVCA 3X20B 3T9VA 3T9XB 3I55A 5I59A 3ME9A 1NJIU 2NXOA 2QTXA 3TTRA 2YLNA 3F11A 2OLBA 4OB3B 2CZLA 2VP1A 3A09A 4G68A 4R6YA 3OBYA 4QFPA 3IB2A 4JSDA 1B58A 3SB2A 3CCSA 4FEBA 3K1MA 4LDYA 3KN7A 2XHDA 1B5IA 4IO4A 1KQ2A 4DIGA 3H7MA 1W2BA 3CPWS 3JCMh 2FB7A 4GF8A 1DTZA 2ALUA 2OZZA 3CCLA 2XXHA 3I5OA 3GPLA 1YJNA 5TP9B 1ZU0A 4BDOA 1EZOA 1K73U 2E41A 5CKEA 4NE4A 1M1KU 1S50A 4EDUA 1KWHA 3PUWE 3N5LA 1J1NA 2JOYA 3M3FA 2HBPA 3PGGA 4QVZA 4XTVA 1KC8U 3JCMf 2ZCFB 1TFAA 2XXPA 1N76A 4DLDA 3EN3A 3LC8A 3RTFB 4F1YA 5I2SA 2REGA 3SEXA 3FUZA 1IIWA 1B52A 3CCJA 1OI1A 1KQSS 3KSXA 3C35A 3PUVE 3SEVA 3CG1A 4OVJA 3MPKA 5CIUA 4RMOA 3CG3A 1ZKBA 4BY6C 1VQNA 1A8FA 3JB9J 1JJ2A 4QVDA 5FTIA 3CCET 1M90C 2UVGA 2MI6A 1MGQA 3C33A 5DTBA 4O6JA 5KE2A 2WSEE 3CXCA 1LAFE 2F78A 4ZS9A 2DTOA 4NTLA 1YI2A 4F3BA 3C4SA 2XDDA 4X9DA 4BDZA 1MPBA 4F19A 3A5ZB 5CKHA 1YJWT 5CK9A 2PT2A 2E70A 3X26B 1VQ7A 5KDTB 3OYFA 3CCMA 4IY6A 4N07A 2O4XA 1M5CA 1Y96A 4M75A 5CVIA 1M1GA 2XICA 2IEEA 1QVGA 4M7DF 3GBBA 4G68C 1YCYA 2XDPA 4WEPA 4C0DB 1Y96B 4GLIA 3VVEA 2RCBA 3PUXE 1WVJA 3O97A 3CEYA 4M7DG 3TCFA 4TVRA 3ZEHA 3N6TA 3PPPA 5GANh 1B5HA 5HPQA 3OMGA 5DVFA 3MWBA 1N9SA 2FVUA 5CQYA 1ZIUA 5K2XA 4Z02A 3LSXA 2LVMA 3LSFB 1L5TA 3MVXA 2QPQA 1VQ4T 3P8HA 3FJMA 4ONYA 5CO7A 3QBYA 4M4GA 2GCXA 4IUPA 3IORA 3EFSA 1G5VA 2I58A 4YB7A 3FD3A 2XD2A 4ZGJB 1XVXA 3CCVT 3OENA 4RK2A 3E9XA 1SD3A 1GGGA 2ESNA 2P2AA 5GANf 1Q82C 3K6XA 3VJPA 3RPWA 1OYXA 3S9MC 3K1NA 5GAN2 3CR9A 3N6UA 3JB9F 3O6GA 4GRKA 2P4TA 4YMAA 4XTZA 2HCAA 1LFIA 5GMKi 2GFEA 4G8HA 2ZPBB 4OYVA 4EF1A 3MC2A 3CC2T 3META 5C6SA 3QHSA 1MXYA 5GMKh 2OWTA 4QFLA 3THIA 2RF1A 1NNFA 4J6YA 3O8VA 3WXMB 3KFMA 1YBYA 2RK1A 3V5AA 2ZNSA 3CCLT 2V8JA 2RJFA 3FXQA 4YAHX 5A2QE 4OB0B 2QDYB 5B70A 4F7UA 3H4ZA 2UYFA 2Y7KA 3SDFA 1SBPA 3U93A 2R9JA 3HRSA 1O75A 4EXKA 2M1HA 4F7UB 3PPNA 3C31A 4LD6A 5TPAB 3SETA 1VQ8A 1N8RC 4PJOE 2CS7A 4M75C 4O3BA 2RO0A 3OSSC 4YKIA 1M90U 1N84A 2QMXA 3AHUA 4XK8E 3HHGA 3IJOB 3URGA 1IXCA 1JQFA 4M7AA 3RGYA 3SEUA 3QXMA 4GQOA 4Q30B 2ABHA 5I2KB