3MP1A

Complex structure of sgf29 and trimethylated h3k4
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
517
structure length
509
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEKETEVTRRLVLPSPTALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
total genus 136
structure length 509
sequence length 517
ec nomenclature
pdb deposition date 2010-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp1A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp1A01
2I58A 3L2UA 5BUUA 1SD3A 3DB3A 1N7XA 2QMWA 4GOTA 1QW0A 3RTWB 3TCGA 3V5AA 2IA4A 1QUIA 1LB8A 1PB8A 2RF1A 3L6GA 3IR1A 3Q26A 2Q89A 4NS5A 3OMCA 3U92A 4BDNA 2R6GE 4GD5A 5ICTA 1PEBA 4NF8B 1PC3A 1BIYA 3EPEA 4ZTFA 2I4CA 4OEUA 3QIIA 2QQSA 3VVFA 2OJTA 5H8HB 3M3KA 3FVGA 4E0XA 1LFHA 4PP0A 3LC8A 2ALUA 3MPKA 1URGA 3ILUB 3U8QA 5AE4A 1MS7A 1H45A 3BBRA 1MQJA 4BE2A 1WJSA 4O3AA 3K6UA 4GY5A 3KN7A 5AA2D 1XNIA 4F18A 4POXA 3KZGA 3OEMA 1VR5A 3DLNA 4F1VA 3TCHA 1JVYA 1H3ZA 4U1ZA 4P0IA 1B3HA 4IO2A 3KG2A 4F3SA 5DTBA 1LCFA 2XXUA 1YTVA 5I59B 4ZDMA 2HZLA 2OWSA 4KI0E 2F6PA 3WAFA 3KN3A 1R6ZA 3PU5A 4IO7A 4OQOA 3GBBA 3E3KA 1O7TA 3H06B 3N6UA 4NTLA 3FUZA 3S9MC 5JTYA 3H6UA 3KBRA 2V93A 2AIXA 4IGRA 3K6WA 3VXCA 1XVYA 5H8FB 2NVUB 2QS1A 2O84X 1YAEA 5CBRA 3UT1A 5C6SA 3Q28A 4KCCA 5KE3A 4YZZA 1Y9UA 4RJZA 3T9XB 2H98A 3O66A 1JNFA 5KCJB 2RHUA 3L6HA 1T0KA 1B5JA 3MZ9A 3SERA 3Q29A 2Z8EA 1UTBB 2FYIA 3QSLA 3OELA 4FEBA 1QUKA 4X34A 3O6GA 2G29A 2Y7IA 4PLLA 1PB9A 5K2XA 3OENA 3G3IA 5H8NB 1KWHA 3P7IA 4KPTA 5AA2A 2L89A 2DS9A 5TP9B 3GLBA 2Q8JA 3OO8A 3HHFA 4DXUA 4ZEIA 4YB6A 4FATA 2PT1A 2XXPA 4AB6A 4ZEKA 3T22A 2K3XA 2YRVA 4OETA 3BDLA 2CKKA 3LBSA 2VP1A 4XKNA 1PBPA 2BIVA 1GVCA 4EDUA 3BFTA 2NLUA 1XVXA 2D9TA 2ONSA 3T9VA 2RJFA 4QFPA 1IQ7A 3PMWA 1DPPA 1A8EA 4MF3A 2CZLA 3C4MA 1MDQA 1N7WA 2XD2A 3SD4A 2Q88A 1JETA 4AQ4A 3EQ1A 3GZGA 3FEOA 1JEVA 2K3YA 3S2VA 4K3FA 4R9GA 1Y4CA 2E0SA 1LSTA 4ELPA 1URDA 3OSQA 4XKRA 2VGQA 1MM6A 3CRBA 4OFJA 4QSDA 5ICQA 2O69A 3S3MA 4O3CA 3VXBA 1JVXA 3OYEA 4GWOA 2F34A 4YKKA 3B6TA 1MXWA 1QKBA 2RKMA 3ODBA 2X26A 2X4XA 4PL6A 5I2KA 3LX7A 5IAYA 4H65A 3TODA 1OQGA 3OO9A 4HCWA 2YJPA 4C1TA 1A55A 1HSJA 3R26A 3G3FA 1Z7ME 4LQ5A 3IX1A 5AA1A 4BDOA 5D6XA 4LQ2A 2RCBA 4LA9A 3MEAA 3UK4A 3TTLA 3Q27A 4F1YA 1SDXA 4XIGQ 3L2RA 4QSEA 3PGFA 4DZ1A 5M2VA 4ZEFA 1ZIUA 3EHTA 4IUQA 4OHNA 4F2OA 1DTGA 3TYHA 4U1OA 2RI2A 3QUFA 1Y20A 1FQEA 4Z0IA 2AL4A 3USDA 4GRKA 2M1HA 3FVNA 2F6GA 1R1NA 3VLUA 3WAEA 3W15C 2ZXTA 5EHMA 2THIA 3MEWA 1ZBMA 2I6EA 3RT6B 3TKDA 1OLAA 4Q0CA 5DEXB 1VE4A 3E9XA 3O29A 2F5KA 5I2NA 1D3KA 1LGBC 1UIUA 1UIVA 1B51A 1OVTA 3MVZA 5J1DA 1IUDA 2FA7A 1MDP1 4QSCA 1Y1MA 3H6WA 4GIZA 2HFBA 2RC8A 5BWJA 1I6BA 4IY6A 4XXUA 2Q2AA 1N3XA 4JSDA 1LCTA 3RTFB 2ESNA 1WJQA 1R9LA 5B70A 1P1QA 3MP1A 1XC1A 4QQGA 3OYNA 1DPEA 3B6WA 1SVXB 1B3GA 1IXIA 2B3BA 3PUZE 3E4RA 4BDRA 5TU0A 4X1DA 4N13A 3C32A 2HZKA 3K2DA 3KFMA 1F9BA 3KSJA 2I3VA 1XS5A 2M8CA 5I59A 5KZTA 4ZEBA 2V3UA 3GBAA 5L9OA 3C4SA 4R75A 3EF7A 4IB2A 3FLGA 2ZYMA 5B7DA 1URSA 3KOSA 4FEDA 4A4FA 3IO6A 1UTBA 3JZJA 1Z7NE 2DE3A 3MPLA 2O7IA 5L8DA 3G3HA 4X1BA 1A54A 3PD8A 3G7WA 5ISUA 1I69A 1ZU0A 1MM7A 1SQYA 2B3FA 3CI8A 3QBYA 1MH4A 2AL5A 4U2RA 3MVYA 1B4ZA 1ZLQA 1A99A 3H6VA 1MPCA 4TLMB 4KFQA 1I6AA 5KCHA 4KYSA 1LAFE 1H76A 2DXRA 2XXVA 3SESA 1HSEA 1B7HA 3S9EA 2PQWA 4A4HA 3PNWC 2MWOA 1SW4A 5IKBA 4EQ9A 4TQUQ 3C34A 4DXCA 4F39A 2DE2A 5TP9A 1O64A 1MPBA 4H5FA 3KJTA 1NNTA 1B7ZA 3PPOA 1MQIA 4Q8RA 4NE4A 5F1QA 3RQTA 5AA2B 2HQEA 3ZKKA 3F11A 4NF6A 1IITA 1RI0A 3FGSA 2I49A 3HV1A 2UYEA 3MVWA 3ME9A 1MQHA 1FW0A 3SEWA 3B7DA 3OS1A 3FV1A 4EQ7A 2QJEA 5IN1A 4Z7EA 4EXKA 4I1DA 1Q35A 3HHGA 2XXXA 3RT8A 1OQHA 4YU0A 1TXFA 1AOVA 4R9FA 2P2AA 3UIFA 4M4GA 3O9PA 4WEPA 4U22A 1FTLA 4PFWA 3IOUA 2XDPA 4Q30B 3ZEHA 4NF8A 3OQ5A 4I9DA 2DWHA 5I57A 2VHAA 3ILTB 3TZAA 4JXIA 1YCJA 2H9BA 3UP9A 2QPQA 3MJNA 1NH7A 5C0MA 2AYSA 3CSGA 4ELOA 4EUOA 3B6QA 5DVIA 3K1MA 3E9GA 3K01A 2A5SA 3IOTA 3UGWA 4ELQA 1P1NA 3BFUA 4DCYA 1MY1A 3QIMA 1R9QA 4YKPA 4ISUA 4LUBA 4NMYA 5F7VA 3LSFB 5JTYB 1M5BA 3TCFA 3H3GA 2NUVA 2GFUA 1WGSA 4POWA 2Y7PA 3FXRA 3SDFA 1H43A 2XD3A 3HN0A 3L2QA 1B32A 3CSBA 1DTZA 4TLLB 4LZ8A 3CEYA 2I0CA 4R73A 3IO4A 2H25A 4I62A 3PMTA 3VFJA 3VV5A 2X7QA 5ITOA 3IOVA 1B3LA 1PB7A 4EF1A 2LCCA 2NOOA 1MQDA 4QVZA 2O4XB 1L5TA 1DOTA 3H4ZA 1FTKA 1B3FA 4AB5A 2GF7A 1N76A 4X48A 5A5XB 4R2FA 2DE4A 4LATA 2XHDA 4PFUA 4BDMA 1Y3NA 4XKQA 3MAMA 4R74A 1SSFA 5TPAB 3TFLA 4F1UA 1B46A 4BDYA 4HS7A 3MEUA 5CBSA 3SEXA 1MXXA 2RC9A 2ZNSA 3O8VA 3TMGA 3D4CA 3I5OA 5AA4A 5HBCA 1NFTA 4GXSB 1FQBA 3PPRA 4FE8A 1EZOA 2DWIA 1EU8A 2Y7RA 2RI3A 3QUJA 3MZBA 3IB2A 1II5A 4JWYA 3H03A 5H8NA 2LDMA 2O6AA 1LAHE 4RY1A 1P1WA 2PYYA 2QS2A 4B9WA 2O7UA 3Q1JA 5I2NB 1LLSA 1MH3A 2JZ2A 4H8JA 4IKFA 5I56B 4E7HA 3PD9A 3SEUA 3FZVA 3HCQA 1UTHB 3DM0A 2F8DA 4N07A 2BJJX 2F97A 4ZS9A 4H6DA 3LYIA 3MC2A 1M5EA 2DYXA 4E7KA 3H6ZA 3C35A 4F29A 2DOJA 3V8XB 4G68B 1Y4TA 2P0KA 1N27A 1S7YA 4QHQA 3S4UA 4LD6A 2RC7A 2W7YA 1MRPA 3DELB 3IJOB 2I48A 3K00A 1FCKA 3QJ6A 1BLFA 2HXWA 2XXTA 2QRYA 1LBCA 2XXQA 4UACA 3OYGA 4C5IA 1LB9A 4N4GA 3KSXA 4KYDA 3AXFA 1J1NA 3EN3A 4L59A 1M5DA 4N4HA 4MLVA 5A5XA 3A3UA 2HQXA 4H0WA 1AL3A 1EH3A 3RNNA 3OYKA 1FTOA 4G4PA 1JW4A 2E5QA 3G3KA 4G8MA 5CRYA 3N26A 4UA8A 1SW1A 3DP6A 3SETA 3FIRA 5J39A 3THIA 4F3PA 5H8FA 4F3GA 1POTA 5KH6A 3DP8A 1WODA 4IO4A 1EZPA 1OIBA 3W9VA 1TT1A 1US4A 2E6NA 3FXUA 3PPQA 5CMMA 4IO3A 3NTKA 4PFTA 2ZNUA 1IXCA 2A5TB 3FATA 2F7AA 1NNPA 2UVHA 4EDPA 3PUWE 1PBQA 3PMIA 4RK9A 2JTFA 1B0LA 3GXAA 3PV0E 4TOZA 3VDFA 5DEXA 1NMUA 4ELRA 3H8ZA 3HPIA 1B58A 2XX8A 3FC3A 1P1OA 2X4YA 1B7UA 4GFRA 2R57A 1OYXA 3ONMA 4BE1A 3OEKA 2CMOA 2F35A 3OMGA 4RNSA 1SI1A 4LP2B 1P1UA 4H5GA 2UXAA 4EQBA 3IOWA 4QRZA 3U1OA 1IZ1A 2YLNA 3LGFA 5CMKA 2ZYNA 1EZ9A 4RYAA 4F22A 2RHIA 3G3JA 4HCZA 3DP4A 3HO7A 1FQFA 1B0HA 1Y1ZA 2F78A 3CVGA 3UWNA 1XOCA 4IUVA 4BDQA 4GL0A 1S9TA 3RGYA 3OD7A 3K1NA 5H8SA 4ND9A 2XK0A 3FV2A 2D21A 4BDZA 4GQOA 4GLIA 4PLIA 1OLCA 3KN8A 5LOMA 1MXVA 1FQAA 4WKMA 5D6YA 1IXGA 3IB1A 1B52A 3CIJA 3OYBA 3MEVA 2KLFA 5CC2A 1D4NA 5CM6A 4U4XA 5CIUA 4ZTJA 2OZZA 4NF5A 2H99A 3LSXA 5H8QA 1GTKA 1SYHA 2XX9A 2XXWA 3EAEA 1YPNA 2RHXA 1MQGA 2EQKA 2ONRA 5ELVA 1N04A 2O4XA 3OS2A 4QQ6A 1PDAA 2RINA 4FU6A 1A7LA 3P8DA 1MXZA 3T93B 3S9LC 5EHSA 2OCUA 4I8CA 1ZMGA 4OYVA 4YB5A 3CFZA 4NWDA 3ZS6A 3OYAA 3PMVA 3LSWA 3PUXE 2XXHA 3R6UA 3VE1B 2GFAA 4JDFA 4MH5A 5DYHA 2DWAA 2XXYA 4H67A 1XHYA 4OZ9A 2L3RA 3L2VA 1XT8A 3PUVE 1B3EA 3FXQA 5I58B 4C5GA 4OEVA 3T9UA 4EF2A 3A09A 4U23A 1D9VA 1US5A 3MZ1A 2H5YA 1MY3A 4NF6B 4F19A 3O97A 1SW2A 2VD2A 4ZEDA 5J26A 1B5HA 5JEIA 2O1LA 4KHZE 3H7MA 1OZ3A 4O3BA 4GXAA 4R2BA 4GF8A 2WKYA 1CE2A 2REGA 3MO8A 2EKOA 4ZZEA 1N0TA 2R58A 1AIVA 4OMBA 3OS0A 1TWYA 1M5FA 3RPWA 1WDNA 3VVEA 4YMAA 2Z8DA 4QFLA 3OYFA 3U72A 3EHUA 1RKMA 1SI0A 4G8NA 2ZYKA 1RYOA 2QQRA 5I56A 1LFGA 1LAGE 4JWXA 2DIGA 2UVJA 3W9WA 2EQJA 2O1MA 1OVBA 1OI1A 3FVKA 2I3WA 3T9HB 1USYE 1SW5A 3M8UA 3MQ9A 3FJ7A 3O6HA 3JYRA 4IO5A 3OOAA 5DVJA 1BP5A 5I57B 1LBBA 3FASA 4IUTA 3JV9A 4OWDA 3KJ7A 5KCJA 3O28A 4F2QA 4BD3A 4G68C 1N3WA 2HAVA 3OYIA 3L42A 1OZ2A 2Y7WA 2EFIA 3KEIA 3UA8A 3T96B 4WEDA 2OWTA 4KD5A 3NTIA 3BKIB 1BKAA 2BKDN 3CFXA 1HSLA 2DSFA 4II1A 3O2AA 2VD3A 1POY1 1N84A 5KE2A 3OO6A 3QXMA 4QFNA 2ZNTA 1QUJA 1SBPA 4DXBA 4QFOA 4PQJA 2O68A 4KYEA 4XKPA 2M0OA 2ZMBA 4Q5WA 2A5TA 3RY3A 2IEEA 3P8HA 3IORA 1GR2A 2P0SA 1B6HA 4G2ZA 1NL5A 3VVDA 1VFDA 3MVXA 4OFOA 3QKJA 1GGGA 5HM4B 5H8HA 3OY9A 4MLQA 2Z22A 2PMSA 1QVSA 5KCOA 1B9JA 2FHDA 2FNCA 1IXHA 2DQVA 2DIQA 1MXUA 2E1SA 3F70A 2LVMA 2VOZA 5L9SA 3SEYA 1ATGA 3CR9A 5FTHA 5AA4B 2V3TA 3LSLA 2G3RA 3LLRA 4JWOA 3TELA 5KDTA 2GHBA 4YKJA 2F5XA 1NNKA 1ZKBA 1H3DA 4EXLA 2UVGA 2HCAA 4YAHX 2F7CA 1S50A 2RO0A 2I0BA 1LFIA 1VFEA 1VSOA 2X7PA 3LGLA 4YICA 1DSNA 4E7JA 4NF4A 3C31A 4WXJA 3TTMA 2Q9TA 4KR5A 3SEVA 4P11A 3QYTA 3TEPA 1UQWA 3R7XA 1ZTYA 1JW1A 1UTHA 2R5MA 4HW8A 3IL1B 5DVFA 3OA6A 3L2WA 3D4GA 4ECFA 4R6KA 3ZSFA 2PBWA 2LRQA 4YB7A 1MY2A 2D5WA 4GL8A 4GVOA 4G68A 5EYFA 3N6TA 2DWJA 1Y3QA 5FHMA 3K4UA 4DIGA 2LTOA 1P99A 3CFLA 4Q5TA 3G3GA 4PE5B 4QW2A 4ZZAA 5FRMA 4R6HA 4ZE8A 2ABHA 3M9QA 2DVZA 3N5LA 2V25A 5M9OA 1B1XA 3A3CA 2Q2CA 2HAUA 4BACA 4ZE9A 1FTMA 1B5IA 2Y84A 4R6YA 3TDJA 1SYIA 2Z8FA 1JQFA 1DMBA 4RXLA 2RCAA 1JW5A 2L8DA 3C36A 3KUFA 1USYH 1QKAA 5D6WA 3ZKLA 5I58A 3OYLA 3E9FA 3K1PA 4IURA 2RJEA 3TUSA 2D3IA 5CMCA 5I84A 2QMXA 4U4SA 4MFIA 2I4BA 1MG1A 2QSXA 3UORA 4G8HA 2XXRA 1WVJA 2OK2A 2B65A 2DVCA 4UC4A 4ESXA 2P1SA 1IEJA 4OVAA 1NNFA 4BLAA 4OENA 1A40A 3I6VA 1BTJA 1B1HA 2NWJA 3OYMA 3PPNA 3MP8A 1G5VA 3TTRA 2VYTA 4E7LA 3V89B 3FVOA 1NH8A 4OESA 4FL6A 2DAQA 4PETA 4C5EA 3OYJA 4FJPA 4C5HA 4YMBA 4BE0A 4HTGA 4CRIA 2R9JA 4FECA 3RN8A 4JBZA 1MY4A 1CB6A 1NKXA 4OERA 4H8IA 2XXIA 2RJDA 2PVUA 1GV8A 3E13X 4A4GA 2O51A 4KCDA 3PPPA 2RI5A 2QL3A 2OLBA 4H1XA 4A4EA 3PMXA 3K0VA 1FTJA 4E7IA 4IGTA 3U93A 4LVQA 3FJGA 4LZ5A 5FTIA 2EQUA 4F3BA 4XTCQ 5H8QB 4FORA 4DDDA 3K6XA 3RUMA 3MWBA 3QAXA 4RPOA 1ANFA 3OO7A 3QK6A 3MBPA 1A8FA 2OBGA 2PT2A 4Z02A 4PFYA 1MXYA 2ZYOA 2F36A 1Q1KA 4ESWA 4OTEA 3FJMA 3CG1A 3M3LA 4KQPA 3S3OA 2LAOA 2GHAA 4IUPA 2M16A 5IAIA 5FRNA 3MUQA 3GOXA 1FQDA 4C1UA 3EHSA 2Z23A 5CMBA 1B2HA 2DXYA 3TAJA 1TFAA 1MHNA 4RK2A 3KOTA 1I6QA 1IIWA 3DLMA 2G93A 4YKIA 3HSTA 5HPQA 4FIMA 4IY5A 3LUYA 1D9YA 3O6IA 3SKPA 4THIA 2ONKE 2UVIA 1RYXA 4JSOA 1M5CA 4DCXA 3U94A 4NWCA 5ITPA 2UYFA 4G77A 1MY0A 3S3NA 4JB7A 3N94A 2HEUA 3S6WA 1AMFA 4RPNA 4OXVA 4L17A 3T66A 1KHCA 2QS4A 3TTKA 2PX1A 1TFDA 2Y7KA 2BUDA 2HQ0A 3TTNA 3META 2X4WA 5KDTB 1LAXA 1FQCA 3OYCA 4QQDA 2R5AA 3ECRA 3Q25A 3M3FA 3VLWA 3FD3A 3LH0A 4R72A 4U21A 5FHOA 1WJRA 5JK4A 4MBPA 3UN6A 3TQWA 5FHNA 2IG0A 2NXOA 3NTHA 2V3QA 2RJCA 1ZJLA 2QS3A 3IAZA 3PFSA 3K02A 3CG3A 4NF4B 3I3VA 2GRVA 5CI5A 4IO6A 1B4HA 3MW0A 4QF9A 3OB9A 3IJXB 4LONB 4N4IA 4HCYA 2MWPA 3ASKA 3S9NC 2XX7A 2GH9A 2V84A 4C0RA 3TPAA 4B9XA 2F7BA 3PUYE 4ONYA 4N6PA 3DB4A 3OSRA 4FAJA 3LR1A 3OYHA 2R71A 1Y3PA 1H44A 5FROA 4DE8A 2ANJA 4DLDA 4IUUA 1MPDA 2YPNA 4E0WA 1JEUA 3C9HA 2GFEA 3H6TA 2X35A 5DT6A 4X9TA 5L9MA 3OYDA 3FDRA 3K6VA 5I2KB 1B40A 4NEDA 1ELJA 3VLVA 3OMBA 4OFLA 4RA1A 4P0GA 2DP8A 4QFKA 2EQMA 4OVJA 2H4IA 4RG2A 4LZ7A 3C33A 3RLFE 3MP6A 3OXNA 1QJMA 3IB0A 3KGCA 1B05A 1QULA 5TPAA 2RHZA 4M1VA 4BDLA 4ZECA 3IK6B 2B8AA 5K2YA 5AA3A 1OMPA 2REJA 1O63A 4F31B 4NF5B 1AH5A 3V83A 2RHYA 2WACA 3TQLA
chains in the Genus database with same CATH superfamily
2I58A 1ZA2B 3L2UA 2XI9A 3REAB 3SHWA 1MV3A 5BUUA 1G3WA 1SD3A 3DB3A 4F7UF 1N7XA 1NPPA 2QMWA 4GOTA 4PBQA 3CBMA 1QW0A 1ZSZA 1AOJA 3RTWB 3TCGA 3V5AA 2IA4A 1FYNA 2CT3A 2ED1A 4M77F 1QUIA 4BI8B 1LB8A 1PB8A 2RF1A 3IR1A 3L6GA 2Q89A 3Q26A 7AT1B 1M1GA 4NS5A 3OMCA 1SEMA 3DLLA 1NJIR 5EQ7A 3U92A 2CZKA 4BDNA 2R6GE 4F7UA 4GD5A 5ICTA 1XQHA 1VQ9Q 1PEBA 1P92A 4NF8B 3B50A 1BB9A 2KMTA 1PC3A 1BIYA 1NM7A 1PKSA 2ZPEB 4J7FA 4ZTFA 3EPEA 2I4CA 2K4YA 4OEUA 3QIIA 2QQSA 5GAMd 3VVFA 2OJTA 5H8HB 3M3KA 3MJXA 3FVGA 4E0XA 2DD4A 4C8QC 1LFHA 3VU3C 4PP0A 1W4SA 3LC8A 2ALUA 3MPKA 1U06A 3M53A 1URGA 3ILUB 3U8QA 1HK9A 5AE4A 1W6XA 1MS7A 1H45A 1KD1R 4P1LA 3BBRA 2QA4Q 1NPRA 4GWWA 1MQJA 2DYBA 2PU9B 4BE2A 4KGZB 4C8QE 1WJSA 3AHUA 1UFFA 2L5VA 2P0PA 3K6UA 4O3AA 4GY5A 4P1EA 1WHHA 3KN7A 3CC7T 2CREA 5AA2D 2EIFA 4M75E 1XNIA 1U5SA 2VGNA 5I21A 2SEMA 3EHRA 4F18A 1SSHA 4POXA 1GXIE 2QG9B 3ROJA 3A8OB 3KZGA 2J6OA 3OEMA 1AWXA 1VR5A 2DL8A 3EFOB 3DLNA 2OTLA 4F1VA 3TCHA 4C0DC 2CP3A 3RUXA 2DXTA 4ZN1A 1JVYA 1H3ZA 3JCMW 3EH2A 3VUZA 1PKTA 4U1ZA 3GYYA 4P0IA 4ZNXA 1B3HA 2Y5KA 4IO2A 2BZXA 1RAHB 3HKSA 3KG2A 1RLPC 3RIRA 3G6EQ 4RTUA 4F3SA 2EJ9A 4BB7A 3CC2Q 5DTBA 1GFCA 3A98A 4OMMA 1LCFA 3IQLA 2XXUA 1D0ZA 2Y5LA 1YTVA 5I59B 1MV0B 2MCNA 4C92D 2HZLA 4ZDMA 2XWKA 2OWSA 2I2LA 4KI0E 2F6PA 1VQMQ 3WAFA 3HL8A 2JVVA 2AKKA 4X04A 3KN3A 3MSTA 5I11A 1R6ZA 3PU5A 1VIFA 2DBKA 5GANg 1IGUA 5CK9A 4J6WA 2RK2A 4IO7A 1VQLQ 4OQOA 4O7IA 1QMCA 3HFUA 1T3SA 1ZSZC 4HE2A 4PJOE 3GBBA 1ZUUA 2QXFA 5GMKl 3E3KA 3H0FA 1X43A 3I55A 2DKGA 2LP5A 1LOJA 1X6BA 1O7TA 3H06B 4RTYA 1D9QA 3N6UA 3BDUA 4NTLA 3FUZA 3CCQT 4NHBA 4E6RA 3S9MC 2EKHA 1ZBJA 4OVSA 5JTYA 2EGAA 5GMKh 2DFUA 3H6UA 2V93A 2AIXA 1BBZA 3KBRA 4IGRA 4M75F 3K6WA 3RKWA 3KXTA 3KBGA 4OP0A 3VXCA 5FWBA 1XVYA 5H8FB 2NVUB 1IZ6A 2QS1A 4AG1C 2L0AA 2O84X 1YAEA 5CBRA 3UT1A 4C92G 3A8GB 5C6SA 2CZ6B 3Q28A 4KCCA 4J9CA 5KE3A 3DKMA 2M51A 4HKEA 2KR0A 4YZZA 3CXCS 1Y9UA 1SKUB 4PF6A 1BKBA 4RJZA 3T9XB 2H98A 2CZ0B 1GBQA 4JZ4A 3O66A 1JNFA 2V8KA 1FMVA 3JCMg 5KCJB 1B07A 4FSXA 3KBZA 2RHUA 3L6HA 2EAYA 3EKIA 1T0KA 1B5JA 1VQ8A 3MZ9A 1K9AA 3SERA 2HD0A 3Q29A 2LX7A 2Z8EA 1UTBB 1NYFA 2FYIA 3OELA 3QSLA 4FEBA 2CZIA 1IREB 1QUKA 2COWA 4JJCA 4X34A 3CC4Q 1K73C 3O6GA 4ANJA 1KZ8A 2G29A 2Y7IA 4AS4A 1MUZA 4M7DB 2FBPA 2MI6A 4DOWA 4PLLA 5CKDA 1PB9A 5K2XA 3OENA 3G3IA 5H8NB 1KWHA 3P7IA 3CXCP 4KPTA 5AA2A 2L89A 2DS9A 4PF8A 5TP9B 2F2VA 1OX9A 1SHFA 3GLBA 1QW1A 3WVDB 2VT5A 2Q8JA 3PE0A 4J83A 3OO8A 1JXOA 5I2MA 3HHFA 4DXUA 1G8XA 2K9GA 3NFCA 1Y71A 4ZEIA 4YB6A 4FATA 2D8HA 2PT1A 2PFZA 3E19A 4JUVA 1VQNT 2CSQA 4QVCA 4ZGJB 2DA9A 4HVWA 4A54A 1FPBA 1VA7A 2XXPA 4NGUA 4AB6A 4ZEKA 3T22A 2IVWA 2K3XA 1HYOA 2YRVA 4OETA 3BDLA 2CKKA 3LBSA 2VP1A 2M9UA 1Q81C 3X24B 4GBWA 4XKNA 1PBPA 2BIVA 1GVCA 3X28B 1B34B 4EDUA 5GAOn 2NLUA 3BFTA 1XVXA 2D9TA 2ONSA 3T9VA 1ABOA 3IFAA 2RJFA 4M78G 3EHQA 2BE7D 4PC9A 1K8AC 3O5ZA 5GANj 2LQ8A 1VQ6A 1V1CA 4QFPA 4XTWA 4XF5A 1IQ7A 1YCSB 1YFNA 2AKLA 1O75A 3PMWA 2KQZA 2O9VA 1GL5A 2YUOA 2DO3A 1XJWB 2LT4A 3GNFB 2ZPHB 2HXRA 1YBYA 4NAPA 4L5GA 1QCNA 1DPPA 4R56A 1A8EA 4MF3A 2CZLA 3C4MA 2P0QA 1MDQA 4DI4B 4JLGA 2FHYA 1N7WA 2XD2A 3SD4A 2Q88A 2ZZVA 1JETA 4AQ4A 3EQ1A 3FXBA 4M7AC 3GZGA 1QGXA 3FEOA 3GNGA 3CC2T 2K3YA 1JEVA 2LMJA 2JM8A 4OF1A 5DW8A 3S2VA 4M7DE 5LJ3j 3V7RA 4M7AD 3B8BA 4K3FA 2GCXA 5FBPA 5FU7C 4R9GA 1K8AU 3I56Q 1Y4CA 2E0SA 4O6JA 1LSTA 4ELPA 1URDA 3OSQA 1QKXA 1VQ7T 3JCMb 3MHXA 4XKRA 2VGQA 4JS4A 4PJNA 2KYMA 3JCMh 1MM6A 3CRBA 4MNCA 4OFJA 2VASA 1AD5A 4QSDA 2FZCB 5ICQA 4XEQA 4ZGEB 2O69A 3S3MA 2NUZA 1INPA 1I5OB 4O3CA 1JVXA 3VXBA 2RM4A 3JV3A 3GP8A 4MMLA 4ELYC 3OYEA 4GWOA 1K8AR 2F34A 3BW1A 5J16A 4YKKA 2K7AA 1NUWA 4M77A 3B6TA 1MXWA 1QKBA 2RKMA 2QEXA 1ABQA 3ODBA 3VS3A 4PAKA 2X26A 1BIAA 2E10A 5ET8A 2X4XA 2P84A 1C6VX 1OU9A 1LNXA 1YWOA 4PL6A 5I2KA 3I55T 1HD3A 4M7DD 1WHJA 2EGEA 3LX7A 4PJJA 3VS7A 5IAYA 5LDZA 4H65A 1FJ6A 3TODA 3HFOA 1OQGA 3OO9A 4HCWA 1Z9ZA 4KXPA 2DDKA 2YJPA 1RUWA 1W2BA 4C1TA 3UDCA 1ZUYA 2XWVA 1A55A 1HSJA 3R26A 2FPEA 4MZMA 4PKCC 3G3FA 1X69A 4X8RA 5HK0A 4FW2A 5GANh 1IMFA 2COZA 1YJ9T 1Z7ME 4JRPA 3RDVA 1LBWA 2Q74A 3EH1A 3IX1A 1UGRB 4LQ5A 5AA1A 4BDOA 5D6XA 4LQ2A 2RCBA 4NQ8A 2L3PA 4AT1B 4CC4B 1EYKA 4ORZA 3CCMT 4N4UA 4LA9A 1UG1A 3MEAA 1EYJA 3UK4A 3SEMA 3TTLA 3Q27A 2DL3A 4FYVB 4F1YA 2FZGB 2QQBA 1SDXA 1H641 4XIGQ 3L2RA 2FL7A 3CPWA 4QSEA 5I3SA 3PGFA 4DZ1A 4HE1A 5M2VA 4ZEFA 2MAMA 3THKA 1ZIUA 4JRIA 4OB2B 3EHTA 4IUQA 5HCKA 4OHNA 4F2OA 1YWPA 3FIFA 1NV4A 3SB2A 3VS5A 4JVIA 2P3VA 5LJ3f 3U65A 1DTGA 4KH0B 3TU4K 1WZOA 2DTIA 3M58A 4U1OA 2RI2A 3TYHA 3QUFA 3V7SA 1Y20A 1FQEA 2CP7A 4Z0IA 2AL4A 3USDA 2O88A 3GIBA 4JPBW 4GRKA 2M1HA 3FVNA 2F6GA 4FYXB 1R1NA 1RAIB 3VLUA 1LCKA 3I56T 3WAEA 3W15C 2ZXTA 2KVQG 1YYZA 2OTLT 1SF9A 5EHMA 2OI3A 2THIA 2CYZB 1MGQA 3MEWA 5I22A 1K9MU 2HSEB 1ZBMA 4N6KA 2I6EA 4KUIA 3RT6B 2LQKA 1ZSZB 3RMSA 4KRTA 3TKDA 1FBPA 1OLAA 4Q0CA 5DEXB 1MMGA 2EGCA 2KBTA 3I35A 1VE4A 3E9XA 1IGQA 2FO0A 5FU6B 3O29A 1I1JA 2F5KA 1RADB 5CKFA 3QZ5B 1D3KA 1LGBC 4F16A 1UIUA 5I2NA 2QAZA 5FW9A 1UIVA 1B51A 1MNDA 1OVTA 3MVZA 4YTLA 3QMFA 5J1DA 2BZYA 1IUDA 5EG2A 2FA7A 1N5ZA 1MDP1 4QSCA 1Y1MA 3VRZA 2XA5A 3H6WA 4GIZA 2HFBA 2RC8A 5ET6A 2V26A 3CCVT 5BWJA 1YJNQ 1I6BA 1NI9A 4IY6A 3RMQA 4XXUA 2FRYA 2Q2AA 1N3XA 4JSDA 3VS6A 1LCTA 3RTFB 2Y4XA 3CPFA 2LJ1A 2ESNA 3OBYA 1WJQA 3D1RA 4M75A 3HHTB 3EGDA 5IT9E 5LJ5h 1D3BB 1A0NB 1R9LA 5B70A 1P1QA 4TVRA 3MP1A 1XC1A 4QQGA 3OYNA 1DPEA 3B6WA 1SVXB 1B3GA 1NV0A 2K3BA 1IXIA 2B3BA 1OULA 3E4RA 3PUZE 4BDRA 5TU0A 2LC4A 1N8RC 2B4LA 4HCKA 4X1DA 1FBEA 4N13A 4QXDA 3C32A 2HZKA 3K2DA 3KFMA 1F9BA 3VYHB 2E5KA 3T1BA 3KSJA 4GWYA 2I3VA 1XS5A 2M8CA 1FPJA 5I59A 4C8QF 2K2MA 5KZTA 3JB9H 1QKWA 4ZEBA 2FPDA 2V1RA 2V3UA 1NEGA 3RBBB 5GAMg 5DLQE 3GBAA 4HCCA 2E64A 3JB9G 4PCDA 5L9OA 3C4SA 4FYWB 1WQWA 1Y57A 2DYIA 2EVRA 3G4SA 4JS5A 3GBQA 4R75A 4RTZA 3EF7A 2Y4YA 3H41A 1E6GA 3G71T 4X1VA 4IB2A 5A5XB 1M8MA 2ZZWA 1EFNA 3FLGA 2ZYMA 5B7DA 4OMPA 2ENMA 2PFYA 4Y28E 3SFMA 1VQ6Q 1URSA 3KOSA 2AZSA 4FEDA 4A4FA 3IO6A 1WNLA 2DJZA 1UTBA 3JZJA 1Z7NE 2DE3A 3H0HA 3MPLA 3X20B 2D0NA 2NWMA 2HEQA 4RCBA 2O7IA 5L8DA 1TUCA 2LCLA 3G3HA 4X1BA 1VQPT 1A54A 3PD8A 3QSUA 1M2VA 5IH2A 2KRMA 3G7WA 5ISUA 4M4ZA 1WI7A 1I69A 1LEVA 1ZU0A 2O31A 1MM7A 5CQXA 1VQ9T 1SQYA 1NG2A 2B3FA 5F24A 2X9HA 5KYXA 5GAN3 3CI8A 1VYVA 3QBYA 4KBMB 2PNIA 4J9GA 2HMAA 1MH4A 4I40A 2DMOA 2AL5A 4U2RA 3CMEQ 1WPYA 4N15A 1KQ2A 2HL5C 4PFIA 1Q7YU 3MVYA 1B4ZA 1ZLQA 4FSSA 1A99A 2QK0A 3H6VA 1MPCA 2LZ6B 4TLMB 4GLKA 4KFQA 3M0QA 6AT1B 1I6AA 3MPUB 5KCHA 4KYSA 1BYMA 1LAFE 1H76A 1NV1A 4JVCA 2DXRA 1TS9A 1HJDA 1RDZA 2XXVA 1T0JA 3SESA 1HSEA 2XXKA 1B7HA 4FW1A 1I07A 4XQ3A 3S9EA 1QWEA 4Y92A 2PQWA 4A4HA 1UJYA 2PUOB 3PNWC 2MWOA 1SW4A 5IKBA 2FG0A 4M7AF 4EQ9A 4TQUQ 3C34A 3ER0A 4DXCA 4F39A 2DE2A 5TP9A 2J06A 3JB9J 1YI2A 3A1PA 1GBRA 1MPBA 1O64A 4H5FA 3X25B 3OS5A 1YJWA 2M0YA 3KJTA 1NNTA 4WCIA 4DBHA 2L3QA 2QGGA 3NOHA 4DBRA 1B7ZA 3PPOA 2CEXA 3PTAA 1KFZA 1MQIA 1YITQ 4Q8RA 5CCAA 2RH2A 3PVQA 3URGA 5LJ5e 4QKUA 1NV6A 4NE4A 1LBYA 4XK8E 4DBFA 2OJ2A 1K0XA 2DVJA 2HSPA 3J81E 1QVFA 5F1QA 2KROA 3RQTA 4LDUA 5AA2B 2HQEA 3ZKKA 4NF0A 2QI2A 3F11A 4NF6A 1IITA 3QYHB 2CUBA 1RI0A 4Z8AA 3FGSA 2I49A 4PJLA 2JJ9A 5LJ3e 5GAN2 2GTJA 2UYEA 3HV1A 3ME9A 1YIJQ 1MQHA 3MVWA 1FW0A 2XDBA 4I3YA 3SEWA 3CC2A 3G71Q 3OS1A 4ATOA 3B7DA 3FV1A 1KD1U 4EQ7A 2QJEA 5IN1A 4Z7EA 2DJQA 1IMEA 1VQ5T 4EXKA 3CD6Q 1M90U 1NJIC 2DLPA 4I1DA 1Q35A 3HHGA 2XXXA 2YLBA 3RT8A 2HDAA 1OQHA 1KJWA 5A0GA 2W0ZA 4YU0A 1TXFA 2KSSA 1AOVA 4R9FA 2P2AA 5IZ1A 3UIFA 4M4GA 4NX1A 3O9PA 2M02A 4WEPA 3WXMB 4PAIA 4U22A 1FTLA 4PFWA 4MMPA 2V8IA 3IOUA 2XDPA 1D1BA 4Q30B 3ZEHA 4NF8A 2AIRB 3OQ5A 3EFOA 4JLIA 2LT1A 4M7AA 4I9DA 2DWHA 1Y7XA 2E4HA 2VKNA 4GBQA 5I57A 1VQOQ 2QEXQ 5I7IA 2VHAA 3ILTB 3TZAA 4JXIA 1YCJA 2H9BA 1U3OA 2XWIA 5CAIA 2KY9A 4V2SA 4PJOG 1VQKT 4HE0A 1AWWA 3UP9A 5I5PA 1AVZC 1Y96B 2QPQA 3MJNA 1NH7A 1VQ6T 5C0MA 1AZGB 5DLOA 4HT9A 2AYSA 2NUTB 3CSGA 4PBHA 4P8BA 4ELOA 4EUOA 3B6QA 2C06A 3CC7A 2XKOC 4A4KA 3K1MA 3E9GA 5DVIA 4QVDA 1RAFB 1VYUA 4GX6A 2K79A 1M30A 5IXFA 4M78A 5GAOr 2A5SA 3IOTA 3K01A 3UGWA 4ELQA 1P1NA 2LJ3A 3BFUA 4DCYA 1MY1A 4QBAA 3JAME 3QIMA 1R9QA 1R77A 2YUNA 4YKPA 1EX4A 4ISUA 4LUBA 2IIMA 1GCQA 2JT4A 4NMYA 1M2VB 5F7VA 3LSFB 5JTYB 1M5BA 3TCFA 3H3GA 5AT1B 2WYKA 2DRKA 2NUVA 1QVPA 2GFUA 2K5LA 1WGSA 3G71A 4POWA 2Y7PA 4KGVB 1FBFA 4DA4A 1UB4A 3FXRA 3SDFA 1H43A 3VS1A 2XD3A 3HN0A 1M1KR 2BZ8A 3L2QA 2EQIA 1B32A 3CSBA 1DTZA 1SG5A 4M77B 3LV0A 4TLLB 1BI3A 4LZ8A 3CEYA 8ATCB 2I0CA 1IB8A 1WYXA 1NLPC 4R73A 3IO4A 1SRLA 3HFNA 5HY6A 2H25A 1JP4A 1UHCA 4I62A 4KGXB 5GAMh 3NMZC 3PMTA 2FVUA 4CC3A 3VFJA 3VV5A 2OX7A 2X7QA 5ITOA 1QVFS 5EQ8A 2VPNA 3IOVA 3CCJQ 1B3LA 4A53A 4JDSA 3QO3A 1PB7A 1D0XA 5GANf 4EF1A 1V29B 2LCCA 4AS5A 2JMAA 1VQ9A 4XU2A 2J6KA 2JM9A 2HBWA 2LX9A 1YJ9A 1UE9A 1MQDA 4EMKA 2NOOA 1X75C 2MYSA 3BFMA 4QVZA 4KH1B 3PIPA 2O4XB 1L5TA 3H9NA 1DOTA 4MEVA 2CSIA 5ECAA 2DPPB 3H4ZA 1FTKA 1B3FA 2VUBA 5A0DA 4IR8A 4AB5A 1VQMA 2B86A 1R8OB 2GF7A 3G4ST 1M4ZA 1N76A 3EG9B 4X48A 4R2FA 2DE4A 4LATA 2DNUA 2OAWA 3G7ZA 4D8DA 2XHDA 3I9QA 4PFUA 4BDMA 1FBGA 1Y3NA 3CMAQ 4P56A 4XKQA 3CCMQ 4LDXA 3MAMA 4R74A 3E1SA 3VKIA 1YJWT 5IM2A 1SSFA 3LWHA 5TPAB 1VQOT 4PGPA 3OW2A 4FYYB 3TFLA 5GAMe 4F1UA 4M75D 3CCVQ 4E7ZA 4ELZC 1B46A 4BDYA 3L2ZA 4HS7A 2WSCE 3MEUA 1SRMA 4P47A 5CBSA 4OANA 3SEXA 1MXXA 1YIJA 2RC9A 2XDDA 2ZNSA 3O8VA 3JCMc 2V8JA 1MMDA 2OTJQ 3TMGA 4WTOB 5CKHA 4LDWA 3D4CA 3I5OA 5AA4A 5HBCA 5J3BA 3RKXA 1NFTA 4GXSB 2DXBA 1OEBA 8AT1B 1VOMA 3ZFJA 3A29A 2QQ9A 1FQBA 4RTTA 2F1LA 3PPRA 4FE8A 3FJPA 1EZOA 1T0HA 2DWIA 4CC7A 1EU8A 2Y7RA 4M7DA 2RI3A 3QUJA 3MZBA 3IB2A 1SPKA 3CCRQ 1U8RA 1FSAA 1TWBA 2J7IA 1II5A 4OVPA 3C0CA 3CCST 4JWYA 3H03A 5H8NA 2LDMA 2JN0A 2O6AA 1LAHE 2DRMA 4RY1A 1W70A 2J05A 1ACMB 2C0OA 1P1WA 2PYYA 2QS2A 1RL2A 4B9WA 5GMKm 5ESYA 4XTYA 2O7UA 3Q1JA 5I2NB 4JRQA 4LDVA 1FPKA 1KQSP 1LLSA 3JB9F 4XTZA 1MH3A 2JZ2A 1KG1A 1M1FA 2XD0A 3J7AF 1WHLA 1BU1A 2QGFB 3VS4A 4H8JA 4IKFA 3CCRT 3G6ET 5I56B 3INZA 1TH7A 1H8KA 4XU1A 4E7HA 2GQIA 2Z0WA 2FPFA 3PD9A 4C8QG 1YXIA 3SEUA 3FZVA 3HCQA 2WSFE 4RCCA 1NBEB 1K73R 1UTHB 3T0JA 1PRMC 3DM0A 2F8DA 4N07A 1R0BG 2JMCA 2BJJX 4NL2A 4RTWA 5AYFA 2F97A 4N8GA 2H3EB 4ZS9A 4H6DA 3LYIA 1KC8R 4MCOA 4PFRA 4C0ZA 3MC2A 1YITT 1M5EA 2DYXA 4E7KA 3H6ZA 4E2FB 3C35A 4F29A 2XWOA 1AEYA 1R0CB 2X4JA 3V7CA 3M0TA 1X6GA 2DOJA 3V8XB 4G68B 1Y4TA 2P0KA 1VQ4Q 1BI1A 2CH4W 1WQ7A 1N27A 2DL4A 1S7YA 4QHQA 3S4UA 2HL3A 3L1AA 1BI2A 1EIFA 4LD6A 4O5VA 4PJMA 1YJWQ 1W2BS 3EFSA 5IHIA 2RC7A 2W7YA 5A5LA 1MRPA 1K9ZA 3DELB 3IJOB 1M1KU 2I48A 1CSKA 2VC8A 4HT8A 1IMAA 1QVGP 1FCKA 3K00A 4P3LA 3QJ6A 2QTXA 4Y91A 3CCUA 1GCQC 3CQTA 5ET5A 1VQPQ 1BLFA 2HXWA 4PJOD 2COYA 4OB1B 3QHSA 2JTMA 4CC2A 2XXTA 2FZKB 2QRYA 1LBCA 2XXQA 2JS0A 4UACA 3OYGA 1UGQB 2P4TA 2X3WD 4NOYA 1LBVA 4EMHA 4C5IA 1UTIA 1LB9A 5IGAA 4N4GA 2ZAEA 3KSXA 1WX6A 4KYDA 4M77E 3AXFA 1J1NA 3EN3A 2RN8A 4N0AA 4L59A 3E79A 1M5DA 2E6ZA 4N4HA 4MLVA 5A5XA 1TXQA 1VUBA 3A3UA 2HQXA 4H0WA 1AL3A 5GAMj 1D1CA 3OYKA 1EH3A 3RNNA 5DY9A 2EWNA 1XI6A 4O7MA 3VS0A 1M1KC 4RUGA 1FTOA 1KHIA 1VQPA 4G4PA 3REBB 2ROLA 1JW4A 2E5QA 3G3KA 1JBMA 4G8MA 5CRYA 3N26A 4UA8A 1SW1A 3DP6A 4XU3A 1T3LA 4MDXA 1UEBA 3SETA 3FIRA 5J39A 3THIA 4AFSC 5IZ3B 3LUZA 4DEYA 2DETA 2GGRA 5KYXB 2JW4A 1WXBA 2YWWA 1TTHB 4VUBA 4F3PA 5H8FA 2DEUA 4FBPA 2CP5A 2E65A 4F3GA 5HKCA 2D0QB 1KIKA 1POTA 1J3TA 5KH6A 3DP8A 4MHFA 5GAN6 4ZN3A 2EYXA 1WODA 1VQ5A 1WHMA 2KK4A 5LJ3h 1B7TA 4OMOA 3RNJA 5GAOq 1JJ2S 1D0YA 4IO4A 1EZPA 5D7UA 4J8OA 2ZPGB 3C95A 1OIBA 3W9VA 1TT1A 1US4A 2E6NA 1FPFA 4DBQA 2RQWA 3P8BB 3FXUA 3PPQA 1S72T 1GRIA 4IO3A 5CMMA 3NTKA 1ZQ1A 2SRCA 4PFTA 2ZNUA 3OSVA 2A37A 2CGHA 3M0UA 1VQ7A 1IXCA 1X27A 2A5TB 2DBMA 5A2QE 3FATA 1VDWA 1UJ0A 3JCMd 2Y90A 2F7AA 2VVKA 3M4GA 1NNPA 1VQ4T 1W2BP 2UVHA 4EDPA 3VUBA 3PUWE 1N6AA 1QVGS 1PBQA 3PMIA 4JRKA 2JTFA 4RK9A 4OMLA 4MAGA 1B0LA 3GXAA 3PV0E 4TOZA 4IIOA 3VDFA 5DEXA 1NMUA 4XU0A 5LJ5j 4ELRA 3H8ZA 3HPIA 4LUDA 1Y96A 3NGPA 1SHGA 1B58A 2XX8A 1WHGA 3FC3A 2CDTA 1IMCA 1P1OA 2Q8MA 2X4YA 1N9SA 1B7UA 1N8RU 3MKDA 4GFRA 4DOVA 1UGSB 2R57A 1OYXA 2P4RA 3ONMA 4BE1A 4HXJA 3QWYA 4LDYA 3OEKA 2CMOA 2F35A 1AWBA 2BE9B 3UPUA 3CBPA 2RMOA 1FBDA 3ISPA 3OMGA 4RNSA 1KA0A 1SI1A 4GWXA 2PZ1A 3EFRA 4LP2B 1P1UA 4R0KA 4H5GA 2UXAA 4EQBA 3IOWA 4QRZA 2F2XA 3U1OA 3PVLA 4M75C 1K9MC 2G6FX 1IZ1A 2H8HA 2YLNA 4NN3A 3LGFA 5CMKA 2A28A 1ZHIA 2ZYNA 2QA4T 3CCSQ 1EZ9A 2RNAA 4RYAA 4F22A 3FRNA 2RHIA 2EBPA 4I3EA 3VV0A 3G3JA 4HCZA 3OW2P 2A08A 2QVRA 1UGPB 4EMGA 2DL5A 2YUQA 4G61A 3DP4A 3HO7A 2HHMA 9ATCB 1K76A 2DK3A 2DD5A 2J6FA 3JCMJ 1MMAA 1QLYA 4X9DA 3CMAA 1B0HA 1FQFA 1Y1ZA 1KD1C 2F78A 3CVGA 3UWNA 2QFLA 1XOCA 4HVUA 4M78B 4IUVA 4BDQA 2YXYA 4GL0A 1S9TA 2HAXA 4QT7A 3CD6A 3RGYA 3OD7A 3K1NA 1LPLA 5H8SA 3UF4A 3CCJA 4ND9A 2XK0A 3BY7A 1QQJA 3FV2A 2D21A 2DL7A 2VB6A 4BDZA 1N9RA 4GLIA 2BTTA 5IHKA 4GQOA 4PLIA 3GF5A 1OLCA 3JCMX 3KN8A 5LOMA 3CCET 1PD1A 1MXVA 4X9CA 1FQAA 3M56A 3KC0A 4WKMA 5D6YA 3MYUA 1WFWA 2YLCA 5KYWB 4OVQA 1IXGA 3IB1A 4PJOC 2XMFA 1B52A 3CIJA 3OYBA 2MF2A 3CMET 2E1HA 3MEVA 4PK4A 1Q7YC 3CMAT 2KLFA 5CC2A 4AMCA 2O9SA 4BY6B 1QCFA 1D4NA 5CM6A 2DXCA 4U4XA 5CIUA 4GWSA 4N0AC 4ZTJA 1K73U 2OZZA 4NF5A 1M8VA 1NV2A 2H99A 3LSXA 5H8QA 1GTKA 1SYHA 2XX9A 2XXWA 3QXEB 3EAEA 1YPNA 2KT1A 1CNQA 3JCMe 2RHXA 4PGNA 1MQGA 3ZBDA 3NPFA 3UATA 1D1AA 1JEGA 2EQKA 2ONRA 5ELVA 5KYNA 3CC7Q 1N04A 2O4XA 3OS2A 3VYGA 1B3QA 2W10A 2FB7A 4QQ6A 4LUEA 1PDAA 2RINA 1BK2A 1QCOA 1JXMA 2ROTA 4FU6A 1A7LA 3P8DA 1MXZA 2FYKA 3T93B 3S9LC 5EHSA 2OCUA 4I8CA 1ZMGA 4PFZA 4OYVA 1BCOA 4Z88A 2WSEE 3V8KA 3LH5A 4YB5A 2AHJB 4J5YA 5LJ5d 3CFZA 4NWDA 1IO6A 1E7OA 3OYAA 4OGEA 3ZS6A 3PMVA 3LSWA 3PUXE 2XXHA 5GANe 1RABB 4Z89A 2VV5A 1Q95G 4RMOA 4M7DF 3JCMV 2A7YA 3R6UA 3VE1B 2GFAA 4JDFA 4OB0B 4MH5A 2E70A 2YRDA 2L3SA 3JB9D 1IMBA 2KYBA 2RQTA 2V4CA 5DYHA 3HSBA 2DWAA 3OBWA 2EYZA 2XXYA 3M57A 4H67A 1OPKA 1XHYA 4OZ9A 2L3RA 1VQ4A 3L2VA 1MNEA 3M0SA 1XT8A 3PUVE 1B3EA 1NUXA 4PJOF 3FXQA 5I58B 4C5GA 3G6EA 2CP2A 3GLXA 1WLPB 3QWXX 4OEVA 3T9UA 2GTOA 1JO8A 4EF2A 2PUKB 3CC4T 3A09A 1KSWA 4J9EA 4U23A 1D9VA 4RTXA 1US5A 3MZ1A 2I0NA 2H5YA 4L6V5 4PDHA 1MY3A 4GBVA 4NF6B 4F19A 3O97A 1SW2A 2VD2A 2QDLA 2MMPA 4ZEDA 3OSSC 5J26A 1YHQQ 1B5HA 2O1LA 5JEIA 1RAAB 4KHZE 3H7MA 1OZ3A 1FBCA 4O3BA 2EJFA 3E2UA 1K4US 4GXAA 1IMDA 4R2BA 4GF8A 2WKYA 1CE2A 1U1SA 2REGA 3CCQA 5CO7A 3MO8A 2EKOA 1VQLA 1FPLA 1ZSGA 4ZZEA 1N0TA 2ZCFB 4C8QB 4PDDA 2R58A 2MOXA 3AT1B 3LW5E 1AIVA 1TUDA 4MJOA 4OMBA 2OTLQ 4BUGA 5EQAA 3OS0A 1TWYA 1M5FA 5KYUB 3RPWA 5ET7A 3M0RA 1WDNA 3VVEA 1UDLA 4A63B 4YMAA 1PSFA 2RQVA 3JCMQ 2DZ9A 3HRSA 4MZPA 2Z8DA 4QFLA 1G83A 1K0SA 3OYFA 2KXDA 3U72A 1M90R 3EHUA 1I0CA 1RKMA 1SI0A 4WF2A 1YHQA 4G8NA 2H3JA 2ZYKA 1TUGB 2O2OA 2XU8A 2YUPA 1RYOA 2QQRA 5GAN5 1AWJA 1LFGA 1LAGE 5I56A 4LXCA 4PFPA 1KK7A 4JWXA 2HCKA 2DIGA 2UVJA 3W9WA 2EQJA 2O1MA 1OVBA 1OI1A 1FRPA 4BI4A 4F04B 4M7AE 2DTOA 3RPLA 3FVKA 3M5AA 1Q81U 2I3WA 2EYWA 4N6DA 2VWFA 4J9DA 2KAFA 2ABLA 3EG0A 3T9HB 1USYE 1SW5A 3M8UA 1PSEA 4LN2A 3MQ9A 3PGGA 3FJ7A 1G2BA 3O6HA 1MMNA 3QG1A 3JYRA 4PE3A 4IO5A 3I5SA 5GAOp 1YZ0A 1M3CA 3OOAA 1V76A 5DVJA 1FX7A 2WEFA 1WIEA 1BP5A 3E78A 1LBXA 5GAOm 4IIMA 4JJNK 5I57B 2ECZA 2F2WA 4XTXA 2B4MA 1M5Q1 1LBBA 1WHKA 5A0LA 3FASA 1RI9A 1Q9DA 1F1BB 2WYPA 4IUTA 4FCYA 3A8LB 1YNZA 5IZ3A 2RA2A 2E41A 4F7UE 3JV9A 4OWDA 2VXFA 4MIJA 1OOTA 3KJ7A 5KCJA 3O28A 1WA7A 4F2QA 4BD3A 1UGVA 4G68C 1N3WA 5KYYA 4DI3D 2K57A 2HAVA 3OYIA 1YJNT 1IHWA 2HQHA 3L42A 1OZ2A 1NUYA 5LJ3g 2Y7WA 2EFIA 1KC8C 3CHGA 3KEIA 2YDLA 3PIOA 1G3YA 3UA8A 2CT4A 5T3JA 3T96B 3TSWA 4WEDA 4P5NA 2KT8A 1WDXA 1RDYA 3EG9A 2OWTA 1VQKQ 4CI0C 4XAXB 3CBOA 4KD5A 3NTIA 2WX9A 3QUIA 5EQ9A 1ZX6A 2FIEA 3BKIB 3C12A 3CCJT 4HCBA 2AT1B 5FU6C 3H0IA 3JCMP 4AG2C 1BKAA 2BKDN 4PNOA 3TVTA 4DEXA 3CFXA 4C8QD 1HSLA 2ATCB 4OMFB 1JQQA 2DSFA 4II1A 2KQWA 1NV5A 3O2AA 1EYIA 2ESWA 2VD3A 3CCUQ 3CCEA 1POY1 1N84A 2PVGB 5KE2A 3OO6A 1AZEA 4M77G 3QXMA 4QFNA 2ZNTA 1QUJA 1SBPA 4DXBA 2DXUA 1DJ7B 3A8MB 3QDFA 2RK1A 1PG5B 4PQJA 4QFOA 2O68A 4PTKA 4KYEA 1VQKA 2JNGA 1C1AA 3QZ9B 4XKPA 2M0OA 2ZMBA 2E3IA 4J9IA 1X2QA 4E7SA 4Q5WA 2A5TA 2VPOA 3RY3A 3TREA 2IEEA 3P8HA 4EMKB 1JJ2P 3IORA 2ZPBB 1GR2A 2XG8D 2KRSA 2P0SA 2A36A 2C0IA 2MPXC 1Q86R 1B6HA 4G2ZA 1NL5A 2VXEA 3VVDA 1VFDA 3MVXA 4N8YA 4OFOA 3QKJA 1GGGA 4J7IA 1SPIA 5HM4B 5H8HA 3OY9A 2HKQB 3X26B 2CUDA 1Q82C 2NUPA 2Z22A 3FBPA 1VQ8Q 4MLQA 4M7AG 2PMSA 1VQOA 1QVSA 1BI0A 5KCOA 1RACB 4PJOB 1FBHA 1YJ9Q 1B9JA 2FRWA 1K9MR 2FHDA 4EIKA 5GAN7 4HXVA 2FNCA 2C0TA 1IXHA 1WXTA 1LVKA 2K5FA 2DQVA 3SWNC 5DM7R 2DIQA 5LL6S 2YRCA 4AFZC 1MXUA 2E1SA 3F70A 5FWCA 1Q7YR 1M3BA 2LVMA 2VOZA 4LN5A 5GAMf 5L9SA 3SEYA 1ATGA 2F5TX 3CR9A 1I4K1 5FTHA 2DX1A 5AA4B 2V3TA 3LSLA 2QASA 2MKZA 2EYYA 5L8RE 1QWFA 1YHQT 2G3RA 3LLRA 4JWOA 3TELA 4OGCA 5KDTA 3C94A 1K9YA 4F17A 4PFBA 3PT9A 3HRTA 2GHBA 4YKJA 4FIBA 3GPLA 2F5XA 3CCLQ 4K11A 1GFDA 1NNKA 1ZKBA 1H3DA 3SWNB 4EXLA 4GWUA 5LJ5g 2UVGA 1Q82U 3CMEA 2HCAA 1VQ5Q 4YAHX 1QVFP 4M77D 2OTJA 2F7CA 1X01A 1S50A 2RO0A 4M75G 2I0BA 4RG8A 4RTVA 4E47A 1LFIA 1VFEA 1VSOA 2X7PA 3LGLA 4YICA 2KNBB 4F7UG 1DSNA 2RQUA 5GMKe 2CS7A 2KI7A 1PHTA 3RYDA 4E7JA 4GLMA 1Z9QA 4C92C 4NF4A 3C31A 1PNJA 4WXJA 2Q9TA 3TTMA 4H46A 2PVDB 1NEBA 4B6MA 4KR5A 4P11A 3SEVA 2CP0A 3QYTA 3TEPA 2A3LA 2CH4A 2CZ1B 2LNHB 1UQWA 2OWZA 3CD6T 1FTAA 3R7XA 4PFOA 1AHJB 2DVEA 4BI3A 1ZTYA 4C92E 1JW1A 4UABA 1UTHA 2P3NA 2R5MA 1FJ9A 4GWZA 3IL1B 3CXCA 1YIJT 4HW8A 4MMKA 2NUTA 5DVFA 3OA6A 2LJ0A 5GMKi 3L2WA 1K1ZA 3D4GA 4ECFA 3IFCA 1OQKA 1UHFA 3RKYA 4R6KA 1Q86U 1UUEA 2JS2A 2PBWA 2LRQA 3ZSFA 1LJOA 1KQSA 2ZZXA 2OX3A 4YB7A 2ZPIB 1MY2A 2D5WA 1IRXA 2LCSA 4GX4A 4GL8A 4GVOA 4J6YA 4G68A 5EYFA 3N6TA 2CZ7B 2DWJA 1XOVA 1YI2Q 1N8RR 2DF6A 1Y3QA 4XFEA 5FHMA 3K4UA 4DIGA 3OYYA 2EW3A 2QQAA 4OMQA 1H92A 2LTOA 4KT0E 1P99A 3KC1A 3CFLA 4Q5TA 3G3GA 4PE5B 4QW2A 1HXDA 4ZZAA 5FRMA 3M0PA 3UA7A 1EZZB 3J80E 4R6HA 4ZE8A 2ABHA 4O94A 3M9QA 3CCLA 2DVZA 3N5LA 1DCUA 1S72Q 2ZGWA 2V25A 1AWOA 5M9OA 1B1XA 1M9SA 3A3CA 2Q2CA 2HAUA 4JVDA 1PD0A 1X2KA 4BACA 4ZE9A 2KE9A 1FTMA 3JCMf 1B5IA 4FT4A 5FLXE 2Y84A 4R6YA 2MK5A 2OTJT 4M78F 3TDJA 1QVGA 1SYIA 2O01E 3WVEB 1DMBA 1JQFA 2Z8FA 4RXLA 3G4SQ 3HRUA 1Q86C 1BCMA 2RCAA 1JW5A 3EG1A 4ESRA 2L8DA 4BY6C 3C36A 3KUFA 4AFQC 5GAN8 1USYH 1XTDA 2HZYA 1QKAA 3I56A 5D6WA 3ZKLA 1KC8U 5I58A 3OYLA 3D7SB 3E9FA 2KDSA 1G3SA 2QVVA 3UA6A 2RPNA 1FPGA 3K1PA 4C92A 4IURA 1JU5C 2RJEA 3TUSA 2D3IA 2FEIA 5CMCA 2PVOB 5I84A 4HVVA 2F3BA 5GJVB 2QMXA 3RERA 2YHTA 3G1JA 4U4SA 4MFIA 1RAEB 2I4BA 2QTVA 2VGMA 3RESA 1MG1A 5CQYA 2BJIA 2QSXA 4G8HA 2LNVA 3UORA 2XXRA 3JB9I 1WVJA 2OK2A 5EC7A 5GJWB 3SDZA 2HBPA 1KA1A 4EPCA 3BIGA 2B65A 2DVCA 4UC4A 1M27C 4ESXA 5GANd 2IPOB 5GAN4 3VJPA 1I81A 2P1SA 2F3DA 1IEJA 2E3HA 2HPGA 1U1TA 4OVAA 1NNFA 2RB6A 4BLAA 2JXBA 4DQ2A 4OENA 3CCMA 1IXDA 4MNPA 1A40A 4H45A 2ZPFB 4J9BA 2GQVA 4D6WA 3I6VA 2XIDA 2KRNA 1BTJA 1B1HA 2NWJA 4C0FA 1YN8A 3OYMA 3PPNA 3MP8A 1G5VA 4KUDK 3TTRA 1NV3A 2VYTA 3CCUT 1G3TA 4E7LA 3V89B 3FVOA 3TSZA 1NH8A 4OESA 4R55A 1ZA1B 1TU0B 4FL6A 1JJ2A 4MX6A 1CKBA 2DAQA 3OW2S 4PETA 3BE3A 2PCRA 4NG7A 4C5EA 3CCLT 1ARKA 3OYJA 1Y0MA 5KYUA 4FJPA 4C5HA 4YMBA 4BE0A 4HTGA 1TG0A 4CRIA 2R9JA 4FECA 1OPLA 4J9HA 3RN8A 5IHNA 1VQLT 5CVIA 1YP5A 4JBZA 2PTKA 2ED0A 1MY4A 1CB6A 4N17A 1NKXA 4OERA 4H8IA 3QPHA 3EG2A 1YITA 2XXIA 4OB3B 2JTEA 2MIOA 2AK5A 2RJDA 2PVUA 1GV8A 3EGXB 1TOVA 1PWTA 3VS2A 3E13X 3CPWP 2DTHA 4A4GA 2O51A 4KCDA 3PPPA 2RI5A 2QL3A 2OLBA 1X6OA 4H1XA 4A4EA 1RAGB 3K0VA 2LQWA 2YT6A 1FTJA 3PMXA 4AFUC 5KYWA 4J9FA 4LE9A 4JJDA 4E7IA 3I55Q 4IGTA 3U93A 1KQ1A 1JB0E 1S1NA 4LVQA 1NZ9A 2KR3A 3FJGA 4M7DC 1VQMT 4LZ5A 5FTIA 1RLQC 1VQNQ 2EQUA 4F3BA 4XTCQ 5H8QB 1FPIA 4FORA 4DDDA 1AT1B 3K6XA 4OVTA 3RUMA 3MWBA 3QAXA 4RPOA 3R6NA 1ANFA 2QA4A 3OO7A 3QK6A 3MBPA 1A8FA 2OBGA 2PT2A 3SZPA 4Z02A 1M90C 4PFYA 1ZUKA 1MXYA 2ZYOA 4FT2A 3CPWS 2F36A 1Q1KA 4ESWA 4OTEA 3FJMA 3CG1A 2HNIA 2RD1A 3M3LA 4KQPA 3S3OA 1S72A 2LAOA 1VQ7Q 3QYGB 2X51A 2GHAA 4IUPA 2M16A 5IAIA 5FRNA 3CCRA 3GOXA 1FQDA 3MUQA 5LJ5f 2HKNA 4C1UA 3EHSA 2Z23A 5EYGA 5CMBA 3EG3A 1B2HA 3VRYA 3TCJA 2QDYB 2DXYA 1TFAA 4MNIA 1MHNA 3TAJA 4RK2A 3KOTA 1I6QA 1IIWA 3DLMA 2G93A 4YKIA 3TEEA 1OV3A 3HSTA 2K5IA 3R6OA 5HPQA 4FIMA 4IY5A 4OVRA 3LUYA 2WBDA 2D8JA 1D9YA 2DE0X 4C0DB 2GBQA 4FM4B 3O6IA 3SKPA 5IZZA 2KGTA 3U23A 4THIA 3CCQQ 2D1XA 2ONKE 3V8LA 2OAUA 2UVIA 2RF0A 2NUPB 1RYXA 1G0HA 4JSOA 1BIBA 2EYQA 3CCVA 1M5CA 4DCXA 3U94A 1BK4A 4NWCA 5ITPA 1UECA 2UYFA 4G77A 1Q81R 2NYSA 4NL3A 3CCEQ 1MY0A 2FVZA 4N91A 3S3NA 1PM3A 1WXUA 2D6FA 4JB7A 3N94A 2HEUA 1GCPA 3S6WA 1IHVA 1AMFA 4RPNA 4OXVA 5CKEA 4L17A 3JRZA 1LBZA 1KQSS 3T66A 1KHCA 2QS4A 1PC0A 3TTKA 2DERA 1TFDA 2CEYA 2PX1A 2Y7KA 4OA4A 1B34A 2BUDA 2K2VA 2ZZDA 3M4YA 2DILA 2HQ0A 3TTNA 5LJ3d 3META 1RDXA 3TQ7P 1NLOC 2QEXT 4XTUA 2X4WA 5FU7B 5I2SA 1LAXA 5KDTB 1FQCA 2GNCA 5HK3A 4QQDA 2EJGA 2R5AA 3OYCA 3ECRA 3Q25A 2L5QA 4C8QA 3FD3A 3M3FA 3VLWA 5CKBA 4PJOA 5GAOl 3HTRA 3LH0A 4OMNA 1NV7A 2L2PA 3SWNA 4M7AB 1JRIA 4R72A 3A5ZB 4RKUE 5GMKj 4U21A 5FHOA 1WJRA 3NHNA 2CZHA 5JK4A 2RQRA 4MBPA 3UN6A 4ZGDB 3TQWA 4F7UB 2IG0A 2NXOA 3NTHA 5FHNA 2V3QA 2RJCA 1ZJLA 2QS3A 4C0GA 1YI2T 2A0FB 1OX8A 4M75B 3T9NA 3PFSA 3IAZA 3EGDB 3K02A 2QVUA 3CG3A 4NF4B 3ULRB 1CKAA 3I3VA 2K6DA 2GRVA 3I5RA 2EPDA 2FIXA 1PRLC 5CI5A 4IO6A 3EGXA 2KEAA 2E12A 5CR2A 1B4HA 2AZVA 1I5LA 4JZ3A 3MW0A 4QF9A 5EYHA 2DZCA 5IXBA 2JJKA 3OB9A 3A8HB 3IJXB 4LONB 5L23A 4P9KA 4N4IA 4EMKC 1Y07A 1ZBXA 3V8JA 4HCYA 2MWPA 3ASKA 3S9NC 2XX7A 2GH9A 2V84A 4C0RA 5LTCA 1NUZA 3KFVA 3TPAA 4B9XA 2F7BA 2WBBA 2GQ1A 3PUYE 4ONYA 1D3BA 4N6PA 3DB4A 3OSRA 4FAJA 1NYGA 4PAFA 3LR1A 1I8FA 4M78E 3OYHA 4JJBA 3RR6A 1Y3PA 1H44A 5FROA 2R71A 2DM1A 4DE8A 1M2OA 4LD9K 1NJIU 2ANJA 3RPLB 1OU8A 4DLDA 1O9SA 1FXXA 1NE8A 4IUUA 1MPDA 3PTYA 1D09B 4D8KA 2YPNA 4E0WA 3HP9A 4M78C 1W1FA 4N81A 1JEUA 1FPEA 4GX3A 3C9HA 2GFEA 3N5BB 2YSQA 3H6TA 2X35A 5DT6A 2X3XD 3EGUA 2XICA 3QDRB 4X9TA 4MDWA 5L9MA 5KYYB 2R8TA 3OYDA 1FPDA 4M77C 1VYTA 4J6XA 3M59A 4ME7A 1DBZA 3ZL7C 4M7DG 3FDRA 4HA8A 3K6VA 2DEQA 5I2KB 1B40A 4NEDA 1ELJA 3VLVA 2F69A 3OMBA 3FB9A 4OFLA 4RA1A 4P0GA 1TSFA 2DP8A 1HSQA 2KXCA 4QFKA 1M3AA 2EQMA 3FJ5A 3QJYA 4KULA 2CP6A 1FMKA 1C0MA 4XTVA 2JOYA 1ZLMA 3MCAB 4OVJA 2H4IA 3CCSA 4RG2A 4LZ7A 3C33A 3RLFE 3MP6A 3OXNA 4MZTA 1QJMA 3IB0A 3KGCA 2V1QA 1B05A 4M78D 1Q82R 1VQNA 3M55A 1QULA 5TPAA 2JUFA 1PCXA 2RHZA 4C92F 3CC4A 4M1VA 3LWIA 4BDLA 4ZECA 3BIHA 1YCYA 2XHCA 3IK6B 3JSCA 1E6HA 1FMWA 2B8AA 1QP3A 5K2YA 5AA3A 4C92B 2QYZA 1VQ8T 1DK4A 4LNPA 1OMPA 2REJA 1O63A 1G0IA 2LQNA 4F31B 4NF5B 1AH5A 1VIEA 4O8MA 4F14A 1QP2A 2RHYA 2WACA 3V83A 3TQLA 1H3HA 1YJNA 1FWZA 3HPWA 3M54A
chains in the Genus database with same CATH topology
2I58A 3L2UA 2XI9A 5BUUA 1G3WA 1SD3A 3DB3A 4F7UF 1N7XA 1NPPA 2QMWA 4GOTA 3CBMA 1QW0A 3RTWB 3TCGA 3V5AA 2IA4A 4M77F 1QUIA 4BI8B 1LB8A 1PB8A 2RF1A 3IR1A 3L6GA 2Q89A 3Q26A 1M1GA 4NS5A 3OMCA 3DLLA 3U92A 4BDNA 2R6GE 4F7UA 4GD5A 5ICTA 1XQHA 1PEBA 1P92A 4NF8B 2KMTA 1PC3A 1BIYA 2ZPEB 4J7FA 3EPEA 4ZTFA 2I4CA 2K4YA 4OEUA 3QIIA 2QQSA 5GAMd 3VVFA 2OJTA 5H8HB 3M3KA 3FVGA 4E0XA 2DD4A 4C8QC 1LFHA 3VU3C 4PP0A 1W4SA 3LC8A 2ALUA 3MPKA 3M53A 1URGA 3ILUB 3U8QA 1HK9A 5AE4A 1MS7A 1H45A 3BBRA 1NPRA 1MQJA 2PU9B 4BE2A 4C8QE 1WJSA 3AHUA 4O3AA 2P0PA 3K6UA 4GY5A 3KN7A 3CC7T 5AA2D 2EIFA 4M75E 1XNIA 5I21A 2VGNA 4F18A 4POXA 1GXIE 3A8OB 3KZGA 3OEMA 1VR5A 3DLNA 2OTLA 4F1VA 3TCHA 4C0DC 3RUXA 2DXTA 4ZN1A 1JVYA 1H3ZA 3JCMW 3VUZA 4U1ZA 4P0IA 1B3HA 4IO2A 3HKSA 3KG2A 3RIRA 4F3SA 2EJ9A 4BB7A 5DTBA 1LCFA 2XXUA 1YTVA 5I59B 4C92D 2HZLA 4ZDMA 2OWSA 2I2LA 4KI0E 2F6PA 3WAFA 3HL8A 2JVVA 3KN3A 1R6ZA 3PU5A 1VIFA 5GANg 4IO7A 5CK9A 4J6WA 2RK2A 4OQOA 4PJOE 3GBBA 2QXFA 5GMKl 3E3KA 3I55A 2DKGA 1LOJA 1O7TA 3H06B 3N6UA 3BDUA 4NTLA 3FUZA 3CCQT 3S9MC 5JTYA 3H6UA 5GMKh 3KBRA 2V93A 2AIXA 4IGRA 4M75F 3K6WA 3RKWA 3KXTA 3KBGA 4OP0A 3VXCA 1XVYA 5H8FB 2NVUB 1IZ6A 2QS1A 2O84X 1YAEA 5CBRA 3UT1A 4C92G 3A8GB 5C6SA 2CZ6B 3Q28A 4KCCA 5KE3A 3DKMA 4HKEA 4YZZA 3CXCS 1Y9UA 1BKBA 4RJZA 3T9XB 2H98A 2CZ0B 3O66A 1JNFA 2V8KA 3JCMg 5KCJB 4FSXA 2RHUA 3L6HA 2EAYA 1T0KA 1B5JA 1VQ8A 3MZ9A 3SERA 2HD0A 3Q29A 2Z8EA 1UTBB 2FYIA 3QSLA 3OELA 4FEBA 1IREB 1QUKA 4X34A 1K73C 3O6GA 2G29A 2Y7IA 4M7DB 2MI6A 4DOWA 4PLLA 5CKDA 1PB9A 5K2XA 3OENA 3G3IA 5H8NB 1KWHA 3P7IA 4KPTA 5AA2A 2L89A 2DS9A 5TP9B 3GLBA 1QW1A 3WVDB 2Q8JA 4J83A 3OO8A 5I2MA 3HHFA 4DXUA 3NFCA 1Y71A 4ZEIA 4YB6A 4FATA 2PT1A 3E19A 4JUVA 1VQNT 4QVCA 4ZGJB 4A54A 2XXPA 4AB6A 4ZEKA 3T22A 2IVWA 2K3XA 2YRVA 4OETA 3BDLA 2CKKA 3LBSA 2VP1A 2M9UA 1Q81C 3X24B 4XKNA 1PBPA 2BIVA 1GVCA 3X28B 1B34B 4EDUA 5GAOn 2NLUA 3BFTA 1XVXA 2D9TA 2ONSA 3T9VA 2RJFA 4M78G 1K8AC 5GANj 2LQ8A 1VQ6A 4QFPA 4XTWA 1IQ7A 1O75A 3PMWA 2DO3A 2LT4A 3GNFB 2ZPHB 1YBYA 4L5GA 1DPPA 4R56A 1A8EA 4MF3A 2CZLA 3C4MA 2P0QA 1MDQA 4JLGA 1N7WA 2XD2A 3SD4A 2Q88A 1JETA 4AQ4A 3EQ1A 4M7AC 3GZGA 3FEOA 3GNGA 3CC2T 2K3YA 1JEVA 4OF1A 3S2VA 4M7DE 5LJ3j 3V7RA 4M7AD 4K3FA 2GCXA 5FU7C 4R9GA 1K8AU 1Y4CA 2E0SA 4O6JA 1LSTA 4ELPA 1URDA 3OSQA 1VQ7T 3JCMb 3MHXA 4XKRA 2VGQA 4JS4A 3JCMh 1MM6A 3CRBA 4OFJA 4QSDA 5ICQA 4ZGEB 2O69A 3S3MA 4O3CA 3VXBA 1JVXA 2RM4A 3GP8A 4MMLA 4ELYC 3OYEA 4GWOA 2F34A 3BW1A 4YKKA 3B6TA 4M77A 1MXWA 1QKBA 2RKMA 2QEXA 3ODBA 2X26A 1BIAA 2E10A 2X4XA 1LNXA 4PL6A 5I2KA 3I55T 4M7DD 3LX7A 5IAYA 4H65A 3TODA 3HFOA 1OQGA 3OO9A 4HCWA 2YJPA 1W2BA 4C1TA 3UDCA 1A55A 1HSJA 3R26A 4MZMA 4PKCC 3G3FA 5HK0A 5GANh 1YJ9T 1Z7ME 4JRPA 4LQ5A 3IX1A 5AA1A 1UGRB 4BDOA 5D6XA 4LQ2A 2RCBA 3CCMT 4LA9A 3MEAA 3UK4A 3TTLA 3Q27A 4F1YA 2QQBA 1SDXA 1H641 4XIGQ 3L2RA 2FL7A 3CPWA 4QSEA 3PGFA 4DZ1A 5M2VA 4ZEFA 2MAMA 1ZIUA 4JRIA 4OB2B 3EHTA 4IUQA 4OHNA 4F2OA 3FIFA 3SB2A 5LJ3f 1DTGA 3TU4K 3TYHA 2DTIA 3M58A 4U1OA 2RI2A 3QUFA 3V7SA 1Y20A 1FQEA 4Z0IA 2AL4A 3USDA 3GIBA 4GRKA 2M1HA 3FVNA 2F6GA 1R1NA 3VLUA 3WAEA 3I56T 3W15C 2ZXTA 2KVQG 5EHMA 2OTLT 2THIA 2CYZB 1MGQA 3MEWA 1K9MU 1ZBMA 2I6EA 4KUIA 3RT6B 2LQKA 3RMSA 3TKDA 1OLAA 4Q0CA 5DEXB 1VE4A 3E9XA 5FU6B 3O29A 2F5KA 5CKFA 3QZ5B 1D3KA 1LGBC 1UIUA 5I2NA 1UIVA 1B51A 1OVTA 3MVZA 4YTLA 5J1DA 1IUDA 5EG2A 2FA7A 1MDP1 4QSCA 1Y1MA 3H6WA 4GIZA 2HFBA 2RC8A 3CCVT 5BWJA 1I6BA 4IY6A 3RMQA 4XXUA 2Q2AA 1N3XA 4JSDA 1LCTA 3RTFB 2Y4XA 3CPFA 2ESNA 3OBYA 1WJQA 4M75A 3HHTB 5IT9E 5LJ5h 1D3BB 1R9LA 5B70A 1P1QA 4TVRA 1XC1A 3MP1A 4QQGA 3OYNA 1DPEA 3B6WA 1SVXB 1B3GA 1IXIA 2B3BA 3PUZE 3E4RA 4BDRA 5TU0A 2LC4A 1N8RC 4X1DA 4N13A 3C32A 2HZKA 3K2DA 3KFMA 1F9BA 3VYHB 3KSJA 2I3VA 1XS5A 2M8CA 5I59A 4C8QF 5KZTA 3JB9H 4ZEBA 2V3UA 5GAMg 5DLQE 3GBAA 4HCCA 2E64A 3JB9G 5L9OA 3C4SA 1WQWA 3G4SA 4JS5A 4R75A 3EF7A 2Y4YA 3G71T 4IB2A 3FLGA 2ZYMA 5B7DA 4Y28E 3SFMA 1URSA 3KOSA 4FEDA 4A4FA 3IO6A 1WNLA 2DJZA 1UTBA 3JZJA 1Z7NE 2DE3A 3MPLA 3X20B 4RCBA 2O7IA 5L8DA 2LCLA 3G3HA 4X1BA 1VQPT 1A54A 3PD8A 3QSUA 3G7WA 5ISUA 1I69A 1ZU0A 1MM7A 5CQXA 1VQ9T 1SQYA 2B3FA 5GAN3 3CI8A 3QBYA 4KBMB 1MH4A 2AL5A 4U2RA 1WPYA 1KQ2A 1Q7YU 3MVYA 1B4ZA 1ZLQA 1A99A 3H6VA 1MPCA 4TLMB 4GLKA 4KFQA 1I6AA 5KCHA 4KYSA 1BYMA 1LAFE 1H76A 2DXRA 2XXVA 3SESA 1HSEA 1B7HA 4XQ3A 3S9EA 2PQWA 4A4HA 3PNWC 2PUOB 2MWOA 1SW4A 5IKBA 4M7AF 4EQ9A 4TQUQ 3C34A 3ER0A 4DXCA 4F39A 2DE2A 5TP9A 1YI2A 3JB9J 1MPBA 1O64A 4H5FA 3X25B 3OS5A 1YJWA 3KJTA 1NNTA 1B7ZA 3PPOA 3PTAA 1MQIA 4Q8RA 5CCAA 2RH2A 3URGA 5LJ5e 4NE4A 4XK8E 3J81E 1QVFA 5F1QA 3RQTA 4LDUA 5AA2B 2HQEA 3ZKKA 2QI2A 3F11A 4NF6A 1IITA 3QYHB 1RI0A 3FGSA 2I49A 5LJ3e 5GAN2 3HV1A 2UYEA 3MVWA 3ME9A 1MQHA 1FW0A 2XDBA 3SEWA 3CC2A 4ATOA 3OS1A 3B7DA 3FV1A 1KD1U 4EQ7A 2QJEA 5IN1A 4Z7EA 1VQ5T 4EXKA 1M90U 1NJIC 4I1DA 1Q35A 3HHGA 2XXXA 2YLBA 3RT8A 1OQHA 5A0GA 4YU0A 1TXFA 2KSSA 1AOVA 4R9FA 2P2AA 3UIFA 4M4GA 3O9PA 4WEPA 3WXMB 4U22A 1FTLA 4PFWA 2V8IA 3IOUA 2XDPA 4Q30B 3ZEHA 4NF8A 3OQ5A 4JLIA 2LT1A 4M7AA 4I9DA 2DWHA 1Y7XA 5I57A 2VHAA 3ILTB 3TZAA 4JXIA 1YCJA 2H9BA 5CAIA 2KY9A 4V2SA 4PJOG 1VQKT 3UP9A 1Y96B 2QPQA 3MJNA 1NH7A 1VQ6T 5C0MA 5DLOA 4HT9A 2AYSA 3CSGA 4ELOA 4EUOA 3B6QA 2C06A 3CC7A 2XKOC 4A4KA 3K1MA 3E9GA 5DVIA 4QVDA 5GAOr 3K01A 4M78A 2A5SA 3IOTA 3UGWA 4ELQA 1P1NA 3BFUA 4DCYA 1MY1A 3JAME 3QIMA 1R9QA 4YKPA 4ISUA 4LUBA 4NMYA 5F7VA 3LSFB 5JTYB 1M5BA 3TCFA 3H3GA 2NUVA 1QVPA 2GFUA 2K5LA 1WGSA 3G71A 4POWA 2Y7PA 4DA4A 1UB4A 3FXRA 3SDFA 1H43A 2XD3A 3HN0A 3L2QA 1B32A 3CSBA 1DTZA 4M77B 4TLLB 1BI3A 4LZ8A 3CEYA 2I0CA 4R73A 3IO4A 3HFNA 5HY6A 2H25A 4I62A 5GAMh 3PMTA 2FVUA 3VFJA 3VV5A 2X7QA 5ITOA 1QVFS 3IOVA 1B3LA 4A53A 4JDSA 3QO3A 1PB7A 5GANf 4EF1A 1V29B 2LCCA 1VQ9A 4XU2A 1YJ9A 2LX9A 2NOOA 1MQDA 4EMKA 1X75C 3BFMA 4QVZA 3PIPA 2O4XB 1L5TA 1DOTA 2DPPB 3H4ZA 1FTKA 1B3FA 2VUBA 5A0DA 4AB5A 1VQMA 2GF7A 1R8OB 3G4ST 1N76A 1M4ZA 4X48A 5A5XB 4R2FA 2DE4A 4LATA 3G7ZA 2XHDA 4PFUA 4BDMA 1Y3NA 4XKQA 4LDXA 3MAMA 4R74A 3E1SA 3VKIA 1YJWT 1SSFA 3LWHA 5TPAB 1VQOT 3OW2A 3TFLA 4F1UA 5GAMe 4M75D 4ELZC 1B46A 4BDYA 3L2ZA 4HS7A 2WSCE 3MEUA 5CBSA 3SEXA 1MXXA 1YIJA 2RC9A 2XDDA 2ZNSA 3O8VA 3JCMc 2V8JA 3TMGA 5CKHA 4LDWA 3D4CA 3I5OA 5AA4A 5HBCA 1NFTA 5J3BA 3RKXA 4GXSB 2DXBA 3ZFJA 2QQ9A 1FQBA 3PPRA 4FE8A 3FJPA 1EZOA 2DWIA 1EU8A 2Y7RA 4M7DA 2RI3A 3QUJA 3MZBA 3IB2A 1U8RA 1II5A 3CCST 4JWYA 3H03A 5H8NA 2LDMA 2JN0A 2O6AA 1LAHE 4RY1A 1P1WA 2PYYA 2QS2A 1RL2A 4B9WA 5GMKm 4XTYA 2O7UA 3Q1JA 5I2NB 4JRQA 4LDVA 1LLSA 3JB9F 4XTZA 1MH3A 2JZ2A 1KG1A 1M1FA 2XD0A 3J7AF 4H8JA 4IKFA 3CCRT 3G6ET 5I56B 3INZA 1TH7A 4XU1A 4E7HA 3PD9A 4C8QG 3SEUA 3FZVA 3HCQA 2WSFE 4RCCA 1UTHB 3DM0A 2F8DA 4N07A 2BJJX 4NL2A 2F97A 5AYFA 4ZS9A 4H6DA 3LYIA 4C0ZA 3MC2A 1YITT 1M5EA 2DYXA 4E7KA 3H6ZA 3C35A 4F29A 2X4JA 3V7CA 2DOJA 3V8XB 4G68B 1Y4TA 2P0KA 1BI1A 1WQ7A 1N27A 1S7YA 4QHQA 3S4UA 3L1AA 1BI2A 1EIFA 4LD6A 4O5VA 1W2BS 3EFSA 2RC7A 2W7YA 1MRPA 3DELB 3IJOB 1M1KU 2I48A 2VC8A 4HT8A 3K00A 1FCKA 3QJ6A 2QTXA 4Y91A 3CCUA 1BLFA 2HXWA 4PJOD 4OB1B 3QHSA 2JTMA 2XXTA 2QRYA 1LBCA 2XXQA 4UACA 3OYGA 1UGQB 2P4TA 4NOYA 4EMHA 4C5IA 1LB9A 4N4GA 3KSXA 4KYDA 4M77E 3AXFA 1J1NA 3EN3A 4N0AA 4L59A 1M5DA 2E6ZA 4N4HA 4MLVA 5A5XA 1VUBA 3A3UA 2HQXA 4H0WA 1AL3A 5GAMj 1EH3A 3OYKA 3RNNA 5DY9A 2EWNA 1M1KC 1FTOA 1KHIA 1VQPA 4G4PA 1JW4A 2E5QA 3G3KA 1JBMA 4G8MA 5CRYA 3N26A 4UA8A 1SW1A 3DP6A 4XU3A 4MDXA 1UEBA 3SETA 3FIRA 5J39A 3THIA 4VUBA 4F3PA 5H8FA 2E65A 4F3GA 5HKCA 2D0QB 1POTA 5KH6A 3DP8A 5GAN6 4ZN3A 1WODA 1VQ5A 2KK4A 5LJ3h 1JJ2S 5GAOq 4IO4A 1EZPA 4J8OA 2ZPGB 3C95A 1OIBA 3W9VA 1TT1A 1US4A 2E6NA 3FXUA 3P8BB 3PPQA 1S72T 5CMMA 4IO3A 3NTKA 1ZQ1A 4PFTA 2ZNUA 3OSVA 2CGHA 1VQ7A 1IXCA 2A5TB 5A2QE 3FATA 3JCMd 2Y90A 2F7AA 3M4GA 1NNPA 1VQ4T 2UVHA 4EDPA 3VUBA 3PUWE 1N6AA 1QVGS 1PBQA 3PMIA 4JRKA 2JTFA 4RK9A 1B0LA 3GXAA 3PV0E 4TOZA 3VDFA 5DEXA 1NMUA 4XU0A 5LJ5j 4ELRA 3H8ZA 3HPIA 1Y96A 1B58A 2XX8A 3FC3A 1P1OA 2X4YA 1N9SA 1B7UA 1N8RU 4GFRA 4DOVA 1UGSB 2R57A 1OYXA 3ONMA 4BE1A 4LDYA 3OEKA 2CMOA 2F35A 3UPUA 3CBPA 3OMGA