4R74A

Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
319
structure length
319
Chain Sequence
SKGRLVIYCSATNVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAKVKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYTAIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQGAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTNTTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC-type Fe3+ transport system, periplasmic component
publication title Active Transport of Phosphorylated Carbohydrates Promotes Intestinal Colonization and Transmission of a Bacterial Pathogen.
pubmed doi rcsb
source organism Actinobacillus pleuropneumoniae
total genus 119
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r74A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r74A01
4JWXA 3Q26A 5H8QB 4DDDA 3LUYA 2XXTA 2H98A 2ZNTA 4UA8A 1JETA 1NH8A 4EQBA 3O6IA 1S9TA 4QSDA 2ZYNA 3USDA 2HAUA 1BP5A 3L6GA 4Z0IA 1A8FA 1SW2A 1FTJA 1ZLQA 4ECFA 4QFKA 4ZEFA 5DVJA 4M1VA 4YICA 4GFRA 3VXBA 1N7XA 4NF6B 4OEVA 4LONB 1QJMA 2NXOA 4IY5A 1MDP1 4F3PA 3TCFA 2F5XA 4GVOA 3MQ9A 2XD3A 4DXCA 3E13X 3G3IA 1OIBA 3T9UA 1B9JA 2NVUB 1IQ7A 2XXQA 1MM6A 1PBQA 1PB9A 4QFPA 5AA2A 4PQJA 3CG3A 4RJZA 2DSFA 3OMBA 4GL8A 4N6PA 3K6UA 3VVEA 3JYRA 1T0KA 3RT6B 3TCGA 3HCQA 4BLAA 4H8IA 4NF8B 1NNFA 4F19A 3DLNA 1ANFA 1UTHB 4POXA 2V3TA 3OO6A 1MY2A 5ICQA 3KG2A 3ZKLA 3R26A 1EU8A 4I8CA 2ONRA 4TLLB 3MVWA 1QUIA 3KOSA 4NMYA 4YMBA 2Y84A 1N3WA 3IB1A 4Q0CA 1URGA 3KOTA 2ALUA 1DTGA 3FGSA 2CZLA 4FIMA 1B2HA 3DM0A 3SERA 4EXLA 4ZZEA 4KD5A 3SEXA 1YTVA 2YPNA 2UVJA 3V83A 2UVGA 1ATGA 1MQIA 1LAXA 4MH5A 5K2XA 3S9LC 1CE2A 1M5EA 2F78A 3MUQA 3H6WA 4ZZAA 5FHNA 3DP8A 3SESA 4U2RA 4EUOA 3A09A 3T93B 2QS3A 4RPNA 3KN3A 1BTJA 3C36A 5I84A 1DPPA 1M5DA 1MXZA 3RT8A 2ZNUA 1A8EA 2QMWA 2I3VA 5I2NB 1O63A 1SBPA 4QFOA 3U1OA 3ONMA 2PT1A 4F3BA 1B3GA 4ONYA 1A40A 3TAJA 2I0BA 3V5AA 4BDOA 5H8NB 3OEKA 4ZS9A 4OZ9A 3SKPA 3S9MC 4GXSB 4PFTA 2A5TB 4K3FA 1A7LA 3MZ1A 1Y9UA 3MPKA 3M3KA 5CRYA 3SEWA 3RQTA 3T9HB 3FXRA 2ZNSA 1I6QA 1MRPA 2RF1A 1US5A 1NNKA 4JBZA 4NF6A 5H8SA 3T66A 3N6TA 4YB6A 2GFEA 2I6EA 4ZEBA 5ITOA 1XS5A 3VFJA 2HXWA 3IOWA 1ZJLA 4O3AA 4GL0A 2B3FA 4R74A 4NF4A 1PB7A 1MXXA 3TTRA 3H03A 3PPOA 1VSOA 3OD7A 5B70A 5DEXB 3LR1A 3TODA 4OFJA 5I57B 3IJOB 2XXWA 5AA3A 2NOOA 1N84A 1JVXA 3S9NC 3VLWA 2Q2AA 4OXVA 1XOCA 2D21A 2RCBA 4NF8A 4OYVA 3MP8A 4EF2A 3IORA 2GH9A 1MQJA 3PUWE 1OQHA 3VXCA 3VLVA 2AIXA 2DVCA 2THIA 3C31A 2OBGA 3RY3A 4QSCA 4WKMA 5AA1A 1AIVA 3KN8A 5LOMA 3IJXB 3O29A 2GHBA 2AL5A 2H25A 3C33A 1NNTA 1MS7A 1QVSA 3FJMA 4G2ZA 1PC3A 3S2VA 4ELPA 2AYSA 3TTKA 2G93A 1JQFA 3OO7A 1II5A 4BDMA 1LCFA 3H6UA 5AA2D 5AA4B 1ELJA 3WAEA 1R9LA 3RNNA 3O6HA 3U94A 2OLBA 1YCJA 3HN0A 3K6XA 5B7DA 3TDJA 1PBPA 4R6KA 1F9BA 3KFMA 4G8NA 4OENA 3K0VA 3PPPA 1CB6A 2DE4A 1FCKA 4GF8A 5HBCA 5H8NA 2HQ0A 3IOVA 2Q88A 1R1NA 3ILUB 4F1YA 3TFLA 4DCXA 1IITA 2A5TA 3O6GA 5CMBA 4DCYA 2OK2A 1P99A 3GZGA 1Y4TA 3I5OA 1O7TA 3MVYA 1B7HA 2O7IA 3ZSFA 3QAXA 2XXIA 1AMFA 5DYHA 4NE4A 5AE4A 3HHGA 1M5CA 4OESA 1RYOA 3K6VA 4NTLA 4U1OA 4XKRA 1A54A 3MC2A 3O9PA 3RUMA 4GXAA 1LLSA 1Q1KA 3K00A 1B46A 2VHAA 2QJEA 2I4BA 2ANJA 4HCYA 4F3SA 1JEVA 4JXIA 5DEXA 5A5XA 5I57A 3MJNA 1JNFA 4Z7EA 5I2KB 3BFUA 5CMKA 3PMWA 2QMXA 4HS7A 2UYFA 2QS1A 5CC2A 4KYEA 2ZYMA 4U21A 4RK2A 5HPQA 4LP2B 4YB7A 1H44A 3TTNA 1MPBA 2OWSA 4NWCA 2DS9A 2W7YA 3GXAA 2V3UA 4XKNA 3H4ZA 2V93A 5HM4B 3IOTA 3H6VA 3Q29A 2PVUA 2AL4A 3ZS6A 5L9MA 3W9WA 5BUUA 4NF5A 1QULA 3ECRA 3LSLA 1GTKA 3FATA 5JTYB 1S50A 5DT6A 5EYFA 3MZBA 2DE3A 3D4CA 1B7UA 4KPTA 3KN7A 3RTFB 4LVQA 1B0LA 5EHMA 4YKKA 5JEIA 1D9YA 2F7BA 3V8XB 3K2DA 4F22A 4OERA 2ZYKA 4DIGA 3TEPA 4IB2A 3LSWA 3V89B 2XXVA 1NNPA 1H76A 1EH3A 3B6TA 4G77A 4F2OA 1SD3A 1MH3A 3RGYA 3E9XA 3CI8A 2H5YA 3QXMA 3KZGA 4ZE9A 2HFBA 4UACA 3I6VA 3TUSA 4PFYA 3TKDA 4IGRA 3FVNA 1QKBA 2PBWA 2PX1A 4KR5A 1B52A 2DWAA 3M3FA 4OEUA 1MXUA 1UIVA 1AL3A 3FASA 1SYIA 3IB0A 2V25A 3TTLA 4JSOA 1ZIUA 2D5WA 4WXJA 4XIGQ 2ZMBA 1FW0A 2RC8A 1S7YA 3TPAA 2DOJA 1AH5A 3TTMA 3S4UA 3CSGA 5M2VA 1B05A 1BLFA 3O66A 2DE2A 2Z8FA 3O97A 5ICTA 4LZ7A 4YU0A 2ONKE 4H0WA 3E3KA 4IO5A 4DLDA 2CMOA 1TFAA 1LB9A 2XX8A 2X7PA 2H9BA 1JW5A 3CFZA 1MXVA 2V84A 4G8MA 3LSXA 3UORA 5I2KA 4GIZA 2F36A 4RXLA 1WVJA 3S9EA 3MP1A 3A3CA 1DSNA 1B7ZA 4DXBA 3KSXA 3LSFB 5H8HB 1PEBA 4BDRA 4H6DA 2H99A 1ZU0A 3Q28A 1SW1A 4KYSA 5EHSA 3EQ1A 3PMXA 3N6UA 1SI1A 1MQDA 3R6UA 4C1TA 1VE4A 2ONSA 5BWJA 1JEUA 5JTYA 1GR2A 2XX9A 1FQFA 2Q2CA 3QK6A 3IO4A 3FVGA 3CG1A 1Y3NA 5H8QA 2Y7WA 1D4NA 4AB5A 1D3KA 4P11A 1YPNA 5CMCA 4GD5A 1KWHA 2IA4A 4HCWA 1LAGE 4TOZA 1IZ1A 3KGCA 4F18A 2I49A 2VP1A 3E4RA 4LATA 4R2BA 1B58A 1MY1A 2ESNA 1FQCA 1LBBA 2BJJX 1LFIA 1M5BA 3OELA 2Z8EA 3HV1A 1Y1ZA 3IAZA 1LB8A 1H3DA 3R7XA 4IGTA 4U1ZA 4IO6A 3FD3A 3OO8A 4F1VA 2XXUA 3DP4A 1BKAA 4E0WA 3WAFA 3QUFA 3K1NA 4ZEDA 2QPQA 3SDFA 4U23A 2RCAA 1HSJA 1MM7A 5DTBA 1NKXA 1FTLA 4C1UA 2Y7PA 1B5HA 4ISUA 1TT1A 4KYDA 1UTHA 4H1XA 2O69A 4H67A 3F11A 2O84X 1GV8A 5CMMA 3PMVA 1M5FA 1SYHA 1H45A 3H6TA 1O64A 3CRBA 4OHNA 3IB2A 4GLIA 2DP8A 4N07A 2QL3A 3I3VA 3VVFA 4DXUA 3K1MA 4C0RA 3UP9A 4EQ9A 2RC9A 4EXKA 5H8HA 3FV2A 4X9TA 5KCJB 1FQBA 1OLCA 3TMGA 1B5IA 2V3QA 3B6WA 2HCAA 3UN6A 5L8DA 3JZJA 3W9VA 3FIRA 5L9SA 4YB5A 4OWDA 3O28A 5I2NA 1VFEA 4QHQA 1HSEA 4THIA 4LA9A 1Y20A 1P1QA 1USYE 1MY0A 5DVIA 1ZMGA 3OSQA 2Y7RA 3HHFA 2HAVA 3GBAA 3IX1A 1FQAA 3FV1A 2ABHA 3TELA 1N3XA 4F1UA 5TU0A 3IR1A 4H8JA 2E1SA 2F7AA 3K6WA 1MXYA 3PPQA 3U8QA 4NEDA 3FXQA 1SI0A 3EHTA 4KQPA 2VGQA 2I0CA 4ELRA 3GLBA 1LFGA 1MPDA 5CI5A 1BIYA 1SW4A 2DQVA 2XXYA 3B7DA 3KSJA 3AXFA 3N94A 1URDA 2I58A 2X26A 3C9HA 3OXNA 2XHDA 1QKAA 1IXCA 3TQWA 3K01A 4IO4A 2RC7A 4TLMB 2OJTA 3VV5A 3CVGA 1TFDA 1NH7A 4KCCA 2DWIA 5I59B 2VD3A 3T22A 1MPCA 4OFOA 3B6QA 1A55A 1ZTYA 3SETA 4G68C 4YMAA 3U93A 4P0GA 4TQUQ 1SW5A 1J1NA 1NFTA 5ITPA 1IEJA 3D4GA 3T9VA 3VLUA 1MH4A 4KI0E 1EZOA 4RK9A 4RPOA 2Y7IA 3CIJA 1UQWA 1DPEA 2DWHA 2Z23A 5DVFA 1IIWA 3LC8A 1MDQA 4R6YA 1YAEA 4OETA 1LAFE 1IXGA 3ODBA 3K1PA 3PV0E 4R75A 2UVIA 3OEMA 1QUKA 4I9DA 4OVJA 5JK4A 4R9GA 3PUXE 5AA4A 2DVZA 3BFTA 3MP6A 4H65A 3JV9A 2PYYA 3EF7A 5KCJA 1L5TA 1B40A 2UXAA 1USYH 3L6HA 4YKJA 3QSLA 4R6HA 4QSEA 2OWTA 3MWBA 4GRKA 3PGFA 2A5SA 1PB8A 1B3EA 1UTBB 4XKQA 4LZ5A 2QS4A 4QFNA 3G3FA 1A99A 1FQDA 4U22A 4LUBA 5F7VA 4DZ1A 4KHZE 1WDNA 4EDPA 1Y4CA 1IXIA 2P2AA 2RKMA 1EZ9A 5F1QA 1US4A 4IO2A 4LQ2A 4E0XA 2GHAA 4NWDA 3QIMA 2Q8JA 4R72A 2HZLA 2I3WA 1LGBC 3SEUA 3TCHA 3T96B 2GRVA 1B1HA 3U72A 4LZ8A 4MLQA 1N0TA 1VFDA 4ESWA 4MBPA 4NF4B 1MQGA 3G3HA 3FJGA 2G29A 4M4GA 2DXYA 2Q9TA 1XHYA 1I6BA 1B32A 4PFWA 3PPRA 3CR9A 1B51A 3W15C 2KLFA 1MY3A 3G3GA 3QYTA 3RTWB 4R73A 3IOUA 1POY1 3KJ7A 4QFLA 2Y7KA 2O7UA 4R2FA 3BKIB 1SDXA 1XT8A 3HSTA 3RN8A 2RINA 5I56B 4XTCQ 4QF9A 3T9XB 1EZPA 2ZXTA 3U92A 1XVYA 3EPEA 1JVYA 4X1DA 2Z8DA 5FHOA 5K2YA 1I69A 2NWJA 4ND9A 3C34A 4RNSA 2XXHA 5I59A 4U4XA 3TZAA 4GOTA 1R6ZA 3Q25A 2DYXA 4U4SA 1SVXB 4ZEKA 4JWYA 1DMBA 3VE1B 4O3CA 2YJPA 4EF1A 3BBRA 1N76A 2QS2A 3QUJA 2UVHA 3FUZA 3SEYA 3OOAA 4FATA 2R9JA 1Y3PA 1P1UA 4MFIA 2H4IA 1MXWA 4QRZA 4F29A 3FXUA 3C35A 4AB6A 2I48A 4IY6A 2FYIA 1GVCA 4H5FA 1R9QA 4HTGA 4PP0A 4HW8A 1GGGA 2E0SA 4OMBA 3PD9A 4F3GA 3UGWA 4PETA 2O68A 4GQOA 2NUVA 2F35A 1QW0A 1OQGA 3P7IA 3IL1B 1PDAA 5ISUA 3OENA 5CBSA 3H06B 4Q5TA 5IAIA 3G3KA 3RPWA 4PFUA 3MAMA 2UYEA 1UTBA 1FTOA 3O2AA 1LFHA 2Q89A 5TP9B 3MVXA 4H5GA 2P0SA 3DP6A 2XXPA 1TWYA 4PE5B 3N5LA 4ZEIA 3Q27A 3ILTB 1HSLA 3VVDA 1MG1A 3VDFA 1B0HA 1B4ZA 4X1BA 3IK6B 4FJPA 4OTEA 5TPAB 1NL5A 5I58B 1I6AA 1FTKA 1SQYA 3CFLA 3KBRA 1MY4A 1DOTA 3CSBA 1IUDA 1POTA 4BDQA 4FEBA 5ELVA 5H8FB 4P0IA 1QUJA 4WEPA 3MW0A 3EHSA 3MZ9A 4MF3A 5A5XB 4JSDA 3M3LA 2F97A 4Q8RA 3C4MA 2F6PA 2Z22A 1Y1MA 1AOVA 3IO6A 1Y3QA 3MVZA 4O3BA 1OLAA 4FECA 1H43A 3G3JA 4JDFA 1TXFA 2IEEA 1P1OA 5I56A 1JW1A 4ZDMA 1B5JA 2F8DA 2B65A 3K4UA 4G68B 3FVKA 2F34A 5KDTB 4IO7A 4I1DA 3G7WA 1Z7ME 4R9FA 3FZVA 3UIFA 1FTMA 3EN3A 4YAHX 2XD2A 3PUVE 4XXUA 5L9OA 1B6HA 1ZBMA 4BDNA 1RYXA 3RLFE 2I4CA 2PMSA 4GWOA 4RA1A 3KEIA 4NF5B 3A3UA 1ZKBA 1Z7NE 5IKBA 4RY1A 2REJA 3UA8A 4YZZA 2XX7A 4POWA 5CM6A 1D9VA 4XKPA 2REGA 2FNCA 1WODA 4RYAA 4IO3A 4F31B 2DWJA 4DE8A 2X7QA 3EHUA 4FEDA 3UK4A 2R71A 3MBPA 3M8UA 4X48A 4YKPA 1JW4A 3SEVA 4ELOA 2O1LA 1N04A 1URSA 4BDLA 4ESXA 3HO7A 2DXRA 2VOZA 4N13A 4KFQA 1DTZA 3C32A 1LSTA 2O6AA 1N7WA 5J1DA 4WEDA 1FQEA 4Q30B 1OMPA 5FTIA 4F2QA 3MPLA 4FORA 2QSXA 2B3BA 2OCUA 3K02A 2HZKA 3THIA 3PPNA 4ZECA 5AA2B 3OSRA 2QRYA 3CFXA 5TP9A 2PT2A 3FVOA 1NMUA 3HPIA 1LCTA 3H7MA 4EQ7A 4I62A 4L17A 3PUZE 2R6GE 3PD8A 4OQOA 5TPAA 2O1MA 4AQ4A 5I58A 4LQ5A 3PU5A 2F7CA 3PUYE 4JWOA 3LBSA 2D3IA 1B3LA 4F39A 2HEUA 1P1WA 3TYHA 3OO9A 1P1NA 3N26A 5H8FA 3DELB 2WKYA 4JB7A 1B3FA 1LBCA 1OVTA 2M8CA 1VR5A 1LAHE 1Q35A 5FHMA 2YLNA 2P1SA 4ELQA 2F6GA 4G8HA 4MLVA 5KZTA 2LAOA 1MQHA 2XXXA 1RKMA 1B4HA 4G4PA 4G68A 1OVBA 3FJ7A 4FAJA 4YKIA 5KDTA 2OZZA 1IXHA 1XVXA 1B3HA 3H3GA 2FA7A 3ZKKA 3TQLA 1UIUA 1XC1A 2O51A 3GBBA 2XXRA 5CBRA 1B1XA 4FE8A 2ZYOA 3KJTA 4OFLA 4ZE8A 5FTHA 4KCDA 2VD2A
chains in the Genus database with same CATH superfamily
4AS4A 4JWXA 3Q26A 5H8QB 4DDDA 3LUZA 3LUYA 2XXTA 2H98A 2ZNTA 4UA8A 1JETA 1NH8A 1YYZA 4EQBA 3O6IA 1S9TA 4PC9A 4QSDA 2ZYNA 3USDA 2HAUA 1BP5A 3L6GA 4Z0IA 1A8FA 1SW2A 4IR8A 1FTJA 1YXIA 1ZLQA 4ECFA 4QFKA 4ZEFA 5DVJA 2Y5KA 4M1VA 4YICA 4GFRA 3VXBA 1N7XA 4NF6B 4OEVA 5IZ3A 4LONB 1QJMA 2NXOA 1FPDA 4FBPA 4IY5A 1MDP1 4F3PA 3TCFA 2F5XA 4GVOA 3MQ9A 2XD3A 3A29A 4DXCA 3EKIA 3E13X 5LTCA 3G3IA 1OIBA 3T9UA 1B9JA 2NVUB 1IQ7A 2XXQA 1NV0A 1MM6A 1PBQA 1PB9A 4QFPA 4H45A 5AA2A 3IFCA 4PQJA 3CG3A 1FBCA 4RJZA 2DSFA 3FXBA 3OMBA 5IGAA 1IMCA 4GL8A 4N6PA 3K6UA 3VVEA 3JYRA 1T0KA 3RT6B 3TCGA 3HCQA 4BLAA 4H8IA 4NF8B 1NNFA 4OVTA 4F19A 3DLNA 1ANFA 2WEFA 1UTHB 4POXA 2V3TA 3OO6A 1MY2A 5ICQA 3KG2A 4H46A 3ZKLA 3R26A 1EU8A 4I8CA 2ONRA 4TLLB 4N8GA 3MVWA 1QUIA 3KOSA 4NMYA 4YMBA 1FBPA 2Y84A 1N3WA 1IMDA 3IB1A 4Q0CA 1URGA 2CEXA 3KOTA 2ALUA 1DTGA 3FGSA 2CZLA 4FIMA 1B2HA 3DM0A 3SERA 4OVRA 4EXLA 4ZZEA 4KD5A 1NV5A 5ET6A 3SEXA 1YTVA 2YPNA 2UVJA 3V83A 5ET8A 2UVGA 1ATGA 1MQIA 1LAXA 4MH5A 5K2XA 4HE2A 1FBFA 4GWUA 3S9LC 1CE2A 1M5EA 2F78A 3MUQA 3H6WA 4ZZAA 5FHNA 3DP8A 3SESA 4U2RA 4EUOA 3QMFA 3A09A 3T93B 2QS3A 4RPNA 1G0HA 3KN3A 1BTJA 3C36A 5T3JA 5I84A 1DPPA 1M5DA 1MXZA 3RT8A 2ZNUA 1A8EA 4NG7A 2QMWA 2I3VA 5I2NB 1O63A 1SBPA 4QFOA 3U1OA 3ONMA 2PT1A 4F3BA 1B3GA 4ONYA 1A40A 1CNQA 3TAJA 2I0BA 3V5AA 1LBZA 4BDOA 5H8NB 3OEKA 4ZS9A 4PTKA 4OZ9A 3SKPA 2XWKA 3S9MC 4GXSB 4PFTA 2A5TB 1FPBA 4K3FA 1A7LA 3MZ1A 1Y9UA 3MPKA 3M3KA 5CRYA 3SEWA 3RQTA 3T9HB 3FXRA 2ZNSA 1I6QA 1MRPA 2RF1A 1US5A 1NNKA 4JBZA 5A5LA 4NF6A 4PAIA 5H8SA 3T66A 1AWBA 3N6TA 4O7IA 2F3DA 4YB6A 4OVQA 2GFEA 2I6EA 4ZEBA 5ITOA 1XS5A 3VFJA 3U65A 2HXWA 3IOWA 1ZJLA 4O3AA 4GL0A 2B3FA 4R74A 4NF4A 1PB7A 1MXXA 3TTRA 3H03A 3PPOA 2CZHA 1VSOA 3D1RA 3OD7A 5B70A 5DEXB 1JP4A 3LR1A 4GWXA 3TODA 4OFJA 5I57B 3IJOB 2XXWA 4PGPA 5AA3A 2NOOA 1N84A 1JVXA 3S9NC 3VLWA 2Q2AA 4OXVA 1XOCA 4N15A 4G61A 2D21A 2RCBA 4NF8A 4GX6A 4OYVA 3MP8A 1EYIA 3IORA 4EF2A 2GH9A 1MQJA 3PUWE 1OQHA 3VXCA 3VLVA 1IMAA 2R8TA 2AIXA 3BIGA 2DVCA 2THIA 3C31A 2OBGA 3RY3A 4QSCA 4WKMA 5AA1A 1NUZA 4MIJA 1AIVA 3KN8A 5LOMA 4MNPA 4N91A 3IJXB 4NQ8A 3O29A 4PBHA 4JVCA 3ROJA 2GHBA 2AL5A 2H25A 3C33A 4HE1A 1NNTA 1MS7A 1QVSA 3FJMA 4G2ZA 1PC3A 3S2VA 4ELPA 2AYSA 3TTKA 5J16A 2G93A 1JQFA 3OO7A 1II5A 4BDMA 1LCFA 3H6UA 5AA2D 4MHFA 5AA4B 1ELJA 4MCOA 2QVRA 3WAEA 1R9LA 3RNNA 3O6HA 3U94A 2DDKA 2OLBA 1YCJA 3HN0A 3K6XA 5B7DA 3TDJA 1PBPA 4PBQA 4R6KA 5I5PA 1F9BA 3LV0A 3KFMA 4G8NA 4OENA 3K0VA 3PPPA 1CB6A 2DE4A 1FCKA 4GF8A 5HBCA 1BK4A 5H8NA 1FRPA 2HQ0A 3IOVA 2Q88A 1R1NA 3ILUB 4F1YA 3TFLA 4N17A 4DCXA 5FBPA 1IITA 2A5TA 3O6GA 5CMBA 4DCYA 2OK2A 1P99A 3GZGA 1Y4TA 3I5OA 1O7TA 3MVYA 1B7HA 2O7IA 3ZSFA 3QAXA 2XWIA 2XXIA 1AMFA 4PAKA 4NE4A 5DYHA 5AE4A 3HHGA 1M5CA 4OESA 1RYOA 4UABA 3K6VA 3NOHA 4NTLA 4U1OA 4XKRA 4GX3A 1A54A 3MC2A 3O9PA 3RUMA 4GXAA 1LLSA 1Q1KA 3K00A 1B46A 2B4LA 2VHAA 2QJEA 2I4BA 2ANJA 4HCYA 2WYKA 4F3SA 1JEVA 4JXIA 5DEXA 5A5XA 5I57A 3MJNA 1RDZA 1JNFA 4Z7EA 5I2KB 3BFUA 1NV2A 5CMKA 3PMWA 2QMXA 2MKZA 4HS7A 2UYFA 2QS1A 5CC2A 4KYEA 2ZYMA 4U21A 4RK2A 5HPQA 4O8MA 4LP2B 1NV3A 4YB7A 1H44A 3TTNA 1MPBA 2OWSA 4NWCA 2DS9A 2W7YA 1K9ZA 3GXAA 2V3UA 4XKNA 3H4ZA 1NV4A 3RYDA 2V93A 5HM4B 3IOTA 3H6VA 3Q29A 2PVUA 2JJKA 2AL4A 3ZS6A 4P1EA 5L9MA 3W9WA 5BUUA 4NF5A 1QULA 3ECRA 3LSLA 1GTKA 3FATA 2PFZA 5JTYB 1S50A 1KA0A 4P9KA 5DT6A 5EYFA 3MZBA 1NV6A 2DE3A 3D4CA 1IMFA 1B7UA 4PF6A 4KPTA 3KN7A 3RTFB 4DI3D 4LVQA 1B0LA 5EHMA 4YKKA 5JEIA 1D9YA 2Q8MA 4OVPA 2ZZWA 2F7BA 3V8XB 2PFYA 3K2DA 4F22A 4PE3A 4OERA 2ZYKA 3SZPA 4DIGA 2VPOA 3TEPA 4IB2A 3LSWA 3V89B 2XXVA 1NNPA 1H76A 1EH3A 4HE0A 3B6TA 1LBVA 4G77A 4F2OA 1SD3A 1MH3A 3RGYA 2VT5A 4OA4A 3E9XA 4P8BA 3CI8A 2H5YA 3QXMA 3KZGA 4ZE9A 2HFBA 4UACA 3I6VA 1FPIA 3TUSA 4PFYA 3TKDA 4IGRA 3FVNA 1QKBA 2PBWA 2PX1A 4KR5A 1B52A 1FBGA 3CHGA 2DWAA 3M3FA 4OEUA 1MXUA 1UIVA 1AL3A 1RDXA 3FASA 1SYIA 3IB0A 2V25A 3TTLA 4JSOA 2L5VA 1ZIUA 2D5WA 4WXJA 1FJ9A 2Q74A 4XIGQ 2ZMBA 1FW0A 2OWZA 2RC8A 4I40A 1S7YA 3TPAA 2DOJA 1AH5A 3TTMA 2QFLA 1D9QA 3S4UA 3CSGA 5M2VA 1B05A 1BLFA 3O66A 2DE2A 2Z8FA 4NHBA 3O97A 5ICTA 4LZ7A 4YU0A 3RPLA 2ONKE 4H0WA 3E3KA 4IO5A 4DLDA 2CMOA 1TFAA 1LB9A 2XX8A 2X7PA 5I7IA 2H9BA 1JW5A 3CFZA 1MXVA 2V84A 4KXPA 4G8MA 3LSXA 4XEQA 3UORA 5I2KA 4GIZA 2F36A 4RXLA 1WVJA 3S9EA 3MP1A 3A3CA 1DSNA 1B7ZA 4DXBA 4GBVA 1FPFA 2FVZA 3KSXA 3LSFB 5H8HB 1XI6A 1PEBA 4BDRA 4H6DA 2H99A 1ZU0A 3Q28A 4OVSA 1SW1A 4KYSA 5EHSA 5IM2A 3EQ1A 3PMXA 3N6UA 1SI1A 1MQDA 3R6UA 4C1TA 2OX3A 4P47A 1VE4A 2ONSA 5DW8A 5BWJA 1JEUA 5JTYA 1GR2A 2XX9A 1FQFA 2P3NA 2Q2CA 3QK6A 3ISPA 3IO4A 3FVGA 3CG1A 2FBPA 1Y3NA 5H8QA 1LBXA 2Y7WA 1D4NA 4AB5A 1D3KA 4P11A 1YPNA 5CMCA 4GD5A 1KWHA 2IA4A 4HCWA 4N81A 1LAGE 4TOZA 1IZ1A 3KGCA 4F18A 4P1LA 2I49A 2VP1A 3MSTA 3E4RA 4LATA 4R2BA 1B58A 1MY1A 2ESNA 1FQCA 1FSAA 1LBBA 2BJJX 4JVDA 1LFIA 1M5BA 3OELA 2Z8EA 3HV1A 1FBDA 1Y1ZA 3IAZA 1LB8A 1H3DA 3R7XA 4IGTA 4U1ZA 4IO6A 3FD3A 3OO8A 2P3VA 4F1VA 4O94A 2XXUA 2QVUA 3DP4A 1FPKA 5ET7A 1BKAA 4E0WA 3WAFA 3QUFA 3K1NA 3E79A 4ZEDA 2QPQA 3SDFA 4U23A 2RCAA 1HSJA 5IZZA 1MM7A 5DTBA 2XWVA 1NKXA 1FTLA 4C1UA 2Y7PA 1B5HA 4ISUA 1TT1A 4KYDA 1UTHA 4H1XA 2O69A 4H67A 3F11A 2O84X 1GV8A 1G0IA 1RDYA 5CMMA 3T1BA 3E78A 2FIXA 3PMVA 1M5FA 1LBWA 1SYHA 1KZ8A 1H45A 3H6TA 1O64A 2PCRA 3CRBA 4OHNA 3IB2A 4GLIA 2DP8A 4N07A 1FPEA 2QL3A 3I3VA 3VVFA 4DXUA 3K1MA 4C0RA 3UP9A 4MNIA 4EQ9A 2RC9A 4EXKA 5H8HA 5LDZA 3FV2A 4X9TA 2HPGA 5KCJB 1FQBA 1OLCA 3TMGA 4PCDA 1B5IA 2V3QA 3B6WA 2HCAA 3UN6A 5L8DA 3JZJA 3W9VA 5EYGA 3FIRA 5L9SA 4HXVA 4YB5A 4PDHA 4OWDA 3O28A 1YZ0A 5I2NA 1VFEA 4QHQA 1HSEA 4THIA 4LA9A 1Y20A 1P1QA 1USYE 1MY0A 2QVVA 5DVIA 1ZMGA 3OSQA 2Y7RA 3HHFA 2HAVA 3GBAA 3IX1A 1FQAA 3FV1A 5IZ3B 2ABHA 3TELA 2KR0A 1N3XA 3B50A 4F1UA 5TU0A 3IR1A 3PTYA 4H8JA 2E1SA 2F7AA 3K6WA 1MXYA 3PPQA 3U8QA 4NAPA 1FPLA 4NEDA 3FXQA 1SI0A 3EHTA 4KQPA 2VGQA 2I0CA 4ELRA 3GLBA 1LFGA 2XWOA 1MPDA 5CI5A 1BIYA 1SW4A 5I3SA 4GWZA 2DQVA 2XXYA 3B7DA 3KSJA 3AXFA 3N94A 1URDA 2I58A 2X26A 3C9HA 3OXNA 2XHDA 1QKAA 4OANA 1IXCA 3TQWA 3K01A 4IO4A 2RC7A 1INPA 4TLMB 2OJTA 3IFAA 3VV5A 3CVGA 1TFDA 1IMEA 1NH7A 2XA5A 4KCCA 2DWIA 5I59B 2VD3A 4P56A 3T22A 1MPCA 4PDDA 4OFOA 3B6QA 1A55A 1ZTYA 3SETA 4G68C 4YMAA 1NV7A 3KC1A 3U93A 4P0GA 4TQUQ 3FBPA 1SW5A 1J1NA 1NFTA 5ITPA 1FTAA 1IEJA 3D4GA 3T9VA 3VLUA 1DBZA 1MH4A 4X8RA 4KI0E 1EZOA 5EYHA 4RK9A 4RPOA 2Y7IA 3CIJA 1UQWA 1DPEA 2DWHA 2Z23A 5DVFA 1IIWA 3LC8A 1MDQA 4R6YA 1YAEA 4OETA 2WYPA 1LAFE 1VDWA 1IXGA 3ODBA 3K1PA 3PV0E 4R75A 2UVIA 4DI4B 3OEMA 1QUKA 4I9DA 2B4MA 4NN3A 4N6KA 4OVJA 5JK4A 4R9GA 3PUXE 4GBWA 5AA4A 2DVZA 3BFTA 3MP6A 4H65A 3JV9A 2PYYA 3EF7A 5KCJA 5EQ7A 1L5TA 1B40A 2UXAA 1USYH 3L6HA 4YKJA 3QSLA 4R6HA 4QSEA 2OWTA 3MWBA 4GRKA 3PGFA 2A5SA 1PB8A 1B3EA 1UTBB 4XKQA 4LZ5A 2QS4A 4QFNA 3G3FA 1A99A 1FQDA 4U22A 4LUBA 5F7VA 4DZ1A 4KHZE 1WDNA 4EDPA 1Y4CA 4MEVA 1IXIA 2P2AA 2RKMA 1EZ9A 5F1QA 1QGXA 1US4A 4IO2A 1FBHA 4LQ2A 4E0XA 2GHAA 1KA1A 4NWDA 3QIMA 2Q8JA 5ESYA 4R72A 2HZLA 2I3WA 1LGBC 3SEUA 3TCHA 3T96B 2GRVA 4PGNA 1B1HA 3U72A 4LZ8A 4MLQA 1N0TA 1VFDA 4ESWA 4MBPA 4NF4B 1MQGA 3G3HA 3FJGA 2G29A 1NUXA 4M4GA 2WBDA 2DXYA 2Q9TA 1XHYA 1I6BA 4NX1A 1B32A 4MAGA 4PFWA 3PPRA 4GWWA 3CR9A 3QYTA 1B51A 2KLFA 1MY3A 3G3GA 3W15C 3RTWB 4R73A 3IOUA 1POY1 3KJ7A 4QFLA 2Y7KA 5EQ8A 2O7UA 4R2FA 3BKIB 1SDXA 1XT8A 3HSTA 3RN8A 2RINA 5I56B 4XTCQ 4QF9A 3T9XB 1EZPA 2ZXTA 3U92A 1XVYA 3EPEA 2HXRA 1JVYA 4X1DA 2Z8DA 1DK4A 4N8YA 5FHOA 5K2YA 1I69A 2F3BA 2NWJA 4ND9A 3C34A 4RNSA 2XXHA 1FJ6A 5I59A 4U4XA 3TZAA 4GOTA 1R6ZA 3Q25A 2DYXA 4U4SA 1SVXB 4ZEKA 4N4UA 4JWYA 1DMBA 3VE1B 4QBAA 4O3CA 2YJPA 4EF1A 3BBRA 1N76A 2QS2A 3QUJA 2UVHA 3FUZA 3SEYA 3OOAA 4FATA 2R9JA 1Y3PA 4MNCA 1P1UA 4MFIA 1SPIA 2H4IA 1MXWA 4QRZA 2XXKA 4F29A 3FXUA 3KC0A 3C35A 4AB6A 2I48A 4IY6A 2FYIA 1GVCA 4H5FA 1R9QA 1K9YA 4HTGA 4PP0A 2FIEA 4HW8A 1GGGA 2E0SA 4OMBA 3PD9A 4F3GA 3UGWA 4PETA 2O68A 4GQOA 2NUVA 4N6DA 2F35A 1QW0A 1OQGA 3P7IA 3IL1B 1PDAA 1DCUA 5ISUA 3OENA 5CBSA 3H06B 4Q5TA 2VPNA 3HFUA 5IAIA 4PFIA 3G3KA 3RPWA 4PFUA 3MAMA 2UYEA 1UTBA 1FTOA 3O2AA 1LFHA 2Q89A 5TP9B 3MVXA 4H5GA 2P0SA 2KQZA 3DP6A 2XXPA 1TWYA 1FPJA 4PE5B 3N5LA 5EQ9A 4ZEIA 1NUYA 3T0JA 3Q27A 3ILTB 1HSLA 3VVDA 1MG1A 3VDFA 1B0HA 1B4ZA 4PAFA 4X1BA 3IK6B 4FJPA 4OTEA 5TPAB 1NL5A 5I58B 1I6AA 1FBEA 1FTKA 1SQYA 3CFLA 3KBRA 1MY4A 1DOTA 3CSBA 1IUDA 1POTA 4BDQA 4FEBA 4X04A 5ELVA 5H8FB 4P0IA 1QUJA 4WEPA 4MMPA 3MW0A 3EHSA 3MZ9A 4MF3A 5A5XB 4JSDA 3M3LA 5ET5A 2F97A 4Q8RA 3C4MA 2F6PA 1NUWA 2Z22A 1Y1MA 2V4CA 1AOVA 3IO6A 1Y3QA 3MVZA 4O3BA 2CZKA 1OLAA 4FECA 4NF0A 1H43A 3G3JA 2HHMA 4XFEA 2BJIA 4JDFA 2FHYA 2CZIA 1TXFA 2IEEA 1P1OA 5I56A 1JW1A 4ZDMA 1B5JA 2F8DA 2B65A 3BIHA 3K4UA 4G68B 3FVKA 2F34A 5KDTB 2GQ1A 4IO7A 4I1DA 3G7WA 1Z7ME 2WX9A 4R9FA 3FZVA 1EYJA 3UIFA 1FTMA 3EN3A 4YAHX 2XD2A 3PUVE 4XXUA 5L9OA 1Q9DA 1B6HA 1ZBMA 1LEVA 4P3LA 4BDNA 1RYXA 3RLFE 2I4CA 2PMSA 4GWOA 4RA1A 3KEIA 1LBYA 4NF5B 4O7MA 3A3UA 1ZKBA 4MJOA 1Z7NE 5IKBA 1FPGA 4RY1A 2REJA 3UA8A 4YZZA 4XF5A 2XX7A 4POWA 5CM6A 1D9VA 4PFBA 4XKPA 2REGA 2FNCA 1WODA 4NGUA 4RYAA 4IO3A 4F31B 2DWJA 4DE8A 2X7QA 3EHUA 4FEDA 4LN5A 3UK4A 2Y5LA 2R71A 3MBPA 3M8UA 4X48A 4YKPA 1JW4A 4JVIA 3SEVA 4ELOA 2O1LA 1N04A 1URSA 4BDLA 4ESXA 3HO7A 2DXRA 2VOZA 4N13A 4KFQA 1DTZA 3C32A 1LSTA 2O6AA 1N7WA 3GYYA 5J1DA 4WEDA 1FQEA 4Q30B 1IMBA 1OMPA 4GX4A 5FTIA 4F2QA 3MPLA 4FORA 2QSXA 2B3BA 2ZZXA 2OCUA 3K02A 2HZKA 3THIA 3PPNA 4ZECA 5AA2B 3OSRA 2QRYA 3CFXA 5EQAA 5TP9A 2PT2A 3MYUA 3FVOA 1NMUA 5IZ1A 2WBBA 3HPIA 1LCTA 3H7MA 4EQ7A 4I62A 4L17A 3PUZE 2R6GE 3PD8A 4OQOA 5TPAA 2O1MA 4AQ4A 5I58A 4LQ5A 3PU5A 2F7CA 4GWSA 3PUYE 4JWOA 3LBSA 2D3IA 4PF8A 1B3LA 1NV1A 4I3EA 4F39A 4I3YA 2HEUA 3KBZA 1P1WA 1EYKA 3TYHA 3RPLB 3OO9A 1P1NA 3N26A 5H8FA 3DELB 2WKYA 3B8BA 4JB7A 4MX6A 1B3FA 4GWYA 1LBCA 4PFRA 1OVTA 2M8CA 1VR5A 1LAHE 1Q35A 5FHMA 2YLNA 2P1SA 4ELQA 2F6GA 4G8HA 4MLVA 4QXDA 5KZTA 2LAOA 1MQHA 2XXXA 1RKMA 1B4HA 1NI9A 4G4PA 4G68A 1OVBA 3FJ7A 4FAJA 4AS5A 4YKIA 5KDTA 2OZZA 1IXHA 1XVXA 1B3HA 5F24A 3H3GA 2FA7A 3ZKKA 3TQLA 1UIUA 1XC1A 2O51A 3GBBA 2CEYA 2XXRA 5CBRA 1B1XA 4FE8A 2ZYOA 3KJTA 4OFLA 4ZE8A 2ZZVA 5FTHA 4KCDA 2VD2A
chains in the Genus database with same CATH topology
4JWXA 3Q26A 5H8QB 4DDDA 3LUYA 2XXTA 2H98A 2ZNTA 4UA8A 1JETA 1NH8A 4EQBA 3O6IA 1S9TA 4QSDA 2ZYNA 3USDA 2HAUA 1BP5A 3L6GA 4Z0IA 1A8FA 1SW2A 1FTJA 1ZLQA 4ECFA 4QFKA 4ZEFA 5DVJA 4M1VA 4YICA 4GFRA 3VXBA 1N7XA 4NF6B 4OEVA 4LONB 1QJMA 2NXOA 4IY5A 1MDP1 4F3PA 3TCFA 2F5XA 4GVOA 3MQ9A 2XD3A 4DXCA 3E13X 3G3IA 1OIBA 3T9UA 1B9JA 2NVUB 1IQ7A 2XXQA 1MM6A 1PBQA 1PB9A 4QFPA 5AA2A 4PQJA 3CG3A 4RJZA 2DSFA 3OMBA 4GL8A 4N6PA 3K6UA 3VVEA 3JYRA 1T0KA 3RT6B 3TCGA 3HCQA 4BLAA 4H8IA 4NF8B 1NNFA 4F19A 3DLNA 1ANFA 1UTHB 4POXA 2V3TA 3OO6A 1MY2A 5ICQA 3KG2A 3ZKLA 3R26A 1EU8A 4I8CA 2ONRA 4TLLB 3MVWA 1QUIA 3KOSA 4NMYA 4YMBA 2Y84A 1N3WA 3IB1A 4Q0CA 1URGA 3KOTA 2ALUA 1DTGA 3FGSA 2CZLA 4FIMA 1B2HA 3DM0A 3SERA 4EXLA 4ZZEA 4KD5A 3SEXA 1YTVA 2YPNA 2UVJA 3V83A 2UVGA 1ATGA 1MQIA 1LAXA 4MH5A 5K2XA 3S9LC 1CE2A 1M5EA 2F78A 3MUQA 3H6WA 4ZZAA 5FHNA 3DP8A 3SESA 4U2RA 4EUOA 3A09A 3T93B 2QS3A 4RPNA 3KN3A 1BTJA 3C36A 5I84A 1DPPA 1M5DA 1MXZA 3RT8A 2ZNUA 1A8EA 2QMWA 2I3VA 5I2NB 1O63A 1SBPA 4QFOA 3U1OA 3ONMA 2PT1A 4F3BA 1B3GA 4ONYA 1A40A 3TAJA 2I0BA 3V5AA 4BDOA 5H8NB 3OEKA 4ZS9A 4OZ9A 3SKPA 3S9MC 4GXSB 4PFTA 2A5TB 4K3FA 1A7LA 3MZ1A 1Y9UA 3MPKA 3M3KA 5CRYA 3SEWA 3RQTA 3T9HB 3FXRA 2ZNSA 1I6QA 1MRPA 2RF1A 1US5A 1NNKA 4JBZA 4NF6A 5H8SA 3T66A 3N6TA 4YB6A 2GFEA 2I6EA 4ZEBA 5ITOA 1XS5A 3VFJA 2HXWA 3IOWA 1ZJLA 4O3AA 4GL0A 2B3FA 4R74A 4NF4A 1PB7A 1MXXA 3TTRA 3H03A 3PPOA 1VSOA 3OD7A 5B70A 5DEXB 3LR1A 3TODA 4OFJA 5I57B 3IJOB 2XXWA 5AA3A 2NOOA 1N84A 1JVXA 3S9NC 3VLWA 2Q2AA 4OXVA 1XOCA 2D21A 2RCBA 4NF8A 4OYVA 3MP8A 4EF2A 3IORA 2GH9A 1MQJA 3PUWE 1OQHA 3VXCA 3VLVA 2AIXA 2DVCA 2THIA 3C31A 2OBGA 3RY3A 4QSCA 4WKMA 5AA1A 1AIVA 3KN8A 5LOMA 3IJXB 3O29A 2GHBA 2AL5A 2H25A 3C33A 1NNTA 1MS7A 1QVSA 3FJMA 4G2ZA 1PC3A 3S2VA 4ELPA 2AYSA 3TTKA 2G93A 1JQFA 3OO7A 1II5A 4BDMA 1LCFA 3H6UA 5AA2D 5AA4B 1ELJA 3WAEA 1R9LA 3RNNA 3O6HA 3U94A 2OLBA 1YCJA 3HN0A 3K6XA 5B7DA 3TDJA 1PBPA 4R6KA 1F9BA 3KFMA 4G8NA 4OENA 3K0VA 3PPPA 1CB6A 2DE4A 1FCKA 4GF8A 5HBCA 5H8NA 2HQ0A 3IOVA 2Q88A 1R1NA 3ILUB 4F1YA 3TFLA 4DCXA 1IITA 2A5TA 3O6GA 5CMBA 4DCYA 2OK2A 1P99A 3GZGA 1Y4TA 3I5OA 1O7TA 3MVYA 1B7HA 2O7IA 3ZSFA 3QAXA 2XXIA 1AMFA 5DYHA 4NE4A 5AE4A 3HHGA 1M5CA 4OESA 1RYOA 3K6VA 4NTLA 4U1OA 4XKRA 1A54A 3MC2A 3O9PA 3RUMA 4GXAA 1LLSA 1Q1KA 3K00A 1B46A 2VHAA 2QJEA 2I4BA 2ANJA 4HCYA 4F3SA 1JEVA 4JXIA 5DEXA 5A5XA 5I57A 3MJNA 1JNFA 4Z7EA 5I2KB 3BFUA 5CMKA 3PMWA 2QMXA 4HS7A 2UYFA 2QS1A 5CC2A 4KYEA 2ZYMA 4U21A 4RK2A 5HPQA 4LP2B 4YB7A 1H44A 3TTNA 1MPBA 2OWSA 4NWCA 2DS9A 2W7YA 3GXAA 2V3UA 4XKNA 3H4ZA 2V93A 5HM4B 3IOTA 3H6VA 3Q29A 2PVUA 2AL4A 3ZS6A 5L9MA 3W9WA 5BUUA 4NF5A 1QULA 3ECRA 3LSLA 1GTKA 3FATA 5JTYB 1S50A 5DT6A 5EYFA 3MZBA 2DE3A 3D4CA 1B7UA 4KPTA 3KN7A 3RTFB 4LVQA 1B0LA 5EHMA 4YKKA 5JEIA 1D9YA 2F7BA 3V8XB 3K2DA 4F22A 4OERA 2ZYKA 4DIGA 3TEPA 4IB2A 3LSWA 3V89B 2XXVA 1NNPA 1H76A 1EH3A 3B6TA 4G77A 4F2OA 1SD3A 1MH3A 3RGYA 3E9XA 3CI8A 2H5YA 3QXMA 3KZGA 4ZE9A 2HFBA 4UACA 3I6VA 3TUSA 4PFYA 3TKDA 4IGRA 3FVNA 1QKBA 2PBWA 2PX1A 4KR5A 1B52A 2DWAA 3M3FA 4OEUA 1MXUA 1UIVA 1AL3A 3FASA 1SYIA 3IB0A 2V25A 3TTLA 4JSOA 1ZIUA 2D5WA 4WXJA 4XIGQ 2ZMBA 1FW0A 2RC8A 1S7YA 3TPAA 2DOJA 1AH5A 3TTMA 3S4UA 3CSGA 5M2VA 1B05A 1BLFA 3O66A 2DE2A 2Z8FA 3O97A 5ICTA 4LZ7A 4YU0A 2ONKE 4H0WA 3E3KA 4IO5A 4DLDA 2CMOA 1TFAA 1LB9A 2XX8A 2X7PA 2H9BA 1JW5A 3CFZA 1MXVA 2V84A 4G8MA 3LSXA 3UORA 5I2KA 4GIZA 2F36A 4RXLA 1WVJA 3S9EA 3MP1A 3A3CA 1DSNA 1B7ZA 4DXBA 3KSXA 3LSFB 5H8HB 1PEBA 4BDRA 4H6DA 2H99A 1ZU0A 3Q28A 1SW1A 4KYSA 5EHSA 3EQ1A 3PMXA 3N6UA 1SI1A 1MQDA 3R6UA 4C1TA 1VE4A 2ONSA 5BWJA 1JEUA 5JTYA 1GR2A 2XX9A 1FQFA 2Q2CA 3QK6A 3IO4A 3FVGA 3CG1A 1Y3NA 5H8QA 2Y7WA 1D4NA 4AB5A 1D3KA 4P11A 1YPNA 5CMCA 4GD5A 1KWHA 2IA4A 4HCWA 1LAGE 4TOZA 1IZ1A 3KGCA 4F18A 2I49A 2VP1A 3E4RA 4LATA 4R2BA 1B58A 1MY1A 2ESNA 1FQCA 1LBBA 2BJJX 1LFIA 1M5BA 3OELA 2Z8EA 3HV1A 1Y1ZA 3IAZA 1LB8A 1H3DA 3R7XA 4IGTA 4U1ZA 4IO6A 3FD3A 3OO8A 4F1VA 2XXUA 3DP4A 1BKAA 4E0WA 3WAFA 3QUFA 3K1NA 4ZEDA 2QPQA 3SDFA 4U23A 2RCAA 1HSJA 1MM7A 5DTBA 1NKXA 1FTLA 4C1UA 2Y7PA 1B5HA 4ISUA 1TT1A 4KYDA 1UTHA 4H1XA 2O69A 4H67A 3F11A 2O84X 1GV8A 5CMMA 3PMVA 1M5FA 1SYHA 1H45A 3H6TA 1O64A 3CRBA 4OHNA 3IB2A 4GLIA 2DP8A 4N07A 2QL3A 3I3VA 3VVFA 4DXUA 3K1MA 4C0RA 3UP9A 4EQ9A 2RC9A 4EXKA 5H8HA 3FV2A 4X9TA 5KCJB 1FQBA 1OLCA 3TMGA 1B5IA 2V3QA 3B6WA 2HCAA 3UN6A 5L8DA 3JZJA 3W9VA 3FIRA 5L9SA 4YB5A 4OWDA 3O28A 5I2NA 1VFEA 4QHQA 1HSEA 4THIA 4LA9A 1Y20A 1P1QA 1USYE 1MY0A 5DVIA 1ZMGA 3OSQA 2Y7RA 3HHFA 2HAVA 3GBAA 3IX1A 1FQAA 3FV1A 2ABHA 3TELA 1N3XA 4F1UA 5TU0A 3IR1A 4H8JA 2E1SA 2F7AA 3K6WA 1MXYA 3PPQA 3U8QA 4NEDA 3FXQA 1SI0A 3EHTA 4KQPA 2VGQA 2I0CA 4ELRA 3GLBA 1LFGA 1MPDA 5CI5A 1BIYA 1SW4A 2DQVA 2XXYA 3B7DA 3KSJA 3AXFA 3N94A 1URDA 2I58A 2X26A 3C9HA 3OXNA 2XHDA 1QKAA 1IXCA 3TQWA 3K01A 4IO4A 2RC7A 4TLMB 2OJTA 3VV5A 3CVGA 1TFDA 1NH7A 4KCCA 2DWIA 5I59B 2VD3A 3T22A 1MPCA 4OFOA 3B6QA 1A55A 1ZTYA 3SETA 4G68C 4YMAA 3U93A 4P0GA 4TQUQ 1SW5A 1J1NA 1NFTA 5ITPA 1IEJA 3D4GA 3T9VA 3VLUA 1MH4A 4KI0E 1EZOA 4RK9A 4RPOA 2Y7IA 3CIJA 1UQWA 1DPEA 2DWHA 2Z23A 5DVFA 1IIWA 3LC8A 1MDQA 4R6YA 1YAEA 4OETA 1LAFE 1IXGA 3ODBA 3K1PA 3PV0E 4R75A 2UVIA 3OEMA 1QUKA 4I9DA 4OVJA 5JK4A 4R9GA 3PUXE 5AA4A 2DVZA 3BFTA 3MP6A 4H65A 3JV9A 2PYYA 3EF7A 5KCJA 1L5TA 1B40A 2UXAA 1USYH 3L6HA 4YKJA 3QSLA 4R6HA 4QSEA 2OWTA 3MWBA 4GRKA 3PGFA 2A5SA 1PB8A 1B3EA 1UTBB 4XKQA 4LZ5A 2QS4A 4QFNA 3G3FA 1A99A 1FQDA 4U22A 4LUBA 5F7VA 4DZ1A 4KHZE 1WDNA 4EDPA 1Y4CA 1IXIA 2P2AA 2RKMA 1EZ9A 5F1QA 1US4A 4IO2A 4LQ2A 4E0XA 2GHAA 4NWDA 3QIMA 2Q8JA 4R72A 2HZLA 2I3WA 1LGBC 3SEUA 3TCHA 3T96B 2GRVA 1B1HA 3U72A 4LZ8A 4MLQA 1N0TA 1VFDA 4ESWA 4MBPA 4NF4B 1MQGA 3G3HA 3FJGA 2G29A 4M4GA 2DXYA 2Q9TA 1XHYA 1I6BA 1B32A 4PFWA 3PPRA 3CR9A 1B51A 3W15C 2KLFA 1MY3A 3G3GA 3QYTA 3RTWB 4R73A 3IOUA 1POY1 3KJ7A 4QFLA 2Y7KA 2O7UA 4R2FA 3BKIB 1SDXA 1XT8A 3HSTA 3RN8A 2RINA 5I56B 4XTCQ 4QF9A 3T9XB 1EZPA 2ZXTA 3U92A 1XVYA 3EPEA 1JVYA 4X1DA 2Z8DA 5FHOA 5K2YA 1I69A 2NWJA 4ND9A 3C34A 4RNSA 2XXHA 5I59A 4U4XA 3TZAA 4GOTA 1R6ZA 3Q25A 2DYXA 4U4SA 1SVXB 4ZEKA 4JWYA 1DMBA 3VE1B 4O3CA 2YJPA 4EF1A 3BBRA 1N76A 2QS2A 3QUJA 2UVHA 3FUZA 3SEYA 3OOAA 4FATA 2R9JA 1Y3PA 1P1UA 4MFIA 2H4IA 1MXWA 4QRZA 4F29A 3FXUA 3C35A 4AB6A 2I48A 4IY6A 2FYIA 1GVCA 4H5FA 1R9QA 4HTGA 4PP0A 4HW8A 1GGGA 2E0SA 4OMBA 3PD9A 4F3GA 3UGWA 4PETA 2O68A 4GQOA 2NUVA 2F35A 1QW0A 1OQGA 3P7IA 3IL1B 1PDAA 5ISUA 3OENA 5CBSA 3H06B 4Q5TA 5IAIA 3G3KA 3RPWA 4PFUA 3MAMA 2UYEA 1UTBA 1FTOA 3O2AA 1LFHA 2Q89A 5TP9B 3MVXA 4H5GA 2P0SA 3DP6A 2XXPA 1TWYA 4PE5B 3N5LA 4ZEIA 3Q27A 3ILTB 1HSLA 3VVDA 1MG1A 3VDFA 1B0HA 1B4ZA 4X1BA 3IK6B 4FJPA 4OTEA 5TPAB 1NL5A 5I58B 1I6AA 1FTKA 1SQYA 3CFLA 3KBRA 1MY4A 1DOTA 3CSBA 1IUDA 1POTA 4BDQA 4FEBA 5ELVA 5H8FB 4P0IA 1QUJA 4WEPA 3MW0A 3EHSA 3MZ9A 4MF3A 5A5XB 4JSDA 3M3LA 2F97A 4Q8RA 3C4MA 2F6PA 2Z22A 1Y1MA 1AOVA 3IO6A 1Y3QA 3MVZA 4O3BA 1OLAA 4FECA 1H43A 3G3JA 4JDFA 1TXFA 2IEEA 1P1OA 5I56A 1JW1A 4ZDMA 1B5JA 2F8DA 2B65A 3K4UA 4G68B 3FVKA 2F34A 5KDTB 4IO7A 4I1DA 3G7WA 1Z7ME 4R9FA 3FZVA 3UIFA 1FTMA 3EN3A 4YAHX 2XD2A 3PUVE 4XXUA 5L9OA 1B6HA 1ZBMA 4BDNA 1RYXA 3RLFE 2I4CA 2PMSA 4GWOA 4RA1A 3KEIA 4NF5B 3A3UA 1ZKBA 1Z7NE 5IKBA 4RY1A 2REJA 3UA8A 4YZZA 2XX7A 4POWA 5CM6A 1D9VA 4XKPA 2REGA 2FNCA 1WODA 4RYAA 4IO3A 4F31B 2DWJA 4DE8A 2X7QA 3EHUA 4FEDA 3UK4A 2R71A 3MBPA 3M8UA 4X48A 4YKPA 1JW4A 3SEVA 4ELOA 2O1LA 1N04A 1URSA 4BDLA 4ESXA 3HO7A 2DXRA 2VOZA 4N13A 4KFQA 1DTZA 3C32A 1LSTA 2O6AA 1N7WA 5J1DA 4WEDA 1FQEA 4Q30B 1OMPA 5FTIA 4F2QA 3MPLA 4FORA 2QSXA 2B3BA 2OCUA 3K02A 2HZKA 3THIA 3PPNA 4ZECA 5AA2B 3OSRA 2QRYA 3CFXA 5TP9A 2PT2A 3FVOA 1NMUA 3HPIA 1LCTA 3H7MA 4EQ7A 4I62A 4L17A 3PUZE 2R6GE 3PD8A 4OQOA 5TPAA 2O1MA 4AQ4A 5I58A 4LQ5A 3PU5A 2F7CA 3PUYE 4JWOA 3LBSA 2D3IA 1B3LA 4F39A 2HEUA 1P1WA 3TYHA 3OO9A 1P1NA 3N26A 5H8FA 3DELB 2WKYA 4JB7A 1B3FA 1LBCA 1OVTA 2M8CA 1VR5A 1LAHE 1Q35A 5FHMA 2YLNA 2P1SA 4ELQA 2F6GA 4G8HA 4MLVA 5KZTA 2LAOA 1MQHA 2XXXA 1RKMA 1B4HA 4G4PA 4G68A 1OVBA 3FJ7A 4FAJA 4YKIA 5KDTA 2OZZA 1IXHA 1XVXA 1B3HA 3H3GA 2FA7A 3ZKKA 3TQLA 1UIUA 1XC1A 2O51A 3GBBA 2XXRA 5CBRA 1B1XA 4FE8A 2ZYOA 3KJTA 4OFLA 4ZE8A 5FTHA 4KCDA 2VD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWX A;  3Q26 A;  5H8Q B;  4DDD A;  3LUY A;  2XXT A;  2H98 A;  2ZNT A;  4UA8 A;  1JET A;  1NH8 A;  4EQB A;  3O6I A;  1S9T A;  4QSD A;  2ZYN A;  3USD A;  2HAU A;  1BP5 A;  3L6G A;  4Z0I A;  1A8F A;  1SW2 A;  1FTJ A;  1ZLQ A;  4ECF A;  4QFK A;  4ZEF A;  5DVJ A;  4M1V A;  4YIC A;  4GFR A;  3VXB A;  1N7X A;  4NF6 B;  4OEV A;  4LON B;  1QJM A;  2NXO A;  4IY5 A;  1MDP 1;  4F3P A;  3TCF A;  2F5X A;  4GVO A;  3MQ9 A;  2XD3 A;  4DXC A;  3E13 X;  3G3I A;  1OIB A;  3T9U A;  1B9J A;  2NVU B;  1IQ7 A;  2XXQ A;  1MM6 A;  1PBQ A;  1PB9 A;  4QFP A;  5AA2 A;  4PQJ A;  3CG3 A;  4RJZ A;  2DSF A;  3OMB A;  4GL8 A;  4N6P A;  3K6U A;  3VVE A;  3JYR A;  1T0K A;  3RT6 B;  3TCG A;  3HCQ A;  4BLA A;  4H8I A;  4NF8 B;  1NNF A;  4F19 A;  3DLN A;  1ANF A;  1UTH B;  4POX A;  2V3T A;  3OO6 A;  1MY2 A;  5ICQ A;  3KG2 A;  3ZKL A;  3R26 A;  1EU8 A;  4I8C A;  2ONR A;  4TLL B;  3MVW A;  1QUI A;  3KOS A;  4NMY A;  4YMB A;  2Y84 A;  1N3W A;  3IB1 A;  4Q0C A;  1URG A;  3KOT A;  2ALU A;  1DTG A;  3FGS A;  2CZL A;  4FIM A;  1B2H A;  3DM0 A;  3SER A;  4EXL A;  4ZZE A;  4KD5 A;  3SEX A;  1YTV A;  2YPN A;  2UVJ A;  3V83 A;  2UVG A;  1ATG A;  1MQI A;  1LAX A;  4MH5 A;  5K2X A;  3S9L C;  1CE2 A;  1M5E A;  2F78 A;  3MUQ A;  3H6W A;  4ZZA A;  5FHN A;  3DP8 A;  3SES A;  4U2R A;  4EUO A;  3A09 A;  3T93 B;  2QS3 A;  4RPN A;  3KN3 A;  1BTJ A;  3C36 A;  5I84 A;  1DPP A;  1M5D A;  1MXZ A;  3RT8 A;  2ZNU A;  1A8E A;  2QMW A;  2I3V A;  5I2N B;  1O63 A;  1SBP A;  4QFO A;  3U1O A;  3ONM A;  2PT1 A;  4F3B A;  1B3G A;  4ONY A;  1A40 A;  3TAJ A;  2I0B A;  3V5A A;  4BDO A;  5H8N B;  3OEK A;  4ZS9 A;  4OZ9 A;  3SKP A;  3S9M C;  4GXS B;  4PFT A;  2A5T B;  4K3F A;  1A7L A;  3MZ1 A;  1Y9U A;  3MPK A;  3M3K A;  5CRY A;  3SEW A;  3RQT A;  3T9H B;  3FXR A;  2ZNS A;  1I6Q A;  1MRP A;  2RF1 A;  1US5 A;  1NNK A;  4JBZ A;  4NF6 A;  5H8S A;  3T66 A;  3N6T A;  4YB6 A;  2GFE A;  2I6E A;  4ZEB A;  5ITO A;  1XS5 A;  3VFJ A;  2HXW A;  3IOW A;  1ZJL A;  4O3A A;  4GL0 A;  2B3F A;  4R74 A;  4NF4 A;  1PB7 A;  1MXX A;  3TTR A;  3H03 A;  3PPO A;  1VSO A;  3OD7 A;  5B70 A;  5DEX B;  3LR1 A;  3TOD A;  4OFJ A;  5I57 B;  3IJO B;  2XXW A;  5AA3 A;  2NOO A;  1N84 A;  1JVX A;  3S9N C;  3VLW A;  2Q2A A;  4OXV A;  1XOC A;  2D21 A;  2RCB A;  4NF8 A;  4OYV A;  3MP8 A;  4EF2 A;  3IOR A;  2GH9 A;  1MQJ A;  3PUW E;  1OQH A;  3VXC A;  3VLV A;  2AIX A;  2DVC A;  2THI A;  3C31 A;  2OBG A;  3RY3 A;  4QSC A;  4WKM A;  5AA1 A;  1AIV A;  3KN8 A;  5LOM A;  3IJX B;  3O29 A;  2GHB A;  2AL5 A;  2H25 A;  3C33 A;  1NNT A;  1MS7 A;  1QVS A;  3FJM A;  4G2Z A;  1PC3 A;  3S2V A;  4ELP A;  2AYS A;  3TTK A;  2G93 A;  1JQF A;  3OO7 A;  1II5 A;  4BDM A;  1LCF A;  3H6U A;  5AA2 D;  5AA4 B;  1ELJ A;  3WAE A;  1R9L A;  3RNN A;  3O6H A;  3U94 A;  2OLB A;  1YCJ A;  3HN0 A;  3K6X A;  5B7D A;  3TDJ A;  1PBP A;  4R6K A;  1F9B A;  3KFM A;  4G8N A;  4OEN A;  3K0V A;  3PPP A;  1CB6 A;  2DE4 A;  1FCK A;  4GF8 A;  5HBC A;  5H8N A;  2HQ0 A;  3IOV A;  2Q88 A;  1R1N A;  3ILU B;  4F1Y A;  3TFL A;  4DCX A;  1IIT A;  2A5T A;  3O6G A;  5CMB A;  4DCY A;  2OK2 A;  1P99 A;  3GZG A;  1Y4T A;  3I5O A;  1O7T A;  3MVY A;  1B7H A;  2O7I A;  3ZSF A;  3QAX A;  2XXI A;  1AMF A;  5DYH A;  4NE4 A;  5AE4 A;  3HHG A;  1M5C A;  4OES A;  1RYO A;  3K6V A;  4NTL A;  4U1O A;  4XKR A;  1A54 A;  3MC2 A;  3O9P A;  3RUM A;  4GXA A;  1LLS A;  1Q1K A;  3K00 A;  1B46 A;  2VHA A;  2QJE A;  2I4B A;  2ANJ A;  4HCY A;  4F3S A;  1JEV A;  4JXI A;  5DEX A;  5A5X A;  5I57 A;  3MJN A;  1JNF A;  4Z7E A;  5I2K B;  3BFU A;  5CMK A;  3PMW A;  2QMX A;  4HS7 A;  2UYF A;  2QS1 A;  5CC2 A;  4KYE A;  2ZYM A;  4U21 A;  4RK2 A;  5HPQ A;  4LP2 B;  4YB7 A;  1H44 A;  3TTN A;  1MPB A;  2OWS A;  4NWC A;  2DS9 A;  2W7Y A;  3GXA A;  2V3U A;  4XKN A;  3H4Z A;  2V93 A;  5HM4 B;  3IOT A;  3H6V A;  3Q29 A;  2PVU A;  2AL4 A;  3ZS6 A;  5L9M A;  3W9W A;  5BUU A;  4NF5 A;  1QUL A;  3ECR A;  3LSL A;  1GTK A;  3FAT A;  5JTY B;  1S50 A;  5DT6 A;  5EYF A;  3MZB A;  2DE3 A;  3D4C A;  1B7U A;  4KPT A;  3KN7 A;  3RTF B;  4LVQ A;  1B0L A;  5EHM A;  4YKK A;  5JEI A;  1D9Y A;  2F7B A;  3V8X B;  3K2D A;  4F22 A;  4OER A;  2ZYK A;  4DIG A;  3TEP A;  4IB2 A;  3LSW A;  3V89 B;  2XXV A;  1NNP A;  1H76 A;  1EH3 A;  3B6T A;  4G77 A;  4F2O A;  1SD3 A;  1MH3 A;  3RGY A;  3E9X A;  3CI8 A;  2H5Y A;  3QXM A;  3KZG A;  4ZE9 A;  2HFB A;  4UAC A;  3I6V A;  3TUS A;  4PFY A;  3TKD A;  4IGR A;  3FVN A;  1QKB A;  2PBW A;  2PX1 A;  4KR5 A;  1B52 A;  2DWA A;  3M3F A;  4OEU A;  1MXU A;  1UIV A;  1AL3 A;  3FAS A;  1SYI A;  3IB0 A;  2V25 A;  3TTL A;  4JSO A;  1ZIU A;  2D5W A;  4WXJ A;  4XIG Q;  2ZMB A;  1FW0 A;  2RC8 A;  1S7Y A;  3TPA A;  2DOJ A;  1AH5 A;  3TTM A;  3S4U A;  3CSG A;  5M2V A;  1B05 A;  1BLF A;  3O66 A;  2DE2 A;  2Z8F A;  3O97 A;  5ICT A;  4LZ7 A;  4YU0 A;  2ONK E;  4H0W A;  3E3K A;  4IO5 A;  4DLD A;  2CMO A;  1TFA A;  1LB9 A;  2XX8 A;  2X7P A;  2H9B A;  1JW5 A;  3CFZ A;  1MXV A;  2V84 A;  4G8M A;  3LSX A;  3UOR A;  5I2K A;  4GIZ A;  2F36 A;  4RXL A;  1WVJ A;  3S9E A;  3MP1 A;  3A3C A;  1DSN A;  1B7Z A;  4DXB A;  3KSX A;  3LSF B;  5H8H B;  1PEB A;  4BDR A;  4H6D A;  2H99 A;  1ZU0 A;  3Q28 A;  1SW1 A;  4KYS A;  5EHS A;  3EQ1 A;  3PMX A;  3N6U A;  1SI1 A;  1MQD A;  3R6U A;  4C1T A;  1VE4 A;  2ONS A;  5BWJ A;  1JEU A;  5JTY A;  1GR2 A;  2XX9 A;  1FQF A;  2Q2C A;  3QK6 A;  3IO4 A;  3FVG A;  3CG1 A;  1Y3N A;  5H8Q A;  2Y7W A;  1D4N A;  4AB5 A;  1D3K A;  4P11 A;  1YPN A;  5CMC A;  4GD5 A;  1KWH A;  2IA4 A;  4HCW A;  1LAG E;  4TOZ A;  1IZ1 A;  3KGC A;  4F18 A;  2I49 A;  2VP1 A;  3E4R A;  4LAT A;  4R2B A;  1B58 A;  1MY1 A;  2ESN A;  1FQC A;  1LBB A;  2BJJ X;  1LFI A;  1M5B A;  3OEL A;  2Z8E A;  3HV1 A;  1Y1Z A;  3IAZ A;  1LB8 A;  1H3D A;  3R7X A;  4IGT A;  4U1Z A;  4IO6 A;  3FD3 A;  3OO8 A;  4F1V A;  2XXU A;  3DP4 A;  1BKA A;  4E0W A;  3WAF A;  3QUF A;  3K1N A;  4ZED A;  2QPQ A;  3SDF A;  4U23 A;  2RCA A;  1HSJ A;  1MM7 A;  5DTB A;  1NKX A;  1FTL A;  4C1U A;  2Y7P A;  1B5H A;  4ISU A;  1TT1 A;  4KYD A;  1UTH A;  4H1X A;  2O69 A;  4H67 A;  3F11 A;  2O84 X;  1GV8 A;  5CMM A;  3PMV A;  1M5F A;  1SYH A;  1H45 A;  3H6T A;  1O64 A;  3CRB A;  4OHN A;  3IB2 A;  4GLI A;  2DP8 A;  4N07 A;  2QL3 A;  3I3V A;  3VVF A;  4DXU A;  3K1M A;  4C0R A;  3UP9 A;  4EQ9 A;  2RC9 A;  4EXK A;  5H8H A;  3FV2 A;  4X9T A;  5KCJ B;  1FQB A;  1OLC A;  3TMG A;  1B5I A;  2V3Q A;  3B6W A;  2HCA A;  3UN6 A;  5L8D A;  3JZJ A;  3W9V A;  3FIR A;  5L9S A;  4YB5 A;  4OWD A;  3O28 A;  5I2N A;  1VFE A;  4QHQ A;  1HSE A;  4THI A;  4LA9 A;  1Y20 A;  1P1Q A;  1USY E;  1MY0 A;  5DVI A;  1ZMG A;  3OSQ A;  2Y7R A;  3HHF A;  2HAV A;  3GBA A;  3IX1 A;  1FQA A;  3FV1 A;  2ABH A;  3TEL A;  1N3X A;  4F1U A;  5TU0 A;  3IR1 A;  4H8J A;  2E1S A;  2F7A A;  3K6W A;  1MXY A;  3PPQ A;  3U8Q A;  4NED A;  3FXQ A;  1SI0 A;  3EHT A;  4KQP A;  2VGQ A;  2I0C A;  4ELR A;  3GLB A;  1LFG A;  1MPD A;  5CI5 A;  1BIY A;  1SW4 A;  2DQV A;  2XXY A;  3B7D A;  3KSJ A;  3AXF A;  3N94 A;  1URD A;  2I58 A;  2X26 A;  3C9H A;  3OXN A;  2XHD A;  1QKA A;  1IXC A;  3TQW A;  3K01 A;  4IO4 A;  2RC7 A;  4TLM B;  2OJT A;  3VV5 A;  3CVG A;  1TFD A;  1NH7 A;  4KCC A;  2DWI A;  5I59 B;  2VD3 A;  3T22 A;  1MPC A;  4OFO A;  3B6Q A;  1A55 A;  1ZTY A;  3SET A;  4G68 C;  4YMA A;  3U93 A;  4P0G A;  4TQU Q;  1SW5 A;  1J1N A;  1NFT A;  5ITP A;  1IEJ A;  3D4G A;  3T9V A;  3VLU A;  1MH4 A;  4KI0 E;  1EZO A;  4RK9 A;  4RPO A;  2Y7I A;  3CIJ A;  1UQW A;  1DPE A;  2DWH A;  2Z23 A;  5DVF A;  1IIW A;  3LC8 A;  1MDQ A;  4R6Y A;  1YAE A;  4OET A;  1LAF E;  1IXG A;  3ODB A;  3K1P A;  3PV0 E;  4R75 A;  2UVI A;  3OEM A;  1QUK A;  4I9D A;  4OVJ A;  5JK4 A;  4R9G A;  3PUX E;  5AA4 A;  2DVZ A;  3BFT A;  3MP6 A;  4H65 A;  3JV9 A;  2PYY A;  3EF7 A;  5KCJ A;  1L5T A;  1B40 A;  2UXA A;  1USY H;  3L6H A;  4YKJ A;  3QSL A;  4R6H A;  4QSE A;  2OWT A;  3MWB A;  4GRK A;  3PGF A;  2A5S A;  1PB8 A;  1B3E A;  1UTB B;  4XKQ A;  4LZ5 A;  2QS4 A;  4QFN A;  3G3F A;  1A99 A;  1FQD A;  4U22 A;  4LUB A;  5F7V A;  4DZ1 A;  4KHZ E;  1WDN A;  4EDP A;  1Y4C A;  1IXI A;  2P2A A;  2RKM A;  1EZ9 A;  5F1Q A;  1US4 A;  4IO2 A;  4LQ2 A;  4E0X A;  2GHA A;  4NWD A;  3QIM A;  2Q8J A;  4R72 A;  2HZL A;  2I3W A;  1LGB C;  3SEU A;  3TCH A;  3T96 B;  2GRV A;  1B1H A;  3U72 A;  4LZ8 A;  4MLQ A;  1N0T A;  1VFD A;  4ESW A;  4MBP A;  4NF4 B;  1MQG A;  3G3H A;  3FJG A;  2G29 A;  4M4G A;  2DXY A;  2Q9T A;  1XHY A;  1I6B A;  1B32 A;  4PFW A;  3PPR A;  3CR9 A;  1B51 A;  3W15 C;  2KLF A;  1MY3 A;  3G3G A;  3QYT A;  3RTW B;  4R73 A;  3IOU A;  1POY 1;  3KJ7 A;  4QFL A;  2Y7K A;  2O7U A;  4R2F A;  3BKI B;  1SDX A;  1XT8 A;  3HST A;  3RN8 A;  2RIN A;  5I56 B;  4XTC Q;  4QF9 A;  3T9X B;  1EZP A;  2ZXT A;  3U92 A;  1XVY A;  3EPE A;  1JVY A;  4X1D A;  2Z8D A;  5FHO A;  5K2Y A;  1I69 A;  2NWJ A;  4ND9 A;  3C34 A;  4RNS A;  2XXH A;  5I59 A;  4U4X A;  3TZA A;  4GOT A;  1R6Z A;  3Q25 A;  2DYX A;  4U4S A;  1SVX B;  4ZEK A;  4JWY A;  1DMB A;  3VE1 B;  4O3C A;  2YJP A;  4EF1 A;  3BBR A;  1N76 A;  2QS2 A;  3QUJ A;  2UVH A;  3FUZ A;  3SEY A;  3OOA A;  4FAT A;  2R9J A;  1Y3P A;  1P1U A;  4MFI A;  2H4I A;  1MXW A;  4QRZ A;  4F29 A;  3FXU A;  3C35 A;  4AB6 A;  2I48 A;  4IY6 A;  2FYI A;  1GVC A;  4H5F A;  1R9Q A;  4HTG A;  4PP0 A;  4HW8 A;  1GGG A;  2E0S A;  4OMB A;  3PD9 A;  4F3G A;  3UGW A;  4PET A;  2O68 A;  4GQO A;  2NUV A;  2F35 A;  1QW0 A;  1OQG A;  3P7I A;  3IL1 B;  1PDA A;  5ISU A;  3OEN A;  5CBS A;  3H06 B;  4Q5T A;  5IAI A;  3G3K A;  3RPW A;  4PFU A;  3MAM A;  2UYE A;  1UTB A;  1FTO A;  3O2A A;  1LFH A;  2Q89 A;  5TP9 B;  3MVX A;  4H5G A;  2P0S A;  3DP6 A;  2XXP A;  1TWY A;  4PE5 B;  3N5L A;  4ZEI A;  3Q27 A;  3ILT B;  1HSL A;  3VVD A;  1MG1 A;  3VDF A;  1B0H A;  1B4Z A;  4X1B A;  3IK6 B;  4FJP A;  4OTE A;  5TPA B;  1NL5 A;  5I58 B;  1I6A A;  1FTK A;  1SQY A;  3CFL A;  3KBR A;  1MY4 A;  1DOT A;  3CSB A;  1IUD A;  1POT A;  4BDQ A;  4FEB A;  5ELV A;  5H8F B;  4P0I A;  1QUJ A;  4WEP A;  3MW0 A;  3EHS A;  3MZ9 A;  4MF3 A;  5A5X B;  4JSD A;  3M3L A;  2F97 A;  4Q8R A;  3C4M A;  2F6P A;  2Z22 A;  1Y1M A;  1AOV A;  3IO6 A;  1Y3Q A;  3MVZ A;  4O3B A;  1OLA A;  4FEC A;  1H43 A;  3G3J A;  4JDF A;  1TXF A;  2IEE A;  1P1O A;  5I56 A;  1JW1 A;  4ZDM A;  1B5J A;  2F8D A;  2B65 A;  3K4U A;  4G68 B;  3FVK A;  2F34 A;  5KDT B;  4IO7 A;  4I1D A;  3G7W A;  1Z7M E;  4R9F A;  3FZV A;  3UIF A;  1FTM A;  3EN3 A;  4YAH X;  2XD2 A;  3PUV E;  4XXU A;  5L9O A;  1B6H A;  1ZBM A;  4BDN A;  1RYX A;  3RLF E;  2I4C A;  2PMS A;  4GWO A;  4RA1 A;  3KEI A;  4NF5 B;  3A3U A;  1ZKB A;  1Z7N E;  5IKB A;  4RY1 A;  2REJ A;  3UA8 A;  4YZZ A;  2XX7 A;  4POW A;  5CM6 A;  1D9V A;  4XKP A;  2REG A;  2FNC A;  1WOD A;  4RYA A;  4IO3 A;  4F31 B;  2DWJ A;  4DE8 A;  2X7Q A;  3EHU A;  4FED A;  3UK4 A;  2R71 A;  3MBP A;  3M8U A;  4X48 A;  4YKP A;  1JW4 A;  3SEV A;  4ELO A;  2O1L A;  1N04 A;  1URS A;  4BDL A;  4ESX A;  3HO7 A;  2DXR A;  2VOZ A;  4N13 A;  4KFQ A;  1DTZ A;  3C32 A;  1LST A;  2O6A A;  1N7W A;  5J1D A;  4WED A;  1FQE A;  4Q30 B;  1OMP A;  5FTI A;  4F2Q A;  3MPL A;  4FOR A;  2QSX A;  2B3B A;  2OCU A;  3K02 A;  2HZK A;  3THI A;  3PPN A;  4ZEC A;  5AA2 B;  3OSR A;  2QRY A;  3CFX A;  5TP9 A;  2PT2 A;  3FVO A;  1NMU A;  3HPI A;  1LCT A;  3H7M A;  4EQ7 A;  4I62 A;  4L17 A;  3PUZ E;  2R6G E;  3PD8 A;  4OQO A;  5TPA A;  2O1M A;  4AQ4 A;  5I58 A;  4LQ5 A;  3PU5 A;  2F7C A;  3PUY E;  4JWO A;  3LBS A;  2D3I A;  1B3L A;  4F39 A;  2HEU A;  1P1W A;  3TYH A;  3OO9 A;  1P1N A;  3N26 A;  5H8F A;  3DEL B;  2WKY A;  4JB7 A;  1B3F A;  1LBC A;  1OVT A;  2M8C A;  1VR5 A;  1LAH E;  1Q35 A;  5FHM A;  2YLN A;  2P1S A;  4ELQ A;  2F6G A;  4G8H A;  4MLV A;  5KZT A;  2LAO A;  1MQH A;  2XXX A;  1RKM A;  1B4H A;  4G4P A;  4G68 A;  1OVB A;  3FJ7 A;  4FAJ A;  4YKI A;  5KDT A;  2OZZ A;  1IXH A;  1XVX A;  1B3H A;  3H3G A;  2FA7 A;  3ZKK A;  3TQL A;  1UIU A;  1XC1 A;  2O51 A;  3GBB A;  2XXR A;  5CBR A;  1B1X A;  4FE8 A;  2ZYO A;  3KJT A;  4OFL A;  4ZE8 A;  5FTH A;  4KCD A;  2VD2 A; 
#chains in the Genus database with same CATH topology
 4AS4 A;  4JWX A;  3Q26 A;  5H8Q B;  4DDD A;  3LUZ A;  3LUY A;  2XXT A;  2H98 A;  2ZNT A;  4UA8 A;  1JET A;  1NH8 A;  1YYZ A;  4EQB A;  3O6I A;  1S9T A;  4PC9 A;  4QSD A;  2ZYN A;  3USD A;  2HAU A;  1BP5 A;  3L6G A;  4Z0I A;  1A8F A;  1SW2 A;  4IR8 A;  1FTJ A;  1YXI A;  1ZLQ A;  4ECF A;  4QFK A;  4ZEF A;  5DVJ A;  2Y5K A;  4M1V A;  4YIC A;  4GFR A;  3VXB A;  1N7X A;  4NF6 B;  4OEV A;  5IZ3 A;  4LON B;  1QJM A;  2NXO A;  1FPD A;  4FBP A;  4IY5 A;  1MDP 1;  4F3P A;  3TCF A;  2F5X A;  4GVO A;  3MQ9 A;  2XD3 A;  3A29 A;  4DXC A;  3EKI A;  3E13 X;  5LTC A;  3G3I A;  1OIB A;  3T9U A;  1B9J A;  2NVU B;  1IQ7 A;  2XXQ A;  1NV0 A;  1MM6 A;  1PBQ A;  1PB9 A;  4QFP A;  4H45 A;  5AA2 A;  3IFC A;  4PQJ A;  3CG3 A;  1FBC A;  4RJZ A;  2DSF A;  3FXB A;  3OMB A;  5IGA A;  1IMC A;  4GL8 A;  4N6P A;  3K6U A;  3VVE A;  3JYR A;  1T0K A;  3RT6 B;  3TCG A;  3HCQ A;  4BLA A;  4H8I A;  4NF8 B;  1NNF A;  4OVT A;  4F19 A;  3DLN A;  1ANF A;  2WEF A;  1UTH B;  4POX A;  2V3T A;  3OO6 A;  1MY2 A;  5ICQ A;  3KG2 A;  4H46 A;  3ZKL A;  3R26 A;  1EU8 A;  4I8C A;  2ONR A;  4TLL B;  4N8G A;  3MVW A;  1QUI A;  3KOS A;  4NMY A;  4YMB A;  1FBP A;  2Y84 A;  1N3W A;  1IMD A;  3IB1 A;  4Q0C A;  1URG A;  2CEX A;  3KOT A;  2ALU A;  1DTG A;  3FGS A;  2CZL A;  4FIM A;  1B2H A;  3DM0 A;  3SER A;  4OVR A;  4EXL A;  4ZZE A;  4KD5 A;  1NV5 A;  5ET6 A;  3SEX A;  1YTV A;  2YPN A;  2UVJ A;  3V83 A;  5ET8 A;  2UVG A;  1ATG A;  1MQI A;  1LAX A;  4MH5 A;  5K2X A;  4HE2 A;  1FBF A;  4GWU A;  3S9L C;  1CE2 A;  1M5E A;  2F78 A;  3MUQ A;  3H6W A;  4ZZA A;  5FHN A;  3DP8 A;  3SES A;  4U2R A;  4EUO A;  3QMF A;  3A09 A;  3T93 B;  2QS3 A;  4RPN A;  1G0H A;  3KN3 A;  1BTJ A;  3C36 A;  5T3J A;  5I84 A;  1DPP A;  1M5D A;  1MXZ A;  3RT8 A;  2ZNU A;  1A8E A;  4NG7 A;  2QMW A;  2I3V A;  5I2N B;  1O63 A;  1SBP A;  4QFO A;  3U1O A;  3ONM A;  2PT1 A;  4F3B A;  1B3G A;  4ONY A;  1A40 A;  1CNQ A;  3TAJ A;  2I0B A;  3V5A A;  1LBZ A;  4BDO A;  5H8N B;  3OEK A;  4ZS9 A;  4PTK A;  4OZ9 A;  3SKP A;  2XWK A;  3S9M C;  4GXS B;  4PFT A;  2A5T B;  1FPB A;  4K3F A;  1A7L A;  3MZ1 A;  1Y9U A;  3MPK A;  3M3K A;  5CRY A;  3SEW A;  3RQT A;  3T9H B;  3FXR A;  2ZNS A;  1I6Q A;  1MRP A;  2RF1 A;  1US5 A;  1NNK A;  4JBZ A;  5A5L A;  4NF6 A;  4PAI A;  5H8S A;  3T66 A;  1AWB A;  3N6T A;  4O7I A;  2F3D A;  4YB6 A;  4OVQ A;  2GFE A;  2I6E A;  4ZEB A;  5ITO A;  1XS5 A;  3VFJ A;  3U65 A;  2HXW A;  3IOW A;  1ZJL A;  4O3A A;  4GL0 A;  2B3F A;  4R74 A;  4NF4 A;  1PB7 A;  1MXX A;  3TTR A;  3H03 A;  3PPO A;  2CZH A;  1VSO A;  3D1R A;  3OD7 A;  5B70 A;  5DEX B;  1JP4 A;  3LR1 A;  4GWX A;  3TOD A;  4OFJ A;  5I57 B;  3IJO B;  2XXW A;  4PGP A;  5AA3 A;  2NOO A;  1N84 A;  1JVX A;  3S9N C;  3VLW A;  2Q2A A;  4OXV A;  1XOC A;  4N15 A;  4G61 A;  2D21 A;  2RCB A;  4NF8 A;  4GX6 A;  4OYV A;  3MP8 A;  1EYI A;  3IOR A;  4EF2 A;  2GH9 A;  1MQJ A;  3PUW E;  1OQH A;  3VXC A;  3VLV A;  1IMA A;  2R8T A;  2AIX A;  3BIG A;  2DVC A;  2THI A;  3C31 A;  2OBG A;  3RY3 A;  4QSC A;  4WKM A;  5AA1 A;  1NUZ A;  4MIJ A;  1AIV A;  3KN8 A;  5LOM A;  4MNP A;  4N91 A;  3IJX B;  4NQ8 A;  3O29 A;  4PBH A;  4JVC A;  3ROJ A;  2GHB A;  2AL5 A;  2H25 A;  3C33 A;  4HE1 A;  1NNT A;  1MS7 A;  1QVS A;  3FJM A;  4G2Z A;  1PC3 A;  3S2V A;  4ELP A;  2AYS A;  3TTK A;  5J16 A;  2G93 A;  1JQF A;  3OO7 A;  1II5 A;  4BDM A;  1LCF A;  3H6U A;  5AA2 D;  4MHF A;  5AA4 B;  1ELJ A;  4MCO A;  2QVR A;  3WAE A;  1R9L A;  3RNN A;  3O6H A;  3U94 A;  2DDK A;  2OLB A;  1YCJ A;  3HN0 A;  3K6X A;  5B7D A;  3TDJ A;  1PBP A;  4PBQ A;  4R6K A;  5I5P A;  1F9B A;  3LV0 A;  3KFM A;  4G8N A;  4OEN A;  3K0V A;  3PPP A;  1CB6 A;  2DE4 A;  1FCK A;  4GF8 A;  5HBC A;  1BK4 A;  5H8N A;  1FRP A;  2HQ0 A;  3IOV A;  2Q88 A;  1R1N A;  3ILU B;  4F1Y A;  3TFL A;  4N17 A;  4DCX A;  5FBP A;  1IIT A;  2A5T A;  3O6G A;  5CMB A;  4DCY A;  2OK2 A;  1P99 A;  3GZG A;  1Y4T A;  3I5O A;  1O7T A;  3MVY A;  1B7H A;  2O7I A;  3ZSF A;  3QAX A;  2XWI A;  2XXI A;  1AMF A;  4PAK A;  4NE4 A;  5DYH A;  5AE4 A;  3HHG A;  1M5C A;  4OES A;  1RYO A;  4UAB A;  3K6V A;  3NOH A;  4NTL A;  4U1O A;  4XKR A;  4GX3 A;  1A54 A;  3MC2 A;  3O9P A;  3RUM A;  4GXA A;  1LLS A;  1Q1K A;  3K00 A;  1B46 A;  2B4L A;  2VHA A;  2QJE A;  2I4B A;  2ANJ A;  4HCY A;  2WYK A;  4F3S A;  1JEV A;  4JXI A;  5DEX A;  5A5X A;  5I57 A;  3MJN A;  1RDZ A;  1JNF A;  4Z7E A;  5I2K B;  3BFU A;  1NV2 A;  5CMK A;  3PMW A;  2QMX A;  2MKZ A;  4HS7 A;  2UYF A;  2QS1 A;  5CC2 A;  4KYE A;  2ZYM A;  4U21 A;  4RK2 A;  5HPQ A;  4O8M A;  4LP2 B;  1NV3 A;  4YB7 A;  1H44 A;  3TTN A;  1MPB A;  2OWS A;  4NWC A;  2DS9 A;  2W7Y A;  1K9Z A;  3GXA A;  2V3U A;  4XKN A;  3H4Z A;  1NV4 A;  3RYD A;  2V93 A;  5HM4 B;  3IOT A;  3H6V A;  3Q29 A;  2PVU A;  2JJK A;  2AL4 A;  3ZS6 A;  4P1E A;  5L9M A;  3W9W A;  5BUU A;  4NF5 A;  1QUL A;  3ECR A;  3LSL A;  1GTK A;  3FAT A;  2PFZ A;  5JTY B;  1S50 A;  1KA0 A;  4P9K A;  5DT6 A;  5EYF A;  3MZB A;  1NV6 A;  2DE3 A;  3D4C A;  1IMF A;  1B7U A;  4PF6 A;  4KPT A;  3KN7 A;  3RTF B;  4DI3 D;  4LVQ A;  1B0L A;  5EHM A;  4YKK A;  5JEI A;  1D9Y A;  2Q8M A;  4OVP A;  2ZZW A;  2F7B A;  3V8X B;  2PFY A;  3K2D A;  4F22 A;  4PE3 A;  4OER A;  2ZYK A;  3SZP A;  4DIG A;  2VPO A;  3TEP A;  4IB2 A;  3LSW A;  3V89 B;  2XXV A;  1NNP A;  1H76 A;  1EH3 A;  4HE0 A;  3B6T A;  1LBV A;  4G77 A;  4F2O A;  1SD3 A;  1MH3 A;  3RGY A;  2VT5 A;  4OA4 A;  3E9X A;  4P8B A;  3CI8 A;  2H5Y A;  3QXM A;  3KZG A;  4ZE9 A;  2HFB A;  4UAC A;  3I6V A;  1FPI A;  3TUS A;  4PFY A;  3TKD A;  4IGR A;  3FVN A;  1QKB A;  2PBW A;  2PX1 A;  4KR5 A;  1B52 A;  1FBG A;  3CHG A;  2DWA A;  3M3F A;  4OEU A;  1MXU A;  1UIV A;  1AL3 A;  1RDX A;  3FAS A;  1SYI A;  3IB0 A;  2V25 A;  3TTL A;  4JSO A;  2L5V A;  1ZIU A;  2D5W A;  4WXJ A;  1FJ9 A;  2Q74 A;  4XIG Q;  2ZMB A;  1FW0 A;  2OWZ A;  2RC8 A;  4I40 A;  1S7Y A;  3TPA A;  2DOJ A;  1AH5 A;  3TTM A;  2QFL A;  1D9Q A;  3S4U A;  3CSG A;  5M2V A;  1B05 A;  1BLF A;  3O66 A;  2DE2 A;  2Z8F A;  4NHB A;  3O97 A;  5ICT A;  4LZ7 A;  4YU0 A;  3RPL A;  2ONK E;  4H0W A;  3E3K A;  4IO5 A;  4DLD A;  2CMO A;  1TFA A;  1LB9 A;  2XX8 A;  2X7P A;  5I7I A;  2H9B A;  1JW5 A;  3CFZ A;  1MXV A;  2V84 A;  4KXP A;  4G8M A;  3LSX A;  4XEQ A;  3UOR A;  5I2K A;  4GIZ A;  2F36 A;  4RXL A;  1WVJ A;  3S9E A;  3MP1 A;  3A3C A;  1DSN A;  1B7Z A;  4DXB A;  4GBV A;  1FPF A;  2FVZ A;  3KSX A;  3LSF B;  5H8H B;  1XI6 A;  1PEB A;  4BDR A;  4H6D A;  2H99 A;  1ZU0 A;  3Q28 A;  4OVS A;  1SW1 A;  4KYS A;  5EHS A;  5IM2 A;  3EQ1 A;  3PMX A;  3N6U A;  1SI1 A;  1MQD A;  3R6U A;  4C1T A;  2OX3 A;  4P47 A;  1VE4 A;  2ONS A;  5DW8 A;  5BWJ A;  1JEU A;  5JTY A;  1GR2 A;  2XX9 A;  1FQF A;  2P3N A;  2Q2C A;  3QK6 A;  3ISP A;  3IO4 A;  3FVG A;  3CG1 A;  2FBP A;  1Y3N A;  5H8Q A;  1LBX A;  2Y7W A;  1D4N A;  4AB5 A;  1D3K A;  4P11 A;  1YPN A;  5CMC A;  4GD5 A;  1KWH A;  2IA4 A;  4HCW A;  4N81 A;  1LAG E;  4TOZ A;  1IZ1 A;  3KGC A;  4F18 A;  4P1L A;  2I49 A;  2VP1 A;  3MST A;  3E4R A;  4LAT A;  4R2B A;  1B58 A;  1MY1 A;  2ESN A;  1FQC A;  1FSA A;  1LBB A;  2BJJ X;  4JVD A;  1LFI A;  1M5B A;  3OEL A;  2Z8E A;  3HV1 A;  1FBD A;  1Y1Z A;  3IAZ A;  1LB8 A;  1H3D A;  3R7X A;  4IGT A;  4U1Z A;  4IO6 A;  3FD3 A;  3OO8 A;  2P3V A;  4F1V A;  4O94 A;  2XXU A;  2QVU A;  3DP4 A;  1FPK A;  5ET7 A;  1BKA A;  4E0W A;  3WAF A;  3QUF A;  3K1N A;  3E79 A;  4ZED A;  2QPQ A;  3SDF A;  4U23 A;  2RCA A;  1HSJ A;  5IZZ A;  1MM7 A;  5DTB A;  2XWV A;  1NKX A;  1FTL A;  4C1U A;  2Y7P A;  1B5H A;  4ISU A;  1TT1 A;  4KYD A;  1UTH A;  4H1X A;  2O69 A;  4H67 A;  3F11 A;  2O84 X;  1GV8 A;  1G0I A;  1RDY A;  5CMM A;  3T1B A;  3E78 A;  2FIX A;  3PMV A;  1M5F A;  1LBW A;  1SYH A;  1KZ8 A;  1H45 A;  3H6T A;  1O64 A;  2PCR A;  3CRB A;  4OHN A;  3IB2 A;  4GLI A;  2DP8 A;  4N07 A;  1FPE A;  2QL3 A;  3I3V A;  3VVF A;  4DXU A;  3K1M A;  4C0R A;  3UP9 A;  4MNI A;  4EQ9 A;  2RC9 A;  4EXK A;  5H8H A;  5LDZ A;  3FV2 A;  4X9T A;  2HPG A;  5KCJ B;  1FQB A;  1OLC A;  3TMG A;  4PCD A;  1B5I A;  2V3Q A;  3B6W A;  2HCA A;  3UN6 A;  5L8D A;  3JZJ A;  3W9V A;  5EYG A;  3FIR A;  5L9S A;  4HXV A;  4YB5 A;  4PDH A;  4OWD A;  3O28 A;  1YZ0 A;  5I2N A;  1VFE A;  4QHQ A;  1HSE A;  4THI A;  4LA9 A;  1Y20 A;  1P1Q A;  1USY E;  1MY0 A;  2QVV A;  5DVI A;  1ZMG A;  3OSQ A;  2Y7R A;  3HHF A;  2HAV A;  3GBA A;  3IX1 A;  1FQA A;  3FV1 A;  5IZ3 B;  2ABH A;  3TEL A;  2KR0 A;  1N3X A;  3B50 A;  4F1U A;  5TU0 A;  3IR1 A;  3PTY A;  4H8J A;  2E1S A;  2F7A A;  3K6W A;  1MXY A;  3PPQ A;  3U8Q A;  4NAP A;  1FPL A;  4NED A;  3FXQ A;  1SI0 A;  3EHT A;  4KQP A;  2VGQ A;  2I0C A;  4ELR A;  3GLB A;  1LFG A;  2XWO A;  1MPD A;  5CI5 A;  1BIY A;  1SW4 A;  5I3S A;  4GWZ A;  2DQV A;  2XXY A;  3B7D A;  3KSJ A;  3AXF A;  3N94 A;  1URD A;  2I58 A;  2X26 A;  3C9H A;  3OXN A;  2XHD A;  1QKA A;  4OAN A;  1IXC A;  3TQW A;  3K01 A;  4IO4 A;  2RC7 A;  1INP A;  4TLM B;  2OJT A;  3IFA A;  3VV5 A;  3CVG A;  1TFD A;  1IME A;  1NH7 A;  2XA5 A;  4KCC A;  2DWI A;  5I59 B;  2VD3 A;  4P56 A;  3T22 A;  1MPC A;  4PDD A;  4OFO A;  3B6Q A;  1A55 A;  1ZTY A;  3SET A;  4G68 C;  4YMA A;  1NV7 A;  3KC1 A;  3U93 A;  4P0G A;  4TQU Q;  3FBP A;  1SW5 A;  1J1N A;  1NFT A;  5ITP A;  1FTA A;  1IEJ A;  3D4G A;  3T9V A;  3VLU A;  1DBZ A;  1MH4 A;  4X8R A;  4KI0 E;  1EZO A;  5EYH A;  4RK9 A;  4RPO A;  2Y7I A;  3CIJ A;  1UQW A;  1DPE A;  2DWH A;  2Z23 A;  5DVF A;  1IIW A;  3LC8 A;  1MDQ A;  4R6Y A;  1YAE A;  4OET A;  2WYP A;  1LAF E;  1VDW A;  1IXG A;  3ODB A;  3K1P A;  3PV0 E;  4R75 A;  2UVI A;  4DI4 B;  3OEM A;  1QUK A;  4I9D A;  2B4M A;  4NN3 A;  4N6K A;  4OVJ A;  5JK4 A;  4R9G A;  3PUX E;  4GBW A;  5AA4 A;  2DVZ A;  3BFT A;  3MP6 A;  4H65 A;  3JV9 A;  2PYY A;  3EF7 A;  5KCJ A;  5EQ7 A;  1L5T A;  1B40 A;  2UXA A;  1USY H;  3L6H A;  4YKJ A;  3QSL A;  4R6H A;  4QSE A;  2OWT A;  3MWB A;  4GRK A;  3PGF A;  2A5S A;  1PB8 A;  1B3E A;  1UTB B;  4XKQ A;  4LZ5 A;  2QS4 A;  4QFN A;  3G3F A;  1A99 A;  1FQD A;  4U22 A;  4LUB A;  5F7V A;  4DZ1 A;  4KHZ E;  1WDN A;  4EDP A;  1Y4C A;  4MEV A;  1IXI A;  2P2A A;  2RKM A;  1EZ9 A;  5F1Q A;  1QGX A;  1US4 A;  4IO2 A;  1FBH A;  4LQ2 A;  4E0X A;  2GHA A;  1KA1 A;  4NWD A;  3QIM A;  2Q8J A;  5ESY A;  4R72 A;  2HZL A;  2I3W A;  1LGB C;  3SEU A;  3TCH A;  3T96 B;  2GRV A;  4PGN A;  1B1H A;  3U72 A;  4LZ8 A;  4MLQ A;  1N0T A;  1VFD A;  4ESW A;  4MBP A;  4NF4 B;  1MQG A;  3G3H A;  3FJG A;  2G29 A;  1NUX A;  4M4G A;  2WBD A;  2DXY A;  2Q9T A;  1XHY A;  1I6B A;  4NX1 A;  1B32 A;  4MAG A;  4PFW A;  3PPR A;  4GWW A;  3CR9 A;  3QYT A;  1B51 A;  2KLF A;  1MY3 A;  3G3G A;  3W15 C;  3RTW B;  4R73 A;  3IOU A;  1POY 1;  3KJ7 A;  4QFL A;  2Y7K A;  5EQ8 A;  2O7U A;  4R2F A;  3BKI B;  1SDX A;  1XT8 A;  3HST A;  3RN8 A;  2RIN A;  5I56 B;  4XTC Q;  4QF9 A;  3T9X B;  1EZP A;  2ZXT A;  3U92 A;  1XVY A;  3EPE A;  2HXR A;  1JVY A;  4X1D A;  2Z8D A;  1DK4 A;  4N8Y A;  5FHO A;  5K2Y A;  1I69 A;  2F3B A;  2NWJ A;  4ND9 A;  3C34 A;  4RNS A;  2XXH A;  1FJ6 A;  5I59 A;  4U4X A;  3TZA A;  4GOT A;  1R6Z A;  3Q25 A;  2DYX A;  4U4S A;  1SVX B;  4ZEK A;  4N4U A;  4JWY A;  1DMB A;  3VE1 B;  4QBA A;  4O3C A;  2YJP A;  4EF1 A;  3BBR A;  1N76 A;  2QS2 A;  3QUJ A;  2UVH A;  3FUZ A;  3SEY A;  3OOA A;  4FAT A;  2R9J A;  1Y3P A;  4MNC A;  1P1U A;  4MFI A;  1SPI A;  2H4I A;  1MXW A;  4QRZ A;  2XXK A;  4F29 A;  3FXU A;  3KC0 A;  3C35 A;  4AB6 A;  2I48 A;  4IY6 A;  2FYI A;  1GVC A;  4H5F A;  1R9Q A;  1K9Y A;  4HTG A;  4PP0 A;  2FIE A;  4HW8 A;  1GGG A;  2E0S A;  4OMB A;  3PD9 A;  4F3G A;  3UGW A;  4PET A;  2O68 A;  4GQO A;  2NUV A;  4N6D A;  2F35 A;  1QW0 A;  1OQG A;  3P7I A;  3IL1 B;  1PDA A;  1DCU A;  5ISU A;  3OEN A;  5CBS A;  3H06 B;  4Q5T A;  2VPN A;  3HFU A;  5IAI A;  4PFI A;  3G3K A;  3RPW A;  4PFU A;  3MAM A;  2UYE A;  1UTB A;  1FTO A;  3O2A A;  1LFH A;  2Q89 A;  5TP9 B;  3MVX A;  4H5G A;  2P0S A;  2KQZ A;  3DP6 A;  2XXP A;  1TWY A;  1FPJ A;  4PE5 B;  3N5L A;  5EQ9 A;  4ZEI A;  1NUY A;  3T0J A;  3Q27 A;  3ILT B;  1HSL A;  3VVD A;  1MG1 A;  3VDF A;  1B0H A;  1B4Z A;  4PAF A;  4X1B A;  3IK6 B;  4FJP A;  4OTE A;  5TPA B;  1NL5 A;  5I58 B;  1I6A A;  1FBE A;  1FTK A;  1SQY A;  3CFL A;  3KBR A;  1MY4 A;  1DOT A;  3CSB A;  1IUD A;  1POT A;  4BDQ A;  4FEB A;  4X04 A;  5ELV A;  5H8F B;  4P0I A;  1QUJ A;  4WEP A;  4MMP A;  3MW0 A;  3EHS A;  3MZ9 A;  4MF3 A;  5A5X B;  4JSD A;  3M3L A;  5ET5 A;  2F97 A;  4Q8R A;  3C4M A;  2F6P A;  1NUW A;  2Z22 A;  1Y1M A;  2V4C A;  1AOV A;  3IO6 A;  1Y3Q A;  3MVZ A;  4O3B A;  2CZK A;  1OLA A;  4FEC A;  4NF0 A;  1H43 A;  3G3J A;  2HHM A;  4XFE A;  2BJI A;  4JDF A;  2FHY A;  2CZI A;  1TXF A;  2IEE A;  1P1O A;  5I56 A;  1JW1 A;  4ZDM A;  1B5J A;  2F8D A;  2B65 A;  3BIH A;  3K4U A;  4G68 B;  3FVK A;  2F34 A;  5KDT B;  2GQ1 A;  4IO7 A;  4I1D A;  3G7W A;  1Z7M E;  2WX9 A;  4R9F A;  3FZV A;  1EYJ A;  3UIF A;  1FTM A;  3EN3 A;  4YAH X;  2XD2 A;  3PUV E;  4XXU A;  5L9O A;  1Q9D A;  1B6H A;  1ZBM A;  1LEV A;  4P3L A;  4BDN A;  1RYX A;  3RLF E;  2I4C A;  2PMS A;  4GWO A;  4RA1 A;  3KEI A;  1LBY A;  4NF5 B;  4O7M A;  3A3U A;  1ZKB A;  4MJO A;  1Z7N E;  5IKB A;  1FPG A;  4RY1 A;  2REJ A;  3UA8 A;  4YZZ A;  4XF5 A;  2XX7 A;  4POW A;  5CM6 A;  1D9V A;  4PFB A;  4XKP A;  2REG A;  2FNC A;  1WOD A;  4NGU A;  4RYA A;  4IO3 A;  4F31 B;  2DWJ A;  4DE8 A;  2X7Q A;  3EHU A;  4FED A;  4LN5 A;  3UK4 A;  2Y5L A;  2R71 A;  3MBP A;  3M8U A;  4X48 A;  4YKP A;  1JW4 A;  4JVI A;  3SEV A;  4ELO A;  2O1L A;  1N04 A;  1URS A;  4BDL A;  4ESX A;  3HO7 A;  2DXR A;  2VOZ A;  4N13 A;  4KFQ A;  1DTZ A;  3C32 A;  1LST A;  2O6A A;  1N7W A;  3GYY A;  5J1D A;  4WED A;  1FQE A;  4Q30 B;  1IMB A;  1OMP A;  4GX4 A;  5FTI A;  4F2Q A;  3MPL A;  4FOR A;  2QSX A;  2B3B A;  2ZZX A;  2OCU A;  3K02 A;  2HZK A;  3THI A;  3PPN A;  4ZEC A;  5AA2 B;  3OSR A;  2QRY A;  3CFX A;  5EQA A;  5TP9 A;  2PT2 A;  3MYU A;  3FVO A;  1NMU A;  5IZ1 A;  2WBB A;  3HPI A;  1LCT A;  3H7M A;  4EQ7 A;  4I62 A;  4L17 A;  3PUZ E;  2R6G E;  3PD8 A;  4OQO A;  5TPA A;  2O1M A;  4AQ4 A;  5I58 A;  4LQ5 A;  3PU5 A;  2F7C A;  4GWS A;  3PUY E;  4JWO A;  3LBS A;  2D3I A;  4PF8 A;  1B3L A;  1NV1 A;  4I3E A;  4F39 A;  4I3Y A;  2HEU A;  3KBZ A;  1P1W A;  1EYK A;  3TYH A;  3RPL B;  3OO9 A;  1P1N A;  3N26 A;  5H8F A;  3DEL B;  2WKY A;  3B8B A;  4JB7 A;  4MX6 A;  1B3F A;  4GWY A;  1LBC A;  4PFR A;  1OVT A;  2M8C A;  1VR5 A;  1LAH E;  1Q35 A;  5FHM A;  2YLN A;  2P1S A;  4ELQ A;  2F6G A;  4G8H A;  4MLV A;  4QXD A;  5KZT A;  2LAO A;  1MQH A;  2XXX A;  1RKM A;  1B4H A;  1NI9 A;  4G4P A;  4G68 A;  1OVB A;  3FJ7 A;  4FAJ A;  4AS5 A;  4YKI A;  5KDT A;  2OZZ A;  1IXH A;  1XVX A;  1B3H A;  5F24 A;  3H3G A;  2FA7 A;  3ZKK A;  3TQL A;  1UIU A;  1XC1 A;  2O51 A;  3GBB A;  2CEY A;  2XXR A;  5CBR A;  1B1X A;  4FE8 A;  2ZYO A;  3KJT A;  4OFL A;  4ZE8 A;  2ZZV A;  5FTH A;  4KCD A;  2VD2 A; 
#chains in the Genus database with same CATH homology
 4JWX A;  3Q26 A;  5H8Q B;  4DDD A;  3LUY A;  2XXT A;  2H98 A;  2ZNT A;  4UA8 A;  1JET A;  1NH8 A;  4EQB A;  3O6I A;  1S9T A;  4QSD A;  2ZYN A;  3USD A;  2HAU A;  1BP5 A;  3L6G A;  4Z0I A;  1A8F A;  1SW2 A;  1FTJ A;  1ZLQ A;  4ECF A;  4QFK A;  4ZEF A;  5DVJ A;  4M1V A;  4YIC A;  4GFR A;  3VXB A;  1N7X A;  4NF6 B;  4OEV A;  4LON B;  1QJM A;  2NXO A;  4IY5 A;  1MDP 1;  4F3P A;  3TCF A;  2F5X A;  4GVO A;  3MQ9 A;  2XD3 A;  4DXC A;  3E13 X;  3G3I A;  1OIB A;  3T9U A;  1B9J A;  2NVU B;  1IQ7 A;  2XXQ A;  1MM6 A;  1PBQ A;  1PB9 A;  4QFP A;  5AA2 A;  4PQJ A;  3CG3 A;  4RJZ A;  2DSF A;  3OMB A;  4GL8 A;  4N6P A;  3K6U A;  3VVE A;  3JYR A;  1T0K A;  3RT6 B;  3TCG A;  3HCQ A;  4BLA A;  4H8I A;  4NF8 B;  1NNF A;  4F19 A;  3DLN A;  1ANF A;  1UTH B;  4POX A;  2V3T A;  3OO6 A;  1MY2 A;  5ICQ A;  3KG2 A;  3ZKL A;  3R26 A;  1EU8 A;  4I8C A;  2ONR A;  4TLL B;  3MVW A;  1QUI A;  3KOS A;  4NMY A;  4YMB A;  2Y84 A;  1N3W A;  3IB1 A;  4Q0C A;  1URG A;  3KOT A;  2ALU A;  1DTG A;  3FGS A;  2CZL A;  4FIM A;  1B2H A;  3DM0 A;  3SER A;  4EXL A;  4ZZE A;  4KD5 A;  3SEX A;  1YTV A;  2YPN A;  2UVJ A;  3V83 A;  2UVG A;  1ATG A;  1MQI A;  1LAX A;  4MH5 A;  5K2X A;  3S9L C;  1CE2 A;  1M5E A;  2F78 A;  3MUQ A;  3H6W A;  4ZZA A;  5FHN A;  3DP8 A;  3SES A;  4U2R A;  4EUO A;  3A09 A;  3T93 B;  2QS3 A;  4RPN A;  3KN3 A;  1BTJ A;  3C36 A;  5I84 A;  1DPP A;  1M5D A;  1MXZ A;  3RT8 A;  2ZNU A;  1A8E A;  2QMW A;  2I3V A;  5I2N B;  1O63 A;  1SBP A;  4QFO A;  3U1O A;  3ONM A;  2PT1 A;  4F3B A;  1B3G A;  4ONY A;  1A40 A;  3TAJ A;  2I0B A;  3V5A A;  4BDO A;  5H8N B;  3OEK A;  4ZS9 A;  4OZ9 A;  3SKP A;  3S9M C;  4GXS B;  4PFT A;  2A5T B;  4K3F A;  1A7L A;  3MZ1 A;  1Y9U A;  3MPK A;  3M3K A;  5CRY A;  3SEW A;  3RQT A;  3T9H B;  3FXR A;  2ZNS A;  1I6Q A;  1MRP A;  2RF1 A;  1US5 A;  1NNK A;  4JBZ A;  4NF6 A;  5H8S A;  3T66 A;  3N6T A;  4YB6 A;  2GFE A;  2I6E A;  4ZEB A;  5ITO A;  1XS5 A;  3VFJ A;  2HXW A;  3IOW A;  1ZJL A;  4O3A A;  4GL0 A;  2B3F A;  4R74 A;  4NF4 A;  1PB7 A;  1MXX A;  3TTR A;  3H03 A;  3PPO A;  1VSO A;  3OD7 A;  5B70 A;  5DEX B;  3LR1 A;  3TOD A;  4OFJ A;  5I57 B;  3IJO B;  2XXW A;  5AA3 A;  2NOO A;  1N84 A;  1JVX A;  3S9N C;  3VLW A;  2Q2A A;  4OXV A;  1XOC A;  2D21 A;  2RCB A;  4NF8 A;  4OYV A;  3MP8 A;  4EF2 A;  3IOR A;  2GH9 A;  1MQJ A;  3PUW E;  1OQH A;  3VXC A;  3VLV A;  2AIX A;  2DVC A;  2THI A;  3C31 A;  2OBG A;  3RY3 A;  4QSC A;  4WKM A;  5AA1 A;  1AIV A;  3KN8 A;  5LOM A;  3IJX B;  3O29 A;  2GHB A;  2AL5 A;  2H25 A;  3C33 A;  1NNT A;  1MS7 A;  1QVS A;  3FJM A;  4G2Z A;  1PC3 A;  3S2V A;  4ELP A;  2AYS A;  3TTK A;  2G93 A;  1JQF A;  3OO7 A;  1II5 A;  4BDM A;  1LCF A;  3H6U A;  5AA2 D;  5AA4 B;  1ELJ A;  3WAE A;  1R9L A;  3RNN A;  3O6H A;  3U94 A;  2OLB A;  1YCJ A;  3HN0 A;  3K6X A;  5B7D A;  3TDJ A;  1PBP A;  4R6K A;  1F9B A;  3KFM A;  4G8N A;  4OEN A;  3K0V A;  3PPP A;  1CB6 A;  2DE4 A;  1FCK A;  4GF8 A;  5HBC A;  5H8N A;  2HQ0 A;  3IOV A;  2Q88 A;  1R1N A;  3ILU B;  4F1Y A;  3TFL A;  4DCX A;  1IIT A;  2A5T A;  3O6G A;  5CMB A;  4DCY A;  2OK2 A;  1P99 A;  3GZG A;  1Y4T A;  3I5O A;  1O7T A;  3MVY A;  1B7H A;  2O7I A;  3ZSF A;  3QAX A;  2XXI A;  1AMF A;  5DYH A;  4NE4 A;  5AE4 A;  3HHG A;  1M5C A;  4OES A;  1RYO A;  3K6V A;  4NTL A;  4U1O A;  4XKR A;  1A54 A;  3MC2 A;  3O9P A;  3RUM A;  4GXA A;  1LLS A;  1Q1K A;  3K00 A;  1B46 A;  2VHA A;  2QJE A;  2I4B A;  2ANJ A;  4HCY A;  4F3S A;  1JEV A;  4JXI A;  5DEX A;  5A5X A;  5I57 A;  3MJN A;  1JNF A;  4Z7E A;  5I2K B;  3BFU A;  5CMK A;  3PMW A;  2QMX A;  4HS7 A;  2UYF A;  2QS1 A;  5CC2 A;  4KYE A;  2ZYM A;  4U21 A;  4RK2 A;  5HPQ A;  4LP2 B;  4YB7 A;  1H44 A;  3TTN A;  1MPB A;  2OWS A;  4NWC A;  2DS9 A;  2W7Y A;  3GXA A;  2V3U A;  4XKN A;  3H4Z A;  2V93 A;  5HM4 B;  3IOT A;  3H6V A;  3Q29 A;  2PVU A;  2AL4 A;  3ZS6 A;  5L9M A;  3W9W A;  5BUU A;  4NF5 A;  1QUL A;  3ECR A;  3LSL A;  1GTK A;  3FAT A;  5JTY B;  1S50 A;  5DT6 A;  5EYF A;  3MZB A;  2DE3 A;  3D4C A;  1B7U A;  4KPT A;  3KN7 A;  3RTF B;  4LVQ A;  1B0L A;  5EHM A;  4YKK A;  5JEI A;  1D9Y A;  2F7B A;  3V8X B;  3K2D A;  4F22 A;  4OER A;  2ZYK A;  4DIG A;  3TEP A;  4IB2 A;  3LSW A;  3V89 B;  2XXV A;  1NNP A;  1H76 A;  1EH3 A;  3B6T A;  4G77 A;  4F2O A;  1SD3 A;  1MH3 A;  3RGY A;  3E9X A;  3CI8 A;  2H5Y A;  3QXM A;  3KZG A;  4ZE9 A;  2HFB A;  4UAC A;  3I6V A;  3TUS A;  4PFY A;  3TKD A;  4IGR A;  3FVN A;  1QKB A;  2PBW A;  2PX1 A;  4KR5 A;  1B52 A;  2DWA A;  3M3F A;  4OEU A;  1MXU A;  1UIV A;  1AL3 A;  3FAS A;  1SYI A;  3IB0 A;  2V25 A;  3TTL A;  4JSO A;  1ZIU A;  2D5W A;  4WXJ A;  4XIG Q;  2ZMB A;  1FW0 A;  2RC8 A;  1S7Y A;  3TPA A;  2DOJ A;  1AH5 A;  3TTM A;  3S4U A;  3CSG A;  5M2V A;  1B05 A;  1BLF A;  3O66 A;  2DE2 A;  2Z8F A;  3O97 A;  5ICT A;  4LZ7 A;  4YU0 A;  2ONK E;  4H0W A;  3E3K A;  4IO5 A;  4DLD A;  2CMO A;  1TFA A;  1LB9 A;  2XX8 A;  2X7P A;  2H9B A;  1JW5 A;  3CFZ A;  1MXV A;  2V84 A;  4G8M A;  3LSX A;  3UOR A;  5I2K A;  4GIZ A;  2F36 A;  4RXL A;  1WVJ A;  3S9E A;  3MP1 A;  3A3C A;  1DSN A;  1B7Z A;  4DXB A;  3KSX A;  3LSF B;  5H8H B;  1PEB A;  4BDR A;  4H6D A;  2H99 A;  1ZU0 A;  3Q28 A;  1SW1 A;  4KYS A;  5EHS A;  3EQ1 A;  3PMX A;  3N6U A;  1SI1 A;  1MQD A;  3R6U A;  4C1T A;  1VE4 A;  2ONS A;  5BWJ A;  1JEU A;  5JTY A;  1GR2 A;  2XX9 A;  1FQF A;  2Q2C A;  3QK6 A;  3IO4 A;  3FVG A;  3CG1 A;  1Y3N A;  5H8Q A;  2Y7W A;  1D4N A;  4AB5 A;  1D3K A;  4P11 A;  1YPN A;  5CMC A;  4GD5 A;  1KWH A;  2IA4 A;  4HCW A;  1LAG E;  4TOZ A;  1IZ1 A;  3KGC A;  4F18 A;  2I49 A;  2VP1 A;  3E4R A;  4LAT A;  4R2B A;  1B58 A;  1MY1 A;  2ESN A;  1FQC A;  1LBB A;  2BJJ X;  1LFI A;  1M5B A;  3OEL A;  2Z8E A;  3HV1 A;  1Y1Z A;  3IAZ A;  1LB8 A;  1H3D A;  3R7X A;  4IGT A;  4U1Z A;  4IO6 A;  3FD3 A;  3OO8 A;  4F1V A;  2XXU A;  3DP4 A;  1BKA A;  4E0W A;  3WAF A;  3QUF A;  3K1N A;  4ZED A;  2QPQ A;  3SDF A;  4U23 A;  2RCA A;  1HSJ A;  1MM7 A;  5DTB A;  1NKX A;  1FTL A;  4C1U A;  2Y7P A;  1B5H A;  4ISU A;  1TT1 A;  4KYD A;  1UTH A;  4H1X A;  2O69 A;  4H67 A;  3F11 A;  2O84 X;  1GV8 A;  5CMM A;  3PMV A;  1M5F A;  1SYH A;  1H45 A;  3H6T A;  1O64 A;  3CRB A;  4OHN A;  3IB2 A;  4GLI A;  2DP8 A;  4N07 A;  2QL3 A;  3I3V A;  3VVF A;  4DXU A;  3K1M A;  4C0R A;  3UP9 A;  4EQ9 A;  2RC9 A;  4EXK A;  5H8H A;  3FV2 A;  4X9T A;  5KCJ B;  1FQB A;  1OLC A;  3TMG A;  1B5I A;  2V3Q A;  3B6W A;  2HCA A;  3UN6 A;  5L8D A;  3JZJ A;  3W9V A;  3FIR A;  5L9S A;  4YB5 A;  4OWD A;  3O28 A;  5I2N A;  1VFE A;  4QHQ A;  1HSE A;  4THI A;  4LA9 A;  1Y20 A;  1P1Q A;  1USY E;  1MY0 A;  5DVI A;  1ZMG A;  3OSQ A;  2Y7R A;  3HHF A;  2HAV A;  3GBA A;  3IX1 A;  1FQA A;  3FV1 A;  2ABH A;  3TEL A;  1N3X A;  4F1U A;  5TU0 A;  3IR1 A;  4H8J A;  2E1S A;  2F7A A;  3K6W A;  1MXY A;  3PPQ A;  3U8Q A;  4NED A;  3FXQ A;  1SI0 A;  3EHT A;  4KQP A;  2VGQ A;  2I0C A;  4ELR A;  3GLB A;  1LFG A;  1MPD A;  5CI5 A;  1BIY A;  1SW4 A;  2DQV A;  2XXY A;  3B7D A;  3KSJ A;  3AXF A;  3N94 A;  1URD A;  2I58 A;  2X26 A;  3C9H A;  3OXN A;  2XHD A;  1QKA A;  1IXC A;  3TQW A;  3K01 A;  4IO4 A;  2RC7 A;  4TLM B;  2OJT A;  3VV5 A;  3CVG A;  1TFD A;  1NH7 A;  4KCC A;  2DWI A;  5I59 B;  2VD3 A;  3T22 A;  1MPC A;  4OFO A;  3B6Q A;  1A55 A;  1ZTY A;  3SET A;  4G68 C;  4YMA A;  3U93 A;  4P0G A;  4TQU Q;  1SW5 A;  1J1N A;  1NFT A;  5ITP A;  1IEJ A;  3D4G A;  3T9V A;  3VLU A;  1MH4 A;  4KI0 E;  1EZO A;  4RK9 A;  4RPO A;  2Y7I A;  3CIJ A;  1UQW A;  1DPE A;  2DWH A;  2Z23 A;  5DVF A;  1IIW A;  3LC8 A;  1MDQ A;  4R6Y A;  1YAE A;  4OET A;  1LAF E;  1IXG A;  3ODB A;  3K1P A;  3PV0 E;  4R75 A;  2UVI A;  3OEM A;  1QUK A;  4I9D A;  4OVJ A;  5JK4 A;  4R9G A;  3PUX E;  5AA4 A;  2DVZ A;  3BFT A;  3MP6 A;  4H65 A;  3JV9 A;  2PYY A;  3EF7 A;  5KCJ A;  1L5T A;  1B40 A;  2UXA A;  1USY H;  3L6H A;  4YKJ A;  3QSL A;  4R6H A;  4QSE A;  2OWT A;  3MWB A;  4GRK A;  3PGF A;  2A5S A;  1PB8 A;  1B3E A;  1UTB B;  4XKQ A;  4LZ5 A;  2QS4 A;  4QFN A;  3G3F A;  1A99 A;  1FQD A;  4U22 A;  4LUB A;  5F7V A;  4DZ1 A;  4KHZ E;  1WDN A;  4EDP A;  1Y4C A;  1IXI A;  2P2A A;  2RKM A;  1EZ9 A;  5F1Q A;  1US4 A;  4IO2 A;  4LQ2 A;  4E0X A;  2GHA A;  4NWD A;  3QIM A;  2Q8J A;  4R72 A;  2HZL A;  2I3W A;  1LGB C;  3SEU A;  3TCH A;  3T96 B;  2GRV A;  1B1H A;  3U72 A;  4LZ8 A;  4MLQ A;  1N0T A;  1VFD A;  4ESW A;  4MBP A;  4NF4 B;  1MQG A;  3G3H A;  3FJG A;  2G29 A;  4M4G A;  2DXY A;  2Q9T A;  1XHY A;  1I6B A;  1B32 A;  4PFW A;  3PPR A;  3CR9 A;  1B51 A;  3W15 C;  2KLF A;  1MY3 A;  3G3G A;  3QYT A;  3RTW B;  4R73 A;  3IOU A;  1POY 1;  3KJ7 A;  4QFL A;  2Y7K A;  2O7U A;  4R2F A;  3BKI B;  1SDX A;  1XT8 A;  3HST A;  3RN8 A;  2RIN A;  5I56 B;  4XTC Q;  4QF9 A;  3T9X B;  1EZP A;  2ZXT A;  3U92 A;  1XVY A;  3EPE A;  1JVY A;  4X1D A;  2Z8D A;  5FHO A;  5K2Y A;  1I69 A;  2NWJ A;  4ND9 A;  3C34 A;  4RNS A;  2XXH A;  5I59 A;  4U4X A;  3TZA A;  4GOT A;  1R6Z A;  3Q25 A;  2DYX A;  4U4S A;  1SVX B;  4ZEK A;  4JWY A;  1DMB A;  3VE1 B;  4O3C A;  2YJP A;  4EF1 A;  3BBR A;  1N76 A;  2QS2 A;  3QUJ A;  2UVH A;  3FUZ A;  3SEY A;  3OOA A;  4FAT A;  2R9J A;  1Y3P A;  1P1U A;  4MFI A;  2H4I A;  1MXW A;  4QRZ A;  4F29 A;  3FXU A;  3C35 A;  4AB6 A;  2I48 A;  4IY6 A;  2FYI A;  1GVC A;  4H5F A;  1R9Q A;  4HTG A;  4PP0 A;  4HW8 A;  1GGG A;  2E0S A;  4OMB A;  3PD9 A;  4F3G A;  3UGW A;  4PET A;  2O68 A;  4GQO A;  2NUV A;  2F35 A;  1QW0 A;  1OQG A;  3P7I A;  3IL1 B;  1PDA A;  5ISU A;  3OEN A;  5CBS A;  3H06 B;  4Q5T A;  5IAI A;  3G3K A;  3RPW A;  4PFU A;  3MAM A;  2UYE A;  1UTB A;  1FTO A;  3O2A A;  1LFH A;  2Q89 A;  5TP9 B;  3MVX A;  4H5G A;  2P0S A;  3DP6 A;  2XXP A;  1TWY A;  4PE5 B;  3N5L A;  4ZEI A;  3Q27 A;  3ILT B;  1HSL A;  3VVD A;  1MG1 A;  3VDF A;  1B0H A;  1B4Z A;  4X1B A;  3IK6 B;  4FJP A;  4OTE A;  5TPA B;  1NL5 A;  5I58 B;  1I6A A;  1FTK A;  1SQY A;  3CFL A;  3KBR A;  1MY4 A;  1DOT A;  3CSB A;  1IUD A;  1POT A;  4BDQ A;  4FEB A;  5ELV A;  5H8F B;  4P0I A;  1QUJ A;  4WEP A;  3MW0 A;  3EHS A;  3MZ9 A;  4MF3 A;  5A5X B;  4JSD A;  3M3L A;  2F97 A;  4Q8R A;  3C4M A;  2F6P A;  2Z22 A;  1Y1M A;  1AOV A;  3IO6 A;  1Y3Q A;  3MVZ A;  4O3B A;  1OLA A;  4FEC A;  1H43 A;  3G3J A;  4JDF A;  1TXF A;  2IEE A;  1P1O A;  5I56 A;  1JW1 A;  4ZDM A;  1B5J A;  2F8D A;  2B65 A;  3K4U A;  4G68 B;  3FVK A;  2F34 A;  5KDT B;  4IO7 A;  4I1D A;  3G7W A;  1Z7M E;  4R9F A;  3FZV A;  3UIF A;  1FTM A;  3EN3 A;  4YAH X;  2XD2 A;  3PUV E;  4XXU A;  5L9O A;  1B6H A;  1ZBM A;  4BDN A;  1RYX A;  3RLF E;  2I4C A;  2PMS A;  4GWO A;  4RA1 A;  3KEI A;  4NF5 B;  3A3U A;  1ZKB A;  1Z7N E;  5IKB A;  4RY1 A;  2REJ A;  3UA8 A;  4YZZ A;  2XX7 A;  4POW A;  5CM6 A;  1D9V A;  4XKP A;  2REG A;  2FNC A;  1WOD A;  4RYA A;  4IO3 A;  4F31 B;  2DWJ A;  4DE8 A;  2X7Q A;  3EHU A;  4FED A;  3UK4 A;  2R71 A;  3MBP A;  3M8U A;  4X48 A;  4YKP A;  1JW4 A;  3SEV A;  4ELO A;  2O1L A;  1N04 A;  1URS A;  4BDL A;  4ESX A;  3HO7 A;  2DXR A;  2VOZ A;  4N13 A;  4KFQ A;  1DTZ A;  3C32 A;  1LST A;  2O6A A;  1N7W A;  5J1D A;  4WED A;  1FQE A;  4Q30 B;  1OMP A;  5FTI A;  4F2Q A;  3MPL A;  4FOR A;  2QSX A;  2B3B A;  2OCU A;  3K02 A;  2HZK A;  3THI A;  3PPN A;  4ZEC A;  5AA2 B;  3OSR A;  2QRY A;  3CFX A;  5TP9 A;  2PT2 A;  3FVO A;  1NMU A;  3HPI A;  1LCT A;  3H7M A;  4EQ7 A;  4I62 A;  4L17 A;  3PUZ E;  2R6G E;  3PD8 A;  4OQO A;  5TPA A;  2O1M A;  4AQ4 A;  5I58 A;  4LQ5 A;  3PU5 A;  2F7C A;  3PUY E;  4JWO A;  3LBS A;  2D3I A;  1B3L A;  4F39 A;  2HEU A;  1P1W A;  3TYH A;  3OO9 A;  1P1N A;  3N26 A;  5H8F A;  3DEL B;  2WKY A;  4JB7 A;  1B3F A;  1LBC A;  1OVT A;  2M8C A;  1VR5 A;  1LAH E;  1Q35 A;  5FHM A;  2YLN A;  2P1S A;  4ELQ A;  2F6G A;  4G8H A;  4MLV A;  5KZT A;  2LAO A;  1MQH A;  2XXX A;  1RKM A;  1B4H A;  4G4P A;  4G68 A;  1OVB A;  3FJ7 A;  4FAJ A;  4YKI A;  5KDT A;  2OZZ A;  1IXH A;  1XVX A;  1B3H A;  3H3G A;  2FA7 A;  3ZKK A;  3TQL A;  1UIU A;  1XC1 A;  2O51 A;  3GBB A;  2XXR A;  5CBR A;  1B1X A;  4FE8 A;  2ZYO A;  3KJT A;  4OFL A;  4ZE8 A;  5FTH A;  4KCD A;  2VD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...