3A3UA

Crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
270
structure length
270
Chain Sequence
ALRLGFSPCPNDTFIFYALVHGRVESPVPLEPVLEDVETLNRWALEGRLPLTKLSYAAYAQVRDRYVALRSGGALGRGVGPLVVARGPLQALEGLRVAVPGRHTTAYFLLSLYAQGFVPVEVRYDRILPMVAQGEVEAGLIIHESRFTYPRYGLVQVVDLGAWWEERTGLPLPLGAILARRDLGEGLIRALDEAVRRSVAYALAHPEEALDYMRAHAQELSDEVIWAHVHTYVNAFSLDVGEEGERAVARLFAEAEARGLAAPSPRPLFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Menaquinone biosynthetic enzyme
publication title Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 95
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02621 VitK2_biosynth Menaquinone biosynthesis
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3a3uA02
4RPNA 3OOAA 4WXJA 2HEUA 3IO6A 2OWSA 4JB7A 2F8DA 3VVDA 1XHYA 1IXHA 2CMOA 5EHSA 5J1DA 1B3HA 3IJOB 4U1OA 3IOWA 4ESXA 5JK4A 3TCGA 4IO7A 1J1NA 3ILUB 2O68A 3U72A 2UVIA 4H8IA 1I6QA 1D9YA 2ALUA 1Y3NA 4G8MA 4LQ2A 2QSXA 1A40A 1FCKA 1P1WA 4U22A 5A5XA 3JYRA 3ZS6A 1SQYA 4EQ7A 2D21A 3VVEA 3FJMA 3K00A 3O2AA 4ZZAA 1OMPA 3RGYA 1Y1ZA 4H6DA 4YMBA 3RTFB 4RK2A 1Y3QA 1FTJA 1HSJA 3K6VA 4ZDMA 5EHMA 3HN0A 4OESA 5I2KA 3KFMA 4YMAA 3IL1B 3LSFB 4LONB 2DYXA 3FIRA 4N6PA 4U1ZA 1DPEA 4C0RA 2UYEA 3I6VA 4FECA 2DWJA 4OEUA 3MW0A 1B3GA 4MLVA 3I5OA 3H6WA 4F3SA 2G29A 4NTLA 4C1UA 3V83A 1IITA 5H8QB 3T93B 2IEEA 1N04A 5CI5A 4Z7EA 4G8NA 5TPAA 1TFAA 2F7CA 3H4ZA 3JZJA 2FYIA 2XD2A 4DXCA 3CFLA 3LSWA 3U93A 4IGRA 1QKAA 1O63A 3FGSA 4EF1A 3L6HA 4O3BA 2H4IA 1SD3A 3MP6A 4ECFA 1MXZA 1AL3A 4PE5B 1P1QA 3Q28A 3CFXA 3SEYA 2I0CA 3BFUA 2QMXA 3O66A 1Z7NE 4NF8A 4PQJA 3IOUA 3PUYE 2Q2CA 3A09A 1H76A 4QFNA 3S2VA 5HBCA 2G93A 1VE4A 4KR5A 3PPQA 3E3KA 4ELRA 3RQTA 1MM7A 1UIVA 4RYAA 1B1XA 2RF1A 1LAFE 3O29A 4E0XA 1A54A 1II5A 4NF6B 3PUWE 3B7DA 2PT1A 2W7YA 5KCJB 4RNSA 2B3BA 2NWJA 2Q8JA 2RC8A 3SETA 1UQWA 1Y1MA 2F78A 1JEVA 3TDJA 1JQFA 1FTMA 1OIBA 1XC1A 1NNPA 1NNTA 1B7HA 3L6GA 4EXKA 3TYHA 1B3EA 1NMUA 3VLUA 4DXUA 2I0BA 1B0LA 2QS2A 4X1DA 4BDNA 3UORA 4KCDA 1GTKA 4OWDA 4R6YA 1H3DA 3KJ7A 3PUVE 4IGTA 2ZXTA 3GLBA 5AA1A 2V25A 3DLNA 2A5TB 3R6UA 5L9MA 2DVCA 1SW5A 2REJA 5CC2A 1P1UA 4LA9A 3OELA 4OZ9A 2ZNUA 4QSDA 3G7WA 4AQ4A 4K3FA 2F5XA 3OO6A 1UTBB 4Q30B 3HHGA 3O9PA 1OVBA 1WDNA 2XX7A 5I58A 3U92A 5I2NA 1LAXA 4P0IA 4ZE8A 2PVUA 1Z7ME 3HO7A 4G4PA 2FNCA 4UACA 4EF2A 1B7UA 1S50A 3TELA 3CRBA 2DQVA 3MPLA 1US5A 1YTVA 3BKIB 4IY6A 4QFKA 4ZECA 1Q1KA 3RY3A 2F97A 3FZVA 4QFLA 2ZMBA 1AH5A 1BP5A 1QKBA 1I6BA 3RUMA 2HCAA 3MZBA 1LLSA 2AIXA 3FATA 3LSXA 1IIWA 1FQBA 4XIGQ 3DP4A 2AYSA 2O84X 3HSTA 4H5FA 3PMXA 3V5AA 2HQ0A 3IX1A 3OEMA 4HCWA 3TFLA 2F6PA 4YKJA 3W15C 1NH8A 4NF5A 4FEBA 2HXWA 2XXIA 3TCFA 1P1OA 2H5YA 2ZNSA 3TZAA 3S4UA 2QMWA 1H43A 1VFEA 2A5SA 3O97A 1QULA 4G68C 5AA4B 3EN3A 4R73A 4TLLB 4C1TA 2OJTA 3R7XA 3T9UA 3VLVA 1MPBA 4O3CA 4OYVA 3H06B 2H9BA 3K1NA 3H03A 1US4A 3RPWA 4KPTA 5CMCA 1H44A 4IB2A 4KYEA 4F2OA 1CE2A 3TTRA 4FATA 3SESA 4QHQA 5F1QA 3KOSA 3TTLA 3OMBA 3ECRA 4AB6A 4N07A 3C32A 5KDTB 3KN8A 3LR1A 3TCHA 4F29A 1IEJA 3KN7A 1S7YA 1N0TA 4XKQA 5TP9B 1ANFA 3FJ7A 1PB8A 3H6VA 3CI8A 3G3IA 1TT1A 4LUBA 5CBSA 1MY0A 1B52A 3TUSA 2F7AA 4H65A 2F6GA 1O7TA 1ZBMA 2VD2A 1DOTA 4GXAA 2OZZA 2RC9A 1QUKA 4U23A 1RYXA 4YKIA 3TMGA 1POY1 3QAXA 5F7VA 1T0KA 4THIA 3MP1A 5CBRA 3VFJA 5CM6A 1BTJA 3IK6B 3MAMA 1MQHA 2ONSA 1EU8A 3FV1A 3K01A 1R1NA 2DOJA 1BIYA 2XX8A 4O3AA 5ITOA 1DTZA 4H8JA 2F7BA 1URGA 3H6TA 3IR1A 2Q9TA 4XTCQ 3M3LA 4Q5TA 4FIMA 3SEXA 5EYFA 2DSFA 3PU5A 2QS1A 1NL5A 2NUVA 1P1NA 2F35A 5IKBA 1AMFA 5I59B 1SW1A 1FQFA 1UTHB 4JXIA 3AXFA 1SW2A 3K6UA 2XHDA 4JDFA 3OEKA 5IAIA 3H6UA 3LBSA 1B6HA 4P11A 4R6KA 4E0WA 1YAEA 4ZEFA 1M5EA 4ZE9A 5L8DA 4GD5A 1LAGE 3EHTA 3MVXA 3A3UA 5H8QA 5K2XA 1Y4TA 5AA2B 1QW0A 3IORA 1QUJA 1GVCA 1B4ZA 4R9FA 3QUJA 1JVYA 2HFBA 3K6WA 3T22A 4GFRA 2O1MA 3UA8A 3S9MC 4GF8A 2HAVA 3DP8A 3PPOA 1S9TA 2H99A 3PPPA 3GBAA 2VOZA 4RXLA 5JTYB 2AL4A 1HSLA 2ONRA 1ZMGA 2WKYA 1EH3A 1MS7A 2GH9A 2DE4A 2Z8FA 4KYSA 1URSA 1A55A 2RCBA 1OQHA 2Z22A 4GRKA 2UVHA 5DTBA 4NF6A 2XX9A 5KCJA 4GLIA 1B51A 1TXFA 3RNNA 4EUOA 1LSTA 3S9LC 1B7ZA 1PEBA 5H8FB 3P7IA 1OVTA 1MQDA 2UYFA 3SKPA 3C35A 3FVNA 3UK4A 4IO6A 4JSOA 3K1PA 3E4RA 5DVFA 1I69A 3C4MA 1OQGA 3WAEA 5FHMA 3K2DA 4I9DA 4F19A 1B46A 3BBRA 2A5TA 4R72A 1ZIUA 2Z8DA 1B3FA 1PB9A 4OMBA 5CRYA 3B6TA 3VXCA 2UXAA 4DLDA 4KCCA 5I57B 1MH4A 3ZKLA 4YKKA 1VSOA 5DYHA 1B58A 1UTBA 4RY1A 4QRZA 5DEXB 1F9BA 5DT6A 1LCTA 2ZNTA 2VP1A 2I6EA 3UGWA 4KI0E 4WEPA 1MXVA 3PGFA 3IOTA 2RINA 5FHOA 1DTGA 2ABHA 1ZU0A 4EDPA 2I4CA 3N6TA 4HW8A 3OO7A 1LB9A 1SI1A 1LBCA 3QUFA 5ICQA 2QRYA 5DVJA 2R71A 1OLAA 2OK2A 3IB1A 3EHSA 1N76A 2V84A 4QF9A 1PDAA 5DVIA 1QJMA 4DE8A 4U4SA 2I48A 3EHUA 1JNFA 2XXYA 1D3KA 1YCJA 5HPQA 4WEDA 3QSLA 4IY5A 3LSLA 2Z8EA 4XXUA 3M8UA 4OQOA 3G3JA 2RC7A 3N26A 1MDP1 2OWTA 4F31B 4NE4A 2BJJX 4Z0IA 2O51A 3TTKA 3W9WA 1SI0A 4ONYA 3QIMA 3CSGA 4DCXA 2DWAA 4X1BA 2RKMA 1P99A 1B5IA 4G2ZA 4H0WA 3MBPA 3FJGA 2YLNA 3TTNA 1SBPA 4R2FA 2P1SA 3CIJA 3V8XB 2IA4A 4RK9A 1NNFA 4R2BA 5AA4A 4I62A 3OSRA 4MBPA 4GXSB 3FVGA 2HAUA 4OVJA 3E9XA 4LP2B 2GRVA 5I56B 4MLQA 3S9EA 1B5HA 1SYIA 4NF4B 3BFTA 4ZZEA 3IO4A 3SEUA 4LATA 5ICTA 1ZKBA 2ANJA 3OSQA 3TKDA 1RYOA 4GWOA 2CZLA 4M1VA 3T9VA 5BUUA 3KSJA 3KBRA 3TTMA 4YICA 4F3BA 2NOOA 3VXBA 2QL3A 1D9VA 5KDTA 1MXYA 4TOZA 5FHNA 5TP9A 4EQBA 2I49A 4R6HA 3KN3A 1SVXB 1USYH 4IO2A 3H7MA 2F36A 1YPNA 4OFJA 3FD3A 5L9SA 2KLFA 2QS3A 4MH5A 5CMMA 2HZKA 1LBBA 1JVXA 2UVJA 4BDQA 2I3VA 1MQGA 4TQUQ 2Y7WA 4ISUA 3OXNA 3PUZE 1A8FA 4EXLA 2V3TA 3TPAA 2OLBA 2Z23A 3T9XB 4HTGA 4F3PA 2XXHA 4PETA 3U8QA 4F3GA 4DIGA 1FQEA 3WAFA 2ZYMA 3VDFA 1XOCA 2ZYKA 1M5BA 5I59A 2H98A 1UTHA 2DWIA 2O1LA 3E13X 4G8HA 2Y7KA 3W9VA 4KD5A 5ITPA 3TAJA 4PFTA 4X48A 2OCUA 1ZLQA 4ELPA 3IB2A 4I1DA 3O6HA 3G3KA 2VGQA 1N3XA 3FXRA 1B1HA 4U2RA 2Q89A 4H1XA 5ISUA 3FV2A 3RT8A 5AA2A 4DDDA 1H45A 2YPNA 2I4BA 1I6AA 2ONKE 1URDA 1WODA 1KWHA 1PC3A 3LUYA 1VR5A 2H25A 1EZPA 1B0HA 1PBQA 4M4GA 4YU0A 4GL8A 4IO5A 4OFOA 3N94A 2Q2AA 1MQIA 1B4HA 1B40A 2XXUA 4YAHX 5JTYA 2Y84A 3B6WA 3N6UA 4F39A 3C36A 3UP9A 4BDMA 1FQCA 3MVZA 3PMVA 2PX1A 2DE2A 4OHNA 4NWDA 1B5JA 4XKNA 1GGGA 4G77A 3Q27A 2XXRA 1LGBC 3C9HA 3MVWA 1MY2A 3CFZA 3Q26A 3SEVA 4GOTA 3DELB 4JBZA 3HPIA 3O28A 4G68B 4R74A 3ZKKA 4QSEA 3D4GA 1M5CA 4JWXA 5H8HB 2THIA 2XXWA 3EQ1A 4LZ5A 5H8FA 1MH3A 5H8NB 3RLFE 2XXTA 2DWHA 1Y4CA 1NNKA 2GHBA 1FTLA 2DE3A 1WVJA 3KZGA 3I3VA 1VFDA 4QFPA 4MF3A 3MUQA 1Y3PA 3TEPA 4DZ1A 1Y20A 4F18A 4N13A 1DMBA 2I3WA 4OERA 4QSCA 1UIUA 4QFOA 1MXXA 3EF7A 5I57A 5L9OA 1MRPA 4RA1A 3VLWA 3KG2A 4OXVA 1N7WA 2QPQA 3K6XA 2Y7IA 5DEXA 3S9NC 1MY4A 1FTKA 2DXRA 4NWCA 1MDQA 5CMKA 5FTHA 4OEVA 4Q0CA 1FTOA 2DXYA 1PBPA 3TODA 1NH7A 5CMBA 4KHZE 1MY1A 3USDA 3OO8A 4FJPA 4YB7A 1QVSA 4KQPA 2B65A 3PMWA 4GL0A 4BLAA 3K0VA 3Q29A 1DPPA 3MZ1A 4AB5A 4KYDA 3MPKA 1JW1A 1MPDA 2D5WA 3MQ9A 2I58A 5AA3A 1A8EA 3CG3A 1IXIA 1ATGA 1M5DA 4ELQA 1A99A 5HM4B 1XT8A 3PUXE 4ZS9A 1XVXA 4FE8A 4F1UA 3F11A 1HSEA 2OBGA 2AL5A 3C34A 3KEIA 1BKAA 2QS4A 2XD3A 4JSDA 2XXXA 3ZSFA 3FUZA 1JW4A 3PPNA 1TFDA 1B2HA 2YJPA 2QJEA 3FVKA 5M2VA 4DCYA 4X9TA 4XKPA 3M3KA 2E0SA 3G3HA 4POWA 4NMYA 4XKRA 3RN8A 5K2YA 4H67A 1CB6A 3A3CA 2E1SA 1IUDA 1AOVA 4ZEIA 1JEUA 3OD7A 3SERA 3OO9A 1RKMA 1R6ZA 3ILTB 4MFIA 2PMSA 1MM6A 1LFHA 2DS9A 1MQJA 5BWJA 2XXQA 1JETA 3T96B 2LAOA 3UIFA 3HHFA 5A5XB 3RTWB 3IAZA 3RT6B 5I56A 1LAHE 1B9JA 4NF4A 4GQOA 1ZJLA 3PD8A 3K1MA 1EZ9A 4F1VA 4LVQA 1XS5A 3N5LA 4OETA 1MXUA 5I2KB 3FASA 1GR2A 1SDXA 4FORA 2P0SA 3GZGA 4ELOA 4UA8A 2M8CA 2PYYA 3GXAA 4PFUA 3T66A 2FA7A 4RPOA 1A7LA 2Y7PA 3MP8A 4IO4A 3GBBA 4BDRA 3JV9A 4ND9A 1R9LA 3QYTA 1B3LA 1B05A 1IXGA 3G3FA 4LQ5A 3TQLA 5TPAB 5H8SA 4TLMB 4L17A 4PFYA 3MZ9A 2GFEA 5KZTA 1ELJA 4OFLA 3OENA 2ZYNA 4ZEBA 4HCYA 4BDOA 2PBWA 1OLCA 1USYE 2Q88A 5FTIA 2R6GE 1N7XA 2DP8A 4NF8B 4YB6A 4YKPA 3R26A 5ELVA 3TQWA 3FXQA 2NXOA 3ONMA 1FQDA 4FEDA 4YB5A 2UVGA 4U4XA 2VD3A 3IB0A 1TWYA 4BDLA 1Y9UA 1FQAA 4I8CA 3C31A 5B70A 1MPCA 2NVUB 3M3FA 3QK6A 3CSBA 2P2AA 1LFIA 3IOVA 2ZYOA 4RJZA 1SW4A 5TU0A 2O6AA 3PPRA 4H5GA 3ODBA 1LB8A 3MVYA 2B3FA 2V3QA 3D4CA 4ESWA 2X7PA 3DP6A 3C33A 3FVOA 3KJTA 4LZ8A 2DVZA 5AE4A 1R9QA 1LFGA 4EQ9A 3CR9A 3HV1A 3THIA 2R9JA 3SDFA 1EZOA 4OENA 1ZTYA 5LOMA 1IZ1A 2RCAA 3SEWA 3G3GA 1Q35A 4Q8RA 2PT2A 3MC2A 3H3GA 4YZZA 1FW0A 3VVFA 3CVGA 1POTA 1IXCA 4GIZA 4NEDA 3UN6A 3PV0E 1XVYA 3DM0A 4OTEA 3Q25A 2V3UA 4KFQA 4ZEDA 4IO3A 1N3WA 1D4NA 4G68A 5I58B 2X26A 3HCQA 5I2NB 4F1YA 2VHAA 5H8HA 2X7QA 1GV8A 1B32A 3EPEA 1MXWA 2V93A 1DSNA 5H8NA 3KOTA 2XXVA 3O6IA 3KSXA 1N84A 2GHAA 3B6QA 1L5TA 3U1OA 1SYHA 3U94A 3O6GA 5JEIA 2O7IA 1MY3A 2ESNA 5I84A 4GVOA 4FAJA 4R75A 3MWBA 3PD9A 3KGCA 4LZ7A 3K02A 4U21A 2O69A 5B7DA 4HS7A 4JWYA 4WKMA 1QUIA 5AA2D 3V89B 2REGA 2F34A 4R9GA 3VE1B 3CG1A 1NFTA 4NF5B 4ZEKA 3VV5A 2HZLA 1O64A 2Y7RA 4DXBA 1NKXA 1M5FA 4PFWA 4POXA 1PB7A 1BLFA 4JWOA 1IQ7A 1JW5A 3FXUA 2O7UA 2XXPA 3QXMA 1AIVA 1LCFA 3K4UA 4F2QA 3T9HB 4P0GA 3LC8A 1MG1A 3MJNA 4F22A 4PP0A 3IJXB 2D3IA
chains in the Genus database with same CATH superfamily
4RPNA 3OOAA 3FBPA 4WXJA 2HEUA 3IO6A 2OWSA 1NUYA 4JB7A 2F8DA 3VVDA 1XHYA 1IXHA 2CMOA 5EHSA 4MJOA 5J1DA 1B3HA 3IJOB 4U1OA 1NV4A 3IOWA 4ESXA 4OVQA 5JK4A 3TCGA 4IO7A 1FPBA 5EQ9A 1DCUA 1J1NA 4H45A 3ILUB 2O68A 3U72A 2UVIA 4H8IA 1I6QA 1D9YA 1FBGA 2ALUA 1Y3NA 2FHYA 4G8MA 4LQ2A 2CZIA 2QSXA 1A40A 1FCKA 1P1WA 4U22A 5A5XA 3JYRA 3ZS6A 1SQYA 4EQ7A 2D21A 3VVEA 3FJMA 3K00A 3O2AA 4LN5A 4ZZAA 1OMPA 3RGYA 1Y1ZA 4H6DA 1RDXA 5ET5A 4YMBA 3RTFB 3IFCA 4RK2A 1Y3QA 1FTJA 1HSJA 3K6VA 4ZDMA 5EHMA 1NV3A 3HN0A 4OESA 5I2KA 3KFMA 1INPA 2DDKA 4YMAA 3IL1B 3LSFB 2PFZA 4LONB 2DYXA 3FIRA 4OVSA 4N6PA 4U1ZA 1KA0A 1DPEA 3RYDA 4C0RA 2UYEA 2PFYA 5IM2A 3I6VA 4FECA 2DWJA 4OEUA 3MW0A 2KQZA 1B3GA 4MLVA 3I5OA 3H6WA 4F3SA 2G29A 4NTLA 4C1UA 3V83A 1IITA 5H8QB 3T93B 2IEEA 1N04A 5CI5A 4Z7EA 4G8NA 5TPAA 1TFAA 4PF6A 2F7CA 3H4ZA 3JZJA 2FYIA 2XD2A 4DXCA 3CFLA 3LSWA 3U93A 4IGRA 1QKAA 1O63A 3FGSA 4EF1A 3L6HA 4O3BA 3ISPA 2H4IA 1SD3A 4NQ8A 4N91A 3MP6A 4ECFA 1MXZA 1AL3A 4PE5B 4I3EA 1P1QA 3Q28A 3CFXA 3SEYA 2I0CA 3BFUA 2QMXA 3O66A 1Z7NE 4NF8A 4PQJA 3IOUA 3PUYE 4GBWA 2Q2CA 3A09A 2QVRA 1H76A 4QFNA 3S2VA 5HBCA 2JJKA 2G93A 1VE4A 4KR5A 3NOHA 3PPQA 3E3KA 4ELRA 3RQTA 1MM7A 1UIVA 4RYAA 4I3YA 1B1XA 2RF1A 1LAFE 2B4MA 3O29A 2FVZA 4E0XA 1A54A 1II5A 4NF6B 3PUWE 3B7DA 2PT1A 1RDYA 4OVRA 2W7YA 5KCJB 4RNSA 2B3BA 2NWJA 2Q8JA 2OWZA 2RC8A 1UQWA 1Y1MA 2F78A 3SETA 1JEVA 3TDJA 1JQFA 1FTMA 1OIBA 1XC1A 1NNPA 1NNTA 1B7HA 3L6GA 4EXKA 3TYHA 3KBZA 1B3EA 1NMUA 1NV2A 3VLUA 4DXUA 1FBEA 2I0BA 3HFUA 1B0LA 2QS2A 4X1DA 4BDNA 3UORA 4KCDA 3T1BA 1GTKA 4OWDA 4R6YA 4DI3D 1H3DA 3KJ7A 3PUVE 4IGTA 2ZXTA 5IZ1A 3GLBA 5AA1A 2V25A 3DLNA 2A5TB 3R6UA 5L9MA 2DVCA 1JP4A 1SW5A 2REJA 5CC2A 1P1UA 4LA9A 3OELA 4OZ9A 2ZNUA 4QSDA 3G7WA 4AQ4A 1NV0A 4K3FA 2F5XA 3OO6A 1NI9A 1UTBB 4Q30B 2WX9A 3HHGA 3O9PA 1OVBA 3KC0A 1WDNA 1FJ9A 2XX7A 5I58A 3U92A 1IMAA 5I2NA 1LAXA 2QVUA 4P0IA 4ZE8A 2PVUA 1Z7ME 3HO7A 4G4PA 4KXPA 3RPLA 2FNCA 1KA1A 4OVPA 4UACA 4EF2A 5I3SA 4GWYA 1B7UA 1BK4A 1S50A 3TELA 3CRBA 1FPJA 2DQVA 3MPLA 1US5A 1YTVA 1G0IA 3BKIB 4IY6A 4QFKA 4ZECA 2VT5A 4HXVA 1Q1KA 1D9QA 4GWUA 3RY3A 2F97A 2FIEA 3FZVA 4QFLA 2ZMBA 1AH5A 1BP5A 1QKBA 1I6BA 3RUMA 2HCAA 3MZBA 1LLSA 2AIXA 4NHBA 3FATA 3LSXA 1IIWA 1FBCA 1FQBA 4XIGQ 3DP4A 2AYSA 5DW8A 2O84X 1FPEA 4PCDA 3HSTA 4H5FA 3QMFA 3PMXA 3V5AA 2HQ0A 3IX1A 3OEMA 4HCWA 3TFLA 2F6PA 2Q74A 4YKJA 3W15C 2KR0A 1NH8A 3MSTA 4NF5A 4FEBA 2HXWA 1DK4A 2XXIA 5T3JA 3TCFA 1P1OA 2H5YA 2ZNSA 3TZAA 3S4UA 2QMWA 1H43A 1VFEA 2A5SA 3O97A 1QULA 4G68C 5AA4B 3EN3A 4R73A 4TLLB 4C1TA 2OJTA 3R7XA 1YZ0A 3T9UA 3VLVA 1MPBA 4PE3A 5EQAA 4O3CA 4OYVA 3H06B 2H9BA 3K1NA 3H03A 1US4A 3RPWA 4KPTA 5CMCA 1H44A 4IB2A 4KYEA 4F2OA 1CE2A 3TTRA 4FATA 3SESA 4QHQA 5F1QA 2QVVA 3KOSA 3TTLA 4JVIA 3OMBA 3ECRA 4AB6A 4N07A 3C32A 5KDTB 3KN8A 3LR1A 3TCHA 4F29A 1IEJA 3KN7A 1S7YA 1N0TA 4XKQA 5TP9B 1ANFA 3FJ7A 4GX6A 1PB8A 1QGXA 3H6VA 1NUZA 3CI8A 3G3IA 4NGUA 1TT1A 4MHFA 4LUBA 1FPLA 5CBSA 1MY0A 1B52A 3TUSA 2F7AA 4H65A 2F6GA 1O7TA 1ZBMA 2VD2A 1DOTA 4GXAA 2OZZA 2RC9A 1QUKA 4U23A 1RYXA 4YKIA 3TMGA 1POY1 3QAXA 5F7VA 4AS5A 1T0KA 4THIA 3MP1A 5CBRA 3VFJA 5CM6A 1BTJA 4MMPA 3IK6B 2L5VA 3MAMA 1MQHA 2ONSA 1EU8A 3FV1A 3K01A 1R1NA 2DOJA 1BIYA 2XX8A 4O3AA 5ITOA 1DTZA 4H8JA 2F7BA 1URGA 3H6TA 3IR1A 2Q9TA 4PAIA 4XTCQ 3M3LA 4Q5TA 4FIMA 3SEXA 5EYFA 2DSFA 3PU5A 2QS1A 1NL5A 2NUVA 1P1NA 2F35A 5IKBA 1AMFA 5I59B 1SW1A 1FQFA 1UTHB 4JXIA 3AXFA 1SW2A 3K6UA 2XHDA 4JDFA 3OEKA 5IAIA 3H6UA 3LBSA 1B6HA 4PC9A 4P11A 4R6KA 5EQ8A 4E0WA 4MCOA 1YAEA 4MIJA 4ZEFA 1M5EA 4ZE9A 5L8DA 1FPIA 4GD5A 1LAGE 3EHTA 3MVXA 3A3UA 5H8QA 5K2XA 1Y4TA 4PGNA 5AA2B 1QW0A 3IORA 1QUJA 1GVCA 1B4ZA 4R9FA 3B8BA 3QUJA 1JVYA 2HFBA 3K6WA 3T22A 4GFRA 2O1MA 3UA8A 5EYHA 3S9MC 4GF8A 3IFAA 2HAVA 3DP8A 3PPOA 1S9TA 2H99A 3PPPA 1LBVA 3GBAA 4MX6A 2VOZA 3E79A 4RXLA 5JTYB 2AL4A 4PFBA 3PTYA 1HSLA 2ONRA 1ZMGA 2WKYA 1EH3A 1MS7A 2GH9A 2DE4A 2CZHA 2Z8FA 4KYSA 1URSA 4DI4B 4P56A 1A55A 2RCBA 1OQHA 4NF0A 2Z22A 4GRKA 2UVHA 5DTBA 4NF6A 2ZZXA 2XX9A 5KCJA 4GLIA 1B51A 1TXFA 3RNNA 4EUOA 1LSTA 3S9LC 1B7ZA 1PEBA 5H8FB 3P7IA 1OVTA 2Y5LA 1MQDA 2UYFA 2QFLA 3SKPA 3C35A 2V4CA 3FVNA 4P9KA 3UK4A 4IO6A 4JSOA 3K1PA 3E4RA 5DVFA 1I69A 3C4MA 1OQGA 3WAEA 5FHMA 3K2DA 4I9DA 4X8RA 4F19A 1B46A 3BBRA 4R72A 2A5TA 1ZIUA 4MNPA 2Z8DA 1B3FA 1PB9A 4OMBA 5CRYA 3B6TA 3VXCA 2UXAA 5I7IA 4DLDA 4KCCA 5I57B 1MH4A 3ZKLA 1FPGA 4H46A 4YKKA 1VSOA 5DYHA 1B58A 4PDHA 5EYGA 1UTBA 3U65A 4RY1A 4QRZA 5DEXB 1F9BA 5DT6A 1LCTA 2ZNTA 4GX3A 2CEYA 2VP1A 2I6EA 3UGWA 1FJ6A 1FPKA 4G61A 4KI0E 4WEPA 1MXVA 3PGFA 3IOTA 2RINA 5FHOA 1DTGA 2ABHA 1ZU0A 4EDPA 2I4CA 3N6TA 4HW8A 3OO7A 1LB9A 1SI1A 1LBCA 4P3LA 3QUFA 2HPGA 5ICQA 2QRYA 5DVJA 2R71A 1OLAA 2OK2A 3IB1A 3EHSA 4GBVA 1N76A 2V84A 4QF9A 1PDAA 5DVIA 1QJMA 4DE8A 4U4SA 2I48A 2CEXA 3EHUA 1JNFA 1XI6A 2XXYA 1D3KA 1YCJA 1LEVA 2P3VA 5HPQA 4WEDA 3QSLA 4IY5A 3LSLA 2Z8EA 4XXUA 3M8UA 4OQOA 4N17A 4PAFA 3G3JA 2RC7A 3N26A 1MDP1 1IMFA 2OWTA 4F31B 4NE4A 2BJJX 4Z0IA 2O51A 3TTKA 3W9WA 1SI0A 4N15A 4ONYA 3QIMA 3CSGA 4DCXA 1K9ZA 2DWAA 4X1BA 2RKMA 1P99A 1B5IA 4G2ZA 4H0WA 4HE1A 3MBPA 3FJGA 2YLNA 3TTNA 1SBPA 4R2FA 2P1SA 3CIJA 3V8XB 2IA4A 4RK9A 1NNFA 4R2BA 5AA4A 4I62A 3OSRA 4MBPA 2MKZA 4GXSB 3FVGA 2HAUA 1EYKA 4X04A 4OVJA 3E9XA 4LP2B 2GRVA 2XWIA 5I56B 4MLQA 3S9EA 1B5HA 1SYIA 2Y5KA 4NF4B 3BFTA 4ZZEA 3IO4A 3SEUA 4LATA 5ICTA 1ZKBA 2ANJA 3OSQA 3TKDA 1RYOA 4GWOA 2CZLA 4M1VA 3T9VA 5BUUA 3KSJA 3KBRA 3TTMA 4YICA 4F3BA 2NOOA 3VXBA 2QL3A 1D9VA 5KDTA 1MXYA 4TOZA 5FHNA 2VPOA 4AS4A 5TP9A 4EQBA 2I49A 3B50A 4R6HA 3KN3A 1SVXB 1USYH 3SZPA 4IO2A 3H7MA 2F36A 1LBXA 1YPNA 1FBFA 4OFJA 3FD3A 5L9SA 1FPFA 2KLFA 2QS3A 4MH5A 5CMMA 2HZKA 1LBBA 1JVXA 2UVJA 4BDQA 4JVDA 2I3VA 2XWKA 1MQGA 4TQUQ 2Y7WA 4ISUA 3OXNA 2XWVA 4XFEA 5ET7A 3PUZE 1LBYA 1A8FA 4EXLA 2V3TA 3TPAA 4N6KA 4PFIA 2OLBA 2Z23A 3T9XB 5FBPA 4HTGA 5IGAA 4F3PA 2XXHA 4PETA 3U8QA 4F3GA 4DIGA 1FQEA 3WAFA 2ZYMA 3VDFA 1XOCA 2WEFA 2ZYKA 3KC1A 1LBWA 4N4UA 1M5BA 4PFRA 5I59A 2H98A 1UTHA 4GWWA 2DWIA 5IZZA 2O1LA 3E13X 4G8HA 2Y7KA 2HHMA 3W9VA 4KD5A 5ITPA 3TAJA 4PFTA 4X48A 2OCUA 1ZLQA 4UABA 4ELPA 2FBPA 3IB2A 4I1DA 3O6HA 3G3KA 2VGQA 1N3XA 3FXRA 1B1HA 4U2RA 1IMCA 2Q89A 4H1XA 5ISUA 3FV2A 3RT8A 5AA2A 4DDDA 1H45A 2YPNA 2I4BA 1FPDA 1I6AA 2ONKE 1URDA 1WODA 1KWHA 1PC3A 4HE2A 3LUYA 1VR5A 2R8TA 2H25A 1EZPA 1B0HA 1PBQA 4M4GA 4YU0A 2CZKA 4GL8A 4IO5A 4OFOA 3N94A 2Q2AA 1MQIA 1B4HA 1B40A 1YYZA 2XXUA 4YAHX 5JTYA 1NUXA 2Y84A 3B6WA 3N6UA 4F39A 3C36A 3UP9A 4P8BA 4BDMA 1FQCA 3MVZA 4NN3A 3PMVA 4PGPA 2PX1A 2DE2A 4OHNA 3CHGA 4NWDA 1B5JA 4XEQA 4XKNA 1GGGA 4G77A 3Q27A 2XXRA 1LGBC 3C9HA 3MVWA 1MY2A 3CFZA 5ET6A 2GQ1A 3Q26A 3SEVA 4GOTA 3DELB 4JBZA 3LV0A 3HPIA 3O28A 4G68B 4R74A 3ZKKA 4QSEA 3E78A 3D4GA 1M5CA 4N81A 1EYJA 4JWXA 5H8HB 2THIA 2XXWA 4MNIA 3EQ1A 4LZ5A 5H8FA 1MH3A 5H8NB 3RLFE 2XXTA 2DWHA 1Y4CA 1NV1A 5EQ7A 4PDDA 1NNKA 2GHBA 5A5LA 1FTLA 2DE3A 1WVJA 1LBZA 3KZGA 3I3VA 1VFDA 4QFPA 4P1LA 2F3BA 4MF3A 3MUQA 1Y3PA 3TEPA 4DZ1A 1Y20A 4F18A 4N13A 1DMBA 2I3WA 4OERA 4QSCA 1UIUA 4QFOA 1MXXA 3EF7A 5I57A 5L9OA 1FTAA 3A29A 1MRPA 4RA1A 3VLWA 3KG2A 4OXVA 1N7WA 2QPQA 3K6XA 4MEVA 2Y7IA 5DEXA 4QXDA 3S9NC 1MY4A 1FTKA 2DXRA 4NWCA 3MYUA 1MDQA 5CMKA 5FTHA 4Q0CA 4OEVA 1FTOA 5ET8A 2DXYA 1PBPA 3TODA 1NV5A 1NH7A 5CMBA 4KHZE 1MY1A 2P3NA 3USDA 3OO8A 4FJPA 4YB7A 1QVSA 4O8MA 4KQPA 2B65A 3PMWA 1EYIA 5IZ3B 4P1EA 4GL0A 4BLAA 3K0VA 3Q29A 1DPPA 3MZ1A 1VDWA 4AB5A 2B4LA 4KYDA 3MPKA 1JW1A 1MPDA 2D5WA 4GX4A 3MQ9A 2I58A 5AA3A 1A8EA 3CG3A 4MNCA 1IXIA 1ATGA 1FRPA 1M5DA 4ELQA 1A99A 5HM4B 1XT8A 3PUXE 4ZS9A 1XVXA 4FE8A 4F1UA 2ZZWA 3F11A 1HSEA 2OBGA 2AL5A 3C34A 4JVCA 3KEIA 1BKAA 2QS4A 2XD3A 4JSDA 2XXXA 3ZSFA 4O7IA 3FUZA 1JW4A 3PPNA 1TFDA 1B2HA 2YJPA 2QJEA 3FVKA 5M2VA 4DCYA 4X9TA 4XKPA 2F3DA 3M3KA 2E0SA 3G3HA 4POWA 4NMYA 4XKRA 3RN8A 5K2YA 4H67A 1CB6A 3A3CA 2E1SA 1IUDA 1AOVA 4ZEIA 1JEUA 3OD7A 3SERA 3OO9A 1RKMA 1R6ZA 3ILTB 4MFIA 2PMSA 1MM6A 1LFHA 2DS9A 1IMBA 1MQJA 5BWJA 2XXQA 1JETA 3T96B 2LAOA 3UIFA 3HHFA 5A5XB 1G0HA 3RTWB 3IAZA 3RT6B 5I56A 1LAHE 1B9JA 4NF4A 4P47A 4GQOA 2OX3A 4IR8A 2ZZVA 1ZJLA 3PD8A 3K1MA 1EZ9A 4F1VA 4LVQA 1XS5A 3N5LA 4OETA 1MXUA 5I2KB 4PTKA 3FASA 1GR2A 1AWBA 1SDXA 4FORA 2P0SA 3GZGA 4ELOA 4UA8A 5ESYA 2M8CA 3BIGA 2PYYA 2VPNA 3GXAA 5F24A 4PFUA 3T66A 2FA7A 4RPOA 1A7LA 2Y7PA 4GWZA 4NG7A 3MP8A 4IO4A 3GBBA 4BDRA 3JV9A 4ND9A 1R9LA 3QYTA 1B3LA 1B05A 1IXGA 3G3FA 4LQ5A 3TQLA 2XA5A 5H8SA 5TPAB 4PF8A 4TLMB 4L17A 4OANA 4PFYA 3MZ9A 2GFEA 5KZTA 1ELJA 4OFLA 3OENA 4PBQA 2ZYNA 1DBZA 2PCRA 4ZEBA 4HCYA 4BDOA 2PBWA 1OLCA 4OA4A 1USYE 2Q88A 1K9YA 5FTIA 2R6GE 1N7XA 4PBHA 2DP8A 4NF8B 2WBBA 4YB6A 4YKPA 3R26A 5ELVA 4MAGA 3TQWA 1FBPA 2NXOA 3FXQA 3ONMA 1YXIA 1FQDA 3D1RA 4FEDA 4YB5A 2UVGA 4U4XA 2VD3A 3IB0A 1TWYA 4BDLA 1KZ8A 1Y9UA 1FQAA 4I8CA 3C31A 5B70A 1MPCA 1FSAA 2NVUB 3M3FA 4QBAA 3QK6A 3CSBA 2P2AA 1RDZA 1NUWA 1LFIA 3IOVA 3LUZA 4GWSA 2ZYOA 1Q9DA 4RJZA 1SW4A 5TU0A 2O6AA 3PPRA 4H5GA 3ODBA 1LB8A 3MVYA 4N6DA 2B3FA 2V3QA 3D4CA 4ESWA 2X7PA 3DP6A 3C33A 3FVOA 4I40A 3KJTA 4LZ8A 2DVZA 5AE4A 3GYYA 1R9QA 1LFGA 4EQ9A 3CR9A 3HV1A 3THIA 2R9JA 3SDFA 1SPIA 1EZOA 4OENA 1ZTYA 5LOMA 2FIXA 1IZ1A 2RCAA 2Q8MA 4HE0A 3SEWA 3G3GA 1Q35A 4Q8RA 2PT2A 3MC2A 3H3GA 4YZZA 2XXKA 1FW0A 3VVFA 4GWXA 3CVGA 1POTA 1IXCA 1CNQA 4GIZA 4NEDA 3UN6A 3PV0E 1XVYA 3DM0A 4OTEA 3Q25A 2V3UA 5LTCA 4KFQA 4ZEDA 4IO3A 5LDZA 1N3WA 1D4NA 4G68A 5I58B 2X26A 2HXRA 1NV7A 3HCQA 4FBPA 5I2NB 4F1YA 2VHAA 2XWOA 4NAPA 1IMDA 5H8HA 2X7QA 3ROJA 3RPLB 3T0JA 1GV8A 1B32A 3EPEA 1MXWA 5I5PA 1FBDA 2V93A 1DSNA 3BIHA 5H8NA 1IMEA 3KOTA 2XXVA 3O6IA 3KSXA 1N84A 2GHAA 3B6QA 1L5TA 3U1OA 1SYHA 3U94A 3O6GA 5JEIA 2O7IA 1MY3A 2ESNA 5I84A 4NX1A 4GVOA 4FAJA 4R75A 4O94A 3MWBA 3PD9A 4XF5A 3KGCA 4LZ7A 3K02A 4U21A 2O69A 5B7DA 4HS7A 4JWYA 4WKMA 3FXBA 1QUIA 1NV6A 4O7MA 5AA2D 3V89B 2REGA 2F34A 4R9GA 3VE1B 3CG1A 1FBHA 1NFTA 4NF5B 2BJIA 4ZEKA 4N8YA 4N8GA 4OVTA 3VV5A 4PAKA 2HZLA 1O64A 2Y7RA 3EKIA 4DXBA 1NKXA 1M5FA 2WYKA 4PFWA 2WBDA 4POXA 1PB7A 1BLFA 4JWOA 1IQ7A 1JW5A 3FXUA 2O7UA 2XXPA 5J16A 3QXMA 1AIVA 5IZ3A 1LCFA 3K4UA 4F2QA 3T9HB 4P0GA 3LC8A 1MG1A 2WYPA 3MJNA 4F22A 4PP0A 3IJXB 2D3IA
chains in the Genus database with same CATH topology
4RPNA 3OOAA 4WXJA 2HEUA 3IO6A 2OWSA 4JB7A 2F8DA 3VVDA 1XHYA 1IXHA 2CMOA 5EHSA 5J1DA 1B3HA 3IJOB 4U1OA 3IOWA 4ESXA 5JK4A 3TCGA 4IO7A 1J1NA 3ILUB 2O68A 3U72A 2UVIA 4H8IA 1I6QA 1D9YA 2ALUA 1Y3NA 4G8MA 4LQ2A 2QSXA 1A40A 1FCKA 1P1WA 4U22A 5A5XA 3JYRA 3ZS6A 1SQYA 4EQ7A 2D21A 3VVEA 3FJMA 3K00A 3O2AA 4ZZAA 1OMPA 3RGYA 1Y1ZA 4H6DA 4YMBA 3RTFB 4RK2A 1Y3QA 1FTJA 1HSJA 3K6VA 4ZDMA 5EHMA 3HN0A 4OESA 5I2KA 3KFMA 4YMAA 3IL1B 3LSFB 4LONB 2DYXA 3FIRA 4N6PA 4U1ZA 1DPEA 4C0RA 2UYEA 3I6VA 4FECA 2DWJA 4OEUA 3MW0A 1B3GA 4MLVA 3I5OA 3H6WA 4F3SA 2G29A 4NTLA 4C1UA 3V83A 1IITA 5H8QB 3T93B 2IEEA 1N04A 5CI5A 4Z7EA 4G8NA 5TPAA 1TFAA 2F7CA 3H4ZA 3JZJA 2FYIA 2XD2A 4DXCA 3CFLA 3LSWA 3U93A 4IGRA 1QKAA 1O63A 3FGSA 4EF1A 3L6HA 4O3BA 2H4IA 1SD3A 3MP6A 4ECFA 1MXZA 1AL3A 4PE5B 1P1QA 3Q28A 3CFXA 3SEYA 2I0CA 3BFUA 2QMXA 3O66A 1Z7NE 4NF8A 4PQJA 3IOUA 3PUYE 2Q2CA 3A09A 1H76A 4QFNA 3S2VA 5HBCA 2G93A 1VE4A 4KR5A 3PPQA 3E3KA 4ELRA 3RQTA 1MM7A 1UIVA 4RYAA 1B1XA 2RF1A 1LAFE 3O29A 4E0XA 1A54A 1II5A 4NF6B 3PUWE 3B7DA 2PT1A 2W7YA 5KCJB 4RNSA 2B3BA 2NWJA 2Q8JA 2RC8A 3SETA 1UQWA 1Y1MA 2F78A 1JEVA 3TDJA 1JQFA 1FTMA 1OIBA 1XC1A 1NNPA 1NNTA 1B7HA 3L6GA 4EXKA 3TYHA 1B3EA 1NMUA 3VLUA 4DXUA 2I0BA 1B0LA 2QS2A 4X1DA 4BDNA 3UORA 4KCDA 1GTKA 4OWDA 4R6YA 1H3DA 3KJ7A 3PUVE 4IGTA 2ZXTA 3GLBA 5AA1A 2V25A 3DLNA 2A5TB 3R6UA 5L9MA 2DVCA 1SW5A 2REJA 5CC2A 1P1UA 4LA9A 3OELA 4OZ9A 2ZNUA 4QSDA 3G7WA 4AQ4A 4K3FA 2F5XA 3OO6A 1UTBB 4Q30B 3HHGA 3O9PA 1OVBA 1WDNA 2XX7A 5I58A 3U92A 5I2NA 1LAXA 4P0IA 4ZE8A 2PVUA 1Z7ME 3HO7A 4G4PA 2FNCA 4UACA 4EF2A 1B7UA 1S50A 3TELA 3CRBA 2DQVA 3MPLA 1US5A 1YTVA 3BKIB 4IY6A 4QFKA 4ZECA 1Q1KA 3RY3A 2F97A 3FZVA 4QFLA 2ZMBA 1AH5A 1BP5A 1QKBA 1I6BA 3RUMA 2HCAA 3MZBA 1LLSA 2AIXA 3FATA 3LSXA 1IIWA 1FQBA 4XIGQ 3DP4A 2AYSA 2O84X 3HSTA 4H5FA 3PMXA 3V5AA 2HQ0A 3IX1A 3OEMA 4HCWA 3TFLA 2F6PA 4YKJA 3W15C 1NH8A 4NF5A 4FEBA 2HXWA 2XXIA 3TCFA 1P1OA 2H5YA 2ZNSA 3TZAA 3S4UA 2QMWA 1H43A 1VFEA 2A5SA 3O97A 1QULA 4G68C 5AA4B 3EN3A 4R73A 4TLLB 4C1TA 2OJTA 3R7XA 3T9UA 3VLVA 1MPBA 4O3CA 4OYVA 3H06B 2H9BA 3K1NA 3H03A 1US4A 3RPWA 4KPTA 5CMCA 1H44A 4IB2A 4KYEA 4F2OA 1CE2A 3TTRA 4FATA 3SESA 4QHQA 5F1QA 3KOSA 3TTLA 3OMBA 3ECRA 4AB6A 4N07A 3C32A 5KDTB 3KN8A 3LR1A 3TCHA 4F29A 1IEJA 3KN7A 1S7YA 1N0TA 4XKQA 5TP9B 1ANFA 3FJ7A 1PB8A 3H6VA 3CI8A 3G3IA 1TT1A 4LUBA 5CBSA 1MY0A 1B52A 3TUSA 2F7AA 4H65A 2F6GA 1O7TA 1ZBMA 2VD2A 1DOTA 4GXAA 2OZZA 2RC9A 1QUKA 4U23A 1RYXA 4YKIA 3TMGA 1POY1 3QAXA 5F7VA 1T0KA 4THIA 3MP1A 5CBRA 3VFJA 5CM6A 1BTJA 3IK6B 3MAMA 1MQHA 2ONSA 1EU8A 3FV1A 3K01A 1R1NA 2DOJA 1BIYA 2XX8A 4O3AA 5ITOA 1DTZA 4H8JA 2F7BA 1URGA 3H6TA 3IR1A 2Q9TA 4XTCQ 3M3LA 4Q5TA 4FIMA 3SEXA 5EYFA 2DSFA 3PU5A 2QS1A 1NL5A 2NUVA 1P1NA 2F35A 5IKBA 1AMFA 5I59B 1SW1A 1FQFA 1UTHB 4JXIA 3AXFA 1SW2A 3K6UA 2XHDA 4JDFA 3OEKA 5IAIA 3H6UA 3LBSA 1B6HA 4P11A 4R6KA 4E0WA 1YAEA 4ZEFA 1M5EA 4ZE9A 5L8DA 4GD5A 1LAGE 3EHTA 3MVXA 3A3UA 5H8QA 5K2XA 1Y4TA 5AA2B 1QW0A 3IORA 1QUJA 1GVCA 1B4ZA 4R9FA 3QUJA 1JVYA 2HFBA 3K6WA 3T22A 4GFRA 2O1MA 3UA8A 3S9MC 4GF8A 2HAVA 3DP8A 3PPOA 1S9TA 2H99A 3PPPA 3GBAA 2VOZA 4RXLA 5JTYB 2AL4A 1HSLA 2ONRA 1ZMGA 2WKYA 1EH3A 1MS7A 2GH9A 2DE4A 2Z8FA 4KYSA 1URSA 1A55A 2RCBA 1OQHA 2Z22A 4GRKA 2UVHA 5DTBA 4NF6A 2XX9A 5KCJA 4GLIA 1B51A 1TXFA 3RNNA 4EUOA 1LSTA 3S9LC 1B7ZA 1PEBA 5H8FB 3P7IA 1OVTA 1MQDA 2UYFA 3SKPA 3C35A 3FVNA 3UK4A 4IO6A 4JSOA 3K1PA 3E4RA 5DVFA 1I69A 3C4MA 1OQGA 3WAEA 5FHMA 3K2DA 4I9DA 4F19A 1B46A 3BBRA 2A5TA 4R72A 1ZIUA 2Z8DA 1B3FA 1PB9A 4OMBA 5CRYA 3B6TA 3VXCA 2UXAA 4DLDA 4KCCA 5I57B 1MH4A 3ZKLA 4YKKA 1VSOA 5DYHA 1B58A 1UTBA 4RY1A 4QRZA 5DEXB 1F9BA 5DT6A 1LCTA 2ZNTA 2VP1A 2I6EA 3UGWA 4KI0E 4WEPA 1MXVA 3PGFA 3IOTA 2RINA 5FHOA 1DTGA 2ABHA 1ZU0A 4EDPA 2I4CA 3N6TA 4HW8A 3OO7A 1LB9A 1SI1A 1LBCA 3QUFA 5ICQA 2QRYA 5DVJA 2R71A 1OLAA 2OK2A 3IB1A 3EHSA 1N76A 2V84A 4QF9A 1PDAA 5DVIA 1QJMA 4DE8A 4U4SA 2I48A 3EHUA 1JNFA 2XXYA 1D3KA 1YCJA 5HPQA 4WEDA 3QSLA 4IY5A 3LSLA 2Z8EA 4XXUA 3M8UA 4OQOA 3G3JA 2RC7A 3N26A 1MDP1 2OWTA 4F31B 4NE4A 2BJJX 4Z0IA 2O51A 3TTKA 3W9WA 1SI0A 4ONYA 3QIMA 3CSGA 4DCXA 2DWAA 4X1BA 2RKMA 1P99A 1B5IA 4G2ZA 4H0WA 3MBPA 3FJGA 2YLNA 3TTNA 1SBPA 4R2FA 2P1SA 3CIJA 3V8XB 2IA4A 4RK9A 1NNFA 4R2BA 5AA4A 4I62A 3OSRA 4MBPA 4GXSB 3FVGA 2HAUA 4OVJA 3E9XA 4LP2B 2GRVA 5I56B 4MLQA 3S9EA 1B5HA 1SYIA 4NF4B 3BFTA 4ZZEA 3IO4A 3SEUA 4LATA 5ICTA 1ZKBA 2ANJA 3OSQA 3TKDA 1RYOA 4GWOA 2CZLA 4M1VA 3T9VA 5BUUA 3KSJA 3KBRA 3TTMA 4YICA 4F3BA 2NOOA 3VXBA 2QL3A 1D9VA 5KDTA 1MXYA 4TOZA 5FHNA 5TP9A 4EQBA 2I49A 4R6HA 3KN3A 1SVXB 1USYH 4IO2A 3H7MA 2F36A 1YPNA 4OFJA 3FD3A 5L9SA 2KLFA 2QS3A 4MH5A 5CMMA 2HZKA 1LBBA 1JVXA 2UVJA 4BDQA 2I3VA 1MQGA 4TQUQ 2Y7WA 4ISUA 3OXNA 3PUZE 1A8FA 4EXLA 2V3TA 3TPAA 2OLBA 2Z23A 3T9XB 4HTGA 4F3PA 2XXHA 4PETA 3U8QA 4F3GA 4DIGA 1FQEA 3WAFA 2ZYMA 3VDFA 1XOCA 2ZYKA 1M5BA 5I59A 2H98A 1UTHA 2DWIA 2O1LA 3E13X 4G8HA 2Y7KA 3W9VA 4KD5A 5ITPA 3TAJA 4PFTA 4X48A 2OCUA 1ZLQA 4ELPA 3IB2A 4I1DA 3O6HA 3G3KA 2VGQA 1N3XA 3FXRA 1B1HA 4U2RA 2Q89A 4H1XA 5ISUA 3FV2A 3RT8A 5AA2A 4DDDA 1H45A 2YPNA 2I4BA 1I6AA 2ONKE 1URDA 1WODA 1KWHA 1PC3A 3LUYA 1VR5A 2H25A 1EZPA 1B0HA 1PBQA 4M4GA 4YU0A 4GL8A 4IO5A 4OFOA 3N94A 2Q2AA 1MQIA 1B4HA 1B40A 2XXUA 4YAHX 5JTYA 2Y84A 3B6WA 3N6UA 4F39A 3C36A 3UP9A 4BDMA 1FQCA 3MVZA 3PMVA 2PX1A 2DE2A 4OHNA 4NWDA 1B5JA 4XKNA 1GGGA 4G77A 3Q27A 2XXRA 1LGBC 3C9HA 3MVWA 1MY2A 3CFZA 3Q26A 3SEVA 4GOTA 3DELB 4JBZA 3HPIA 3O28A 4G68B 4R74A 3ZKKA 4QSEA 3D4GA 1M5CA 4JWXA 5H8HB 2THIA 2XXWA 3EQ1A 4LZ5A 5H8FA 1MH3A 5H8NB 3RLFE 2XXTA 2DWHA 1Y4CA 1NNKA 2GHBA 1FTLA 2DE3A 1WVJA 3KZGA 3I3VA 1VFDA 4QFPA 4MF3A 3MUQA 1Y3PA 3TEPA 4DZ1A 1Y20A 4F18A 4N13A 1DMBA 2I3WA 4OERA 4QSCA 1UIUA 4QFOA 1MXXA 3EF7A 5I57A 5L9OA 1MRPA 4RA1A 3VLWA 3KG2A 4OXVA 1N7WA 2QPQA 3K6XA 2Y7IA 5DEXA 3S9NC 1MY4A 1FTKA 2DXRA 4NWCA 1MDQA 5CMKA 5FTHA 4OEVA 4Q0CA 1FTOA 2DXYA 1PBPA 3TODA 1NH7A 5CMBA 4KHZE 1MY1A 3USDA 3OO8A 4FJPA 4YB7A 1QVSA 4KQPA 2B65A 3PMWA 4GL0A 4BLAA 3K0VA 3Q29A 1DPPA 3MZ1A 4AB5A 4KYDA 3MPKA 1JW1A 1MPDA 2D5WA 3MQ9A 2I58A 5AA3A 1A8EA 3CG3A 1IXIA 1ATGA 1M5DA 4ELQA 1A99A 5HM4B 1XT8A 3PUXE 4ZS9A 1XVXA 4FE8A 4F1UA 3F11A 1HSEA 2OBGA 2AL5A 3C34A 3KEIA 1BKAA 2QS4A 2XD3A 4JSDA 2XXXA 3ZSFA 3FUZA 1JW4A 3PPNA 1TFDA 1B2HA 2YJPA 2QJEA 3FVKA 5M2VA 4DCYA 4X9TA 4XKPA 3M3KA 2E0SA 3G3HA 4POWA 4NMYA 4XKRA 3RN8A 5K2YA 4H67A 1CB6A 3A3CA 2E1SA 1IUDA 1AOVA 4ZEIA 1JEUA 3OD7A 3SERA 3OO9A 1RKMA 1R6ZA 3ILTB 4MFIA 2PMSA 1MM6A 1LFHA 2DS9A 1MQJA 5BWJA 2XXQA 1JETA 3T96B 2LAOA 3UIFA 3HHFA 5A5XB 3RTWB 3IAZA 3RT6B 5I56A 1LAHE 1B9JA 4NF4A 4GQOA 1ZJLA 3PD8A 3K1MA 1EZ9A 4F1VA 4LVQA 1XS5A 3N5LA 4OETA 1MXUA 5I2KB 3FASA 1GR2A 1SDXA 4FORA 2P0SA 3GZGA 4ELOA 4UA8A 2M8CA 2PYYA 3GXAA 4PFUA 3T66A 2FA7A 4RPOA 1A7LA 2Y7PA 3MP8A 4IO4A 3GBBA 4BDRA 3JV9A 4ND9A 1R9LA 3QYTA 1B3LA 1B05A 1IXGA 3G3FA 4LQ5A 3TQLA 5TPAB 5H8SA 4TLMB 4L17A 4PFYA 3MZ9A 2GFEA 5KZTA 1ELJA 4OFLA 3OENA 2ZYNA 4ZEBA 4HCYA 4BDOA 2PBWA 1OLCA 1USYE 2Q88A 5FTIA 2R6GE 1N7XA 2DP8A 4NF8B 4YB6A 4YKPA 3R26A 5ELVA 3TQWA 3FXQA 2NXOA 3ONMA 1FQDA 4FEDA 4YB5A 2UVGA 4U4XA 2VD3A 3IB0A 1TWYA 4BDLA 1Y9UA 1FQAA 4I8CA 3C31A 5B70A 1MPCA 2NVUB 3M3FA 3QK6A 3CSBA 2P2AA 1LFIA 3IOVA 2ZYOA 4RJZA 1SW4A 5TU0A 2O6AA 3PPRA 4H5GA 3ODBA 1LB8A 3MVYA 2B3FA 2V3QA 3D4CA 4ESWA 2X7PA 3DP6A 3C33A 3FVOA 3KJTA 4LZ8A 2DVZA 5AE4A 1R9QA 1LFGA 4EQ9A 3CR9A 3HV1A 3THIA 2R9JA 3SDFA 1EZOA 4OENA 1ZTYA 5LOMA 1IZ1A 2RCAA 3SEWA 3G3GA 1Q35A 4Q8RA 2PT2A 3MC2A 3H3GA 4YZZA 1FW0A 3VVFA 3CVGA 1POTA 1IXCA 4GIZA 4NEDA 3UN6A 3PV0E 1XVYA 3DM0A 4OTEA 3Q25A 2V3UA 4KFQA 4ZEDA 4IO3A 1N3WA 1D4NA 4G68A 5I58B 2X26A 3HCQA 5I2NB 4F1YA 2VHAA 5H8HA 2X7QA 1GV8A 1B32A 3EPEA 1MXWA 2V93A 1DSNA 5H8NA 3KOTA 2XXVA 3O6IA 3KSXA 1N84A 2GHAA 3B6QA 1L5TA 3U1OA 1SYHA 3U94A 3O6GA 5JEIA 2O7IA 1MY3A 2ESNA 5I84A 4GVOA 4FAJA 4R75A 3MWBA 3PD9A 3KGCA 4LZ7A 3K02A 4U21A 2O69A 5B7DA 4HS7A 4JWYA 4WKMA 1QUIA 5AA2D 3V89B 2REGA 2F34A 4R9GA 3VE1B 3CG1A 1NFTA 4NF5B 4ZEKA 3VV5A 2HZLA 1O64A 2Y7RA 4DXBA 1NKXA 1M5FA 4PFWA 4POXA 1PB7A 1BLFA 4JWOA 1IQ7A 1JW5A 3FXUA 2O7UA 2XXPA 3QXMA 1AIVA 1LCFA 3K4UA 4F2QA 3T9HB 4P0GA 3LC8A 1MG1A 3MJNA 4F22A 4PP0A 3IJXB 2D3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPN A;  3OOA A;  4WXJ A;  2HEU A;  3IO6 A;  2OWS A;  4JB7 A;  2F8D A;  3VVD A;  1XHY A;  1IXH A;  2CMO A;  5EHS A;  5J1D A;  1B3H A;  3IJO B;  4U1O A;  3IOW A;  4ESX A;  5JK4 A;  3TCG A;  4IO7 A;  1J1N A;  3ILU B;  2O68 A;  3U72 A;  2UVI A;  4H8I A;  1I6Q A;  1D9Y A;  2ALU A;  1Y3N A;  4G8M A;  4LQ2 A;  2QSX A;  1A40 A;  1FCK A;  1P1W A;  4U22 A;  5A5X A;  3JYR A;  3ZS6 A;  1SQY A;  4EQ7 A;  2D21 A;  3VVE A;  3FJM A;  3K00 A;  3O2A A;  4ZZA A;  1OMP A;  3RGY A;  1Y1Z A;  4H6D A;  4YMB A;  3RTF B;  4RK2 A;  1Y3Q A;  1FTJ A;  1HSJ A;  3K6V A;  4ZDM A;  5EHM A;  3HN0 A;  4OES A;  5I2K A;  3KFM A;  4YMA A;  3IL1 B;  3LSF B;  4LON B;  2DYX A;  3FIR A;  4N6P A;  4U1Z A;  1DPE A;  4C0R A;  2UYE A;  3I6V A;  4FEC A;  2DWJ A;  4OEU A;  3MW0 A;  1B3G A;  4MLV A;  3I5O A;  3H6W A;  4F3S A;  2G29 A;  4NTL A;  4C1U A;  3V83 A;  1IIT A;  5H8Q B;  3T93 B;  2IEE A;  1N04 A;  5CI5 A;  4Z7E A;  4G8N A;  5TPA A;  1TFA A;  2F7C A;  3H4Z A;  3JZJ A;  2FYI A;  2XD2 A;  4DXC A;  3CFL A;  3LSW A;  3U93 A;  4IGR A;  1QKA A;  1O63 A;  3FGS A;  4EF1 A;  3L6H A;  4O3B A;  2H4I A;  1SD3 A;  3MP6 A;  4ECF A;  1MXZ A;  1AL3 A;  4PE5 B;  1P1Q A;  3Q28 A;  3CFX A;  3SEY A;  2I0C A;  3BFU A;  2QMX A;  3O66 A;  1Z7N E;  4NF8 A;  4PQJ A;  3IOU A;  3PUY E;  2Q2C A;  3A09 A;  1H76 A;  4QFN A;  3S2V A;  5HBC A;  2G93 A;  1VE4 A;  4KR5 A;  3PPQ A;  3E3K A;  4ELR A;  3RQT A;  1MM7 A;  1UIV A;  4RYA A;  1B1X A;  2RF1 A;  1LAF E;  3O29 A;  4E0X A;  1A54 A;  1II5 A;  4NF6 B;  3PUW E;  3B7D A;  2PT1 A;  2W7Y A;  5KCJ B;  4RNS A;  2B3B A;  2NWJ A;  2Q8J A;  2RC8 A;  3SET A;  1UQW A;  1Y1M A;  2F78 A;  1JEV A;  3TDJ A;  1JQF A;  1FTM A;  1OIB A;  1XC1 A;  1NNP A;  1NNT A;  1B7H A;  3L6G A;  4EXK A;  3TYH A;  1B3E A;  1NMU A;  3VLU A;  4DXU A;  2I0B A;  1B0L A;  2QS2 A;  4X1D A;  4BDN A;  3UOR A;  4KCD A;  1GTK A;  4OWD A;  4R6Y A;  1H3D A;  3KJ7 A;  3PUV E;  4IGT A;  2ZXT A;  3GLB A;  5AA1 A;  2V25 A;  3DLN A;  2A5T B;  3R6U A;  5L9M A;  2DVC A;  1SW5 A;  2REJ A;  5CC2 A;  1P1U A;  4LA9 A;  3OEL A;  4OZ9 A;  2ZNU A;  4QSD A;  3G7W A;  4AQ4 A;  4K3F A;  2F5X A;  3OO6 A;  1UTB B;  4Q30 B;  3HHG A;  3O9P A;  1OVB A;  1WDN A;  2XX7 A;  5I58 A;  3U92 A;  5I2N A;  1LAX A;  4P0I A;  4ZE8 A;  2PVU A;  1Z7M E;  3HO7 A;  4G4P A;  2FNC A;  4UAC A;  4EF2 A;  1B7U A;  1S50 A;  3TEL A;  3CRB A;  2DQV A;  3MPL A;  1US5 A;  1YTV A;  3BKI B;  4IY6 A;  4QFK A;  4ZEC A;  1Q1K A;  3RY3 A;  2F97 A;  3FZV A;  4QFL A;  2ZMB A;  1AH5 A;  1BP5 A;  1QKB A;  1I6B A;  3RUM A;  2HCA A;  3MZB A;  1LLS A;  2AIX A;  3FAT A;  3LSX A;  1IIW A;  1FQB A;  4XIG Q;  3DP4 A;  2AYS A;  2O84 X;  3HST A;  4H5F A;  3PMX A;  3V5A A;  2HQ0 A;  3IX1 A;  3OEM A;  4HCW A;  3TFL A;  2F6P A;  4YKJ A;  3W15 C;  1NH8 A;  4NF5 A;  4FEB A;  2HXW A;  2XXI A;  3TCF A;  1P1O A;  2H5Y A;  2ZNS A;  3TZA A;  3S4U A;  2QMW A;  1H43 A;  1VFE A;  2A5S A;  3O97 A;  1QUL A;  4G68 C;  5AA4 B;  3EN3 A;  4R73 A;  4TLL B;  4C1T A;  2OJT A;  3R7X A;  3T9U A;  3VLV A;  1MPB A;  4O3C A;  4OYV A;  3H06 B;  2H9B A;  3K1N A;  3H03 A;  1US4 A;  3RPW A;  4KPT A;  5CMC A;  1H44 A;  4IB2 A;  4KYE A;  4F2O A;  1CE2 A;  3TTR A;  4FAT A;  3SES A;  4QHQ A;  5F1Q A;  3KOS A;  3TTL A;  3OMB A;  3ECR A;  4AB6 A;  4N07 A;  3C32 A;  5KDT B;  3KN8 A;  3LR1 A;  3TCH A;  4F29 A;  1IEJ A;  3KN7 A;  1S7Y A;  1N0T A;  4XKQ A;  5TP9 B;  1ANF A;  3FJ7 A;  1PB8 A;  3H6V A;  3CI8 A;  3G3I A;  1TT1 A;  4LUB A;  5CBS A;  1MY0 A;  1B52 A;  3TUS A;  2F7A A;  4H65 A;  2F6G A;  1O7T A;  1ZBM A;  2VD2 A;  1DOT A;  4GXA A;  2OZZ A;  2RC9 A;  1QUK A;  4U23 A;  1RYX A;  4YKI A;  3TMG A;  1POY 1;  3QAX A;  5F7V A;  1T0K A;  4THI A;  3MP1 A;  5CBR A;  3VFJ A;  5CM6 A;  1BTJ A;  3IK6 B;  3MAM A;  1MQH A;  2ONS A;  1EU8 A;  3FV1 A;  3K01 A;  1R1N A;  2DOJ A;  1BIY A;  2XX8 A;  4O3A A;  5ITO A;  1DTZ A;  4H8J A;  2F7B A;  1URG A;  3H6T A;  3IR1 A;  2Q9T A;  4XTC Q;  3M3L A;  4Q5T A;  4FIM A;  3SEX A;  5EYF A;  2DSF A;  3PU5 A;  2QS1 A;  1NL5 A;  2NUV A;  1P1N A;  2F35 A;  5IKB A;  1AMF A;  5I59 B;  1SW1 A;  1FQF A;  1UTH B;  4JXI A;  3AXF A;  1SW2 A;  3K6U A;  2XHD A;  4JDF A;  3OEK A;  5IAI A;  3H6U A;  3LBS A;  1B6H A;  4P11 A;  4R6K A;  4E0W A;  1YAE A;  4ZEF A;  1M5E A;  4ZE9 A;  5L8D A;  4GD5 A;  1LAG E;  3EHT A;  3MVX A;  3A3U A;  5H8Q A;  5K2X A;  1Y4T A;  5AA2 B;  1QW0 A;  3IOR A;  1QUJ A;  1GVC A;  1B4Z A;  4R9F A;  3QUJ A;  1JVY A;  2HFB A;  3K6W A;  3T22 A;  4GFR A;  2O1M A;  3UA8 A;  3S9M C;  4GF8 A;  2HAV A;  3DP8 A;  3PPO A;  1S9T A;  2H99 A;  3PPP A;  3GBA A;  2VOZ A;  4RXL A;  5JTY B;  2AL4 A;  1HSL A;  2ONR A;  1ZMG A;  2WKY A;  1EH3 A;  1MS7 A;  2GH9 A;  2DE4 A;  2Z8F A;  4KYS A;  1URS A;  1A55 A;  2RCB A;  1OQH A;  2Z22 A;  4GRK A;  2UVH A;  5DTB A;  4NF6 A;  2XX9 A;  5KCJ A;  4GLI A;  1B51 A;  1TXF A;  3RNN A;  4EUO A;  1LST A;  3S9L C;  1B7Z A;  1PEB A;  5H8F B;  3P7I A;  1OVT A;  1MQD A;  2UYF A;  3SKP A;  3C35 A;  3FVN A;  3UK4 A;  4IO6 A;  4JSO A;  3K1P A;  3E4R A;  5DVF A;  1I69 A;  3C4M A;  1OQG A;  3WAE A;  5FHM A;  3K2D A;  4I9D A;  4F19 A;  1B46 A;  3BBR A;  2A5T A;  4R72 A;  1ZIU A;  2Z8D A;  1B3F A;  1PB9 A;  4OMB A;  5CRY A;  3B6T A;  3VXC A;  2UXA A;  4DLD A;  4KCC A;  5I57 B;  1MH4 A;  3ZKL A;  4YKK A;  1VSO A;  5DYH A;  1B58 A;  1UTB A;  4RY1 A;  4QRZ A;  5DEX B;  1F9B A;  5DT6 A;  1LCT A;  2ZNT A;  2VP1 A;  2I6E A;  3UGW A;  4KI0 E;  4WEP A;  1MXV A;  3PGF A;  3IOT A;  2RIN A;  5FHO A;  1DTG A;  2ABH A;  1ZU0 A;  4EDP A;  2I4C A;  3N6T A;  4HW8 A;  3OO7 A;  1LB9 A;  1SI1 A;  1LBC A;  3QUF A;  5ICQ A;  2QRY A;  5DVJ A;  2R71 A;  1OLA A;  2OK2 A;  3IB1 A;  3EHS A;  1N76 A;  2V84 A;  4QF9 A;  1PDA A;  5DVI A;  1QJM A;  4DE8 A;  4U4S A;  2I48 A;  3EHU A;  1JNF A;  2XXY A;  1D3K A;  1YCJ A;  5HPQ A;  4WED A;  3QSL A;  4IY5 A;  3LSL A;  2Z8E A;  4XXU A;  3M8U A;  4OQO A;  3G3J A;  2RC7 A;  3N26 A;  1MDP 1;  2OWT A;  4F31 B;  4NE4 A;  2BJJ X;  4Z0I A;  2O51 A;  3TTK A;  3W9W A;  1SI0 A;  4ONY A;  3QIM A;  3CSG A;  4DCX A;  2DWA A;  4X1B A;  2RKM A;  1P99 A;  1B5I A;  4G2Z A;  4H0W A;  3MBP A;  3FJG A;  2YLN A;  3TTN A;  1SBP A;  4R2F A;  2P1S A;  3CIJ A;  3V8X B;  2IA4 A;  4RK9 A;  1NNF A;  4R2B A;  5AA4 A;  4I62 A;  3OSR A;  4MBP A;  4GXS B;  3FVG A;  2HAU A;  4OVJ A;  3E9X A;  4LP2 B;  2GRV A;  5I56 B;  4MLQ A;  3S9E A;  1B5H A;  1SYI A;  4NF4 B;  3BFT A;  4ZZE A;  3IO4 A;  3SEU A;  4LAT A;  5ICT A;  1ZKB A;  2ANJ A;  3OSQ A;  3TKD A;  1RYO A;  4GWO A;  2CZL A;  4M1V A;  3T9V A;  5BUU A;  3KSJ A;  3KBR A;  3TTM A;  4YIC A;  4F3B A;  2NOO A;  3VXB A;  2QL3 A;  1D9V A;  5KDT A;  1MXY A;  4TOZ A;  5FHN A;  5TP9 A;  4EQB A;  2I49 A;  4R6H A;  3KN3 A;  1SVX B;  1USY H;  4IO2 A;  3H7M A;  2F36 A;  1YPN A;  4OFJ A;  3FD3 A;  5L9S A;  2KLF A;  2QS3 A;  4MH5 A;  5CMM A;  2HZK A;  1LBB A;  1JVX A;  2UVJ A;  4BDQ A;  2I3V A;  1MQG A;  4TQU Q;  2Y7W A;  4ISU A;  3OXN A;  3PUZ E;  1A8F A;  4EXL A;  2V3T A;  3TPA A;  2OLB A;  2Z23 A;  3T9X B;  4HTG A;  4F3P A;  2XXH A;  4PET A;  3U8Q A;  4F3G A;  4DIG A;  1FQE A;  3WAF A;  2ZYM A;  3VDF A;  1XOC A;  2ZYK A;  1M5B A;  5I59 A;  2H98 A;  1UTH A;  2DWI A;  2O1L A;  3E13 X;  4G8H A;  2Y7K A;  3W9V A;  4KD5 A;  5ITP A;  3TAJ A;  4PFT A;  4X48 A;  2OCU A;  1ZLQ A;  4ELP A;  3IB2 A;  4I1D A;  3O6H A;  3G3K A;  2VGQ A;  1N3X A;  3FXR A;  1B1H A;  4U2R A;  2Q89 A;  4H1X A;  5ISU A;  3FV2 A;  3RT8 A;  5AA2 A;  4DDD A;  1H45 A;  2YPN A;  2I4B A;  1I6A A;  2ONK E;  1URD A;  1WOD A;  1KWH A;  1PC3 A;  3LUY A;  1VR5 A;  2H25 A;  1EZP A;  1B0H A;  1PBQ A;  4M4G A;  4YU0 A;  4GL8 A;  4IO5 A;  4OFO A;  3N94 A;  2Q2A A;  1MQI A;  1B4H A;  1B40 A;  2XXU A;  4YAH X;  5JTY A;  2Y84 A;  3B6W A;  3N6U A;  4F39 A;  3C36 A;  3UP9 A;  4BDM A;  1FQC A;  3MVZ A;  3PMV A;  2PX1 A;  2DE2 A;  4OHN A;  4NWD A;  1B5J A;  4XKN A;  1GGG A;  4G77 A;  3Q27 A;  2XXR A;  1LGB C;  3C9H A;  3MVW A;  1MY2 A;  3CFZ A;  3Q26 A;  3SEV A;  4GOT A;  3DEL B;  4JBZ A;  3HPI A;  3O28 A;  4G68 B;  4R74 A;  3ZKK A;  4QSE A;  3D4G A;  1M5C A;  4JWX A;  5H8H B;  2THI A;  2XXW A;  3EQ1 A;  4LZ5 A;  5H8F A;  1MH3 A;  5H8N B;  3RLF E;  2XXT A;  2DWH A;  1Y4C A;  1NNK A;  2GHB A;  1FTL A;  2DE3 A;  1WVJ A;  3KZG A;  3I3V A;  1VFD A;  4QFP A;  4MF3 A;  3MUQ A;  1Y3P A;  3TEP A;  4DZ1 A;  1Y20 A;  4F18 A;  4N13 A;  1DMB A;  2I3W A;  4OER A;  4QSC A;  1UIU A;  4QFO A;  1MXX A;  3EF7 A;  5I57 A;  5L9O A;  1MRP A;  4RA1 A;  3VLW A;  3KG2 A;  4OXV A;  1N7W A;  2QPQ A;  3K6X A;  2Y7I A;  5DEX A;  3S9N C;  1MY4 A;  1FTK A;  2DXR A;  4NWC A;  1MDQ A;  5CMK A;  5FTH A;  4OEV A;  4Q0C A;  1FTO A;  2DXY A;  1PBP A;  3TOD A;  1NH7 A;  5CMB A;  4KHZ E;  1MY1 A;  3USD A;  3OO8 A;  4FJP A;  4YB7 A;  1QVS A;  4KQP A;  2B65 A;  3PMW A;  4GL0 A;  4BLA A;  3K0V A;  3Q29 A;  1DPP A;  3MZ1 A;  4AB5 A;  4KYD A;  3MPK A;  1JW1 A;  1MPD A;  2D5W A;  3MQ9 A;  2I58 A;  5AA3 A;  1A8E A;  3CG3 A;  1IXI A;  1ATG A;  1M5D A;  4ELQ A;  1A99 A;  5HM4 B;  1XT8 A;  3PUX E;  4ZS9 A;  1XVX A;  4FE8 A;  4F1U A;  3F11 A;  1HSE A;  2OBG A;  2AL5 A;  3C34 A;  3KEI A;  1BKA A;  2QS4 A;  2XD3 A;  4JSD A;  2XXX A;  3ZSF A;  3FUZ A;  1JW4 A;  3PPN A;  1TFD A;  1B2H A;  2YJP A;  2QJE A;  3FVK A;  5M2V A;  4DCY A;  4X9T A;  4XKP A;  3M3K A;  2E0S A;  3G3H A;  4POW A;  4NMY A;  4XKR A;  3RN8 A;  5K2Y A;  4H67 A;  1CB6 A;  3A3C A;  2E1S A;  1IUD A;  1AOV A;  4ZEI A;  1JEU A;  3OD7 A;  3SER A;  3OO9 A;  1RKM A;  1R6Z A;  3ILT B;  4MFI A;  2PMS A;  1MM6 A;  1LFH A;  2DS9 A;  1MQJ A;  5BWJ A;  2XXQ A;  1JET A;  3T96 B;  2LAO A;  3UIF A;  3HHF A;  5A5X B;  3RTW B;  3IAZ A;  3RT6 B;  5I56 A;  1LAH E;  1B9J A;  4NF4 A;  4GQO A;  1ZJL A;  3PD8 A;  3K1M A;  1EZ9 A;  4F1V A;  4LVQ A;  1XS5 A;  3N5L A;  4OET A;  1MXU A;  5I2K B;  3FAS A;  1GR2 A;  1SDX A;  4FOR A;  2P0S A;  3GZG A;  4ELO A;  4UA8 A;  2M8C A;  2PYY A;  3GXA A;  4PFU A;  3T66 A;  2FA7 A;  4RPO A;  1A7L A;  2Y7P A;  3MP8 A;  4IO4 A;  3GBB A;  4BDR A;  3JV9 A;  4ND9 A;  1R9L A;  3QYT A;  1B3L A;  1B05 A;  1IXG A;  3G3F A;  4LQ5 A;  3TQL A;  5TPA B;  5H8S A;  4TLM B;  4L17 A;  4PFY A;  3MZ9 A;  2GFE A;  5KZT A;  1ELJ A;  4OFL A;  3OEN A;  2ZYN A;  4ZEB A;  4HCY A;  4BDO A;  2PBW A;  1OLC A;  1USY E;  2Q88 A;  5FTI A;  2R6G E;  1N7X A;  2DP8 A;  4NF8 B;  4YB6 A;  4YKP A;  3R26 A;  5ELV A;  3TQW A;  3FXQ A;  2NXO A;  3ONM A;  1FQD A;  4FED A;  4YB5 A;  2UVG A;  4U4X A;  2VD3 A;  3IB0 A;  1TWY A;  4BDL A;  1Y9U A;  1FQA A;  4I8C A;  3C31 A;  5B70 A;  1MPC A;  2NVU B;  3M3F A;  3QK6 A;  3CSB A;  2P2A A;  1LFI A;  3IOV A;  2ZYO A;  4RJZ A;  1SW4 A;  5TU0 A;  2O6A A;  3PPR A;  4H5G A;  3ODB A;  1LB8 A;  3MVY A;  2B3F A;  2V3Q A;  3D4C A;  4ESW A;  2X7P A;  3DP6 A;  3C33 A;  3FVO A;  3KJT A;  4LZ8 A;  2DVZ A;  5AE4 A;  1R9Q A;  1LFG A;  4EQ9 A;  3CR9 A;  3HV1 A;  3THI A;  2R9J A;  3SDF A;  1EZO A;  4OEN A;  1ZTY A;  5LOM A;  1IZ1 A;  2RCA A;  3SEW A;  3G3G A;  1Q35 A;  4Q8R A;  2PT2 A;  3MC2 A;  3H3G A;  4YZZ A;  1FW0 A;  3VVF A;  3CVG A;  1POT A;  1IXC A;  4GIZ A;  4NED A;  3UN6 A;  3PV0 E;  1XVY A;  3DM0 A;  4OTE A;  3Q25 A;  2V3U A;  4KFQ A;  4ZED A;  4IO3 A;  1N3W A;  1D4N A;  4G68 A;  5I58 B;  2X26 A;  3HCQ A;  5I2N B;  4F1Y A;  2VHA A;  5H8H A;  2X7Q A;  1GV8 A;  1B32 A;  3EPE A;  1MXW A;  2V93 A;  1DSN A;  5H8N A;  3KOT A;  2XXV A;  3O6I A;  3KSX A;  1N84 A;  2GHA A;  3B6Q A;  1L5T A;  3U1O A;  1SYH A;  3U94 A;  3O6G A;  5JEI A;  2O7I A;  1MY3 A;  2ESN A;  5I84 A;  4GVO A;  4FAJ A;  4R75 A;  3MWB A;  3PD9 A;  3KGC A;  4LZ7 A;  3K02 A;  4U21 A;  2O69 A;  5B7D A;  4HS7 A;  4JWY A;  4WKM A;  1QUI A;  5AA2 D;  3V89 B;  2REG A;  2F34 A;  4R9G A;  3VE1 B;  3CG1 A;  1NFT A;  4NF5 B;  4ZEK A;  3VV5 A;  2HZL A;  1O64 A;  2Y7R A;  4DXB A;  1NKX A;  1M5F A;  4PFW A;  4POX A;  1PB7 A;  1BLF A;  4JWO A;  1IQ7 A;  1JW5 A;  3FXU A;  2O7U A;  2XXP A;  3QXM A;  1AIV A;  1LCF A;  3K4U A;  4F2Q A;  3T9H B;  4P0G A;  3LC8 A;  1MG1 A;  3MJN A;  4F22 A;  4PP0 A;  3IJX B;  2D3I A; 
#chains in the Genus database with same CATH topology
 4RPN A;  3OOA A;  3FBP A;  4WXJ A;  2HEU A;  3IO6 A;  2OWS A;  1NUY A;  4JB7 A;  2F8D A;  3VVD A;  1XHY A;  1IXH A;  2CMO A;  5EHS A;  4MJO A;  5J1D A;  1B3H A;  3IJO B;  4U1O A;  1NV4 A;  3IOW A;  4ESX A;  4OVQ A;  5JK4 A;  3TCG A;  4IO7 A;  1FPB A;  5EQ9 A;  1DCU A;  1J1N A;  4H45 A;  3ILU B;  2O68 A;  3U72 A;  2UVI A;  4H8I A;  1I6Q A;  1D9Y A;  1FBG A;  2ALU A;  1Y3N A;  2FHY A;  4G8M A;  4LQ2 A;  2CZI A;  2QSX A;  1A40 A;  1FCK A;  1P1W A;  4U22 A;  5A5X A;  3JYR A;  3ZS6 A;  1SQY A;  4EQ7 A;  2D21 A;  3VVE A;  3FJM A;  3K00 A;  3O2A A;  4LN5 A;  4ZZA A;  1OMP A;  3RGY A;  1Y1Z A;  4H6D A;  1RDX A;  5ET5 A;  4YMB A;  3RTF B;  3IFC A;  4RK2 A;  1Y3Q A;  1FTJ A;  1HSJ A;  3K6V A;  4ZDM A;  5EHM A;  1NV3 A;  3HN0 A;  4OES A;  5I2K A;  3KFM A;  1INP A;  2DDK A;  4YMA A;  3IL1 B;  3LSF B;  2PFZ A;  4LON B;  2DYX A;  3FIR A;  4OVS A;  4N6P A;  4U1Z A;  1KA0 A;  1DPE A;  3RYD A;  4C0R A;  2UYE A;  2PFY A;  5IM2 A;  3I6V A;  4FEC A;  2DWJ A;  4OEU A;  3MW0 A;  2KQZ A;  1B3G A;  4MLV A;  3I5O A;  3H6W A;  4F3S A;  2G29 A;  4NTL A;  4C1U A;  3V83 A;  1IIT A;  5H8Q B;  3T93 B;  2IEE A;  1N04 A;  5CI5 A;  4Z7E A;  4G8N A;  5TPA A;  1TFA A;  4PF6 A;  2F7C A;  3H4Z A;  3JZJ A;  2FYI A;  2XD2 A;  4DXC A;  3CFL A;  3LSW A;  3U93 A;  4IGR A;  1QKA A;  1O63 A;  3FGS A;  4EF1 A;  3L6H A;  4O3B A;  3ISP A;  2H4I A;  1SD3 A;  4NQ8 A;  4N91 A;  3MP6 A;  4ECF A;  1MXZ A;  1AL3 A;  4PE5 B;  4I3E A;  1P1Q A;  3Q28 A;  3CFX A;  3SEY A;  2I0C A;  3BFU A;  2QMX A;  3O66 A;  1Z7N E;  4NF8 A;  4PQJ A;  3IOU A;  3PUY E;  4GBW A;  2Q2C A;  3A09 A;  2QVR A;  1H76 A;  4QFN A;  3S2V A;  5HBC A;  2JJK A;  2G93 A;  1VE4 A;  4KR5 A;  3NOH A;  3PPQ A;  3E3K A;  4ELR A;  3RQT A;  1MM7 A;  1UIV A;  4RYA A;  4I3Y A;  1B1X A;  2RF1 A;  1LAF E;  2B4M A;  3O29 A;  2FVZ A;  4E0X A;  1A54 A;  1II5 A;  4NF6 B;  3PUW E;  3B7D A;  2PT1 A;  1RDY A;  4OVR A;  2W7Y A;  5KCJ B;  4RNS A;  2B3B A;  2NWJ A;  2Q8J A;  2OWZ A;  2RC8 A;  1UQW A;  1Y1M A;  2F78 A;  3SET A;  1JEV A;  3TDJ A;  1JQF A;  1FTM A;  1OIB A;  1XC1 A;  1NNP A;  1NNT A;  1B7H A;  3L6G A;  4EXK A;  3TYH A;  3KBZ A;  1B3E A;  1NMU A;  1NV2 A;  3VLU A;  4DXU A;  1FBE A;  2I0B A;  3HFU A;  1B0L A;  2QS2 A;  4X1D A;  4BDN A;  3UOR A;  4KCD A;  3T1B A;  1GTK A;  4OWD A;  4R6Y A;  4DI3 D;  1H3D A;  3KJ7 A;  3PUV E;  4IGT A;  2ZXT A;  5IZ1 A;  3GLB A;  5AA1 A;  2V25 A;  3DLN A;  2A5T B;  3R6U A;  5L9M A;  2DVC A;  1JP4 A;  1SW5 A;  2REJ A;  5CC2 A;  1P1U A;  4LA9 A;  3OEL A;  4OZ9 A;  2ZNU A;  4QSD A;  3G7W A;  4AQ4 A;  1NV0 A;  4K3F A;  2F5X A;  3OO6 A;  1NI9 A;  1UTB B;  4Q30 B;  2WX9 A;  3HHG A;  3O9P A;  1OVB A;  3KC0 A;  1WDN A;  1FJ9 A;  2XX7 A;  5I58 A;  3U92 A;  1IMA A;  5I2N A;  1LAX A;  2QVU A;  4P0I A;  4ZE8 A;  2PVU A;  1Z7M E;  3HO7 A;  4G4P A;  4KXP A;  3RPL A;  2FNC A;  1KA1 A;  4OVP A;  4UAC A;  4EF2 A;  5I3S A;  4GWY A;  1B7U A;  1BK4 A;  1S50 A;  3TEL A;  3CRB A;  1FPJ A;  2DQV A;  3MPL A;  1US5 A;  1YTV A;  1G0I A;  3BKI B;  4IY6 A;  4QFK A;  4ZEC A;  2VT5 A;  4HXV A;  1Q1K A;  1D9Q A;  4GWU A;  3RY3 A;  2F97 A;  2FIE A;  3FZV A;  4QFL A;  2ZMB A;  1AH5 A;  1BP5 A;  1QKB A;  1I6B A;  3RUM A;  2HCA A;  3MZB A;  1LLS A;  2AIX A;  4NHB A;  3FAT A;  3LSX A;  1IIW A;  1FBC A;  1FQB A;  4XIG Q;  3DP4 A;  2AYS A;  5DW8 A;  2O84 X;  1FPE A;  4PCD A;  3HST A;  4H5F A;  3QMF A;  3PMX A;  3V5A A;  2HQ0 A;  3IX1 A;  3OEM A;  4HCW A;  3TFL A;  2F6P A;  2Q74 A;  4YKJ A;  3W15 C;  2KR0 A;  1NH8 A;  3MST A;  4NF5 A;  4FEB A;  2HXW A;  1DK4 A;  2XXI A;  5T3J A;  3TCF A;  1P1O A;  2H5Y A;  2ZNS A;  3TZA A;  3S4U A;  2QMW A;  1H43 A;  1VFE A;  2A5S A;  3O97 A;  1QUL A;  4G68 C;  5AA4 B;  3EN3 A;  4R73 A;  4TLL B;  4C1T A;  2OJT A;  3R7X A;  1YZ0 A;  3T9U A;  3VLV A;  1MPB A;  4PE3 A;  5EQA A;  4O3C A;  4OYV A;  3H06 B;  2H9B A;  3K1N A;  3H03 A;  1US4 A;  3RPW A;  4KPT A;  5CMC A;  1H44 A;  4IB2 A;  4KYE A;  4F2O A;  1CE2 A;  3TTR A;  4FAT A;  3SES A;  4QHQ A;  5F1Q A;  2QVV A;  3KOS A;  3TTL A;  4JVI A;  3OMB A;  3ECR A;  4AB6 A;  4N07 A;  3C32 A;  5KDT B;  3KN8 A;  3LR1 A;  3TCH A;  4F29 A;  1IEJ A;  3KN7 A;  1S7Y A;  1N0T A;  4XKQ A;  5TP9 B;  1ANF A;  3FJ7 A;  4GX6 A;  1PB8 A;  1QGX A;  3H6V A;  1NUZ A;  3CI8 A;  3G3I A;  4NGU A;  1TT1 A;  4MHF A;  4LUB A;  1FPL A;  5CBS A;  1MY0 A;  1B52 A;  3TUS A;  2F7A A;  4H65 A;  2F6G A;  1O7T A;  1ZBM A;  2VD2 A;  1DOT A;  4GXA A;  2OZZ A;  2RC9 A;  1QUK A;  4U23 A;  1RYX A;  4YKI A;  3TMG A;  1POY 1;  3QAX A;  5F7V A;  4AS5 A;  1T0K A;  4THI A;  3MP1 A;  5CBR A;  3VFJ A;  5CM6 A;  1BTJ A;  4MMP A;  3IK6 B;  2L5V A;  3MAM A;  1MQH A;  2ONS A;  1EU8 A;  3FV1 A;  3K01 A;  1R1N A;  2DOJ A;  1BIY A;  2XX8 A;  4O3A A;  5ITO A;  1DTZ A;  4H8J A;  2F7B A;  1URG A;  3H6T A;  3IR1 A;  2Q9T A;  4PAI A;  4XTC Q;  3M3L A;  4Q5T A;  4FIM A;  3SEX A;  5EYF A;  2DSF A;  3PU5 A;  2QS1 A;  1NL5 A;  2NUV A;  1P1N A;  2F35 A;  5IKB A;  1AMF A;  5I59 B;  1SW1 A;  1FQF A;  1UTH B;  4JXI A;  3AXF A;  1SW2 A;  3K6U A;  2XHD A;  4JDF A;  3OEK A;  5IAI A;  3H6U A;  3LBS A;  1B6H A;  4PC9 A;  4P11 A;  4R6K A;  5EQ8 A;  4E0W A;  4MCO A;  1YAE A;  4MIJ A;  4ZEF A;  1M5E A;  4ZE9 A;  5L8D A;  1FPI A;  4GD5 A;  1LAG E;  3EHT A;  3MVX A;  3A3U A;  5H8Q A;  5K2X A;  1Y4T A;  4PGN A;  5AA2 B;  1QW0 A;  3IOR A;  1QUJ A;  1GVC A;  1B4Z A;  4R9F A;  3B8B A;  3QUJ A;  1JVY A;  2HFB A;  3K6W A;  3T22 A;  4GFR A;  2O1M A;  3UA8 A;  5EYH A;  3S9M C;  4GF8 A;  3IFA A;  2HAV A;  3DP8 A;  3PPO A;  1S9T A;  2H99 A;  3PPP A;  1LBV A;  3GBA A;  4MX6 A;  2VOZ A;  3E79 A;  4RXL A;  5JTY B;  2AL4 A;  4PFB A;  3PTY A;  1HSL A;  2ONR A;  1ZMG A;  2WKY A;  1EH3 A;  1MS7 A;  2GH9 A;  2DE4 A;  2CZH A;  2Z8F A;  4KYS A;  1URS A;  4DI4 B;  4P56 A;  1A55 A;  2RCB A;  1OQH A;  4NF0 A;  2Z22 A;  4GRK A;  2UVH A;  5DTB A;  4NF6 A;  2ZZX A;  2XX9 A;  5KCJ A;  4GLI A;  1B51 A;  1TXF A;  3RNN A;  4EUO A;  1LST A;  3S9L C;  1B7Z A;  1PEB A;  5H8F B;  3P7I A;  1OVT A;  2Y5L A;  1MQD A;  2UYF A;  2QFL A;  3SKP A;  3C35 A;  2V4C A;  3FVN A;  4P9K A;  3UK4 A;  4IO6 A;  4JSO A;  3K1P A;  3E4R A;  5DVF A;  1I69 A;  3C4M A;  1OQG A;  3WAE A;  5FHM A;  3K2D A;  4I9D A;  4X8R A;  4F19 A;  1B46 A;  3BBR A;  4R72 A;  2A5T A;  1ZIU A;  4MNP A;  2Z8D A;  1B3F A;  1PB9 A;  4OMB A;  5CRY A;  3B6T A;  3VXC A;  2UXA A;  5I7I A;  4DLD A;  4KCC A;  5I57 B;  1MH4 A;  3ZKL A;  1FPG A;  4H46 A;  4YKK A;  1VSO A;  5DYH A;  1B58 A;  4PDH A;  5EYG A;  1UTB A;  3U65 A;  4RY1 A;  4QRZ A;  5DEX B;  1F9B A;  5DT6 A;  1LCT A;  2ZNT A;  4GX3 A;  2CEY A;  2VP1 A;  2I6E A;  3UGW A;  1FJ6 A;  1FPK A;  4G61 A;  4KI0 E;  4WEP A;  1MXV A;  3PGF A;  3IOT A;  2RIN A;  5FHO A;  1DTG A;  2ABH A;  1ZU0 A;  4EDP A;  2I4C A;  3N6T A;  4HW8 A;  3OO7 A;  1LB9 A;  1SI1 A;  1LBC A;  4P3L A;  3QUF A;  2HPG A;  5ICQ A;  2QRY A;  5DVJ A;  2R71 A;  1OLA A;  2OK2 A;  3IB1 A;  3EHS A;  4GBV A;  1N76 A;  2V84 A;  4QF9 A;  1PDA A;  5DVI A;  1QJM A;  4DE8 A;  4U4S A;  2I48 A;  2CEX A;  3EHU A;  1JNF A;  1XI6 A;  2XXY A;  1D3K A;  1YCJ A;  1LEV A;  2P3V A;  5HPQ A;  4WED A;  3QSL A;  4IY5 A;  3LSL A;  2Z8E A;  4XXU A;  3M8U A;  4OQO A;  4N17 A;  4PAF A;  3G3J A;  2RC7 A;  3N26 A;  1MDP 1;  1IMF A;  2OWT A;  4F31 B;  4NE4 A;  2BJJ X;  4Z0I A;  2O51 A;  3TTK A;  3W9W A;  1SI0 A;  4N15 A;  4ONY A;  3QIM A;  3CSG A;  4DCX A;  1K9Z A;  2DWA A;  4X1B A;  2RKM A;  1P99 A;  1B5I A;  4G2Z A;  4H0W A;  4HE1 A;  3MBP A;  3FJG A;  2YLN A;  3TTN A;  1SBP A;  4R2F A;  2P1S A;  3CIJ A;  3V8X B;  2IA4 A;  4RK9 A;  1NNF A;  4R2B A;  5AA4 A;  4I62 A;  3OSR A;  4MBP A;  2MKZ A;  4GXS B;  3FVG A;  2HAU A;  1EYK A;  4X04 A;  4OVJ A;  3E9X A;  4LP2 B;  2GRV A;  2XWI A;  5I56 B;  4MLQ A;  3S9E A;  1B5H A;  1SYI A;  2Y5K A;  4NF4 B;  3BFT A;  4ZZE A;  3IO4 A;  3SEU A;  4LAT A;  5ICT A;  1ZKB A;  2ANJ A;  3OSQ A;  3TKD A;  1RYO A;  4GWO A;  2CZL A;  4M1V A;  3T9V A;  5BUU A;  3KSJ A;  3KBR A;  3TTM A;  4YIC A;  4F3B A;  2NOO A;  3VXB A;  2QL3 A;  1D9V A;  5KDT A;  1MXY A;  4TOZ A;  5FHN A;  2VPO A;  4AS4 A;  5TP9 A;  4EQB A;  2I49 A;  3B50 A;  4R6H A;  3KN3 A;  1SVX B;  1USY H;  3SZP A;  4IO2 A;  3H7M A;  2F36 A;  1LBX A;  1YPN A;  1FBF A;  4OFJ A;  3FD3 A;  5L9S A;  1FPF A;  2KLF A;  2QS3 A;  4MH5 A;  5CMM A;  2HZK A;  1LBB A;  1JVX A;  2UVJ A;  4BDQ A;  4JVD A;  2I3V A;  2XWK A;  1MQG A;  4TQU Q;  2Y7W A;  4ISU A;  3OXN A;  2XWV A;  4XFE A;  5ET7 A;  3PUZ E;  1LBY A;  1A8F A;  4EXL A;  2V3T A;  3TPA A;  4N6K A;  4PFI A;  2OLB A;  2Z23 A;  3T9X B;  5FBP A;  4HTG A;  5IGA A;  4F3P A;  2XXH A;  4PET A;  3U8Q A;  4F3G A;  4DIG A;  1FQE A;  3WAF A;  2ZYM A;  3VDF A;  1XOC A;  2WEF A;  2ZYK A;  3KC1 A;  1LBW A;  4N4U A;  1M5B A;  4PFR A;  5I59 A;  2H98 A;  1UTH A;  4GWW A;  2DWI A;  5IZZ A;  2O1L A;  3E13 X;  4G8H A;  2Y7K A;  2HHM A;  3W9V A;  4KD5 A;  5ITP A;  3TAJ A;  4PFT A;  4X48 A;  2OCU A;  1ZLQ A;  4UAB A;  4ELP A;  2FBP A;  3IB2 A;  4I1D A;  3O6H A;  3G3K A;  2VGQ A;  1N3X A;  3FXR A;  1B1H A;  4U2R A;  1IMC A;  2Q89 A;  4H1X A;  5ISU A;  3FV2 A;  3RT8 A;  5AA2 A;  4DDD A;  1H45 A;  2YPN A;  2I4B A;  1FPD A;  1I6A A;  2ONK E;  1URD A;  1WOD A;  1KWH A;  1PC3 A;  4HE2 A;  3LUY A;  1VR5 A;  2R8T A;  2H25 A;  1EZP A;  1B0H A;  1PBQ A;  4M4G A;  4YU0 A;  2CZK A;  4GL8 A;  4IO5 A;  4OFO A;  3N94 A;  2Q2A A;  1MQI A;  1B4H A;  1B40 A;  1YYZ A;  2XXU A;  4YAH X;  5JTY A;  1NUX A;  2Y84 A;  3B6W A;  3N6U A;  4F39 A;  3C36 A;  3UP9 A;  4P8B A;  4BDM A;  1FQC A;  3MVZ A;  4NN3 A;  3PMV A;  4PGP A;  2PX1 A;  2DE2 A;  4OHN A;  3CHG A;  4NWD A;  1B5J A;  4XEQ A;  4XKN A;  1GGG A;  4G77 A;  3Q27 A;  2XXR A;  1LGB C;  3C9H A;  3MVW A;  1MY2 A;  3CFZ A;  5ET6 A;  2GQ1 A;  3Q26 A;  3SEV A;  4GOT A;  3DEL B;  4JBZ A;  3LV0 A;  3HPI A;  3O28 A;  4G68 B;  4R74 A;  3ZKK A;  4QSE A;  3E78 A;  3D4G A;  1M5C A;  4N81 A;  1EYJ A;  4JWX A;  5H8H B;  2THI A;  2XXW A;  4MNI A;  3EQ1 A;  4LZ5 A;  5H8F A;  1MH3 A;  5H8N B;  3RLF E;  2XXT A;  2DWH A;  1Y4C A;  1NV1 A;  5EQ7 A;  4PDD A;  1NNK A;  2GHB A;  5A5L A;  1FTL A;  2DE3 A;  1WVJ A;  1LBZ A;  3KZG A;  3I3V A;  1VFD A;  4QFP A;  4P1L A;  2F3B A;  4MF3 A;  3MUQ A;  1Y3P A;  3TEP A;  4DZ1 A;  1Y20 A;  4F18 A;  4N13 A;  1DMB A;  2I3W A;  4OER A;  4QSC A;  1UIU A;  4QFO A;  1MXX A;  3EF7 A;  5I57 A;  5L9O A;  1FTA A;  3A29 A;  1MRP A;  4RA1 A;  3VLW A;  3KG2 A;  4OXV A;  1N7W A;  2QPQ A;  3K6X A;  4MEV A;  2Y7I A;  5DEX A;  4QXD A;  3S9N C;  1MY4 A;  1FTK A;  2DXR A;  4NWC A;  3MYU A;  1MDQ A;  5CMK A;  5FTH A;  4Q0C A;  4OEV A;  1FTO A;  5ET8 A;  2DXY A;  1PBP A;  3TOD A;  1NV5 A;  1NH7 A;  5CMB A;  4KHZ E;  1MY1 A;  2P3N A;  3USD A;  3OO8 A;  4FJP A;  4YB7 A;  1QVS A;  4O8M A;  4KQP A;  2B65 A;  3PMW A;  1EYI A;  5IZ3 B;  4P1E A;  4GL0 A;  4BLA A;  3K0V A;  3Q29 A;  1DPP A;  3MZ1 A;  1VDW A;  4AB5 A;  2B4L A;  4KYD A;  3MPK A;  1JW1 A;  1MPD A;  2D5W A;  4GX4 A;  3MQ9 A;  2I58 A;  5AA3 A;  1A8E A;  3CG3 A;  4MNC A;  1IXI A;  1ATG A;  1FRP A;  1M5D A;  4ELQ A;  1A99 A;  5HM4 B;  1XT8 A;  3PUX E;  4ZS9 A;  1XVX A;  4FE8 A;  4F1U A;  2ZZW A;  3F11 A;  1HSE A;  2OBG A;  2AL5 A;  3C34 A;  4JVC A;  3KEI A;  1BKA A;  2QS4 A;  2XD3 A;  4JSD A;  2XXX A;  3ZSF A;  4O7I A;  3FUZ A;  1JW4 A;  3PPN A;  1TFD A;  1B2H A;  2YJP A;  2QJE A;  3FVK A;  5M2V A;  4DCY A;  4X9T A;  4XKP A;  2F3D A;  3M3K A;  2E0S A;  3G3H A;  4POW A;  4NMY A;  4XKR A;  3RN8 A;  5K2Y A;  4H67 A;  1CB6 A;  3A3C A;  2E1S A;  1IUD A;  1AOV A;  4ZEI A;  1JEU A;  3OD7 A;  3SER A;  3OO9 A;  1RKM A;  1R6Z A;  3ILT B;  4MFI A;  2PMS A;  1MM6 A;  1LFH A;  2DS9 A;  1IMB A;  1MQJ A;  5BWJ A;  2XXQ A;  1JET A;  3T96 B;  2LAO A;  3UIF A;  3HHF A;  5A5X B;  1G0H A;  3RTW B;  3IAZ A;  3RT6 B;  5I56 A;  1LAH E;  1B9J A;  4NF4 A;  4P47 A;  4GQO A;  2OX3 A;  4IR8 A;  2ZZV A;  1ZJL A;  3PD8 A;  3K1M A;  1EZ9 A;  4F1V A;  4LVQ A;  1XS5 A;  3N5L A;  4OET A;  1MXU A;  5I2K B;  4PTK A;  3FAS A;  1GR2 A;  1AWB A;  1SDX A;  4FOR A;  2P0S A;  3GZG A;  4ELO A;  4UA8 A;  5ESY A;  2M8C A;  3BIG A;  2PYY A;  2VPN A;  3GXA A;  5F24 A;  4PFU A;  3T66 A;  2FA7 A;  4RPO A;  1A7L A;  2Y7P A;  4GWZ A;  4NG7 A;  3MP8 A;  4IO4 A;  3GBB A;  4BDR A;  3JV9 A;  4ND9 A;  1R9L A;  3QYT A;  1B3L A;  1B05 A;  1IXG A;  3G3F A;  4LQ5 A;  3TQL A;  2XA5 A;  5H8S A;  5TPA B;  4PF8 A;  4TLM B;  4L17 A;  4OAN A;  4PFY A;  3MZ9 A;  2GFE A;  5KZT A;  1ELJ A;  4OFL A;  3OEN A;  4PBQ A;  2ZYN A;  1DBZ A;  2PCR A;  4ZEB A;  4HCY A;  4BDO A;  2PBW A;  1OLC A;  4OA4 A;  1USY E;  2Q88 A;  1K9Y A;  5FTI A;  2R6G E;  1N7X A;  4PBH A;  2DP8 A;  4NF8 B;  2WBB A;  4YB6 A;  4YKP A;  3R26 A;  5ELV A;  4MAG A;  3TQW A;  1FBP A;  2NXO A;  3FXQ A;  3ONM A;  1YXI A;  1FQD A;  3D1R A;  4FED A;  4YB5 A;  2UVG A;  4U4X A;  2VD3 A;  3IB0 A;  1TWY A;  4BDL A;  1KZ8 A;  1Y9U A;  1FQA A;  4I8C A;  3C31 A;  5B70 A;  1MPC A;  1FSA A;  2NVU B;  3M3F A;  4QBA A;  3QK6 A;  3CSB A;  2P2A A;  1RDZ A;  1NUW A;  1LFI A;  3IOV A;  3LUZ A;  4GWS A;  2ZYO A;  1Q9D A;  4RJZ A;  1SW4 A;  5TU0 A;  2O6A A;  3PPR A;  4H5G A;  3ODB A;  1LB8 A;  3MVY A;  4N6D A;  2B3F A;  2V3Q A;  3D4C A;  4ESW A;  2X7P A;  3DP6 A;  3C33 A;  3FVO A;  4I40 A;  3KJT A;  4LZ8 A;  2DVZ A;  5AE4 A;  3GYY A;  1R9Q A;  1LFG A;  4EQ9 A;  3CR9 A;  3HV1 A;  3THI A;  2R9J A;  3SDF A;  1SPI A;  1EZO A;  4OEN A;  1ZTY A;  5LOM A;  2FIX A;  1IZ1 A;  2RCA A;  2Q8M A;  4HE0 A;  3SEW A;  3G3G A;  1Q35 A;  4Q8R A;  2PT2 A;  3MC2 A;  3H3G A;  4YZZ A;  2XXK A;  1FW0 A;  3VVF A;  4GWX A;  3CVG A;  1POT A;  1IXC A;  1CNQ A;  4GIZ A;  4NED A;  3UN6 A;  3PV0 E;  1XVY A;  3DM0 A;  4OTE A;  3Q25 A;  2V3U A;  5LTC A;  4KFQ A;  4ZED A;  4IO3 A;  5LDZ A;  1N3W A;  1D4N A;  4G68 A;  5I58 B;  2X26 A;  2HXR A;  1NV7 A;  3HCQ A;  4FBP A;  5I2N B;  4F1Y A;  2VHA A;  2XWO A;  4NAP A;  1IMD A;  5H8H A;  2X7Q A;  3ROJ A;  3RPL B;  3T0J A;  1GV8 A;  1B32 A;  3EPE A;  1MXW A;  5I5P A;  1FBD A;  2V93 A;  1DSN A;  3BIH A;  5H8N A;  1IME A;  3KOT A;  2XXV A;  3O6I A;  3KSX A;  1N84 A;  2GHA A;  3B6Q A;  1L5T A;  3U1O A;  1SYH A;  3U94 A;  3O6G A;  5JEI A;  2O7I A;  1MY3 A;  2ESN A;  5I84 A;  4NX1 A;  4GVO A;  4FAJ A;  4R75 A;  4O94 A;  3MWB A;  3PD9 A;  4XF5 A;  3KGC A;  4LZ7 A;  3K02 A;  4U21 A;  2O69 A;  5B7D A;  4HS7 A;  4JWY A;  4WKM A;  3FXB A;  1QUI A;  1NV6 A;  4O7M A;  5AA2 D;  3V89 B;  2REG A;  2F34 A;  4R9G A;  3VE1 B;  3CG1 A;  1FBH A;  1NFT A;  4NF5 B;  2BJI A;  4ZEK A;  4N8Y A;  4N8G A;  4OVT A;  3VV5 A;  4PAK A;  2HZL A;  1O64 A;  2Y7R A;  3EKI A;  4DXB A;  1NKX A;  1M5F A;  2WYK A;  4PFW A;  2WBD A;  4POX A;  1PB7 A;  1BLF A;  4JWO A;  1IQ7 A;  1JW5 A;  3FXU A;  2O7U A;  2XXP A;  5J16 A;  3QXM A;  1AIV A;  5IZ3 A;  1LCF A;  3K4U A;  4F2Q A;  3T9H B;  4P0G A;  3LC8 A;  1MG1 A;  2WYP A;  3MJN A;  4F22 A;  4PP0 A;  3IJX B;  2D3I A; 
#chains in the Genus database with same CATH homology
 4RPN A;  3OOA A;  4WXJ A;  2HEU A;  3IO6 A;  2OWS A;  4JB7 A;  2F8D A;  3VVD A;  1XHY A;  1IXH A;  2CMO A;  5EHS A;  5J1D A;  1B3H A;  3IJO B;  4U1O A;  3IOW A;  4ESX A;  5JK4 A;  3TCG A;  4IO7 A;  1J1N A;  3ILU B;  2O68 A;  3U72 A;  2UVI A;  4H8I A;  1I6Q A;  1D9Y A;  2ALU A;  1Y3N A;  4G8M A;  4LQ2 A;  2QSX A;  1A40 A;  1FCK A;  1P1W A;  4U22 A;  5A5X A;  3JYR A;  3ZS6 A;  1SQY A;  4EQ7 A;  2D21 A;  3VVE A;  3FJM A;  3K00 A;  3O2A A;  4ZZA A;  1OMP A;  3RGY A;  1Y1Z A;  4H6D A;  4YMB A;  3RTF B;  4RK2 A;  1Y3Q A;  1FTJ A;  1HSJ A;  3K6V A;  4ZDM A;  5EHM A;  3HN0 A;  4OES A;  5I2K A;  3KFM A;  4YMA A;  3IL1 B;  3LSF B;  4LON B;  2DYX A;  3FIR A;  4N6P A;  4U1Z A;  1DPE A;  4C0R A;  2UYE A;  3I6V A;  4FEC A;  2DWJ A;  4OEU A;  3MW0 A;  1B3G A;  4MLV A;  3I5O A;  3H6W A;  4F3S A;  2G29 A;  4NTL A;  4C1U A;  3V83 A;  1IIT A;  5H8Q B;  3T93 B;  2IEE A;  1N04 A;  5CI5 A;  4Z7E A;  4G8N A;  5TPA A;  1TFA A;  2F7C A;  3H4Z A;  3JZJ A;  2FYI A;  2XD2 A;  4DXC A;  3CFL A;  3LSW A;  3U93 A;  4IGR A;  1QKA A;  1O63 A;  3FGS A;  4EF1 A;  3L6H A;  4O3B A;  2H4I A;  1SD3 A;  3MP6 A;  4ECF A;  1MXZ A;  1AL3 A;  4PE5 B;  1P1Q A;  3Q28 A;  3CFX A;  3SEY A;  2I0C A;  3BFU A;  2QMX A;  3O66 A;  1Z7N E;  4NF8 A;  4PQJ A;  3IOU A;  3PUY E;  2Q2C A;  3A09 A;  1H76 A;  4QFN A;  3S2V A;  5HBC A;  2G93 A;  1VE4 A;  4KR5 A;  3PPQ A;  3E3K A;  4ELR A;  3RQT A;  1MM7 A;  1UIV A;  4RYA A;  1B1X A;  2RF1 A;  1LAF E;  3O29 A;  4E0X A;  1A54 A;  1II5 A;  4NF6 B;  3PUW E;  3B7D A;  2PT1 A;  2W7Y A;  5KCJ B;  4RNS A;  2B3B A;  2NWJ A;  2Q8J A;  2RC8 A;  3SET A;  1UQW A;  1Y1M A;  2F78 A;  1JEV A;  3TDJ A;  1JQF A;  1FTM A;  1OIB A;  1XC1 A;  1NNP A;  1NNT A;  1B7H A;  3L6G A;  4EXK A;  3TYH A;  1B3E A;  1NMU A;  3VLU A;  4DXU A;  2I0B A;  1B0L A;  2QS2 A;  4X1D A;  4BDN A;  3UOR A;  4KCD A;  1GTK A;  4OWD A;  4R6Y A;  1H3D A;  3KJ7 A;  3PUV E;  4IGT A;  2ZXT A;  3GLB A;  5AA1 A;  2V25 A;  3DLN A;  2A5T B;  3R6U A;  5L9M A;  2DVC A;  1SW5 A;  2REJ A;  5CC2 A;  1P1U A;  4LA9 A;  3OEL A;  4OZ9 A;  2ZNU A;  4QSD A;  3G7W A;  4AQ4 A;  4K3F A;  2F5X A;  3OO6 A;  1UTB B;  4Q30 B;  3HHG A;  3O9P A;  1OVB A;  1WDN A;  2XX7 A;  5I58 A;  3U92 A;  5I2N A;  1LAX A;  4P0I A;  4ZE8 A;  2PVU A;  1Z7M E;  3HO7 A;  4G4P A;  2FNC A;  4UAC A;  4EF2 A;  1B7U A;  1S50 A;  3TEL A;  3CRB A;  2DQV A;  3MPL A;  1US5 A;  1YTV A;  3BKI B;  4IY6 A;  4QFK A;  4ZEC A;  1Q1K A;  3RY3 A;  2F97 A;  3FZV A;  4QFL A;  2ZMB A;  1AH5 A;  1BP5 A;  1QKB A;  1I6B A;  3RUM A;  2HCA A;  3MZB A;  1LLS A;  2AIX A;  3FAT A;  3LSX A;  1IIW A;  1FQB A;  4XIG Q;  3DP4 A;  2AYS A;  2O84 X;  3HST A;  4H5F A;  3PMX A;  3V5A A;  2HQ0 A;  3IX1 A;  3OEM A;  4HCW A;  3TFL A;  2F6P A;  4YKJ A;  3W15 C;  1NH8 A;  4NF5 A;  4FEB A;  2HXW A;  2XXI A;  3TCF A;  1P1O A;  2H5Y A;  2ZNS A;  3TZA A;  3S4U A;  2QMW A;  1H43 A;  1VFE A;  2A5S A;  3O97 A;  1QUL A;  4G68 C;  5AA4 B;  3EN3 A;  4R73 A;  4TLL B;  4C1T A;  2OJT A;  3R7X A;  3T9U A;  3VLV A;  1MPB A;  4O3C A;  4OYV A;  3H06 B;  2H9B A;  3K1N A;  3H03 A;  1US4 A;  3RPW A;  4KPT A;  5CMC A;  1H44 A;  4IB2 A;  4KYE A;  4F2O A;  1CE2 A;  3TTR A;  4FAT A;  3SES A;  4QHQ A;  5F1Q A;  3KOS A;  3TTL A;  3OMB A;  3ECR A;  4AB6 A;  4N07 A;  3C32 A;  5KDT B;  3KN8 A;  3LR1 A;  3TCH A;  4F29 A;  1IEJ A;  3KN7 A;  1S7Y A;  1N0T A;  4XKQ A;  5TP9 B;  1ANF A;  3FJ7 A;  1PB8 A;  3H6V A;  3CI8 A;  3G3I A;  1TT1 A;  4LUB A;  5CBS A;  1MY0 A;  1B52 A;  3TUS A;  2F7A A;  4H65 A;  2F6G A;  1O7T A;  1ZBM A;  2VD2 A;  1DOT A;  4GXA A;  2OZZ A;  2RC9 A;  1QUK A;  4U23 A;  1RYX A;  4YKI A;  3TMG A;  1POY 1;  3QAX A;  5F7V A;  1T0K A;  4THI A;  3MP1 A;  5CBR A;  3VFJ A;  5CM6 A;  1BTJ A;  3IK6 B;  3MAM A;  1MQH A;  2ONS A;  1EU8 A;  3FV1 A;  3K01 A;  1R1N A;  2DOJ A;  1BIY A;  2XX8 A;  4O3A A;  5ITO A;  1DTZ A;  4H8J A;  2F7B A;  1URG A;  3H6T A;  3IR1 A;  2Q9T A;  4XTC Q;  3M3L A;  4Q5T A;  4FIM A;  3SEX A;  5EYF A;  2DSF A;  3PU5 A;  2QS1 A;  1NL5 A;  2NUV A;  1P1N A;  2F35 A;  5IKB A;  1AMF A;  5I59 B;  1SW1 A;  1FQF A;  1UTH B;  4JXI A;  3AXF A;  1SW2 A;  3K6U A;  2XHD A;  4JDF A;  3OEK A;  5IAI A;  3H6U A;  3LBS A;  1B6H A;  4P11 A;  4R6K A;  4E0W A;  1YAE A;  4ZEF A;  1M5E A;  4ZE9 A;  5L8D A;  4GD5 A;  1LAG E;  3EHT A;  3MVX A;  3A3U A;  5H8Q A;  5K2X A;  1Y4T A;  5AA2 B;  1QW0 A;  3IOR A;  1QUJ A;  1GVC A;  1B4Z A;  4R9F A;  3QUJ A;  1JVY A;  2HFB A;  3K6W A;  3T22 A;  4GFR A;  2O1M A;  3UA8 A;  3S9M C;  4GF8 A;  2HAV A;  3DP8 A;  3PPO A;  1S9T A;  2H99 A;  3PPP A;  3GBA A;  2VOZ A;  4RXL A;  5JTY B;  2AL4 A;  1HSL A;  2ONR A;  1ZMG A;  2WKY A;  1EH3 A;  1MS7 A;  2GH9 A;  2DE4 A;  2Z8F A;  4KYS A;  1URS A;  1A55 A;  2RCB A;  1OQH A;  2Z22 A;  4GRK A;  2UVH A;  5DTB A;  4NF6 A;  2XX9 A;  5KCJ A;  4GLI A;  1B51 A;  1TXF A;  3RNN A;  4EUO A;  1LST A;  3S9L C;  1B7Z A;  1PEB A;  5H8F B;  3P7I A;  1OVT A;  1MQD A;  2UYF A;  3SKP A;  3C35 A;  3FVN A;  3UK4 A;  4IO6 A;  4JSO A;  3K1P A;  3E4R A;  5DVF A;  1I69 A;  3C4M A;  1OQG A;  3WAE A;  5FHM A;  3K2D A;  4I9D A;  4F19 A;  1B46 A;  3BBR A;  2A5T A;  4R72 A;  1ZIU A;  2Z8D A;  1B3F A;  1PB9 A;  4OMB A;  5CRY A;  3B6T A;  3VXC A;  2UXA A;  4DLD A;  4KCC A;  5I57 B;  1MH4 A;  3ZKL A;  4YKK A;  1VSO A;  5DYH A;  1B58 A;  1UTB A;  4RY1 A;  4QRZ A;  5DEX B;  1F9B A;  5DT6 A;  1LCT A;  2ZNT A;  2VP1 A;  2I6E A;  3UGW A;  4KI0 E;  4WEP A;  1MXV A;  3PGF A;  3IOT A;  2RIN A;  5FHO A;  1DTG A;  2ABH A;  1ZU0 A;  4EDP A;  2I4C A;  3N6T A;  4HW8 A;  3OO7 A;  1LB9 A;  1SI1 A;  1LBC A;  3QUF A;  5ICQ A;  2QRY A;  5DVJ A;  2R71 A;  1OLA A;  2OK2 A;  3IB1 A;  3EHS A;  1N76 A;  2V84 A;  4QF9 A;  1PDA A;  5DVI A;  1QJM A;  4DE8 A;  4U4S A;  2I48 A;  3EHU A;  1JNF A;  2XXY A;  1D3K A;  1YCJ A;  5HPQ A;  4WED A;  3QSL A;  4IY5 A;  3LSL A;  2Z8E A;  4XXU A;  3M8U A;  4OQO A;  3G3J A;  2RC7 A;  3N26 A;  1MDP 1;  2OWT A;  4F31 B;  4NE4 A;  2BJJ X;  4Z0I A;  2O51 A;  3TTK A;  3W9W A;  1SI0 A;  4ONY A;  3QIM A;  3CSG A;  4DCX A;  2DWA A;  4X1B A;  2RKM A;  1P99 A;  1B5I A;  4G2Z A;  4H0W A;  3MBP A;  3FJG A;  2YLN A;  3TTN A;  1SBP A;  4R2F A;  2P1S A;  3CIJ A;  3V8X B;  2IA4 A;  4RK9 A;  1NNF A;  4R2B A;  5AA4 A;  4I62 A;  3OSR A;  4MBP A;  4GXS B;  3FVG A;  2HAU A;  4OVJ A;  3E9X A;  4LP2 B;  2GRV A;  5I56 B;  4MLQ A;  3S9E A;  1B5H A;  1SYI A;  4NF4 B;  3BFT A;  4ZZE A;  3IO4 A;  3SEU A;  4LAT A;  5ICT A;  1ZKB A;  2ANJ A;  3OSQ A;  3TKD A;  1RYO A;  4GWO A;  2CZL A;  4M1V A;  3T9V A;  5BUU A;  3KSJ A;  3KBR A;  3TTM A;  4YIC A;  4F3B A;  2NOO A;  3VXB A;  2QL3 A;  1D9V A;  5KDT A;  1MXY A;  4TOZ A;  5FHN A;  5TP9 A;  4EQB A;  2I49 A;  4R6H A;  3KN3 A;  1SVX B;  1USY H;  4IO2 A;  3H7M A;  2F36 A;  1YPN A;  4OFJ A;  3FD3 A;  5L9S A;  2KLF A;  2QS3 A;  4MH5 A;  5CMM A;  2HZK A;  1LBB A;  1JVX A;  2UVJ A;  4BDQ A;  2I3V A;  1MQG A;  4TQU Q;  2Y7W A;  4ISU A;  3OXN A;  3PUZ E;  1A8F A;  4EXL A;  2V3T A;  3TPA A;  2OLB A;  2Z23 A;  3T9X B;  4HTG A;  4F3P A;  2XXH A;  4PET A;  3U8Q A;  4F3G A;  4DIG A;  1FQE A;  3WAF A;  2ZYM A;  3VDF A;  1XOC A;  2ZYK A;  1M5B A;  5I59 A;  2H98 A;  1UTH A;  2DWI A;  2O1L A;  3E13 X;  4G8H A;  2Y7K A;  3W9V A;  4KD5 A;  5ITP A;  3TAJ A;  4PFT A;  4X48 A;  2OCU A;  1ZLQ A;  4ELP A;  3IB2 A;  4I1D A;  3O6H A;  3G3K A;  2VGQ A;  1N3X A;  3FXR A;  1B1H A;  4U2R A;  2Q89 A;  4H1X A;  5ISU A;  3FV2 A;  3RT8 A;  5AA2 A;  4DDD A;  1H45 A;  2YPN A;  2I4B A;  1I6A A;  2ONK E;  1URD A;  1WOD A;  1KWH A;  1PC3 A;  3LUY A;  1VR5 A;  2H25 A;  1EZP A;  1B0H A;  1PBQ A;  4M4G A;  4YU0 A;  4GL8 A;  4IO5 A;  4OFO A;  3N94 A;  2Q2A A;  1MQI A;  1B4H A;  1B40 A;  2XXU A;  4YAH X;  5JTY A;  2Y84 A;  3B6W A;  3N6U A;  4F39 A;  3C36 A;  3UP9 A;  4BDM A;  1FQC A;  3MVZ A;  3PMV A;  2PX1 A;  2DE2 A;  4OHN A;  4NWD A;  1B5J A;  4XKN A;  1GGG A;  4G77 A;  3Q27 A;  2XXR A;  1LGB C;  3C9H A;  3MVW A;  1MY2 A;  3CFZ A;  3Q26 A;  3SEV A;  4GOT A;  3DEL B;  4JBZ A;  3HPI A;  3O28 A;  4G68 B;  4R74 A;  3ZKK A;  4QSE A;  3D4G A;  1M5C A;  4JWX A;  5H8H B;  2THI A;  2XXW A;  3EQ1 A;  4LZ5 A;  5H8F A;  1MH3 A;  5H8N B;  3RLF E;  2XXT A;  2DWH A;  1Y4C A;  1NNK A;  2GHB A;  1FTL A;  2DE3 A;  1WVJ A;  3KZG A;  3I3V A;  1VFD A;  4QFP A;  4MF3 A;  3MUQ A;  1Y3P A;  3TEP A;  4DZ1 A;  1Y20 A;  4F18 A;  4N13 A;  1DMB A;  2I3W A;  4OER A;  4QSC A;  1UIU A;  4QFO A;  1MXX A;  3EF7 A;  5I57 A;  5L9O A;  1MRP A;  4RA1 A;  3VLW A;  3KG2 A;  4OXV A;  1N7W A;  2QPQ A;  3K6X A;  2Y7I A;  5DEX A;  3S9N C;  1MY4 A;  1FTK A;  2DXR A;  4NWC A;  1MDQ A;  5CMK A;  5FTH A;  4OEV A;  4Q0C A;  1FTO A;  2DXY A;  1PBP A;  3TOD A;  1NH7 A;  5CMB A;  4KHZ E;  1MY1 A;  3USD A;  3OO8 A;  4FJP A;  4YB7 A;  1QVS A;  4KQP A;  2B65 A;  3PMW A;  4GL0 A;  4BLA A;  3K0V A;  3Q29 A;  1DPP A;  3MZ1 A;  4AB5 A;  4KYD A;  3MPK A;  1JW1 A;  1MPD A;  2D5W A;  3MQ9 A;  2I58 A;  5AA3 A;  1A8E A;  3CG3 A;  1IXI A;  1ATG A;  1M5D A;  4ELQ A;  1A99 A;  5HM4 B;  1XT8 A;  3PUX E;  4ZS9 A;  1XVX A;  4FE8 A;  4F1U A;  3F11 A;  1HSE A;  2OBG A;  2AL5 A;  3C34 A;  3KEI A;  1BKA A;  2QS4 A;  2XD3 A;  4JSD A;  2XXX A;  3ZSF A;  3FUZ A;  1JW4 A;  3PPN A;  1TFD A;  1B2H A;  2YJP A;  2QJE A;  3FVK A;  5M2V A;  4DCY A;  4X9T A;  4XKP A;  3M3K A;  2E0S A;  3G3H A;  4POW A;  4NMY A;  4XKR A;  3RN8 A;  5K2Y A;  4H67 A;  1CB6 A;  3A3C A;  2E1S A;  1IUD A;  1AOV A;  4ZEI A;  1JEU A;  3OD7 A;  3SER A;  3OO9 A;  1RKM A;  1R6Z A;  3ILT B;  4MFI A;  2PMS A;  1MM6 A;  1LFH A;  2DS9 A;  1MQJ A;  5BWJ A;  2XXQ A;  1JET A;  3T96 B;  2LAO A;  3UIF A;  3HHF A;  5A5X B;  3RTW B;  3IAZ A;  3RT6 B;  5I56 A;  1LAH E;  1B9J A;  4NF4 A;  4GQO A;  1ZJL A;  3PD8 A;  3K1M A;  1EZ9 A;  4F1V A;  4LVQ A;  1XS5 A;  3N5L A;  4OET A;  1MXU A;  5I2K B;  3FAS A;  1GR2 A;  1SDX A;  4FOR A;  2P0S A;  3GZG A;  4ELO A;  4UA8 A;  2M8C A;  2PYY A;  3GXA A;  4PFU A;  3T66 A;  2FA7 A;  4RPO A;  1A7L A;  2Y7P A;  3MP8 A;  4IO4 A;  3GBB A;  4BDR A;  3JV9 A;  4ND9 A;  1R9L A;  3QYT A;  1B3L A;  1B05 A;  1IXG A;  3G3F A;  4LQ5 A;  3TQL A;  5TPA B;  5H8S A;  4TLM B;  4L17 A;  4PFY A;  3MZ9 A;  2GFE A;  5KZT A;  1ELJ A;  4OFL A;  3OEN A;  2ZYN A;  4ZEB A;  4HCY A;  4BDO A;  2PBW A;  1OLC A;  1USY E;  2Q88 A;  5FTI A;  2R6G E;  1N7X A;  2DP8 A;  4NF8 B;  4YB6 A;  4YKP A;  3R26 A;  5ELV A;  3TQW A;  3FXQ A;  2NXO A;  3ONM A;  1FQD A;  4FED A;  4YB5 A;  2UVG A;  4U4X A;  2VD3 A;  3IB0 A;  1TWY A;  4BDL A;  1Y9U A;  1FQA A;  4I8C A;  3C31 A;  5B70 A;  1MPC A;  2NVU B;  3M3F A;  3QK6 A;  3CSB A;  2P2A A;  1LFI A;  3IOV A;  2ZYO A;  4RJZ A;  1SW4 A;  5TU0 A;  2O6A A;  3PPR A;  4H5G A;  3ODB A;  1LB8 A;  3MVY A;  2B3F A;  2V3Q A;  3D4C A;  4ESW A;  2X7P A;  3DP6 A;  3C33 A;  3FVO A;  3KJT A;  4LZ8 A;  2DVZ A;  5AE4 A;  1R9Q A;  1LFG A;  4EQ9 A;  3CR9 A;  3HV1 A;  3THI A;  2R9J A;  3SDF A;  1EZO A;  4OEN A;  1ZTY A;  5LOM A;  1IZ1 A;  2RCA A;  3SEW A;  3G3G A;  1Q35 A;  4Q8R A;  2PT2 A;  3MC2 A;  3H3G A;  4YZZ A;  1FW0 A;  3VVF A;  3CVG A;  1POT A;  1IXC A;  4GIZ A;  4NED A;  3UN6 A;  3PV0 E;  1XVY A;  3DM0 A;  4OTE A;  3Q25 A;  2V3U A;  4KFQ A;  4ZED A;  4IO3 A;  1N3W A;  1D4N A;  4G68 A;  5I58 B;  2X26 A;  3HCQ A;  5I2N B;  4F1Y A;  2VHA A;  5H8H A;  2X7Q A;  1GV8 A;  1B32 A;  3EPE A;  1MXW A;  2V93 A;  1DSN A;  5H8N A;  3KOT A;  2XXV A;  3O6I A;  3KSX A;  1N84 A;  2GHA A;  3B6Q A;  1L5T A;  3U1O A;  1SYH A;  3U94 A;  3O6G A;  5JEI A;  2O7I A;  1MY3 A;  2ESN A;  5I84 A;  4GVO A;  4FAJ A;  4R75 A;  3MWB A;  3PD9 A;  3KGC A;  4LZ7 A;  3K02 A;  4U21 A;  2O69 A;  5B7D A;  4HS7 A;  4JWY A;  4WKM A;  1QUI A;  5AA2 D;  3V89 B;  2REG A;  2F34 A;  4R9G A;  3VE1 B;  3CG1 A;  1NFT A;  4NF5 B;  4ZEK A;  3VV5 A;  2HZL A;  1O64 A;  2Y7R A;  4DXB A;  1NKX A;  1M5F A;  4PFW A;  4POX A;  1PB7 A;  1BLF A;  4JWO A;  1IQ7 A;  1JW5 A;  3FXU A;  2O7U A;  2XXP A;  3QXM A;  1AIV A;  1LCF A;  3K4U A;  4F2Q A;  3T9H B;  4P0G A;  3LC8 A;  1MG1 A;  3MJN A;  4F22 A;  4PP0 A;  3IJX B;  2D3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...