4MNIA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p6522
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
QEVTLRLVSAFPENGIYVQRLLPWIAKVNAEGKGVLQINFLGGPKAIPTFEAGNAVKTGVVDMAMNTGAFYTNVMPEADFLKLTQIPVAEQRKNGAFDAINKVWNEKGNTQYLARMVENQPFHIYTNKKIDKPDLSGQKIRISPVYRDFFQALNANVVTTPPGEVYTALERGVVDGYGWPIGGIFDLNWQEKTKFRVDPGFYDAEVSLTMNLPAYKKLTDAQRNYLQKQLLVLEAENTFWTRYGNVETARQETAGIQTIKFDAATSKAFREKAYEVGWAGAMKQSPEVAARFKTLFSKAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas sp.
total genus 114
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mniA00
4PFRA 3U65A 4OVTA 4YICA 4MIJA 2HZKA 4N4UA 4O8MA 4MNIA 4OVRA 4PBHA 4X04A 2XXKA 3B50A 2CEYA 2PFZA 4P47A 5LTCA 4PF8A 4XEQA 4OVSA 2WYKA 2ZZVA 4UABA 4PGPA 4P1LA 4PGNA 4MAGA 5I5PA 4N6KA 4MMPA 4NQ8A 4NF0A 2VPNA 4MNPA 5IZZA 2XWOA 5I7IA 4P9KA 4O7MA 4DI3D 4PETA 4P8BA 2HPGA 4P56A 3GYYA 4PDHA 4MEVA 4OVQA 4PBQA 2VPOA 2XWVA 4MHFA 4PCDA 5IGAA 2XA5A 2HZLA 2V4CA 4DI4B 4NHBA 4O94A 2XWKA 4N15A 2XWIA 4OVPA 4NAPA 4N6DA 4PAFA 4NGUA 5CM6A 4N8GA 3FXBA 4MNCA 4N91A 4PC9A 4MCOA 5IM2A 4PAIA 4NN3A 4PAKA 4XFEA 2CEXA 2WX9A 4OA4A 4NG7A 4PE3A 4PFIA 2PFYA 4NX1A 4XF5A 4P1EA 4YZZA 4OANA 4N17A 4PDDA 2WYPA 2ZZXA 4MX6A 4N8YA 4PFBA 4LN5A 2ZZWA 4X8RA 4P3LA 4PF6A
chains in the Genus database with same CATH superfamily
4KPTA 4GVOA 3UA8A 3RYDA 4PP0A 1MPDA 2XXKA 2DDKA 3VVFA 4EUOA 2PFZA 3C31A 3K4UA 4PFWA 2NWJA 3B6QA 4OVSA 2FIEA 2H25A 5JTYA 5IAIA 1R1NA 2DQVA 4GFRA 4DIGA 4LQ2A 4PFYA 1IMDA 2XD3A 5B7DA 3KOTA 2FIXA 3FASA 3T1BA 4U1OA 3LBSA 4HE1A 3CR9A 1QULA 3CSBA 1DK4A 3H6WA 1B5IA 5IKBA 2FHYA 1FBEA 2QS3A 4EF2A 1FBFA 2F3BA 5DW8A 1B32A 4R74A 1LBCA 1MPBA 3PD8A 1S9TA 4QFKA 4R6HA 5L9MA 4PBQA 3VLWA 2XA5A 4R9FA 4NHBA 4DE8A 1QUIA 2XWIA 4OVPA 3GBBA 2F7AA 1B1XA 2L5VA 5JK4A 4QFNA 1LAHE 3IFCA 3GLBA 3KBRA 3DM0A 1H76A 5FHMA 4F1UA 4P0GA 4F18A 3IL1B 4QSEA 3AXFA 4OYVA 4H5FA 5BUUA 1YCJA 3BIHA 4GBVA 1I6BA 4BDNA 4NF8B 1H45A 1CNQA 3PPPA 1K9YA 4YKKA 4U4SA 2V3TA 3SERA 1FQDA 3N26A 1IIWA 4BDOA 4OXVA 2HZKA 1I6AA 4MNIA 1BP5A 4X04A 1ZMGA 4XXUA 3ILTB 3MP1A 4KCCA 2D21A 3CI8A 4GIZA 1NNFA 5CMMA 4PF8A 4XEQA 2THIA 2QVRA 5EQ8A 3UN6A 3HSTA 1ZKBA 4BDMA 1MY1A 4OMBA 4FEBA 5ET8A 1CE2A 4U22A 4IO4A 2Y7IA 5AE4A 3MSTA 4LZ5A 2XX8A 2RKMA 1S7YA 4GWOA 1I6QA 1P1WA 3B6WA 3L6GA 1UIUA 4WXJA 1BKAA 2XWOA 1EZOA 1L5TA 4ELPA 1MQHA 3SEYA 4DI3D 2NUVA 1JNFA 3S4UA 3LSLA 1B7HA 1NNPA 3H03A 4DCYA 3VE1B 3D1RA 4PDHA 1NV0A 2OBGA 1NMUA 4MH5A 2PMSA 3H06B 1ZIUA 2UVHA 1US5A 4KI0E 2HZLA 4YKJA 4PAFA 3RUMA 3IX1A 4IY6A 3PMWA 1QJMA 3DLNA 3FV2A 1Y3PA 1T0KA 2KQZA 2W7YA 1DCUA 4OEVA 4GQOA 3R26A 3E3KA 1OIBA 1PBPA 1B3HA 3MVYA 4OANA 1M5BA 2R8TA 4OENA 4RPOA 2G29A 4NF8A 3R6UA 1MY3A 2CMOA 2PT1A 1ATGA 1AOVA 4DCXA 1JP4A 1NUZA 1BTJA 4I8CA 4DXBA 4EXLA 3MPKA 1Q9DA 4NE4A 2OWZA 1JW1A 1Z7NE 4N13A 3SEVA 4QSCA 2MKZA 4H45A 3PUYE 3IB1A 3VXCA 1I69A 5KDTB 1QUJA 4OQOA 3G3FA 4GL8A 1H3DA 2AL4A 1A55A 4H46A 4H8IA 3MVWA 4DZ1A 4H1XA 5I5PA 5F1QA 4NQ8A 1D9QA 2CZLA 1JQFA 5H8NB 2B3BA 1B58A 4Z7EA 2OCUA 4EQ7A 4TOZA 1XOCA 3OOAA 2XXXA 3MVXA 1FPFA 1RYOA 4GWYA 1NV7A 4QFOA 1VFDA 4FORA 2FVZA 3RT6B 4QSDA 4OTEA 2XWVA 2PYYA 1HSJA 1MH4A 2FA7A 1LBWA 3IORA 1NV4A 2O84X 3SEXA 2XXUA 3IK6B 4JB7A 3C36A 3ILUB 3KZGA 1PDAA 4IY5A 3K6UA 3THIA 3OXNA 1HSLA 2XXYA 5CMKA 1BIYA 1FQFA 2XXVA 4R72A 3O66A 5DT6A 4JSOA 1NUYA 1FPJA 2ZZXA 3G3HA 2ONRA 1OVTA 2P1SA 4RYAA 4MX6A 4PFBA 3PU5A 4IO6A 3RN8A 5TP9B 1FTMA 1UIVA 3EHUA 4PF6A 1MY0A 1FTLA 2B4MA 1ANFA 4HW8A 3VDFA 2V3QA 2Z22A 1B40A 3MAMA 2Y5LA 2Q2AA 5KDTA 2RCAA 1R9QA 3L6HA 1KA0A 4ELQA 2O1LA 2R6GE 1VSOA 4GX4A 4JVCA 2XX9A 3N6TA 3TZAA 2XX7A 1NH7A 5H8NA 1URDA 2F34A 1FTOA 3KJ7A 4Q5TA 4XKPA 2ONSA 2E1SA 2CZHA 3KBZA 4YMAA 2VP1A 3E4RA 4ZE8A 4DXCA 3T96B 3H4ZA 4RXLA 1N3XA 1LLSA 1MM6A 4FJPA 4FE8A 1FJ6A 4G68B 4MHFA 3IO6A 1MXVA 4UA8A 2X7QA 1KZ8A 4NEDA 2B3FA 2HAVA 5A5XB 2QSXA 1AIVA 3SKPA 3TCGA 1NUWA 4R2FA 1YXIA 4GOTA 4JWOA 1M5DA 3U94A 4WEDA 3S9LC 1M5EA 4G4PA 5H8FA 5ISUA 1AL3A 5ET7A 5HM4B 3GBAA 3G3GA 5TP9A 3FVOA 2NXOA 2Q9TA 2RC7A 3CVGA 1IXIA 4GX3A 3IFAA 1NUXA 1FPDA 2UVGA 1HSEA 3FVGA 5IZ3B 4PFRA 4I1DA 2ZNTA 4H6DA 4X48A 4FAJA 1TT1A 3DP8A 4OVRA 2O1MA 3M3KA 4ZZEA 4G61A 3HO7A 3EN3A 3RQTA 5CBSA 4Z0IA 4HCYA 5B70A 1YTVA 1F9BA 3K6XA 1N7XA 1SW1A 3IB0A 1LEVA 3JV9A 3FUZA 3K2DA 5L8DA 4M4GA 5I56B 4WKMA 1H43A 1N76A 3H6VA 4F2OA 3SZPA 2CZKA 3TEPA 1FBGA 1FQCA 2F7CA 3G7WA 2H9BA 3RLFE 3BKIB 4G68A 1DBZA 1A8FA 1P1UA 3FXRA 5A5XA 2V93A 2F3DA 3QMFA 4U4XA 3RPLB 2I0BA 1MY2A 2RCBA 4PAIA 1GR2A 1XT8A 2HCAA 5LDZA 1FW0A 3CG3A 3KN7A 1CB6A 4GWXA 1SDXA 4MJOA 5CRYA 1IITA 2AYSA 4XF5A 4PQJA 5CMBA 1XVXA 1AMFA 1B7ZA 3B7DA 3TQLA 4ESXA 3R7XA 1LBVA 3H7MA 3UGWA 5IZ1A 5CMCA 3EPEA 1XC1A 1PEBA 5ET6A 2REGA 2V84A 2ALUA 1J1NA 1JW4A 3K0VA 4EDPA 2H4IA 4YB7A 2FYIA 4ELRA 2ONKE 4KD5A 4R73A 3S9MC 2F97A 4ECFA 4JDFA 3MP6A 4BLAA 2ZYMA 2P0SA 3HHGA 4OFOA 5I59B 3C34A 1IXGA 1EU8A 1NNTA 3Q25A 4PE5B 5I56A 1DPEA 3TELA 2OZZA 4F29A 1MDP1 2ABHA 2QFLA 3H6TA 1FPBA 2XD2A 4MLVA 1D9YA 4GWSA 4P9KA 3MVZA 3D4GA 1SI0A 2XXIA 2WBDA 3IAZA 3V83A 4XKNA 1N84A 3LV0A 4QFLA 1GV8A 5EQ9A 3HV1A 4EXKA 4O3CA 1D3KA 1US4A 3T9HB 2XWKA 3RPLA 2DSFA 2D5WA 5AA4B 1Y4TA 4R9GA 1B05A 4MNCA 4HE0A 1LAGE 3OO6A 3ZSFA 1Y3QA 3IOTA 2PFYA 4IO7A 3RPWA 5J16A 3PV0E 4JBZA 2R71A 4DXUA 4PDDA 1XI6A 1MDQA 2P3NA 4U21A 4BDQA 2P3VA 4ZEBA 2O69A 3OEKA 4LATA 1IMAA 3U65A 4OVTA 4ZECA 5FTIA 4KXPA 2B65A 2Y7KA 3HN0A 1B3EA 2DYXA 1SI1A 4GX6A 2I4CA 5I2KB 4GXAA 4R6KA 4WEPA 5I59A 2KLFA 4ONYA 5EYGA 2VD3A 4G2ZA 4P1LA 1SD3A 3N6UA 1IMFA 1ZBMA 3USDA 4E0WA 1NH8A 1M5FA 3H3GA 4MNPA 1IXCA 3OSQA 1FTKA 3QXMA 1MQIA 2QS4A 4ZE9A 4Q30B 4F1VA 2VT5A 3GXAA 3Q28A 4PETA 2VOZA 3VLUA 1IMCA 3F11A 5FTHA 4KFQA 1DMBA 2I48A 3MC2A 2ZNSA 4OVQA 2VPOA 4KR5A 3A29A 5AA4A 3K1MA 3V89B 2O6AA 3IB2A 4GWZA 4AS5A 3OO8A 1FPIA 1Y9UA 5EYFA 4MCOA 3QIMA 2F6GA 3EKIA 3K1NA 4NMYA 4ZEKA 3LUZA 4Q8RA 1FBCA 2D3IA 3MBPA 3FVNA 2HHMA 4I3YA 5ELVA 2Q8JA 1D9VA 3JZJA 4YZZA 3KFMA 4LP2B 1LBXA 1B7UA 2UXAA 1MH3A 1Y1ZA 3S9EA 3TYHA 5BWJA 4THIA 2NVUB 3SESA 4LUBA 4POWA 3VFJA 2I4BA 3B8BA 1SPIA 1O7TA 3E9XA 1MQJA 2O51A 1EYJA 3MW0A 5I2KA 3O97A 2CEYA 5H8SA 2ESNA 1S50A 1LBYA 1FQEA 4RY1A 3ISPA 5LTCA 2DWJA 1UTHB 2UYFA 2BJIA 4X1BA 1NV6A 2AL5A 1EH3A 3RGYA 3K6WA 4G8HA 3ROJA 2PX1A 3UK4A 2Z8EA 3I5OA 1FPGA 2QJEA 3E13X 1YZ0A 2GHBA 2E0SA 1SYHA 5H8HB 2VD2A 1DPPA 3U8QA 1LAFE 3U93A 5LOMA 3LR1A 2Z8DA 1A8EA 2V4CA 5A5LA 3FD3A 1OQGA 2PCRA 1B52A 5EQAA 2FNCA 3OO7A 4K3FA 3OSRA 3TKDA 2VHAA 4N91A 3W9VA 4PC9A 4ZEDA 5I57B 4U2RA 3ZKKA 4ESWA 1IXHA 5M2VA 3K1PA 4XFEA 1XVYA 2CEXA 3G3JA 1ELJA 3RY3A 1B6HA 3T9VA 4OFLA 4IO2A 3FXUA 5KCJB 1B4ZA 1PC3A 2OK2A 4R2BA 3PPQA 1IZ1A 4N8YA 3FV1A 1B51A 2H5YA 3RNNA 3IR1A 1FJ9A 2WKYA 1ZLQA 1VFEA 3MYUA 2QVUA 3PMVA 3CSGA 1MRPA 3TQWA 1POY1 2WYKA 3TPAA 1IUDA 3T22A 4POXA 1QVSA 1YAEA 3U1OA 3PGFA 3MJNA 1M5CA 3GZGA 2AIXA 1INPA 4ISUA 1ZTYA 4EQ9A 2OWSA 3CFXA 3FJGA 5H8HA 4F19A 2XXQA 3BFTA 1Q35A 4HS7A 4P8BA 4P56A 4IGTA 3KG2A 4HCWA 2UVJA 2Y5KA 3PTYA 1DSNA 2QS1A 1B46A 2I3VA 3FVKA 3IOWA 1MG1A 4FEDA 3HPIA 4DI4B 4RNSA 1AH5A 3M3LA 3MZ9A 1A40A 3Q26A 5I57A 5H8QB 1FBPA 4YU0A 4N6DA 3CIJA 4NGUA 1LAXA 1DOTA 3UIFA 1LBZA 3TCFA 2LAOA 3O6HA 3FIRA 3RTWB 2DS9A 1XS5A 1SW5A 4PFIA 4N07A 4GWWA 2ANJA 5KCJA 2Z8FA 2BJJX 1NV2A 2GFEA 4RK9A 4ZEIA 4F3PA 5J1DA 4LQ5A 4R6YA 4RA1A 3FBPA 4G8NA 4LVQA 2Y84A 1B0HA 3PPNA 2OX3A 1A7LA 4XKRA 4XTCQ 4OEUA 4PFTA 4ZEFA 3WAEA 2HXWA 5ICTA 2O7UA 5TPAB 4EQBA 5TU0A 2DWAA 2I58A 3KOSA 1VDWA 3FATA 4FBPA 2F6PA 3HCQA 1A54A 1WVJA 1RYXA 1MQGA 2OWTA 4MMPA 2RINA 1YYZA 1QW0A 3PD9A 5CBRA 3EHSA 2QL3A 1DTZA 1SVXB 2HEUA 1MS7A 3T66A 1VE4A 1JEUA 2WEFA 1FSAA 1FQAA 5H8QA 1B3GA 1RKMA 3V8XB 2NOOA 3FXBA 3N5LA 1OLCA 1N0TA 1R9LA 5AA1A 4I62A 3MPLA 3PMXA 4PE3A 3VVEA 5I58B 2DE3A 4ZDMA 4YKIA 1OQHA 4AB6A 2WYPA 4YB5A 5EHMA 3OELA 4JVIA 3SEWA 4H8JA 2YJPA 4KYDA 3EQ1A 1QKBA 4KYSA 4I9DA 1B5HA 5F7VA 3KEIA 1P1NA 3HHFA 3C4MA 5CI5A 1NKXA 3IOVA 1LFGA 2Y7RA 2Q8MA 3EF7A 4OETA 4P47A 3MP8A 4GXSB 3PUWE 3I6VA 5IZ3A 1FQBA 3TUSA 4G77A 4LONB 5EQ7A 3FJMA 1FPEA 3B6TA 2OLBA 3C9HA 1VR5A 1LBBA 3S2VA 4IO3A 2ZNUA 1KWHA 1EZ9A 4F3BA 1IMBA 4O7MA 1IQ7A 3PUVE 5AA2D 3KSXA 1Y3NA 1UTBB 2A5TB 5KZTA 5DYHA 3A3CA 1POTA 3OMBA 3K6VA 4JWYA 2XXHA 5IGAA 1MPCA 5HBCA 3ONMA 5FHNA 1G0HA 4NAPA 3PPRA 3PUZE 3I3VA 3UORA 3MUQA 4H0WA 3O6GA 4GLIA 4O3AA 4F31B 2F35A 4NF5B 2WX9A 2X7PA 5I58A 4NG7A 3LSWA 4YAHX 3IO4A 3E79A 1Q1KA 2DWIA 4PFUA 3CG1A 3MZBA 2Y7WA 2IEEA 5AA3A 2DP8A 3KN3A 4MFIA 3TTLA 1OLAA 5I2NB 4IO5A 2V3UA 5F24A 5K2YA 1EYIA 4C1TA 2KR0A 1BLFA 4XKQA 1JVXA 4OERA 4YB6A 2GHAA 2A5SA 1QGXA 2XHDA 1N7WA 4TLLB 4UABA 4O3BA 3CRBA 1Y1MA 3LSFB 1P1OA 1NV3A 1B3FA 5I3SA 1LFIA 4ND9A 3T9UA 2Z23A 4O7IA 1UQWA 3HFUA 1UTBA 2A5TA 1FBHA 3G3IA 3ODBA 4BDRA 4OESA 1NL5A 3QUJA 2DXRA 3K00A 3GYYA 2QVVA 4F2QA 3NOHA 4O94A 3ZS6A 4N15A 1ZU0A 4RJZA 1LB9A 2REJA 5IM2A 4NF5A 3SEUA 3C32A 2F5XA 4QFPA 1B2HA 4MLQA 4N17A 3RTFB 1USYE 4JXIA 1TFDA 4L17A 2DVZA 1WODA 2FBPA 2F7BA 1FTAA 1QUKA 4F3SA 4X1DA 3SETA 4YICA 4HTGA 5I2NA 1O63A 5FBPA 4MIJA 4H67A 3B50A 2F36A 2ZYNA 1USYH 4F22A 2GQ1A 3W9WA 3O9PA 1B1HA 3MWBA 2I0CA 2ZZVA 4TQUQ 3TTKA 5ET5A 5CC2A 4QF9A 2QPQA 1R6ZA 1RDZA 5HPQA 4PGPA 3Q29A 4NTLA 4DDDA 4ZS9A 3RT8A 1MXXA 4QHQA 3KC0A 4NF0A 2G93A 1O64A 3TTNA 1MQDA 2VPNA 3MZ1A 4AB5A 4KYEA 3LUYA 5IZZA 1OVBA 3T9XB 3CHGA 1B9JA 4E0XA 1FTJA 5AA2B 4N6PA 1AWBA 4MEVA 4KQPA 4Q0CA 3KN8A 4ZZAA 2ZYOA 2DE2A 3TTRA 4PCDA 3O6IA 1FPKA 2O68A 3VXBA 3IJOB 3VV5A 1B5JA 3MQ9A 2WBBA 2XXTA 3DP6A 3QAXA 3BBRA 4H5GA 1DTGA 3IJXB 1RDXA 1B3LA 2HAUA 1MXUA 3TAJA 1P1QA 3P7IA 2ZMBA 2QS2A 4QRZA 1WDNA 3A09A 3EHTA 3JYRA 2I49A 3D4CA 1YPNA 2DOJA 4LN5A 3QK6A 4M1VA 2ZXTA 5T3JA 2Q2CA 5EHSA 3OENA 3TFLA 5DEXB 1N3WA 4I3EA 2Q74A 4GRKA 4OHNA 4O8MA 5ITOA 4PBHA 1FCKA 3W15C 5ICQA 4JWXA 4NF6B 1B0LA 4NWDA 3PPOA 2DXYA 1NI9A 2XXRA 1TWYA 4LZ8A 4EF1A 5ITPA 1SYIA 4PGNA 4I40A 4LA9A 4MAGA 2M8CA 2F8DA 4N6KA 4G8MA 1G0IA 2Y7PA 1LCFA 1NNKA 4P11A 3Q27A 2XXWA 1UTHA 4KHZE 3K01A 1JVYA 3KGCA 3DP4A 5AA2A 3U92A 1FRPA 5L9SA 1Z7ME 2JJKA 3FZVA 3VVDA 5H8FB 4TLMB 5DVFA 3QSLA 1D4NA 4AS4A 4U23A 1QKAA 3M8UA 2DWHA 3ECRA 3ZKLA 4C0RA 3TDJA 4NN3A 1JW5A 4OZ9A 1JEVA 3SDFA 1SW4A 1FPLA 4PAKA 1K9ZA 4OA4A 5L9OA 4OWDA 3KJTA 4GWUA 4OVJA 3G3KA 4NX1A 1GVCA 4R75A 3U72A 2P2AA 4DLDA 1II5A 4ELOA 3LSXA 3KC1A 4X8RA 1FBDA 5DEXA 4P3LA 4XIGQ 3IOUA 1ZJLA 4RPNA 1GTKA 1H44A 5DVJA 4OFJA 3PUXE 4N4UA 4NF6A 1MM7A 3E78A 1PBQA 1NV1A 2QRYA 5EYHA 1MXWA 4FIMA 2RC8A 2H98A 1PB9A 4AQ4A 3O2AA 4NF4B 1LGBC 3N94A 3QYTA 4QBAA 3FJ7A 2ZYKA 4GBWA 2YLNA 3VLVA 2HQ0A 3V5AA 4YMBA 2UVIA 1URSA 4MBPA 2GH9A 3T0JA 2VGQA 1A99A 3QUFA 2B4LA 2RC9A 4GD5A 5K2XA 1MY4A 4IGRA 2GRVA 1SBPA 4G68C 4IR8A 2DVCA 2F78A 3OO9A 4N8GA 4UACA 3FXQA 4KCDA 2UYEA 2PVUA 3O28A 4HXVA 5ESYA 4FATA 4GL0A 5DTBA 4X9TA 3LC8A 4JVDA 1IMEA 2HFBA 3K02A 4LZ7A 3DELB 4IB2A 4C1UA 1SQYA 3A3UA 2I6EA 4F3GA 2X26A 1SW2A 3KSJA 4MF3A 4F1YA 2PBWA 1EZPA 4JSDA 1PB8A 3C33A 1MXZA 1Y20A 1TFAA 3BFUA 1JETA 3FGSA 3C35A 3TTMA 1XHYA 1PB7A 4PTKA 1N04A 3OEMA 5JTYB 1P99A 4NF4A 4FECA 1MXYA 4GF8A 1OMPA 2QMWA 2QMXA 2V25A 2XXPA 3TODA 3S9NC 3T93B 2DE4A 2CZIA 2H99A 5TPAA 2R9JA 4P0IA 5I7IA 2I3WA 2YPNA 1KA1A 2O7IA 2Q89A 1LCTA 3H6UA 2HPGA 3TMGA 3O29A 4YKPA 2Q88A 3M3FA 1BK4A 4HE2A 3OD7A 1URGA 1IEJA 5I84A 1RDYA 1EYKA 1TXFA 4QXDA 4BDLA 2PT2A 5CM6A 3UP9A 1GGGA 3TCHA 4F39A 2HXRA 2IA4A 5JEIA 1LB8A 1Y4CA 4U1ZA 1NFTA 1B4HA 5FHOA 2OJTA 4P1EA 4NWCA 4RK2A 1LSTA 2RF1A 3CFLA 1LFHA 1NV5A 4H65A 3BIGA 5DVIA 2ZZWA 4N81A 3WAFA 3CFZA
chains in the Genus database with same CATH topology
5IZ3B 4PFRA 4YICA 1FJ9A 5FBPA 4MIJA 3MYUA 3RYDA 2QVUA 4OVRA 2XXKA 3B50A 2DDKA 2PFZA 4G61A 2GQ1A 4OVSA 2FIEA 3W9WA 2WYKA 4HCYA 2ZZVA 5ET5A 1IMDA 2QPQA 1LEVA 2FIXA 1RDZA 4PGPA 3T1BA 4HE1A 1DK4A 1INPA 3KC0A 4NF0A 2VPNA 5IZZA 3SZPA 2FHYA 1FBEA 2CZKA 3CHGA 4F19A 1FBFA 2F3BA 5DW8A 1FBGA 4P8BA 4P56A 1AWBA 1DBZA 4MEVA 4HCWA 4PBQA 2DE2A 2Y5KA 4PCDA 1FPKA 2XA5A 3PTYA 4DI4B 2WBBA 4NHBA 2XWIA 4OVPA 1FBPA 2F3DA 4N6DA 3QMFA 4NGUA 3RPLB 2L5VA 5JK4A 1LBZA 4PAIA 3IFCA 1RDXA 5LDZA 4PFIA 4GWWA 4GWXA 4MJOA 4F1UA 1NV2A 4XF5A 4F18A 1LBVA 5J1DA 3BIHA 4GBVA 5IZ1A 3FBPA 4LN5A 5ET6A 4M1VA 5T3JA 1CNQA 1K9YA 2OX3A 4I3EA 2Q74A 2HZKA 4O8MA 4MNIA 4PBHA 4X04A 4PF8A 4XEQA 2QVRA 5EQ8A 1VDWA 1NI9A 4FBPA 5ET8A 4PGNA 4I40A 4MAGA 3MSTA 2QFLA 4N6KA 4MMPA 1G0IA 1FPBA 1YYZA 2XWOA 4GWSA 4P9KA 4DI3D 2WBDA 3LV0A 1FRPA 3D1RA 4PDHA 1NV0A 5EQ9A 2JJKA 2WEFA 1FSAA 2HZLA 2XWKA 3RPLA 4AS4A 4PAFA 3FXBA 4MNCA 4HE0A 4NN3A 1FPLA 2KQZA 1DCUA 1K9ZA 4PAKA 4OA4A 4PE3A 2PFYA 4GWUA 5J16A 4NX1A 2DE3A 4OANA 4PDDA 2R8TA 2WYPA 1XI6A 2P3NA 4JVIA 2P3VA 3KC1A 4X8RA 1FBDA 4P3LA 1IMAA 3U65A 1JP4A 4OVTA 1NUZA 4KXPA 1Q9DA 4N4UA 2OWZA 2Q8MA 3E78A 1NV1A 4GX6A 2MKZA 5EYHA 4P47A 4H45A 5IZ3A 5EYGA 4H46A 5EQ7A 4P1LA 1FPEA 1IMFA 4QBAA 5I5PA 4NQ8A 1D9QA 4MNPA 4GBWA 1IMBA 4O7MA 4F1VA 1FPFA 2VT5A 4GWYA 3T0JA 4PETA 1NV7A 1IMCA 2B4LA 4OVQA 2FVZA 2VPOA 2XWVA 3A29A 5IGAA 1LBWA 1G0HA 4NAPA 4GWZA 4IR8A 1NV4A 4AS5A 1FPIA 4N8GA 4MCOA 3EKIA 3LUZA 4HXVA 5ESYA 1FBCA 2WX9A 4NG7A 2HHMA 4I3YA 4X9TA 4JVDA 1IMEA 3E79A 4YZZA 1LBXA 1NUYA 1FPJA 2ZZXA 4MX6A 4PFBA 4PF6A 2B4MA 3B8BA 2V3QA 1SPIA 1EYJA 5F24A 2CEYA 2Y5LA 1EYIA 1LBYA 2KR0A 3ISPA 5LTCA 4PTKA 1KA0A 4GX4A 4JVCA 1QGXA 2BJIA 4UABA 1NV6A 2DE4A 2CZIA 1NV3A 3ROJA 5I3SA 1FPGA 4O7IA 5I7IA 1YZ0A 3HFUA 1KA1A 1FBHA 2CZHA 3KBZA 2HPGA 3GYYA 2QVVA 1BK4A 4HE2A 1FJ6A 4MHFA 3NOHA 1RDYA 1EYKA 2V4CA 5A5LA 4O94A 4QXDA 1KZ8A 4N15A 2PCRA 5EQAA 3W9VA 5CM6A 4N91A 4PC9A 1NUWA 5IM2A 2HXRA 1YXIA 4XFEA 2CEXA 2F5XA 4P1EA 4N17A 5ET7A 2DVZA 2FBPA 1NV5A 1FTAA 2Q9TA 4N8YA 3BIGA 2ZZWA 4GX3A 3IFAA 4N81A 1NUXA 1FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFR A;  3U65 A;  4OVT A;  4YIC A;  4MIJ A;  2HZK A;  4N4U A;  4O8M A;  4MNI A;  4OVR A;  4PBH A;  4X04 A;  2XXK A;  3B50 A;  2CEY A;  2PFZ A;  4P47 A;  5LTC A;  4PF8 A;  4XEQ A;  4OVS A;  2WYK A;  2ZZV A;  4UAB A;  4PGP A;  4P1L A;  4PGN A;  4MAG A;  5I5P A;  4N6K A;  4MMP A;  4NQ8 A;  4NF0 A;  2VPN A;  4MNP A;  5IZZ A;  2XWO A;  5I7I A;  4P9K A;  4O7M A;  4DI3 D;  4PET A;  4P8B A;  2HPG A;  4P56 A;  3GYY A;  4PDH A;  4MEV A;  4OVQ A;  4PBQ A;  2VPO A;  2XWV A;  4MHF A;  4PCD A;  5IGA A;  2XA5 A;  2HZL A;  2V4C A;  4DI4 B;  4NHB A;  4O94 A;  2XWK A;  4N15 A;  2XWI A;  4OVP A;  4NAP A;  4N6D A;  4PAF A;  4NGU A;  5CM6 A;  4N8G A;  3FXB A;  4MNC A;  4N91 A;  4PC9 A;  4MCO A;  5IM2 A;  4PAI A;  4NN3 A;  4PAK A;  4XFE A;  2CEX A;  2WX9 A;  4OA4 A;  4NG7 A;  4PE3 A;  4PFI A;  2PFY A;  4NX1 A;  4XF5 A;  4P1E A;  4YZZ A;  4OAN A;  4N17 A;  4PDD A;  2WYP A;  2ZZX A;  4MX6 A;  4N8Y A;  4PFB A;  4LN5 A;  2ZZW A;  4X8R A;  4P3L A;  4PF6 A; 
#chains in the Genus database with same CATH topology
 4KPT A;  4GVO A;  3UA8 A;  3RYD A;  4PP0 A;  1MPD A;  2XXK A;  2DDK A;  3VVF A;  4EUO A;  2PFZ A;  3C31 A;  3K4U A;  4PFW A;  2NWJ A;  3B6Q A;  4OVS A;  2FIE A;  2H25 A;  5JTY A;  5IAI A;  1R1N A;  2DQV A;  4GFR A;  4DIG A;  4LQ2 A;  4PFY A;  1IMD A;  2XD3 A;  5B7D A;  3KOT A;  2FIX A;  3FAS A;  3T1B A;  4U1O A;  3LBS A;  4HE1 A;  3CR9 A;  1QUL A;  3CSB A;  1DK4 A;  3H6W A;  1B5I A;  5IKB A;  2FHY A;  1FBE A;  2QS3 A;  4EF2 A;  1FBF A;  2F3B A;  5DW8 A;  1B32 A;  4R74 A;  1LBC A;  1MPB A;  3PD8 A;  1S9T A;  4QFK A;  4R6H A;  5L9M A;  4PBQ A;  3VLW A;  2XA5 A;  4R9F A;  4NHB A;  4DE8 A;  1QUI A;  2XWI A;  4OVP A;  3GBB A;  2F7A A;  1B1X A;  2L5V A;  5JK4 A;  4QFN A;  1LAH E;  3IFC A;  3GLB A;  3KBR A;  3DM0 A;  1H76 A;  5FHM A;  4F1U A;  4P0G A;  4F18 A;  3IL1 B;  4QSE A;  3AXF A;  4OYV A;  4H5F A;  5BUU A;  1YCJ A;  3BIH A;  4GBV A;  1I6B A;  4BDN A;  4NF8 B;  1H45 A;  1CNQ A;  3PPP A;  1K9Y A;  4YKK A;  4U4S A;  2V3T A;  3SER A;  1FQD A;  3N26 A;  1IIW A;  4BDO A;  4OXV A;  2HZK A;  1I6A A;  4MNI A;  1BP5 A;  4X04 A;  1ZMG A;  4XXU A;  3ILT B;  3MP1 A;  4KCC A;  2D21 A;  3CI8 A;  4GIZ A;  1NNF A;  5CMM A;  4PF8 A;  4XEQ A;  2THI A;  2QVR A;  5EQ8 A;  3UN6 A;  3HST A;  1ZKB A;  4BDM A;  1MY1 A;  4OMB A;  4FEB A;  5ET8 A;  1CE2 A;  4U22 A;  4IO4 A;  2Y7I A;  5AE4 A;  3MST A;  4LZ5 A;  2XX8 A;  2RKM A;  1S7Y A;  4GWO A;  1I6Q A;  1P1W A;  3B6W A;  3L6G A;  1UIU A;  4WXJ A;  1BKA A;  2XWO A;  1EZO A;  1L5T A;  4ELP A;  1MQH A;  3SEY A;  4DI3 D;  2NUV A;  1JNF A;  3S4U A;  3LSL A;  1B7H A;  1NNP A;  3H03 A;  4DCY A;  3VE1 B;  3D1R A;  4PDH A;  1NV0 A;  2OBG A;  1NMU A;  4MH5 A;  2PMS A;  3H06 B;  1ZIU A;  2UVH A;  1US5 A;  4KI0 E;  2HZL A;  4YKJ A;  4PAF A;  3RUM A;  3IX1 A;  4IY6 A;  3PMW A;  1QJM A;  3DLN A;  3FV2 A;  1Y3P A;  1T0K A;  2KQZ A;  2W7Y A;  1DCU A;  4OEV A;  4GQO A;  3R26 A;  3E3K A;  1OIB A;  1PBP A;  1B3H A;  3MVY A;  4OAN A;  1M5B A;  2R8T A;  4OEN A;  4RPO A;  2G29 A;  4NF8 A;  3R6U A;  1MY3 A;  2CMO A;  2PT1 A;  1ATG A;  1AOV A;  4DCX A;  1JP4 A;  1NUZ A;  1BTJ A;  4I8C A;  4DXB A;  4EXL A;  3MPK A;  1Q9D A;  4NE4 A;  2OWZ A;  1JW1 A;  1Z7N E;  4N13 A;  3SEV A;  4QSC A;  2MKZ A;  4H45 A;  3PUY E;  3IB1 A;  3VXC A;  1I69 A;  5KDT B;  1QUJ A;  4OQO A;  3G3F A;  4GL8 A;  1H3D A;  2AL4 A;  1A55 A;  4H46 A;  4H8I A;  3MVW A;  4DZ1 A;  4H1X A;  5I5P A;  5F1Q A;  4NQ8 A;  1D9Q A;  2CZL A;  1JQF A;  5H8N B;  2B3B A;  1B58 A;  4Z7E A;  2OCU A;  4EQ7 A;  4TOZ A;  1XOC A;  3OOA A;  2XXX A;  3MVX A;  1FPF A;  1RYO A;  4GWY A;  1NV7 A;  4QFO A;  1VFD A;  4FOR A;  2FVZ A;  3RT6 B;  4QSD A;  4OTE A;  2XWV A;  2PYY A;  1HSJ A;  1MH4 A;  2FA7 A;  1LBW A;  3IOR A;  1NV4 A;  2O84 X;  3SEX A;  2XXU A;  3IK6 B;  4JB7 A;  3C36 A;  3ILU B;  3KZG A;  1PDA A;  4IY5 A;  3K6U A;  3THI A;  3OXN A;  1HSL A;  2XXY A;  5CMK A;  1BIY A;  1FQF A;  2XXV A;  4R72 A;  3O66 A;  5DT6 A;  4JSO A;  1NUY A;  1FPJ A;  2ZZX A;  3G3H A;  2ONR A;  1OVT A;  2P1S A;  4RYA A;  4MX6 A;  4PFB A;  3PU5 A;  4IO6 A;  3RN8 A;  5TP9 B;  1FTM A;  1UIV A;  3EHU A;  4PF6 A;  1MY0 A;  1FTL A;  2B4M A;  1ANF A;  4HW8 A;  3VDF A;  2V3Q A;  2Z22 A;  1B40 A;  3MAM A;  2Y5L A;  2Q2A A;  5KDT A;  2RCA A;  1R9Q A;  3L6H A;  1KA0 A;  4ELQ A;  2O1L A;  2R6G E;  1VSO A;  4GX4 A;  4JVC A;  2XX9 A;  3N6T A;  3TZA A;  2XX7 A;  1NH7 A;  5H8N A;  1URD A;  2F34 A;  1FTO A;  3KJ7 A;  4Q5T A;  4XKP A;  2ONS A;  2E1S A;  2CZH A;  3KBZ A;  4YMA A;  2VP1 A;  3E4R A;  4ZE8 A;  4DXC A;  3T96 B;  3H4Z A;  4RXL A;  1N3X A;  1LLS A;  1MM6 A;  4FJP A;  4FE8 A;  1FJ6 A;  4G68 B;  4MHF A;  3IO6 A;  1MXV A;  4UA8 A;  2X7Q A;  1KZ8 A;  4NED A;  2B3F A;  2HAV A;  5A5X B;  2QSX A;  1AIV A;  3SKP A;  3TCG A;  1NUW A;  4R2F A;  1YXI A;  4GOT A;  4JWO A;  1M5D A;  3U94 A;  4WED A;  3S9L C;  1M5E A;  4G4P A;  5H8F A;  5ISU A;  1AL3 A;  5ET7 A;  5HM4 B;  3GBA A;  3G3G A;  5TP9 A;  3FVO A;  2NXO A;  2Q9T A;  2RC7 A;  3CVG A;  1IXI A;  4GX3 A;  3IFA A;  1NUX A;  1FPD A;  2UVG A;  1HSE A;  3FVG A;  5IZ3 B;  4PFR A;  4I1D A;  2ZNT A;  4H6D A;  4X48 A;  4FAJ A;  1TT1 A;  3DP8 A;  4OVR A;  2O1M A;  3M3K A;  4ZZE A;  4G61 A;  3HO7 A;  3EN3 A;  3RQT A;  5CBS A;  4Z0I A;  4HCY A;  5B70 A;  1YTV A;  1F9B A;  3K6X A;  1N7X A;  1SW1 A;  3IB0 A;  1LEV A;  3JV9 A;  3FUZ A;  3K2D A;  5L8D A;  4M4G A;  5I56 B;  4WKM A;  1H43 A;  1N76 A;  3H6V A;  4F2O A;  3SZP A;  2CZK A;  3TEP A;  1FBG A;  1FQC A;  2F7C A;  3G7W A;  2H9B A;  3RLF E;  3BKI B;  4G68 A;  1DBZ A;  1A8F A;  1P1U A;  3FXR A;  5A5X A;  2V93 A;  2F3D A;  3QMF A;  4U4X A;  3RPL B;  2I0B A;  1MY2 A;  2RCB A;  4PAI A;  1GR2 A;  1XT8 A;  2HCA A;  5LDZ A;  1FW0 A;  3CG3 A;  3KN7 A;  1CB6 A;  4GWX A;  1SDX A;  4MJO A;  5CRY A;  1IIT A;  2AYS A;  4XF5 A;  4PQJ A;  5CMB A;  1XVX A;  1AMF A;  1B7Z A;  3B7D A;  3TQL A;  4ESX A;  3R7X A;  1LBV A;  3H7M A;  3UGW A;  5IZ1 A;  5CMC A;  3EPE A;  1XC1 A;  1PEB A;  5ET6 A;  2REG A;  2V84 A;  2ALU A;  1J1N A;  1JW4 A;  3K0V A;  4EDP A;  2H4I A;  4YB7 A;  2FYI A;  4ELR A;  2ONK E;  4KD5 A;  4R73 A;  3S9M C;  2F97 A;  4ECF A;  4JDF A;  3MP6 A;  4BLA A;  2ZYM A;  2P0S A;  3HHG A;  4OFO A;  5I59 B;  3C34 A;  1IXG A;  1EU8 A;  1NNT A;  3Q25 A;  4PE5 B;  5I56 A;  1DPE A;  3TEL A;  2OZZ A;  4F29 A;  1MDP 1;  2ABH A;  2QFL A;  3H6T A;  1FPB A;  2XD2 A;  4MLV A;  1D9Y A;  4GWS A;  4P9K A;  3MVZ A;  3D4G A;  1SI0 A;  2XXI A;  2WBD A;  3IAZ A;  3V83 A;  4XKN A;  1N84 A;  3LV0 A;  4QFL A;  1GV8 A;  5EQ9 A;  3HV1 A;  4EXK A;  4O3C A;  1D3K A;  1US4 A;  3T9H B;  2XWK A;  3RPL A;  2DSF A;  2D5W A;  5AA4 B;  1Y4T A;  4R9G A;  1B05 A;  4MNC A;  4HE0 A;  1LAG E;  3OO6 A;  3ZSF A;  1Y3Q A;  3IOT A;  2PFY A;  4IO7 A;  3RPW A;  5J16 A;  3PV0 E;  4JBZ A;  2R71 A;  4DXU A;  4PDD A;  1XI6 A;  1MDQ A;  2P3N A;  4U21 A;  4BDQ A;  2P3V A;  4ZEB A;  2O69 A;  3OEK A;  4LAT A;  1IMA A;  3U65 A;  4OVT A;  4ZEC A;  5FTI A;  4KXP A;  2B65 A;  2Y7K A;  3HN0 A;  1B3E A;  2DYX A;  1SI1 A;  4GX6 A;  2I4C A;  5I2K B;  4GXA A;  4R6K A;  4WEP A;  5I59 A;  2KLF A;  4ONY A;  5EYG A;  2VD3 A;  4G2Z A;  4P1L A;  1SD3 A;  3N6U A;  1IMF A;  1ZBM A;  3USD A;  4E0W A;  1NH8 A;  1M5F A;  3H3G A;  4MNP A;  1IXC A;  3OSQ A;  1FTK A;  3QXM A;  1MQI A;  2QS4 A;  4ZE9 A;  4Q30 B;  4F1V A;  2VT5 A;  3GXA A;  3Q28 A;  4PET A;  2VOZ A;  3VLU A;  1IMC A;  3F11 A;  5FTH A;  4KFQ A;  1DMB A;  2I48 A;  3MC2 A;  2ZNS A;  4OVQ A;  2VPO A;  4KR5 A;  3A29 A;  5AA4 A;  3K1M A;  3V89 B;  2O6A A;  3IB2 A;  4GWZ A;  4AS5 A;  3OO8 A;  1FPI A;  1Y9U A;  5EYF A;  4MCO A;  3QIM A;  2F6G A;  3EKI A;  3K1N A;  4NMY A;  4ZEK A;  3LUZ A;  4Q8R A;  1FBC A;  2D3I A;  3MBP A;  3FVN A;  2HHM A;  4I3Y A;  5ELV A;  2Q8J A;  1D9V A;  3JZJ A;  4YZZ A;  3KFM A;  4LP2 B;  1LBX A;  1B7U A;  2UXA A;  1MH3 A;  1Y1Z A;  3S9E A;  3TYH A;  5BWJ A;  4THI A;  2NVU B;  3SES A;  4LUB A;  4POW A;  3VFJ A;  2I4B A;  3B8B A;  1SPI A;  1O7T A;  3E9X A;  1MQJ A;  2O51 A;  1EYJ A;  3MW0 A;  5I2K A;  3O97 A;  2CEY A;  5H8S A;  2ESN A;  1S50 A;  1LBY A;  1FQE A;  4RY1 A;  3ISP A;  5LTC A;  2DWJ A;  1UTH B;  2UYF A;  2BJI A;  4X1B A;  1NV6 A;  2AL5 A;  1EH3 A;  3RGY A;  3K6W A;  4G8H A;  3ROJ A;  2PX1 A;  3UK4 A;  2Z8E A;  3I5O A;  1FPG A;  2QJE A;  3E13 X;  1YZ0 A;  2GHB A;  2E0S A;  1SYH A;  5H8H B;  2VD2 A;  1DPP A;  3U8Q A;  1LAF E;  3U93 A;  5LOM A;  3LR1 A;  2Z8D A;  1A8E A;  2V4C A;  5A5L A;  3FD3 A;  1OQG A;  2PCR A;  1B52 A;  5EQA A;  2FNC A;  3OO7 A;  4K3F A;  3OSR A;  3TKD A;  2VHA A;  4N91 A;  3W9V A;  4PC9 A;  4ZED A;  5I57 B;  4U2R A;  3ZKK A;  4ESW A;  1IXH A;  5M2V A;  3K1P A;  4XFE A;  1XVY A;  2CEX A;  3G3J A;  1ELJ A;  3RY3 A;  1B6H A;  3T9V A;  4OFL A;  4IO2 A;  3FXU A;  5KCJ B;  1B4Z A;  1PC3 A;  2OK2 A;  4R2B A;  3PPQ A;  1IZ1 A;  4N8Y A;  3FV1 A;  1B51 A;  2H5Y A;  3RNN A;  3IR1 A;  1FJ9 A;  2WKY A;  1ZLQ A;  1VFE A;  3MYU A;  2QVU A;  3PMV A;  3CSG A;  1MRP A;  3TQW A;  1POY 1;  2WYK A;  3TPA A;  1IUD A;  3T22 A;  4POX A;  1QVS A;  1YAE A;  3U1O A;  3PGF A;  3MJN A;  1M5C A;  3GZG A;  2AIX A;  1INP A;  4ISU A;  1ZTY A;  4EQ9 A;  2OWS A;  3CFX A;  3FJG A;  5H8H A;  4F19 A;  2XXQ A;  3BFT A;  1Q35 A;  4HS7 A;  4P8B A;  4P56 A;  4IGT A;  3KG2 A;  4HCW A;  2UVJ A;  2Y5K A;  3PTY A;  1DSN A;  2QS1 A;  1B46 A;  2I3V A;  3FVK A;  3IOW A;  1MG1 A;  4FED A;  3HPI A;  4DI4 B;  4RNS A;  1AH5 A;  3M3L A;  3MZ9 A;  1A40 A;  3Q26 A;  5I57 A;  5H8Q B;  1FBP A;  4YU0 A;  4N6D A;  3CIJ A;  4NGU A;  1LAX A;  1DOT A;  3UIF A;  1LBZ A;  3TCF A;  2LAO A;  3O6H A;  3FIR A;  3RTW B;  2DS9 A;  1XS5 A;  1SW5 A;  4PFI A;  4N07 A;  4GWW A;  2ANJ A;  5KCJ A;  2Z8F A;  2BJJ X;  1NV2 A;  2GFE A;  4RK9 A;  4ZEI A;  4F3P A;  5J1D A;  4LQ5 A;  4R6Y A;  4RA1 A;  3FBP A;  4G8N A;  4LVQ A;  2Y84 A;  1B0H A;  3PPN A;  2OX3 A;  1A7L A;  4XKR A;  4XTC Q;  4OEU A;  4PFT A;  4ZEF A;  3WAE A;  2HXW A;  5ICT A;  2O7U A;  5TPA B;  4EQB A;  5TU0 A;  2DWA A;  2I58 A;  3KOS A;  1VDW A;  3FAT A;  4FBP A;  2F6P A;  3HCQ A;  1A54 A;  1WVJ A;  1RYX A;  1MQG A;  2OWT A;  4MMP A;  2RIN A;  1YYZ A;  1QW0 A;  3PD9 A;  5CBR A;  3EHS A;  2QL3 A;  1DTZ A;  1SVX B;  2HEU A;  1MS7 A;  3T66 A;  1VE4 A;  1JEU A;  2WEF A;  1FSA A;  1FQA A;  5H8Q A;  1B3G A;  1RKM A;  3V8X B;  2NOO A;  3FXB A;  3N5L A;  1OLC A;  1N0T A;  1R9L A;  5AA1 A;  4I62 A;  3MPL A;  3PMX A;  4PE3 A;  3VVE A;  5I58 B;  2DE3 A;  4ZDM A;  4YKI A;  1OQH A;  4AB6 A;  2WYP A;  4YB5 A;  5EHM A;  3OEL A;  4JVI A;  3SEW A;  4H8J A;  2YJP A;  4KYD A;  3EQ1 A;  1QKB A;  4KYS A;  4I9D A;  1B5H A;  5F7V A;  3KEI A;  1P1N A;  3HHF A;  3C4M A;  5CI5 A;  1NKX A;  3IOV A;  1LFG A;  2Y7R A;  2Q8M A;  3EF7 A;  4OET A;  4P47 A;  3MP8 A;  4GXS B;  3PUW E;  3I6V A;  5IZ3 A;  1FQB A;  3TUS A;  4G77 A;  4LON B;  5EQ7 A;  3FJM A;  1FPE A;  3B6T A;  2OLB A;  3C9H A;  1VR5 A;  1LBB A;  3S2V A;  4IO3 A;  2ZNU A;  1KWH A;  1EZ9 A;  4F3B A;  1IMB A;  4O7M A;  1IQ7 A;  3PUV E;  5AA2 D;  3KSX A;  1Y3N A;  1UTB B;  2A5T B;  5KZT A;  5DYH A;  3A3C A;  1POT A;  3OMB A;  3K6V A;  4JWY A;  2XXH A;  5IGA A;  1MPC A;  5HBC A;  3ONM A;  5FHN A;  1G0H A;  4NAP A;  3PPR A;  3PUZ E;  3I3V A;  3UOR A;  3MUQ A;  4H0W A;  3O6G A;  4GLI A;  4O3A A;  4F31 B;  2F35 A;  4NF5 B;  2WX9 A;  2X7P A;  5I58 A;  4NG7 A;  3LSW A;  4YAH X;  3IO4 A;  3E79 A;  1Q1K A;  2DWI A;  4PFU A;  3CG1 A;  3MZB A;  2Y7W A;  2IEE A;  5AA3 A;  2DP8 A;  3KN3 A;  4MFI A;  3TTL A;  1OLA A;  5I2N B;  4IO5 A;  2V3U A;  5F24 A;  5K2Y A;  1EYI A;  4C1T A;  2KR0 A;  1BLF A;  4XKQ A;  1JVX A;  4OER A;  4YB6 A;  2GHA A;  2A5S A;  1QGX A;  2XHD A;  1N7W A;  4TLL B;  4UAB A;  4O3B A;  3CRB A;  1Y1M A;  3LSF B;  1P1O A;  1NV3 A;  1B3F A;  5I3S A;  1LFI A;  4ND9 A;  3T9U A;  2Z23 A;  4O7I A;  1UQW A;  3HFU A;  1UTB A;  2A5T A;  1FBH A;  3G3I A;  3ODB A;  4BDR A;  4OES A;  1NL5 A;  3QUJ A;  2DXR A;  3K00 A;  3GYY A;  2QVV A;  4F2Q A;  3NOH A;  4O94 A;  3ZS6 A;  4N15 A;  1ZU0 A;  4RJZ A;  1LB9 A;  2REJ A;  5IM2 A;  4NF5 A;  3SEU A;  3C32 A;  2F5X A;  4QFP A;  1B2H A;  4MLQ A;  4N17 A;  3RTF B;  1USY E;  4JXI A;  1TFD A;  4L17 A;  2DVZ A;  1WOD A;  2FBP A;  2F7B A;  1FTA A;  1QUK A;  4F3S A;  4X1D A;  3SET A;  4YIC A;  4HTG A;  5I2N A;  1O63 A;  5FBP A;  4MIJ A;  4H67 A;  3B50 A;  2F36 A;  2ZYN A;  1USY H;  4F22 A;  2GQ1 A;  3W9W A;  3O9P A;  1B1H A;  3MWB A;  2I0C A;  2ZZV A;  4TQU Q;  3TTK A;  5ET5 A;  5CC2 A;  4QF9 A;  2QPQ A;  1R6Z A;  1RDZ A;  5HPQ A;  4PGP A;  3Q29 A;  4NTL A;  4DDD A;  4ZS9 A;  3RT8 A;  1MXX A;  4QHQ A;  3KC0 A;  4NF0 A;  2G93 A;  1O64 A;  3TTN A;  1MQD A;  2VPN A;  3MZ1 A;  4AB5 A;  4KYE A;  3LUY A;  5IZZ A;  1OVB A;  3T9X B;  3CHG A;  1B9J A;  4E0X A;  1FTJ A;  5AA2 B;  4N6P A;  1AWB A;  4MEV A;  4KQP A;  4Q0C A;  3KN8 A;  4ZZA A;  2ZYO A;  2DE2 A;  3TTR A;  4PCD A;  3O6I A;  1FPK A;  2O68 A;  3VXB A;  3IJO B;  3VV5 A;  1B5J A;  3MQ9 A;  2WBB A;  2XXT A;  3DP6 A;  3QAX A;  3BBR A;  4H5G A;  1DTG A;  3IJX B;  1RDX A;  1B3L A;  2HAU A;  1MXU A;  3TAJ A;  1P1Q A;  3P7I A;  2ZMB A;  2QS2 A;  4QRZ A;  1WDN A;  3A09 A;  3EHT A;  3JYR A;  2I49 A;  3D4C A;  1YPN A;  2DOJ A;  4LN5 A;  3QK6 A;  4M1V A;  2ZXT A;  5T3J A;  2Q2C A;  5EHS A;  3OEN A;  3TFL A;  5DEX B;  1N3W A;  4I3E A;  2Q74 A;  4GRK A;  4OHN A;  4O8M A;  5ITO A;  4PBH A;  1FCK A;  3W15 C;  5ICQ A;  4JWX A;  4NF6 B;  1B0L A;  4NWD A;  3PPO A;  2DXY A;  1NI9 A;  2XXR A;  1TWY A;  4LZ8 A;  4EF1 A;  5ITP A;  1SYI A;  4PGN A;  4I40 A;  4LA9 A;  4MAG A;  2M8C A;  2F8D A;  4N6K A;  4G8M A;  1G0I A;  2Y7P A;  1LCF A;  1NNK A;  4P11 A;  3Q27 A;  2XXW A;  1UTH A;  4KHZ E;  3K01 A;  1JVY A;  3KGC A;  3DP4 A;  5AA2 A;  3U92 A;  1FRP A;  5L9S A;  1Z7M E;  2JJK A;  3FZV A;  3VVD A;  5H8F B;  4TLM B;  5DVF A;  3QSL A;  1D4N A;  4AS4 A;  4U23 A;  1QKA A;  3M8U A;  2DWH A;  3ECR A;  3ZKL A;  4C0R A;  3TDJ A;  4NN3 A;  1JW5 A;  4OZ9 A;  1JEV A;  3SDF A;  1SW4 A;  1FPL A;  4PAK A;  1K9Z A;  4OA4 A;  5L9O A;  4OWD A;  3KJT A;  4GWU A;  4OVJ A;  3G3K A;  4NX1 A;  1GVC A;  4R75 A;  3U72 A;  2P2A A;  4DLD A;  1II5 A;  4ELO A;  3LSX A;  3KC1 A;  4X8R A;  1FBD A;  5DEX A;  4P3L A;  4XIG Q;  3IOU A;  1ZJL A;  4RPN A;  1GTK A;  1H44 A;  5DVJ A;  4OFJ A;  3PUX E;  4N4U A;  4NF6 A;  1MM7 A;  3E78 A;  1PBQ A;  1NV1 A;  2QRY A;  5EYH A;  1MXW A;  4FIM A;  2RC8 A;  2H98 A;  1PB9 A;  4AQ4 A;  3O2A A;  4NF4 B;  1LGB C;  3N94 A;  3QYT A;  4QBA A;  3FJ7 A;  2ZYK A;  4GBW A;  2YLN A;  3VLV A;  2HQ0 A;  3V5A A;  4YMB A;  2UVI A;  1URS A;  4MBP A;  2GH9 A;  3T0J A;  2VGQ A;  1A99 A;  3QUF A;  2B4L A;  2RC9 A;  4GD5 A;  5K2X A;  1MY4 A;  4IGR A;  2GRV A;  1SBP A;  4G68 C;  4IR8 A;  2DVC A;  2F78 A;  3OO9 A;  4N8G A;  4UAC A;  3FXQ A;  4KCD A;  2UYE A;  2PVU A;  3O28 A;  4HXV A;  5ESY A;  4FAT A;  4GL0 A;  5DTB A;  4X9T A;  3LC8 A;  4JVD A;  1IME A;  2HFB A;  3K02 A;  4LZ7 A;  3DEL B;  4IB2 A;  4C1U A;  1SQY A;  3A3U A;  2I6E A;  4F3G A;  2X26 A;  1SW2 A;  3KSJ A;  4MF3 A;  4F1Y A;  2PBW A;  1EZP A;  4JSD A;  1PB8 A;  3C33 A;  1MXZ A;  1Y20 A;  1TFA A;  3BFU A;  1JET A;  3FGS A;  3C35 A;  3TTM A;  1XHY A;  1PB7 A;  4PTK A;  1N04 A;  3OEM A;  5JTY B;  1P99 A;  4NF4 A;  4FEC A;  1MXY A;  4GF8 A;  1OMP A;  2QMW A;  2QMX A;  2V25 A;  2XXP A;  3TOD A;  3S9N C;  3T93 B;  2DE4 A;  2CZI A;  2H99 A;  5TPA A;  2R9J A;  4P0I A;  5I7I A;  2I3W A;  2YPN A;  1KA1 A;  2O7I A;  2Q89 A;  1LCT A;  3H6U A;  2HPG A;  3TMG A;  3O29 A;  4YKP A;  2Q88 A;  3M3F A;  1BK4 A;  4HE2 A;  3OD7 A;  1URG A;  1IEJ A;  5I84 A;  1RDY A;  1EYK A;  1TXF A;  4QXD A;  4BDL A;  2PT2 A;  5CM6 A;  3UP9 A;  1GGG A;  3TCH A;  4F39 A;  2HXR A;  2IA4 A;  5JEI A;  1LB8 A;  1Y4C A;  4U1Z A;  1NFT A;  1B4H A;  5FHO A;  2OJT A;  4P1E A;  4NWC A;  4RK2 A;  1LST A;  2RF1 A;  3CFL A;  1LFH A;  1NV5 A;  4H65 A;  3BIG A;  5DVI A;  2ZZW A;  4N81 A;  3WAF A;  3CFZ A; 
#chains in the Genus database with same CATH homology
 5IZ3 B;  4PFR A;  4YIC A;  1FJ9 A;  5FBP A;  4MIJ A;  3MYU A;  3RYD A;  2QVU A;  4OVR A;  2XXK A;  3B50 A;  2DDK A;  2PFZ A;  4G61 A;  2GQ1 A;  4OVS A;  2FIE A;  3W9W A;  2WYK A;  4HCY A;  2ZZV A;  5ET5 A;  1IMD A;  2QPQ A;  1LEV A;  2FIX A;  1RDZ A;  4PGP A;  3T1B A;  4HE1 A;  1DK4 A;  1INP A;  3KC0 A;  4NF0 A;  2VPN A;  5IZZ A;  3SZP A;  2FHY A;  1FBE A;  2CZK A;  3CHG A;  4F19 A;  1FBF A;  2F3B A;  5DW8 A;  1FBG A;  4P8B A;  4P56 A;  1AWB A;  1DBZ A;  4MEV A;  4HCW A;  4PBQ A;  2DE2 A;  2Y5K A;  4PCD A;  1FPK A;  2XA5 A;  3PTY A;  4DI4 B;  2WBB A;  4NHB A;  2XWI A;  4OVP A;  1FBP A;  2F3D A;  4N6D A;  3QMF A;  4NGU A;  3RPL B;  2L5V A;  5JK4 A;  1LBZ A;  4PAI A;  3IFC A;  1RDX A;  5LDZ A;  4PFI A;  4GWW A;  4GWX A;  4MJO A;  4F1U A;  1NV2 A;  4XF5 A;  4F18 A;  1LBV A;  5J1D A;  3BIH A;  4GBV A;  5IZ1 A;  3FBP A;  4LN5 A;  5ET6 A;  4M1V A;  5T3J A;  1CNQ A;  1K9Y A;  2OX3 A;  4I3E A;  2Q74 A;  2HZK A;  4O8M A;  4MNI A;  4PBH A;  4X04 A;  4PF8 A;  4XEQ A;  2QVR A;  5EQ8 A;  1VDW A;  1NI9 A;  4FBP A;  5ET8 A;  4PGN A;  4I40 A;  4MAG A;  3MST A;  2QFL A;  4N6K A;  4MMP A;  1G0I A;  1FPB A;  1YYZ A;  2XWO A;  4GWS A;  4P9K A;  4DI3 D;  2WBD A;  3LV0 A;  1FRP A;  3D1R A;  4PDH A;  1NV0 A;  5EQ9 A;  2JJK A;  2WEF A;  1FSA A;  2HZL A;  2XWK A;  3RPL A;  4AS4 A;  4PAF A;  3FXB A;  4MNC A;  4HE0 A;  4NN3 A;  1FPL A;  2KQZ A;  1DCU A;  1K9Z A;  4PAK A;  4OA4 A;  4PE3 A;  2PFY A;  4GWU A;  5J16 A;  4NX1 A;  2DE3 A;  4OAN A;  4PDD A;  2R8T A;  2WYP A;  1XI6 A;  2P3N A;  4JVI A;  2P3V A;  3KC1 A;  4X8R A;  1FBD A;  4P3L A;  1IMA A;  3U65 A;  1JP4 A;  4OVT A;  1NUZ A;  4KXP A;  1Q9D A;  4N4U A;  2OWZ A;  2Q8M A;  3E78 A;  1NV1 A;  4GX6 A;  2MKZ A;  5EYH A;  4P47 A;  4H45 A;  5IZ3 A;  5EYG A;  4H46 A;  5EQ7 A;  4P1L A;  1FPE A;  1IMF A;  4QBA A;  5I5P A;  4NQ8 A;  1D9Q A;  4MNP A;  4GBW A;  1IMB A;  4O7M A;  4F1V A;  1FPF A;  2VT5 A;  4GWY A;  3T0J A;  4PET A;  1NV7 A;  1IMC A;  2B4L A;  4OVQ A;  2FVZ A;  2VPO A;  2XWV A;  3A29 A;  5IGA A;  1LBW A;  1G0H A;  4NAP A;  4GWZ A;  4IR8 A;  1NV4 A;  4AS5 A;  1FPI A;  4N8G A;  4MCO A;  3EKI A;  3LUZ A;  4HXV A;  5ESY A;  1FBC A;  2WX9 A;  4NG7 A;  2HHM A;  4I3Y A;  4X9T A;  4JVD A;  1IME A;  3E79 A;  4YZZ A;  1LBX A;  1NUY A;  1FPJ A;  2ZZX A;  4MX6 A;  4PFB A;  4PF6 A;  2B4M A;  3B8B A;  2V3Q A;  1SPI A;  1EYJ A;  5F24 A;  2CEY A;  2Y5L A;  1EYI A;  1LBY A;  2KR0 A;  3ISP A;  5LTC A;  4PTK A;  1KA0 A;  4GX4 A;  4JVC A;  1QGX A;  2BJI A;  4UAB A;  1NV6 A;  2DE4 A;  2CZI A;  1NV3 A;  3ROJ A;  5I3S A;  1FPG A;  4O7I A;  5I7I A;  1YZ0 A;  3HFU A;  1KA1 A;  1FBH A;  2CZH A;  3KBZ A;  2HPG A;  3GYY A;  2QVV A;  1BK4 A;  4HE2 A;  1FJ6 A;  4MHF A;  3NOH A;  1RDY A;  1EYK A;  2V4C A;  5A5L A;  4O94 A;  4QXD A;  1KZ8 A;  4N15 A;  2PCR A;  5EQA A;  3W9V A;  5CM6 A;  4N91 A;  4PC9 A;  1NUW A;  5IM2 A;  2HXR A;  1YXI A;  4XFE A;  2CEX A;  2F5X A;  4P1E A;  4N17 A;  5ET7 A;  2DVZ A;  2FBP A;  1NV5 A;  1FTA A;  2Q9T A;  4N8Y A;  3BIG A;  2ZZW A;  4GX3 A;  3IFA A;  4N81 A;  1NUX A;  1FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...