1H45A

R210g n-terminal lobe human lactoferrin
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
RRRSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLDWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIGESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords LACTOFERRIN
publication title "Dilysine Trigger" in Transferrins Probed by Mutagenesis of Lactoferrin: Crystal Structures of the R210G, R210E, and R210L Mutants of Human Lactoferrin
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2002-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h45A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h45A02
4YICA 1LCFA 3CG1A 3ZKKA 1PDAA 4YMAA 1FTOA 1T0KA 5TU0A 2XXIA 2GHAA 4RXLA 3C34A 2G29A 3RN8A 4HW8A 3CSBA 2D5WA 3PPPA 4QFLA 5TPAA 1A8FA 3MPKA 4ESWA 3E3KA 5M2VA 1QUJA 3PUVE 3EHUA 4R2FA 1QULA 5I56A 1GTKA 2E1SA 4OESA 3EQ1A 3OD7A 1MDQA 4ISUA 1I6QA 4G77A 1XOCA 1TWYA 5DEXA 5JTYB 2FNCA 2VP1A 3GBAA 1Y1MA 5CBRA 1POTA 1FTKA 3IO4A 3TCGA 3K4UA 4F19A 2IA4A 3IB2A 3TZAA 1R9QA 5JEIA 1JNFA 2XD2A 2G93A 3TYHA 3CG3A 4K3FA 4LQ5A 4PFUA 2M8CA 5ICQA 4MFIA 3SKPA 4ZZAA 2XD3A 1MY3A 4H8IA 2Y7IA 4EF1A 3LC8A 1N04A 2ONRA 4DXCA 4GD5A 1MXWA 4GLIA 4KD5A 1L5TA 4FE8A 1M5CA 2ZNUA 3ECRA 1DSNA 3IB0A 3QUFA 4NWDA 2OZZA 4G8HA 3T22A 3HPIA 1BTJA 2GH9A 2UYFA 3TTLA 2DWIA 5I58A 2X7QA 1CE2A 4KYSA 3MAMA 4NE4A 2B3BA 1LFGA 3HCQA 3MP1A 1PBPA 3RPWA 2F36A 4LQ2A 2DOJA 2GFEA 4G2ZA 2NWJA 4Q30B 3FIRA 1NFTA 2Q89A 2Y7KA 2VD2A 4JBZA 2O6AA 4FEBA 3UA8A 4LZ5A 5KCJA 5DVIA 4YB5A 1B40A 3O2AA 2CZLA 1MH4A 4ELOA 3KN7A 4DXBA 3G3GA 4GQOA 2O69A 1Y3NA 4KCDA 1PC3A 5H8HB 1LFHA 3ILTB 4ELRA 3O66A 3VXCA 1MXXA 4LUBA 3ZS6A 3MP6A 4PFWA 2DXRA 1GV8A 2D3IA 3S2VA 1ZJLA 4MH5A 3CFZA 4JWOA 4JWXA 1JEVA 4ECFA 4DCYA 1ATGA 3A3CA 4XIGQ 3VLWA 1OMPA 3LBSA 4ZECA 4U2RA 2ZNSA 3MWBA 1JVXA 1Y1ZA 5DVJA 3H3GA 1M5DA 3D4CA 2DP8A 2XX7A 1MDP1 3IORA 2RC9A 4DZ1A 1YPNA 2O1MA 1B7ZA 3G7WA 1NNFA 1FQEA 1JETA 2UYEA 4IY5A 2F6PA 5CMMA 1D9YA 1B3GA 4LP2B 3KN3A 3KG2A 2XX9A 4I1DA 1OIBA 1FQBA 3W9VA 1FTJA 3ILUB 5TPAB 4F3SA 4JSOA 3UGWA 1QJMA 4G4PA 1OLCA 3GLBA 3IOTA 2RF1A 3EN3A 4N6PA 1F9BA 1JW1A 2V3UA 4JXIA 3T93B 2H9BA 4ZZEA 5DEXB 4GL0A 2THIA 4WKMA 1FTMA 3UP9A 1US4A 4QFKA 4LATA 4GRKA 2F5XA 3K6XA 2ZYKA 1NNPA 5I57A 4NF8A 2UVHA 1LCTA 3KBRA 4EF2A 1PB8A 4DIGA 3EPEA 3I5OA 3FJ7A 5H8SA 3S9MC 1QUKA 1B5HA 1PEBA 3SEWA 3U93A 4QSDA 4ZE9A 3KSXA 4KHZE 4RNSA 1SBPA 2OCUA 4IB2A 1H76A 3RLFE 1B7UA 2O51A 4OHNA 2D21A 3K1NA 1DPPA 1O64A 3SERA 4RJZA 4BLAA 3MVWA 3TQLA 2XXTA 4RK9A 4O3AA 3E4RA 4KFQA 5BWJA 1I69A 5L8DA 3HSTA 1I6BA 4RYAA 1BKAA 4UACA 4M4GA 3RNNA 1VFEA 2Y7WA 1R9LA 5I58B 5ITPA 3M3FA 4GXSB 3S9NC 1LAXA 3FD3A 4IO3A 4ELPA 4YAHX 5HM4B 4H5GA 3SESA 2Z8EA 1MS7A 1R1NA 4F3PA 1UTHA 2ZXTA 3Q29A 4GIZA 1O7TA 1AH5A 2FA7A 1B3LA 5AA3A 4F39A 1B4HA 2REGA 4R2BA 2ZMBA 4R6KA 3H7MA 2DWHA 4HTGA 5KCJB 2QL3A 4NF4A 4F1YA 2I3VA 1DTZA 3A09A 3MPLA 1DMBA 2DE2A 4N07A 3EF7A 1N0TA 3TCFA 1SW5A 4AB5A 2ONKE 4THIA 1MQJA 3FVNA 4TLMB 4KI0E 3C4MA 4XKRA 3GZGA 3P7IA 3MZ1A 5FTHA 4XKPA 3K01A 5CBSA 1JW4A 2QS1A 4GL8A 1RYOA 1D9VA 3O6GA 3PGFA 1OQGA 3CIJA 4BDOA 3F11A 4PP0A 2XXWA 5F1QA 3GXAA 1IEJA 5CM6A 2F7CA 3IR1A 5CI5A 3CSGA 1FQAA 3HV1A 1N3XA 3N94A 3ZKLA 5K2XA 1NL5A 1A7LA 3QSLA 1SI0A 1LFIA 3U1OA 2F35A 3TKDA 4E0XA 1B52A 3TTRA 4QSCA 3T9HB 3PPRA 1MM6A 3B6QA 1NKXA 4BDQA 3CVGA 3OO9A 1LLSA 3DELB 2B65A 1TFDA 4JSDA 4OXVA 5H8FA 2QS3A 1N7WA 3TQWA 1P1NA 4GOTA 4KQPA 3THIA 2XXVA 3H4ZA 3IJOB 2Y84A 2R71A 3FVKA 4H65A 1JEUA 2ONSA 2O7UA 1FQCA 3DLNA 2OWSA 1TXFA 3KOTA 4R72A 4U1ZA 3BKIB 1NNKA 4R6HA 1SI1A 3BBRA 1LB8A 5I57B 4NF8B 1YAEA 3M8UA 2H4IA 1A8EA 3O97A 1UTBA 2DE4A 3HN0A 1LBBA 3DP6A 2Q8JA 1CB6A 4E0WA 4P0GA 4QFPA 4IGRA 3O28A 1DPEA 1USYE 4QFOA 2DSFA 3C32A 3LSXA 3H6TA 3PD8A 4RK2A 5H8NA 2P1SA 2PT1A 5A5XB 1SDXA 1GGGA 4GF8A 3VDFA 2HQ0A 3MVYA 1DOTA 1B4ZA 3CFXA 4H6DA 3OEKA 3W9WA 1USYH 1M5FA 3VLVA 3FUZA 1QUIA 3QUJA 1H43A 3IB1A 4O3BA 1URGA 2VGQA 2XXYA 2XHDA 3Q27A 4UA8A 1Q35A 2Z22A 4X1DA 2BJJX 1Z7ME 4FAJA 4Z7EA 1P99A 1ZLQA 1MPDA 1N76A 2HCAA 4ND9A 3HHFA 1P1QA 1SYHA 4PFYA 4U22A 4F3BA 4F2OA 1GR2A 4R74A 1B5IA 1KWHA 2I49A 2W7YA 1VFDA 4ESXA 1MY4A 5HPQA 3PUWE 3IOVA 4KPTA 2IEEA 1A40A 3UIFA 2H99A 3OMBA 3VE1B 2R6GE 4JB7A 1M5BA 5AA1A 3LSLA 4NF5B 1Q1KA 2F8DA 3O29A 2PT2A 4OEVA 3MJNA 3CFLA 2VD3A 3KFMA 4YKIA 1NH7A 3Q26A 3MUQA 4M1VA 1XT8A 4X1BA 5I2NA 3VLUA 2Y7RA 3IOUA 2Q88A 1LB9A 3RT8A 2XXPA 3U94A 3VXBA 3K6VA 4DLDA 1S50A 3MQ9A 3OXNA 2RINA 2ABHA 1B6HA 5EYFA 1UIVA 4U4SA 2I0BA 3PD9A 4TOZA 2A5TA 1N7XA 3EHSA 1SD3A 3Q28A 4Q0CA 1WDNA 1FQFA 1Y3QA 3S9LC 1B7HA 2O84X 1QW0A 4R73A 4LZ7A 3N6TA 1RYXA 1ZKBA 3UN6A 3WAEA 4OENA 4OTEA 1D4NA 2F7BA 1ZMGA 1Y4CA 3M3KA 3C36A 5B7DA 2Z23A 4H8JA 3T9VA 4GXAA 4RPOA 4FIMA 2PMSA 2ZNTA 4GFRA 4IO7A 3FVOA 1IUDA 1IIWA 3I6VA 5I56B 1ELJA 3MZ9A 2RKMA 3IK6B 4U23A 4F31B 2NUVA 5K2YA 3IAZA 2DYXA 5KDTA 5IAIA 4FATA 1NH8A 1IXIA 3PUYE 1H3DA 3KZGA 1Y20A 5EHSA 4TLLB 3JYRA 4YU0A 3FASA 3O9PA 5FTIA 3FJGA 3PMWA 2QJEA 4OFJA 1Y3PA 1I6AA 3RQTA 3TMGA 4I9DA 1XVYA 4LONB 2AL5A 1SVXB 1ZIUA 4OEUA 4OWDA 3L6HA 3SDFA 4HCWA 2OJTA 1BP5A 4XXUA 2QMXA 1BLFA 1MXYA 4BDNA 1SYIA 2XXXA 1B05A 3PPNA 3R7XA 3PU5A 2QMWA 4KCCA 1NMUA 2P0SA 2ZYMA 3G3IA 3G3KA 1P1OA 3IL1B 1VSOA 2AL4A 4X48A 3N5LA 2RCBA 1B0HA 2O1LA 2O7IA 1H44A 1QKBA 3IJXB 3OEMA 4ZS9A 5FHMA 4EXLA 2UVGA 4OQOA 4ELQA 3DP4A 1URDA 3FV1A 3C33A 1BIYA 1UQWA 3Q25A 2V3QA 2B3FA 3O6IA 2OBGA 3B6TA 3RUMA 2DE3A 1POY1 1LAFE 5BUUA 3TCHA 4IO5A 1B1XA 4G68A 1EZPA 2HAVA 3PMXA 3G3HA 3H6UA 3UORA 3CRBA 4ZEKA 1JW5A 3K02A 4OVJA 3OENA 4Q5TA 4ZEFA 1LSTA 5I2NB 4YZZA 5CMBA 2LAOA 3TELA 2QSXA 4EQ7A 2DXYA 1MQIA 4OYVA 1Z7NE 3B6WA 5IKBA 4ZEIA 4KYDA 2F6GA 3E13X 1ZU0A 4O3CA 5L9OA 2REJA 4WEDA 4ZDMA 1AL3A 2YPNA 2A5TB 3PUXE 2I48A 1B0LA 3OSQA 2V93A 4ZEDA 2HAUA 4NF6A 2KLFA 4EQBA 4U21A 1R6ZA 2HZLA 5H8HA 2H5YA 2V3TA 1MPCA 3KSJA 4YKPA 3H03A 3LR1A 3TAJA 3VFJA 2UXAA 5TP9A 1IZ1A 3T96B 4KYEA 5DVFA 5I84A 4RA1A 3FZVA 3K00A 5CC2A 4EQ9A 2AYSA 1LAHE 1YCJA 2XXRA 2HZKA 2CMOA 3QIMA 2QPQA 3QXMA 3KEIA 2Z8FA 2GRVA 4NMYA 1FQDA 1UIUA 2Q2CA 4DXUA 3CR9A 3SETA 4IY6A 2RC8A 5KDTB 3S9EA 3SEVA 2VHAA 2ZYNA 2OWTA 3H06B 3KJTA 1HSLA 5AA2A 4AB6A 1EU8A 2I4CA 5H8QA 2Z8DA 2XXHA 3H6WA 4YMBA 4FORA 5DT6A 4H1XA 3JV9A 2RC7A 1SW2A 1B9JA 2PBWA 4EDPA 3OO6A 2HXWA 4OMBA 5DYHA 3RTWB 4DDDA 1HSEA 1SQYA 4XKNA 1XHYA 4POWA 2DWAA 2HFBA 1MM7A 4AQ4A 2AIXA 3MC2A 1XS5A 4YKJA 3BFUA 4MLVA 4QHQA 1HSJA 2F78A 1TFAA 5AA4A 1OQHA 4OFLA 3MVZA 3H6VA 3V8XB 3VVEA 2F34A 1EH3A 3GBBA 5ELVA 1B3EA 4QFNA 4F1UA 3PUZE 4BDRA 1Y9UA 3MBPA 1SW4A 4Z0IA 4G8NA 4U1OA 3K2DA 4BDMA 3PPQA 1PB9A 1LBCA 3FXQA 1UTHB 3D4GA 2E0SA 4C0RA 3I3VA 3QYTA 3TFLA 3CI8A 3E9XA 2OLBA 4X9TA 1S7YA 1II5A 4G68B 4F29A 2A5SA 3EHTA 3SEXA 4R9GA 4NF4B 1A99A 3TPAA 3QK6A 3KN8A 3K1PA 4YKKA 3U8QA 1P1UA 2H98A 2PX1A 4RPNA 2DS9A 5KZTA 2YLNA 4H0WA 5FHNA 2V84A 1NNTA 3TDJA 2OK2A 3IX1A 5JK4A 1GVCA 4GVOA 1H45A 4YB6A 2Y7PA 1MXZA 4DCXA 3UK4A 4QF9A 4KR5A 1JQFA 1B2HA 3TTNA 4DE8A 2F97A 3L6GA 3IOWA 4OETA 3A3UA 3WAFA 2QRYA 3DP8A 4IO6A 4H5FA 4FJPA 2I3WA 4FECA 4NF6B 2NVUB 1D3KA 3O6HA 3RTFB 4F22A 3ODBA 4F2QA 3IO6A 4F18A 3OO8A 5L9SA 2PYYA 4RY1A 2R9JA 3S4UA 1JVYA 4ONYA 2XX8A 2ESNA 5TP9B 2VOZA 2Q9TA 4WEPA 1MY1A 4N13A 3HHGA 3K1MA 4IO4A 4PETA 3TODA 5H8FB 3TTMA 2V25A 5ITOA 3V83A 1Y4TA 4HS7A 5I59A 5ISUA 2QS2A 4BDLA 4EXKA 1IXHA 4PQJA 3R6UA 1MRPA 2PVUA 2O68A 4IO2A 1MH3A 2DVCA 3N6UA 1WODA 5L9MA 1IXGA 3LSWA 3K0VA 2NXOA 1OVTA 2F7AA 2Q2AA 3HO7A 4XKQA 3C35A 3QAXA 2HEUA 3RT6B 2XXQA 1FW0A 1SW1A 2DVZA 4NEDA 3C9HA 1MXUA 3FXRA 1LAGE 3FJMA 5I2KA 5AA2B 1UTBB 1YTVA 3G3FA 5LOMA 1MG1A 2ALUA 4G68C 4XTCQ 1OLAA 3PMVA 5H8QB 4WXJA 4LVQA 3T9XB 1DTGA 4ZEBA 3W15C 4POXA 3B7DA 3TEPA 5H8NB 4FEDA 3LSFB 3K6UA 3BFTA 1RKMA 2I0CA 4NTLA 2ZYOA 1N84A 1J1NA 2NOOA 4F3GA 4R6YA 3ZSFA 3MZBA 1URSA 1MY2A 3PV0E 3MW0A 3FVGA 1ZTYA 2UVIA 1B32A 1VR5A 4EUOA 5DTBA 5AA4B 4GWOA 5JTYA 4U4XA 1B3FA 1QVSA 1B58A 5B70A 3FATA 4I62A 4C1TA 3LUYA 5EHMA 3OOAA 5A5XA 1MY0A 3FV2A 2XXUA 1B5JA 3G3JA 1ZBMA 2H25A 1B46A 5CMCA 1US5A 3OSRA 3VV5A 1IQ7A 2P2AA 3MP8A 3T9UA 4R9FA 4HCYA 2RCAA 3MVXA 2FYIA 3KJ7A 4LZ8A 3USDA 1IITA 2X26A 3OELA 4YB7A 2DQVA 3R26A 5CRYA 2ANJA 3OO7A 1IXCA 4PE5B 3U72A 1MQHA 3RY3A 4C1UA 3FGSA 4I8CA 1MQDA 4JWYA 3K6WA 4MLQA 1A55A 3ONMA 5ICTA 1XVXA 1ANFA 5F7VA 1A54A 3V5AA 4PFTA 4MF3A 1B51A 1PB7A 1FTLA 1MQGA 4Q8RA 1MXVA 1LGBC 1AOVA 4R75A 1EZOA 2I6EA 3VVDA 2QS4A 3TTKA 1AIVA 2I4BA 1OVBA 4IGTA 4JDFA 2UVJA 1MPBA 1O63A 3KOSA 2X7PA 5HBCA 1B3HA 4NF5A 3TUSA 3FXUA 4OERA 3KGCA 4P11A 4H67A 2GHBA 1N3WA 4QSEA 4TQUQ 3JZJA 3U92A 3AXFA 1M5EA 4OFOA 5I59B 3V89B 1VE4A 3C31A 1S9TA 1PBQA 1B1HA 1XC1A 3PPOA 4OZ9A 1AMFA 5J1DA 1TT1A 5AE4A 2I58A 3SEUA 4ZE8A 5CMKA 3RGYA 1FCKA 2YJPA 4F1VA 3T66A 3DM0A 1P1WA 2DWJA 4QRZA 4NWCA 1EZ9A 1QKAA 1WVJA 3N26A 5I2KB 3SEYA 4L17A 3VVFA 4G8MA 4LA9A 4MBPA 3M3LA 4P0IA 2WKYA 5AA2D 5FHOA
chains in the Genus database with same CATH superfamily
4YICA 1LCFA 3CG1A 3ZKKA 1PDAA 4YMAA 1FTOA 1T0KA 5TU0A 2XXIA 2GHAA 4O94A 4RXLA 3C34A 2G29A 3RN8A 4HW8A 3CSBA 2D5WA 3PPPA 4QFLA 5TPAA 4MHFA 4H46A 1A8FA 3MPKA 4ESWA 3E3KA 5M2VA 1QUJA 3PUVE 3EHUA 4R2FA 4P56A 1QULA 5I56A 1GTKA 2E1SA 4OESA 3EQ1A 3OD7A 1MDQA 5IZ3A 4ISUA 1I6QA 4G77A 4GWYA 1XOCA 1TWYA 5DEXA 5JTYB 5LTCA 2FNCA 2VP1A 3GBAA 1Y1MA 1IMBA 5CBRA 1POTA 1FTKA 3IO4A 3TCGA 3K4UA 1FPBA 2R8TA 2QVUA 4F19A 2IA4A 3IB2A 3TZAA 1R9QA 5JEIA 2ZZVA 1JNFA 2QVVA 2XD2A 2G93A 3TYHA 3CG3A 4K3FA 4LQ5A 4PFUA 2M8CA 5ICQA 4PF6A 4MFIA 3SKPA 4ZZAA 2XD3A 1MY3A 4H8IA 2Y7IA 4EF1A 3LC8A 1N04A 2ONRA 4DXCA 4GD5A 1MXWA 4GLIA 4KD5A 4MJOA 1L5TA 4FE8A 1M5CA 1NV3A 2ZNUA 3ECRA 1DSNA 3IB0A 2FVZA 3QUFA 4NWDA 4GWSA 2OZZA 4G8HA 3T22A 1RDXA 3HPIA 1BTJA 2GH9A 2UYFA 3TTLA 2DWIA 5I58A 2X7QA 1CE2A 4KYSA 4DI3D 3MAMA 4NE4A 2B3BA 1LFGA 4XFEA 3HCQA 3MP1A 4N6DA 1PBPA 3RPWA 3PTYA 2F36A 4LQ2A 3LV0A 2DOJA 2GFEA 4G2ZA 5DW8A 2NWJA 4Q30B 3FIRA 3EKIA 1NFTA 2Q89A 2Y7KA 2PCRA 4H45A 2VD2A 3QMFA 4JBZA 4N81A 4MEVA 2O6AA 4FEBA 3UA8A 4LZ5A 5KCJA 5DVIA 4YB5A 1B40A 2JJKA 1FBPA 3O2AA 2CZLA 1MH4A 4ELOA 3KN7A 4DXBA 3G3GA 4GQOA 2O69A 1Y3NA 4KCDA 2CEYA 1PC3A 5H8HB 1LFHA 4JVCA 3ILTB 4ELRA 3O66A 3VXCA 1MXXA 4LUBA 3ZS6A 3MP6A 4PFWA 2DXRA 1DCUA 1GV8A 2D3IA 1G0IA 1JP4A 3S2VA 1ZJLA 4MH5A 3CFZA 4JWOA 4JWXA 1JEVA 4ECFA 4DCYA 1ATGA 3A3CA 4XIGQ 3VLWA 1OMPA 3LBSA 4ZECA 1LBVA 4U2RA 2ZNSA 3MWBA 1JVXA 1Y1ZA 5DVJA 3H3GA 1M5DA 3D4CA 2DP8A 4MAGA 2XX7A 1MDP1 3IORA 2RC9A 2QFLA 4DZ1A 1YPNA 1VDWA 2O1MA 4QXDA 1B7ZA 3G7WA 1NNFA 1FQEA 1JETA 2UYEA 4IY5A 1KA0A 2F6PA 5CMMA 1D9YA 1B3GA 4LP2B 3KN3A 3KG2A 2XX9A 4I1DA 1OIBA 1FQBA 3W9VA 4NX1A 1FTJA 3ILUB 4NHBA 5EYHA 5TPAB 4F3SA 4JSOA 3UGWA 1QJMA 4G4PA 1OLCA 3GLBA 3IOTA 2RF1A 3EN3A 4N6PA 2WYPA 1F9BA 1JW1A 2V3UA 4JXIA 3T93B 2H9BA 4ZZEA 5DEXB 4GL0A 4I40A 2THIA 4WKMA 1FTMA 3UP9A 1US4A 4QFKA 4LATA 4GRKA 2F5XA 3K6XA 3E78A 4PGPA 2ZYKA 1NNPA 5T3JA 5I57A 4NF8A 2UVHA 1LCTA 3KBRA 4EF2A 1PB8A 4DIGA 3EPEA 3I5OA 1SPIA 3FJ7A 5H8SA 3S9MC 1QUKA 1B5HA 1PEBA 3SEWA 3U93A 4GWWA 4QSDA 4ZE9A 3KSXA 4KHZE 4RNSA 1SBPA 2OCUA 4IB2A 1K9ZA 5ESYA 1H76A 3RLFE 1B7UA 2O51A 4OHNA 2D21A 5EQAA 3K1NA 4GWUA 5IZZA 4P3LA 1DPPA 4OANA 1O64A 3SERA 4RJZA 4BLAA 3MVWA 3TQLA 2XXTA 4RK9A 4O3AA 3E4RA 4KFQA 5BWJA 1I69A 5L8DA 2CZIA 1I6BA 3HSTA 4RYAA 1BKAA 4UACA 4M4GA 3RNNA 1VFEA 1DK4A 1R9LA 2BJIA 2Y7WA 5I58B 5ITPA 3M3FA 4GXSB 3S9NC 1LAXA 3FD3A 4GX6A 4IO3A 4ELPA 4MNPA 4YAHX 5HM4B 4H5GA 3SESA 2Z8EA 3U65A 1MS7A 1R1NA 4F3PA 4NG7A 1UTHA 2ZXTA 3Q29A 4GIZA 1O7TA 1AH5A 1FPLA 2FA7A 1B3LA 5AA3A 4F39A 1IMEA 1B4HA 2REGA 4R2BA 4PCDA 4OA4A 5F24A 1D9QA 4OVPA 2ZMBA 4R6KA 3H7MA 2DWHA 4HTGA 5KCJB 2QL3A 2F3BA 4GBVA 4NF4A 2CZKA 4F1YA 2I3VA 1DTZA 3A09A 3MPLA 1DMBA 2DE2A 1LEVA 4N07A 3EF7A 1N0TA 3TCFA 1SW5A 4AB5A 2ONKE 4THIA 1MQJA 3FVNA 4TLMB 4KI0E 3C4MA 4XKRA 3GZGA 3P7IA 1FJ6A 3MZ1A 5FTHA 4XKPA 3K01A 5CBSA 1JW4A 2QS1A 4JVDA 4GL8A 1RYOA 1D9VA 3O6GA 3PGFA 1NUXA 1OQGA 3CIJA 4BDOA 3F11A 4PP0A 2XXWA 2B4MA 5F1QA 3GXAA 1IEJA 5CM6A 4N8YA 2F7CA 3IR1A 5CI5A 2ZZXA 1CNQA 3CSGA 1FQAA 3HV1A 1N3XA 3N94A 3ZKLA 5K2XA 1NL5A 1A7LA 3QSLA 1SI0A 1LFIA 3U1OA 2F35A 3TKDA 4E0XA 1B52A 3TTRA 4QSCA 3T9HB 1LBXA 3PPRA 1MM6A 3B6QA 1NKXA 4BDQA 1FJ9A 3CVGA 4NGUA 4PFRA 3OO9A 1LLSA 3DELB 2B65A 1TFDA 4JSDA 4OXVA 5H8FA 3LUZA 2QS3A 1N7WA 3TQWA 1P1NA 4GOTA 4KQPA 3THIA 5ET8A 2XXVA 4MNIA 3H4ZA 3IJOB 2Y84A 2R71A 3FVKA 4H65A 1JEUA 2ONSA 2O7UA 1FQCA 3ISPA 4MNCA 3DLNA 2OWSA 1TXFA 5ET6A 3GYYA 3KOTA 4R72A 4U1ZA 4IR8A 3BKIB 1NNKA 4MX6A 4P8BA 4R6HA 1SI1A 4N4UA 3BBRA 1LB8A 4AS4A 5I57B 4NF8B 1YAEA 3M8UA 2H4IA 1A8EA 2Y5LA 1UTBA 3O97A 2DE4A 3HN0A 1LBBA 3DP6A 2Q8JA 1CB6A 4E0WA 4P0GA 3SZPA 4QFPA 4IGRA 1YZ0A 3O28A 1DPEA 1KA1A 1USYE 4QFOA 2DSFA 3C32A 3LSXA 3H6TA 3PD8A 1NV1A 4RK2A 5H8NA 2WBDA 2P1SA 2P3VA 4HE0A 2PT1A 2Q74A 5A5XB 1SDXA 4MIJA 1GGGA 4GF8A 3VDFA 2HQ0A 4JVIA 2FBPA 1Q9DA 3MVYA 1DOTA 1B4ZA 4PFBA 3CFXA 1FBFA 4H6DA 3OEKA 3W9WA 1USYH 1M5FA 3FUZA 1QUIA 3VLVA 3QUJA 1FPDA 1H43A 3IB1A 4OVTA 4O3BA 1URGA 2VGQA 2XXYA 1XI6A 2XHDA 4P47A 3Q27A 4UA8A 1Q35A 4PBQA 2Z22A 4X1DA 2BJJX 1Z7ME 2XWIA 4FAJA 4Z7EA 1P99A 1ZLQA 1MPDA 1N76A 2HCAA 4ND9A 3HHFA 1P1QA 1NV5A 1SYHA 4PFYA 4U22A 4KXPA 4F3BA 4F2OA 1GR2A 1FBEA 3BIGA 4R74A 3BIHA 1B5IA 1KWHA 2I49A 2W7YA 1VFDA 4ESXA 1EYIA 4N8GA 1MY4A 5HPQA 1FSAA 3PUWE 3IOVA 4KPTA 2IEEA 1A40A 3UIFA 2H99A 3OMBA 3T1BA 3VE1B 4GBWA 2R6GE 3MSTA 4JB7A 3HFUA 1M5BA 5AA1A 4P1EA 3LSLA 4NF5B 1Q1KA 3CHGA 2F8DA 3O29A 2PT2A 4OEVA 3MJNA 3CFLA 2VD3A 3KFMA 4YKIA 1NH7A 3Q26A 3MUQA 4M1VA 1XT8A 4X1BA 1KZ8A 5I2NA 3VLUA 1FPIA 2Y7RA 3B8BA 2Q88A 3IOUA 1NV0A 1LB9A 3RT8A 2XXPA 3U94A 3VXBA 3K6VA 4DLDA 1S50A 3MQ9A 3OXNA 2B4LA 2RINA 1NV4A 2ABHA 4P1LA 1B6HA 4PGNA 5EYFA 1UIVA 4U4SA 2I0BA 2FIXA 2WX9A 4TOZA 3PD9A 2A5TA 1N7XA 2Y5KA 1EYKA 1SD3A 3EHSA 3Q28A 4Q0CA 3A29A 3FXBA 1WDNA 1FQFA 1Y3QA 5ET7A 3S9LC 1B7HA 2O84X 1QW0A 4R73A 4LZ7A 3N6TA 1RYXA 1ZKBA 3UN6A 3WAEA 4OENA 4OTEA 1D4NA 2F7BA 1ZMGA 1Y4CA 3M3KA 3C36A 1YYZA 5B7DA 5I5PA 2Z23A 4H8JA 1FBGA 3T9VA 4O7MA 4GXAA 4RPOA 4FIMA 2PMSA 2ZNTA 4GFRA 4IO7A 1INPA 3FVOA 1FRPA 1FPEA 1IUDA 1IIWA 3I6VA 5I56B 1ELJA 1G0HA 3MZ9A 5EQ7A 2RKMA 5IZ3B 3IK6B 4U23A 4F31B 2NUVA 5K2YA 3IAZA 2DYXA 5IGAA 5KDTA 5IAIA 4FATA 1LBZA 1NH8A 1IXIA 3PUYE 1H3DA 3KZGA 1Y20A 5EHSA 4TLLB 3JYRA 2PFYA 1FPJA 4YU0A 3RPLA 3FASA 3O9PA 5FTIA 3FJGA 3PMWA 2QJEA 4OFJA 4PF8A 1Y3PA 1I6AA 3RQTA 3TMGA 4I9DA 1XVYA 4LONB 4NAPA 2AL5A 1FBDA 1SVXB 1ZIUA 2L5VA 4NQ8A 4OEUA 4OWDA 4PC9A 3L6HA 3SDFA 4HCWA 2OJTA 1BP5A 4XXUA 2QMXA 1BLFA 1MXYA 4BDNA 1SYIA 4PDDA 4PFIA 2XXXA 1B05A 3PPNA 3R7XA 4O7IA 3PU5A 2QMWA 4KCCA 1NMUA 2P0SA 2ZYMA 4X04A 3G3IA 3G3KA 2XWVA 1P1OA 3IL1B 1VSOA 2AL4A 4X48A 5FBPA 2XWOA 4GWXA 3N5LA 2RCBA 1BK4A 1B0HA 2O1LA 2O7IA 1H44A 1QKBA 3IJXB 3OEMA 4ZS9A 5FHMA 4MMPA 4EXLA 2UVGA 4OQOA 4ELQA 3DP4A 4UABA 1IMCA 1URDA 3FV1A 3C33A 1BIYA 1UQWA 3Q25A 2V3QA 2B3FA 3O6IA 2OBGA 2V4CA 3B6TA 3E79A 3RUMA 2DE3A 4PAIA 1POY1 1LAFE 5BUUA 3TCHA 4IO5A 1B1XA 4G68A 3KC0A 1EZPA 1FTAA 2HAVA 3PMXA 3G3HA 2VPNA 3H6UA 3UORA 3CRBA 4ZEKA 1JW5A 3K02A 4OVJA 3OENA 4Q5TA 4ZEFA 1NUWA 1LSTA 5I2NB 4PAKA 5CMBA 4YZZA 2LAOA 3TELA 2QSXA 4EQ7A 2DXYA 2PFZA 1MQIA 4OYVA 3D1RA 1Z7NE 4GX3A 3B6WA 5IKBA 2FIEA 4ZEIA 4KYDA 2F6GA 3E13X 1ZU0A 4O3CA 5L9OA 2REJA 4WEDA 4ZDMA 4HE1A 1AL3A 2YPNA 2XXKA 2A5TB 1NV6A 3PUXE 2I48A 1B0LA 3OSQA 2V93A 4I3EA 2HAUA 4NF6A 4ZEDA 1EYJA 2KLFA 4EQBA 4U21A 1NI9A 1R6ZA 2HZLA 5H8HA 2H5YA 2V3TA 1MPCA 3KSJA 3MYUA 4YKPA 3H03A 3LR1A 3TAJA 2F3DA 3VFJA 2UXAA 5TP9A 2HXRA 1IZ1A 3T96B 4KYEA 5DVFA 2VT5A 5I84A 4RA1A 5EQ9A 4OVQA 3FZVA 1FBHA 3K00A 5CC2A 4EQ9A 2AYSA 1LAHE 1YCJA 2XXRA 2HZKA 2CMOA 3QIMA 2QPQA 3QXMA 3KEIA 2Z8FA 2GRVA 4NMYA 1FQDA 1UIUA 2Q2CA 4DXUA 3CR9A 3KBZA 3SETA 4IY6A 2RC8A 5KDTB 3S9EA 4AS5A 3B50A 3IFCA 4N6KA 2CZHA 3SEVA 2VHAA 2ZYNA 2OWTA 3IFAA 1LBWA 3H06B 3RPLB 1QGXA 3KJTA 2HHMA 1IMFA 4N17A 1HSLA 1FBCA 1YXIA 5AA2A 4AB6A 1EU8A 2I4CA 5A5LA 5H8QA 2Z8DA 2XXHA 3H6WA 4YMBA 4FORA 5DT6A 4H1XA 3JV9A 2RC7A 4NF0A 1SW2A 1B9JA 2PBWA 4EDPA 3OO6A 2HXWA 3T0JA 4OMBA 5DYHA 3RTWB 4DDDA 1HSEA 2Q8MA 1SQYA 4XKNA 1XHYA 4O8MA 2XWKA 4POWA 2DWAA 2HFBA 1MM7A 4AQ4A 5IM2A 2AIXA 5ET5A 3MC2A 1XS5A 4YKJA 3BFUA 4MLVA 4QHQA 4P9KA 1HSJA 2F78A 1TFAA 5AA4A 1OQHA 4OFLA 3MVZA 1LBYA 5EQ8A 3H6VA 3V8XB 3VVEA 2F34A 4PDHA 1EH3A 3GBBA 4PTKA 2QVRA 5ELVA 1B3EA 4QFNA 4F1UA 3PUZE 4BDRA 1Y9UA 2KQZA 3MBPA 1SW4A 4Z0IA 4G8NA 4U1OA 3K2DA 4BDMA 3PPQA 1PB9A 1LBCA 3FXQA 1UTHB 3D4GA 1RDYA 2E0SA 3FBPA 4C0RA 3I3VA 2WBBA 3QYTA 3TFLA 2OWZA 3CI8A 3E9XA 2OLBA 4X9TA 1S7YA 1II5A 4LN5A 4G68B 4F29A 2A5SA 3EHTA 3SEXA 4I3YA 4R9GA 4NF4B 1A99A 3TPAA 3QK6A 2HPGA 3KN8A 3K1PA 4OVSA 4YKKA 3U8QA 1P1UA 2H98A 2PX1A 4RPNA 2DS9A 5KZTA 2YLNA 4H0WA 5FHNA 1FPFA 2V84A 1NNTA 4G61A 3TDJA 2OK2A 3IX1A 4PAFA 5JK4A 1GVCA 4GVOA 3NOHA 1H45A 4YB6A 4GX4A 2Y7PA 1MXZA 4DCXA 3UK4A 4QF9A 4KR5A 1JQFA 1B2HA 3TTNA 4DE8A 2F97A 3L6GA 3IOWA 4OETA 1NUYA 3A3UA 3WAFA 2QRYA 3DP8A 4DI4B 4IO6A 4H5FA 2DDKA 4PBHA 4FJPA 2I3WA 4FECA 4NF6B 2NVUB 1D3KA 3O6HA 3RTFB 4F22A 3ODBA 4F2QA 3IO6A 4F18A 3OO8A 5L9SA 2PYYA 4RY1A 2R9JA 3S4UA 1JVYA 4ONYA 2XX8A 2ESNA 5TP9B 2KR0A 4FBPA 2VOZA 2Q9TA 4WEPA 1MY1A 4N13A 3HHGA 3K1MA 4IO4A 4PETA 3TODA 2GQ1A 5H8FB 3TTMA 2V25A 4GWZA 5ITOA 3V83A 1Y4TA 4HS7A 5I59A 5ISUA 4N91A 2QS2A 4BDLA 4EXKA 1IXHA 4PQJA 3R6UA 1MRPA 2PVUA 2O68A 2XA5A 4IO2A 1MH3A 2DVCA 3N6UA 1WODA 5L9MA 1IXGA 3LSWA 3K0VA 2NXOA 1OVTA 1NV2A 2F7AA 2Q2AA 3HO7A 4XKQA 3C35A 3KC1A 3QAXA 2HEUA 3RT6B 2XXQA 1FW0A 1SW1A 2DVZA 1RDZA 4NEDA 3C9HA 1MXUA 3FXRA 1LAGE 3FJMA 5I2KA 5AA2B 1UTBB 1YTVA 3G3FA 5LOMA 1MG1A 2ALUA 4G68C 4XTCQ 1OLAA 3PMVA 5H8QB 4WXJA 1FPGA 5I7IA 4LVQA 3T9XB 1DTGA 4ZEBA 3W15C 4POXA 4XEQA 3B7DA 2WEFA 3TEPA 5H8NB 4FEDA 3LSFB 4HE2A 3K6UA 3BFTA 1RKMA 2I0CA 4NTLA 2ZYOA 1N84A 1J1NA 2NOOA 4F3GA 4R6YA 3ZSFA 5IZ1A 4QBAA 3MZBA 1URSA 1MY2A 3PV0E 5EYGA 3MW0A 3FVGA 1ZTYA 2UVIA 1B32A 1VR5A 4EUOA 5DTBA 4MCOA 4GWOA 5AA4B 5JTYA 4U4XA 4X8RA 1B3FA 1QVSA 1B58A 5B70A 3FATA 4I62A 4C1TA 3LUYA 5EHMA 3OOAA 5A5XA 1MY0A 3FV2A 2XXUA 1B5JA 3G3JA 1ZBMA 2H25A 2P3NA 1B46A 5CMCA 1US5A 3OSRA 3VV5A 1IQ7A 2P2AA 3MP8A 3T9UA 4R9FA 4HCYA 2RCAA 3MVXA 2FYIA 3KJ7A 4XF5A 4LZ8A 3USDA 1IITA 2CEXA 2X26A 3OELA 4YB7A 2DQVA 3R26A 5CRYA 2FHYA 2ANJA 3OO7A 1AWBA 1NV7A 1IXCA 4PE5B 3U72A 1MQHA 3RY3A 2VPOA 4C1UA 3FGSA 4I8CA 1MQDA 4JWYA 3K6WA 4MLQA 1A55A 3ONMA 5ICTA 2ZZWA 4PE3A 4NN3A 1XVXA 1ANFA 5F7VA 2MKZA 1A54A 3V5AA 4PFTA 4MF3A 1B51A 1PB7A 1FTLA 1MQGA 4Q8RA 1MXVA 1IMAA 1LGBC 1AOVA 4R75A 1EZOA 2WYKA 2I6EA 3VVDA 2QS4A 3RYDA 3TTKA 1NUZA 5LDZA 1AIVA 2I4BA 1OVBA 2OX3A 4IGTA 4JDFA 2UVJA 1MPBA 1O63A 3KOSA 5I3SA 2X7PA 5HBCA 1K9YA 1B3HA 4HXVA 1DBZA 4NF5A 3TUSA 3FXUA 4OERA 3KGCA 4P11A 4H67A 2GHBA 1N3WA 4QSEA 4TQUQ 3JZJA 3U92A 3AXFA 3ROJA 1M5EA 4OFOA 5I59B 3V89B 1VE4A 3C31A 4N15A 1S9TA 1PBQA 1B1HA 1XC1A 3PPOA 4OZ9A 1AMFA 5J1DA 1TT1A 5AE4A 2I58A 3SEUA 4ZE8A 5CMKA 3RGYA 1FCKA 2YJPA 4F1VA 5J16A 3T66A 3DM0A 1P1WA 2DWJA 4QRZA 4NWCA 1EZ9A 1QKAA 1WVJA 3N26A 5I2KB 3SEYA 4L17A 1IMDA 3VVFA 4G8MA 4LA9A 1FPKA 4MBPA 3M3LA 4P0IA 2WKYA 5AA2D 4OVRA 5FHOA
chains in the Genus database with same CATH topology
4YICA 1LCFA 3CG1A 3ZKKA 1PDAA 4YMAA 1FTOA 1T0KA 5TU0A 2XXIA 2GHAA 4RXLA 3C34A 2G29A 3RN8A 4HW8A 3CSBA 2D5WA 3PPPA 4QFLA 5TPAA 1A8FA 3MPKA 4ESWA 3E3KA 5M2VA 1QUJA 3PUVE 3EHUA 4R2FA 1QULA 5I56A 1GTKA 2E1SA 4OESA 3EQ1A 3OD7A 1MDQA 4ISUA 1I6QA 4G77A 1XOCA 1TWYA 5DEXA 5JTYB 2FNCA 2VP1A 3GBAA 1Y1MA 5CBRA 1POTA 1FTKA 3IO4A 3TCGA 3K4UA 4F19A 2IA4A 3IB2A 3TZAA 1R9QA 5JEIA 1JNFA 2XD2A 2G93A 3TYHA 3CG3A 4K3FA 4LQ5A 4PFUA 2M8CA 5ICQA 4MFIA 3SKPA 4ZZAA 2XD3A 1MY3A 4H8IA 2Y7IA 4EF1A 3LC8A 1N04A 2ONRA 4DXCA 4GD5A 1MXWA 4GLIA 4KD5A 1L5TA 4FE8A 1M5CA 2ZNUA 3ECRA 1DSNA 3IB0A 3QUFA 4NWDA 2OZZA 4G8HA 3T22A 3HPIA 1BTJA 2GH9A 2UYFA 3TTLA 2DWIA 5I58A 2X7QA 1CE2A 4KYSA 3MAMA 4NE4A 2B3BA 1LFGA 3HCQA 3MP1A 1PBPA 3RPWA 2F36A 4LQ2A 2DOJA 2GFEA 4G2ZA 2NWJA 4Q30B 3FIRA 1NFTA 2Q89A 2Y7KA 2VD2A 4JBZA 2O6AA 4FEBA 3UA8A 4LZ5A 5KCJA 5DVIA 4YB5A 1B40A 3O2AA 2CZLA 1MH4A 4ELOA 3KN7A 4DXBA 3G3GA 4GQOA 2O69A 1Y3NA 4KCDA 1PC3A 5H8HB 1LFHA 3ILTB 4ELRA 3O66A 3VXCA 1MXXA 4LUBA 3ZS6A 3MP6A 4PFWA 2DXRA 1GV8A 2D3IA 3S2VA 1ZJLA 4MH5A 3CFZA 4JWOA 4JWXA 1JEVA 4ECFA 4DCYA 1ATGA 3A3CA 4XIGQ 3VLWA 1OMPA 3LBSA 4ZECA 4U2RA 2ZNSA 3MWBA 1JVXA 1Y1ZA 5DVJA 3H3GA 1M5DA 3D4CA 2DP8A 2XX7A 1MDP1 3IORA 2RC9A 4DZ1A 1YPNA 2O1MA 1B7ZA 3G7WA 1NNFA 1FQEA 1JETA 2UYEA 4IY5A 2F6PA 5CMMA 1D9YA 1B3GA 4LP2B 3KN3A 3KG2A 2XX9A 4I1DA 1OIBA 1FQBA 3W9VA 1FTJA 3ILUB 5TPAB 4F3SA 4JSOA 3UGWA 1QJMA 4G4PA 1OLCA 3GLBA 3IOTA 2RF1A 3EN3A 4N6PA 1F9BA 1JW1A 2V3UA 4JXIA 3T93B 2H9BA 4ZZEA 5DEXB 4GL0A 2THIA 4WKMA 1FTMA 3UP9A 1US4A 4QFKA 4LATA 4GRKA 2F5XA 3K6XA 2ZYKA 1NNPA 5I57A 4NF8A 2UVHA 1LCTA 3KBRA 4EF2A 1PB8A 4DIGA 3EPEA 3I5OA 3FJ7A 5H8SA 3S9MC 1QUKA 1B5HA 1PEBA 3SEWA 3U93A 4QSDA 4ZE9A 3KSXA 4KHZE 4RNSA 1SBPA 2OCUA 4IB2A 1H76A 3RLFE 1B7UA 2O51A 4OHNA 2D21A 3K1NA 1DPPA 1O64A 3SERA 4RJZA 4BLAA 3MVWA 3TQLA 2XXTA 4RK9A 4O3AA 3E4RA 4KFQA 5BWJA 1I69A 5L8DA 3HSTA 1I6BA 4RYAA 1BKAA 4UACA 4M4GA 3RNNA 1VFEA 2Y7WA 1R9LA 5I58B 5ITPA 3M3FA 4GXSB 3S9NC 1LAXA 3FD3A 4IO3A 4ELPA 4YAHX 5HM4B 4H5GA 3SESA 2Z8EA 1MS7A 1R1NA 4F3PA 1UTHA 2ZXTA 3Q29A 4GIZA 1O7TA 1AH5A 2FA7A 1B3LA 5AA3A 4F39A 1B4HA 2REGA 4R2BA 2ZMBA 4R6KA 3H7MA 2DWHA 4HTGA 5KCJB 2QL3A 4NF4A 4F1YA 2I3VA 1DTZA 3A09A 3MPLA 1DMBA 2DE2A 4N07A 3EF7A 1N0TA 3TCFA 1SW5A 4AB5A 2ONKE 4THIA 1MQJA 3FVNA 4TLMB 4KI0E 3C4MA 4XKRA 3GZGA 3P7IA 3MZ1A 5FTHA 4XKPA 3K01A 5CBSA 1JW4A 2QS1A 4GL8A 1RYOA 1D9VA 3O6GA 3PGFA 1OQGA 3CIJA 4BDOA 3F11A 4PP0A 2XXWA 5F1QA 3GXAA 1IEJA 5CM6A 2F7CA 3IR1A 5CI5A 3CSGA 1FQAA 3HV1A 1N3XA 3N94A 3ZKLA 5K2XA 1NL5A 1A7LA 3QSLA 1SI0A 1LFIA 3U1OA 2F35A 3TKDA 4E0XA 1B52A 3TTRA 4QSCA 3T9HB 3PPRA 1MM6A 3B6QA 1NKXA 4BDQA 3CVGA 3OO9A 1LLSA 3DELB 2B65A 1TFDA 4JSDA 4OXVA 5H8FA 2QS3A 1N7WA 3TQWA 1P1NA 4GOTA 4KQPA 3THIA 2XXVA 3H4ZA 3IJOB 2Y84A 2R71A 3FVKA 4H65A 1JEUA 2ONSA 2O7UA 1FQCA 3DLNA 2OWSA 1TXFA 3KOTA 4R72A 4U1ZA 3BKIB 1NNKA 4R6HA 1SI1A 3BBRA 1LB8A 5I57B 4NF8B 1YAEA 3M8UA 2H4IA 1A8EA 3O97A 1UTBA 2DE4A 3HN0A 1LBBA 3DP6A 2Q8JA 1CB6A 4E0WA 4P0GA 4QFPA 4IGRA 3O28A 1DPEA 1USYE 4QFOA 2DSFA 3C32A 3LSXA 3H6TA 3PD8A 4RK2A 5H8NA 2P1SA 2PT1A 5A5XB 1SDXA 1GGGA 4GF8A 3VDFA 2HQ0A 3MVYA 1DOTA 1B4ZA 3CFXA 4H6DA 3OEKA 3W9WA 1USYH 1M5FA 3VLVA 3FUZA 1QUIA 3QUJA 1H43A 3IB1A 4O3BA 1URGA 2VGQA 2XXYA 2XHDA 3Q27A 4UA8A 1Q35A 2Z22A 4X1DA 2BJJX 1Z7ME 4FAJA 4Z7EA 1P99A 1ZLQA 1MPDA 1N76A 2HCAA 4ND9A 3HHFA 1P1QA 1SYHA 4PFYA 4U22A 4F3BA 4F2OA 1GR2A 4R74A 1B5IA 1KWHA 2I49A 2W7YA 1VFDA 4ESXA 1MY4A 5HPQA 3PUWE 3IOVA 4KPTA 2IEEA 1A40A 3UIFA 2H99A 3OMBA 3VE1B 2R6GE 4JB7A 1M5BA 5AA1A 3LSLA 4NF5B 1Q1KA 2F8DA 3O29A 2PT2A 4OEVA 3MJNA 3CFLA 2VD3A 3KFMA 4YKIA 1NH7A 3Q26A 3MUQA 4M1VA 1XT8A 4X1BA 5I2NA 3VLUA 2Y7RA 3IOUA 2Q88A 1LB9A 3RT8A 2XXPA 3U94A 3VXBA 3K6VA 4DLDA 1S50A 3MQ9A 3OXNA 2RINA 2ABHA 1B6HA 5EYFA 1UIVA 4U4SA 2I0BA 3PD9A 4TOZA 2A5TA 1N7XA 3EHSA 1SD3A 3Q28A 4Q0CA 1WDNA 1FQFA 1Y3QA 3S9LC 1B7HA 2O84X 1QW0A 4R73A 4LZ7A 3N6TA 1RYXA 1ZKBA 3UN6A 3WAEA 4OENA 4OTEA 1D4NA 2F7BA 1ZMGA 1Y4CA 3M3KA 3C36A 5B7DA 2Z23A 4H8JA 3T9VA 4GXAA 4RPOA 4FIMA 2PMSA 2ZNTA 4GFRA 4IO7A 3FVOA 1IUDA 1IIWA 3I6VA 5I56B 1ELJA 3MZ9A 2RKMA 3IK6B 4U23A 4F31B 2NUVA 5K2YA 3IAZA 2DYXA 5KDTA 5IAIA 4FATA 1NH8A 1IXIA 3PUYE 1H3DA 3KZGA 1Y20A 5EHSA 4TLLB 3JYRA 4YU0A 3FASA 3O9PA 5FTIA 3FJGA 3PMWA 2QJEA 4OFJA 1Y3PA 1I6AA 3RQTA 3TMGA 4I9DA 1XVYA 4LONB 2AL5A 1SVXB 1ZIUA 4OEUA 4OWDA 3L6HA 3SDFA 4HCWA 2OJTA 1BP5A 4XXUA 2QMXA 1BLFA 1MXYA 4BDNA 1SYIA 2XXXA 1B05A 3PPNA 3R7XA 3PU5A 2QMWA 4KCCA 1NMUA 2P0SA 2ZYMA 3G3IA 3G3KA 1P1OA 3IL1B 1VSOA 2AL4A 4X48A 3N5LA 2RCBA 1B0HA 2O1LA 2O7IA 1H44A 1QKBA 3IJXB 3OEMA 4ZS9A 5FHMA 4EXLA 2UVGA 4OQOA 4ELQA 3DP4A 1URDA 3FV1A 3C33A 1BIYA 1UQWA 3Q25A 2V3QA 2B3FA 3O6IA 2OBGA 3B6TA 3RUMA 2DE3A 1POY1 1LAFE 5BUUA 3TCHA 4IO5A 1B1XA 4G68A 1EZPA 2HAVA 3PMXA 3G3HA 3H6UA 3UORA 3CRBA 4ZEKA 1JW5A 3K02A 4OVJA 3OENA 4Q5TA 4ZEFA 1LSTA 5I2NB 4YZZA 5CMBA 2LAOA 3TELA 2QSXA 4EQ7A 2DXYA 1MQIA 4OYVA 1Z7NE 3B6WA 5IKBA 4ZEIA 4KYDA 2F6GA 3E13X 1ZU0A 4O3CA 5L9OA 2REJA 4WEDA 4ZDMA 1AL3A 2YPNA 2A5TB 3PUXE 2I48A 1B0LA 3OSQA 2V93A 4ZEDA 2HAUA 4NF6A 2KLFA 4EQBA 4U21A 1R6ZA 2HZLA 5H8HA 2H5YA 2V3TA 1MPCA 3KSJA 4YKPA 3H03A 3LR1A 3TAJA 3VFJA 2UXAA 5TP9A 1IZ1A 3T96B 4KYEA 5DVFA 5I84A 4RA1A 3FZVA 3K00A 5CC2A 4EQ9A 2AYSA 1LAHE 1YCJA 2XXRA 2HZKA 2CMOA 3QIMA 2QPQA 3QXMA 3KEIA 2Z8FA 2GRVA 4NMYA 1FQDA 1UIUA 2Q2CA 4DXUA 3CR9A 3SETA 4IY6A 2RC8A 5KDTB 3S9EA 3SEVA 2VHAA 2ZYNA 2OWTA 3H06B 3KJTA 1HSLA 5AA2A 4AB6A 1EU8A 2I4CA 5H8QA 2Z8DA 2XXHA 3H6WA 4YMBA 4FORA 5DT6A 4H1XA 3JV9A 2RC7A 1SW2A 1B9JA 2PBWA 4EDPA 3OO6A 2HXWA 4OMBA 5DYHA 3RTWB 4DDDA 1HSEA 1SQYA 4XKNA 1XHYA 4POWA 2DWAA 2HFBA 1MM7A 4AQ4A 2AIXA 3MC2A 1XS5A 4YKJA 3BFUA 4MLVA 4QHQA 1HSJA 2F78A 1TFAA 5AA4A 1OQHA 4OFLA 3MVZA 3H6VA 3V8XB 3VVEA 2F34A 1EH3A 3GBBA 5ELVA 1B3EA 4QFNA 4F1UA 3PUZE 4BDRA 1Y9UA 3MBPA 1SW4A 4Z0IA 4G8NA 4U1OA 3K2DA 4BDMA 3PPQA 1PB9A 1LBCA 3FXQA 1UTHB 3D4GA 2E0SA 4C0RA 3I3VA 3QYTA 3TFLA 3CI8A 3E9XA 2OLBA 4X9TA 1S7YA 1II5A 4G68B 4F29A 2A5SA 3EHTA 3SEXA 4R9GA 4NF4B 1A99A 3TPAA 3QK6A 3KN8A 3K1PA 4YKKA 3U8QA 1P1UA 2H98A 2PX1A 4RPNA 2DS9A 5KZTA 2YLNA 4H0WA 5FHNA 2V84A 1NNTA 3TDJA 2OK2A 3IX1A 5JK4A 1GVCA 4GVOA 1H45A 4YB6A 2Y7PA 1MXZA 4DCXA 3UK4A 4QF9A 4KR5A 1JQFA 1B2HA 3TTNA 4DE8A 2F97A 3L6GA 3IOWA 4OETA 3A3UA 3WAFA 2QRYA 3DP8A 4IO6A 4H5FA 4FJPA 2I3WA 4FECA 4NF6B 2NVUB 1D3KA 3O6HA 3RTFB 4F22A 3ODBA 4F2QA 3IO6A 4F18A 3OO8A 5L9SA 2PYYA 4RY1A 2R9JA 3S4UA 1JVYA 4ONYA 2XX8A 2ESNA 5TP9B 2VOZA 2Q9TA 4WEPA 1MY1A 4N13A 3HHGA 3K1MA 4IO4A 4PETA 3TODA 5H8FB 3TTMA 2V25A 5ITOA 3V83A 1Y4TA 4HS7A 5I59A 5ISUA 2QS2A 4BDLA 4EXKA 1IXHA 4PQJA 3R6UA 1MRPA 2PVUA 2O68A 4IO2A 1MH3A 2DVCA 3N6UA 1WODA 5L9MA 1IXGA 3LSWA 3K0VA 2NXOA 1OVTA 2F7AA 2Q2AA 3HO7A 4XKQA 3C35A 3QAXA 2HEUA 3RT6B 2XXQA 1FW0A 1SW1A 2DVZA 4NEDA 3C9HA 1MXUA 3FXRA 1LAGE 3FJMA 5I2KA 5AA2B 1UTBB 1YTVA 3G3FA 5LOMA 1MG1A 2ALUA 4G68C 4XTCQ 1OLAA 3PMVA 5H8QB 4WXJA 4LVQA 3T9XB 1DTGA 4ZEBA 3W15C 4POXA 3B7DA 3TEPA 5H8NB 4FEDA 3LSFB 3K6UA 3BFTA 1RKMA 2I0CA 4NTLA 2ZYOA 1N84A 1J1NA 2NOOA 4F3GA 4R6YA 3ZSFA 3MZBA 1URSA 1MY2A 3PV0E 3MW0A 3FVGA 1ZTYA 2UVIA 1B32A 1VR5A 4EUOA 5DTBA 5AA4B 4GWOA 5JTYA 4U4XA 1B3FA 1QVSA 1B58A 5B70A 3FATA 4I62A 4C1TA 3LUYA 5EHMA 3OOAA 5A5XA 1MY0A 3FV2A 2XXUA 1B5JA 3G3JA 1ZBMA 2H25A 1B46A 5CMCA 1US5A 3OSRA 3VV5A 1IQ7A 2P2AA 3MP8A 3T9UA 4R9FA 4HCYA 2RCAA 3MVXA 2FYIA 3KJ7A 4LZ8A 3USDA 1IITA 2X26A 3OELA 4YB7A 2DQVA 3R26A 5CRYA 2ANJA 3OO7A 1IXCA 4PE5B 3U72A 1MQHA 3RY3A 4C1UA 3FGSA 4I8CA 1MQDA 4JWYA 3K6WA 4MLQA 1A55A 3ONMA 5ICTA 1XVXA 1ANFA 5F7VA 1A54A 3V5AA 4PFTA 4MF3A 1B51A 1PB7A 1FTLA 1MQGA 4Q8RA 1MXVA 1LGBC 1AOVA 4R75A 1EZOA 2I6EA 3VVDA 2QS4A 3TTKA 1AIVA 2I4BA 1OVBA 4IGTA 4JDFA 2UVJA 1MPBA 1O63A 3KOSA 2X7PA 5HBCA 1B3HA 4NF5A 3TUSA 3FXUA 4OERA 3KGCA 4P11A 4H67A 2GHBA 1N3WA 4QSEA 4TQUQ 3JZJA 3U92A 3AXFA 1M5EA 4OFOA 5I59B 3V89B 1VE4A 3C31A 1S9TA 1PBQA 1B1HA 1XC1A 3PPOA 4OZ9A 1AMFA 5J1DA 1TT1A 5AE4A 2I58A 3SEUA 4ZE8A 5CMKA 3RGYA 1FCKA 2YJPA 4F1VA 3T66A 3DM0A 1P1WA 2DWJA 4QRZA 4NWCA 1EZ9A 1QKAA 1WVJA 3N26A 5I2KB 3SEYA 4L17A 3VVFA 4G8MA 4LA9A 4MBPA 3M3LA 4P0IA 2WKYA 5AA2D 5FHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIC A;  1LCF A;  3CG1 A;  3ZKK A;  1PDA A;  4YMA A;  1FTO A;  1T0K A;  5TU0 A;  2XXI A;  2GHA A;  4RXL A;  3C34 A;  2G29 A;  3RN8 A;  4HW8 A;  3CSB A;  2D5W A;  3PPP A;  4QFL A;  5TPA A;  1A8F A;  3MPK A;  4ESW A;  3E3K A;  5M2V A;  1QUJ A;  3PUV E;  3EHU A;  4R2F A;  1QUL A;  5I56 A;  1GTK A;  2E1S A;  4OES A;  3EQ1 A;  3OD7 A;  1MDQ A;  4ISU A;  1I6Q A;  4G77 A;  1XOC A;  1TWY A;  5DEX A;  5JTY B;  2FNC A;  2VP1 A;  3GBA A;  1Y1M A;  5CBR A;  1POT A;  1FTK A;  3IO4 A;  3TCG A;  3K4U A;  4F19 A;  2IA4 A;  3IB2 A;  3TZA A;  1R9Q A;  5JEI A;  1JNF A;  2XD2 A;  2G93 A;  3TYH A;  3CG3 A;  4K3F A;  4LQ5 A;  4PFU A;  2M8C A;  5ICQ A;  4MFI A;  3SKP A;  4ZZA A;  2XD3 A;  1MY3 A;  4H8I A;  2Y7I A;  4EF1 A;  3LC8 A;  1N04 A;  2ONR A;  4DXC A;  4GD5 A;  1MXW A;  4GLI A;  4KD5 A;  1L5T A;  4FE8 A;  1M5C A;  2ZNU A;  3ECR A;  1DSN A;  3IB0 A;  3QUF A;  4NWD A;  2OZZ A;  4G8H A;  3T22 A;  3HPI A;  1BTJ A;  2GH9 A;  2UYF A;  3TTL A;  2DWI A;  5I58 A;  2X7Q A;  1CE2 A;  4KYS A;  3MAM A;  4NE4 A;  2B3B A;  1LFG A;  3HCQ A;  3MP1 A;  1PBP A;  3RPW A;  2F36 A;  4LQ2 A;  2DOJ A;  2GFE A;  4G2Z A;  2NWJ A;  4Q30 B;  3FIR A;  1NFT A;  2Q89 A;  2Y7K A;  2VD2 A;  4JBZ A;  2O6A A;  4FEB A;  3UA8 A;  4LZ5 A;  5KCJ A;  5DVI A;  4YB5 A;  1B40 A;  3O2A A;  2CZL A;  1MH4 A;  4ELO A;  3KN7 A;  4DXB A;  3G3G A;  4GQO A;  2O69 A;  1Y3N A;  4KCD A;  1PC3 A;  5H8H B;  1LFH A;  3ILT B;  4ELR A;  3O66 A;  3VXC A;  1MXX A;  4LUB A;  3ZS6 A;  3MP6 A;  4PFW A;  2DXR A;  1GV8 A;  2D3I A;  3S2V A;  1ZJL A;  4MH5 A;  3CFZ A;  4JWO A;  4JWX A;  1JEV A;  4ECF A;  4DCY A;  1ATG A;  3A3C A;  4XIG Q;  3VLW A;  1OMP A;  3LBS A;  4ZEC A;  4U2R A;  2ZNS A;  3MWB A;  1JVX A;  1Y1Z A;  5DVJ A;  3H3G A;  1M5D A;  3D4C A;  2DP8 A;  2XX7 A;  1MDP 1;  3IOR A;  2RC9 A;  4DZ1 A;  1YPN A;  2O1M A;  1B7Z A;  3G7W A;  1NNF A;  1FQE A;  1JET A;  2UYE A;  4IY5 A;  2F6P A;  5CMM A;  1D9Y A;  1B3G A;  4LP2 B;  3KN3 A;  3KG2 A;  2XX9 A;  4I1D A;  1OIB A;  1FQB A;  3W9V A;  1FTJ A;  3ILU B;  5TPA B;  4F3S A;  4JSO A;  3UGW A;  1QJM A;  4G4P A;  1OLC A;  3GLB A;  3IOT A;  2RF1 A;  3EN3 A;  4N6P A;  1F9B A;  1JW1 A;  2V3U A;  4JXI A;  3T93 B;  2H9B A;  4ZZE A;  5DEX B;  4GL0 A;  2THI A;  4WKM A;  1FTM A;  3UP9 A;  1US4 A;  4QFK A;  4LAT A;  4GRK A;  2F5X A;  3K6X A;  2ZYK A;  1NNP A;  5I57 A;  4NF8 A;  2UVH A;  1LCT A;  3KBR A;  4EF2 A;  1PB8 A;  4DIG A;  3EPE A;  3I5O A;  3FJ7 A;  5H8S A;  3S9M C;  1QUK A;  1B5H A;  1PEB A;  3SEW A;  3U93 A;  4QSD A;  4ZE9 A;  3KSX A;  4KHZ E;  4RNS A;  1SBP A;  2OCU A;  4IB2 A;  1H76 A;  3RLF E;  1B7U A;  2O51 A;  4OHN A;  2D21 A;  3K1N A;  1DPP A;  1O64 A;  3SER A;  4RJZ A;  4BLA A;  3MVW A;  3TQL A;  2XXT A;  4RK9 A;  4O3A A;  3E4R A;  4KFQ A;  5BWJ A;  1I69 A;  5L8D A;  3HST A;  1I6B A;  4RYA A;  1BKA A;  4UAC A;  4M4G A;  3RNN A;  1VFE A;  2Y7W A;  1R9L A;  5I58 B;  5ITP A;  3M3F A;  4GXS B;  3S9N C;  1LAX A;  3FD3 A;  4IO3 A;  4ELP A;  4YAH X;  5HM4 B;  4H5G A;  3SES A;  2Z8E A;  1MS7 A;  1R1N A;  4F3P A;  1UTH A;  2ZXT A;  3Q29 A;  4GIZ A;  1O7T A;  1AH5 A;  2FA7 A;  1B3L A;  5AA3 A;  4F39 A;  1B4H A;  2REG A;  4R2B A;  2ZMB A;  4R6K A;  3H7M A;  2DWH A;  4HTG A;  5KCJ B;  2QL3 A;  4NF4 A;  4F1Y A;  2I3V A;  1DTZ A;  3A09 A;  3MPL A;  1DMB A;  2DE2 A;  4N07 A;  3EF7 A;  1N0T A;  3TCF A;  1SW5 A;  4AB5 A;  2ONK E;  4THI A;  1MQJ A;  3FVN A;  4TLM B;  4KI0 E;  3C4M A;  4XKR A;  3GZG A;  3P7I A;  3MZ1 A;  5FTH A;  4XKP A;  3K01 A;  5CBS A;  1JW4 A;  2QS1 A;  4GL8 A;  1RYO A;  1D9V A;  3O6G A;  3PGF A;  1OQG A;  3CIJ A;  4BDO A;  3F11 A;  4PP0 A;  2XXW A;  5F1Q A;  3GXA A;  1IEJ A;  5CM6 A;  2F7C A;  3IR1 A;  5CI5 A;  3CSG A;  1FQA A;  3HV1 A;  1N3X A;  3N94 A;  3ZKL A;  5K2X A;  1NL5 A;  1A7L A;  3QSL A;  1SI0 A;  1LFI A;  3U1O A;  2F35 A;  3TKD A;  4E0X A;  1B52 A;  3TTR A;  4QSC A;  3T9H B;  3PPR A;  1MM6 A;  3B6Q A;  1NKX A;  4BDQ A;  3CVG A;  3OO9 A;  1LLS A;  3DEL B;  2B65 A;  1TFD A;  4JSD A;  4OXV A;  5H8F A;  2QS3 A;  1N7W A;  3TQW A;  1P1N A;  4GOT A;  4KQP A;  3THI A;  2XXV A;  3H4Z A;  3IJO B;  2Y84 A;  2R71 A;  3FVK A;  4H65 A;  1JEU A;  2ONS A;  2O7U A;  1FQC A;  3DLN A;  2OWS A;  1TXF A;  3KOT A;  4R72 A;  4U1Z A;  3BKI B;  1NNK A;  4R6H A;  1SI1 A;  3BBR A;  1LB8 A;  5I57 B;  4NF8 B;  1YAE A;  3M8U A;  2H4I A;  1A8E A;  3O97 A;  1UTB A;  2DE4 A;  3HN0 A;  1LBB A;  3DP6 A;  2Q8J A;  1CB6 A;  4E0W A;  4P0G A;  4QFP A;  4IGR A;  3O28 A;  1DPE A;  1USY E;  4QFO A;  2DSF A;  3C32 A;  3LSX A;  3H6T A;  3PD8 A;  4RK2 A;  5H8N A;  2P1S A;  2PT1 A;  5A5X B;  1SDX A;  1GGG A;  4GF8 A;  3VDF A;  2HQ0 A;  3MVY A;  1DOT A;  1B4Z A;  3CFX A;  4H6D A;  3OEK A;  3W9W A;  1USY H;  1M5F A;  3VLV A;  3FUZ A;  1QUI A;  3QUJ A;  1H43 A;  3IB1 A;  4O3B A;  1URG A;  2VGQ A;  2XXY A;  2XHD A;  3Q27 A;  4UA8 A;  1Q35 A;  2Z22 A;  4X1D A;  2BJJ X;  1Z7M E;  4FAJ A;  4Z7E A;  1P99 A;  1ZLQ A;  1MPD A;  1N76 A;  2HCA A;  4ND9 A;  3HHF A;  1P1Q A;  1SYH A;  4PFY A;  4U22 A;  4F3B A;  4F2O A;  1GR2 A;  4R74 A;  1B5I A;  1KWH A;  2I49 A;  2W7Y A;  1VFD A;  4ESX A;  1MY4 A;  5HPQ A;  3PUW E;  3IOV A;  4KPT A;  2IEE A;  1A40 A;  3UIF A;  2H99 A;  3OMB A;  3VE1 B;  2R6G E;  4JB7 A;  1M5B A;  5AA1 A;  3LSL A;  4NF5 B;  1Q1K A;  2F8D A;  3O29 A;  2PT2 A;  4OEV A;  3MJN A;  3CFL A;  2VD3 A;  3KFM A;  4YKI A;  1NH7 A;  3Q26 A;  3MUQ A;  4M1V A;  1XT8 A;  4X1B A;  5I2N A;  3VLU A;  2Y7R A;  3IOU A;  2Q88 A;  1LB9 A;  3RT8 A;  2XXP A;  3U94 A;  3VXB A;  3K6V A;  4DLD A;  1S50 A;  3MQ9 A;  3OXN A;  2RIN A;  2ABH A;  1B6H A;  5EYF A;  1UIV A;  4U4S A;  2I0B A;  3PD9 A;  4TOZ A;  2A5T A;  1N7X A;  3EHS A;  1SD3 A;  3Q28 A;  4Q0C A;  1WDN A;  1FQF A;  1Y3Q A;  3S9L C;  1B7H A;  2O84 X;  1QW0 A;  4R73 A;  4LZ7 A;  3N6T A;  1RYX A;  1ZKB A;  3UN6 A;  3WAE A;  4OEN A;  4OTE A;  1D4N A;  2F7B A;  1ZMG A;  1Y4C A;  3M3K A;  3C36 A;  5B7D A;  2Z23 A;  4H8J A;  3T9V A;  4GXA A;  4RPO A;  4FIM A;  2PMS A;  2ZNT A;  4GFR A;  4IO7 A;  3FVO A;  1IUD A;  1IIW A;  3I6V A;  5I56 B;  1ELJ A;  3MZ9 A;  2RKM A;  3IK6 B;  4U23 A;  4F31 B;  2NUV A;  5K2Y A;  3IAZ A;  2DYX A;  5KDT A;  5IAI A;  4FAT A;  1NH8 A;  1IXI A;  3PUY E;  1H3D A;  3KZG A;  1Y20 A;  5EHS A;  4TLL B;  3JYR A;  4YU0 A;  3FAS A;  3O9P A;  5FTI A;  3FJG A;  3PMW A;  2QJE A;  4OFJ A;  1Y3P A;  1I6A A;  3RQT A;  3TMG A;  4I9D A;  1XVY A;  4LON B;  2AL5 A;  1SVX B;  1ZIU A;  4OEU A;  4OWD A;  3L6H A;  3SDF A;  4HCW A;  2OJT A;  1BP5 A;  4XXU A;  2QMX A;  1BLF A;  1MXY A;  4BDN A;  1SYI A;  2XXX A;  1B05 A;  3PPN A;  3R7X A;  3PU5 A;  2QMW A;  4KCC A;  1NMU A;  2P0S A;  2ZYM A;  3G3I A;  3G3K A;  1P1O A;  3IL1 B;  1VSO A;  2AL4 A;  4X48 A;  3N5L A;  2RCB A;  1B0H A;  2O1L A;  2O7I A;  1H44 A;  1QKB A;  3IJX B;  3OEM A;  4ZS9 A;  5FHM A;  4EXL A;  2UVG A;  4OQO A;  4ELQ A;  3DP4 A;  1URD A;  3FV1 A;  3C33 A;  1BIY A;  1UQW A;  3Q25 A;  2V3Q A;  2B3F A;  3O6I A;  2OBG A;  3B6T A;  3RUM A;  2DE3 A;  1POY 1;  1LAF E;  5BUU A;  3TCH A;  4IO5 A;  1B1X A;  4G68 A;  1EZP A;  2HAV A;  3PMX A;  3G3H A;  3H6U A;  3UOR A;  3CRB A;  4ZEK A;  1JW5 A;  3K02 A;  4OVJ A;  3OEN A;  4Q5T A;  4ZEF A;  1LST A;  5I2N B;  4YZZ A;  5CMB A;  2LAO A;  3TEL A;  2QSX A;  4EQ7 A;  2DXY A;  1MQI A;  4OYV A;  1Z7N E;  3B6W A;  5IKB A;  4ZEI A;  4KYD A;  2F6G A;  3E13 X;  1ZU0 A;  4O3C A;  5L9O A;  2REJ A;  4WED A;  4ZDM A;  1AL3 A;  2YPN A;  2A5T B;  3PUX E;  2I48 A;  1B0L A;  3OSQ A;  2V93 A;  4ZED A;  2HAU A;  4NF6 A;  2KLF A;  4EQB A;  4U21 A;  1R6Z A;  2HZL A;  5H8H A;  2H5Y A;  2V3T A;  1MPC A;  3KSJ A;  4YKP A;  3H03 A;  3LR1 A;  3TAJ A;  3VFJ A;  2UXA A;  5TP9 A;  1IZ1 A;  3T96 B;  4KYE A;  5DVF A;  5I84 A;  4RA1 A;  3FZV A;  3K00 A;  5CC2 A;  4EQ9 A;  2AYS A;  1LAH E;  1YCJ A;  2XXR A;  2HZK A;  2CMO A;  3QIM A;  2QPQ A;  3QXM A;  3KEI A;  2Z8F A;  2GRV A;  4NMY A;  1FQD A;  1UIU A;  2Q2C A;  4DXU A;  3CR9 A;  3SET A;  4IY6 A;  2RC8 A;  5KDT B;  3S9E A;  3SEV A;  2VHA A;  2ZYN A;  2OWT A;  3H06 B;  3KJT A;  1HSL A;  5AA2 A;  4AB6 A;  1EU8 A;  2I4C A;  5H8Q A;  2Z8D A;  2XXH A;  3H6W A;  4YMB A;  4FOR A;  5DT6 A;  4H1X A;  3JV9 A;  2RC7 A;  1SW2 A;  1B9J A;  2PBW A;  4EDP A;  3OO6 A;  2HXW A;  4OMB A;  5DYH A;  3RTW B;  4DDD A;  1HSE A;  1SQY A;  4XKN A;  1XHY A;  4POW A;  2DWA A;  2HFB A;  1MM7 A;  4AQ4 A;  2AIX A;  3MC2 A;  1XS5 A;  4YKJ A;  3BFU A;  4MLV A;  4QHQ A;  1HSJ A;  2F78 A;  1TFA A;  5AA4 A;  1OQH A;  4OFL A;  3MVZ A;  3H6V A;  3V8X B;  3VVE A;  2F34 A;  1EH3 A;  3GBB A;  5ELV A;  1B3E A;  4QFN A;  4F1U A;  3PUZ E;  4BDR A;  1Y9U A;  3MBP A;  1SW4 A;  4Z0I A;  4G8N A;  4U1O A;  3K2D A;  4BDM A;  3PPQ A;  1PB9 A;  1LBC A;  3FXQ A;  1UTH B;  3D4G A;  2E0S A;  4C0R A;  3I3V A;  3QYT A;  3TFL A;  3CI8 A;  3E9X A;  2OLB A;  4X9T A;  1S7Y A;  1II5 A;  4G68 B;  4F29 A;  2A5S A;  3EHT A;  3SEX A;  4R9G A;  4NF4 B;  1A99 A;  3TPA A;  3QK6 A;  3KN8 A;  3K1P A;  4YKK A;  3U8Q A;  1P1U A;  2H98 A;  2PX1 A;  4RPN A;  2DS9 A;  5KZT A;  2YLN A;  4H0W A;  5FHN A;  2V84 A;  1NNT A;  3TDJ A;  2OK2 A;  3IX1 A;  5JK4 A;  1GVC A;  4GVO A;  1H45 A;  4YB6 A;  2Y7P A;  1MXZ A;  4DCX A;  3UK4 A;  4QF9 A;  4KR5 A;  1JQF A;  1B2H A;  3TTN A;  4DE8 A;  2F97 A;  3L6G A;  3IOW A;  4OET A;  3A3U A;  3WAF A;  2QRY A;  3DP8 A;  4IO6 A;  4H5F A;  4FJP A;  2I3W A;  4FEC A;  4NF6 B;  2NVU B;  1D3K A;  3O6H A;  3RTF B;  4F22 A;  3ODB A;  4F2Q A;  3IO6 A;  4F18 A;  3OO8 A;  5L9S A;  2PYY A;  4RY1 A;  2R9J A;  3S4U A;  1JVY A;  4ONY A;  2XX8 A;  2ESN A;  5TP9 B;  2VOZ A;  2Q9T A;  4WEP A;  1MY1 A;  4N13 A;  3HHG A;  3K1M A;  4IO4 A;  4PET A;  3TOD A;  5H8F B;  3TTM A;  2V25 A;  5ITO A;  3V83 A;  1Y4T A;  4HS7 A;  5I59 A;  5ISU A;  2QS2 A;  4BDL A;  4EXK A;  1IXH A;  4PQJ A;  3R6U A;  1MRP A;  2PVU A;  2O68 A;  4IO2 A;  1MH3 A;  2DVC A;  3N6U A;  1WOD A;  5L9M A;  1IXG A;  3LSW A;  3K0V A;  2NXO A;  1OVT A;  2F7A A;  2Q2A A;  3HO7 A;  4XKQ A;  3C35 A;  3QAX A;  2HEU A;  3RT6 B;  2XXQ A;  1FW0 A;  1SW1 A;  2DVZ A;  4NED A;  3C9H A;  1MXU A;  3FXR A;  1LAG E;  3FJM A;  5I2K A;  5AA2 B;  1UTB B;  1YTV A;  3G3F A;  5LOM A;  1MG1 A;  2ALU A;  4G68 C;  4XTC Q;  1OLA A;  3PMV A;  5H8Q B;  4WXJ A;  4LVQ A;  3T9X B;  1DTG A;  4ZEB A;  3W15 C;  4POX A;  3B7D A;  3TEP A;  5H8N B;  4FED A;  3LSF B;  3K6U A;  3BFT A;  1RKM A;  2I0C A;  4NTL A;  2ZYO A;  1N84 A;  1J1N A;  2NOO A;  4F3G A;  4R6Y A;  3ZSF A;  3MZB A;  1URS A;  1MY2 A;  3PV0 E;  3MW0 A;  3FVG A;  1ZTY A;  2UVI A;  1B32 A;  1VR5 A;  4EUO A;  5DTB A;  5AA4 B;  4GWO A;  5JTY A;  4U4X A;  1B3F A;  1QVS A;  1B58 A;  5B70 A;  3FAT A;  4I62 A;  4C1T A;  3LUY A;  5EHM A;  3OOA A;  5A5X A;  1MY0 A;  3FV2 A;  2XXU A;  1B5J A;  3G3J A;  1ZBM A;  2H25 A;  1B46 A;  5CMC A;  1US5 A;  3OSR A;  3VV5 A;  1IQ7 A;  2P2A A;  3MP8 A;  3T9U A;  4R9F A;  4HCY A;  2RCA A;  3MVX A;  2FYI A;  3KJ7 A;  4LZ8 A;  3USD A;  1IIT A;  2X26 A;  3OEL A;  4YB7 A;  2DQV A;  3R26 A;  5CRY A;  2ANJ A;  3OO7 A;  1IXC A;  4PE5 B;  3U72 A;  1MQH A;  3RY3 A;  4C1U A;  3FGS A;  4I8C A;  1MQD A;  4JWY A;  3K6W A;  4MLQ A;  1A55 A;  3ONM A;  5ICT A;  1XVX A;  1ANF A;  5F7V A;  1A54 A;  3V5A A;  4PFT A;  4MF3 A;  1B51 A;  1PB7 A;  1FTL A;  1MQG A;  4Q8R A;  1MXV A;  1LGB C;  1AOV A;  4R75 A;  1EZO A;  2I6E A;  3VVD A;  2QS4 A;  3TTK A;  1AIV A;  2I4B A;  1OVB A;  4IGT A;  4JDF A;  2UVJ A;  1MPB A;  1O63 A;  3KOS A;  2X7P A;  5HBC A;  1B3H A;  4NF5 A;  3TUS A;  3FXU A;  4OER A;  3KGC A;  4P11 A;  4H67 A;  2GHB A;  1N3W A;  4QSE A;  4TQU Q;  3JZJ A;  3U92 A;  3AXF A;  1M5E A;  4OFO A;  5I59 B;  3V89 B;  1VE4 A;  3C31 A;  1S9T A;  1PBQ A;  1B1H A;  1XC1 A;  3PPO A;  4OZ9 A;  1AMF A;  5J1D A;  1TT1 A;  5AE4 A;  2I58 A;  3SEU A;  4ZE8 A;  5CMK A;  3RGY A;  1FCK A;  2YJP A;  4F1V A;  3T66 A;  3DM0 A;  1P1W A;  2DWJ A;  4QRZ A;  4NWC A;  1EZ9 A;  1QKA A;  1WVJ A;  3N26 A;  5I2K B;  3SEY A;  4L17 A;  3VVF A;  4G8M A;  4LA9 A;  4MBP A;  3M3L A;  4P0I A;  2WKY A;  5AA2 D;  5FHO A; 
#chains in the Genus database with same CATH topology
 4YIC A;  1LCF A;  3CG1 A;  3ZKK A;  1PDA A;  4YMA A;  1FTO A;  1T0K A;  5TU0 A;  2XXI A;  2GHA A;  4O94 A;  4RXL A;  3C34 A;  2G29 A;  3RN8 A;  4HW8 A;  3CSB A;  2D5W A;  3PPP A;  4QFL A;  5TPA A;  4MHF A;  4H46 A;  1A8F A;  3MPK A;  4ESW A;  3E3K A;  5M2V A;  1QUJ A;  3PUV E;  3EHU A;  4R2F A;  4P56 A;  1QUL A;  5I56 A;  1GTK A;  2E1S A;  4OES A;  3EQ1 A;  3OD7 A;  1MDQ A;  5IZ3 A;  4ISU A;  1I6Q A;  4G77 A;  4GWY A;  1XOC A;  1TWY A;  5DEX A;  5JTY B;  5LTC A;  2FNC A;  2VP1 A;  3GBA A;  1Y1M A;  1IMB A;  5CBR A;  1POT A;  1FTK A;  3IO4 A;  3TCG A;  3K4U A;  1FPB A;  2R8T A;  2QVU A;  4F19 A;  2IA4 A;  3IB2 A;  3TZA A;  1R9Q A;  5JEI A;  2ZZV A;  1JNF A;  2QVV A;  2XD2 A;  2G93 A;  3TYH A;  3CG3 A;  4K3F A;  4LQ5 A;  4PFU A;  2M8C A;  5ICQ A;  4PF6 A;  4MFI A;  3SKP A;  4ZZA A;  2XD3 A;  1MY3 A;  4H8I A;  2Y7I A;  4EF1 A;  3LC8 A;  1N04 A;  2ONR A;  4DXC A;  4GD5 A;  1MXW A;  4GLI A;  4KD5 A;  4MJO A;  1L5T A;  4FE8 A;  1M5C A;  1NV3 A;  2ZNU A;  3ECR A;  1DSN A;  3IB0 A;  2FVZ A;  3QUF A;  4NWD A;  4GWS A;  2OZZ A;  4G8H A;  3T22 A;  1RDX A;  3HPI A;  1BTJ A;  2GH9 A;  2UYF A;  3TTL A;  2DWI A;  5I58 A;  2X7Q A;  1CE2 A;  4KYS A;  4DI3 D;  3MAM A;  4NE4 A;  2B3B A;  1LFG A;  4XFE A;  3HCQ A;  3MP1 A;  4N6D A;  1PBP A;  3RPW A;  3PTY A;  2F36 A;  4LQ2 A;  3LV0 A;  2DOJ A;  2GFE A;  4G2Z A;  5DW8 A;  2NWJ A;  4Q30 B;  3FIR A;  3EKI A;  1NFT A;  2Q89 A;  2Y7K A;  2PCR A;  4H45 A;  2VD2 A;  3QMF A;  4JBZ A;  4N81 A;  4MEV A;  2O6A A;  4FEB A;  3UA8 A;  4LZ5 A;  5KCJ A;  5DVI A;  4YB5 A;  1B40 A;  2JJK A;  1FBP A;  3O2A A;  2CZL A;  1MH4 A;  4ELO A;  3KN7 A;  4DXB A;  3G3G A;  4GQO A;  2O69 A;  1Y3N A;  4KCD A;  2CEY A;  1PC3 A;  5H8H B;  1LFH A;  4JVC A;  3ILT B;  4ELR A;  3O66 A;  3VXC A;  1MXX A;  4LUB A;  3ZS6 A;  3MP6 A;  4PFW A;  2DXR A;  1DCU A;  1GV8 A;  2D3I A;  1G0I A;  1JP4 A;  3S2V A;  1ZJL A;  4MH5 A;  3CFZ A;  4JWO A;  4JWX A;  1JEV A;  4ECF A;  4DCY A;  1ATG A;  3A3C A;  4XIG Q;  3VLW A;  1OMP A;  3LBS A;  4ZEC A;  1LBV A;  4U2R A;  2ZNS A;  3MWB A;  1JVX A;  1Y1Z A;  5DVJ A;  3H3G A;  1M5D A;  3D4C A;  2DP8 A;  4MAG A;  2XX7 A;  1MDP 1;  3IOR A;  2RC9 A;  2QFL A;  4DZ1 A;  1YPN A;  1VDW A;  2O1M A;  4QXD A;  1B7Z A;  3G7W A;  1NNF A;  1FQE A;  1JET A;  2UYE A;  4IY5 A;  1KA0 A;  2F6P A;  5CMM A;  1D9Y A;  1B3G A;  4LP2 B;  3KN3 A;  3KG2 A;  2XX9 A;  4I1D A;  1OIB A;  1FQB A;  3W9V A;  4NX1 A;  1FTJ A;  3ILU B;  4NHB A;  5EYH A;  5TPA B;  4F3S A;  4JSO A;  3UGW A;  1QJM A;  4G4P A;  1OLC A;  3GLB A;  3IOT A;  2RF1 A;  3EN3 A;  4N6P A;  2WYP A;  1F9B A;  1JW1 A;  2V3U A;  4JXI A;  3T93 B;  2H9B A;  4ZZE A;  5DEX B;  4GL0 A;  4I40 A;  2THI A;  4WKM A;  1FTM A;  3UP9 A;  1US4 A;  4QFK A;  4LAT A;  4GRK A;  2F5X A;  3K6X A;  3E78 A;  4PGP A;  2ZYK A;  1NNP A;  5T3J A;  5I57 A;  4NF8 A;  2UVH A;  1LCT A;  3KBR A;  4EF2 A;  1PB8 A;  4DIG A;  3EPE A;  3I5O A;  1SPI A;  3FJ7 A;  5H8S A;  3S9M C;  1QUK A;  1B5H A;  1PEB A;  3SEW A;  3U93 A;  4GWW A;  4QSD A;  4ZE9 A;  3KSX A;  4KHZ E;  4RNS A;  1SBP A;  2OCU A;  4IB2 A;  1K9Z A;  5ESY A;  1H76 A;  3RLF E;  1B7U A;  2O51 A;  4OHN A;  2D21 A;  5EQA A;  3K1N A;  4GWU A;  5IZZ A;  4P3L A;  1DPP A;  4OAN A;  1O64 A;  3SER A;  4RJZ A;  4BLA A;  3MVW A;  3TQL A;  2XXT A;  4RK9 A;  4O3A A;  3E4R A;  4KFQ A;  5BWJ A;  1I69 A;  5L8D A;  2CZI A;  1I6B A;  3HST A;  4RYA A;  1BKA A;  4UAC A;  4M4G A;  3RNN A;  1VFE A;  1DK4 A;  1R9L A;  2BJI A;  2Y7W A;  5I58 B;  5ITP A;  3M3F A;  4GXS B;  3S9N C;  1LAX A;  3FD3 A;  4GX6 A;  4IO3 A;  4ELP A;  4MNP A;  4YAH X;  5HM4 B;  4H5G A;  3SES A;  2Z8E A;  3U65 A;  1MS7 A;  1R1N A;  4F3P A;  4NG7 A;  1UTH A;  2ZXT A;  3Q29 A;  4GIZ A;  1O7T A;  1AH5 A;  1FPL A;  2FA7 A;  1B3L A;  5AA3 A;  4F39 A;  1IME A;  1B4H A;  2REG A;  4R2B A;  4PCD A;  4OA4 A;  5F24 A;  1D9Q A;  4OVP A;  2ZMB A;  4R6K A;  3H7M A;  2DWH A;  4HTG A;  5KCJ B;  2QL3 A;  2F3B A;  4GBV A;  4NF4 A;  2CZK A;  4F1Y A;  2I3V A;  1DTZ A;  3A09 A;  3MPL A;  1DMB A;  2DE2 A;  1LEV A;  4N07 A;  3EF7 A;  1N0T A;  3TCF A;  1SW5 A;  4AB5 A;  2ONK E;  4THI A;  1MQJ A;  3FVN A;  4TLM B;  4KI0 E;  3C4M A;  4XKR A;  3GZG A;  3P7I A;  1FJ6 A;  3MZ1 A;  5FTH A;  4XKP A;  3K01 A;  5CBS A;  1JW4 A;  2QS1 A;  4JVD A;  4GL8 A;  1RYO A;  1D9V A;  3O6G A;  3PGF A;  1NUX A;  1OQG A;  3CIJ A;  4BDO A;  3F11 A;  4PP0 A;  2XXW A;  2B4M A;  5F1Q A;  3GXA A;  1IEJ A;  5CM6 A;  4N8Y A;  2F7C A;  3IR1 A;  5CI5 A;  2ZZX A;  1CNQ A;  3CSG A;  1FQA A;  3HV1 A;  1N3X A;  3N94 A;  3ZKL A;  5K2X A;  1NL5 A;  1A7L A;  3QSL A;  1SI0 A;  1LFI A;  3U1O A;  2F35 A;  3TKD A;  4E0X A;  1B52 A;  3TTR A;  4QSC A;  3T9H B;  1LBX A;  3PPR A;  1MM6 A;  3B6Q A;  1NKX A;  4BDQ A;  1FJ9 A;  3CVG A;  4NGU A;  4PFR A;  3OO9 A;  1LLS A;  3DEL B;  2B65 A;  1TFD A;  4JSD A;  4OXV A;  5H8F A;  3LUZ A;  2QS3 A;  1N7W A;  3TQW A;  1P1N A;  4GOT A;  4KQP A;  3THI A;  5ET8 A;  2XXV A;  4MNI A;  3H4Z A;  3IJO B;  2Y84 A;  2R71 A;  3FVK A;  4H65 A;  1JEU A;  2ONS A;  2O7U A;  1FQC A;  3ISP A;  4MNC A;  3DLN A;  2OWS A;  1TXF A;  5ET6 A;  3GYY A;  3KOT A;  4R72 A;  4U1Z A;  4IR8 A;  3BKI B;  1NNK A;  4MX6 A;  4P8B A;  4R6H A;  1SI1 A;  4N4U A;  3BBR A;  1LB8 A;  4AS4 A;  5I57 B;  4NF8 B;  1YAE A;  3M8U A;  2H4I A;  1A8E A;  2Y5L A;  1UTB A;  3O97 A;  2DE4 A;  3HN0 A;  1LBB A;  3DP6 A;  2Q8J A;  1CB6 A;  4E0W A;  4P0G A;  3SZP A;  4QFP A;  4IGR A;  1YZ0 A;  3O28 A;  1DPE A;  1KA1 A;  1USY E;  4QFO A;  2DSF A;  3C32 A;  3LSX A;  3H6T A;  3PD8 A;  1NV1 A;  4RK2 A;  5H8N A;  2WBD A;  2P1S A;  2P3V A;  4HE0 A;  2PT1 A;  2Q74 A;  5A5X B;  1SDX A;  4MIJ A;  1GGG A;  4GF8 A;  3VDF A;  2HQ0 A;  4JVI A;  2FBP A;  1Q9D A;  3MVY A;  1DOT A;  1B4Z A;  4PFB A;  3CFX A;  1FBF A;  4H6D A;  3OEK A;  3W9W A;  1USY H;  1M5F A;  3FUZ A;  1QUI A;  3VLV A;  3QUJ A;  1FPD A;  1H43 A;  3IB1 A;  4OVT A;  4O3B A;  1URG A;  2VGQ A;  2XXY A;  1XI6 A;  2XHD A;  4P47 A;  3Q27 A;  4UA8 A;  1Q35 A;  4PBQ A;  2Z22 A;  4X1D A;  2BJJ X;  1Z7M E;  2XWI A;  4FAJ A;  4Z7E A;  1P99 A;  1ZLQ A;  1MPD A;  1N76 A;  2HCA A;  4ND9 A;  3HHF A;  1P1Q A;  1NV5 A;  1SYH A;  4PFY A;  4U22 A;  4KXP A;  4F3B A;  4F2O A;  1GR2 A;  1FBE A;  3BIG A;  4R74 A;  3BIH A;  1B5I A;  1KWH A;  2I49 A;  2W7Y A;  1VFD A;  4ESX A;  1EYI A;  4N8G A;  1MY4 A;  5HPQ A;  1FSA A;  3PUW E;  3IOV A;  4KPT A;  2IEE A;  1A40 A;  3UIF A;  2H99 A;  3OMB A;  3T1B A;  3VE1 B;  4GBW A;  2R6G E;  3MST A;  4JB7 A;  3HFU A;  1M5B A;  5AA1 A;  4P1E A;  3LSL A;  4NF5 B;  1Q1K A;  3CHG A;  2F8D A;  3O29 A;  2PT2 A;  4OEV A;  3MJN A;  3CFL A;  2VD3 A;  3KFM A;  4YKI A;  1NH7 A;  3Q26 A;  3MUQ A;  4M1V A;  1XT8 A;  4X1B A;  1KZ8 A;  5I2N A;  3VLU A;  1FPI A;  2Y7R A;  3B8B A;  2Q88 A;  3IOU A;  1NV0 A;  1LB9 A;  3RT8 A;  2XXP A;  3U94 A;  3VXB A;  3K6V A;  4DLD A;  1S50 A;  3MQ9 A;  3OXN A;  2B4L A;  2RIN A;  1NV4 A;  2ABH A;  4P1L A;  1B6H A;  4PGN A;  5EYF A;  1UIV A;  4U4S A;  2I0B A;  2FIX A;  2WX9 A;  4TOZ A;  3PD9 A;  2A5T A;  1N7X A;  2Y5K A;  1EYK A;  1SD3 A;  3EHS A;  3Q28 A;  4Q0C A;  3A29 A;  3FXB A;  1WDN A;  1FQF A;  1Y3Q A;  5ET7 A;  3S9L C;  1B7H A;  2O84 X;  1QW0 A;  4R73 A;  4LZ7 A;  3N6T A;  1RYX A;  1ZKB A;  3UN6 A;  3WAE A;  4OEN A;  4OTE A;  1D4N A;  2F7B A;  1ZMG A;  1Y4C A;  3M3K A;  3C36 A;  1YYZ A;  5B7D A;  5I5P A;  2Z23 A;  4H8J A;  1FBG A;  3T9V A;  4O7M A;  4GXA A;  4RPO A;  4FIM A;  2PMS A;  2ZNT A;  4GFR A;  4IO7 A;  1INP A;  3FVO A;  1FRP A;  1FPE A;  1IUD A;  1IIW A;  3I6V A;  5I56 B;  1ELJ A;  1G0H A;  3MZ9 A;  5EQ7 A;  2RKM A;  5IZ3 B;  3IK6 B;  4U23 A;  4F31 B;  2NUV A;  5K2Y A;  3IAZ A;  2DYX A;  5IGA A;  5KDT A;  5IAI A;  4FAT A;  1LBZ A;  1NH8 A;  1IXI A;  3PUY E;  1H3D A;  3KZG A;  1Y20 A;  5EHS A;  4TLL B;  3JYR A;  2PFY A;  1FPJ A;  4YU0 A;  3RPL A;  3FAS A;  3O9P A;  5FTI A;  3FJG A;  3PMW A;  2QJE A;  4OFJ A;  4PF8 A;  1Y3P A;  1I6A A;  3RQT A;  3TMG A;  4I9D A;  1XVY A;  4LON B;  4NAP A;  2AL5 A;  1FBD A;  1SVX B;  1ZIU A;  2L5V A;  4NQ8 A;  4OEU A;  4OWD A;  4PC9 A;  3L6H A;  3SDF A;  4HCW A;  2OJT A;  1BP5 A;  4XXU A;  2QMX A;  1BLF A;  1MXY A;  4BDN A;  1SYI A;  4PDD A;  4PFI A;  2XXX A;  1B05 A;  3PPN A;  3R7X A;  4O7I A;  3PU5 A;  2QMW A;  4KCC A;  1NMU A;  2P0S A;  2ZYM A;  4X04 A;  3G3I A;  3G3K A;  2XWV A;  1P1O A;  3IL1 B;  1VSO A;  2AL4 A;  4X48 A;  5FBP A;  2XWO A;  4GWX A;  3N5L A;  2RCB A;  1BK4 A;  1B0H A;  2O1L A;  2O7I A;  1H44 A;  1QKB A;  3IJX B;  3OEM A;  4ZS9 A;  5FHM A;  4MMP A;  4EXL A;  2UVG A;  4OQO A;  4ELQ A;  3DP4 A;  4UAB A;  1IMC A;  1URD A;  3FV1 A;  3C33 A;  1BIY A;  1UQW A;  3Q25 A;  2V3Q A;  2B3F A;  3O6I A;  2OBG A;  2V4C A;  3B6T A;  3E79 A;  3RUM A;  2DE3 A;  4PAI A;  1POY 1;  1LAF E;  5BUU A;  3TCH A;  4IO5 A;  1B1X A;  4G68 A;  3KC0 A;  1EZP A;  1FTA A;  2HAV A;  3PMX A;  3G3H A;  2VPN A;  3H6U A;  3UOR A;  3CRB A;  4ZEK A;  1JW5 A;  3K02 A;  4OVJ A;  3OEN A;  4Q5T A;  4ZEF A;  1NUW A;  1LST A;  5I2N B;  4PAK A;  5CMB A;  4YZZ A;  2LAO A;  3TEL A;  2QSX A;  4EQ7 A;  2DXY A;  2PFZ A;  1MQI A;  4OYV A;  3D1R A;  1Z7N E;  4GX3 A;  3B6W A;  5IKB A;  2FIE A;  4ZEI A;  4KYD A;  2F6G A;  3E13 X;  1ZU0 A;  4O3C A;  5L9O A;  2REJ A;  4WED A;  4ZDM A;  4HE1 A;  1AL3 A;  2YPN A;  2XXK A;  2A5T B;  1NV6 A;  3PUX E;  2I48 A;  1B0L A;  3OSQ A;  2V93 A;  4I3E A;  2HAU A;  4NF6 A;  4ZED A;  1EYJ A;  2KLF A;  4EQB A;  4U21 A;  1NI9 A;  1R6Z A;  2HZL A;  5H8H A;  2H5Y A;  2V3T A;  1MPC A;  3KSJ A;  3MYU A;  4YKP A;  3H03 A;  3LR1 A;  3TAJ A;  2F3D A;  3VFJ A;  2UXA A;  5TP9 A;  2HXR A;  1IZ1 A;  3T96 B;  4KYE A;  5DVF A;  2VT5 A;  5I84 A;  4RA1 A;  5EQ9 A;  4OVQ A;  3FZV A;  1FBH A;  3K00 A;  5CC2 A;  4EQ9 A;  2AYS A;  1LAH E;  1YCJ A;  2XXR A;  2HZK A;  2CMO A;  3QIM A;  2QPQ A;  3QXM A;  3KEI A;  2Z8F A;  2GRV A;  4NMY A;  1FQD A;  1UIU A;  2Q2C A;  4DXU A;  3CR9 A;  3KBZ A;  3SET A;  4IY6 A;  2RC8 A;  5KDT B;  3S9E A;  4AS5 A;  3B50 A;  3IFC A;  4N6K A;  2CZH A;  3SEV A;  2VHA A;  2ZYN A;  2OWT A;  3IFA A;  1LBW A;  3H06 B;  3RPL B;  1QGX A;  3KJT A;  2HHM A;  1IMF A;  4N17 A;  1HSL A;  1FBC A;  1YXI A;  5AA2 A;  4AB6 A;  1EU8 A;  2I4C A;  5A5L A;  5H8Q A;  2Z8D A;  2XXH A;  3H6W A;  4YMB A;  4FOR A;  5DT6 A;  4H1X A;  3JV9 A;  2RC7 A;  4NF0 A;  1SW2 A;  1B9J A;  2PBW A;  4EDP A;  3OO6 A;  2HXW A;  3T0J A;  4OMB A;  5DYH A;  3RTW B;  4DDD A;  1HSE A;  2Q8M A;  1SQY A;  4XKN A;  1XHY A;  4O8M A;  2XWK A;  4POW A;  2DWA A;  2HFB A;  1MM7 A;  4AQ4 A;  5IM2 A;  2AIX A;  5ET5 A;  3MC2 A;  1XS5 A;  4YKJ A;  3BFU A;  4MLV A;  4QHQ A;  4P9K A;  1HSJ A;  2F78 A;  1TFA A;  5AA4 A;  1OQH A;  4OFL A;  3MVZ A;  1LBY A;  5EQ8 A;  3H6V A;  3V8X B;  3VVE A;  2F34 A;  4PDH A;  1EH3 A;  3GBB A;  4PTK A;  2QVR A;  5ELV A;  1B3E A;  4QFN A;  4F1U A;  3PUZ E;  4BDR A;  1Y9U A;  2KQZ A;  3MBP A;  1SW4 A;  4Z0I A;  4G8N A;  4U1O A;  3K2D A;  4BDM A;  3PPQ A;  1PB9 A;  1LBC A;  3FXQ A;  1UTH B;  3D4G A;  1RDY A;  2E0S A;  3FBP A;  4C0R A;  3I3V A;  2WBB A;  3QYT A;  3TFL A;  2OWZ A;  3CI8 A;  3E9X A;  2OLB A;  4X9T A;  1S7Y A;  1II5 A;  4LN5 A;  4G68 B;  4F29 A;  2A5S A;  3EHT A;  3SEX A;  4I3Y A;  4R9G A;  4NF4 B;  1A99 A;  3TPA A;  3QK6 A;  2HPG A;  3KN8 A;  3K1P A;  4OVS A;  4YKK A;  3U8Q A;  1P1U A;  2H98 A;  2PX1 A;  4RPN A;  2DS9 A;  5KZT A;  2YLN A;  4H0W A;  5FHN A;  1FPF A;  2V84 A;  1NNT A;  4G61 A;  3TDJ A;  2OK2 A;  3IX1 A;  4PAF A;  5JK4 A;  1GVC A;  4GVO A;  3NOH A;  1H45 A;  4YB6 A;  4GX4 A;  2Y7P A;  1MXZ A;  4DCX A;  3UK4 A;  4QF9 A;  4KR5 A;  1JQF A;  1B2H A;  3TTN A;  4DE8 A;  2F97 A;  3L6G A;  3IOW A;  4OET A;  1NUY A;  3A3U A;  3WAF A;  2QRY A;  3DP8 A;  4DI4 B;  4IO6 A;  4H5F A;  2DDK A;  4PBH A;  4FJP A;  2I3W A;  4FEC A;  4NF6 B;  2NVU B;  1D3K A;  3O6H A;  3RTF B;  4F22 A;  3ODB A;  4F2Q A;  3IO6 A;  4F18 A;  3OO8 A;  5L9S A;  2PYY A;  4RY1 A;  2R9J A;  3S4U A;  1JVY A;  4ONY A;  2XX8 A;  2ESN A;  5TP9 B;  2KR0 A;  4FBP A;  2VOZ A;  2Q9T A;  4WEP A;  1MY1 A;  4N13 A;  3HHG A;  3K1M A;  4IO4 A;  4PET A;  3TOD A;  2GQ1 A;  5H8F B;  3TTM A;  2V25 A;  4GWZ A;  5ITO A;  3V83 A;  1Y4T A;  4HS7 A;  5I59 A;  5ISU A;  4N91 A;  2QS2 A;  4BDL A;  4EXK A;  1IXH A;  4PQJ A;  3R6U A;  1MRP A;  2PVU A;  2O68 A;  2XA5 A;  4IO2 A;  1MH3 A;  2DVC A;  3N6U A;  1WOD A;  5L9M A;  1IXG A;  3LSW A;  3K0V A;  2NXO A;  1OVT A;  1NV2 A;  2F7A A;  2Q2A A;  3HO7 A;  4XKQ A;  3C35 A;  3KC1 A;  3QAX A;  2HEU A;  3RT6 B;  2XXQ A;  1FW0 A;  1SW1 A;  2DVZ A;  1RDZ A;  4NED A;  3C9H A;  1MXU A;  3FXR A;  1LAG E;  3FJM A;  5I2K A;  5AA2 B;  1UTB B;  1YTV A;  3G3F A;  5LOM A;  1MG1 A;  2ALU A;  4G68 C;  4XTC Q;  1OLA A;  3PMV A;  5H8Q B;  4WXJ A;  1FPG A;  5I7I A;  4LVQ A;  3T9X B;  1DTG A;  4ZEB A;  3W15 C;  4POX A;  4XEQ A;  3B7D A;  2WEF A;  3TEP A;  5H8N B;  4FED A;  3LSF B;  4HE2 A;  3K6U A;  3BFT A;  1RKM A;  2I0C A;  4NTL A;  2ZYO A;  1N84 A;  1J1N A;  2NOO A;  4F3G A;  4R6Y A;  3ZSF A;  5IZ1 A;  4QBA A;  3MZB A;  1URS A;  1MY2 A;  3PV0 E;  5EYG A;  3MW0 A;  3FVG A;  1ZTY A;  2UVI A;  1B32 A;  1VR5 A;  4EUO A;  5DTB A;  4MCO A;  4GWO A;  5AA4 B;  5JTY A;  4U4X A;  4X8R A;  1B3F A;  1QVS A;  1B58 A;  5B70 A;  3FAT A;  4I62 A;  4C1T A;  3LUY A;  5EHM A;  3OOA A;  5A5X A;  1MY0 A;  3FV2 A;  2XXU A;  1B5J A;  3G3J A;  1ZBM A;  2H25 A;  2P3N A;  1B46 A;  5CMC A;  1US5 A;  3OSR A;  3VV5 A;  1IQ7 A;  2P2A A;  3MP8 A;  3T9U A;  4R9F A;  4HCY A;  2RCA A;  3MVX A;  2FYI A;  3KJ7 A;  4XF5 A;  4LZ8 A;  3USD A;  1IIT A;  2CEX A;  2X26 A;  3OEL A;  4YB7 A;  2DQV A;  3R26 A;  5CRY A;  2FHY A;  2ANJ A;  3OO7 A;  1AWB A;  1NV7 A;  1IXC A;  4PE5 B;  3U72 A;  1MQH A;  3RY3 A;  2VPO A;  4C1U A;  3FGS A;  4I8C A;  1MQD A;  4JWY A;  3K6W A;  4MLQ A;  1A55 A;  3ONM A;  5ICT A;  2ZZW A;  4PE3 A;  4NN3 A;  1XVX A;  1ANF A;  5F7V A;  2MKZ A;  1A54 A;  3V5A A;  4PFT A;  4MF3 A;  1B51 A;  1PB7 A;  1FTL A;  1MQG A;  4Q8R A;  1MXV A;  1IMA A;  1LGB C;  1AOV A;  4R75 A;  1EZO A;  2WYK A;  2I6E A;  3VVD A;  2QS4 A;  3RYD A;  3TTK A;  1NUZ A;  5LDZ A;  1AIV A;  2I4B A;  1OVB A;  2OX3 A;  4IGT A;  4JDF A;  2UVJ A;  1MPB A;  1O63 A;  3KOS A;  5I3S A;  2X7P A;  5HBC A;  1K9Y A;  1B3H A;  4HXV A;  1DBZ A;  4NF5 A;  3TUS A;  3FXU A;  4OER A;  3KGC A;  4P11 A;  4H67 A;  2GHB A;  1N3W A;  4QSE A;  4TQU Q;  3JZJ A;  3U92 A;  3AXF A;  3ROJ A;  1M5E A;  4OFO A;  5I59 B;  3V89 B;  1VE4 A;  3C31 A;  4N15 A;  1S9T A;  1PBQ A;  1B1H A;  1XC1 A;  3PPO A;  4OZ9 A;  1AMF A;  5J1D A;  1TT1 A;  5AE4 A;  2I58 A;  3SEU A;  4ZE8 A;  5CMK A;  3RGY A;  1FCK A;  2YJP A;  4F1V A;  5J16 A;  3T66 A;  3DM0 A;  1P1W A;  2DWJ A;  4QRZ A;  4NWC A;  1EZ9 A;  1QKA A;  1WVJ A;  3N26 A;  5I2K B;  3SEY A;  4L17 A;  1IMD A;  3VVF A;  4G8M A;  4LA9 A;  1FPK A;  4MBP A;  3M3L A;  4P0I A;  2WKY A;  5AA2 D;  4OVR A;  5FHO A; 
#chains in the Genus database with same CATH homology
 4YIC A;  1LCF A;  3CG1 A;  3ZKK A;  1PDA A;  4YMA A;  1FTO A;  1T0K A;  5TU0 A;  2XXI A;  2GHA A;  4RXL A;  3C34 A;  2G29 A;  3RN8 A;  4HW8 A;  3CSB A;  2D5W A;  3PPP A;  4QFL A;  5TPA A;  1A8F A;  3MPK A;  4ESW A;  3E3K A;  5M2V A;  1QUJ A;  3PUV E;  3EHU A;  4R2F A;  1QUL A;  5I56 A;  1GTK A;  2E1S A;  4OES A;  3EQ1 A;  3OD7 A;  1MDQ A;  4ISU A;  1I6Q A;  4G77 A;  1XOC A;  1TWY A;  5DEX A;  5JTY B;  2FNC A;  2VP1 A;  3GBA A;  1Y1M A;  5CBR A;  1POT A;  1FTK A;  3IO4 A;  3TCG A;  3K4U A;  4F19 A;  2IA4 A;  3IB2 A;  3TZA A;  1R9Q A;  5JEI A;  1JNF A;  2XD2 A;  2G93 A;  3TYH A;  3CG3 A;  4K3F A;  4LQ5 A;  4PFU A;  2M8C A;  5ICQ A;  4MFI A;  3SKP A;  4ZZA A;  2XD3 A;  1MY3 A;  4H8I A;  2Y7I A;  4EF1 A;  3LC8 A;  1N04 A;  2ONR A;  4DXC A;  4GD5 A;  1MXW A;  4GLI A;  4KD5 A;  1L5T A;  4FE8 A;  1M5C A;  2ZNU A;  3ECR A;  1DSN A;  3IB0 A;  3QUF A;  4NWD A;  2OZZ A;  4G8H A;  3T22 A;  3HPI A;  1BTJ A;  2GH9 A;  2UYF A;  3TTL A;  2DWI A;  5I58 A;  2X7Q A;  1CE2 A;  4KYS A;  3MAM A;  4NE4 A;  2B3B A;  1LFG A;  3HCQ A;  3MP1 A;  1PBP A;  3RPW A;  2F36 A;  4LQ2 A;  2DOJ A;  2GFE A;  4G2Z A;  2NWJ A;  4Q30 B;  3FIR A;  1NFT A;  2Q89 A;  2Y7K A;  2VD2 A;  4JBZ A;  2O6A A;  4FEB A;  3UA8 A;  4LZ5 A;  5KCJ A;  5DVI A;  4YB5 A;  1B40 A;  3O2A A;  2CZL A;  1MH4 A;  4ELO A;  3KN7 A;  4DXB A;  3G3G A;  4GQO A;  2O69 A;  1Y3N A;  4KCD A;  1PC3 A;  5H8H B;  1LFH A;  3ILT B;  4ELR A;  3O66 A;  3VXC A;  1MXX A;  4LUB A;  3ZS6 A;  3MP6 A;  4PFW A;  2DXR A;  1GV8 A;  2D3I A;  3S2V A;  1ZJL A;  4MH5 A;  3CFZ A;  4JWO A;  4JWX A;  1JEV A;  4ECF A;  4DCY A;  1ATG A;  3A3C A;  4XIG Q;  3VLW A;  1OMP A;  3LBS A;  4ZEC A;  4U2R A;  2ZNS A;  3MWB A;  1JVX A;  1Y1Z A;  5DVJ A;  3H3G A;  1M5D A;  3D4C A;  2DP8 A;  2XX7 A;  1MDP 1;  3IOR A;  2RC9 A;  4DZ1 A;  1YPN A;  2O1M A;  1B7Z A;  3G7W A;  1NNF A;  1FQE A;  1JET A;  2UYE A;  4IY5 A;  2F6P A;  5CMM A;  1D9Y A;  1B3G A;  4LP2 B;  3KN3 A;  3KG2 A;  2XX9 A;  4I1D A;  1OIB A;  1FQB A;  3W9V A;  1FTJ A;  3ILU B;  5TPA B;  4F3S A;  4JSO A;  3UGW A;  1QJM A;  4G4P A;  1OLC A;  3GLB A;  3IOT A;  2RF1 A;  3EN3 A;  4N6P A;  1F9B A;  1JW1 A;  2V3U A;  4JXI A;  3T93 B;  2H9B A;  4ZZE A;  5DEX B;  4GL0 A;  2THI A;  4WKM A;  1FTM A;  3UP9 A;  1US4 A;  4QFK A;  4LAT A;  4GRK A;  2F5X A;  3K6X A;  2ZYK A;  1NNP A;  5I57 A;  4NF8 A;  2UVH A;  1LCT A;  3KBR A;  4EF2 A;  1PB8 A;  4DIG A;  3EPE A;  3I5O A;  3FJ7 A;  5H8S A;  3S9M C;  1QUK A;  1B5H A;  1PEB A;  3SEW A;  3U93 A;  4QSD A;  4ZE9 A;  3KSX A;  4KHZ E;  4RNS A;  1SBP A;  2OCU A;  4IB2 A;  1H76 A;  3RLF E;  1B7U A;  2O51 A;  4OHN A;  2D21 A;  3K1N A;  1DPP A;  1O64 A;  3SER A;  4RJZ A;  4BLA A;  3MVW A;  3TQL A;  2XXT A;  4RK9 A;  4O3A A;  3E4R A;  4KFQ A;  5BWJ A;  1I69 A;  5L8D A;  3HST A;  1I6B A;  4RYA A;  1BKA A;  4UAC A;  4M4G A;  3RNN A;  1VFE A;  2Y7W A;  1R9L A;  5I58 B;  5ITP A;  3M3F A;  4GXS B;  3S9N C;  1LAX A;  3FD3 A;  4IO3 A;  4ELP A;  4YAH X;  5HM4 B;  4H5G A;  3SES A;  2Z8E A;  1MS7 A;  1R1N A;  4F3P A;  1UTH A;  2ZXT A;  3Q29 A;  4GIZ A;  1O7T A;  1AH5 A;  2FA7 A;  1B3L A;  5AA3 A;  4F39 A;  1B4H A;  2REG A;  4R2B A;  2ZMB A;  4R6K A;  3H7M A;  2DWH A;  4HTG A;  5KCJ B;  2QL3 A;  4NF4 A;  4F1Y A;  2I3V A;  1DTZ A;  3A09 A;  3MPL A;  1DMB A;  2DE2 A;  4N07 A;  3EF7 A;  1N0T A;  3TCF A;  1SW5 A;  4AB5 A;  2ONK E;  4THI A;  1MQJ A;  3FVN A;  4TLM B;  4KI0 E;  3C4M A;  4XKR A;  3GZG A;  3P7I A;  3MZ1 A;  5FTH A;  4XKP A;  3K01 A;  5CBS A;  1JW4 A;  2QS1 A;  4GL8 A;  1RYO A;  1D9V A;  3O6G A;  3PGF A;  1OQG A;  3CIJ A;  4BDO A;  3F11 A;  4PP0 A;  2XXW A;  5F1Q A;  3GXA A;  1IEJ A;  5CM6 A;  2F7C A;  3IR1 A;  5CI5 A;  3CSG A;  1FQA A;  3HV1 A;  1N3X A;  3N94 A;  3ZKL A;  5K2X A;  1NL5 A;  1A7L A;  3QSL A;  1SI0 A;  1LFI A;  3U1O A;  2F35 A;  3TKD A;  4E0X A;  1B52 A;  3TTR A;  4QSC A;  3T9H B;  3PPR A;  1MM6 A;  3B6Q A;  1NKX A;  4BDQ A;  3CVG A;  3OO9 A;  1LLS A;  3DEL B;  2B65 A;  1TFD A;  4JSD A;  4OXV A;  5H8F A;  2QS3 A;  1N7W A;  3TQW A;  1P1N A;  4GOT A;  4KQP A;  3THI A;  2XXV A;  3H4Z A;  3IJO B;  2Y84 A;  2R71 A;  3FVK A;  4H65 A;  1JEU A;  2ONS A;  2O7U A;  1FQC A;  3DLN A;  2OWS A;  1TXF A;  3KOT A;  4R72 A;  4U1Z A;  3BKI B;  1NNK A;  4R6H A;  1SI1 A;  3BBR A;  1LB8 A;  5I57 B;  4NF8 B;  1YAE A;  3M8U A;  2H4I A;  1A8E A;  3O97 A;  1UTB A;  2DE4 A;  3HN0 A;  1LBB A;  3DP6 A;  2Q8J A;  1CB6 A;  4E0W A;  4P0G A;  4QFP A;  4IGR A;  3O28 A;  1DPE A;  1USY E;  4QFO A;  2DSF A;  3C32 A;  3LSX A;  3H6T A;  3PD8 A;  4RK2 A;  5H8N A;  2P1S A;  2PT1 A;  5A5X B;  1SDX A;  1GGG A;  4GF8 A;  3VDF A;  2HQ0 A;  3MVY A;  1DOT A;  1B4Z A;  3CFX A;  4H6D A;  3OEK A;  3W9W A;  1USY H;  1M5F A;  3VLV A;  3FUZ A;  1QUI A;  3QUJ A;  1H43 A;  3IB1 A;  4O3B A;  1URG A;  2VGQ A;  2XXY A;  2XHD A;  3Q27 A;  4UA8 A;  1Q35 A;  2Z22 A;  4X1D A;  2BJJ X;  1Z7M E;  4FAJ A;  4Z7E A;  1P99 A;  1ZLQ A;  1MPD A;  1N76 A;  2HCA A;  4ND9 A;  3HHF A;  1P1Q A;  1SYH A;  4PFY A;  4U22 A;  4F3B A;  4F2O A;  1GR2 A;  4R74 A;  1B5I A;  1KWH A;  2I49 A;  2W7Y A;  1VFD A;  4ESX A;  1MY4 A;  5HPQ A;  3PUW E;  3IOV A;  4KPT A;  2IEE A;  1A40 A;  3UIF A;  2H99 A;  3OMB A;  3VE1 B;  2R6G E;  4JB7 A;  1M5B A;  5AA1 A;  3LSL A;  4NF5 B;  1Q1K A;  2F8D A;  3O29 A;  2PT2 A;  4OEV A;  3MJN A;  3CFL A;  2VD3 A;  3KFM A;  4YKI A;  1NH7 A;  3Q26 A;  3MUQ A;  4M1V A;  1XT8 A;  4X1B A;  5I2N A;  3VLU A;  2Y7R A;  3IOU A;  2Q88 A;  1LB9 A;  3RT8 A;  2XXP A;  3U94 A;  3VXB A;  3K6V A;  4DLD A;  1S50 A;  3MQ9 A;  3OXN A;  2RIN A;  2ABH A;  1B6H A;  5EYF A;  1UIV A;  4U4S A;  2I0B A;  3PD9 A;  4TOZ A;  2A5T A;  1N7X A;  3EHS A;  1SD3 A;  3Q28 A;  4Q0C A;  1WDN A;  1FQF A;  1Y3Q A;  3S9L C;  1B7H A;  2O84 X;  1QW0 A;  4R73 A;  4LZ7 A;  3N6T A;  1RYX A;  1ZKB A;  3UN6 A;  3WAE A;  4OEN A;  4OTE A;  1D4N A;  2F7B A;  1ZMG A;  1Y4C A;  3M3K A;  3C36 A;  5B7D A;  2Z23 A;  4H8J A;  3T9V A;  4GXA A;  4RPO A;  4FIM A;  2PMS A;  2ZNT A;  4GFR A;  4IO7 A;  3FVO A;  1IUD A;  1IIW A;  3I6V A;  5I56 B;  1ELJ A;  3MZ9 A;  2RKM A;  3IK6 B;  4U23 A;  4F31 B;  2NUV A;  5K2Y A;  3IAZ A;  2DYX A;  5KDT A;  5IAI A;  4FAT A;  1NH8 A;  1IXI A;  3PUY E;  1H3D A;  3KZG A;  1Y20 A;  5EHS A;  4TLL B;  3JYR A;  4YU0 A;  3FAS A;  3O9P A;  5FTI A;  3FJG A;  3PMW A;  2QJE A;  4OFJ A;  1Y3P A;  1I6A A;  3RQT A;  3TMG A;  4I9D A;  1XVY A;  4LON B;  2AL5 A;  1SVX B;  1ZIU A;  4OEU A;  4OWD A;  3L6H A;  3SDF A;  4HCW A;  2OJT A;  1BP5 A;  4XXU A;  2QMX A;  1BLF A;  1MXY A;  4BDN A;  1SYI A;  2XXX A;  1B05 A;  3PPN A;  3R7X A;  3PU5 A;  2QMW A;  4KCC A;  1NMU A;  2P0S A;  2ZYM A;  3G3I A;  3G3K A;  1P1O A;  3IL1 B;  1VSO A;  2AL4 A;  4X48 A;  3N5L A;  2RCB A;  1B0H A;  2O1L A;  2O7I A;  1H44 A;  1QKB A;  3IJX B;  3OEM A;  4ZS9 A;  5FHM A;  4EXL A;  2UVG A;  4OQO A;  4ELQ A;  3DP4 A;  1URD A;  3FV1 A;  3C33 A;  1BIY A;  1UQW A;  3Q25 A;  2V3Q A;  2B3F A;  3O6I A;  2OBG A;  3B6T A;  3RUM A;  2DE3 A;  1POY 1;  1LAF E;  5BUU A;  3TCH A;  4IO5 A;  1B1X A;  4G68 A;  1EZP A;  2HAV A;  3PMX A;  3G3H A;  3H6U A;  3UOR A;  3CRB A;  4ZEK A;  1JW5 A;  3K02 A;  4OVJ A;  3OEN A;  4Q5T A;  4ZEF A;  1LST A;  5I2N B;  4YZZ A;  5CMB A;  2LAO A;  3TEL A;  2QSX A;  4EQ7 A;  2DXY A;  1MQI A;  4OYV A;  1Z7N E;  3B6W A;  5IKB A;  4ZEI A;  4KYD A;  2F6G A;  3E13 X;  1ZU0 A;  4O3C A;  5L9O A;  2REJ A;  4WED A;  4ZDM A;  1AL3 A;  2YPN A;  2A5T B;  3PUX E;  2I48 A;  1B0L A;  3OSQ A;  2V93 A;  4ZED A;  2HAU A;  4NF6 A;  2KLF A;  4EQB A;  4U21 A;  1R6Z A;  2HZL A;  5H8H A;  2H5Y A;  2V3T A;  1MPC A;  3KSJ A;  4YKP A;  3H03 A;  3LR1 A;  3TAJ A;  3VFJ A;  2UXA A;  5TP9 A;  1IZ1 A;  3T96 B;  4KYE A;  5DVF A;  5I84 A;  4RA1 A;  3FZV A;  3K00 A;  5CC2 A;  4EQ9 A;  2AYS A;  1LAH E;  1YCJ A;  2XXR A;  2HZK A;  2CMO A;  3QIM A;  2QPQ A;  3QXM A;  3KEI A;  2Z8F A;  2GRV A;  4NMY A;  1FQD A;  1UIU A;  2Q2C A;  4DXU A;  3CR9 A;  3SET A;  4IY6 A;  2RC8 A;  5KDT B;  3S9E A;  3SEV A;  2VHA A;  2ZYN A;  2OWT A;  3H06 B;  3KJT A;  1HSL A;  5AA2 A;  4AB6 A;  1EU8 A;  2I4C A;  5H8Q A;  2Z8D A;  2XXH A;  3H6W A;  4YMB A;  4FOR A;  5DT6 A;  4H1X A;  3JV9 A;  2RC7 A;  1SW2 A;  1B9J A;  2PBW A;  4EDP A;  3OO6 A;  2HXW A;  4OMB A;  5DYH A;  3RTW B;  4DDD A;  1HSE A;  1SQY A;  4XKN A;  1XHY A;  4POW A;  2DWA A;  2HFB A;  1MM7 A;  4AQ4 A;  2AIX A;  3MC2 A;  1XS5 A;  4YKJ A;  3BFU A;  4MLV A;  4QHQ A;  1HSJ A;  2F78 A;  1TFA A;  5AA4 A;  1OQH A;  4OFL A;  3MVZ A;  3H6V A;  3V8X B;  3VVE A;  2F34 A;  1EH3 A;  3GBB A;  5ELV A;  1B3E A;  4QFN A;  4F1U A;  3PUZ E;  4BDR A;  1Y9U A;  3MBP A;  1SW4 A;  4Z0I A;  4G8N A;  4U1O A;  3K2D A;  4BDM A;  3PPQ A;  1PB9 A;  1LBC A;  3FXQ A;  1UTH B;  3D4G A;  2E0S A;  4C0R A;  3I3V A;  3QYT A;  3TFL A;  3CI8 A;  3E9X A;  2OLB A;  4X9T A;  1S7Y A;  1II5 A;  4G68 B;  4F29 A;  2A5S A;  3EHT A;  3SEX A;  4R9G A;  4NF4 B;  1A99 A;  3TPA A;  3QK6 A;  3KN8 A;  3K1P A;  4YKK A;  3U8Q A;  1P1U A;  2H98 A;  2PX1 A;  4RPN A;  2DS9 A;  5KZT A;  2YLN A;  4H0W A;  5FHN A;  2V84 A;  1NNT A;  3TDJ A;  2OK2 A;  3IX1 A;  5JK4 A;  1GVC A;  4GVO A;  1H45 A;  4YB6 A;  2Y7P A;  1MXZ A;  4DCX A;  3UK4 A;  4QF9 A;  4KR5 A;  1JQF A;  1B2H A;  3TTN A;  4DE8 A;  2F97 A;  3L6G A;  3IOW A;  4OET A;  3A3U A;  3WAF A;  2QRY A;  3DP8 A;  4IO6 A;  4H5F A;  4FJP A;  2I3W A;  4FEC A;  4NF6 B;  2NVU B;  1D3K A;  3O6H A;  3RTF B;  4F22 A;  3ODB A;  4F2Q A;  3IO6 A;  4F18 A;  3OO8 A;  5L9S A;  2PYY A;  4RY1 A;  2R9J A;  3S4U A;  1JVY A;  4ONY A;  2XX8 A;  2ESN A;  5TP9 B;  2VOZ A;  2Q9T A;  4WEP A;  1MY1 A;  4N13 A;  3HHG A;  3K1M A;  4IO4 A;  4PET A;  3TOD A;  5H8F B;  3TTM A;  2V25 A;  5ITO A;  3V83 A;  1Y4T A;  4HS7 A;  5I59 A;  5ISU A;  2QS2 A;  4BDL A;  4EXK A;  1IXH A;  4PQJ A;  3R6U A;  1MRP A;  2PVU A;  2O68 A;  4IO2 A;  1MH3 A;  2DVC A;  3N6U A;  1WOD A;  5L9M A;  1IXG A;  3LSW A;  3K0V A;  2NXO A;  1OVT A;  2F7A A;  2Q2A A;  3HO7 A;  4XKQ A;  3C35 A;  3QAX A;  2HEU A;  3RT6 B;  2XXQ A;  1FW0 A;  1SW1 A;  2DVZ A;  4NED A;  3C9H A;  1MXU A;  3FXR A;  1LAG E;  3FJM A;  5I2K A;  5AA2 B;  1UTB B;  1YTV A;  3G3F A;  5LOM A;  1MG1 A;  2ALU A;  4G68 C;  4XTC Q;  1OLA A;  3PMV A;  5H8Q B;  4WXJ A;  4LVQ A;  3T9X B;  1DTG A;  4ZEB A;  3W15 C;  4POX A;  3B7D A;  3TEP A;  5H8N B;  4FED A;  3LSF B;  3K6U A;  3BFT A;  1RKM A;  2I0C A;  4NTL A;  2ZYO A;  1N84 A;  1J1N A;  2NOO A;  4F3G A;  4R6Y A;  3ZSF A;  3MZB A;  1URS A;  1MY2 A;  3PV0 E;  3MW0 A;  3FVG A;  1ZTY A;  2UVI A;  1B32 A;  1VR5 A;  4EUO A;  5DTB A;  5AA4 B;  4GWO A;  5JTY A;  4U4X A;  1B3F A;  1QVS A;  1B58 A;  5B70 A;  3FAT A;  4I62 A;  4C1T A;  3LUY A;  5EHM A;  3OOA A;  5A5X A;  1MY0 A;  3FV2 A;  2XXU A;  1B5J A;  3G3J A;  1ZBM A;  2H25 A;  1B46 A;  5CMC A;  1US5 A;  3OSR A;  3VV5 A;  1IQ7 A;  2P2A A;  3MP8 A;  3T9U A;  4R9F A;  4HCY A;  2RCA A;  3MVX A;  2FYI A;  3KJ7 A;  4LZ8 A;  3USD A;  1IIT A;  2X26 A;  3OEL A;  4YB7 A;  2DQV A;  3R26 A;  5CRY A;  2ANJ A;  3OO7 A;  1IXC A;  4PE5 B;  3U72 A;  1MQH A;  3RY3 A;  4C1U A;  3FGS A;  4I8C A;  1MQD A;  4JWY A;  3K6W A;  4MLQ A;  1A55 A;  3ONM A;  5ICT A;  1XVX A;  1ANF A;  5F7V A;  1A54 A;  3V5A A;  4PFT A;  4MF3 A;  1B51 A;  1PB7 A;  1FTL A;  1MQG A;  4Q8R A;  1MXV A;  1LGB C;  1AOV A;  4R75 A;  1EZO A;  2I6E A;  3VVD A;  2QS4 A;  3TTK A;  1AIV A;  2I4B A;  1OVB A;  4IGT A;  4JDF A;  2UVJ A;  1MPB A;  1O63 A;  3KOS A;  2X7P A;  5HBC A;  1B3H A;  4NF5 A;  3TUS A;  3FXU A;  4OER A;  3KGC A;  4P11 A;  4H67 A;  2GHB A;  1N3W A;  4QSE A;  4TQU Q;  3JZJ A;  3U92 A;  3AXF A;  1M5E A;  4OFO A;  5I59 B;  3V89 B;  1VE4 A;  3C31 A;  1S9T A;  1PBQ A;  1B1H A;  1XC1 A;  3PPO A;  4OZ9 A;  1AMF A;  5J1D A;  1TT1 A;  5AE4 A;  2I58 A;  3SEU A;  4ZE8 A;  5CMK A;  3RGY A;  1FCK A;  2YJP A;  4F1V A;  3T66 A;  3DM0 A;  1P1W A;  2DWJ A;  4QRZ A;  4NWC A;  1EZ9 A;  1QKA A;  1WVJ A;  3N26 A;  5I2K B;  3SEY A;  4L17 A;  3VVF A;  4G8M A;  4LA9 A;  4MBP A;  3M3L A;  4P0I A;  2WKY A;  5AA2 D;  5FHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...