1H45A

R210g n-terminal lobe human lactoferrin
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
b'RRRSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLDWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIGESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTOFERRIN
publication title "Dilysine Trigger" in Transferrins Probed by Mutagenesis of Lactoferrin: Crystal Structures of the R210G, R210E, and R210L Mutants of Human Lactoferrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 104
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2002-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h45A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h45A02
1D3KA 1KWHA 3KOSA 3IX1A 3S2VA 4IB2A 3USDA 2XXYA 1SQYA 2I3VA 3WAEA 1MDQA 4IO6A 1SW2A 1N3WA 3FATA 4G68C 2XHDA 2XXQA 4WXJA 1QKAA 3A3UA 3G3IA 4GF8A 1LFHA 3K6UA 1OMPA 2OBGA 3DM0A 3RTFB 2PT2A 1MXWA 3S9LC 3PGFA 3SEUA 3SEYA 1AOVA 4OERA 3U93A 1NH8A 3PU5A 3B6QA 4THIA 3I6VA 4OEUA 4G68A 1QUKA 4RY1A 2XXRA 3DP6A 5H8FA 2A5SA 5KCJB 3MQ9A 3H6WA 4R74A 3Q27A 1B7UA 3MP8A 3OMBA 1RYOA 1MY2A 1VR5A 3H3GA 4WEDA 3M3KA 4F39A 2DS9A 2QMXA 2DWHA 4HCYA 1NMUA 1Y9UA 3M8UA 2Q8JA 1TT1A 1R6ZA 2UVJA 3FD3A 1QW0A 4F29A 3I5OA 3TYHA 4KHZE 4GL0A 5DEXB 1Z7ME 2HFBA 4YU0A 4XTCQ 5JTYA 3B7DA 3Q25A 1LBBA 5IAIA 2CZLA 3IOTA 3C33A 2F7CA 4KYDA 4PFWA 2I58A 3MZ9A 1N3XA 3G3JA 4H5FA 2R71A 3TZAA 4JSDA 5HPQA 2Q9TA 4ZEIA 3EQ1A 3D4GA 1IITA 4O3BA 3T9HB 3LSFB 4RK2A 1B3EA 2ANJA 2XXIA 2H98A 1IQ7A 4E0XA 3ODBA 4DXUA 2DVZA 3MZBA 4H1XA 1FQAA 4G68B 2PYYA 2DSFA 3TTKA 5H8FB 4XIGQ 3D4CA 1B2HA 2HZLA 3TCGA 1ZMGA 1DMBA 2BJJX 2I3WA 3OD7A 3KOTA 3Q28A 1FCKA 1B5HA 1MQJA 3R6UA 5HM4B 3KGCA 3MVWA 3KSXA 3OEMA 1LAHE 1VE4A 4LVQA 3PMWA 3O9PA 2O68A 1BKAA 1NNPA 1S7YA 5H8NA 2HAVA 4DXBA 2I48A 3IOWA 2I6EA 3TMGA 1NH7A 4MH5A 3SEXA 4RA1A 1MXZA 3FJMA 2H25A 5DVJA 3TODA 5CM6A 1GTKA 5JTYB 2YPNA 3ILTB 3V89B 2XD2A 3TUSA 4F18A 1PBPA 4EUOA 3FV2A 3QSLA 1H43A 3C4MA 4UACA 5EHMA 1YTVA 4LA9A 2F6PA 1MM6A 3GBBA 3U8QA 2Q88A 1XT8A 5J1DA 1N84A 2O6AA 5AA2B 3VVEA 3SDFA 4PFYA 3EHSA 1B3GA 2Y7KA 3RNNA 5FHMA 1FTJA 3S4UA 3N6TA 1MPBA 4OFOA 1YCJA 2I4BA 2ZYKA 3TEPA 5AA2D 3TCFA 4U21A 5A5XA 3RUMA 4HS7A 1GV8A 2X7PA 1QVSA 5ISUA 3OENA 2ONRA 1J1NA 2HZKA 1B4ZA 4EDPA 1FW0A 3O6GA 1WVJA 3DELB 2AL4A 4OYVA 1PB7A 2Z8FA 3V8XB 3PUYE 3C31A 3VVDA 1JVXA 3PUWE 4R2BA 5KZTA 1DTZA 2H99A 4P0IA 3PD9A 1B58A 3KG2A 1B0LA 4F31B 4ZZAA 5CMMA 3KEIA 1ZKBA 4QSDA 2LAOA 4XKPA 4KCDA 2KLFA 4POWA 1ZLQA 4NF5A 5H8NB 3FASA 3GBAA 4ZEDA 1AH5A 4X48A 4MBPA 4EXLA 2O69A 1B9JA 3B6WA 3OO6A 4OFLA 1O64A 5M2VA 3TTMA 1RYXA 1MQIA 5TU0A 1S50A 4NF4A 3O6HA 4JBZA 2YJPA 1UIUA 3W9VA 4PP0A 3TAJA 1MQHA 4XXUA 3FVKA 1L5TA 2V3TA 3MVZA 2Y84A 3V5AA 2DXRA 3H4ZA 1A8FA 1MY0A 3G3GA 1N76A 3A09A 5H8HA 4FEBA 5CBRA 4DLDA 3OOAA 3UORA 4ELPA 4I9DA 3S9EA 3QXMA 3H6UA 4QSEA 3SEVA 2DXYA 3QK6A 3K6VA 4KYSA 3KN3A 4NTLA 1FTLA 3SERA 2NVUB 1JW1A 5A5XB 1NFTA 3KZGA 1AMFA 1II5A 4R2FA 3T9XB 4BLAA 4AB5A 4GOTA 2O84X 2VP1A 3MPLA 2I0BA 1Y4TA 3N5LA 1I6QA 2V3UA 2DE3A 2XD3A 2M8CA 1LB8A 2WKYA 3MJNA 5B7DA 2GRVA 5BUUA 5DYHA 2PBWA 3MAMA 1MS7A 2I49A 3VXCA 1ANFA 1FTKA 1SW4A 3CVGA 2V93A 4LQ2A 3IAZA 4DCYA 4YAHX 1M5DA 1B7ZA 2B65A 1DSNA 3MVYA 3BFTA 4NF4B 1EZ9A 2Q89A 4YKJA 4YMBA 2ZNUA 1B6HA 2VGQA 2X7QA 1H44A 1Y3QA 5H8HB 1Y3NA 2R9JA 5L9OA 3QYTA 3OO7A 4M4GA 4G8NA 4R9GA 2HEUA 2RF1A 2Z22A 4YB7A 4JSOA 1PDAA 1Y1MA 4Q30B 1LB9A 3UN6A 2Z23A 3IO6A 2B3BA 4XKRA 3C36A 1YPNA 5I57A 1JQFA 2GH9A 3TDJA 4NEDA 2O7IA 2DYXA 4Z7EA 5HBCA 4EF1A 2Q2CA 3EN3A 3PPQA 3VVFA 5KDTA 1P1OA 3UGWA 2OZZA 1JETA 1TFAA 2ZYNA 4YKKA 2UVHA 4IY5A 3C32A 3FXRA 4MFIA 4DZ1A 3K6WA 5K2XA 4F2OA 1B1XA 4IO2A 3IORA 1OQHA 1IIWA 5AA4B 1MG1A 1BP5A 3R7XA 2NOOA 3THIA 1FQBA 4H65A 3CI8A 3T9VA 3K1PA 3CSBA 1UTBA 1URSA 3EPEA 4U22A 1B40A 1P1WA 3H03A 3OSQA 4F3PA 4YZZA 1B0HA 5L8DA 4C0RA 4YKIA 2F97A 1R9QA 3HPIA 4EXKA 4ZECA 4H5GA 4NF8A 3IK6B 1P99A 4DIGA 3K01A 1Y3PA 2DP8A 1QJMA 1B1HA 4G4PA 2DWIA 4JDFA 4LZ8A 4YB5A 3K1NA 3O29A 3B6TA 3K1MA 4FEDA 2QS4A 4IO4A 4JXIA 5ITPA 1FQDA 2QJEA 5DTBA 4G77A 4DE8A 3CFZA 4P11A 4G8HA 4OFJA 3ONMA 1ZBMA 3KSJA 4QFNA 3U94A 4KCCA 4ISUA 5I57B 4AQ4A 2DWAA 3IB1A 5TPAA 4BDOA 4U4XA 3G3HA 4O3AA 3G3KA 4IGTA 3FIRA 3P7IA 5CMKA 4AB6A 5CRYA 5I2NA 5KDTB 1HSJA 3KN8A 1A55A 3H6TA 5AA2A 3N6UA 1JVYA 4QFKA 3MBPA 1B3FA 5JK4A 3O28A 4EQ7A 1GR2A 4KR5A 2XX8A 3PPNA 4I62A 1UTBB 1N7XA 1XHYA 1H3DA 5LOMA 1BIYA 4OQOA 5K2YA 4FE8A 4LZ7A 4F3SA 1SW1A 1D9YA 5F1QA 1ZTYA 3F11A 4ZE8A 2DQVA 1B51A 1MY1A 3CG3A 4O3CA 3IJOB 4NF8B 3VLUA 1UIVA 5AE4A 4RPNA 4F1UA 1B32A 1IXHA 2Z8EA 4WKMA 1LBCA 3BFUA 3SKPA 1ELJA 1XVXA 1SVXB 4OXVA 4ESXA 1POY1 4U4SA 4IO7A 3PUZE 4E0WA 1MPCA 1UTHA 4JWXA 1UQWA 4H8JA 2H9BA 4IGRA 1NNFA 2ONSA 3TTLA 3LSXA 4F1YA 1MM7A 3VLVA 1US4A 5I56A 1MY3A 3ECRA 5DVFA 4ONYA 4TOZA 4N6PA 2QPQA 3PPPA 1RKMA 1M5EA 3FXUA 5TPAB 3C9HA 2NUVA 1MH4A 2ZYOA 3HHGA 4BDMA 1LAXA 4F19A 2F6GA 2Q2AA 2GHAA 3TFLA 5I2NB 3WAFA 4JB7A 1LAGE 2Y7WA 1B3HA 3A3CA 3CRBA 5DVIA 4OENA 3W15C 1MPDA 1H76A 2YLNA 3M3LA 2QS3A 3SETA 1M5CA 3CSGA 1A8EA 1BTJA 3H6VA 3LUYA 1B05A 2PVUA 4IY6A 4FJPA 5BWJA 4I1DA 4ZDMA 3TKDA 2VHAA 3LR1A 3HHFA 3SESA 2QMWA 2ABHA 2V3QA 4OZ9A 1EZOA 4MLVA 1NNKA 4QHQA 3H7MA 4XKNA 3UIFA 1SI0A 1SD3A 4XKQA 2V25A 5CMCA 1UTHB 3QUFA 3OXNA 3Q26A 4LZ5A 1FTOA 2FNCA 3U1OA 3RQTA 2F78A 3RY3A 5I56B 4K3FA 5FHOA 1MY4A 2RKMA 3JV9A 4F3GA 5B70A 4FAJA 1AL3A 4M1VA 5CBSA 4PFTA 2UVGA 1XS5A 5I59A 4KPTA 3ZS6A 4LQ5A 2QS1A 4F22A 3HSTA 4QSCA 4Z0IA 3T66A 4LP2B 3IO4A 2XXUA 3IB0A 2A5TA 4HW8A 1I69A 1URGA 1LLSA 1M5BA 3TPAA 2CMOA 2UXAA 1TFDA 2UYFA 4R6YA 3RPWA 2DE4A 2H5YA 3E13X 4NF6A 4YMAA 4U1ZA 1PEBA 1H45A 3RT8A 1AIVA 3JYRA 1NL5A 4NE4A 1LCFA 2VD3A 2O51A 1FQFA 5I2KA 1Z7NE 2GHBA 1DOTA 2Y7RA 3IOUA 3HCQA 2F35A 4ELQA 2Y7PA 1MXXA 2NXOA 3TELA 1SI1A 5L9SA 5AA4A 1R9LA 5H8QA 2ONKE 3OEKA 1A40A 2O1MA 1QULA 1LFGA 5ITOA 3UA8A 4GLIA 2FA7A 3K2DA 2D21A 4ZEKA 1JW5A 3K0VA 4G8MA 1SDXA 3CFLA 5I59B 3PPRA 3T93B 2OWSA 4I8CA 4X9TA 3E3KA 1ZJLA 3RLFE 4GVOA 5CC2A 4FORA 1DTGA 4ELOA 1MQGA 4OWDA 4R6KA 2A5TB 3VDFA 1IXGA 1A54A 3K00A 1IXCA 1LSTA 2Z8DA 4OEVA 3MZ1A 4ESWA 4FECA 3L6HA 3MUQA 3MWBA 1EU8A 4GD5A 3FUZA 4F2QA 1VSOA 1Q35A 1VFEA 4NF6B 1CE2A 1B3LA 4IO5A 3PUXE 2ZXTA 3O6IA 5AA3A 1OVTA 4GXSB 3HN0A 4X1BA 5I2KB 4NWCA 1LGBC 2E1SA 3V83A 1A7LA 2RINA 2THIA 2IA4A 3LBSA 4R9FA 3HV1A 5ICQA 1NNTA 5H8SA 4KFQA 5H8QB 4U2RA 4KQPA 4YB6A 2HCAA 3AXFA 2H4IA 3BKIB 3T22A 1VFDA 4G2ZA 1JEVA 4NMYA 3EHTA 4GFRA 1SBPA 2D3IA 1I6AA 1IXIA 2UYEA 5AA1A 1YAEA 4GWOA 3Q29A 5CMBA 2VD2A 3MVXA 2F36A 4EQ9A 3PD8A 2IEEA 2OK2A 4H67A 2ZNTA 1F9BA 4BDNA 1NKXA 2HXWA 4GIZA 4POXA 3G3FA 1HSEA 2QS2A 4EF2A 3CR9A 5IKBA 4X1DA 1OLCA 1URDA 3FGSA 3IOVA 2D5WA 2P0SA 4ECFA 4QRZA 3KJTA 3KJ7A 2F5XA 4F3BA 3L6GA 1IEJA 4KI0E 4P0GA 4R6HA 2O1LA 3U72A 3TTNA 4OMBA 2DE2A 5ICTA 2DOJA 1GVCA 1MXUA 2DWJA 1O7TA 4PETA 5ELVA 3KBRA 2XXVA 1CB6A 3FXQA 3GLBA 1USYE 3DP8A 2RC8A 4ZEBA 1WODA 3G7WA 1QUIA 4EQBA 4N13A 1LCTA 3FVGA 2OJTA 1Y20A 1IZ1A 2PX1A 3BBRA 1ATGA 4QFLA 2G93A 2PMSA 3LSWA 4C1UA 3ILUB 3KFMA 3ZKLA 1S9TA 2REGA 4JWYA 2Y7IA 2XXTA 2ESNA 4HTGA 3K6XA 3DLNA 1QKBA 3N26A 2B3FA 4BDRA 1MXVA 4R73A 3OO9A 1FQCA 3CFXA 2RC7A 3IL1B 1B4HA 3IB2A 4FATA 5JEIA 1XC1A 2REJA 1JW4A 4OETA 3CG1A 4ZE9A 1JNFA 2I4CA 4MLQA 3FVOA 3PMVA 3N94A 3PUVE 1QUJA 4ZS9A 5EHSA 4OESA 3LC8A 3RN8A 5F7VA 1ZU0A 2QL3A 4GXAA 2QSXA 3H06B 4C1TA 1P1NA 1P1UA 3OO8A 4QFOA 3RT6B 4H6DA 1MDP1 4H8IA 3SEWA 3PPOA 5DT6A 3EHUA 4GRKA 1EZPA 4RK9A 3FVNA 4QF9A 1BLFA 5FHNA 3CIJA 1IUDA 2X26A 1B5IA 4YKPA 3FZVA 3W9WA 5TP9A 3S9MC 4OHNA 4WEPA 1XVYA 1N0TA 1B52A 4ND9A 3TCHA 4BDQA 1ZIUA 1D4NA 4F1VA 4KYEA 1N04A 1TWYA 4LATA 3MP6A 1MH3A 2F34A 4HCWA 4N07A 1B5JA 5CI5A 4TQUQ 2HQ0A 4R72A 3QUJA 4NWDA 1I6BA 1MXYA 1JEUA 1Y1ZA 1B7HA 1TXFA 1FQEA 3E9XA 3GXAA 1T0KA 2XXPA 3C34A 4TLLB 3FJ7A 4ZZEA 3T96B 3JZJA 1OVBA 2F8DA 5I58A 1DPPA 2XXHA 1DPEA 3UP9A 4H0WA 1PBQA 4L17A 1SYHA 2ZMBA 3QIMA 1POTA 4UA8A 2OWTA 1R1NA 2QRYA 4Q5TA 4Q0CA 4TLMB 1Y4CA 3E4RA 4OVJA 2DVCA 3VLWA 3ZSFA 2P1SA 5I84A 3EF7A 1M5FA 2HAUA 1PC3A 4YICA 1LAFE 4GL8A 5FTHA 5L9MA 1GGGA 3PMXA 1OQGA 3PV0E 4RYAA 1D9VA 4LUBA 3KN7A 5TP9B 4RXLA 1HSLA 3TTRA 4U23A 1MRPA 4DXCA 3K4UA 1SYIA 2AL5A 2E0SA 3R26A 3U92A 3O66A 3MP1A 2RC9A 3IJXB 2AYSA 4DDDA 1WDNA 2VOZA 4ZEFA 4DCXA 2W7YA 5FTIA 3UK4A 1FTMA 2XXWA 2F7BA 4LONB 3MPKA 3I3VA 5EYFA 2G29A 3QAXA 3TQLA 3VV5A 2OLBA 2AIXA 3MW0A 4RJZA 2XX7A 4OTEA 3IR1A 1PB9A 1O63A 1LFIA 1OLAA 2ZYMA 2R6GE 1SW5A 3RGYA 2NWJA 3GZGA 4RPOA 1PB8A 4IO3A 3LSLA 4GQOA 5I58B 2V84A 1A99A 4PE5B 4R75A 4ELRA 4NF5B 2O7UA 2P2AA 1EH3A 1Q1KA 1USYH 4MF3A 4KD5A 1MQDA 4PQJA 4RNSA 3FJGA 3TQWA 1OIBA 2XX9A 1P1QA 3S9NC 2ALUA 3K02A 5KCJA 1XOCA 3VFJA 3VXBA 4FIMA 4U1OA 2RCAA 2F7AA 3DP4A 3M3FA 4Q8RA 3ZKKA 4JWOA 1B46A 3VE1B 1US5A 3FV1A 3RTWB 2OCUA 1N7WA 2I0CA 3MC2A 3OELA 2PT1A 4BDLA 2ZNSA 2UVIA 3O2AA 3HO7A 3C35A 3O97A 2XXXA 2GFEA 3OSRA 4PFUA 3T9UA 4QFPA 5DEXA 2FYIA 2RCBA
chains in the Genus database with same CATH superfamily
1D3KA 1KWHA 3KOSA 4GX6A 1IMFA 3IX1A 3S2VA 4IB2A 2P3VA 3USDA 2XXYA 1SQYA 2I3VA 3WAEA 1MDQA 4IO6A 4HE1A 1SW2A 4PAKA 1N3WA 3FATA 4G68C 2XHDA 2XXQA 4WXJA 1QKAA 3A3UA 3G3IA 4GF8A 2XA5A 1LFHA 3K6UA 1OMPA 2OBGA 3DM0A 3U65A 3RTFB 2PT2A 4DI3D 2VT5A 1MXWA 3S9LC 3PGFA 3SEUA 4P1EA 3SEYA 1AOVA 4OERA 3U93A 1NH8A 1VDWA 3PU5A 3B6QA 4THIA 3I6VA 4OEUA 1JP4A 4MMPA 4G68A 1QUKA 4RY1A 2XXRA 3DP6A 5H8FA 2A5SA 1LBZA 5KCJB 3MQ9A 5IZ3A 2OX3A 3H6WA 4NG7A 2CEXA 4R74A 3Q27A 5EQ8A 1B7UA 2WX9A 3MP8A 4PFIA 3OMBA 1RYOA 1MY2A 1LBWA 1VR5A 3H3GA 4WEDA 3M3KA 3PTYA 4F39A 2DS9A 2KQZA 2QMXA 2DWHA 4HCYA 1NMUA 1Y9UA 3M8UA 2Q8JA 1TT1A 1R6ZA 2UVJA 3FD3A 1QW0A 4F29A 3I5OA 3TYHA 1LBXA 4KHZE 4GL0A 5DEXB 1Z7ME 2HFBA 2WBDA 4YU0A 4XTCQ 4QBAA 5JTYA 3B7DA 3Q25A 1LBBA 5IAIA 2CZLA 3IOTA 3C33A 2F7CA 4KYDA 4PFWA 2I58A 4QXDA 3MZ9A 1D9QA 1N3XA 3G3JA 4H5FA 2R71A 3KBZA 3TZAA 4JSDA 5HPQA 2Q9TA 4ZEIA 3EQ1A 3D4GA 1IITA 4O3BA 4OANA 3KC1A 3T9HB 3LSFB 4RK2A 1EYKA 1IMEA 1B3EA 2ANJA 2XXIA 2H98A 1IQ7A 1SPIA 4E0XA 3ODBA 4DXUA 2DVZA 3MSTA 3MZBA 4H1XA 1FQAA 4G68B 2PYYA 5IM2A 2DSFA 3TTKA 5H8FB 4XIGQ 1FJ9A 3D4CA 1B2HA 2HZLA 3TCGA 1ZMGA 1DMBA 2BJJX 2I3WA 3OD7A 5IZ3B 3KOTA 4NX1A 3Q28A 1FCKA 1B5HA 1FPDA 1MQJA 3R6UA 4MNCA 5HM4B 4PCDA 3KGCA 4XFEA 3MVWA 3KSXA 3OEMA 1LAHE 4GWUA 1VE4A 4LVQA 3PMWA 3O9PA 2O68A 1BKAA 1NNPA 1NV5A 1S7YA 5H8NA 2HAVA 4DXBA 2I48A 3IOWA 1KZ8A 2I6EA 3TMGA 4GBVA 2XWVA 1NH7A 4HE0A 4MH5A 5EYGA 3SEXA 4RA1A 1MXZA 3FJMA 2QVVA 2H25A 5DVJA 3TODA 5CM6A 1GTKA 5JTYB 2YPNA 2MKZA 3ILTB 3V89B 4I3YA 2XD2A 3TUSA 4F18A 1PBPA 3FV2A 4EUOA 3QSLA 1AWBA 1H43A 3C4MA 4UACA 5EHMA 2VPOA 1YTVA 4LA9A 2F6PA 1MM6A 3GBBA 3U8QA 2Q88A 1BK4A 1XT8A 5J1DA 1N84A 2O6AA 5AA2B 3VVEA 3SDFA 4PFYA 3EHSA 1B3GA 2Y7KA 3RNNA 3BIHA 5FHMA 1FTJA 3S4UA 3N6TA 1MPBA 4OFOA 1YCJA 2I4BA 2ZYKA 3TEPA 2WYPA 5AA2D 3TCFA 4U21A 5A5XA 3RUMA 4HS7A 1GV8A 2X7PA 1QVSA 5ISUA 3OENA 2ONRA 1J1NA 2HZKA 1B4ZA 4EDPA 1FW0A 3O6GA 1WVJA 3DELB 2AL4A 4OYVA 1PB7A 2Z8FA 3V8XB 3PUYE 3C31A 3VVDA 1JVXA 3PUWE 4R2BA 5KZTA 1DTZA 2H99A 4P0IA 3PD9A 5EQAA 1B58A 3KG2A 1B0LA 4F31B 1IMAA 3EKIA 4ZZAA 5CMMA 4NQ8A 3KEIA 1ZKBA 4QSDA 2LAOA 4XKPA 4KCDA 2KLFA 4POWA 1ZLQA 5EYHA 4NF5A 5H8NB 3FASA 3GBAA 4ZEDA 1AH5A 4X48A 4MBPA 4EXLA 2O69A 2WYKA 2FHYA 1B9JA 4OFLA 3B6WA 3OO6A 1O64A 5M2VA 3TTMA 1RYXA 1MQIA 5TU0A 1S50A 4NF4A 2Q8MA 1IMCA 3O6HA 4JBZA 2YJPA 1UIUA 3W9VA 4PP0A 3TAJA 1MQHA 4XXUA 3FVKA 1L5TA 2V3TA 3MVZA 2Y84A 3V5AA 2DXRA 4G61A 3H4ZA 1A8FA 1MY0A 3G3GA 1N76A 3A09A 5H8HA 4FEBA 5CBRA 5J16A 4DLDA 3OOAA 4JVDA 3UORA 4ELPA 4I9DA 3S9EA 1FPJA 3QXMA 3H6UA 4NHBA 4N15A 4QSEA 3SEVA 2DXYA 3QK6A 3D1RA 3K6VA 4KYSA 3KN3A 4NTLA 1FTLA 3SERA 2NVUB 4PFRA 1JW1A 5A5XB 1NFTA 3KZGA 1AMFA 1II5A 4R2FA 1FJ6A 3T9XB 4HXVA 4BLAA 4AB5A 4GOTA 2O84X 2VP1A 3MPLA 2I0BA 4N17A 1Y4TA 3N5LA 2DDKA 1I6QA 2V3UA 2DE3A 2FBPA 2F3DA 3ROJA 2XD3A 1QGXA 2M8CA 1LB8A 2WKYA 3MJNA 5B7DA 2GRVA 5BUUA 5DYHA 2PBWA 3MAMA 1MS7A 4PAFA 2I49A 2XXKA 3VXCA 1ANFA 1FTKA 1SW4A 3CVGA 4AS4A 2V93A 4LQ2A 3IAZA 4DCYA 4YAHX 1M5DA 1B7ZA 2B65A 1DSNA 3MVYA 3BFTA 4NF4B 1EZ9A 2Q89A 4YKJA 4NN3A 4YMBA 4PDDA 4GX3A 2ZNUA 1B6HA 2VGQA 2X7QA 3T0JA 1H44A 1Y3QA 5H8HB 1LBYA 1Y3NA 1INPA 2R9JA 5L9OA 3QYTA 3OO7A 4M4GA 4G8NA 3FBPA 4R9GA 1DBZA 2HEUA 2FVZA 3LUZA 2RF1A 2Z22A 4PBQA 4YB7A 4H46A 4JSOA 1PDAA 5EQ7A 1Y1MA 4PGNA 4Q30B 1LB9A 3UN6A 2Z23A 3IO6A 4OVSA 3SZPA 2B3BA 4XKRA 3C36A 1YPNA 5I57A 1JQFA 2GH9A 3TDJA 4NEDA 4OVTA 2R8TA 2O7IA 2DYXA 4Z7EA 5HBCA 4EF1A 2Q2CA 3EN3A 3PPQA 3VVFA 1FPFA 5KDTA 1P1OA 3UGWA 2OZZA 3MYUA 1JETA 1TFAA 2ZYNA 4YKKA 2UVHA 4IY5A 2OWZA 3C32A 3FXRA 4MFIA 4DZ1A 3K6WA 5K2XA 4F2OA 1B1XA 4IO2A 3IORA 1OQHA 1IIWA 5AA4B 1MG1A 1BP5A 3R7XA 2NOOA 3THIA 1FQBA 4H65A 3CI8A 3T9VA 3K1PA 3CSBA 1XI6A 1UTBA 1URSA 3EPEA 4U22A 3CHGA 1B40A 1P1WA 2QVRA 3H03A 3OSQA 4F3PA 4YZZA 1B0HA 5L8DA 4C0RA 4YKIA 4JVIA 2F97A 1R9QA 3HPIA 4EXKA 4ZECA 4H5GA 4NF8A 3IK6B 3IFAA 1P99A 4DIGA 3K01A 1Y3PA 2DP8A 1QJMA 4PDHA 1B1HA 4G4PA 2DWIA 4JDFA 2F3BA 4LZ8A 3KC0A 4YB5A 3K1NA 3O29A 3B6TA 1FBCA 4N91A 3K1MA 4MJOA 4FEDA 1FBHA 2QS4A 1LBVA 4IO4A 4JXIA 5ITPA 1FQDA 2QJEA 5DTBA 4G77A 4O7MA 4DE8A 3CFZA 4P11A 4G8HA 4OFJA 3ONMA 1ZBMA 3KSJA 5A5LA 4QFNA 3U94A 4KCCA 4ISUA 5I57B 2JJKA 4AQ4A 2DWAA 3IB1A 5TPAA 2CZHA 4BDOA 4U4XA 3G3HA 4O3AA 3G3KA 1K9ZA 4IGTA 3FIRA 3P7IA 5CMKA 4AB6A 4P56A 5CRYA 5I2NA 5KDTB 3A29A 1HSJA 2P3NA 3KN8A 1A55A 3H6TA 5AA2A 2Y5KA 3RYDA 3N6UA 1JVYA 4QFKA 2HXRA 3MBPA 4N6DA 1B3FA 4MEVA 5JK4A 3O28A 4JVCA 4EQ7A 1GR2A 4KR5A 2XX8A 3PPNA 4I62A 1UTBB 1N7XA 1XHYA 1H3DA 5LOMA 1BIYA 4OQOA 5K2YA 4FE8A 4LZ7A 4OA4A 4F3SA 1SW1A 1D9YA 4N6KA 5ESYA 5F1QA 1ZTYA 3F11A 4ZE8A 3B50A 2DQVA 1B51A 1MY1A 3CG3A 4O3CA 4NAPA 3IJOB 4NF8B 3VLUA 1UIVA 5AE4A 4RPNA 4F1UA 1B32A 1IXHA 2Z8EA 3IFCA 4WKMA 1LBCA 3BFUA 3GYYA 2CZIA 3SKPA 1ELJA 1XVXA 1SVXB 4OXVA 4ESXA 1POY1 4U4SA 4IO7A 3PUZE 4E0WA 1MPCA 1UTHA 4JWXA 1UQWA 1DCUA 4H8JA 2H9BA 4IGRA 5F24A 1NNFA 2ONSA 3B8BA 3TTLA 3LSXA 4F1YA 1MM7A 3VLVA 1US4A 2ZZWA 5I56A 1MY3A 3ECRA 5DVFA 4ONYA 4TOZA 4N6PA 2QPQA 3PPPA 1RKMA 1M5EA 3FXUA 5TPAB 3C9HA 2NUVA 2XWKA 1MH4A 2ZYOA 3HHGA 4BDMA 1LAXA 4F19A 1NI9A 2F6GA 1IMBA 2Q2AA 2GHAA 3TFLA 5I2NB 2V4CA 5ET7A 3WAFA 4JB7A 1LAGE 2GQ1A 2Y7WA 4X04A 1B3HA 3A3CA 5ET6A 3CRBA 5DVIA 4OENA 2KR0A 3W15C 1MPDA 1H76A 4H45A 2YLNA 3M3LA 2QS3A 3SETA 1M5CA 2BJIA 3CSGA 1A8EA 2HPGA 1BTJA 3H6VA 3LUYA 1B05A 2PVUA 4IY6A 4O94A 4FJPA 5BWJA 4I1DA 2CEYA 1FRPA 4ZDMA 3TKDA 1FSAA 2VHAA 3NOHA 1NV6A 3LR1A 5EQ9A 3HHFA 3SESA 2QMWA 2ABHA 2V3QA 4OZ9A 1EZOA 4MLVA 1NNKA 4QHQA 3H7MA 4MIJA 4XKNA 3UIFA 2L5VA 2FIEA 4P8BA 1IMDA 1SI0A 1SD3A 4XKQA 2V25A 5CMCA 1UTHB 1FPEA 3QUFA 3OXNA 2WBBA 3Q26A 4LZ5A 1FTOA 2FNCA 3U1OA 4IR8A 3RQTA 2F78A 3RY3A 5I56B 4K3FA 1LEVA 5FHOA 1MY4A 2RKMA 3JV9A 1FBDA 1FBEA 4F3GA 5B70A 2Y5LA 4FAJA 1AL3A 4M1VA 5CBSA 4PFTA 2UVGA 1XS5A 5I59A 4KPTA 3ZS6A 4LQ5A 2QS1A 4F22A 3HSTA 1KA1A 4QSCA 4Z0IA 3T66A 4LP2B 3IO4A 2XXUA 3IB0A 2A5TA 1G0IA 4HW8A 1I69A 1URGA 1LLSA 1M5BA 3TPAA 4PF6A 2CMOA 2UXAA 4NGUA 4PTKA 4GWZA 1KA0A 1TFDA 2UYFA 4R6YA 1FPGA 3RPWA 5IGAA 2DE4A 2H5YA 3HFUA 2B4LA 2PFZA 3E13X 4NF6A 4YMAA 4U1ZA 1PEBA 1H45A 3RT8A 1AIVA 3JYRA 1NL5A 4NE4A 1LCFA 2CZKA 2VD3A 2O51A 4GX4A 4O7IA 1FQFA 1FBGA 5I2KA 1Z7NE 2GHBA 1DOTA 2Y7RA 3IOUA 3HCQA 2F35A 4ELQA 2Y7PA 1MXXA 4MHFA 2NXOA 3TELA 1SI1A 3E78A 5L9SA 5AA4A 3ISPA 1R9LA 4AS5A 5H8QA 2ONKE 3OEKA 1A40A 2O1MA 1QULA 5T3JA 1LFGA 5ITOA 3UA8A 4GLIA 3BIGA 2FA7A 3K2DA 2D21A 4ZEKA 1JW5A 4PC9A 3RPLA 2ZZVA 3K0VA 4G8MA 1SDXA 3CFLA 5I59B 3PPRA 1RDZA 3T93B 2OWSA 1NUYA 4I8CA 4X9TA 3E3KA 1ZJLA 3RLFE 4GVOA 5CC2A 3LV0A 4FORA 1DTGA 4ELOA 1MQGA 4OWDA 4R6KA 4P3LA 2A5TB 3VDFA 4OVPA 1NUWA 1IXGA 1A54A 3K00A 1IXCA 1LSTA 2Z8DA 4OEVA 3MZ1A 4ESWA 4NF0A 4FECA 3L6HA 4PFBA 3MUQA 3MWBA 1EU8A 4GD5A 3FUZA 4F2QA 1VSOA 1Q35A 1VFEA 4NF6B 1Q9DA 1CE2A 1B3LA 4P1LA 4IO5A 3PUXE 2ZXTA 3O6IA 5AA3A 1OVTA 4GXSB 4PAIA 3HN0A 2QFLA 1FPKA 4X1BA 5I2KB 4NWCA 1LGBC 2E1SA 3V83A 1A7LA 2RINA 2THIA 2IA4A 3LBSA 1NV7A 4R9FA 3HV1A 5ICQA 5FBPA 1NNTA 5H8SA 4MAGA 4KFQA 5H8QB 4U2RA 4KQPA 4YB6A 2HCAA 4N4UA 3AXFA 2H4IA 3BKIB 3T22A 1VFDA 4G2ZA 1JEVA 3RPLB 4NMYA 3EHTA 4GFRA 1SBPA 2D3IA 1I6AA 1IXIA 2UYEA 5AA1A 1YAEA 1NV1A 3FXBA 4GWOA 3Q29A 5CMBA 2VD2A 3MVXA 2F36A 4EQ9A 3PD8A 2IEEA 2OK2A 4H67A 2ZNTA 1F9BA 4BDNA 1NKXA 2HXWA 4GIZA 4POXA 3G3FA 1HSEA 2QS2A 4EF2A 3CR9A 5IKBA 4X1DA 1OLCA 1URDA 3FGSA 3IOVA 2D5WA 2P0SA 4PF8A 2B4MA 4ECFA 4QRZA 3KJTA 4PE3A 3KJ7A 2F5XA 1FTAA 4F3BA 4GWSA 3L6GA 1IEJA 4KI0E 4P0GA 4R6HA 4MNPA 1G0HA 2O1LA 3U72A 4N8YA 3TTNA 4OMBA 2DE2A 5ICTA 2DOJA 1GVCA 1MXUA 2DWJA 1O7TA 4PETA 5ELVA 1NV3A 3KBRA 2XXVA 1CB6A 3FXQA 3GLBA 1USYE 4GBWA 3DP8A 2RC8A 4ZEBA 1WODA 4O8MA 3G7WA 1FBFA 1QUIA 4P47A 3E79A 2XWOA 4EQBA 4N13A 1LCTA 3FVGA 2OJTA 1Y20A 1NUZA 1IZ1A 2PX1A 4X8RA 3BBRA 2WEFA 1ATGA 4QFLA 1NV2A 2G93A 2PCRA 2PMSA 3LSWA 4C1UA 3ILUB 3KFMA 3ZKLA 1S9TA 2REGA 4JWYA 2Y7IA 2XXTA 2ESNA 5ET8A 4HTGA 4PGPA 3K6XA 3DLNA 1QKBA 3N26A 2B3FA 4BDRA 1MXVA 1CNQA 4R73A 3OO9A 5LTCA 1FQCA 3CFXA 2RC7A 4I3EA 1NV0A 3IL1B 1B4HA 3IB2A 4FATA 5JEIA 1XC1A 1FPLA 2HHMA 2REJA 1JW4A 4OETA 3CG1A 4ZE9A 1JNFA 2I4CA 4MLQA 3FVOA 3PMVA 1YZ0A 3N94A 3PUVE 1QUJA 4ZS9A 5EHSA 4OESA 3LC8A 4N81A 5IZZA 2XWIA 3RN8A 5F7VA 1ZU0A 2QL3A 4GXAA 2QSXA 3H06B 4C1TA 1P1NA 1P1UA 1DK4A 3OO8A 4QFOA 3RT6B 4H6DA 1MDP1 5I3SA 4H8IA 3SEWA 3PPOA 5DT6A 3EHUA 4GRKA 1EZPA 4RK9A 3FVNA 1K9YA 4QF9A 1BLFA 2FIXA 5FHNA 3CIJA 1IUDA 2X26A 1B5IA 4YKPA 1FPIA 3FZVA 3W9WA 5TP9A 3S9MC 4OHNA 4WEPA 1XVYA 4P9KA 1N0TA 1B52A 4ND9A 3TCHA 4BDQA 4MX6A 1ZIUA 1D4NA 4F1VA 4KYEA 2Q74A 1N04A 1TWYA 4LATA 3MP6A 1RDYA 1MH3A 2F34A 4HCWA 4GWWA 4N07A 1B5JA 5CI5A 4TQUQ 2HQ0A 4R72A 1NV4A 3QUJA 4NWDA 1I6BA 1MXYA 1JEUA 1Y1ZA 1B7HA 1TXFA 2VPNA 1FQEA 3E9XA 3GXAA 1T0KA 2XXPA 3C34A 4TLLB 3T1BA 3FJ7A 4ZZEA 3T96B 3JZJA 1OVBA 2F8DA 5I58A 1DPPA 2XXHA 1DPEA 4GWYA 3UP9A 4H0WA 1PBQA 4L17A 2ZZXA 4MNIA 1SYHA 2ZMBA 2PFYA 3QIMA 1POTA 4UA8A 2OWTA 1R1NA 2QRYA 4FBPA 4Q5TA 4Q0CA 4TLMB 1Y4CA 3E4RA 5IZ1A 4OVJA 2DVCA 3VLWA 3ZSFA 2P1SA 5I84A 4GWXA 3EF7A 4LN5A 1M5FA 2HAUA 1PC3A 1YXIA 4YICA 1LAFE 4GL8A 5FTHA 5L9MA 1GGGA 3PMXA 1EYIA 1OQGA 3PV0E 4RYAA 1D9VA 4LUBA 3KN7A 5TP9B 4RXLA 4XEQA 1HSLA 3TTRA 4U23A 1MRPA 4DXCA 3K4UA 1SYIA 3QMFA 2AL5A 2E0SA 3R26A 3U92A 3O66A 1FPBA 3MP1A 2RC9A 3IJXB 2AYSA 4DDDA 1WDNA 2VOZA 4ZEFA 4DCXA 2W7YA 5FTIA 3UK4A 4OVRA 1FTMA 2XXWA 2F7BA 4LONB 4N8GA 3MPKA 3I3VA 5EYFA 2G29A 3QAXA 3TQLA 3VV5A 2OLBA 2AIXA 3MW0A 4RJZA 4MCOA 4OVQA 2XX7A 4OTEA 3IR1A 4DI4B 1PB9A 1O63A 1LFIA 1OLAA 2ZYMA 2R6GE 5LDZA 1SW5A 3RGYA 2NWJA 3GZGA 4RPOA 1PB8A 4IO3A 3LSLA 4GQOA 5I58B 2V84A 1A99A 4PE5B 4R75A 4ELRA 4NF5B 4XF5A 2O7UA 2P2AA 1EH3A 1Q1KA 1USYH 4MF3A 4KD5A 1MQDA 4PQJA 4RNSA 3FJGA 3TQWA 1OIBA 2XX9A 1P1QA 1YYZA 3S9NC 2ALUA 4HE2A 3K02A 5KCJA 1XOCA 3VFJA 3VXBA 4FIMA 5DW8A 4U1OA 5I5PA 1RDXA 1FBPA 2RCAA 2F7AA 3DP4A 3M3FA 4Q8RA 4UABA 3ZKKA 4JWOA 5I7IA 1B46A 1EYJA 3VE1B 1US5A 4KXPA 3FV1A 3RTWB 2OCUA 2QVUA 4I40A 1N7WA 5ET5A 1NUXA 2I0CA 3MC2A 3OELA 2PT1A 4BDLA 4PBHA 2ZNSA 2UVIA 3O2AA 3HO7A 3C35A 3O97A 2XXXA 2GFEA 3OSRA 4PFUA 3T9UA 4QFPA 5DEXA 2FYIA 2RCBA
chains in the Genus database with same CATH topology
1D3KA 1KWHA 3KOSA 3IX1A 3S2VA 4IB2A 3USDA 2XXYA 1SQYA 2I3VA 3WAEA 1MDQA 4IO6A 1SW2A 1N3WA 3FATA 4G68C 2XHDA 2XXQA 4WXJA 1QKAA 3A3UA 3G3IA 4GF8A 1LFHA 3K6UA 1OMPA 2OBGA 3DM0A 3RTFB 2PT2A 1MXWA 3S9LC 3PGFA 3SEUA 3SEYA 1AOVA 4OERA 3U93A 1NH8A 3PU5A 3B6QA 4THIA 3I6VA 4OEUA 4G68A 1QUKA 4RY1A 2XXRA 3DP6A 5H8FA 2A5SA 5KCJB 3MQ9A 3H6WA 4R74A 3Q27A 1B7UA 3MP8A 3OMBA 1RYOA 1MY2A 1VR5A 3H3GA 4WEDA 3M3KA 4F39A 2DS9A 2QMXA 2DWHA 4HCYA 1NMUA 1Y9UA 3M8UA 2Q8JA 1TT1A 1R6ZA 2UVJA 3FD3A 1QW0A 4F29A 3I5OA 3TYHA 4KHZE 4GL0A 5DEXB 1Z7ME 2HFBA 4YU0A 4XTCQ 5JTYA 3B7DA 3Q25A 1LBBA 5IAIA 2CZLA 3IOTA 3C33A 2F7CA 4KYDA 4PFWA 2I58A 3MZ9A 1N3XA 3G3JA 4H5FA 2R71A 3TZAA 4JSDA 5HPQA 2Q9TA 4ZEIA 3EQ1A 3D4GA 1IITA 4O3BA 3T9HB 3LSFB 4RK2A 1B3EA 2ANJA 2XXIA 2H98A 1IQ7A 4E0XA 3ODBA 4DXUA 2DVZA 3MZBA 4H1XA 1FQAA 4G68B 2PYYA 2DSFA 3TTKA 5H8FB 4XIGQ 3D4CA 1B2HA 2HZLA 3TCGA 1ZMGA 1DMBA 2BJJX 2I3WA 3OD7A 3KOTA 3Q28A 1FCKA 1B5HA 1MQJA 3R6UA 5HM4B 3KGCA 3MVWA 3KSXA 3OEMA 1LAHE 1VE4A 4LVQA 3PMWA 3O9PA 2O68A 1BKAA 1NNPA 1S7YA 5H8NA 2HAVA 4DXBA 2I48A 3IOWA 2I6EA 3TMGA 1NH7A 4MH5A 3SEXA 4RA1A 1MXZA 3FJMA 2H25A 5DVJA 3TODA 5CM6A 1GTKA 5JTYB 2YPNA 3ILTB 3V89B 2XD2A 3TUSA 4F18A 1PBPA 4EUOA 3FV2A 3QSLA 1H43A 3C4MA 4UACA 5EHMA 1YTVA 4LA9A 2F6PA 1MM6A 3GBBA 3U8QA 2Q88A 1XT8A 5J1DA 1N84A 2O6AA 5AA2B 3VVEA 3SDFA 4PFYA 3EHSA 1B3GA 2Y7KA 3RNNA 5FHMA 1FTJA 3S4UA 3N6TA 1MPBA 4OFOA 1YCJA 2I4BA 2ZYKA 3TEPA 5AA2D 3TCFA 4U21A 5A5XA 3RUMA 4HS7A 1GV8A 2X7PA 1QVSA 5ISUA 3OENA 2ONRA 1J1NA 2HZKA 1B4ZA 4EDPA 1FW0A 3O6GA 1WVJA 3DELB 2AL4A 4OYVA 1PB7A 2Z8FA 3V8XB 3PUYE 3C31A 3VVDA 1JVXA 3PUWE 4R2BA 5KZTA 1DTZA 2H99A 4P0IA 3PD9A 1B58A 3KG2A 1B0LA 4F31B 4ZZAA 5CMMA 3KEIA 1ZKBA 4QSDA 2LAOA 4XKPA 4KCDA 2KLFA 4POWA 1ZLQA 4NF5A 5H8NB 3FASA 3GBAA 4ZEDA 1AH5A 4X48A 4MBPA 4EXLA 2O69A 1B9JA 3B6WA 3OO6A 4OFLA 1O64A 5M2VA 3TTMA 1RYXA 1MQIA 5TU0A 1S50A 4NF4A 3O6HA 4JBZA 2YJPA 1UIUA 3W9VA 4PP0A 3TAJA 1MQHA 4XXUA 3FVKA 1L5TA 2V3TA 3MVZA 2Y84A 3V5AA 2DXRA 3H4ZA 1A8FA 1MY0A 3G3GA 1N76A 3A09A 5H8HA 4FEBA 5CBRA 4DLDA 3OOAA 3UORA 4ELPA 4I9DA 3S9EA 3QXMA 3H6UA 4QSEA 3SEVA 2DXYA 3QK6A 3K6VA 4KYSA 3KN3A 4NTLA 1FTLA 3SERA 2NVUB 1JW1A 5A5XB 1NFTA 3KZGA 1AMFA 1II5A 4R2FA 3T9XB 4BLAA 4AB5A 4GOTA 2O84X 2VP1A 3MPLA 2I0BA 1Y4TA 3N5LA 1I6QA 2V3UA 2DE3A 2XD3A 2M8CA 1LB8A 2WKYA 3MJNA 5B7DA 2GRVA 5BUUA 5DYHA 2PBWA 3MAMA 1MS7A 2I49A 3VXCA 1ANFA 1FTKA 1SW4A 3CVGA 2V93A 4LQ2A 3IAZA 4DCYA 4YAHX 1M5DA 1B7ZA 2B65A 1DSNA 3MVYA 3BFTA 4NF4B 1EZ9A 2Q89A 4YKJA 4YMBA 2ZNUA 1B6HA 2VGQA 2X7QA 1H44A 1Y3QA 5H8HB 1Y3NA 2R9JA 5L9OA 3QYTA 3OO7A 4M4GA 4G8NA 4R9GA 2HEUA 2RF1A 2Z22A 4YB7A 4JSOA 1PDAA 1Y1MA 4Q30B 1LB9A 3UN6A 2Z23A 3IO6A 2B3BA 4XKRA 3C36A 1YPNA 5I57A 1JQFA 2GH9A 3TDJA 4NEDA 2O7IA 2DYXA 4Z7EA 5HBCA 4EF1A 2Q2CA 3EN3A 3PPQA 3VVFA 5KDTA 1P1OA 3UGWA 2OZZA 1JETA 1TFAA 2ZYNA 4YKKA 2UVHA 4IY5A 3C32A 3FXRA 4MFIA 4DZ1A 3K6WA 5K2XA 4F2OA 1B1XA 4IO2A 3IORA 1OQHA 1IIWA 5AA4B 1MG1A 1BP5A 3R7XA 2NOOA 3THIA 1FQBA 4H65A 3CI8A 3T9VA 3K1PA 3CSBA 1UTBA 1URSA 3EPEA 4U22A 1B40A 1P1WA 3H03A 3OSQA 4F3PA 4YZZA 1B0HA 5L8DA 4C0RA 4YKIA 2F97A 1R9QA 3HPIA 4EXKA 4ZECA 4H5GA 4NF8A 3IK6B 1P99A 4DIGA 3K01A 1Y3PA 2DP8A 1QJMA 1B1HA 4G4PA 2DWIA 4JDFA 4LZ8A 4YB5A 3K1NA 3O29A 3B6TA 3K1MA 4FEDA 2QS4A 4IO4A 4JXIA 5ITPA 1FQDA 2QJEA 5DTBA 4G77A 4DE8A 3CFZA 4P11A 4G8HA 4OFJA 3ONMA 1ZBMA 3KSJA 4QFNA 3U94A 4KCCA 4ISUA 5I57B 4AQ4A 2DWAA 3IB1A 5TPAA 4BDOA 4U4XA 3G3HA 4O3AA 3G3KA 4IGTA 3FIRA 3P7IA 5CMKA 4AB6A 5CRYA 5I2NA 5KDTB 1HSJA 3KN8A 1A55A 3H6TA 5AA2A 3N6UA 1JVYA 4QFKA 3MBPA 1B3FA 5JK4A 3O28A 4EQ7A 1GR2A 4KR5A 2XX8A 3PPNA 4I62A 1UTBB 1N7XA 1XHYA 1H3DA 5LOMA 1BIYA 4OQOA 5K2YA 4FE8A 4LZ7A 4F3SA 1SW1A 1D9YA 5F1QA 1ZTYA 3F11A 4ZE8A 2DQVA 1B51A 1MY1A 3CG3A 4O3CA 3IJOB 4NF8B 3VLUA 1UIVA 5AE4A 4RPNA 4F1UA 1B32A 1IXHA 2Z8EA 4WKMA 1LBCA 3BFUA 3SKPA 1ELJA 1XVXA 1SVXB 4OXVA 4ESXA 1POY1 4U4SA 4IO7A 3PUZE 4E0WA 1MPCA 1UTHA 4JWXA 1UQWA 4H8JA 2H9BA 4IGRA 1NNFA 2ONSA 3TTLA 3LSXA 4F1YA 1MM7A 3VLVA 1US4A 5I56A 1MY3A 3ECRA 5DVFA 4ONYA 4TOZA 4N6PA 2QPQA 3PPPA 1RKMA 1M5EA 3FXUA 5TPAB 3C9HA 2NUVA 1MH4A 2ZYOA 3HHGA 4BDMA 1LAXA 4F19A 2F6GA 2Q2AA 2GHAA 3TFLA 5I2NB 3WAFA 4JB7A 1LAGE 2Y7WA 1B3HA 3A3CA 3CRBA 5DVIA 4OENA 3W15C 1MPDA 1H76A 2YLNA 3M3LA 2QS3A 3SETA 1M5CA 3CSGA 1A8EA 1BTJA 3H6VA 3LUYA 1B05A 2PVUA 4IY6A 4FJPA 5BWJA 4I1DA 4ZDMA 3TKDA 2VHAA 3LR1A 3HHFA 3SESA 2QMWA 2ABHA 2V3QA 4OZ9A 1EZOA 4MLVA 1NNKA 4QHQA 3H7MA 4XKNA 3UIFA 1SI0A 1SD3A 4XKQA 2V25A 5CMCA 1UTHB 3QUFA 3OXNA 3Q26A 4LZ5A 1FTOA 2FNCA 3U1OA 3RQTA 2F78A 3RY3A 5I56B 4K3FA 5FHOA 1MY4A 2RKMA 3JV9A 4F3GA 5B70A 4FAJA 1AL3A 4M1VA 5CBSA 4PFTA 2UVGA 1XS5A 5I59A 4KPTA 3ZS6A 4LQ5A 2QS1A 4F22A 3HSTA 4QSCA 4Z0IA 3T66A 4LP2B 3IO4A 2XXUA 3IB0A 2A5TA 4HW8A 1I69A 1URGA 1LLSA 1M5BA 3TPAA 2CMOA 2UXAA 1TFDA 2UYFA 4R6YA 3RPWA 2DE4A 2H5YA 3E13X 4NF6A 4YMAA 4U1ZA 1PEBA 1H45A 3RT8A 1AIVA 3JYRA 1NL5A 4NE4A 1LCFA 2VD3A 2O51A 1FQFA 5I2KA 1Z7NE 2GHBA 1DOTA 2Y7RA 3IOUA 3HCQA 2F35A 4ELQA 2Y7PA 1MXXA 2NXOA 3TELA 1SI1A 5L9SA 5AA4A 1R9LA 5H8QA 2ONKE 3OEKA 1A40A 2O1MA 1QULA 1LFGA 5ITOA 3UA8A 4GLIA 2FA7A 3K2DA 2D21A 4ZEKA 1JW5A 3K0VA 4G8MA 1SDXA 3CFLA 5I59B 3PPRA 3T93B 2OWSA 4I8CA 4X9TA 3E3KA 1ZJLA 3RLFE 4GVOA 5CC2A 4FORA 1DTGA 4ELOA 1MQGA 4OWDA 4R6KA 2A5TB 3VDFA 1IXGA 1A54A 3K00A 1IXCA 1LSTA 2Z8DA 4OEVA 3MZ1A 4ESWA 4FECA 3L6HA 3MUQA 3MWBA 1EU8A 4GD5A 3FUZA 4F2QA 1VSOA 1Q35A 1VFEA 4NF6B 1CE2A 1B3LA 4IO5A 3PUXE 2ZXTA 3O6IA 5AA3A 1OVTA 4GXSB 3HN0A 4X1BA 5I2KB 4NWCA 1LGBC 2E1SA 3V83A 1A7LA 2RINA 2THIA 2IA4A 3LBSA 4R9FA 3HV1A 5ICQA 1NNTA 5H8SA 4KFQA 5H8QB 4U2RA 4KQPA 4YB6A 2HCAA 3AXFA 2H4IA 3BKIB 3T22A 1VFDA 4G2ZA 1JEVA 4NMYA 3EHTA 4GFRA 1SBPA 2D3IA 1I6AA 1IXIA 2UYEA 5AA1A 1YAEA 4GWOA 3Q29A 5CMBA 2VD2A 3MVXA 2F36A 4EQ9A 3PD8A 2IEEA 2OK2A 4H67A 2ZNTA 1F9BA 4BDNA 1NKXA 2HXWA 4GIZA 4POXA 3G3FA 1HSEA 2QS2A 4EF2A 3CR9A 5IKBA 4X1DA 1OLCA 1URDA 3FGSA 3IOVA 2D5WA 2P0SA 4ECFA 4QRZA 3KJTA 3KJ7A 2F5XA 4F3BA 3L6GA 1IEJA 4KI0E 4P0GA 4R6HA 2O1LA 3U72A 3TTNA 4OMBA 2DE2A 5ICTA 2DOJA 1GVCA 1MXUA 2DWJA 1O7TA 4PETA 5ELVA 3KBRA 2XXVA 1CB6A 3FXQA 3GLBA 1USYE 3DP8A 2RC8A 4ZEBA 1WODA 3G7WA 1QUIA 4EQBA 4N13A 1LCTA 3FVGA 2OJTA 1Y20A 1IZ1A 2PX1A 3BBRA 1ATGA 4QFLA 2G93A 2PMSA 3LSWA 4C1UA 3ILUB 3KFMA 3ZKLA 1S9TA 2REGA 4JWYA 2Y7IA 2XXTA 2ESNA 4HTGA 3K6XA 3DLNA 1QKBA 3N26A 2B3FA 4BDRA 1MXVA 4R73A 3OO9A 1FQCA 3CFXA 2RC7A 3IL1B 1B4HA 3IB2A 4FATA 5JEIA 1XC1A 2REJA 1JW4A 4OETA 3CG1A 4ZE9A 1JNFA 2I4CA 4MLQA 3FVOA 3PMVA 3N94A 3PUVE 1QUJA 4ZS9A 5EHSA 4OESA 3LC8A 3RN8A 5F7VA 1ZU0A 2QL3A 4GXAA 2QSXA 3H06B 4C1TA 1P1NA 1P1UA 3OO8A 4QFOA 3RT6B 4H6DA 1MDP1 4H8IA 3SEWA 3PPOA 5DT6A 3EHUA 4GRKA 1EZPA 4RK9A 3FVNA 4QF9A 1BLFA 5FHNA 3CIJA 1IUDA 2X26A 1B5IA 4YKPA 3FZVA 3W9WA 5TP9A 3S9MC 4OHNA 4WEPA 1XVYA 1N0TA 1B52A 4ND9A 3TCHA 4BDQA 1ZIUA 1D4NA 4F1VA 4KYEA 1N04A 1TWYA 4LATA 3MP6A 1MH3A 2F34A 4HCWA 4N07A 1B5JA 5CI5A 4TQUQ 2HQ0A 4R72A 3QUJA 4NWDA 1I6BA 1MXYA 1JEUA 1Y1ZA 1B7HA 1TXFA 1FQEA 3E9XA 3GXAA 1T0KA 2XXPA 3C34A 4TLLB 3FJ7A 4ZZEA 3T96B 3JZJA 1OVBA 2F8DA 5I58A 1DPPA 2XXHA 1DPEA 3UP9A 4H0WA 1PBQA 4L17A 1SYHA 2ZMBA 3QIMA 1POTA 4UA8A 2OWTA 1R1NA 2QRYA 4Q5TA 4Q0CA 4TLMB 1Y4CA 3E4RA 4OVJA 2DVCA 3VLWA 3ZSFA 2P1SA 5I84A 3EF7A 1M5FA 2HAUA 1PC3A 4YICA 1LAFE 4GL8A 5FTHA 5L9MA 1GGGA 3PMXA 1OQGA 3PV0E 4RYAA 1D9VA 4LUBA 3KN7A 5TP9B 4RXLA 1HSLA 3TTRA 4U23A 1MRPA 4DXCA 3K4UA 1SYIA 2AL5A 2E0SA 3R26A 3U92A 3O66A 3MP1A 2RC9A 3IJXB 2AYSA 4DDDA 1WDNA 2VOZA 4ZEFA 4DCXA 2W7YA 5FTIA 3UK4A 1FTMA 2XXWA 2F7BA 4LONB 3MPKA 3I3VA 5EYFA 2G29A 3QAXA 3TQLA 3VV5A 2OLBA 2AIXA 3MW0A 4RJZA 2XX7A 4OTEA 3IR1A 1PB9A 1O63A 1LFIA 1OLAA 2ZYMA 2R6GE 1SW5A 3RGYA 2NWJA 3GZGA 4RPOA 1PB8A 4IO3A 3LSLA 4GQOA 5I58B 2V84A 1A99A 4PE5B 4R75A 4ELRA 4NF5B 2O7UA 2P2AA 1EH3A 1Q1KA 1USYH 4MF3A 4KD5A 1MQDA 4PQJA 4RNSA 3FJGA 3TQWA 1OIBA 2XX9A 1P1QA 3S9NC 2ALUA 3K02A 5KCJA 1XOCA 3VFJA 3VXBA 4FIMA 4U1OA 2RCAA 2F7AA 3DP4A 3M3FA 4Q8RA 3ZKKA 4JWOA 1B46A 3VE1B 1US5A 3FV1A 3RTWB 2OCUA 1N7WA 2I0CA 3MC2A 3OELA 2PT1A 4BDLA 2ZNSA 2UVIA 3O2AA 3HO7A 3C35A 3O97A 2XXXA 2GFEA 3OSRA 4PFUA 3T9UA 4QFPA 5DEXA 2FYIA 2RCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3K A;  1KWH A;  3KOS A;  3IX1 A;  3S2V A;  4IB2 A;  3USD A;  2XXY A;  1SQY A;  2I3V A;  3WAE A;  1MDQ A;  4IO6 A;  1SW2 A;  1N3W A;  3FAT A;  4G68 C;  2XHD A;  2XXQ A;  4WXJ A;  1QKA A;  3A3U A;  3G3I A;  4GF8 A;  1LFH A;  3K6U A;  1OMP A;  2OBG A;  3DM0 A;  3RTF B;  2PT2 A;  1MXW A;  3S9L C;  3PGF A;  3SEU A;  3SEY A;  1AOV A;  4OER A;  3U93 A;  1NH8 A;  3PU5 A;  3B6Q A;  4THI A;  3I6V A;  4OEU A;  4G68 A;  1QUK A;  4RY1 A;  2XXR A;  3DP6 A;  5H8F A;  2A5S A;  5KCJ B;  3MQ9 A;  3H6W A;  4R74 A;  3Q27 A;  1B7U A;  3MP8 A;  3OMB A;  1RYO A;  1MY2 A;  1VR5 A;  3H3G A;  4WED A;  3M3K A;  4F39 A;  2DS9 A;  2QMX A;  2DWH A;  4HCY A;  1NMU A;  1Y9U A;  3M8U A;  2Q8J A;  1TT1 A;  1R6Z A;  2UVJ A;  3FD3 A;  1QW0 A;  4F29 A;  3I5O A;  3TYH A;  4KHZ E;  4GL0 A;  5DEX B;  1Z7M E;  2HFB A;  4YU0 A;  4XTC Q;  5JTY A;  3B7D A;  3Q25 A;  1LBB A;  5IAI A;  2CZL A;  3IOT A;  3C33 A;  2F7C A;  4KYD A;  4PFW A;  2I58 A;  3MZ9 A;  1N3X A;  3G3J A;  4H5F A;  2R71 A;  3TZA A;  4JSD A;  5HPQ A;  2Q9T A;  4ZEI A;  3EQ1 A;  3D4G A;  1IIT A;  4O3B A;  3T9H B;  3LSF B;  4RK2 A;  1B3E A;  2ANJ A;  2XXI A;  2H98 A;  1IQ7 A;  4E0X A;  3ODB A;  4DXU A;  2DVZ A;  3MZB A;  4H1X A;  1FQA A;  4G68 B;  2PYY A;  2DSF A;  3TTK A;  5H8F B;  4XIG Q;  3D4C A;  1B2H A;  2HZL A;  3TCG A;  1ZMG A;  1DMB A;  2BJJ X;  2I3W A;  3OD7 A;  3KOT A;  3Q28 A;  1FCK A;  1B5H A;  1MQJ A;  3R6U A;  5HM4 B;  3KGC A;  3MVW A;  3KSX A;  3OEM A;  1LAH E;  1VE4 A;  4LVQ A;  3PMW A;  3O9P A;  2O68 A;  1BKA A;  1NNP A;  1S7Y A;  5H8N A;  2HAV A;  4DXB A;  2I48 A;  3IOW A;  2I6E A;  3TMG A;  1NH7 A;  4MH5 A;  3SEX A;  4RA1 A;  1MXZ A;  3FJM A;  2H25 A;  5DVJ A;  3TOD A;  5CM6 A;  1GTK A;  5JTY B;  2YPN A;  3ILT B;  3V89 B;  2XD2 A;  3TUS A;  4F18 A;  1PBP A;  4EUO A;  3FV2 A;  3QSL A;  1H43 A;  3C4M A;  4UAC A;  5EHM A;  1YTV A;  4LA9 A;  2F6P A;  1MM6 A;  3GBB A;  3U8Q A;  2Q88 A;  1XT8 A;  5J1D A;  1N84 A;  2O6A A;  5AA2 B;  3VVE A;  3SDF A;  4PFY A;  3EHS A;  1B3G A;  2Y7K A;  3RNN A;  5FHM A;  1FTJ A;  3S4U A;  3N6T A;  1MPB A;  4OFO A;  1YCJ A;  2I4B A;  2ZYK A;  3TEP A;  5AA2 D;  3TCF A;  4U21 A;  5A5X A;  3RUM A;  4HS7 A;  1GV8 A;  2X7P A;  1QVS A;  5ISU A;  3OEN A;  2ONR A;  1J1N A;  2HZK A;  1B4Z A;  4EDP A;  1FW0 A;  3O6G A;  1WVJ A;  3DEL B;  2AL4 A;  4OYV A;  1PB7 A;  2Z8F A;  3V8X B;  3PUY E;  3C31 A;  3VVD A;  1JVX A;  3PUW E;  4R2B A;  5KZT A;  1DTZ A;  2H99 A;  4P0I A;  3PD9 A;  1B58 A;  3KG2 A;  1B0L A;  4F31 B;  4ZZA A;  5CMM A;  3KEI A;  1ZKB A;  4QSD A;  2LAO A;  4XKP A;  4KCD A;  2KLF A;  4POW A;  1ZLQ A;  4NF5 A;  5H8N B;  3FAS A;  3GBA A;  4ZED A;  1AH5 A;  4X48 A;  4MBP A;  4EXL A;  2O69 A;  1B9J A;  3B6W A;  3OO6 A;  4OFL A;  1O64 A;  5M2V A;  3TTM A;  1RYX A;  1MQI A;  5TU0 A;  1S50 A;  4NF4 A;  3O6H A;  4JBZ A;  2YJP A;  1UIU A;  3W9V A;  4PP0 A;  3TAJ A;  1MQH A;  4XXU A;  3FVK A;  1L5T A;  2V3T A;  3MVZ A;  2Y84 A;  3V5A A;  2DXR A;  3H4Z A;  1A8F A;  1MY0 A;  3G3G A;  1N76 A;  3A09 A;  5H8H A;  4FEB A;  5CBR A;  4DLD A;  3OOA A;  3UOR A;  4ELP A;  4I9D A;  3S9E A;  3QXM A;  3H6U A;  4QSE A;  3SEV A;  2DXY A;  3QK6 A;  3K6V A;  4KYS A;  3KN3 A;  4NTL A;  1FTL A;  3SER A;  2NVU B;  1JW1 A;  5A5X B;  1NFT A;  3KZG A;  1AMF A;  1II5 A;  4R2F A;  3T9X B;  4BLA A;  4AB5 A;  4GOT A;  2O84 X;  2VP1 A;  3MPL A;  2I0B A;  1Y4T A;  3N5L A;  1I6Q A;  2V3U A;  2DE3 A;  2XD3 A;  2M8C A;  1LB8 A;  2WKY A;  3MJN A;  5B7D A;  2GRV A;  5BUU A;  5DYH A;  2PBW A;  3MAM A;  1MS7 A;  2I49 A;  3VXC A;  1ANF A;  1FTK A;  1SW4 A;  3CVG A;  2V93 A;  4LQ2 A;  3IAZ A;  4DCY A;  4YAH X;  1M5D A;  1B7Z A;  2B65 A;  1DSN A;  3MVY A;  3BFT A;  4NF4 B;  1EZ9 A;  2Q89 A;  4YKJ A;  4YMB A;  2ZNU A;  1B6H A;  2VGQ A;  2X7Q A;  1H44 A;  1Y3Q A;  5H8H B;  1Y3N A;  2R9J A;  5L9O A;  3QYT A;  3OO7 A;  4M4G A;  4G8N A;  4R9G A;  2HEU A;  2RF1 A;  2Z22 A;  4YB7 A;  4JSO A;  1PDA A;  1Y1M A;  4Q30 B;  1LB9 A;  3UN6 A;  2Z23 A;  3IO6 A;  2B3B A;  4XKR A;  3C36 A;  1YPN A;  5I57 A;  1JQF A;  2GH9 A;  3TDJ A;  4NED A;  2O7I A;  2DYX A;  4Z7E A;  5HBC A;  4EF1 A;  2Q2C A;  3EN3 A;  3PPQ A;  3VVF A;  5KDT A;  1P1O A;  3UGW A;  2OZZ A;  1JET A;  1TFA A;  2ZYN A;  4YKK A;  2UVH A;  4IY5 A;  3C32 A;  3FXR A;  4MFI A;  4DZ1 A;  3K6W A;  5K2X A;  4F2O A;  1B1X A;  4IO2 A;  3IOR A;  1OQH A;  1IIW A;  5AA4 B;  1MG1 A;  1BP5 A;  3R7X A;  2NOO A;  3THI A;  1FQB A;  4H65 A;  3CI8 A;  3T9V A;  3K1P A;  3CSB A;  1UTB A;  1URS A;  3EPE A;  4U22 A;  1B40 A;  1P1W A;  3H03 A;  3OSQ A;  4F3P A;  4YZZ A;  1B0H A;  5L8D A;  4C0R A;  4YKI A;  2F97 A;  1R9Q A;  3HPI A;  4EXK A;  4ZEC A;  4H5G A;  4NF8 A;  3IK6 B;  1P99 A;  4DIG A;  3K01 A;  1Y3P A;  2DP8 A;  1QJM A;  1B1H A;  4G4P A;  2DWI A;  4JDF A;  4LZ8 A;  4YB5 A;  3K1N A;  3O29 A;  3B6T A;  3K1M A;  4FED A;  2QS4 A;  4IO4 A;  4JXI A;  5ITP A;  1FQD A;  2QJE A;  5DTB A;  4G77 A;  4DE8 A;  3CFZ A;  4P11 A;  4G8H A;  4OFJ A;  3ONM A;  1ZBM A;  3KSJ A;  4QFN A;  3U94 A;  4KCC A;  4ISU A;  5I57 B;  4AQ4 A;  2DWA A;  3IB1 A;  5TPA A;  4BDO A;  4U4X A;  3G3H A;  4O3A A;  3G3K A;  4IGT A;  3FIR A;  3P7I A;  5CMK A;  4AB6 A;  5CRY A;  5I2N A;  5KDT B;  1HSJ A;  3KN8 A;  1A55 A;  3H6T A;  5AA2 A;  3N6U A;  1JVY A;  4QFK A;  3MBP A;  1B3F A;  5JK4 A;  3O28 A;  4EQ7 A;  1GR2 A;  4KR5 A;  2XX8 A;  3PPN A;  4I62 A;  1UTB B;  1N7X A;  1XHY A;  1H3D A;  5LOM A;  1BIY A;  4OQO A;  5K2Y A;  4FE8 A;  4LZ7 A;  4F3S A;  1SW1 A;  1D9Y A;  5F1Q A;  1ZTY A;  3F11 A;  4ZE8 A;  2DQV A;  1B51 A;  1MY1 A;  3CG3 A;  4O3C A;  3IJO B;  4NF8 B;  3VLU A;  1UIV A;  5AE4 A;  4RPN A;  4F1U A;  1B32 A;  1IXH A;  2Z8E A;  4WKM A;  1LBC A;  3BFU A;  3SKP A;  1ELJ A;  1XVX A;  1SVX B;  4OXV A;  4ESX A;  1POY 1;  4U4S A;  4IO7 A;  3PUZ E;  4E0W A;  1MPC A;  1UTH A;  4JWX A;  1UQW A;  4H8J A;  2H9B A;  4IGR A;  1NNF A;  2ONS A;  3TTL A;  3LSX A;  4F1Y A;  1MM7 A;  3VLV A;  1US4 A;  5I56 A;  1MY3 A;  3ECR A;  5DVF A;  4ONY A;  4TOZ A;  4N6P A;  2QPQ A;  3PPP A;  1RKM A;  1M5E A;  3FXU A;  5TPA B;  3C9H A;  2NUV A;  1MH4 A;  2ZYO A;  3HHG A;  4BDM A;  1LAX A;  4F19 A;  2F6G A;  2Q2A A;  2GHA A;  3TFL A;  5I2N B;  3WAF A;  4JB7 A;  1LAG E;  2Y7W A;  1B3H A;  3A3C A;  3CRB A;  5DVI A;  4OEN A;  3W15 C;  1MPD A;  1H76 A;  2YLN A;  3M3L A;  2QS3 A;  3SET A;  1M5C A;  3CSG A;  1A8E A;  1BTJ A;  3H6V A;  3LUY A;  1B05 A;  2PVU A;  4IY6 A;  4FJP A;  5BWJ A;  4I1D A;  4ZDM A;  3TKD A;  2VHA A;  3LR1 A;  3HHF A;  3SES A;  2QMW A;  2ABH A;  2V3Q A;  4OZ9 A;  1EZO A;  4MLV A;  1NNK A;  4QHQ A;  3H7M A;  4XKN A;  3UIF A;  1SI0 A;  1SD3 A;  4XKQ A;  2V25 A;  5CMC A;  1UTH B;  3QUF A;  3OXN A;  3Q26 A;  4LZ5 A;  1FTO A;  2FNC A;  3U1O A;  3RQT A;  2F78 A;  3RY3 A;  5I56 B;  4K3F A;  5FHO A;  1MY4 A;  2RKM A;  3JV9 A;  4F3G A;  5B70 A;  4FAJ A;  1AL3 A;  4M1V A;  5CBS A;  4PFT A;  2UVG A;  1XS5 A;  5I59 A;  4KPT A;  3ZS6 A;  4LQ5 A;  2QS1 A;  4F22 A;  3HST A;  4QSC A;  4Z0I A;  3T66 A;  4LP2 B;  3IO4 A;  2XXU A;  3IB0 A;  2A5T A;  4HW8 A;  1I69 A;  1URG A;  1LLS A;  1M5B A;  3TPA A;  2CMO A;  2UXA A;  1TFD A;  2UYF A;  4R6Y A;  3RPW A;  2DE4 A;  2H5Y A;  3E13 X;  4NF6 A;  4YMA A;  4U1Z A;  1PEB A;  1H45 A;  3RT8 A;  1AIV A;  3JYR A;  1NL5 A;  4NE4 A;  1LCF A;  2VD3 A;  2O51 A;  1FQF A;  5I2K A;  1Z7N E;  2GHB A;  1DOT A;  2Y7R A;  3IOU A;  3HCQ A;  2F35 A;  4ELQ A;  2Y7P A;  1MXX A;  2NXO A;  3TEL A;  1SI1 A;  5L9S A;  5AA4 A;  1R9L A;  5H8Q A;  2ONK E;  3OEK A;  1A40 A;  2O1M A;  1QUL A;  1LFG A;  5ITO A;  3UA8 A;  4GLI A;  2FA7 A;  3K2D A;  2D21 A;  4ZEK A;  1JW5 A;  3K0V A;  4G8M A;  1SDX A;  3CFL A;  5I59 B;  3PPR A;  3T93 B;  2OWS A;  4I8C A;  4X9T A;  3E3K A;  1ZJL A;  3RLF E;  4GVO A;  5CC2 A;  4FOR A;  1DTG A;  4ELO A;  1MQG A;  4OWD A;  4R6K A;  2A5T B;  3VDF A;  1IXG A;  1A54 A;  3K00 A;  1IXC A;  1LST A;  2Z8D A;  4OEV A;  3MZ1 A;  4ESW A;  4FEC A;  3L6H A;  3MUQ A;  3MWB A;  1EU8 A;  4GD5 A;  3FUZ A;  4F2Q A;  1VSO A;  1Q35 A;  1VFE A;  4NF6 B;  1CE2 A;  1B3L A;  4IO5 A;  3PUX E;  2ZXT A;  3O6I A;  5AA3 A;  1OVT A;  4GXS B;  3HN0 A;  4X1B A;  5I2K B;  4NWC A;  1LGB C;  2E1S A;  3V83 A;  1A7L A;  2RIN A;  2THI A;  2IA4 A;  3LBS A;  4R9F A;  3HV1 A;  5ICQ A;  1NNT A;  5H8S A;  4KFQ A;  5H8Q B;  4U2R A;  4KQP A;  4YB6 A;  2HCA A;  3AXF A;  2H4I A;  3BKI B;  3T22 A;  1VFD A;  4G2Z A;  1JEV A;  4NMY A;  3EHT A;  4GFR A;  1SBP A;  2D3I A;  1I6A A;  1IXI A;  2UYE A;  5AA1 A;  1YAE A;  4GWO A;  3Q29 A;  5CMB A;  2VD2 A;  3MVX A;  2F36 A;  4EQ9 A;  3PD8 A;  2IEE A;  2OK2 A;  4H67 A;  2ZNT A;  1F9B A;  4BDN A;  1NKX A;  2HXW A;  4GIZ A;  4POX A;  3G3F A;  1HSE A;  2QS2 A;  4EF2 A;  3CR9 A;  5IKB A;  4X1D A;  1OLC A;  1URD A;  3FGS A;  3IOV A;  2D5W A;  2P0S A;  4ECF A;  4QRZ A;  3KJT A;  3KJ7 A;  2F5X A;  4F3B A;  3L6G A;  1IEJ A;  4KI0 E;  4P0G A;  4R6H A;  2O1L A;  3U72 A;  3TTN A;  4OMB A;  2DE2 A;  5ICT A;  2DOJ A;  1GVC A;  1MXU A;  2DWJ A;  1O7T A;  4PET A;  5ELV A;  3KBR A;  2XXV A;  1CB6 A;  3FXQ A;  3GLB A;  1USY E;  3DP8 A;  2RC8 A;  4ZEB A;  1WOD A;  3G7W A;  1QUI A;  4EQB A;  4N13 A;  1LCT A;  3FVG A;  2OJT A;  1Y20 A;  1IZ1 A;  2PX1 A;  3BBR A;  1ATG A;  4QFL A;  2G93 A;  2PMS A;  3LSW A;  4C1U A;  3ILU B;  3KFM A;  3ZKL A;  1S9T A;  2REG A;  4JWY A;  2Y7I A;  2XXT A;  2ESN A;  4HTG A;  3K6X A;  3DLN A;  1QKB A;  3N26 A;  2B3F A;  4BDR A;  1MXV A;  4R73 A;  3OO9 A;  1FQC A;  3CFX A;  2RC7 A;  3IL1 B;  1B4H A;  3IB2 A;  4FAT A;  5JEI A;  1XC1 A;  2REJ A;  1JW4 A;  4OET A;  3CG1 A;  4ZE9 A;  1JNF A;  2I4C A;  4MLQ A;  3FVO A;  3PMV A;  3N94 A;  3PUV E;  1QUJ A;  4ZS9 A;  5EHS A;  4OES A;  3LC8 A;  3RN8 A;  5F7V A;  1ZU0 A;  2QL3 A;  4GXA A;  2QSX A;  3H06 B;  4C1T A;  1P1N A;  1P1U A;  3OO8 A;  4QFO A;  3RT6 B;  4H6D A;  1MDP 1;  4H8I A;  3SEW A;  3PPO A;  5DT6 A;  3EHU A;  4GRK A;  1EZP A;  4RK9 A;  3FVN A;  4QF9 A;  1BLF A;  5FHN A;  3CIJ A;  1IUD A;  2X26 A;  1B5I A;  4YKP A;  3FZV A;  3W9W A;  5TP9 A;  3S9M C;  4OHN A;  4WEP A;  1XVY A;  1N0T A;  1B52 A;  4ND9 A;  3TCH A;  4BDQ A;  1ZIU A;  1D4N A;  4F1V A;  4KYE A;  1N04 A;  1TWY A;  4LAT A;  3MP6 A;  1MH3 A;  2F34 A;  4HCW A;  4N07 A;  1B5J A;  5CI5 A;  4TQU Q;  2HQ0 A;  4R72 A;  3QUJ A;  4NWD A;  1I6B A;  1MXY A;  1JEU A;  1Y1Z A;  1B7H A;  1TXF A;  1FQE A;  3E9X A;  3GXA A;  1T0K A;  2XXP A;  3C34 A;  4TLL B;  3FJ7 A;  4ZZE A;  3T96 B;  3JZJ A;  1OVB A;  2F8D A;  5I58 A;  1DPP A;  2XXH A;  1DPE A;  3UP9 A;  4H0W A;  1PBQ A;  4L17 A;  1SYH A;  2ZMB A;  3QIM A;  1POT A;  4UA8 A;  2OWT A;  1R1N A;  2QRY A;  4Q5T A;  4Q0C A;  4TLM B;  1Y4C A;  3E4R A;  4OVJ A;  2DVC A;  3VLW A;  3ZSF A;  2P1S A;  5I84 A;  3EF7 A;  1M5F A;  2HAU A;  1PC3 A;  4YIC A;  1LAF E;  4GL8 A;  5FTH A;  5L9M A;  1GGG A;  3PMX A;  1OQG A;  3PV0 E;  4RYA A;  1D9V A;  4LUB A;  3KN7 A;  5TP9 B;  4RXL A;  1HSL A;  3TTR A;  4U23 A;  1MRP A;  4DXC A;  3K4U A;  1SYI A;  2AL5 A;  2E0S A;  3R26 A;  3U92 A;  3O66 A;  3MP1 A;  2RC9 A;  3IJX B;  2AYS A;  4DDD A;  1WDN A;  2VOZ A;  4ZEF A;  4DCX A;  2W7Y A;  5FTI A;  3UK4 A;  1FTM A;  2XXW A;  2F7B A;  4LON B;  3MPK A;  3I3V A;  5EYF A;  2G29 A;  3QAX A;  3TQL A;  3VV5 A;  2OLB A;  2AIX A;  3MW0 A;  4RJZ A;  2XX7 A;  4OTE A;  3IR1 A;  1PB9 A;  1O63 A;  1LFI A;  1OLA A;  2ZYM A;  2R6G E;  1SW5 A;  3RGY A;  2NWJ A;  3GZG A;  4RPO A;  1PB8 A;  4IO3 A;  3LSL A;  4GQO A;  5I58 B;  2V84 A;  1A99 A;  4PE5 B;  4R75 A;  4ELR A;  4NF5 B;  2O7U A;  2P2A A;  1EH3 A;  1Q1K A;  1USY H;  4MF3 A;  4KD5 A;  1MQD A;  4PQJ A;  4RNS A;  3FJG A;  3TQW A;  1OIB A;  2XX9 A;  1P1Q A;  3S9N C;  2ALU A;  3K02 A;  5KCJ A;  1XOC A;  3VFJ A;  3VXB A;  4FIM A;  4U1O A;  2RCA A;  2F7A A;  3DP4 A;  3M3F A;  4Q8R A;  3ZKK A;  4JWO A;  1B46 A;  3VE1 B;  1US5 A;  3FV1 A;  3RTW B;  2OCU A;  1N7W A;  2I0C A;  3MC2 A;  3OEL A;  2PT1 A;  4BDL A;  2ZNS A;  2UVI A;  3O2A A;  3HO7 A;  3C35 A;  3O97 A;  2XXX A;  2GFE A;  3OSR A;  4PFU A;  3T9U A;  4QFP A;  5DEX A;  2FYI A;  2RCB A; 
#chains in the Genus database with same CATH topology
 1D3K A;  1KWH A;  3KOS A;  4GX6 A;  1IMF A;  3IX1 A;  3S2V A;  4IB2 A;  2P3V A;  3USD A;  2XXY A;  1SQY A;  2I3V A;  3WAE A;  1MDQ A;  4IO6 A;  4HE1 A;  1SW2 A;  4PAK A;  1N3W A;  3FAT A;  4G68 C;  2XHD A;  2XXQ A;  4WXJ A;  1QKA A;  3A3U A;  3G3I A;  4GF8 A;  2XA5 A;  1LFH A;  3K6U A;  1OMP A;  2OBG A;  3DM0 A;  3U65 A;  3RTF B;  2PT2 A;  4DI3 D;  2VT5 A;  1MXW A;  3S9L C;  3PGF A;  3SEU A;  4P1E A;  3SEY A;  1AOV A;  4OER A;  3U93 A;  1NH8 A;  1VDW A;  3PU5 A;  3B6Q A;  4THI A;  3I6V A;  4OEU A;  1JP4 A;  4MMP A;  4G68 A;  1QUK A;  4RY1 A;  2XXR A;  3DP6 A;  5H8F A;  2A5S A;  1LBZ A;  5KCJ B;  3MQ9 A;  5IZ3 A;  2OX3 A;  3H6W A;  4NG7 A;  2CEX A;  4R74 A;  3Q27 A;  5EQ8 A;  1B7U A;  2WX9 A;  3MP8 A;  4PFI A;  3OMB A;  1RYO A;  1MY2 A;  1LBW A;  1VR5 A;  3H3G A;  4WED A;  3M3K A;  3PTY A;  4F39 A;  2DS9 A;  2KQZ A;  2QMX A;  2DWH A;  4HCY A;  1NMU A;  1Y9U A;  3M8U A;  2Q8J A;  1TT1 A;  1R6Z A;  2UVJ A;  3FD3 A;  1QW0 A;  4F29 A;  3I5O A;  3TYH A;  1LBX A;  4KHZ E;  4GL0 A;  5DEX B;  1Z7M E;  2HFB A;  2WBD A;  4YU0 A;  4XTC Q;  4QBA A;  5JTY A;  3B7D A;  3Q25 A;  1LBB A;  5IAI A;  2CZL A;  3IOT A;  3C33 A;  2F7C A;  4KYD A;  4PFW A;  2I58 A;  4QXD A;  3MZ9 A;  1D9Q A;  1N3X A;  3G3J A;  4H5F A;  2R71 A;  3KBZ A;  3TZA A;  4JSD A;  5HPQ A;  2Q9T A;  4ZEI A;  3EQ1 A;  3D4G A;  1IIT A;  4O3B A;  4OAN A;  3KC1 A;  3T9H B;  3LSF B;  4RK2 A;  1EYK A;  1IME A;  1B3E A;  2ANJ A;  2XXI A;  2H98 A;  1IQ7 A;  1SPI A;  4E0X A;  3ODB A;  4DXU A;  2DVZ A;  3MST A;  3MZB A;  4H1X A;  1FQA A;  4G68 B;  2PYY A;  5IM2 A;  2DSF A;  3TTK A;  5H8F B;  4XIG Q;  1FJ9 A;  3D4C A;  1B2H A;  2HZL A;  3TCG A;  1ZMG A;  1DMB A;  2BJJ X;  2I3W A;  3OD7 A;  5IZ3 B;  3KOT A;  4NX1 A;  3Q28 A;  1FCK A;  1B5H A;  1FPD A;  1MQJ A;  3R6U A;  4MNC A;  5HM4 B;  4PCD A;  3KGC A;  4XFE A;  3MVW A;  3KSX A;  3OEM A;  1LAH E;  4GWU A;  1VE4 A;  4LVQ A;  3PMW A;  3O9P A;  2O68 A;  1BKA A;  1NNP A;  1NV5 A;  1S7Y A;  5H8N A;  2HAV A;  4DXB A;  2I48 A;  3IOW A;  1KZ8 A;  2I6E A;  3TMG A;  4GBV A;  2XWV A;  1NH7 A;  4HE0 A;  4MH5 A;  5EYG A;  3SEX A;  4RA1 A;  1MXZ A;  3FJM A;  2QVV A;  2H25 A;  5DVJ A;  3TOD A;  5CM6 A;  1GTK A;  5JTY B;  2YPN A;  2MKZ A;  3ILT B;  3V89 B;  4I3Y A;  2XD2 A;  3TUS A;  4F18 A;  1PBP A;  3FV2 A;  4EUO A;  3QSL A;  1AWB A;  1H43 A;  3C4M A;  4UAC A;  5EHM A;  2VPO A;  1YTV A;  4LA9 A;  2F6P A;  1MM6 A;  3GBB A;  3U8Q A;  2Q88 A;  1BK4 A;  1XT8 A;  5J1D A;  1N84 A;  2O6A A;  5AA2 B;  3VVE A;  3SDF A;  4PFY A;  3EHS A;  1B3G A;  2Y7K A;  3RNN A;  3BIH A;  5FHM A;  1FTJ A;  3S4U A;  3N6T A;  1MPB A;  4OFO A;  1YCJ A;  2I4B A;  2ZYK A;  3TEP A;  2WYP A;  5AA2 D;  3TCF A;  4U21 A;  5A5X A;  3RUM A;  4HS7 A;  1GV8 A;  2X7P A;  1QVS A;  5ISU A;  3OEN A;  2ONR A;  1J1N A;  2HZK A;  1B4Z A;  4EDP A;  1FW0 A;  3O6G A;  1WVJ A;  3DEL B;  2AL4 A;  4OYV A;  1PB7 A;  2Z8F A;  3V8X B;  3PUY E;  3C31 A;  3VVD A;  1JVX A;  3PUW E;  4R2B A;  5KZT A;  1DTZ A;  2H99 A;  4P0I A;  3PD9 A;  5EQA A;  1B58 A;  3KG2 A;  1B0L A;  4F31 B;  1IMA A;  3EKI A;  4ZZA A;  5CMM A;  4NQ8 A;  3KEI A;  1ZKB A;  4QSD A;  2LAO A;  4XKP A;  4KCD A;  2KLF A;  4POW A;  1ZLQ A;  5EYH A;  4NF5 A;  5H8N B;  3FAS A;  3GBA A;  4ZED A;  1AH5 A;  4X48 A;  4MBP A;  4EXL A;  2O69 A;  2WYK A;  2FHY A;  1B9J A;  4OFL A;  3B6W A;  3OO6 A;  1O64 A;  5M2V A;  3TTM A;  1RYX A;  1MQI A;  5TU0 A;  1S50 A;  4NF4 A;  2Q8M A;  1IMC A;  3O6H A;  4JBZ A;  2YJP A;  1UIU A;  3W9V A;  4PP0 A;  3TAJ A;  1MQH A;  4XXU A;  3FVK A;  1L5T A;  2V3T A;  3MVZ A;  2Y84 A;  3V5A A;  2DXR A;  4G61 A;  3H4Z A;  1A8F A;  1MY0 A;  3G3G A;  1N76 A;  3A09 A;  5H8H A;  4FEB A;  5CBR A;  5J16 A;  4DLD A;  3OOA A;  4JVD A;  3UOR A;  4ELP A;  4I9D A;  3S9E A;  1FPJ A;  3QXM A;  3H6U A;  4NHB A;  4N15 A;  4QSE A;  3SEV A;  2DXY A;  3QK6 A;  3D1R A;  3K6V A;  4KYS A;  3KN3 A;  4NTL A;  1FTL A;  3SER A;  2NVU B;  4PFR A;  1JW1 A;  5A5X B;  1NFT A;  3KZG A;  1AMF A;  1II5 A;  4R2F A;  1FJ6 A;  3T9X B;  4HXV A;  4BLA A;  4AB5 A;  4GOT A;  2O84 X;  2VP1 A;  3MPL A;  2I0B A;  4N17 A;  1Y4T A;  3N5L A;  2DDK A;  1I6Q A;  2V3U A;  2DE3 A;  2FBP A;  2F3D A;  3ROJ A;  2XD3 A;  1QGX A;  2M8C A;  1LB8 A;  2WKY A;  3MJN A;  5B7D A;  2GRV A;  5BUU A;  5DYH A;  2PBW A;  3MAM A;  1MS7 A;  4PAF A;  2I49 A;  2XXK A;  3VXC A;  1ANF A;  1FTK A;  1SW4 A;  3CVG A;  4AS4 A;  2V93 A;  4LQ2 A;  3IAZ A;  4DCY A;  4YAH X;  1M5D A;  1B7Z A;  2B65 A;  1DSN A;  3MVY A;  3BFT A;  4NF4 B;  1EZ9 A;  2Q89 A;  4YKJ A;  4NN3 A;  4YMB A;  4PDD A;  4GX3 A;  2ZNU A;  1B6H A;  2VGQ A;  2X7Q A;  3T0J A;  1H44 A;  1Y3Q A;  5H8H B;  1LBY A;  1Y3N A;  1INP A;  2R9J A;  5L9O A;  3QYT A;  3OO7 A;  4M4G A;  4G8N A;  3FBP A;  4R9G A;  1DBZ A;  2HEU A;  2FVZ A;  3LUZ A;  2RF1 A;  2Z22 A;  4PBQ A;  4YB7 A;  4H46 A;  4JSO A;  1PDA A;  5EQ7 A;  1Y1M A;  4PGN A;  4Q30 B;  1LB9 A;  3UN6 A;  2Z23 A;  3IO6 A;  4OVS A;  3SZP A;  2B3B A;  4XKR A;  3C36 A;  1YPN A;  5I57 A;  1JQF A;  2GH9 A;  3TDJ A;  4NED A;  4OVT A;  2R8T A;  2O7I A;  2DYX A;  4Z7E A;  5HBC A;  4EF1 A;  2Q2C A;  3EN3 A;  3PPQ A;  3VVF A;  1FPF A;  5KDT A;  1P1O A;  3UGW A;  2OZZ A;  3MYU A;  1JET A;  1TFA A;  2ZYN A;  4YKK A;  2UVH A;  4IY5 A;  2OWZ A;  3C32 A;  3FXR A;  4MFI A;  4DZ1 A;  3K6W A;  5K2X A;  4F2O A;  1B1X A;  4IO2 A;  3IOR A;  1OQH A;  1IIW A;  5AA4 B;  1MG1 A;  1BP5 A;  3R7X A;  2NOO A;  3THI A;  1FQB A;  4H65 A;  3CI8 A;  3T9V A;  3K1P A;  3CSB A;  1XI6 A;  1UTB A;  1URS A;  3EPE A;  4U22 A;  3CHG A;  1B40 A;  1P1W A;  2QVR A;  3H03 A;  3OSQ A;  4F3P A;  4YZZ A;  1B0H A;  5L8D A;  4C0R A;  4YKI A;  4JVI A;  2F97 A;  1R9Q A;  3HPI A;  4EXK A;  4ZEC A;  4H5G A;  4NF8 A;  3IK6 B;  3IFA A;  1P99 A;  4DIG A;  3K01 A;  1Y3P A;  2DP8 A;  1QJM A;  4PDH A;  1B1H A;  4G4P A;  2DWI A;  4JDF A;  2F3B A;  4LZ8 A;  3KC0 A;  4YB5 A;  3K1N A;  3O29 A;  3B6T A;  1FBC A;  4N91 A;  3K1M A;  4MJO A;  4FED A;  1FBH A;  2QS4 A;  1LBV A;  4IO4 A;  4JXI A;  5ITP A;  1FQD A;  2QJE A;  5DTB A;  4G77 A;  4O7M A;  4DE8 A;  3CFZ A;  4P11 A;  4G8H A;  4OFJ A;  3ONM A;  1ZBM A;  3KSJ A;  5A5L A;  4QFN A;  3U94 A;  4KCC A;  4ISU A;  5I57 B;  2JJK A;  4AQ4 A;  2DWA A;  3IB1 A;  5TPA A;  2CZH A;  4BDO A;  4U4X A;  3G3H A;  4O3A A;  3G3K A;  1K9Z A;  4IGT A;  3FIR A;  3P7I A;  5CMK A;  4AB6 A;  4P56 A;  5CRY A;  5I2N A;  5KDT B;  3A29 A;  1HSJ A;  2P3N A;  3KN8 A;  1A55 A;  3H6T A;  5AA2 A;  2Y5K A;  3RYD A;  3N6U A;  1JVY A;  4QFK A;  2HXR A;  3MBP A;  4N6D A;  1B3F A;  4MEV A;  5JK4 A;  3O28 A;  4JVC A;  4EQ7 A;  1GR2 A;  4KR5 A;  2XX8 A;  3PPN A;  4I62 A;  1UTB B;  1N7X A;  1XHY A;  1H3D A;  5LOM A;  1BIY A;  4OQO A;  5K2Y A;  4FE8 A;  4LZ7 A;  4OA4 A;  4F3S A;  1SW1 A;  1D9Y A;  4N6K A;  5ESY A;  5F1Q A;  1ZTY A;  3F11 A;  4ZE8 A;  3B50 A;  2DQV A;  1B51 A;  1MY1 A;  3CG3 A;  4O3C A;  4NAP A;  3IJO B;  4NF8 B;  3VLU A;  1UIV A;  5AE4 A;  4RPN A;  4F1U A;  1B32 A;  1IXH A;  2Z8E A;  3IFC A;  4WKM A;  1LBC A;  3BFU A;  3GYY A;  2CZI A;  3SKP A;  1ELJ A;  1XVX A;  1SVX B;  4OXV A;  4ESX A;  1POY 1;  4U4S A;  4IO7 A;  3PUZ E;  4E0W A;  1MPC A;  1UTH A;  4JWX A;  1UQW A;  1DCU A;  4H8J A;  2H9B A;  4IGR A;  5F24 A;  1NNF A;  2ONS A;  3B8B A;  3TTL A;  3LSX A;  4F1Y A;  1MM7 A;  3VLV A;  1US4 A;  2ZZW A;  5I56 A;  1MY3 A;  3ECR A;  5DVF A;  4ONY A;  4TOZ A;  4N6P A;  2QPQ A;  3PPP A;  1RKM A;  1M5E A;  3FXU A;  5TPA B;  3C9H A;  2NUV A;  2XWK A;  1MH4 A;  2ZYO A;  3HHG A;  4BDM A;  1LAX A;  4F19 A;  1NI9 A;  2F6G A;  1IMB A;  2Q2A A;  2GHA A;  3TFL A;  5I2N B;  2V4C A;  5ET7 A;  3WAF A;  4JB7 A;  1LAG E;  2GQ1 A;  2Y7W A;  4X04 A;  1B3H A;  3A3C A;  5ET6 A;  3CRB A;  5DVI A;  4OEN A;  2KR0 A;  3W15 C;  1MPD A;  1H76 A;  4H45 A;  2YLN A;  3M3L A;  2QS3 A;  3SET A;  1M5C A;  2BJI A;  3CSG A;  1A8E A;  2HPG A;  1BTJ A;  3H6V A;  3LUY A;  1B05 A;  2PVU A;  4IY6 A;  4O94 A;  4FJP A;  5BWJ A;  4I1D A;  2CEY A;  1FRP A;  4ZDM A;  3TKD A;  1FSA A;  2VHA A;  3NOH A;  1NV6 A;  3LR1 A;  5EQ9 A;  3HHF A;  3SES A;  2QMW A;  2ABH A;  2V3Q A;  4OZ9 A;  1EZO A;  4MLV A;  1NNK A;  4QHQ A;  3H7M A;  4MIJ A;  4XKN A;  3UIF A;  2L5V A;  2FIE A;  4P8B A;  1IMD A;  1SI0 A;  1SD3 A;  4XKQ A;  2V25 A;  5CMC A;  1UTH B;  1FPE A;  3QUF A;  3OXN A;  2WBB A;  3Q26 A;  4LZ5 A;  1FTO A;  2FNC A;  3U1O A;  4IR8 A;  3RQT A;  2F78 A;  3RY3 A;  5I56 B;  4K3F A;  1LEV A;  5FHO A;  1MY4 A;  2RKM A;  3JV9 A;  1FBD A;  1FBE A;  4F3G A;  5B70 A;  2Y5L A;  4FAJ A;  1AL3 A;  4M1V A;  5CBS A;  4PFT A;  2UVG A;  1XS5 A;  5I59 A;  4KPT A;  3ZS6 A;  4LQ5 A;  2QS1 A;  4F22 A;  3HST A;  1KA1 A;  4QSC A;  4Z0I A;  3T66 A;  4LP2 B;  3IO4 A;  2XXU A;  3IB0 A;  2A5T A;  1G0I A;  4HW8 A;  1I69 A;  1URG A;  1LLS A;  1M5B A;  3TPA A;  4PF6 A;  2CMO A;  2UXA A;  4NGU A;  4PTK A;  4GWZ A;  1KA0 A;  1TFD A;  2UYF A;  4R6Y A;  1FPG A;  3RPW A;  5IGA A;  2DE4 A;  2H5Y A;  3HFU A;  2B4L A;  2PFZ A;  3E13 X;  4NF6 A;  4YMA A;  4U1Z A;  1PEB A;  1H45 A;  3RT8 A;  1AIV A;  3JYR A;  1NL5 A;  4NE4 A;  1LCF A;  2CZK A;  2VD3 A;  2O51 A;  4GX4 A;  4O7I A;  1FQF A;  1FBG A;  5I2K A;  1Z7N E;  2GHB A;  1DOT A;  2Y7R A;  3IOU A;  3HCQ A;  2F35 A;  4ELQ A;  2Y7P A;  1MXX A;  4MHF A;  2NXO A;  3TEL A;  1SI1 A;  3E78 A;  5L9S A;  5AA4 A;  3ISP A;  1R9L A;  4AS5 A;  5H8Q A;  2ONK E;  3OEK A;  1A40 A;  2O1M A;  1QUL A;  5T3J A;  1LFG A;  5ITO A;  3UA8 A;  4GLI A;  3BIG A;  2FA7 A;  3K2D A;  2D21 A;  4ZEK A;  1JW5 A;  4PC9 A;  3RPL A;  2ZZV A;  3K0V A;  4G8M A;  1SDX A;  3CFL A;  5I59 B;  3PPR A;  1RDZ A;  3T93 B;  2OWS A;  1NUY A;  4I8C A;  4X9T A;  3E3K A;  1ZJL A;  3RLF E;  4GVO A;  5CC2 A;  3LV0 A;  4FOR A;  1DTG A;  4ELO A;  1MQG A;  4OWD A;  4R6K A;  4P3L A;  2A5T B;  3VDF A;  4OVP A;  1NUW A;  1IXG A;  1A54 A;  3K00 A;  1IXC A;  1LST A;  2Z8D A;  4OEV A;  3MZ1 A;  4ESW A;  4NF0 A;  4FEC A;  3L6H A;  4PFB A;  3MUQ A;  3MWB A;  1EU8 A;  4GD5 A;  3FUZ A;  4F2Q A;  1VSO A;  1Q35 A;  1VFE A;  4NF6 B;  1Q9D A;  1CE2 A;  1B3L A;  4P1L A;  4IO5 A;  3PUX E;  2ZXT A;  3O6I A;  5AA3 A;  1OVT A;  4GXS B;  4PAI A;  3HN0 A;  2QFL A;  1FPK A;  4X1B A;  5I2K B;  4NWC A;  1LGB C;  2E1S A;  3V83 A;  1A7L A;  2RIN A;  2THI A;  2IA4 A;  3LBS A;  1NV7 A;  4R9F A;  3HV1 A;  5ICQ A;  5FBP A;  1NNT A;  5H8S A;  4MAG A;  4KFQ A;  5H8Q B;  4U2R A;  4KQP A;  4YB6 A;  2HCA A;  4N4U A;  3AXF A;  2H4I A;  3BKI B;  3T22 A;  1VFD A;  4G2Z A;  1JEV A;  3RPL B;  4NMY A;  3EHT A;  4GFR A;  1SBP A;  2D3I A;  1I6A A;  1IXI A;  2UYE A;  5AA1 A;  1YAE A;  1NV1 A;  3FXB A;  4GWO A;  3Q29 A;  5CMB A;  2VD2 A;  3MVX A;  2F36 A;  4EQ9 A;  3PD8 A;  2IEE A;  2OK2 A;  4H67 A;  2ZNT A;  1F9B A;  4BDN A;  1NKX A;  2HXW A;  4GIZ A;  4POX A;  3G3F A;  1HSE A;  2QS2 A;  4EF2 A;  3CR9 A;  5IKB A;  4X1D A;  1OLC A;  1URD A;  3FGS A;  3IOV A;  2D5W A;  2P0S A;  4PF8 A;  2B4M A;  4ECF A;  4QRZ A;  3KJT A;  4PE3 A;  3KJ7 A;  2F5X A;  1FTA A;  4F3B A;  4GWS A;  3L6G A;  1IEJ A;  4KI0 E;  4P0G A;  4R6H A;  4MNP A;  1G0H A;  2O1L A;  3U72 A;  4N8Y A;  3TTN A;  4OMB A;  2DE2 A;  5ICT A;  2DOJ A;  1GVC A;  1MXU A;  2DWJ A;  1O7T A;  4PET A;  5ELV A;  1NV3 A;  3KBR A;  2XXV A;  1CB6 A;  3FXQ A;  3GLB A;  1USY E;  4GBW A;  3DP8 A;  2RC8 A;  4ZEB A;  1WOD A;  4O8M A;  3G7W A;  1FBF A;  1QUI A;  4P47 A;  3E79 A;  2XWO A;  4EQB A;  4N13 A;  1LCT A;  3FVG A;  2OJT A;  1Y20 A;  1NUZ A;  1IZ1 A;  2PX1 A;  4X8R A;  3BBR A;  2WEF A;  1ATG A;  4QFL A;  1NV2 A;  2G93 A;  2PCR A;  2PMS A;  3LSW A;  4C1U A;  3ILU B;  3KFM A;  3ZKL A;  1S9T A;  2REG A;  4JWY A;  2Y7I A;  2XXT A;  2ESN A;  5ET8 A;  4HTG A;  4PGP A;  3K6X A;  3DLN A;  1QKB A;  3N26 A;  2B3F A;  4BDR A;  1MXV A;  1CNQ A;  4R73 A;  3OO9 A;  5LTC A;  1FQC A;  3CFX A;  2RC7 A;  4I3E A;  1NV0 A;  3IL1 B;  1B4H A;  3IB2 A;  4FAT A;  5JEI A;  1XC1 A;  1FPL A;  2HHM A;  2REJ A;  1JW4 A;  4OET A;  3CG1 A;  4ZE9 A;  1JNF A;  2I4C A;  4MLQ A;  3FVO A;  3PMV A;  1YZ0 A;  3N94 A;  3PUV E;  1QUJ A;  4ZS9 A;  5EHS A;  4OES A;  3LC8 A;  4N81 A;  5IZZ A;  2XWI A;  3RN8 A;  5F7V A;  1ZU0 A;  2QL3 A;  4GXA A;  2QSX A;  3H06 B;  4C1T A;  1P1N A;  1P1U A;  1DK4 A;  3OO8 A;  4QFO A;  3RT6 B;  4H6D A;  1MDP 1;  5I3S A;  4H8I A;  3SEW A;  3PPO A;  5DT6 A;  3EHU A;  4GRK A;  1EZP A;  4RK9 A;  3FVN A;  1K9Y A;  4QF9 A;  1BLF A;  2FIX A;  5FHN A;  3CIJ A;  1IUD A;  2X26 A;  1B5I A;  4YKP A;  1FPI A;  3FZV A;  3W9W A;  5TP9 A;  3S9M C;  4OHN A;  4WEP A;  1XVY A;  4P9K A;  1N0T A;  1B52 A;  4ND9 A;  3TCH A;  4BDQ A;  4MX6 A;  1ZIU A;  1D4N A;  4F1V A;  4KYE A;  2Q74 A;  1N04 A;  1TWY A;  4LAT A;  3MP6 A;  1RDY A;  1MH3 A;  2F34 A;  4HCW A;  4GWW A;  4N07 A;  1B5J A;  5CI5 A;  4TQU Q;  2HQ0 A;  4R72 A;  1NV4 A;  3QUJ A;  4NWD A;  1I6B A;  1MXY A;  1JEU A;  1Y1Z A;  1B7H A;  1TXF A;  2VPN A;  1FQE A;  3E9X A;  3GXA A;  1T0K A;  2XXP A;  3C34 A;  4TLL B;  3T1B A;  3FJ7 A;  4ZZE A;  3T96 B;  3JZJ A;  1OVB A;  2F8D A;  5I58 A;  1DPP A;  2XXH A;  1DPE A;  4GWY A;  3UP9 A;  4H0W A;  1PBQ A;  4L17 A;  2ZZX A;  4MNI A;  1SYH A;  2ZMB A;  2PFY A;  3QIM A;  1POT A;  4UA8 A;  2OWT A;  1R1N A;  2QRY A;  4FBP A;  4Q5T A;  4Q0C A;  4TLM B;  1Y4C A;  3E4R A;  5IZ1 A;  4OVJ A;  2DVC A;  3VLW A;  3ZSF A;  2P1S A;  5I84 A;  4GWX A;  3EF7 A;  4LN5 A;  1M5F A;  2HAU A;  1PC3 A;  1YXI A;  4YIC A;  1LAF E;  4GL8 A;  5FTH A;  5L9M A;  1GGG A;  3PMX A;  1EYI A;  1OQG A;  3PV0 E;  4RYA A;  1D9V A;  4LUB A;  3KN7 A;  5TP9 B;  4RXL A;  4XEQ A;  1HSL A;  3TTR A;  4U23 A;  1MRP A;  4DXC A;  3K4U A;  1SYI A;  3QMF A;  2AL5 A;  2E0S A;  3R26 A;  3U92 A;  3O66 A;  1FPB A;  3MP1 A;  2RC9 A;  3IJX B;  2AYS A;  4DDD A;  1WDN A;  2VOZ A;  4ZEF A;  4DCX A;  2W7Y A;  5FTI A;  3UK4 A;  4OVR A;  1FTM A;  2XXW A;  2F7B A;  4LON B;  4N8G A;  3MPK A;  3I3V A;  5EYF A;  2G29 A;  3QAX A;  3TQL A;  3VV5 A;  2OLB A;  2AIX A;  3MW0 A;  4RJZ A;  4MCO A;  4OVQ A;  2XX7 A;  4OTE A;  3IR1 A;  4DI4 B;  1PB9 A;  1O63 A;  1LFI A;  1OLA A;  2ZYM A;  2R6G E;  5LDZ A;  1SW5 A;  3RGY A;  2NWJ A;  3GZG A;  4RPO A;  1PB8 A;  4IO3 A;  3LSL A;  4GQO A;  5I58 B;  2V84 A;  1A99 A;  4PE5 B;  4R75 A;  4ELR A;  4NF5 B;  4XF5 A;  2O7U A;  2P2A A;  1EH3 A;  1Q1K A;  1USY H;  4MF3 A;  4KD5 A;  1MQD A;  4PQJ A;  4RNS A;  3FJG A;  3TQW A;  1OIB A;  2XX9 A;  1P1Q A;  1YYZ A;  3S9N C;  2ALU A;  4HE2 A;  3K02 A;  5KCJ A;  1XOC A;  3VFJ A;  3VXB A;  4FIM A;  5DW8 A;  4U1O A;  5I5P A;  1RDX A;  1FBP A;  2RCA A;  2F7A A;  3DP4 A;  3M3F A;  4Q8R A;  4UAB A;  3ZKK A;  4JWO A;  5I7I A;  1B46 A;  1EYJ A;  3VE1 B;  1US5 A;  4KXP A;  3FV1 A;  3RTW B;  2OCU A;  2QVU A;  4I40 A;  1N7W A;  5ET5 A;  1NUX A;  2I0C A;  3MC2 A;  3OEL A;  2PT1 A;  4BDL A;  4PBH A;  2ZNS A;  2UVI A;  3O2A A;  3HO7 A;  3C35 A;  3O97 A;  2XXX A;  2GFE A;  3OSR A;  4PFU A;  3T9U A;  4QFP A;  5DEX A;  2FYI A;  2RCB A; 
#chains in the Genus database with same CATH homology
 1D3K A;  1KWH A;  3KOS A;  3IX1 A;  3S2V A;  4IB2 A;  3USD A;  2XXY A;  1SQY A;  2I3V A;  3WAE A;  1MDQ A;  4IO6 A;  1SW2 A;  1N3W A;  3FAT A;  4G68 C;  2XHD A;  2XXQ A;  4WXJ A;  1QKA A;  3A3U A;  3G3I A;  4GF8 A;  1LFH A;  3K6U A;  1OMP A;  2OBG A;  3DM0 A;  3RTF B;  2PT2 A;  1MXW A;  3S9L C;  3PGF A;  3SEU A;  3SEY A;  1AOV A;  4OER A;  3U93 A;  1NH8 A;  3PU5 A;  3B6Q A;  4THI A;  3I6V A;  4OEU A;  4G68 A;  1QUK A;  4RY1 A;  2XXR A;  3DP6 A;  5H8F A;  2A5S A;  5KCJ B;  3MQ9 A;  3H6W A;  4R74 A;  3Q27 A;  1B7U A;  3MP8 A;  3OMB A;  1RYO A;  1MY2 A;  1VR5 A;  3H3G A;  4WED A;  3M3K A;  4F39 A;  2DS9 A;  2QMX A;  2DWH A;  4HCY A;  1NMU A;  1Y9U A;  3M8U A;  2Q8J A;  1TT1 A;  1R6Z A;  2UVJ A;  3FD3 A;  1QW0 A;  4F29 A;  3I5O A;  3TYH A;  4KHZ E;  4GL0 A;  5DEX B;  1Z7M E;  2HFB A;  4YU0 A;  4XTC Q;  5JTY A;  3B7D A;  3Q25 A;  1LBB A;  5IAI A;  2CZL A;  3IOT A;  3C33 A;  2F7C A;  4KYD A;  4PFW A;  2I58 A;  3MZ9 A;  1N3X A;  3G3J A;  4H5F A;  2R71 A;  3TZA A;  4JSD A;  5HPQ A;  2Q9T A;  4ZEI A;  3EQ1 A;  3D4G A;  1IIT A;  4O3B A;  3T9H B;  3LSF B;  4RK2 A;  1B3E A;  2ANJ A;  2XXI A;  2H98 A;  1IQ7 A;  4E0X A;  3ODB A;  4DXU A;  2DVZ A;  3MZB A;  4H1X A;  1FQA A;  4G68 B;  2PYY A;  2DSF A;  3TTK A;  5H8F B;  4XIG Q;  3D4C A;  1B2H A;  2HZL A;  3TCG A;  1ZMG A;  1DMB A;  2BJJ X;  2I3W A;  3OD7 A;  3KOT A;  3Q28 A;  1FCK A;  1B5H A;  1MQJ A;  3R6U A;  5HM4 B;  3KGC A;  3MVW A;  3KSX A;  3OEM A;  1LAH E;  1VE4 A;  4LVQ A;  3PMW A;  3O9P A;  2O68 A;  1BKA A;  1NNP A;  1S7Y A;  5H8N A;  2HAV A;  4DXB A;  2I48 A;  3IOW A;  2I6E A;  3TMG A;  1NH7 A;  4MH5 A;  3SEX A;  4RA1 A;  1MXZ A;  3FJM A;  2H25 A;  5DVJ A;  3TOD A;  5CM6 A;  1GTK A;  5JTY B;  2YPN A;  3ILT B;  3V89 B;  2XD2 A;  3TUS A;  4F18 A;  1PBP A;  4EUO A;  3FV2 A;  3QSL A;  1H43 A;  3C4M A;  4UAC A;  5EHM A;  1YTV A;  4LA9 A;  2F6P A;  1MM6 A;  3GBB A;  3U8Q A;  2Q88 A;  1XT8 A;  5J1D A;  1N84 A;  2O6A A;  5AA2 B;  3VVE A;  3SDF A;  4PFY A;  3EHS A;  1B3G A;  2Y7K A;  3RNN A;  5FHM A;  1FTJ A;  3S4U A;  3N6T A;  1MPB A;  4OFO A;  1YCJ A;  2I4B A;  2ZYK A;  3TEP A;  5AA2 D;  3TCF A;  4U21 A;  5A5X A;  3RUM A;  4HS7 A;  1GV8 A;  2X7P A;  1QVS A;  5ISU A;  3OEN A;  2ONR A;  1J1N A;  2HZK A;  1B4Z A;  4EDP A;  1FW0 A;  3O6G A;  1WVJ A;  3DEL B;  2AL4 A;  4OYV A;  1PB7 A;  2Z8F A;  3V8X B;  3PUY E;  3C31 A;  3VVD A;  1JVX A;  3PUW E;  4R2B A;  5KZT A;  1DTZ A;  2H99 A;  4P0I A;  3PD9 A;  1B58 A;  3KG2 A;  1B0L A;  4F31 B;  4ZZA A;  5CMM A;  3KEI A;  1ZKB A;  4QSD A;  2LAO A;  4XKP A;  4KCD A;  2KLF A;  4POW A;  1ZLQ A;  4NF5 A;  5H8N B;  3FAS A;  3GBA A;  4ZED A;  1AH5 A;  4X48 A;  4MBP A;  4EXL A;  2O69 A;  1B9J A;  3B6W A;  3OO6 A;  4OFL A;  1O64 A;  5M2V A;  3TTM A;  1RYX A;  1MQI A;  5TU0 A;  1S50 A;  4NF4 A;  3O6H A;  4JBZ A;  2YJP A;  1UIU A;  3W9V A;  4PP0 A;  3TAJ A;  1MQH A;  4XXU A;  3FVK A;  1L5T A;  2V3T A;  3MVZ A;  2Y84 A;  3V5A A;  2DXR A;  3H4Z A;  1A8F A;  1MY0 A;  3G3G A;  1N76 A;  3A09 A;  5H8H A;  4FEB A;  5CBR A;  4DLD A;  3OOA A;  3UOR A;  4ELP A;  4I9D A;  3S9E A;  3QXM A;  3H6U A;  4QSE A;  3SEV A;  2DXY A;  3QK6 A;  3K6V A;  4KYS A;  3KN3 A;  4NTL A;  1FTL A;  3SER A;  2NVU B;  1JW1 A;  5A5X B;  1NFT A;  3KZG A;  1AMF A;  1II5 A;  4R2F A;  3T9X B;  4BLA A;  4AB5 A;  4GOT A;  2O84 X;  2VP1 A;  3MPL A;  2I0B A;  1Y4T A;  3N5L A;  1I6Q A;  2V3U A;  2DE3 A;  2XD3 A;  2M8C A;  1LB8 A;  2WKY A;  3MJN A;  5B7D A;  2GRV A;  5BUU A;  5DYH A;  2PBW A;  3MAM A;  1MS7 A;  2I49 A;  3VXC A;  1ANF A;  1FTK A;  1SW4 A;  3CVG A;  2V93 A;  4LQ2 A;  3IAZ A;  4DCY A;  4YAH X;  1M5D A;  1B7Z A;  2B65 A;  1DSN A;  3MVY A;  3BFT A;  4NF4 B;  1EZ9 A;  2Q89 A;  4YKJ A;  4YMB A;  2ZNU A;  1B6H A;  2VGQ A;  2X7Q A;  1H44 A;  1Y3Q A;  5H8H B;  1Y3N A;  2R9J A;  5L9O A;  3QYT A;  3OO7 A;  4M4G A;  4G8N A;  4R9G A;  2HEU A;  2RF1 A;  2Z22 A;  4YB7 A;  4JSO A;  1PDA A;  1Y1M A;  4Q30 B;  1LB9 A;  3UN6 A;  2Z23 A;  3IO6 A;  2B3B A;  4XKR A;  3C36 A;  1YPN A;  5I57 A;  1JQF A;  2GH9 A;  3TDJ A;  4NED A;  2O7I A;  2DYX A;  4Z7E A;  5HBC A;  4EF1 A;  2Q2C A;  3EN3 A;  3PPQ A;  3VVF A;  5KDT A;  1P1O A;  3UGW A;  2OZZ A;  1JET A;  1TFA A;  2ZYN A;  4YKK A;  2UVH A;  4IY5 A;  3C32 A;  3FXR A;  4MFI A;  4DZ1 A;  3K6W A;  5K2X A;  4F2O A;  1B1X A;  4IO2 A;  3IOR A;  1OQH A;  1IIW A;  5AA4 B;  1MG1 A;  1BP5 A;  3R7X A;  2NOO A;  3THI A;  1FQB A;  4H65 A;  3CI8 A;  3T9V A;  3K1P A;  3CSB A;  1UTB A;  1URS A;  3EPE A;  4U22 A;  1B40 A;  1P1W A;  3H03 A;  3OSQ A;  4F3P A;  4YZZ A;  1B0H A;  5L8D A;  4C0R A;  4YKI A;  2F97 A;  1R9Q A;  3HPI A;  4EXK A;  4ZEC A;  4H5G A;  4NF8 A;  3IK6 B;  1P99 A;  4DIG A;  3K01 A;  1Y3P A;  2DP8 A;  1QJM A;  1B1H A;  4G4P A;  2DWI A;  4JDF A;  4LZ8 A;  4YB5 A;  3K1N A;  3O29 A;  3B6T A;  3K1M A;  4FED A;  2QS4 A;  4IO4 A;  4JXI A;  5ITP A;  1FQD A;  2QJE A;  5DTB A;  4G77 A;  4DE8 A;  3CFZ A;  4P11 A;  4G8H A;  4OFJ A;  3ONM A;  1ZBM A;  3KSJ A;  4QFN A;  3U94 A;  4KCC A;  4ISU A;  5I57 B;  4AQ4 A;  2DWA A;  3IB1 A;  5TPA A;  4BDO A;  4U4X A;  3G3H A;  4O3A A;  3G3K A;  4IGT A;  3FIR A;  3P7I A;  5CMK A;  4AB6 A;  5CRY A;  5I2N A;  5KDT B;  1HSJ A;  3KN8 A;  1A55 A;  3H6T A;  5AA2 A;  3N6U A;  1JVY A;  4QFK A;  3MBP A;  1B3F A;  5JK4 A;  3O28 A;  4EQ7 A;  1GR2 A;  4KR5 A;  2XX8 A;  3PPN A;  4I62 A;  1UTB B;  1N7X A;  1XHY A;  1H3D A;  5LOM A;  1BIY A;  4OQO A;  5K2Y A;  4FE8 A;  4LZ7 A;  4F3S A;  1SW1 A;  1D9Y A;  5F1Q A;  1ZTY A;  3F11 A;  4ZE8 A;  2DQV A;  1B51 A;  1MY1 A;  3CG3 A;  4O3C A;  3IJO B;  4NF8 B;  3VLU A;  1UIV A;  5AE4 A;  4RPN A;  4F1U A;  1B32 A;  1IXH A;  2Z8E A;  4WKM A;  1LBC A;  3BFU A;  3SKP A;  1ELJ A;  1XVX A;  1SVX B;  4OXV A;  4ESX A;  1POY 1;  4U4S A;  4IO7 A;  3PUZ E;  4E0W A;  1MPC A;  1UTH A;  4JWX A;  1UQW A;  4H8J A;  2H9B A;  4IGR A;  1NNF A;  2ONS A;  3TTL A;  3LSX A;  4F1Y A;  1MM7 A;  3VLV A;  1US4 A;  5I56 A;  1MY3 A;  3ECR A;  5DVF A;  4ONY A;  4TOZ A;  4N6P A;  2QPQ A;  3PPP A;  1RKM A;  1M5E A;  3FXU A;  5TPA B;  3C9H A;  2NUV A;  1MH4 A;  2ZYO A;  3HHG A;  4BDM A;  1LAX A;  4F19 A;  2F6G A;  2Q2A A;  2GHA A;  3TFL A;  5I2N B;  3WAF A;  4JB7 A;  1LAG E;  2Y7W A;  1B3H A;  3A3C A;  3CRB A;  5DVI A;  4OEN A;  3W15 C;  1MPD A;  1H76 A;  2YLN A;  3M3L A;  2QS3 A;  3SET A;  1M5C A;  3CSG A;  1A8E A;  1BTJ A;  3H6V A;  3LUY A;  1B05 A;  2PVU A;  4IY6 A;  4FJP A;  5BWJ A;  4I1D A;  4ZDM A;  3TKD A;  2VHA A;  3LR1 A;  3HHF A;  3SES A;  2QMW A;  2ABH A;  2V3Q A;  4OZ9 A;  1EZO A;  4MLV A;  1NNK A;  4QHQ A;  3H7M A;  4XKN A;  3UIF A;  1SI0 A;  1SD3 A;  4XKQ A;  2V25 A;  5CMC A;  1UTH B;  3QUF A;  3OXN A;  3Q26 A;  4LZ5 A;  1FTO A;  2FNC A;  3U1O A;  3RQT A;  2F78 A;  3RY3 A;  5I56 B;  4K3F A;  5FHO A;  1MY4 A;  2RKM A;  3JV9 A;  4F3G A;  5B70 A;  4FAJ A;  1AL3 A;  4M1V A;  5CBS A;  4PFT A;  2UVG A;  1XS5 A;  5I59 A;  4KPT A;  3ZS6 A;  4LQ5 A;  2QS1 A;  4F22 A;  3HST A;  4QSC A;  4Z0I A;  3T66 A;  4LP2 B;  3IO4 A;  2XXU A;  3IB0 A;  2A5T A;  4HW8 A;  1I69 A;  1URG A;  1LLS A;  1M5B A;  3TPA A;  2CMO A;  2UXA A;  1TFD A;  2UYF A;  4R6Y A;  3RPW A;  2DE4 A;  2H5Y A;  3E13 X;  4NF6 A;  4YMA A;  4U1Z A;  1PEB A;  1H45 A;  3RT8 A;  1AIV A;  3JYR A;  1NL5 A;  4NE4 A;  1LCF A;  2VD3 A;  2O51 A;  1FQF A;  5I2K A;  1Z7N E;  2GHB A;  1DOT A;  2Y7R A;  3IOU A;  3HCQ A;  2F35 A;  4ELQ A;  2Y7P A;  1MXX A;  2NXO A;  3TEL A;  1SI1 A;  5L9S A;  5AA4 A;  1R9L A;  5H8Q A;  2ONK E;  3OEK A;  1A40 A;  2O1M A;  1QUL A;  1LFG A;  5ITO A;  3UA8 A;  4GLI A;  2FA7 A;  3K2D A;  2D21 A;  4ZEK A;  1JW5 A;  3K0V A;  4G8M A;  1SDX A;  3CFL A;  5I59 B;  3PPR A;  3T93 B;  2OWS A;  4I8C A;  4X9T A;  3E3K A;  1ZJL A;  3RLF E;  4GVO A;  5CC2 A;  4FOR A;  1DTG A;  4ELO A;  1MQG A;  4OWD A;  4R6K A;  2A5T B;  3VDF A;  1IXG A;  1A54 A;  3K00 A;  1IXC A;  1LST A;  2Z8D A;  4OEV A;  3MZ1 A;  4ESW A;  4FEC A;  3L6H A;  3MUQ A;  3MWB A;  1EU8 A;  4GD5 A;  3FUZ A;  4F2Q A;  1VSO A;  1Q35 A;  1VFE A;  4NF6 B;  1CE2 A;  1B3L A;  4IO5 A;  3PUX E;  2ZXT A;  3O6I A;  5AA3 A;  1OVT A;  4GXS B;  3HN0 A;  4X1B A;  5I2K B;  4NWC A;  1LGB C;  2E1S A;  3V83 A;  1A7L A;  2RIN A;  2THI A;  2IA4 A;  3LBS A;  4R9F A;  3HV1 A;  5ICQ A;  1NNT A;  5H8S A;  4KFQ A;  5H8Q B;  4U2R A;  4KQP A;  4YB6 A;  2HCA A;  3AXF A;  2H4I A;  3BKI B;  3T22 A;  1VFD A;  4G2Z A;  1JEV A;  4NMY A;  3EHT A;  4GFR A;  1SBP A;  2D3I A;  1I6A A;  1IXI A;  2UYE A;  5AA1 A;  1YAE A;  4GWO A;  3Q29 A;  5CMB A;  2VD2 A;  3MVX A;  2F36 A;  4EQ9 A;  3PD8 A;  2IEE A;  2OK2 A;  4H67 A;  2ZNT A;  1F9B A;  4BDN A;  1NKX A;  2HXW A;  4GIZ A;  4POX A;  3G3F A;  1HSE A;  2QS2 A;  4EF2 A;  3CR9 A;  5IKB A;  4X1D A;  1OLC A;  1URD A;  3FGS A;  3IOV A;  2D5W A;  2P0S A;  4ECF A;  4QRZ A;  3KJT A;  3KJ7 A;  2F5X A;  4F3B A;  3L6G A;  1IEJ A;  4KI0 E;  4P0G A;  4R6H A;  2O1L A;  3U72 A;  3TTN A;  4OMB A;  2DE2 A;  5ICT A;  2DOJ A;  1GVC A;  1MXU A;  2DWJ A;  1O7T A;  4PET A;  5ELV A;  3KBR A;  2XXV A;  1CB6 A;  3FXQ A;  3GLB A;  1USY E;  3DP8 A;  2RC8 A;  4ZEB A;  1WOD A;  3G7W A;  1QUI A;  4EQB A;  4N13 A;  1LCT A;  3FVG A;  2OJT A;  1Y20 A;  1IZ1 A;  2PX1 A;  3BBR A;  1ATG A;  4QFL A;  2G93 A;  2PMS A;  3LSW A;  4C1U A;  3ILU B;  3KFM A;  3ZKL A;  1S9T A;  2REG A;  4JWY A;  2Y7I A;  2XXT A;  2ESN A;  4HTG A;  3K6X A;  3DLN A;  1QKB A;  3N26 A;  2B3F A;  4BDR A;  1MXV A;  4R73 A;  3OO9 A;  1FQC A;  3CFX A;  2RC7 A;  3IL1 B;  1B4H A;  3IB2 A;  4FAT A;  5JEI A;  1XC1 A;  2REJ A;  1JW4 A;  4OET A;  3CG1 A;  4ZE9 A;  1JNF A;  2I4C A;  4MLQ A;  3FVO A;  3PMV A;  3N94 A;  3PUV E;  1QUJ A;  4ZS9 A;  5EHS A;  4OES A;  3LC8 A;  3RN8 A;  5F7V A;  1ZU0 A;  2QL3 A;  4GXA A;  2QSX A;  3H06 B;  4C1T A;  1P1N A;  1P1U A;  3OO8 A;  4QFO A;  3RT6 B;  4H6D A;  1MDP 1;  4H8I A;  3SEW A;  3PPO A;  5DT6 A;  3EHU A;  4GRK A;  1EZP A;  4RK9 A;  3FVN A;  4QF9 A;  1BLF A;  5FHN A;  3CIJ A;  1IUD A;  2X26 A;  1B5I A;  4YKP A;  3FZV A;  3W9W A;  5TP9 A;  3S9M C;  4OHN A;  4WEP A;  1XVY A;  1N0T A;  1B52 A;  4ND9 A;  3TCH A;  4BDQ A;  1ZIU A;  1D4N A;  4F1V A;  4KYE A;  1N04 A;  1TWY A;  4LAT A;  3MP6 A;  1MH3 A;  2F34 A;  4HCW A;  4N07 A;  1B5J A;  5CI5 A;  4TQU Q;  2HQ0 A;  4R72 A;  3QUJ A;  4NWD A;  1I6B A;  1MXY A;  1JEU A;  1Y1Z A;  1B7H A;  1TXF A;  1FQE A;  3E9X A;  3GXA A;  1T0K A;  2XXP A;  3C34 A;  4TLL B;  3FJ7 A;  4ZZE A;  3T96 B;  3JZJ A;  1OVB A;  2F8D A;  5I58 A;  1DPP A;  2XXH A;  1DPE A;  3UP9 A;  4H0W A;  1PBQ A;  4L17 A;  1SYH A;  2ZMB A;  3QIM A;  1POT A;  4UA8 A;  2OWT A;  1R1N A;  2QRY A;  4Q5T A;  4Q0C A;  4TLM B;  1Y4C A;  3E4R A;  4OVJ A;  2DVC A;  3VLW A;  3ZSF A;  2P1S A;  5I84 A;  3EF7 A;  1M5F A;  2HAU A;  1PC3 A;  4YIC A;  1LAF E;  4GL8 A;  5FTH A;  5L9M A;  1GGG A;  3PMX A;  1OQG A;  3PV0 E;  4RYA A;  1D9V A;  4LUB A;  3KN7 A;  5TP9 B;  4RXL A;  1HSL A;  3TTR A;  4U23 A;  1MRP A;  4DXC A;  3K4U A;  1SYI A;  2AL5 A;  2E0S A;  3R26 A;  3U92 A;  3O66 A;  3MP1 A;  2RC9 A;  3IJX B;  2AYS A;  4DDD A;  1WDN A;  2VOZ A;  4ZEF A;  4DCX A;  2W7Y A;  5FTI A;  3UK4 A;  1FTM A;  2XXW A;  2F7B A;  4LON B;  3MPK A;  3I3V A;  5EYF A;  2G29 A;  3QAX A;  3TQL A;  3VV5 A;  2OLB A;  2AIX A;  3MW0 A;  4RJZ A;  2XX7 A;  4OTE A;  3IR1 A;  1PB9 A;  1O63 A;  1LFI A;  1OLA A;  2ZYM A;  2R6G E;  1SW5 A;  3RGY A;  2NWJ A;  3GZG A;  4RPO A;  1PB8 A;  4IO3 A;  3LSL A;  4GQO A;  5I58 B;  2V84 A;  1A99 A;  4PE5 B;  4R75 A;  4ELR A;  4NF5 B;  2O7U A;  2P2A A;  1EH3 A;  1Q1K A;  1USY H;  4MF3 A;  4KD5 A;  1MQD A;  4PQJ A;  4RNS A;  3FJG A;  3TQW A;  1OIB A;  2XX9 A;  1P1Q A;  3S9N C;  2ALU A;  3K02 A;  5KCJ A;  1XOC A;  3VFJ A;  3VXB A;  4FIM A;  4U1O A;  2RCA A;  2F7A A;  3DP4 A;  3M3F A;  4Q8R A;  3ZKK A;  4JWO A;  1B46 A;  3VE1 B;  1US5 A;  3FV1 A;  3RTW B;  2OCU A;  1N7W A;  2I0C A;  3MC2 A;  3OEL A;  2PT1 A;  4BDL A;  2ZNS A;  2UVI A;  3O2A A;  3HO7 A;  3C35 A;  3O97 A;  2XXX A;  2GFE A;  3OSR A;  4PFU A;  3T9U A;  4QFP A;  5DEX A;  2FYI A;  2RCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...