1H45A

R210g n-terminal lobe human lactoferrin
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
RRRSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLDWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIGESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTOFERRIN
publication title "Dilysine Trigger" in Transferrins Probed by Mutagenesis of Lactoferrin: Crystal Structures of the R210G, R210E, and R210L Mutants of Human Lactoferrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 104
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2002-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h45A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h45A02
1R1NA 4H65A 3C33A 3RT8A 3M8UA 2DP8A 1LBCA 2Z8DA 2ZXTA 5TU0A 1YCJA 5DEXA 3EHUA 1LB9A 4THIA 3LC8A 4YKJA 1GGGA 1JVXA 5F1QA 4AQ4A 1ZTYA 1B5IA 4GQOA 1JEUA 4F1YA 4RK9A 3SEXA 2B65A 4H6DA 4LVQA 2UYEA 2OZZA 5B7DA 4X9TA 3ZKKA 3R7XA 3S9NC 4GOTA 1O64A 1PB8A 3T96B 1NMUA 2Z8FA 2F7AA 3H06B 2ALUA 2G93A 4R2BA 2P0SA 3I3VA 4ZZEA 5L9SA 1S50A 4XXUA 1IQ7A 4C1UA 4EQ7A 3KZGA 4ZS9A 3PUVE 1LB8A 5AA2B 1NH7A 3IOVA 2HQ0A 4HW8A 3F11A 3QIMA 1N0TA 3IJXB 1B51A 2QPQA 5M2VA 1YTVA 1BP5A 4G68C 5I84A 1LFGA 4I62A 4LQ2A 4IO5A 2XD3A 4IO2A 4IB2A 3DP6A 5TPAA 2F5XA 2VHAA 4BDLA 4U2RA 3CIJA 3TTRA 4F2QA 2QL3A 2HAUA 2ZYOA 3KFMA 2PX1A 3OENA 4QFNA 2GRVA 4MH5A 2G29A 5TP9B 2ZNTA 4OZ9A 1MXYA 2YJPA 4QSCA 3QUFA 5CRYA 2I4BA 2H98A 1VFEA 2H5YA 3SEVA 4RK2A 1USYE 4OQOA 1UTBA 3FIRA 3WAFA 1EH3A 2HAVA 3FXQA 4NE4A 3MP1A 4PE5B 1QJMA 2CMOA 3GBBA 4ELOA 1SI0A 1LGBC 4F29A 4IGRA 4YKPA 4QFLA 2PYYA 2DE2A 4OESA 1UIVA 3A3CA 3B6QA 1OQHA 2DVCA 2XXQA 1FQAA 3PPNA 3TELA 3QYTA 3K1NA 3Q27A 3H3GA 4OETA 1PC3A 1Y3PA 3U94A 4C1TA 1KWHA 4RY1A 1LCFA 3K6XA 4ZECA 1P1NA 2HZKA 1US5A 2GHBA 2RC8A 4DIGA 5I58B 4PFUA 3S4UA 1MG1A 3KBRA 5DTBA 1L5TA 5F7VA 3GBAA 3MAMA 3QAXA 3HV1A 3CSGA 2D5WA 4LONB 1B2HA 1S9TA 2F6GA 1PBQA 1A55A 4X1DA 3RTWB 1MH3A 3FVNA 5CM6A 2FA7A 1MH4A 3IOWA 3JZJA 5H8NA 2ZYNA 1XS5A 3KOSA 3U93A 3FJMA 4JSOA 2DWAA 2V3UA 3FJ7A 3V8XB 2V3QA 1N84A 3FV1A 3HO7A 3B6TA 4FEDA 2O1MA 3UIFA 5AE4A 1B40A 2FNCA 5I59A 3IX1A 4ZE9A 4KQPA 4PQJA 1NFTA 5AA3A 4JB7A 3CG3A 4GLIA 1B1XA 3M3KA 4GRKA 2DWIA 5KCJA 3Q26A 2OCUA 5DT6A 1MQGA 4OYVA 1P1QA 4TQUQ 1IEJA 2ONSA 3TCFA 2OLBA 3CFLA 4F39A 4XTCQ 3RPWA 4G68B 3EHSA 4FECA 2QMXA 4F1VA 1P1OA 3G3IA 3K6WA 4QF9A 4POWA 1BLFA 4R74A 2QS1A 1MXVA 5BWJA 1MPDA 4GL0A 1RYXA 4XKPA 4H67A 3RY3A 1FQFA 3O28A 2O6AA 4U1OA 2DE3A 5AA2A 2NUVA 5EHSA 1MY2A 4Q0CA 3KN7A 3TMGA 1VR5A 1B58A 4RA1A 1FQBA 2O69A 4DZ1A 3HHGA 3B6WA 3R26A 3T22A 4IGTA 1HSLA 4X1BA 4KFQA 2X7PA 3OEKA 1SI1A 3MP6A 2XXHA 1GV8A 3FATA 4NF8B 4KD5A 4F2OA 4WEDA 3VXCA 3PPOA 5TPAB 1LFHA 2AL5A 4YMBA 2ZNUA 3MZ9A 3TPAA 4TLMB 3SETA 3H6TA 5CMKA 3IAZA 5ISUA 1MPBA 4DXBA 2BJJX 2UVJA 4GVOA 5TP9A 4R9FA 2RCAA 2DXRA 3MPLA 1FQCA 1EZPA 3MC2A 4Q5TA 4H8JA 1Y3QA 3FVKA 3OXNA 3I5OA 5H8FA 2A5SA 1B5JA 1MY3A 4YAHX 4DE8A 1NL5A 3FD3A 4I1DA 2LAOA 3WAEA 3PUXE 4N13A 3VLUA 3C32A 1MM6A 1B6HA 3CR9A 4PFWA 3THIA 4PFYA 4NMYA 3DM0A 3CVGA 3V5AA 3RQTA 1FTKA 1JW5A 4EQBA 4N07A 4P0IA 1MQDA 4R73A 3C4MA 4RXLA 1SYIA 3PV0E 4POXA 4O3AA 1S7YA 1TWYA 3IB2A 3CFXA 2XXWA 4OVJA 3HPIA 5LOMA 1QKAA 3G7WA 4ND9A 3T93B 1OMPA 3OSQA 3TYHA 4KCCA 4KYSA 3S9MC 1NNPA 4H0WA 2QMWA 5I58A 3KJ7A 3DP4A 2ABHA 4KYDA 4IO7A 1XVYA 5FHMA 2F8DA 1IIWA 3PMVA 2F7CA 4EF1A 1B0LA 5DVJA 4QRZA 4O3CA 4WEPA 1LAXA 1J1NA 5H8SA 3KSXA 1MY0A 2H4IA 1IXGA 3A09A 1Y4TA 3VE1B 5I56A 1VE4A 5H8NB 4XIGQ 4QFKA 1URDA 1Z7NE 3CRBA 3P7IA 3TAJA 3QSLA 2FYIA 1MQIA 2OWSA 1IXCA 3CFZA 2Z8EA 5I59B 2AYSA 1B0HA 1B32A 2I6EA 3GXAA 2XXPA 3H4ZA 4GWOA 3AXFA 2VD2A 1M5EA 5KDTB 2OBGA 5J1DA 4JDFA 5KCJB 2F36A 4IO6A 2GH9A 1XVXA 3C35A 4FEBA 1B7ZA 2NXOA 1FQEA 1H44A 2XHDA 3UN6A 2Y84A 1FCKA 3U1OA 4F3SA 4G68A 1ELJA 3VFJA 1DTGA 1OIBA 1T0KA 1FTOA 3S9LC 4LZ5A 4OERA 3IJOB 3EN3A 4F18A 4MF3A 1JETA 2PT1A 1JVYA 1F9BA 4YKIA 4ZEKA 4ZDMA 3ECRA 4FE8A 1FTLA 2IA4A 3IOUA 3TUSA 1B3GA 3K6UA 4HTGA 1DPEA 4MLQA 1B1HA 4NTLA 1OLAA 5I2NA 4NF8A 1O7TA 3GLBA 1PB9A 3MVXA 4I9DA 1D9YA 1N7XA 3KN8A 3ZS6A 4TOZA 4EDPA 1IITA 4QSEA 2OK2A 4MLVA 1MM7A 4GIZA 3FVOA 5CBSA 2GHAA 4NF4B 3L6HA 2R9JA 1LLSA 1QUJA 3H6WA 1B5HA 2ZYKA 3O97A 5FTIA 1IXHA 4U4XA 4JWXA 4R6HA 4BDNA 5H8FB 1ZKBA 4P0GA 3HN0A 3C9HA 5AA4A 1I6BA 2ESNA 3FASA 2QRYA 2REGA 2DWHA 4YU0A 3TTLA 3UA8A 3O6HA 4GXAA 4RNSA 1ANFA 2I48A 3FVGA 3H03A 4G8MA 1MDP1 1ATGA 4NF6B 5AA2D 1JW4A 3LR1A 1URGA 2Y7RA 2XX8A 4H8IA 3MP8A 3H6UA 4M1VA 1ZU0A 1PB7A 2M8CA 3O66A 5I2KA 1TFAA 5EHMA 5AA1A 4ZEFA 4JXIA 2W7YA 4ESWA 1UQWA 3G3FA 1H43A 1LAFE 4PP0A 3KEIA 1A40A 4FATA 1B3EA 3Q28A 2DSFA 1A54A 2I3WA 3VVDA 4YKKA 2X7QA 2DE4A 2DS9A 2YPNA 3K4UA 4IO4A 1M5CA 3GZGA 1WVJA 2B3FA 4F1UA 4RYAA 2ZYMA 5I56B 1ZIUA 2Q2AA 5HPQA 1AMFA 3UORA 3DLNA 1MDQA 1GTKA 3C34A 4X48A 4YB5A 1MS7A 4OEUA 2F6PA 3N5LA 2DXYA 4ELPA 3TEPA 3IO6A 2V25A 2F97A 1B46A 2DOJA 1ZLQA 4KR5A 3PU5A 3SEYA 4H1XA 1WODA 4EF2A 2E0SA 1UIUA 2PT2A 5KDTA 2F7BA 4DXUA 1P1WA 4HCWA 4IY6A 4ZEIA 3ONMA 4PETA 4NWDA 4OTEA 2HFBA 4OMBA 1YAEA 1SW2A 3UGWA 3U92A 4F3GA 3FV2A 4Q8RA 3D4CA 2VGQA 1MPCA 4YZZA 4G8HA 1A8FA 1A8EA 3EQ1A 2Q88A 2R6GE 2R71A 3TCHA 1FTMA 2OJTA 1VFDA 3TFLA 3G3KA 3T9XB 4RJZA 4ZZAA 1XT8A 4U21A 3FUZA 3G3GA 4AB6A 1SBPA 5FTHA 3O6GA 4YB6A 3LSWA 1SW5A 3MQ9A 2NWJA 1BTJA 2YLNA 2I4CA 4ONYA 3M3LA 3RN8A 2V3TA 3ILTB 3VXBA 5I2NB 2UVGA 3UK4A 1LSTA 2Y7KA 1M5BA 5A5XA 2XXUA 2XXIA 3BFTA 1RYOA 2O51A 3SKPA 3EPEA 3RT6B 1I69A 4Z0IA 3K2DA 1MXXA 3N94A 3O9PA 3UP9A 2ZMBA 3ILUB 1B4HA 1DMBA 1IUDA 4NF4A 1SVXB 2NOOA 2XXYA 1D9VA 4Z7EA 1AOVA 3EF7A 5ITPA 1URSA 3PD9A 2F34A 3IB1A 2AIXA 3KG2A 4GF8A 1OVBA 2O7UA 2UXAA 1B3HA 4KYEA 3PUYE 2XXXA 1JEVA 1US4A 5AA4B 3SEUA 1OQGA 4KI0E 1AIVA 4LP2B 5KZTA 3U8QA 4C0RA 3IORA 3OO8A 1I6AA 5DVFA 1BKAA 2PVUA 2HZLA 3DELB 3RNNA 4HS7A 3O29A 4NF6A 1YPNA 3OO9A 5BUUA 3DP8A 1N3XA 3I6VA 4DXCA 1PBPA 3H6VA 5CC2A 2H9BA 2Q9TA 2OWTA 1QKBA 1SD3A 4EXLA 4QFOA 2F78A 5FHNA 3TQWA 5I2KB 1II5A 4ZEBA 1LFIA 4OXVA 3VVEA 1N76A 3E9XA 4RPOA 4WXJA 1Q1KA 1TT1A 4NWCA 1NH8A 2O7IA 1B7UA 4NF5A 3PPRA 3E13X 4M4GA 5H8QA 3OO7A 3JYRA 2DWJA 4DLDA 3HSTA 3VVFA 3ZKLA 1QUKA 5CBRA 4BDOA 3OSRA 2ONRA 1ZJLA 4XKRA 5L9OA 1JNFA 3KGCA 4YB7A 1UTHA 1MY4A 4GXSB 3MW0A 2O84X 1P99A 2UVHA 1B52A 2H25A 4G2ZA 3E3KA 2WKYA 3TKDA 4ZE8A 4GFRA 3FXRA 3KN3A 3EHTA 1Y1ZA 3W15C 3RGYA 3MVYA 1MY1A 4Q30B 3VV5A 1XOCA 1XC1A 2HEUA 5L9MA 3K02A 3S2VA 4F19A 3MBPA 3H7MA 4G8NA 1NNTA 2RINA 2I0BA 4ESXA 5JTYA 3RTFB 3PUZE 3MZ1A 2XD2A 3Q25A 1SYHA 2Y7PA 3OO6A 1Y4CA 5IKBA 1QUIA 2X26A 2ZNSA 1XHYA 4LZ7A 2I3VA 1MQJA 3K1PA 4BDRA 5H8HB 2I49A 4OHNA 3O2AA 4OENA 5JEIA 3OOAA 3E4RA 4JWOA 4WKMA 2ONKE 3TQLA 2D3IA 3CG1A 2E1SA 3HCQA 1GR2A 2UYFA 3LSXA 3PPQA 2Z23A 1PEBA 3MZBA 2D21A 3MVWA 4I8CA 2XXTA 1QULA 3K01A 3B7DA 5A5XB 4FIMA 4HCYA 4H5GA 3U72A 3VLWA 4U23A 4N6PA 1P1UA 2RKMA 4GD5A 4EUOA 1IZ1A 1ZBMA 3MUQA 3S9EA 2DQVA 5I57A 1TFDA 4XKQA 3FGSA 4R2FA 3HHFA 4KCDA 1B9JA 1AL3A 2H99A 3LSFB 1ZMGA 2A5TA 1USYH 3LBSA 1POY1 3C36A 3OMBA 1DPPA 3TZAA 3PMWA 1M5FA 4G77A 4U4SA 3PGFA 4YMAA 2I58A 4LATA 1NNFA 3SDFA 4YICA 4R6YA 3IOTA 4U22A 4LA9A 1Y3NA 4BDMA 1A99A 3G3JA 4FJPA 4R75A 1PDAA 4IO3A 4QSDA 2F35A 2PMSA 4F3BA 3IO4A 1JQFA 2P2AA 3QXMA 1R9QA 3IB0A 3USDA 4KHZE 3G3HA 4F22A 1SQYA 3MJNA 5L8DA 1Y9UA 4BDQA 3V89B 4U1ZA 3OELA 4XKNA 1SW1A 2VD3A 3A3UA 2HXWA 1MXZA 3KJTA 4NF5B 4TLLB 3K0VA 3IR1A 1VSOA 5H8QB 1LAGE 4F3PA 4ECFA 2O1LA 3Q29A 2QSXA 2RC9A 1DTZA 5DVIA 3T9UA 1B7HA 4MBPA 2XX7A 1DOTA 4UACA 3PD8A 1MXWA 2KLFA 1B4ZA 3V83A 1UTHB 1SW4A 3T9VA 2IEEA 3OEMA 4RPNA 1MRPA 4ELRA 1FTJA 3TODA 3C31A 3K6VA 3K00A 5FHOA 1SDXA 3L6GA 3MWBA 3T9HB 1MQHA 2DYXA 1LBBA 3KSJA 1CB6A 3IL1B 3VLVA 2Y7IA 3SEWA 2Q8JA 1B05A 4ELQA 1HSEA 1WDNA 5HM4B 1M5DA 2NVUB 1D4NA 4QHQA 5DEXB 2XXVA 5JTYB 1NKXA 5ITOA 1N3WA 4L17A 1DSNA 2CZLA 4LQ5A 1Y20A 3N6UA 2PBWA 3MVZA 3LSLA 3PPPA 4BLAA 5H8HA 3KOTA 4QFPA 4IY5A 2VOZA 2REJA 5ICQA 3N6TA 1Q35A 3BKIB 4R9GA 1B3LA 4R72A 4F31B 2RC7A 1BIYA 3CI8A 3BBRA 4JWYA 2VP1A 3ZSFA 3JV9A 2Q89A 1A7LA 3K1MA 3LUYA 3N26A 4DCYA 4E0XA 5K2YA 2DVZA 5CI5A 3RLFE 3FZVA 1HSJA 2Z22A 2ANJA 4LUBA 4GL8A 5I57B 4OWDA 1QW0A 3FJGA 5HBCA 1MXUA 1I6QA 2QS3A 2Y7WA 5JK4A 4ZEDA 2A5TB 2I0CA 4MFIA 3FXUA 3O6IA 4G4PA 2HCAA 1O63A 3T66A 1H76A 1CE2A 1QVSA 4FORA 3W9VA 1RKMA 1POTA 3TCGA 3PUWE 3QUJA 2V84A 3CSBA 3PMXA 4DDDA 1LAHE 4OFJA 1EU8A 5EYFA 3R6UA 2P1SA 1UTBB 2UVIA 1N7WA 3SERA 2QS4A 4P11A 1H45A 1R6ZA 4O3BA 1H3DA 4JSDA 3QK6A 1OVTA 2AL4A 4AB5A 1Z7ME 4R6KA 4OEVA 1R9LA 1EZOA 4E0WA 3VDFA 4KPTA 1NNKA 4UA8A 1JW1A 2QJEA 3ODBA 4DCXA 2THIA 4NEDA 3TTMA 2GFEA 5CMMA 2XXRA 1B3FA 3OD7A 4EXKA 4OFOA 2XX9A 4ISUA 4PFTA 2QS2A 3W9WA 2V93A 4K3FA 3IK6B 3TTKA 4EQ9A 3BFUA 3D4GA 3TDJA 5DYHA 3RUMA 1Y1MA 1N04A 4OFLA 4JBZA 5ELVA 5K2XA 1OLCA 5CMCA 1IXIA 1LCTA 5IAIA 1FW0A 3TTNA 2O68A 5B70A 3SESA 3M3FA 2B3BA 1GVCA 4H5FA 4FAJA 4LZ8A 5CMBA 2Q2CA 1FQDA 1EZ9A 1D3KA 1AH5A 2RF1A 1TXFA 2RCBA 3MPKA 5ICTA
chains in the Genus database with same CATH superfamily
1R1NA 4H65A 2FIEA 4HE1A 3C33A 4O7IA 3RT8A 3M8UA 2DP8A 1LBCA 2Z8DA 1RDYA 2ZXTA 5TU0A 5IZ3A 1Q9DA 1YCJA 5DEXA 3EHUA 2QVUA 5EYGA 1LB9A 4THIA 3LC8A 4YKJA 4PFIA 1GGGA 1JVXA 5F1QA 1FBEA 4AQ4A 4OA4A 1ZTYA 2L5VA 1B5IA 4GQOA 1JEUA 4F1YA 4RK9A 3SEXA 2B65A 4H6DA 4LVQA 2UYEA 2OZZA 5B7DA 4X9TA 3ZKKA 3R7XA 3S9NC 5LDZA 4GOTA 1O64A 1PB8A 3T96B 1NMUA 2Z8FA 2F7AA 3H06B 2ALUA 2G93A 4R2BA 2P0SA 3I3VA 4ZZEA 5L9SA 1S50A 4XXUA 1IQ7A 4C1UA 4EQ7A 3KZGA 4ZS9A 1NUWA 3PUVE 4OVQA 1LB8A 2ZZXA 5AA2B 1NH7A 3IOVA 2HQ0A 4HW8A 3F11A 3QIMA 1N0TA 1VDWA 3IJXB 1B51A 2QPQA 5M2VA 4NG7A 1YTVA 1BP5A 2QVVA 4PBQA 4G68C 5I84A 1LFGA 4I62A 4LQ2A 4IO5A 2XD3A 4IO2A 4DI3D 4IB2A 3DP6A 5TPAA 1EYJA 4N6KA 2F5XA 2VHAA 4BDLA 4U2RA 1IMCA 3CIJA 3TTRA 4F2QA 5IZZA 2QL3A 2HAUA 2BJIA 2ZYOA 3KFMA 2PX1A 3OENA 4QFNA 2GRVA 4MH5A 2G29A 5TP9B 2KQZA 2ZNTA 2FVZA 1MXYA 4OZ9A 2YJPA 1KZ8A 4QSCA 3QUFA 5CRYA 2I4BA 2H98A 1VFEA 3KC1A 2H5YA 3SEVA 4RK2A 1USYE 1FPJA 4OQOA 1UTBA 3FIRA 3WAFA 5I7IA 1EH3A 2HAVA 3FXQA 2QVRA 4NE4A 3MP1A 1IMAA 4PE5B 1QJMA 2CMOA 3GBBA 4ELOA 1SI0A 1LGBC 4F29A 4IGRA 4YKPA 4QFLA 2PYYA 2DE2A 4OESA 1UIVA 3A3CA 3B6QA 3E78A 1OQHA 2DVCA 2XXQA 1FQAA 4GWXA 3PPNA 3TELA 3QYTA 3K1NA 3KC0A 3Q27A 4NQ8A 4OVSA 3H3GA 4OETA 1PC3A 1Y3PA 4NGUA 3U94A 4C1TA 1KWHA 4RY1A 1LCFA 3K6XA 4ZECA 1P1NA 2HZKA 1US5A 2GHBA 2RC8A 4DIGA 5I58B 4PFUA 3S4UA 1MG1A 3KBRA 5DTBA 1L5TA 5F7VA 3GBAA 1EYIA 1BK4A 3MAMA 3QAXA 3HV1A 3CSGA 2D5WA 4LONB 1B2HA 1S9TA 2F6GA 1PBQA 1A55A 4X1DA 3RTWB 1MH3A 5ESYA 3FVNA 5CM6A 4P3LA 1NUYA 2FA7A 1MH4A 3IOWA 3JZJA 5H8NA 2ZYNA 1XS5A 3KOSA 3U93A 1FBFA 3FJMA 4JSOA 2DWAA 2V3UA 1LBXA 3FJ7A 3V8XB 2V3QA 4I3YA 2ZZVA 1N84A 3FV1A 3HO7A 3B6TA 4FEDA 2O1MA 1JP4A 2VPOA 3UIFA 4H45A 5AE4A 1B40A 2FNCA 5I59A 3IX1A 4ZE9A 4KQPA 4PQJA 1NFTA 5AA3A 4JB7A 3KBZA 3CG3A 4GLIA 1B1XA 3M3KA 4GRKA 2DWIA 2HPGA 5KCJA 3Q26A 2OCUA 5DT6A 4GX4A 1MQGA 4OYVA 1P1QA 4TQUQ 3U65A 1IEJA 2ONSA 3TCFA 2OLBA 3CFLA 4F39A 4XTCQ 3RPWA 4G68B 3EHSA 4FECA 2QMXA 4F1VA 1P1OA 3G3IA 3K6WA 4QF9A 1FBHA 4POWA 1FPBA 1BLFA 4R74A 4OANA 1AWBA 2QS1A 1MXVA 5BWJA 1MPDA 4GL0A 1RYXA 4XKPA 4H67A 3RY3A 1FQFA 3O28A 2O6AA 4U1OA 2DE3A 5AA2A 2NUVA 5EHSA 1MY2A 4Q0CA 3KN7A 3TMGA 1VR5A 1B58A 4RA1A 1FQBA 2O69A 4N8YA 3HHGA 3B6WA 3R26A 4LN5A 4DZ1A 3T22A 4IGTA 1HSLA 4X1BA 4KFQA 2X7PA 3OEKA 1SI1A 3MP6A 2XXHA 1GV8A 3FATA 4NF8B 4KD5A 4F2OA 4WEDA 1INPA 3VXCA 3PPOA 1IMDA 5TPAB 1LFHA 2AL5A 4YMBA 2ZNUA 3MZ9A 3TPAA 4TLMB 1NV7A 3SETA 3H6TA 5CMKA 3IAZA 5ISUA 1MPBA 1FPLA 4DXBA 2BJJX 2UVJA 5EQAA 4GVOA 5TP9A 4R9FA 4O8MA 4UABA 1D9QA 2RCAA 2DXRA 1LEVA 3MPLA 1FQCA 1EZPA 3MC2A 1IMEA 4Q5TA 4H8JA 5I5PA 3D1RA 1Y3QA 3FVKA 3OXNA 3I5OA 5H8FA 2A5SA 1B5JA 1MY3A 3CHGA 4YAHX 4DE8A 5DW8A 4PBHA 1NL5A 3FD3A 4I1DA 2LAOA 3WAEA 3PUXE 1DBZA 4N13A 3VLUA 3C32A 4G61A 1MM6A 1B6HA 3CR9A 4PFWA 4AS5A 1NV0A 3LV0A 4QBAA 4N6DA 3THIA 1DCUA 4PFYA 4NMYA 3DM0A 3CVGA 3V5AA 1QGXA 3RQTA 1FTKA 1JW5A 4EQBA 4N07A 4P0IA 1MQDA 4R73A 3C4MA 4RXLA 1SYIA 3PV0E 1RDXA 4POXA 4O3AA 1S7YA 1TWYA 3IB2A 3CFXA 2XXWA 2HXRA 4OVJA 3HPIA 5LOMA 1QKAA 3G7WA 4ND9A 3T93B 1OMPA 2WYPA 3OSQA 4IR8A 3TYHA 4KCCA 4KYSA 3S9MC 4NF0A 1NNPA 4H0WA 2QMWA 5I58A 3KJ7A 3DP4A 2ABHA 4KYDA 4IO7A 2DDKA 2WBDA 4MNPA 2CZIA 1XVYA 5FHMA 4I40A 2F8DA 1IIWA 3PMVA 2F7CA 4EF1A 1B0LA 5DVJA 4QRZA 4O3CA 2Q8MA 4MNCA 4WEPA 1LAXA 1J1NA 5H8SA 3KSXA 1MY0A 2H4IA 1IXGA 3A09A 1Y4TA 3VE1B 2GQ1A 5I56A 1VE4A 5H8NB 4XIGQ 4QFKA 4N91A 4PC9A 1URDA 1Z7NE 3CRBA 3P7IA 3TAJA 3QSLA 2FYIA 1MQIA 2OWSA 1IXCA 3CFZA 2Z8EA 1FPIA 5I59B 2AYSA 4MMPA 1B0HA 1B32A 2I6EA 3GXAA 4PE3A 2XXPA 1NV2A 3FBPA 4N17A 3T0JA 3H4ZA 4GWOA 1NV5A 3AXFA 4GWUA 2VD2A 1M5EA 4HXVA 5KDTB 2OBGA 5J1DA 4JDFA 5KCJB 2FIXA 2F36A 4IO6A 2GH9A 1XVXA 3B50A 3C35A 4FEBA 1B7ZA 2ZZWA 4N4UA 2NXOA 1FQEA 1H44A 2XHDA 3UN6A 2Y84A 1FCKA 3U1OA 4F3SA 4G68A 1ELJA 3VFJA 1DTGA 1OIBA 1T0KA 1FTOA 3S9LC 4LZ5A 4OERA 3IJOB 3EN3A 4F18A 4MF3A 2CZHA 1JETA 2PT1A 1JVYA 1F9BA 4YKIA 4ZEKA 3IFCA 4NN3A 4ZDMA 3ECRA 4FE8A 1FTLA 1NUXA 2IA4A 3IOUA 3TUSA 1B3GA 3K6UA 4HTGA 1DPEA 4I3EA 4MLQA 1B1HA 4NTLA 1OLAA 5I2NA 4NF8A 1O7TA 3GLBA 1PB9A 3MVXA 4I9DA 1D9YA 5IZ1A 4X8RA 1N7XA 3FXBA 4P1LA 3KN8A 4O94A 3ZS6A 4TOZA 4EDPA 1IITA 4QSEA 2OK2A 4MLVA 1MM7A 4GIZA 3FVOA 5CBSA 2GHAA 3GYYA 4NF4B 3IFAA 3L6HA 2R9JA 1LLSA 1QUJA 3H6WA 1B5HA 2KR0A 2ZYKA 1YYZA 3O97A 4AS4A 5FTIA 1IXHA 4U4XA 4JWXA 4R6HA 4BDNA 5H8FB 1ZKBA 4P0GA 3HN0A 3C9HA 5AA4A 1I6BA 2ESNA 3FASA 2QRYA 2REGA 2DWHA 4DI4B 4YU0A 3TTLA 3UA8A 3O6HA 4GXAA 4RNSA 1ANFA 2I48A 3FVGA 2F3BA 3H03A 4G8MA 1MDP1 1ATGA 4NF6B 5AA2D 1JW4A 3LR1A 1URGA 4MCOA 3BIHA 2WBBA 1FPEA 2XX8A 2Y7RA 4H8IA 3MP8A 3H6UA 2XWKA 4M1VA 1ZU0A 1PB7A 2M8CA 3O66A 5I2KA 4GWYA 4P8BA 1TFAA 5F24A 4P9KA 5EHMA 4MIJA 5AA1A 4ZEFA 4JXIA 2W7YA 4ESWA 3NOHA 1UQWA 3G3FA 1H43A 1LAFE 4PP0A 2WEFA 3KEIA 1A40A 4GWZA 4PCDA 4FATA 1B3EA 3Q28A 2DSFA 5T3JA 1A54A 2I3WA 3VVDA 4YKKA 2X7QA 2DE4A 5EYHA 2DS9A 2YPNA 3K4UA 1CNQA 4IO4A 1M5CA 2P3NA 3GZGA 1WVJA 4XFEA 2B3FA 4F1UA 3PTYA 4RYAA 2ZYMA 5I56B 1ZIUA 4N81A 2Q2AA 5HPQA 1AMFA 3UORA 3DLNA 1MDQA 1GTKA 3C34A 4X48A 4YB5A 1MS7A 1FBCA 4OEUA 2HHMA 2F6PA 2V4CA 3N5LA 2DXYA 4ELPA 3TEPA 3IO6A 2V25A 2F97A 1B46A 2DOJA 4P47A 1ZLQA 1FBDA 4KR5A 3RPLA 3PU5A 3SEYA 4H1XA 1WODA 2VPNA 4EF2A 2E0SA 1UIUA 2PT2A 5KDTA 2F7BA 4DXUA 1P1WA 4HCWA 5LTCA 4IY6A 4ZEIA 3ONMA 4PETA 4NWDA 4OTEA 2HFBA 4OMBA 1YAEA 1SW2A 4JVDA 3UGWA 3U92A 4F3GA 1IMFA 3FV2A 1G0HA 4Q8RA 3D4CA 2VGQA 1MPCA 4YZZA 4G8HA 1A8FA 2Q74A 1A8EA 3EQ1A 2Q88A 1LBYA 1NUZA 2R6GE 2R71A 3TCHA 1FTMA 1LBVA 2OJTA 4H46A 1VFDA 3TFLA 3G3KA 1G0IA 3T9XB 4RJZA 4ZZAA 2WX9A 1XT8A 3HFUA 4U21A 3FUZA 3G3GA 4AB6A 1SBPA 5FTHA 3ISPA 1FTAA 3O6GA 4YB6A 3LSWA 1LBZA 1SW5A 3MQ9A 2NWJA 1BTJA 3B8BA 2YLNA 2I4CA 4ONYA 1NV4A 3M3LA 3RN8A 2V3TA 3ILTB 3VXBA 5I2NB 2UVGA 3UK4A 1LSTA 2Y7KA 1M5BA 3EKIA 5A5XA 2XXUA 2PCRA 2XXIA 2VT5A 3BFTA 1RYOA 2O51A 3SKPA 3EPEA 4GBWA 3RT6B 4GBVA 1I69A 4Z0IA 3K2DA 1MXXA 3N94A 3O9PA 3UP9A 4PTKA 2ZMBA 3ILUB 1B4HA 1FBGA 1DMBA 1IUDA 4NF4A 1SVXB 2NOOA 2XXYA 1D9VA 4Z7EA 1AOVA 3EF7A 5ITPA 1URSA 3PD9A 2F34A 3IB1A 5ET8A 2AIXA 3KG2A 4GF8A 1OVBA 2O7UA 2UXAA 3SZPA 1B3HA 4KYEA 5EQ7A 3PUYE 2XXXA 1JEVA 1US4A 5AA4B 3SEUA 2P3VA 1OQGA 4KI0E 1AIVA 4LP2B 4OVRA 5KZTA 5EQ9A 3U8QA 4C0RA 3IORA 3OO8A 1I6AA 5DVFA 1BKAA 2PVUA 2HZLA 3DELB 1FPDA 4PAIA 4HS7A 3RNNA 3O29A 4NF6A 1YPNA 3OO9A 5BUUA 3DP8A 1N3XA 3I6VA 4DXCA 1PBPA 3H6VA 5CC2A 2H9BA 2Q9TA 2OWTA 1QKBA 1SD3A 4EXLA 4QFOA 2F78A 5FHNA 3TQWA 5I2KB 1II5A 4ZEBA 1LFIA 4OXVA 3VVEA 1N76A 3E9XA 4RPOA 4WXJA 1Q1KA 1TT1A 4NWCA 4PGPA 1NH8A 2O7IA 1B7UA 4NF5A 3PPRA 3E13X 2XWIA 3MYUA 4M4GA 5H8QA 3OO7A 3JYRA 2DWJA 4DLDA 2CEYA 3HSTA 3VVFA 3ZKLA 1QUKA 5CBRA 4BDOA 3OSRA 2ONRA 1ZJLA 4XKRA 5L9OA 1JNFA 1FPFA 3KGCA 4YB7A 1UTHA 1MY4A 4GXSB 3MW0A 2O84X 2XWOA 1P99A 2UVHA 1B52A 3E79A 2H25A 4G2ZA 3E3KA 2WKYA 3TKDA 4ZE8A 4GFRA 3FXRA 3KN3A 3EHTA 1Y1ZA 3W15C 2R8TA 3RGYA 3MVYA 1MY1A 4Q30B 4FBPA 3VV5A 1XOCA 1XC1A 1FRPA 5ET5A 2HEUA 3ROJA 5L9MA 3K02A 3S2VA 3RPLB 5I3SA 4F19A 4MAGA 3MBPA 3H7MA 4G8NA 1NNTA 2RINA 2I0BA 4ESXA 5JTYA 3RTFB 3PUZE 3MZ1A 2XD2A 3Q25A 1SYHA 2WYKA 2Y7PA 3OO6A 1Y4CA 5IKBA 1QUIA 4MEVA 2X26A 2ZNSA 1XHYA 4LZ7A 2I3VA 1MQJA 3K1PA 1NI9A 4BDRA 5IGAA 5H8HB 2I49A 4OHNA 3O2AA 4OENA 5JEIA 3OOAA 3E4RA 4JWOA 4WKMA 2ONKE 3TQLA 2D3IA 3CG1A 2XWVA 2E1SA 4KXPA 3HCQA 1GR2A 2UYFA 3LSXA 3PPQA 2Z23A 3RYDA 1PEBA 3MZBA 2D21A 3MVWA 4I8CA 2XXTA 1QULA 3K01A 3B7DA 5A5XB 4FIMA 4HCYA 4H5GA 3U72A 3VLWA 4U23A 4N6PA 1P1UA 2RKMA 4GD5A 4EUOA 1IZ1A 1ZBMA 3MUQA 3S9EA 1FPKA 1LBWA 2DQVA 5I57A 1TFDA 2PFYA 4XKQA 3FGSA 4R2FA 3HHFA 4KCDA 1B9JA 1AL3A 2H99A 3LSFB 1ZMGA 2A5TA 1USYH 3LBSA 1POY1 3C36A 3OMBA 1DPPA 3TZAA 3PMWA 1M5FA 4G77A 4U4SA 3PGFA 4YMAA 2I58A 4LATA 1NNFA 2FHYA 3SDFA 4YICA 1IMBA 4R6YA 3IOTA 4U22A 4LA9A 5EQ8A 1Y3NA 4BDMA 1A99A 3G3JA 4FJPA 4R75A 1PDAA 4IO3A 4QSDA 2MKZA 2F35A 2PMSA 4F3BA 3IO4A 1JQFA 2P2AA 3QXMA 1R9QA 3IB0A 1SPIA 3USDA 4KHZE 4P56A 3G3HA 4F22A 1SQYA 3MJNA 2CEXA 5L8DA 1Y9UA 5ET7A 5ET6A 4BDQA 3V89B 4U1ZA 2Y5LA 3OELA 4XKNA 1SW1A 2VD3A 3A3UA 2HXWA 3MSTA 1MXZA 3KJTA 1YZ0A 4NF5B 4TLLB 3K0VA 4MHFA 3IR1A 1VSOA 5H8QB 1LAGE 2JJKA 4F3PA 4ECFA 2O1LA 1YXIA 3Q29A 1FSAA 4XEQA 2QSXA 1NV1A 2RC9A 1DTZA 4PAFA 5DVIA 3T9UA 1B7HA 4MBPA 4MX6A 2XX7A 1DOTA 4UACA 3PD8A 1MXWA 2KLFA 1B4ZA 4X04A 4PAKA 3V83A 1UTHB 1SW4A 3T9VA 2IEEA 3OEMA 4RPNA 1MRPA 4PFBA 2FBPA 4ELRA 1DK4A 4NX1A 1FTJA 3TODA 3C31A 3K6VA 4JVCA 2QFLA 3K00A 5FHOA 1SDXA 3L6GA 3MWBA 3T9HB 1MQHA 2DYXA 1LBBA 3KSJA 1CB6A 3IL1B 2XXKA 3VLVA 2Y7IA 3SEWA 2Q8JA 1B05A 4ELQA 1HSEA 1WDNA 5HM4B 3QMFA 1M5DA 2NVUB 5IZ3B 1D4NA 4QHQA 5DEXB 2XXVA 2F3DA 5JTYB 1NKXA 5ITOA 1N3WA 1K9YA 4L17A 1DSNA 2CZLA 4LQ5A 1Y20A 3N6UA 2PBWA 3MVZA 4MJOA 4MNIA 3LSLA 4OVPA 3PPPA 4BLAA 2PFZA 4HE0A 5H8HA 3KOTA 4QFPA 1KA1A 5A5LA 4IY5A 2VOZA 2REJA 5ICQA 3N6TA 1Q35A 3BKIB 4R9GA 3T1BA 1B3LA 4R72A 4F31B 4GWWA 2RC7A 1BIYA 3CI8A 3BBRA 4JWYA 2VP1A 3ZSFA 3JV9A 2Q89A 4XF5A 1A7LA 3K1MA 3LUYA 5IM2A 3N26A 4DCYA 4PF8A 4E0XA 5K2YA 2DVZA 2OX3A 5CI5A 3RLFE 3FZVA 1HSJA 2Z22A 4N15A 2ANJA 4LUBA 4GL8A 5I57B 5J16A 4OWDA 1QW0A 3FJGA 5HBCA 2Y5KA 1MXUA 1I6QA 4O7MA 2QS3A 2Y7WA 4JVIA 5JK4A 4ZEDA 2A5TB 1RDZA 2I0CA 4MFIA 3FXUA 3O6IA 4G4PA 4PDDA 2HCAA 1O63A 3T66A 1H76A 1CE2A 1QVSA 4FORA 1NV6A 1RKMA 3W9VA 1POTA 3TCGA 4GX3A 4NHBA 3PUWE 3QUJA 2V84A 3CSBA 3PMXA 4DDDA 1LAHE 4OFJA 1FBPA 1EU8A 5EYFA 3R6UA 2P1SA 1UTBB 2UVIA 2XA5A 1N7WA 3SERA 2QS4A 4P11A 1H45A 4OVTA 3A29A 1R6ZA 4O3BA 1H3DA 1K9ZA 3QK6A 4JSDA 1OVTA 2AL4A 4AB5A 1Z7ME 3BIGA 4R6KA 4GX6A 4OEVA 1KA0A 1NV3A 1R9LA 1EZOA 4GWSA 1XI6A 4E0WA 3VDFA 4PF6A 4KPTA 1NNKA 2B4LA 4UA8A 1JW1A 2QJEA 3ODBA 4DCXA 2THIA 2OWZA 4NEDA 3TTMA 2GFEA 5CMMA 3LUZA 2XXRA 1B3FA 3OD7A 4EXKA 4OFOA 2XX9A 4PFRA 4ISUA 4PFTA 2QS2A 3W9WA 2V93A 4PDHA 4K3FA 3IK6B 3TTKA 4NAPA 4EQ9A 3BFUA 3D4GA 3TDJA 5DYHA 3RUMA 1Y1MA 1N04A 4OFLA 4JBZA 5ELVA 1FPGA 5K2XA 1OLCA 5CMCA 1IXIA 1LCTA 5IAIA 1FW0A 3TTNA 2O68A 2CZKA 5B70A 3SESA 3M3FA 2B3BA 4PGNA 1GVCA 1FJ6A 4H5FA 4QXDA 4FAJA 4LZ8A 4P1EA 4N8GA 1FJ9A 5CMBA 4HE2A 2Q2CA 1FQDA 1EZ9A 1D3KA 1AH5A 2RF1A 1EYKA 1TXFA 2B4MA 2RCBA 5FBPA 3MPKA 5ICTA
chains in the Genus database with same CATH topology
1R1NA 4H65A 3C33A 3RT8A 3M8UA 2DP8A 1LBCA 2Z8DA 2ZXTA 5TU0A 1YCJA 5DEXA 3EHUA 1LB9A 4THIA 3LC8A 4YKJA 1GGGA 1JVXA 5F1QA 4AQ4A 1ZTYA 1B5IA 4GQOA 1JEUA 4F1YA 4RK9A 3SEXA 2B65A 4H6DA 4LVQA 2UYEA 2OZZA 5B7DA 4X9TA 3ZKKA 3R7XA 3S9NC 4GOTA 1O64A 1PB8A 3T96B 1NMUA 2Z8FA 2F7AA 3H06B 2ALUA 2G93A 4R2BA 2P0SA 3I3VA 4ZZEA 5L9SA 1S50A 4XXUA 1IQ7A 4C1UA 4EQ7A 3KZGA 4ZS9A 3PUVE 1LB8A 5AA2B 1NH7A 3IOVA 2HQ0A 4HW8A 3F11A 3QIMA 1N0TA 3IJXB 1B51A 2QPQA 5M2VA 1YTVA 1BP5A 4G68C 5I84A 1LFGA 4I62A 4LQ2A 4IO5A 2XD3A 4IO2A 4IB2A 3DP6A 5TPAA 2F5XA 2VHAA 4BDLA 4U2RA 3CIJA 3TTRA 4F2QA 2QL3A 2HAUA 2ZYOA 3KFMA 2PX1A 3OENA 4QFNA 2GRVA 4MH5A 2G29A 5TP9B 2ZNTA 4OZ9A 1MXYA 2YJPA 4QSCA 3QUFA 5CRYA 2I4BA 2H98A 1VFEA 2H5YA 3SEVA 4RK2A 1USYE 4OQOA 1UTBA 3FIRA 3WAFA 1EH3A 2HAVA 3FXQA 4NE4A 3MP1A 4PE5B 1QJMA 2CMOA 3GBBA 4ELOA 1SI0A 1LGBC 4F29A 4IGRA 4YKPA 4QFLA 2PYYA 2DE2A 4OESA 1UIVA 3A3CA 3B6QA 1OQHA 2DVCA 2XXQA 1FQAA 3PPNA 3TELA 3QYTA 3K1NA 3Q27A 3H3GA 4OETA 1PC3A 1Y3PA 3U94A 4C1TA 1KWHA 4RY1A 1LCFA 3K6XA 4ZECA 1P1NA 2HZKA 1US5A 2GHBA 2RC8A 4DIGA 5I58B 4PFUA 3S4UA 1MG1A 3KBRA 5DTBA 1L5TA 5F7VA 3GBAA 3MAMA 3QAXA 3HV1A 3CSGA 2D5WA 4LONB 1B2HA 1S9TA 2F6GA 1PBQA 1A55A 4X1DA 3RTWB 1MH3A 3FVNA 5CM6A 2FA7A 1MH4A 3IOWA 3JZJA 5H8NA 2ZYNA 1XS5A 3KOSA 3U93A 3FJMA 4JSOA 2DWAA 2V3UA 3FJ7A 3V8XB 2V3QA 1N84A 3FV1A 3HO7A 3B6TA 4FEDA 2O1MA 3UIFA 5AE4A 1B40A 2FNCA 5I59A 3IX1A 4ZE9A 4KQPA 4PQJA 1NFTA 5AA3A 4JB7A 3CG3A 4GLIA 1B1XA 3M3KA 4GRKA 2DWIA 5KCJA 3Q26A 2OCUA 5DT6A 1MQGA 4OYVA 1P1QA 4TQUQ 1IEJA 2ONSA 3TCFA 2OLBA 3CFLA 4F39A 4XTCQ 3RPWA 4G68B 3EHSA 4FECA 2QMXA 4F1VA 1P1OA 3G3IA 3K6WA 4QF9A 4POWA 1BLFA 4R74A 2QS1A 1MXVA 5BWJA 1MPDA 4GL0A 1RYXA 4XKPA 4H67A 3RY3A 1FQFA 3O28A 2O6AA 4U1OA 2DE3A 5AA2A 2NUVA 5EHSA 1MY2A 4Q0CA 3KN7A 3TMGA 1VR5A 1B58A 4RA1A 1FQBA 2O69A 4DZ1A 3HHGA 3B6WA 3R26A 3T22A 4IGTA 1HSLA 4X1BA 4KFQA 2X7PA 3OEKA 1SI1A 3MP6A 2XXHA 1GV8A 3FATA 4NF8B 4KD5A 4F2OA 4WEDA 3VXCA 3PPOA 5TPAB 1LFHA 2AL5A 4YMBA 2ZNUA 3MZ9A 3TPAA 4TLMB 3SETA 3H6TA 5CMKA 3IAZA 5ISUA 1MPBA 4DXBA 2BJJX 2UVJA 4GVOA 5TP9A 4R9FA 2RCAA 2DXRA 3MPLA 1FQCA 1EZPA 3MC2A 4Q5TA 4H8JA 1Y3QA 3FVKA 3OXNA 3I5OA 5H8FA 2A5SA 1B5JA 1MY3A 4YAHX 4DE8A 1NL5A 3FD3A 4I1DA 2LAOA 3WAEA 3PUXE 4N13A 3VLUA 3C32A 1MM6A 1B6HA 3CR9A 4PFWA 3THIA 4PFYA 4NMYA 3DM0A 3CVGA 3V5AA 3RQTA 1FTKA 1JW5A 4EQBA 4N07A 4P0IA 1MQDA 4R73A 3C4MA 4RXLA 1SYIA 3PV0E 4POXA 4O3AA 1S7YA 1TWYA 3IB2A 3CFXA 2XXWA 4OVJA 3HPIA 5LOMA 1QKAA 3G7WA 4ND9A 3T93B 1OMPA 3OSQA 3TYHA 4KCCA 4KYSA 3S9MC 1NNPA 4H0WA 2QMWA 5I58A 3KJ7A 3DP4A 2ABHA 4KYDA 4IO7A 1XVYA 5FHMA 2F8DA 1IIWA 3PMVA 2F7CA 4EF1A 1B0LA 5DVJA 4QRZA 4O3CA 4WEPA 1LAXA 1J1NA 5H8SA 3KSXA 1MY0A 2H4IA 1IXGA 3A09A 1Y4TA 3VE1B 5I56A 1VE4A 5H8NB 4XIGQ 4QFKA 1URDA 1Z7NE 3CRBA 3P7IA 3TAJA 3QSLA 2FYIA 1MQIA 2OWSA 1IXCA 3CFZA 2Z8EA 5I59B 2AYSA 1B0HA 1B32A 2I6EA 3GXAA 2XXPA 3H4ZA 4GWOA 3AXFA 2VD2A 1M5EA 5KDTB 2OBGA 5J1DA 4JDFA 5KCJB 2F36A 4IO6A 2GH9A 1XVXA 3C35A 4FEBA 1B7ZA 2NXOA 1FQEA 1H44A 2XHDA 3UN6A 2Y84A 1FCKA 3U1OA 4F3SA 4G68A 1ELJA 3VFJA 1DTGA 1OIBA 1T0KA 1FTOA 3S9LC 4LZ5A 4OERA 3IJOB 3EN3A 4F18A 4MF3A 1JETA 2PT1A 1JVYA 1F9BA 4YKIA 4ZEKA 4ZDMA 3ECRA 4FE8A 1FTLA 2IA4A 3IOUA 3TUSA 1B3GA 3K6UA 4HTGA 1DPEA 4MLQA 1B1HA 4NTLA 1OLAA 5I2NA 4NF8A 1O7TA 3GLBA 1PB9A 3MVXA 4I9DA 1D9YA 1N7XA 3KN8A 3ZS6A 4TOZA 4EDPA 1IITA 4QSEA 2OK2A 4MLVA 1MM7A 4GIZA 3FVOA 5CBSA 2GHAA 4NF4B 3L6HA 2R9JA 1LLSA 1QUJA 3H6WA 1B5HA 2ZYKA 3O97A 5FTIA 1IXHA 4U4XA 4JWXA 4R6HA 4BDNA 5H8FB 1ZKBA 4P0GA 3HN0A 3C9HA 5AA4A 1I6BA 2ESNA 3FASA 2QRYA 2REGA 2DWHA 4YU0A 3TTLA 3UA8A 3O6HA 4GXAA 4RNSA 1ANFA 2I48A 3FVGA 3H03A 4G8MA 1MDP1 1ATGA 4NF6B 5AA2D 1JW4A 3LR1A 1URGA 2Y7RA 2XX8A 4H8IA 3MP8A 3H6UA 4M1VA 1ZU0A 1PB7A 2M8CA 3O66A 5I2KA 1TFAA 5EHMA 5AA1A 4ZEFA 4JXIA 2W7YA 4ESWA 1UQWA 3G3FA 1H43A 1LAFE 4PP0A 3KEIA 1A40A 4FATA 1B3EA 3Q28A 2DSFA 1A54A 2I3WA 3VVDA 4YKKA 2X7QA 2DE4A 2DS9A 2YPNA 3K4UA 4IO4A 1M5CA 3GZGA 1WVJA 2B3FA 4F1UA 4RYAA 2ZYMA 5I56B 1ZIUA 2Q2AA 5HPQA 1AMFA 3UORA 3DLNA 1MDQA 1GTKA 3C34A 4X48A 4YB5A 1MS7A 4OEUA 2F6PA 3N5LA 2DXYA 4ELPA 3TEPA 3IO6A 2V25A 2F97A 1B46A 2DOJA 1ZLQA 4KR5A 3PU5A 3SEYA 4H1XA 1WODA 4EF2A 2E0SA 1UIUA 2PT2A 5KDTA 2F7BA 4DXUA 1P1WA 4HCWA 4IY6A 4ZEIA 3ONMA 4PETA 4NWDA 4OTEA 2HFBA 4OMBA 1YAEA 1SW2A 3UGWA 3U92A 4F3GA 3FV2A 4Q8RA 3D4CA 2VGQA 1MPCA 4YZZA 4G8HA 1A8FA 1A8EA 3EQ1A 2Q88A 2R6GE 2R71A 3TCHA 1FTMA 2OJTA 1VFDA 3TFLA 3G3KA 3T9XB 4RJZA 4ZZAA 1XT8A 4U21A 3FUZA 3G3GA 4AB6A 1SBPA 5FTHA 3O6GA 4YB6A 3LSWA 1SW5A 3MQ9A 2NWJA 1BTJA 2YLNA 2I4CA 4ONYA 3M3LA 3RN8A 2V3TA 3ILTB 3VXBA 5I2NB 2UVGA 3UK4A 1LSTA 2Y7KA 1M5BA 5A5XA 2XXUA 2XXIA 3BFTA 1RYOA 2O51A 3SKPA 3EPEA 3RT6B 1I69A 4Z0IA 3K2DA 1MXXA 3N94A 3O9PA 3UP9A 2ZMBA 3ILUB 1B4HA 1DMBA 1IUDA 4NF4A 1SVXB 2NOOA 2XXYA 1D9VA 4Z7EA 1AOVA 3EF7A 5ITPA 1URSA 3PD9A 2F34A 3IB1A 2AIXA 3KG2A 4GF8A 1OVBA 2O7UA 2UXAA 1B3HA 4KYEA 3PUYE 2XXXA 1JEVA 1US4A 5AA4B 3SEUA 1OQGA 4KI0E 1AIVA 4LP2B 5KZTA 3U8QA 4C0RA 3IORA 3OO8A 1I6AA 5DVFA 1BKAA 2PVUA 2HZLA 3DELB 3RNNA 4HS7A 3O29A 4NF6A 1YPNA 3OO9A 5BUUA 3DP8A 1N3XA 3I6VA 4DXCA 1PBPA 3H6VA 5CC2A 2H9BA 2Q9TA 2OWTA 1QKBA 1SD3A 4EXLA 4QFOA 2F78A 5FHNA 3TQWA 5I2KB 1II5A 4ZEBA 1LFIA 4OXVA 3VVEA 1N76A 3E9XA 4RPOA 4WXJA 1Q1KA 1TT1A 4NWCA 1NH8A 2O7IA 1B7UA 4NF5A 3PPRA 3E13X 4M4GA 5H8QA 3OO7A 3JYRA 2DWJA 4DLDA 3HSTA 3VVFA 3ZKLA 1QUKA 5CBRA 4BDOA 3OSRA 2ONRA 1ZJLA 4XKRA 5L9OA 1JNFA 3KGCA 4YB7A 1UTHA 1MY4A 4GXSB 3MW0A 2O84X 1P99A 2UVHA 1B52A 2H25A 4G2ZA 3E3KA 2WKYA 3TKDA 4ZE8A 4GFRA 3FXRA 3KN3A 3EHTA 1Y1ZA 3W15C 3RGYA 3MVYA 1MY1A 4Q30B 3VV5A 1XOCA 1XC1A 2HEUA 5L9MA 3K02A 3S2VA 4F19A 3MBPA 3H7MA 4G8NA 1NNTA 2RINA 2I0BA 4ESXA 5JTYA 3RTFB 3PUZE 3MZ1A 2XD2A 3Q25A 1SYHA 2Y7PA 3OO6A 1Y4CA 5IKBA 1QUIA 2X26A 2ZNSA 1XHYA 4LZ7A 2I3VA 1MQJA 3K1PA 4BDRA 5H8HB 2I49A 4OHNA 3O2AA 4OENA 5JEIA 3OOAA 3E4RA 4JWOA 4WKMA 2ONKE 3TQLA 2D3IA 3CG1A 2E1SA 3HCQA 1GR2A 2UYFA 3LSXA 3PPQA 2Z23A 1PEBA 3MZBA 2D21A 3MVWA 4I8CA 2XXTA 1QULA 3K01A 3B7DA 5A5XB 4FIMA 4HCYA 4H5GA 3U72A 3VLWA 4U23A 4N6PA 1P1UA 2RKMA 4GD5A 4EUOA 1IZ1A 1ZBMA 3MUQA 3S9EA 2DQVA 5I57A 1TFDA 4XKQA 3FGSA 4R2FA 3HHFA 4KCDA 1B9JA 1AL3A 2H99A 3LSFB 1ZMGA 2A5TA 1USYH 3LBSA 1POY1 3C36A 3OMBA 1DPPA 3TZAA 3PMWA 1M5FA 4G77A 4U4SA 3PGFA 4YMAA 2I58A 4LATA 1NNFA 3SDFA 4YICA 4R6YA 3IOTA 4U22A 4LA9A 1Y3NA 4BDMA 1A99A 3G3JA 4FJPA 4R75A 1PDAA 4IO3A 4QSDA 2F35A 2PMSA 4F3BA 3IO4A 1JQFA 2P2AA 3QXMA 1R9QA 3IB0A 3USDA 4KHZE 3G3HA 4F22A 1SQYA 3MJNA 5L8DA 1Y9UA 4BDQA 3V89B 4U1ZA 3OELA 4XKNA 1SW1A 2VD3A 3A3UA 2HXWA 1MXZA 3KJTA 4NF5B 4TLLB 3K0VA 3IR1A 1VSOA 5H8QB 1LAGE 4F3PA 4ECFA 2O1LA 3Q29A 2QSXA 2RC9A 1DTZA 5DVIA 3T9UA 1B7HA 4MBPA 2XX7A 1DOTA 4UACA 3PD8A 1MXWA 2KLFA 1B4ZA 3V83A 1UTHB 1SW4A 3T9VA 2IEEA 3OEMA 4RPNA 1MRPA 4ELRA 1FTJA 3TODA 3C31A 3K6VA 3K00A 5FHOA 1SDXA 3L6GA 3MWBA 3T9HB 1MQHA 2DYXA 1LBBA 3KSJA 1CB6A 3IL1B 3VLVA 2Y7IA 3SEWA 2Q8JA 1B05A 4ELQA 1HSEA 1WDNA 5HM4B 1M5DA 2NVUB 1D4NA 4QHQA 5DEXB 2XXVA 5JTYB 1NKXA 5ITOA 1N3WA 4L17A 1DSNA 2CZLA 4LQ5A 1Y20A 3N6UA 2PBWA 3MVZA 3LSLA 3PPPA 4BLAA 5H8HA 3KOTA 4QFPA 4IY5A 2VOZA 2REJA 5ICQA 3N6TA 1Q35A 3BKIB 4R9GA 1B3LA 4R72A 4F31B 2RC7A 1BIYA 3CI8A 3BBRA 4JWYA 2VP1A 3ZSFA 3JV9A 2Q89A 1A7LA 3K1MA 3LUYA 3N26A 4DCYA 4E0XA 5K2YA 2DVZA 5CI5A 3RLFE 3FZVA 1HSJA 2Z22A 2ANJA 4LUBA 4GL8A 5I57B 4OWDA 1QW0A 3FJGA 5HBCA 1MXUA 1I6QA 2QS3A 2Y7WA 5JK4A 4ZEDA 2A5TB 2I0CA 4MFIA 3FXUA 3O6IA 4G4PA 2HCAA 1O63A 3T66A 1H76A 1CE2A 1QVSA 4FORA 3W9VA 1RKMA 1POTA 3TCGA 3PUWE 3QUJA 2V84A 3CSBA 3PMXA 4DDDA 1LAHE 4OFJA 1EU8A 5EYFA 3R6UA 2P1SA 1UTBB 2UVIA 1N7WA 3SERA 2QS4A 4P11A 1H45A 1R6ZA 4O3BA 1H3DA 4JSDA 3QK6A 1OVTA 2AL4A 4AB5A 1Z7ME 4R6KA 4OEVA 1R9LA 1EZOA 4E0WA 3VDFA 4KPTA 1NNKA 4UA8A 1JW1A 2QJEA 3ODBA 4DCXA 2THIA 4NEDA 3TTMA 2GFEA 5CMMA 2XXRA 1B3FA 3OD7A 4EXKA 4OFOA 2XX9A 4ISUA 4PFTA 2QS2A 3W9WA 2V93A 4K3FA 3IK6B 3TTKA 4EQ9A 3BFUA 3D4GA 3TDJA 5DYHA 3RUMA 1Y1MA 1N04A 4OFLA 4JBZA 5ELVA 5K2XA 1OLCA 5CMCA 1IXIA 1LCTA 5IAIA 1FW0A 3TTNA 2O68A 5B70A 3SESA 3M3FA 2B3BA 1GVCA 4H5FA 4FAJA 4LZ8A 5CMBA 2Q2CA 1FQDA 1EZ9A 1D3KA 1AH5A 2RF1A 1TXFA 2RCBA 3MPKA 5ICTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1N A;  4H65 A;  3C33 A;  3RT8 A;  3M8U A;  2DP8 A;  1LBC A;  2Z8D A;  2ZXT A;  5TU0 A;  1YCJ A;  5DEX A;  3EHU A;  1LB9 A;  4THI A;  3LC8 A;  4YKJ A;  1GGG A;  1JVX A;  5F1Q A;  4AQ4 A;  1ZTY A;  1B5I A;  4GQO A;  1JEU A;  4F1Y A;  4RK9 A;  3SEX A;  2B65 A;  4H6D A;  4LVQ A;  2UYE A;  2OZZ A;  5B7D A;  4X9T A;  3ZKK A;  3R7X A;  3S9N C;  4GOT A;  1O64 A;  1PB8 A;  3T96 B;  1NMU A;  2Z8F A;  2F7A A;  3H06 B;  2ALU A;  2G93 A;  4R2B A;  2P0S A;  3I3V A;  4ZZE A;  5L9S A;  1S50 A;  4XXU A;  1IQ7 A;  4C1U A;  4EQ7 A;  3KZG A;  4ZS9 A;  3PUV E;  1LB8 A;  5AA2 B;  1NH7 A;  3IOV A;  2HQ0 A;  4HW8 A;  3F11 A;  3QIM A;  1N0T A;  3IJX B;  1B51 A;  2QPQ A;  5M2V A;  1YTV A;  1BP5 A;  4G68 C;  5I84 A;  1LFG A;  4I62 A;  4LQ2 A;  4IO5 A;  2XD3 A;  4IO2 A;  4IB2 A;  3DP6 A;  5TPA A;  2F5X A;  2VHA A;  4BDL A;  4U2R A;  3CIJ A;  3TTR A;  4F2Q A;  2QL3 A;  2HAU A;  2ZYO A;  3KFM A;  2PX1 A;  3OEN A;  4QFN A;  2GRV A;  4MH5 A;  2G29 A;  5TP9 B;  2ZNT A;  4OZ9 A;  1MXY A;  2YJP A;  4QSC A;  3QUF A;  5CRY A;  2I4B A;  2H98 A;  1VFE A;  2H5Y A;  3SEV A;  4RK2 A;  1USY E;  4OQO A;  1UTB A;  3FIR A;  3WAF A;  1EH3 A;  2HAV A;  3FXQ A;  4NE4 A;  3MP1 A;  4PE5 B;  1QJM A;  2CMO A;  3GBB A;  4ELO A;  1SI0 A;  1LGB C;  4F29 A;  4IGR A;  4YKP A;  4QFL A;  2PYY A;  2DE2 A;  4OES A;  1UIV A;  3A3C A;  3B6Q A;  1OQH A;  2DVC A;  2XXQ A;  1FQA A;  3PPN A;  3TEL A;  3QYT A;  3K1N A;  3Q27 A;  3H3G A;  4OET A;  1PC3 A;  1Y3P A;  3U94 A;  4C1T A;  1KWH A;  4RY1 A;  1LCF A;  3K6X A;  4ZEC A;  1P1N A;  2HZK A;  1US5 A;  2GHB A;  2RC8 A;  4DIG A;  5I58 B;  4PFU A;  3S4U A;  1MG1 A;  3KBR A;  5DTB A;  1L5T A;  5F7V A;  3GBA A;  3MAM A;  3QAX A;  3HV1 A;  3CSG A;  2D5W A;  4LON B;  1B2H A;  1S9T A;  2F6G A;  1PBQ A;  1A55 A;  4X1D A;  3RTW B;  1MH3 A;  3FVN A;  5CM6 A;  2FA7 A;  1MH4 A;  3IOW A;  3JZJ A;  5H8N A;  2ZYN A;  1XS5 A;  3KOS A;  3U93 A;  3FJM A;  4JSO A;  2DWA A;  2V3U A;  3FJ7 A;  3V8X B;  2V3Q A;  1N84 A;  3FV1 A;  3HO7 A;  3B6T A;  4FED A;  2O1M A;  3UIF A;  5AE4 A;  1B40 A;  2FNC A;  5I59 A;  3IX1 A;  4ZE9 A;  4KQP A;  4PQJ A;  1NFT A;  5AA3 A;  4JB7 A;  3CG3 A;  4GLI A;  1B1X A;  3M3K A;  4GRK A;  2DWI A;  5KCJ A;  3Q26 A;  2OCU A;  5DT6 A;  1MQG A;  4OYV A;  1P1Q A;  4TQU Q;  1IEJ A;  2ONS A;  3TCF A;  2OLB A;  3CFL A;  4F39 A;  4XTC Q;  3RPW A;  4G68 B;  3EHS A;  4FEC A;  2QMX A;  4F1V A;  1P1O A;  3G3I A;  3K6W A;  4QF9 A;  4POW A;  1BLF A;  4R74 A;  2QS1 A;  1MXV A;  5BWJ A;  1MPD A;  4GL0 A;  1RYX A;  4XKP A;  4H67 A;  3RY3 A;  1FQF A;  3O28 A;  2O6A A;  4U1O A;  2DE3 A;  5AA2 A;  2NUV A;  5EHS A;  1MY2 A;  4Q0C A;  3KN7 A;  3TMG A;  1VR5 A;  1B58 A;  4RA1 A;  1FQB A;  2O69 A;  4DZ1 A;  3HHG A;  3B6W A;  3R26 A;  3T22 A;  4IGT A;  1HSL A;  4X1B A;  4KFQ A;  2X7P A;  3OEK A;  1SI1 A;  3MP6 A;  2XXH A;  1GV8 A;  3FAT A;  4NF8 B;  4KD5 A;  4F2O A;  4WED A;  3VXC A;  3PPO A;  5TPA B;  1LFH A;  2AL5 A;  4YMB A;  2ZNU A;  3MZ9 A;  3TPA A;  4TLM B;  3SET A;  3H6T A;  5CMK A;  3IAZ A;  5ISU A;  1MPB A;  4DXB A;  2BJJ X;  2UVJ A;  4GVO A;  5TP9 A;  4R9F A;  2RCA A;  2DXR A;  3MPL A;  1FQC A;  1EZP A;  3MC2 A;  4Q5T A;  4H8J A;  1Y3Q A;  3FVK A;  3OXN A;  3I5O A;  5H8F A;  2A5S A;  1B5J A;  1MY3 A;  4YAH X;  4DE8 A;  1NL5 A;  3FD3 A;  4I1D A;  2LAO A;  3WAE A;  3PUX E;  4N13 A;  3VLU A;  3C32 A;  1MM6 A;  1B6H A;  3CR9 A;  4PFW A;  3THI A;  4PFY A;  4NMY A;  3DM0 A;  3CVG A;  3V5A A;  3RQT A;  1FTK A;  1JW5 A;  4EQB A;  4N07 A;  4P0I A;  1MQD A;  4R73 A;  3C4M A;  4RXL A;  1SYI A;  3PV0 E;  4POX A;  4O3A A;  1S7Y A;  1TWY A;  3IB2 A;  3CFX A;  2XXW A;  4OVJ A;  3HPI A;  5LOM A;  1QKA A;  3G7W A;  4ND9 A;  3T93 B;  1OMP A;  3OSQ A;  3TYH A;  4KCC A;  4KYS A;  3S9M C;  1NNP A;  4H0W A;  2QMW A;  5I58 A;  3KJ7 A;  3DP4 A;  2ABH A;  4KYD A;  4IO7 A;  1XVY A;  5FHM A;  2F8D A;  1IIW A;  3PMV A;  2F7C A;  4EF1 A;  1B0L A;  5DVJ A;  4QRZ A;  4O3C A;  4WEP A;  1LAX A;  1J1N A;  5H8S A;  3KSX A;  1MY0 A;  2H4I A;  1IXG A;  3A09 A;  1Y4T A;  3VE1 B;  5I56 A;  1VE4 A;  5H8N B;  4XIG Q;  4QFK A;  1URD A;  1Z7N E;  3CRB A;  3P7I A;  3TAJ A;  3QSL A;  2FYI A;  1MQI A;  2OWS A;  1IXC A;  3CFZ A;  2Z8E A;  5I59 B;  2AYS A;  1B0H A;  1B32 A;  2I6E A;  3GXA A;  2XXP A;  3H4Z A;  4GWO A;  3AXF A;  2VD2 A;  1M5E A;  5KDT B;  2OBG A;  5J1D A;  4JDF A;  5KCJ B;  2F36 A;  4IO6 A;  2GH9 A;  1XVX A;  3C35 A;  4FEB A;  1B7Z A;  2NXO A;  1FQE A;  1H44 A;  2XHD A;  3UN6 A;  2Y84 A;  1FCK A;  3U1O A;  4F3S A;  4G68 A;  1ELJ A;  3VFJ A;  1DTG A;  1OIB A;  1T0K A;  1FTO A;  3S9L C;  4LZ5 A;  4OER A;  3IJO B;  3EN3 A;  4F18 A;  4MF3 A;  1JET A;  2PT1 A;  1JVY A;  1F9B A;  4YKI A;  4ZEK A;  4ZDM A;  3ECR A;  4FE8 A;  1FTL A;  2IA4 A;  3IOU A;  3TUS A;  1B3G A;  3K6U A;  4HTG A;  1DPE A;  4MLQ A;  1B1H A;  4NTL A;  1OLA A;  5I2N A;  4NF8 A;  1O7T A;  3GLB A;  1PB9 A;  3MVX A;  4I9D A;  1D9Y A;  1N7X A;  3KN8 A;  3ZS6 A;  4TOZ A;  4EDP A;  1IIT A;  4QSE A;  2OK2 A;  4MLV A;  1MM7 A;  4GIZ A;  3FVO A;  5CBS A;  2GHA A;  4NF4 B;  3L6H A;  2R9J A;  1LLS A;  1QUJ A;  3H6W A;  1B5H A;  2ZYK A;  3O97 A;  5FTI A;  1IXH A;  4U4X A;  4JWX A;  4R6H A;  4BDN A;  5H8F B;  1ZKB A;  4P0G A;  3HN0 A;  3C9H A;  5AA4 A;  1I6B A;  2ESN A;  3FAS A;  2QRY A;  2REG A;  2DWH A;  4YU0 A;  3TTL A;  3UA8 A;  3O6H A;  4GXA A;  4RNS A;  1ANF A;  2I48 A;  3FVG A;  3H03 A;  4G8M A;  1MDP 1;  1ATG A;  4NF6 B;  5AA2 D;  1JW4 A;  3LR1 A;  1URG A;  2Y7R A;  2XX8 A;  4H8I A;  3MP8 A;  3H6U A;  4M1V A;  1ZU0 A;  1PB7 A;  2M8C A;  3O66 A;  5I2K A;  1TFA A;  5EHM A;  5AA1 A;  4ZEF A;  4JXI A;  2W7Y A;  4ESW A;  1UQW A;  3G3F A;  1H43 A;  1LAF E;  4PP0 A;  3KEI A;  1A40 A;  4FAT A;  1B3E A;  3Q28 A;  2DSF A;  1A54 A;  2I3W A;  3VVD A;  4YKK A;  2X7Q A;  2DE4 A;  2DS9 A;  2YPN A;  3K4U A;  4IO4 A;  1M5C A;  3GZG A;  1WVJ A;  2B3F A;  4F1U A;  4RYA A;  2ZYM A;  5I56 B;  1ZIU A;  2Q2A A;  5HPQ A;  1AMF A;  3UOR A;  3DLN A;  1MDQ A;  1GTK A;  3C34 A;  4X48 A;  4YB5 A;  1MS7 A;  4OEU A;  2F6P A;  3N5L A;  2DXY A;  4ELP A;  3TEP A;  3IO6 A;  2V25 A;  2F97 A;  1B46 A;  2DOJ A;  1ZLQ A;  4KR5 A;  3PU5 A;  3SEY A;  4H1X A;  1WOD A;  4EF2 A;  2E0S A;  1UIU A;  2PT2 A;  5KDT A;  2F7B A;  4DXU A;  1P1W A;  4HCW A;  4IY6 A;  4ZEI A;  3ONM A;  4PET A;  4NWD A;  4OTE A;  2HFB A;  4OMB A;  1YAE A;  1SW2 A;  3UGW A;  3U92 A;  4F3G A;  3FV2 A;  4Q8R A;  3D4C A;  2VGQ A;  1MPC A;  4YZZ A;  4G8H A;  1A8F A;  1A8E A;  3EQ1 A;  2Q88 A;  2R6G E;  2R71 A;  3TCH A;  1FTM A;  2OJT A;  1VFD A;  3TFL A;  3G3K A;  3T9X B;  4RJZ A;  4ZZA A;  1XT8 A;  4U21 A;  3FUZ A;  3G3G A;  4AB6 A;  1SBP A;  5FTH A;  3O6G A;  4YB6 A;  3LSW A;  1SW5 A;  3MQ9 A;  2NWJ A;  1BTJ A;  2YLN A;  2I4C A;  4ONY A;  3M3L A;  3RN8 A;  2V3T A;  3ILT B;  3VXB A;  5I2N B;  2UVG A;  3UK4 A;  1LST A;  2Y7K A;  1M5B A;  5A5X A;  2XXU A;  2XXI A;  3BFT A;  1RYO A;  2O51 A;  3SKP A;  3EPE A;  3RT6 B;  1I69 A;  4Z0I A;  3K2D A;  1MXX A;  3N94 A;  3O9P A;  3UP9 A;  2ZMB A;  3ILU B;  1B4H A;  1DMB A;  1IUD A;  4NF4 A;  1SVX B;  2NOO A;  2XXY A;  1D9V A;  4Z7E A;  1AOV A;  3EF7 A;  5ITP A;  1URS A;  3PD9 A;  2F34 A;  3IB1 A;  2AIX A;  3KG2 A;  4GF8 A;  1OVB A;  2O7U A;  2UXA A;  1B3H A;  4KYE A;  3PUY E;  2XXX A;  1JEV A;  1US4 A;  5AA4 B;  3SEU A;  1OQG A;  4KI0 E;  1AIV A;  4LP2 B;  5KZT A;  3U8Q A;  4C0R A;  3IOR A;  3OO8 A;  1I6A A;  5DVF A;  1BKA A;  2PVU A;  2HZL A;  3DEL B;  3RNN A;  4HS7 A;  3O29 A;  4NF6 A;  1YPN A;  3OO9 A;  5BUU A;  3DP8 A;  1N3X A;  3I6V A;  4DXC A;  1PBP A;  3H6V A;  5CC2 A;  2H9B A;  2Q9T A;  2OWT A;  1QKB A;  1SD3 A;  4EXL A;  4QFO A;  2F78 A;  5FHN A;  3TQW A;  5I2K B;  1II5 A;  4ZEB A;  1LFI A;  4OXV A;  3VVE A;  1N76 A;  3E9X A;  4RPO A;  4WXJ A;  1Q1K A;  1TT1 A;  4NWC A;  1NH8 A;  2O7I A;  1B7U A;  4NF5 A;  3PPR A;  3E13 X;  4M4G A;  5H8Q A;  3OO7 A;  3JYR A;  2DWJ A;  4DLD A;  3HST A;  3VVF A;  3ZKL A;  1QUK A;  5CBR A;  4BDO A;  3OSR A;  2ONR A;  1ZJL A;  4XKR A;  5L9O A;  1JNF A;  3KGC A;  4YB7 A;  1UTH A;  1MY4 A;  4GXS B;  3MW0 A;  2O84 X;  1P99 A;  2UVH A;  1B52 A;  2H25 A;  4G2Z A;  3E3K A;  2WKY A;  3TKD A;  4ZE8 A;  4GFR A;  3FXR A;  3KN3 A;  3EHT A;  1Y1Z A;  3W15 C;  3RGY A;  3MVY A;  1MY1 A;  4Q30 B;  3VV5 A;  1XOC A;  1XC1 A;  2HEU A;  5L9M A;  3K02 A;  3S2V A;  4F19 A;  3MBP A;  3H7M A;  4G8N A;  1NNT A;  2RIN A;  2I0B A;  4ESX A;  5JTY A;  3RTF B;  3PUZ E;  3MZ1 A;  2XD2 A;  3Q25 A;  1SYH A;  2Y7P A;  3OO6 A;  1Y4C A;  5IKB A;  1QUI A;  2X26 A;  2ZNS A;  1XHY A;  4LZ7 A;  2I3V A;  1MQJ A;  3K1P A;  4BDR A;  5H8H B;  2I49 A;  4OHN A;  3O2A A;  4OEN A;  5JEI A;  3OOA A;  3E4R A;  4JWO A;  4WKM A;  2ONK E;  3TQL A;  2D3I A;  3CG1 A;  2E1S A;  3HCQ A;  1GR2 A;  2UYF A;  3LSX A;  3PPQ A;  2Z23 A;  1PEB A;  3MZB A;  2D21 A;  3MVW A;  4I8C A;  2XXT A;  1QUL A;  3K01 A;  3B7D A;  5A5X B;  4FIM A;  4HCY A;  4H5G A;  3U72 A;  3VLW A;  4U23 A;  4N6P A;  1P1U A;  2RKM A;  4GD5 A;  4EUO A;  1IZ1 A;  1ZBM A;  3MUQ A;  3S9E A;  2DQV A;  5I57 A;  1TFD A;  4XKQ A;  3FGS A;  4R2F A;  3HHF A;  4KCD A;  1B9J A;  1AL3 A;  2H99 A;  3LSF B;  1ZMG A;  2A5T A;  1USY H;  3LBS A;  1POY 1;  3C36 A;  3OMB A;  1DPP A;  3TZA A;  3PMW A;  1M5F A;  4G77 A;  4U4S A;  3PGF A;  4YMA A;  2I58 A;  4LAT A;  1NNF A;  3SDF A;  4YIC A;  4R6Y A;  3IOT A;  4U22 A;  4LA9 A;  1Y3N A;  4BDM A;  1A99 A;  3G3J A;  4FJP A;  4R75 A;  1PDA A;  4IO3 A;  4QSD A;  2F35 A;  2PMS A;  4F3B A;  3IO4 A;  1JQF A;  2P2A A;  3QXM A;  1R9Q A;  3IB0 A;  3USD A;  4KHZ E;  3G3H A;  4F22 A;  1SQY A;  3MJN A;  5L8D A;  1Y9U A;  4BDQ A;  3V89 B;  4U1Z A;  3OEL A;  4XKN A;  1SW1 A;  2VD3 A;  3A3U A;  2HXW A;  1MXZ A;  3KJT A;  4NF5 B;  4TLL B;  3K0V A;  3IR1 A;  1VSO A;  5H8Q B;  1LAG E;  4F3P A;  4ECF A;  2O1L A;  3Q29 A;  2QSX A;  2RC9 A;  1DTZ A;  5DVI A;  3T9U A;  1B7H A;  4MBP A;  2XX7 A;  1DOT A;  4UAC A;  3PD8 A;  1MXW A;  2KLF A;  1B4Z A;  3V83 A;  1UTH B;  1SW4 A;  3T9V A;  2IEE A;  3OEM A;  4RPN A;  1MRP A;  4ELR A;  1FTJ A;  3TOD A;  3C31 A;  3K6V A;  3K00 A;  5FHO A;  1SDX A;  3L6G A;  3MWB A;  3T9H B;  1MQH A;  2DYX A;  1LBB A;  3KSJ A;  1CB6 A;  3IL1 B;  3VLV A;  2Y7I A;  3SEW A;  2Q8J A;  1B05 A;  4ELQ A;  1HSE A;  1WDN A;  5HM4 B;  1M5D A;  2NVU B;  1D4N A;  4QHQ A;  5DEX B;  2XXV A;  5JTY B;  1NKX A;  5ITO A;  1N3W A;  4L17 A;  1DSN A;  2CZL A;  4LQ5 A;  1Y20 A;  3N6U A;  2PBW A;  3MVZ A;  3LSL A;  3PPP A;  4BLA A;  5H8H A;  3KOT A;  4QFP A;  4IY5 A;  2VOZ A;  2REJ A;  5ICQ A;  3N6T A;  1Q35 A;  3BKI B;  4R9G A;  1B3L A;  4R72 A;  4F31 B;  2RC7 A;  1BIY A;  3CI8 A;  3BBR A;  4JWY A;  2VP1 A;  3ZSF A;  3JV9 A;  2Q89 A;  1A7L A;  3K1M A;  3LUY A;  3N26 A;  4DCY A;  4E0X A;  5K2Y A;  2DVZ A;  5CI5 A;  3RLF E;  3FZV A;  1HSJ A;  2Z22 A;  2ANJ A;  4LUB A;  4GL8 A;  5I57 B;  4OWD A;  1QW0 A;  3FJG A;  5HBC A;  1MXU A;  1I6Q A;  2QS3 A;  2Y7W A;  5JK4 A;  4ZED A;  2A5T B;  2I0C A;  4MFI A;  3FXU A;  3O6I A;  4G4P A;  2HCA A;  1O63 A;  3T66 A;  1H76 A;  1CE2 A;  1QVS A;  4FOR A;  3W9V A;  1RKM A;  1POT A;  3TCG A;  3PUW E;  3QUJ A;  2V84 A;  3CSB A;  3PMX A;  4DDD A;  1LAH E;  4OFJ A;  1EU8 A;  5EYF A;  3R6U A;  2P1S A;  1UTB B;  2UVI A;  1N7W A;  3SER A;  2QS4 A;  4P11 A;  1H45 A;  1R6Z A;  4O3B A;  1H3D A;  4JSD A;  3QK6 A;  1OVT A;  2AL4 A;  4AB5 A;  1Z7M E;  4R6K A;  4OEV A;  1R9L A;  1EZO A;  4E0W A;  3VDF A;  4KPT A;  1NNK A;  4UA8 A;  1JW1 A;  2QJE A;  3ODB A;  4DCX A;  2THI A;  4NED A;  3TTM A;  2GFE A;  5CMM A;  2XXR A;  1B3F A;  3OD7 A;  4EXK A;  4OFO A;  2XX9 A;  4ISU A;  4PFT A;  2QS2 A;  3W9W A;  2V93 A;  4K3F A;  3IK6 B;  3TTK A;  4EQ9 A;  3BFU A;  3D4G A;  3TDJ A;  5DYH A;  3RUM A;  1Y1M A;  1N04 A;  4OFL A;  4JBZ A;  5ELV A;  5K2X A;  1OLC A;  5CMC A;  1IXI A;  1LCT A;  5IAI A;  1FW0 A;  3TTN A;  2O68 A;  5B70 A;  3SES A;  3M3F A;  2B3B A;  1GVC A;  4H5F A;  4FAJ A;  4LZ8 A;  5CMB A;  2Q2C A;  1FQD A;  1EZ9 A;  1D3K A;  1AH5 A;  2RF1 A;  1TXF A;  2RCB A;  3MPK A;  5ICT A; 
#chains in the Genus database with same CATH topology
 1R1N A;  4H65 A;  2FIE A;  4HE1 A;  3C33 A;  4O7I A;  3RT8 A;  3M8U A;  2DP8 A;  1LBC A;  2Z8D A;  1RDY A;  2ZXT A;  5TU0 A;  5IZ3 A;  1Q9D A;  1YCJ A;  5DEX A;  3EHU A;  2QVU A;  5EYG A;  1LB9 A;  4THI A;  3LC8 A;  4YKJ A;  4PFI A;  1GGG A;  1JVX A;  5F1Q A;  1FBE A;  4AQ4 A;  4OA4 A;  1ZTY A;  2L5V A;  1B5I A;  4GQO A;  1JEU A;  4F1Y A;  4RK9 A;  3SEX A;  2B65 A;  4H6D A;  4LVQ A;  2UYE A;  2OZZ A;  5B7D A;  4X9T A;  3ZKK A;  3R7X A;  3S9N C;  5LDZ A;  4GOT A;  1O64 A;  1PB8 A;  3T96 B;  1NMU A;  2Z8F A;  2F7A A;  3H06 B;  2ALU A;  2G93 A;  4R2B A;  2P0S A;  3I3V A;  4ZZE A;  5L9S A;  1S50 A;  4XXU A;  1IQ7 A;  4C1U A;  4EQ7 A;  3KZG A;  4ZS9 A;  1NUW A;  3PUV E;  4OVQ A;  1LB8 A;  2ZZX A;  5AA2 B;  1NH7 A;  3IOV A;  2HQ0 A;  4HW8 A;  3F11 A;  3QIM A;  1N0T A;  1VDW A;  3IJX B;  1B51 A;  2QPQ A;  5M2V A;  4NG7 A;  1YTV A;  1BP5 A;  2QVV A;  4PBQ A;  4G68 C;  5I84 A;  1LFG A;  4I62 A;  4LQ2 A;  4IO5 A;  2XD3 A;  4IO2 A;  4DI3 D;  4IB2 A;  3DP6 A;  5TPA A;  1EYJ A;  4N6K A;  2F5X A;  2VHA A;  4BDL A;  4U2R A;  1IMC A;  3CIJ A;  3TTR A;  4F2Q A;  5IZZ A;  2QL3 A;  2HAU A;  2BJI A;  2ZYO A;  3KFM A;  2PX1 A;  3OEN A;  4QFN A;  2GRV A;  4MH5 A;  2G29 A;  5TP9 B;  2KQZ A;  2ZNT A;  2FVZ A;  1MXY A;  4OZ9 A;  2YJP A;  1KZ8 A;  4QSC A;  3QUF A;  5CRY A;  2I4B A;  2H98 A;  1VFE A;  3KC1 A;  2H5Y A;  3SEV A;  4RK2 A;  1USY E;  1FPJ A;  4OQO A;  1UTB A;  3FIR A;  3WAF A;  5I7I A;  1EH3 A;  2HAV A;  3FXQ A;  2QVR A;  4NE4 A;  3MP1 A;  1IMA A;  4PE5 B;  1QJM A;  2CMO A;  3GBB A;  4ELO A;  1SI0 A;  1LGB C;  4F29 A;  4IGR A;  4YKP A;  4QFL A;  2PYY A;  2DE2 A;  4OES A;  1UIV A;  3A3C A;  3B6Q A;  3E78 A;  1OQH A;  2DVC A;  2XXQ A;  1FQA A;  4GWX A;  3PPN A;  3TEL A;  3QYT A;  3K1N A;  3KC0 A;  3Q27 A;  4NQ8 A;  4OVS A;  3H3G A;  4OET A;  1PC3 A;  1Y3P A;  4NGU A;  3U94 A;  4C1T A;  1KWH A;  4RY1 A;  1LCF A;  3K6X A;  4ZEC A;  1P1N A;  2HZK A;  1US5 A;  2GHB A;  2RC8 A;  4DIG A;  5I58 B;  4PFU A;  3S4U A;  1MG1 A;  3KBR A;  5DTB A;  1L5T A;  5F7V A;  3GBA A;  1EYI A;  1BK4 A;  3MAM A;  3QAX A;  3HV1 A;  3CSG A;  2D5W A;  4LON B;  1B2H A;  1S9T A;  2F6G A;  1PBQ A;  1A55 A;  4X1D A;  3RTW B;  1MH3 A;  5ESY A;  3FVN A;  5CM6 A;  4P3L A;  1NUY A;  2FA7 A;  1MH4 A;  3IOW A;  3JZJ A;  5H8N A;  2ZYN A;  1XS5 A;  3KOS A;  3U93 A;  1FBF A;  3FJM A;  4JSO A;  2DWA A;  2V3U A;  1LBX A;  3FJ7 A;  3V8X B;  2V3Q A;  4I3Y A;  2ZZV A;  1N84 A;  3FV1 A;  3HO7 A;  3B6T A;  4FED A;  2O1M A;  1JP4 A;  2VPO A;  3UIF A;  4H45 A;  5AE4 A;  1B40 A;  2FNC A;  5I59 A;  3IX1 A;  4ZE9 A;  4KQP A;  4PQJ A;  1NFT A;  5AA3 A;  4JB7 A;  3KBZ A;  3CG3 A;  4GLI A;  1B1X A;  3M3K A;  4GRK A;  2DWI A;  2HPG A;  5KCJ A;  3Q26 A;  2OCU A;  5DT6 A;  4GX4 A;  1MQG A;  4OYV A;  1P1Q A;  4TQU Q;  3U65 A;  1IEJ A;  2ONS A;  3TCF A;  2OLB A;  3CFL A;  4F39 A;  4XTC Q;  3RPW A;  4G68 B;  3EHS A;  4FEC A;  2QMX A;  4F1V A;  1P1O A;  3G3I A;  3K6W A;  4QF9 A;  1FBH A;  4POW A;  1FPB A;  1BLF A;  4R74 A;  4OAN A;  1AWB A;  2QS1 A;  1MXV A;  5BWJ A;  1MPD A;  4GL0 A;  1RYX A;  4XKP A;  4H67 A;  3RY3 A;  1FQF A;  3O28 A;  2O6A A;  4U1O A;  2DE3 A;  5AA2 A;  2NUV A;  5EHS A;  1MY2 A;  4Q0C A;  3KN7 A;  3TMG A;  1VR5 A;  1B58 A;  4RA1 A;  1FQB A;  2O69 A;  4N8Y A;  3HHG A;  3B6W A;  3R26 A;  4LN5 A;  4DZ1 A;  3T22 A;  4IGT A;  1HSL A;  4X1B A;  4KFQ A;  2X7P A;  3OEK A;  1SI1 A;  3MP6 A;  2XXH A;  1GV8 A;  3FAT A;  4NF8 B;  4KD5 A;  4F2O A;  4WED A;  1INP A;  3VXC A;  3PPO A;  1IMD A;  5TPA B;  1LFH A;  2AL5 A;  4YMB A;  2ZNU A;  3MZ9 A;  3TPA A;  4TLM B;  1NV7 A;  3SET A;  3H6T A;  5CMK A;  3IAZ A;  5ISU A;  1MPB A;  1FPL A;  4DXB A;  2BJJ X;  2UVJ A;  5EQA A;  4GVO A;  5TP9 A;  4R9F A;  4O8M A;  4UAB A;  1D9Q A;  2RCA A;  2DXR A;  1LEV A;  3MPL A;  1FQC A;  1EZP A;  3MC2 A;  1IME A;  4Q5T A;  4H8J A;  5I5P A;  3D1R A;  1Y3Q A;  3FVK A;  3OXN A;  3I5O A;  5H8F A;  2A5S A;  1B5J A;  1MY3 A;  3CHG A;  4YAH X;  4DE8 A;  5DW8 A;  4PBH A;  1NL5 A;  3FD3 A;  4I1D A;  2LAO A;  3WAE A;  3PUX E;  1DBZ A;  4N13 A;  3VLU A;  3C32 A;  4G61 A;  1MM6 A;  1B6H A;  3CR9 A;  4PFW A;  4AS5 A;  1NV0 A;  3LV0 A;  4QBA A;  4N6D A;  3THI A;  1DCU A;  4PFY A;  4NMY A;  3DM0 A;  3CVG A;  3V5A A;  1QGX A;  3RQT A;  1FTK A;  1JW5 A;  4EQB A;  4N07 A;  4P0I A;  1MQD A;  4R73 A;  3C4M A;  4RXL A;  1SYI A;  3PV0 E;  1RDX A;  4POX A;  4O3A A;  1S7Y A;  1TWY A;  3IB2 A;  3CFX A;  2XXW A;  2HXR A;  4OVJ A;  3HPI A;  5LOM A;  1QKA A;  3G7W A;  4ND9 A;  3T93 B;  1OMP A;  2WYP A;  3OSQ A;  4IR8 A;  3TYH A;  4KCC A;  4KYS A;  3S9M C;  4NF0 A;  1NNP A;  4H0W A;  2QMW A;  5I58 A;  3KJ7 A;  3DP4 A;  2ABH A;  4KYD A;  4IO7 A;  2DDK A;  2WBD A;  4MNP A;  2CZI A;  1XVY A;  5FHM A;  4I40 A;  2F8D A;  1IIW A;  3PMV A;  2F7C A;  4EF1 A;  1B0L A;  5DVJ A;  4QRZ A;  4O3C A;  2Q8M A;  4MNC A;  4WEP A;  1LAX A;  1J1N A;  5H8S A;  3KSX A;  1MY0 A;  2H4I A;  1IXG A;  3A09 A;  1Y4T A;  3VE1 B;  2GQ1 A;  5I56 A;  1VE4 A;  5H8N B;  4XIG Q;  4QFK A;  4N91 A;  4PC9 A;  1URD A;  1Z7N E;  3CRB A;  3P7I A;  3TAJ A;  3QSL A;  2FYI A;  1MQI A;  2OWS A;  1IXC A;  3CFZ A;  2Z8E A;  1FPI A;  5I59 B;  2AYS A;  4MMP A;  1B0H A;  1B32 A;  2I6E A;  3GXA A;  4PE3 A;  2XXP A;  1NV2 A;  3FBP A;  4N17 A;  3T0J A;  3H4Z A;  4GWO A;  1NV5 A;  3AXF A;  4GWU A;  2VD2 A;  1M5E A;  4HXV A;  5KDT B;  2OBG A;  5J1D A;  4JDF A;  5KCJ B;  2FIX A;  2F36 A;  4IO6 A;  2GH9 A;  1XVX A;  3B50 A;  3C35 A;  4FEB A;  1B7Z A;  2ZZW A;  4N4U A;  2NXO A;  1FQE A;  1H44 A;  2XHD A;  3UN6 A;  2Y84 A;  1FCK A;  3U1O A;  4F3S A;  4G68 A;  1ELJ A;  3VFJ A;  1DTG A;  1OIB A;  1T0K A;  1FTO A;  3S9L C;  4LZ5 A;  4OER A;  3IJO B;  3EN3 A;  4F18 A;  4MF3 A;  2CZH A;  1JET A;  2PT1 A;  1JVY A;  1F9B A;  4YKI A;  4ZEK A;  3IFC A;  4NN3 A;  4ZDM A;  3ECR A;  4FE8 A;  1FTL A;  1NUX A;  2IA4 A;  3IOU A;  3TUS A;  1B3G A;  3K6U A;  4HTG A;  1DPE A;  4I3E A;  4MLQ A;  1B1H A;  4NTL A;  1OLA A;  5I2N A;  4NF8 A;  1O7T A;  3GLB A;  1PB9 A;  3MVX A;  4I9D A;  1D9Y A;  5IZ1 A;  4X8R A;  1N7X A;  3FXB A;  4P1L A;  3KN8 A;  4O94 A;  3ZS6 A;  4TOZ A;  4EDP A;  1IIT A;  4QSE A;  2OK2 A;  4MLV A;  1MM7 A;  4GIZ A;  3FVO A;  5CBS A;  2GHA A;  3GYY A;  4NF4 B;  3IFA A;  3L6H A;  2R9J A;  1LLS A;  1QUJ A;  3H6W A;  1B5H A;  2KR0 A;  2ZYK A;  1YYZ A;  3O97 A;  4AS4 A;  5FTI A;  1IXH A;  4U4X A;  4JWX A;  4R6H A;  4BDN A;  5H8F B;  1ZKB A;  4P0G A;  3HN0 A;  3C9H A;  5AA4 A;  1I6B A;  2ESN A;  3FAS A;  2QRY A;  2REG A;  2DWH A;  4DI4 B;  4YU0 A;  3TTL A;  3UA8 A;  3O6H A;  4GXA A;  4RNS A;  1ANF A;  2I48 A;  3FVG A;  2F3B A;  3H03 A;  4G8M A;  1MDP 1;  1ATG A;  4NF6 B;  5AA2 D;  1JW4 A;  3LR1 A;  1URG A;  4MCO A;  3BIH A;  2WBB A;  1FPE A;  2XX8 A;  2Y7R A;  4H8I A;  3MP8 A;  3H6U A;  2XWK A;  4M1V A;  1ZU0 A;  1PB7 A;  2M8C A;  3O66 A;  5I2K A;  4GWY A;  4P8B A;  1TFA A;  5F24 A;  4P9K A;  5EHM A;  4MIJ A;  5AA1 A;  4ZEF A;  4JXI A;  2W7Y A;  4ESW A;  3NOH A;  1UQW A;  3G3F A;  1H43 A;  1LAF E;  4PP0 A;  2WEF A;  3KEI A;  1A40 A;  4GWZ A;  4PCD A;  4FAT A;  1B3E A;  3Q28 A;  2DSF A;  5T3J A;  1A54 A;  2I3W A;  3VVD A;  4YKK A;  2X7Q A;  2DE4 A;  5EYH A;  2DS9 A;  2YPN A;  3K4U A;  1CNQ A;  4IO4 A;  1M5C A;  2P3N A;  3GZG A;  1WVJ A;  4XFE A;  2B3F A;  4F1U A;  3PTY A;  4RYA A;  2ZYM A;  5I56 B;  1ZIU A;  4N81 A;  2Q2A A;  5HPQ A;  1AMF A;  3UOR A;  3DLN A;  1MDQ A;  1GTK A;  3C34 A;  4X48 A;  4YB5 A;  1MS7 A;  1FBC A;  4OEU A;  2HHM A;  2F6P A;  2V4C A;  3N5L A;  2DXY A;  4ELP A;  3TEP A;  3IO6 A;  2V25 A;  2F97 A;  1B46 A;  2DOJ A;  4P47 A;  1ZLQ A;  1FBD A;  4KR5 A;  3RPL A;  3PU5 A;  3SEY A;  4H1X A;  1WOD A;  2VPN A;  4EF2 A;  2E0S A;  1UIU A;  2PT2 A;  5KDT A;  2F7B A;  4DXU A;  1P1W A;  4HCW A;  5LTC A;  4IY6 A;  4ZEI A;  3ONM A;  4PET A;  4NWD A;  4OTE A;  2HFB A;  4OMB A;  1YAE A;  1SW2 A;  4JVD A;  3UGW A;  3U92 A;  4F3G A;  1IMF A;  3FV2 A;  1G0H A;  4Q8R A;  3D4C A;  2VGQ A;  1MPC A;  4YZZ A;  4G8H A;  1A8F A;  2Q74 A;  1A8E A;  3EQ1 A;  2Q88 A;  1LBY A;  1NUZ A;  2R6G E;  2R71 A;  3TCH A;  1FTM A;  1LBV A;  2OJT A;  4H46 A;  1VFD A;  3TFL A;  3G3K A;  1G0I A;  3T9X B;  4RJZ A;  4ZZA A;  2WX9 A;  1XT8 A;  3HFU A;  4U21 A;  3FUZ A;  3G3G A;  4AB6 A;  1SBP A;  5FTH A;  3ISP A;  1FTA A;  3O6G A;  4YB6 A;  3LSW A;  1LBZ A;  1SW5 A;  3MQ9 A;  2NWJ A;  1BTJ A;  3B8B A;  2YLN A;  2I4C A;  4ONY A;  1NV4 A;  3M3L A;  3RN8 A;  2V3T A;  3ILT B;  3VXB A;  5I2N B;  2UVG A;  3UK4 A;  1LST A;  2Y7K A;  1M5B A;  3EKI A;  5A5X A;  2XXU A;  2PCR A;  2XXI A;  2VT5 A;  3BFT A;  1RYO A;  2O51 A;  3SKP A;  3EPE A;  4GBW A;  3RT6 B;  4GBV A;  1I69 A;  4Z0I A;  3K2D A;  1MXX A;  3N94 A;  3O9P A;  3UP9 A;  4PTK A;  2ZMB A;  3ILU B;  1B4H A;  1FBG A;  1DMB A;  1IUD A;  4NF4 A;  1SVX B;  2NOO A;  2XXY A;  1D9V A;  4Z7E A;  1AOV A;  3EF7 A;  5ITP A;  1URS A;  3PD9 A;  2F34 A;  3IB1 A;  5ET8 A;  2AIX A;  3KG2 A;  4GF8 A;  1OVB A;  2O7U A;  2UXA A;  3SZP A;  1B3H A;  4KYE A;  5EQ7 A;  3PUY E;  2XXX A;  1JEV A;  1US4 A;  5AA4 B;  3SEU A;  2P3V A;  1OQG A;  4KI0 E;  1AIV A;  4LP2 B;  4OVR A;  5KZT A;  5EQ9 A;  3U8Q A;  4C0R A;  3IOR A;  3OO8 A;  1I6A A;  5DVF A;  1BKA A;  2PVU A;  2HZL A;  3DEL B;  1FPD A;  4PAI A;  4HS7 A;  3RNN A;  3O29 A;  4NF6 A;  1YPN A;  3OO9 A;  5BUU A;  3DP8 A;  1N3X A;  3I6V A;  4DXC A;  1PBP A;  3H6V A;  5CC2 A;  2H9B A;  2Q9T A;  2OWT A;  1QKB A;  1SD3 A;  4EXL A;  4QFO A;  2F78 A;  5FHN A;  3TQW A;  5I2K B;  1II5 A;  4ZEB A;  1LFI A;  4OXV A;  3VVE A;  1N76 A;  3E9X A;  4RPO A;  4WXJ A;  1Q1K A;  1TT1 A;  4NWC A;  4PGP A;  1NH8 A;  2O7I A;  1B7U A;  4NF5 A;  3PPR A;  3E13 X;  2XWI A;  3MYU A;  4M4G A;  5H8Q A;  3OO7 A;  3JYR A;  2DWJ A;  4DLD A;  2CEY A;  3HST A;  3VVF A;  3ZKL A;  1QUK A;  5CBR A;  4BDO A;  3OSR A;  2ONR A;  1ZJL A;  4XKR A;  5L9O A;  1JNF A;  1FPF A;  3KGC A;  4YB7 A;  1UTH A;  1MY4 A;  4GXS B;  3MW0 A;  2O84 X;  2XWO A;  1P99 A;  2UVH A;  1B52 A;  3E79 A;  2H25 A;  4G2Z A;  3E3K A;  2WKY A;  3TKD A;  4ZE8 A;  4GFR A;  3FXR A;  3KN3 A;  3EHT A;  1Y1Z A;  3W15 C;  2R8T A;  3RGY A;  3MVY A;  1MY1 A;  4Q30 B;  4FBP A;  3VV5 A;  1XOC A;  1XC1 A;  1FRP A;  5ET5 A;  2HEU A;  3ROJ A;  5L9M A;  3K02 A;  3S2V A;  3RPL B;  5I3S A;  4F19 A;  4MAG A;  3MBP A;  3H7M A;  4G8N A;  1NNT A;  2RIN A;  2I0B A;  4ESX A;  5JTY A;  3RTF B;  3PUZ E;  3MZ1 A;  2XD2 A;  3Q25 A;  1SYH A;  2WYK A;  2Y7P A;  3OO6 A;  1Y4C A;  5IKB A;  1QUI A;  4MEV A;  2X26 A;  2ZNS A;  1XHY A;  4LZ7 A;  2I3V A;  1MQJ A;  3K1P A;  1NI9 A;  4BDR A;  5IGA A;  5H8H B;  2I49 A;  4OHN A;  3O2A A;  4OEN A;  5JEI A;  3OOA A;  3E4R A;  4JWO A;  4WKM A;  2ONK E;  3TQL A;  2D3I A;  3CG1 A;  2XWV A;  2E1S A;  4KXP A;  3HCQ A;  1GR2 A;  2UYF A;  3LSX A;  3PPQ A;  2Z23 A;  3RYD A;  1PEB A;  3MZB A;  2D21 A;  3MVW A;  4I8C A;  2XXT A;  1QUL A;  3K01 A;  3B7D A;  5A5X B;  4FIM A;  4HCY A;  4H5G A;  3U72 A;  3VLW A;  4U23 A;  4N6P A;  1P1U A;  2RKM A;  4GD5 A;  4EUO A;  1IZ1 A;  1ZBM A;  3MUQ A;  3S9E A;  1FPK A;  1LBW A;  2DQV A;  5I57 A;  1TFD A;  2PFY A;  4XKQ A;  3FGS A;  4R2F A;  3HHF A;  4KCD A;  1B9J A;  1AL3 A;  2H99 A;  3LSF B;  1ZMG A;  2A5T A;  1USY H;  3LBS A;  1POY 1;  3C36 A;  3OMB A;  1DPP A;  3TZA A;  3PMW A;  1M5F A;  4G77 A;  4U4S A;  3PGF A;  4YMA A;  2I58 A;  4LAT A;  1NNF A;  2FHY A;  3SDF A;  4YIC A;  1IMB A;  4R6Y A;  3IOT A;  4U22 A;  4LA9 A;  5EQ8 A;  1Y3N A;  4BDM A;  1A99 A;  3G3J A;  4FJP A;  4R75 A;  1PDA A;  4IO3 A;  4QSD A;  2MKZ A;  2F35 A;  2PMS A;  4F3B A;  3IO4 A;  1JQF A;  2P2A A;  3QXM A;  1R9Q A;  3IB0 A;  1SPI A;  3USD A;  4KHZ E;  4P56 A;  3G3H A;  4F22 A;  1SQY A;  3MJN A;  2CEX A;  5L8D A;  1Y9U A;  5ET7 A;  5ET6 A;  4BDQ A;  3V89 B;  4U1Z A;  2Y5L A;  3OEL A;  4XKN A;  1SW1 A;  2VD3 A;  3A3U A;  2HXW A;  3MST A;  1MXZ A;  3KJT A;  1YZ0 A;  4NF5 B;  4TLL B;  3K0V A;  4MHF A;  3IR1 A;  1VSO A;  5H8Q B;  1LAG E;  2JJK A;  4F3P A;  4ECF A;  2O1L A;  1YXI A;  3Q29 A;  1FSA A;  4XEQ A;  2QSX A;  1NV1 A;  2RC9 A;  1DTZ A;  4PAF A;  5DVI A;  3T9U A;  1B7H A;  4MBP A;  4MX6 A;  2XX7 A;  1DOT A;  4UAC A;  3PD8 A;  1MXW A;  2KLF A;  1B4Z A;  4X04 A;  4PAK A;  3V83 A;  1UTH B;  1SW4 A;  3T9V A;  2IEE A;  3OEM A;  4RPN A;  1MRP A;  4PFB A;  2FBP A;  4ELR A;  1DK4 A;  4NX1 A;  1FTJ A;  3TOD A;  3C31 A;  3K6V A;  4JVC A;  2QFL A;  3K00 A;  5FHO A;  1SDX A;  3L6G A;  3MWB A;  3T9H B;  1MQH A;  2DYX A;  1LBB A;  3KSJ A;  1CB6 A;  3IL1 B;  2XXK A;  3VLV A;  2Y7I A;  3SEW A;  2Q8J A;  1B05 A;  4ELQ A;  1HSE A;  1WDN A;  5HM4 B;  3QMF A;  1M5D A;  2NVU B;  5IZ3 B;  1D4N A;  4QHQ A;  5DEX B;  2XXV A;  2F3D A;  5JTY B;  1NKX A;  5ITO A;  1N3W A;  1K9Y A;  4L17 A;  1DSN A;  2CZL A;  4LQ5 A;  1Y20 A;  3N6U A;  2PBW A;  3MVZ A;  4MJO A;  4MNI A;  3LSL A;  4OVP A;  3PPP A;  4BLA A;  2PFZ A;  4HE0 A;  5H8H A;  3KOT A;  4QFP A;  1KA1 A;  5A5L A;  4IY5 A;  2VOZ A;  2REJ A;  5ICQ A;  3N6T A;  1Q35 A;  3BKI B;  4R9G A;  3T1B A;  1B3L A;  4R72 A;  4F31 B;  4GWW A;  2RC7 A;  1BIY A;  3CI8 A;  3BBR A;  4JWY A;  2VP1 A;  3ZSF A;  3JV9 A;  2Q89 A;  4XF5 A;  1A7L A;  3K1M A;  3LUY A;  5IM2 A;  3N26 A;  4DCY A;  4PF8 A;  4E0X A;  5K2Y A;  2DVZ A;  2OX3 A;  5CI5 A;  3RLF E;  3FZV A;  1HSJ A;  2Z22 A;  4N15 A;  2ANJ A;  4LUB A;  4GL8 A;  5I57 B;  5J16 A;  4OWD A;  1QW0 A;  3FJG A;  5HBC A;  2Y5K A;  1MXU A;  1I6Q A;  4O7M A;  2QS3 A;  2Y7W A;  4JVI A;  5JK4 A;  4ZED A;  2A5T B;  1RDZ A;  2I0C A;  4MFI A;  3FXU A;  3O6I A;  4G4P A;  4PDD A;  2HCA A;  1O63 A;  3T66 A;  1H76 A;  1CE2 A;  1QVS A;  4FOR A;  1NV6 A;  1RKM A;  3W9V A;  1POT A;  3TCG A;  4GX3 A;  4NHB A;  3PUW E;  3QUJ A;  2V84 A;  3CSB A;  3PMX A;  4DDD A;  1LAH E;  4OFJ A;  1FBP A;  1EU8 A;  5EYF A;  3R6U A;  2P1S A;  1UTB B;  2UVI A;  2XA5 A;  1N7W A;  3SER A;  2QS4 A;  4P11 A;  1H45 A;  4OVT A;  3A29 A;  1R6Z A;  4O3B A;  1H3D A;  1K9Z A;  3QK6 A;  4JSD A;  1OVT A;  2AL4 A;  4AB5 A;  1Z7M E;  3BIG A;  4R6K A;  4GX6 A;  4OEV A;  1KA0 A;  1NV3 A;  1R9L A;  1EZO A;  4GWS A;  1XI6 A;  4E0W A;  3VDF A;  4PF6 A;  4KPT A;  1NNK A;  2B4L A;  4UA8 A;  1JW1 A;  2QJE A;  3ODB A;  4DCX A;  2THI A;  2OWZ A;  4NED A;  3TTM A;  2GFE A;  5CMM A;  3LUZ A;  2XXR A;  1B3F A;  3OD7 A;  4EXK A;  4OFO A;  2XX9 A;  4PFR A;  4ISU A;  4PFT A;  2QS2 A;  3W9W A;  2V93 A;  4PDH A;  4K3F A;  3IK6 B;  3TTK A;  4NAP A;  4EQ9 A;  3BFU A;  3D4G A;  3TDJ A;  5DYH A;  3RUM A;  1Y1M A;  1N04 A;  4OFL A;  4JBZ A;  5ELV A;  1FPG A;  5K2X A;  1OLC A;  5CMC A;  1IXI A;  1LCT A;  5IAI A;  1FW0 A;  3TTN A;  2O68 A;  2CZK A;  5B70 A;  3SES A;  3M3F A;  2B3B A;  4PGN A;  1GVC A;  1FJ6 A;  4H5F A;  4QXD A;  4FAJ A;  4LZ8 A;  4P1E A;  4N8G A;  1FJ9 A;  5CMB A;  4HE2 A;  2Q2C A;  1FQD A;  1EZ9 A;  1D3K A;  1AH5 A;  2RF1 A;  1EYK A;  1TXF A;  2B4M A;  2RCB A;  5FBP A;  3MPK A;  5ICT A; 
#chains in the Genus database with same CATH homology
 1R1N A;  4H65 A;  3C33 A;  3RT8 A;  3M8U A;  2DP8 A;  1LBC A;  2Z8D A;  2ZXT A;  5TU0 A;  1YCJ A;  5DEX A;  3EHU A;  1LB9 A;  4THI A;  3LC8 A;  4YKJ A;  1GGG A;  1JVX A;  5F1Q A;  4AQ4 A;  1ZTY A;  1B5I A;  4GQO A;  1JEU A;  4F1Y A;  4RK9 A;  3SEX A;  2B65 A;  4H6D A;  4LVQ A;  2UYE A;  2OZZ A;  5B7D A;  4X9T A;  3ZKK A;  3R7X A;  3S9N C;  4GOT A;  1O64 A;  1PB8 A;  3T96 B;  1NMU A;  2Z8F A;  2F7A A;  3H06 B;  2ALU A;  2G93 A;  4R2B A;  2P0S A;  3I3V A;  4ZZE A;  5L9S A;  1S50 A;  4XXU A;  1IQ7 A;  4C1U A;  4EQ7 A;  3KZG A;  4ZS9 A;  3PUV E;  1LB8 A;  5AA2 B;  1NH7 A;  3IOV A;  2HQ0 A;  4HW8 A;  3F11 A;  3QIM A;  1N0T A;  3IJX B;  1B51 A;  2QPQ A;  5M2V A;  1YTV A;  1BP5 A;  4G68 C;  5I84 A;  1LFG A;  4I62 A;  4LQ2 A;  4IO5 A;  2XD3 A;  4IO2 A;  4IB2 A;  3DP6 A;  5TPA A;  2F5X A;  2VHA A;  4BDL A;  4U2R A;  3CIJ A;  3TTR A;  4F2Q A;  2QL3 A;  2HAU A;  2ZYO A;  3KFM A;  2PX1 A;  3OEN A;  4QFN A;  2GRV A;  4MH5 A;  2G29 A;  5TP9 B;  2ZNT A;  4OZ9 A;  1MXY A;  2YJP A;  4QSC A;  3QUF A;  5CRY A;  2I4B A;  2H98 A;  1VFE A;  2H5Y A;  3SEV A;  4RK2 A;  1USY E;  4OQO A;  1UTB A;  3FIR A;  3WAF A;  1EH3 A;  2HAV A;  3FXQ A;  4NE4 A;  3MP1 A;  4PE5 B;  1QJM A;  2CMO A;  3GBB A;  4ELO A;  1SI0 A;  1LGB C;  4F29 A;  4IGR A;  4YKP A;  4QFL A;  2PYY A;  2DE2 A;  4OES A;  1UIV A;  3A3C A;  3B6Q A;  1OQH A;  2DVC A;  2XXQ A;  1FQA A;  3PPN A;  3TEL A;  3QYT A;  3K1N A;  3Q27 A;  3H3G A;  4OET A;  1PC3 A;  1Y3P A;  3U94 A;  4C1T A;  1KWH A;  4RY1 A;  1LCF A;  3K6X A;  4ZEC A;  1P1N A;  2HZK A;  1US5 A;  2GHB A;  2RC8 A;  4DIG A;  5I58 B;  4PFU A;  3S4U A;  1MG1 A;  3KBR A;  5DTB A;  1L5T A;  5F7V A;  3GBA A;  3MAM A;  3QAX A;  3HV1 A;  3CSG A;  2D5W A;  4LON B;  1B2H A;  1S9T A;  2F6G A;  1PBQ A;  1A55 A;  4X1D A;  3RTW B;  1MH3 A;  3FVN A;  5CM6 A;  2FA7 A;  1MH4 A;  3IOW A;  3JZJ A;  5H8N A;  2ZYN A;  1XS5 A;  3KOS A;  3U93 A;  3FJM A;  4JSO A;  2DWA A;  2V3U A;  3FJ7 A;  3V8X B;  2V3Q A;  1N84 A;  3FV1 A;  3HO7 A;  3B6T A;  4FED A;  2O1M A;  3UIF A;  5AE4 A;  1B40 A;  2FNC A;  5I59 A;  3IX1 A;  4ZE9 A;  4KQP A;  4PQJ A;  1NFT A;  5AA3 A;  4JB7 A;  3CG3 A;  4GLI A;  1B1X A;  3M3K A;  4GRK A;  2DWI A;  5KCJ A;  3Q26 A;  2OCU A;  5DT6 A;  1MQG A;  4OYV A;  1P1Q A;  4TQU Q;  1IEJ A;  2ONS A;  3TCF A;  2OLB A;  3CFL A;  4F39 A;  4XTC Q;  3RPW A;  4G68 B;  3EHS A;  4FEC A;  2QMX A;  4F1V A;  1P1O A;  3G3I A;  3K6W A;  4QF9 A;  4POW A;  1BLF A;  4R74 A;  2QS1 A;  1MXV A;  5BWJ A;  1MPD A;  4GL0 A;  1RYX A;  4XKP A;  4H67 A;  3RY3 A;  1FQF A;  3O28 A;  2O6A A;  4U1O A;  2DE3 A;  5AA2 A;  2NUV A;  5EHS A;  1MY2 A;  4Q0C A;  3KN7 A;  3TMG A;  1VR5 A;  1B58 A;  4RA1 A;  1FQB A;  2O69 A;  4DZ1 A;  3HHG A;  3B6W A;  3R26 A;  3T22 A;  4IGT A;  1HSL A;  4X1B A;  4KFQ A;  2X7P A;  3OEK A;  1SI1 A;  3MP6 A;  2XXH A;  1GV8 A;  3FAT A;  4NF8 B;  4KD5 A;  4F2O A;  4WED A;  3VXC A;  3PPO A;  5TPA B;  1LFH A;  2AL5 A;  4YMB A;  2ZNU A;  3MZ9 A;  3TPA A;  4TLM B;  3SET A;  3H6T A;  5CMK A;  3IAZ A;  5ISU A;  1MPB A;  4DXB A;  2BJJ X;  2UVJ A;  4GVO A;  5TP9 A;  4R9F A;  2RCA A;  2DXR A;  3MPL A;  1FQC A;  1EZP A;  3MC2 A;  4Q5T A;  4H8J A;  1Y3Q A;  3FVK A;  3OXN A;  3I5O A;  5H8F A;  2A5S A;  1B5J A;  1MY3 A;  4YAH X;  4DE8 A;  1NL5 A;  3FD3 A;  4I1D A;  2LAO A;  3WAE A;  3PUX E;  4N13 A;  3VLU A;  3C32 A;  1MM6 A;  1B6H A;  3CR9 A;  4PFW A;  3THI A;  4PFY A;  4NMY A;  3DM0 A;  3CVG A;  3V5A A;  3RQT A;  1FTK A;  1JW5 A;  4EQB A;  4N07 A;  4P0I A;  1MQD A;  4R73 A;  3C4M A;  4RXL A;  1SYI A;  3PV0 E;  4POX A;  4O3A A;  1S7Y A;  1TWY A;  3IB2 A;  3CFX A;  2XXW A;  4OVJ A;  3HPI A;  5LOM A;  1QKA A;  3G7W A;  4ND9 A;  3T93 B;  1OMP A;  3OSQ A;  3TYH A;  4KCC A;  4KYS A;  3S9M C;  1NNP A;  4H0W A;  2QMW A;  5I58 A;  3KJ7 A;  3DP4 A;  2ABH A;  4KYD A;  4IO7 A;  1XVY A;  5FHM A;  2F8D A;  1IIW A;  3PMV A;  2F7C A;  4EF1 A;  1B0L A;  5DVJ A;  4QRZ A;  4O3C A;  4WEP A;  1LAX A;  1J1N A;  5H8S A;  3KSX A;  1MY0 A;  2H4I A;  1IXG A;  3A09 A;  1Y4T A;  3VE1 B;  5I56 A;  1VE4 A;  5H8N B;  4XIG Q;  4QFK A;  1URD A;  1Z7N E;  3CRB A;  3P7I A;  3TAJ A;  3QSL A;  2FYI A;  1MQI A;  2OWS A;  1IXC A;  3CFZ A;  2Z8E A;  5I59 B;  2AYS A;  1B0H A;  1B32 A;  2I6E A;  3GXA A;  2XXP A;  3H4Z A;  4GWO A;  3AXF A;  2VD2 A;  1M5E A;  5KDT B;  2OBG A;  5J1D A;  4JDF A;  5KCJ B;  2F36 A;  4IO6 A;  2GH9 A;  1XVX A;  3C35 A;  4FEB A;  1B7Z A;  2NXO A;  1FQE A;  1H44 A;  2XHD A;  3UN6 A;  2Y84 A;  1FCK A;  3U1O A;  4F3S A;  4G68 A;  1ELJ A;  3VFJ A;  1DTG A;  1OIB A;  1T0K A;  1FTO A;  3S9L C;  4LZ5 A;  4OER A;  3IJO B;  3EN3 A;  4F18 A;  4MF3 A;  1JET A;  2PT1 A;  1JVY A;  1F9B A;  4YKI A;  4ZEK A;  4ZDM A;  3ECR A;  4FE8 A;  1FTL A;  2IA4 A;  3IOU A;  3TUS A;  1B3G A;  3K6U A;  4HTG A;  1DPE A;  4MLQ A;  1B1H A;  4NTL A;  1OLA A;  5I2N A;  4NF8 A;  1O7T A;  3GLB A;  1PB9 A;  3MVX A;  4I9D A;  1D9Y A;  1N7X A;  3KN8 A;  3ZS6 A;  4TOZ A;  4EDP A;  1IIT A;  4QSE A;  2OK2 A;  4MLV A;  1MM7 A;  4GIZ A;  3FVO A;  5CBS A;  2GHA A;  4NF4 B;  3L6H A;  2R9J A;  1LLS A;  1QUJ A;  3H6W A;  1B5H A;  2ZYK A;  3O97 A;  5FTI A;  1IXH A;  4U4X A;  4JWX A;  4R6H A;  4BDN A;  5H8F B;  1ZKB A;  4P0G A;  3HN0 A;  3C9H A;  5AA4 A;  1I6B A;  2ESN A;  3FAS A;  2QRY A;  2REG A;  2DWH A;  4YU0 A;  3TTL A;  3UA8 A;  3O6H A;  4GXA A;  4RNS A;  1ANF A;  2I48 A;  3FVG A;  3H03 A;  4G8M A;  1MDP 1;  1ATG A;  4NF6 B;  5AA2 D;  1JW4 A;  3LR1 A;  1URG A;  2Y7R A;  2XX8 A;  4H8I A;  3MP8 A;  3H6U A;  4M1V A;  1ZU0 A;  1PB7 A;  2M8C A;  3O66 A;  5I2K A;  1TFA A;  5EHM A;  5AA1 A;  4ZEF A;  4JXI A;  2W7Y A;  4ESW A;  1UQW A;  3G3F A;  1H43 A;  1LAF E;  4PP0 A;  3KEI A;  1A40 A;  4FAT A;  1B3E A;  3Q28 A;  2DSF A;  1A54 A;  2I3W A;  3VVD A;  4YKK A;  2X7Q A;  2DE4 A;  2DS9 A;  2YPN A;  3K4U A;  4IO4 A;  1M5C A;  3GZG A;  1WVJ A;  2B3F A;  4F1U A;  4RYA A;  2ZYM A;  5I56 B;  1ZIU A;  2Q2A A;  5HPQ A;  1AMF A;  3UOR A;  3DLN A;  1MDQ A;  1GTK A;  3C34 A;  4X48 A;  4YB5 A;  1MS7 A;  4OEU A;  2F6P A;  3N5L A;  2DXY A;  4ELP A;  3TEP A;  3IO6 A;  2V25 A;  2F97 A;  1B46 A;  2DOJ A;  1ZLQ A;  4KR5 A;  3PU5 A;  3SEY A;  4H1X A;  1WOD A;  4EF2 A;  2E0S A;  1UIU A;  2PT2 A;  5KDT A;  2F7B A;  4DXU A;  1P1W A;  4HCW A;  4IY6 A;  4ZEI A;  3ONM A;  4PET A;  4NWD A;  4OTE A;  2HFB A;  4OMB A;  1YAE A;  1SW2 A;  3UGW A;  3U92 A;  4F3G A;  3FV2 A;  4Q8R A;  3D4C A;  2VGQ A;  1MPC A;  4YZZ A;  4G8H A;  1A8F A;  1A8E A;  3EQ1 A;  2Q88 A;  2R6G E;  2R71 A;  3TCH A;  1FTM A;  2OJT A;  1VFD A;  3TFL A;  3G3K A;  3T9X B;  4RJZ A;  4ZZA A;  1XT8 A;  4U21 A;  3FUZ A;  3G3G A;  4AB6 A;  1SBP A;  5FTH A;  3O6G A;  4YB6 A;  3LSW A;  1SW5 A;  3MQ9 A;  2NWJ A;  1BTJ A;  2YLN A;  2I4C A;  4ONY A;  3M3L A;  3RN8 A;  2V3T A;  3ILT B;  3VXB A;  5I2N B;  2UVG A;  3UK4 A;  1LST A;  2Y7K A;  1M5B A;  5A5X A;  2XXU A;  2XXI A;  3BFT A;  1RYO A;  2O51 A;  3SKP A;  3EPE A;  3RT6 B;  1I69 A;  4Z0I A;  3K2D A;  1MXX A;  3N94 A;  3O9P A;  3UP9 A;  2ZMB A;  3ILU B;  1B4H A;  1DMB A;  1IUD A;  4NF4 A;  1SVX B;  2NOO A;  2XXY A;  1D9V A;  4Z7E A;  1AOV A;  3EF7 A;  5ITP A;  1URS A;  3PD9 A;  2F34 A;  3IB1 A;  2AIX A;  3KG2 A;  4GF8 A;  1OVB A;  2O7U A;  2UXA A;  1B3H A;  4KYE A;  3PUY E;  2XXX A;  1JEV A;  1US4 A;  5AA4 B;  3SEU A;  1OQG A;  4KI0 E;  1AIV A;  4LP2 B;  5KZT A;  3U8Q A;  4C0R A;  3IOR A;  3OO8 A;  1I6A A;  5DVF A;  1BKA A;  2PVU A;  2HZL A;  3DEL B;  3RNN A;  4HS7 A;  3O29 A;  4NF6 A;  1YPN A;  3OO9 A;  5BUU A;  3DP8 A;  1N3X A;  3I6V A;  4DXC A;  1PBP A;  3H6V A;  5CC2 A;  2H9B A;  2Q9T A;  2OWT A;  1QKB A;  1SD3 A;  4EXL A;  4QFO A;  2F78 A;  5FHN A;  3TQW A;  5I2K B;  1II5 A;  4ZEB A;  1LFI A;  4OXV A;  3VVE A;  1N76 A;  3E9X A;  4RPO A;  4WXJ A;  1Q1K A;  1TT1 A;  4NWC A;  1NH8 A;  2O7I A;  1B7U A;  4NF5 A;  3PPR A;  3E13 X;  4M4G A;  5H8Q A;  3OO7 A;  3JYR A;  2DWJ A;  4DLD A;  3HST A;  3VVF A;  3ZKL A;  1QUK A;  5CBR A;  4BDO A;  3OSR A;  2ONR A;  1ZJL A;  4XKR A;  5L9O A;  1JNF A;  3KGC A;  4YB7 A;  1UTH A;  1MY4 A;  4GXS B;  3MW0 A;  2O84 X;  1P99 A;  2UVH A;  1B52 A;  2H25 A;  4G2Z A;  3E3K A;  2WKY A;  3TKD A;  4ZE8 A;  4GFR A;  3FXR A;  3KN3 A;  3EHT A;  1Y1Z A;  3W15 C;  3RGY A;  3MVY A;  1MY1 A;  4Q30 B;  3VV5 A;  1XOC A;  1XC1 A;  2HEU A;  5L9M A;  3K02 A;  3S2V A;  4F19 A;  3MBP A;  3H7M A;  4G8N A;  1NNT A;  2RIN A;  2I0B A;  4ESX A;  5JTY A;  3RTF B;  3PUZ E;  3MZ1 A;  2XD2 A;  3Q25 A;  1SYH A;  2Y7P A;  3OO6 A;  1Y4C A;  5IKB A;  1QUI A;  2X26 A;  2ZNS A;  1XHY A;  4LZ7 A;  2I3V A;  1MQJ A;  3K1P A;  4BDR A;  5H8H B;  2I49 A;  4OHN A;  3O2A A;  4OEN A;  5JEI A;  3OOA A;  3E4R A;  4JWO A;  4WKM A;  2ONK E;  3TQL A;  2D3I A;  3CG1 A;  2E1S A;  3HCQ A;  1GR2 A;  2UYF A;  3LSX A;  3PPQ A;  2Z23 A;  1PEB A;  3MZB A;  2D21 A;  3MVW A;  4I8C A;  2XXT A;  1QUL A;  3K01 A;  3B7D A;  5A5X B;  4FIM A;  4HCY A;  4H5G A;  3U72 A;  3VLW A;  4U23 A;  4N6P A;  1P1U A;  2RKM A;  4GD5 A;  4EUO A;  1IZ1 A;  1ZBM A;  3MUQ A;  3S9E A;  2DQV A;  5I57 A;  1TFD A;  4XKQ A;  3FGS A;  4R2F A;  3HHF A;  4KCD A;  1B9J A;  1AL3 A;  2H99 A;  3LSF B;  1ZMG A;  2A5T A;  1USY H;  3LBS A;  1POY 1;  3C36 A;  3OMB A;  1DPP A;  3TZA A;  3PMW A;  1M5F A;  4G77 A;  4U4S A;  3PGF A;  4YMA A;  2I58 A;  4LAT A;  1NNF A;  3SDF A;  4YIC A;  4R6Y A;  3IOT A;  4U22 A;  4LA9 A;  1Y3N A;  4BDM A;  1A99 A;  3G3J A;  4FJP A;  4R75 A;  1PDA A;  4IO3 A;  4QSD A;  2F35 A;  2PMS A;  4F3B A;  3IO4 A;  1JQF A;  2P2A A;  3QXM A;  1R9Q A;  3IB0 A;  3USD A;  4KHZ E;  3G3H A;  4F22 A;  1SQY A;  3MJN A;  5L8D A;  1Y9U A;  4BDQ A;  3V89 B;  4U1Z A;  3OEL A;  4XKN A;  1SW1 A;  2VD3 A;  3A3U A;  2HXW A;  1MXZ A;  3KJT A;  4NF5 B;  4TLL B;  3K0V A;  3IR1 A;  1VSO A;  5H8Q B;  1LAG E;  4F3P A;  4ECF A;  2O1L A;  3Q29 A;  2QSX A;  2RC9 A;  1DTZ A;  5DVI A;  3T9U A;  1B7H A;  4MBP A;  2XX7 A;  1DOT A;  4UAC A;  3PD8 A;  1MXW A;  2KLF A;  1B4Z A;  3V83 A;  1UTH B;  1SW4 A;  3T9V A;  2IEE A;  3OEM A;  4RPN A;  1MRP A;  4ELR A;  1FTJ A;  3TOD A;  3C31 A;  3K6V A;  3K00 A;  5FHO A;  1SDX A;  3L6G A;  3MWB A;  3T9H B;  1MQH A;  2DYX A;  1LBB A;  3KSJ A;  1CB6 A;  3IL1 B;  3VLV A;  2Y7I A;  3SEW A;  2Q8J A;  1B05 A;  4ELQ A;  1HSE A;  1WDN A;  5HM4 B;  1M5D A;  2NVU B;  1D4N A;  4QHQ A;  5DEX B;  2XXV A;  5JTY B;  1NKX A;  5ITO A;  1N3W A;  4L17 A;  1DSN A;  2CZL A;  4LQ5 A;  1Y20 A;  3N6U A;  2PBW A;  3MVZ A;  3LSL A;  3PPP A;  4BLA A;  5H8H A;  3KOT A;  4QFP A;  4IY5 A;  2VOZ A;  2REJ A;  5ICQ A;  3N6T A;  1Q35 A;  3BKI B;  4R9G A;  1B3L A;  4R72 A;  4F31 B;  2RC7 A;  1BIY A;  3CI8 A;  3BBR A;  4JWY A;  2VP1 A;  3ZSF A;  3JV9 A;  2Q89 A;  1A7L A;  3K1M A;  3LUY A;  3N26 A;  4DCY A;  4E0X A;  5K2Y A;  2DVZ A;  5CI5 A;  3RLF E;  3FZV A;  1HSJ A;  2Z22 A;  2ANJ A;  4LUB A;  4GL8 A;  5I57 B;  4OWD A;  1QW0 A;  3FJG A;  5HBC A;  1MXU A;  1I6Q A;  2QS3 A;  2Y7W A;  5JK4 A;  4ZED A;  2A5T B;  2I0C A;  4MFI A;  3FXU A;  3O6I A;  4G4P A;  2HCA A;  1O63 A;  3T66 A;  1H76 A;  1CE2 A;  1QVS A;  4FOR A;  3W9V A;  1RKM A;  1POT A;  3TCG A;  3PUW E;  3QUJ A;  2V84 A;  3CSB A;  3PMX A;  4DDD A;  1LAH E;  4OFJ A;  1EU8 A;  5EYF A;  3R6U A;  2P1S A;  1UTB B;  2UVI A;  1N7W A;  3SER A;  2QS4 A;  4P11 A;  1H45 A;  1R6Z A;  4O3B A;  1H3D A;  4JSD A;  3QK6 A;  1OVT A;  2AL4 A;  4AB5 A;  1Z7M E;  4R6K A;  4OEV A;  1R9L A;  1EZO A;  4E0W A;  3VDF A;  4KPT A;  1NNK A;  4UA8 A;  1JW1 A;  2QJE A;  3ODB A;  4DCX A;  2THI A;  4NED A;  3TTM A;  2GFE A;  5CMM A;  2XXR A;  1B3F A;  3OD7 A;  4EXK A;  4OFO A;  2XX9 A;  4ISU A;  4PFT A;  2QS2 A;  3W9W A;  2V93 A;  4K3F A;  3IK6 B;  3TTK A;  4EQ9 A;  3BFU A;  3D4G A;  3TDJ A;  5DYH A;  3RUM A;  1Y1M A;  1N04 A;  4OFL A;  4JBZ A;  5ELV A;  5K2X A;  1OLC A;  5CMC A;  1IXI A;  1LCT A;  5IAI A;  1FW0 A;  3TTN A;  2O68 A;  5B70 A;  3SES A;  3M3F A;  2B3B A;  1GVC A;  4H5F A;  4FAJ A;  4LZ8 A;  5CMB A;  2Q2C A;  1FQD A;  1EZ9 A;  1D3K A;  1AH5 A;  2RF1 A;  1TXF A;  2RCB A;  3MPK A;  5ICT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...