4ZDMA

Pleurobrachia bachei iglur3 lbd glycine complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
254
structure length
249
Chain Sequence
SNNLNGMHLRLGIIPEMPFISEPSLGCTNIRDPSCYTGVNVEIVSMMSQDLNFTYNFITPEDLKFGGKEWNGLIRDLLDNKTDMIVVALSNNAVRKADIDFSLSMMDGGLGALVKSDGTDLSHPLELLNQDKYQWGVVDSRNPELLLASNQNADYNRIAEDAVKVGSYGEGLERMRAGGFVFIDEIPGINYATKGECDIVQIGETFQPFELAFGLRKNSPFKNLVDTFMLGIREQGVISELYAKYENQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor kainate-like protein
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
source organism Pleurobrachia bachei
total genus 81
structure length 249
sequence length 254
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zdmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zdmA02
4FAJA 1P1NA 5JK4A 3VVEA 5CMCA 4XKRA 1B51A 3OO7A 2DE2A 4JSOA 1XHYA 2PT1A 4ZS9A 2OZZA 2RC7A 5ITOA 3FJMA 4THIA 4X9TA 3PUWE 3KGCA 1IXIA 3IO4A 3L6HA 4PE5B 5AA3A 4QSCA 2PYYA 1MXXA 3FVKA 2XX8A 3L6GA 3QAXA 1QUKA 4MF3A 3SEVA 4GD5A 1J1NA 3S4UA 5H8FA 1BKAA 5L9MA 3W9WA 2F7BA 3HV1A 1YAEA 4AQ4A 3VDFA 4ESWA 2E0SA 1FW0A 2O6AA 1MY4A 3FD3A 1OVBA 4EF2A 5CM6A 1MPCA 4ZE9A 3C36A 2Y7WA 3KN3A 4OEUA 4PQJA 1OLAA 4PFTA 3B6TA 3MZBA 4QFOA 5B7DA 1MG1A 1QULA 2PVUA 2QL3A 1FQAA 4JWOA 4DIGA 4QFNA 2D5WA 4QRZA 3OEMA 1PBQA 1MY2A 1RYOA 1Y4TA 1ZJLA 4M1VA 4FATA 4F1VA 4F39A 2H9BA 1OLCA 3SESA 3W9VA 1PB9A 1GTKA 1A7LA 4NF4A 4HCWA 3TZAA 4NEDA 4KQPA 5EHSA 4DXCA 1NH7A 5BWJA 4KR5A 1SW5A 1QKAA 1A40A 5H8HA 2H25A 1P1UA 5DVIA 3UA8A 2O1LA 4C1UA 1EZOA 1MQGA 4M4GA 3TTKA 4ELQA 4U22A 5AA2B 2G93A 2XXQA 1OVTA 4OFLA 4FECA 4YMBA 1A54A 2P1SA 3G3HA 1Y3PA 2YLNA 2DXYA 3PUZE 2I58A 5K2XA 3OD7A 2P0SA 4KYSA 2ESNA 2QS3A 4BDOA 1N04A 4GFRA 4NMYA 4OVJA 3RN8A 1O7TA 3JZJA 1FTMA 4FORA 1VE4A 5ICTA 4U2RA 1VFDA 3ZKLA 1MQJA 5B70A 3UK4A 3LSXA 1D3KA 1VSOA 3QIMA 5ITPA 3IJOB 2DE3A 3EN3A 2XX9A 4F2OA 4DCYA 1NFTA 3D4GA 2F34A 2HAVA 3C32A 3QXMA 1MH3A 1Q1KA 2DWAA 2GHBA 5F7VA 4U1ZA 3Q26A 4I62A 1A55A 3TAJA 3FVNA 1YPNA 1SW1A 1MPBA 3VLUA 1MH4A 4NF6B 1MDP1 3QUJA 4R74A 5JTYB 2F6GA 3PUVE 4GIZA 1B1XA 4G2ZA 2DYXA 3CR9A 3O2AA 2I6EA 1N3WA 2XXXA 3FV1A 3MVXA 5EYFA 2Q2AA 2AIXA 1IITA 4DLDA 4F3SA 5KZTA 3OO9A 3A3UA 5I2NA 4YB7A 4GOTA 3ZSFA 4GLIA 3RTFB 4YKKA 4ELPA 3PV0E 4AB6A 4OESA 2ZYKA 3FXUA 4HW8A 4Z0IA 3HPIA 4R9FA 1MY1A 4ZEIA 1B3EA 5AA4A 2CMOA 3Q25A 5I57B 3MWBA 2R71A 2O69A 5DEXA 2RCBA 2A5TB 3IB2A 2Y7KA 1DTGA 3R26A 3RUMA 4OWDA 1O64A 4IO4A 2X26A 3HHFA 3VV5A 5I56A 2HXWA 2B3FA 3KOTA 2Q2CA 2UVJA 1GV8A 3FZVA 4ELOA 5H8NB 1B46A 3K4UA 3ODBA 4WEPA 1H43A 4EQ9A 1FTJA 1JVXA 1S9TA 3TDJA 3LSLA 4R2BA 3VE1B 3PUXE 1LLSA 1URSA 2I0CA 3H6UA 3V89B 3LR1A 1XOCA 1VFEA 4NTLA 3OXNA 2V3QA 3DM0A 3S2VA 2OK2A 4E0XA 2UYFA 4Q0CA 2A5SA 2F8DA 1Y1ZA 4QFKA 4OMBA 3H6TA 2DE4A 3K02A 1QVSA 3ILUB 2PBWA 2QSXA 3ONMA 1FQCA 1B5JA 2RINA 5I2KA 2HQ0A 5DYHA 1H45A 3IB1A 1SI0A 2RC8A 4ECFA 1FQDA 1HSLA 1UTBB 3QUFA 5CBSA 2ONSA 4U4SA 2XX7A 4ZEFA 3SEXA 1OQHA 4XTCQ 4RK2A 4GXSB 4YKPA 3DP6A 3M3FA 2GFEA 1L5TA 3HN0A 1MQIA 5FHMA 3O97A 1CB6A 3FASA 3SEUA 1MY0A 4GXAA 4XKPA 2X7PA 3CI8A 3PMWA 5CMKA 3N26A 1NL5A 4YMAA 1EH3A 3WAEA 5FHNA 3T9VA 3O6IA 2O51A 3TQLA 3HO7A 1H3DA 3BBRA 3TPAA 4RPOA 5DT6A 1B7UA 2P2AA 3IOTA 1NMUA 3IX1A 2V3TA 3SEWA 3S9NC 3CG3A 4ND9A 3UIFA 2I4CA 1I69A 4N13A 2XD3A 5A5XB 4LA9A 3OENA 5KCJB 4P0GA 2VP1A 1LFHA 5BUUA 2ALUA 1JW4A 4F2QA 3DP4A 4GL0A 1Y4CA 2B65A 1OQGA 3QYTA 4R6KA 1MY3A 1B7ZA 1T0KA 1B3GA 4JBZA 2Q89A 4EXLA 1MPDA 1P99A 1XT8A 1JNFA 3D4CA 5TPAA 2F97A 4F19A 2AYSA 3O28A 4LZ5A 1UTHA 3PPNA 3Q27A 1ZTYA 2KLFA 3H6VA 4PFWA 1CE2A 1QUIA 3MUQA 3PMVA 3PPRA 4LQ2A 5CMMA 4GVOA 2HZLA 1SW2A 5FTHA 1ANFA 5H8FB 1IZ1A 1XC1A 3T9HB 4FJPA 3RQTA 4I1DA 4QF9A 4IGTA 1AMFA 1B6HA 5AA1A 5M2VA 2QS1A 4ZEBA 3H03A 1B40A 4MH5A 3H7MA 4L17A 1O63A 2I4BA 4F18A 1EZPA 1AOVA 3RY3A 1B4ZA 4OFOA 1HSEA 3KFMA 1Y3QA 4RA1A 3RNNA 3B7DA 3OMBA 3S9EA 4LP2B 1P1OA 4U1OA 3K1MA 1Q35A 1LBCA 4RK9A 2RCAA 3U94A 2G29A 1B2HA 4TOZA 3PGFA 4H8IA 4YB6A 4KCDA 1MXUA 1NNKA 3GBBA 3IO6A 3T96B 2F78A 4POWA 1AL3A 3TELA 2I49A 2HAUA 5I59A 4IO2A 3AXFA 3HSTA 4QSDA 3IORA 3E3KA 5I58B 4BDLA 4EXKA 5F1QA 2THIA 3B6QA 1LFIA 1QKBA 2O68A 1IIWA 1B52A 4PFYA 5H8HB 1TXFA 3OEKA 4KYEA 4KYDA 2Z8FA 3I6VA 3PU5A 5EHMA 4F3PA 1AH5A 1JVYA 1A8EA 5JEIA 3G3JA 4N07A 4R6HA 4DZ1A 1MXYA 1PBPA 3K6WA 4XKNA 5L9SA 3TYHA 3V83A 2VD3A 3PD9A 3CFLA 1ZLQA 3CRBA 2HFBA 2VD2A 2GHAA 1B7HA 2ANJA 4FEDA 1MM7A 3T9XB 4RXLA 4POXA 3PD8A 1R6ZA 1QUJA 1Y3NA 3EPEA 2VHAA 3FJGA 3ZS6A 2IA4A 1DSNA 3T93B 4O3AA 4H5GA 3O6GA 4QFPA 5ELVA 4JWXA 3SERA 3S9MC 4BDRA 5AA2A 1JQFA 2NXOA 3PPQA 1M5CA 3MZ9A 1DPPA 5HM4B 2AL4A 1I6BA 2H4IA 1RYXA 4WEDA 3UGWA 1F9BA 1FTLA 2UXAA 4JDFA 2DQVA 5DVFA 1M5EA 3LSWA 3KEIA 1N84A 3M3LA 1ZMGA 1B3FA 3K6VA 4IO7A 1SYHA 3MAMA 5K2YA 4IO6A 1R1NA 3N6TA 3IOUA 3N5LA 1B3LA 1MXVA 3G3FA 3I3VA 4E0WA 1D4NA 2Y7RA 4HTGA 3Q28A 3VLVA 4HS7A 4ZZAA 5I84A 1SD3A 4LONB 4GRKA 1LAHE 3BFUA 3K6UA 5DEXB 4Q8RA 1II5A 3PMXA 3CSBA 3SDFA 2Q88A 4YU0A 3KJTA 5I56B 2Y7PA 1RKMA 4R73A 3USDA 1BLFA 2Y7IA 3BKIB 3OSRA 2DWJA 4H65A 4F3BA 1PB7A 3F11A 2UVGA 1IXCA 2OBGA 3TCHA 3KZGA 3E13X 3RPWA 1LAFE 1Y20A 3MP1A 2ZXTA 1FCKA 1IQ7A 1N76A 2ZYMA 3EQ1A 2HCAA 1R9QA 3ILTB 3MZ1A 1US5A 3O66A 3C31A 1GGGA 3CG1A 3FXRA 2F5XA 2A5TA 1B32A 3K00A 3MP6A 5ICQA 2QJEA 4UA8A 2F7AA 3LC8A 3DELB 1AIVA 2VOZA 4GL8A 2ABHA 1QW0A 4IO3A 1Y1MA 4MLVA 5H8NA 2FA7A 3FUZA 3OSQA 4UACA 3B6WA 2Q8JA 1XVYA 2Z22A 1UIVA 3G3KA 1PB8A 1DOTA 4KCCA 3WAFA 3GBAA 4X1DA 1MS7A 4NE4A 2XXTA 1YCJA 1P1QA 2VGQA 3U1OA 5KDTA 1LB9A 3O29A 3KSXA 1USYE 2XHDA 3G3GA 2H99A 4DCXA 3SETA 4IB2A 3MVWA 3K1PA 4NF5B 4F22A 3K6XA 2NOOA 4U21A 2WKYA 4OYVA 2ZMBA 4OZ9A 3VXCA 3E9XA 2V25A 1B05A 4RY1A 1URDA 4H5FA 1SW4A 2FYIA 2I48A 4P11A 2CZLA 4IGRA 4EQBA 1XVXA 2R6GE 3T66A 3RTWB 4Q30B 4MBPA 2DXRA 4R2FA 3H6WA 2X7QA 1JEUA 3FGSA 2QPQA 3QK6A 3N6UA 1LGBC 4QHQA 1R9LA 1P1WA 2Y84A 4OHNA 3MVYA 4ELRA 2XXHA 4WKMA 2ZNSA 3RT8A 4NF8B 1JEVA 3CSGA 1MRPA 2F6PA 4R6YA 4YAHX 4DDDA 2V93A 3GLBA 5H8QA 2F35A 2OCUA 3FATA 2ZYNA 4F31B 4BDMA 4OENA 4G68B 1I6AA 1S50A 3BFTA 3JYRA 3K1NA 5TP9A 4QFLA 1MXWA 3TUSA 1KWHA 3K01A 3LBSA 4BDNA 2NWJA 3ZKKA 4TLMB 2HEUA 1D9YA 1B1HA 2OWSA 1MXZA 2E1SA 3UN6A 5A5XA 4JWYA 5IAIA 4C1TA 2R9JA 1LBBA 1JW1A 2DSFA 1FQBA 3HCQA 4MFIA 2YPNA 4KPTA 5TU0A 3TTMA 2RKMA 4LZ8A 1SYIA 4OQOA 4DXBA 5FTIA 3MPLA 1N0TA 4JXIA 1WVJA 4R9GA 3M3KA 5L9OA 5DTBA 1OMPA 1JETA 3QSLA 1IEJA 3U93A 4I9DA 1N7XA 1DPEA 1B4HA 2QMWA 2GRVA 4OETA 5CI5A 2HZKA 3R7XA 5J1DA 2XXIA 3OELA 3KG2A 4GWOA 3CFZA 2BJJX 3LUYA 4RJZA 2V3UA 3RLFE 4G77A 3H06B 5CBRA 3LSFB 4ESXA 1MQDA 3G7WA 5I59B 2XD2A 4C0RA 4LUBA 2H98A 1UQWA 2M8CA 2QMXA 4H67A 3ECRA 3C33A 3OO8A 3PUYE 2OLBA 2B3BA 1IXGA 4LATA 3T22A 1LFGA 4G4PA 2AL5A 2DWHA 4NF4B 4IY5A 4ZDMA 3KOSA 3TCFA 1FQEA 1MM6A 3C34A 1ZIUA 4ONYA 4MLQA 2XXVA 4R75A 5L8DA 3K2DA 3C35A 5HBCA 2ZYOA 2O7IA 3MPKA 1TFAA 3DLNA 5FHOA 4WXJA 3A3CA 4G8NA 4TQUQ 3M8UA 4N6PA 1MQHA 1LAXA 1GVCA 5I58A 4FE8A 1POY1 3SEYA 1ELJA 3PPPA 2NUVA 3PPOA 3IOWA 4OEVA 4PFUA 1S7YA 3MW0A 4H8JA 2XXWA 3FV2A 4PETA 4NWDA 4OTEA 1SBPA 3O9PA 1PDAA 3FJ7A 4LQ5A 4KHZE 1B58A 3THIA 2D3IA 2ONKE 4ZECA 2IEEA 1B9JA 1H76A 1LCFA 4OERA 3GZGA 4ZZEA 3A09A 1NNPA 4XIGQ 4ZEDA 4R72A 2W7YA 1DMBA 1TFDA 2LAOA 2O1MA 3TTRA 3FIRA 1B5HA 1TWYA 1SDXA 1NNTA 3E4RA 1B0LA 1US4A 4OXVA 5I2NB 2XXPA 1NKXA 4LZ7A 1PC3A 4ZEKA 1FTOA 2I0BA 3TEPA 1B5IA 3U8QA 3T9UA 3TQWA 2Z8DA 5HPQA 3H3GA 4IY6A 5AA4B 4H0WA 1FTKA 2QS4A 3KBRA 4YKJA 1A8FA 3R6UA 1NH8A 4DXUA 3TCGA 2UVHA 4ISUA 2DWIA 4EF1A 1WDNA 5IKBA 3U72A 4NF6A 1Z7NE 1NNFA 5JTYA 1Z7ME 1B3HA 3P7IA 4RYAA 2UYEA 1LSTA 3FXQA 4LVQA 3TMGA 3IJXB 2H5YA 4K3FA 2OWTA 4Q5TA 3FVOA 3IOVA 1GR2A 3IL1B 4YB5A 4YKIA 4EQ7A 1VR5A 1TT1A 1OIBA 1USYH 1BTJA 3H4ZA 4F3GA 4QSEA 2NVUB 4KFQA 4U4XA 3JV9A 5AA2D 2ONRA 5CMBA 3KN7A 3KSJA 1JW5A 2QS2A 1YTVA 4F1UA 1IXHA 4YZZA 5I57A 3VVDA 3Q29A 1M5DA 4YICA 2UVIA 1BIYA 3C4MA 3VXBA 1QJMA 2XXYA 3I5OA 5I2KB 1M5FA 1PEBA 3IR1A 2I3WA 3FVGA 1A99A 1SI1A 3UORA 3C9HA 2PMSA 4H6DA 3KN8A 4H1XA 5KDTB 1LB8A 3MVZA 2XXRA 4F1YA 2F7CA 1FQFA 4EUOA 3SKPA 1EU8A 4IO5A 4P0IA 3W15C 4PP0A 4RPNA 4NWCA 3O6HA 4HCYA 1LCTA 4FEBA 3V8XB 2GH9A 4BLAA 3G3IA 3S9LC 3K0VA 3UP9A 3RGYA 2REGA 2RC9A 3TKDA 4ZE8A 4G8HA 4DE8A 2DVCA 1SVXB 4GF8A 4O3CA 5DVJA 2REJA 2DP8A 5H8SA 3TTLA 2YJPA 4G68C 1ZU0A 1BP5A 1SQYA 4TLLB 2FNCA 1WODA 3IK6B 3V5AA 3IB0A 1N3XA 3IAZA 1IUDA 4JB7A 4U23A 2RF1A 2OJTA 3RT6B 4KD5A 1UTBA 2DVZA 3CIJA 4GQOA 1B0HA 4AB5A 4JSDA 3N94A 1Y9UA 2I3VA 2O84X 4X1BA 4BDQA 4NF5A 5LOMA 1HSJA 5AE4A 2PX1A 4I8CA 2PT2A 1ATGA 3MP8A 5H8QB 3OOAA 4XKQA 1ZKBA 3TODA 2QRYA 5TP9B 5ISUA 1MDQA 5TPAB 3TTNA 3EHUA 1D9VA 1UTHB 4FIMA 4XXUA 3MC2A 4OFJA 3TFLA 4Z7EA 2Z23A 1H44A 2Q9TA 3EF7A 1I6QA 2Z8EA 1M5BA 3U92A 1POTA 2DS9A 1URGA 1UIUA 2V84A 2ZNTA 2DOJA 4EDPA 3VLWA 3VFJA 3MJNA 1ZBMA 2ZNUA 3CVGA 3MBPA 3MQ9A 5CC2A 3EHSA 1LAGE 4NF8A 5KCJA 4X48A 1EZ9A 4RNSA 3GXAA 3DP8A 1N7WA 3EHTA 3OO6A 2D21A 2XXUA 3VVFA 3CFXA 1DTZA 1XS5A 5CRYA 3HHGA 4O3BA 4G8MA 3KJ7A 4F29A 4KI0E 2O7UA 4G68A 2F36A
chains in the Genus database with same CATH superfamily
4FAJA 1P1NA 5JK4A 3VVEA 5CMCA 4XKRA 1B51A 3OO7A 2DE2A 4JSOA 1XHYA 2PT1A 4ZS9A 2OZZA 2RC7A 5ITOA 3FJMA 4THIA 4X9TA 3PUWE 3KGCA 2FVZA 1IXIA 3IO4A 3L6HA 4PE5B 5AA3A 4QSCA 2PYYA 1KZ8A 1MXXA 3FVKA 2XX8A 3L6GA 3QAXA 1QUKA 4MF3A 3SEVA 4GD5A 1J1NA 1NV1A 3S4UA 5H8FA 1BKAA 5L9MA 3W9WA 2F7BA 3HV1A 3CHGA 4QXDA 1YAEA 4AQ4A 3VDFA 4ESWA 2E0SA 1FW0A 2O6AA 1MY4A 3FD3A 3PTYA 1OVBA 5I3SA 4EF2A 5CM6A 1D9QA 1MPCA 4ZE9A 3C36A 2Y7WA 3KN3A 4OEUA 4PQJA 1OLAA 4PFTA 3B6TA 3MZBA 4QFOA 5B7DA 1MG1A 1QULA 2PVUA 2QL3A 1FQAA 4JWOA 4DIGA 4QFNA 2D5WA 2JJKA 4QRZA 3OEMA 1PBQA 1MY2A 1RYOA 1Y4TA 1ZJLA 4M1VA 4FATA 4F1VA 4F39A 2H9BA 1OLCA 3SESA 3W9VA 4X8RA 4PFRA 4JVCA 1IMBA 1PB9A 1GTKA 4OVPA 1A7LA 4NF4A 4HCWA 3TZAA 4NEDA 4KQPA 5EHSA 4DXCA 1NH7A 5BWJA 4HE1A 4KR5A 1SW5A 1QKAA 1A40A 5H8HA 2H25A 1P1UA 5DVIA 3UA8A 1FBEA 2O1LA 4C1UA 1EZOA 1MQGA 4M4GA 3TTKA 4ELQA 4U22A 5AA2B 2G93A 2XXQA 1OVTA 4OFLA 4FECA 4YMBA 2XWIA 1A54A 2P1SA 3G3HA 1Y3PA 1JP4A 2YLNA 2VT5A 2DXYA 3PUZE 4O7MA 2I58A 5K2XA 3OD7A 2QVRA 2P0SA 4KYSA 2F3DA 2ESNA 4PGNA 2QS3A 4BDOA 1N04A 4GFRA 4MMPA 1LBZA 4NMYA 4OVJA 3RN8A 1O7TA 3JZJA 1FTMA 4FORA 1VE4A 4PTKA 5ICTA 4U2RA 1VFDA 3ZKLA 1MQJA 4GX3A 5B70A 3UK4A 3LSXA 1D3KA 3KBZA 1VSOA 3QIMA 5ITPA 3IJOB 2DE3A 3EN3A 2XX9A 4F2OA 4DCYA 4N4UA 1NFTA 3D4GA 2F34A 2HAVA 3C32A 3QXMA 3T0JA 1MH3A 1Q1KA 2DWAA 2GHBA 2Q74A 5F7VA 4U1ZA 3Q26A 4I62A 1A55A 3TAJA 3FVNA 1YPNA 4PFIA 1SW1A 1MPBA 1NV2A 1NV5A 4OVRA 4NF6B 1MH4A 3VLUA 1MDP1 3QUJA 4R74A 1EYJA 5JTYB 2F6GA 3PUVE 4GIZA 1B1XA 1NUWA 4G2ZA 2DYXA 3CR9A 3O2AA 4GX6A 2I6EA 1N3WA 2XXXA 3FV1A 3MVXA 5EYFA 2Q2AA 2AIXA 1IITA 4DLDA 4F3SA 2Y5LA 5KZTA 3OO9A 3A3UA 5I2NA 4YB7A 4GOTA 3ZSFA 5T3JA 4GLIA 3RTFB 2OWZA 4MNPA 4YKKA 4ELPA 3PV0E 4AB6A 4OESA 2ZYKA 3FXUA 4HW8A 4Z0IA 3HPIA 4R9FA 1MY1A 4ZEIA 1B3EA 5AA4A 2CMOA 3Q25A 5I57B 3MWBA 2R71A 2O69A 5DEXA 2RCBA 2A5TB 3IB2A 2Y7KA 1DTGA 3R26A 3EKIA 3RUMA 4OWDA 1O64A 4IO4A 2X26A 3HHFA 3VV5A 3IFCA 5I56A 2HXWA 1FTAA 2B3FA 3KOTA 2Q2CA 2UVJA 4HE2A 1GV8A 3FZVA 4ELOA 5H8NB 1B46A 4O7IA 3K4UA 3ODBA 4WEPA 1H43A 4EQ9A 1FTJA 1JVXA 1S9TA 3TDJA 3LSLA 4R2BA 3VE1B 3PUXE 1LLSA 1IMAA 1URSA 2I0CA 3H6UA 3V89B 3LR1A 4DI3D 1XOCA 1VFEA 4NTLA 3OXNA 1NV3A 2V3QA 3DM0A 3S2VA 2OK2A 4E0XA 2UYFA 1FBCA 4Q0CA 2A5SA 2F8DA 1Y1ZA 1FRPA 4MAGA 4QFKA 4OMBA 3H6TA 2DE4A 3K02A 1QVSA 5EQ9A 3ILUB 2PBWA 2QSXA 5I7IA 3ONMA 1FQCA 2VPOA 1B5JA 2RINA 5I2KA 4GWXA 2HQ0A 5DYHA 1H45A 3IB1A 5F24A 1SI0A 3T1BA 2RC8A 4ECFA 1FQDA 1HSLA 1UTBB 3QUFA 5CBSA 2ONSA 4U4SA 2XX7A 4ZEFA 3SEXA 1VDWA 1OQHA 4XTCQ 4RK2A 4GXSB 4YKPA 2R8TA 3DP6A 2BJIA 3M3FA 2GFEA 1L5TA 3HN0A 1MQIA 5FHMA 3O97A 1CB6A 3FASA 3HFUA 3SEUA 4MNCA 1MY0A 4GXAA 2XWVA 4XKPA 2X7PA 3CI8A 1FBDA 3PMWA 4PDHA 1AWBA 5CMKA 4NF0A 3N26A 1NL5A 4N91A 4YMAA 1EH3A 3WAEA 5FHNA 3T9VA 3O6IA 2O51A 1EYIA 3TQLA 3HO7A 1H3DA 3BBRA 3TPAA 4RPOA 5DT6A 1B7UA 4AS5A 5LTCA 2P2AA 3IOTA 1NMUA 3IX1A 2V3TA 3SEWA 3S9NC 2QVUA 3CG3A 4NN3A 4ND9A 3UIFA 3B50A 2I4CA 1I69A 4HXVA 4N13A 2XD3A 1RDZA 5A5XB 4LA9A 3OENA 5KCJB 4MEVA 4P0GA 2VP1A 1LFHA 5BUUA 1JW4A 2ALUA 4O94A 4F2QA 3DP4A 4GL0A 1Y4CA 5EYHA 2B65A 1OQGA 3QYTA 4R6KA 1MY3A 1B7ZA 1T0KA 1B3GA 4JBZA 4GX4A 2Q89A 4GWYA 4NX1A 4EXLA 1MPDA 1P99A 1XT8A 2XWKA 1JNFA 3D4CA 5TPAA 2F97A 4F19A 2AYSA 3O28A 4LZ5A 1UTHA 3PPNA 3Q27A 3RYDA 4N8GA 4JVDA 4QBAA 4KXPA 1ZTYA 4PAKA 2KLFA 3H6VA 4PFWA 1QUIA 1CE2A 3MUQA 3PMVA 4LN5A 2CZKA 3PPRA 4LQ2A 5CMMA 4GVOA 4H45A 4MNIA 2HZLA 1SW2A 1NUYA 5FTHA 1ANFA 5H8FB 1IZ1A 1XC1A 3T9HB 4FJPA 2MKZA 3RQTA 5I5PA 4DI4B 3ISPA 4I1DA 4QF9A 4IGTA 1AMFA 1B6HA 5EQ8A 5AA1A 5M2VA 2QS1A 4ZEBA 3H03A 1B40A 3NOHA 4MH5A 3H7MA 2WBBA 4L17A 1O63A 2I4BA 1XI6A 3ROJA 4F18A 1EZPA 4FBPA 1AOVA 3RY3A 1B4ZA 4OFOA 1HSEA 3KFMA 1Y3QA 1IMFA 4GWUA 4RA1A 3RNNA 3B7DA 2WYKA 3OMBA 3S9EA 2WYPA 3SZPA 4P9KA 4LP2B 4O8MA 1P1OA 4U1OA 3K1MA 1Q35A 1LBCA 4RK9A 2RCAA 3U94A 2G29A 1B2HA 4TOZA 3PGFA 4H8IA 4YB6A 5ET7A 1CNQA 4NQ8A 2ZZWA 4KCDA 1MXUA 1NNKA 3GBBA 3IO6A 3T96B 2XWOA 2F78A 4POWA 1AL3A 3TELA 2I49A 3E79A 2HAUA 5I59A 4IO2A 3AXFA 3HSTA 4QSDA 3IORA 3E3KA 5I58B 4BDLA 4EXKA 5F1QA 2THIA 3B6QA 1LFIA 1QKBA 2O68A 1IIWA 1NV6A 1B52A 4PFYA 5H8HB 1TXFA 3OEKA 1LBWA 4KYEA 4KYDA 2Z8FA 3I6VA 3PU5A 5EHMA 4F3PA 1AH5A 1JVYA 1A8EA 2PFYA 5JEIA 3G3JA 4N07A 4R6HA 4DZ1A 1MXYA 1PBPA 3K6WA 4P47A 2HHMA 4XKNA 5L9SA 3TYHA 3V83A 2VD3A 3PD9A 3CFLA 1LEVA 1ZLQA 3CRBA 2HFBA 2VD2A 1NV7A 1FPIA 2GHAA 1B7HA 2ANJA 3KC0A 4FEDA 1MM7A 3T9XB 4RXLA 4POXA 3PD8A 2XA5A 2FHYA 1R6ZA 1QUJA 2L5VA 1Y3NA 3EPEA 2VHAA 3FJGA 3ZS6A 2IA4A 1DSNA 5ESYA 3T93B 4O3AA 4H5GA 3O6GA 4QFPA 5ELVA 4PCDA 4JWXA 3SERA 3S9MC 4MHFA 4BDRA 5AA2A 1JQFA 1NUZA 2NXOA 3PPQA 1M5CA 2FIEA 3MZ9A 1DPPA 5HM4B 5LDZA 1I6BA 2AL4A 2H4IA 2P3VA 1RYXA 4WEDA 3UGWA 1F9BA 5IZ1A 1FTLA 2UXAA 4JDFA 2DQVA 5DVFA 1M5EA 3RPLB 3LSWA 4JVIA 3KEIA 1N84A 3M3LA 1ZMGA 1B3FA 3K6VA 4IO7A 1SYHA 5DW8A 3MAMA 5K2YA 4IO6A 4PFBA 1R1NA 3N6TA 3IOUA 3N5LA 1B3LA 1MXVA 5A5LA 3G3FA 3I3VA 4E0WA 1D4NA 2Y7RA 4HTGA 1FPLA 1SPIA 1QGXA 3Q28A 3LUZA 3VLVA 4HS7A 4ZZAA 5I84A 1SD3A 4LONB 4GRKA 4P56A 1LAHE 3BFUA 3K6UA 4MJOA 5DEXB 1FJ9A 4Q8RA 1II5A 3PMXA 4XEQA 3CSBA 3SDFA 2Q88A 1IMCA 1K9ZA 4IR8A 4YU0A 3KJTA 4I40A 5I56B 1YXIA 2Y7PA 1RKMA 4R73A 3USDA 1BLFA 2Y7IA 3BKIB 3OSRA 2DWJA 4H65A 4F3BA 1NUXA 1PB7A 2XXKA 3F11A 2UVGA 1IXCA 2OBGA 2WBDA 3TCHA 3KZGA 4N15A 3E13X 4PE3A 3RPWA 1INPA 4GWSA 1LAFE 4PDDA 1Y20A 3MP1A 2ZXTA 1FCKA 1IQ7A 1N76A 2ZYMA 3EQ1A 2HCAA 1R9QA 3ILTB 3MZ1A 4P8BA 1US5A 3O66A 3C31A 1GGGA 3CG1A 3FXRA 2F5XA 2A5TA 1B32A 3K00A 3MP6A 4OA4A 1DCUA 2QJEA 5ICQA 4UA8A 2F7AA 3LC8A 3DELB 1AIVA 2VOZA 4GL8A 4NAPA 2ABHA 1QW0A 4IO3A 1Y1MA 4MLVA 5H8NA 2FA7A 3FUZA 3OSQA 4X04A 4UACA 3B6WA 2Q8JA 1XVYA 2Z22A 1UIVA 3G3KA 1FPGA 4OANA 1PB8A 1DOTA 4KCCA 3WAFA 3GBAA 4X1DA 1MS7A 4NE4A 1DK4A 2XXTA 1YCJA 1P1QA 2VGQA 3U1OA 5KDTA 4PBHA 1LB9A 3O29A 3KSXA 1USYE 2XHDA 3G3GA 4UABA 2H99A 4DCXA 3SETA 4IB2A 3MVWA 3K1PA 4NF5B 2B4LA 4F22A 3K6XA 2NOOA 4U21A 2WKYA 4OYVA 2OX3A 2ZMBA 4OZ9A 3VXCA 3E9XA 2V25A 1B05A 4RY1A 1URDA 3MSTA 1SW4A 4H5FA 5FBPA 2KQZA 2FYIA 2I48A 4P11A 2CZLA 4IGRA 4EQBA 1XVXA 2R6GE 3T66A 3RTWB 3BIGA 2KR0A 4Q30B 4MBPA 2DXRA 4R2FA 3H6WA 5IGAA 4PC9A 2X7QA 1JEUA 3FGSA 2QPQA 3QK6A 1FBPA 3N6UA 1Q9DA 1LGBC 4QHQA 1R9LA 1P1WA 2DDKA 2Y84A 4OHNA 3MVYA 3GYYA 4ELRA 2XXHA 4WKMA 2ZNSA 4PF8A 3RT8A 4NF8B 2FIXA 1JEVA 3CSGA 1MRPA 2F6PA 4R6YA 4YAHX 2Y5KA 4DDDA 2V93A 3GLBA 1NV4A 5IZ3B 5H8QA 2F35A 2OCUA 3FATA 5IM2A 2ZYNA 4F31B 4BDMA 4AS4A 4OENA 4G68B 1I6AA 1S50A 3BFTA 3JYRA 3K1NA 5TP9A 4QFLA 1MXWA 3TUSA 1KWHA 3K01A 5EQ7A 3LBSA 4BDNA 2NWJA 3ZKKA 4TLMB 2HEUA 1FPFA 1D9YA 1B1HA 2OWSA 1MXZA 2E1SA 3UN6A 5A5XA 4JWYA 5IAIA 2Q8MA 4C1TA 2R9JA 1LBBA 1LBVA 1JW1A 2DSFA 1FQBA 3HCQA 4P1LA 4MFIA 2YPNA 4KPTA 5TU0A 1FPDA 3TTMA 2RKMA 4LZ8A 3FBPA 1SYIA 4OQOA 4DXBA 5FTIA 1K9YA 3MPLA 1N0TA 2CEYA 4JXIA 1WVJA 4R9GA 2HPGA 3M3KA 2B4MA 4HE0A 5ET8A 5L9OA 5DTBA 1NI9A 2F3BA 1OMPA 1JETA 3QSLA 1IEJA 3U93A 4I9DA 2PFZA 1N7XA 1DPEA 1B4HA 2QMWA 2GQ1A 2GRVA 4OETA 5CI5A 2HZKA 3R7XA 5J1DA 2XXIA 3OELA 3KG2A 4GWOA 3CFZA 2BJJX 3LUYA 1RDYA 2V3UA 4RJZA 3RLFE 4G77A 3H06B 5CBRA 1FPKA 3LSFB 3IFAA 4ESXA 1MQDA 3G7WA 5I59B 2XD2A 4C0RA 1FSAA 4LUBA 2H98A 1UQWA 2M8CA 2QMXA 4H67A 3ECRA 3C33A 3OO8A 4N81A 3PUYE 2OLBA 2B3BA 1IXGA 4LATA 4PGPA 3T22A 4GWWA 1LFGA 4G4PA 1YYZA 3QMFA 2AL5A 2DWHA 4NF4B 4IY5A 4ZDMA 3KOSA 3TCFA 1FQEA 1LBYA 1MM6A 3C34A 4N17A 1ZIUA 5EYGA 2QVVA 4ONYA 4MLQA 2XXVA 4R75A 5L8DA 3K2DA 3C35A 5HBCA 2ZYOA 5ET6A 2O7IA 3MPKA 1TFAA 3DLNA 5FHOA 4WXJA 3A3CA 4G8NA 4TQUQ 3M8UA 4N6PA 4I3YA 1RDXA 1MQHA 1LAXA 4OVTA 1G0IA 1GVCA 4GBVA 1NV0A 5I58A 4FE8A 1POY1 3SEYA 1ELJA 3PPPA 2NUVA 4N8YA 3PPOA 3IOWA 1EYKA 4OEVA 4PFUA 1S7YA 3MW0A 4H8JA 2HXRA 2XXWA 3FV2A 4PETA 4NWDA 4OTEA 1SBPA 4PBQA 1FPEA 3O9PA 1PDAA 3FJ7A 4LQ5A 4I3EA 4KHZE 1B58A 1FJ6A 3THIA 2D3IA 4MCOA 2ONKE 4ZECA 1FPBA 2IEEA 1B9JA 1H76A 1LCFA 4OERA 3GZGA 4ZZEA 3A09A 1NNPA 4XIGQ 4ZEDA 4R72A 2W7YA 1DMBA 1TFDA 2P3NA 2LAOA 2O1MA 3TTRA 3FIRA 1B5HA 1TWYA 1SDXA 1NNTA 3E4RA 1B0LA 1US4A 4OXVA 4NGUA 2V4CA 5I2NB 2XXPA 1NKXA 4LZ7A 1PC3A 4ZEKA 1FTOA 4G61A 2I0BA 3TEPA 1B5IA 3U8QA 3T9UA 3TQWA 2VPNA 2Z8DA 5EQAA 5HPQA 3H3GA 4IY6A 5AA4B 4H0WA 1FTKA 2QS4A 3KBRA 4YKJA 1A8FA 3R6UA 1NH8A 4DXUA 3TCGA 2UVHA 4ISUA 3RPLA 1YZ0A 2DWIA 4EF1A 2WX9A 1WDNA 5IKBA 3U72A 4NF6A 1Z7NE 1NNFA 5JTYA 1Z7ME 1B3HA 2FBPA 3P7IA 1KA1A 4RYAA 2UYEA 1LSTA 3MYUA 2CZHA 3BIHA 3D1RA 3FXQA 4LVQA 3TMGA 3IJXB 2H5YA 4K3FA 2OWTA 4Q5TA 3FVOA 3IOVA 4NHBA 1GR2A 3IL1B 4YB5A 4YKIA 1FBGA 4EQ7A 1VR5A 5IZZA 1TT1A 1OIBA 1USYH 1BTJA 3H4ZA 4QSEA 4F3GA 2NVUB 4KFQA 4U4XA 3JV9A 5AA2D 4OVQA 2ONRA 5CMBA 3KN7A 1FBHA 2ZZVA 3E78A 3KSJA 1JW5A 2QS2A 1YTVA 4F1UA 4MIJA 1IXHA 4YZZA 5I57A 3VVDA 3Q29A 1M5DA 4P3LA 4YICA 2UVIA 4NG7A 1BIYA 3C4MA 3VXBA 1QJMA 2WEFA 2XXYA 3I5OA 5I2KB 1M5FA 1PEBA 3IR1A 2I3WA 2CEXA 3FVGA 1A99A 1SI1A 3UORA 3C9HA 3A29A 1BK4A 2PMSA 3U65A 4H6DA 1DBZA 4P1EA 3KN8A 4H1XA 5KDTB 1LB8A 1IMDA 4GWZA 3MVZA 2XXRA 4F1YA 2F7CA 1FQFA 4EUOA 3SKPA 1EU8A 1LBXA 1IMEA 4IO5A 4P0IA 3W15C 4H46A 4PP0A 4RPNA 4NWCA 3LV0A 3KC1A 3O6HA 4HCYA 4PAIA 1LCTA 4FEBA 4MX6A 2PCRA 3V8XB 2GH9A 1G0HA 3G3IA 4BLAA 3S9LC 3K0VA 3UP9A 3RGYA 2REGA 2RC9A 4PAFA 3TKDA 4ZE8A 4G8HA 4DE8A 2DVCA 1SVXB 4GF8A 4XF5A 4O3CA 5DVJA 2REJA 2DP8A 5H8SA 3TTLA 2YJPA 4G68C 1ZU0A 1BP5A 1SQYA 4TLLB 2FNCA 1WODA 3IK6B 1KA0A 3V5AA 3IB0A 1N3XA 3IAZA 1IUDA 4JB7A 4U23A 2RF1A 2OJTA 3RT6B 2ZZXA 4KD5A 1UTBA 1FBFA 2DVZA 3CIJA 4GQOA 1B0HA 4AB5A 4JSDA 3N94A 1Y9UA 2I3VA 2O84X 4X1BA 4BDQA 4NF5A 5LOMA 1HSJA 4OVSA 5AE4A 2PX1A 4I8CA 2PT2A 1ATGA 3MP8A 5H8QB 3OOAA 4GBWA 4XKQA 3B8BA 1ZKBA 3TODA 2QRYA 5TP9B 5ISUA 1MDQA 5TPAB 3TTNA 4N6DA 3EHUA 1D9VA 1UTHB 2CZIA 4FIMA 4XXUA 3MC2A 4OFJA 4N6KA 4XFEA 3TFLA 4Z7EA 2QFLA 2Z23A 1H44A 1FPJA 2Q9TA 3EF7A 1I6QA 2Z8EA 1M5BA 3U92A 1POTA 2DS9A 1URGA 1UIUA 2V84A 2ZNTA 2DOJA 4EDPA 5ET5A 3VLWA 3VFJA 3MJNA 1ZBMA 2ZNUA 3CVGA 3MBPA 3MQ9A 5CC2A 3EHSA 1LAGE 4NF8A 5KCJA 4X48A 1EZ9A 4RNSA 3GXAA 3DP8A 3FXBA 1N7WA 3EHTA 3OO6A 2D21A 2XXUA 3VVFA 5IZ3A 3CFXA 1DTZA 1XS5A 5CRYA 3HHGA 4O3BA 4PF6A 4G8MA 3KJ7A 4F29A 5J16A 4KI0E 2O7UA 4G68A 2F36A
chains in the Genus database with same CATH topology
4FAJA 1P1NA 5JK4A 3VVEA 5CMCA 4XKRA 1B51A 3OO7A 2DE2A 4JSOA 1XHYA 2PT1A 4ZS9A 2OZZA 2RC7A 5ITOA 3FJMA 4THIA 4X9TA 3PUWE 3KGCA 1IXIA 3IO4A 3L6HA 4PE5B 5AA3A 4QSCA 2PYYA 1MXXA 3FVKA 2XX8A 3L6GA 3QAXA 1QUKA 4MF3A 3SEVA 4GD5A 1J1NA 3S4UA 5H8FA 1BKAA 5L9MA 3W9WA 2F7BA 3HV1A 1YAEA 4AQ4A 3VDFA 4ESWA 2E0SA 1FW0A 2O6AA 1MY4A 3FD3A 1OVBA 4EF2A 5CM6A 1MPCA 4ZE9A 3C36A 2Y7WA 3KN3A 4OEUA 4PQJA 1OLAA 4PFTA 3B6TA 3MZBA 4QFOA 5B7DA 1MG1A 1QULA 2PVUA 2QL3A 1FQAA 4JWOA 4DIGA 4QFNA 2D5WA 4QRZA 3OEMA 1PBQA 1MY2A 1RYOA 1Y4TA 1ZJLA 4M1VA 4FATA 4F1VA 4F39A 2H9BA 1OLCA 3SESA 3W9VA 1PB9A 1GTKA 1A7LA 4NF4A 4HCWA 3TZAA 4NEDA 4KQPA 5EHSA 4DXCA 1NH7A 5BWJA 4KR5A 1SW5A 1QKAA 1A40A 5H8HA 2H25A 1P1UA 5DVIA 3UA8A 2O1LA 4C1UA 1EZOA 1MQGA 4M4GA 3TTKA 4ELQA 4U22A 5AA2B 2G93A 2XXQA 1OVTA 4OFLA 4FECA 4YMBA 1A54A 2P1SA 3G3HA 1Y3PA 2YLNA 2DXYA 3PUZE 2I58A 5K2XA 3OD7A 2P0SA 4KYSA 2ESNA 2QS3A 4BDOA 1N04A 4GFRA 4NMYA 4OVJA 3RN8A 1O7TA 3JZJA 1FTMA 4FORA 1VE4A 5ICTA 4U2RA 1VFDA 3ZKLA 1MQJA 5B70A 3UK4A 3LSXA 1D3KA 1VSOA 3QIMA 5ITPA 3IJOB 2DE3A 3EN3A 2XX9A 4F2OA 4DCYA 1NFTA 3D4GA 2F34A 2HAVA 3C32A 3QXMA 1MH3A 1Q1KA 2DWAA 2GHBA 5F7VA 4U1ZA 3Q26A 4I62A 1A55A 3TAJA 3FVNA 1YPNA 1SW1A 1MPBA 3VLUA 1MH4A 4NF6B 1MDP1 3QUJA 4R74A 5JTYB 2F6GA 3PUVE 4GIZA 1B1XA 4G2ZA 2DYXA 3CR9A 3O2AA 2I6EA 1N3WA 2XXXA 3FV1A 3MVXA 5EYFA 2Q2AA 2AIXA 1IITA 4DLDA 4F3SA 5KZTA 3OO9A 3A3UA 5I2NA 4YB7A 4GOTA 3ZSFA 4GLIA 3RTFB 4YKKA 4ELPA 3PV0E 4AB6A 4OESA 2ZYKA 3FXUA 4HW8A 4Z0IA 3HPIA 4R9FA 1MY1A 4ZEIA 1B3EA 5AA4A 2CMOA 3Q25A 5I57B 3MWBA 2R71A 2O69A 5DEXA 2RCBA 2A5TB 3IB2A 2Y7KA 1DTGA 3R26A 3RUMA 4OWDA 1O64A 4IO4A 2X26A 3HHFA 3VV5A 5I56A 2HXWA 2B3FA 3KOTA 2Q2CA 2UVJA 1GV8A 3FZVA 4ELOA 5H8NB 1B46A 3K4UA 3ODBA 4WEPA 1H43A 4EQ9A 1FTJA 1JVXA 1S9TA 3TDJA 3LSLA 4R2BA 3VE1B 3PUXE 1LLSA 1URSA 2I0CA 3H6UA 3V89B 3LR1A 1XOCA 1VFEA 4NTLA 3OXNA 2V3QA 3DM0A 3S2VA 2OK2A 4E0XA 2UYFA 4Q0CA 2A5SA 2F8DA 1Y1ZA 4QFKA 4OMBA 3H6TA 2DE4A 3K02A 1QVSA 3ILUB 2PBWA 2QSXA 3ONMA 1FQCA 1B5JA 2RINA 5I2KA 2HQ0A 5DYHA 1H45A 3IB1A 1SI0A 2RC8A 4ECFA 1FQDA 1HSLA 1UTBB 3QUFA 5CBSA 2ONSA 4U4SA 2XX7A 4ZEFA 3SEXA 1OQHA 4XTCQ 4RK2A 4GXSB 4YKPA 3DP6A 3M3FA 2GFEA 1L5TA 3HN0A 1MQIA 5FHMA 3O97A 1CB6A 3FASA 3SEUA 1MY0A 4GXAA 4XKPA 2X7PA 3CI8A 3PMWA 5CMKA 3N26A 1NL5A 4YMAA 1EH3A 3WAEA 5FHNA 3T9VA 3O6IA 2O51A 3TQLA 3HO7A 1H3DA 3BBRA 3TPAA 4RPOA 5DT6A 1B7UA 2P2AA 3IOTA 1NMUA 3IX1A 2V3TA 3SEWA 3S9NC 3CG3A 4ND9A 3UIFA 2I4CA 1I69A 4N13A 2XD3A 5A5XB 4LA9A 3OENA 5KCJB 4P0GA 2VP1A 1LFHA 5BUUA 2ALUA 1JW4A 4F2QA 3DP4A 4GL0A 1Y4CA 2B65A 1OQGA 3QYTA 4R6KA 1MY3A 1B7ZA 1T0KA 1B3GA 4JBZA 2Q89A 4EXLA 1MPDA 1P99A 1XT8A 1JNFA 3D4CA 5TPAA 2F97A 4F19A 2AYSA 3O28A 4LZ5A 1UTHA 3PPNA 3Q27A 1ZTYA 2KLFA 3H6VA 4PFWA 1CE2A 1QUIA 3MUQA 3PMVA 3PPRA 4LQ2A 5CMMA 4GVOA 2HZLA 1SW2A 5FTHA 1ANFA 5H8FB 1IZ1A 1XC1A 3T9HB 4FJPA 3RQTA 4I1DA 4QF9A 4IGTA 1AMFA 1B6HA 5AA1A 5M2VA 2QS1A 4ZEBA 3H03A 1B40A 4MH5A 3H7MA 4L17A 1O63A 2I4BA 4F18A 1EZPA 1AOVA 3RY3A 1B4ZA 4OFOA 1HSEA 3KFMA 1Y3QA 4RA1A 3RNNA 3B7DA 3OMBA 3S9EA 4LP2B 1P1OA 4U1OA 3K1MA 1Q35A 1LBCA 4RK9A 2RCAA 3U94A 2G29A 1B2HA 4TOZA 3PGFA 4H8IA 4YB6A 4KCDA 1MXUA 1NNKA 3GBBA 3IO6A 3T96B 2F78A 4POWA 1AL3A 3TELA 2I49A 2HAUA 5I59A 4IO2A 3AXFA 3HSTA 4QSDA 3IORA 3E3KA 5I58B 4BDLA 4EXKA 5F1QA 2THIA 3B6QA 1LFIA 1QKBA 2O68A 1IIWA 1B52A 4PFYA 5H8HB 1TXFA 3OEKA 4KYEA 4KYDA 2Z8FA 3I6VA 3PU5A 5EHMA 4F3PA 1AH5A 1JVYA 1A8EA 5JEIA 3G3JA 4N07A 4R6HA 4DZ1A 1MXYA 1PBPA 3K6WA 4XKNA 5L9SA 3TYHA 3V83A 2VD3A 3PD9A 3CFLA 1ZLQA 3CRBA 2HFBA 2VD2A 2GHAA 1B7HA 2ANJA 4FEDA 1MM7A 3T9XB 4RXLA 4POXA 3PD8A 1R6ZA 1QUJA 1Y3NA 3EPEA 2VHAA 3FJGA 3ZS6A 2IA4A 1DSNA 3T93B 4O3AA 4H5GA 3O6GA 4QFPA 5ELVA 4JWXA 3SERA 3S9MC 4BDRA 5AA2A 1JQFA 2NXOA 3PPQA 1M5CA 3MZ9A 1DPPA 5HM4B 2AL4A 1I6BA 2H4IA 1RYXA 4WEDA 3UGWA 1F9BA 1FTLA 2UXAA 4JDFA 2DQVA 5DVFA 1M5EA 3LSWA 3KEIA 1N84A 3M3LA 1ZMGA 1B3FA 3K6VA 4IO7A 1SYHA 3MAMA 5K2YA 4IO6A 1R1NA 3N6TA 3IOUA 3N5LA 1B3LA 1MXVA 3G3FA 3I3VA 4E0WA 1D4NA 2Y7RA 4HTGA 3Q28A 3VLVA 4HS7A 4ZZAA 5I84A 1SD3A 4LONB 4GRKA 1LAHE 3BFUA 3K6UA 5DEXB 4Q8RA 1II5A 3PMXA 3CSBA 3SDFA 2Q88A 4YU0A 3KJTA 5I56B 2Y7PA 1RKMA 4R73A 3USDA 1BLFA 2Y7IA 3BKIB 3OSRA 2DWJA 4H65A 4F3BA 1PB7A 3F11A 2UVGA 1IXCA 2OBGA 3TCHA 3KZGA 3E13X 3RPWA 1LAFE 1Y20A 3MP1A 2ZXTA 1FCKA 1IQ7A 1N76A 2ZYMA 3EQ1A 2HCAA 1R9QA 3ILTB 3MZ1A 1US5A 3O66A 3C31A 1GGGA 3CG1A 3FXRA 2F5XA 2A5TA 1B32A 3K00A 3MP6A 5ICQA 2QJEA 4UA8A 2F7AA 3LC8A 3DELB 1AIVA 2VOZA 4GL8A 2ABHA 1QW0A 4IO3A 1Y1MA 4MLVA 5H8NA 2FA7A 3FUZA 3OSQA 4UACA 3B6WA 2Q8JA 1XVYA 2Z22A 1UIVA 3G3KA 1PB8A 1DOTA 4KCCA 3WAFA 3GBAA 4X1DA 1MS7A 4NE4A 2XXTA 1YCJA 1P1QA 2VGQA 3U1OA 5KDTA 1LB9A 3O29A 3KSXA 1USYE 2XHDA 3G3GA 2H99A 4DCXA 3SETA 4IB2A 3MVWA 3K1PA 4NF5B 4F22A 3K6XA 2NOOA 4U21A 2WKYA 4OYVA 2ZMBA 4OZ9A 3VXCA 3E9XA 2V25A 1B05A 4RY1A 1URDA 4H5FA 1SW4A 2FYIA 2I48A 4P11A 2CZLA 4IGRA 4EQBA 1XVXA 2R6GE 3T66A 3RTWB 4Q30B 4MBPA 2DXRA 4R2FA 3H6WA 2X7QA 1JEUA 3FGSA 2QPQA 3QK6A 3N6UA 1LGBC 4QHQA 1R9LA 1P1WA 2Y84A 4OHNA 3MVYA 4ELRA 2XXHA 4WKMA 2ZNSA 3RT8A 4NF8B 1JEVA 3CSGA 1MRPA 2F6PA 4R6YA 4YAHX 4DDDA 2V93A 3GLBA 5H8QA 2F35A 2OCUA 3FATA 2ZYNA 4F31B 4BDMA 4OENA 4G68B 1I6AA 1S50A 3BFTA 3JYRA 3K1NA 5TP9A 4QFLA 1MXWA 3TUSA 1KWHA 3K01A 3LBSA 4BDNA 2NWJA 3ZKKA 4TLMB 2HEUA 1D9YA 1B1HA 2OWSA 1MXZA 2E1SA 3UN6A 5A5XA 4JWYA 5IAIA 4C1TA 2R9JA 1LBBA 1JW1A 2DSFA 1FQBA 3HCQA 4MFIA 2YPNA 4KPTA 5TU0A 3TTMA 2RKMA 4LZ8A 1SYIA 4OQOA 4DXBA 5FTIA 3MPLA 1N0TA 4JXIA 1WVJA 4R9GA 3M3KA 5L9OA 5DTBA 1OMPA 1JETA 3QSLA 1IEJA 3U93A 4I9DA 1N7XA 1DPEA 1B4HA 2QMWA 2GRVA 4OETA 5CI5A 2HZKA 3R7XA 5J1DA 2XXIA 3OELA 3KG2A 4GWOA 3CFZA 2BJJX 3LUYA 4RJZA 2V3UA 3RLFE 4G77A 3H06B 5CBRA 3LSFB 4ESXA 1MQDA 3G7WA 5I59B 2XD2A 4C0RA 4LUBA 2H98A 1UQWA 2M8CA 2QMXA 4H67A 3ECRA 3C33A 3OO8A 3PUYE 2OLBA 2B3BA 1IXGA 4LATA 3T22A 1LFGA 4G4PA 2AL5A 2DWHA 4NF4B 4IY5A 4ZDMA 3KOSA 3TCFA 1FQEA 1MM6A 3C34A 1ZIUA 4ONYA 4MLQA 2XXVA 4R75A 5L8DA 3K2DA 3C35A 5HBCA 2ZYOA 2O7IA 3MPKA 1TFAA 3DLNA 5FHOA 4WXJA 3A3CA 4G8NA 4TQUQ 3M8UA 4N6PA 1MQHA 1LAXA 1GVCA 5I58A 4FE8A 1POY1 3SEYA 1ELJA 3PPPA 2NUVA 3PPOA 3IOWA 4OEVA 4PFUA 1S7YA 3MW0A 4H8JA 2XXWA 3FV2A 4PETA 4NWDA 4OTEA 1SBPA 3O9PA 1PDAA 3FJ7A 4LQ5A 4KHZE 1B58A 3THIA 2D3IA 2ONKE 4ZECA 2IEEA 1B9JA 1H76A 1LCFA 4OERA 3GZGA 4ZZEA 3A09A 1NNPA 4XIGQ 4ZEDA 4R72A 2W7YA 1DMBA 1TFDA 2LAOA 2O1MA 3TTRA 3FIRA 1B5HA 1TWYA 1SDXA 1NNTA 3E4RA 1B0LA 1US4A 4OXVA 5I2NB 2XXPA 1NKXA 4LZ7A 1PC3A 4ZEKA 1FTOA 2I0BA 3TEPA 1B5IA 3U8QA 3T9UA 3TQWA 2Z8DA 5HPQA 3H3GA 4IY6A 5AA4B 4H0WA 1FTKA 2QS4A 3KBRA 4YKJA 1A8FA 3R6UA 1NH8A 4DXUA 3TCGA 2UVHA 4ISUA 2DWIA 4EF1A 1WDNA 5IKBA 3U72A 4NF6A 1Z7NE 1NNFA 5JTYA 1Z7ME 1B3HA 3P7IA 4RYAA 2UYEA 1LSTA 3FXQA 4LVQA 3TMGA 3IJXB 2H5YA 4K3FA 2OWTA 4Q5TA 3FVOA 3IOVA 1GR2A 3IL1B 4YB5A 4YKIA 4EQ7A 1VR5A 1TT1A 1OIBA 1USYH 1BTJA 3H4ZA 4F3GA 4QSEA 2NVUB 4KFQA 4U4XA 3JV9A 5AA2D 2ONRA 5CMBA 3KN7A 3KSJA 1JW5A 2QS2A 1YTVA 4F1UA 1IXHA 4YZZA 5I57A 3VVDA 3Q29A 1M5DA 4YICA 2UVIA 1BIYA 3C4MA 3VXBA 1QJMA 2XXYA 3I5OA 5I2KB 1M5FA 1PEBA 3IR1A 2I3WA 3FVGA 1A99A 1SI1A 3UORA 3C9HA 2PMSA 4H6DA 3KN8A 4H1XA 5KDTB 1LB8A 3MVZA 2XXRA 4F1YA 2F7CA 1FQFA 4EUOA 3SKPA 1EU8A 4IO5A 4P0IA 3W15C 4PP0A 4RPNA 4NWCA 3O6HA 4HCYA 1LCTA 4FEBA 3V8XB 2GH9A 4BLAA 3G3IA 3S9LC 3K0VA 3UP9A 3RGYA 2REGA 2RC9A 3TKDA 4ZE8A 4G8HA 4DE8A 2DVCA 1SVXB 4GF8A 4O3CA 5DVJA 2REJA 2DP8A 5H8SA 3TTLA 2YJPA 4G68C 1ZU0A 1BP5A 1SQYA 4TLLB 2FNCA 1WODA 3IK6B 3V5AA 3IB0A 1N3XA 3IAZA 1IUDA 4JB7A 4U23A 2RF1A 2OJTA 3RT6B 4KD5A 1UTBA 2DVZA 3CIJA 4GQOA 1B0HA 4AB5A 4JSDA 3N94A 1Y9UA 2I3VA 2O84X 4X1BA 4BDQA 4NF5A 5LOMA 1HSJA 5AE4A 2PX1A 4I8CA 2PT2A 1ATGA 3MP8A 5H8QB 3OOAA 4XKQA 1ZKBA 3TODA 2QRYA 5TP9B 5ISUA 1MDQA 5TPAB 3TTNA 3EHUA 1D9VA 1UTHB 4FIMA 4XXUA 3MC2A 4OFJA 3TFLA 4Z7EA 2Z23A 1H44A 2Q9TA 3EF7A 1I6QA 2Z8EA 1M5BA 3U92A 1POTA 2DS9A 1URGA 1UIUA 2V84A 2ZNTA 2DOJA 4EDPA 3VLWA 3VFJA 3MJNA 1ZBMA 2ZNUA 3CVGA 3MBPA 3MQ9A 5CC2A 3EHSA 1LAGE 4NF8A 5KCJA 4X48A 1EZ9A 4RNSA 3GXAA 3DP8A 1N7WA 3EHTA 3OO6A 2D21A 2XXUA 3VVFA 3CFXA 1DTZA 1XS5A 5CRYA 3HHGA 4O3BA 4G8MA 3KJ7A 4F29A 4KI0E 2O7UA 4G68A 2F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAJ A;  1P1N A;  5JK4 A;  3VVE A;  5CMC A;  4XKR A;  1B51 A;  3OO7 A;  2DE2 A;  4JSO A;  1XHY A;  2PT1 A;  4ZS9 A;  2OZZ A;  2RC7 A;  5ITO A;  3FJM A;  4THI A;  4X9T A;  3PUW E;  3KGC A;  1IXI A;  3IO4 A;  3L6H A;  4PE5 B;  5AA3 A;  4QSC A;  2PYY A;  1MXX A;  3FVK A;  2XX8 A;  3L6G A;  3QAX A;  1QUK A;  4MF3 A;  3SEV A;  4GD5 A;  1J1N A;  3S4U A;  5H8F A;  1BKA A;  5L9M A;  3W9W A;  2F7B A;  3HV1 A;  1YAE A;  4AQ4 A;  3VDF A;  4ESW A;  2E0S A;  1FW0 A;  2O6A A;  1MY4 A;  3FD3 A;  1OVB A;  4EF2 A;  5CM6 A;  1MPC A;  4ZE9 A;  3C36 A;  2Y7W A;  3KN3 A;  4OEU A;  4PQJ A;  1OLA A;  4PFT A;  3B6T A;  3MZB A;  4QFO A;  5B7D A;  1MG1 A;  1QUL A;  2PVU A;  2QL3 A;  1FQA A;  4JWO A;  4DIG A;  4QFN A;  2D5W A;  4QRZ A;  3OEM A;  1PBQ A;  1MY2 A;  1RYO A;  1Y4T A;  1ZJL A;  4M1V A;  4FAT A;  4F1V A;  4F39 A;  2H9B A;  1OLC A;  3SES A;  3W9V A;  1PB9 A;  1GTK A;  1A7L A;  4NF4 A;  4HCW A;  3TZA A;  4NED A;  4KQP A;  5EHS A;  4DXC A;  1NH7 A;  5BWJ A;  4KR5 A;  1SW5 A;  1QKA A;  1A40 A;  5H8H A;  2H25 A;  1P1U A;  5DVI A;  3UA8 A;  2O1L A;  4C1U A;  1EZO A;  1MQG A;  4M4G A;  3TTK A;  4ELQ A;  4U22 A;  5AA2 B;  2G93 A;  2XXQ A;  1OVT A;  4OFL A;  4FEC A;  4YMB A;  1A54 A;  2P1S A;  3G3H A;  1Y3P A;  2YLN A;  2DXY A;  3PUZ E;  2I58 A;  5K2X A;  3OD7 A;  2P0S A;  4KYS A;  2ESN A;  2QS3 A;  4BDO A;  1N04 A;  4GFR A;  4NMY A;  4OVJ A;  3RN8 A;  1O7T A;  3JZJ A;  1FTM A;  4FOR A;  1VE4 A;  5ICT A;  4U2R A;  1VFD A;  3ZKL A;  1MQJ A;  5B70 A;  3UK4 A;  3LSX A;  1D3K A;  1VSO A;  3QIM A;  5ITP A;  3IJO B;  2DE3 A;  3EN3 A;  2XX9 A;  4F2O A;  4DCY A;  1NFT A;  3D4G A;  2F34 A;  2HAV A;  3C32 A;  3QXM A;  1MH3 A;  1Q1K A;  2DWA A;  2GHB A;  5F7V A;  4U1Z A;  3Q26 A;  4I62 A;  1A55 A;  3TAJ A;  3FVN A;  1YPN A;  1SW1 A;  1MPB A;  3VLU A;  1MH4 A;  4NF6 B;  1MDP 1;  3QUJ A;  4R74 A;  5JTY B;  2F6G A;  3PUV E;  4GIZ A;  1B1X A;  4G2Z A;  2DYX A;  3CR9 A;  3O2A A;  2I6E A;  1N3W A;  2XXX A;  3FV1 A;  3MVX A;  5EYF A;  2Q2A A;  2AIX A;  1IIT A;  4DLD A;  4F3S A;  5KZT A;  3OO9 A;  3A3U A;  5I2N A;  4YB7 A;  4GOT A;  3ZSF A;  4GLI A;  3RTF B;  4YKK A;  4ELP A;  3PV0 E;  4AB6 A;  4OES A;  2ZYK A;  3FXU A;  4HW8 A;  4Z0I A;  3HPI A;  4R9F A;  1MY1 A;  4ZEI A;  1B3E A;  5AA4 A;  2CMO A;  3Q25 A;  5I57 B;  3MWB A;  2R71 A;  2O69 A;  5DEX A;  2RCB A;  2A5T B;  3IB2 A;  2Y7K A;  1DTG A;  3R26 A;  3RUM A;  4OWD A;  1O64 A;  4IO4 A;  2X26 A;  3HHF A;  3VV5 A;  5I56 A;  2HXW A;  2B3F A;  3KOT A;  2Q2C A;  2UVJ A;  1GV8 A;  3FZV A;  4ELO A;  5H8N B;  1B46 A;  3K4U A;  3ODB A;  4WEP A;  1H43 A;  4EQ9 A;  1FTJ A;  1JVX A;  1S9T A;  3TDJ A;  3LSL A;  4R2B A;  3VE1 B;  3PUX E;  1LLS A;  1URS A;  2I0C A;  3H6U A;  3V89 B;  3LR1 A;  1XOC A;  1VFE A;  4NTL A;  3OXN A;  2V3Q A;  3DM0 A;  3S2V A;  2OK2 A;  4E0X A;  2UYF A;  4Q0C A;  2A5S A;  2F8D A;  1Y1Z A;  4QFK A;  4OMB A;  3H6T A;  2DE4 A;  3K02 A;  1QVS A;  3ILU B;  2PBW A;  2QSX A;  3ONM A;  1FQC A;  1B5J A;  2RIN A;  5I2K A;  2HQ0 A;  5DYH A;  1H45 A;  3IB1 A;  1SI0 A;  2RC8 A;  4ECF A;  1FQD A;  1HSL A;  1UTB B;  3QUF A;  5CBS A;  2ONS A;  4U4S A;  2XX7 A;  4ZEF A;  3SEX A;  1OQH A;  4XTC Q;  4RK2 A;  4GXS B;  4YKP A;  3DP6 A;  3M3F A;  2GFE A;  1L5T A;  3HN0 A;  1MQI A;  5FHM A;  3O97 A;  1CB6 A;  3FAS A;  3SEU A;  1MY0 A;  4GXA A;  4XKP A;  2X7P A;  3CI8 A;  3PMW A;  5CMK A;  3N26 A;  1NL5 A;  4YMA A;  1EH3 A;  3WAE A;  5FHN A;  3T9V A;  3O6I A;  2O51 A;  3TQL A;  3HO7 A;  1H3D A;  3BBR A;  3TPA A;  4RPO A;  5DT6 A;  1B7U A;  2P2A A;  3IOT A;  1NMU A;  3IX1 A;  2V3T A;  3SEW A;  3S9N C;  3CG3 A;  4ND9 A;  3UIF A;  2I4C A;  1I69 A;  4N13 A;  2XD3 A;  5A5X B;  4LA9 A;  3OEN A;  5KCJ B;  4P0G A;  2VP1 A;  1LFH A;  5BUU A;  2ALU A;  1JW4 A;  4F2Q A;  3DP4 A;  4GL0 A;  1Y4C A;  2B65 A;  1OQG A;  3QYT A;  4R6K A;  1MY3 A;  1B7Z A;  1T0K A;  1B3G A;  4JBZ A;  2Q89 A;  4EXL A;  1MPD A;  1P99 A;  1XT8 A;  1JNF A;  3D4C A;  5TPA A;  2F97 A;  4F19 A;  2AYS A;  3O28 A;  4LZ5 A;  1UTH A;  3PPN A;  3Q27 A;  1ZTY A;  2KLF A;  3H6V A;  4PFW A;  1CE2 A;  1QUI A;  3MUQ A;  3PMV A;  3PPR A;  4LQ2 A;  5CMM A;  4GVO A;  2HZL A;  1SW2 A;  5FTH A;  1ANF A;  5H8F B;  1IZ1 A;  1XC1 A;  3T9H B;  4FJP A;  3RQT A;  4I1D A;  4QF9 A;  4IGT A;  1AMF A;  1B6H A;  5AA1 A;  5M2V A;  2QS1 A;  4ZEB A;  3H03 A;  1B40 A;  4MH5 A;  3H7M A;  4L17 A;  1O63 A;  2I4B A;  4F18 A;  1EZP A;  1AOV A;  3RY3 A;  1B4Z A;  4OFO A;  1HSE A;  3KFM A;  1Y3Q A;  4RA1 A;  3RNN A;  3B7D A;  3OMB A;  3S9E A;  4LP2 B;  1P1O A;  4U1O A;  3K1M A;  1Q35 A;  1LBC A;  4RK9 A;  2RCA A;  3U94 A;  2G29 A;  1B2H A;  4TOZ A;  3PGF A;  4H8I A;  4YB6 A;  4KCD A;  1MXU A;  1NNK A;  3GBB A;  3IO6 A;  3T96 B;  2F78 A;  4POW A;  1AL3 A;  3TEL A;  2I49 A;  2HAU A;  5I59 A;  4IO2 A;  3AXF A;  3HST A;  4QSD A;  3IOR A;  3E3K A;  5I58 B;  4BDL A;  4EXK A;  5F1Q A;  2THI A;  3B6Q A;  1LFI A;  1QKB A;  2O68 A;  1IIW A;  1B52 A;  4PFY A;  5H8H B;  1TXF A;  3OEK A;  4KYE A;  4KYD A;  2Z8F A;  3I6V A;  3PU5 A;  5EHM A;  4F3P A;  1AH5 A;  1JVY A;  1A8E A;  5JEI A;  3G3J A;  4N07 A;  4R6H A;  4DZ1 A;  1MXY A;  1PBP A;  3K6W A;  4XKN A;  5L9S A;  3TYH A;  3V83 A;  2VD3 A;  3PD9 A;  3CFL A;  1ZLQ A;  3CRB A;  2HFB A;  2VD2 A;  2GHA A;  1B7H A;  2ANJ A;  4FED A;  1MM7 A;  3T9X B;  4RXL A;  4POX A;  3PD8 A;  1R6Z A;  1QUJ A;  1Y3N A;  3EPE A;  2VHA A;  3FJG A;  3ZS6 A;  2IA4 A;  1DSN A;  3T93 B;  4O3A A;  4H5G A;  3O6G A;  4QFP A;  5ELV A;  4JWX A;  3SER A;  3S9M C;  4BDR A;  5AA2 A;  1JQF A;  2NXO A;  3PPQ A;  1M5C A;  3MZ9 A;  1DPP A;  5HM4 B;  2AL4 A;  1I6B A;  2H4I A;  1RYX A;  4WED A;  3UGW A;  1F9B A;  1FTL A;  2UXA A;  4JDF A;  2DQV A;  5DVF A;  1M5E A;  3LSW A;  3KEI A;  1N84 A;  3M3L A;  1ZMG A;  1B3F A;  3K6V A;  4IO7 A;  1SYH A;  3MAM A;  5K2Y A;  4IO6 A;  1R1N A;  3N6T A;  3IOU A;  3N5L A;  1B3L A;  1MXV A;  3G3F A;  3I3V A;  4E0W A;  1D4N A;  2Y7R A;  4HTG A;  3Q28 A;  3VLV A;  4HS7 A;  4ZZA A;  5I84 A;  1SD3 A;  4LON B;  4GRK A;  1LAH E;  3BFU A;  3K6U A;  5DEX B;  4Q8R A;  1II5 A;  3PMX A;  3CSB A;  3SDF A;  2Q88 A;  4YU0 A;  3KJT A;  5I56 B;  2Y7P A;  1RKM A;  4R73 A;  3USD A;  1BLF A;  2Y7I A;  3BKI B;  3OSR A;  2DWJ A;  4H65 A;  4F3B A;  1PB7 A;  3F11 A;  2UVG A;  1IXC A;  2OBG A;  3TCH A;  3KZG A;  3E13 X;  3RPW A;  1LAF E;  1Y20 A;  3MP1 A;  2ZXT A;  1FCK A;  1IQ7 A;  1N76 A;  2ZYM A;  3EQ1 A;  2HCA A;  1R9Q A;  3ILT B;  3MZ1 A;  1US5 A;  3O66 A;  3C31 A;  1GGG A;  3CG1 A;  3FXR A;  2F5X A;  2A5T A;  1B32 A;  3K00 A;  3MP6 A;  5ICQ A;  2QJE A;  4UA8 A;  2F7A A;  3LC8 A;  3DEL B;  1AIV A;  2VOZ A;  4GL8 A;  2ABH A;  1QW0 A;  4IO3 A;  1Y1M A;  4MLV A;  5H8N A;  2FA7 A;  3FUZ A;  3OSQ A;  4UAC A;  3B6W A;  2Q8J A;  1XVY A;  2Z22 A;  1UIV A;  3G3K A;  1PB8 A;  1DOT A;  4KCC A;  3WAF A;  3GBA A;  4X1D A;  1MS7 A;  4NE4 A;  2XXT A;  1YCJ A;  1P1Q A;  2VGQ A;  3U1O A;  5KDT A;  1LB9 A;  3O29 A;  3KSX A;  1USY E;  2XHD A;  3G3G A;  2H99 A;  4DCX A;  3SET A;  4IB2 A;  3MVW A;  3K1P A;  4NF5 B;  4F22 A;  3K6X A;  2NOO A;  4U21 A;  2WKY A;  4OYV A;  2ZMB A;  4OZ9 A;  3VXC A;  3E9X A;  2V25 A;  1B05 A;  4RY1 A;  1URD A;  4H5F A;  1SW4 A;  2FYI A;  2I48 A;  4P11 A;  2CZL A;  4IGR A;  4EQB A;  1XVX A;  2R6G E;  3T66 A;  3RTW B;  4Q30 B;  4MBP A;  2DXR A;  4R2F A;  3H6W A;  2X7Q A;  1JEU A;  3FGS A;  2QPQ A;  3QK6 A;  3N6U A;  1LGB C;  4QHQ A;  1R9L A;  1P1W A;  2Y84 A;  4OHN A;  3MVY A;  4ELR A;  2XXH A;  4WKM A;  2ZNS A;  3RT8 A;  4NF8 B;  1JEV A;  3CSG A;  1MRP A;  2F6P A;  4R6Y A;  4YAH X;  4DDD A;  2V93 A;  3GLB A;  5H8Q A;  2F35 A;  2OCU A;  3FAT A;  2ZYN A;  4F31 B;  4BDM A;  4OEN A;  4G68 B;  1I6A A;  1S50 A;  3BFT A;  3JYR A;  3K1N A;  5TP9 A;  4QFL A;  1MXW A;  3TUS A;  1KWH A;  3K01 A;  3LBS A;  4BDN A;  2NWJ A;  3ZKK A;  4TLM B;  2HEU A;  1D9Y A;  1B1H A;  2OWS A;  1MXZ A;  2E1S A;  3UN6 A;  5A5X A;  4JWY A;  5IAI A;  4C1T A;  2R9J A;  1LBB A;  1JW1 A;  2DSF A;  1FQB A;  3HCQ A;  4MFI A;  2YPN A;  4KPT A;  5TU0 A;  3TTM A;  2RKM A;  4LZ8 A;  1SYI A;  4OQO A;  4DXB A;  5FTI A;  3MPL A;  1N0T A;  4JXI A;  1WVJ A;  4R9G A;  3M3K A;  5L9O A;  5DTB A;  1OMP A;  1JET A;  3QSL A;  1IEJ A;  3U93 A;  4I9D A;  1N7X A;  1DPE A;  1B4H A;  2QMW A;  2GRV A;  4OET A;  5CI5 A;  2HZK A;  3R7X A;  5J1D A;  2XXI A;  3OEL A;  3KG2 A;  4GWO A;  3CFZ A;  2BJJ X;  3LUY A;  4RJZ A;  2V3U A;  3RLF E;  4G77 A;  3H06 B;  5CBR A;  3LSF B;  4ESX A;  1MQD A;  3G7W A;  5I59 B;  2XD2 A;  4C0R A;  4LUB A;  2H98 A;  1UQW A;  2M8C A;  2QMX A;  4H67 A;  3ECR A;  3C33 A;  3OO8 A;  3PUY E;  2OLB A;  2B3B A;  1IXG A;  4LAT A;  3T22 A;  1LFG A;  4G4P A;  2AL5 A;  2DWH A;  4NF4 B;  4IY5 A;  4ZDM A;  3KOS A;  3TCF A;  1FQE A;  1MM6 A;  3C34 A;  1ZIU A;  4ONY A;  4MLQ A;  2XXV A;  4R75 A;  5L8D A;  3K2D A;  3C35 A;  5HBC A;  2ZYO A;  2O7I A;  3MPK A;  1TFA A;  3DLN A;  5FHO A;  4WXJ A;  3A3C A;  4G8N A;  4TQU Q;  3M8U A;  4N6P A;  1MQH A;  1LAX A;  1GVC A;  5I58 A;  4FE8 A;  1POY 1;  3SEY A;  1ELJ A;  3PPP A;  2NUV A;  3PPO A;  3IOW A;  4OEV A;  4PFU A;  1S7Y A;  3MW0 A;  4H8J A;  2XXW A;  3FV2 A;  4PET A;  4NWD A;  4OTE A;  1SBP A;  3O9P A;  1PDA A;  3FJ7 A;  4LQ5 A;  4KHZ E;  1B58 A;  3THI A;  2D3I A;  2ONK E;  4ZEC A;  2IEE A;  1B9J A;  1H76 A;  1LCF A;  4OER A;  3GZG A;  4ZZE A;  3A09 A;  1NNP A;  4XIG Q;  4ZED A;  4R72 A;  2W7Y A;  1DMB A;  1TFD A;  2LAO A;  2O1M A;  3TTR A;  3FIR A;  1B5H A;  1TWY A;  1SDX A;  1NNT A;  3E4R A;  1B0L A;  1US4 A;  4OXV A;  5I2N B;  2XXP A;  1NKX A;  4LZ7 A;  1PC3 A;  4ZEK A;  1FTO A;  2I0B A;  3TEP A;  1B5I A;  3U8Q A;  3T9U A;  3TQW A;  2Z8D A;  5HPQ A;  3H3G A;  4IY6 A;  5AA4 B;  4H0W A;  1FTK A;  2QS4 A;  3KBR A;  4YKJ A;  1A8F A;  3R6U A;  1NH8 A;  4DXU A;  3TCG A;  2UVH A;  4ISU A;  2DWI A;  4EF1 A;  1WDN A;  5IKB A;  3U72 A;  4NF6 A;  1Z7N E;  1NNF A;  5JTY A;  1Z7M E;  1B3H A;  3P7I A;  4RYA A;  2UYE A;  1LST A;  3FXQ A;  4LVQ A;  3TMG A;  3IJX B;  2H5Y A;  4K3F A;  2OWT A;  4Q5T A;  3FVO A;  3IOV A;  1GR2 A;  3IL1 B;  4YB5 A;  4YKI A;  4EQ7 A;  1VR5 A;  1TT1 A;  1OIB A;  1USY H;  1BTJ A;  3H4Z A;  4F3G A;  4QSE A;  2NVU B;  4KFQ A;  4U4X A;  3JV9 A;  5AA2 D;  2ONR A;  5CMB A;  3KN7 A;  3KSJ A;  1JW5 A;  2QS2 A;  1YTV A;  4F1U A;  1IXH A;  4YZZ A;  5I57 A;  3VVD A;  3Q29 A;  1M5D A;  4YIC A;  2UVI A;  1BIY A;  3C4M A;  3VXB A;  1QJM A;  2XXY A;  3I5O A;  5I2K B;  1M5F A;  1PEB A;  3IR1 A;  2I3W A;  3FVG A;  1A99 A;  1SI1 A;  3UOR A;  3C9H A;  2PMS A;  4H6D A;  3KN8 A;  4H1X A;  5KDT B;  1LB8 A;  3MVZ A;  2XXR A;  4F1Y A;  2F7C A;  1FQF A;  4EUO A;  3SKP A;  1EU8 A;  4IO5 A;  4P0I A;  3W15 C;  4PP0 A;  4RPN A;  4NWC A;  3O6H A;  4HCY A;  1LCT A;  4FEB A;  3V8X B;  2GH9 A;  4BLA A;  3G3I A;  3S9L C;  3K0V A;  3UP9 A;  3RGY A;  2REG A;  2RC9 A;  3TKD A;  4ZE8 A;  4G8H A;  4DE8 A;  2DVC A;  1SVX B;  4GF8 A;  4O3C A;  5DVJ A;  2REJ A;  2DP8 A;  5H8S A;  3TTL A;  2YJP A;  4G68 C;  1ZU0 A;  1BP5 A;  1SQY A;  4TLL B;  2FNC A;  1WOD A;  3IK6 B;  3V5A A;  3IB0 A;  1N3X A;  3IAZ A;  1IUD A;  4JB7 A;  4U23 A;  2RF1 A;  2OJT A;  3RT6 B;  4KD5 A;  1UTB A;  2DVZ A;  3CIJ A;  4GQO A;  1B0H A;  4AB5 A;  4JSD A;  3N94 A;  1Y9U A;  2I3V A;  2O84 X;  4X1B A;  4BDQ A;  4NF5 A;  5LOM A;  1HSJ A;  5AE4 A;  2PX1 A;  4I8C A;  2PT2 A;  1ATG A;  3MP8 A;  5H8Q B;  3OOA A;  4XKQ A;  1ZKB A;  3TOD A;  2QRY A;  5TP9 B;  5ISU A;  1MDQ A;  5TPA B;  3TTN A;  3EHU A;  1D9V A;  1UTH B;  4FIM A;  4XXU A;  3MC2 A;  4OFJ A;  3TFL A;  4Z7E A;  2Z23 A;  1H44 A;  2Q9T A;  3EF7 A;  1I6Q A;  2Z8E A;  1M5B A;  3U92 A;  1POT A;  2DS9 A;  1URG A;  1UIU A;  2V84 A;  2ZNT A;  2DOJ A;  4EDP A;  3VLW A;  3VFJ A;  3MJN A;  1ZBM A;  2ZNU A;  3CVG A;  3MBP A;  3MQ9 A;  5CC2 A;  3EHS A;  1LAG E;  4NF8 A;  5KCJ A;  4X48 A;  1EZ9 A;  4RNS A;  3GXA A;  3DP8 A;  1N7W A;  3EHT A;  3OO6 A;  2D21 A;  2XXU A;  3VVF A;  3CFX A;  1DTZ A;  1XS5 A;  5CRY A;  3HHG A;  4O3B A;  4G8M A;  3KJ7 A;  4F29 A;  4KI0 E;  2O7U A;  4G68 A;  2F36 A; 
#chains in the Genus database with same CATH topology
 4FAJ A;  1P1N A;  5JK4 A;  3VVE A;  5CMC A;  4XKR A;  1B51 A;  3OO7 A;  2DE2 A;  4JSO A;  1XHY A;  2PT1 A;  4ZS9 A;  2OZZ A;  2RC7 A;  5ITO A;  3FJM A;  4THI A;  4X9T A;  3PUW E;  3KGC A;  2FVZ A;  1IXI A;  3IO4 A;  3L6H A;  4PE5 B;  5AA3 A;  4QSC A;  2PYY A;  1KZ8 A;  1MXX A;  3FVK A;  2XX8 A;  3L6G A;  3QAX A;  1QUK A;  4MF3 A;  3SEV A;  4GD5 A;  1J1N A;  1NV1 A;  3S4U A;  5H8F A;  1BKA A;  5L9M A;  3W9W A;  2F7B A;  3HV1 A;  3CHG A;  4QXD A;  1YAE A;  4AQ4 A;  3VDF A;  4ESW A;  2E0S A;  1FW0 A;  2O6A A;  1MY4 A;  3FD3 A;  3PTY A;  1OVB A;  5I3S A;  4EF2 A;  5CM6 A;  1D9Q A;  1MPC A;  4ZE9 A;  3C36 A;  2Y7W A;  3KN3 A;  4OEU A;  4PQJ A;  1OLA A;  4PFT A;  3B6T A;  3MZB A;  4QFO A;  5B7D A;  1MG1 A;  1QUL A;  2PVU A;  2QL3 A;  1FQA A;  4JWO A;  4DIG A;  4QFN A;  2D5W A;  2JJK A;  4QRZ A;  3OEM A;  1PBQ A;  1MY2 A;  1RYO A;  1Y4T A;  1ZJL A;  4M1V A;  4FAT A;  4F1V A;  4F39 A;  2H9B A;  1OLC A;  3SES A;  3W9V A;  4X8R A;  4PFR A;  4JVC A;  1IMB A;  1PB9 A;  1GTK A;  4OVP A;  1A7L A;  4NF4 A;  4HCW A;  3TZA A;  4NED A;  4KQP A;  5EHS A;  4DXC A;  1NH7 A;  5BWJ A;  4HE1 A;  4KR5 A;  1SW5 A;  1QKA A;  1A40 A;  5H8H A;  2H25 A;  1P1U A;  5DVI A;  3UA8 A;  1FBE A;  2O1L A;  4C1U A;  1EZO A;  1MQG A;  4M4G A;  3TTK A;  4ELQ A;  4U22 A;  5AA2 B;  2G93 A;  2XXQ A;  1OVT A;  4OFL A;  4FEC A;  4YMB A;  2XWI A;  1A54 A;  2P1S A;  3G3H A;  1Y3P A;  1JP4 A;  2YLN A;  2VT5 A;  2DXY A;  3PUZ E;  4O7M A;  2I58 A;  5K2X A;  3OD7 A;  2QVR A;  2P0S A;  4KYS A;  2F3D A;  2ESN A;  4PGN A;  2QS3 A;  4BDO A;  1N04 A;  4GFR A;  4MMP A;  1LBZ A;  4NMY A;  4OVJ A;  3RN8 A;  1O7T A;  3JZJ A;  1FTM A;  4FOR A;  1VE4 A;  4PTK A;  5ICT A;  4U2R A;  1VFD A;  3ZKL A;  1MQJ A;  4GX3 A;  5B70 A;  3UK4 A;  3LSX A;  1D3K A;  3KBZ A;  1VSO A;  3QIM A;  5ITP A;  3IJO B;  2DE3 A;  3EN3 A;  2XX9 A;  4F2O A;  4DCY A;  4N4U A;  1NFT A;  3D4G A;  2F34 A;  2HAV A;  3C32 A;  3QXM A;  3T0J A;  1MH3 A;  1Q1K A;  2DWA A;  2GHB A;  2Q74 A;  5F7V A;  4U1Z A;  3Q26 A;  4I62 A;  1A55 A;  3TAJ A;  3FVN A;  1YPN A;  4PFI A;  1SW1 A;  1MPB A;  1NV2 A;  1NV5 A;  4OVR A;  4NF6 B;  1MH4 A;  3VLU A;  1MDP 1;  3QUJ A;  4R74 A;  1EYJ A;  5JTY B;  2F6G A;  3PUV E;  4GIZ A;  1B1X A;  1NUW A;  4G2Z A;  2DYX A;  3CR9 A;  3O2A A;  4GX6 A;  2I6E A;  1N3W A;  2XXX A;  3FV1 A;  3MVX A;  5EYF A;  2Q2A A;  2AIX A;  1IIT A;  4DLD A;  4F3S A;  2Y5L A;  5KZT A;  3OO9 A;  3A3U A;  5I2N A;  4YB7 A;  4GOT A;  3ZSF A;  5T3J A;  4GLI A;  3RTF B;  2OWZ A;  4MNP A;  4YKK A;  4ELP A;  3PV0 E;  4AB6 A;  4OES A;  2ZYK A;  3FXU A;  4HW8 A;  4Z0I A;  3HPI A;  4R9F A;  1MY1 A;  4ZEI A;  1B3E A;  5AA4 A;  2CMO A;  3Q25 A;  5I57 B;  3MWB A;  2R71 A;  2O69 A;  5DEX A;  2RCB A;  2A5T B;  3IB2 A;  2Y7K A;  1DTG A;  3R26 A;  3EKI A;  3RUM A;  4OWD A;  1O64 A;  4IO4 A;  2X26 A;  3HHF A;  3VV5 A;  3IFC A;  5I56 A;  2HXW A;  1FTA A;  2B3F A;  3KOT A;  2Q2C A;  2UVJ A;  4HE2 A;  1GV8 A;  3FZV A;  4ELO A;  5H8N B;  1B46 A;  4O7I A;  3K4U A;  3ODB A;  4WEP A;  1H43 A;  4EQ9 A;  1FTJ A;  1JVX A;  1S9T A;  3TDJ A;  3LSL A;  4R2B A;  3VE1 B;  3PUX E;  1LLS A;  1IMA A;  1URS A;  2I0C A;  3H6U A;  3V89 B;  3LR1 A;  4DI3 D;  1XOC A;  1VFE A;  4NTL A;  3OXN A;  1NV3 A;  2V3Q A;  3DM0 A;  3S2V A;  2OK2 A;  4E0X A;  2UYF A;  1FBC A;  4Q0C A;  2A5S A;  2F8D A;  1Y1Z A;  1FRP A;  4MAG A;  4QFK A;  4OMB A;  3H6T A;  2DE4 A;  3K02 A;  1QVS A;  5EQ9 A;  3ILU B;  2PBW A;  2QSX A;  5I7I A;  3ONM A;  1FQC A;  2VPO A;  1B5J A;  2RIN A;  5I2K A;  4GWX A;  2HQ0 A;  5DYH A;  1H45 A;  3IB1 A;  5F24 A;  1SI0 A;  3T1B A;  2RC8 A;  4ECF A;  1FQD A;  1HSL A;  1UTB B;  3QUF A;  5CBS A;  2ONS A;  4U4S A;  2XX7 A;  4ZEF A;  3SEX A;  1VDW A;  1OQH A;  4XTC Q;  4RK2 A;  4GXS B;  4YKP A;  2R8T A;  3DP6 A;  2BJI A;  3M3F A;  2GFE A;  1L5T A;  3HN0 A;  1MQI A;  5FHM A;  3O97 A;  1CB6 A;  3FAS A;  3HFU A;  3SEU A;  4MNC A;  1MY0 A;  4GXA A;  2XWV A;  4XKP A;  2X7P A;  3CI8 A;  1FBD A;  3PMW A;  4PDH A;  1AWB A;  5CMK A;  4NF0 A;  3N26 A;  1NL5 A;  4N91 A;  4YMA A;  1EH3 A;  3WAE A;  5FHN A;  3T9V A;  3O6I A;  2O51 A;  1EYI A;  3TQL A;  3HO7 A;  1H3D A;  3BBR A;  3TPA A;  4RPO A;  5DT6 A;  1B7U A;  4AS5 A;  5LTC A;  2P2A A;  3IOT A;  1NMU A;  3IX1 A;  2V3T A;  3SEW A;  3S9N C;  2QVU A;  3CG3 A;  4NN3 A;  4ND9 A;  3UIF A;  3B50 A;  2I4C A;  1I69 A;  4HXV A;  4N13 A;  2XD3 A;  1RDZ A;  5A5X B;  4LA9 A;  3OEN A;  5KCJ B;  4MEV A;  4P0G A;  2VP1 A;  1LFH A;  5BUU A;  1JW4 A;  2ALU A;  4O94 A;  4F2Q A;  3DP4 A;  4GL0 A;  1Y4C A;  5EYH A;  2B65 A;  1OQG A;  3QYT A;  4R6K A;  1MY3 A;  1B7Z A;  1T0K A;  1B3G A;  4JBZ A;  4GX4 A;  2Q89 A;  4GWY A;  4NX1 A;  4EXL A;  1MPD A;  1P99 A;  1XT8 A;  2XWK A;  1JNF A;  3D4C A;  5TPA A;  2F97 A;  4F19 A;  2AYS A;  3O28 A;  4LZ5 A;  1UTH A;  3PPN A;  3Q27 A;  3RYD A;  4N8G A;  4JVD A;  4QBA A;  4KXP A;  1ZTY A;  4PAK A;  2KLF A;  3H6V A;  4PFW A;  1QUI A;  1CE2 A;  3MUQ A;  3PMV A;  4LN5 A;  2CZK A;  3PPR A;  4LQ2 A;  5CMM A;  4GVO A;  4H45 A;  4MNI A;  2HZL A;  1SW2 A;  1NUY A;  5FTH A;  1ANF A;  5H8F B;  1IZ1 A;  1XC1 A;  3T9H B;  4FJP A;  2MKZ A;  3RQT A;  5I5P A;  4DI4 B;  3ISP A;  4I1D A;  4QF9 A;  4IGT A;  1AMF A;  1B6H A;  5EQ8 A;  5AA1 A;  5M2V A;  2QS1 A;  4ZEB A;  3H03 A;  1B40 A;  3NOH A;  4MH5 A;  3H7M A;  2WBB A;  4L17 A;  1O63 A;  2I4B A;  1XI6 A;  3ROJ A;  4F18 A;  1EZP A;  4FBP A;  1AOV A;  3RY3 A;  1B4Z A;  4OFO A;  1HSE A;  3KFM A;  1Y3Q A;  1IMF A;  4GWU A;  4RA1 A;  3RNN A;  3B7D A;  2WYK A;  3OMB A;  3S9E A;  2WYP A;  3SZP A;  4P9K A;  4LP2 B;  4O8M A;  1P1O A;  4U1O A;  3K1M A;  1Q35 A;  1LBC A;  4RK9 A;  2RCA A;  3U94 A;  2G29 A;  1B2H A;  4TOZ A;  3PGF A;  4H8I A;  4YB6 A;  5ET7 A;  1CNQ A;  4NQ8 A;  2ZZW A;  4KCD A;  1MXU A;  1NNK A;  3GBB A;  3IO6 A;  3T96 B;  2XWO A;  2F78 A;  4POW A;  1AL3 A;  3TEL A;  2I49 A;  3E79 A;  2HAU A;  5I59 A;  4IO2 A;  3AXF A;  3HST A;  4QSD A;  3IOR A;  3E3K A;  5I58 B;  4BDL A;  4EXK A;  5F1Q A;  2THI A;  3B6Q A;  1LFI A;  1QKB A;  2O68 A;  1IIW A;  1NV6 A;  1B52 A;  4PFY A;  5H8H B;  1TXF A;  3OEK A;  1LBW A;  4KYE A;  4KYD A;  2Z8F A;  3I6V A;  3PU5 A;  5EHM A;  4F3P A;  1AH5 A;  1JVY A;  1A8E A;  2PFY A;  5JEI A;  3G3J A;  4N07 A;  4R6H A;  4DZ1 A;  1MXY A;  1PBP A;  3K6W A;  4P47 A;  2HHM A;  4XKN A;  5L9S A;  3TYH A;  3V83 A;  2VD3 A;  3PD9 A;  3CFL A;  1LEV A;  1ZLQ A;  3CRB A;  2HFB A;  2VD2 A;  1NV7 A;  1FPI A;  2GHA A;  1B7H A;  2ANJ A;  3KC0 A;  4FED A;  1MM7 A;  3T9X B;  4RXL A;  4POX A;  3PD8 A;  2XA5 A;  2FHY A;  1R6Z A;  1QUJ A;  2L5V A;  1Y3N A;  3EPE A;  2VHA A;  3FJG A;  3ZS6 A;  2IA4 A;  1DSN A;  5ESY A;  3T93 B;  4O3A A;  4H5G A;  3O6G A;  4QFP A;  5ELV A;  4PCD A;  4JWX A;  3SER A;  3S9M C;  4MHF A;  4BDR A;  5AA2 A;  1JQF A;  1NUZ A;  2NXO A;  3PPQ A;  1M5C A;  2FIE A;  3MZ9 A;  1DPP A;  5HM4 B;  5LDZ A;  1I6B A;  2AL4 A;  2H4I A;  2P3V A;  1RYX A;  4WED A;  3UGW A;  1F9B A;  5IZ1 A;  1FTL A;  2UXA A;  4JDF A;  2DQV A;  5DVF A;  1M5E A;  3RPL B;  3LSW A;  4JVI A;  3KEI A;  1N84 A;  3M3L A;  1ZMG A;  1B3F A;  3K6V A;  4IO7 A;  1SYH A;  5DW8 A;  3MAM A;  5K2Y A;  4IO6 A;  4PFB A;  1R1N A;  3N6T A;  3IOU A;  3N5L A;  1B3L A;  1MXV A;  5A5L A;  3G3F A;  3I3V A;  4E0W A;  1D4N A;  2Y7R A;  4HTG A;  1FPL A;  1SPI A;  1QGX A;  3Q28 A;  3LUZ A;  3VLV A;  4HS7 A;  4ZZA A;  5I84 A;  1SD3 A;  4LON B;  4GRK A;  4P56 A;  1LAH E;  3BFU A;  3K6U A;  4MJO A;  5DEX B;  1FJ9 A;  4Q8R A;  1II5 A;  3PMX A;  4XEQ A;  3CSB A;  3SDF A;  2Q88 A;  1IMC A;  1K9Z A;  4IR8 A;  4YU0 A;  3KJT A;  4I40 A;  5I56 B;  1YXI A;  2Y7P A;  1RKM A;  4R73 A;  3USD A;  1BLF A;  2Y7I A;  3BKI B;  3OSR A;  2DWJ A;  4H65 A;  4F3B A;  1NUX A;  1PB7 A;  2XXK A;  3F11 A;  2UVG A;  1IXC A;  2OBG A;  2WBD A;  3TCH A;  3KZG A;  4N15 A;  3E13 X;  4PE3 A;  3RPW A;  1INP A;  4GWS A;  1LAF E;  4PDD A;  1Y20 A;  3MP1 A;  2ZXT A;  1FCK A;  1IQ7 A;  1N76 A;  2ZYM A;  3EQ1 A;  2HCA A;  1R9Q A;  3ILT B;  3MZ1 A;  4P8B A;  1US5 A;  3O66 A;  3C31 A;  1GGG A;  3CG1 A;  3FXR A;  2F5X A;  2A5T A;  1B32 A;  3K00 A;  3MP6 A;  4OA4 A;  1DCU A;  2QJE A;  5ICQ A;  4UA8 A;  2F7A A;  3LC8 A;  3DEL B;  1AIV A;  2VOZ A;  4GL8 A;  4NAP A;  2ABH A;  1QW0 A;  4IO3 A;  1Y1M A;  4MLV A;  5H8N A;  2FA7 A;  3FUZ A;  3OSQ A;  4X04 A;  4UAC A;  3B6W A;  2Q8J A;  1XVY A;  2Z22 A;  1UIV A;  3G3K A;  1FPG A;  4OAN A;  1PB8 A;  1DOT A;  4KCC A;  3WAF A;  3GBA A;  4X1D A;  1MS7 A;  4NE4 A;  1DK4 A;  2XXT A;  1YCJ A;  1P1Q A;  2VGQ A;  3U1O A;  5KDT A;  4PBH A;  1LB9 A;  3O29 A;  3KSX A;  1USY E;  2XHD A;  3G3G A;  4UAB A;  2H99 A;  4DCX A;  3SET A;  4IB2 A;  3MVW A;  3K1P A;  4NF5 B;  2B4L A;  4F22 A;  3K6X A;  2NOO A;  4U21 A;  2WKY A;  4OYV A;  2OX3 A;  2ZMB A;  4OZ9 A;  3VXC A;  3E9X A;  2V25 A;  1B05 A;  4RY1 A;  1URD A;  3MST A;  1SW4 A;  4H5F A;  5FBP A;  2KQZ A;  2FYI A;  2I48 A;  4P11 A;  2CZL A;  4IGR A;  4EQB A;  1XVX A;  2R6G E;  3T66 A;  3RTW B;  3BIG A;  2KR0 A;  4Q30 B;  4MBP A;  2DXR A;  4R2F A;  3H6W A;  5IGA A;  4PC9 A;  2X7Q A;  1JEU A;  3FGS A;  2QPQ A;  3QK6 A;  1FBP A;  3N6U A;  1Q9D A;  1LGB C;  4QHQ A;  1R9L A;  1P1W A;  2DDK A;  2Y84 A;  4OHN A;  3MVY A;  3GYY A;  4ELR A;  2XXH A;  4WKM A;  2ZNS A;  4PF8 A;  3RT8 A;  4NF8 B;  2FIX A;  1JEV A;  3CSG A;  1MRP A;  2F6P A;  4R6Y A;  4YAH X;  2Y5K A;  4DDD A;  2V93 A;  3GLB A;  1NV4 A;  5IZ3 B;  5H8Q A;  2F35 A;  2OCU A;  3FAT A;  5IM2 A;  2ZYN A;  4F31 B;  4BDM A;  4AS4 A;  4OEN A;  4G68 B;  1I6A A;  1S50 A;  3BFT A;  3JYR A;  3K1N A;  5TP9 A;  4QFL A;  1MXW A;  3TUS A;  1KWH A;  3K01 A;  5EQ7 A;  3LBS A;  4BDN A;  2NWJ A;  3ZKK A;  4TLM B;  2HEU A;  1FPF A;  1D9Y A;  1B1H A;  2OWS A;  1MXZ A;  2E1S A;  3UN6 A;  5A5X A;  4JWY A;  5IAI A;  2Q8M A;  4C1T A;  2R9J A;  1LBB A;  1LBV A;  1JW1 A;  2DSF A;  1FQB A;  3HCQ A;  4P1L A;  4MFI A;  2YPN A;  4KPT A;  5TU0 A;  1FPD A;  3TTM A;  2RKM A;  4LZ8 A;  3FBP A;  1SYI A;  4OQO A;  4DXB A;  5FTI A;  1K9Y A;  3MPL A;  1N0T A;  2CEY A;  4JXI A;  1WVJ A;  4R9G A;  2HPG A;  3M3K A;  2B4M A;  4HE0 A;  5ET8 A;  5L9O A;  5DTB A;  1NI9 A;  2F3B A;  1OMP A;  1JET A;  3QSL A;  1IEJ A;  3U93 A;  4I9D A;  2PFZ A;  1N7X A;  1DPE A;  1B4H A;  2QMW A;  2GQ1 A;  2GRV A;  4OET A;  5CI5 A;  2HZK A;  3R7X A;  5J1D A;  2XXI A;  3OEL A;  3KG2 A;  4GWO A;  3CFZ A;  2BJJ X;  3LUY A;  1RDY A;  2V3U A;  4RJZ A;  3RLF E;  4G77 A;  3H06 B;  5CBR A;  1FPK A;  3LSF B;  3IFA A;  4ESX A;  1MQD A;  3G7W A;  5I59 B;  2XD2 A;  4C0R A;  1FSA A;  4LUB A;  2H98 A;  1UQW A;  2M8C A;  2QMX A;  4H67 A;  3ECR A;  3C33 A;  3OO8 A;  4N81 A;  3PUY E;  2OLB A;  2B3B A;  1IXG A;  4LAT A;  4PGP A;  3T22 A;  4GWW A;  1LFG A;  4G4P A;  1YYZ A;  3QMF A;  2AL5 A;  2DWH A;  4NF4 B;  4IY5 A;  4ZDM A;  3KOS A;  3TCF A;  1FQE A;  1LBY A;  1MM6 A;  3C34 A;  4N17 A;  1ZIU A;  5EYG A;  2QVV A;  4ONY A;  4MLQ A;  2XXV A;  4R75 A;  5L8D A;  3K2D A;  3C35 A;  5HBC A;  2ZYO A;  5ET6 A;  2O7I A;  3MPK A;  1TFA A;  3DLN A;  5FHO A;  4WXJ A;  3A3C A;  4G8N A;  4TQU Q;  3M8U A;  4N6P A;  4I3Y A;  1RDX A;  1MQH A;  1LAX A;  4OVT A;  1G0I A;  1GVC A;  4GBV A;  1NV0 A;  5I58 A;  4FE8 A;  1POY 1;  3SEY A;  1ELJ A;  3PPP A;  2NUV A;  4N8Y A;  3PPO A;  3IOW A;  1EYK A;  4OEV A;  4PFU A;  1S7Y A;  3MW0 A;  4H8J A;  2HXR A;  2XXW A;  3FV2 A;  4PET A;  4NWD A;  4OTE A;  1SBP A;  4PBQ A;  1FPE A;  3O9P A;  1PDA A;  3FJ7 A;  4LQ5 A;  4I3E A;  4KHZ E;  1B58 A;  1FJ6 A;  3THI A;  2D3I A;  4MCO A;  2ONK E;  4ZEC A;  1FPB A;  2IEE A;  1B9J A;  1H76 A;  1LCF A;  4OER A;  3GZG A;  4ZZE A;  3A09 A;  1NNP A;  4XIG Q;  4ZED A;  4R72 A;  2W7Y A;  1DMB A;  1TFD A;  2P3N A;  2LAO A;  2O1M A;  3TTR A;  3FIR A;  1B5H A;  1TWY A;  1SDX A;  1NNT A;  3E4R A;  1B0L A;  1US4 A;  4OXV A;  4NGU A;  2V4C A;  5I2N B;  2XXP A;  1NKX A;  4LZ7 A;  1PC3 A;  4ZEK A;  1FTO A;  4G61 A;  2I0B A;  3TEP A;  1B5I A;  3U8Q A;  3T9U A;  3TQW A;  2VPN A;  2Z8D A;  5EQA A;  5HPQ A;  3H3G A;  4IY6 A;  5AA4 B;  4H0W A;  1FTK A;  2QS4 A;  3KBR A;  4YKJ A;  1A8F A;  3R6U A;  1NH8 A;  4DXU A;  3TCG A;  2UVH A;  4ISU A;  3RPL A;  1YZ0 A;  2DWI A;  4EF1 A;  2WX9 A;  1WDN A;  5IKB A;  3U72 A;  4NF6 A;  1Z7N E;  1NNF A;  5JTY A;  1Z7M E;  1B3H A;  2FBP A;  3P7I A;  1KA1 A;  4RYA A;  2UYE A;  1LST A;  3MYU A;  2CZH A;  3BIH A;  3D1R A;  3FXQ A;  4LVQ A;  3TMG A;  3IJX B;  2H5Y A;  4K3F A;  2OWT A;  4Q5T A;  3FVO A;  3IOV A;  4NHB A;  1GR2 A;  3IL1 B;  4YB5 A;  4YKI A;  1FBG A;  4EQ7 A;  1VR5 A;  5IZZ A;  1TT1 A;  1OIB A;  1USY H;  1BTJ A;  3H4Z A;  4QSE A;  4F3G A;  2NVU B;  4KFQ A;  4U4X A;  3JV9 A;  5AA2 D;  4OVQ A;  2ONR A;  5CMB A;  3KN7 A;  1FBH A;  2ZZV A;  3E78 A;  3KSJ A;  1JW5 A;  2QS2 A;  1YTV A;  4F1U A;  4MIJ A;  1IXH A;  4YZZ A;  5I57 A;  3VVD A;  3Q29 A;  1M5D A;  4P3L A;  4YIC A;  2UVI A;  4NG7 A;  1BIY A;  3C4M A;  3VXB A;  1QJM A;  2WEF A;  2XXY A;  3I5O A;  5I2K B;  1M5F A;  1PEB A;  3IR1 A;  2I3W A;  2CEX A;  3FVG A;  1A99 A;  1SI1 A;  3UOR A;  3C9H A;  3A29 A;  1BK4 A;  2PMS A;  3U65 A;  4H6D A;  1DBZ A;  4P1E A;  3KN8 A;  4H1X A;  5KDT B;  1LB8 A;  1IMD A;  4GWZ A;  3MVZ A;  2XXR A;  4F1Y A;  2F7C A;  1FQF A;  4EUO A;  3SKP A;  1EU8 A;  1LBX A;  1IME A;  4IO5 A;  4P0I A;  3W15 C;  4H46 A;  4PP0 A;  4RPN A;  4NWC A;  3LV0 A;  3KC1 A;  3O6H A;  4HCY A;  4PAI A;  1LCT A;  4FEB A;  4MX6 A;  2PCR A;  3V8X B;  2GH9 A;  1G0H A;  3G3I A;  4BLA A;  3S9L C;  3K0V A;  3UP9 A;  3RGY A;  2REG A;  2RC9 A;  4PAF A;  3TKD A;  4ZE8 A;  4G8H A;  4DE8 A;  2DVC A;  1SVX B;  4GF8 A;  4XF5 A;  4O3C A;  5DVJ A;  2REJ A;  2DP8 A;  5H8S A;  3TTL A;  2YJP A;  4G68 C;  1ZU0 A;  1BP5 A;  1SQY A;  4TLL B;  2FNC A;  1WOD A;  3IK6 B;  1KA0 A;  3V5A A;  3IB0 A;  1N3X A;  3IAZ A;  1IUD A;  4JB7 A;  4U23 A;  2RF1 A;  2OJT A;  3RT6 B;  2ZZX A;  4KD5 A;  1UTB A;  1FBF A;  2DVZ A;  3CIJ A;  4GQO A;  1B0H A;  4AB5 A;  4JSD A;  3N94 A;  1Y9U A;  2I3V A;  2O84 X;  4X1B A;  4BDQ A;  4NF5 A;  5LOM A;  1HSJ A;  4OVS A;  5AE4 A;  2PX1 A;  4I8C A;  2PT2 A;  1ATG A;  3MP8 A;  5H8Q B;  3OOA A;  4GBW A;  4XKQ A;  3B8B A;  1ZKB A;  3TOD A;  2QRY A;  5TP9 B;  5ISU A;  1MDQ A;  5TPA B;  3TTN A;  4N6D A;  3EHU A;  1D9V A;  1UTH B;  2CZI A;  4FIM A;  4XXU A;  3MC2 A;  4OFJ A;  4N6K A;  4XFE A;  3TFL A;  4Z7E A;  2QFL A;  2Z23 A;  1H44 A;  1FPJ A;  2Q9T A;  3EF7 A;  1I6Q A;  2Z8E A;  1M5B A;  3U92 A;  1POT A;  2DS9 A;  1URG A;  1UIU A;  2V84 A;  2ZNT A;  2DOJ A;  4EDP A;  5ET5 A;  3VLW A;  3VFJ A;  3MJN A;  1ZBM A;  2ZNU A;  3CVG A;  3MBP A;  3MQ9 A;  5CC2 A;  3EHS A;  1LAG E;  4NF8 A;  5KCJ A;  4X48 A;  1EZ9 A;  4RNS A;  3GXA A;  3DP8 A;  3FXB A;  1N7W A;  3EHT A;  3OO6 A;  2D21 A;  2XXU A;  3VVF A;  5IZ3 A;  3CFX A;  1DTZ A;  1XS5 A;  5CRY A;  3HHG A;  4O3B A;  4PF6 A;  4G8M A;  3KJ7 A;  4F29 A;  5J16 A;  4KI0 E;  2O7U A;  4G68 A;  2F36 A; 
#chains in the Genus database with same CATH homology
 4FAJ A;  1P1N A;  5JK4 A;  3VVE A;  5CMC A;  4XKR A;  1B51 A;  3OO7 A;  2DE2 A;  4JSO A;  1XHY A;  2PT1 A;  4ZS9 A;  2OZZ A;  2RC7 A;  5ITO A;  3FJM A;  4THI A;  4X9T A;  3PUW E;  3KGC A;  1IXI A;  3IO4 A;  3L6H A;  4PE5 B;  5AA3 A;  4QSC A;  2PYY A;  1MXX A;  3FVK A;  2XX8 A;  3L6G A;  3QAX A;  1QUK A;  4MF3 A;  3SEV A;  4GD5 A;  1J1N A;  3S4U A;  5H8F A;  1BKA A;  5L9M A;  3W9W A;  2F7B A;  3HV1 A;  1YAE A;  4AQ4 A;  3VDF A;  4ESW A;  2E0S A;  1FW0 A;  2O6A A;  1MY4 A;  3FD3 A;  1OVB A;  4EF2 A;  5CM6 A;  1MPC A;  4ZE9 A;  3C36 A;  2Y7W A;  3KN3 A;  4OEU A;  4PQJ A;  1OLA A;  4PFT A;  3B6T A;  3MZB A;  4QFO A;  5B7D A;  1MG1 A;  1QUL A;  2PVU A;  2QL3 A;  1FQA A;  4JWO A;  4DIG A;  4QFN A;  2D5W A;  4QRZ A;  3OEM A;  1PBQ A;  1MY2 A;  1RYO A;  1Y4T A;  1ZJL A;  4M1V A;  4FAT A;  4F1V A;  4F39 A;  2H9B A;  1OLC A;  3SES A;  3W9V A;  1PB9 A;  1GTK A;  1A7L A;  4NF4 A;  4HCW A;  3TZA A;  4NED A;  4KQP A;  5EHS A;  4DXC A;  1NH7 A;  5BWJ A;  4KR5 A;  1SW5 A;  1QKA A;  1A40 A;  5H8H A;  2H25 A;  1P1U A;  5DVI A;  3UA8 A;  2O1L A;  4C1U A;  1EZO A;  1MQG A;  4M4G A;  3TTK A;  4ELQ A;  4U22 A;  5AA2 B;  2G93 A;  2XXQ A;  1OVT A;  4OFL A;  4FEC A;  4YMB A;  1A54 A;  2P1S A;  3G3H A;  1Y3P A;  2YLN A;  2DXY A;  3PUZ E;  2I58 A;  5K2X A;  3OD7 A;  2P0S A;  4KYS A;  2ESN A;  2QS3 A;  4BDO A;  1N04 A;  4GFR A;  4NMY A;  4OVJ A;  3RN8 A;  1O7T A;  3JZJ A;  1FTM A;  4FOR A;  1VE4 A;  5ICT A;  4U2R A;  1VFD A;  3ZKL A;  1MQJ A;  5B70 A;  3UK4 A;  3LSX A;  1D3K A;  1VSO A;  3QIM A;  5ITP A;  3IJO B;  2DE3 A;  3EN3 A;  2XX9 A;  4F2O A;  4DCY A;  1NFT A;  3D4G A;  2F34 A;  2HAV A;  3C32 A;  3QXM A;  1MH3 A;  1Q1K A;  2DWA A;  2GHB A;  5F7V A;  4U1Z A;  3Q26 A;  4I62 A;  1A55 A;  3TAJ A;  3FVN A;  1YPN A;  1SW1 A;  1MPB A;  3VLU A;  1MH4 A;  4NF6 B;  1MDP 1;  3QUJ A;  4R74 A;  5JTY B;  2F6G A;  3PUV E;  4GIZ A;  1B1X A;  4G2Z A;  2DYX A;  3CR9 A;  3O2A A;  2I6E A;  1N3W A;  2XXX A;  3FV1 A;  3MVX A;  5EYF A;  2Q2A A;  2AIX A;  1IIT A;  4DLD A;  4F3S A;  5KZT A;  3OO9 A;  3A3U A;  5I2N A;  4YB7 A;  4GOT A;  3ZSF A;  4GLI A;  3RTF B;  4YKK A;  4ELP A;  3PV0 E;  4AB6 A;  4OES A;  2ZYK A;  3FXU A;  4HW8 A;  4Z0I A;  3HPI A;  4R9F A;  1MY1 A;  4ZEI A;  1B3E A;  5AA4 A;  2CMO A;  3Q25 A;  5I57 B;  3MWB A;  2R71 A;  2O69 A;  5DEX A;  2RCB A;  2A5T B;  3IB2 A;  2Y7K A;  1DTG A;  3R26 A;  3RUM A;  4OWD A;  1O64 A;  4IO4 A;  2X26 A;  3HHF A;  3VV5 A;  5I56 A;  2HXW A;  2B3F A;  3KOT A;  2Q2C A;  2UVJ A;  1GV8 A;  3FZV A;  4ELO A;  5H8N B;  1B46 A;  3K4U A;  3ODB A;  4WEP A;  1H43 A;  4EQ9 A;  1FTJ A;  1JVX A;  1S9T A;  3TDJ A;  3LSL A;  4R2B A;  3VE1 B;  3PUX E;  1LLS A;  1URS A;  2I0C A;  3H6U A;  3V89 B;  3LR1 A;  1XOC A;  1VFE A;  4NTL A;  3OXN A;  2V3Q A;  3DM0 A;  3S2V A;  2OK2 A;  4E0X A;  2UYF A;  4Q0C A;  2A5S A;  2F8D A;  1Y1Z A;  4QFK A;  4OMB A;  3H6T A;  2DE4 A;  3K02 A;  1QVS A;  3ILU B;  2PBW A;  2QSX A;  3ONM A;  1FQC A;  1B5J A;  2RIN A;  5I2K A;  2HQ0 A;  5DYH A;  1H45 A;  3IB1 A;  1SI0 A;  2RC8 A;  4ECF A;  1FQD A;  1HSL A;  1UTB B;  3QUF A;  5CBS A;  2ONS A;  4U4S A;  2XX7 A;  4ZEF A;  3SEX A;  1OQH A;  4XTC Q;  4RK2 A;  4GXS B;  4YKP A;  3DP6 A;  3M3F A;  2GFE A;  1L5T A;  3HN0 A;  1MQI A;  5FHM A;  3O97 A;  1CB6 A;  3FAS A;  3SEU A;  1MY0 A;  4GXA A;  4XKP A;  2X7P A;  3CI8 A;  3PMW A;  5CMK A;  3N26 A;  1NL5 A;  4YMA A;  1EH3 A;  3WAE A;  5FHN A;  3T9V A;  3O6I A;  2O51 A;  3TQL A;  3HO7 A;  1H3D A;  3BBR A;  3TPA A;  4RPO A;  5DT6 A;  1B7U A;  2P2A A;  3IOT A;  1NMU A;  3IX1 A;  2V3T A;  3SEW A;  3S9N C;  3CG3 A;  4ND9 A;  3UIF A;  2I4C A;  1I69 A;  4N13 A;  2XD3 A;  5A5X B;  4LA9 A;  3OEN A;  5KCJ B;  4P0G A;  2VP1 A;  1LFH A;  5BUU A;  2ALU A;  1JW4 A;  4F2Q A;  3DP4 A;  4GL0 A;  1Y4C A;  2B65 A;  1OQG A;  3QYT A;  4R6K A;  1MY3 A;  1B7Z A;  1T0K A;  1B3G A;  4JBZ A;  2Q89 A;  4EXL A;  1MPD A;  1P99 A;  1XT8 A;  1JNF A;  3D4C A;  5TPA A;  2F97 A;  4F19 A;  2AYS A;  3O28 A;  4LZ5 A;  1UTH A;  3PPN A;  3Q27 A;  1ZTY A;  2KLF A;  3H6V A;  4PFW A;  1CE2 A;  1QUI A;  3MUQ A;  3PMV A;  3PPR A;  4LQ2 A;  5CMM A;  4GVO A;  2HZL A;  1SW2 A;  5FTH A;  1ANF A;  5H8F B;  1IZ1 A;  1XC1 A;  3T9H B;  4FJP A;  3RQT A;  4I1D A;  4QF9 A;  4IGT A;  1AMF A;  1B6H A;  5AA1 A;  5M2V A;  2QS1 A;  4ZEB A;  3H03 A;  1B40 A;  4MH5 A;  3H7M A;  4L17 A;  1O63 A;  2I4B A;  4F18 A;  1EZP A;  1AOV A;  3RY3 A;  1B4Z A;  4OFO A;  1HSE A;  3KFM A;  1Y3Q A;  4RA1 A;  3RNN A;  3B7D A;  3OMB A;  3S9E A;  4LP2 B;  1P1O A;  4U1O A;  3K1M A;  1Q35 A;  1LBC A;  4RK9 A;  2RCA A;  3U94 A;  2G29 A;  1B2H A;  4TOZ A;  3PGF A;  4H8I A;  4YB6 A;  4KCD A;  1MXU A;  1NNK A;  3GBB A;  3IO6 A;  3T96 B;  2F78 A;  4POW A;  1AL3 A;  3TEL A;  2I49 A;  2HAU A;  5I59 A;  4IO2 A;  3AXF A;  3HST A;  4QSD A;  3IOR A;  3E3K A;  5I58 B;  4BDL A;  4EXK A;  5F1Q A;  2THI A;  3B6Q A;  1LFI A;  1QKB A;  2O68 A;  1IIW A;  1B52 A;  4PFY A;  5H8H B;  1TXF A;  3OEK A;  4KYE A;  4KYD A;  2Z8F A;  3I6V A;  3PU5 A;  5EHM A;  4F3P A;  1AH5 A;  1JVY A;  1A8E A;  5JEI A;  3G3J A;  4N07 A;  4R6H A;  4DZ1 A;  1MXY A;  1PBP A;  3K6W A;  4XKN A;  5L9S A;  3TYH A;  3V83 A;  2VD3 A;  3PD9 A;  3CFL A;  1ZLQ A;  3CRB A;  2HFB A;  2VD2 A;  2GHA A;  1B7H A;  2ANJ A;  4FED A;  1MM7 A;  3T9X B;  4RXL A;  4POX A;  3PD8 A;  1R6Z A;  1QUJ A;  1Y3N A;  3EPE A;  2VHA A;  3FJG A;  3ZS6 A;  2IA4 A;  1DSN A;  3T93 B;  4O3A A;  4H5G A;  3O6G A;  4QFP A;  5ELV A;  4JWX A;  3SER A;  3S9M C;  4BDR A;  5AA2 A;  1JQF A;  2NXO A;  3PPQ A;  1M5C A;  3MZ9 A;  1DPP A;  5HM4 B;  2AL4 A;  1I6B A;  2H4I A;  1RYX A;  4WED A;  3UGW A;  1F9B A;  1FTL A;  2UXA A;  4JDF A;  2DQV A;  5DVF A;  1M5E A;  3LSW A;  3KEI A;  1N84 A;  3M3L A;  1ZMG A;  1B3F A;  3K6V A;  4IO7 A;  1SYH A;  3MAM A;  5K2Y A;  4IO6 A;  1R1N A;  3N6T A;  3IOU A;  3N5L A;  1B3L A;  1MXV A;  3G3F A;  3I3V A;  4E0W A;  1D4N A;  2Y7R A;  4HTG A;  3Q28 A;  3VLV A;  4HS7 A;  4ZZA A;  5I84 A;  1SD3 A;  4LON B;  4GRK A;  1LAH E;  3BFU A;  3K6U A;  5DEX B;  4Q8R A;  1II5 A;  3PMX A;  3CSB A;  3SDF A;  2Q88 A;  4YU0 A;  3KJT A;  5I56 B;  2Y7P A;  1RKM A;  4R73 A;  3USD A;  1BLF A;  2Y7I A;  3BKI B;  3OSR A;  2DWJ A;  4H65 A;  4F3B A;  1PB7 A;  3F11 A;  2UVG A;  1IXC A;  2OBG A;  3TCH A;  3KZG A;  3E13 X;  3RPW A;  1LAF E;  1Y20 A;  3MP1 A;  2ZXT A;  1FCK A;  1IQ7 A;  1N76 A;  2ZYM A;  3EQ1 A;  2HCA A;  1R9Q A;  3ILT B;  3MZ1 A;  1US5 A;  3O66 A;  3C31 A;  1GGG A;  3CG1 A;  3FXR A;  2F5X A;  2A5T A;  1B32 A;  3K00 A;  3MP6 A;  5ICQ A;  2QJE A;  4UA8 A;  2F7A A;  3LC8 A;  3DEL B;  1AIV A;  2VOZ A;  4GL8 A;  2ABH A;  1QW0 A;  4IO3 A;  1Y1M A;  4MLV A;  5H8N A;  2FA7 A;  3FUZ A;  3OSQ A;  4UAC A;  3B6W A;  2Q8J A;  1XVY A;  2Z22 A;  1UIV A;  3G3K A;  1PB8 A;  1DOT A;  4KCC A;  3WAF A;  3GBA A;  4X1D A;  1MS7 A;  4NE4 A;  2XXT A;  1YCJ A;  1P1Q A;  2VGQ A;  3U1O A;  5KDT A;  1LB9 A;  3O29 A;  3KSX A;  1USY E;  2XHD A;  3G3G A;  2H99 A;  4DCX A;  3SET A;  4IB2 A;  3MVW A;  3K1P A;  4NF5 B;  4F22 A;  3K6X A;  2NOO A;  4U21 A;  2WKY A;  4OYV A;  2ZMB A;  4OZ9 A;  3VXC A;  3E9X A;  2V25 A;  1B05 A;  4RY1 A;  1URD A;  4H5F A;  1SW4 A;  2FYI A;  2I48 A;  4P11 A;  2CZL A;  4IGR A;  4EQB A;  1XVX A;  2R6G E;  3T66 A;  3RTW B;  4Q30 B;  4MBP A;  2DXR A;  4R2F A;  3H6W A;  2X7Q A;  1JEU A;  3FGS A;  2QPQ A;  3QK6 A;  3N6U A;  1LGB C;  4QHQ A;  1R9L A;  1P1W A;  2Y84 A;  4OHN A;  3MVY A;  4ELR A;  2XXH A;  4WKM A;  2ZNS A;  3RT8 A;  4NF8 B;  1JEV A;  3CSG A;  1MRP A;  2F6P A;  4R6Y A;  4YAH X;  4DDD A;  2V93 A;  3GLB A;  5H8Q A;  2F35 A;  2OCU A;  3FAT A;  2ZYN A;  4F31 B;  4BDM A;  4OEN A;  4G68 B;  1I6A A;  1S50 A;  3BFT A;  3JYR A;  3K1N A;  5TP9 A;  4QFL A;  1MXW A;  3TUS A;  1KWH A;  3K01 A;  3LBS A;  4BDN A;  2NWJ A;  3ZKK A;  4TLM B;  2HEU A;  1D9Y A;  1B1H A;  2OWS A;  1MXZ A;  2E1S A;  3UN6 A;  5A5X A;  4JWY A;  5IAI A;  4C1T A;  2R9J A;  1LBB A;  1JW1 A;  2DSF A;  1FQB A;  3HCQ A;  4MFI A;  2YPN A;  4KPT A;  5TU0 A;  3TTM A;  2RKM A;  4LZ8 A;  1SYI A;  4OQO A;  4DXB A;  5FTI A;  3MPL A;  1N0T A;  4JXI A;  1WVJ A;  4R9G A;  3M3K A;  5L9O A;  5DTB A;  1OMP A;  1JET A;  3QSL A;  1IEJ A;  3U93 A;  4I9D A;  1N7X A;  1DPE A;  1B4H A;  2QMW A;  2GRV A;  4OET A;  5CI5 A;  2HZK A;  3R7X A;  5J1D A;  2XXI A;  3OEL A;  3KG2 A;  4GWO A;  3CFZ A;  2BJJ X;  3LUY A;  4RJZ A;  2V3U A;  3RLF E;  4G77 A;  3H06 B;  5CBR A;  3LSF B;  4ESX A;  1MQD A;  3G7W A;  5I59 B;  2XD2 A;  4C0R A;  4LUB A;  2H98 A;  1UQW A;  2M8C A;  2QMX A;  4H67 A;  3ECR A;  3C33 A;  3OO8 A;  3PUY E;  2OLB A;  2B3B A;  1IXG A;  4LAT A;  3T22 A;  1LFG A;  4G4P A;  2AL5 A;  2DWH A;  4NF4 B;  4IY5 A;  4ZDM A;  3KOS A;  3TCF A;  1FQE A;  1MM6 A;  3C34 A;  1ZIU A;  4ONY A;  4MLQ A;  2XXV A;  4R75 A;  5L8D A;  3K2D A;  3C35 A;  5HBC A;  2ZYO A;  2O7I A;  3MPK A;  1TFA A;  3DLN A;  5FHO A;  4WXJ A;  3A3C A;  4G8N A;  4TQU Q;  3M8U A;  4N6P A;  1MQH A;  1LAX A;  1GVC A;  5I58 A;  4FE8 A;  1POY 1;  3SEY A;  1ELJ A;  3PPP A;  2NUV A;  3PPO A;  3IOW A;  4OEV A;  4PFU A;  1S7Y A;  3MW0 A;  4H8J A;  2XXW A;  3FV2 A;  4PET A;  4NWD A;  4OTE A;  1SBP A;  3O9P A;  1PDA A;  3FJ7 A;  4LQ5 A;  4KHZ E;  1B58 A;  3THI A;  2D3I A;  2ONK E;  4ZEC A;  2IEE A;  1B9J A;  1H76 A;  1LCF A;  4OER A;  3GZG A;  4ZZE A;  3A09 A;  1NNP A;  4XIG Q;  4ZED A;  4R72 A;  2W7Y A;  1DMB A;  1TFD A;  2LAO A;  2O1M A;  3TTR A;  3FIR A;  1B5H A;  1TWY A;  1SDX A;  1NNT A;  3E4R A;  1B0L A;  1US4 A;  4OXV A;  5I2N B;  2XXP A;  1NKX A;  4LZ7 A;  1PC3 A;  4ZEK A;  1FTO A;  2I0B A;  3TEP A;  1B5I A;  3U8Q A;  3T9U A;  3TQW A;  2Z8D A;  5HPQ A;  3H3G A;  4IY6 A;  5AA4 B;  4H0W A;  1FTK A;  2QS4 A;  3KBR A;  4YKJ A;  1A8F A;  3R6U A;  1NH8 A;  4DXU A;  3TCG A;  2UVH A;  4ISU A;  2DWI A;  4EF1 A;  1WDN A;  5IKB A;  3U72 A;  4NF6 A;  1Z7N E;  1NNF A;  5JTY A;  1Z7M E;  1B3H A;  3P7I A;  4RYA A;  2UYE A;  1LST A;  3FXQ A;  4LVQ A;  3TMG A;  3IJX B;  2H5Y A;  4K3F A;  2OWT A;  4Q5T A;  3FVO A;  3IOV A;  1GR2 A;  3IL1 B;  4YB5 A;  4YKI A;  4EQ7 A;  1VR5 A;  1TT1 A;  1OIB A;  1USY H;  1BTJ A;  3H4Z A;  4F3G A;  4QSE A;  2NVU B;  4KFQ A;  4U4X A;  3JV9 A;  5AA2 D;  2ONR A;  5CMB A;  3KN7 A;  3KSJ A;  1JW5 A;  2QS2 A;  1YTV A;  4F1U A;  1IXH A;  4YZZ A;  5I57 A;  3VVD A;  3Q29 A;  1M5D A;  4YIC A;  2UVI A;  1BIY A;  3C4M A;  3VXB A;  1QJM A;  2XXY A;  3I5O A;  5I2K B;  1M5F A;  1PEB A;  3IR1 A;  2I3W A;  3FVG A;  1A99 A;  1SI1 A;  3UOR A;  3C9H A;  2PMS A;  4H6D A;  3KN8 A;  4H1X A;  5KDT B;  1LB8 A;  3MVZ A;  2XXR A;  4F1Y A;  2F7C A;  1FQF A;  4EUO A;  3SKP A;  1EU8 A;  4IO5 A;  4P0I A;  3W15 C;  4PP0 A;  4RPN A;  4NWC A;  3O6H A;  4HCY A;  1LCT A;  4FEB A;  3V8X B;  2GH9 A;  4BLA A;  3G3I A;  3S9L C;  3K0V A;  3UP9 A;  3RGY A;  2REG A;  2RC9 A;  3TKD A;  4ZE8 A;  4G8H A;  4DE8 A;  2DVC A;  1SVX B;  4GF8 A;  4O3C A;  5DVJ A;  2REJ A;  2DP8 A;  5H8S A;  3TTL A;  2YJP A;  4G68 C;  1ZU0 A;  1BP5 A;  1SQY A;  4TLL B;  2FNC A;  1WOD A;  3IK6 B;  3V5A A;  3IB0 A;  1N3X A;  3IAZ A;  1IUD A;  4JB7 A;  4U23 A;  2RF1 A;  2OJT A;  3RT6 B;  4KD5 A;  1UTB A;  2DVZ A;  3CIJ A;  4GQO A;  1B0H A;  4AB5 A;  4JSD A;  3N94 A;  1Y9U A;  2I3V A;  2O84 X;  4X1B A;  4BDQ A;  4NF5 A;  5LOM A;  1HSJ A;  5AE4 A;  2PX1 A;  4I8C A;  2PT2 A;  1ATG A;  3MP8 A;  5H8Q B;  3OOA A;  4XKQ A;  1ZKB A;  3TOD A;  2QRY A;  5TP9 B;  5ISU A;  1MDQ A;  5TPA B;  3TTN A;  3EHU A;  1D9V A;  1UTH B;  4FIM A;  4XXU A;  3MC2 A;  4OFJ A;  3TFL A;  4Z7E A;  2Z23 A;  1H44 A;  2Q9T A;  3EF7 A;  1I6Q A;  2Z8E A;  1M5B A;  3U92 A;  1POT A;  2DS9 A;  1URG A;  1UIU A;  2V84 A;  2ZNT A;  2DOJ A;  4EDP A;  3VLW A;  3VFJ A;  3MJN A;  1ZBM A;  2ZNU A;  3CVG A;  3MBP A;  3MQ9 A;  5CC2 A;  3EHS A;  1LAG E;  4NF8 A;  5KCJ A;  4X48 A;  1EZ9 A;  4RNS A;  3GXA A;  3DP8 A;  1N7W A;  3EHT A;  3OO6 A;  2D21 A;  2XXU A;  3VVF A;  3CFX A;  1DTZ A;  1XS5 A;  5CRY A;  3HHG A;  4O3B A;  4G8M A;  3KJ7 A;  4F29 A;  4KI0 E;  2O7U A;  4G68 A;  2F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...