4ZDMA

Pleurobrachia bachei iglur3 lbd glycine complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
254
structure length
249
Chain Sequence
SNNLNGMHLRLGIIPEMPFISEPSLGCTNIRDPSCYTGVNVEIVSMMSQDLNFTYNFITPEDLKFGGKEWNGLIRDLLDNKTDMIVVALSNNAVRKADIDFSLSMMDGGLGALVKSDGTDLSHPLELLNQDKYQWGVVDSRNPELLLASNQNADYNRIAEDAVKVGSYGEGLERMRAGGFVFIDEIPGINYATKGECDIVQIGETFQPFELAFGLRKNSPFKNLVDTFMLGIREQGVISELYAKYENQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor kainate-like protein
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
source organism Pleurobrachia bachei
molecule tags Membrane protein
total genus 81
structure length 249
sequence length 254
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zdmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zdmA02
1EH3A 1RKMA 3P7IA 3O28A 3RN8A 3G3HA 1B1HA 3C35A 5CM6A 1Q35A 3IOUA 4H8JA 5DVJA 5L9SA 4MBPA 1I69A 2WKYA 3OSQA 3KN3A 3CI8A 1LFIA 4OERA 1OQGA 3IJXB 3TTMA 4NF6A 3MVWA 1SDXA 5I56B 1FQBA 2Z8FA 3DP4A 2CMOA 3W9VA 1EU8A 1FQEA 2RCAA 1OQHA 4N6PA 3TTLA 3GXAA 1LCTA 3MVYA 1HSLA 4LONB 2UXAA 4Q0CA 3LC8A 2HFBA 1IQ7A 4RPOA 1ZLQA 1MY2A 1ATGA 4BLAA 5TP9A 4QFPA 1URSA 3CIJA 2DP8A 2R71A 3TTRA 4KYSA 1MY0A 1XHYA 5H8HB 4ELOA 2XXRA 1YPNA 2O1MA 3H6WA 3MQ9A 1FCKA 3MPKA 4FAJA 4DDDA 2OK2A 2DYXA 1H3DA 1UIVA 3PU5A 3C34A 1NH8A 1P1UA 3H6UA 5DEXB 4GFRA 4GVOA 3W9WA 3RT6B 4M1VA 3SEUA 5H8NA 3SDFA 4HTGA 2THIA 1Y1MA 4PP0A 5JEIA 5TPAB 1DTGA 1KWHA 4RK2A 1B7ZA 2H99A 3QUJA 2DXYA 3HHFA 4OXVA 1BTJA 1JEVA 5CI5A 1MPCA 1MY1A 1LSTA 4M4GA 2Q8JA 5HM4B 2RINA 5JTYA 4DXBA 1PB8A 3RTFB 2A5TB 1N04A 2CZLA 4R2BA 5CMCA 4H5FA 2XX9A 1LAFE 1YAEA 1GVCA 3PUVE 4P11A 4RJZA 4IO3A 4HCYA 3K4UA 4KFQA 2XD2A 4KI0E 4EDPA 4RA1A 3IB1A 5H8QA 1B7UA 5ICQA 3MZ1A 3T66A 5DVFA 1DPEA 1D4NA 1LB8A 3E13X 1LGBC 2PMSA 3TDJA 1ZKBA 3C36A 5ELVA 2DVCA 2PYYA 4ZEIA 5AA1A 4NTLA 1TT1A 1XT8A 4IY5A 3U92A 2O1LA 1VR5A 5CBRA 1FTJA 4QSEA 4O3AA 2LAOA 3KJ7A 4LVQA 3S9NC 2DS9A 5AA2A 3MBPA 3C31A 4O3BA 1QUJA 4NF4B 3H03A 5DTBA 3EN3A 1XC1A 1QUIA 2OBGA 2QMXA 1Z7NE 3EF7A 2Y84A 3DM0A 2NXOA 4WXJA 4YKJA 2DSFA 1OVBA 3OSRA 4ZECA 3K02A 4ELRA 5K2XA 3IO6A 5FHMA 3QIMA 2HCAA 1NL5A 2P2AA 5L8DA 2W7YA 3PPOA 3MZ9A 1NNPA 5J1DA 1B2HA 1HSEA 3O2AA 2ZYOA 2E1SA 2ONRA 2H5YA 4OEUA 2F6PA 3JYRA 1N7WA 4DCXA 4H0WA 3FXQA 4R9FA 2F97A 1SW1A 3LSFB 4U1OA 3EHUA 1B4ZA 1BKAA 5AA4B 3TPAA 4G8HA 5A5XA 3M8UA 2PVUA 4G4PA 4E0WA 3MZBA 2QS3A 3TFLA 1B3LA 3QAXA 4ISUA 4QF9A 1B4HA 4LA9A 5EHMA 4C1TA 4U2RA 3PUYE 1TXFA 3PD9A 4OEVA 1N76A 1B3FA 4LZ8A 3IX1A 1Y1ZA 1MQIA 4YZZA 4OQOA 1IUDA 4DE8A 4QSCA 5HPQA 3VVFA 1B58A 3PMXA 4OETA 4ELQA 3V83A 1R1NA 4Q5TA 4OHNA 3IL1B 3FATA 4PFTA 4ZZEA 3MC2A 2QS1A 2HQ0A 4YKPA 1FQAA 1MM6A 2M8CA 4ZZAA 2Q89A 1M5EA 1LFHA 4LP2B 4FECA 2R9JA 1JW4A 3B6QA 1B0HA 1XOCA 1HSJA 5I56A 3N94A 4F29A 4QFOA 1P1OA 3QXMA 4LUBA 2OCUA 2HEUA 4LQ2A 4EQBA 4U22A 1Y3QA 2V25A 3FUZA 4ZE9A 1LFGA 5I59B 1B3HA 5CRYA 1MPDA 4DXCA 3RPWA 2OZZA 1NNFA 5CC2A 2RC8A 4NF8B 3O97A 3Q27A 2O6AA 3C33A 3GBAA 3T9XB 4DIGA 3EHSA 3FJGA 2I3WA 1Y3NA 4XKPA 4LATA 3U1OA 1BLFA 4PE5B 2I48A 4MF3A 2XXQA 1YTVA 2ANJA 1XVYA 2QJEA 3K1PA 1B05A 3MAMA 1O7TA 3DP8A 4I62A 2GRVA 4KD5A 3TYHA 4PQJA 3LR1A 2I0CA 4R75A 4AB6A 5TPAA 3CRBA 1UQWA 4QHQA 1FTMA 4DLDA 3N5LA 3IR1A 3MP6A 3O66A 3OO8A 3TTNA 4POWA 1QKBA 1US4A 1J1NA 2UYFA 3V8XB 1RYOA 4ELPA 3IOVA 3SETA 1JVXA 2DVZA 3OXNA 2I4BA 1MPBA 3T9VA 2Q2AA 1SW2A 3MWBA 4YB7A 4OTEA 3PPQA 3TCHA 2O51A 5AA3A 5LOMA 4HW8A 4BDRA 1AL3A 3VE1B 3KSXA 1H43A 4KQPA 4EXKA 3CFXA 3HO7A 4OENA 5I58A 2XXWA 1S9TA 5ITOA 2FNCA 4GXSB 5KZTA 1MQHA 2XXUA 1MY3A 1MM7A 1ZMGA 1IEJA 3A09A 3ZKLA 3CVGA 3H7MA 4Q8RA 3O9PA 3TEPA 1JVYA 1M5BA 3ECRA 1A7LA 4ZEDA 3S9LC 1UIUA 3C32A 2IEEA 3TMGA 3UP9A 2HAVA 1P1QA 1URGA 3OO7A 1I6BA 3G7WA 1SVXB 3CSBA 4R73A 2VD2A 2D5WA 4QFKA 4IB2A 5IKBA 1P99A 3A3UA 2QS2A 2XX7A 1ELJA 1LAGE 5DYHA 2VOZA 5IAIA 2ONKE 3IOTA 3ODBA 2A5SA 4GF8A 4GXAA 1H44A 4F3PA 3O6HA 4Q30B 5CMKA 4NWCA 4P0IA 3H6TA 4KYEA 3CG1A 1Y4TA 3UK4A 1WDNA 1M5FA 3ILUB 4X1DA 4THIA 1TFDA 3T9UA 1GTKA 1B40A 1USYH 3K6XA 4GLIA 1N7XA 2V84A 3FZVA 1NNTA 1SYHA 2XX8A 4NF5B 3V5AA 4TLMB 1O63A 3BBRA 5KCJB 2ALUA 2D21A 3FASA 1B52A 3GBBA 5EYFA 3QUFA 1NMUA 1JETA 4QFLA 3EPEA 2UVIA 1Y3PA 3Q25A 2H25A 5I2KA 4L17A 2HZLA 2XXHA 4KYDA 4TLLB 3VXBA 2VHAA 2F8DA 3OO6A 2XHDA 2Z8DA 5I84A 4UA8A 2DE3A 1Y9UA 1FQFA 5H8FB 3CFLA 4P0GA 1OIBA 2FA7A 2V3TA 4F2OA 3PGFA 1URDA 4BDOA 2D3IA 3PV0E 2AYSA 4RK9A 4ZDMA 3E3KA 1LCFA 2ZNTA 4YMAA 2I6EA 1B51A 1FTLA 3C9HA 1MS7A 4OFJA 3B6TA 3R6UA 2QL3A 1MXXA 4ZEBA 1US5A 3IB0A 1S50A 1QULA 1B1XA 4U4XA 2PX1A 1UTHA 4OYVA 5AE4A 1Y20A 4G68A 4ZE8A 2RKMA 4EQ7A 4IO2A 3N26A 3KJTA 2XXIA 3FJMA 3FVOA 3IB2A 2UVJA 3TZAA 3WAFA 2I4CA 4MFIA 1L5TA 4R72A 3FV1A 2YJPA 4R6YA 2VP1A 1SYIA 4KCDA 2DE2A 4GWOA 3CR9A 4G77A 3FVNA 4ZEFA 2B3FA 3RGYA 3PUWE 3S9MC 1TWYA 1LBBA 4WEDA 3ZKKA 1T0KA 2Y7PA 2Z22A 4JBZA 3T22A 2I58A 2AIXA 3MW0A 3K00A 3VXCA 3I5OA 3THIA 3CSGA 3Q26A 2VGQA 2O69A 3KBRA 4F1UA 3RTWB 1I6AA 3SEVA 4U23A 2GFEA 1AH5A 3LBSA 1PEBA 4TQUQ 3I6VA 3UORA 4GRKA 4U4SA 1N0TA 2FYIA 4FATA 3SERA 1VFEA 4NF6B 5FTIA 1POTA 2F7AA 2F5XA 4HCWA 2QPQA 2REGA 1LB9A 2Z8EA 3FGSA 4MH5A 1TFAA 3KOTA 3OEMA 3MP1A 1SW5A 4H1XA 1IIWA 1SI0A 3K6VA 3PPNA 3SEWA 4FEBA 2QRYA 5F7VA 2Y7RA 1JEUA 2PT2A 3KG2A 2QSXA 4N13A 2I0BA 4QRZA 3KGCA 2UYEA 3G3IA 1JW5A 2F6GA 4Z7EA 2G93A 1LLSA 1UTBB 5TP9B 3G3FA 5KDTB 3IK6B 2R6GE 3IOWA 5DT6A 4N07A 1DPPA 3L6GA 4GIZA 4G8MA 4C1UA 1LAHE 3JZJA 1EZ9A 1MDP1 4DZ1A 2V3QA 5FHNA 2HAUA 5H8NB 1B7HA 4IO5A 4ND9A 3M3KA 1SW4A 1JNFA 2XXPA 3FVGA 3N6UA 2O84X 5M2VA 2BJJX 3E9XA 1MG1A 2B3BA 3D4GA 3VDFA 3R26A 2XXYA 5JTYB 1A55A 2ZYNA 3OEKA 1B9JA 2V93A 4AQ4A 4U1ZA 5JK4A 2NVUB 2XXTA 5ICTA 1ZIUA 4BDQA 3VLWA 3QSLA 4NWDA 3RNNA 2HZKA 4XIGQ 5H8HA 4NF5A 4EF2A 3OOAA 3GZGA 4H6DA 2DWJA 1O64A 5KCJA 1ZJLA 1H45A 2E0SA 1B5HA 2ESNA 5DEXA 4EXLA 1NKXA 4ESXA 3I3VA 4F18A 3C4MA 2DWIA 1SI1A 4JWYA 3K0VA 1PB9A 5K2YA 5CMBA 3FD3A 1MH3A 4PFYA 2F7CA 2AL4A 3S2VA 3FXUA 3CG3A 4G68C 4MLVA 3T9HB 4H8IA 2H98A 3O6GA 5AA2B 1POY1 1MQDA 1M5CA 3TQWA 2ZYMA 3HCQA 3FVKA 2Q9TA 2A5TA 2ZXTA 1MY4A 4JWOA 1Q1KA 3VVDA 5ITPA 2OLBA 3TKDA 4YAHX 3V89B 3IAZA 2ZMBA 4R6KA 3PUZE 2Y7KA 3K01A 3KOSA 3PUXE 3AXFA 1Z7ME 4E0XA 5L9OA 3USDA 3BKIB 2XD3A 3M3FA 3OMBA 2P0SA 1ZU0A 4R74A 2IA4A 2G29A 4R9GA 3FV2A 4F19A 1GV8A 1DMBA 3PMWA 1QJMA 4IGTA 4X9TA 4I8CA 3OENA 4ONYA 3IORA 3MJNA 2H9BA 4FIMA 4IO7A 3SKPA 5CBSA 3RT8A 1BP5A 1SBPA 3RQTA 2Y7WA 1EZOA 1P1NA 1OLCA 4K3FA 2O7UA 3EQ1A 3WAEA 1OVTA 5A5XB 2I49A 3B6WA 4UACA 3OELA 3UA8A 4OZ9A 5I2NB 4EF1A 4NF4A 4H67A 4FJPA 1QVSA 3E4RA 5I57B 5FHOA 4XKQA 2XXVA 2V3UA 3D4CA 4F31B 4QFNA 2PBWA 5B70A 1LBCA 2PT1A 1H76A 1IXIA 1R9QA 3PD8A 1DOTA 3ZSFA 4Z0IA 4OMBA 2AL5A 1AIVA 4NEDA 4JSDA 4OWDA 3TELA 4DCYA 3U94A 4I1DA 4GOTA 1N84A 2RC9A 1NH7A 2DE4A 4XKNA 2GHBA 5AA4A 1USYE 2O68A 3LUYA 1XVXA 1PC3A 3VV5A 3KZGA 3QYTA 2OWTA 3FXRA 1FTOA 1B0LA 3N6TA 2NUVA 2Y7IA 3F11A 4X48A 2F7BA 1UTBA 2HXWA 2Q88A 5KDTA 4KPTA 2GHAA 3K2DA 1A54A 1JW1A 1GR2A 2NOOA 4PFUA 2GH9A 3SEYA 4XTCQ 2REJA 4ESWA 4RNSA 2O7IA 4RY1A 4GL8A 1GGGA 3L6HA 4JDFA 4NE4A 3G3KA 1II5A 3EHTA 4POXA 3UGWA 5DVIA 3IO4A 2VD3A 3OD7A 1QUKA 4YB6A 4IGRA 1F9BA 1P1WA 2DQVA 1WVJA 4F39A 3W15C 4X1BA 3Q29A 3G3GA 3K6WA 5I59A 1DTZA 5FTHA 4KHZE 4JSOA 4YICA 4GD5A 4NF8A 4WKMA 3H4ZA 4LQ5A 4H5GA 1CB6A 3PMVA 1FQCA 1NNKA 3Q28A 3LSXA 2Z23A 3CFZA 1PB7A 1R6ZA 1S7YA 2ABHA 1MXVA 3PPRA 1ANFA 3RUMA 4OESA 4R2FA 3TCFA 5I58B 3KN8A 2I3VA 1MH4A 1QKAA 1A40A 3MVXA 5F1QA 4JWXA 2ZNUA 3U93A 2F34A 3KEIA 4F1VA 4C0RA 2YLNA 1ZBMA 4R6HA 4BDMA 4IO4A 3S9EA 1OLAA 1IXHA 2DWHA 4RPNA 2X26A 4PETA 5L9MA 4FEDA 5HBCA 4YU0A 3VVEA 5ISUA 4F3BA 3K1NA 3MVZA 1MXYA 4OFOA 1ZTYA 4H65A 4OVJA 3JV9A 3S4UA 2DXRA 3OO9A 1XS5A 3RY3A 1CE2A 3TUSA 1MQJA 4EUOA 4RYAA 3RLFE 4F3SA 3TCGA 1B46A 3QK6A 1R9LA 2DWAA 1B3GA 2UVGA 3G3JA 3KFMA 1NFTA 3IJOB 3ILTB 1WODA 3HV1A 5I2NA 4BDLA 3B7DA 1PDAA 1B3EA 1MDQA 1A99A 1LAXA 4ZS9A 5I57A 1IITA 4GQOA 3A3CA 2DOJA 3HN0A 3UN6A 1SD3A 2OJTA 1IZ1A 1PBQA 1B32A 5BUUA 2RC7A 5I2KB 1I6QA 4GL0A 1B5IA 3T96B 1EZPA 3LSLA 1OMPA 3MP8A 2F78A 2F35A 1QW0A 3FIRA 1VE4A 3DP6A 3K1MA 1RYXA 3TODA 2ZYKA 3R7XA 2ZNSA 2H4IA 4ECFA 3U8QA 1VSOA 4KR5A 3VFJA 4IY6A 3FJ7A 5H8SA 2XXXA 1N3XA 4YKIA 3DLNA 5EHSA 3MUQA 4DXUA 3BFTA 1BIYA 2RCBA 4I9DA 4U21A 1B5JA 2KLFA 3O29A 2RF1A 4ZEKA 3KSJA 1MRPA 1VFDA 3HPIA 1UTHB 1A8FA 4F22A 4G2ZA 5H8QB 1PBPA 3SEXA 1SQYA 4G68B 4FORA 4YMBA 4F3GA 4FE8A 4AB5A 3DELB 3K6UA 4IO6A 2YPNA 4G8NA 1YCJA 3SESA 5H8FA 1Y4CA 2QS4A 5B7DA 4YKKA 1B6HA 3TTKA 2OWSA 3M3LA 1D3KA 2UVHA 1D9VA 3VLUA 4EQ9A 3TAJA 4RXLA 3O6IA 1N3WA 4NMYA 4BDNA 3PPPA 4TOZA 3H3GA 3H06B 1IXCA 1DSNA 2B65A 1MXUA 1JQFA 1D9YA 3GLBA 2ONSA 3UIFA 4MLQA 2F36A 1FW0A 2QMWA 5BWJA 4LZ5A 1FQDA 2Q2CA 2NWJA 1AOVA 3ZS6A 1M5DA 3HSTA 4JXIA 1MQGA 1AMFA 3BFUA 3TQLA 4PFWA 3MPLA 3HHGA 5CMMA 3ONMA 4O3CA 1A8EA 4F1YA 3LSWA 3U72A 4QSDA 4F2QA 1FTKA 4KCCA 3H6VA 3T93B 3VLVA 5AA2D 2X7QA 1IXGA 4XXUA 3KN7A 5TU0A 4LZ7A 2P1SA 4XKRA 4HS7A 4YB5A 1MXWA 1MXZA 4JB7A 2X7PA 4WEPA 4OFLA
chains in the Genus database with same CATH superfamily
1EH3A 1RKMA 3P7IA 3O28A 3RN8A 4QXDA 3G3HA 5ET7A 1B1HA 3C35A 5CM6A 1Q35A 1FBCA 3HFUA 3BIHA 3IOUA 4H8JA 4P56A 5DVJA 5L9SA 4MBPA 1I69A 2WKYA 2CEXA 3OSQA 3KN3A 3CI8A 1LFIA 1K9ZA 4OERA 1OQGA 3IJXB 3TTMA 4NF6A 1G0HA 2Q74A 4MAGA 3MVWA 5IZ3B 1SDXA 4MX6A 5I56B 1FQBA 2Z8FA 3DP4A 2CMOA 4GX6A 3W9VA 1EU8A 1FQEA 2RCAA 1OQHA 4N6PA 3TTLA 2P3VA 3GXAA 1LCTA 3MVYA 3B50A 1NUWA 1HSLA 4LONB 2CZHA 2UXAA 4Q0CA 3LC8A 2WYPA 2CZKA 2HFBA 1IQ7A 4RPOA 1ZLQA 3B8BA 1MY2A 1ATGA 4BLAA 5TP9A 4QFPA 1URSA 3CIJA 4GBWA 2DP8A 1KZ8A 2R71A 3TTRA 4KYSA 1MY0A 1XHYA 5H8HB 4ELOA 2WBDA 2XXRA 1YPNA 2O1MA 3H6WA 3MQ9A 1FCKA 3MPKA 4FAJA 4DDDA 2OK2A 2DYXA 1H3DA 4GWYA 1UIVA 3PU5A 3C34A 1NH8A 1P1UA 3H6UA 5DEXB 1FTAA 4GFRA 4GVOA 3W9WA 4PFBA 3RT6B 4M1VA 4O94A 3SEUA 5H8NA 3SDFA 4HTGA 2THIA 4XEQA 1Y1MA 4PP0A 5JEIA 5ESYA 3SZPA 5TPAB 1DTGA 1KWHA 4RK2A 1B7ZA 2H99A 3QUJA 1YXIA 2DXYA 1KA0A 3HHFA 4OXVA 1BTJA 1JEVA 5CI5A 1MPCA 1MY1A 1LSTA 4M4GA 2Q8JA 5HM4B 2RINA 5JTYA 5I5PA 4DXBA 1PB8A 3RTFB 4N8GA 4PGPA 2A5TB 1N04A 2CZLA 4R2BA 5CMCA 4H5FA 2XX9A 1LAFE 1YAEA 1GVCA 3PUVE 4P11A 4RJZA 4IO3A 4HCYA 2OWZA 3K4UA 4KFQA 4I3EA 2XD2A 4MEVA 4KI0E 4EDPA 4LN5A 4MMPA 4RA1A 3IB1A 5H8QA 1B7UA 5ICQA 3MZ1A 3T66A 5DVFA 4GWSA 1DPEA 1D4NA 1LB8A 3E13X 1LGBC 2PMSA 3TDJA 1ZKBA 3C36A 5ELVA 2DVCA 2PYYA 4ZEIA 5AA1A 4NTLA 3D1RA 1TT1A 1XT8A 4IY5A 3U92A 2O1LA 1VR5A 5CBRA 1FTJA 4QSEA 4O3AA 2LAOA 3KJ7A 4LVQA 4OVTA 3S9NC 2DS9A 5AA2A 1FPJA 3MBPA 3C31A 4N91A 2CZIA 4QBAA 5LTCA 4O3BA 1QUJA 4NF4B 4NQ8A 3H03A 5DTBA 3EN3A 1XC1A 1QUIA 5IZ1A 2OBGA 2QMXA 1Z7NE 3EF7A 2Y84A 3DM0A 2NXOA 4WXJA 4YKJA 2DSFA 1OVBA 3OSRA 4ZECA 3K02A 5F24A 4ELRA 5K2XA 3IO6A 5FHMA 2QVVA 3QIMA 2HCAA 1NL5A 2P2AA 5L8DA 4HE1A 2W7YA 3PPOA 1FPLA 3MZ9A 1NNPA 5J1DA 1B2HA 1HSEA 1LEVA 3O2AA 4GX4A 2ZYOA 2E1SA 2ONRA 2H5YA 4OEUA 3KC0A 2F6PA 3JYRA 1N7WA 4DCXA 4H0WA 3FXQA 4R9FA 2F97A 2CEYA 1SW1A 3LSFB 4U1OA 3EHUA 3A29A 1B4ZA 1BKAA 5AA4B 3TPAA 4OVSA 4G8HA 5A5XA 3M8UA 1FPEA 2PVUA 4G4PA 3KC1A 4E0WA 3MZBA 2QS3A 3TFLA 1B3LA 4N6DA 3QAXA 4ISUA 4QF9A 1B4HA 4LA9A 5EHMA 4C1TA 4U2RA 3PUYE 1TXFA 3PD9A 4OEVA 4GWZA 1N76A 1FPGA 1B3FA 4LZ8A 3IX1A 1Y1ZA 1MQIA 4YZZA 4OQOA 1RDXA 1IUDA 4DE8A 4QSCA 5HPQA 3VVFA 1B58A 3PMXA 4OETA 4ELQA 4X8RA 3V83A 1R1NA 4Q5TA 4OHNA 3IL1B 3FATA 4PFTA 4ZZEA 3MC2A 2QS1A 2HQ0A 4YKPA 1FQAA 1MM6A 2M8CA 4ZZAA 2Q89A 1M5EA 1LFHA 5J16A 4LP2B 4FECA 2R9JA 1JW4A 3B6QA 1B0HA 1XOCA 1HSJA 5I56A 3N94A 4F29A 4QFOA 1P1OA 3QXMA 1IMBA 4LUBA 2OCUA 2HEUA 4LQ2A 4EQBA 4U22A 1Y3QA 2V25A 3FUZA 4ZE9A 1LFGA 5I59B 1B3HA 4NN3A 5CRYA 1MPDA 4DXCA 3RPWA 2OZZA 1NNFA 2B4MA 4P47A 5CC2A 2RC8A 4NF8B 3O97A 3Q27A 2O6AA 3C33A 3GBAA 3T9XB 4DIGA 3EHSA 3FJGA 2I3WA 1Y3NA 4XKPA 1FBHA 1FSAA 2WYKA 4LATA 3U1OA 1BLFA 4PE5B 2MKZA 2I48A 4MF3A 2XXQA 2ZZWA 1YTVA 2ANJA 1NV6A 1XVYA 2QJEA 3K1PA 1NV7A 1B05A 3MAMA 1O7TA 2PFYA 3DP8A 4I62A 2GRVA 4KD5A 3TYHA 4PQJA 1NV1A 1NI9A 3LR1A 2GQ1A 2I0CA 4R75A 5IM2A 3GYYA 4AB6A 5TPAA 3CRBA 1UQWA 4QHQA 1FTMA 4DLDA 3N5LA 3IR1A 3MP6A 3O66A 3OO8A 3TTNA 4POWA 1QKBA 1US4A 1J1NA 2UYFA 2KR0A 3V8XB 1RYOA 4ELPA 3IOVA 3SETA 1JVXA 2DVZA 3OXNA 2I4BA 1MPBA 3T9VA 2Q2AA 4PAKA 1SW2A 3MWBA 4YB7A 4OTEA 3PPQA 2JJKA 3TCHA 2QFLA 2O51A 2VPOA 5AA3A 4OANA 1IMAA 1EYIA 5LOMA 4HW8A 4BDRA 1AL3A 3VE1B 3KSXA 2FBPA 1H43A 2QVRA 4KQPA 4EXKA 3CFXA 3HO7A 4OENA 3RPLB 4MHFA 5I58A 2XXWA 2XA5A 1LBVA 1S9TA 5ITOA 2FNCA 4P9KA 4GXSB 5KZTA 1MQHA 2XXUA 1MY3A 1Q9DA 4MNPA 1MM7A 1ZMGA 4HXVA 1IEJA 3A09A 3ZKLA 3CVGA 5T3JA 3H7MA 2Y5KA 4Q8RA 3O9PA 3TEPA 1JVYA 1M5BA 3ECRA 1A7LA 4P1LA 4NGUA 4ZEDA 3S9LC 1IMEA 1UIUA 3C32A 2IEEA 4NAPA 4O7MA 3TMGA 3UP9A 2HAVA 1P1QA 1URGA 3OO7A 1I6BA 3G7WA 1D9QA 1SVXB 3CSBA 4R73A 1FJ6A 2VD2A 2D5WA 1XI6A 4PDHA 4O8MA 4QFKA 4IB2A 5IKBA 2V4CA 1P99A 3A3UA 2QS2A 2XX7A 3MSTA 1ELJA 1LAGE 5DYHA 2VOZA 5IAIA 2ONKE 3IOTA 3CHGA 3ODBA 2A5SA 4GF8A 4GXAA 2XWIA 1H44A 4F3PA 4PF6A 1NV3A 3O6HA 4Q30B 5CMKA 4NWCA 4P0IA 3H6TA 4KYEA 3CG1A 1Y4TA 4P3LA 3UK4A 1WDNA 1M5FA 3ILUB 4X1DA 4THIA 4NHBA 1TFDA 3T9UA 1GTKA 1B40A 1USYH 3K6XA 4GLIA 1N7XA 2V84A 3FZVA 1NNTA 1SYHA 2XX8A 4NF5B 3V5AA 4TLMB 1O63A 3BBRA 5KCJB 2ALUA 2D21A 3FASA 1B52A 3GBBA 5EYFA 3QUFA 5LDZA 1NMUA 1JETA 4QFLA 3EPEA 2UVIA 1Y3PA 3Q25A 2OX3A 2H25A 5I2KA 4L17A 2HZLA 2XXHA 4KYDA 4TLLB 3VXBA 2VHAA 1NV5A 2F8DA 3T0JA 3OO6A 2XHDA 1EYJA 1G0IA 2Z8DA 5I84A 4UA8A 2DE3A 1Y9UA 1FQFA 5H8FB 3CFLA 4P0GA 1NV2A 1OIBA 2FA7A 2V3TA 4F2OA 3PGFA 1URDA 4BDOA 2D3IA 3PV0E 2AYSA 4RK9A 3IFAA 4ZDMA 3E3KA 5EQAA 1LCFA 2ZNTA 4YMAA 2I6EA 1B51A 1FTLA 3C9HA 1MS7A 4PBQA 4OFJA 3B6TA 3R6UA 2QL3A 1MXXA 3T1BA 2ZZVA 4ZEBA 1US5A 3IB0A 1S50A 4AS5A 1FPBA 1QULA 1B1XA 4U4XA 2PX1A 1UTHA 4OYVA 5AE4A 1Y20A 4G68A 4ZE8A 2RKMA 4OVQA 4EQ7A 4IO2A 2HPGA 3N26A 3KJTA 2XXIA 3FJMA 3FVOA 3IB2A 2UVJA 3IFCA 3TZAA 3WAFA 2I4CA 4MFIA 1L5TA 3E78A 4R72A 3FV1A 2YJPA 4R6YA 2VP1A 1SYIA 4KCDA 2DE2A 4PC9A 4PF8A 1FBDA 4GWOA 4OA4A 4N4UA 2FIXA 3CR9A 4G77A 3FVNA 4XF5A 4ZEFA 2B3FA 3PUWE 3RGYA 3S9MC 1TWYA 1LBBA 4WEDA 3ZKKA 1T0KA 2Y7PA 2Z22A 4JBZA 3T22A 2I58A 2HHMA 2AIXA 3MW0A 3K00A 3VXCA 3I5OA 3THIA 3CSGA 3Q26A 2VGQA 2O69A 3KBRA 4F1UA 3RTWB 5ET5A 1I6AA 3SEVA 4U23A 2GFEA 3MYUA 1AH5A 3LBSA 1PEBA 4TQUQ 3I6VA 3UORA 4GRKA 4U4SA 1N0TA 2FYIA 1VFEA 3SERA 4FATA 4NF6B 5FTIA 1POTA 2F7AA 2F5XA 4HCWA 2QPQA 2REGA 1LB9A 2Z8EA 2HXRA 3FGSA 4MH5A 1TFAA 3KOTA 3OEMA 3MP1A 1SW5A 4H1XA 1IIWA 1SI0A 3K6VA 3PPNA 3SEWA 3LUZA 1BK4A 4FEBA 2QRYA 5F7VA 3EKIA 2Y7RA 1JEUA 4NF0A 4DI4B 3KBZA 2PT2A 3KG2A 2QSXA 4N13A 2I0BA 5I7IA 4QRZA 5IGAA 3KGCA 2UYEA 3G3IA 1JW5A 2F6GA 4Z7EA 4PGNA 2G93A 1LLSA 1NUZA 1UTBB 5TP9B 3G3FA 5KDTB 3IK6B 2R6GE 2Q8MA 3IOWA 4JVIA 5DT6A 1YZ0A 2XXKA 4N07A 1DPPA 3L6GA 4GIZA 4G8MA 4C1UA 1LAHE 3JZJA 1EZ9A 1MDP1 4DZ1A 2V3QA 1FBFA 5FHNA 2HAUA 5H8NB 1B7HA 4IO5A 4ND9A 1FJ9A 3M3KA 4N8YA 1SW4A 1JNFA 5IZ3A 2XXPA 3FVGA 3N6UA 2O84X 5M2VA 2BJJX 3E9XA 1MG1A 2B3BA 3D4GA 3VDFA 1FPDA 3R26A 5FBPA 2XXYA 2FIEA 5JTYB 1A55A 2ZYNA 3OEKA 1B9JA 2V93A 4AQ4A 4U1ZA 4P1EA 5JK4A 4MJOA 2NVUB 4G61A 2PFZA 2XXTA 5ICTA 1ZIUA 4BDQA 3VLWA 3QSLA 4NWDA 1FBPA 3RNNA 2HZKA 4XIGQ 5H8HA 4NF5A 4EF2A 3OOAA 3GZGA 4H6DA 2DWJA 1O64A 5KCJA 1ZJLA 1K9YA 1H45A 2E0SA 4GWWA 1B5HA 2L5VA 2ESNA 5DEXA 5IZZA 2DDKA 4JVCA 4EXLA 1NKXA 4ESXA 3I3VA 4MNIA 4F18A 3C4MA 2DWIA 1SI1A 4JWYA 3K0VA 1PB9A 5K2YA 5CMBA 4DI3D 3FD3A 1MH3A 4PFYA 2F7CA 2AL4A 3S2VA 3FXUA 3CG3A 1NUYA 2VPNA 4G68C 4MLVA 3T9HB 4H8IA 2H98A 3E79A 3O6GA 5AA2B 1POY1 5A5LA 1MQDA 1M5CA 3TQWA 2ZYMA 3HCQA 3FVKA 2Q9TA 2A5TA 2ZXTA 1MY4A 4JWOA 5I3SA 1FBEA 1Q1KA 3VVDA 5ITPA 2OLBA 3TKDA 4YAHX 3V89B 4N6KA 3IAZA 3QMFA 1VDWA 2ZMBA 4R6KA 3PUZE 2Y7KA 3K01A 3KOSA 3PUXE 3AXFA 1Z7ME 4E0XA 5L9OA 3USDA 3BKIB 2XD3A 2KQZA 3M3FA 3OMBA 2P0SA 1ZU0A 4R74A 2IA4A 2G29A 4R9GA 3FV2A 4F19A 1GV8A 1DMBA 3PMWA 1QJMA 4IGTA 4MNCA 4X9TA 1DBZA 4I8CA 3OENA 4ONYA 3IORA 3MJNA 2H9BA 4FIMA 4IO7A 3SKPA 5CBSA 3RT8A 1BP5A 1SBPA 3RQTA 2Y7WA 1EZOA 1IMCA 1OLCA 1P1NA 4K3FA 2O7UA 3EQ1A 3WAEA 1OVTA 5A5XB 2I49A 3B6WA 4UACA 3OELA 3UA8A 4OZ9A 5I2NB 4EF1A 4PBHA 1KA1A 4NF4A 4H67A 4FJPA 1QVSA 3E4RA 5I57B 4I40A 5FHOA 4XKQA 1FRPA 2XXVA 2V3UA 3D4CA 4F31B 4QFNA 4PFIA 2PBWA 5B70A 1LBCA 2PT1A 1H76A 1IXIA 4GWUA 1R9QA 3PD8A 1DOTA 3ZSFA 4PTKA 4Z0IA 2WX9A 4OMBA 2AL5A 1AIVA 4NEDA 4JSDA 4HE2A 4OWDA 3TELA 4DCYA 3U94A 4I1DA 4GOTA 1N84A 2RC9A 1NH7A 2DE4A 4XKNA 2GHBA 5ET6A 5AA4A 1IMDA 1USYE 2O68A 3LUYA 1XVXA 1PC3A 3VV5A 3KZGA 1SPIA 1LBWA 3QYTA 2OWTA 3FXRA 1FTOA 1B0LA 3N6TA 2NUVA 2Y7IA 3F11A 4JVDA 1AWBA 2PCRA 4X48A 2F7BA 1UTBA 2HXWA 2Q88A 5KDTA 3ISPA 4FBPA 2GHAA 3K2DA 4KPTA 1A54A 1JW1A 1GR2A 4PCDA 2NOOA 4PFUA 2GH9A 3SEYA 4XTCQ 2REJA 4ESWA 4RNSA 2O7IA 4RY1A 4OVPA 2XWKA 4GL8A 1GGGA 3L6HA 4XFEA 3U65A 4JDFA 4NE4A 3G3KA 4H45A 1II5A 4PAIA 3EHTA 4POXA 3UGWA 5DVIA 3IO4A 4N15A 2VD3A 3OD7A 1QUKA 4YB6A 4IGRA 1F9BA 1P1WA 2DQVA 1WVJA 4F39A 2WEFA 3W15C 4X1BA 3Q29A 3G3GA 3K6WA 5I59A 1JP4A 1DTZA 5FTHA 4KHZE 4JSOA 4YICA 4GD5A 4I3YA 4NF8A 4WKMA 3H4ZA 4LQ5A 4H5GA 1NUXA 1CB6A 3PMVA 1FQCA 1NNKA 3Q28A 3LSXA 2Z23A 3CFZA 1PB7A 1R6ZA 1S7YA 2ABHA 1RDZA 1MXVA 3BIGA 3PPRA 4NX1A 1ANFA 3RUMA 1INPA 4KXPA 4OESA 4R2FA 3TCFA 5I58B 3KN8A 2I3VA 1MH4A 1RDYA 1QKAA 1A40A 3MVXA 5F1QA 4JWXA 2ZNUA 3U93A 2F34A 3KEIA 4F1VA 4C0RA 4N17A 2YLNA 1ZBMA 4R6HA 4BDMA 4IO4A 3S9EA 5EQ9A 1OLAA 1IXHA 2DWHA 2FVZA 4RPNA 2X26A 4PETA 5L9MA 4FEDA 1IMFA 5HBCA 4YU0A 3VVEA 4UABA 5ISUA 2QVUA 4F3BA 3K1NA 5EQ7A 4MIJA 3MVZA 1MXYA 4OFOA 2P3NA 3NOHA 1ZTYA 4H65A 4OVJA 3JV9A 3S4UA 4PDDA 1NV0A 5ET8A 2DXRA 3OO9A 1XS5A 3RY3A 3RPLA 1CE2A 3TUSA 1MQJA 4EUOA 4RYAA 3RLFE 1LBXA 4F3SA 3TCGA 1B46A 3QK6A 1R9LA 2DWAA 1B3GA 2UVGA 3G3JA 3KFMA 3RYDA 1NFTA 3IJOB 3ILTB 1WODA 4N81A 3HV1A 1FPIA 5I2NA 4BDLA 3B7DA 1PDAA 1B3EA 2BJIA 1MDQA 1A99A 1QGXA 5EYGA 1LAXA 4ZS9A 5I57A 1IITA 4GQOA 3A3CA 4AS4A 2DOJA 3HN0A 3UN6A 1SD3A 4OVRA 3ROJA 2OJTA 1IZ1A 1PBQA 1B32A 1LBZA 3FBPA 5BUUA 2RC7A 5I2KB 1I6QA 4GL0A 1B5IA 3T96B 1EZPA 3LSLA 4NG7A 2VT5A 1OMPA 3MP8A 2F3DA 2F78A 4GWXA 2F35A 1QW0A 3FIRA 1VE4A 4MCOA 3FXBA 2B4LA 3DP6A 3K1MA 1RYXA 3TODA 2ZYKA 1YYZA 3R7XA 2ZNSA 2H4IA 4ECFA 3U8QA 1VSOA 4KR5A 3VFJA 4IY6A 3FJ7A 5H8SA 2XXXA 1N3XA 4YKIA 3DLNA 5EHSA 3MUQA 4DXUA 3BFTA 1BIYA 2RCBA 4I9DA 4O7IA 4U21A 1B5JA 2KLFA 3O29A 2RF1A 2R8TA 4ZEKA 2WBBA 3KSJA 1MRPA 3LV0A 4IR8A 1VFDA 3HPIA 1UTHB 1A8FA 4F22A 4G2ZA 5H8QB 1PBPA 3SEXA 1SQYA 4G68B 4FORA 4YMBA 4F3GA 4FE8A 4AB5A 4GX3A 2XWVA 2Y5LA 3DELB 3K6UA 4IO6A 2YPNA 4G8NA 2XWOA 1YCJA 3SESA 1FPFA 5H8FA 1Y4CA 2QS4A 5B7DA 4YKKA 1B6HA 3TTKA 2OWSA 3M3LA 1D3KA 2UVHA 1D9VA 3VLUA 1DCUA 4EQ9A 3TAJA 4RXLA 3O6IA 1N3WA 4NMYA 4BDNA 3PPPA 4TOZA 5EYHA 4P8BA 3H3GA 4PAFA 3PTYA 3H06B 1IXCA 1DSNA 2B65A 1MXUA 1JQFA 1D9YA 1EYKA 3GLBA 2ONSA 3UIFA 4MLQA 1NV4A 1DK4A 2F36A 1FW0A 2QMWA 4H46A 5BWJA 4LZ5A 1FQDA 2Q2CA 2NWJA 1AOVA 3ZS6A 1M5DA 3HSTA 4JXIA 1MQGA 4GBVA 1AMFA 3BFUA 3TQLA 4PFWA 1FBGA 1CNQA 3MPLA 5DW8A 3HHGA 5CMMA 3ONMA 4O3CA 1A8EA 4HE0A 4F1YA 2F3BA 3LSWA 3U72A 4QSDA 4F2QA 1FTKA 4KCCA 3H6VA 3T93B 4X04A 3VLVA 1LBYA 5AA2D 2X7QA 1IXGA 5EQ8A 4PFRA 4XXUA 4PE3A 2FHYA 3KN7A 1FPKA 5TU0A 4LZ7A 2P1SA 4XKRA 4HS7A 4YB5A 1MXWA 1MXZA 2ZZXA 4JB7A 2X7PA 4WEPA 4OFLA
chains in the Genus database with same CATH topology
1EH3A 1RKMA 3P7IA 3O28A 3RN8A 3G3HA 1B1HA 3C35A 5CM6A 1Q35A 3IOUA 4H8JA 5DVJA 5L9SA 4MBPA 1I69A 2WKYA 3OSQA 3KN3A 3CI8A 1LFIA 4OERA 1OQGA 3IJXB 3TTMA 4NF6A 3MVWA 1SDXA 5I56B 1FQBA 2Z8FA 3DP4A 2CMOA 3W9VA 1EU8A 1FQEA 2RCAA 1OQHA 4N6PA 3TTLA 3GXAA 1LCTA 3MVYA 1HSLA 4LONB 2UXAA 4Q0CA 3LC8A 2HFBA 1IQ7A 4RPOA 1ZLQA 1MY2A 1ATGA 4BLAA 5TP9A 4QFPA 1URSA 3CIJA 2DP8A 2R71A 3TTRA 4KYSA 1MY0A 1XHYA 5H8HB 4ELOA 2XXRA 1YPNA 2O1MA 3H6WA 3MQ9A 1FCKA 3MPKA 4FAJA 4DDDA 2OK2A 2DYXA 1H3DA 1UIVA 3PU5A 3C34A 1NH8A 1P1UA 3H6UA 5DEXB 4GFRA 4GVOA 3W9WA 3RT6B 4M1VA 3SEUA 5H8NA 3SDFA 4HTGA 2THIA 1Y1MA 4PP0A 5JEIA 5TPAB 1DTGA 1KWHA 4RK2A 1B7ZA 2H99A 3QUJA 2DXYA 3HHFA 4OXVA 1BTJA 1JEVA 5CI5A 1MPCA 1MY1A 1LSTA 4M4GA 2Q8JA 5HM4B 2RINA 5JTYA 4DXBA 1PB8A 3RTFB 2A5TB 1N04A 2CZLA 4R2BA 5CMCA 4H5FA 2XX9A 1LAFE 1YAEA 1GVCA 3PUVE 4P11A 4RJZA 4IO3A 4HCYA 3K4UA 4KFQA 2XD2A 4KI0E 4EDPA 4RA1A 3IB1A 5H8QA 1B7UA 5ICQA 3MZ1A 3T66A 5DVFA 1DPEA 1D4NA 1LB8A 3E13X 1LGBC 2PMSA 3TDJA 1ZKBA 3C36A 5ELVA 2DVCA 2PYYA 4ZEIA 5AA1A 4NTLA 1TT1A 1XT8A 4IY5A 3U92A 2O1LA 1VR5A 5CBRA 1FTJA 4QSEA 4O3AA 2LAOA 3KJ7A 4LVQA 3S9NC 2DS9A 5AA2A 3MBPA 3C31A 4O3BA 1QUJA 4NF4B 3H03A 5DTBA 3EN3A 1XC1A 1QUIA 2OBGA 2QMXA 1Z7NE 3EF7A 2Y84A 3DM0A 2NXOA 4WXJA 4YKJA 2DSFA 1OVBA 3OSRA 4ZECA 3K02A 4ELRA 5K2XA 3IO6A 5FHMA 3QIMA 2HCAA 1NL5A 2P2AA 5L8DA 2W7YA 3PPOA 3MZ9A 1NNPA 5J1DA 1B2HA 1HSEA 3O2AA 2ZYOA 2E1SA 2ONRA 2H5YA 4OEUA 2F6PA 3JYRA 1N7WA 4DCXA 4H0WA 3FXQA 4R9FA 2F97A 1SW1A 3LSFB 4U1OA 3EHUA 1B4ZA 1BKAA 5AA4B 3TPAA 4G8HA 5A5XA 3M8UA 2PVUA 4G4PA 4E0WA 3MZBA 2QS3A 3TFLA 1B3LA 3QAXA 4ISUA 4QF9A 1B4HA 4LA9A 5EHMA 4C1TA 4U2RA 3PUYE 1TXFA 3PD9A 4OEVA 1N76A 1B3FA 4LZ8A 3IX1A 1Y1ZA 1MQIA 4YZZA 4OQOA 1IUDA 4DE8A 4QSCA 5HPQA 3VVFA 1B58A 3PMXA 4OETA 4ELQA 3V83A 1R1NA 4Q5TA 4OHNA 3IL1B 3FATA 4PFTA 4ZZEA 3MC2A 2QS1A 2HQ0A 4YKPA 1FQAA 1MM6A 2M8CA 4ZZAA 2Q89A 1M5EA 1LFHA 4LP2B 4FECA 2R9JA 1JW4A 3B6QA 1B0HA 1XOCA 1HSJA 5I56A 3N94A 4F29A 4QFOA 1P1OA 3QXMA 4LUBA 2OCUA 2HEUA 4LQ2A 4EQBA 4U22A 1Y3QA 2V25A 3FUZA 4ZE9A 1LFGA 5I59B 1B3HA 5CRYA 1MPDA 4DXCA 3RPWA 2OZZA 1NNFA 5CC2A 2RC8A 4NF8B 3O97A 3Q27A 2O6AA 3C33A 3GBAA 3T9XB 4DIGA 3EHSA 3FJGA 2I3WA 1Y3NA 4XKPA 4LATA 3U1OA 1BLFA 4PE5B 2I48A 4MF3A 2XXQA 1YTVA 2ANJA 1XVYA 2QJEA 3K1PA 1B05A 3MAMA 1O7TA 3DP8A 4I62A 2GRVA 4KD5A 3TYHA 4PQJA 3LR1A 2I0CA 4R75A 4AB6A 5TPAA 3CRBA 1UQWA 4QHQA 1FTMA 4DLDA 3N5LA 3IR1A 3MP6A 3O66A 3OO8A 3TTNA 4POWA 1QKBA 1US4A 1J1NA 2UYFA 3V8XB 1RYOA 4ELPA 3IOVA 3SETA 1JVXA 2DVZA 3OXNA 2I4BA 1MPBA 3T9VA 2Q2AA 1SW2A 3MWBA 4YB7A 4OTEA 3PPQA 3TCHA 2O51A 5AA3A 5LOMA 4HW8A 4BDRA 1AL3A 3VE1B 3KSXA 1H43A 4KQPA 4EXKA 3CFXA 3HO7A 4OENA 5I58A 2XXWA 1S9TA 5ITOA 2FNCA 4GXSB 5KZTA 1MQHA 2XXUA 1MY3A 1MM7A 1ZMGA 1IEJA 3A09A 3ZKLA 3CVGA 3H7MA 4Q8RA 3O9PA 3TEPA 1JVYA 1M5BA 3ECRA 1A7LA 4ZEDA 3S9LC 1UIUA 3C32A 2IEEA 3TMGA 3UP9A 2HAVA 1P1QA 1URGA 3OO7A 1I6BA 3G7WA 1SVXB 3CSBA 4R73A 2VD2A 2D5WA 4QFKA 4IB2A 5IKBA 1P99A 3A3UA 2QS2A 2XX7A 1ELJA 1LAGE 5DYHA 2VOZA 5IAIA 2ONKE 3IOTA 3ODBA 2A5SA 4GF8A 4GXAA 1H44A 4F3PA 3O6HA 4Q30B 5CMKA 4NWCA 4P0IA 3H6TA 4KYEA 3CG1A 1Y4TA 3UK4A 1WDNA 1M5FA 3ILUB 4X1DA 4THIA 1TFDA 3T9UA 1GTKA 1B40A 1USYH 3K6XA 4GLIA 1N7XA 2V84A 3FZVA 1NNTA 1SYHA 2XX8A 4NF5B 3V5AA 4TLMB 1O63A 3BBRA 5KCJB 2ALUA 2D21A 3FASA 1B52A 3GBBA 5EYFA 3QUFA 1NMUA 1JETA 4QFLA 3EPEA 2UVIA 1Y3PA 3Q25A 2H25A 5I2KA 4L17A 2HZLA 2XXHA 4KYDA 4TLLB 3VXBA 2VHAA 2F8DA 3OO6A 2XHDA 2Z8DA 5I84A 4UA8A 2DE3A 1Y9UA 1FQFA 5H8FB 3CFLA 4P0GA 1OIBA 2FA7A 2V3TA 4F2OA 3PGFA 1URDA 4BDOA 2D3IA 3PV0E 2AYSA 4RK9A 4ZDMA 3E3KA 1LCFA 2ZNTA 4YMAA 2I6EA 1B51A 1FTLA 3C9HA 1MS7A 4OFJA 3B6TA 3R6UA 2QL3A 1MXXA 4ZEBA 1US5A 3IB0A 1S50A 1QULA 1B1XA 4U4XA 2PX1A 1UTHA 4OYVA 5AE4A 1Y20A 4G68A 4ZE8A 2RKMA 4EQ7A 4IO2A 3N26A 3KJTA 2XXIA 3FJMA 3FVOA 3IB2A 2UVJA 3TZAA 3WAFA 2I4CA 4MFIA 1L5TA 4R72A 3FV1A 2YJPA 4R6YA 2VP1A 1SYIA 4KCDA 2DE2A 4GWOA 3CR9A 4G77A 3FVNA 4ZEFA 2B3FA 3RGYA 3PUWE 3S9MC 1TWYA 1LBBA 4WEDA 3ZKKA 1T0KA 2Y7PA 2Z22A 4JBZA 3T22A 2I58A 2AIXA 3MW0A 3K00A 3VXCA 3I5OA 3THIA 3CSGA 3Q26A 2VGQA 2O69A 3KBRA 4F1UA 3RTWB 1I6AA 3SEVA 4U23A 2GFEA 1AH5A 3LBSA 1PEBA 4TQUQ 3I6VA 3UORA 4GRKA 4U4SA 1N0TA 2FYIA 4FATA 3SERA 1VFEA 4NF6B 5FTIA 1POTA 2F7AA 2F5XA 4HCWA 2QPQA 2REGA 1LB9A 2Z8EA 3FGSA 4MH5A 1TFAA 3KOTA 3OEMA 3MP1A 1SW5A 4H1XA 1IIWA 1SI0A 3K6VA 3PPNA 3SEWA 4FEBA 2QRYA 5F7VA 2Y7RA 1JEUA 2PT2A 3KG2A 2QSXA 4N13A 2I0BA 4QRZA 3KGCA 2UYEA 3G3IA 1JW5A 2F6GA 4Z7EA 2G93A 1LLSA 1UTBB 5TP9B 3G3FA 5KDTB 3IK6B 2R6GE 3IOWA 5DT6A 4N07A 1DPPA 3L6GA 4GIZA 4G8MA 4C1UA 1LAHE 3JZJA 1EZ9A 1MDP1 4DZ1A 2V3QA 5FHNA 2HAUA 5H8NB 1B7HA 4IO5A 4ND9A 3M3KA 1SW4A 1JNFA 2XXPA 3FVGA 3N6UA 2O84X 5M2VA 2BJJX 3E9XA 1MG1A 2B3BA 3D4GA 3VDFA 3R26A 2XXYA 5JTYB 1A55A 2ZYNA 3OEKA 1B9JA 2V93A 4AQ4A 4U1ZA 5JK4A 2NVUB 2XXTA 5ICTA 1ZIUA 4BDQA 3VLWA 3QSLA 4NWDA 3RNNA 2HZKA 4XIGQ 5H8HA 4NF5A 4EF2A 3OOAA 3GZGA 4H6DA 2DWJA 1O64A 5KCJA 1ZJLA 1H45A 2E0SA 1B5HA 2ESNA 5DEXA 4EXLA 1NKXA 4ESXA 3I3VA 4F18A 3C4MA 2DWIA 1SI1A 4JWYA 3K0VA 1PB9A 5K2YA 5CMBA 3FD3A 1MH3A 4PFYA 2F7CA 2AL4A 3S2VA 3FXUA 3CG3A 4G68C 4MLVA 3T9HB 4H8IA 2H98A 3O6GA 5AA2B 1POY1 1MQDA 1M5CA 3TQWA 2ZYMA 3HCQA 3FVKA 2Q9TA 2A5TA 2ZXTA 1MY4A 4JWOA 1Q1KA 3VVDA 5ITPA 2OLBA 3TKDA 4YAHX 3V89B 3IAZA 2ZMBA 4R6KA 3PUZE 2Y7KA 3K01A 3KOSA 3PUXE 3AXFA 1Z7ME 4E0XA 5L9OA 3USDA 3BKIB 2XD3A 3M3FA 3OMBA 2P0SA 1ZU0A 4R74A 2IA4A 2G29A 4R9GA 3FV2A 4F19A 1GV8A 1DMBA 3PMWA 1QJMA 4IGTA 4X9TA 4I8CA 3OENA 4ONYA 3IORA 3MJNA 2H9BA 4FIMA 4IO7A 3SKPA 5CBSA 3RT8A 1BP5A 1SBPA 3RQTA 2Y7WA 1EZOA 1P1NA 1OLCA 4K3FA 2O7UA 3EQ1A 3WAEA 1OVTA 5A5XB 2I49A 3B6WA 4UACA 3OELA 3UA8A 4OZ9A 5I2NB 4EF1A 4NF4A 4H67A 4FJPA 1QVSA 3E4RA 5I57B 5FHOA 4XKQA 2XXVA 2V3UA 3D4CA 4F31B 4QFNA 2PBWA 5B70A 1LBCA 2PT1A 1H76A 1IXIA 1R9QA 3PD8A 1DOTA 3ZSFA 4Z0IA 4OMBA 2AL5A 1AIVA 4NEDA 4JSDA 4OWDA 3TELA 4DCYA 3U94A 4I1DA 4GOTA 1N84A 2RC9A 1NH7A 2DE4A 4XKNA 2GHBA 5AA4A 1USYE 2O68A 3LUYA 1XVXA 1PC3A 3VV5A 3KZGA 3QYTA 2OWTA 3FXRA 1FTOA 1B0LA 3N6TA 2NUVA 2Y7IA 3F11A 4X48A 2F7BA 1UTBA 2HXWA 2Q88A 5KDTA 4KPTA 2GHAA 3K2DA 1A54A 1JW1A 1GR2A 2NOOA 4PFUA 2GH9A 3SEYA 4XTCQ 2REJA 4ESWA 4RNSA 2O7IA 4RY1A 4GL8A 1GGGA 3L6HA 4JDFA 4NE4A 3G3KA 1II5A 3EHTA 4POXA 3UGWA 5DVIA 3IO4A 2VD3A 3OD7A 1QUKA 4YB6A 4IGRA 1F9BA 1P1WA 2DQVA 1WVJA 4F39A 3W15C 4X1BA 3Q29A 3G3GA 3K6WA 5I59A 1DTZA 5FTHA 4KHZE 4JSOA 4YICA 4GD5A 4NF8A 4WKMA 3H4ZA 4LQ5A 4H5GA 1CB6A 3PMVA 1FQCA 1NNKA 3Q28A 3LSXA 2Z23A 3CFZA 1PB7A 1R6ZA 1S7YA 2ABHA 1MXVA 3PPRA 1ANFA 3RUMA 4OESA 4R2FA 3TCFA 5I58B 3KN8A 2I3VA 1MH4A 1QKAA 1A40A 3MVXA 5F1QA 4JWXA 2ZNUA 3U93A 2F34A 3KEIA 4F1VA 4C0RA 2YLNA 1ZBMA 4R6HA 4BDMA 4IO4A 3S9EA 1OLAA 1IXHA 2DWHA 4RPNA 2X26A 4PETA 5L9MA 4FEDA 5HBCA 4YU0A 3VVEA 5ISUA 4F3BA 3K1NA 3MVZA 1MXYA 4OFOA 1ZTYA 4H65A 4OVJA 3JV9A 3S4UA 2DXRA 3OO9A 1XS5A 3RY3A 1CE2A 3TUSA 1MQJA 4EUOA 4RYAA 3RLFE 4F3SA 3TCGA 1B46A 3QK6A 1R9LA 2DWAA 1B3GA 2UVGA 3G3JA 3KFMA 1NFTA 3IJOB 3ILTB 1WODA 3HV1A 5I2NA 4BDLA 3B7DA 1PDAA 1B3EA 1MDQA 1A99A 1LAXA 4ZS9A 5I57A 1IITA 4GQOA 3A3CA 2DOJA 3HN0A 3UN6A 1SD3A 2OJTA 1IZ1A 1PBQA 1B32A 5BUUA 2RC7A 5I2KB 1I6QA 4GL0A 1B5IA 3T96B 1EZPA 3LSLA 1OMPA 3MP8A 2F78A 2F35A 1QW0A 3FIRA 1VE4A 3DP6A 3K1MA 1RYXA 3TODA 2ZYKA 3R7XA 2ZNSA 2H4IA 4ECFA 3U8QA 1VSOA 4KR5A 3VFJA 4IY6A 3FJ7A 5H8SA 2XXXA 1N3XA 4YKIA 3DLNA 5EHSA 3MUQA 4DXUA 3BFTA 1BIYA 2RCBA 4I9DA 4U21A 1B5JA 2KLFA 3O29A 2RF1A 4ZEKA 3KSJA 1MRPA 1VFDA 3HPIA 1UTHB 1A8FA 4F22A 4G2ZA 5H8QB 1PBPA 3SEXA 1SQYA 4G68B 4FORA 4YMBA 4F3GA 4FE8A 4AB5A 3DELB 3K6UA 4IO6A 2YPNA 4G8NA 1YCJA 3SESA 5H8FA 1Y4CA 2QS4A 5B7DA 4YKKA 1B6HA 3TTKA 2OWSA 3M3LA 1D3KA 2UVHA 1D9VA 3VLUA 4EQ9A 3TAJA 4RXLA 3O6IA 1N3WA 4NMYA 4BDNA 3PPPA 4TOZA 3H3GA 3H06B 1IXCA 1DSNA 2B65A 1MXUA 1JQFA 1D9YA 3GLBA 2ONSA 3UIFA 4MLQA 2F36A 1FW0A 2QMWA 5BWJA 4LZ5A 1FQDA 2Q2CA 2NWJA 1AOVA 3ZS6A 1M5DA 3HSTA 4JXIA 1MQGA 1AMFA 3BFUA 3TQLA 4PFWA 3MPLA 3HHGA 5CMMA 3ONMA 4O3CA 1A8EA 4F1YA 3LSWA 3U72A 4QSDA 4F2QA 1FTKA 4KCCA 3H6VA 3T93B 3VLVA 5AA2D 2X7QA 1IXGA 4XXUA 3KN7A 5TU0A 4LZ7A 2P1SA 4XKRA 4HS7A 4YB5A 1MXWA 1MXZA 4JB7A 2X7PA 4WEPA 4OFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH3 A;  1RKM A;  3P7I A;  3O28 A;  3RN8 A;  3G3H A;  1B1H A;  3C35 A;  5CM6 A;  1Q35 A;  3IOU A;  4H8J A;  5DVJ A;  5L9S A;  4MBP A;  1I69 A;  2WKY A;  3OSQ A;  3KN3 A;  3CI8 A;  1LFI A;  4OER A;  1OQG A;  3IJX B;  3TTM A;  4NF6 A;  3MVW A;  1SDX A;  5I56 B;  1FQB A;  2Z8F A;  3DP4 A;  2CMO A;  3W9V A;  1EU8 A;  1FQE A;  2RCA A;  1OQH A;  4N6P A;  3TTL A;  3GXA A;  1LCT A;  3MVY A;  1HSL A;  4LON B;  2UXA A;  4Q0C A;  3LC8 A;  2HFB A;  1IQ7 A;  4RPO A;  1ZLQ A;  1MY2 A;  1ATG A;  4BLA A;  5TP9 A;  4QFP A;  1URS A;  3CIJ A;  2DP8 A;  2R71 A;  3TTR A;  4KYS A;  1MY0 A;  1XHY A;  5H8H B;  4ELO A;  2XXR A;  1YPN A;  2O1M A;  3H6W A;  3MQ9 A;  1FCK A;  3MPK A;  4FAJ A;  4DDD A;  2OK2 A;  2DYX A;  1H3D A;  1UIV A;  3PU5 A;  3C34 A;  1NH8 A;  1P1U A;  3H6U A;  5DEX B;  4GFR A;  4GVO A;  3W9W A;  3RT6 B;  4M1V A;  3SEU A;  5H8N A;  3SDF A;  4HTG A;  2THI A;  1Y1M A;  4PP0 A;  5JEI A;  5TPA B;  1DTG A;  1KWH A;  4RK2 A;  1B7Z A;  2H99 A;  3QUJ A;  2DXY A;  3HHF A;  4OXV A;  1BTJ A;  1JEV A;  5CI5 A;  1MPC A;  1MY1 A;  1LST A;  4M4G A;  2Q8J A;  5HM4 B;  2RIN A;  5JTY A;  4DXB A;  1PB8 A;  3RTF B;  2A5T B;  1N04 A;  2CZL A;  4R2B A;  5CMC A;  4H5F A;  2XX9 A;  1LAF E;  1YAE A;  1GVC A;  3PUV E;  4P11 A;  4RJZ A;  4IO3 A;  4HCY A;  3K4U A;  4KFQ A;  2XD2 A;  4KI0 E;  4EDP A;  4RA1 A;  3IB1 A;  5H8Q A;  1B7U A;  5ICQ A;  3MZ1 A;  3T66 A;  5DVF A;  1DPE A;  1D4N A;  1LB8 A;  3E13 X;  1LGB C;  2PMS A;  3TDJ A;  1ZKB A;  3C36 A;  5ELV A;  2DVC A;  2PYY A;  4ZEI A;  5AA1 A;  4NTL A;  1TT1 A;  1XT8 A;  4IY5 A;  3U92 A;  2O1L A;  1VR5 A;  5CBR A;  1FTJ A;  4QSE A;  4O3A A;  2LAO A;  3KJ7 A;  4LVQ A;  3S9N C;  2DS9 A;  5AA2 A;  3MBP A;  3C31 A;  4O3B A;  1QUJ A;  4NF4 B;  3H03 A;  5DTB A;  3EN3 A;  1XC1 A;  1QUI A;  2OBG A;  2QMX A;  1Z7N E;  3EF7 A;  2Y84 A;  3DM0 A;  2NXO A;  4WXJ A;  4YKJ A;  2DSF A;  1OVB A;  3OSR A;  4ZEC A;  3K02 A;  4ELR A;  5K2X A;  3IO6 A;  5FHM A;  3QIM A;  2HCA A;  1NL5 A;  2P2A A;  5L8D A;  2W7Y A;  3PPO A;  3MZ9 A;  1NNP A;  5J1D A;  1B2H A;  1HSE A;  3O2A A;  2ZYO A;  2E1S A;  2ONR A;  2H5Y A;  4OEU A;  2F6P A;  3JYR A;  1N7W A;  4DCX A;  4H0W A;  3FXQ A;  4R9F A;  2F97 A;  1SW1 A;  3LSF B;  4U1O A;  3EHU A;  1B4Z A;  1BKA A;  5AA4 B;  3TPA A;  4G8H A;  5A5X A;  3M8U A;  2PVU A;  4G4P A;  4E0W A;  3MZB A;  2QS3 A;  3TFL A;  1B3L A;  3QAX A;  4ISU A;  4QF9 A;  1B4H A;  4LA9 A;  5EHM A;  4C1T A;  4U2R A;  3PUY E;  1TXF A;  3PD9 A;  4OEV A;  1N76 A;  1B3F A;  4LZ8 A;  3IX1 A;  1Y1Z A;  1MQI A;  4YZZ A;  4OQO A;  1IUD A;  4DE8 A;  4QSC A;  5HPQ A;  3VVF A;  1B58 A;  3PMX A;  4OET A;  4ELQ A;  3V83 A;  1R1N A;  4Q5T A;  4OHN A;  3IL1 B;  3FAT A;  4PFT A;  4ZZE A;  3MC2 A;  2QS1 A;  2HQ0 A;  4YKP A;  1FQA A;  1MM6 A;  2M8C A;  4ZZA A;  2Q89 A;  1M5E A;  1LFH A;  4LP2 B;  4FEC A;  2R9J A;  1JW4 A;  3B6Q A;  1B0H A;  1XOC A;  1HSJ A;  5I56 A;  3N94 A;  4F29 A;  4QFO A;  1P1O A;  3QXM A;  4LUB A;  2OCU A;  2HEU A;  4LQ2 A;  4EQB A;  4U22 A;  1Y3Q A;  2V25 A;  3FUZ A;  4ZE9 A;  1LFG A;  5I59 B;  1B3H A;  5CRY A;  1MPD A;  4DXC A;  3RPW A;  2OZZ A;  1NNF A;  5CC2 A;  2RC8 A;  4NF8 B;  3O97 A;  3Q27 A;  2O6A A;  3C33 A;  3GBA A;  3T9X B;  4DIG A;  3EHS A;  3FJG A;  2I3W A;  1Y3N A;  4XKP A;  4LAT A;  3U1O A;  1BLF A;  4PE5 B;  2I48 A;  4MF3 A;  2XXQ A;  1YTV A;  2ANJ A;  1XVY A;  2QJE A;  3K1P A;  1B05 A;  3MAM A;  1O7T A;  3DP8 A;  4I62 A;  2GRV A;  4KD5 A;  3TYH A;  4PQJ A;  3LR1 A;  2I0C A;  4R75 A;  4AB6 A;  5TPA A;  3CRB A;  1UQW A;  4QHQ A;  1FTM A;  4DLD A;  3N5L A;  3IR1 A;  3MP6 A;  3O66 A;  3OO8 A;  3TTN A;  4POW A;  1QKB A;  1US4 A;  1J1N A;  2UYF A;  3V8X B;  1RYO A;  4ELP A;  3IOV A;  3SET A;  1JVX A;  2DVZ A;  3OXN A;  2I4B A;  1MPB A;  3T9V A;  2Q2A A;  1SW2 A;  3MWB A;  4YB7 A;  4OTE A;  3PPQ A;  3TCH A;  2O51 A;  5AA3 A;  5LOM A;  4HW8 A;  4BDR A;  1AL3 A;  3VE1 B;  3KSX A;  1H43 A;  4KQP A;  4EXK A;  3CFX A;  3HO7 A;  4OEN A;  5I58 A;  2XXW A;  1S9T A;  5ITO A;  2FNC A;  4GXS B;  5KZT A;  1MQH A;  2XXU A;  1MY3 A;  1MM7 A;  1ZMG A;  1IEJ A;  3A09 A;  3ZKL A;  3CVG A;  3H7M A;  4Q8R A;  3O9P A;  3TEP A;  1JVY A;  1M5B A;  3ECR A;  1A7L A;  4ZED A;  3S9L C;  1UIU A;  3C32 A;  2IEE A;  3TMG A;  3UP9 A;  2HAV A;  1P1Q A;  1URG A;  3OO7 A;  1I6B A;  3G7W A;  1SVX B;  3CSB A;  4R73 A;  2VD2 A;  2D5W A;  4QFK A;  4IB2 A;  5IKB A;  1P99 A;  3A3U A;  2QS2 A;  2XX7 A;  1ELJ A;  1LAG E;  5DYH A;  2VOZ A;  5IAI A;  2ONK E;  3IOT A;  3ODB A;  2A5S A;  4GF8 A;  4GXA A;  1H44 A;  4F3P A;  3O6H A;  4Q30 B;  5CMK A;  4NWC A;  4P0I A;  3H6T A;  4KYE A;  3CG1 A;  1Y4T A;  3UK4 A;  1WDN A;  1M5F A;  3ILU B;  4X1D A;  4THI A;  1TFD A;  3T9U A;  1GTK A;  1B40 A;  1USY H;  3K6X A;  4GLI A;  1N7X A;  2V84 A;  3FZV A;  1NNT A;  1SYH A;  2XX8 A;  4NF5 B;  3V5A A;  4TLM B;  1O63 A;  3BBR A;  5KCJ B;  2ALU A;  2D21 A;  3FAS A;  1B52 A;  3GBB A;  5EYF A;  3QUF A;  1NMU A;  1JET A;  4QFL A;  3EPE A;  2UVI A;  1Y3P A;  3Q25 A;  2H25 A;  5I2K A;  4L17 A;  2HZL A;  2XXH A;  4KYD A;  4TLL B;  3VXB A;  2VHA A;  2F8D A;  3OO6 A;  2XHD A;  2Z8D A;  5I84 A;  4UA8 A;  2DE3 A;  1Y9U A;  1FQF A;  5H8F B;  3CFL A;  4P0G A;  1OIB A;  2FA7 A;  2V3T A;  4F2O A;  3PGF A;  1URD A;  4BDO A;  2D3I A;  3PV0 E;  2AYS A;  4RK9 A;  4ZDM A;  3E3K A;  1LCF A;  2ZNT A;  4YMA A;  2I6E A;  1B51 A;  1FTL A;  3C9H A;  1MS7 A;  4OFJ A;  3B6T A;  3R6U A;  2QL3 A;  1MXX A;  4ZEB A;  1US5 A;  3IB0 A;  1S50 A;  1QUL A;  1B1X A;  4U4X A;  2PX1 A;  1UTH A;  4OYV A;  5AE4 A;  1Y20 A;  4G68 A;  4ZE8 A;  2RKM A;  4EQ7 A;  4IO2 A;  3N26 A;  3KJT A;  2XXI A;  3FJM A;  3FVO A;  3IB2 A;  2UVJ A;  3TZA A;  3WAF A;  2I4C A;  4MFI A;  1L5T A;  4R72 A;  3FV1 A;  2YJP A;  4R6Y A;  2VP1 A;  1SYI A;  4KCD A;  2DE2 A;  4GWO A;  3CR9 A;  4G77 A;  3FVN A;  4ZEF A;  2B3F A;  3RGY A;  3PUW E;  3S9M C;  1TWY A;  1LBB A;  4WED A;  3ZKK A;  1T0K A;  2Y7P A;  2Z22 A;  4JBZ A;  3T22 A;  2I58 A;  2AIX A;  3MW0 A;  3K00 A;  3VXC A;  3I5O A;  3THI A;  3CSG A;  3Q26 A;  2VGQ A;  2O69 A;  3KBR A;  4F1U A;  3RTW B;  1I6A A;  3SEV A;  4U23 A;  2GFE A;  1AH5 A;  3LBS A;  1PEB A;  4TQU Q;  3I6V A;  3UOR A;  4GRK A;  4U4S A;  1N0T A;  2FYI A;  4FAT A;  3SER A;  1VFE A;  4NF6 B;  5FTI A;  1POT A;  2F7A A;  2F5X A;  4HCW A;  2QPQ A;  2REG A;  1LB9 A;  2Z8E A;  3FGS A;  4MH5 A;  1TFA A;  3KOT A;  3OEM A;  3MP1 A;  1SW5 A;  4H1X A;  1IIW A;  1SI0 A;  3K6V A;  3PPN A;  3SEW A;  4FEB A;  2QRY A;  5F7V A;  2Y7R A;  1JEU A;  2PT2 A;  3KG2 A;  2QSX A;  4N13 A;  2I0B A;  4QRZ A;  3KGC A;  2UYE A;  3G3I A;  1JW5 A;  2F6G A;  4Z7E A;  2G93 A;  1LLS A;  1UTB B;  5TP9 B;  3G3F A;  5KDT B;  3IK6 B;  2R6G E;  3IOW A;  5DT6 A;  4N07 A;  1DPP A;  3L6G A;  4GIZ A;  4G8M A;  4C1U A;  1LAH E;  3JZJ A;  1EZ9 A;  1MDP 1;  4DZ1 A;  2V3Q A;  5FHN A;  2HAU A;  5H8N B;  1B7H A;  4IO5 A;  4ND9 A;  3M3K A;  1SW4 A;  1JNF A;  2XXP A;  3FVG A;  3N6U A;  2O84 X;  5M2V A;  2BJJ X;  3E9X A;  1MG1 A;  2B3B A;  3D4G A;  3VDF A;  3R26 A;  2XXY A;  5JTY B;  1A55 A;  2ZYN A;  3OEK A;  1B9J A;  2V93 A;  4AQ4 A;  4U1Z A;  5JK4 A;  2NVU B;  2XXT A;  5ICT A;  1ZIU A;  4BDQ A;  3VLW A;  3QSL A;  4NWD A;  3RNN A;  2HZK A;  4XIG Q;  5H8H A;  4NF5 A;  4EF2 A;  3OOA A;  3GZG A;  4H6D A;  2DWJ A;  1O64 A;  5KCJ A;  1ZJL A;  1H45 A;  2E0S A;  1B5H A;  2ESN A;  5DEX A;  4EXL A;  1NKX A;  4ESX A;  3I3V A;  4F18 A;  3C4M A;  2DWI A;  1SI1 A;  4JWY A;  3K0V A;  1PB9 A;  5K2Y A;  5CMB A;  3FD3 A;  1MH3 A;  4PFY A;  2F7C A;  2AL4 A;  3S2V A;  3FXU A;  3CG3 A;  4G68 C;  4MLV A;  3T9H B;  4H8I A;  2H98 A;  3O6G A;  5AA2 B;  1POY 1;  1MQD A;  1M5C A;  3TQW A;  2ZYM A;  3HCQ A;  3FVK A;  2Q9T A;  2A5T A;  2ZXT A;  1MY4 A;  4JWO A;  1Q1K A;  3VVD A;  5ITP A;  2OLB A;  3TKD A;  4YAH X;  3V89 B;  3IAZ A;  2ZMB A;  4R6K A;  3PUZ E;  2Y7K A;  3K01 A;  3KOS A;  3PUX E;  3AXF A;  1Z7M E;  4E0X A;  5L9O A;  3USD A;  3BKI B;  2XD3 A;  3M3F A;  3OMB A;  2P0S A;  1ZU0 A;  4R74 A;  2IA4 A;  2G29 A;  4R9G A;  3FV2 A;  4F19 A;  1GV8 A;  1DMB A;  3PMW A;  1QJM A;  4IGT A;  4X9T A;  4I8C A;  3OEN A;  4ONY A;  3IOR A;  3MJN A;  2H9B A;  4FIM A;  4IO7 A;  3SKP A;  5CBS A;  3RT8 A;  1BP5 A;  1SBP A;  3RQT A;  2Y7W A;  1EZO A;  1P1N A;  1OLC A;  4K3F A;  2O7U A;  3EQ1 A;  3WAE A;  1OVT A;  5A5X B;  2I49 A;  3B6W A;  4UAC A;  3OEL A;  3UA8 A;  4OZ9 A;  5I2N B;  4EF1 A;  4NF4 A;  4H67 A;  4FJP A;  1QVS A;  3E4R A;  5I57 B;  5FHO A;  4XKQ A;  2XXV A;  2V3U A;  3D4C A;  4F31 B;  4QFN A;  2PBW A;  5B70 A;  1LBC A;  2PT1 A;  1H76 A;  1IXI A;  1R9Q A;  3PD8 A;  1DOT A;  3ZSF A;  4Z0I A;  4OMB A;  2AL5 A;  1AIV A;  4NED A;  4JSD A;  4OWD A;  3TEL A;  4DCY A;  3U94 A;  4I1D A;  4GOT A;  1N84 A;  2RC9 A;  1NH7 A;  2DE4 A;  4XKN A;  2GHB A;  5AA4 A;  1USY E;  2O68 A;  3LUY A;  1XVX A;  1PC3 A;  3VV5 A;  3KZG A;  3QYT A;  2OWT A;  3FXR A;  1FTO A;  1B0L A;  3N6T A;  2NUV A;  2Y7I A;  3F11 A;  4X48 A;  2F7B A;  1UTB A;  2HXW A;  2Q88 A;  5KDT A;  4KPT A;  2GHA A;  3K2D A;  1A54 A;  1JW1 A;  1GR2 A;  2NOO A;  4PFU A;  2GH9 A;  3SEY A;  4XTC Q;  2REJ A;  4ESW A;  4RNS A;  2O7I A;  4RY1 A;  4GL8 A;  1GGG A;  3L6H A;  4JDF A;  4NE4 A;  3G3K A;  1II5 A;  3EHT A;  4POX A;  3UGW A;  5DVI A;  3IO4 A;  2VD3 A;  3OD7 A;  1QUK A;  4YB6 A;  4IGR A;  1F9B A;  1P1W A;  2DQV A;  1WVJ A;  4F39 A;  3W15 C;  4X1B A;  3Q29 A;  3G3G A;  3K6W A;  5I59 A;  1DTZ A;  5FTH A;  4KHZ E;  4JSO A;  4YIC A;  4GD5 A;  4NF8 A;  4WKM A;  3H4Z A;  4LQ5 A;  4H5G A;  1CB6 A;  3PMV A;  1FQC A;  1NNK A;  3Q28 A;  3LSX A;  2Z23 A;  3CFZ A;  1PB7 A;  1R6Z A;  1S7Y A;  2ABH A;  1MXV A;  3PPR A;  1ANF A;  3RUM A;  4OES A;  4R2F A;  3TCF A;  5I58 B;  3KN8 A;  2I3V A;  1MH4 A;  1QKA A;  1A40 A;  3MVX A;  5F1Q A;  4JWX A;  2ZNU A;  3U93 A;  2F34 A;  3KEI A;  4F1V A;  4C0R A;  2YLN A;  1ZBM A;  4R6H A;  4BDM A;  4IO4 A;  3S9E A;  1OLA A;  1IXH A;  2DWH A;  4RPN A;  2X26 A;  4PET A;  5L9M A;  4FED A;  5HBC A;  4YU0 A;  3VVE A;  5ISU A;  4F3B A;  3K1N A;  3MVZ A;  1MXY A;  4OFO A;  1ZTY A;  4H65 A;  4OVJ A;  3JV9 A;  3S4U A;  2DXR A;  3OO9 A;  1XS5 A;  3RY3 A;  1CE2 A;  3TUS A;  1MQJ A;  4EUO A;  4RYA A;  3RLF E;  4F3S A;  3TCG A;  1B46 A;  3QK6 A;  1R9L A;  2DWA A;  1B3G A;  2UVG A;  3G3J A;  3KFM A;  1NFT A;  3IJO B;  3ILT B;  1WOD A;  3HV1 A;  5I2N A;  4BDL A;  3B7D A;  1PDA A;  1B3E A;  1MDQ A;  1A99 A;  1LAX A;  4ZS9 A;  5I57 A;  1IIT A;  4GQO A;  3A3C A;  2DOJ A;  3HN0 A;  3UN6 A;  1SD3 A;  2OJT A;  1IZ1 A;  1PBQ A;  1B32 A;  5BUU A;  2RC7 A;  5I2K B;  1I6Q A;  4GL0 A;  1B5I A;  3T96 B;  1EZP A;  3LSL A;  1OMP A;  3MP8 A;  2F78 A;  2F35 A;  1QW0 A;  3FIR A;  1VE4 A;  3DP6 A;  3K1M A;  1RYX A;  3TOD A;  2ZYK A;  3R7X A;  2ZNS A;  2H4I A;  4ECF A;  3U8Q A;  1VSO A;  4KR5 A;  3VFJ A;  4IY6 A;  3FJ7 A;  5H8S A;  2XXX A;  1N3X A;  4YKI A;  3DLN A;  5EHS A;  3MUQ A;  4DXU A;  3BFT A;  1BIY A;  2RCB A;  4I9D A;  4U21 A;  1B5J A;  2KLF A;  3O29 A;  2RF1 A;  4ZEK A;  3KSJ A;  1MRP A;  1VFD A;  3HPI A;  1UTH B;  1A8F A;  4F22 A;  4G2Z A;  5H8Q B;  1PBP A;  3SEX A;  1SQY A;  4G68 B;  4FOR A;  4YMB A;  4F3G A;  4FE8 A;  4AB5 A;  3DEL B;  3K6U A;  4IO6 A;  2YPN A;  4G8N A;  1YCJ A;  3SES A;  5H8F A;  1Y4C A;  2QS4 A;  5B7D A;  4YKK A;  1B6H A;  3TTK A;  2OWS A;  3M3L A;  1D3K A;  2UVH A;  1D9V A;  3VLU A;  4EQ9 A;  3TAJ A;  4RXL A;  3O6I A;  1N3W A;  4NMY A;  4BDN A;  3PPP A;  4TOZ A;  3H3G A;  3H06 B;  1IXC A;  1DSN A;  2B65 A;  1MXU A;  1JQF A;  1D9Y A;  3GLB A;  2ONS A;  3UIF A;  4MLQ A;  2F36 A;  1FW0 A;  2QMW A;  5BWJ A;  4LZ5 A;  1FQD A;  2Q2C A;  2NWJ A;  1AOV A;  3ZS6 A;  1M5D A;  3HST A;  4JXI A;  1MQG A;  1AMF A;  3BFU A;  3TQL A;  4PFW A;  3MPL A;  3HHG A;  5CMM A;  3ONM A;  4O3C A;  1A8E A;  4F1Y A;  3LSW A;  3U72 A;  4QSD A;  4F2Q A;  1FTK A;  4KCC A;  3H6V A;  3T93 B;  3VLV A;  5AA2 D;  2X7Q A;  1IXG A;  4XXU A;  3KN7 A;  5TU0 A;  4LZ7 A;  2P1S A;  4XKR A;  4HS7 A;  4YB5 A;  1MXW A;  1MXZ A;  4JB7 A;  2X7P A;  4WEP A;  4OFL A; 
#chains in the Genus database with same CATH topology
 1EH3 A;  1RKM A;  3P7I A;  3O28 A;  3RN8 A;  4QXD A;  3G3H A;  5ET7 A;  1B1H A;  3C35 A;  5CM6 A;  1Q35 A;  1FBC A;  3HFU A;  3BIH A;  3IOU A;  4H8J A;  4P56 A;  5DVJ A;  5L9S A;  4MBP A;  1I69 A;  2WKY A;  2CEX A;  3OSQ A;  3KN3 A;  3CI8 A;  1LFI A;  1K9Z A;  4OER A;  1OQG A;  3IJX B;  3TTM A;  4NF6 A;  1G0H A;  2Q74 A;  4MAG A;  3MVW A;  5IZ3 B;  1SDX A;  4MX6 A;  5I56 B;  1FQB A;  2Z8F A;  3DP4 A;  2CMO A;  4GX6 A;  3W9V A;  1EU8 A;  1FQE A;  2RCA A;  1OQH A;  4N6P A;  3TTL A;  2P3V A;  3GXA A;  1LCT A;  3MVY A;  3B50 A;  1NUW A;  1HSL A;  4LON B;  2CZH A;  2UXA A;  4Q0C A;  3LC8 A;  2WYP A;  2CZK A;  2HFB A;  1IQ7 A;  4RPO A;  1ZLQ A;  3B8B A;  1MY2 A;  1ATG A;  4BLA A;  5TP9 A;  4QFP A;  1URS A;  3CIJ A;  4GBW A;  2DP8 A;  1KZ8 A;  2R71 A;  3TTR A;  4KYS A;  1MY0 A;  1XHY A;  5H8H B;  4ELO A;  2WBD A;  2XXR A;  1YPN A;  2O1M A;  3H6W A;  3MQ9 A;  1FCK A;  3MPK A;  4FAJ A;  4DDD A;  2OK2 A;  2DYX A;  1H3D A;  4GWY A;  1UIV A;  3PU5 A;  3C34 A;  1NH8 A;  1P1U A;  3H6U A;  5DEX B;  1FTA A;  4GFR A;  4GVO A;  3W9W A;  4PFB A;  3RT6 B;  4M1V A;  4O94 A;  3SEU A;  5H8N A;  3SDF A;  4HTG A;  2THI A;  4XEQ A;  1Y1M A;  4PP0 A;  5JEI A;  5ESY A;  3SZP A;  5TPA B;  1DTG A;  1KWH A;  4RK2 A;  1B7Z A;  2H99 A;  3QUJ A;  1YXI A;  2DXY A;  1KA0 A;  3HHF A;  4OXV A;  1BTJ A;  1JEV A;  5CI5 A;  1MPC A;  1MY1 A;  1LST A;  4M4G A;  2Q8J A;  5HM4 B;  2RIN A;  5JTY A;  5I5P A;  4DXB A;  1PB8 A;  3RTF B;  4N8G A;  4PGP A;  2A5T B;  1N04 A;  2CZL A;  4R2B A;  5CMC A;  4H5F A;  2XX9 A;  1LAF E;  1YAE A;  1GVC A;  3PUV E;  4P11 A;  4RJZ A;  4IO3 A;  4HCY A;  2OWZ A;  3K4U A;  4KFQ A;  4I3E A;  2XD2 A;  4MEV A;  4KI0 E;  4EDP A;  4LN5 A;  4MMP A;  4RA1 A;  3IB1 A;  5H8Q A;  1B7U A;  5ICQ A;  3MZ1 A;  3T66 A;  5DVF A;  4GWS A;  1DPE A;  1D4N A;  1LB8 A;  3E13 X;  1LGB C;  2PMS A;  3TDJ A;  1ZKB A;  3C36 A;  5ELV A;  2DVC A;  2PYY A;  4ZEI A;  5AA1 A;  4NTL A;  3D1R A;  1TT1 A;  1XT8 A;  4IY5 A;  3U92 A;  2O1L A;  1VR5 A;  5CBR A;  1FTJ A;  4QSE A;  4O3A A;  2LAO A;  3KJ7 A;  4LVQ A;  4OVT A;  3S9N C;  2DS9 A;  5AA2 A;  1FPJ A;  3MBP A;  3C31 A;  4N91 A;  2CZI A;  4QBA A;  5LTC A;  4O3B A;  1QUJ A;  4NF4 B;  4NQ8 A;  3H03 A;  5DTB A;  3EN3 A;  1XC1 A;  1QUI A;  5IZ1 A;  2OBG A;  2QMX A;  1Z7N E;  3EF7 A;  2Y84 A;  3DM0 A;  2NXO A;  4WXJ A;  4YKJ A;  2DSF A;  1OVB A;  3OSR A;  4ZEC A;  3K02 A;  5F24 A;  4ELR A;  5K2X A;  3IO6 A;  5FHM A;  2QVV A;  3QIM A;  2HCA A;  1NL5 A;  2P2A A;  5L8D A;  4HE1 A;  2W7Y A;  3PPO A;  1FPL A;  3MZ9 A;  1NNP A;  5J1D A;  1B2H A;  1HSE A;  1LEV A;  3O2A A;  4GX4 A;  2ZYO A;  2E1S A;  2ONR A;  2H5Y A;  4OEU A;  3KC0 A;  2F6P A;  3JYR A;  1N7W A;  4DCX A;  4H0W A;  3FXQ A;  4R9F A;  2F97 A;  2CEY A;  1SW1 A;  3LSF B;  4U1O A;  3EHU A;  3A29 A;  1B4Z A;  1BKA A;  5AA4 B;  3TPA A;  4OVS A;  4G8H A;  5A5X A;  3M8U A;  1FPE A;  2PVU A;  4G4P A;  3KC1 A;  4E0W A;  3MZB A;  2QS3 A;  3TFL A;  1B3L A;  4N6D A;  3QAX A;  4ISU A;  4QF9 A;  1B4H A;  4LA9 A;  5EHM A;  4C1T A;  4U2R A;  3PUY E;  1TXF A;  3PD9 A;  4OEV A;  4GWZ A;  1N76 A;  1FPG A;  1B3F A;  4LZ8 A;  3IX1 A;  1Y1Z A;  1MQI A;  4YZZ A;  4OQO A;  1RDX A;  1IUD A;  4DE8 A;  4QSC A;  5HPQ A;  3VVF A;  1B58 A;  3PMX A;  4OET A;  4ELQ A;  4X8R A;  3V83 A;  1R1N A;  4Q5T A;  4OHN A;  3IL1 B;  3FAT A;  4PFT A;  4ZZE A;  3MC2 A;  2QS1 A;  2HQ0 A;  4YKP A;  1FQA A;  1MM6 A;  2M8C A;  4ZZA A;  2Q89 A;  1M5E A;  1LFH A;  5J16 A;  4LP2 B;  4FEC A;  2R9J A;  1JW4 A;  3B6Q A;  1B0H A;  1XOC A;  1HSJ A;  5I56 A;  3N94 A;  4F29 A;  4QFO A;  1P1O A;  3QXM A;  1IMB A;  4LUB A;  2OCU A;  2HEU A;  4LQ2 A;  4EQB A;  4U22 A;  1Y3Q A;  2V25 A;  3FUZ A;  4ZE9 A;  1LFG A;  5I59 B;  1B3H A;  4NN3 A;  5CRY A;  1MPD A;  4DXC A;  3RPW A;  2OZZ A;  1NNF A;  2B4M A;  4P47 A;  5CC2 A;  2RC8 A;  4NF8 B;  3O97 A;  3Q27 A;  2O6A A;  3C33 A;  3GBA A;  3T9X B;  4DIG A;  3EHS A;  3FJG A;  2I3W A;  1Y3N A;  4XKP A;  1FBH A;  1FSA A;  2WYK A;  4LAT A;  3U1O A;  1BLF A;  4PE5 B;  2MKZ A;  2I48 A;  4MF3 A;  2XXQ A;  2ZZW A;  1YTV A;  2ANJ A;  1NV6 A;  1XVY A;  2QJE A;  3K1P A;  1NV7 A;  1B05 A;  3MAM A;  1O7T A;  2PFY A;  3DP8 A;  4I62 A;  2GRV A;  4KD5 A;  3TYH A;  4PQJ A;  1NV1 A;  1NI9 A;  3LR1 A;  2GQ1 A;  2I0C A;  4R75 A;  5IM2 A;  3GYY A;  4AB6 A;  5TPA A;  3CRB A;  1UQW A;  4QHQ A;  1FTM A;  4DLD A;  3N5L A;  3IR1 A;  3MP6 A;  3O66 A;  3OO8 A;  3TTN A;  4POW A;  1QKB A;  1US4 A;  1J1N A;  2UYF A;  2KR0 A;  3V8X B;  1RYO A;  4ELP A;  3IOV A;  3SET A;  1JVX A;  2DVZ A;  3OXN A;  2I4B A;  1MPB A;  3T9V A;  2Q2A A;  4PAK A;  1SW2 A;  3MWB A;  4YB7 A;  4OTE A;  3PPQ A;  2JJK A;  3TCH A;  2QFL A;  2O51 A;  2VPO A;  5AA3 A;  4OAN A;  1IMA A;  1EYI A;  5LOM A;  4HW8 A;  4BDR A;  1AL3 A;  3VE1 B;  3KSX A;  2FBP A;  1H43 A;  2QVR A;  4KQP A;  4EXK A;  3CFX A;  3HO7 A;  4OEN A;  3RPL B;  4MHF A;  5I58 A;  2XXW A;  2XA5 A;  1LBV A;  1S9T A;  5ITO A;  2FNC A;  4P9K A;  4GXS B;  5KZT A;  1MQH A;  2XXU A;  1MY3 A;  1Q9D A;  4MNP A;  1MM7 A;  1ZMG A;  4HXV A;  1IEJ A;  3A09 A;  3ZKL A;  3CVG A;  5T3J A;  3H7M A;  2Y5K A;  4Q8R A;  3O9P A;  3TEP A;  1JVY A;  1M5B A;  3ECR A;  1A7L A;  4P1L A;  4NGU A;  4ZED A;  3S9L C;  1IME A;  1UIU A;  3C32 A;  2IEE A;  4NAP A;  4O7M A;  3TMG A;  3UP9 A;  2HAV A;  1P1Q A;  1URG A;  3OO7 A;  1I6B A;  3G7W A;  1D9Q A;  1SVX B;  3CSB A;  4R73 A;  1FJ6 A;  2VD2 A;  2D5W A;  1XI6 A;  4PDH A;  4O8M A;  4QFK A;  4IB2 A;  5IKB A;  2V4C A;  1P99 A;  3A3U A;  2QS2 A;  2XX7 A;  3MST A;  1ELJ A;  1LAG E;  5DYH A;  2VOZ A;  5IAI A;  2ONK E;  3IOT A;  3CHG A;  3ODB A;  2A5S A;  4GF8 A;  4GXA A;  2XWI A;  1H44 A;  4F3P A;  4PF6 A;  1NV3 A;  3O6H A;  4Q30 B;  5CMK A;  4NWC A;  4P0I A;  3H6T A;  4KYE A;  3CG1 A;  1Y4T A;  4P3L A;  3UK4 A;  1WDN A;  1M5F A;  3ILU B;  4X1D A;  4THI A;  4NHB A;  1TFD A;  3T9U A;  1GTK A;  1B40 A;  1USY H;  3K6X A;  4GLI A;  1N7X A;  2V84 A;  3FZV A;  1NNT A;  1SYH A;  2XX8 A;  4NF5 B;  3V5A A;  4TLM B;  1O63 A;  3BBR A;  5KCJ B;  2ALU A;  2D21 A;  3FAS A;  1B52 A;  3GBB A;  5EYF A;  3QUF A;  5LDZ A;  1NMU A;  1JET A;  4QFL A;  3EPE A;  2UVI A;  1Y3P A;  3Q25 A;  2OX3 A;  2H25 A;  5I2K A;  4L17 A;  2HZL A;  2XXH A;  4KYD A;  4TLL B;  3VXB A;  2VHA A;  1NV5 A;  2F8D A;  3T0J A;  3OO6 A;  2XHD A;  1EYJ A;  1G0I A;  2Z8D A;  5I84 A;  4UA8 A;  2DE3 A;  1Y9U A;  1FQF A;  5H8F B;  3CFL A;  4P0G A;  1NV2 A;  1OIB A;  2FA7 A;  2V3T A;  4F2O A;  3PGF A;  1URD A;  4BDO A;  2D3I A;  3PV0 E;  2AYS A;  4RK9 A;  3IFA A;  4ZDM A;  3E3K A;  5EQA A;  1LCF A;  2ZNT A;  4YMA A;  2I6E A;  1B51 A;  1FTL A;  3C9H A;  1MS7 A;  4PBQ A;  4OFJ A;  3B6T A;  3R6U A;  2QL3 A;  1MXX A;  3T1B A;  2ZZV A;  4ZEB A;  1US5 A;  3IB0 A;  1S50 A;  4AS5 A;  1FPB A;  1QUL A;  1B1X A;  4U4X A;  2PX1 A;  1UTH A;  4OYV A;  5AE4 A;  1Y20 A;  4G68 A;  4ZE8 A;  2RKM A;  4OVQ A;  4EQ7 A;  4IO2 A;  2HPG A;  3N26 A;  3KJT A;  2XXI A;  3FJM A;  3FVO A;  3IB2 A;  2UVJ A;  3IFC A;  3TZA A;  3WAF A;  2I4C A;  4MFI A;  1L5T A;  3E78 A;  4R72 A;  3FV1 A;  2YJP A;  4R6Y A;  2VP1 A;  1SYI A;  4KCD A;  2DE2 A;  4PC9 A;  4PF8 A;  1FBD A;  4GWO A;  4OA4 A;  4N4U A;  2FIX A;  3CR9 A;  4G77 A;  3FVN A;  4XF5 A;  4ZEF A;  2B3F A;  3PUW E;  3RGY A;  3S9M C;  1TWY A;  1LBB A;  4WED A;  3ZKK A;  1T0K A;  2Y7P A;  2Z22 A;  4JBZ A;  3T22 A;  2I58 A;  2HHM A;  2AIX A;  3MW0 A;  3K00 A;  3VXC A;  3I5O A;  3THI A;  3CSG A;  3Q26 A;  2VGQ A;  2O69 A;  3KBR A;  4F1U A;  3RTW B;  5ET5 A;  1I6A A;  3SEV A;  4U23 A;  2GFE A;  3MYU A;  1AH5 A;  3LBS A;  1PEB A;  4TQU Q;  3I6V A;  3UOR A;  4GRK A;  4U4S A;  1N0T A;  2FYI A;  1VFE A;  3SER A;  4FAT A;  4NF6 B;  5FTI A;  1POT A;  2F7A A;  2F5X A;  4HCW A;  2QPQ A;  2REG A;  1LB9 A;  2Z8E A;  2HXR A;  3FGS A;  4MH5 A;  1TFA A;  3KOT A;  3OEM A;  3MP1 A;  1SW5 A;  4H1X A;  1IIW A;  1SI0 A;  3K6V A;  3PPN A;  3SEW A;  3LUZ A;  1BK4 A;  4FEB A;  2QRY A;  5F7V A;  3EKI A;  2Y7R A;  1JEU A;  4NF0 A;  4DI4 B;  3KBZ A;  2PT2 A;  3KG2 A;  2QSX A;  4N13 A;  2I0B A;  5I7I A;  4QRZ A;  5IGA A;  3KGC A;  2UYE A;  3G3I A;  1JW5 A;  2F6G A;  4Z7E A;  4PGN A;  2G93 A;  1LLS A;  1NUZ A;  1UTB B;  5TP9 B;  3G3F A;  5KDT B;  3IK6 B;  2R6G E;  2Q8M A;  3IOW A;  4JVI A;  5DT6 A;  1YZ0 A;  2XXK A;  4N07 A;  1DPP A;  3L6G A;  4GIZ A;  4G8M A;  4C1U A;  1LAH E;  3JZJ A;  1EZ9 A;  1MDP 1;  4DZ1 A;  2V3Q A;  1FBF A;  5FHN A;  2HAU A;  5H8N B;  1B7H A;  4IO5 A;  4ND9 A;  1FJ9 A;  3M3K A;  4N8Y A;  1SW4 A;  1JNF A;  5IZ3 A;  2XXP A;  3FVG A;  3N6U A;  2O84 X;  5M2V A;  2BJJ X;  3E9X A;  1MG1 A;  2B3B A;  3D4G A;  3VDF A;  1FPD A;  3R26 A;  5FBP A;  2XXY A;  2FIE A;  5JTY B;  1A55 A;  2ZYN A;  3OEK A;  1B9J A;  2V93 A;  4AQ4 A;  4U1Z A;  4P1E A;  5JK4 A;  4MJO A;  2NVU B;  4G61 A;  2PFZ A;  2XXT A;  5ICT A;  1ZIU A;  4BDQ A;  3VLW A;  3QSL A;  4NWD A;  1FBP A;  3RNN A;  2HZK A;  4XIG Q;  5H8H A;  4NF5 A;  4EF2 A;  3OOA A;  3GZG A;  4H6D A;  2DWJ A;  1O64 A;  5KCJ A;  1ZJL A;  1K9Y A;  1H45 A;  2E0S A;  4GWW A;  1B5H A;  2L5V A;  2ESN A;  5DEX A;  5IZZ A;  2DDK A;  4JVC A;  4EXL A;  1NKX A;  4ESX A;  3I3V A;  4MNI A;  4F18 A;  3C4M A;  2DWI A;  1SI1 A;  4JWY A;  3K0V A;  1PB9 A;  5K2Y A;  5CMB A;  4DI3 D;  3FD3 A;  1MH3 A;  4PFY A;  2F7C A;  2AL4 A;  3S2V A;  3FXU A;  3CG3 A;  1NUY A;  2VPN A;  4G68 C;  4MLV A;  3T9H B;  4H8I A;  2H98 A;  3E79 A;  3O6G A;  5AA2 B;  1POY 1;  5A5L A;  1MQD A;  1M5C A;  3TQW A;  2ZYM A;  3HCQ A;  3FVK A;  2Q9T A;  2A5T A;  2ZXT A;  1MY4 A;  4JWO A;  5I3S A;  1FBE A;  1Q1K A;  3VVD A;  5ITP A;  2OLB A;  3TKD A;  4YAH X;  3V89 B;  4N6K A;  3IAZ A;  3QMF A;  1VDW A;  2ZMB A;  4R6K A;  3PUZ E;  2Y7K A;  3K01 A;  3KOS A;  3PUX E;  3AXF A;  1Z7M E;  4E0X A;  5L9O A;  3USD A;  3BKI B;  2XD3 A;  2KQZ A;  3M3F A;  3OMB A;  2P0S A;  1ZU0 A;  4R74 A;  2IA4 A;  2G29 A;  4R9G A;  3FV2 A;  4F19 A;  1GV8 A;  1DMB A;  3PMW A;  1QJM A;  4IGT A;  4MNC A;  4X9T A;  1DBZ A;  4I8C A;  3OEN A;  4ONY A;  3IOR A;  3MJN A;  2H9B A;  4FIM A;  4IO7 A;  3SKP A;  5CBS A;  3RT8 A;  1BP5 A;  1SBP A;  3RQT A;  2Y7W A;  1EZO A;  1IMC A;  1OLC A;  1P1N A;  4K3F A;  2O7U A;  3EQ1 A;  3WAE A;  1OVT A;  5A5X B;  2I49 A;  3B6W A;  4UAC A;  3OEL A;  3UA8 A;  4OZ9 A;  5I2N B;  4EF1 A;  4PBH A;  1KA1 A;  4NF4 A;  4H67 A;  4FJP A;  1QVS A;  3E4R A;  5I57 B;  4I40 A;  5FHO A;  4XKQ A;  1FRP A;  2XXV A;  2V3U A;  3D4C A;  4F31 B;  4QFN A;  4PFI A;  2PBW A;  5B70 A;  1LBC A;  2PT1 A;  1H76 A;  1IXI A;  4GWU A;  1R9Q A;  3PD8 A;  1DOT A;  3ZSF A;  4PTK A;  4Z0I A;  2WX9 A;  4OMB A;  2AL5 A;  1AIV A;  4NED A;  4JSD A;  4HE2 A;  4OWD A;  3TEL A;  4DCY A;  3U94 A;  4I1D A;  4GOT A;  1N84 A;  2RC9 A;  1NH7 A;  2DE4 A;  4XKN A;  2GHB A;  5ET6 A;  5AA4 A;  1IMD A;  1USY E;  2O68 A;  3LUY A;  1XVX A;  1PC3 A;  3VV5 A;  3KZG A;  1SPI A;  1LBW A;  3QYT A;  2OWT A;  3FXR A;  1FTO A;  1B0L A;  3N6T A;  2NUV A;  2Y7I A;  3F11 A;  4JVD A;  1AWB A;  2PCR A;  4X48 A;  2F7B A;  1UTB A;  2HXW A;  2Q88 A;  5KDT A;  3ISP A;  4FBP A;  2GHA A;  3K2D A;  4KPT A;  1A54 A;  1JW1 A;  1GR2 A;  4PCD A;  2NOO A;  4PFU A;  2GH9 A;  3SEY A;  4XTC Q;  2REJ A;  4ESW A;  4RNS A;  2O7I A;  4RY1 A;  4OVP A;  2XWK A;  4GL8 A;  1GGG A;  3L6H A;  4XFE A;  3U65 A;  4JDF A;  4NE4 A;  3G3K A;  4H45 A;  1II5 A;  4PAI A;  3EHT A;  4POX A;  3UGW A;  5DVI A;  3IO4 A;  4N15 A;  2VD3 A;  3OD7 A;  1QUK A;  4YB6 A;  4IGR A;  1F9B A;  1P1W A;  2DQV A;  1WVJ A;  4F39 A;  2WEF A;  3W15 C;  4X1B A;  3Q29 A;  3G3G A;  3K6W A;  5I59 A;  1JP4 A;  1DTZ A;  5FTH A;  4KHZ E;  4JSO A;  4YIC A;  4GD5 A;  4I3Y A;  4NF8 A;  4WKM A;  3H4Z A;  4LQ5 A;  4H5G A;  1NUX A;  1CB6 A;  3PMV A;  1FQC A;  1NNK A;  3Q28 A;  3LSX A;  2Z23 A;  3CFZ A;  1PB7 A;  1R6Z A;  1S7Y A;  2ABH A;  1RDZ A;  1MXV A;  3BIG A;  3PPR A;  4NX1 A;  1ANF A;  3RUM A;  1INP A;  4KXP A;  4OES A;  4R2F A;  3TCF A;  5I58 B;  3KN8 A;  2I3V A;  1MH4 A;  1RDY A;  1QKA A;  1A40 A;  3MVX A;  5F1Q A;  4JWX A;  2ZNU A;  3U93 A;  2F34 A;  3KEI A;  4F1V A;  4C0R A;  4N17 A;  2YLN A;  1ZBM A;  4R6H A;  4BDM A;  4IO4 A;  3S9E A;  5EQ9 A;  1OLA A;  1IXH A;  2DWH A;  2FVZ A;  4RPN A;  2X26 A;  4PET A;  5L9M A;  4FED A;  1IMF A;  5HBC A;  4YU0 A;  3VVE A;  4UAB A;  5ISU A;  2QVU A;  4F3B A;  3K1N A;  5EQ7 A;  4MIJ A;  3MVZ A;  1MXY A;  4OFO A;  2P3N A;  3NOH A;  1ZTY A;  4H65 A;  4OVJ A;  3JV9 A;  3S4U A;  4PDD A;  1NV0 A;  5ET8 A;  2DXR A;  3OO9 A;  1XS5 A;  3RY3 A;  3RPL A;  1CE2 A;  3TUS A;  1MQJ A;  4EUO A;  4RYA A;  3RLF E;  1LBX A;  4F3S A;  3TCG A;  1B46 A;  3QK6 A;  1R9L A;  2DWA A;  1B3G A;  2UVG A;  3G3J A;  3KFM A;  3RYD A;  1NFT A;  3IJO B;  3ILT B;  1WOD A;  4N81 A;  3HV1 A;  1FPI A;  5I2N A;  4BDL A;  3B7D A;  1PDA A;  1B3E A;  2BJI A;  1MDQ A;  1A99 A;  1QGX A;  5EYG A;  1LAX A;  4ZS9 A;  5I57 A;  1IIT A;  4GQO A;  3A3C A;  4AS4 A;  2DOJ A;  3HN0 A;  3UN6 A;  1SD3 A;  4OVR A;  3ROJ A;  2OJT A;  1IZ1 A;  1PBQ A;  1B32 A;  1LBZ A;  3FBP A;  5BUU A;  2RC7 A;  5I2K B;  1I6Q A;  4GL0 A;  1B5I A;  3T96 B;  1EZP A;  3LSL A;  4NG7 A;  2VT5 A;  1OMP A;  3MP8 A;  2F3D A;  2F78 A;  4GWX A;  2F35 A;  1QW0 A;  3FIR A;  1VE4 A;  4MCO A;  3FXB A;  2B4L A;  3DP6 A;  3K1M A;  1RYX A;  3TOD A;  2ZYK A;  1YYZ A;  3R7X A;  2ZNS A;  2H4I A;  4ECF A;  3U8Q A;  1VSO A;  4KR5 A;  3VFJ A;  4IY6 A;  3FJ7 A;  5H8S A;  2XXX A;  1N3X A;  4YKI A;  3DLN A;  5EHS A;  3MUQ A;  4DXU A;  3BFT A;  1BIY A;  2RCB A;  4I9D A;  4O7I A;  4U21 A;  1B5J A;  2KLF A;  3O29 A;  2RF1 A;  2R8T A;  4ZEK A;  2WBB A;  3KSJ A;  1MRP A;  3LV0 A;  4IR8 A;  1VFD A;  3HPI A;  1UTH B;  1A8F A;  4F22 A;  4G2Z A;  5H8Q B;  1PBP A;  3SEX A;  1SQY A;  4G68 B;  4FOR A;  4YMB A;  4F3G A;  4FE8 A;  4AB5 A;  4GX3 A;  2XWV A;  2Y5L A;  3DEL B;  3K6U A;  4IO6 A;  2YPN A;  4G8N A;  2XWO A;  1YCJ A;  3SES A;  1FPF A;  5H8F A;  1Y4C A;  2QS4 A;  5B7D A;  4YKK A;  1B6H A;  3TTK A;  2OWS A;  3M3L A;  1D3K A;  2UVH A;  1D9V A;  3VLU A;  1DCU A;  4EQ9 A;  3TAJ A;  4RXL A;  3O6I A;  1N3W A;  4NMY A;  4BDN A;  3PPP A;  4TOZ A;  5EYH A;  4P8B A;  3H3G A;  4PAF A;  3PTY A;  3H06 B;  1IXC A;  1DSN A;  2B65 A;  1MXU A;  1JQF A;  1D9Y A;  1EYK A;  3GLB A;  2ONS A;  3UIF A;  4MLQ A;  1NV4 A;  1DK4 A;  2F36 A;  1FW0 A;  2QMW A;  4H46 A;  5BWJ A;  4LZ5 A;  1FQD A;  2Q2C A;  2NWJ A;  1AOV A;  3ZS6 A;  1M5D A;  3HST A;  4JXI A;  1MQG A;  4GBV A;  1AMF A;  3BFU A;  3TQL A;  4PFW A;  1FBG A;  1CNQ A;  3MPL A;  5DW8 A;  3HHG A;  5CMM A;  3ONM A;  4O3C A;  1A8E A;  4HE0 A;  4F1Y A;  2F3B A;  3LSW A;  3U72 A;  4QSD A;  4F2Q A;  1FTK A;  4KCC A;  3H6V A;  3T93 B;  4X04 A;  3VLV A;  1LBY A;  5AA2 D;  2X7Q A;  1IXG A;  5EQ8 A;  4PFR A;  4XXU A;  4PE3 A;  2FHY A;  3KN7 A;  1FPK A;  5TU0 A;  4LZ7 A;  2P1S A;  4XKR A;  4HS7 A;  4YB5 A;  1MXW A;  1MXZ A;  2ZZX A;  4JB7 A;  2X7P A;  4WEP A;  4OFL A; 
#chains in the Genus database with same CATH homology
 1EH3 A;  1RKM A;  3P7I A;  3O28 A;  3RN8 A;  3G3H A;  1B1H A;  3C35 A;  5CM6 A;  1Q35 A;  3IOU A;  4H8J A;  5DVJ A;  5L9S A;  4MBP A;  1I69 A;  2WKY A;  3OSQ A;  3KN3 A;  3CI8 A;  1LFI A;  4OER A;  1OQG A;  3IJX B;  3TTM A;  4NF6 A;  3MVW A;  1SDX A;  5I56 B;  1FQB A;  2Z8F A;  3DP4 A;  2CMO A;  3W9V A;  1EU8 A;  1FQE A;  2RCA A;  1OQH A;  4N6P A;  3TTL A;  3GXA A;  1LCT A;  3MVY A;  1HSL A;  4LON B;  2UXA A;  4Q0C A;  3LC8 A;  2HFB A;  1IQ7 A;  4RPO A;  1ZLQ A;  1MY2 A;  1ATG A;  4BLA A;  5TP9 A;  4QFP A;  1URS A;  3CIJ A;  2DP8 A;  2R71 A;  3TTR A;  4KYS A;  1MY0 A;  1XHY A;  5H8H B;  4ELO A;  2XXR A;  1YPN A;  2O1M A;  3H6W A;  3MQ9 A;  1FCK A;  3MPK A;  4FAJ A;  4DDD A;  2OK2 A;  2DYX A;  1H3D A;  1UIV A;  3PU5 A;  3C34 A;  1NH8 A;  1P1U A;  3H6U A;  5DEX B;  4GFR A;  4GVO A;  3W9W A;  3RT6 B;  4M1V A;  3SEU A;  5H8N A;  3SDF A;  4HTG A;  2THI A;  1Y1M A;  4PP0 A;  5JEI A;  5TPA B;  1DTG A;  1KWH A;  4RK2 A;  1B7Z A;  2H99 A;  3QUJ A;  2DXY A;  3HHF A;  4OXV A;  1BTJ A;  1JEV A;  5CI5 A;  1MPC A;  1MY1 A;  1LST A;  4M4G A;  2Q8J A;  5HM4 B;  2RIN A;  5JTY A;  4DXB A;  1PB8 A;  3RTF B;  2A5T B;  1N04 A;  2CZL A;  4R2B A;  5CMC A;  4H5F A;  2XX9 A;  1LAF E;  1YAE A;  1GVC A;  3PUV E;  4P11 A;  4RJZ A;  4IO3 A;  4HCY A;  3K4U A;  4KFQ A;  2XD2 A;  4KI0 E;  4EDP A;  4RA1 A;  3IB1 A;  5H8Q A;  1B7U A;  5ICQ A;  3MZ1 A;  3T66 A;  5DVF A;  1DPE A;  1D4N A;  1LB8 A;  3E13 X;  1LGB C;  2PMS A;  3TDJ A;  1ZKB A;  3C36 A;  5ELV A;  2DVC A;  2PYY A;  4ZEI A;  5AA1 A;  4NTL A;  1TT1 A;  1XT8 A;  4IY5 A;  3U92 A;  2O1L A;  1VR5 A;  5CBR A;  1FTJ A;  4QSE A;  4O3A A;  2LAO A;  3KJ7 A;  4LVQ A;  3S9N C;  2DS9 A;  5AA2 A;  3MBP A;  3C31 A;  4O3B A;  1QUJ A;  4NF4 B;  3H03 A;  5DTB A;  3EN3 A;  1XC1 A;  1QUI A;  2OBG A;  2QMX A;  1Z7N E;  3EF7 A;  2Y84 A;  3DM0 A;  2NXO A;  4WXJ A;  4YKJ A;  2DSF A;  1OVB A;  3OSR A;  4ZEC A;  3K02 A;  4ELR A;  5K2X A;  3IO6 A;  5FHM A;  3QIM A;  2HCA A;  1NL5 A;  2P2A A;  5L8D A;  2W7Y A;  3PPO A;  3MZ9 A;  1NNP A;  5J1D A;  1B2H A;  1HSE A;  3O2A A;  2ZYO A;  2E1S A;  2ONR A;  2H5Y A;  4OEU A;  2F6P A;  3JYR A;  1N7W A;  4DCX A;  4H0W A;  3FXQ A;  4R9F A;  2F97 A;  1SW1 A;  3LSF B;  4U1O A;  3EHU A;  1B4Z A;  1BKA A;  5AA4 B;  3TPA A;  4G8H A;  5A5X A;  3M8U A;  2PVU A;  4G4P A;  4E0W A;  3MZB A;  2QS3 A;  3TFL A;  1B3L A;  3QAX A;  4ISU A;  4QF9 A;  1B4H A;  4LA9 A;  5EHM A;  4C1T A;  4U2R A;  3PUY E;  1TXF A;  3PD9 A;  4OEV A;  1N76 A;  1B3F A;  4LZ8 A;  3IX1 A;  1Y1Z A;  1MQI A;  4YZZ A;  4OQO A;  1IUD A;  4DE8 A;  4QSC A;  5HPQ A;  3VVF A;  1B58 A;  3PMX A;  4OET A;  4ELQ A;  3V83 A;  1R1N A;  4Q5T A;  4OHN A;  3IL1 B;  3FAT A;  4PFT A;  4ZZE A;  3MC2 A;  2QS1 A;  2HQ0 A;  4YKP A;  1FQA A;  1MM6 A;  2M8C A;  4ZZA A;  2Q89 A;  1M5E A;  1LFH A;  4LP2 B;  4FEC A;  2R9J A;  1JW4 A;  3B6Q A;  1B0H A;  1XOC A;  1HSJ A;  5I56 A;  3N94 A;  4F29 A;  4QFO A;  1P1O A;  3QXM A;  4LUB A;  2OCU A;  2HEU A;  4LQ2 A;  4EQB A;  4U22 A;  1Y3Q A;  2V25 A;  3FUZ A;  4ZE9 A;  1LFG A;  5I59 B;  1B3H A;  5CRY A;  1MPD A;  4DXC A;  3RPW A;  2OZZ A;  1NNF A;  5CC2 A;  2RC8 A;  4NF8 B;  3O97 A;  3Q27 A;  2O6A A;  3C33 A;  3GBA A;  3T9X B;  4DIG A;  3EHS A;  3FJG A;  2I3W A;  1Y3N A;  4XKP A;  4LAT A;  3U1O A;  1BLF A;  4PE5 B;  2I48 A;  4MF3 A;  2XXQ A;  1YTV A;  2ANJ A;  1XVY A;  2QJE A;  3K1P A;  1B05 A;  3MAM A;  1O7T A;  3DP8 A;  4I62 A;  2GRV A;  4KD5 A;  3TYH A;  4PQJ A;  3LR1 A;  2I0C A;  4R75 A;  4AB6 A;  5TPA A;  3CRB A;  1UQW A;  4QHQ A;  1FTM A;  4DLD A;  3N5L A;  3IR1 A;  3MP6 A;  3O66 A;  3OO8 A;  3TTN A;  4POW A;  1QKB A;  1US4 A;  1J1N A;  2UYF A;  3V8X B;  1RYO A;  4ELP A;  3IOV A;  3SET A;  1JVX A;  2DVZ A;  3OXN A;  2I4B A;  1MPB A;  3T9V A;  2Q2A A;  1SW2 A;  3MWB A;  4YB7 A;  4OTE A;  3PPQ A;  3TCH A;  2O51 A;  5AA3 A;  5LOM A;  4HW8 A;  4BDR A;  1AL3 A;  3VE1 B;  3KSX A;  1H43 A;  4KQP A;  4EXK A;  3CFX A;  3HO7 A;  4OEN A;  5I58 A;  2XXW A;  1S9T A;  5ITO A;  2FNC A;  4GXS B;  5KZT A;  1MQH A;  2XXU A;  1MY3 A;  1MM7 A;  1ZMG A;  1IEJ A;  3A09 A;  3ZKL A;  3CVG A;  3H7M A;  4Q8R A;  3O9P A;  3TEP A;  1JVY A;  1M5B A;  3ECR A;  1A7L A;  4ZED A;  3S9L C;  1UIU A;  3C32 A;  2IEE A;  3TMG A;  3UP9 A;  2HAV A;  1P1Q A;  1URG A;  3OO7 A;  1I6B A;  3G7W A;  1SVX B;  3CSB A;  4R73 A;  2VD2 A;  2D5W A;  4QFK A;  4IB2 A;  5IKB A;  1P99 A;  3A3U A;  2QS2 A;  2XX7 A;  1ELJ A;  1LAG E;  5DYH A;  2VOZ A;  5IAI A;  2ONK E;  3IOT A;  3ODB A;  2A5S A;  4GF8 A;  4GXA A;  1H44 A;  4F3P A;  3O6H A;  4Q30 B;  5CMK A;  4NWC A;  4P0I A;  3H6T A;  4KYE A;  3CG1 A;  1Y4T A;  3UK4 A;  1WDN A;  1M5F A;  3ILU B;  4X1D A;  4THI A;  1TFD A;  3T9U A;  1GTK A;  1B40 A;  1USY H;  3K6X A;  4GLI A;  1N7X A;  2V84 A;  3FZV A;  1NNT A;  1SYH A;  2XX8 A;  4NF5 B;  3V5A A;  4TLM B;  1O63 A;  3BBR A;  5KCJ B;  2ALU A;  2D21 A;  3FAS A;  1B52 A;  3GBB A;  5EYF A;  3QUF A;  1NMU A;  1JET A;  4QFL A;  3EPE A;  2UVI A;  1Y3P A;  3Q25 A;  2H25 A;  5I2K A;  4L17 A;  2HZL A;  2XXH A;  4KYD A;  4TLL B;  3VXB A;  2VHA A;  2F8D A;  3OO6 A;  2XHD A;  2Z8D A;  5I84 A;  4UA8 A;  2DE3 A;  1Y9U A;  1FQF A;  5H8F B;  3CFL A;  4P0G A;  1OIB A;  2FA7 A;  2V3T A;  4F2O A;  3PGF A;  1URD A;  4BDO A;  2D3I A;  3PV0 E;  2AYS A;  4RK9 A;  4ZDM A;  3E3K A;  1LCF A;  2ZNT A;  4YMA A;  2I6E A;  1B51 A;  1FTL A;  3C9H A;  1MS7 A;  4OFJ A;  3B6T A;  3R6U A;  2QL3 A;  1MXX A;  4ZEB A;  1US5 A;  3IB0 A;  1S50 A;  1QUL A;  1B1X A;  4U4X A;  2PX1 A;  1UTH A;  4OYV A;  5AE4 A;  1Y20 A;  4G68 A;  4ZE8 A;  2RKM A;  4EQ7 A;  4IO2 A;  3N26 A;  3KJT A;  2XXI A;  3FJM A;  3FVO A;  3IB2 A;  2UVJ A;  3TZA A;  3WAF A;  2I4C A;  4MFI A;  1L5T A;  4R72 A;  3FV1 A;  2YJP A;  4R6Y A;  2VP1 A;  1SYI A;  4KCD A;  2DE2 A;  4GWO A;  3CR9 A;  4G77 A;  3FVN A;  4ZEF A;  2B3F A;  3RGY A;  3PUW E;  3S9M C;  1TWY A;  1LBB A;  4WED A;  3ZKK A;  1T0K A;  2Y7P A;  2Z22 A;  4JBZ A;  3T22 A;  2I58 A;  2AIX A;  3MW0 A;  3K00 A;  3VXC A;  3I5O A;  3THI A;  3CSG A;  3Q26 A;  2VGQ A;  2O69 A;  3KBR A;  4F1U A;  3RTW B;  1I6A A;  3SEV A;  4U23 A;  2GFE A;  1AH5 A;  3LBS A;  1PEB A;  4TQU Q;  3I6V A;  3UOR A;  4GRK A;  4U4S A;  1N0T A;  2FYI A;  4FAT A;  3SER A;  1VFE A;  4NF6 B;  5FTI A;  1POT A;  2F7A A;  2F5X A;  4HCW A;  2QPQ A;  2REG A;  1LB9 A;  2Z8E A;  3FGS A;  4MH5 A;  1TFA A;  3KOT A;  3OEM A;  3MP1 A;  1SW5 A;  4H1X A;  1IIW A;  1SI0 A;  3K6V A;  3PPN A;  3SEW A;  4FEB A;  2QRY A;  5F7V A;  2Y7R A;  1JEU A;  2PT2 A;  3KG2 A;  2QSX A;  4N13 A;  2I0B A;  4QRZ A;  3KGC A;  2UYE A;  3G3I A;  1JW5 A;  2F6G A;  4Z7E A;  2G93 A;  1LLS A;  1UTB B;  5TP9 B;  3G3F A;  5KDT B;  3IK6 B;  2R6G E;  3IOW A;  5DT6 A;  4N07 A;  1DPP A;  3L6G A;  4GIZ A;  4G8M A;  4C1U A;  1LAH E;  3JZJ A;  1EZ9 A;  1MDP 1;  4DZ1 A;  2V3Q A;  5FHN A;  2HAU A;  5H8N B;  1B7H A;  4IO5 A;  4ND9 A;  3M3K A;  1SW4 A;  1JNF A;  2XXP A;  3FVG A;  3N6U A;  2O84 X;  5M2V A;  2BJJ X;  3E9X A;  1MG1 A;  2B3B A;  3D4G A;  3VDF A;  3R26 A;  2XXY A;  5JTY B;  1A55 A;  2ZYN A;  3OEK A;  1B9J A;  2V93 A;  4AQ4 A;  4U1Z A;  5JK4 A;  2NVU B;  2XXT A;  5ICT A;  1ZIU A;  4BDQ A;  3VLW A;  3QSL A;  4NWD A;  3RNN A;  2HZK A;  4XIG Q;  5H8H A;  4NF5 A;  4EF2 A;  3OOA A;  3GZG A;  4H6D A;  2DWJ A;  1O64 A;  5KCJ A;  1ZJL A;  1H45 A;  2E0S A;  1B5H A;  2ESN A;  5DEX A;  4EXL A;  1NKX A;  4ESX A;  3I3V A;  4F18 A;  3C4M A;  2DWI A;  1SI1 A;  4JWY A;  3K0V A;  1PB9 A;  5K2Y A;  5CMB A;  3FD3 A;  1MH3 A;  4PFY A;  2F7C A;  2AL4 A;  3S2V A;  3FXU A;  3CG3 A;  4G68 C;  4MLV A;  3T9H B;  4H8I A;  2H98 A;  3O6G A;  5AA2 B;  1POY 1;  1MQD A;  1M5C A;  3TQW A;  2ZYM A;  3HCQ A;  3FVK A;  2Q9T A;  2A5T A;  2ZXT A;  1MY4 A;  4JWO A;  1Q1K A;  3VVD A;  5ITP A;  2OLB A;  3TKD A;  4YAH X;  3V89 B;  3IAZ A;  2ZMB A;  4R6K A;  3PUZ E;  2Y7K A;  3K01 A;  3KOS A;  3PUX E;  3AXF A;  1Z7M E;  4E0X A;  5L9O A;  3USD A;  3BKI B;  2XD3 A;  3M3F A;  3OMB A;  2P0S A;  1ZU0 A;  4R74 A;  2IA4 A;  2G29 A;  4R9G A;  3FV2 A;  4F19 A;  1GV8 A;  1DMB A;  3PMW A;  1QJM A;  4IGT A;  4X9T A;  4I8C A;  3OEN A;  4ONY A;  3IOR A;  3MJN A;  2H9B A;  4FIM A;  4IO7 A;  3SKP A;  5CBS A;  3RT8 A;  1BP5 A;  1SBP A;  3RQT A;  2Y7W A;  1EZO A;  1P1N A;  1OLC A;  4K3F A;  2O7U A;  3EQ1 A;  3WAE A;  1OVT A;  5A5X B;  2I49 A;  3B6W A;  4UAC A;  3OEL A;  3UA8 A;  4OZ9 A;  5I2N B;  4EF1 A;  4NF4 A;  4H67 A;  4FJP A;  1QVS A;  3E4R A;  5I57 B;  5FHO A;  4XKQ A;  2XXV A;  2V3U A;  3D4C A;  4F31 B;  4QFN A;  2PBW A;  5B70 A;  1LBC A;  2PT1 A;  1H76 A;  1IXI A;  1R9Q A;  3PD8 A;  1DOT A;  3ZSF A;  4Z0I A;  4OMB A;  2AL5 A;  1AIV A;  4NED A;  4JSD A;  4OWD A;  3TEL A;  4DCY A;  3U94 A;  4I1D A;  4GOT A;  1N84 A;  2RC9 A;  1NH7 A;  2DE4 A;  4XKN A;  2GHB A;  5AA4 A;  1USY E;  2O68 A;  3LUY A;  1XVX A;  1PC3 A;  3VV5 A;  3KZG A;  3QYT A;  2OWT A;  3FXR A;  1FTO A;  1B0L A;  3N6T A;  2NUV A;  2Y7I A;  3F11 A;  4X48 A;  2F7B A;  1UTB A;  2HXW A;  2Q88 A;  5KDT A;  4KPT A;  2GHA A;  3K2D A;  1A54 A;  1JW1 A;  1GR2 A;  2NOO A;  4PFU A;  2GH9 A;  3SEY A;  4XTC Q;  2REJ A;  4ESW A;  4RNS A;  2O7I A;  4RY1 A;  4GL8 A;  1GGG A;  3L6H A;  4JDF A;  4NE4 A;  3G3K A;  1II5 A;  3EHT A;  4POX A;  3UGW A;  5DVI A;  3IO4 A;  2VD3 A;  3OD7 A;  1QUK A;  4YB6 A;  4IGR A;  1F9B A;  1P1W A;  2DQV A;  1WVJ A;  4F39 A;  3W15 C;  4X1B A;  3Q29 A;  3G3G A;  3K6W A;  5I59 A;  1DTZ A;  5FTH A;  4KHZ E;  4JSO A;  4YIC A;  4GD5 A;  4NF8 A;  4WKM A;  3H4Z A;  4LQ5 A;  4H5G A;  1CB6 A;  3PMV A;  1FQC A;  1NNK A;  3Q28 A;  3LSX A;  2Z23 A;  3CFZ A;  1PB7 A;  1R6Z A;  1S7Y A;  2ABH A;  1MXV A;  3PPR A;  1ANF A;  3RUM A;  4OES A;  4R2F A;  3TCF A;  5I58 B;  3KN8 A;  2I3V A;  1MH4 A;  1QKA A;  1A40 A;  3MVX A;  5F1Q A;  4JWX A;  2ZNU A;  3U93 A;  2F34 A;  3KEI A;  4F1V A;  4C0R A;  2YLN A;  1ZBM A;  4R6H A;  4BDM A;  4IO4 A;  3S9E A;  1OLA A;  1IXH A;  2DWH A;  4RPN A;  2X26 A;  4PET A;  5L9M A;  4FED A;  5HBC A;  4YU0 A;  3VVE A;  5ISU A;  4F3B A;  3K1N A;  3MVZ A;  1MXY A;  4OFO A;  1ZTY A;  4H65 A;  4OVJ A;  3JV9 A;  3S4U A;  2DXR A;  3OO9 A;  1XS5 A;  3RY3 A;  1CE2 A;  3TUS A;  1MQJ A;  4EUO A;  4RYA A;  3RLF E;  4F3S A;  3TCG A;  1B46 A;  3QK6 A;  1R9L A;  2DWA A;  1B3G A;  2UVG A;  3G3J A;  3KFM A;  1NFT A;  3IJO B;  3ILT B;  1WOD A;  3HV1 A;  5I2N A;  4BDL A;  3B7D A;  1PDA A;  1B3E A;  1MDQ A;  1A99 A;  1LAX A;  4ZS9 A;  5I57 A;  1IIT A;  4GQO A;  3A3C A;  2DOJ A;  3HN0 A;  3UN6 A;  1SD3 A;  2OJT A;  1IZ1 A;  1PBQ A;  1B32 A;  5BUU A;  2RC7 A;  5I2K B;  1I6Q A;  4GL0 A;  1B5I A;  3T96 B;  1EZP A;  3LSL A;  1OMP A;  3MP8 A;  2F78 A;  2F35 A;  1QW0 A;  3FIR A;  1VE4 A;  3DP6 A;  3K1M A;  1RYX A;  3TOD A;  2ZYK A;  3R7X A;  2ZNS A;  2H4I A;  4ECF A;  3U8Q A;  1VSO A;  4KR5 A;  3VFJ A;  4IY6 A;  3FJ7 A;  5H8S A;  2XXX A;  1N3X A;  4YKI A;  3DLN A;  5EHS A;  3MUQ A;  4DXU A;  3BFT A;  1BIY A;  2RCB A;  4I9D A;  4U21 A;  1B5J A;  2KLF A;  3O29 A;  2RF1 A;  4ZEK A;  3KSJ A;  1MRP A;  1VFD A;  3HPI A;  1UTH B;  1A8F A;  4F22 A;  4G2Z A;  5H8Q B;  1PBP A;  3SEX A;  1SQY A;  4G68 B;  4FOR A;  4YMB A;  4F3G A;  4FE8 A;  4AB5 A;  3DEL B;  3K6U A;  4IO6 A;  2YPN A;  4G8N A;  1YCJ A;  3SES A;  5H8F A;  1Y4C A;  2QS4 A;  5B7D A;  4YKK A;  1B6H A;  3TTK A;  2OWS A;  3M3L A;  1D3K A;  2UVH A;  1D9V A;  3VLU A;  4EQ9 A;  3TAJ A;  4RXL A;  3O6I A;  1N3W A;  4NMY A;  4BDN A;  3PPP A;  4TOZ A;  3H3G A;  3H06 B;  1IXC A;  1DSN A;  2B65 A;  1MXU A;  1JQF A;  1D9Y A;  3GLB A;  2ONS A;  3UIF A;  4MLQ A;  2F36 A;  1FW0 A;  2QMW A;  5BWJ A;  4LZ5 A;  1FQD A;  2Q2C A;  2NWJ A;  1AOV A;  3ZS6 A;  1M5D A;  3HST A;  4JXI A;  1MQG A;  1AMF A;  3BFU A;  3TQL A;  4PFW A;  3MPL A;  3HHG A;  5CMM A;  3ONM A;  4O3C A;  1A8E A;  4F1Y A;  3LSW A;  3U72 A;  4QSD A;  4F2Q A;  1FTK A;  4KCC A;  3H6V A;  3T93 B;  3VLV A;  5AA2 D;  2X7Q A;  1IXG A;  4XXU A;  3KN7 A;  5TU0 A;  4LZ7 A;  2P1S A;  4XKR A;  4HS7 A;  4YB5 A;  1MXW A;  1MXZ A;  4JB7 A;  2X7P A;  4WEP A;  4OFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...