1NFTA

Ovotransferrin, n-terminal lobe, iron loaded open form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
KSVIRWCTVSSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLDGGQVFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLGRSAGWNIPIGTLIHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYKTCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (OVOTRANSFERRIN)
publication title Alternative structural state of transferrin. The crystallographic analysis of iron-loaded but domain-opened ovotransferrin N-lobe.
pubmed doi rcsb
molecule tags Transport protein
total genus 97
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 1999-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nftA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nftA02
3G3JA 1QUKA 1VFDA 4U2RA 2H4IA 1PBPA 1GVCA 3A3UA 2XXUA 2GHAA 5AA2D 2XXWA 4F2OA 1IQ7A 3U94A 2DYXA 4R6YA 3KOTA 4DLDA 2YPNA 4OHNA 4HTGA 1SW5A 3PV0E 1LFGA 1VSOA 4NF6A 3T93B 2XXRA 4G4PA 3F11A 2DWIA 1DSNA 1S7YA 3C36A 1JEUA 1AOVA 4ECFA 3B7DA 2V84A 2A5SA 4AQ4A 3MW0A 4HS7A 2O84X 3T9HB 1PC3A 3T66A 4F3SA 4OTEA 1I6BA 2Q2CA 5IAIA 1B1XA 3D4CA 2D21A 4N6PA 1B7UA 3A3CA 4TQUQ 3R7XA 3SEYA 3H6VA 1QULA 5I59A 4PP0A 4RPNA 1MPDA 4ONYA 3BBRA 5KCJB 4IY5A 2NUVA 1PB7A 4LUBA 3PPOA 1MQGA 3Q26A 5I57A 3C33A 3OXNA 4MBPA 3TKDA 1L5TA 4IY6A 2Y84A 3SETA 4H65A 3TDJA 1MXUA 5FHNA 1N7WA 2PT2A 4ZE9A 2I0CA 4ZDMA 3H06B 1QVSA 1FQDA 5FTHA 3TYHA 3K1PA 3CSBA 3OSQA 1M5BA 3UN6A 1DTZA 3Q29A 1ZKBA 1B6HA 1O63A 3IB0A 5FHMA 2AYSA 2R71A 1LAHE 4QSCA 4LQ2A 3KG2A 3Q27A 1MXYA 1POY1 5IKBA 1NNFA 1J1NA 2F34A 1OQGA 2QSXA 3WAEA 3OMBA 2O51A 1P1UA 3DM0A 4BDLA 3L6HA 4JWOA 4YMAA 3V83A 3P7IA 1LCTA 1IXHA 1IUDA 2FA7A 1D9YA 4F1YA 3JZJA 3TTMA 2P0SA 4G68C 4LA9A 2DWAA 4KQPA 2B3FA 3CFXA 3PD9A 2REJA 1NH7A 4JXIA 3OO7A 3EF7A 1XHYA 1XOCA 2HEUA 3E13X 2XXHA 5CMMA 5H8FB 4U4SA 1N0TA 4RXLA 4R75A 1WODA 2AIXA 1QKAA 3KN8A 1EZ9A 1B5HA 1IXIA 4QSDA 4JB7A 4R9GA 2DWHA 3QYTA 3G3IA 3HHGA 3N5LA 1B3GA 3QUFA 3TTLA 1LCFA 1N04A 3VXCA 1FTOA 3Q25A 4IGRA 3IO6A 3LSFB 3S9EA 2I4BA 5I2KA 1MXWA 3M3LA 3IOUA 1R1NA 5FHOA 3PPNA 4GD5A 2DS9A 2Q2AA 4YMBA 3FV2A 5F1QA 2QPQA 2ZYKA 4P0GA 4GRKA 2OZZA 2DE2A 4H8IA 4M4GA 4ZECA 3TAJA 1FQFA 4KFQA 3G3KA 2V3QA 2R6GE 4OYVA 3LUYA 4OQOA 1POTA 2Y7IA 1A54A 2Q89A 1UTBB 4LATA 3EQ1A 5DEXA 3G3HA 4DZ1A 1Y1ZA 1LAXA 1VR5A 2ESNA 3EPEA 3IK6B 4KCDA 1NNPA 2GH9A 4OFOA 4MF3A 5CBSA 2I48A 2CMOA 3HO7A 5H8QA 3U92A 1Z7NE 4H5GA 1B4ZA 5TP9A 2HAVA 3A09A 4LZ5A 3PGFA 1LSTA 2DVZA 3R6UA 4ZS9A 5TPAA 4O3CA 1M5EA 1B7ZA 2NVUB 1XS5A 3B6QA 3RGYA 1MXXA 5ITPA 3VFJA 4NWCA 2B65A 3MAMA 3K0VA 1TT1A 3USDA 3O2AA 2A5TB 1URSA 1MXVA 1AMFA 1B3LA 1Q35A 2I58A 4Q30B 1MH4A 4OERA 4XIGQ 4G8NA 2Z8DA 3CFZA 3V5AA 3DP6A 2XXIA 4DXBA 5H8HA 4YAHX 1SVXB 1A55A 3TTNA 1BP5A 4NF8B 1MY2A 3DP8A 4ZEBA 2F7AA 1IEJA 1RYOA 3FIRA 3H6TA 3FXRA 3T96B 3FUZA 4DXCA 1QUJA 1T0KA 1FTLA 3HV1A 5ITOA 3N6TA 3PPRA 2RC9A 4N13A 3THIA 5AA2A 1XVXA 1IXCA 4FJPA 4F3PA 3IR1A 1MY1A 3IJOB 1USYE 2XX9A 3VLVA 4YKIA 4F1UA 4GIZA 1ZIUA 4NMYA 1P1NA 4R72A 5AA4B 4PFUA 3MP6A 2D3IA 2DSFA 3TCFA 4EF1A 5L8DA 5DT6A 1DOTA 3MPKA 3KN7A 1XVYA 2I3VA 4U1OA 3QIMA 3VLWA 2DOJA 1B0LA 2V93A 4IGTA 3O97A 2X26A 2F7BA 3MP8A 2QRYA 2ZYOA 4H67A 1A7LA 3IOWA 2NWJA 3MVYA 4FECA 4HW8A 2HZLA 1D3KA 4JSDA 1UTHA 2QS4A 1Q1KA 5A5XA 5CC2A 1NKXA 4LZ7A 5AA1A 4U1ZA 5CM6A 4MH5A 3W9WA 2HCAA 1LB9A 1TFDA 2THIA 2VP1A 3K6XA 4C1TA 4RPOA 1LAGE 4F22A 3TEPA 1ZLQA 4IO4A 1BKAA 3FXQA 3TUSA 4NF8A 3FVNA 1GGGA 3R26A 3ILTB 2H98A 3MZ9A 1JW1A 3UIFA 4N07A 2RCBA 3ZSFA 3IX1A 4O3AA 4LVQA 1B32A 5ISUA 1YTVA 3FD3A 3OELA 3KBRA 2G29A 1MS7A 2PX1A 5K2YA 3M8UA 2ZXTA 4YKKA 4AB6A 4UACA 1NMUA 4YKPA 3O6IA 3QXMA 2OJTA 2F78A 1UIUA 2D5WA 1Y3NA 3CG1A 3S9NC 1AL3A 3IB2A 4NTLA 3MBPA 4G77A 4ZEFA 3ZS6A 4R6HA 4TOZA 3U1OA 2F35A 1WDNA 4RNSA 4BDMA 1SW2A 4ZEIA 1B0HA 3RN8A 1B7HA 1PDAA 1LLSA 2REGA 4DE8A 3GLBA 2LAOA 3CVGA 1YPNA 2M8CA 1I6AA 3MVXA 4XTCQ 4TLLB 4GXAA 1DMBA 2O68A 1DTGA 4GWOA 4F19A 3KZGA 1OVTA 3G3GA 4QFNA 4I1DA 3PUVE 2ABHA 1AH5A 2Y7KA 4YB6A 1WVJA 4GVOA 1B5IA 4RK2A 2DWJA 1B3EA 1NNKA 4G68A 3PU5A 4GQOA 3FVOA 3O66A 1O7TA 4BDRA 4BDNA 3TZAA 5KZTA 1LFIA 2PYYA 4Q0CA 2NOOA 1ZBMA 4FAJA 3HPIA 1P99A 1MRPA 2QMWA 4IO7A 4ZZAA 3OSRA 5H8NB 3MZBA 3H7MA 4E0XA 4KYEA 3FVKA 3C32A 3OO6A 4R74A 3I6VA 4F18A 1XC1A 3CI8A 3UK4A 4GOTA 3W15C 3CSGA 2ANJA 4H6DA 2XX7A 2KLFA 4FATA 2Y7RA 1AIVA 4RY1A 1MDQA 3S9MC 2I4CA 3HN0A 2F8DA 5I2NB 3E3KA 1HSJA 4Q5TA 3M3FA 4E0WA 1NL5A 1N84A 3JYRA 4MFIA 4POXA 5M2VA 3M3KA 4EF2A 1JW4A 1ANFA 1FTJA 1JQFA 1TFAA 4ELOA 2UYEA 2Z22A 5KDTB 1B9JA 1BTJA 1JVXA 5KCJA 1MQJA 1USYH 4ZE8A 3AXFA 2Q9TA 2I6EA 4KPTA 2NXOA 2OK2A 3MPLA 2DE4A 2E0SA 3O29A 1US4A 2E1SA 2I0BA 3S9LC 5FTIA 3SEVA 3T22A 5F7VA 1B51A 1EZPA 2UVIA 2IA4A 3SKPA 5JK4A 4OENA 3H6WA 3PMWA 4G2ZA 1UIVA 1SI0A 4RK9A 1KWHA 4LP2B 1B58A 4OEUA 3C9HA 3DELB 3ZKKA 2XXQA 1SD3A 1FQEA 2HZKA 1QUIA 3E9XA 3FJGA 3FJMA 3LSXA 2QS3A 1UQWA 2P1SA 2FYIA 3LR1A 4OETA 3LBSA 5DYHA 3OEKA 2VD3A 3UP9A 1TXFA 2OLBA 1FQAA 1SBPA 4RYAA 4ZZEA 5CI5A 3K00A 1Y4TA 3PMVA 4U4XA 4Z0IA 4QFLA 1P1QA 4HCYA 1M5CA 3KFMA 4PE5B 4YICA 5I2NA 3OD7A 4R2FA 3JV9A 3RT6B 3SEUA 1MY0A 3LSWA 1MM7A 2XD3A 4ZEKA 2UVHA 3MC2A 3IL1B 2UVGA 4OESA 1XT8A 3OENA 4ND9A 4POWA 3CR9A 4MLVA 1EH3A 3T9VA 1LBBA 3TTRA 2ALUA 3BFTA 5HBCA 3O9PA 4NWDA 3RT8A 3GZGA 1H76A 3K02A 5L9OA 1OLAA 1ZU0A 5BWJA 3VVEA 3IO4A 2UYFA 2G93A 1URGA 5H8FA 5I58B 1NNTA 4QFOA 2PBWA 2OBGA 2Z8EA 3ECRA 4Z7EA 1SQYA 4I9DA 3S2VA 2V3TA 2GFEA 1ZTYA 1HSEA 5HPQA 3TCHA 2O69A 3N26A 3WAFA 4NF4B 1H45A 3EN3A 3O6GA 4FE8A 4IO3A 2F6PA 3T9UA 3PUWE 3U8QA 4P11A 1MY4A 3LC8A 1LFHA 4U23A 5K2XA 2B3BA 2H99A 1LBCA 2YLNA 4PFYA 2QS2A 4IO2A 2WKYA 4JWXA 1JETA 1SI1A 2F36A 4YU0A 1SYIA 4NF5B 5BUUA 5I56B 5J1DA 3PMXA 4QF9A 1JVYA 3V8XB 3U72A 2XXVA 2GRVA 5ICTA 2W7YA 4C0RA 2XHDA 2RCAA 3H4ZA 1SW4A 2ZNSA 4R9FA 1UTBA 3FXUA 4GL8A 1OVBA 4THIA 4X9TA 4R2BA 3N6UA 3OEMA 2P2AA 5AE4A 1MXZA 3MVZA 4I8CA 2F6GA 3RPWA 3VDFA 2ZYMA 4FIMA 2RC7A 4OWDA 5DVIA 3IOTA 4XKQA 4OFLA 2HXWA 3B6TA 4OXVA 5H8SA 1H3DA 1US5A 2AL4A 1GV8A 1MPCA 4U22A 2GHBA 4IO6A 3LSLA 4KD5A 1BIYA 1CE2A 2H25A 1PB9A 1Y1MA 3VE1B 2A5TA 2RF1A 3FGSA 1OMPA 4QFPA 3K4UA 5CRYA 3G7WA 5I59B 3TPAA 4KYSA 1ATGA 5HM4B 2O1LA 4ELPA 3GXAA 1R6ZA 1Y3PA 4EQ7A 3KSJA 5I57B 4QFKA 1B3FA 5CBRA 3MWBA 3VVFA 4XKRA 3B6WA 3IAZA 4BDQA 4Q8RA 3KN3A 3RUMA 3CG3A 5I84A 2PT1A 3H3GA 5CMKA 3EHSA 1M5FA 3MQ9A 4F2QA 3CFLA 3D4GA 2ZNTA 3FVGA 1A8EA 4ESXA 2YJPA 4EQ9A 2H9BA 3TQLA 2O7UA 3SDFA 4I62A 5AA4A 3KOSA 1VFEA 1GR2A 1R9QA 4JDFA 3RLFE 1MM6A 2VHAA 1TWYA 3QK6A 3IOVA 2Z23A 2RINA 2IEEA 3KSXA 4O3BA 2Q8JA 4IO5A 1MDP1 1SDXA 4FORA 4EXLA 4PETA 4OZ9A 3FZVA 2VD2A 3DP4A 2XD2A 4LONB 3FASA 5CMBA 1EU8A 2AL5A 3VXBA 2BJJX 2F5XA 2OWTA 2QJEA 4OVJA 1FCKA 4FEDA 4GFRA 1SYHA 4QSEA 2QS1A 4JWYA 3K1NA 4TLMB 4R73A 4QHQA 3W9VA 3RY3A 3K01A 5TU0A 1RKMA 5DVFA 2XXTA 4X48A 4WKMA 4WXJA 1FTKA 4YZZA 4AB5A 1JW5A 3ZKLA 1MG1A 4H8JA 4GL0A 1URDA 2DQVA 1HSLA 3BFUA 1DPEA 5B70A 5I2KB 2RC8A 1BLFA 1OLCA 4H0WA 2OCUA 2O6AA 1PEBA 2V3UA 3KGCA 3FV1A 4KR5A 2RKMA 1FTMA 2FNCA 1IXGA 1LAFE 1H44A 4EXKA 4X1BA 5AA3A 3TCGA 3OO8A 3UA8A 5DVJA 3U93A 4NE4A 1D9VA 3IORA 2X7PA 1PB8A 1ZJLA 3ILUB 3O28A 1N3XA 1I69A 1GTKA 1ELJA 1B5JA 3PPPA 2I49A 1P1WA 4F39A 5EYFA 3K6WA 2QMXA 5JEIA 4XKNA 3MP1A 3RNNA 4F3BA 3EHTA 2UVJA 1B1HA 1S50A 1B40A 3KJ7A 3CRBA 5DEXB 3GBAA 1QJMA 4YB5A 1Y9UA 4H5FA 2OWSA 2Y7WA 4DIGA 3QSLA 4IB2A 4JBZA 3H6UA 4WEDA 3DLNA 1N3WA 3Q28A 5LOMA 3T9XB 4G8MA 2ZYNA 2F97A 4DCYA 3FATA 3MVWA 2XX8A 5H8QB 4ZEDA 3UGWA 5TP9B 1OIBA 1MQHA 2O7IA 3GBBA 4KI0E 4EQBA 3ODBA 5TPAB 1Y3QA 4EDPA 4ELRA 5H8NA 3KJTA 1I6QA 1MQIA 4YB7A 1DPPA 2XXPA 3CIJA 3K1MA 3FJ7A 3HCQA 5L9SA 2HFBA 4P0IA 4WEPA 3C4MA 4XXUA 5JTYB 1B2HA 5B7DA 1YAEA 5DTBA 4GLIA 3I3VA 2DP8A 4DCXA 5H8HB 3MUQA 4LZ8A 4ISUA 4G8HA 4XKPA 3PPQA 5L9MA 1MY3A 3IB1A 2X7QA 1MH3A 1H43A 4GXSB 5AA2B 3V89B 1OQHA 2R9JA 1QW0A 3QAXA 5KDTA 1M5DA 1N76A 3N94A 4PQJA 1JEVA 2QL3A 2ONRA 5CMCA 2ZNUA 1YCJA 4MLQA 1F9BA 1B52A 2F7CA 3L6GA 1Y4CA 4GF8A 4HCWA 3RTWB 3PUZE 5EHSA 3QUJA 3UORA 2DXYA 3BKIB 4R6KA 1VE4A 1IIWA 2O1MA 2DXRA 2UXAA 3I5OA 2HAUA 3VVDA 4F31B 3TFLA 1LGBC 1O64A 4ESWA 4OMBA 1NH8A 4OFJA 4RA1A 3MJNA 3C34A 4F29A 4ELQA 3PD8A 3EHUA 1UTHB 4FEBA 5A5XB 3ONMA 4C1UA 5JTYA 3TTKA 1R9LA 4UA8A 3TODA 1A8FA 1RYXA 2VOZA 4LQ5A 2PVUA 2Y7PA 3MZ1A 4M1VA 4K3FA 1A99A 4H1XA 2CZLA 4U21A 5EHMA 3SESA 2XXYA 2I3WA 4X1DA 4DXUA 3OO9A 4BLAA 3C35A 3HSTA 1A40A 1FQBA 2ZMBA 3TELA 3RTFB 1CB6A 3OOAA 1IITA 1LB8A 1QKBA 4PFTA 3H03A 2ONKE 4F3GA 4OEVA 2HQ0A 3TQWA 4EUOA 3VLUA 1B4HA 4PFWA 1D4NA 1SW1A 3K6UA 1B05A 4NF6B 3SERA 4KCCA 2XXXA 3KEIA 2Z8FA 5I58A 3TMGA 4BDOA 3IJXB 1Y20A 3SEWA 3O6HA 3VV5A 3K2DA 1B46A 2VGQA 3RQTA 1NFTA 2V25A 4DDDA 4YKJA 2DE3A 4L17A 4NF4A 3G3FA 1B3HA 1IZ1A 1FQCA 1JNFA 2DVCA 4KHZE 2Q88A 4KYDA 1S9TA 2ONSA 5ELVA 3SEXA 3HHFA 1PBQA 1II5A 3E4RA 2PMSA 5ICQA 4NEDA 4NF5A 3K6VA 3C31A 5I56A 1ZMGA 1FW0A 3PUXE 1P1OA 1EZOA 4JSOA 1MQDA 3PUYE 1Z7ME 4QRZA 4G68B 3S4UA 1N7XA 1MPBA 4RJZA 4F1VA 2H5YA
chains in the Genus database with same CATH superfamily
2FIEA 3G3JA 1QUKA 4JVCA 1VFDA 4U2RA 2H4IA 1PBPA 1FBPA 1FPKA 1GVCA 2B4MA 3A3UA 2XXUA 2GHAA 2Q74A 5AA2D 4MNCA 2XXWA 4F2OA 1IQ7A 4NG7A 3U94A 2DYXA 4R6YA 4GX4A 3KOTA 2VT5A 1IMCA 4DLDA 2YPNA 4OHNA 4HTGA 1SW5A 3PV0E 1LFGA 1VSOA 4NF6A 3T93B 2XXRA 4G4PA 1G0HA 3F11A 4NN3A 2DWIA 1DSNA 1S7YA 3C36A 1JEUA 1AOVA 4ECFA 3B7DA 4PBQA 2V84A 2A5SA 4AQ4A 3MW0A 4HS7A 2O84X 3T9HB 1PC3A 3T66A 1VDWA 4F3SA 4OTEA 1I6BA 2Q2CA 5IAIA 1B1XA 3D4CA 2D21A 4N6PA 1B7UA 3A3CA 4TQUQ 4XEQA 3BIHA 3R7XA 3SEYA 3H6VA 2XWVA 3IFAA 1QULA 5EQ9A 5I59A 4PP0A 4RPNA 1MPDA 4ONYA 3BBRA 5KCJB 5I3SA 4IY5A 2NUVA 1PB7A 4LUBA 3PPOA 1MQGA 3Q26A 5I57A 3C33A 3OXNA 4MBPA 3TKDA 1L5TA 4IY6A 2Y84A 3SETA 4H65A 4MNIA 3TDJA 1MXUA 5EQ8A 5FHNA 2FBPA 1N7WA 2PT2A 1FJ6A 2MKZA 4ZE9A 2I0CA 4ZDMA 3H06B 1QVSA 3D1RA 4HE2A 1FQDA 5FTHA 3TYHA 3K1PA 3CSBA 3OSQA 1M5BA 3UN6A 1DTZA 3Q29A 1ZKBA 1B6HA 4MCOA 1O63A 3IB0A 5FHMA 2AYSA 2R71A 1LAHE 4QSCA 4LQ2A 3KG2A 3Q27A 4P3LA 1MXYA 1POY1 1DBZA 2ZZVA 5IKBA 1NNFA 1J1NA 2F34A 1OQGA 2QSXA 3WAEA 3OMBA 2O51A 1P1UA 3DM0A 4BDLA 3L6HA 4I3EA 4JWOA 4YMAA 3V83A 3P7IA 4HE1A 1LCTA 1IXHA 3T0JA 1IUDA 2FA7A 1D9YA 4F1YA 3JZJA 3TTMA 4HXVA 4MAGA 2P0SA 4G68C 4GBWA 1QGXA 4LA9A 2DWAA 4KQPA 2B4LA 2B3FA 5IZZA 3CFXA 3PD9A 2REJA 1NH7A 4JXIA 3OO7A 5DW8A 3EF7A 1XHYA 2CZIA 1EYKA 1XOCA 2HEUA 1DK4A 3E13X 2XXHA 5CMMA 5H8FB 4U4SA 1N0TA 4MEVA 4RXLA 4R75A 1WODA 2AIXA 1QKAA 3KN8A 2WBBA 1EZ9A 1B5HA 4QSDA 1IXIA 4JB7A 4R9GA 2DWHA 3QYTA 3G3IA 1DCUA 3HHGA 1D9QA 4P56A 3N5LA 1B3GA 3QUFA 3TTLA 1LCFA 1N04A 3VXCA 1FTOA 3Q25A 4IGRA 3IO6A 3LSFB 3S9EA 2I4BA 5I2KA 1MXWA 3M3LA 3IOUA 1R1NA 5FHOA 3PPNA 4GD5A 2DS9A 2Q2AA 4I3YA 4YMBA 3FV2A 3EKIA 5F1QA 2QPQA 2ZYKA 4P0GA 4GRKA 2OZZA 2DE2A 1RDXA 1NV7A 4H8IA 4M4GA 4ZECA 3TAJA 1FQFA 4KFQA 3G3KA 2V3QA 2R6GE 4OYVA 3LUYA 4OQOA 1POTA 2Y7IA 1A54A 4PC9A 1KA1A 2Q89A 1UTBB 1FJ9A 4LATA 3EQ1A 5DEXA 3G3HA 4DZ1A 1Y1ZA 1LAXA 1VR5A 2ESNA 3EPEA 3IK6B 4KCDA 1NNPA 2GH9A 4OFOA 4MF3A 5CBSA 2I48A 2CMOA 3HO7A 5H8QA 3U92A 1Z7NE 4H5GA 1B4ZA 5TP9A 4MHFA 2HAVA 3A09A 1FBCA 3KC1A 2OWZA 4LZ5A 3PGFA 1LSTA 2DVZA 3R6UA 4ZS9A 5TPAA 4O3CA 1XI6A 1M5EA 1B7ZA 4OVSA 4O94A 2NVUB 1XS5A 3B6QA 3RGYA 1MXXA 5ITPA 3VFJA 4NWCA 2XXKA 2B65A 3MAMA 1IMEA 3K0VA 1TT1A 3O2AA 2A5TB 3USDA 1URSA 1MXVA 1AMFA 1B3LA 1Q35A 2I58A 4Q30B 1MH4A 4OERA 4O7MA 4XIGQ 4GX3A 4G8NA 2Z8DA 2CEXA 3CFZA 1KA0A 3V5AA 3DP6A 2XXIA 4DXBA 5H8HA 4YAHX 1SVXB 1A55A 3TTNA 1BP5A 4NF8B 1K9YA 1MY2A 1FPDA 3DP8A 4ZEBA 2F7AA 1IEJA 1RYOA 5I5PA 3FIRA 3H6TA 2PCRA 3FXRA 1JP4A 3T96B 3FUZA 1G0IA 4DXCA 1QUJA 1T0KA 1FTLA 3HV1A 5ITOA 2WBDA 3N6TA 3PPRA 2RC9A 4N13A 3THIA 5AA2A 1XVXA 1IXCA 4FJPA 4F3PA 3IR1A 3E78A 1MY1A 3IJOB 1NUYA 1USYE 2XX9A 3VLVA 4GWUA 4YKIA 4F1UA 4GIZA 1ZIUA 4NMYA 1P1NA 4R72A 5AA4B 4PFUA 3MP6A 2D3IA 2DSFA 3TCFA 4EF1A 5L8DA 5DT6A 1FSAA 1DOTA 3MPKA 2FVZA 1YZ0A 3KN7A 1XVYA 2I3VA 4U1OA 3QIMA 3VLWA 2DOJA 1B0LA 2V93A 4IGTA 3O97A 2X26A 2F7BA 3MP8A 1NV2A 2QRYA 2ZYOA 4H67A 1A7LA 1SPIA 3IOWA 2NWJA 3ISPA 3MVYA 4FECA 4HW8A 2HZLA 1D3KA 4JSDA 1UTHA 2QS4A 1Q1KA 5A5XA 5CC2A 5EQ7A 4MX6A 1NKXA 4LZ7A 5AA1A 4GBVA 4U1ZA 5CM6A 4PGPA 4MH5A 3W9WA 2HCAA 1LB9A 1TFDA 2THIA 2VP1A 3K6XA 1NUXA 4C1TA 4RPOA 1LAGE 5ET7A 4F22A 3TEPA 4O8MA 1ZLQA 4IO4A 1BKAA 4GWYA 3FXQA 3TUSA 1YYZA 4NF8A 3FVNA 1GGGA 3R26A 3ILTB 2H98A 3MZ9A 5IZ3B 1JW1A 3UIFA 4N07A 2RCBA 3ZSFA 3IX1A 4O3AA 4LVQA 1B32A 5ISUA 2V4CA 1YTVA 4P1LA 3FD3A 3OELA 3KBRA 2G29A 1MS7A 2PX1A 5K2YA 3M8UA 2ZXTA 1LBVA 1BK4A 4YKKA 4PAIA 4AB6A 4UACA 1NMUA 4YKPA 4H46A 3O6IA 3QXMA 2OJTA 2F78A 1UIUA 2D5WA 1Y3NA 3CG1A 3S9NC 1AL3A 3IB2A 4NTLA 3MBPA 4G77A 4ZEFA 4QBAA 3ZS6A 4R6HA 4TOZA 5ET8A 3PTYA 3U1OA 2F35A 1WDNA 3LUZA 4P47A 5EQAA 4RNSA 5IM2A 4BDMA 4NAPA 1SW2A 4ZEIA 1B0HA 3RN8A 4QXDA 1B7HA 1PDAA 2P3VA 1LLSA 4N6DA 4FBPA 2REGA 4DE8A 3GLBA 2LAOA 1CNQA 3CVGA 1YPNA 2M8CA 1I6AA 3MVXA 4XTCQ 4TLLB 3RPLB 4GXAA 2KQZA 1DMBA 2O68A 1DTGA 2XWIA 4GWOA 4F19A 3KZGA 1OVTA 3G3GA 4QFNA 4GWSA 3LV0A 4I1DA 3PUVE 2ABHA 1AH5A 3A29A 2Y7KA 4YB6A 1WVJA 4GVOA 1B5IA 4RK2A 2DWJA 1B3EA 1NNKA 4G68A 3PU5A 4GQOA 3FVOA 2BJIA 3O66A 1O7TA 4BDRA 4BDNA 1FPJA 3TZAA 5KZTA 1LFIA 2PYYA 4Q0CA 2ZZWA 2NOOA 1ZBMA 1FPBA 4FAJA 3HPIA 1P99A 1MRPA 2QMWA 4IO7A 4ZZAA 3OSRA 5H8NB 3MZBA 3HFUA 2P3NA 3H7MA 4E0XA 4OVPA 4KYEA 3FVKA 1RDZA 1INPA 3C32A 3OO6A 3KBZA 4R74A 3B50A 3I6VA 4F18A 1XC1A 3CI8A 4IR8A 3UK4A 4GOTA 3W15C 3CSGA 2ANJA 4H6DA 2XX7A 2KLFA 4FATA 2Y7RA 1AIVA 4RY1A 1MDQA 3S9MC 2I4CA 2QFLA 4NHBA 3HN0A 5IZ1A 5I7IA 2F8DA 5I2NB 4GWXA 3E3KA 1HSJA 4Q5TA 3SZPA 5F24A 3M3FA 4E0WA 1NL5A 1N84A 3JYRA 4MFIA 4POXA 2JJKA 5M2VA 3M3KA 4EF2A 1JW4A 1ANFA 1FTJA 1JQFA 1TFAA 4ELOA 2UYEA 2Z22A 5KDTB 1B9JA 1BTJA 1JVXA 1K9ZA 5KCJA 1MQJA 1USYH 4ZE8A 2WEFA 3AXFA 2Q9TA 2I6EA 4KPTA 4N4UA 2NXOA 2OK2A 3MSTA 3MPLA 2DE4A 2E0SA 3O29A 1US4A 2E1SA 2I0BA 3S9LC 5FTIA 3SEVA 3T22A 5F7VA 1B51A 1EZPA 2UVIA 2IA4A 3SKPA 5JK4A 2ZZXA 4OENA 1FBFA 3H6WA 3PMWA 4G2ZA 1UIVA 4GX6A 1SI0A 4RK9A 1KWHA 4LP2B 4OEUA 1B58A 4MNPA 1NV5A 3C9HA 3DELB 3ZKKA 2XXQA 1SD3A 1FQEA 2HZKA 4PBHA 3IFCA 1QUIA 3E9XA 3FJGA 3FJMA 3LSXA 2QS3A 1UQWA 2P1SA 3FBPA 2FYIA 3LR1A 4N81A 4OETA 3LBSA 5DYHA 3OEKA 2VD3A 3UP9A 1TXFA 2OLBA 1FQAA 3E79A 1SBPA 4RYAA 4ZZEA 5CI5A 4PE3A 3K00A 1Y4TA 3PMVA 4U4XA 4Z0IA 4N91A 1P1QA 4QFLA 4HCYA 1M5CA 3KFMA 4PE5B 1FPFA 4H45A 4YICA 5I2NA 3OD7A 4R2FA 3JV9A 1LBZA 3RT6B 3SEUA 1MY0A 3LSWA 1MM7A 2XD3A 4ZEKA 2UVHA 3MC2A 1NV4A 3IL1B 2UVGA 4OESA 1XT8A 3OENA 4PDDA 2XA5A 2XWKA 4ND9A 4POWA 3CR9A 4MLVA 1EH3A 3T9VA 1LBBA 3TTRA 2ALUA 3BFTA 5HBCA 4PF8A 3O9PA 4NWDA 3RT8A 3GZGA 1H76A 2L5VA 3K02A 5L9OA 1OLAA 1ZU0A 5BWJA 3VVEA 3IO4A 2UYFA 2G93A 1URGA 5H8FA 4X8RA 5I58B 4N8YA 1NNTA 4QFOA 2PBWA 1EYIA 2OBGA 2Z8EA 2R8TA 2HHMA 3ECRA 4Z7EA 1SQYA 4I9DA 3S2VA 2V3TA 4JVIA 2GFEA 1ZTYA 1HSEA 5HPQA 3TCHA 2O69A 3N26A 5A5LA 3WAFA 2VPOA 4NF4B 1H45A 3EN3A 3O6GA 4FE8A 4IO3A 2F6PA 4X04A 3T9UA 3PUWE 3U8QA 1IMFA 4P11A 1MY4A 3LC8A 1LFHA 4U23A 5K2XA 2B3BA 2H99A 1LBCA 2YLNA 4PFYA 2QS2A 4IO2A 2WKYA 4JWXA 4MMPA 1JETA 1SI1A 2F36A 4YU0A 1SYIA 4NF5B 5BUUA 5I56B 5J1DA 3PMXA 4QF9A 1JVYA 3V8XB 3U72A 2XXVA 2GRVA 5ICTA 2W7YA 4C0RA 2XHDA 2RCAA 3H4ZA 4DI4B 4P8BA 1SW4A 2HPGA 2ZNSA 3U65A 4R9FA 1UTBA 3FXUA 4GL8A 1OVBA 4UABA 4THIA 4OVRA 4X9TA 4R2BA 3N6UA 3OEMA 2P2AA 5AE4A 1MXZA 3MVZA 4I8CA 2F6GA 1AWBA 3RPWA 3VDFA 2ZYMA 1LBYA 4FIMA 2RC7A 4OWDA 5DVIA 3IOTA 4XKQA 2FHYA 4OFLA 2HXWA 1FPIA 3B6TA 2F3DA 1NUWA 4OXVA 5H8SA 1H3DA 1US5A 2AL4A 2CZKA 1GV8A 1MPCA 4U22A 2GHBA 1FBEA 4IO6A 3LSLA 4KD5A 1BIYA 1CE2A 2H25A 1PB9A 1Y1MA 3VE1B 2A5TA 2RF1A 3FGSA 1OMPA 4QFPA 4NF0A 3K4UA 5CRYA 3G7WA 5I59B 2GQ1A 3TPAA 4KYSA 1ATGA 5HM4B 2WYPA 2O1LA 4ELPA 3GXAA 1R6ZA 1Y3PA 4EQ7A 3KSJA 5I57B 4KXPA 4QFKA 1B3FA 5CBRA 3MWBA 3VVFA 4XKRA 3B6WA 3IAZA 4BDQA 4Q8RA 1IMAA 3KN3A 3RUMA 3CG3A 5I84A 2PT1A 3H3GA 5CMKA 3EHSA 1M5FA 3MQ9A 1FTAA 4F2QA 3CFLA 3D4GA 2ZNTA 3FVGA 1A8EA 4ESXA 2YJPA 4EQ9A 2H9BA 3TQLA 2O7UA 3SDFA 4I62A 3FXBA 5AA4A 3KOSA 4O7IA 1VFEA 1GR2A 1R9QA 4JDFA 3RLFE 1MM6A 2VHAA 1TWYA 3QK6A 3IOVA 2Z23A 2F3BA 2RINA 2CZHA 2IEEA 3KSXA 4O3BA 2Q8JA 1NV1A 4IO5A 1MDP1 1SDXA 1LBXA 3MYUA 4FORA 4EXLA 2Y5KA 4PETA 4OZ9A 3FZVA 4XFEA 2VD2A 3DP4A 2DDKA 2XD2A 4LONB 4PTKA 3FASA 5CMBA 1EU8A 2AL5A 3VXBA 2BJJX 2F5XA 2OWTA 2QJEA 2KR0A 4OVJA 1FCKA 4FEDA 4GWWA 4GFRA 1SYHA 4QSEA 2QS1A 4JWYA 3K1NA 4TLMB 4I40A 4R73A 4QHQA 5ET6A 3W9VA 4HE0A 3RY3A 1FPLA 3K01A 5TU0A 1RKMA 5DVFA 2XXTA 4X48A 1IMDA 3GYYA 5IZ3A 4WKMA 4WXJA 1FTKA 4YZZA 4AB5A 1JW5A 4G61A 1EYJA 3ZKLA 1MG1A 4H8JA 4GL0A 1URDA 2PFYA 2DQVA 1HSLA 4MIJA 1FBDA 3BFUA 1DPEA 4LN5A 5B70A 5I2KB 2RC8A 1BLFA 1OLCA 4H0WA 2OCUA 1RDYA 2O6AA 1PEBA 2V3UA 3KGCA 3FV1A 4KR5A 2RKMA 4MJOA 1FTMA 2FNCA 1IXGA 1LAFE 1H44A 4EXKA 4X1BA 5AA3A 1NV0A 3TCGA 2FIXA 4N17A 5T3JA 3ROJA 3OO8A 3UA8A 5DVJA 3U93A 4NE4A 1D9VA 3IORA 2PFZA 2X7PA 4PF6A 1PB8A 2QVVA 1ZJLA 3ILUB 1YXIA 3O28A 1N3XA 1I69A 1GTKA 1ELJA 4P9KA 3RYDA 1B5JA 4GWZA 5ET5A 3PPPA 2I49A 1FBHA 1P1WA 4F39A 5EYFA 3K6WA 2QMXA 5JEIA 4XKNA 3MP1A 3RNNA 4F3BA 3EHTA 2UVJA 1B1HA 1S50A 1B40A 3KJ7A 3CRBA 5DEXB 3GBAA 3RPLA 1QJMA 4YB5A 4N15A 1Y9UA 4H5FA 2OWSA 2Y7WA 4DIGA 3QSLA 4IB2A 4JBZA 3H6UA 4PFBA 4WEDA 3DLNA 1N3WA 3Q28A 5LDZA 5LOMA 3T9XB 4G8MA 2ZYNA 2F97A 4DCYA 3KC0A 3FATA 5J16A 3MVWA 2XX8A 5H8QB 4ZEDA 5FBPA 5EYGA 3UGWA 5TP9B 1OIBA 1MQHA 3BIGA 4N6KA 2O7IA 3GBBA 4KI0E 4EQBA 3ODBA 5TPAB 1Y3QA 4EDPA 4ELRA 5H8NA 3KJTA 1I6QA 1MQIA 4YB7A 1DPPA 3T1BA 4OVQA 2XXPA 3CIJA 3K1MA 3FJ7A 3HCQA 5L9SA 2HFBA 4PAFA 4P0IA 4WEPA 4PDHA 2QVUA 3C4MA 4XXUA 5JTYB 1B2HA 5B7DA 1YAEA 4PGNA 5DTBA 4GLIA 3B8BA 2WYKA 3I3VA 5LTCA 2DP8A 4OVTA 4NX1A 4DCXA 5H8HB 3MUQA 4LZ8A 4ISUA 4G8HA 4XKPA 3PPQA 5L9MA 1MY3A 3IB1A 1FPEA 2X7QA 1MH3A 1NI9A 1H43A 4GXSB 5AA2B 3V89B 1OQHA 2R9JA 1QW0A 3QAXA 5KDTA 1NV3A 1M5DA 1N76A 3N94A 3QMFA 4NGUA 4PQJA 1JEVA 2QL3A 2ONRA 5CMCA 1LBWA 2ZNUA 1YCJA 4MLQA 1F9BA 1B52A 4NQ8A 4XF5A 2F7CA 3L6GA 1Y4CA 4GF8A 4HCWA 3RTWB 3PUZE 5EHSA 3QUJA 3UORA 2DXYA 3BKIB 4R6KA 4DI3D 1VE4A 1IIWA 5EYHA 2O1MA 2DXRA 2UXAA 3I5OA 2HAUA 2HXRA 3VVDA 4F31B 4OA4A 3TFLA 1LGBC 1O64A 4ESWA 4OMBA 1NH8A 4JVDA 4OFJA 4RA1A 3MJNA 3C34A 2CEYA 4F29A 4ELQA 3PD8A 3EHUA 1UTHB 4AS5A 4FEBA 5A5XB 3ONMA 4C1UA 5JTYA 3TTKA 1R9LA 4UA8A 3TODA 1A8FA 1RYXA 2VOZA 4LQ5A 2Q8MA 2PVUA 1NUZA 2Y7PA 3MZ1A 4M1VA 4K3FA 1A99A 4H1XA 2CZLA 4U21A 5EHMA 1FRPA 3SESA 2XXYA 2I3WA 4X1DA 4DXUA 3OO9A 4BLAA 3C35A 3HSTA 1A40A 1FQBA 2ZMBA 3TELA 3RTFB 1CB6A 3NOHA 2Y5LA 3OOAA 1IITA 1LB8A 1QKBA 4PFTA 3H03A 2ONKE 4PFRA 4F3GA 3CHGA 4OEVA 2HQ0A 2VPNA 3TQWA 4EUOA 1KZ8A 3VLUA 1B4HA 4PFWA 2WX9A 1D4NA 1SW1A 3K6UA 1B05A 1LEVA 4NF6B 3SERA 1FPGA 4KCCA 2XXXA 3KEIA 2Z8FA 4PCDA 1Q9DA 5I58A 3TMGA 4BDOA 3IJXB 1Y20A 3SEWA 3O6HA 2OX3A 3VV5A 1IMBA 3K2DA 1FBGA 1B46A 2VGQA 3RQTA 4PFIA 1NFTA 2V25A 5IGAA 4DDDA 2QVRA 4YKJA 2DE3A 4L17A 4NF4A 3G3FA 1B3HA 1IZ1A 2XWOA 1FQCA 1JNFA 2DVCA 4P1EA 4KHZE 2Q88A 4KYDA 4N8GA 1S9TA 4PAKA 2ONSA 5ELVA 3SEXA 4AS4A 3HHFA 1PBQA 1II5A 3E4RA 5ESYA 2PMSA 5ICQA 4OANA 4NEDA 4NF5A 3K6VA 3C31A 5I56A 1ZMGA 1FW0A 3PUXE 1P1OA 1NV6A 4JSOA 1EZOA 1MQDA 3PUYE 1Z7ME 4QRZA 4G68B 3S4UA 1N7XA 1MPBA 4RJZA 4F1VA 2H5YA
chains in the Genus database with same CATH topology
3G3JA 1QUKA 1VFDA 4U2RA 2H4IA 1PBPA 1GVCA 3A3UA 2XXUA 2GHAA 5AA2D 2XXWA 4F2OA 1IQ7A 3U94A 2DYXA 4R6YA 3KOTA 4DLDA 2YPNA 4OHNA 4HTGA 1SW5A 3PV0E 1LFGA 1VSOA 4NF6A 3T93B 2XXRA 4G4PA 3F11A 2DWIA 1DSNA 1S7YA 3C36A 1JEUA 1AOVA 4ECFA 3B7DA 2V84A 2A5SA 4AQ4A 3MW0A 4HS7A 2O84X 3T9HB 1PC3A 3T66A 4F3SA 4OTEA 1I6BA 2Q2CA 5IAIA 1B1XA 3D4CA 2D21A 4N6PA 1B7UA 3A3CA 4TQUQ 3R7XA 3SEYA 3H6VA 1QULA 5I59A 4PP0A 4RPNA 1MPDA 4ONYA 3BBRA 5KCJB 4IY5A 2NUVA 1PB7A 4LUBA 3PPOA 1MQGA 3Q26A 5I57A 3C33A 3OXNA 4MBPA 3TKDA 1L5TA 4IY6A 2Y84A 3SETA 4H65A 3TDJA 1MXUA 5FHNA 1N7WA 2PT2A 4ZE9A 2I0CA 4ZDMA 3H06B 1QVSA 1FQDA 5FTHA 3TYHA 3K1PA 3CSBA 3OSQA 1M5BA 3UN6A 1DTZA 3Q29A 1ZKBA 1B6HA 1O63A 3IB0A 5FHMA 2AYSA 2R71A 1LAHE 4QSCA 4LQ2A 3KG2A 3Q27A 1MXYA 1POY1 5IKBA 1NNFA 1J1NA 2F34A 1OQGA 2QSXA 3WAEA 3OMBA 2O51A 1P1UA 3DM0A 4BDLA 3L6HA 4JWOA 4YMAA 3V83A 3P7IA 1LCTA 1IXHA 1IUDA 2FA7A 1D9YA 4F1YA 3JZJA 3TTMA 2P0SA 4G68C 4LA9A 2DWAA 4KQPA 2B3FA 3CFXA 3PD9A 2REJA 1NH7A 4JXIA 3OO7A 3EF7A 1XHYA 1XOCA 2HEUA 3E13X 2XXHA 5CMMA 5H8FB 4U4SA 1N0TA 4RXLA 4R75A 1WODA 2AIXA 1QKAA 3KN8A 1EZ9A 1B5HA 1IXIA 4QSDA 4JB7A 4R9GA 2DWHA 3QYTA 3G3IA 3HHGA 3N5LA 1B3GA 3QUFA 3TTLA 1LCFA 1N04A 3VXCA 1FTOA 3Q25A 4IGRA 3IO6A 3LSFB 3S9EA 2I4BA 5I2KA 1MXWA 3M3LA 3IOUA 1R1NA 5FHOA 3PPNA 4GD5A 2DS9A 2Q2AA 4YMBA 3FV2A 5F1QA 2QPQA 2ZYKA 4P0GA 4GRKA 2OZZA 2DE2A 4H8IA 4M4GA 4ZECA 3TAJA 1FQFA 4KFQA 3G3KA 2V3QA 2R6GE 4OYVA 3LUYA 4OQOA 1POTA 2Y7IA 1A54A 2Q89A 1UTBB 4LATA 3EQ1A 5DEXA 3G3HA 4DZ1A 1Y1ZA 1LAXA 1VR5A 2ESNA 3EPEA 3IK6B 4KCDA 1NNPA 2GH9A 4OFOA 4MF3A 5CBSA 2I48A 2CMOA 3HO7A 5H8QA 3U92A 1Z7NE 4H5GA 1B4ZA 5TP9A 2HAVA 3A09A 4LZ5A 3PGFA 1LSTA 2DVZA 3R6UA 4ZS9A 5TPAA 4O3CA 1M5EA 1B7ZA 2NVUB 1XS5A 3B6QA 3RGYA 1MXXA 5ITPA 3VFJA 4NWCA 2B65A 3MAMA 3K0VA 1TT1A 3USDA 3O2AA 2A5TB 1URSA 1MXVA 1AMFA 1B3LA 1Q35A 2I58A 4Q30B 1MH4A 4OERA 4XIGQ 4G8NA 2Z8DA 3CFZA 3V5AA 3DP6A 2XXIA 4DXBA 5H8HA 4YAHX 1SVXB 1A55A 3TTNA 1BP5A 4NF8B 1MY2A 3DP8A 4ZEBA 2F7AA 1IEJA 1RYOA 3FIRA 3H6TA 3FXRA 3T96B 3FUZA 4DXCA 1QUJA 1T0KA 1FTLA 3HV1A 5ITOA 3N6TA 3PPRA 2RC9A 4N13A 3THIA 5AA2A 1XVXA 1IXCA 4FJPA 4F3PA 3IR1A 1MY1A 3IJOB 1USYE 2XX9A 3VLVA 4YKIA 4F1UA 4GIZA 1ZIUA 4NMYA 1P1NA 4R72A 5AA4B 4PFUA 3MP6A 2D3IA 2DSFA 3TCFA 4EF1A 5L8DA 5DT6A 1DOTA 3MPKA 3KN7A 1XVYA 2I3VA 4U1OA 3QIMA 3VLWA 2DOJA 1B0LA 2V93A 4IGTA 3O97A 2X26A 2F7BA 3MP8A 2QRYA 2ZYOA 4H67A 1A7LA 3IOWA 2NWJA 3MVYA 4FECA 4HW8A 2HZLA 1D3KA 4JSDA 1UTHA 2QS4A 1Q1KA 5A5XA 5CC2A 1NKXA 4LZ7A 5AA1A 4U1ZA 5CM6A 4MH5A 3W9WA 2HCAA 1LB9A 1TFDA 2THIA 2VP1A 3K6XA 4C1TA 4RPOA 1LAGE 4F22A 3TEPA 1ZLQA 4IO4A 1BKAA 3FXQA 3TUSA 4NF8A 3FVNA 1GGGA 3R26A 3ILTB 2H98A 3MZ9A 1JW1A 3UIFA 4N07A 2RCBA 3ZSFA 3IX1A 4O3AA 4LVQA 1B32A 5ISUA 1YTVA 3FD3A 3OELA 3KBRA 2G29A 1MS7A 2PX1A 5K2YA 3M8UA 2ZXTA 4YKKA 4AB6A 4UACA 1NMUA 4YKPA 3O6IA 3QXMA 2OJTA 2F78A 1UIUA 2D5WA 1Y3NA 3CG1A 3S9NC 1AL3A 3IB2A 4NTLA 3MBPA 4G77A 4ZEFA 3ZS6A 4R6HA 4TOZA 3U1OA 2F35A 1WDNA 4RNSA 4BDMA 1SW2A 4ZEIA 1B0HA 3RN8A 1B7HA 1PDAA 1LLSA 2REGA 4DE8A 3GLBA 2LAOA 3CVGA 1YPNA 2M8CA 1I6AA 3MVXA 4XTCQ 4TLLB 4GXAA 1DMBA 2O68A 1DTGA 4GWOA 4F19A 3KZGA 1OVTA 3G3GA 4QFNA 4I1DA 3PUVE 2ABHA 1AH5A 2Y7KA 4YB6A 1WVJA 4GVOA 1B5IA 4RK2A 2DWJA 1B3EA 1NNKA 4G68A 3PU5A 4GQOA 3FVOA 3O66A 1O7TA 4BDRA 4BDNA 3TZAA 5KZTA 1LFIA 2PYYA 4Q0CA 2NOOA 1ZBMA 4FAJA 3HPIA 1P99A 1MRPA 2QMWA 4IO7A 4ZZAA 3OSRA 5H8NB 3MZBA 3H7MA 4E0XA 4KYEA 3FVKA 3C32A 3OO6A 4R74A 3I6VA 4F18A 1XC1A 3CI8A 3UK4A 4GOTA 3W15C 3CSGA 2ANJA 4H6DA 2XX7A 2KLFA 4FATA 2Y7RA 1AIVA 4RY1A 1MDQA 3S9MC 2I4CA 3HN0A 2F8DA 5I2NB 3E3KA 1HSJA 4Q5TA 3M3FA 4E0WA 1NL5A 1N84A 3JYRA 4MFIA 4POXA 5M2VA 3M3KA 4EF2A 1JW4A 1ANFA 1FTJA 1JQFA 1TFAA 4ELOA 2UYEA 2Z22A 5KDTB 1B9JA 1BTJA 1JVXA 5KCJA 1MQJA 1USYH 4ZE8A 3AXFA 2Q9TA 2I6EA 4KPTA 2NXOA 2OK2A 3MPLA 2DE4A 2E0SA 3O29A 1US4A 2E1SA 2I0BA 3S9LC 5FTIA 3SEVA 3T22A 5F7VA 1B51A 1EZPA 2UVIA 2IA4A 3SKPA 5JK4A 4OENA 3H6WA 3PMWA 4G2ZA 1UIVA 1SI0A 4RK9A 1KWHA 4LP2B 1B58A 4OEUA 3C9HA 3DELB 3ZKKA 2XXQA 1SD3A 1FQEA 2HZKA 1QUIA 3E9XA 3FJGA 3FJMA 3LSXA 2QS3A 1UQWA 2P1SA 2FYIA 3LR1A 4OETA 3LBSA 5DYHA 3OEKA 2VD3A 3UP9A 1TXFA 2OLBA 1FQAA 1SBPA 4RYAA 4ZZEA 5CI5A 3K00A 1Y4TA 3PMVA 4U4XA 4Z0IA 4QFLA 1P1QA 4HCYA 1M5CA 3KFMA 4PE5B 4YICA 5I2NA 3OD7A 4R2FA 3JV9A 3RT6B 3SEUA 1MY0A 3LSWA 1MM7A 2XD3A 4ZEKA 2UVHA 3MC2A 3IL1B 2UVGA 4OESA 1XT8A 3OENA 4ND9A 4POWA 3CR9A 4MLVA 1EH3A 3T9VA 1LBBA 3TTRA 2ALUA 3BFTA 5HBCA 3O9PA 4NWDA 3RT8A 3GZGA 1H76A 3K02A 5L9OA 1OLAA 1ZU0A 5BWJA 3VVEA 3IO4A 2UYFA 2G93A 1URGA 5H8FA 5I58B 1NNTA 4QFOA 2PBWA 2OBGA 2Z8EA 3ECRA 4Z7EA 1SQYA 4I9DA 3S2VA 2V3TA 2GFEA 1ZTYA 1HSEA 5HPQA 3TCHA 2O69A 3N26A 3WAFA 4NF4B 1H45A 3EN3A 3O6GA 4FE8A 4IO3A 2F6PA 3T9UA 3PUWE 3U8QA 4P11A 1MY4A 3LC8A 1LFHA 4U23A 5K2XA 2B3BA 2H99A 1LBCA 2YLNA 4PFYA 2QS2A 4IO2A 2WKYA 4JWXA 1JETA 1SI1A 2F36A 4YU0A 1SYIA 4NF5B 5BUUA 5I56B 5J1DA 3PMXA 4QF9A 1JVYA 3V8XB 3U72A 2XXVA 2GRVA 5ICTA 2W7YA 4C0RA 2XHDA 2RCAA 3H4ZA 1SW4A 2ZNSA 4R9FA 1UTBA 3FXUA 4GL8A 1OVBA 4THIA 4X9TA 4R2BA 3N6UA 3OEMA 2P2AA 5AE4A 1MXZA 3MVZA 4I8CA 2F6GA 3RPWA 3VDFA 2ZYMA 4FIMA 2RC7A 4OWDA 5DVIA 3IOTA 4XKQA 4OFLA 2HXWA 3B6TA 4OXVA 5H8SA 1H3DA 1US5A 2AL4A 1GV8A 1MPCA 4U22A 2GHBA 4IO6A 3LSLA 4KD5A 1BIYA 1CE2A 2H25A 1PB9A 1Y1MA 3VE1B 2A5TA 2RF1A 3FGSA 1OMPA 4QFPA 3K4UA 5CRYA 3G7WA 5I59B 3TPAA 4KYSA 1ATGA 5HM4B 2O1LA 4ELPA 3GXAA 1R6ZA 1Y3PA 4EQ7A 3KSJA 5I57B 4QFKA 1B3FA 5CBRA 3MWBA 3VVFA 4XKRA 3B6WA 3IAZA 4BDQA 4Q8RA 3KN3A 3RUMA 3CG3A 5I84A 2PT1A 3H3GA 5CMKA 3EHSA 1M5FA 3MQ9A 4F2QA 3CFLA 3D4GA 2ZNTA 3FVGA 1A8EA 4ESXA 2YJPA 4EQ9A 2H9BA 3TQLA 2O7UA 3SDFA 4I62A 5AA4A 3KOSA 1VFEA 1GR2A 1R9QA 4JDFA 3RLFE 1MM6A 2VHAA 1TWYA 3QK6A 3IOVA 2Z23A 2RINA 2IEEA 3KSXA 4O3BA 2Q8JA 4IO5A 1MDP1 1SDXA 4FORA 4EXLA 4PETA 4OZ9A 3FZVA 2VD2A 3DP4A 2XD2A 4LONB 3FASA 5CMBA 1EU8A 2AL5A 3VXBA 2BJJX 2F5XA 2OWTA 2QJEA 4OVJA 1FCKA 4FEDA 4GFRA 1SYHA 4QSEA 2QS1A 4JWYA 3K1NA 4TLMB 4R73A 4QHQA 3W9VA 3RY3A 3K01A 5TU0A 1RKMA 5DVFA 2XXTA 4X48A 4WKMA 4WXJA 1FTKA 4YZZA 4AB5A 1JW5A 3ZKLA 1MG1A 4H8JA 4GL0A 1URDA 2DQVA 1HSLA 3BFUA 1DPEA 5B70A 5I2KB 2RC8A 1BLFA 1OLCA 4H0WA 2OCUA 2O6AA 1PEBA 2V3UA 3KGCA 3FV1A 4KR5A 2RKMA 1FTMA 2FNCA 1IXGA 1LAFE 1H44A 4EXKA 4X1BA 5AA3A 3TCGA 3OO8A 3UA8A 5DVJA 3U93A 4NE4A 1D9VA 3IORA 2X7PA 1PB8A 1ZJLA 3ILUB 3O28A 1N3XA 1I69A 1GTKA 1ELJA 1B5JA 3PPPA 2I49A 1P1WA 4F39A 5EYFA 3K6WA 2QMXA 5JEIA 4XKNA 3MP1A 3RNNA 4F3BA 3EHTA 2UVJA 1B1HA 1S50A 1B40A 3KJ7A 3CRBA 5DEXB 3GBAA 1QJMA 4YB5A 1Y9UA 4H5FA 2OWSA 2Y7WA 4DIGA 3QSLA 4IB2A 4JBZA 3H6UA 4WEDA 3DLNA 1N3WA 3Q28A 5LOMA 3T9XB 4G8MA 2ZYNA 2F97A 4DCYA 3FATA 3MVWA 2XX8A 5H8QB 4ZEDA 3UGWA 5TP9B 1OIBA 1MQHA 2O7IA 3GBBA 4KI0E 4EQBA 3ODBA 5TPAB 1Y3QA 4EDPA 4ELRA 5H8NA 3KJTA 1I6QA 1MQIA 4YB7A 1DPPA 2XXPA 3CIJA 3K1MA 3FJ7A 3HCQA 5L9SA 2HFBA 4P0IA 4WEPA 3C4MA 4XXUA 5JTYB 1B2HA 5B7DA 1YAEA 5DTBA 4GLIA 3I3VA 2DP8A 4DCXA 5H8HB 3MUQA 4LZ8A 4ISUA 4G8HA 4XKPA 3PPQA 5L9MA 1MY3A 3IB1A 2X7QA 1MH3A 1H43A 4GXSB 5AA2B 3V89B 1OQHA 2R9JA 1QW0A 3QAXA 5KDTA 1M5DA 1N76A 3N94A 4PQJA 1JEVA 2QL3A 2ONRA 5CMCA 2ZNUA 1YCJA 4MLQA 1F9BA 1B52A 2F7CA 3L6GA 1Y4CA 4GF8A 4HCWA 3RTWB 3PUZE 5EHSA 3QUJA 3UORA 2DXYA 3BKIB 4R6KA 1VE4A 1IIWA 2O1MA 2DXRA 2UXAA 3I5OA 2HAUA 3VVDA 4F31B 3TFLA 1LGBC 1O64A 4ESWA 4OMBA 1NH8A 4OFJA 4RA1A 3MJNA 3C34A 4F29A 4ELQA 3PD8A 3EHUA 1UTHB 4FEBA 5A5XB 3ONMA 4C1UA 5JTYA 3TTKA 1R9LA 4UA8A 3TODA 1A8FA 1RYXA 2VOZA 4LQ5A 2PVUA 2Y7PA 3MZ1A 4M1VA 4K3FA 1A99A 4H1XA 2CZLA 4U21A 5EHMA 3SESA 2XXYA 2I3WA 4X1DA 4DXUA 3OO9A 4BLAA 3C35A 3HSTA 1A40A 1FQBA 2ZMBA 3TELA 3RTFB 1CB6A 3OOAA 1IITA 1LB8A 1QKBA 4PFTA 3H03A 2ONKE 4F3GA 4OEVA 2HQ0A 3TQWA 4EUOA 3VLUA 1B4HA 4PFWA 1D4NA 1SW1A 3K6UA 1B05A 4NF6B 3SERA 4KCCA 2XXXA 3KEIA 2Z8FA 5I58A 3TMGA 4BDOA 3IJXB 1Y20A 3SEWA 3O6HA 3VV5A 3K2DA 1B46A 2VGQA 3RQTA 1NFTA 2V25A 4DDDA 4YKJA 2DE3A 4L17A 4NF4A 3G3FA 1B3HA 1IZ1A 1FQCA 1JNFA 2DVCA 4KHZE 2Q88A 4KYDA 1S9TA 2ONSA 5ELVA 3SEXA 3HHFA 1PBQA 1II5A 3E4RA 2PMSA 5ICQA 4NEDA 4NF5A 3K6VA 3C31A 5I56A 1ZMGA 1FW0A 3PUXE 1P1OA 1EZOA 4JSOA 1MQDA 3PUYE 1Z7ME 4QRZA 4G68B 3S4UA 1N7XA 1MPBA 4RJZA 4F1VA 2H5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3J A;  1QUK A;  1VFD A;  4U2R A;  2H4I A;  1PBP A;  1GVC A;  3A3U A;  2XXU A;  2GHA A;  5AA2 D;  2XXW A;  4F2O A;  1IQ7 A;  3U94 A;  2DYX A;  4R6Y A;  3KOT A;  4DLD A;  2YPN A;  4OHN A;  4HTG A;  1SW5 A;  3PV0 E;  1LFG A;  1VSO A;  4NF6 A;  3T93 B;  2XXR A;  4G4P A;  3F11 A;  2DWI A;  1DSN A;  1S7Y A;  3C36 A;  1JEU A;  1AOV A;  4ECF A;  3B7D A;  2V84 A;  2A5S A;  4AQ4 A;  3MW0 A;  4HS7 A;  2O84 X;  3T9H B;  1PC3 A;  3T66 A;  4F3S A;  4OTE A;  1I6B A;  2Q2C A;  5IAI A;  1B1X A;  3D4C A;  2D21 A;  4N6P A;  1B7U A;  3A3C A;  4TQU Q;  3R7X A;  3SEY A;  3H6V A;  1QUL A;  5I59 A;  4PP0 A;  4RPN A;  1MPD A;  4ONY A;  3BBR A;  5KCJ B;  4IY5 A;  2NUV A;  1PB7 A;  4LUB A;  3PPO A;  1MQG A;  3Q26 A;  5I57 A;  3C33 A;  3OXN A;  4MBP A;  3TKD A;  1L5T A;  4IY6 A;  2Y84 A;  3SET A;  4H65 A;  3TDJ A;  1MXU A;  5FHN A;  1N7W A;  2PT2 A;  4ZE9 A;  2I0C A;  4ZDM A;  3H06 B;  1QVS A;  1FQD A;  5FTH A;  3TYH A;  3K1P A;  3CSB A;  3OSQ A;  1M5B A;  3UN6 A;  1DTZ A;  3Q29 A;  1ZKB A;  1B6H A;  1O63 A;  3IB0 A;  5FHM A;  2AYS A;  2R71 A;  1LAH E;  4QSC A;  4LQ2 A;  3KG2 A;  3Q27 A;  1MXY A;  1POY 1;  5IKB A;  1NNF A;  1J1N A;  2F34 A;  1OQG A;  2QSX A;  3WAE A;  3OMB A;  2O51 A;  1P1U A;  3DM0 A;  4BDL A;  3L6H A;  4JWO A;  4YMA A;  3V83 A;  3P7I A;  1LCT A;  1IXH A;  1IUD A;  2FA7 A;  1D9Y A;  4F1Y A;  3JZJ A;  3TTM A;  2P0S A;  4G68 C;  4LA9 A;  2DWA A;  4KQP A;  2B3F A;  3CFX A;  3PD9 A;  2REJ A;  1NH7 A;  4JXI A;  3OO7 A;  3EF7 A;  1XHY A;  1XOC A;  2HEU A;  3E13 X;  2XXH A;  5CMM A;  5H8F B;  4U4S A;  1N0T A;  4RXL A;  4R75 A;  1WOD A;  2AIX A;  1QKA A;  3KN8 A;  1EZ9 A;  1B5H A;  1IXI A;  4QSD A;  4JB7 A;  4R9G A;  2DWH A;  3QYT A;  3G3I A;  3HHG A;  3N5L A;  1B3G A;  3QUF A;  3TTL A;  1LCF A;  1N04 A;  3VXC A;  1FTO A;  3Q25 A;  4IGR A;  3IO6 A;  3LSF B;  3S9E A;  2I4B A;  5I2K A;  1MXW A;  3M3L A;  3IOU A;  1R1N A;  5FHO A;  3PPN A;  4GD5 A;  2DS9 A;  2Q2A A;  4YMB A;  3FV2 A;  5F1Q A;  2QPQ A;  2ZYK A;  4P0G A;  4GRK A;  2OZZ A;  2DE2 A;  4H8I A;  4M4G A;  4ZEC A;  3TAJ A;  1FQF A;  4KFQ A;  3G3K A;  2V3Q A;  2R6G E;  4OYV A;  3LUY A;  4OQO A;  1POT A;  2Y7I A;  1A54 A;  2Q89 A;  1UTB B;  4LAT A;  3EQ1 A;  5DEX A;  3G3H A;  4DZ1 A;  1Y1Z A;  1LAX A;  1VR5 A;  2ESN A;  3EPE A;  3IK6 B;  4KCD A;  1NNP A;  2GH9 A;  4OFO A;  4MF3 A;  5CBS A;  2I48 A;  2CMO A;  3HO7 A;  5H8Q A;  3U92 A;  1Z7N E;  4H5G A;  1B4Z A;  5TP9 A;  2HAV A;  3A09 A;  4LZ5 A;  3PGF A;  1LST A;  2DVZ A;  3R6U A;  4ZS9 A;  5TPA A;  4O3C A;  1M5E A;  1B7Z A;  2NVU B;  1XS5 A;  3B6Q A;  3RGY A;  1MXX A;  5ITP A;  3VFJ A;  4NWC A;  2B65 A;  3MAM A;  3K0V A;  1TT1 A;  3USD A;  3O2A A;  2A5T B;  1URS A;  1MXV A;  1AMF A;  1B3L A;  1Q35 A;  2I58 A;  4Q30 B;  1MH4 A;  4OER A;  4XIG Q;  4G8N A;  2Z8D A;  3CFZ A;  3V5A A;  3DP6 A;  2XXI A;  4DXB A;  5H8H A;  4YAH X;  1SVX B;  1A55 A;  3TTN A;  1BP5 A;  4NF8 B;  1MY2 A;  3DP8 A;  4ZEB A;  2F7A A;  1IEJ A;  1RYO A;  3FIR A;  3H6T A;  3FXR A;  3T96 B;  3FUZ A;  4DXC A;  1QUJ A;  1T0K A;  1FTL A;  3HV1 A;  5ITO A;  3N6T A;  3PPR A;  2RC9 A;  4N13 A;  3THI A;  5AA2 A;  1XVX A;  1IXC A;  4FJP A;  4F3P A;  3IR1 A;  1MY1 A;  3IJO B;  1USY E;  2XX9 A;  3VLV A;  4YKI A;  4F1U A;  4GIZ A;  1ZIU A;  4NMY A;  1P1N A;  4R72 A;  5AA4 B;  4PFU A;  3MP6 A;  2D3I A;  2DSF A;  3TCF A;  4EF1 A;  5L8D A;  5DT6 A;  1DOT A;  3MPK A;  3KN7 A;  1XVY A;  2I3V A;  4U1O A;  3QIM A;  3VLW A;  2DOJ A;  1B0L A;  2V93 A;  4IGT A;  3O97 A;  2X26 A;  2F7B A;  3MP8 A;  2QRY A;  2ZYO A;  4H67 A;  1A7L A;  3IOW A;  2NWJ A;  3MVY A;  4FEC A;  4HW8 A;  2HZL A;  1D3K A;  4JSD A;  1UTH A;  2QS4 A;  1Q1K A;  5A5X A;  5CC2 A;  1NKX A;  4LZ7 A;  5AA1 A;  4U1Z A;  5CM6 A;  4MH5 A;  3W9W A;  2HCA A;  1LB9 A;  1TFD A;  2THI A;  2VP1 A;  3K6X A;  4C1T A;  4RPO A;  1LAG E;  4F22 A;  3TEP A;  1ZLQ A;  4IO4 A;  1BKA A;  3FXQ A;  3TUS A;  4NF8 A;  3FVN A;  1GGG A;  3R26 A;  3ILT B;  2H98 A;  3MZ9 A;  1JW1 A;  3UIF A;  4N07 A;  2RCB A;  3ZSF A;  3IX1 A;  4O3A A;  4LVQ A;  1B32 A;  5ISU A;  1YTV A;  3FD3 A;  3OEL A;  3KBR A;  2G29 A;  1MS7 A;  2PX1 A;  5K2Y A;  3M8U A;  2ZXT A;  4YKK A;  4AB6 A;  4UAC A;  1NMU A;  4YKP A;  3O6I A;  3QXM A;  2OJT A;  2F78 A;  1UIU A;  2D5W A;  1Y3N A;  3CG1 A;  3S9N C;  1AL3 A;  3IB2 A;  4NTL A;  3MBP A;  4G77 A;  4ZEF A;  3ZS6 A;  4R6H A;  4TOZ A;  3U1O A;  2F35 A;  1WDN A;  4RNS A;  4BDM A;  1SW2 A;  4ZEI A;  1B0H A;  3RN8 A;  1B7H A;  1PDA A;  1LLS A;  2REG A;  4DE8 A;  3GLB A;  2LAO A;  3CVG A;  1YPN A;  2M8C A;  1I6A A;  3MVX A;  4XTC Q;  4TLL B;  4GXA A;  1DMB A;  2O68 A;  1DTG A;  4GWO A;  4F19 A;  3KZG A;  1OVT A;  3G3G A;  4QFN A;  4I1D A;  3PUV E;  2ABH A;  1AH5 A;  2Y7K A;  4YB6 A;  1WVJ A;  4GVO A;  1B5I A;  4RK2 A;  2DWJ A;  1B3E A;  1NNK A;  4G68 A;  3PU5 A;  4GQO A;  3FVO A;  3O66 A;  1O7T A;  4BDR A;  4BDN A;  3TZA A;  5KZT A;  1LFI A;  2PYY A;  4Q0C A;  2NOO A;  1ZBM A;  4FAJ A;  3HPI A;  1P99 A;  1MRP A;  2QMW A;  4IO7 A;  4ZZA A;  3OSR A;  5H8N B;  3MZB A;  3H7M A;  4E0X A;  4KYE A;  3FVK A;  3C32 A;  3OO6 A;  4R74 A;  3I6V A;  4F18 A;  1XC1 A;  3CI8 A;  3UK4 A;  4GOT A;  3W15 C;  3CSG A;  2ANJ A;  4H6D A;  2XX7 A;  2KLF A;  4FAT A;  2Y7R A;  1AIV A;  4RY1 A;  1MDQ A;  3S9M C;  2I4C A;  3HN0 A;  2F8D A;  5I2N B;  3E3K A;  1HSJ A;  4Q5T A;  3M3F A;  4E0W A;  1NL5 A;  1N84 A;  3JYR A;  4MFI A;  4POX A;  5M2V A;  3M3K A;  4EF2 A;  1JW4 A;  1ANF A;  1FTJ A;  1JQF A;  1TFA A;  4ELO A;  2UYE A;  2Z22 A;  5KDT B;  1B9J A;  1BTJ A;  1JVX A;  5KCJ A;  1MQJ A;  1USY H;  4ZE8 A;  3AXF A;  2Q9T A;  2I6E A;  4KPT A;  2NXO A;  2OK2 A;  3MPL A;  2DE4 A;  2E0S A;  3O29 A;  1US4 A;  2E1S A;  2I0B A;  3S9L C;  5FTI A;  3SEV A;  3T22 A;  5F7V A;  1B51 A;  1EZP A;  2UVI A;  2IA4 A;  3SKP A;  5JK4 A;  4OEN A;  3H6W A;  3PMW A;  4G2Z A;  1UIV A;  1SI0 A;  4RK9 A;  1KWH A;  4LP2 B;  1B58 A;  4OEU A;  3C9H A;  3DEL B;  3ZKK A;  2XXQ A;  1SD3 A;  1FQE A;  2HZK A;  1QUI A;  3E9X A;  3FJG A;  3FJM A;  3LSX A;  2QS3 A;  1UQW A;  2P1S A;  2FYI A;  3LR1 A;  4OET A;  3LBS A;  5DYH A;  3OEK A;  2VD3 A;  3UP9 A;  1TXF A;  2OLB A;  1FQA A;  1SBP A;  4RYA A;  4ZZE A;  5CI5 A;  3K00 A;  1Y4T A;  3PMV A;  4U4X A;  4Z0I A;  4QFL A;  1P1Q A;  4HCY A;  1M5C A;  3KFM A;  4PE5 B;  4YIC A;  5I2N A;  3OD7 A;  4R2F A;  3JV9 A;  3RT6 B;  3SEU A;  1MY0 A;  3LSW A;  1MM7 A;  2XD3 A;  4ZEK A;  2UVH A;  3MC2 A;  3IL1 B;  2UVG A;  4OES A;  1XT8 A;  3OEN A;  4ND9 A;  4POW A;  3CR9 A;  4MLV A;  1EH3 A;  3T9V A;  1LBB A;  3TTR A;  2ALU A;  3BFT A;  5HBC A;  3O9P A;  4NWD A;  3RT8 A;  3GZG A;  1H76 A;  3K02 A;  5L9O A;  1OLA A;  1ZU0 A;  5BWJ A;  3VVE A;  3IO4 A;  2UYF A;  2G93 A;  1URG A;  5H8F A;  5I58 B;  1NNT A;  4QFO A;  2PBW A;  2OBG A;  2Z8E A;  3ECR A;  4Z7E A;  1SQY A;  4I9D A;  3S2V A;  2V3T A;  2GFE A;  1ZTY A;  1HSE A;  5HPQ A;  3TCH A;  2O69 A;  3N26 A;  3WAF A;  4NF4 B;  1H45 A;  3EN3 A;  3O6G A;  4FE8 A;  4IO3 A;  2F6P A;  3T9U A;  3PUW E;  3U8Q A;  4P11 A;  1MY4 A;  3LC8 A;  1LFH A;  4U23 A;  5K2X A;  2B3B A;  2H99 A;  1LBC A;  2YLN A;  4PFY A;  2QS2 A;  4IO2 A;  2WKY A;  4JWX A;  1JET A;  1SI1 A;  2F36 A;  4YU0 A;  1SYI A;  4NF5 B;  5BUU A;  5I56 B;  5J1D A;  3PMX A;  4QF9 A;  1JVY A;  3V8X B;  3U72 A;  2XXV A;  2GRV A;  5ICT A;  2W7Y A;  4C0R A;  2XHD A;  2RCA A;  3H4Z A;  1SW4 A;  2ZNS A;  4R9F A;  1UTB A;  3FXU A;  4GL8 A;  1OVB A;  4THI A;  4X9T A;  4R2B A;  3N6U A;  3OEM A;  2P2A A;  5AE4 A;  1MXZ A;  3MVZ A;  4I8C A;  2F6G A;  3RPW A;  3VDF A;  2ZYM A;  4FIM A;  2RC7 A;  4OWD A;  5DVI A;  3IOT A;  4XKQ A;  4OFL A;  2HXW A;  3B6T A;  4OXV A;  5H8S A;  1H3D A;  1US5 A;  2AL4 A;  1GV8 A;  1MPC A;  4U22 A;  2GHB A;  4IO6 A;  3LSL A;  4KD5 A;  1BIY A;  1CE2 A;  2H25 A;  1PB9 A;  1Y1M A;  3VE1 B;  2A5T A;  2RF1 A;  3FGS A;  1OMP A;  4QFP A;  3K4U A;  5CRY A;  3G7W A;  5I59 B;  3TPA A;  4KYS A;  1ATG A;  5HM4 B;  2O1L A;  4ELP A;  3GXA A;  1R6Z A;  1Y3P A;  4EQ7 A;  3KSJ A;  5I57 B;  4QFK A;  1B3F A;  5CBR A;  3MWB A;  3VVF A;  4XKR A;  3B6W A;  3IAZ A;  4BDQ A;  4Q8R A;  3KN3 A;  3RUM A;  3CG3 A;  5I84 A;  2PT1 A;  3H3G A;  5CMK A;  3EHS A;  1M5F A;  3MQ9 A;  4F2Q A;  3CFL A;  3D4G A;  2ZNT A;  3FVG A;  1A8E A;  4ESX A;  2YJP A;  4EQ9 A;  2H9B A;  3TQL A;  2O7U A;  3SDF A;  4I62 A;  5AA4 A;  3KOS A;  1VFE A;  1GR2 A;  1R9Q A;  4JDF A;  3RLF E;  1MM6 A;  2VHA A;  1TWY A;  3QK6 A;  3IOV A;  2Z23 A;  2RIN A;  2IEE A;  3KSX A;  4O3B A;  2Q8J A;  4IO5 A;  1MDP 1;  1SDX A;  4FOR A;  4EXL A;  4PET A;  4OZ9 A;  3FZV A;  2VD2 A;  3DP4 A;  2XD2 A;  4LON B;  3FAS A;  5CMB A;  1EU8 A;  2AL5 A;  3VXB A;  2BJJ X;  2F5X A;  2OWT A;  2QJE A;  4OVJ A;  1FCK A;  4FED A;  4GFR A;  1SYH A;  4QSE A;  2QS1 A;  4JWY A;  3K1N A;  4TLM B;  4R73 A;  4QHQ A;  3W9V A;  3RY3 A;  3K01 A;  5TU0 A;  1RKM A;  5DVF A;  2XXT A;  4X48 A;  4WKM A;  4WXJ A;  1FTK A;  4YZZ A;  4AB5 A;  1JW5 A;  3ZKL A;  1MG1 A;  4H8J A;  4GL0 A;  1URD A;  2DQV A;  1HSL A;  3BFU A;  1DPE A;  5B70 A;  5I2K B;  2RC8 A;  1BLF A;  1OLC A;  4H0W A;  2OCU A;  2O6A A;  1PEB A;  2V3U A;  3KGC A;  3FV1 A;  4KR5 A;  2RKM A;  1FTM A;  2FNC A;  1IXG A;  1LAF E;  1H44 A;  4EXK A;  4X1B A;  5AA3 A;  3TCG A;  3OO8 A;  3UA8 A;  5DVJ A;  3U93 A;  4NE4 A;  1D9V A;  3IOR A;  2X7P A;  1PB8 A;  1ZJL A;  3ILU B;  3O28 A;  1N3X A;  1I69 A;  1GTK A;  1ELJ A;  1B5J A;  3PPP A;  2I49 A;  1P1W A;  4F39 A;  5EYF A;  3K6W A;  2QMX A;  5JEI A;  4XKN A;  3MP1 A;  3RNN A;  4F3B A;  3EHT A;  2UVJ A;  1B1H A;  1S50 A;  1B40 A;  3KJ7 A;  3CRB A;  5DEX B;  3GBA A;  1QJM A;  4YB5 A;  1Y9U A;  4H5F A;  2OWS A;  2Y7W A;  4DIG A;  3QSL A;  4IB2 A;  4JBZ A;  3H6U A;  4WED A;  3DLN A;  1N3W A;  3Q28 A;  5LOM A;  3T9X B;  4G8M A;  2ZYN A;  2F97 A;  4DCY A;  3FAT A;  3MVW A;  2XX8 A;  5H8Q B;  4ZED A;  3UGW A;  5TP9 B;  1OIB A;  1MQH A;  2O7I A;  3GBB A;  4KI0 E;  4EQB A;  3ODB A;  5TPA B;  1Y3Q A;  4EDP A;  4ELR A;  5H8N A;  3KJT A;  1I6Q A;  1MQI A;  4YB7 A;  1DPP A;  2XXP A;  3CIJ A;  3K1M A;  3FJ7 A;  3HCQ A;  5L9S A;  2HFB A;  4P0I A;  4WEP A;  3C4M A;  4XXU A;  5JTY B;  1B2H A;  5B7D A;  1YAE A;  5DTB A;  4GLI A;  3I3V A;  2DP8 A;  4DCX A;  5H8H B;  3MUQ A;  4LZ8 A;  4ISU A;  4G8H A;  4XKP A;  3PPQ A;  5L9M A;  1MY3 A;  3IB1 A;  2X7Q A;  1MH3 A;  1H43 A;  4GXS B;  5AA2 B;  3V89 B;  1OQH A;  2R9J A;  1QW0 A;  3QAX A;  5KDT A;  1M5D A;  1N76 A;  3N94 A;  4PQJ A;  1JEV A;  2QL3 A;  2ONR A;  5CMC A;  2ZNU A;  1YCJ A;  4MLQ A;  1F9B A;  1B52 A;  2F7C A;  3L6G A;  1Y4C A;  4GF8 A;  4HCW A;  3RTW B;  3PUZ E;  5EHS A;  3QUJ A;  3UOR A;  2DXY A;  3BKI B;  4R6K A;  1VE4 A;  1IIW A;  2O1M A;  2DXR A;  2UXA A;  3I5O A;  2HAU A;  3VVD A;  4F31 B;  3TFL A;  1LGB C;  1O64 A;  4ESW A;  4OMB A;  1NH8 A;  4OFJ A;  4RA1 A;  3MJN A;  3C34 A;  4F29 A;  4ELQ A;  3PD8 A;  3EHU A;  1UTH B;  4FEB A;  5A5X B;  3ONM A;  4C1U A;  5JTY A;  3TTK A;  1R9L A;  4UA8 A;  3TOD A;  1A8F A;  1RYX A;  2VOZ A;  4LQ5 A;  2PVU A;  2Y7P A;  3MZ1 A;  4M1V A;  4K3F A;  1A99 A;  4H1X A;  2CZL A;  4U21 A;  5EHM A;  3SES A;  2XXY A;  2I3W A;  4X1D A;  4DXU A;  3OO9 A;  4BLA A;  3C35 A;  3HST A;  1A40 A;  1FQB A;  2ZMB A;  3TEL A;  3RTF B;  1CB6 A;  3OOA A;  1IIT A;  1LB8 A;  1QKB A;  4PFT A;  3H03 A;  2ONK E;  4F3G A;  4OEV A;  2HQ0 A;  3TQW A;  4EUO A;  3VLU A;  1B4H A;  4PFW A;  1D4N A;  1SW1 A;  3K6U A;  1B05 A;  4NF6 B;  3SER A;  4KCC A;  2XXX A;  3KEI A;  2Z8F A;  5I58 A;  3TMG A;  4BDO A;  3IJX B;  1Y20 A;  3SEW A;  3O6H A;  3VV5 A;  3K2D A;  1B46 A;  2VGQ A;  3RQT A;  1NFT A;  2V25 A;  4DDD A;  4YKJ A;  2DE3 A;  4L17 A;  4NF4 A;  3G3F A;  1B3H A;  1IZ1 A;  1FQC A;  1JNF A;  2DVC A;  4KHZ E;  2Q88 A;  4KYD A;  1S9T A;  2ONS A;  5ELV A;  3SEX A;  3HHF A;  1PBQ A;  1II5 A;  3E4R A;  2PMS A;  5ICQ A;  4NED A;  4NF5 A;  3K6V A;  3C31 A;  5I56 A;  1ZMG A;  1FW0 A;  3PUX E;  1P1O A;  1EZO A;  4JSO A;  1MQD A;  3PUY E;  1Z7M E;  4QRZ A;  4G68 B;  3S4U A;  1N7X A;  1MPB A;  4RJZ A;  4F1V A;  2H5Y A; 
#chains in the Genus database with same CATH topology
 2FIE A;  3G3J A;  1QUK A;  4JVC A;  1VFD A;  4U2R A;  2H4I A;  1PBP A;  1FBP A;  1FPK A;  1GVC A;  2B4M A;  3A3U A;  2XXU A;  2GHA A;  2Q74 A;  5AA2 D;  4MNC A;  2XXW A;  4F2O A;  1IQ7 A;  4NG7 A;  3U94 A;  2DYX A;  4R6Y A;  4GX4 A;  3KOT A;  2VT5 A;  1IMC A;  4DLD A;  2YPN A;  4OHN A;  4HTG A;  1SW5 A;  3PV0 E;  1LFG A;  1VSO A;  4NF6 A;  3T93 B;  2XXR A;  4G4P A;  1G0H A;  3F11 A;  4NN3 A;  2DWI A;  1DSN A;  1S7Y A;  3C36 A;  1JEU A;  1AOV A;  4ECF A;  3B7D A;  4PBQ A;  2V84 A;  2A5S A;  4AQ4 A;  3MW0 A;  4HS7 A;  2O84 X;  3T9H B;  1PC3 A;  3T66 A;  1VDW A;  4F3S A;  4OTE A;  1I6B A;  2Q2C A;  5IAI A;  1B1X A;  3D4C A;  2D21 A;  4N6P A;  1B7U A;  3A3C A;  4TQU Q;  4XEQ A;  3BIH A;  3R7X A;  3SEY A;  3H6V A;  2XWV A;  3IFA A;  1QUL A;  5EQ9 A;  5I59 A;  4PP0 A;  4RPN A;  1MPD A;  4ONY A;  3BBR A;  5KCJ B;  5I3S A;  4IY5 A;  2NUV A;  1PB7 A;  4LUB A;  3PPO A;  1MQG A;  3Q26 A;  5I57 A;  3C33 A;  3OXN A;  4MBP A;  3TKD A;  1L5T A;  4IY6 A;  2Y84 A;  3SET A;  4H65 A;  4MNI A;  3TDJ A;  1MXU A;  5EQ8 A;  5FHN A;  2FBP A;  1N7W A;  2PT2 A;  1FJ6 A;  2MKZ A;  4ZE9 A;  2I0C A;  4ZDM A;  3H06 B;  1QVS A;  3D1R A;  4HE2 A;  1FQD A;  5FTH A;  3TYH A;  3K1P A;  3CSB A;  3OSQ A;  1M5B A;  3UN6 A;  1DTZ A;  3Q29 A;  1ZKB A;  1B6H A;  4MCO A;  1O63 A;  3IB0 A;  5FHM A;  2AYS A;  2R71 A;  1LAH E;  4QSC A;  4LQ2 A;  3KG2 A;  3Q27 A;  4P3L A;  1MXY A;  1POY 1;  1DBZ A;  2ZZV A;  5IKB A;  1NNF A;  1J1N A;  2F34 A;  1OQG A;  2QSX A;  3WAE A;  3OMB A;  2O51 A;  1P1U A;  3DM0 A;  4BDL A;  3L6H A;  4I3E A;  4JWO A;  4YMA A;  3V83 A;  3P7I A;  4HE1 A;  1LCT A;  1IXH A;  3T0J A;  1IUD A;  2FA7 A;  1D9Y A;  4F1Y A;  3JZJ A;  3TTM A;  4HXV A;  4MAG A;  2P0S A;  4G68 C;  4GBW A;  1QGX A;  4LA9 A;  2DWA A;  4KQP A;  2B4L A;  2B3F A;  5IZZ A;  3CFX A;  3PD9 A;  2REJ A;  1NH7 A;  4JXI A;  3OO7 A;  5DW8 A;  3EF7 A;  1XHY A;  2CZI A;  1EYK A;  1XOC A;  2HEU A;  1DK4 A;  3E13 X;  2XXH A;  5CMM A;  5H8F B;  4U4S A;  1N0T A;  4MEV A;  4RXL A;  4R75 A;  1WOD A;  2AIX A;  1QKA A;  3KN8 A;  2WBB A;  1EZ9 A;  1B5H A;  4QSD A;  1IXI A;  4JB7 A;  4R9G A;  2DWH A;  3QYT A;  3G3I A;  1DCU A;  3HHG A;  1D9Q A;  4P56 A;  3N5L A;  1B3G A;  3QUF A;  3TTL A;  1LCF A;  1N04 A;  3VXC A;  1FTO A;  3Q25 A;  4IGR A;  3IO6 A;  3LSF B;  3S9E A;  2I4B A;  5I2K A;  1MXW A;  3M3L A;  3IOU A;  1R1N A;  5FHO A;  3PPN A;  4GD5 A;  2DS9 A;  2Q2A A;  4I3Y A;  4YMB A;  3FV2 A;  3EKI A;  5F1Q A;  2QPQ A;  2ZYK A;  4P0G A;  4GRK A;  2OZZ A;  2DE2 A;  1RDX A;  1NV7 A;  4H8I A;  4M4G A;  4ZEC A;  3TAJ A;  1FQF A;  4KFQ A;  3G3K A;  2V3Q A;  2R6G E;  4OYV A;  3LUY A;  4OQO A;  1POT A;  2Y7I A;  1A54 A;  4PC9 A;  1KA1 A;  2Q89 A;  1UTB B;  1FJ9 A;  4LAT A;  3EQ1 A;  5DEX A;  3G3H A;  4DZ1 A;  1Y1Z A;  1LAX A;  1VR5 A;  2ESN A;  3EPE A;  3IK6 B;  4KCD A;  1NNP A;  2GH9 A;  4OFO A;  4MF3 A;  5CBS A;  2I48 A;  2CMO A;  3HO7 A;  5H8Q A;  3U92 A;  1Z7N E;  4H5G A;  1B4Z A;  5TP9 A;  4MHF A;  2HAV A;  3A09 A;  1FBC A;  3KC1 A;  2OWZ A;  4LZ5 A;  3PGF A;  1LST A;  2DVZ A;  3R6U A;  4ZS9 A;  5TPA A;  4O3C A;  1XI6 A;  1M5E A;  1B7Z A;  4OVS A;  4O94 A;  2NVU B;  1XS5 A;  3B6Q A;  3RGY A;  1MXX A;  5ITP A;  3VFJ A;  4NWC A;  2XXK A;  2B65 A;  3MAM A;  1IME A;  3K0V A;  1TT1 A;  3O2A A;  2A5T B;  3USD A;  1URS A;  1MXV A;  1AMF A;  1B3L A;  1Q35 A;  2I58 A;  4Q30 B;  1MH4 A;  4OER A;  4O7M A;  4XIG Q;  4GX3 A;  4G8N A;  2Z8D A;  2CEX A;  3CFZ A;  1KA0 A;  3V5A A;  3DP6 A;  2XXI A;  4DXB A;  5H8H A;  4YAH X;  1SVX B;  1A55 A;  3TTN A;  1BP5 A;  4NF8 B;  1K9Y A;  1MY2 A;  1FPD A;  3DP8 A;  4ZEB A;  2F7A A;  1IEJ A;  1RYO A;  5I5P A;  3FIR A;  3H6T A;  2PCR A;  3FXR A;  1JP4 A;  3T96 B;  3FUZ A;  1G0I A;  4DXC A;  1QUJ A;  1T0K A;  1FTL A;  3HV1 A;  5ITO A;  2WBD A;  3N6T A;  3PPR A;  2RC9 A;  4N13 A;  3THI A;  5AA2 A;  1XVX A;  1IXC A;  4FJP A;  4F3P A;  3IR1 A;  3E78 A;  1MY1 A;  3IJO B;  1NUY A;  1USY E;  2XX9 A;  3VLV A;  4GWU A;  4YKI A;  4F1U A;  4GIZ A;  1ZIU A;  4NMY A;  1P1N A;  4R72 A;  5AA4 B;  4PFU A;  3MP6 A;  2D3I A;  2DSF A;  3TCF A;  4EF1 A;  5L8D A;  5DT6 A;  1FSA A;  1DOT A;  3MPK A;  2FVZ A;  1YZ0 A;  3KN7 A;  1XVY A;  2I3V A;  4U1O A;  3QIM A;  3VLW A;  2DOJ A;  1B0L A;  2V93 A;  4IGT A;  3O97 A;  2X26 A;  2F7B A;  3MP8 A;  1NV2 A;  2QRY A;  2ZYO A;  4H67 A;  1A7L A;  1SPI A;  3IOW A;  2NWJ A;  3ISP A;  3MVY A;  4FEC A;  4HW8 A;  2HZL A;  1D3K A;  4JSD A;  1UTH A;  2QS4 A;  1Q1K A;  5A5X A;  5CC2 A;  5EQ7 A;  4MX6 A;  1NKX A;  4LZ7 A;  5AA1 A;  4GBV A;  4U1Z A;  5CM6 A;  4PGP A;  4MH5 A;  3W9W A;  2HCA A;  1LB9 A;  1TFD A;  2THI A;  2VP1 A;  3K6X A;  1NUX A;  4C1T A;  4RPO A;  1LAG E;  5ET7 A;  4F22 A;  3TEP A;  4O8M A;  1ZLQ A;  4IO4 A;  1BKA A;  4GWY A;  3FXQ A;  3TUS A;  1YYZ A;  4NF8 A;  3FVN A;  1GGG A;  3R26 A;  3ILT B;  2H98 A;  3MZ9 A;  5IZ3 B;  1JW1 A;  3UIF A;  4N07 A;  2RCB A;  3ZSF A;  3IX1 A;  4O3A A;  4LVQ A;  1B32 A;  5ISU A;  2V4C A;  1YTV A;  4P1L A;  3FD3 A;  3OEL A;  3KBR A;  2G29 A;  1MS7 A;  2PX1 A;  5K2Y A;  3M8U A;  2ZXT A;  1LBV A;  1BK4 A;  4YKK A;  4PAI A;  4AB6 A;  4UAC A;  1NMU A;  4YKP A;  4H46 A;  3O6I A;  3QXM A;  2OJT A;  2F78 A;  1UIU A;  2D5W A;  1Y3N A;  3CG1 A;  3S9N C;  1AL3 A;  3IB2 A;  4NTL A;  3MBP A;  4G77 A;  4ZEF A;  4QBA A;  3ZS6 A;  4R6H A;  4TOZ A;  5ET8 A;  3PTY A;  3U1O A;  2F35 A;  1WDN A;  3LUZ A;  4P47 A;  5EQA A;  4RNS A;  5IM2 A;  4BDM A;  4NAP A;  1SW2 A;  4ZEI A;  1B0H A;  3RN8 A;  4QXD A;  1B7H A;  1PDA A;  2P3V A;  1LLS A;  4N6D A;  4FBP A;  2REG A;  4DE8 A;  3GLB A;  2LAO A;  1CNQ A;  3CVG A;  1YPN A;  2M8C A;  1I6A A;  3MVX A;  4XTC Q;  4TLL B;  3RPL B;  4GXA A;  2KQZ A;  1DMB A;  2O68 A;  1DTG A;  2XWI A;  4GWO A;  4F19 A;  3KZG A;  1OVT A;  3G3G A;  4QFN A;  4GWS A;  3LV0 A;  4I1D A;  3PUV E;  2ABH A;  1AH5 A;  3A29 A;  2Y7K A;  4YB6 A;  1WVJ A;  4GVO A;  1B5I A;  4RK2 A;  2DWJ A;  1B3E A;  1NNK A;  4G68 A;  3PU5 A;  4GQO A;  3FVO A;  2BJI A;  3O66 A;  1O7T A;  4BDR A;  4BDN A;  1FPJ A;  3TZA A;  5KZT A;  1LFI A;  2PYY A;  4Q0C A;  2ZZW A;  2NOO A;  1ZBM A;  1FPB A;  4FAJ A;  3HPI A;  1P99 A;  1MRP A;  2QMW A;  4IO7 A;  4ZZA A;  3OSR A;  5H8N B;  3MZB A;  3HFU A;  2P3N A;  3H7M A;  4E0X A;  4OVP A;  4KYE A;  3FVK A;  1RDZ A;  1INP A;  3C32 A;  3OO6 A;  3KBZ A;  4R74 A;  3B50 A;  3I6V A;  4F18 A;  1XC1 A;  3CI8 A;  4IR8 A;  3UK4 A;  4GOT A;  3W15 C;  3CSG A;  2ANJ A;  4H6D A;  2XX7 A;  2KLF A;  4FAT A;  2Y7R A;  1AIV A;  4RY1 A;  1MDQ A;  3S9M C;  2I4C A;  2QFL A;  4NHB A;  3HN0 A;  5IZ1 A;  5I7I A;  2F8D A;  5I2N B;  4GWX A;  3E3K A;  1HSJ A;  4Q5T A;  3SZP A;  5F24 A;  3M3F A;  4E0W A;  1NL5 A;  1N84 A;  3JYR A;  4MFI A;  4POX A;  2JJK A;  5M2V A;  3M3K A;  4EF2 A;  1JW4 A;  1ANF A;  1FTJ A;  1JQF A;  1TFA A;  4ELO A;  2UYE A;  2Z22 A;  5KDT B;  1B9J A;  1BTJ A;  1JVX A;  1K9Z A;  5KCJ A;  1MQJ A;  1USY H;  4ZE8 A;  2WEF A;  3AXF A;  2Q9T A;  2I6E A;  4KPT A;  4N4U A;  2NXO A;  2OK2 A;  3MST A;  3MPL A;  2DE4 A;  2E0S A;  3O29 A;  1US4 A;  2E1S A;  2I0B A;  3S9L C;  5FTI A;  3SEV A;  3T22 A;  5F7V A;  1B51 A;  1EZP A;  2UVI A;  2IA4 A;  3SKP A;  5JK4 A;  2ZZX A;  4OEN A;  1FBF A;  3H6W A;  3PMW A;  4G2Z A;  1UIV A;  4GX6 A;  1SI0 A;  4RK9 A;  1KWH A;  4LP2 B;  4OEU A;  1B58 A;  4MNP A;  1NV5 A;  3C9H A;  3DEL B;  3ZKK A;  2XXQ A;  1SD3 A;  1FQE A;  2HZK A;  4PBH A;  3IFC A;  1QUI A;  3E9X A;  3FJG A;  3FJM A;  3LSX A;  2QS3 A;  1UQW A;  2P1S A;  3FBP A;  2FYI A;  3LR1 A;  4N81 A;  4OET A;  3LBS A;  5DYH A;  3OEK A;  2VD3 A;  3UP9 A;  1TXF A;  2OLB A;  1FQA A;  3E79 A;  1SBP A;  4RYA A;  4ZZE A;  5CI5 A;  4PE3 A;  3K00 A;  1Y4T A;  3PMV A;  4U4X A;  4Z0I A;  4N91 A;  1P1Q A;  4QFL A;  4HCY A;  1M5C A;  3KFM A;  4PE5 B;  1FPF A;  4H45 A;  4YIC A;  5I2N A;  3OD7 A;  4R2F A;  3JV9 A;  1LBZ A;  3RT6 B;  3SEU A;  1MY0 A;  3LSW A;  1MM7 A;  2XD3 A;  4ZEK A;  2UVH A;  3MC2 A;  1NV4 A;  3IL1 B;  2UVG A;  4OES A;  1XT8 A;  3OEN A;  4PDD A;  2XA5 A;  2XWK A;  4ND9 A;  4POW A;  3CR9 A;  4MLV A;  1EH3 A;  3T9V A;  1LBB A;  3TTR A;  2ALU A;  3BFT A;  5HBC A;  4PF8 A;  3O9P A;  4NWD A;  3RT8 A;  3GZG A;  1H76 A;  2L5V A;  3K02 A;  5L9O A;  1OLA A;  1ZU0 A;  5BWJ A;  3VVE A;  3IO4 A;  2UYF A;  2G93 A;  1URG A;  5H8F A;  4X8R A;  5I58 B;  4N8Y A;  1NNT A;  4QFO A;  2PBW A;  1EYI A;  2OBG A;  2Z8E A;  2R8T A;  2HHM A;  3ECR A;  4Z7E A;  1SQY A;  4I9D A;  3S2V A;  2V3T A;  4JVI A;  2GFE A;  1ZTY A;  1HSE A;  5HPQ A;  3TCH A;  2O69 A;  3N26 A;  5A5L A;  3WAF A;  2VPO A;  4NF4 B;  1H45 A;  3EN3 A;  3O6G A;  4FE8 A;  4IO3 A;  2F6P A;  4X04 A;  3T9U A;  3PUW E;  3U8Q A;  1IMF A;  4P11 A;  1MY4 A;  3LC8 A;  1LFH A;  4U23 A;  5K2X A;  2B3B A;  2H99 A;  1LBC A;  2YLN A;  4PFY A;  2QS2 A;  4IO2 A;  2WKY A;  4JWX A;  4MMP A;  1JET A;  1SI1 A;  2F36 A;  4YU0 A;  1SYI A;  4NF5 B;  5BUU A;  5I56 B;  5J1D A;  3PMX A;  4QF9 A;  1JVY A;  3V8X B;  3U72 A;  2XXV A;  2GRV A;  5ICT A;  2W7Y A;  4C0R A;  2XHD A;  2RCA A;  3H4Z A;  4DI4 B;  4P8B A;  1SW4 A;  2HPG A;  2ZNS A;  3U65 A;  4R9F A;  1UTB A;  3FXU A;  4GL8 A;  1OVB A;  4UAB A;  4THI A;  4OVR A;  4X9T A;  4R2B A;  3N6U A;  3OEM A;  2P2A A;  5AE4 A;  1MXZ A;  3MVZ A;  4I8C A;  2F6G A;  1AWB A;  3RPW A;  3VDF A;  2ZYM A;  1LBY A;  4FIM A;  2RC7 A;  4OWD A;  5DVI A;  3IOT A;  4XKQ A;  2FHY A;  4OFL A;  2HXW A;  1FPI A;  3B6T A;  2F3D A;  1NUW A;  4OXV A;  5H8S A;  1H3D A;  1US5 A;  2AL4 A;  2CZK A;  1GV8 A;  1MPC A;  4U22 A;  2GHB A;  1FBE A;  4IO6 A;  3LSL A;  4KD5 A;  1BIY A;  1CE2 A;  2H25 A;  1PB9 A;  1Y1M A;  3VE1 B;  2A5T A;  2RF1 A;  3FGS A;  1OMP A;  4QFP A;  4NF0 A;  3K4U A;  5CRY A;  3G7W A;  5I59 B;  2GQ1 A;  3TPA A;  4KYS A;  1ATG A;  5HM4 B;  2WYP A;  2O1L A;  4ELP A;  3GXA A;  1R6Z A;  1Y3P A;  4EQ7 A;  3KSJ A;  5I57 B;  4KXP A;  4QFK A;  1B3F A;  5CBR A;  3MWB A;  3VVF A;  4XKR A;  3B6W A;  3IAZ A;  4BDQ A;  4Q8R A;  1IMA A;  3KN3 A;  3RUM A;  3CG3 A;  5I84 A;  2PT1 A;  3H3G A;  5CMK A;  3EHS A;  1M5F A;  3MQ9 A;  1FTA A;  4F2Q A;  3CFL A;  3D4G A;  2ZNT A;  3FVG A;  1A8E A;  4ESX A;  2YJP A;  4EQ9 A;  2H9B A;  3TQL A;  2O7U A;  3SDF A;  4I62 A;  3FXB A;  5AA4 A;  3KOS A;  4O7I A;  1VFE A;  1GR2 A;  1R9Q A;  4JDF A;  3RLF E;  1MM6 A;  2VHA A;  1TWY A;  3QK6 A;  3IOV A;  2Z23 A;  2F3B A;  2RIN A;  2CZH A;  2IEE A;  3KSX A;  4O3B A;  2Q8J A;  1NV1 A;  4IO5 A;  1MDP 1;  1SDX A;  1LBX A;  3MYU A;  4FOR A;  4EXL A;  2Y5K A;  4PET A;  4OZ9 A;  3FZV A;  4XFE A;  2VD2 A;  3DP4 A;  2DDK A;  2XD2 A;  4LON B;  4PTK A;  3FAS A;  5CMB A;  1EU8 A;  2AL5 A;  3VXB A;  2BJJ X;  2F5X A;  2OWT A;  2QJE A;  2KR0 A;  4OVJ A;  1FCK A;  4FED A;  4GWW A;  4GFR A;  1SYH A;  4QSE A;  2QS1 A;  4JWY A;  3K1N A;  4TLM B;  4I40 A;  4R73 A;  4QHQ A;  5ET6 A;  3W9V A;  4HE0 A;  3RY3 A;  1FPL A;  3K01 A;  5TU0 A;  1RKM A;  5DVF A;  2XXT A;  4X48 A;  1IMD A;  3GYY A;  5IZ3 A;  4WKM A;  4WXJ A;  1FTK A;  4YZZ A;  4AB5 A;  1JW5 A;  4G61 A;  1EYJ A;  3ZKL A;  1MG1 A;  4H8J A;  4GL0 A;  1URD A;  2PFY A;  2DQV A;  1HSL A;  4MIJ A;  1FBD A;  3BFU A;  1DPE A;  4LN5 A;  5B70 A;  5I2K B;  2RC8 A;  1BLF A;  1OLC A;  4H0W A;  2OCU A;  1RDY A;  2O6A A;  1PEB A;  2V3U A;  3KGC A;  3FV1 A;  4KR5 A;  2RKM A;  4MJO A;  1FTM A;  2FNC A;  1IXG A;  1LAF E;  1H44 A;  4EXK A;  4X1B A;  5AA3 A;  1NV0 A;  3TCG A;  2FIX A;  4N17 A;  5T3J A;  3ROJ A;  3OO8 A;  3UA8 A;  5DVJ A;  3U93 A;  4NE4 A;  1D9V A;  3IOR A;  2PFZ A;  2X7P A;  4PF6 A;  1PB8 A;  2QVV A;  1ZJL A;  3ILU B;  1YXI A;  3O28 A;  1N3X A;  1I69 A;  1GTK A;  1ELJ A;  4P9K A;  3RYD A;  1B5J A;  4GWZ A;  5ET5 A;  3PPP A;  2I49 A;  1FBH A;  1P1W A;  4F39 A;  5EYF A;  3K6W A;  2QMX A;  5JEI A;  4XKN A;  3MP1 A;  3RNN A;  4F3B A;  3EHT A;  2UVJ A;  1B1H A;  1S50 A;  1B40 A;  3KJ7 A;  3CRB A;  5DEX B;  3GBA A;  3RPL A;  1QJM A;  4YB5 A;  4N15 A;  1Y9U A;  4H5F A;  2OWS A;  2Y7W A;  4DIG A;  3QSL A;  4IB2 A;  4JBZ A;  3H6U A;  4PFB A;  4WED A;  3DLN A;  1N3W A;  3Q28 A;  5LDZ A;  5LOM A;  3T9X B;  4G8M A;  2ZYN A;  2F97 A;  4DCY A;  3KC0 A;  3FAT A;  5J16 A;  3MVW A;  2XX8 A;  5H8Q B;  4ZED A;  5FBP A;  5EYG A;  3UGW A;  5TP9 B;  1OIB A;  1MQH A;  3BIG A;  4N6K A;  2O7I A;  3GBB A;  4KI0 E;  4EQB A;  3ODB A;  5TPA B;  1Y3Q A;  4EDP A;  4ELR A;  5H8N A;  3KJT A;  1I6Q A;  1MQI A;  4YB7 A;  1DPP A;  3T1B A;  4OVQ A;  2XXP A;  3CIJ A;  3K1M A;  3FJ7 A;  3HCQ A;  5L9S A;  2HFB A;  4PAF A;  4P0I A;  4WEP A;  4PDH A;  2QVU A;  3C4M A;  4XXU A;  5JTY B;  1B2H A;  5B7D A;  1YAE A;  4PGN A;  5DTB A;  4GLI A;  3B8B A;  2WYK A;  3I3V A;  5LTC A;  2DP8 A;  4OVT A;  4NX1 A;  4DCX A;  5H8H B;  3MUQ A;  4LZ8 A;  4ISU A;  4G8H A;  4XKP A;  3PPQ A;  5L9M A;  1MY3 A;  3IB1 A;  1FPE A;  2X7Q A;  1MH3 A;  1NI9 A;  1H43 A;  4GXS B;  5AA2 B;  3V89 B;  1OQH A;  2R9J A;  1QW0 A;  3QAX A;  5KDT A;  1NV3 A;  1M5D A;  1N76 A;  3N94 A;  3QMF A;  4NGU A;  4PQJ A;  1JEV A;  2QL3 A;  2ONR A;  5CMC A;  1LBW A;  2ZNU A;  1YCJ A;  4MLQ A;  1F9B A;  1B52 A;  4NQ8 A;  4XF5 A;  2F7C A;  3L6G A;  1Y4C A;  4GF8 A;  4HCW A;  3RTW B;  3PUZ E;  5EHS A;  3QUJ A;  3UOR A;  2DXY A;  3BKI B;  4R6K A;  4DI3 D;  1VE4 A;  1IIW A;  5EYH A;  2O1M A;  2DXR A;  2UXA A;  3I5O A;  2HAU A;  2HXR A;  3VVD A;  4F31 B;  4OA4 A;  3TFL A;  1LGB C;  1O64 A;  4ESW A;  4OMB A;  1NH8 A;  4JVD A;  4OFJ A;  4RA1 A;  3MJN A;  3C34 A;  2CEY A;  4F29 A;  4ELQ A;  3PD8 A;  3EHU A;  1UTH B;  4AS5 A;  4FEB A;  5A5X B;  3ONM A;  4C1U A;  5JTY A;  3TTK A;  1R9L A;  4UA8 A;  3TOD A;  1A8F A;  1RYX A;  2VOZ A;  4LQ5 A;  2Q8M A;  2PVU A;  1NUZ A;  2Y7P A;  3MZ1 A;  4M1V A;  4K3F A;  1A99 A;  4H1X A;  2CZL A;  4U21 A;  5EHM A;  1FRP A;  3SES A;  2XXY A;  2I3W A;  4X1D A;  4DXU A;  3OO9 A;  4BLA A;  3C35 A;  3HST A;  1A40 A;  1FQB A;  2ZMB A;  3TEL A;  3RTF B;  1CB6 A;  3NOH A;  2Y5L A;  3OOA A;  1IIT A;  1LB8 A;  1QKB A;  4PFT A;  3H03 A;  2ONK E;  4PFR A;  4F3G A;  3CHG A;  4OEV A;  2HQ0 A;  2VPN A;  3TQW A;  4EUO A;  1KZ8 A;  3VLU A;  1B4H A;  4PFW A;  2WX9 A;  1D4N A;  1SW1 A;  3K6U A;  1B05 A;  1LEV A;  4NF6 B;  3SER A;  1FPG A;  4KCC A;  2XXX A;  3KEI A;  2Z8F A;  4PCD A;  1Q9D A;  5I58 A;  3TMG A;  4BDO A;  3IJX B;  1Y20 A;  3SEW A;  3O6H A;  2OX3 A;  3VV5 A;  1IMB A;  3K2D A;  1FBG A;  1B46 A;  2VGQ A;  3RQT A;  4PFI A;  1NFT A;  2V25 A;  5IGA A;  4DDD A;  2QVR A;  4YKJ A;  2DE3 A;  4L17 A;  4NF4 A;  3G3F A;  1B3H A;  1IZ1 A;  2XWO A;  1FQC A;  1JNF A;  2DVC A;  4P1E A;  4KHZ E;  2Q88 A;  4KYD A;  4N8G A;  1S9T A;  4PAK A;  2ONS A;  5ELV A;  3SEX A;  4AS4 A;  3HHF A;  1PBQ A;  1II5 A;  3E4R A;  5ESY A;  2PMS A;  5ICQ A;  4OAN A;  4NED A;  4NF5 A;  3K6V A;  3C31 A;  5I56 A;  1ZMG A;  1FW0 A;  3PUX E;  1P1O A;  1NV6 A;  4JSO A;  1EZO A;  1MQD A;  3PUY E;  1Z7M E;  4QRZ A;  4G68 B;  3S4U A;  1N7X A;  1MPB A;  4RJZ A;  4F1V A;  2H5Y A; 
#chains in the Genus database with same CATH homology
 3G3J A;  1QUK A;  1VFD A;  4U2R A;  2H4I A;  1PBP A;  1GVC A;  3A3U A;  2XXU A;  2GHA A;  5AA2 D;  2XXW A;  4F2O A;  1IQ7 A;  3U94 A;  2DYX A;  4R6Y A;  3KOT A;  4DLD A;  2YPN A;  4OHN A;  4HTG A;  1SW5 A;  3PV0 E;  1LFG A;  1VSO A;  4NF6 A;  3T93 B;  2XXR A;  4G4P A;  3F11 A;  2DWI A;  1DSN A;  1S7Y A;  3C36 A;  1JEU A;  1AOV A;  4ECF A;  3B7D A;  2V84 A;  2A5S A;  4AQ4 A;  3MW0 A;  4HS7 A;  2O84 X;  3T9H B;  1PC3 A;  3T66 A;  4F3S A;  4OTE A;  1I6B A;  2Q2C A;  5IAI A;  1B1X A;  3D4C A;  2D21 A;  4N6P A;  1B7U A;  3A3C A;  4TQU Q;  3R7X A;  3SEY A;  3H6V A;  1QUL A;  5I59 A;  4PP0 A;  4RPN A;  1MPD A;  4ONY A;  3BBR A;  5KCJ B;  4IY5 A;  2NUV A;  1PB7 A;  4LUB A;  3PPO A;  1MQG A;  3Q26 A;  5I57 A;  3C33 A;  3OXN A;  4MBP A;  3TKD A;  1L5T A;  4IY6 A;  2Y84 A;  3SET A;  4H65 A;  3TDJ A;  1MXU A;  5FHN A;  1N7W A;  2PT2 A;  4ZE9 A;  2I0C A;  4ZDM A;  3H06 B;  1QVS A;  1FQD A;  5FTH A;  3TYH A;  3K1P A;  3CSB A;  3OSQ A;  1M5B A;  3UN6 A;  1DTZ A;  3Q29 A;  1ZKB A;  1B6H A;  1O63 A;  3IB0 A;  5FHM A;  2AYS A;  2R71 A;  1LAH E;  4QSC A;  4LQ2 A;  3KG2 A;  3Q27 A;  1MXY A;  1POY 1;  5IKB A;  1NNF A;  1J1N A;  2F34 A;  1OQG A;  2QSX A;  3WAE A;  3OMB A;  2O51 A;  1P1U A;  3DM0 A;  4BDL A;  3L6H A;  4JWO A;  4YMA A;  3V83 A;  3P7I A;  1LCT A;  1IXH A;  1IUD A;  2FA7 A;  1D9Y A;  4F1Y A;  3JZJ A;  3TTM A;  2P0S A;  4G68 C;  4LA9 A;  2DWA A;  4KQP A;  2B3F A;  3CFX A;  3PD9 A;  2REJ A;  1NH7 A;  4JXI A;  3OO7 A;  3EF7 A;  1XHY A;  1XOC A;  2HEU A;  3E13 X;  2XXH A;  5CMM A;  5H8F B;  4U4S A;  1N0T A;  4RXL A;  4R75 A;  1WOD A;  2AIX A;  1QKA A;  3KN8 A;  1EZ9 A;  1B5H A;  1IXI A;  4QSD A;  4JB7 A;  4R9G A;  2DWH A;  3QYT A;  3G3I A;  3HHG A;  3N5L A;  1B3G A;  3QUF A;  3TTL A;  1LCF A;  1N04 A;  3VXC A;  1FTO A;  3Q25 A;  4IGR A;  3IO6 A;  3LSF B;  3S9E A;  2I4B A;  5I2K A;  1MXW A;  3M3L A;  3IOU A;  1R1N A;  5FHO A;  3PPN A;  4GD5 A;  2DS9 A;  2Q2A A;  4YMB A;  3FV2 A;  5F1Q A;  2QPQ A;  2ZYK A;  4P0G A;  4GRK A;  2OZZ A;  2DE2 A;  4H8I A;  4M4G A;  4ZEC A;  3TAJ A;  1FQF A;  4KFQ A;  3G3K A;  2V3Q A;  2R6G E;  4OYV A;  3LUY A;  4OQO A;  1POT A;  2Y7I A;  1A54 A;  2Q89 A;  1UTB B;  4LAT A;  3EQ1 A;  5DEX A;  3G3H A;  4DZ1 A;  1Y1Z A;  1LAX A;  1VR5 A;  2ESN A;  3EPE A;  3IK6 B;  4KCD A;  1NNP A;  2GH9 A;  4OFO A;  4MF3 A;  5CBS A;  2I48 A;  2CMO A;  3HO7 A;  5H8Q A;  3U92 A;  1Z7N E;  4H5G A;  1B4Z A;  5TP9 A;  2HAV A;  3A09 A;  4LZ5 A;  3PGF A;  1LST A;  2DVZ A;  3R6U A;  4ZS9 A;  5TPA A;  4O3C A;  1M5E A;  1B7Z A;  2NVU B;  1XS5 A;  3B6Q A;  3RGY A;  1MXX A;  5ITP A;  3VFJ A;  4NWC A;  2B65 A;  3MAM A;  3K0V A;  1TT1 A;  3USD A;  3O2A A;  2A5T B;  1URS A;  1MXV A;  1AMF A;  1B3L A;  1Q35 A;  2I58 A;  4Q30 B;  1MH4 A;  4OER A;  4XIG Q;  4G8N A;  2Z8D A;  3CFZ A;  3V5A A;  3DP6 A;  2XXI A;  4DXB A;  5H8H A;  4YAH X;  1SVX B;  1A55 A;  3TTN A;  1BP5 A;  4NF8 B;  1MY2 A;  3DP8 A;  4ZEB A;  2F7A A;  1IEJ A;  1RYO A;  3FIR A;  3H6T A;  3FXR A;  3T96 B;  3FUZ A;  4DXC A;  1QUJ A;  1T0K A;  1FTL A;  3HV1 A;  5ITO A;  3N6T A;  3PPR A;  2RC9 A;  4N13 A;  3THI A;  5AA2 A;  1XVX A;  1IXC A;  4FJP A;  4F3P A;  3IR1 A;  1MY1 A;  3IJO B;  1USY E;  2XX9 A;  3VLV A;  4YKI A;  4F1U A;  4GIZ A;  1ZIU A;  4NMY A;  1P1N A;  4R72 A;  5AA4 B;  4PFU A;  3MP6 A;  2D3I A;  2DSF A;  3TCF A;  4EF1 A;  5L8D A;  5DT6 A;  1DOT A;  3MPK A;  3KN7 A;  1XVY A;  2I3V A;  4U1O A;  3QIM A;  3VLW A;  2DOJ A;  1B0L A;  2V93 A;  4IGT A;  3O97 A;  2X26 A;  2F7B A;  3MP8 A;  2QRY A;  2ZYO A;  4H67 A;  1A7L A;  3IOW A;  2NWJ A;  3MVY A;  4FEC A;  4HW8 A;  2HZL A;  1D3K A;  4JSD A;  1UTH A;  2QS4 A;  1Q1K A;  5A5X A;  5CC2 A;  1NKX A;  4LZ7 A;  5AA1 A;  4U1Z A;  5CM6 A;  4MH5 A;  3W9W A;  2HCA A;  1LB9 A;  1TFD A;  2THI A;  2VP1 A;  3K6X A;  4C1T A;  4RPO A;  1LAG E;  4F22 A;  3TEP A;  1ZLQ A;  4IO4 A;  1BKA A;  3FXQ A;  3TUS A;  4NF8 A;  3FVN A;  1GGG A;  3R26 A;  3ILT B;  2H98 A;  3MZ9 A;  1JW1 A;  3UIF A;  4N07 A;  2RCB A;  3ZSF A;  3IX1 A;  4O3A A;  4LVQ A;  1B32 A;  5ISU A;  1YTV A;  3FD3 A;  3OEL A;  3KBR A;  2G29 A;  1MS7 A;  2PX1 A;  5K2Y A;  3M8U A;  2ZXT A;  4YKK A;  4AB6 A;  4UAC A;  1NMU A;  4YKP A;  3O6I A;  3QXM A;  2OJT A;  2F78 A;  1UIU A;  2D5W A;  1Y3N A;  3CG1 A;  3S9N C;  1AL3 A;  3IB2 A;  4NTL A;  3MBP A;  4G77 A;  4ZEF A;  3ZS6 A;  4R6H A;  4TOZ A;  3U1O A;  2F35 A;  1WDN A;  4RNS A;  4BDM A;  1SW2 A;  4ZEI A;  1B0H A;  3RN8 A;  1B7H A;  1PDA A;  1LLS A;  2REG A;  4DE8 A;  3GLB A;  2LAO A;  3CVG A;  1YPN A;  2M8C A;  1I6A A;  3MVX A;  4XTC Q;  4TLL B;  4GXA A;  1DMB A;  2O68 A;  1DTG A;  4GWO A;  4F19 A;  3KZG A;  1OVT A;  3G3G A;  4QFN A;  4I1D A;  3PUV E;  2ABH A;  1AH5 A;  2Y7K A;  4YB6 A;  1WVJ A;  4GVO A;  1B5I A;  4RK2 A;  2DWJ A;  1B3E A;  1NNK A;  4G68 A;  3PU5 A;  4GQO A;  3FVO A;  3O66 A;  1O7T A;  4BDR A;  4BDN A;  3TZA A;  5KZT A;  1LFI A;  2PYY A;  4Q0C A;  2NOO A;  1ZBM A;  4FAJ A;  3HPI A;  1P99 A;  1MRP A;  2QMW A;  4IO7 A;  4ZZA A;  3OSR A;  5H8N B;  3MZB A;  3H7M A;  4E0X A;  4KYE A;  3FVK A;  3C32 A;  3OO6 A;  4R74 A;  3I6V A;  4F18 A;  1XC1 A;  3CI8 A;  3UK4 A;  4GOT A;  3W15 C;  3CSG A;  2ANJ A;  4H6D A;  2XX7 A;  2KLF A;  4FAT A;  2Y7R A;  1AIV A;  4RY1 A;  1MDQ A;  3S9M C;  2I4C A;  3HN0 A;  2F8D A;  5I2N B;  3E3K A;  1HSJ A;  4Q5T A;  3M3F A;  4E0W A;  1NL5 A;  1N84 A;  3JYR A;  4MFI A;  4POX A;  5M2V A;  3M3K A;  4EF2 A;  1JW4 A;  1ANF A;  1FTJ A;  1JQF A;  1TFA A;  4ELO A;  2UYE A;  2Z22 A;  5KDT B;  1B9J A;  1BTJ A;  1JVX A;  5KCJ A;  1MQJ A;  1USY H;  4ZE8 A;  3AXF A;  2Q9T A;  2I6E A;  4KPT A;  2NXO A;  2OK2 A;  3MPL A;  2DE4 A;  2E0S A;  3O29 A;  1US4 A;  2E1S A;  2I0B A;  3S9L C;  5FTI A;  3SEV A;  3T22 A;  5F7V A;  1B51 A;  1EZP A;  2UVI A;  2IA4 A;  3SKP A;  5JK4 A;  4OEN A;  3H6W A;  3PMW A;  4G2Z A;  1UIV A;  1SI0 A;  4RK9 A;  1KWH A;  4LP2 B;  1B58 A;  4OEU A;  3C9H A;  3DEL B;  3ZKK A;  2XXQ A;  1SD3 A;  1FQE A;  2HZK A;  1QUI A;  3E9X A;  3FJG A;  3FJM A;  3LSX A;  2QS3 A;  1UQW A;  2P1S A;  2FYI A;  3LR1 A;  4OET A;  3LBS A;  5DYH A;  3OEK A;  2VD3 A;  3UP9 A;  1TXF A;  2OLB A;  1FQA A;  1SBP A;  4RYA A;  4ZZE A;  5CI5 A;  3K00 A;  1Y4T A;  3PMV A;  4U4X A;  4Z0I A;  4QFL A;  1P1Q A;  4HCY A;  1M5C A;  3KFM A;  4PE5 B;  4YIC A;  5I2N A;  3OD7 A;  4R2F A;  3JV9 A;  3RT6 B;  3SEU A;  1MY0 A;  3LSW A;  1MM7 A;  2XD3 A;  4ZEK A;  2UVH A;  3MC2 A;  3IL1 B;  2UVG A;  4OES A;  1XT8 A;  3OEN A;  4ND9 A;  4POW A;  3CR9 A;  4MLV A;  1EH3 A;  3T9V A;  1LBB A;  3TTR A;  2ALU A;  3BFT A;  5HBC A;  3O9P A;  4NWD A;  3RT8 A;  3GZG A;  1H76 A;  3K02 A;  5L9O A;  1OLA A;  1ZU0 A;  5BWJ A;  3VVE A;  3IO4 A;  2UYF A;  2G93 A;  1URG A;  5H8F A;  5I58 B;  1NNT A;  4QFO A;  2PBW A;  2OBG A;  2Z8E A;  3ECR A;  4Z7E A;  1SQY A;  4I9D A;  3S2V A;  2V3T A;  2GFE A;  1ZTY A;  1HSE A;  5HPQ A;  3TCH A;  2O69 A;  3N26 A;  3WAF A;  4NF4 B;  1H45 A;  3EN3 A;  3O6G A;  4FE8 A;  4IO3 A;  2F6P A;  3T9U A;  3PUW E;  3U8Q A;  4P11 A;  1MY4 A;  3LC8 A;  1LFH A;  4U23 A;  5K2X A;  2B3B A;  2H99 A;  1LBC A;  2YLN A;  4PFY A;  2QS2 A;  4IO2 A;  2WKY A;  4JWX A;  1JET A;  1SI1 A;  2F36 A;  4YU0 A;  1SYI A;  4NF5 B;  5BUU A;  5I56 B;  5J1D A;  3PMX A;  4QF9 A;  1JVY A;  3V8X B;  3U72 A;  2XXV A;  2GRV A;  5ICT A;  2W7Y A;  4C0R A;  2XHD A;  2RCA A;  3H4Z A;  1SW4 A;  2ZNS A;  4R9F A;  1UTB A;  3FXU A;  4GL8 A;  1OVB A;  4THI A;  4X9T A;  4R2B A;  3N6U A;  3OEM A;  2P2A A;  5AE4 A;  1MXZ A;  3MVZ A;  4I8C A;  2F6G A;  3RPW A;  3VDF A;  2ZYM A;  4FIM A;  2RC7 A;  4OWD A;  5DVI A;  3IOT A;  4XKQ A;  4OFL A;  2HXW A;  3B6T A;  4OXV A;  5H8S A;  1H3D A;  1US5 A;  2AL4 A;  1GV8 A;  1MPC A;  4U22 A;  2GHB A;  4IO6 A;  3LSL A;  4KD5 A;  1BIY A;  1CE2 A;  2H25 A;  1PB9 A;  1Y1M A;  3VE1 B;  2A5T A;  2RF1 A;  3FGS A;  1OMP A;  4QFP A;  3K4U A;  5CRY A;  3G7W A;  5I59 B;  3TPA A;  4KYS A;  1ATG A;  5HM4 B;  2O1L A;  4ELP A;  3GXA A;  1R6Z A;  1Y3P A;  4EQ7 A;  3KSJ A;  5I57 B;  4QFK A;  1B3F A;  5CBR A;  3MWB A;  3VVF A;  4XKR A;  3B6W A;  3IAZ A;  4BDQ A;  4Q8R A;  3KN3 A;  3RUM A;  3CG3 A;  5I84 A;  2PT1 A;  3H3G A;  5CMK A;  3EHS A;  1M5F A;  3MQ9 A;  4F2Q A;  3CFL A;  3D4G A;  2ZNT A;  3FVG A;  1A8E A;  4ESX A;  2YJP A;  4EQ9 A;  2H9B A;  3TQL A;  2O7U A;  3SDF A;  4I62 A;  5AA4 A;  3KOS A;  1VFE A;  1GR2 A;  1R9Q A;  4JDF A;  3RLF E;  1MM6 A;  2VHA A;  1TWY A;  3QK6 A;  3IOV A;  2Z23 A;  2RIN A;  2IEE A;  3KSX A;  4O3B A;  2Q8J A;  4IO5 A;  1MDP 1;  1SDX A;  4FOR A;  4EXL A;  4PET A;  4OZ9 A;  3FZV A;  2VD2 A;  3DP4 A;  2XD2 A;  4LON B;  3FAS A;  5CMB A;  1EU8 A;  2AL5 A;  3VXB A;  2BJJ X;  2F5X A;  2OWT A;  2QJE A;  4OVJ A;  1FCK A;  4FED A;  4GFR A;  1SYH A;  4QSE A;  2QS1 A;  4JWY A;  3K1N A;  4TLM B;  4R73 A;  4QHQ A;  3W9V A;  3RY3 A;  3K01 A;  5TU0 A;  1RKM A;  5DVF A;  2XXT A;  4X48 A;  4WKM A;  4WXJ A;  1FTK A;  4YZZ A;  4AB5 A;  1JW5 A;  3ZKL A;  1MG1 A;  4H8J A;  4GL0 A;  1URD A;  2DQV A;  1HSL A;  3BFU A;  1DPE A;  5B70 A;  5I2K B;  2RC8 A;  1BLF A;  1OLC A;  4H0W A;  2OCU A;  2O6A A;  1PEB A;  2V3U A;  3KGC A;  3FV1 A;  4KR5 A;  2RKM A;  1FTM A;  2FNC A;  1IXG A;  1LAF E;  1H44 A;  4EXK A;  4X1B A;  5AA3 A;  3TCG A;  3OO8 A;  3UA8 A;  5DVJ A;  3U93 A;  4NE4 A;  1D9V A;  3IOR A;  2X7P A;  1PB8 A;  1ZJL A;  3ILU B;  3O28 A;  1N3X A;  1I69 A;  1GTK A;  1ELJ A;  1B5J A;  3PPP A;  2I49 A;  1P1W A;  4F39 A;  5EYF A;  3K6W A;  2QMX A;  5JEI A;  4XKN A;  3MP1 A;  3RNN A;  4F3B A;  3EHT A;  2UVJ A;  1B1H A;  1S50 A;  1B40 A;  3KJ7 A;  3CRB A;  5DEX B;  3GBA A;  1QJM A;  4YB5 A;  1Y9U A;  4H5F A;  2OWS A;  2Y7W A;  4DIG A;  3QSL A;  4IB2 A;  4JBZ A;  3H6U A;  4WED A;  3DLN A;  1N3W A;  3Q28 A;  5LOM A;  3T9X B;  4G8M A;  2ZYN A;  2F97 A;  4DCY A;  3FAT A;  3MVW A;  2XX8 A;  5H8Q B;  4ZED A;  3UGW A;  5TP9 B;  1OIB A;  1MQH A;  2O7I A;  3GBB A;  4KI0 E;  4EQB A;  3ODB A;  5TPA B;  1Y3Q A;  4EDP A;  4ELR A;  5H8N A;  3KJT A;  1I6Q A;  1MQI A;  4YB7 A;  1DPP A;  2XXP A;  3CIJ A;  3K1M A;  3FJ7 A;  3HCQ A;  5L9S A;  2HFB A;  4P0I A;  4WEP A;  3C4M A;  4XXU A;  5JTY B;  1B2H A;  5B7D A;  1YAE A;  5DTB A;  4GLI A;  3I3V A;  2DP8 A;  4DCX A;  5H8H B;  3MUQ A;  4LZ8 A;  4ISU A;  4G8H A;  4XKP A;  3PPQ A;  5L9M A;  1MY3 A;  3IB1 A;  2X7Q A;  1MH3 A;  1H43 A;  4GXS B;  5AA2 B;  3V89 B;  1OQH A;  2R9J A;  1QW0 A;  3QAX A;  5KDT A;  1M5D A;  1N76 A;  3N94 A;  4PQJ A;  1JEV A;  2QL3 A;  2ONR A;  5CMC A;  2ZNU A;  1YCJ A;  4MLQ A;  1F9B A;  1B52 A;  2F7C A;  3L6G A;  1Y4C A;  4GF8 A;  4HCW A;  3RTW B;  3PUZ E;  5EHS A;  3QUJ A;  3UOR A;  2DXY A;  3BKI B;  4R6K A;  1VE4 A;  1IIW A;  2O1M A;  2DXR A;  2UXA A;  3I5O A;  2HAU A;  3VVD A;  4F31 B;  3TFL A;  1LGB C;  1O64 A;  4ESW A;  4OMB A;  1NH8 A;  4OFJ A;  4RA1 A;  3MJN A;  3C34 A;  4F29 A;  4ELQ A;  3PD8 A;  3EHU A;  1UTH B;  4FEB A;  5A5X B;  3ONM A;  4C1U A;  5JTY A;  3TTK A;  1R9L A;  4UA8 A;  3TOD A;  1A8F A;  1RYX A;  2VOZ A;  4LQ5 A;  2PVU A;  2Y7P A;  3MZ1 A;  4M1V A;  4K3F A;  1A99 A;  4H1X A;  2CZL A;  4U21 A;  5EHM A;  3SES A;  2XXY A;  2I3W A;  4X1D A;  4DXU A;  3OO9 A;  4BLA A;  3C35 A;  3HST A;  1A40 A;  1FQB A;  2ZMB A;  3TEL A;  3RTF B;  1CB6 A;  3OOA A;  1IIT A;  1LB8 A;  1QKB A;  4PFT A;  3H03 A;  2ONK E;  4F3G A;  4OEV A;  2HQ0 A;  3TQW A;  4EUO A;  3VLU A;  1B4H A;  4PFW A;  1D4N A;  1SW1 A;  3K6U A;  1B05 A;  4NF6 B;  3SER A;  4KCC A;  2XXX A;  3KEI A;  2Z8F A;  5I58 A;  3TMG A;  4BDO A;  3IJX B;  1Y20 A;  3SEW A;  3O6H A;  3VV5 A;  3K2D A;  1B46 A;  2VGQ A;  3RQT A;  1NFT A;  2V25 A;  4DDD A;  4YKJ A;  2DE3 A;  4L17 A;  4NF4 A;  3G3F A;  1B3H A;  1IZ1 A;  1FQC A;  1JNF A;  2DVC A;  4KHZ E;  2Q88 A;  4KYD A;  1S9T A;  2ONS A;  5ELV A;  3SEX A;  3HHF A;  1PBQ A;  1II5 A;  3E4R A;  2PMS A;  5ICQ A;  4NED A;  4NF5 A;  3K6V A;  3C31 A;  5I56 A;  1ZMG A;  1FW0 A;  3PUX E;  1P1O A;  1EZO A;  4JSO A;  1MQD A;  3PUY E;  1Z7M E;  4QRZ A;  4G68 B;  3S4U A;  1N7X A;  1MPB A;  4RJZ A;  4F1V A;  2H5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...