3T1BA

Crystal structure of the full-length aphb n100e variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSELTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
total genus 84
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t1bA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t1bA02
4ENKA 5JVTA 1W5TA 1G3SA 3W6KB 4UNOA 2JRTA 3DKWA 2XUBA 3FXUA 3ISPA 1LDKB 3Q9SA 3HFUA 3RYRA 2H09A 1B6AA 5J8CA 2KJCA 5LLQA 1NHAA 5BPDA 5E8GA 3L2CA 4ESBA 3ZMTA 2P5KA 4MEYF 3H3ZA 5HOOA 1MZBA 1K7AA 2BYVE 1YW8A 3ML6A 2NAZA 4DQ2A 1R36A 4KIGA 3ZMZA 3MWMA 2RC4A 3E3VA 2FF4A 2WWYA 3T5XA 1ULYA 1WKMA 3M1EA 3FF5A 2FMLA 4HBLA 1Z05A 1YTYA 2PMUA 2QWWA 2G9WA 5BOXA 3K2ZA 1EH8A 2VOOA 3WGHA 3V7SA 1RUOA 2ADUA 1R00A 2Q2EA 3ZMDA 3FXRA 2QQ9A 3ROUA 2GXBA 2QQAA 3I71A 5DEQA 6PAXA 3IKVA 4JQFA 1TW3A 1MJ9A 2DLLA 1EV7A 1K78B 4KYWA 2L02A 4I09A 1H9TA 3V4GA 2CFXA 4P96A 1U6GA 1MJBA 4FX4A 2R3SA 2LF8A 1O3SA 1U5TA 2O3FA 4WXCA 2PI0A 4UVBA 1IN7A 2Q0OA 5LHIA 2EWNA 2ISYA 2KIMA 3U1DA 4EV0A 2K02A 1ZGJA 3KP7A 3T8RA 4EQQA 1XGNA 3LQRA 2Z99A 3RKWA 3FM5A 2L4MA 3TOAA 1RZ4A 2GXGA 5FD5A 1FLIA 2H27A 4KMUX 2IA1A 3ELKA 3ECHA 4I0AA 5D6EA 5A2QZ 4KUMA 3WGIA 4HV5A 3HOSA 2XHKA 3FXQA 1LEBA 3CDHA 1IXCA 1ZGAA 4ON0A 3WTWC 2F5CA 3S2WA 1YS6A 1BOAA 3E5QA 5K5QA 2JT1A 4S05A 4KN4X 4I0BA 1OPCA 4M71A 1XSVA 3HHHA 1I1SA 4TV7A 2OQGA 3ZPLA 5HLGA 5LRSA 2OD5A 3HTUA 2HDCA 5IT9Z 1G3YA 1K79A 3LA3A 2DO7A 2OQRA 2Y48A 4U0VA 1KU2A 2PLYA 4EJTA 1IXRC 2XASA 3ZQ7A 4RGXA 1LB2A 3HSFA 3KETA 2A6EF 2NRAC 4XLPF 4AWXB 4JVDA 5BS6A 1J9IA 4LG0A 2FEZA 2DFIA 2E7WA 1R1VA 1T6SA 2DQRA 4IVNA 2IVMA 4IRIA 4FX0A 2NS0A 2DBBA 5FD6A 4IRGA 1LEAA 4B8XA 4G8XA 2CSOA 1USTA 2VODA 1SFUA 2MA3A 2L01A 1L3LA 3VEPA 3IC7A 3J80Z 2VT3A 3GUDA 5F64A 4HF2A 4GYIA 5ED4A 3BOQA 2PN6A 3K1PA 1UB9A 5H6RA 1J59A 1XN7A 2Z9OA 1HBXG 2HEOA 3WU1B 5J6XA 4MEXF 2PEXA 3FMRA 3ZMSA 5JHUA 1FZPB 5FGMA 3KP6A 2EFOA 2DW4A 1D8KA 2O61A 2FBKA 2F5FA 1EH7A 3IHUA 4L0YB 3VB2A 2V1DA 4KIFA 1O57A 3FMQA 3ABTA 1U2WA 2OBPA 4OIOF 1C0WA 1DPUA 1P4WA 3E6BA 5IT3A 3GZ6A 2ETHA 3BDDA 3KP2A 2E7XA 4RGSA 4QWQA 3SZPA 3U9GA 4AVPA 5DCFA 2OAZA 1FBQA 3HSEA 2PBIA 5D5VB 5LHHA 1AWCA 2EV5A 3TKYA 1O7LA 3R0JA 2GQQA 2M8EA 4YFNF 1IN8A 2KIUA 5AONA 1U3EM 2MC3A 1JHHA 5DD8A 3SFZA 3E5XA 1I27A 4XLNF 2IP2A 1FYMA 4ZYGA 3F6VA 1TTYA 3TQNA 3WTTC 2O8XA 1B1BA 2ELHA 3RKXA 5E1WA 3MQ0A 1T2KA 1R58A 2XKPA 1YYVA 4P9FA 3HRTA 2EFWA 3NQOA 4PGGA 4HX4A 1ZRDA 5CVJA 4HOBA 4G7OF 3H92A 3ZMUA 3HRSA 4ENMA 3L9FA 3SQNA 1Q1HA 2IA0A 1ZHFA 3TO9A 5ERIA 1KU3A 2FE3A 3AAFA 2HS5A 1MD0A 2Y0MA 3T8TA 1BC7C 4UHTA 4L9VA 5ILSA 4EM1A 2GIVA 4MGRA 1TNSA 1KA8A 4CO8A 4LLNA 3E6MA 3MFKA 2GWRA 2DPUA 4ZZLA 4KIBA 1S7OA 1XGOA 4M9ZA 2E1NA 3CO7C 2YPRA 4E70A 3RI4A 4I01A 3WE2A 1HKTA 5LGTA 2AXLA 4A0XA 3G3ZA 2R7FA 2JTVA 3F22A 1O3TA 5KVRA 3TDUC 1U5TB 2E1CA 2QUFA 3O2PE 3QAHA 5D5WB 4XRFA 1U5TC 4PDKA 2BV6A 4Q48A 1ZLKA 2HKOA 2A68F 4XSXF 1LNWA 3WTYC 4EMSA 1BI1A 3KLNA 3LAJA 2P6TA 1KU7A 1W5SA 2VBXA 4O5VA 4IF4A 4O6JA 2XAGA 3M7GA 3WTZA 4KT5C 4EVIA 2K27A 3F6OA 2RQPA 1ODDA 1JXSA 4YIIA 4KFCA 4LLLA 2YU3A 3DV8A 1T39A 1F1ZA 2Z3YA 2EA4A 1OMIA 1ZAOA 1J75A 1WI9A 3CTAA 1XDSA 1B59A 1KYWA 1R1TA 2A3SA 3B73A 3P9KA 5D8LB 2CQKA 1HW1A 1R23A 4G6QA 2O03A 5HDGA 2RVCA 4ESJA 3GW2A 5L3FA 2COMA 4OMZA 1XCBA 1IAWA 1QGPA 1G3WA 2UXXA 1IRFA 3OOPA 1UCRA 4Q5SF 2G7UA 1LDJA 3NEUA 1FWZA 4HDVA 1U8RA 1TW2A 2QZ8A 4ETSA 3LWFA 1J0RA 5H6QA 3KLOA 1S6LA 4YG2F 1FBSA 4PCQA 4IHTA 1L0OC 5ICCA 1R5GA 3V8KA 3HOTA 1A04A 1V3FA 5CVIA 3F8CA 4LFUA 2DT5A 2FNPA 5FLXZ 3E5UA 4G6DA 4JBAA 3W6JB 4RB0A 1FC3A 3DXJF 4MTEA 3TOBA 1XCVA 2D2WA 4IJAA 1YLFA 3FM3A 5HS7A 4EJWA 2ZFWA 1ZG5A 1CF7B 1W4MA 2J5OA 4HX7A 4K2EA 2GA2A 3K69A 4HDUA 1XGMA 2XGXA 4AIHA 3KEOA 2ZMEA 4UV9A 3GFJA 3F3XA 2HTSA 3I4PA 1ZYRF 5LEJA 1OYIA 2FU4A 1P4XA 4HYEA 2P7CB 2F5EA 1D5VA 1Z6TA 4A0ZA 3N97A 1LVAA 2QBYB 4HA8A 4EM2A 3KCCA 3ZP5A 1HW5A 4Y13A 3KE2A 1T98A 1TNTA 4L9JA 4YIFA 2ZCWA 3RIRA 2MD5A 4HAMA 3JSPA 3JTGA 4FHTA 3L7WA 3V8LA 3P9IA 3R0AA 4PZJA 2NYXA 4F7ZA 5IT9K 4EGYA 4HW0A 2P5LC 1FP2A 2W25A 4KDPA 3M8FA 1O7FA 3GEZA 3KP3A 1D3YA 1HW2A 2DQLA 3RTRA 2A69F 2EFPA 3OV8A 2BGCA 3VFZA 4NB5A 1QZYA 3P9CA 4ESFA 1IN5A 4UVCA 3BJAA 5D8KB 3R6SA 1CGPA 3BWGA 1ZG3A 4N9HA 2JPBA 1S29A 5ILVA 2RV8A 1YIOA 3I64A 4RB3C 1RIOH 1BI3A 4LG0B 5E1ZB 1HSTA 3DEUA 1B4AA 4IXAA 3ZMVA 4KMFA 4GXOA 2RKHA 2MH2A 2OZUA 2K86A 2V1UA 5EEHA 1LQ1A 4ENNA 5ICEA 3BY6A 3SZTA 1H9GA 2D1VA 1O3QA 2VXZA 2QVOA 2FQ3A 3BZ6A 2HXRA 5L3DA 3HYIA 2DU9A 1X3UA 1YQAA 3ULQB 2HQNA 2HFHA 2IPQX 2VC1A 3BPXA 3MZYA 4PGHA 2P8TA 3GWZA 3BPVA 4HQMA 4L0ZB 4YFKF 2OZ6A 4GGGA 4WCGA 1SAXA 4Z2YA 1FT9A 4G9YA 1QQIA 1RNLA 5H20A 5D4RA 1PDNC 4BXUA 2OA4A 5F1RA 3PQJA 3REOA 3GFLA 2VOPA 1OYYA 3IL2A 4WX9A 3QPTA 2DI3A 5EEGA 1I6XA 2XAJA 2XIGA 4LGWA 4HX8A 4LK1F 2ZBKA 4MQVA 2M5WA 1UFMA 1HKQA 2GA1A 4A0YA 1YO5C 1QNTA 4DNCA 3L00A 1W7PA 1QZZA 3IRQA 5L3EA 3HIFA 2LF7A 1GVJA 2QM3A 4IRHA 1J7KA 4MNUA 4GCVA 2EV0A 4OIQF 3IRRA 3HTSB 3D5LA 2DK5A 4LB5A 4AD9A 2FOKA 3K9TA 4WWCA 2WC2A 5A2QK 5DCMB 2D45A 2L54A 4L5JA 5BPIA 2L4AA 2ZJ2A 4CXFA 3EYYA 1R5HA 4HV6A 4MTDA 1LDDA 2HKXA 4Q47A 1ZREA 3KZZA 3TGNA 1BC8C 4L18B 4BHPA 2UWMA 2ZO4A 3I53A 1KYZA 1XB4A 1BI0A 4LJZF 3MZHA 1Y0UA 3JAMK 2BE5F 3QP6A 5D5UB 1OKRA 3R61A 1FSHA 1LJ9A 1F5TA 4D0PA 3RDIA 3R4KA 3JW4A 5K5RA 1HSJA 2FBHA 2W84A 4EGZA 2STTA 5K1YA 2PJPA 2EK5A 1DPRA 3DQVC 3EQLF 3F8BA 1KQ9A 2MH9A 4GYGA 4EJOA 3EUHA 3N4MA 1FSEA 3BJ6A 2FSWA 2P5VA 3O6BB 1WRJA 2VBYA 4HLXA 4BAYA 2XAFA 4I7HA 1KGSA 4P5OA 5DV5A 1OR7A 2IW5A 1ZN2A 1ON1A 1BIAA 2KIFA 2HYFA 2QBYA 2CGPA 2O6GE 2QQBA 1B9MA 3HRMA 1VTNC 1XSDA 5J8FA 2LSOA 3F72A 2DAOA 3R60A 1P6RA 5DUIA 3DFGA 4M72A 4MHGA 2O0YA 1SFEA 4A5NA 2IRFG 1KQ8A 2QYOA 2PG4A 1QBJA 1ZRCA 2CYYA 3ECOA 5DDGA 4HQEA 4M6YA 4BYYA 2M30A 3GXOA 4WF2A 1WSUA 3CUOA 1IF1A 3H3UA 3FMSA 2JSCA 4JVIA 3DP7A 2ZNZA 3RPQA 5LGNA 4UUVA 2F2EA 3I59A 3JTHA 2XAHA 4ZYEA 3FZVA 4G7HF 2ISZA 5HLIA 5JR3A 2VN2A 4I2OA 1GXQA 3SXYA 4QLCU 4M9SA 4R1HA 1W7PD 1IN4A 3O3KA 2RNJA 1E17A 1XSXA 3T1BA 4AIKA 5LHGA 3RKYA 1FX7A 2M87A 2HR3A 1FBUA 3V7RA 1S8NA 2HQRA 5FB2A 1P2FA 4OIRF 2Z5UA 4CGZA 4Q4ZF 1DP7P 3E6CC 4U7BA 4UV8A 5CVRA 2ACJA 5AIQA 2VONA 4MQ9F 3NRVA 1XDUA 2L3DA 1ZARA 2XRNA 2MLGA 3I59B 5HS9A 2NNYA 1P92A 1TBXA 3GFMA 3GZ5A 5HDKA 4P55A 3EYIA 4OOIA 3HSRA 1FPQA 2W57A 2V6CA 2RDPA 3LA2A 3WGGA 2IA2A 4BQAA 1WWXA 1IXSB 3FX3A 4H0EA 1IN6A 2HWVA 3DPLC 1MDMA 4IPAA 5F6FA 5HVQC 1REPC 3GVAA 5HS8A 1T0FA 4A5MA 1DUXC 3BJOA 3JAMZ 3CLOA 5CVUA 4G94A 2STWA 5D6FA 3RPUA 1BM9A 5E1XA 2ZMEB 2YR2A 4RGUA 1MKMA 4GO1A 3C3WA 2BEOA 2ZXJA 3RJPA 2TDXA 4N9IA 4L5IA 1FOKA 2H6BA 1RI7A 2UZKA 1TQIA 5BMZA 2Q8KA 1BI2A 5JI6A 3IWZA 2G7HA 4CDGA 2FNAA 3KZYA 5ICFA 3JSOA 3HRUA 3T0YA 1JHFA 5TJJA 4OMYA 4UVAA 4CHUA 1Z9CA 2DK8A 2AS5F 1ZRFA 1KU9A 5CJ9A 4ENJA 5L3GA 1BN5A 1MDMB 1IZ1A 2XVCA 4HLYA 1MJAA 4KICA 2M45A 4I98B 3WODF 4M74A 3J80K 4Y17A 1QO0D 1E2XA 3GLXA 3VOEA 2FA5A 5DYMA 1SD4A 2A07F 3I54A 1I5ZA 4B09A 4M9XA 1YW7A 4U7DA 2YX4A 4QBAA 4KA4A 4JK1X 2P6SA 3F21A 4A12A 3Q9VA 5DCMA 1CF7A 4XSZF 4L9TA 2RGVA 4A2UA 2A61A 5ICGA 4FT8A 1OYWA 2XROA 5D5XB 5ILUA 3GX4X 1UHMA 3SHFA 5L3BA 5DUKA 1FP1D 5TRDA 3MEXA 2EA2A 1PUEE 5CVVA 4G7ZF 3QP5A 5CYVA 3BROA 2W85A 5FFZA 2KRFA 4IHSA 4JVCA 3FHZA 1W7PB 1XMAA 2EV6A 3G73A 1RUNA 4KNYA 4NHJA 3F8MA 1TLHB 3EETA 3M9AA 4U0WA 4ASNA 1QPMA 1JE8A 4BH9A 1R22A 3EDPA 3D0SA 5LGUA 1Z6RA 3WU0A 1ZH5A 2LKPA 4AIJA 2XKOA 2VC0A 3I0TA 4RB1A 2V1XA 2BBYA 2JZYA 2P4WA 1ON2A 3FWEA 2LDUA 2A6HF 4M73A 5JFRA 2HYGD 4LB6B 3HHGA 2FBIA 3QOPA 3ABUA 1H0MA 1EH6A 4OIPF 2FXAA 2HOEA 3KFWX 4ZYHA 3QU6A 1YG2A 3TO7A 4CZZA 4OINF 2ESHA 2GZWA 5LEKA 3WE3A 3E97A 4P9UA 1B9NA 3V7CA 1P4AA 1YW9A 2X4HA 1XMKA 3LAPA 3GYHX 3PFIA 3WTVC 1GXPA 4EM0B 2QLZA 2C6YA 1Z1DA 1K6OA 5E18F 1PP8F 2V9VA 1F4KA 3I58A 3KP5A 4S04A 1XD7A 3L09A 2R7DA 2GAUA 3CO6C 4LLGF 2XAQA 2DTRA 3RYPA 3C18A 2CG4A 2A5YB 1S3JA 3K1NA 3PQKA 3IKTA 5LRRA 3WTSC 3J7AO 3HUGA 4HF1A 3TDZC 4EJUA 1SMYF 2PMHA 3DF8A 3F23A 1G6NA 1BIBA 1XGSA 2ZNYA 4UXNA 4WXHA 4RAZA 4ZH4F 3BP8A 1FY7A 1TQPA 1V4RA 2EJRA 4N0BA 4ZYDA 5BQTA 5FLXK 1HXDA 1IUYA 3VODA 2KJBA 2Y75A 2VE8A 3IWFA 2EFNA 1ONVA 5CLSA 3CUQB 3CUQA 3DPTA 1S7AA 1AOYA 1PP7U 1IRGA 3COAC 3CUQC 5AIPA 3LFKA 5KK1A 5L3CA 4OU0A 4R8HA 5K5OA 5DD4A 3CJNA 3P7NA 3I5UA 2VT2A 1Z7UA 1R7JA 3KP4A 4R79A 5HDNA 1J5YA 2VBWA 2MBFA 4HF0A 2PFBA 3QRFF 1ZG1A 1Z91A 1YS7A 4LK0F 3GO5A 3LQQA 1SFXA 1O3RA 1D8JA 1HQCA 2J5PA 2B0LA 4U0YA 1USSA 1J2XA 1JGSA 1SMTA 1FNNA 2M1BA 3E6DA 2EFQA 2WTEA 1WQ2A 5E20A 5HLHA 3C1DA 2H6CA 3F8NA 4RS8A 1R1UA 1HKSA 2D1HA 2IJLA 4CYDA 2X0LA 4ZZDA 3WTUC 3K0LA 1G3TA 1ZLJA 2KKOA 2W24A 3GF2A 3J81K 1U78A 4YFXF 2PQ8A 4A6DA 5E17F 3U2RA 4WK8F 3TO6A 2HTJA 4U88A 2JPCA 3LA7A 4L9NA 1STZA 2FRHA 2UXNA 1T38A 1MGTA 4A6EA 2ZKZA 4RGRA 1F9NA 3WG9A 2RN7A 2LNBA 3ERED 2QENA 4O3MA 2VE9A 1FYLA 1BBYA 2HGCA 2P7VB 1SD6A 2CO5A 4WXDA 5D4SA 1GHCA 3Q5FA 2YX7A 2ESNA 2K7LA 4LD5A 4NQWA 1DDNA 2Z33A 3M8EA 2F5DA 1IW7F 2OU2A 2DPDA 2V79A 3F8FA 2YSRA 1K78A 4LMYA 2K4JA 1TQMA 2CWEA 4M6XA 3KEQA 1YFHA 3V8JA 3ZN1A 3WTXC 1KQ0A 3MCZA 4BHBA 5LBQA 2XV4S 5FO5A 3MAJA 1I1GA 1FYKA 3K1MA 4CICA 1SD5A 3LSTA 4KN7X 5FFXA 3QPHA 4Y15A 4BNCA 4RAYA 2IT0A 1UHWA 2CW0F 1BJAA 4HZFA 3ZN0A 2EB7A 4BHCA 3QU3A 3J81Z 2K4BA 2VBZA 2FMYA 2H94A 3GFIA 3C7JA 4EJVA 2HZTA 2NNNA 4RB2C 2MLKA 2WV0A 1G4DA 4I02A 4XBFA 5E8IA 3B02A 1SD7A
chains in the Genus database with same CATH superfamily
1VR5A 3DTIA 4N07A 5DW8A 3FIWA 4OYVA 4ENKA 5CRYA 2NOJB 3SEZA 5FKOA 2ONKE 3OSRA 5JVTA 2GQ1A 2WAEA 1W5TA 1G3SA 4F93B 4IB2A 1RKMA 1H43A 1NI9A 3W6KB 4UNOA 3CJRB 2JRTA 3KPHA 3DKWA 2XUBA 2OWZA 3FXUA 3G3GA 1HSLA 4F39A 3K6XA 3ISPA 1LDKB 5FLMJ 1ZR4A 3Q9SA 1B2HA 2XXPA 3HFUA 4QFKA 3U1OA 1MH4A 1TL8A 3RYRA 1D0ZA 2MABA 2H09A 2HAUA 5EYHA 1WVJA 3L2UA 1PBPA 1B6AA 2A5TB 5J8CA 2HI3A 4L5EA 1AL3A 4QXDA 2KJCA 5J4YA 4F91B 5LLQA 2V9PA 1NHAA 5BPDA 2VPNA 5E8GA 3OYBA 3S4UA 3L2CA 4ESBA 1IRXA 2PYYA 4BDZA 3ZMTA 1Y1MA 2P5KA 5JHFA 5DTBA 4MEYF 2L7FP 3LSGA 4OFOA 3H3ZA 5HOOA 4GWOA 2UVGA 2OWSA 3QYBA 1MZBA 1K7AA 4PE5B 2BYVE 1YW8A 1E3HA 3ML6A 4D9JA 4JXIA 2NAZA 5JTYA 4DQ2A 2VP1A 1SAUA 4MH5A 1GV5A 4XLHA 1R36A 3OD7A 2Z23A 4KIGA 3ZMZA 3KYLA 3MWMA 3AKZA 1RRJA 1SEUA 2RC4A 3E3VA 3FVNA 4ZEIA 2WBDA 1WVRA 3CC4I 1M1EB 2VJ5A 4OTEA 2FF4A 2WWYA 4Y52J 1MY4A 4D1QA 3T5XA 3U21A 3DLLF 3OO9A 1MMGA 2DA7A 1ULYA 1ATGA 4CSWA 1WKMA 4B44A 3M1EA 3G3FA 2KQZA 2ONSA 1P99A 4OMBA 4P56A 1OLCA 3FF5A 1YHQI 2PVUA 2FMLA 3VLWA 3OR1C 4HBLA 3OYLA 4BGDA 1Z05A 3K7AJ 1YTYA 2XWVA 2PMUA 2BHYA 3G3KA 4R75A 1RYOA 2F4OB 5ITPA 2QWWA 2G9WA 2VI6A 3S9NC 3FIRA 5J16A 5BOXA 3K2ZA 3FHNA 3MN2A 5FKLA 5CI5A 1S7EA 2GLOA 4R2BA 1JKOC 1EH8A 2VOOA 3WGHA 3L6HA 3KEYA 3V7SA 1ZMGA 2V4JC 3BR3A 3ZRGA 1XS9A 2ADUA 1R00A 1RUOA 2Q2EA 2ECCA 3MKLA 3U1KA 4E7JA 4IHWA 3ZMDA 4PDHA 3FXRA 2QQ9A 3K4KA 3MD2A 3ROUA 2GXBA 2L9NA 2QQAA 2BZTA 3I71A 5DEQA 4RM3A 6PAXA 3IKVA 1VQKI 3WAFA 4JQFA 1TW3A 1MJ9A 1OCCH 2DLLA 3LSJA 3ZQIA 1EV7A 3OO6A 2NXNB 2M4KA 1K78B 4NQ8A 5I58B 4KYWA 4HE2A 2L02A 4OAYA 1UHSA 4I09A 1H9TA 5I2KB 3V4GA 2CFXA 2ZSIB 1U6GA 4P96A 5GAGJ 1MJBA 1VFCA 3USDA 1NFTA 3G4SI 1LSTA 4FTHA 4FX4A 1ZJLA 4RPOA 1FQDA 2PFYA 2R3SA 2LF8A 4D5FA 4EATA 5IOYA 1U5TA 1O3SA 2O3FA 1MDQA 1ZIUA 3HPIA 4PFWA 4G4PA 4WXCA 2PI0A 5I56A 1Q1KA 4UB8C 4ZECA 4UVBA 1IN7A 3V89B 3T66A 2F7BA 3Q29A 3OEMA 3PFYA 1TT1A 2Q0OA 3UP9A 2XGEA 2QSHX 1HC8A 1IXIA 2KIQA 4GRKA 5EZHA 5LHIA 1RDZA 4MNIA 2EWNA 2ISYA 3CCUI 2KIMA 5FROA 1WJAA 2H8WA 3MMYB 3U1DA 3SZGA 2K02A 4EV0A 1LB9A 1ZGJA 4IO7A 3ZKLA 5HPQA 1IMFA 4IQ4A 3W6VA 3KP7A 3LV0A 3WHBA 3T8RA 4EQQA 3VXCA 3ASNH 1B46A 4F2OA 1XGNA 5ICTA 1FQEA 3LQRA 3DBHB 5EYFA 1WJFA 2BY2A 2Z99A 4XM3A 5LFAA 2R7XA 3RKWA 3ZSFA 2XD2A 3KG2A 4WXJA 1BP5A 4FASD 3FM5A 2L4MA 3TOAA 4A3IJ 1FBHA 1NKXA 1Q9DA 2EZHA 2Z8FA 3KBRA 4BDQA 1FIAA 1RZ4A 4W97A 4BDLA 2GXGA 3Q25A 5FD5A 1FLIA 2H27A 2G29A 4KMUX 3CR9A 2IA1A 3SDBA 4XRSA 3ELKA 3BG9A 2ZXHA 3ECHA 1UQWA 5FKMA 2CMOA 4I0AA 5D6EA 2IS6A 4GF8A 1Q1VA 2Q8JA 1LE8A 1II5A 2UVJA 4OEUA 5A2QZ 4KUMA 3WGIA 4HV5A 1NV2A 2HYJA 3HOSA 2XHKA 3FXQA 3HJEA 1KA0A 1LEBA 3CDHA 2L2OA 3CG3A 4M3EA 3PMVA 1IXCA 1UELB 4GL8A 2EZLA 1RESA 4DYQA 1ZGAA 2X6OA 1JP4A 1UIUA 3LSLA 1RYXA 4ON0A 3WTWC 1MG1A 2F5CA 2X6WA 1AMFA 4GXSB 3T9UA 5CBSA 1MQJA 5CC2A 3S2WA 1FPLA 1YS6A 1Y3PA 4BDRA 1US4A 4LIVA 1BOAA 3E5QA 5HLTA 5K5QA 4DZ1A 2H9BA 3S3NA 2JT1A 2RF1A 3ZGKA 2HZLA 4F3QA 4S05A 2KPMA 1X1CA 4KN4X 4DZJA 4I0BA 1XTAA 3UORA 2KT0A 1OPCA 1TWCJ 2XXYA 5K2YA 4M71A 4ZE8A 1XSVA 4OETA 5IP7J 3MQ9A 4BDNA 1Y20A 1BR1A 3MC2A 1Y4CA 3BQZA 3TW7A 3HHHA 3FKIJ 3CMEI 1I1SA 1R1NA 2F34A 3D1RA 3GBBA 3R26A 1MMAA 3H9JA 5EDNA 3C32A 4TV7A 2X7QA 1SFOJ 3KC0A 4PE3A 5EQ8A 3BR6A 5DYHA 4G68B 3PPRA 2OQGA 3RYDA 4A3FJ 1VSOA 2XA5A 3CCRI 3ZPLA 2ZXTA 1UAAA 5HLGA 2L5VA 5LRSA 1GV8A 1Y8QB 1G59A 3ZQQA 2I0CA 3M3LA 3VWBA 2OD5A 3S2DJ 3C2GA 3HKZA 3A09A 1WJCA 3HTUA 1VQ9I 2CUJA 2HDCA 4GWSA 4NC8A 5K2XA 5IT9Z 4X48A 4PJJA 3D5SC 2KR0A 1Z67A 2E2JJ 2RAEA 2Q2EB 2M4GA 2JK3A 1FMWA 3S3OA 1G3YA 4GL0A 1K79A 2OCCH 1QJMA 2DDAA 2K3FA 3TCFA 1IEJA 4OANA 3LA3A 4XLFA 2LYCA 2DO7A 2OQRA 1SVXB 2Q2AA 2Y48A 3MVXA 4U0VA 2ID3A 5FRMA 4OEVA 1EZ9A 3RQIA 1KU2A 2IGKA 2VKEA 1OVTA 2O68A 2PLYA 4EJTA 1IXRC 3O8HA 4GWYA 5JLWA 1Z21A 2XASA 3ZQ7A 4RGXA 4YB5A 1LB2A 2LP0A 2IEEA 3HSFA 4F3PA 4NDLA 3EUKL 4B3XA 1I39A 3EKIA 3KETA 2QMWA 1SANA 2A6EF 1A40A 2ZYOA 5L9SA 1MSFC 3T22A 1FW0A 3HB9A 3EUHC 2HDDA 2NRAC 4NUBA 1YAEA 4XLPF 2THIA 4FQGA 2DE4A 4AWXB 2X1DA 2E19A 5IKBA 3MW0A 2VHAA 4JVDA 1DPEA 4GD5A 2X7PA 4ELOA 4F3SA 4ECFA 2FUG2 5BS6A 1J9IA 4LG0A 2FEZA 2DFIA 2E36A 2DOJA 4O7MA 1QRYA 2EH3A 1LBBA 1WGXA 2QF7A 2CZHA 1SQYA 2WADA 2CEXA 2E7WA 2H1KA 1R1VA 1IMBA 4XNFA 1W36D 1T6SA 2DQRA 1OCZH 1GT0C 4IVNA 4QHQA 2OUMA 2IVMA 4IRIA 4FX0A 2NS0A 1BJZA 2DBBA 5FD6A 1FQAA 1LBXA 4IRGA 2HNHA 5C4XJ 3RPLA 3T93B 3VLVA 2VPOA 3ZS6A 1LEAA 1EA3A 4B8XA 5DVJA 2WY8Q 5IY5H 2ZNSA 4G8XA 1SFKA 1XC5A 2CSOA 4RBOA 5AA2D 1USTA 5I57A 3O6IA 2HQ5A 2VODA 2Q2CA 3TCHA 4R73A 5BWJA 2LRDA 2V9KA 1AIVA 2HVRA 2L9SA 1SFUA 1H88C 2MA3A 1AU7A 5H8FA 2L01A 2M9HA 3DKYA 3GZGA 1L3LA 1H76A 3TYHA 4NF5A 5KHDA 3FV1A 1WCMJ 2KQRA 1VQ4I 3DTKA 1LFIA 1N3XA 5EQ9A 3SETA 3VEPA 3IC7A 3J80Z 3OYCA 4AIDA 2Y7IA 4Q8RA 2LREA 2ELKA 2VT3A 4NX1A 2CQ7A 3GUDA 1K9YA 2H98A 4PP0A 1PVEA 5F64A 4HF2A 4H67A 4GYIA 4KQPA 4JX4A 4UUTA 4XKWA 5ED4A 2A5TA 3KN3A 3BOQA 1NV7A 4DYRA 1NV4A 3A4CA 4LP2B 2DCEA 2Y9YA 2ONRA 3WU2C 5E3NA 4CA0A 2PN6A 4PFUA 3K1PA 5FRNA 4PGPA 1UB9A 3GZNB 4PK4A 5H6RA 4KYDA 4Q5TA 1J59A 4R2FA 4OERA 4UABA 4F22A 1XN7A 2Z22A 2H25A 4C9YA 4IZZA 2Z9OA 3K4JA 3NOHA 2VPRA 3GTKJ 1VQOI 2X9DA 1HBXG 2PJRB 2HEOA 3PGFA 2PJRA 3OYGA 3WU1B 4XICA 3OSGA 1P7JA 5J6XA 1VNDA 2Y7PA 2ABHA 3CHGA 4MNCA 4C1TA 2ECBA 3M8JA 4MEXF 1TWAJ 1Y0NA 2PEXA 4RA1A 3FMRA 3ZMSA 2GM4A 5JHUA 1FZPB 5FGMA 4F31B 1WJEA 3KP6A 2G93A 2EFOA 4Q30B 1G0HA 3O2AA 1JQFA 1WH7A 2DW4A 4LG3A 1D8KA 2O61A 2FBKA 2PFZA 2F5FA 4OENA 3AL0C 4KT6A 3HDDA 4AM3A 1X2NA 3CSGA 2DT7B 3DELB 4AS4A 1EH7A 3IHUA 4L0YB 3MWBA 3VB2A 5J1DA 1N25A 3WHCA 1W0UA 3RN8A 2V1DA 4KIFA 1O57A 2N8GA 2XPVA 4DYCA 3FMQA 3SEXA 1EYIA 1XG1A 3RKQA 4JWYA 3D1NI 3PUFA 3ABTA 1LGBC 4HTGA 2KZVA 2P0WA 3HL2A 3LL7A 4PJMA 5H8HA 2E5ZA 1X2MA 1U2WA 2OBPA 3M07A 4MLVA 5C3EJ 4OIOF 1C0WA 4H5FA 4X9TA 1DPUA 1IMCA 3I4NJ 1P4WA 3LMMA 3E6BA 3SFIA 3K6GA 4R6KA 2UVHA 2W00A 4D7NA 1Y1VJ 1H45A 2BY0A 5IT3A 3H0GJ 1PB9A 2DMPA 4YAHX 4ELQA 2DOFA 3GZ6A 1POY1 2ETHA 3BDDA 3KP2A 2I3VA 2E7XA 4KI0E 1LFBA 3IOWA 2VLAA 2CU7A 1Y6IA 4DIQA 1MQDA 4RGSA 5CQGA 4N6DA 4NC6A 1UG0A 4M6VA 4QWQA 3SZPA 1QU3A 3U9GA 4H46A 4AVPA 3U93A 2RINA 2LKSA 3TW6A 4NF8B 3GTGJ 5DCFA 2OAZA 3U94A 3TQWA 3PSFA 4YMAA 1FBQA 2EIJH 4RJZA 3HSEA 2PBIA 2LKXA 3MZ1A 5I84A 5D5VB 2YLNA 5LHHA 3JCUC 1AWCA 2XF5A 2K9SA 4A3BJ 2EV5A 1XOCA 4OZ9A 3FV2A 5F24A 1R9QA 3TKYA 1O7LA 2Q89A 2CV0A 3R0JA 3CESA 2GQQA 1RDYA 2PT2A 5KDTA 4EQBA 2M8EA 3CJQB 1MMNA 1AA7A 4IO5A 4PCDA 4C2TA 4J00A 4ZS9A 3U65A 3IK6B 4Y7NJ 1Y9UA 4YFNF 3V42A 1IN8A 2KIUA 3LOCA 3QQAA 5AONA 1HCRA 5I59A 2B3BA 1U3EM 3E4RA 4GOTA 2MC3A 1WJ5A 1E3PA 1JHHA 2DMUA 5B66C 1B9JA 4POWA 5DD8A 3SFZA 3E5XA 1GVDA 3Q26A 1ZK8A 4E0XA 1I27A 3TL4X 1X58A 4LQ5A 1QHHD 4F2QA 2KRHA 4XLNF 2IP2A 3HV1A 5J4VA 1JUSA 4ZYGA 1FYMA 3PPQA 3F6VA 3CCMI 1UTBB 4P0GA 1TTYA 4MFDA 4BU2A 3TQNA 3A29A 4PFOA 2CV2A 1DU6A 3GBGA 3WTTC 2O8XA 1B1BA 2ELHA 5FBPA 3RKXA 1JUMA 2KDOA 5E1WA 3LSPA 2ZC2A 4EEFG 1ETXA 2VQLA 3OIQA 4A3LJ 3BIHA 3MQ0A 2VASA 1OISA 4LIUA 3HOWJ 1T2KA 2O9LA 2DFEA 3O6HA 3N6UA 1R58A 3IH2A 2XKPA 1B40A 1T0KA 1YYVA 4P9FA 4GFBA 3W15C 4C0RA 3S9EA 3LSMA 1W36C 3J7AY 1MBKA 3HRTA 3NQOA 2EFWA 4PGGA 3TTMA 4HX4A 3QUFA 2ZB9A 1ZRDA 5CVJA 3FBIB 4HOBA 1MM7A 4XKRA 1IV8A 4G7OF 5IM2A 4AYBA 3E3KA 3H92A 1ZGWA 2WEFA 3EHUA 3PV0E 4XXUA 3ZMUA 3HRSA 4ENMA 4NF4B 3L9FA 3SQNA 3HOUJ 3SEUA 2QVUA 1Q1HA 2F7CA 4QSCA 4XTCQ 2IA0A 1MQHA 1X19A 2B7EA 4ITVA 1QHGA 1ZHFA 2Q9TA 1QVSA 3TO9A 2GHBA 5ERIA 2VB6A 2R5YA 1KU3A 5AA3A 2FYIA 2FE3A 3AAFA 1HDDC 4H0WA 4E0WA 1MY1A 2HS5A 1MD0A 3LC8A 2Y0MA 2DDBA 5HBCA 2E2IJ 2ME0A 3T8TA 3TPAA 4XMYA 3F11A 1BC7C 3V83A 4UHTA 4L9VA 5ILSA 4EM1A 4O94A 2GIVA 3P7IA 5TP9A 2WAFA 3Q0UA 4MGRA 1Z77A 3MZ8A 3BKIB 2OWTA 1TNSA 3JRIA 2Y2ZA 5GAEJ 2AO9A 3PUYE 3A0HC 3PD9A 4ZDOA 1O7TA 3MZBA 1T56A 2CEYA 2A5WA 1KA8A 2O1MA 3N5LA 4AB5A 3OS2A 4ZDPA 3PJRA 4UA8A 4YICA 2V4CA 1RR7A 1CQTA 4A3MJ 2HXOA 2QS4A 4CO8A 4LLNA 2ZMBA 3E6MA 3MFKA 2GWRA 2DPUA 2P81A 2F97A 4XR6A 4ZZLA 4KIBA 2Y5LA 1V5EA 3OS1A 4DJAA 4MNPA 1S7OA 2CQQA 3N6TA 1XGOA 4M9ZA 2XXXA 1NV3A 2E1NA 3CO7C 2YPRA 1YITI 1F9BA 1MRPA 1ZU0A 4OWDA 4E70A 3RI4A 4I01A 3WE2A 1JKPC 1IITA 1HKTA 4H8IA 5LGTA 2AXLA 4A0XA 1A54A 4BACA 1N3WA 3LSRA 1LBCA 3G3ZA 3Q27A 3MVWA 2R7FA 2JTVA 3SESA 2CUFA 4CCNA 3CF5F 1LLSA 4PJ0C 2H4IA 3F22A 1O3TA 4IO6A 5KVRA 4UY8I 2LOOA 3TDUC 1U5TB 3QYEA 1MXUA 2E1CA 1JNFA 2QUFA 4BS9A 1NL5A 1FOWA 2W82A 3O2PE 4Y33A 2KMUA 1LCFA 3QAHA 1I6BA 1BL0A 1U0JA 5D5WB 3PUVE 3PTYA 1J1NA 1OCRH 1U5TC 4PDKA 4XRFA 3ZQGA 4B47A 3B8BA 4HEA2 2H1LA 4Z0IA 3TTNA 4F3GA 2I3WA 2BV6A 1NMUA 3KOSA 3OYNA 2XAUA 1LAGE 2NVTJ 4Q48A 1ZLKA 2P3NA 1A6IA 4NE4A 4B43A 4X6AJ 4XKVA 4JX5A 1SYHA 4O3BA 4AQ4A 3HHFA 5IP9J 2HKOA 1YPNA 1MPBA 3GXAA 2A68F 4XSXF 4B1RA 1LNWA 4PJNA 4RLQA 3WTYC 2WV1A 4EMSA 5M5WJ 3KIOA 4HSRA 3O9PA 3BTIA 1DPPA 4G8NA 3CF2A 1FIPA 2HU9A 5M3MJ 2KRCA 1BI1A 1FBDA 4I99C 1MXWA 1PBQA 2F36A 5IGAA 3KLNA 4ZDLA 5FHNA 3SERA 3KN8A 3LAJA 2XB0X 5CM6A 2DDKA 3DEEA 1W5CC 5B5EC 2P6TA 3PUBA 1D9YA 2O7UA 3OEKA 4RXLA 3SEWA 3UIFA 2VT5A 1UTBA 3K4UA 2UYFA 3H36A 1KU7A 4BY1J 4EXLA 2DWHA 3H5RA 3VYRB 2DA1A 3QYTA 1W5SA 4U21A 2VBXA 4U2RA 2XF6A 4O5VA 1P9QC 4IF4A 4O6JA 3S1NJ 2XAGA 3M7GA 3WTZA 1POTA 4H5GA 4N81A 4P1EA 3LSHA 5EJCA 4A3DJ 3W2AA 3U8QA 5KCJB 3K4MA 3E1SA 4KT5C 4EVIA 2K27A 2PX9A 4JX6A 5EG0A 2NVQJ 3K2DA 4GFRA 3HZJA 4DLDA 1JVYA 2TCTA 4XRMA 3W2WA 1G2HA 5T3JA 3F6OA 2RQPA 1ODDA 3H35A 3HUGB 3LSWA 3MZ9A 1JXSA 5IP6A 4YIIA 3L6GA 2BOLA 4KFCA 4EF2A 4LLLA 1DK4A 3IJXB 1FTTA 2YU3A 3KBZA 4E4HA 4IKFA 1JEVA 4FETA 1B3FA 3DV8A 1T39A 1MM6A 3H0DA 1F1ZA 5GPAA 1X1AA 4XFEA 4BUPA 1DTGA 1F36A 1OLTA 2EA4A 2Z3YA 3PNTA 1OVBA 3AG3H 1OMIA 1RKWA 2JRMA 1X1BA 1EH3A 1ZAOA 1FPJA 2PT1A 3BFUA 4LONB 1J75A 2R4GA 1IO2A 2ZSHB 1WI9A 1K9ZA 1F43A 4CCLA 2DA5A 2FIEA 1B5JA 1N04A 2R9JA 4H65A 3CTAA 4OVRA 1XDSA 1B59A 1KYWA 1R1TA 2A3SA 3JRGA 3B73A 1NUZA 2B63J 3P9KA 3A03A 5FKKA 5D8LB 1AKHB 1MSEC 2F35A 3AG4H 1PDAA 2BJIA 2I49A 4BLAA 1VF9A 2CQKA 1HW1A 4BJTA 5M2VA 1R23A 4G6QA 3GBAA 3TDJA 1GVCA 1D1AA 2VGQA 2P2AA 3TP3A 2O03A 3S2VA 3DWLE 2VQCA 3JRFA 1FPBA 5HDGA 4P0IA 4PFPA 4NF5B 1BK4A 3SKPA 1R4NB 1ZTRA 2RVCA 3MVPA 4ESJA 3GW2A 3K70D 1K4SA 4XONA 1M5CA 5L3FA 2COMA 4OMZA 1XCBA 4OAZA 3HG9A 1IAWA 5DM7F 1B1HA 3CMAI 2I4BA 1XPXA 1QGPA 3HC7A 4FJPA 4PBQA 4YRVA 2L9RA 2KISA 5ET5A 5B3SH 1TZLA 3EHTA 4OVTA 3F0CA 1G3WA 3C2HA 3QODA 2UXXA 3C31A 1IRFA 3OOPA 3MP6A 1UCRA 4Q5SF 5E3LA 1BW6A 2PMZN 4N4UA 2G7UA 4XQFA 1MMSA 3A3CA 1SDXA 1A31A 1MPDA 2MKZA 5EQ7A 1LDJA 1OCTC 3NEUA 1FWZA 4HDVA 3CFLA 2HOSA 3MP1A 5GPCA 1T08B 1DQUA 1W0TA 1U8RA 3KSXA 3HCQA 4MAGA 1OIBA 1TW2A 2QZ8A 2X26A 1SVMA 4R72A 2NS7A 3CCVI 1JT6A 4ETSA 4PAIA 4QFOA 4GWXA 4XKQA 2EILH 4M1VA 3LWFA 3LSKA 5KCJA 3TAJA 3K02A 1MNEA 1J0RA 2DMTA 1JT0A 1VQNI 5H6QA 4BXXJ 1ETVA 3KLOA 1S6LA 3DP8A 4YG2F 3S1RJ 4H6DA 5E3MA 1NV1A 2YJPA 3WG7H 1B32A 1X4OA 1FTMA 2O7IA 4HS7A 3OYMA 1FBSA 4ZTFA 5CMMA 4PCQA 1FTZA 4IHTA 1URGA 4X1DA 1L0OC 1RKTA 5ICCA 1R5GA 3V8KA 3HOTA 3IOUA 1A04A 3A0BC 1V3FA 2R5YB 3HOVJ 1TWFJ 5CVIA 1PEBA 3JZJA 3SEVA 3F8CA 2FHYA 4V2FA 4LFUA 5F1JA 2CUZA 2Y9ZA 3CSBA 2DT5A 3OYKA 4MO7A 2FNPA 1LBYA 5AA1A 2LY1A 1EKEA 3E5UA 4BKXA 5FLXZ 2OV7A 2GHAA 4G6DA 1ETKA 4JBAA 3CC2I 1IMDA 2RCBA 3W6JB 3H7MA 4RB0A 4M3FA 4JP0A 3RZDJ 3M8UA 1FC3A 3DXJF 3ILTB 5LD2C 5L8DA 1V54H 4MTEA 1TWYA 2LVSA 3TOBA 2XXHA 2K40A 1XCVA 3G1LA 1EF4A 2D2WA 4IJAA 1YLFA 3FM3A 5HS7A 2R7QA 2ZFWA 4EJWA 1ZG5A 5ELVA 3VYSB 1K4TA 1NNTA 3SEQA 1CF7B 3BZCA 1W4MA 2J5OA 4HX7A 2O7OA 2GA2A 3BTJA 4K2EA 1FQBA 4Y4RA 1RDXA 2OBGA 2RCAA 3CFXA 1V5GA 3VDFA 1H89C 3QSLA 3K69A 4AB6A 2OF7A 5FHMA 1ACIA 4HDUA 1INPA 1XGMA 3FK6A 2XGXA 2ZJRF 4AIHA 2XXWA 4YKKA 3T9VA 3KEOA 4J01A 3KC1A 5H8FB 4QTRA 4XLAA 2COBA 2HXIA 2ZMEA 2A5SA 3H3GA 5H8NB 1XVXA 3BTCA 4CYCB 1POGA 1N84A 2RC9A 4P1LA 4UV9A 4QF9A 2IBDA 2R7RA 3K4CA 1OJLA 3GFJA 1JJ6C 5TPAB 3F3XA 2ELJA 2HTSA 3BR2A 3I4PA 4FE8A 1ZYRF 5LEJA 4UUSA 4TLMB 4R9GA 1IGNA 1OYIA 2Y0SN 2FU4A 3QWLA 3PSIA 2VQGA 3IJOB 1UJ8A 3FKJA 3A01A 2ZZWA 4F92B 1P4XA 1R5ID 2WBMA 1TWGJ 4HYEA 3M3FA 1IC8A 2P7CB 2F5EA 4BXFA 1D5VA 1Z6TA 3CI8A 1IUDA 5L9OA 4A0ZA 2Z2SB 2ZJQF 4BBRJ 2QEXI 3SDFA 1B3GA 4MFEA 3N97A 1PUFB 4B4CA 1LVAA 2QBYB 4HA8A 3S1QJ 4DGWB 3CRBA 4EM2A 4IOCF 3KCCA 3ZP5A 2FX0A 2F4IA 2ZNTA 1MXVA 1HW5A 2Y69H 2V25A 3TTRA 4Y13A 2QS2A 3KE2A 4GLIA 3H4ZA 1T98A 1TNTA 4L9JA 4P8BA 4P47A 2WB1A 4LOCA 2ZCWA 4YIFA 1VDWA 4H8JA 2CW8A 3RIRA 2F6CA 3PL8A 5I5PA 2MD5A 3SYTA 2Z8DA 4TLLB 4HAMA 3JSPA 3JR9A 2CV1A 3JTGA 4FHTA 3GTPJ 1G0IA 1NNPA 3L7WA 3I5OA 3V8LA 3P9IA 1SI1A 3R0AA 2EQRA 1OCPA 4PZJA 5F08A 2VD2A 2NYXA 4F7ZA 5IT9K 2DA6A 2IAIA 4HW0A 4EGYA 1GTKA 2CH0A 2P5LC 2F78A 2OCUA 4MFIA 1FP2A 3UGWA 4LUBA 3CCSI 2QGUA 4NBQA 1IV6A 1IUFA 3MAMA 2HOAA 2VJJA 2W25A 1MY2A 2F8DA 3KZIC 3G3IA 3IOTA 3OENA 1A36A 4KDPA 4IR8A 2DN0A 2IGNA 4TQUQ 2XPWA 1KA1A 2JN6A 1MQIA 4H45A 3M8FA 1O7FA 3IAM2 3GEZA 1IXGA 1FSAA 3KP3A 5TGTA 3QIMA 4WKMA 4U23A 1D3YA 1Z7LA 2X1EA 4AU7A 1HW2A 2DQLA 2I5UA 1I3QJ 3RTRA 2MGQA 1MBJA 2A69F 3K0VA 3E13X 2DOAA 1R4MB 2EFPA 3OV8A 1BR4A 2BGCA 2E5NA 3VFZA 1XS5A 4MCOA 3K6UA 1WJBA 4NB5A 1QZYA 1MH3A 3P9CA 4RYAA 1JW1A 3ZQLA 5L9MA 2CRGA 3PUWE 2FQ4A 2AHQA 1TFAA 5EGOA 3U92A 3DTEA 1IN5A 4ESFA 4UVCA 2G0EA 3BJAA 1NH8A 3U72A 5D8KB 3L2QA 4YZZA 3R6SA 3SJMA 1CGPA 1BLFA 3MSTA 3QUJA 3BWGA 1ZG3A 4IEJA 2M7BA 4OWRB 4N9HA 2JPBA 1S29A 3MKZA 2R8TA 4GX6A 4KYEA 5FKNA 3RT8A 9ANTA 3KJ7A 1BR2A 5ILVA 1LBVA 1DCUA 4QRZA 1QA6A 2RV8A 1YIOA 3VVEA 2DE2A 1B5HA 2ZZXA 3I64A 4RB3C 2B3FA 1RIOH 2E1MC 1QKBA 1FPFA 2KLOA 1BI3A 4LG0B 3OYDA 5E1ZB 2JJKA 2VD3A 1HSTA 1LFUP 3DEUA 1CB6A 2CZKA 4I1DA 1B4AA 4IXAA 3ZMVA 4KMFA 2DYXA 3N26A 1B51A 4GXOA 2KZGA 2GOXB 2RKHA 2WAQA 1ERDA 2F3BA 1UMQA 2MH2A 4YKJA 4QSHA 3S14J 2EBIA 2OZUA 2DA3A 3ESWB 4P1WA 1H3DA 4CCKA 1B72A 1K6YA 3W3CA 3IFAA 2K86A 2V1UA 5EEHA 4BY7J 1LQ1A 5GTIC 2P1SA 1UTHA 4UB6C 4ENNA 2JJ7A 5ICEA 1R9TJ 3BY6A 2MSYA 3CIJA 1JTXA 1AWBA 3FVGA 4G2ZA 3SZTA 1H9GA 4KCDA 4ZZAA 2D1VA 1O3QA 4P11A 2UYEA 5DVFA 5E79C 3CMYA 2VXZA 2QVOA 2FQ3A 1D1CA 3BZ6A 2LBFA 3CJTB 2K3PA 5L3DA 3S3MA 1M5BA 3HYIA 2DU9A 1X3UA 2WAQN 2AQFA 3TELA 3I4MJ 5I2KA 1ZELA 2AL4A 2O1LA 1MBEA 1R6RA 1YQAA 3ULQB 2HQNA 2HFHA 3TMGA 2IPQX 2VC1A 2ZFUA 3BPXA 3MZYA 3T9HB 1YOVB 3ZR8X 5AA2A 4PGHA 4CYCA 5CBRA 3NWTA 3GLBA 2GBYA 2VKDA 4IY6A 5ISUA 2P8TA 4U4XA 3GWZA 4NMYA 1H8AC 1YX3A 3BPVA 4HQMA 1YI2I 4L0ZB 4N8GA 3IR1A 4YFKF 1ZKGA 4BJ5C 5EGOB 5J1UA 1PJRA 2NWJA 3KYDB 4QFNA 3IL1B 2OZ6A 4GGGA 4WCGA 1SAXA 2R93J 2REGA 4ELPA 4Z2YA 1FT9A 4G9YA 1QQIA 2Y0SA 3JRHA 2R0QC 3E79A 5JEIA 1RNLA 2QL3A 5H20A 2PX1A 3TCGA 4XL9A 3CCYA 5D4RA 2R7UA 1PDNC 4GRIA 3H6WA 3I3LA 3KOTA 3S32A 4BXUA 1O4XA 1QGXA 1YX5A 2OA4A 5F1RA 3EPZA 3QAXA 1D0XA 3B50A 5I2NA 1VQLI 1JI8A 5I59B 3CDIA 4RLFA 5DM6F 3AXFA 3VV5A 1FTOA 1PB7A 5F7VA 4QSEA 3FBNB 3PQJA 4N4OB 1MNDA 3GFLA 3REOA 4HE1A 4ANJA 2VOPA 1OYYA 2DFHA 5H8HB 3IL2A 4WX9A 3QPTA 3AFHA 1DSNA 2DI3A 1FPDA 5KAFC 3FVOA 5EEGA 1FPIA 4FATA 1I6XA 2XAJA 2LY2A 2XIGA 4LGWA 1ZR2A 4HX8A 3PPPA 4LK1F 3VFJA 2XGDA 2ZBKA 2V3QA 4MQVA 3BC8A 4HE0A 4LZ8A 2XWOA 1XMXA 2M5WA 1MW7A 1SBPA 5B1AH 1UFMA 1SD3A 1DP3A 1HKQA 4M3BA 3IUOA 4A3KJ 2HQAA 1M5EA 3OMYA 1LE8B 4AVZA 3KYCB 4FEDA 2XPUA 2BY3A 4BJ6C 2Y84A 3FJGA 4I3YA 4N17A 5HNHA 2GA1A 1R49A 1IRZA 1N7WA 1FOYA 4A0YA 5CPRB 1YO5C 1LBZA 4C3JJ 1QNTA 4DNCA 3EUAA 1EYKA 4A3EJ 3L00A 4OA4A 5CKTA 1FCKA 1W7PA 1QZZA 4RAGA 3IRQA 1WZ2A 4CCJA 4JOMA 5L3EA 3LFUA 3UN6A 5I7IA 1B58A 3H5NA 4YU0A 3HIFA 2BVMA 2LF7A 1GVJA 5JK4A 2QM3A 2LD5A 5H8QB 4IRHA 4RY1A 1TT5B 1J7KA 4MNUA 4GCVA 4XOTA 3IAS2 2V7FA 2EV0A 4OIQF 4PQJA 3IRRA 1ETWA 2Y7KA 2JA5J 3HTSB 1OCOH 4LA9A 4GBWA 2DJIA 3D5LA 2QA4I 5F0HA 1IJWC 4R74A 1A8EA 1IDYA 4XKCA 4XRSG 1L5TA 3TBIA 2DK5A 1R71A 3OO7A 4HNTA 3HM5A 3GTOJ 1NH7A 1TP4A 1VQPI 4AD9A 4LB5A 2FOKA 2LTPA 3K9TA 2WC2A 4WWCA 1D3KA 5A2QK 3OIOA 5DCMB 1VZ0A 4XK4A 4C3HJ 2D45A 1I69A 2L54A 2XX7A 3C35A 4ABZA 1RR8C 3FXMA 4L5JA 5BPIA 2DFFA 4II3A 1M5FA 2L4AA 2ZJ2A 1FTAA 1FBFA 4CXFA 3O6GA 3CZ6A 4BE1A 2Q74A 3A02A 3EYYA 1R5HA 4HV6A 4IQJA 4MTDA 1LDDA 4BE2A 2PMZA 3VYTB 2K85A 3IFCA 2E1MB 4DE8A 3TKDA 2W7YA 5TISC 2HKXA 4ND9A 4D5CA 3O97A 1MBFA 4KJZA 3MJNA 3K6VA 4DI4B 1LBWA 3TODA 4PBHA 4Q47A 4E7LA 1ZREA 2UUZA 3KZZA 3TGNA 4KPTA 1LAXA 1S7YA 1BC8C 1PYVA 4L18B 4N6PA 5K7HA 4CCOA 4BHPA 2AIXA 3HOZJ 2OC6A 5IZZA 2UWMA 3LSIA 3IO6A 4DBQA 1QUJA 2ZO4A 3I53A 1KYZA 2QSFX 1LAHE 2OZZA 4ZEDA 3I6VA 1XB4A 4CH7A 1BI0A 4LJZF 3MZHA 2VKVA 1Y0UA 1NG7A 3JAMK 3BR5A 2BE5F 1VE4A 2WA0A 3QP6A 5D5UB 1FQCA 4KHZE 1OKRA 2DODA 5M5YJ 1Y3NA 4G8HA 2FOWA 4BDMA 3R61A 3OYEA 2QSXA 2LFBA 1FSHA 4N13A 2H5YA 3JRAA 3DP4A 1LJ9A 4PAFA 4BBSJ 1QUIA 4BQNA 3CP8A 2NVXJ 5F0FA 3GTJJ 2GFEA 5B70A 5HODA 1F5TA 1VQ6I 3ONQA 1IMEA 2CZIA 5AA4A 4D0PA 3BLYA 3RDIA 5IYBJ 2PCRA 3VXBA 3R4KA 3JW4A 4ONYA 1IXHA 5K5RA 2HFBA 3DPUA 3CG1A 1HSJA 3BG3A 3S2HJ 5DT6A 4DBRA 3BZKA 5M3FJ 3MVZA 2E1SA 2FBHA 5A5LA 1X1DA 2W84A 4EGZA 3M3KA 2Y7RA 1GLNA 3BG7A 5HM4B 2ZXWH 2STTA 1B7HA 4F1VA 1A6QA 5GADJ 2XXUA 3IB2A 1NNFA 1WDNA 5K1YA 4R6HA 2PJPA 2EK5A 3HN0A 1DPRA 3DQVC 3EQLF 2ALUA 4DXCA 4AUXA 4FCYA 5IYDJ 2DT6A 2NXOA 3ROJA 3F8BA 4NHBA 5E3OA 1KQ9A 3PO3J 3TEDA 3VPRA 4RA2A 2MH9A 3UKGA 4GYGA 5KNLA 2D5VA 2GRVA 4EJOA 1XVYA 3RUMA 1QPIA 3KX2A 2X85A 3CP2A 2K9MA 4E7IA 3EUHA 1SW4A 1JTYA 3I3VA 4NF6A 2XXVA 3B6WA 1SW1A 3N4MA 4ELRA 1FSEA 3BJ6A 3FXJA 3M4OJ 3LSXA 1URDA 1YJWI 1S5LC 2L5QA 3C36A 2FSWA 2NS8A 2ANJA 3D4GA 2MD0A 2P5VA 3O6BB 4PTKA 3PIPF 1WRJA 1ETQA 2VBYA 2H8RA 2Q88A 4HLXA 4BAYA 4J19A 4RK9A 4BQQA 3OSQA 4V19K 2XAFA 1Y4TA 4I7HA 1KGSA 4P5OA 5DV5A 1VQMI 4Z6YA 1OR7A 3OL3A 2IW5A 3E7LA 2V84A 2W1OA 4G12A 1ZN2A 1ON1A 2NOOA 2O84X 1I6QA 3CC7I 1AOVA 1BIAA 2KIFA 4M3GA 1KWHA 2PMSA 2VQHA 4KFQA 3H03A 2HYFA 3AG1H 3R7XA 1Y39A 4F1UA 4Q0CA 2QBYA 2CGPA 1LFHA 2O6GE 3IORA 1D5YA 2DXIA 2QQBA 4FECA 1X4PA 1B9MA 2GIZA 2E34A 2EINH 3RTWB 1S9HA 3HRMA 2I6EA 1VTNC 1XSDA 5J8FA 1NG6A 4NAPA 5IZ1A 5AA4B 2LSOA 1I3AA 2DAOA 3F72A 5DS9A 2K9QA 2VL8A 3W9WA 4ZDMA 2HXRA 3R60A 3JREA 4N6KA 1V5FA 5B7DA 4HG2A 1WI3A 1P6RA 5DUIA 3BFTA 3DFGA 4H4KC 2R7ZJ 3FGSA 4M72A 1FBCA 4MHGA 3MUQA 1Z7ME 1KONA 2QS1A 2JVGA 2O0YA 1SFEA 1I6HJ 1MMDA 4XLCA 3VSLA 1EZPA 2BY1A 1NV5A 2EPFA 1W1WE 4A5NA 2IRFG 4HCYA 1KQ8A 2QYOA 2PG4A 4RDUA 1X3WB 2NVYJ 4PJLA 1Y8RB 2DWJA 1QBJA 4M4GA 3T0JA 1ZRCA 1XC1A 3OELA 3T9XB 5ESYA 4PSWA 2AQEA 2CYYA 1HLVA 2E35A 2L9VA 3G7WA 5ET8A 4RPNA 3ECOA 5DDGA 4HQEA 3ZQCA 3VLUA 1UG2A 1B4ZA 1MBHA 4G61A 4M6YA 1XHYA 4BYYA 4C3IJ 2M30A 3GXOA 4G77A 5H8NA 2M34A 3MYUA 4WF2A 1WSUA 1YE9A 1K61A 1GR2A 2WYPA 3CUOA 3ONMA 4U1OA 1IF1A 3H3UA 4FE4A 3HO7A 4PF8A 3LSFB 3FMSA 2QJEA 3TQLA 2JSCA 4JVIA 3DP7A 2ZNZA 5F27A 3RPQA 2O51A 1GDTA 1ZQ3P 4MIJA 4NF4A 5LGNA 5A5XA 4UUVA 4JSOA 1A8FA 2WY7Q 3G3HA 2F2EA 2W48A 2M0CA 2XAHA 3I59A 3JTHA 4A3GJ 2IS2A 1PB8A 3HSTA 4PF6A 4ZYEA 3FZVA 4G7HF 1OQYA 3Q0WA 3L2WA 2ISZA 3FBPA 3FUZA 5HLIA 5JR3A 3RY3A 2VN2A 4I2OA 1GXQA 3SXYA 1YJ9I 4XN3A 4QLCU 1B8IA 1EU8A 1SYIA 4M9SA 2V93A 4MIMA 2QCOA 4R1HA 3K70C 1QZEA 1W7PD 1VQ5I 2Q8MA 1IN4A 5DEXB 1KZ8A 3O3KA 4FE7A 2RC7A 4I40A 4W1UA 3GTQJ 2X6XA 2RNJA 2F5XA 1MPCA 1E17A 2UXAA 1O64A 4EQ9A 4TOZA 4RAFA 5EHSA 1XSXA 2B4MA 5LOMA 3T1BA 4AIKA 1CE2A 2QS3A 2XXKA 3GCMA 3RKYA 5LHGA 3JRCA 3BIGA 1T0FC 1FX7A 2QMXA 2KL4A 1R6ZA 2M87A 3FISA 3IP4B 2HR3A 4A3CJ 1FBUA 1ORKA 1DBZA 4KD5A 2EZKA 1Z0XA 5GP9A 3V7RA 2YU9J 4PFTA 4IGTA 4BQOA 4NNJA 2F7AA 1S8NA 1B0HA 2HQRA 3BTLA 5FB2A 3KGCA 1P2FA 1VI0A 4RMNA 1QULA 1B3LA 4OIRF 1JEUA 3IB0A 2KDZA 3K01A 4JBZA 2P0SA 2LY9A 2D21A 3EHSA 2Z5UA 3A2KA 5J1YA 4CGZA 3B7DA 4JSDA 1P1OA 4U1ZA 2A05A 2DA4A 1MNMC 4Q4ZF 2I0BA 1DP7P 3IOVA 2MW8A 4X1EA 4U7BA 3E6CC 4UV8A 3I55I 1N76A 1P1NA 2R7TA 2OX3A 2WYKA 5CVRA 4GBVA 4IO4A 5IZ3A 3FXKA 1HDPA 2ACJA 5AIQA 3L1PA 5DTDA 2VONA 1US5A 4MQ9F 3NRVA 1OMPA 1XDUA 2L3DA 1ZARA 3PMXA 4H1XA 1Z7NE 3HPGA 2XRNA 2MLGA 3I59B 2ZYNA 5HS9A 1T95A 4F3BA 2NNYA 1J09A 1A35A 2IS1A 2BJJX 2HXWA 3G1OA 4DOZA 1P92A 1TC3C 4U4SA 1LB8A 4GX3A 1TBXA 3QPSA 2OJED 3GFMA 1DGRM 3H5AA 3GZ5A 5HDKA 1BTJA 2M0MA 5HNFA 1NUYA 4GXAA 4OVJA 2M8CA 4A3JJ 3ABKH 4P55A 1SPIA 3EYIA 4OESA 4OOIA 3HXLA 3HOXJ 3HSRA 2JWTA 2DXYA 3MKWB 1FPQA 2W57A 2V6CA 2I4CA 3DP6A 2RDPA 3LA2A 2UV1A 2VJ4A 2P3VA 3J7ZI 3RCOA 3WGGA 2IA2A 3FJMA 4BQAA 3DLNA 4PAKA 3UA8A 1WWXA 3KJTA 4U22A 1IXSB 2ID6A 2MYSA 1NUWA 3G6EI 3FX3A 4NC7A 3OY9A 2XX8A 4H0EA 1IN6A 4UACA 3DU6A 3G2BA 1EJ9A 3DBRB 2O6AA 2HWVA 3QMFA 3DPLC 3G1MA 4LQ2A 3BR1A 3NAUA 4X8RA 4ZEFA 4KR5A 3ERMA 5TU0A 3D4CA 2DA2A 5DVIA 1MDMA 4IPAA 5BNGA 3EQ1A 5F6FA 5FTIA 4XIGQ 5HVQC 1REPC 3SEYA 2XC7A 3GVAA 1HF0A 2Y5KA 1IMAA 5HS8A 1T0FA 4XLEA 4MX6A 4A5MA 1Z3YA 1DUXC 3BJOA 3FXLA 4F55A 3JAMZ 1WHUA 3PPOA 2R7OA 4N15A 3H9QA 3MVYA 3H06B 2DYSH 4XF5A 5LTCA 2L7MP 4N8YA 3CLOA 1R9LA 2WB1N 5CVUA 2F3DA 2DP8A 2E60A 3HEFA 4G94A 3TZAA 2STWA 5D6FA 3C33A 4PFRA 3R6UA 4LITA 3CCQI 2PBWA 3RPUA 2DOEA 5LDZA 5F1QA 4I76A 3V5AA 1BM9A 5E1XA 4IL6C 5JTYB 2ZMEB 2LK2A 2YR2A 4EDPA 4RGUA 2DMNA 3JYRA 1MKMA 2DYRH 3RGYA 2MFZA 4GO1A 2CQNA 1P1UA 3IV5A 3C3WA 1G8XA 3NWSA 2BEOA 2ZXJA 1B3EA 5TP9B 4BDOA 3RJPA 2R92J 2TDXA 4QFPA 4N9IA 3E78A 4L5IA 1FOKA 4II2A 5GAHJ 2WX9A 2H6BA 1RI7A 2UZKA 1AKHA 2GXAA 1FBPA 2YS9A 1YCJA 3KFMA 2Q1ZB 1TQIA 5BMZA 1B0LA 4HW8A 3BCAA 3BCBA 2R7WA 1BIYA 2OPTA 3J7YJ 2Q8KA 1ZBMA 2ZNUA 3H1CA 1BI2A 4PETA 3IWZA 5JI6A 2G7HA 4CDGA 3KEIA 4WEDA 3H9GA 2FNAA 3KZYA 3ZKKA 1GUUA 2R6GE 3RPLB 3H6UA 1N7XA 2ZZVA 1MXZA 5ICFA 2BW3B 1VQ8I 2JA7J 3S1MJ 1NV0A 3K2AA 4XIDA 3JSOA 2V6EA 3HRUA 5EYGA 3CCJI 4Z7EA 3T0YA 1JHFA 4QIWN 3OSFA 2EIMH 5TJJA 4ZJZA 2IGMA 4GDFA 5K7ZA 1QVUA 1HOMA 4OMYA 4IHXA 3IB1A 2FD5A 4UVAA 1U8BA 5BUUA 2JQ7A 4CHUA 1Z9CA 2DK8A 1OR7C 5EG0B 2AS5F 1ZRFA 1KU9A 5CJ9A 4ENJA 1NUXA 3K6WA 5L3GA 1I50J 1D9QA 1BN5A 4MMPA 1MDMB 4AC0A 4LZ7A 3D5RC 1IZ1A 2GOMA 2XVCA 4HLYA 1MJAA 2M8GX 1FJ9A 4PDDA 3GMEA 2FVZA 4KICA 5ET6A 2M45A 1U9NA 4I98B 1USYH 1D1BA 3WODF 4M74A 4YB6A 3J80K 1BOBA 4Y3OA 1ITYA 1MS7A 3A3UA 4Y17A 2CW7A 1ZTYA 1XX5A 1QO0D 2RNGA 3O8GA 3RQ4A 3VDXA 1E2XA 2M7AA 3GLXA 1T8IA 1USYE 2E0SA 3VOEA 2WKYA 1SC7A 4X0GA 1FPKA 2FA5A 2JA6J 5DYMA 3RZOJ 2DVZA 1SD4A 2A07F 5I2NB 3OWTA 5ICQA 5EF6A 3I54A 1I5ZA 2K5CA 3ABMH 2DSFA 4B09A 4M9XA 1D4NA 1JW5A 2DMQA 1IG7A 3UR3C 1YXIA 2DJNA 1YW7A 4OFJA 1UIVA 2I48A 4U7DA 3OOUA 2YX4A 3FASA 5EQAA 4QBAA 4KA4A 4JK1X 2P6SA 3O28A 3W2VA 1YJNI 3BG6A 3F21A 1YRNA 3JV9A 4EXKA 2Z1DA 1AH5A 4A12A 3Q9VA 4C1UA 5FLVA 1Y56A 4XORA 3RTFB 2R5ZB 5DCMA 1DGWY 1PC3A 1CF7A 1SW5A 2CJJA 4XSZF 1WODA 4L9TA 2RGVA 4V2GA 4A2UA 5IZ3B 2A61A 5ICGA 4FT8A 5GTHC 3UK4A 1MXXA 5FJ8J 4YKIA 4CCMA 1OYWA 4IGRA 3HBLA 2RREA 2XROA 3DBLB 2X51A 5D5XB 5ILUA 2GH9A 3FVKA 4O7IA 5I57B 2O5RA 3OYHA 3GX4X 4YELA 1UHMA 3SHFA 3C2BA 4DZPA 4MLOA 5EHMA 5L3BA 2DWAA 2HCAA 4I62A 4ZEBA 5FHOA 5DUKA 3RLFE 3S9MC 3TEPA 4QPOA 2CUEA 1P1WA 1TT0A 2KLFA 5EEAA 2LMDA 3GYYA 2XF7A 4F29A 3PU5A 2IXSA 3N05A 2XWKA 1FP1D 2QFLA 2RKMA 4I6ZA 1FPEA 4IO3A 5TRDA 3MEXA 3DKXA 2EIKH 1FQFA 2DVCA 2ZYKA 4JB7A 3RPWA 2W4SA 4PUSA 3IO4A 2EA2A 4O8MA 2R7VA 2OCEA 2HOTA 2VOZA 4DXBA 1SW2A 3K10A 1PUEE 5CVVA 4G7ZF 4C2UA 3QP5A 5CYVA 4KYSA 5AA2B 1JKQC 1FTKA 3BROA 3DM0A 2MC4A 2W85A 4IX7A 5FFZA 2KRFA 4IHSA 4JVCA 3FHZA 1W7PB 4QFLA 2IA4A 3TTLA 3CQZJ 4XOPA 1XMAA 5J3LA 2EV6A 1B52A 3AG2H 3G73A 1RUNA 4KNYA 4NHJA 3F8MA 1SVOA 1TLHB 3EETA 3M9AA 4U0WA 2E1OA 1RC9A 4ASNA 4E7SA 1QPMA 3M1CA 2F6PA 2ZYMA 3OO8A 4FBPA 2QKLB 3OYAA 4BH9A 1JE8A 4JDFA 1R22A 1MXYA 3EDPA 4FIMA 4JWXA 3S9LC 3D0SA 3DEWA 3I9V2 4POXA 2ZMEC 4LZ5A 1RPWA 5IOZA 5LGUA 1Z6RA 1JGGA 2FIXA 1N0TA 3WU0A 1A5JA 2NUVA 1ZH5A 2Y7WA 3TTKA 2LKPA 2Y31A 2KP6A 3BBRA 5CMKA 1WPKA 4AIJA 2XKOA 2VC0A 1PUFA 3I0TA 4RB1A 3Q28A 2ICWG 2I8DA 2BBYA 2JZYA 2V1XA 2DXRA 3WAEA 4GWZA 2P4WA 1Y3QA 3G3JA 2XXRA 1ON2A 3FWEA 5K7FA 2LDUA 4HPQA 3JRBA 3CCLI 2A6HF 4BDYA 1N77A 4M73A 5JFRA 1MDP1 2HYGD 4NF6B 1HA8A 5FTHA 2BW3A 2DTZA 1P7IA 4LB6B 4LN5A 3HHGA 3MKYB 3KZGA 4DXUA 2Z16A 5CMCA 2FBIA 3QOPA 1Y1ZA 1JUPA 2HZDA 4XKBA 3VYUB 4A93J 1IIWA 1SI0A 3ABUA 1JJ8C 3AL0B 1NV6A 1URSA 2HHMA 4GWWA 4KXPA 4O3CA 3CLQA 1H0MA 1EH6A 3BG5A 2CFOA 2CQXA 1GV2A 4OIPF 2JSPA 2BXZA 3ZOBA 3THIA 4ESWA 2KFDA 2DWIA 2L7KA 1NNKA 4OVPA 5EZGA 2YPNA 2FXAA 2HOEA 3PM1A 2D5WA 3KFWX 4ZYHA 3QU6A 1YG2A 3P5JA 2FA7A 2NOGA 4I8CA 4NWCA 2F48A 4DI3D 3TO7A 2JUGA 3X2QH 4CZZA 4OINF 4N91A 2ESHA 4YMBA 3RT6B 2GZWA 4E6KG 5LEKA 3FXOA 3WE3A 2XSDC 4PFBA 3E97A 3C9HA 4THIA 3VSKA 4P9UA 5IPAA 4M3DA 1B4HA 3H6VA 1B9NA 3V7CA 1P4AA 1YW9A 2OLBA 1QVTA 1N75A 2X4HA 1XMKA 1RETA 2LC2A 4XN0A 3LAPA 3GYHX 3LBSA 3PFIA 3QXMA 3WTVC 1GXPA 4EM0B 4B3AA 3C34A 3MP8A 3RPUD 1LCTA 1LUJB 1ANFA 2QLZA 1T33A 3HKZN 3K4LA 2FBPA 3PUXE 4PC9A 3OL4A 2C6YA 1Z1DA 2BHZA 1K6OA 2O69A 4FEBA 3LUYA 5E18F 1PP8F 4HNUA 4ZEKA 2HPIA 1K83J 1N78A 4OHNA 2V9VA 1F4KA 3I58A 3HGGA 1OFCX 4DDDA 3KP5A 4S0HB 4EUOA 3ODBA 1B72B 4S04A 2M3AA 3K4NA 2JUCA 1XD7A 2V1NA 2XXTA 3ECRA 2OTJI 3L09A 3M3YJ 1DTZA 4MBPA 4ZYAA 4E7KA 1WH5A 2R7DA 2GAUA 1NTCA 3CO6C 4LLGF 1HSEA 1OLAA 1S9TA 1ZKBA 4RK2A 2A6TA 3QPLA 4MHFA 2XAQA 2DTRA 1WFXA 5KCMA 3NARA 3RYPA 3C18A 1B7UA 4I3EA 2CG4A 4R9FA 4B48A 2A5YB 3S17J 1EZOA 1FJLA 1S3JA 4G6TB 1VFDA 1D0YA 3K1NA 3ZCOA 4OVSA 3PQKA 4PFIA 3IKTA 2F4MB 5LRRA 2DS9A 4HXVA 3WTSC 4YEJA 3LUZA 1ENHA 3J7AO 1FOXA 1IDZA 4EF1A 1FBGA 1ZLQA 3HUGA 1X3ZB 4YB7A 4HF1A 3UNGC 4D7MA 2QKMB 2E2HJ 3HOYJ 3TDZC 4HRIA 1O63A 4EJUA 4E7ZA 1LVKA 4U87A 3A01B 2WBBA 2Z8EA 1SMYF 2PMHA 1WJDA 3DF8A 3OYFA 3F23A 1B7ZA 4IY5A 4I9DA 3BQYA 1LEVA 1G6NA 5I58A 5JLXA 4P3LA 1BIBA 3I56I 2QVVA 1XGSA 1X1PA 2ZNYA 4DW6A 4UXNA 3OMBA 4WXHA 3TUSA 5H2FC 4RAZA 4ZH4F 2HPGA 4RNSA 3BP8A 1FY7A 1TQPA 5I3SA 2CMPA 1DMBA 3QOEA 1LPQA 1V4RA 2EJRA 4N0BA 1KZHA 3PMWA 1TWHJ 2F6GA 4G8MA 4ZYDA 4LVQA 2IS4A 1B5IA 1XI6A 5BQTA 1DOTA 3EF7A 2IEKA 5FLXK 4P9KA 1HXDA 1Q35A 4G68A 4GWUA 2M2EA 2HZKA 2DE3A 2X6YA 2EZIA 3G71I 3E9XA 1IUYA 3FDYA 3VODA 3FATA 2OJTA 4WEPA 2KJBA 2XSJC 2X48A 2Y75A 4HCWA 2HDWA 1YZ0A 2XHDA 4O3AA 4C30A 2VE8A 3IWFA 1YTVA 2EFNA 1ONVA 4IHVA 3RSNA 1M5DA 3PO2J 5CLSA 5KZTA 2B4LA 3CUQB 3CUQA 4LATA 3FD3A 3DPTA 1S7AA 2LBFB 1MBGA 1AOYA 1EYJA 3O29A 3QK6A 1PP7U 1IRGA 3PUZE 2FJ1A 3COAC 5H8SA 3CUQC 5AIPA 4ZE9A 5KAIC 3VVDA 4NTLA 3LFKA 5KK1A 5L3CA 3PNVA 4XEQA 3B6QA 4OU0A 1JVXA 4R8HA 5CQEA 3DCFA 5DD4A 4AYBN 5K5OA 3IX1A 3CJNA 3OXNA 4AS5A 3P7NA 4YIRX 3I5UA 3GTMJ 2VT2A 1Z7UA 1R7JA 1Z3XA 2CZLA 2XB5A 4NG7A 2W7NA 3T96B 3O66A 2L0KA 3KP4A 4R79A 3OYIA 5HDNA 1A99A 1J5YA 2VBWA 1MQGA 1OQGA 1TFDA 2XD3A 2MBFA 3K4BA 3DLAA 4HF0A 4FISA 2PFBA 2O8KA 5J1RA 3QRFF 1ETOA 2HPMA 2XXIA 3K00A 3L2VA 1XT8A 4GX4A 4L17A 1ZG1A 5A5XB 3S8PA 5J40A 1Z91A 3KSJA 2YUSA 1P1QA 1YS7A 4KISA 1B8IB 4LK0F 3RQTA 3GO5A 1QUKA 4JWOA 4MEVA 1QW0A 1B05A 3LQQA 1SFXA 3HPHA 1O3RA 3S15J 1HQCA 2K9LA 2NVUB 1D8JA 1U9OA 1E3OC 4A69C 3OS0A 2J5PA 3L2RA 3E0JB 2B0LA 1MY0A 3N94A 5C44J 4U0YA 4NGUA 3VVFA 1USSA 3CD6I 3B6AA 2JMWA 1J2XA 1JGSA 4F19A 4NN3A 1SMTA 3CVGA 1FNNA 2M1BA 3Q0VA 3H6TA 3E6DA 4KITB 2EFQA 4HNVA 2WTEA 1FBEA 5H8QA 2K9NA 4FORA 1WQ2A 2VKHA 2HVSA 1B3HA 5F04A 3S93A 1B6HA 3EN3A 1FTLA 4MLQA 3VE1B 4RM2A 1Y1WJ 5E20A 1YRNB 5HLHA 3C1DA 4X04A 2HEUA 1A55A 2H6CA 3F8NA 4BE0A 4RS8A 1R1UA 3MPKA 2R5ZA 2IGOA 1HKSA 2XXQA 4HSTA 2D1HA 4EQ7A 3OYJA 2IJLA 1BW5A 4R6YA 2LH9A 4BL0B 5ITOA 3GTLJ 4G68C 4FAJA 3IAZA 5C4JJ 4F52A 2BXYA 1LAFE 4CYDA 3FK7A 1E0EA 2TRTA 2L7ZA 2X0LA 4ZZDA 1FPGA 1UTHB 3LNQA 3WTUC 1OQHA 2LR8A 5J47A 3K0LA 1BA5A 2D3IA 3PPNA 4OVQA 2QVRA 3GLLA 4GIZA 1V55H 3A1YA 1G3TA 3ZQFA 4MJOA 5F0CA 1D9VA 4NWDA 4DCXA 3ASOH 2X1CA 1ZLJA 2AL5A 2KKOA 2W24A 1TXFA 3GF2A 4NF8A 4NF0A 3J81K 3JRDA 5IYCJ 4YFXF 2PQ8A 4A6DA 1U78A 1NK2P 5E17F 1ELJA 3U2RA 4WK8F 4CUGA 2B65A 3TFLA 5EYRA 1VQ7I 2RQQA 3TO6A 2HTJA 3B6CA 5M5XJ 2QSGX 4XKPA 4YKPA 5TPAA 4CZCA 2B9SA 3CDLA 2ZJPF 1S50A 1IQ7A 1JW4A 2VJIA 4ZTJA 2JA8J 4KCCA 4U88A 3W9VA 1FMVA 2JPCA 2OK2A 3F9KA 3LA7A 4PFYA 4L9NA 4N4NB 4IOAF 4DCYA 2LG4A 1STZA 4ZC3A 2HQ0A 2QPQA 2FRHA 3OIPA 3CCEI 1GGGA 3B6TA 2UXNA 5KDTB 1T38A 1MGTA 3TP0A 4ESXA 4PGNA 4A6EA 2ZKZA 2XRLA 2ME6A 5DEXA 4RGRA 4UUSB 1F9NA 1DU0A 4MF3A 3WG9A 3PIOF 1AHDP 4ZZEA 2RN7A 3TMOA 2R7SA 3S16J 3DU5A 2E71A 5IAIA 3ZQHA 2R71A 2LNBA 3IH3A 3ERED 2QRYA 4PSXA 1BKAA 1JKRC 1LFGA 3V8XB 2BVLA 2QENA 1JETA 4C2MJ 2V26A 4O3MA 3Q3SA 4JYKA 3KN7A 2VE9A 3HGYA 1FYLA 1BBYA 4GQOA 2HGCA 2P7VB 1SD6A 2CO5A 4WXDA 5D4SA 1H44A 2LAOA 2XWIA 3ZXSA 3C4MA 4K3FA 2XX9A 1GHCA 2VIXA 2UVIA 3Q5FA 2VPLA 3H3VK 2YX7A 2ESNA 2K7LA 1UZCA 1VFEA 3IH4A 3MPLA 2VXDA 5JVGF 4LD5A 4NQWA 3PNYA 4BEHA 1YIJI 4NQWB 4BEHB 2Z33A 1DDNA 2V3TA 3M8EA 2F5DA 1FTJA 1IW7F 1I6AA 4ISUA 2OU2A 2DPDA 2QQ8A 2Y30A 2V79A 2I58A 3LR1A 3MBPA 3F8FA 3SDGA 2YSRA 5CMBA 1K78A 2AXTC 5B1BH 2LLKA 4LMYA 2F5VA 2JVHA 2K4JA 1TQMA 1B1XA 4OQOA 3FXBA 3BR0A 1MIJA 1SVLA 1YYZA 2CWEA 3CFZA 3BT9A 1LFPA 4M6XA 3KEQA 2HVQA 3ABLH 1S72I 4QSDA 2V3UA 1YFHA 2OTLI 4GVOA 1MY3A 4IHYA 2VUMJ 4OXVA 2REJA 3V8JA 3ZN1A 3WTXC 1NH3A 1KQ0A 2HAVA 3FJ7A 5ET7A 3MCZA 4F1YA 2ZXIA 4BHBA 5LBQA 4NEDA 2MG4A 4XKNA 2XV4S 2CS3A 4DIGA 4F18A 5FO5A 4QPQA 4X1BA 3MAJA 4OFLA 1I1GA 3PD8A 1QKAA 1FYKA 2DQVA 3K1MA 4CICA 1SD5A 2JA2A 3LSTA 2XGCA 4KN7X 1CNQA 3EPEA 5FFXA 3QPHA 4Y15A 4BNCA 4RAYA 2IT0A 1UHWA 2CW0F 1BJAA 3OR2C 4HZFA 3ZN0A 2EB7A 2I10A 2RC8A 1ETYA 4BHCA 2FNCA 5AE4A 1LKXA 3QU3A 1FJ6A 2H99A 5I56B 1NK3P 3RNNA 1APLC 3J81Z 1FRPA 3OOAA 2K4BA 3QYFA 4IO2A 2AYSA 2VBZA 2FMYA 4IO9F 2H94A 3GFIA 2KHMA 2XDVA 3C7JA 4EJVA 1FEXA 2HZTA 2NNNA 4RB2C 3ILUB 2MLKA 2WV0A 1A7LA 1G4DA 4I02A 4XBFA 5E8IA 4E7HA 3B02A 1SD7A 3CMMA
chains in the Genus database with same CATH topology
5DW8A 4ENKA 5JVTA 2GQ1A 1W5TA 1G3SA 1NI9A 3W6KB 4UNOA 2JRTA 3DKWA 2XUBA 2OWZA 3FXUA 3ISPA 1LDKB 3Q9SA 3HFUA 3RYRA 2H09A 5EYHA 1B6AA 5J8CA 4QXDA 2KJCA 5LLQA 1NHAA 5BPDA 2VPNA 5E8GA 3L2CA 4ESBA 3ZMTA 2P5KA 4MEYF 3H3ZA 5HOOA 1MZBA 1K7AA 2BYVE 1YW8A 3ML6A 2NAZA 4DQ2A 1R36A 4KIGA 3ZMZA 3MWMA 2RC4A 3E3VA 2FF4A 2WWYA 3T5XA 1ULYA 1WKMA 4P56A 3M1EA 2KQZA 3FF5A 2FMLA 4HBLA 1Z05A 1YTYA 2XWVA 2PMUA 2QWWA 2G9WA 5J16A 5BOXA 3K2ZA 1EH8A 2VOOA 3WGHA 3V7SA 1RUOA 2ADUA 1R00A 2Q2EA 4PDHA 3ZMDA 3FXRA 2QQ9A 3ROUA 2GXBA 2QQAA 3I71A 5DEQA 6PAXA 3IKVA 4JQFA 1TW3A 1MJ9A 2DLLA 1EV7A 1K78B 4NQ8A 4KYWA 4HE2A 2L02A 4I09A 1H9TA 3V4GA 2CFXA 4P96A 1U6GA 1MJBA 4FX4A 2PFYA 2R3SA 2LF8A 1O3SA 1U5TA 2O3FA 4WXCA 2PI0A 4UVBA 1IN7A 2Q0OA 5LHIA 1RDZA 4MNIA 2EWNA 2ISYA 2KIMA 3U1DA 4EV0A 2K02A 1ZGJA 1IMFA 3KP7A 3LV0A 3T8RA 4EQQA 1XGNA 3LQRA 2Z99A 3RKWA 1FBHA 3FM5A 2L4MA 3TOAA 1Q9DA 1RZ4A 2GXGA 5FD5A 1FLIA 2H27A 4KMUX 2IA1A 3ELKA 3ECHA 4I0AA 5D6EA 5A2QZ 4KUMA 3WGIA 4HV5A 1NV2A 3HOSA 2XHKA 3FXQA 1KA0A 1LEBA 3CDHA 1IXCA 1ZGAA 1JP4A 4ON0A 3WTWC 2F5CA 3S2WA 1FPLA 1YS6A 1BOAA 3E5QA 5K5QA 2JT1A 2HZLA 4S05A 4KN4X 4I0BA 1OPCA 4M71A 1XSVA 3HHHA 1I1SA 3D1RA 4TV7A 3KC0A 5EQ8A 4PE3A 2OQGA 3RYDA 2XA5A 3ZPLA 5HLGA 2L5VA 5LRSA 2OD5A 3HTUA 2HDCA 4GWSA 5IT9Z 2KR0A 1G3YA 1K79A 4OANA 3LA3A 2DO7A 2OQRA 2Y48A 4U0VA 1KU2A 2PLYA 4EJTA 1IXRC 4GWYA 2XASA 3ZQ7A 4RGXA 1LB2A 3HSFA 3EKIA 3KETA 2A6EF 2NRAC 4XLPF 2DE4A 4AWXB 4JVDA 5BS6A 1J9IA 4LG0A 2FEZA 2DFIA 4O7MA 2CZHA 2CEXA 2E7WA 1R1VA 1IMBA 1T6SA 2DQRA 4IVNA 2IVMA 4IRIA 4FX0A 2NS0A 2DBBA 5FD6A 1LBXA 4IRGA 3RPLA 2VPOA 1LEAA 4B8XA 4G8XA 2CSOA 1USTA 2VODA 1SFUA 2MA3A 2L01A 1L3LA 5EQ9A 3VEPA 3IC7A 3J80Z 2VT3A 4NX1A 3GUDA 1K9YA 5F64A 4HF2A 4GYIA 5ED4A 3BOQA 1NV7A 1NV4A 2PN6A 3K1PA 4PGPA 1UB9A 5H6RA 1J59A 4UABA 1XN7A 2Z9OA 3NOHA 1HBXG 2HEOA 3WU1B 3CHGA 5J6XA 4MNCA 4MEXF 2PEXA 3FMRA 3ZMSA 5JHUA 1FZPB 5FGMA 3KP6A 2EFOA 1G0HA 2DW4A 1D8KA 2O61A 2FBKA 2PFZA 2F5FA 4AS4A 1EH7A 3IHUA 4L0YB 3VB2A 5J1DA 2V1DA 4KIFA 1O57A 3FMQA 1EYIA 3ABTA 1U2WA 2OBPA 4OIOF 1C0WA 4X9TA 1DPUA 1IMCA 1P4WA 3E6BA 5IT3A 3GZ6A 2ETHA</