3T1BA

Crystal structure of the full-length aphb n100e variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSELTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
total genus 84
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t1bA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t1bA02
4XLNF 2E7XA 1DPUA 2YX4A 1F1ZA 2XVCA 5D8KB 4UVCA 5E20A 2V9VA 2VBWA 2D1VA 1DPRA 4CHUA 3M9AA 3WU1B 2YU3A 3GUDA 5A2QK 3LQRA 4HF1A 2HTSA 3LFKA 4ZH4F 5DD8A 1YYVA 4EVIA 2CQKA 4GCVA 2FBKA 3HSFA 3DV8A 2OBPA 3PQKA 3FWEA 3PFIA 1G3SA 3FX3A 4E70A 1MJBA 2V1XA 1SD5A 3CUQC 5DUKA 2OQRA 1EH6A 2HGCA 3EETA 4KN4X 4HDVA 3ZMDA 3KP6A 3GX4X 4JVIA 1I1GA 3F72A 2DPDA 2F5DA 2Y0MA 4K2EA 1XSDA 2NAZA 4PZJA 2ZO4A 3TO9A 1ULYA 1H9TA 1K78B 1GVJA 2E1CA 2L02A 1S7AA 1YG2A 4QBAA 5ICFA 4WF2A 1XDUA 4U0YA 4CO8A 4EJUA 1W5TA 4HOBA 1HXDA 3Q9SA 5TRDA 3MZYA 3LWFA 1ZG1A 1A04A 2FQ3A 3BZ6A 2OAZA 3GEZA 2P7VB 3HTUA 3FM3A 3FF5A 4MHGA 1IAWA 2V6CA 1FLIA 2HFHA 1MKMA 2LSOA 2IVMA 4UHTA 1L3LA 2W25A 3D5LA 1FC3A 4LG0A 1FYMA 4YIFA 3LA7A 3V8KA 2QUFA 1LQ1A 2XAQA 4RB0A 5H6RA 2ZXJA 1FT9A 4ENNA 1IXRC 1R23A 1STZA 4OU0A 3ZMUA 3ZMZA 3HSRA 4EJOA 2XAFA 3SQNA 3E6DA 4ESJA 5KVRA 4HLXA 1R36A 1JGSA 3EYIA 2A61A 3NQOA 4AD9A 3IKTA 4IVNA 1R5GA 2ELHA 2YR2A 1R1VA 4KNYA 1ODDA 1TQIA 1XSVA 2PI0A 1BI3A 1TQPA 3V8LA 2KJCA 3L2CA 3HOTA 2IA1A 3KEQA 1XB4A 2D1HA 4RAYA 3F3XA 4HQEA 3MAJA 1LB2A 1HSJA 2QENA 1Y0UA 3QU3A 4HDUA 3T5XA 3IKVA 4R8HA 3FMRA 3W6KB 2GA1A 3M8EA 1YTYA 3K2ZA 1LDDA 3MCZA 4IRGA 3I59A 1WQ2A 3VEPA 4N9HA 2DU9A 2JSCA 1ZRDA 2KIUA 2M30A 3E5XA 5HLHA 2FE3A 1KYZA 1B9MA 2EFQA 1BI1A 2QWWA 3R0JA 4LFUA 2F5EA 3HIFA 3F21A 3KE2A 5D6EA 2RVCA 4EJTA 2QBYB 1SFEA 5EEHA 3WODF 4OOIA 3JSPA 2M5WA 4KICA 4I09A 4I7HA 4OMZA 4L0ZB 3BJOA 2W85A 3H3UA 4GYGA 1W7PB 4HLYA 2HZTA 3GFJA 5LRRA 1BI2A 3GLXA 4PCQA 5CVVA 5E1WA 3I58A 1ON2A 4S04A 4ON0A 1E2XA 2CWEA 2LDUA 1ZHFA 3JAMK 2HOEA 3NRVA 3HRSA 4A5NA 1VTNC 2NS0A 1FSHA 1OR7A 3HHHA 4XBFA 2FOKA 2XIGA 2IP2A 1WSUA 5D5XB 5IT3A 1IN5A 4IPAA 5DCMB 3D0SA 2WWYA 3EQLF 4XLPF 4Z2YA 3KP4A 4L9VA 3E5QA 5F1RA 4EQQA 4L0YB 2FSWA 4YFKF 1XMKA 3GF2A 3F8MA 2HQNA 2ISYA 2P6TA 4XRFA 1X3UA 3JTHA 3I5UA 1G3WA 1T98A 2DPUA 2C6YA 3MQ0A 2DQLA 2UZKA 2NRAC 2LKPA 4D0PA 4RB1A 1J75A 1D3YA 1OYIA 2VOOA 1LEAA 4HAMA 2EV0A 1KQ8A 3WE2A 1NHAA 2H94A 5CVUA 2O8XA 5L3GA 4MEXF 3H92A 3MEXA 4ETSA 1FBQA 5K5QA 1UHMA 4OIQF 3O6BB 2ZJ2A 2ISZA 1Z1DA 1G6NA 1K79A 2O0YA 2COMA 4FX0A 4WXDA 3ABUA 4OMYA 1YS6A 2JTVA 2HKXA 3J81Z 4KN7X 4UV9A 5JVTA 4I02A 3ZPLA 1XGOA 4ZZLA 4HQMA 5HDKA 1IN6A 4A6DA 1IW7F 4MGRA 1ZH5A 1KA8A 1KQ0A 1IRGA 5D5WB 5LEJA 1WWXA 4M74A 4LB5A 2L4MA 1C0WA 4Q48A 5HDNA 3M1EA 4QWQA 4ZYHA 3HOSA 4YIIA 4I2OA 4KMFA 4MTEA 4PGHA 2EFOA 3VODA 1YW7A 4HF2A 4L9TA 2P5LC 3M7GA 4LG0B 2K27A 3KP7A 1BBYA 1USTA 1W5SA 1ZN2A 1O7FA 3KZZA 1IUYA 1YW8A 1DDNA 4I0BA 2GA2A 5HS8A 3K0LA 1XMAA 1JHHA 2IPQX 2MLGA 3WGIA 2CG4A 2IRFG 2PMUA 3C3WA 2MH9A 2XUBA 3BP8A 4P5OA 1MGTA 5DYMA 3V7CA 1YW9A 2EK5A 4HYEA 4I98B 3K69A 3KZYA 1CF7B 1ONVA 1Z05A 4LJZF 3LAJA 3ECOA 2WV0A 1O3TA 4KMUX 2QQ9A 5E18F 1FYLA 3HRMA 2WTEA 2BBYA 1TNTA 3TOBA 1HQCA 3F8FA 3V4GA 1R1UA 3KP2A 5L3FA 4RGXA 1H9GA 2CO5A 3HSEA 4LD5A 2MD5A 1BIBA 5IT9Z 5HS9A 1ZRFA 3HFUA 5LHGA 5AONA 3U9GA 3EDPA 2Y48A 2QLZA 3L09A 3O3KA 5ICGA 2M1BA 4A5MA 4WCGA 3RTRA 2HTJA 1WRJA 2FNPA 2DQRA 2V1UA 2XRNA 1ZG5A 1OKRA 1LEBA 2QYOA 2ZMEB 3IL2A 4O6JA 1G3TA 2R7FA 3Q5FA 1SAXA 1ZYRF 2XKOA 3RKYA 2P7CB 2IJLA 4RB3C 3IRQA 1P2FA 4P55A 4M9SA 2FMYA 2W57A 1HW5A 4M9XA 3TO6A 1XGSA 4Y15A 1TW3A 3F22A 2V79A 1TBXA 2R7DA 1IF1A 5CVRA 2FF4A 1QBJA 4GXOA 1YQAA 3B73A 2OD5A 5HVQC 2QQBA 4RGRA 4I01A 1EH7A 3GW2A 4EJVA 3V8JA 3IC7A 3SZTA 3MFKA 4KA4A 1F4KA 3I4PA 2E7WA 2A68F 2H6BA 2W84A 2DO7A 2HYFA 2VBZA 2G7UA 3JTGA 1BM9A 3E6MA 3GFMA 1FNNA 2NNNA 3P9IA 2JT1A 2UWMA 2L01A 3J80Z 3IWFA 2OA4A 3OOPA 1YFHA 1I1SA 3ULQB 4IRIA 2UXXA 2P8TA 4JQFA 4G7HF 1LNWA 5LGUA 5DD4A 3WU0A 3DPLC 4MQVA 1AWCA 3W6JB 3JSOA 2IA2A 4BXUA 5H6QA 3C7JA 3EYYA 5ILVA 2P6SA 1T2KA 2BV6A 1XSXA 4WX9A 5ED4A 5D5UB 2GXGA 2F2EA 1XGMA 2A3SA 2PN6A 4FHTA 5HDGA 2PBIA 3CTAA 3WTTC 3QU6A 2G9WA 1FX7A 2L3DA 3RYPA 5DEQA 1BC8C 2DK5A 4LMYA 5D5VB 2FEZA 1T0FA 1U6GA 2R3SA 2QQAA 5D8LB 4OINF 1TQMA 4BHBA 2HDCA 2HS5A 2RGVA 2K4BA 2WC2A 5DUIA 1J59A 3SFZA 3F23A 4EM1A 1ZARA 1JE8A 1FP2A 3RPQA 3KETA 2RNJA 2DAOA 2X4HA 3LA3A 1Q1HA 2DI3A 4KIBA 4IXAA 3WTUC 4AWXB 4M71A 5CVIA 1G3YA 1P4XA 3CJNA 4HX7A 2O03A 3IHUA 2FA5A 1RUNA 2XKPA 3N4MA 2K86A 1BC7C 2NNYA 1IZ1A 2FXAA 3FXUA 3DKWA 1MDMA 2RC4A 1ON1A 4WXHA 1GXPA 4IHTA 1JXSA 3BROA 5EEGA 3CO6C 4PDKA 1P6RA 3P9CA 1K6OA 4ESBA 2KIMA 2YSRA 5CVJA 2EFNA 5J8FA 4XSZF 3COAC 2CGPA 1RZ4A 4F7ZA 1FSEA 2YX7A 1BN5A 3E5UA 1ZGJA 2L54A 4CDGA 4OIOF 4I0AA 5FLXZ 2AXLA 3K1NA 1GXQA 5D6FA 4A6EA 1HSTA 2PJPA 3ABTA 3ERED 6PAXA 1HBXG 3FXQA 1F9NA 1SMTA 5FB2A 3DQVC 2DFIA 1Z6TA 2FU4A 2VT2A 3LQQA 1O3QA 5L3EA 1WI9A 2VXZA 1T6SA 3I54A 5D4SA 3DEUA 2FBIA 4B8XA 1WKMA 1KU9A 2RQPA 2EA2A 2AS5F 2GZWA 2ZKZA 3ZQ7A 1SFXA 1R00A 1LDKB 4BAYA 4CICA 5FD5A 3ROUA 1IN8A 4AIJA 4NHJA 5HLGA 2K7LA 2EFWA 2D45A 3F8NA 2BYVE 1H0MA 3WGHA 2VBYA 1UB9A 3KCCA 2DT5A 1SD6A 3DFGA 2VC1A 1MDMB 1USSA 5LRSA 2EFPA 2PEXA 3WG9A 3JW4A 1LJ9A 4L5JA 1J0RA 2CFXA 3IWZA 3B02A 3I53A 3J7AO 3WTWC 4KUMA 1FYKA 2VODA 4M6YA 3JAMZ 2BE5F 2Z5UA 4G6QA 3FXRA 4ASNA 2O3FA 3DP7A 2HYGD 2ACJA 4YFNF 1EV7A 5A2QZ 3FHZA 1XCBA 2M45A 1R1TA 1ZLKA 4WK8F 1W4MA 3AAFA 1TW2A 1Z9CA 4U0WA 2F5FA 2ZNZA 1MJAA 5DCFA 3TOAA 3L9FA 5BQTA 4LGWA 3VB2A 3G3ZA 1SFUA 2EWNA 4M72A 3H3ZA 4Q5SF 3P9KA 4MQ9F 4AIKA 1B6AA 5DV5A 3IRRA 4ZYDA 1D8KA 3CO7C 2W24A 2XROA 2EB7A 2HWVA 1KYWA 3VFZA 4N0BA 1FBUA 3TKYA 1P4WA 1T39A 1LDJA 3G73A 3GFLA 1SMYF 1O3RA 2HKOA 5ILSA 1O7LA 1MZBA 4M73A 4G6DA 1V3FA 5ILUA 5E1ZB 3KP5A 3L00A 4CGZA 4RAZA 2L4AA 4OIPF 1L0OC 1ZAOA 2XV4S 4Y17A 1D5VA 2KRFA 2XASA 1KQ9A 4RB2C 1J7KA 4ESFA 5HS7A 5E8GA 1F5TA 3QOPA 2Z99A 5BPIA 1YLFA 2PQ8A 4UNOA 4JBAA 2QM3A 3GO5A 4L5IA 3ZP5A 5F64A 2IW5A 3ML6A 4A0XA 2H6CA 3KFWX 3ISPA 1T38A 1FWZA 2DBBA 1PP7U 3E97A 3ECHA 3RKXA 4YFXF 5JHUA 1O3SA 3RYRA 3GYHX 5FLXK 2GWRA 4HX4A 3QAHA 1QPMA 1HKTA 3R6SA 4MEYF 2ZBKA 4EGZA 2P5KA 4NB5A 4U88A 1RUOA 2ESHA 2H09A 3L7WA 4CYDA 4KIFA 1ZLJA 3RDIA 3J80K 3GXOA 1JHFA 5BPDA 4DNCA 4HZFA 2ESNA 5JFRA 2CSOA 4FX4A 2HR3A 4BHCA 2XAGA 5BS6A 3BWGA 1FY7A 1OYWA 5LEKA 2Z3YA 3E6CC 1BJAA 1J2XA 3BY6A 2VONA 2HXRA 2RV8A 3KLOA 2DW4A 3HUGA 3T0YA 4KIGA 2Q8KA 4P96A 5LGNA 1QNTA 4L9NA 3NEUA 3REOA 2LNBA 4UV8A 5F6FA 2VT3A 4AVPA 1G4DA 2ZCWA 3I59B 4UUVA 3RI4A 3MWMA 3I64A 4G7ZF 3V7RA 2G7HA 2VC0A 3DXJF 5LBQA 3FMSA 4LK1F 2PMHA 2ZNYA 1QO0D 3LAPA 3KP3A 1U3EM 1S8NA 1HKQA 3U1DA 4LK0F 1U5TA 2HQRA 3VOEA 3J81K 3GVAA 2JRTA 5DCMA 1TTYA 3M8FA 5CLSA 1RIOH 2VE9A 2X0LA 5IT9K 4EM0B 4EV0A 2XHKA 1HW1A 3F6VA 1S29A 5CJ9A 4G7OF 1RNLA 3KLNA 2PFBA 1YIOA 3GZ5A 1B4AA 1FPQA 2O6GE 5ICEA 2DTRA 3S2WA 4Q4ZF 1S7OA 2EV5A 5FD6A 1MJ9A 4NQWA 2OZ6A 3N97A 4KYWA 2GQQA 3WTVC 1DUXC 3GZ6A 2RN7A 3RKWA 5LHHA 2D2WA 1OPCA 2VE8A 1MD0A 3ZN0A 3TGNA 2VN2A 1ZG3A 1CF7A 4XSXF 2RKHA 4H0EA 1I5ZA 1KGSA 4R1HA 1OMIA 2ZMEA 4JVCA 2KKOA 1B1BA 3T8RA 3MZHA 3LSTA 3RIRA 2ETHA 5HOOA 4LB6B 1E17A 5AIPA 5FGMA 4Q47A 2STTA 4UVBA 1R5HA 4GGGA 2XAJA 5E17F 1S3JA 4CZZA 4G8XA 4EJWA 3WTXC 3SZPA 2UXNA 2LF7A 2YPRA 2Z9OA 2OQGA 3K1PA 4ENMA 1AOYA 2QZ8A 2CW0F 3FMQA 3EUHA 2JPCA 4A2UA 1REPC 1IXSB 3KEOA 3PQJA 3RJPA 2Q2EA 4FT8A 1XCVA 4ZYGA 3T1BA 5HLIA 2EV6A 4HW0A 1ZRCA 3E3VA 4HF0A 2BEOA 3R4KA 2FNAA 3HRUA 3CUOA 1B9NA 2H27A 4YG2F 3CUQB 3QP5A 2DK8A 2GAUA 4S05A 3BOQA 4WXCA 1DP7P 3P7NA 1IRFA 1RI7A 3BPVA 4P9UA 4A12A 3V7SA 3R0AA 3I0TA 4BH9A 4BYYA 3SHFA 1QZYA 2RDPA 3TO7A 3RPUA 4U0VA 5J8CA 3F6OA 3BJ6A 3O2PE 1SD7A 4UXNA 2IA0A 1SD4A 4O5VA 4ENKA 5K1YA 1FOKA 5LGTA 1PUEE 2MH2A 4BHPA 4BQAA 4WWCA 4L9JA 3QRFF 4LLLA 4ZYEA 4IF4A 3T8TA 2FMLA 4PGGA 4LLNA 1XGNA 3C1DA 5KK1A 1FZPB 5J6XA 3K1MA 2VOPA 2A69F 3ZMTA 2HEOA 1R58A 3C18A 1B59A 1S6LA 4EGYA 2M8EA 1QQIA 1BOAA 5DDGA 4RGUA 2PG4A 5FO5A 2K02A 2B0LA 3QPHA 5E1XA 1ZGAA 2XAHA 3QPTA 1J9IA 1CGPA 5H20A 4GYIA 1PDNC 1HKSA 4L18B 1UHWA 5ICCA 5BMZA 1UCRA 3ELKA 4MTDA 5CYVA 3K9TA 4CXFA 2PLYA 3GWZA 2GIVA 1UFMA 5LHIA 4A0ZA 3DPTA 1J5YA 2P4WA 3WGGA 2M87A 2Z33A 4M6XA 1KU7A 3HTSB 2BGCA 2IT0A 1R7JA 1Z91A 3OV8A 4JK1X 5JI6A 5ERIA 2J5PA 5L3DA 5BOXA 1R22A 4M9ZA 4OIRF 3Q9VA 4U7BA 4HV5A 4A0YA 4LLGF 3HYIA 5AIQA 5TJJA 1KU3A 2MA3A 1O57A 4HA8A 1HW2A 2Q0OA 2FRHA 1XN7A 3TDUC 2JZYA 3CDHA 3WE3A 2OU2A 2O61A 4G94A 2A5YB 3R61A 2ZFWA 2JPBA 2QVOA 5E8IA 2MC3A 4QLCU 3BPXA 1V4RA 3WTZA 2A6EF 1D8JA 1OYYA 1Z6RA 4R79A 2F5CA 3CLOA 1W7PA 2NYXA 2MBFA 1Z7UA 1BI0A 3FZVA 2FBHA 2MLKA 1IXCA 4EMSA 1TNSA 2LF8A 4UVAA 3WTSC 4GO1A 4P9FA 1KU2A 1K7AA 1EH8A 2V1DA 2A6HF 3DF8A 2CYYA 3BJAA 5D4RA 2TDXA 1QZZA 3CUQA 4IHSA 4HBLA 4EM2A 3FM5A 3E6BA 3I71A 2K4JA 3TQNA 4DQ2A 4Y13A 3ZMVA 2VBXA 3HRTA 5JR3A 1TLHB 1BIAA 4KDPA 1U2WA 1LVAA 3SXYA 2J5OA 4AIHA 1PP8F 2ADUA 3GFIA 1I27A 3BDDA 1XD7A 2P5VA 4KT5C 4RGSA 4O3MA 1YS7A 2QBYA 1U5TB 4HX8A 4B09A 3R60A 5L3BA 1GHCA 5FFXA 4BNCA 1U8RA 2OZUA 3QP6A 4IRHA 3F8BA 1FP1D 3U2RA 4ENJA 1ZREA 2KJBA 1U78A 2XGXA 4G9YA 3TDZC 4ZZDA 2Y75A 4JVDA 3HHGA 2GXBA 1IN4A 3WTYC 2KIFA 1FBSA 1QGPA 2EJRA 1P4AA 5LLQA 2DLLA 2A07F 2EA4A 4RS8A 1U5TC 5L3CA 1W7PD 4HV6A 4U7DA 4IJAA 5K5OA 1P92A 1K78A 4MNUA 3LA2A 2E1NA 3ZMSA 1YO5C 1I6XA 1XDSA 2STWA 1IN7A 5K5RA 5FFZA 3ZN1A 3F8CA 4N9IA 4TV7A 4KFCA
chains in the Genus database with same CATH superfamily
2JA6J 3GTOJ 3H6TA 2WADA 1Y1MA 4FETA 1LFGA 4II2A 2R7TA 3HJEA 3H03A 1LBZA 2Y2ZA 3TQLA 2A5SA 2LBFA 5FKMA 3MKWB 5KCMA 4XLNF 3WHBA 4ZTFA 3W2AA 3KOSA 1D3KA 4XTCQ 1APLC 1MNMC 2E7XA 2QA4I 1DPUA 5I2KB 1EF4A 3PNYA 1YPNA 5TGTA 2YX4A 5EDNA 2EQRA 5A5XA 1F1ZA 1KA0A 2XVCA 1FPGA 5D8KB 1QUJA 1SW4A 4UVCA 5E20A 3OYHA 3L2QA 2HOAA 1EKEA 2V9VA 2VBWA 4IY6A 4RNSA 5HNHA 3PUWE 2D1VA 2RF1A 3O8GA 3TQWA 2L7ZA 1DPRA 2DXIA 1R1NA 4CHUA 2REJA 5LFAA 4P56A 3M9AA 3EQ1A 4LQ2A 1GV5A 3WU1B 1O64A 4AYBN 5DYHA 3S15J 1EYKA 3BC8A 1VFEA 2YU3A 2P2AA 1S7EA 1FTTA 3GUDA 1MS7A 4BEHA 5A2QK 1JW1A 3LQRA 1B46A 4HF1A 2I3VA 3TEDA 2HTSA 2FUG2 3LFKA 3ZQQA 2XWOA 1SVOA 4ZH4F 5DD8A 1MMAA 3FXKA 1YRNB 4G68A 4YKKA 4GL0A 2WX9A 1DTZA 1YYVA 4F31B 4EVIA 2VJJA 3ZQHA 2CQKA 2KFDA 2FA7A 4DOZA 4GCVA 2FBKA 2AQFA 3HSFA 1JQFA 2F4MB 3CMYA 3DV8A 2OBPA 3PQKA 4QSDA 1UELB 3G2BA 3C2GA 2JRMA 2X1DA 4OMBA 3RT8A 3FWEA 2JJ7A 3H6VA 3PFIA 3HXLA 3MP8A 1G3SA 2VXDA 2ZC2A 3JR9A 2NVQJ 2G0EA 3FX3A 2ELKA 2MGQA 3PNTA 4E70A 1FPKA 2XPVA 2X6OA 4HS7A 5H8NA 3OS2A 5ITPA 3FISA 2VPOA 4IO3A 4BQNA 4P3LA 1MJBA 2FYIA 2CZHA 1R9LA 5F08A 2V1XA 1SD5A 1OVBA 2HVQA 3GTQJ 4MFDA 3BFUA 1A8EA 4P47A 2Q2EB 3CUQC 1D9YA 1VI0A 3F9KA 1I6HJ 1VDWA 3LSLA 4PTKA 4QSCA 5DUKA 2OQRA 2H9BA 3IAM2 1V54H 1EH6A 3OMYA 5H2FC 2HOSA 4GL8A 2M7BA 1RKWA 2HGCA 1IMBA 1P1WA 3RT6B 4POXA 4RA2A 3EETA 4KN4X 4HDVA 4KXPA 1HCRA 2E2IJ 3ZMDA 3KP6A 1RPWA 3NWSA 4B44A 3GX4X 4AM3A 3G3HA 4JVIA 2QJEA 1SAUA 1YAEA 1PB8A 5LD2C 1I1GA 2DOAA 1I39A 1VQ4I 2MKZA 3F72A 1VE4A 2OBGA 3MUQA 2CW7A 2DPDA 2F5DA 1MQDA 1AWBA 2Y0MA 2OWTA 3PGFA 2EZHA 3IOWA 4K2EA 4QPQA 1XSDA 1IGNA 2NVTJ 1NNTA 2XXWA 2NAZA 4PZJA 3H35A 1M5FA 1VFDA 2ZO4A 3PUYE 3TO9A 3TCGA 1ULYA 2LD5A 1JKPC 3SFIA 5IYBJ 1GVJA 4XRMA 1K78B 1H9TA 2E1CA 1UIVA 3A3UA 1NH7A 2L02A 4BQOA 1S7AA 2D21A 1JP4A 1MBEA 1YG2A 4QBAA 4JOMA 5ICFA 4WF2A 1X1PA 3IOUA 4M1VA 1XDUA 3FVNA 4U0YA 2COBA 4CO8A 5K7FA 2ZJPF 4CSWA 4EJUA 2UVJA 4A3CJ 1W5TA 2CQNA 3RTFB 4YB5A 4HOBA 1HXDA 3Q9SA 4GXAA 2LKXA 5TRDA 2X7QA 5ICTA 1Y8QB 5F27A 3MZYA 1IMCA 1NMUA 2RNGA 2GXAA 3R6UA 3LWFA 1ZG1A 4LIVA 1A04A 1K83J 2FQ3A 2FX0A 3BG3A 4M6VA 4PJNA 3UGWA 3BZ6A 2OAZA 1MDQA 3GEZA 2P7VB 3HTUA 1M5DA 1W5CC 4UY8I 3RKQA 3HPGA 5IZZA 3FM3A 3OYLA 2Z23A 2KMUA 3FF5A 2DOFA 2K3PA 1SW2A 4PETA 3HPHA 2AXTC 4BJ6C 5JHFA 4MHGA 1IAWA 2V6CA 1UTBB 5KCJB 2O5RA 1FLIA 2HFHA 1MKMA 2LSOA 4M3BA 5J1YA 2K9NA 2IVMA 4UHTA 3PNVA 3IFAA 4YKIA 4YKPA 4P9KA 4PFYA 3CCJI 2HDWA 2W25A 1L3LA 5I2NB 3D5LA 1FC3A 2AYSA 4LG0A 2H99A 1FYMA 4YIFA 1OQHA 4AYBA 1LBWA 4R9FA 3LA7A 1QW0A 3V8KA 4F22A 3LUZA 2E1SA 2QUFA 3W9VA 2NS8A 5CI5A 1LQ1A 3IH2A 2F6GA 2F35A 4F2OA 2XAQA 3SEQA 1N7WA 4B3XA 3QYEA 2Y84A 4RB0A 4GWWA 3GTPJ 3S1NJ 3PSFA 2IS4A 5H6RA 2ZXJA 4G12A 2Q2CA 4KYDA 1FT9A 1XMXA 2QGUA 4ENNA 4FQGA 3OL4A 1IXRC 2QMXA 3HBLA 1R23A 1STZA 2CUFA 4OU0A 3OYJA 2PBWA 1AHDP 4MLOA 3ZMUA 3TZAA 1X1BA 3E79A 1N3WA 4NF0A 3VLUA 3ZMZA 4HEA2 3I6VA 1ITYA 3E0JB 3HSRA 2XAFA 4EJOA 1VFCA 3SQNA 3E6DA 3GLBA 3E78A 2JUCA 1TT1A 1U0JA 4ESJA 5KVRA 2OJTA 4HLXA 3LSXA 4UACA 1R36A 1ACIA 2KHMA 5IZ3B 1JGSA 2KRCA 2HQ5A 2JA2A 1BL0A 1V55H 2F78A 3EYIA 3DBRB 2K40A 2A61A 3NQOA 4AD9A 1YIJI 3IKTA 3CG1A 4OWRB 3ASOH 4IVNA 3DP6A 5J1RA 4PK4A 1R5GA 1FPBA 4R2BA 1OLCA 2F97A 2ELHA 2V25A 2YR2A 1PYVA 3NARA 3U94A 3HGGA 4X48A 3JREA 1WJBA 1YXIA 4GX6A 4PJ0C 1R1VA 4GFRA 3RGYA 1J09A 3S1RJ 1DU0A 3EUHC 4KNYA 1ODDA 1TQIA 2KRHA 1XSVA 2XSJC 2O69A 2PI0A 1UJ8A 1BI3A 3C36A 2IGKA 1TQPA 2KP6A 3V8LA 1II5A 1IUFA 1IXIA 3PUXE 1X3WB 1A8FA 1DPPA 2FNCA 2X26A 3K7AJ 2DS9A 4RY1A 2KJCA 3L2CA 3HOTA 1IITA 1JUPA 5C4JJ 1PUFA 4PFIA 5CC2A 5F24A 3CP2A 2IA1A 3KEQA 3OY9A 5I57B 2HZKA 2HVSA 1XB4A 2D1HA 4RAYA 5FRNA 1NTCA 4PF6A 4THIA 3F3XA 1MBGA 2R7UA 1E3HA 2B3FA 3ONMA 4NAPA 5I7IA 4HQEA 1UMQA 3MAJA 1LB2A 1HSJA 4CYCB 2QENA 5J4YA 5B5EC 1ERDA 1Y0UA 1CE2A 2F3DA 3QU3A 1XS5A 4O3AA 4CCOA 3HL2A 2RCBA 2DA5A 4HDUA 3T5XA 1A7LA 2QF7A 3ONQA 3RYDA 3IKVA 4O94A 3BTCA 1ZR4A 1WJEA 1EU8A 1NV7A 1T8IA 3DKYA 4R8HA 3FMRA 1P1OA 3Q3SA 3FVKA 2HNHA 4O7IA 3W6KB 3MVZA 2GA1A 3M8EA 4RA1A 1YTYA 3K2ZA 4D7NA 1B5JA 1LDDA 3U92A 3CCUI 5A5LA 2DMPA 3G6EI 2R92J 4E0XA 2E19A 2PFYA 5GADJ 2RINA 3MCZA 4IRGA 2ANJA 3I59A 1WQ2A 3VEPA 2Z16A 3E3KA 3SEXA 4N9HA 2LG4A 5KDTB 1SFKA 2DU9A 2JSCA 4LZ8A 1ZRDA 2KIUA 2M30A 3E5XA 2QMWA 5IYCJ 4I99C 1I6QA 4PFUA 4BE2A 1S50A 4FBPA 2DMNA 3UNGC 5ICQA 5HLHA 3CJRB 4DXUA 1DPEA 3U1KA 1B3GA 4N15A 1N0TA 4P1EA 5DEXB 2FE3A 5AA4A 1KYZA 3DEEA 1B9MA 4BUPA 1FJ9A 2DE4A 1QVTA 4E7ZA 2L2OA 4IHVA 2EFQA 4UUSA 1BI1A 4IQ4A 2R7ZJ 2QWWA 3R0JA 4LFUA 2F5EA 1N76A 3Q25A 4MCOA 3HIFA 3F21A 1MXYA 4YU0A 3KE2A 2L9RA 3OYEA 1B1XA 4W1UA 4E6KG 4PFRA 5D6EA 3JRIA 2L9VA 2DDBA 2RVCA 4EJTA 3VLVA 1Y6IA 4XKWA 1SANA 2QBYB 5I84A 3KSJA 1SFEA 3H9JA 3B6CA 5EEHA 5BNGA 1VR5A 3DBLB 3WODF 3LSHA 4OOIA 4P11A 4X04A 5I58B 3PV0E 1XX5A 2UUZA 3UP9A 2R7SA 1S7YA 3JSPA 2VPNA 2Y5KA 3MYUA 4LQ5A 2Y31A 2M5WA 4KICA 1P9QC 4I09A 4BGDA 4I7HA 4OMZA 4L0ZB 4GD5A 3O29A 2GBYA 3BJOA 3H3UA 2W85A 3JRGA 1E3OC 1DP3A 1PBPA 4Y33A 3KN8A 4GYGA 1W7PB 4HLYA 1NV1A 3ZS6A 1XT8A 1BJZA 2HZTA 3A0BC 3DU6A 3GFJA 1BI2A 3GLXA 2NOJB 4PCQA 5CVVA 5LRRA 2P3VA 4FECA 5E1WA 1XC1A 2X9DA 1Y3PA 3TAJA 3BTJA 2DODA 3I58A 2ZMEC 1ON2A 5EG0A 3A2KA 4PF8A 5EHSA 4BE0A 5KDTA 4S04A 5EZGA 4ON0A 4GVOA 4ZZEA 3ABLH 3WAEA 1E2XA 2CWEA 2RQQA 1N04A 2ZXIA 4BY7J 3H36A 2LDUA 4PSXA 5ESYA 4ZEFA 2I58A 2CZLA 1ZHFA 3JAMK 3MBPA 5EF6A 2HOEA 5C3EJ 1ETWA 4PP0A 3NRVA 3E9XA 2DCEA 1QVUA 4H8IA 4TV7A 4B48A 2REGA 3HRSA 3KOTA 1ETKA 1NUXA 4CYCA 4PC9A 5LOMA 4A5NA 1VTNC 2NS0A 3ZQIA 1YJNI 1UIUA 1HC8A 2F7BA 1FSHA 2Z22A 1OR7A 3HHHA 4MLQA 2XA5A 4XBFA 2FOKA 1ZMGA 4N17A 3OIOA 1LB8A 5GP9A 1JVXA 1ZR2A 4ITVA 4IOAF 2XIGA 2IP2A 1JETA 1WSUA 5D5XB 2RC7A 3ZSFA 5IT3A 1IN5A 4IPAA 3BIHA 4ZEBA 3V83A 2QCOA 5DCMB 3H3VK 2THIA 2RREA 3D0SA 2WWYA 3S32A 2CS3A 5IKBA 3DKXA 3EQLF 2EIMH 4I8CA 1BW6A 4IEJA 4XLPF 4M4GA 4Z2YA 2D5WA 2M8GX 4PAIA 3KP4A 1JNFA 1AU7A 4L9VA 1LFBA 3E5QA 2DFEA 1AMFA 5F1RA 3QIMA 4EQQA 1AKHB 4L0YB 3QOEA 2R0QC 1NV4A 2R71A 2FSWA 4FTHA 4YFKF 1BIYA 1XMKA 3K4UA 3GF2A 1WVJA 3TP3A 3BQZA 5L9OA 4XRSA 3F8MA 1AL3A 3KC1A 2VB6A 2QFLA 3BIGA 3VSLA 4OVSA 4YB7A 3GXAA 2HQNA 3OYNA 2I0CA 1B7UA 2VOZA 2BHZA 2ISYA 2P6TA 2LY2A 2XB5A 1H88C 4MAGA 3C31A 4XRFA 3ABKH 1MG1A 2Z8EA 3D1NI 2GH9A 4HTGA 3CCYA 1X3UA 3JTHA 5TP9A 3I5UA 1ORKA 1BTJA 1G3WA 1RDZA 3RLFE 1T98A 5H8HA 5AE4A 2DPUA 2C6YA 4U87A 3MPKA 2KL4A 2XGCA 3MQ0A 2E5ZA 5KNLA 4XL9A 2DQLA 1IDZA 4PFBA 3HOZJ 4A3KJ 1H44A 1BOBA 4H65A 2UVGA 2UZKA 2JVGA 3LSWA 1RYOA 2NRAC 4BJ5C 3MZBA 2LKPA 4D0PA 4RB1A 3KPHA 2RC9A 1IQ7A 2CEYA 2P3NA 3VVEA 2IS2A 4G8MA 3OO7A 2IEEA 2QVRA 2B4LA 2BZTA 3ZKKA 3TTLA 2L5VA 4Y4RA 4JX5A 4YB6A 4H8JA 5I56B 2XXKA 1EZPA 1MY4A 3TP0A 1H43A 3H06B 4D7MA 3CDIA 1N77A 3PUZE 1J75A 4JX6A 1NK3P 2CFOA 2V1NA 2X6WA 4AIDA 1W1WE 3CVGA 1JKOC 5FRMA 4P1WA 3BLYA 1D3YA 3TL4X 4ZDPA 1OYIA 2B3BA 3U21A 1QU3A 2I48A 1B40A 1NV6A 4Z0IA 2VOOA 4JWOA 1FCKA 4C2UA 4GWSA 2OJED 1FBCA 1OCCH 3ZRGA 1WGXA 1LEAA 2VJIA 4F52A 4HAMA 1UZCA 1DOTA 3IX1A 2ID6A 2EV0A 3K4NA 3WE2A 2K9SA 1KQ8A 2ZYOA 3RPWA 4HNTA 1NHAA 1KONA 1V5GA 2NVYJ 3CF2A 3ZQGA 2G29A 3KC0A 4C3HJ 1XOCA 3IUOA 3FBPA 1FBDA 3V42A 2H94A 2WY8Q 4H46A 1VQKI 5CVUA 4HXVA 2O8XA 4NMYA 5L3GA 3QODA 5DM7F 4MEXF 3H92A 3MEXA 4FATA 4GRKA 4A3JJ 2X51A 4ETSA 1NH3A 3A01A 1FBQA 3CG3A 1AOVA 3JZJA 3FJ7A 5K5QA 1UG0A 1UHMA 2EZIA 1SI0A 2OUMA 4OIQF 2DMUA 1QUKA 3BKIB 2M0MA 2X85A 3O6BB 4KCDA 2ZJ2A 2ISZA 5DEXA 4DCXA 2VGQA 4BQQA 1NG6A 1Z1DA 1G6NA 1MDP1 2O6AA 4F29A 1K79A 2O0YA 4DYRA 3GTMJ 2VQGA 3S14J 3P7IA 4JWYA 2Y0SN 2VQHA 4MH5A 4BXFA 2COMA 4FX0A 5GPCA 4WXDA 3ABUA 3OOUA 4OMYA 1YS6A 4M3DA 2JTVA 2HKXA 3T93B 4QFOA 3TEPA 3J81Z 4KN7X 4UV9A 2CV0A 5JVTA 2WBDA 3PMVA 3AFHA 4I02A 2QEXI 3BTIA 1IV8A 2IXSA 5GAEJ 5I3SA 4G2ZA 3RTWB 2OWZA 3ZPLA 1XGOA 4ZZLA 4HQMA 3OO6A 5HDKA 3LSJA 1W36C 3DELB 4E0WA 5CMCA 3G71I 4PUSA 4F55A 4NBQA 1IN6A 4A6DA 1IW7F 4MGRA 1ZH5A 1V5FA 1ZTYA 2V3TA 3EUKL 1KA8A 1KQ0A 4XKCA 1FOWA 3FK7A 4C30A 3X2QH 5LEJA 5D5WB 3OYBA 1WWXA 1IRGA 1JI8A 4M74A 4LB5A 2Y5LA 2EZKA 2L4MA 1Y1ZA 4G8NA 4OERA 1C0WA 2OCCH 1URDA 3CDLA 5CPRB 2M2EA 2H1LA 3K6GA 3M1EA 4Q48A 4QWQA 4CCNA 4ZYHA 2PMZA 5HDNA 4YIIA 3HOSA 2N8GA 2KQZA 4IGTA 2DFHA 4ZYAA 2HQAA 4NDLA 4MTEA 4I2OA 3A01B 4KMFA 1MNEA 2Y30A 1Z7LA 3I4NJ 4DIGA 1DQUA 1BLFA 2LAOA 3C33A 3BR6A 4PGHA 2EFOA 4F39A 3VODA 4BXXJ 3FIRA 2R7OA 2H25A 1YW7A 4HF2A 4L9TA 2P5LC 3M7GA 2F8DA 3R7XA 4LG0B 2F34A 5JTYB 2K27A 2CZIA 5F1JA 3GLLA 4H1XA 2LRDA 3OR1C 5GTHC 3DM0A 3KP7A 4DBRA 1BBYA 4D5FA 1USTA 1Y4CA 5F7VA 1W5SA 3O6HA 1ZN2A 1O7FA 1JEUA 3KZZA 1D0YA 1IUYA 2ONKE 1YW8A 4YMAA 2F48A 3HOUJ 4HW8A 1DDNA 2QKLB 1MXWA 1YHQI 1AIVA 5I2KA 3LR1A 4I0BA 4A3IJ 2R7QA 4IO6A 2GA2A 2R5ZA 1PC3A 3PL8A 5H8NB 4UUSB 2R7VA 4ZS9A 2A6TA 3SEZA 3K0LA 1XMAA 1JHHA 2IPQX 2MLGA 3SZGA 5HS8A 2PVUA 4E7LA 3A09A 4GWUA 4MF3A 1MIJA 4GRIA 3WGIA 2CG4A 2P81A 4XOPA 5CQEA 1ZTRA 2PMUA 3C3WA 2IRFG 1TWYA 3VFJA 3H0GJ 1AH5A 3WAFA 2MH9A 2XUBA 3BP8A 4P5OA 2B9SA 1T95A 1MGTA 5DYMA 1SI1A 3V7CA 1LUJB 5TP9B 1YW9A 2IAIA 2EK5A 4HYEA 3DLAA 4BJTA 1JKRC 2K3FA 2DXRA 2FVZA 2NS7A 1XVYA 3IR1A 4I98B 1TWAJ 3K69A 3KZYA 1CF7B 1ONVA 1Z05A 2XX8A 4LJZF 2WB1N 4CA0A 3LAJA 3ESWB 3CCSI 1MQJA 2HI3A 2MABA 3SETA 3LNQA 2ZB9A 1VQ5I 3PPQA 4G6TB 1N84A 3ECOA 2WV0A 3RPUD 1O3TA 2ME6A 4G4PA 5TU0A 1YE9A 3IH4A 1BP5A 1RDXA 4KMUX 2QQ9A 1QRYA 5E18F 4RM3A 4ISUA 3T9HB 2QKMB 2WAEA 3BQYA 1FYLA 2F4IA 3CMAI 1J1NA 3HRMA 4F18A 1ETVA 3PTYA 2CUZA 1H8AC 1GGGA 2WTEA 1Q1VA 2BBYA 4BACA 1TNTA 2XXHA 3FKJA 1IRXA 3ZQFA 3TOBA 1HQCA 1LKXA 3F8FA 1R1UA 3V4GA 2ZSIB 3KP2A 4MFIA 1Y3QA 1VQNI 4OEUA 2BY1A 4N13A 5L3FA 1G59A 4KR5A 4RGXA 1MPBA 3SEYA 2KIQA 4MNPA 5DTBA 3B8BA 1H9GA 2CO5A 2KZVA 3HSEA 1B7HA 4LD5A 2CH0A 2MD5A 1BIBA 4RLFA 5IP7J 5IT9Z 4MNCA 5HS9A 1ZRFA 3HFUA 2QQ8A 1E3PA 4BDZA 1Y8RB 4N4OB 2NOGA 4RPNA 5LHGA 3UORA 2Y7WA 5AONA 3S2VA 3U9GA 2EILH 3EDPA 3HB9A 4UB8C 2QVUA 4NHBA 2Y48A 4QFLA 1OCPA 2QLZA 4BDLA 4LVQA 2Y7RA 3L09A 1VQ9I 3O3KA 2UXAA 3EHSA 5ICGA 2M1BA 4UUTA 2WBBA 4NC7A 4A5MA 3C32A 4WCGA 2A5TA 3RTRA 4I40A 3M3YJ 2HTJA 1SQYA 3ODBA 1WRJA 2CEXA 1NI9A 3BG7A 4R6KA 1IUDA 5FLMJ 3CFZA 4DIQA 4Y7NJ 1GV2A 2DQRA 2FNPA 4A3MJ 2EZLA 1NV0A 1JKQC 2V1UA 3PM1A 2QS2A 2XRNA 2ZJQF 4R6YA 1ZG5A 2TRTA 1OKRA 3AKZA 4X8RA 1LEBA 3VYUB 2QYOA 2CUJA 4LONB 4R2FA 3PD9A 2O7IA 4GX3A 2ZMEB 4AS4A 4CUGA 4ESWA 3BCBA 3IL2A 1A99A 4O6JA 2LP0A 4B1RA 3C2HA 5AA3A 1G3TA 5ISUA 5E3MA 1X4PA 3QWLA 5J1DA 5EYFA 2R7FA 3Q5FA 1AKHA 2MC4A 5FLVA 1IXHA 3DLNA 4P0GA 3OYGA 1SAXA 2OC6A 4N8YA 3TUSA 3K0VA 1ZYRF 3PUBA 5FHMA 2XKOA 3RKYA 1PUFB 2P7CB 3G3GA 4DE8A 1TWGJ 4PFWA 2VPRA 3C2BA 3LL7A 3K4LA 2IJLA 3ZR8X 4RB3C 3IRQA 1IMDA 1FQDA 2ONRA 4OQOA 1Y3NA 1P2FA 4P55A 4M9SA 2FMYA 5JLXA 4D1QA 2W57A 4ND9A 1HW5A 4M9XA 4PAFA 3T96B 3A03A 3H4ZA 1R4MB 3TO6A 3SJMA 2VD3A 4NE4A 1MPCA 1XGSA 4Y15A 4DLDA 3LSFB 1IMAA 4OHNA 1TW3A 2VKHA 3LMMA 4GWYA 4PGPA 3QYFA 3N5LA 3F22A 3S1QJ 1JVYA 4G8HA 1SYIA 2V79A 5GAGJ 5GTIC 3GTJJ 3QYTA 1TBXA 2OF7A 4F92B 3CFXA 3T66A 3H1CA 2R7DA 1IF1A 1FTKA 5CVRA 2FF4A 1VQ7I 1QBJA 2P0SA 3ILTB 1GV8A 4GXOA 1LFHA 4CCJA 2XPWA 1YQAA 3B73A 2OWSA 2OD5A 3P5JA 5HVQC 1D9VA 3IORA 2QQBA 5EEAA 5ET7A 4QTRA 2QVVA 4XF5A 4RGRA 2E35A 3LBSA 1MNDA 4RBOA 3ZCOA 4LUBA 3DP4A 4OFLA 1MBKA 4I01A 3OEKA 1EH7A 4XLHA 1D1BA 3GW2A 3V89B 1OCTC 2MFZA 4EJVA 2PFZA 3IJXB 1D1AA 3V8JA 1B72B 3LC8A 3IC7A 1MPDA 4QFKA 1K61A 2Q2AA 3C4MA 3SZTA 3OOAA 3MFKA 4KA4A 1F4KA 3I4PA 2E7WA 2ZXHA 3FK6A 2A68F 2FOWA 4Q5TA 2H6BA 2V4CA 4MBPA 2W84A 2DO7A 1EZOA 2HYFA 1NNKA 2DE2A 2VBZA 2G7UA 5H8FA 3PIOF 3JTGA 1OIBA 1BM9A 2KR0A 2HDDA 4A3DJ 2OV7A 4FEBA 3E6MA 3SEVA 4C1TA 3GFMA 2IGNA 1IRZA 3KEIA 1FNNA 2FD5A 5IM2A 2NNNA 3CP8A 1QJMA 2AIXA 4AB5A 3P9IA 1NK2P 2ZZVA 2JT1A 1T0FC 1IMEA 1MXVA 3I3VA 2UWMA 2L01A 3J80Z 3IWFA 3S3MA 3EHTA 3HV1A 4QHQA 1MXZA 3KZGA 2OA4A 3OOPA 4AUXA 1T56A 3MKLA 1YFHA 3ULQB 1I1SA 2LOOA 3CCRI 2CW8A 5AA1A 1FTZA 3AG3H 4JYKA 4IRIA 4XONA 2YS9A 2UXXA 2XHDA 3K6UA 3U65A 5ET5A 2P8TA 3USDA 2XAUA 5TISC 2LKSA 3OMBA 4RJZA 3RZOJ 4RAGA 4JQFA 4G7HF 3G7WA 1JW4A 1LNWA 5HLTA 2MD0A 5LGUA 2UYFA 5DD4A 2V3UA 4OENA 1TWCJ 1SC7A 3WU0A 1W36D 5K7ZA 3DPLC 3JCUC 4DYCA 4MQVA 1AWCA 2GLOA 3W6JB 3MVYA 3JSOA 1QULA 2IA2A 1XG1A 4BXUA 1RR7A 1X19A 2KDOA 2W00A 5H6QA 5DS9A 2UYEA 4PDHA 5I5PA 1UHSA 3C7JA 4LZ7A 2F5VA 3EYYA 3CSGA 5ILVA 2W1OA 1LAGE 3VE1B 2P6SA 1T2KA 2BV6A 2DMTA 4PE5B 2W4SA 1XSXA 1SEUA 2LR8A 4WX9A 2M4GA 3HHFA 1QPIA 5ED4A 3H3GA 5D5UB 2GXGA 1M5CA 1MY2A 4GX4A 2F2EA 3TELA 1B32A 2VLAA 1B05A 3U1OA 3S9LC 1XGMA 1GT0C 1A6IA 2A3SA 2GIZA 1FPDA 2PX9A 3MMYB 2X1EA 3M3LA 4U2RA 2PN6A 4TLLB 2F7CA 2H5YA 1TFAA 3JRDA 4FHTA 3CHGA 2WBMA 5HDGA 2HOTA 2PBIA 3CTAA 4XQFA 3FV2A 4GF8A 4DXCA 1FOYA 3D4CA 3L6GA 4ZDMA 2ZZXA 4X0GA 4C1UA 3WTTC 3QU6A 2R7XA 2G9WA 3OS1A 3H9QA 1X2MA 1FX7A 1I6BA 2L3DA 4EXKA 4LIUA 3OYCA 1LEVA 3RYPA 2JA7J 1FPIA 5DEQA 3FXJA 1BC8C 3E7LA 4BL0B 2PJRA 4B3AA 1X3ZB 4R9GA 2DK5A 5HNFA 4LMYA 4V2FA 2DDKA 4G61A 3MC2A 2Q8MA 4IO7A 5D5VB 2FEZA 3BG9A 2KPMA 4I3EA 2JQ7A 4UABA 3ASNH 2Q89A 4MLVA 1T0FA 1JTXA 3FVGA 1U6GA 4DGWB 2D3IA 3MPLA 3VVDA 2BVMA 2R3SA 2QQAA 1YJWI 3H5RA 1Z0XA 3PO3J 1XI6A 3QMFA 5D8LB 4OINF 1TQMA 3PUVE 4DZPA 4R6HA 4ZE8A 2L9NA 1LE8A 4N91A 4BHBA 4FE4A 2HDCA 1BK4A 5H8HB 1FBEA 4MEVA 4JBZA 2HS5A 2RGVA 4O3CA 1U9OA 2K4BA 2JN6A 2EH3A 2WC2A 1MBHA 2KLOA 5M3FJ 3T9VA 1S72I 5DUIA 1J59A 3SFZA 3F23A 2ME0A 4EM1A 3HM5A 1ZARA 1FSAA 1JE8A 1FP2A 3RPQA 3KZIC 3MWBA 1RYXA 2FBPA 4EATA 3JRCA 1LBYA 2DYRH 1POY1 4E7SA 4PAKA 2RNJA 2DAOA 3KETA 1EA3A 1LPQA 3EKIA 2Z8FA 3MZ1A 2X4HA 4Y52J 4POWA 3SDFA 4V2GA 2OCEA 1Q1HA 2DI3A 2P0WA 3LA3A 4KIBA 4IXAA 4DBQA 3QUFA 4FIMA 2LK2A 1EZ9A 1MW7A 1D1CA 4AWXB 3WTUC 4JWXA 4M71A 2OTLI 4NF4B 5J3LA 5CVIA 3S4UA 3F0CA 4HCYA 1G3YA 3PSIA 1YJ9I 1N3XA 1P4XA 4J19A 2WYPA 3OYDA 5CQGA 1DSNA 3O6IA 3N6TA 3CJNA 4HX7A 2O03A 3IHUA 1RKMA 2FA5A 2GM4A 2DYXA 4H45A 1YITI 2JUGA 2E71A 1A55A 3S9NC 1B6HA 1RUNA 2VT5A 1MMDA 4NG7A 2XKPA 1B58A 1LBBA 2HFBA 1FEXA 1RR8C 3N4MA 2I10A 4OAZA 4QPOA 1SD3A 2WEFA 4C3JJ 4X1BA 1WH7A 5J4VA 2K86A 4HPQA 1BC7C 1TXFA 2YLNA 2NNYA 1IZ1A 5EYGA 2FXAA 2BVLA 3FXUA 3DKWA 1FBHA 5M5XJ 4MNIA 3CRBA 2XPUA 1MDMA 2QSXA 2RC4A 3E1SA 3VV5A 1ON1A 4WXHA 2X6YA 4BDYA 1LAXA 1GXPA 4IHTA 1JXSA 4DZ1A 1MSFC 3BROA 4H6DA 4JSOA 2EIJH 5EEGA 3CO6C 2JMWA 4J00A 2VUMJ 4YICA 4PDKA 1P6RA 4B4CA 3V8XB 5JEIA 2OZZA 1DBZA 3G3IA 4IHXA 2FQ4A 2WAQA 1VQLI 3P9CA 3FBNB 1OLAA 2XXYA 1K6OA 3OSRA 3VXBA 4XMYA 4ESBA 3MW0A 4EF1A 2KIMA 2Q1ZB 2YSRA 5CVJA 2XXRA 3LSMA 2EFNA 2EINH 1ETYA 5E79C 5J8FA 2ZMBA 3N94A 4OVRA 4XSZF 3COAC 2CGPA 1VNDA 1OISA 1DU6A 3OYAA 1RZ4A 4F7ZA 3FXLA 4ELPA 1ZU0A 2I0BA 1FSEA 5E3OA 3L1PA 2F6PA 4I62A 3TKDA 4NEDA 3S9MC 2YX7A 1BN5A 3E5UA 3PUFA 4PDDA 1ZK8A 1ZGJA 2Q8JA 4H0WA 3PU5A 2L54A 4CDGA 4OIOF 3S1MJ 3TODA 4I0AA 5FLXZ 1KZHA 2AXLA 3K1NA 1GXQA 3VWBA 2V4JC 5D6FA 4X1EA 2O7UA 4DW6A 1M5EA 3BG5A 3K4KA 4A6EA 1HSTA 2PJPA 5I58A 3ABTA 2IGMA 3ERED 1B9JA 3IAZA 3PIPF 6PAXA 3EN3A 1NKXA 1HBXG 3FXQA 1F9NA 1SMTA 5FB2A 1Y39A 3J7AY 2CZKA 3DQVC 1IIWA 2DFIA 1Z6TA 3FGSA 4UB6C 1OCZH 2M0CA 1X2NA 4A3LJ 2FU4A 3A4CA 4ELOA 1YCJA 2HAUA 4GFBA 2VT2A 3LQQA 2CQXA 1O3QA 4KI0E 4XLEA 3CJTB 2MW8A 5L3EA 3A3CA 1WI9A 1Q35A 3FIWA 2XGEA 2UVIA 2VXZA 2LBFB 2ZXTA 3VDXA 1T6SA 4OTEA 3I54A 4UA8A 3D5RC 1UTHA 4KYEA 5D4SA 3DEUA 5EYRA 3S2DJ 2FBIA 4B8XA 3LFUA 1WKMA 1KU9A 2RQPA 2EA2A 3TW7A 2AS5F 2BJIA 3KFMA 2GZWA 2ZKZA 1LFPA 3OSQA 4D9JA 3RNNA 4DXBA 3ZQ7A 1SFXA 1MM7A 3F11A 1RC9A 3HZJA 4PFOA 5B66C 1ETQA 1R00A 3CF5F 3Q27A 2XD3A 4IHWA 4EDPA 1LDKB 4F3GA 2WYKA 1N25A 3M4OJ 1MXXA 1FPEA 1BR4A 2I4BA 3OEMA 4BAYA 2DMQA 3D5SC 4CICA 3FVOA 1VQ8I 5FD5A 1FMVA 4O7MA 3ROUA 1IN8A 4AVZA 4V19K 4QFNA 3DWLE 5EG0B 3JRBA 4AIJA 4NHJA 3FXMA 5HLGA 4MIJA 4U23A 3TTRA 1FTOA 2ZSHB 4BDOA 4FE7A 2K7LA 3AG4H 2EFWA 1LE8B 3PPNA 2KT0A 2D45A 4F3SA 3F8NA 3S8PA 2BYVE 3K6WA 5EQAA 3DLLF 1IG7A 1F36A 1TL8A 4II3A 4XKBA 1H0MA 1R6RA 3WGHA 1NFTA 2VBYA 3DBHB 3B7DA 4HE1A 2Q88A 4MJOA 1UB9A 5CM6A 4PSWA 4XLAA 3KCCA 2DT5A 1SD6A 4BBSJ 4EEFG 3DFGA 1B3FA 1HLVA 2BW3A 2VC1A 2ZZWA 5KZTA 1MDMB 1USSA 1OVTA 2QS3A 1MSEC 5GAHJ 4NC8A 5LRSA 3KYLA 3HDDA 2PX1A 2EFPA 1K6YA 2PEXA 3WG9A 3JW4A 4IO9F 1LJ9A 4L5JA 1J0RA 2M8CA 3KX2A 4X1DA 2VIXA 4ZE9A 1LSTA 2CFXA 1TC3C 2Y69H 4XFEA 3IWZA 1SW1A 3B02A 3I53A 4MFEA 1NNFA 1UQWA 3FATA 3U93A 3FXOA 4OAYA 4NNJA 3J7AO 2V7FA 2L9SA 3DPUA 1YTVA 2Y7KA 3KN3A 2BY2A 5EQ8A 3VYSB 1HOMA 3WTWC 4KUMA 1S9TA 1FYKA 2VODA 2Y7PA 4M6YA 1FPJA 2GHAA 4U4SA 1HDDC 3JAMZ 1QA6A 3IFCA 3GTLJ 2ICWG 5EHMA 2BE5F 1MMSA 2Z5UA 3K4JA 1MH4A 3KYDB 4G6QA 3FXRA 1OJLA 4AU7A 2BOLA 4ASNA 1FBPA 4H5FA 2O3FA 3DP7A 2HYGD 2ACJA 4MMPA 1SVLA 4YFNF 1Y0NA 5IZ1A 4XN0A 1EV7A 3HCQA 4F19A 5F0FA 2H8WA 2XF5A 1FW0A 1K4TA 3SERA 2CUEA 1FTAA 3MVPA 5A2QZ 4N8GA 3FHZA 4OVJA 2YJPA 1XCBA 4KHZE 3CSBA 4O3BA 3AG1H 3W15C 4OXVA 2LREA 2M45A 4PJLA 3GBAA 4ESXA 1R1TA 5JLWA 2HPGA 3TW6A 4WK8F 1ZLKA 4LATA 1W4MA 1EJ9A 4ANJA 5J47A 3AAFA 1TW2A 1Z9CA 3QK6A 4F3BA 2Y9YA 4U0WA 3MVWA 4QRZA 2F5FA 2ZNZA 3PFYA 1MJAA 5DCFA 3TOAA 1DK4A 3L9FA 1QZEA 4XN3A 4KT6A 4RYAA 4BE1A 4N07A 2LLKA 3KGCA 5FHNA 3UIFA 1PDAA 2X6XA 2HZDA 1OCOH 2M4KA 4LGWA 5BQTA 2RCAA 3G3JA 2HYJA 3VB2A 2ZXWH 3G3ZA 5FHOA 2XRLA 2DWHA 1SFUA 1MQHA 1VF9A 2EWNA 1DGWY 4M72A 4KFQA 4XEQA 5H8QB 2DWJA 3H3ZA 3OSFA 5EQ9A 4Q5SF 5JTYA 3HKZA 2X7PA 3P9KA 4MQ9F 1FPFA 2R4GA 4AIKA 1B6AA 5DV5A 3T9XB 3IRRA 3VSKA 1MBFA 4ZYDA 4FEDA 4IO5A 1WCMJ 2PMZN 1D8KA 3CO7C 2E36A 3HOXJ 4FASD 4HE0A 1V5EA 3J7ZI 2BW3B 3QSLA 2W24A 2XROA 2EB7A 2HWVA 1UAAA 3M3FA 1KYWA 3VFZA 2VD2A 2F5XA 3JRHA 3MP6A 1WJAA 4N0BA 1FBUA 5FJ8J 3MKZA 1OFCX 3TKYA 4FORA 3EUAA 2YU9J 1P4WA 1T39A 3THIA 1LDJA 3BR2A 1B52A 3L2UA 3G73A 2HZLA 1FTLA 4PBHA 2D5VA 1CB6A 2OLBA 3GFLA 5CBRA 5IOYA 3CIJA 4GBVA 1SMYF 1R49A 3RQ4A 1D4NA 1SFOJ 2NXNB 2PCRA 1O3RA 2HKOA 4J01A 2HEUA 5ILSA 5B3SH 1O7LA 5DVJA 5FKLA 3NOHA 2QS4A 1MZBA 1PB7A 2VJ5A 5CMKA 4M73A 3LOCA 3G1OA 4NF4A 4G6DA 4PJMA 1IDYA 1V3FA 4L17A 4CCKA 5TPAA 2ID3A 1Y4TA 3BZKA 2DA6A 1WJFA 5ILUA 1WJCA 2G93A 5E1ZB 5B70A 3KP5A 1G0IA 1SDXA 2Y7IA 3K10A 4H4KC 2F6CA 3L00A 4W97A 4YIRX 4CGZA 2XXPA 4JXIA 4RAZA 2L4AA 4E7KA 4OIPF 1L0OC 1R9QA 5FTIA 3TFLA 3W2WA 3QPLA 1NL5A 1XHYA 1INPA 1ZAOA 2XV4S 4Y17A 4IX7A 2KRFA 2VKVA 1D5VA 1A40A 1JEVA 2XASA 1KQ9A 1DTGA 1FIAA 1X58A 1NV3A 1I50J 2XF6A 5K7HA 4RB2C 1EYIA 1J7KA 4ESFA 2ZYKA 4IR8A 2HPIA 5HS7A 3ZKLA 5I57A 5E8GA 5IGAA 2L7KA 1QHGA 1F5TA 1FQBA 2CJJA 4MHFA 3QOPA 3LV0A 2DVZA 5L8DA 2HPMA 4M3FA 2Z99A 5BPIA 1MMNA 1YLFA 2E2JJ 1OQGA 3PO2J 4GOTA 1D5YA 2PQ8A 1SYHA 2QSFX 4UNOA 4JBAA 4HSRA 1KZ8A 1ZBMA 4GXSB 2QM3A 3GO5A 4L5IA 3ZP5A 2JJKA 4JB7A 1P7IA 2BY3A 1D0XA 2OPTA 4MIMA 5F64A 2IW5A 3ML6A 2H98A 3K4MA 4A0XA 3D1RA 2H6CA 1FQAA 2XXVA 4GWZA 2DTZA 4RPOA 3HOWJ 1LCFA 2AQEA 3KFWX 3MP1A 3ISPA 2OK2A 1QGXA 4YELA 3CC7I 1T38A 1FWZA 2DBBA 1B3LA 1PP7U 3E97A 1US4A 3GMEA 2O9LA 2PYYA 3GTGJ 3ECHA 5AA2B 1XVXA 4ZJZA 3K2AA 1GUUA 3RKXA 4ABZA 4BU2A 1LBXA 2B4MA 1MY1A 1NV2A 1WVRA 2E0SA 2KDZA 3E4RA 3RPLB 3IO6A 4A3FJ 4YFXF 1US5A 2XWKA 3O8HA 5JHUA 3Q0WA 1X1AA 3D4GA 4BS9A 1POGA 2KQRA 3QQAA 4I76A 3ZQLA 1O3SA 3RYRA 3SYTA 3GYHX 2NXOA 5FLXK 2R8TA 2GWRA 3HGYA 2E34A 3V5AA 4YZZA 4HX4A 2NUVA 3QAHA 3PD8A 1QPMA 4OFOA 1HKTA 3ZQCA 1JW5A 5J1UA 3T0JA 2LTPA 3OYMA 3R6SA 4N81A 4MEYF 3Q29A 2ZYMA 3IB0A 2LY1A 5IAIA 2ZBKA 2DT7B 4EGZA 2ZJRF 2ALUA 5TPAB 3W6VA 4KISA 1QHHD 2P5KA 4NB5A 3I3LA 4OYVA 2OCUA 2KISA 1PJRA 1I3AA 2DOEA 4U88A 2ESHA 1LFUP 1RUOA 4WKMA 2H09A 2R9JA 2W48A 3L7WA 3BTLA 1QKAA 4CYDA 1N78A 4KIFA 1ZLJA 3RDIA 4GLIA 3J80K 4FJPA 3WG7H 4LITA 3GXOA 9ANTA 1JHFA 5BPDA 1MQIA 4DNCA 4HZFA 2BJJX 2ESNA 4Y3OA 4ECFA 3RCOA 4GQOA 5JFRA 2CSOA 4FX4A 2HR3A 4BHCA 1B4HA 2WV1A 2XAGA 3PJRA 4F2QA 5BS6A 1FJLA 1DGRM 4F1UA 1U8BA 2VKEA 2DFFA 1FY7A 1BR2A 3BWGA 1USYE 3OYKA 2I3WA 1MH3A 3BT9A 1L5TA 1OYWA 2JWTA 5LEKA 2Z3YA 3LSPA 4ZTJA 1B51A 2F36A 5FKNA 3J7YJ 3E6CC 3HN0A 1BJAA 1J2XA 3BY6A 2VONA 5DVFA 2HXRA 2RV8A 3KLOA 4F91B 3T9UA 2DOJA 2DW4A 3HUGA 1MY3A 1N7XA 3T0YA 1POTA 1MRPA 4KIGA 1ZKGA 2VL8A 3JRFA 2Q8KA 1TT0A 1MY0A 3R26A 2E5NA 1LVKA 4P96A 3KYCB 5LGNA 3TTNA 4AB6A 1QNTA 3M3KA 4L9NA 3CCLI 3TTMA 2XB0X 2GOMA 3WU2C 2EPFA 3NEUA 5ET6A 3REOA 3G3FA 3FKIJ 2LNBA 4M3GA 4UV8A 1K4SA 5F6FA 4BDRA 2E1MB 1O4XA 1B8IB 2VT3A 4AVPA 4QSHA 1DMBA 2DA2A 1G4DA 1ELJA 3K00A 5CMMA 3ZOBA 3RUMA 1FIPA 4C2TA 2VPLA 2ZCWA 1LGBC 4XXUA 3G1LA 4HSTA 1B72A 3JV9A 2R5YB 2TCTA 1DCUA 1I6AA 3I59B 4UUVA 2FHYA 3RI4A 2F4OB 3MWMA 2V3QA 3A0HC 4OANA 3I64A 4G7ZF 5GPAA 3CLQA 4BBRJ 3HEFA 4MX6A 2ZYNA 5AA2A 3V7RA 2G7HA 3O28A 2CV2A 5DVIA 5T3JA 2AL5A 3CESA 4ZEKA 2VC0A 2GRVA 1IO2A 3DXJF 3VYRB 4IB2A 5LBQA 4RMNA 4QF9A 3RY3A 3A29A 3K4CA 4A3EJ 4Q0CA 4ZDLA 3DTKA 3FMSA 4LK1F 4FCYA 1FPLA 2W7YA 4PCDA 1D0ZA 1RKTA 2PMHA 2W7NA 1IC8A 3QAXA 2IGOA 2RAEA 2ZNYA 2HAVA 4PQJA 5DT6A 2XWIA 1QO0D 4EUOA 1WHUA 2B7EA 2V9KA 2Z1DA 3LSRA 2VP1A 4QFPA 2V93A 3LAPA 2R6GE 4GBWA 4H5GA 3KP3A 3RQIA 4C3IJ 1U3EM 3NAUA 2V84A 4HRIA 3BR5A 4XR6A 4HNVA 1S8NA 1HKQA 3BBRA 3U1DA 4LK0F 1YYZA 5K2XA 1U5TA 2HQRA 3VOEA 1Y20A 4OEVA 2HU9A 3EF7A 3J81K 1URSA 2IS1A 3GVAA 2JRTA 5DCMA 2DA4A 4LN5A 1TTYA 3AL0C 5F1QA 3M8FA 4A3GJ 5CLSA 3MZ9A 2DYSH 1RIOH 2O7OA 1ENHA 2VE9A 4NWDA 3K02A 2X0LA 5IT9K 4EM0B 4EV0A 3KJ7A 2Q74A 4R75A 5FTHA 2XHKA 4I9DA 2CMPA 3F6VA 1HW1A 4KYSA 4YEJA 2VJ4A 2QSHX 5C4XJ 2AO9A 1S29A 3N26A 5CJ9A 4G7OF 1RNLA 3CC4I 4NUBA 2HXWA 1Z77A 3B6QA 4OVTA 3KLNA 2WA0A 3GZGA 3TTKA 4S0HB 2PFBA 1NUWA 4TLMB 2AL4A 5J40A 1YIOA 2E60A 1R6ZA 1JJ6C 2O1MA 3W3CA 3TPAA 4PFPA 3GZ5A 1UTHB 1B4AA 2A5WA 1A35A 1FPQA 2KZGA 3GBGA 1P7JA 2O6GE 4R73A 4G68C 3HSTA 5ICEA 1CQTA 2EBIA 3RN8A 2DTRA 1USYH 2HXOA 3S2WA 2PJRB 3M1CA 4Q4ZF 1S7OA 3CD6I 3JRAA 2EV5A 3LSIA 5FD6A 3HUGB 4EQ7A 1MJ9A 2K85A 3DCFA 4NQWA 5EZHA 3S3OA 3IOTA 1ANFA 3PPPA 5FBPA 2OZ6A 4XIDA 1VSOA 1F9BA 3N97A 3LSGA 4KYWA 4U22A 3OWTA 1KWHA 2GQQA 2I8DA 3WTVC 1DUXC 2Z8DA 4RM2A 3GZ6A 5DM6F 2RN7A 1UTBA 3RKWA 5LHHA 3LUYA 5KCJA 3OIPA 4NGUA 3O2AA 2ZNSA 2I49A 1VZ0A 2CV1A 3IL1B 3MVXA 2DA7A 2D2WA 1OPCA 3UR3C 2VE8A 3CC2I 1MD0A 4XORA 4YAHX 3ZN0A 4OVPA 3OIQA 4U1OA 3ABMH 3OL3A 3TGNA 5M5YJ 5IY5H 2VN2A 5EGOA 4JSDA 1ZG3A 1CF7A 3FBIB 2RKHA 4XSXF 1WJDA 4ZZAA 4H0EA 1I5ZA 4GDFA 5EYHA 1KGSA 2FIEA 2MSYA 4R1HA 1OMIA 4KQPA 3O97A 3O6GA 2ZMEA 1YOVB 5IOZA 1VQMI 2XXQA 4JVCA 2KKOA 2O1LA 2JSPA 4BLAA 1B1BA 3T8RA 3QPSA 3MZHA 4FISA 1ZJLA 4DI3D 2DE3A 3LSTA 2WKYA 4BEHB 4OWDA 3RIRA 2I5UA 2ETHA 5HOOA 4LB6B 2AHQA 1E17A 2QRYA 1IV6A 5AIPA 5FGMA 4Q47A 4ZC3A 5LTCA 2H4IA 2STTA 1LAFE 3MQ9A 1P1NA 1FQFA 4ZECA 3ROJA 1H45A 1Y1WJ 1YX3A 1SVXB 4UVBA 2I4CA 5L9SA 2PMSA 1R5HA 2R93J 4GGGA 4Q30B 2XAJA 1B1HA 4ZEIA 3M8JA 1BW5A 1RESA 3SKPA 2HHMA 5CBSA 5E17F 1S3JA 3GZNB 4CZZA 4G8XA 2GOXB 3BR1A 4C0RA 4XLCA 4EJWA 3WTXC 3SZPA 2BXZA 2UXNA 5DTDA 5KAFC 3MAMA 4N4UA 2LF7A 2YPRA 1IXGA 3I55I 2Z9OA 3IB2A 2FJ1A 2M3AA 3HOYJ 2OQGA 1NUZA 4I1DA 4OZ9A 2XGDA 4U4XA 4ELRA 4G77A 1ZLQA 3K1PA 4NQWB 4ENMA 1AOYA 3MN2A 1LB9A 2QZ8A 3K4BA 2LY9A 5IPAA 2RKMA 3TCHA 2VASA 2CW0F 1OR7C 3FMQA 3GCMA 2QS1A 2CQQA 5IP9J 3UKGA 1I69A 4XIGQ 4XK4A 1SVMA 3EUHA 2JPCA 3U8QA 4A2UA 1I3QJ 4N6DA 1REPC 3N05A 1OMPA 2F3BA 3RZDJ 1B7ZA 1IXSB 2BHYA 5CKTA 3KEOA 1FMWA 3PQJA 3K70C 3RJPA 3QYBA 3BFTA 2Q2EA 2F7AA 2DDAA 4FT8A 1XCVA 2UV1A 3S16J 1R4NB 1GVCA 1FBGA 3C9HA 4ZYGA 5DW8A 1MMGA 3I4MJ 1YRNA 3T1BA 3IJOB 4G68B 2X1CA 1HA8A 4RXLA 3M07A 1UG2A 3BG6A 5HLIA 3OSGA 2DWIA 2EV6A 4HW0A 4QIWN 4GWOA 1ZRCA 1Z7ME 1Y9UA 2R7WA 1FTJA 3H9GA 4ZDOA 1HSLA 2QSGX 3E3VA 3M8UA 4HF0A 4Q8RA 4NC6A 2BEOA 3QXMA 4N6PA 3R4KA 2FNAA 2XD2A 4P8BA 1XS9A 3HRUA 3CUOA 1B9NA 1ZGWA 2H27A 5M3MJ 1NNPA 3Q26A 4N6KA 4YKJA 4FAJA 3OELA 2WAQN 1NH8A 1URGA 1A5JA 4YG2F 2O51A 3CUQB 2BXYA 3QP5A 2DK8A 1FJ6A 4IHYA 3FASA 5ELVA 3VXCA 2GAUA 4BY1J 4Z7EA 5A5XB 1GDTA 1OQYA 1SBPA 2UVHA 3QUJA 2DT6A 4NF6A 2DJNA 4S05A 3BOQA 4WXCA 1DP7P 3P7NA 4M3EA 1B3EA 2YUSA 4LG3A 3C35A 3A02A 1IRFA 1BR1A 3G1MA 3B6WA 3FJGA 5EGOB 4P0IA 1RI7A 3BPVA 1H89C 1BA5A 1HSEA 2ZFUA 3BR3A 3S3NA 4NF5B 2B63J 4P9UA 4A12A 1P99A 3V7SA 1D9QA 5AA2D 3R0AA 2LFBA 4PFTA 1FQEA 2VQCA 3I0TA 4BH9A 4BYYA 4BDQA 3CR9A 3MD2A 4U1ZA 3SHFA 1MM6A 2O68A 2A05A 1MXUA 1FTMA 1QZYA 2RDPA 3MZ8A 1S5LC 4Z6YA 3WHCA 4IY5A 2QL3A 3TO7A 3RPUA 4U0VA 2XXXA 1X1DA 3S17J 3TCFA 4BDMA 3SDBA 5J8CA 1JT6A 3F6OA 2GFEA 3BJ6A 3O2PE 4FE8A 2JA5J 1SD7A 3IH3A 2PT1A 5BWJA 4CCLA 3EPEA 3H5NA 2V6EA 4UXNA 3H5AA 1JUMA 3RSNA 1YI2I 2L7MP 2IA0A 3K2DA 1Z67A 4RLQA 1SD4A 3H0DA 1ATGA 3OO8A 2IEKA 3IB1A 5IYDJ 1H3DA 4O5VA 5M2VA 2I6EA 1VQ6I 2GHBA 5B1AH 1H76A 4ENKA 1ZQ3P 1LFIA 5K1YA 2O84X 4NWCA 1AA7A 4N4NB 4AC0A 4E7HA 3VLWA 1FOKA 3IO4A 5I56A 5LGTA 1TWFJ 3SDGA 1PUEE 2MH2A 4BHPA 2YPNA 4EF2A 5H8QA 4LA9A 1WI3A 4B47A 4DDDA 4BQAA 3JYRA 5KHDA 4WWCA 2NVXJ 2E1OA 4L9JA 3QRFF 1VQOI 4LLLA 4ZYEA 4IF4A 4KITB 2XXIA 3H7MA 5ET8A 3CMMA 3T8TA 4IL6C 2XDVA 1ETXA 2FMLA 5FKOA 4PGGA 2E1MC 4LLNA 1XGNA 3C1DA 5KK1A 3T22A 2JVHA 1FZPB 3L2RA 5J6XA 2DA1A 1NV5A 3K1MA 1WPKA 1WJ5A 1JUSA 2VOPA 2A69F 4WEPA 3W9WA 3ZMTA 4ELQA 2HEOA 3B6TA 2X48A 1XPXA 1QVSA 1R58A 1E0EA 1SW5A 4OVQA 2E2HJ 1S9HA 3C18A 3UK4A 1K9ZA 1B59A 2VI6A 4KCCA 1NUYA 1S6LA 4EGYA 5BUUA 4HG2A 3FXBA 3ZGKA 1IEJA 2M8EA 3HO7A 3CCEI 4I3YA 1QQIA 4IQJA 1BOAA 5DDGA 3CI8A 4RGUA 4HCWA 2L0KA 4P1LA 4NF6B 2PG4A 3CJQB 1T33A 1B0LA 5FO5A 1B5HA 1EH3A 3PPOA 2K02A 2B0LA 1PB9A 4I6ZA 3C34A 5HBCA 3SESA 2HXIA 3QPHA 5E1XA 1GLNA 5I2NA 3B6AA 5I59B 1A36A 3OYIA 4JDFA 1T0KA 1ZGAA 2XAHA 2Q9TA 3QPTA 3IOVA 1J9IA 5L9MA 3RQTA 4NQ8A 2DP8A 1M5BA 1CGPA 4DJAA 1G0HA 2NWJA 3TMOA 5H20A 2M34A 4B43A 4PBQA 4GYIA 1U9NA 1PDNC 1HKSA 4NF8A 4RK9A 4L18B 1UHWA 2K9LA 3OYFA 1B0HA 2NOOA 2VKDA 3W2VA 5ICCA 1UCRA 3OS0A 5BMZA 3MSTA 1B4ZA 1WDNA 3ELKA 3OR2C 4MTDA 2HVRA 4OA4A 4TQUQ 1A6QA 5CYVA 3K9TA 4C9YA 4CXFA 4E4HA 3AG2H 3KJTA 3OENA 3MJNA 4LP2B 3IAS2 3HPIA 4JP0A 2PLYA 3GWZA 2GIVA 4NF8B 1W0UA 1TP4A 3OO9A 4XLFA 4BDNA 4XRSG 1ZELA 2LVSA 4A93J 1X1CA 2VQLA 4R72A 1W0TA 3IK6B 3DEWA 2A5TB 1RDYA 3PPRA 1UFMA 5EQ7A 3KSXA 2R5YA 5LHIA 1ZIUA 4A0ZA 3DPTA 1J5YA 2P4WA 2M7AA 3G4SI 5E3NA 1K9YA 3WGGA 2M87A 4KPTA 3TBIA 2Z33A 4M6XA 1RETA 3O9PA 2KLFA 2JA8J 3I9V2 1KU7A 4OESA 3HTSB 3SEWA 2BGCA 1WODA 5H8SA 1GVDA 2IT0A 2R5ZB 4XKVA 1R7JA 3N6UA 1Z91A 3MKYB 3OV8A 1X4OA 2H8RA 3VVFA 1LBVA 4JK1X 3RPLA 4AQ4A 5JI6A 5E3LA 4CZCA 2XF7A 1XTAA 5ERIA 1N75A 1FOXA 3G3KA 4CH7A 2J5PA 1B3HA 1ETOA 1TWHJ 1EYJA 3TYHA 4F1YA 5L3DA 2BY0A 5BOXA 3AXFA 3HOVJ 4ZEDA 1R22A 4M9ZA 4IOCF 5K2YA 5H8FB 4OIRF 2LMDA 1MQGA 1WFXA 2HQ0A 2CU7A 1KA1A 1YX5A 2XWVA 3Q9VA 5B7DA 2V9PA 1Z3YA 3K01A 4PE3A 4U7BA 3KG2A 4HV5A 4A0YA 1RRJA 4WEDA 1Y1VJ 2DWAA 4LLGF 2PT2A 3K6VA 4BKXA 2Y0SA 3HYIA 5AIQA 5FKKA 1KU3A 5TJJA 1R71A 3AL0B 2MA3A 1QUIA 4WXJA 3CMEI 3CCMI 1LLSA 1O57A 1FRPA 3LSKA 4IO2A 3A1YA 3BR0A 4HE2A 4F93B 3IV5A 4MO7A 3DTEA 3DTIA 4HA8A 2Q0OA 1HW2A 3TDJA 2FRHA 1XN7A 4E7IA 3TDUC 2RC8A 2JZYA 5HM4B 2Z2SB 3CDHA 3WE3A 3S93A 2OU2A 2O61A 1R5ID 3B50A 4G94A 1TZLA 2WY7Q 4LZ5A 4DYQA 1TFDA 1NG7A 3U72A 2ELJA 5C44J 1O7TA 2A5YB 4XKPA 1B5IA 3R61A 1IMFA 2ZFWA 2Y9ZA 4GWXA 2JPBA 2DXYA 3HC7A 3FD3A 2QVOA 3FHNA 5LDZA 2MYSA 4XICA 2CRGA 2MC3A 5E8IA 3CFLA 2L5QA 3S9EA 4QLCU 4XKQA 3FUZA 5HPQA 2OX3A 4RAFA 3BPXA 4EXLA 1V4RA 5CMBA 3WTZA 4NX1A 2MG4A 4GIZA 4HNUA 2A6EF 2CQ7A 1B8IA 1ZKBA 4OETA 1CNQA 3VDFA 4AS5A 1D8JA 2IBDA 4F3PA 2LH9A 1OYYA 2EIKH 1Z6RA 3L2VA 4R79A 2ZNUA 1O63A 2F5CA 3CLOA 3DU5A 3H6WA 1W7PA 2JK3A 3E13X 2NYXA 2MBFA 1JT0A 1Z7UA 2FIXA 1BI0A 3IP4B 4OFJA 3FZVA 5HODA 2IS6A 4U21A 4DI4B 4CCMA 1SPIA 2FBHA 2DN0A 4XM3A 2MLKA 2LC2A 4O8MA 1IXCA 3HKZN 4EMSA 1TNSA 2LF8A 4UVAA 1JJ8C 4IKFA 3WTSC 4GO1A 3VYTB 1T08B 3K70D 3HG9A 4PGNA 2WAFA 1Z7NE 4P9FA 3H6UA 1KU2A 2M9HA 1K7AA 4XKNA 2ONSA 1EH8A 2V1DA 4E7JA 2A6HF 3O66A 5ITOA 2XSDC 4A3BJ 3DF8A 2CYYA 3Q28A 4QXDA 3BJAA 2NVUB 2W82A 3FDYA 5D4RA 2K9MA 1LAHE 5F0HA 5F0CA 2TDXA 3KBZA 2IA4A 1QZZA 2QPQA 3CUQA 3VPRA 3I5OA 4IHSA 4HBLA 4EM2A 3FM5A 1JTYA 3E6BA 1FQCA 3I71A 2K4JA 3SEUA 2DJIA 1P1QA 4YRVA 1LCTA 2OTJI 3TQNA 4DQ2A 5IZ3A 2WB1A 4Y13A 2XXUA 3FJMA 1Z21A 5JK4A 3ZMVA 4TOZA 1M1EB 1G8XA 2VBXA 3HRTA 5JR3A 3Q0UA 1BKAA 3I56I 1TLHB 3FV1A 1BIAA 3CZ6A 4KDPA 3KEYA 5EJCA 1U2WA 4RDUA 1LVAA 3SXYA 2J5OA 4AIHA 1PP8F 2XX9A 2ADUA 1PEBA 1I27A 3GFIA 3BDDA 2R7RA 2ABHA 1WH5A 3KBRA 4R74A 1XD7A 2P5VA 4KT5C 4D5CA 1HF0A 3GYYA 3ILUB 4RGSA 1IJWC 4NN3A 5AA4B 4JX4A 3GTKJ 3ECRA 4F1VA 5I59A 4XNFA 1Z3XA 2GQ1A 4O3MA 1B2HA 5IP6A 1P1UA 1YS7A 4ONYA 1GR2A 1GTKA 1XC5A 2QBYA 4K3FA 1U5TB 1Q1KA 1JGGA 2L7FP 4HX8A 4B09A 3OD7A 3R60A 3S2HJ 1A31A 5L3BA 1GHCA 4IGRA 5FFXA 4BNCA 1U8RA 2VHAA 2OZUA 1FBFA 2B65A 2V26A 3QP6A 1TT5B 4IRHA 3F8BA 4EQ9A 4QSEA 1FP1D 5F04A 3U2RA 4ENJA 4A69C 2ECCA 4DZJA 1ZREA 4EQBA 2KJBA 3ZXSA 3TMGA 3L2WA 3EHUA 4NF5A 1MBJA 2XGXA 4G9YA 1U78A 1A54A 3ERMA 4DCYA 1LBCA 5B1BH 3TDZC 1OCRH 1PVEA 4NTLA 2O8KA 3CCQI 4C2MJ 2XC7A 3BZCA 4ZZDA 4X9TA 2Y75A 3OXNA 1YZ0A 4X6AJ 5J16A 4JVDA 3L6HA 3CQZJ 3HHGA 2K9QA 3EPZA 1IN4A 1OLTA 3NWTA 3WTYC 2GXBA 2DVCA 5CRYA 1F43A 2H1KA 4PJJA 3PMXA 1WZ2A 3BCAA 2K5CA 2HCAA 2KIFA 1FBSA 1QGPA 3CCVI 2CMOA 2EJRA 1P4AA 5LLQA 2DLLA 2LYCA 2A07F 3K6XA 2EA4A 4RS8A 1PBQA 1U5TC 1Y56A 2XXTA 1VQPI 5FROA 5M5WJ 4KD5A 4KJZA 3GBBA 5L3CA 3PMWA 1W7PD 2XX7A 4RK2A 1QKBA 4HV6A 4U7DA 3UN6A 3UA8A 4IJAA 2DQVA 2ECBA 5K5OA 5JVGF 4L5EA 1P92A 1K78A 4MNUA 3LA2A 4H67A 2E1NA 1Q9DA 1G2HA 3DP8A 4F3QA 3ZMSA 4IO4A 1YO5C 2P1SA 1I6XA 4YMBA 3Q0VA 4XKRA 3KN7A 1XDSA 1HDPA 2ZNTA 2STWA 1R9TJ 1IN7A 2DA3A 5FFZA 5K5RA 3KIOA 3ZN1A 3F8CA 4N9IA 5KAIC 4IZZA 4LOCA 4XOTA 2DSFA 4KFCA
chains in the Genus database with same CATH topology
1LBZA 4XLNF 2E7XA 1DPUA 2YX4A 1F1ZA 1KA0A 2XVCA 1FPGA 5D8KB 4UVCA 5E20A 2V9VA 2VBWA 2D1VA 1DPRA 4CHUA 4P56A 3M9AA 3WU1B 1EYKA 2YU3A 3GUDA 5A2QK 3LQRA 4HF1A 2HTSA 3LFKA 2XWOA 4ZH4F 5DD8A 2WX9A 1YYVA 4EVIA 2CQKA 4GCVA 2FBKA 3HSFA 3DV8A 2OBPA 3PQKA 3FWEA 3PFIA 1G3SA 3FX3A 4E70A 1FPKA 2VPOA 4P3LA 1MJBA 2CZHA 2V1XA 1SD5A 4P47A 3CUQC 1VDWA 4PTKA 5DUKA 2OQRA 1EH6A 1IMBA 2HGCA 3EETA 4KN4X 4HDVA 4KXPA 3ZMDA 3KP6A 3GX4X 4JVIA 1I1GA 2MKZA 3F72A 2DPDA 2F5DA 1AWBA 2Y0MA 4K2EA 1XSDA 2NAZA 4PZJA 2ZO4A 3TO9A 1ULYA 1H9TA 1K78B 1GVJA 2E1CA 2L02A 1S7AA 1JP4A 1YG2A 4QBAA 5ICFA 4WF2A 4M1VA 1XDUA 4U0YA 4CO8A 4EJUA 1W5TA 4HOBA 1HXDA 3Q9SA 5TRDA 1IMCA 3MZYA 3LWFA 1ZG1A 1A04A 2FQ3A 3BZ6A 2OAZA 3GEZA 2P7VB 3HTUA 5IZZA 3FM3A 3FF5A 4PETA 4MHGA 1IAWA 2V6CA 1FLIA 2HFHA 1MKMA 2LSOA 2IVMA 4UHTA 3IFAA 4P9KA 1L3LA 2W25A 3D5LA 1FC3A 4LG0A 1FYMA 4YIFA 1LBWA 3LA7A 3V8KA 3LUZA 2QUFA 3W9VA 1LQ1A 2XAQA 4GWWA 4RB0A 5H6RA 2ZXJA 1FT9A 4ENNA 1IXRC 1R23A 1STZA 4OU0A 3ZMUA 3E79A 4NF0A 3ZMZA 3HSRA 4EJOA 2XAFA 3E78A 3SQNA 3E6DA 4ESJA 5KVRA 4HLXA 1R36A 5IZ3B 1JGSA 3EYIA 2A61A 3NQOA 4AD9A 3IKTA 4IVNA 1R5GA 1FPBA 2ELHA 2YR2A 1YXIA 4GX6A 1R1VA 4KNYA 1ODDA 1TQIA 1XSVA 2PI0A 1BI3A 1TQPA 3V8LA 2KJCA 3L2CA 3HOTA 4PFIA 5F24A 2IA1A 3KEQA 2HZKA 1XB4A 2D1HA 4RAYA 4PF6A 3F3XA 5I7IA 4NAPA 4HQEA 3MAJA 1LB2A 1HSJA 2QENA 2F3DA 1Y0UA 3QU3A 4HDUA 3T5XA 3RYDA 3IKVA 4O94A 1NV7A 4R8HA 3FMRA 4O7IA 3W6KB 2GA1A 3M8EA 1YTYA 3K2ZA 1LDDA 5A5LA 2PFYA 3MCZA 4IRGA 3I59A 1WQ2A 3VEPA 4N9HA 2DU9A 2JSCA 1ZRDA 2KIUA 2M30A 3E5XA 4FBPA 5HLHA 4N15A 4P1EA 2FE3A 1KYZA 1FJ9A 1B9MA 2DE4A 2EFQA 1BI1A 2QWWA 3R0JA 4LFUA 2F5EA 4MCOA 3HIFA 3F21A 3KE2A 4PFRA 5D6EA 2RVCA 4EJTA 2QBYB 1SFEA 5EEHA 4X04A 3WODF 4OOIA 2Y5KA 2VPNA 3JSPA 3MYUA 2M5WA 4KICA 4I09A 4I7HA 4OMZA 4L0ZB 3BJOA 2W85A 3H3UA 4GYGA 1W7PB 4HLYA 1NV1A 2HZTA 3GFJA 5LRRA 1BI2A 3GLXA 4PCQA 5CVVA 2P3VA 5E1WA 3I58A 1ON2A 4PF8A 4S04A 4ON0A 1E2XA 2CWEA 2LDUA 5ESYA 1ZHFA 3JAMK 2HOEA 3NRVA 3HRSA 1NUXA 4PC9A 4A5NA 1VTNC 2NS0A 1FSHA 1OR7A 3HHHA 2XA5A 4XBFA 2FOKA 4N17A 2XIGA 2IP2A 1WSUA 5D5XB 5IT3A 1IN5A 4IPAA 3BIHA 5DCMB</