3T1BA

Crystal structure of the full-length aphb n100e variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
b'MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSELTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
total genus 84
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t1bA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t1bA02
3OOPA 1Z6TA 2ZMEB 3ZN0A 3I5UA 4WCGA 1LDKB 4B09A 3WTZA 3TOBA 1P4XA 3C7JA 2JPBA 3KLOA 1E17A 4RGSA 2IW5A 3GWZA 4ETSA 3R61A 5ICGA 1SAXA 3V4GA 1VTNC 5L3EA 2W84A 1WRJA 3V7RA 1XGOA 3DXJF 1G3WA 1EH7A 4A5MA 4KIFA 3IKTA 3BJOA 3B02A 3F8MA 3R4KA 1DDNA 2JZYA 3OV8A 1IN7A 1P2FA 2FRHA 1ZREA 3GFMA 4FHTA 3L2CA 3E6CC 4GGGA 1U6GA 4TV7A 2RNJA 4L5JA 1ON1A 3ECHA 2O03A 3JTHA 3TGNA 1OR7A 1BC7C 3HTSB 5L3DA 4LK1F 1IN5A 1O3RA 2CFXA 4P5OA 1O57A 2JSCA 3BDDA 1HSJA 5BS6A 4IRGA 1R22A 3KEOA 1D5VA 3JSOA 3BP8A 1K6OA 2NNYA 4BNCA 3E5XA 3GLXA 4IRHA 3HUGA 4IF4A 4QWQA 2XROA 3NEUA 4HDUA 1FT9A 1S7AA 2L02A 4HQEA 4F7ZA 3FMSA 2A61A 1Z1DA 3CTAA 3NRVA 3QPHA 4O6JA 5D5VB 4U0YA 3K1NA 2IA1A 1IW7F 2OU2A 1EH6A 5DD4A 3F22A 4M9XA 1ZGJA 1ZYRF 3V8LA 2ZBKA 2RKHA 4LJZF 1J9IA 1C0WA 1ZH5A 4UXNA 2Z99A 1U3EM 4M74A 2KIUA 3IRRA 2BGCA 4HAMA 2DU9A 1A04A 2H09A 5BMZA 3NQOA 2F5CA 2HEOA 3I54A 1MGTA 1QQIA 4N0BA 4G7OF 3KZYA 3CDHA 3HFUA 5JR3A 4CO8A 4D0PA 3WU0A 4EV0A 1KU2A 2HYGD 1J59A 2RQPA 5K5RA 4L18B 3GXOA 2VC0A 1FZPB 4ZH4F 1J0RA 1B6AA 3F72A 1MDMA 3F21A 3LA2A 2DI3A 2H6BA 2CO5A 4YIFA 1KQ0A 2ESNA 4MEXF 3EYYA 4UV9A 1MDMB 3LFKA 2XASA 3T5XA 3F3XA 1E2XA 1D8KA 4OIPF 1ZRFA 4NHJA 5JHUA 2NNNA 1B9MA 4EJWA 2A6HF 3R0JA 4ESJA 2H27A 1U5TA 4ENMA 3TO9A 2GQQA 1SD6A 4YG2F 1GXQA 2K27A 5K5OA 1JXSA 4IRIA 4LMYA 1FP1D 3TQNA 1XGNA 2BBYA 2IP2A 4KMFA 3L7WA 1U5TB 1D3YA 2E1CA 5LGUA 4PCQA 3HIFA 4UVAA 1T0FA 4RAYA 3LQQA 3D5LA 2GZWA 2WV0A 1SFUA 2CW0F 3GYHX 1XCBA 3WGGA 1FBSA 2PMUA 3ZMUA 5JFRA 2M45A 2E1NA 2STTA 1IRFA 4MNUA 2QM3A 5ILSA 5DCFA 3CUQA 3QRFF 1S7OA 1H0MA 5L3CA 1QO0D 2VXZA 1RI7A 2K4JA 2K02A 2ISYA 4LLLA 1HKSA 2K4BA 1QGPA 2FF4A 3KP6A 4EMSA 2HXRA 1W7PB 1P4AA 2EA4A 4M9ZA 5FFXA 2M87A 4ZYDA 1Z7UA 4O3MA 5DEQA 2Q8KA 1YYVA 4KDPA 2DT5A 1DPUA 3WG9A 1I5ZA 4PGGA 5IT3A 1SD4A 5KK1A 2XRNA 4UVCA 3KP4A 3RIRA 4IHSA 3WTSC 4ZYGA 3KFWX 3BZ6A 3C18A 3FZVA 4A6EA 3T1BA 1FBQA 3KE2A 3QU6A 1GXPA 2EFPA 1KA8A 3CO7C 2FSWA 5AIQA 4I0BA 5D6FA 2G9WA 5AONA 4HX8A 1F5TA 4KA4A 3HRMA 3JTGA 5HLIA 5CVRA 2LSOA 3JW4A 3V7SA 3ZMVA 2FBHA 2EV5A 4RS8A 3H92A 1H9TA 1CF7A 4OINF 3KLNA 4HV5A 5HDGA 1FPQA 1V3FA 2H94A 5E1WA 2XAFA 2DW4A 1OYYA 4LG0B 1J7KA 1O3TA 1CF7B 2FU4A 2VOPA 1HKTA 3ULQB 4I2OA 1XSXA 5IT9Z 4R8HA 4A2UA 4L0ZB 1IXRC 4HZFA 1LEBA 3EUHA 2P7CB 3E3VA 2ZFWA 3L9FA 2Q0OA 2G7HA 4P9FA 4LGWA 4KN7X 3QP6A 3HTUA 3SHFA 2BE5F 3I64A 5F64A 3K2ZA 1R5HA 1Z9CA 2TDXA 2MH9A 3PQJA 2PLYA 3DF8A 4G9YA 1SMTA 5CVIA 3PQKA 3W6JB 2XAJA 1P4WA 3KZZA 4L9VA 2VBXA 3ZP5A 1QZZA 2VBYA 3J80Z 2A3SA 3I53A 4YFKF 3N4MA 3CO6C 2PEXA 3BY6A 2A69F 3BJAA 3GO5A 2HQNA 1EV7A 1XDSA 4P9UA 3S2WA 4CZZA 4HOBA 4S04A 2YU3A 2D1HA 2HOEA 3BPVA 2GWRA 2EFOA 2HDCA 2Y75A 3ZMZA 3P9IA 1J2XA 2OAZA 1GVJA 5ERIA 3F8BA 4FX4A 1SFEA 2P5KA 1UB9A 2QYOA 4ESFA 4HX7A 5LBQA 1YW8A 4JK1X 4BXUA 1ZGAA 4ZYEA 5DUIA 3M8FA 2P8TA 1S3JA 2QVOA 5L3BA 2VODA 2HR3A 5F6FA 4G94A 4CHUA 4UV8A 1YTYA 2HKXA 1IN8A 2PQ8A 3RKWA 1F1ZA 3WGIA 1HW5A 3HOSA 5LEJA 1JHFA 3DP7A 2W85A 1LEAA 2OQRA 1BI1A 4EM0B 1R58A 3DV8A 5HLHA 4G7HF 1O7LA 1TW2A 3ELKA 1FSHA 3MFKA 1K79A 4RB1A 3FX3A 3GFJA 2MLGA 5JI6A 3ECOA 4MGRA 2M8EA 2F5FA 2DBBA 5HS8A 2ETHA 3P7NA 4KT5C 1IRGA 1G3YA 1FBUA 4EQQA 4MTDA 1LJ9A 3WODF 4JVDA 4GYGA 3ML6A 2D2WA 4WXDA 3E97A 5F1RA 2W24A 2X0LA 3M9AA 4AIKA 5HDKA 2MBFA 1RNLA 1G6NA 4G7ZF 1G4DA 5D8KB 3J81Z 1RUOA 1B1BA 4AIJA 2E7WA 2JT1A 2GA2A 2EB7A 1SD7A 2VC1A 1IN6A 1MKMA 5HVQC 2KIFA 3TDZC 5LHHA 1I1GA 2QQ9A 1KYZA 2QWWA 3I4PA 1OYWA 3R0AA 4ZZLA 2X4HA 3SZTA 3WTWC 3F6VA 2K86A 3K9TA 2R7DA 2YSRA 4A5NA 1AOYA 1FSEA 3IL2A 2P5LC 1O3QA 2CSOA 1JGSA 2F2EA 4KMUX 1YLFA 3U2RA 1U78A 4YFXF 3FWEA 4XRFA 4N9IA 3MZHA 1SD5A 2IPQX 3DEUA 3P9CA 4GCVA 4Z2YA 2LKPA 2Y48A 4AWXB 3GF2A 2EV0A 3BPXA 3RYRA 3ZPLA 1KGSA 4A6DA 1LDJA 1BIBA 2P7VB 4IVNA 1W7PD 2F5EA 1I1SA 4DQ2A 2FBKA 4ON0A 3RPUA 4FT8A 3FM3A 3W6KB 3I71A 3E6BA 5D4SA 3BROA 2IA0A 2J5OA 2PMHA 1PP8F 2GXGA 3M1EA 5AIPA 3C1DA 2ZNZA 4EM1A 1YO5C 2XV4S 4BQAA 5TRDA 5BOXA 2FEZA 4O5VA 2HQRA 1FYKA 5J8FA 2VE8A 3HRSA 4EM2A 1XMKA 1STZA 3TDUC 4U7DA 1HBXG 4Q5SF 2HS5A 1LVAA 5FB2A 1WI9A 3WE2A 4ENNA 3LQRA 2R3SA 4OIRF 3TOAA 2QQAA 1DUXC 5HOOA 2JPCA 2H6CA 2Q2EA 1FOKA 5LHGA 1ODDA 4P96A 5IT9K 3JAMZ 4RAZA 1G3SA 3MQ0A 1KU3A 4I01A 5E8GA 3HSFA 3U1DA 2V1UA 3KP2A 2NAZA 4P55A 2V1DA 3RYPA 1IAWA 1D8JA 3Q9SA 2QZ8A 3O6BB 2W57A 4KICA 3LWFA 2L4MA 1RIOH 2FQ3A 2QQBA 3EQLF 1MJAA 3RKXA 4HYEA 2LNBA 4I98B 5D8LB 2UZKA 3HOTA 1U2WA 4LB6B 4EJTA 2A6EF 1ZHFA 2QBYA 5D4RA 1H9GA 3GZ5A 1MD0A 2EFWA 3FMRA 1R36A 1W7PA 5LLQA 2ZXJA 4EGYA 2E7XA 3QU3A 2OD5A 2YPRA 3J80K 3H3UA 4XLNF 2QBYB 1T98A 2HGCA 2RVCA 4EJVA 3L09A 2EWNA 2VT3A 4RB0A 1K7AA 3J7AO 1F4KA 2KJBA 5LHIA 5K1YA 4LK0F 1XCVA 2CYYA 4RB2C 1OYIA 4CYDA 5BQTA 1TNSA 4KUMA 4XSXF 4MEYF 4R1HA 4EJUA 5L3GA 1S6LA 3ZMDA 5CLSA 5E18F 3SXYA 3M7GA 5TJJA 3HRUA 3DPTA 5J8CA 3MAJA 4LD5A 4GO1A 1LNWA 1J75A 3VB2A 3SQNA 4I7HA 1OKRA 2GIVA 1BJAA 3K1MA 5D5XB 4L9TA 3DFGA 4OMYA 2FE3A 4RGXA 4WK8F 1DPRA 3AAFA 1Y0UA 2A07F 3FXUA 1WSUA 4LG0A 3B73A 3JSPA 5H6QA 4I0AA 5CVUA 4UUVA 4M71A 2ACJA 1XSDA 2LF8A 5CJ9A 4KN4X 3M8EA 2K7LA 2DPUA 5HDNA 5EEGA 1BI3A 2UXXA 5E20A 1PUEE 2AXLA 4UNOA 5E17F 5FFZA 4HF2A 1RUNA 2NYXA 4AIHA 2O6GE 2NRAC 4MHGA 2GXBA 1TQMA 4R79A 1FC3A 4HF1A 2DFIA 3RPQA 2HZTA 4L0YB 5HS9A 2ELHA 1HXDA 3KP7A 1ZN2A 3O2PE 2OA4A 4OU0A 4A0XA 1KQ9A 4CICA 3T0YA 3GX4X 5DUKA 3WTXC 5H6RA 4BHPA 2UWMA 2VN2A 4MTEA 4H0EA 1QBJA 2KIMA 3E6MA 3RDIA 4RGRA 2EA2A 4CGZA 1TTYA 2HKOA 4MQVA 3REOA 1MJBA 1Z05A 4HF0A 2RN7A 1R1UA 1TBXA 1NHAA 4BH9A 2ADUA 1YS6A 1LQ1A 2L4AA 2XUBA 3I58A 1UFMA 4CXFA 2EFQA 5ED4A 5DDGA 2EK5A 4JQFA 2ZJ2A 4K2EA 1X3UA 1UHMA 3ZMTA 3U9GA 3ZN1A 2FOKA 1ZRCA 3FXRA 2OQGA 3LAJA 4G6DA 1ON2A 1XGMA 2CWEA 1UCRA 4Q4ZF 3O3KA 1ZAOA 2R7FA 2RV8A 5LGTA 1PDNC 2AS5F 4S05A 3H3ZA 1W5SA 1XGSA 3N97A 3FM5A 2KKOA 3V7CA 4HA8A 3WU1B 1I6XA 3VEPA 3ZMSA 4WWCA 1K78A 5ICFA 3G3ZA 4YFNF 2L01A 4M6YA 3DPLC 4UHTA 1ZG1A 4GYIA 4I09A 2YR2A 5DYMA 1K78B 1R00A 1OPCA 3ISPA 4JVIA 1R5GA 4QBAA 2ZNYA 3COAC 3HSRA 5E8IA 4PZJA 4Y15A 3WTYC 2XKPA 1ZG3A 1OMIA 5CYVA 2PN6A 3QOPA 4WX9A 4LLNA 5ILVA 1LB2A 2DPDA 1T6SA 4PGHA 1FP2A 3GZ6A 3MCZA 3E5QA 2VBWA 4JBAA 2J5PA 1FYMA 5HLGA 4M73A 3HHHA 4KYWA 5LEKA 2XVCA 4DNCA 4HLXA 2OBPA 2OZUA 2Z3YA 4QLCU 5DCMA 5A2QZ 1YW7A 3JAMK 2YX4A 1TQIA 3KETA 2M30A 4Y17A 5LRSA 1USTA 4MQ9F 3FHZA 2DAOA 1LDDA 3KCCA 5DCMB 1IF1A 1CGPA 3T8RA 5FLXZ 3Q5FA 2FMYA 4WXCA 2OZ6A 4IPAA 3LA3A 3P9KA 1DP7P 2DQRA 3EETA 2PI0A 3C3WA 3QAHA 3HHGA 4IHTA 2DK8A 2VOOA 1S8NA 4AVPA 3CLOA 3LAPA 3F8FA 1WKMA 2DK5A 1HKQA 2VBZA 3ROUA 1BOAA 1B4AA 4ENKA 3TKYA 1FYLA 3LSTA 4ESBA 2WC2A 4RGUA 3MWMA 3WTUC 3FF5A 1BC8C 3R60A 4U0WA 2LDUA 4XLPF 2A5YB 1B9NA 2V6CA 2RGVA 2IJLA 1JHHA 1XN7A 3Q9VA 4U88A 1ZLKA 1ONVA 2GAUA 1YIOA 3IRQA 4U7BA 2MH2A 1YQAA 3VODA 2QLZA 4Q48A 3WE3A 3DKWA 1JE8A 3GUDA 4EJOA 4M72A 1L0OC 1V4RA 2EV6A 3GFIA 2FNAA 1MZBA 4M6XA 1F9NA 3BJ6A 2VE9A 1ZRDA 1TNTA 5FGMA 5ICCA 3D0SA 4UVBA 4LFUA 5H20A 5KVRA 1XB4A 4G6QA 3ZQ7A 3K0LA 1IZ1A 2PBIA 1Q1HA 5HS7A 1IXSB 3WGHA 2ZCWA 1KU9A 1T2KA 1IN4A 2F5DA 2FBIA 1SFXA 4KIBA 1G3TA 3ERED 2NS0A 2ESHA 4N9HA 4BHCA 1ZG5A 2XIGA 4PDKA 2A68F 3R6SA 4WXHA 2IT0A 1J5YA 4BHBA 4HQMA 2YX7A 4NQWA 1ZLJA 2KJCA 1WWXA 3F23A 3SFZA 3IC7A 4KNYA 2O8XA 4BYYA 2D45A 3QP5A 2KRFA 5CVJA 4ASNA 1KQ8A 1W4MA 1XD7A 4A12A 4U0VA 5JVTA 3HSEA 1YS7A 4XBFA 2BEOA 5FD6A 5LGNA 3GEZA 2XAQA 3GW2A 3G73A 4A0YA 2L3DA 2STWA 2HWVA 2CG4A 3BWGA 3RJPA 4IJAA 5EEHA 1HW2A 1TLHB 2G7UA 2FA5A 1TQPA 3E6DA 6PAXA 3EDPA 4A0ZA 2RDPA 2WTEA 1P92A 3F8NA 3FMQA 1YW9A 1IUYA 4XSZF 4E70A 3BOQA 1B59A 2EJRA 4Y13A 3ABUA 1W5TA 3I0TA 1HQCA 4ENJA 2XHKA 2RC4A 1BM9A 2Y0MA 2IVMA 5FO5A 3CUOA 3VOEA 3K69A 4HDVA 2HTSA 4JVCA 1SMYF 2MA3A 3IWFA 1YG2A 4HV6A 5ILUA 5K5QA 3DQVC 2FXAA 3FXQA 4G8XA 5DV5A 4LLGF 2Z9OA 3EYIA 3CJNA 3KP3A 3E5UA 2O3FA 2PG4A 3CUQB 3MZYA 1GHCA 2JRTA 2DQLA 4IXAA 2HYFA 1U5TC 3IHUA 5L3FA 2D1VA 4CDGA 1I27A 1WQ2A 4OIQF 2MC3A 5D5WB 5ICEA 1O7FA 1XSVA 2HFHA 2JTVA 3TO7A 4EGZA 2ZO4A 2GA1A 5BPIA 2ISZA 1FWZA 1T39A 4NB5A 1XDUA 2M1BA 1ULYA 2ZKZA 4KFCA 1R23A 2C6YA 1HW1A 1FNNA 1R1VA 3V8JA 2QUFA 1QZYA 4M9SA 2UXNA 1P6RA 2FMLA 4YIIA 2EFNA 3LA7A 2O0YA 2M5WA 3CUQC 3IKVA 2DTRA 3WTVC 2WWYA 1USSA 1FLIA 4I02A 1BN5A 1MJ9A 2XGXA 3VFZA 1KYWA 4OOIA 2P6TA 2O61A 2XAHA 4L9JA 2V1XA 3T8TA 3TO6A 2VONA 2XKOA 1UHWA 4B8XA 4RB3C 2LF7A 5J6XA 1KU7A 2BYVE 1BIAA 1EH8A 3F8CA 2BV6A 5FD5A 1TW3A 3MEXA 2QENA 1XMAA 5A2QK 3PFIA 2HTJA 1HSTA 1REPC 3IWZA 4GXOA 2P4WA 3J81K 3L00A 2CGPA 5DD8A 1AWCA 1YFHA 4BAYA 5D5UB 4WF2A 1T38A 5FLXK 3F6OA 3SZPA 2MLKA 4ZZDA 4OMZA 1Z91A 1ZARA 1QNTA 5LRRA 4OIOF 2Z5UA 1RZ4A 2PJPA 1Z6RA 1S29A 2Z33A 3RKYA 1BI2A 2B0LA 3HYIA 4Q47A 1R7JA 5E1XA 1BI0A 3KP5A 1BBYA 2FNPA 4FX0A 3KEQA 2V9VA 2W25A 2DLLA 4KIGA 4L5IA 1FY7A 2COMA 3QPTA 3GFLA 2P6SA 3I59A 1PP7U 2PFBA 3RTRA 2IA2A 3RI4A 4HBLA 2IRFG 3WTTC 3ABTA 3GVAA 1U8RA 3V8KA 1FX7A 5CVVA 3I59B 5BPDA 1IXCA 5E1ZB 2XAGA 2CQKA 4HX4A 4AD9A 1QPMA 2DO7A 2P5VA 2VT2A 3K1PA 4ZYHA 2MD5A 4HLYA 2ZMEA 2V79A 5D6EA 4L9NA 2L54A 4EVIA 1L3LA 1R1TA 4HW0A 1O3SA 3HRTA 4LB5A
chains in the Genus database with same CATH superfamily
1XS5A 1B1HA 3TQLA 1EYIA 1F9BA 1LLSA 2L0KA 4EXKA 3OOPA 1Z6TA 2W82A 2ZMEB 3OR2C 3ZN0A 1WODA 2XDVA 3I5UA 1IV6A 3G7WA 2AQFA 2UVJA 4WCGA 1LDKB 2ZC2A 1T8IA 4B09A 3WTZA 3TOBA 4J19A 4XFEA 1P4XA 3C7JA 4HCWA 3OMYA 2JPBA 2JA2A 4C9YA 3K6XA 2X1EA 5DVIA 3KLOA 3MP6A 2NVQJ 1E17A 3OMBA 4WEPA 4RGSA 3PD8A 3TCHA 5L9OA 3FJ7A 1NUYA 2IW5A 5B5EC 3MP8A 1WH7A 2JSPA 1LKXA 1FMWA 3GWZA 3TW7A 4ETSA 1M5BA 2HXWA 4FAJA 3R61A 1ACIA 5ICGA 1SAXA 3V4GA 1SAUA 1WJFA 1VTNC 4RAGA 5J4VA 5L3EA 1DMBA 2W84A 4Z6YA 2IAIA 1IMEA 3O28A 4FBPA 3CJTB 1WRJA 2CQXA 3V7RA 1XGOA 2L5VA 4G8NA 1QJMA 2VKEA 3DXJF 4E7KA 1ZELA 2NVUB 4F92B 4DI3D 2HI3A 4OFLA 1MY1A 2VIXA 1JGGA 4A3KJ 1G3WA 4OYVA 3CMYA 4BJTA 3C34A 1MW7A 1EH7A 3MVWA 4A5MA 1QVSA 4KIFA 3EQ1A 2CMOA 3IUOA 4XLFA 4GWYA 4EQ7A 2KZGA 2UYEA 3RSNA 3G4SI 1H89C 3VYTB 1N7XA 1MY2A 1SYIA 3B6WA 4JWOA 3TCFA 3RQ4A 2CZKA 3OIOA 5FKMA 3A29A 1WDNA 4OAYA 2QJEA 5B7DA 3B7DA 2DA6A 3IKTA 3BJOA 3S32A 3B02A 1H45A 3Q0WA 2I3WA 3B50A 1MIJA 4IKFA 3F8MA 4DCYA 3U1KA 3R4KA 1B7ZA 1DDNA 2JZYA 4A3EJ 3OV8A 2OZZA 4PAIA 3I4MJ 4KT6A 1IN7A 1P2FA 2FRHA 3WG7H 1ZREA 2V9KA 3BZCA 3GFMA 4FHTA 3A01A 3OYBA 3L2CA 1TWCJ 3E6CC 2F36A 2WEFA 4KPTA 5I57B 4GGGA 5I5PA 1U6GA 4YKJA 4TV7A 1U8BA 2ALUA 2HQ0A 3C4MA 3TAJA 2RNJA 2BW3A 4L5JA 1US4A 3DP4A 3CMAI 4N13A 1X1CA 4OXVA 2IA4A 1ON1A 3ECHA 4RK2A 2O03A 2ZMEC 3JTHA 3TGNA 1JVYA 1OR7A 1BC7C 2X7QA 5FHOA 4AB5A 3DTIA 3HTSB 3LSGA 5L3DA 2LKSA 2Y0SN 4LK1F 1IN5A 5JHFA 3S9EA 1V5EA 2O51A 1O3RA 2ZMBA 4KYDA 2HQ5A 3M4OJ 3RLFE 1Y1WJ 2CFXA 1QVUA 4P5OA 3IAS2 3A01B 1A36A 2VJJA 1PB9A 1O57A 4RM2A 3EN3A 4G8MA 2K9QA 2JSCA 2DVCA 4LATA 2BW3B 2EH3A 3BDDA 1HSJA 5BS6A 1MDQA 2B3FA 4R9FA 4IRGA 1R22A 2F4MB 2X1CA 3KEOA 4J01A 3RQIA 1D5VA 4GBVA 4Q5TA 3CCEI 2KR0A 3UR3C 3JSOA 4Z0IA 1XI6A 4OETA 5EEAA 4ELPA 1FIPA 5C3EJ 2DFEA 2M4KA 3BP8A 4BJ5C 1O4XA 1MBJA 2JA5J 1K6OA 1B6HA 3K10A 1JTXA 2HU9A 4IHYA 2Y5LA 1MBKA 2NNYA 3E5XA 4BNCA 2GH9A 2GOMA 2XGCA 3GLXA 4YIRX 3OSQA 2HAUA 3GTQJ 2IXSA 5M5WJ 3C36A 3I56I 4JX4A 1FBHA 1H3DA 4GOTA 4XN0A 3CMMA 1SW2A 4PTKA 3QSLA 1CE2A 4IRHA 3CMEI 4EATA 3HUGA 4OVRA 4BKXA 4N15A 2M8GX 1QKBA 2RCAA 2GQ1A 1FQBA 4IF4A 2VT5A 4GL8A 2LY2A 3GZNB 3M8JA 4RLQA 1QULA 2OCCH 4QWQA 4D7MA 3M3LA 2GHAA 4CCJA 2XROA 3GTMJ 3NEUA 2LH9A 4X1EA 5J3LA 3VWBA 1N84A 2QPQA 4HDUA 4P56A 1FT9A 1S7AA 1QUJA 2D3IA 2L02A 4HQEA 1AOVA 4F7ZA 3MC2A 4TOZA 3FMSA 3KYCB 3UIFA 2A61A 1Z1DA 3CTAA 3NRVA 3QPHA 4O6JA 5D5VB 4W1UA 4U0YA 3K1NA 2CW8A 2YU9J 1BK4A 1VFCA 2IA1A 4YAHX 2QSXA 1IW7F 2OU2A 1EH6A 5DD4A 4A3LJ 3F22A 2HVQA 4LITA 1HC8A 2I0CA 2ZNTA 2GOXB 4M9XA 1MXZA 2WBBA 4B3AA 4IO9F 2DWJA 2ZZVA 1ZGJA 2V6EA 1UIUA 3HOUJ 3M3YJ 2VKDA 3AG3H 3RYDA 2QVRA 2Y31A 1ZYRF 3V8LA 2Z2SB 4O94A 5ESYA 3WAEA 2ZBKA 2RKHA 4BACA 4LJZF 3SJMA 1J9IA 4KCDA 4JXIA 2XWIA 5TU0A 5IZ3A 1FPIA 5EYFA 1C0WA 1ZIUA 2VLAA 4Y7NJ 1URDA 1ZH5A 4UXNA 3L6GA 4I40A 2Z99A 4XRSG 1U3EM 3ONMA 4M74A 4KQPA 1E3HA 1DGWY 2KIUA 2BGCA 2LBFA 4FE4A 3SEQA 3IRRA 3CCUI 1VQOI 3SEXA 2ID3A 4HAMA 1R9TJ 3RT6B 3SEUA 2DU9A 4E0XA 3C35A 1YX5A 1A04A 2H09A 1NH8A 4FIMA 5BMZA 4YMBA 2NXOA 3NQOA 2QEXI 4JX5A 1HDPA 2F5CA 5H8SA 2HEOA 2DMQA 1H44A 4YB5A 1ZTRA 1ATGA 5IZ3B 2RQQA 3I54A 4GVOA 2WY7Q 1MGTA 3JYRA 3GCMA 1QQIA 4N0BA 4BDYA 4G7OF 3KZYA 3CDHA 5F04A 3HFUA 5JR3A 3MZBA 2Y7KA 5J1DA 2VQHA 2LBFB 4CO8A 1POGA 4D0PA 1IC8A 5FTIA 3WU0A 4EV0A 1FEXA 1KU2A 2HYGD 5IOZA 2KRCA 2P0SA 3FJMA 4LZ8A 5T3JA 3CZ6A 3RZDJ 1AMFA 4N8GA 4D1QA 1J59A 2RQPA 2CQQA 5K5RA 5B66C 4L18B 4NQ8A 1AH5A 1IMFA 1GLNA 2OC6A 1N04A 2XPVA 3H6WA 3HN0A 3GXOA 2HHMA 2VC0A 1HSEA 3PTYA 3LSWA 1FZPB 1VQ4I 4ZH4F 1J0RA 2QKLB 1LBCA 5EYRA 4PFYA 1B6AA 3F72A 4XKPA 1MDMA 3F21A 3LA2A 1OCOH 4M3DA 2DI3A 2H6BA 3S2VA 2CO5A 1ETYA 5E3NA 2Y7WA 3QYFA 3IJXB 3E0JB 4C1TA 4YIFA 3KG2A 2CQNA 1UMQA 2ZXIA 1KQ0A 4ECFA 1RRJA 3TUSA 2E1MC 2ESNA 4MEXF 3KBRA 1YX3A 2LG4A 3EYYA 3FD3A 4U4SA 1MXWA 2LD5A 1LFPA 4UV9A 4H6DA 4KCCA 1MDMB 3LFKA 2XASA 3T5XA 3F3XA 1E2XA 3E1SA 4X6AJ 4H0WA 1D8KA 1LEVA 2F7AA 4H8IA 4GWZA 2DT7B 2KT0A 1ZRFA 4OIPF 3LUZA 4OEVA 4NHJA 2EILH 2FVZA 5JTYB 3R7XA 4ANJA 2F3BA 5JHUA 3CCSI 2CZHA 2H5YA 3MKZA 2G29A 1IJWC 1D9QA 4BDMA 2NNNA 3LSJA 4PE3A 1B9MA 3D1RA 2X6WA 4EJWA 2A6HF 4BJ6C 1A35A 3EPZA 1OVBA 3R0JA 3CJRB 1B0LA 2KDOA 1Y4CA 1OCPA 1VZ0A 3IAM2 4ESJA 1Z21A 2NOGA 3PO3J 3D4CA 1IIWA 1MQHA 4XKRA 4DXCA 1R4MB 1WFXA 2H1LA 2H27A 1U5TA 4P1LA 4ESXA 2XX7A 4ENMA 1MRPA 4DI4B 5AE4A 3TO9A 2GQQA 4BEHA 2YJPA 1SD6A 3O6GA 3PPPA 4YG2F 4PFWA 3FXKA 3PUBA 1GXQA 2V4JC 2K27A 2FJ1A 3CF2A 5K5OA 3PNYA 1JXSA 4IRIA 5CBRA 4LMYA 2KIQA 1FP1D 3TQNA 1JVXA 1Y39A 1XGNA 2BBYA 2IP2A 4KMFA 3S15J 2YUSA 4XMYA 4CUGA 4A3BJ 3L7WA 1U5TB 1D3YA 2DMUA 2F4IA 2E1CA 3CG1A 3V42A 1S7EA 2QSHX 2VASA 1WHUA 5LGUA 3V5AA 4PCQA 2ZJQF 4A3IJ 4OANA 3HIFA 4UVAA 1T0FA 4RAYA 4XORA 1MM7A 2CEXA 3TCGA 3S9MC 3LQQA 1VQNI 4OZ9A 3ZRGA 3D5LA 1DCUA 3D4GA 3SEVA 3HZJA 3NAUA 3H7MA 2GZWA 2WV0A 1SFUA 3L2WA 2CW0F 3GYHX 4YELA 2XXTA 1XCBA 1ZK8A 3WGGA 2LVSA 1NH7A 3M1CA 3GTLJ 3PSFA 3BG5A 1LAGE 2V9PA 2KDZA 3VFJA 1FBSA 4BQQA 2PMUA 1MSEC 3S1NJ 2KPMA 2Y0SA 4IZZA 1W0TA 3ZMUA 1B32A 2HPGA 4NMYA 5JFRA 1FCKA 1Y8RB 1XVXA 2M45A 2E1NA 3MW0A 2STTA 2OV7A 4IB2A 4GX3A 1IRFA 2JVHA 4MNUA 2DXRA 3LSXA 4JBZA 2QM3A 3FXJA 2R4GA 3K6UA 1B9JA 2I4BA 5ILSA 3H5RA 5DCFA 1S9TA 2XGEA 3CUQA 3AG2H 5ET8A 4XRMA 2M3AA 3QRFF 3IFAA 1S7OA 5K2XA 1H0MA 5L3CA 1QO0D 2VXZA 3T22A 3FXBA 1RI7A 3S9LC 3LFUA 4DYRA 2K4JA 3DLAA 2K02A 4OA4A 2ISYA 4M6VA 2VPRA 4LLLA 4A3DJ 1HKSA 4IGTA 2B3BA 1UJ8A 4IO7A 3MVXA 3EUAA 1Y20A 4X0GA 2K4BA 1QGPA 1GV5A 3SZGA 1NV4A 3LSMA 3CF5F 4LZ5A 1Q1KA 4P9KA 2FF4A 2JJ7A 2Q1ZB 3KP6A 3OL4A 4PJMA 1W7PB 4DZPA 1P4AA 4EMSA 4BE1A 2HXRA 4YB7A 3KC0A 3PUZE 2EA4A 3L1PA 3BQZA 3A02A 2XB5A 4M9ZA 1Y1MA 1FTAA 5FFXA 3IH4A 2AYSA 2M87A 4AYBA 4ZYDA 1Z7UA 3JRAA 4O3MA 2E5ZA 4GWWA 4FETA 5DEQA 4XKNA 2DQVA 2VXDA 1K4SA 5FBPA 2Q8KA 3PO2J 1N3XA 1YYVA 4XKCA 3T96B 1N25A 4KDPA 1S5LC 5A5XA 2DT5A 1MG1A 2O69A 1DPUA 4QHQA 4PBQA 3FXMA 2LY1A 5K7ZA 3WG9A 1EZPA 1I5ZA 4PGGA 3HKZA 1L5TA 3IH3A 2IS6A 5IT3A 3BCAA 3FJGA 4PDDA 3SFIA 1SD4A 2RKMA 1A8EA 3HOZJ 5KK1A 1FRPA 2XRNA 4UVCA 3KP4A 1V55H 3RIRA 1BIYA 4GBWA 2XPUA 2CW7A 1HA8A 4UUSA 1T0FC 2COBA 4IHSA 1N78A 3WTSC 4AU7A 2Z8EA 4ZYGA 1BP5A 2DJNA 5AA1A 5A5XB 1Y0NA 3KFWX 3ZQLA 5F7VA 3VVFA 3PMVA 3CJQB 4DXUA 1RESA 3BZ6A 3C18A 1Y6IA 3FZVA 3CC2I 4A6EA 4N17A 3CSGA 5EQ8A 3AG4H 4R2BA 3T1BA 1FBQA 3KE2A 1B5IA 2Z1DA 3QU6A 1GXPA 4FJPA 5KCJB 4PFIA 2BJJX 2EFPA 2X6OA 1KA8A 3CO7C 5IYCJ 1G2HA 1EYKA 4NEDA 2AQEA 3ERMA 2FSWA 5AIQA 2N8GA 3OO8A 1FTZA 4LN5A 4I0BA 5D6FA 2G9WA 4H1XA 1IO2A 5AONA 1YJ9I 4HX8A 1F5TA 4KA4A 1QUKA 4CH7A 3HRMA 1AIVA 3A0BC 3L2RA 3VPRA 3JTGA 4MMPA 5HLIA 3K6GA 3KSXA 2FA7A 2BXYA 1Z7LA 5CVRA 3S8PA 5CKTA 2LSOA 1TT1A 3TTRA 3JW4A 3V7SA 3BG6A 3CFZA 3KFMA 4ZDMA 4N81A 4A3GJ 3ZMVA 3VYUB 2FBHA 4F2OA 3G2BA 3HJEA 2EV5A 4RS8A 3JRIA 3H92A 1H9TA 1CF7A 4OINF 1FQFA 3CQZJ 2AHQA 2CH0A 3O6HA 5IZ1A 3GTPJ 3KLNA 4HV5A 5HLTA 2VPNA 1LBWA 3USDA 1B3EA 4MLOA 4TLMB 2XD3A 4OMBA 2FD5A 5HDGA 1FPQA 1V3FA 2H94A 4QTRA 5E1WA 1P1NA 4I76A 1Y4TA 2XAFA 2DW4A 4A3FJ 4CCNA 3CDIA 3PUVE 1OYYA 4LG0B 1I3AA 1N0TA 1T95A 1J7KA 5IPAA 1O3TA 4E7HA 1FBDA 5I58A 5IZZA 1CF7B 2FU4A 3BFTA 3KOSA 1X2NA 2K40A 2R7QA 2VOPA 1HKTA 4Q0CA 1PJRA 2VKHA 2DFFA 4C2UA 3J7ZI 2QVVA 3ULQB 4I2OA 1XSXA 5IT9Z 4R8HA 1MQJA 4I3EA 4A2UA 1Y3NA 1LGBC 4RK9A 4L0ZB 2Z22A 1IXRC 2IGMA 4HZFA 1LEBA 3EUHA 2W7NA 1NNKA 2AXTC 2EZLA 4KISA 3BIHA 3ESWB 3OYAA 1KWHA 1JW4A 3QQAA 3J7YJ 4R75A 1ZU0A 2P7CB 3RN8A 3E3VA 2ZFWA 2CUZA 3KIOA 1FBPA 3OO9A 3L9FA 4UABA 2Q0OA 1SANA 2G7HA 4UUTA 4P9FA 4QRZA 4YB6A 2DMNA 3H9GA 4LGWA 4KN7X 3QP6A 3HTUA 3IFCA 1I6HJ 2DA1A 3GTOJ 2JUCA 4BQNA 5EHSA 3SHFA 1FJ9A 3BKIB 4RMNA 2BE5F 3I64A 1Z3XA 2HPMA 1UG0A 3AXFA 4MIMA 3MQ9A 1GVDA 1YOVB 5F64A 4PP0A 4ZEFA 3DBLB 3VVEA 4ZE8A 4LIVA 1SVXB 1JP4A 4R9GA 3G3HA 3BZKA 3A3UA 2LTPA 1LBBA 3K2ZA 2E19A 1IV8A 1SQYA 1OQHA 1USYE 1SI0A 4UY8I 2QL3A 3K6VA 1R5HA 4B43A 3I4NJ 4C2TA 3RQTA 1Z9CA 1MBGA 2TDXA 3TQWA 5IYBJ 4U1OA 4P1WA 4N6KA 3OOUA 4OVPA 1P1UA 1LFGA 1SVOA 2MH9A 3TZAA 2IBDA 3PQJA 2PLYA 3H4ZA 3DF8A 2HZLA 2ZXWH 4G9YA 4IGRA 1SMTA 5CVIA 3PQKA 3W6JB 2XAJA 4XK4A 1P4WA 2CV2A 2K9MA 3KZZA 3PMWA 4IQ4A 1PBPA 4L9VA 1YJNI 2QRYA 2VBXA 4PJJA 3H9JA 3F11A 3ZP5A 3N6UA 1QZZA 4X8RA 2VBYA 1H8AC 3G1MA 4FTHA 2E1SA 2F7CA 5EYHA 2ZSHB 2A3SA 2E60A 3I53A 4YFKF 5KAFC 3J80Z 3CO6C 3N4MA 1JJ6C 2CEYA 2PEXA 3BY6A 2ZYOA 4J00A 2R7UA 2QGUA 3CR9A 4F55A 2A69F 1WGXA 2WV1A 3BJAA 3GO5A 1XMXA 1FOXA 2HQNA 5KZTA 1EV7A 1XDSA 2O7UA 4P9UA 3S2WA 4CZZA 4HOBA 2DMPA 2I49A 1NFTA 4S04A 2YU3A 2D1HA 2BY3A 2HOEA 2XF6A 4BE2A 1ELJA 3V89B 1RPWA 1UZCA 1FPJA 3BPVA 2VP1A 4GIZA 4BGDA 3MWBA 2VD3A 2UUZA 2GWRA 3O29A 2R5YA 4U2RA 2EFOA 1JETA 1X4PA 4CCKA 2DXIA 2L7KA 4OVSA 2HDCA 2R7ZJ 2KHMA 4M4GA 2Y75A 3BBRA 2VOZA 3EUHC 4KJZA 2V1NA 3ZMZA 1VQ6I 3P9IA 1J2XA 1P7IA 1GVJA 2BOLA 2OAZA 3N94A 2LLKA 5ERIA 2F3DA 3F8BA 2F97A 4IL6C 4NUBA 2RCBA 5K7FA 3HL2A 4FX4A 5FHMA 1SFEA 5IM2A 5C4XJ 4NF5A 2QS1A 2L7FP 2P5KA 2JQ7A 2H98A 2R5YB 3RZOJ 1UB9A 2DE3A 5M3FJ 1JKRC 2WB1A 2R92J 3KOTA 3P7IA 4W97A 2MD0A 4PCDA 2QYOA 4ESFA 1FBFA 4F19A 4HX7A 2EQRA 2JN6A 5LBQA 1YW8A 4JK1X 5IY5H 3OWTA 1FPBA 1BL0A 5GPCA 4BXUA 2D21A 2DDKA 4ZZAA 1ZGAA 3BG3A 4ZYEA 4AQ4A 3LUYA 3UNGC 2LAOA 5DUIA 2LMDA 4GQOA 2CZLA 3M8FA 1AU7A 2P8TA 4NF5B 1S3JA 2DCEA 2XF5A 1JTYA 2JVGA 2QVOA 5L3BA 4OWRB 2VODA 3LSHA 3A03A 2VPLA 3KBZA 3SKPA 4F39A 2HR3A 3MZ1A 5F6FA 3FDYA 4BDZA 4G94A 3S9NC 4CHUA 4UV8A 1OISA 1YTYA 1RDXA 3DEEA 2HKXA 4NNJA 4FORA 1IN8A 2P0WA 2PQ8A 4QFLA 4AB6A 3RKWA 5LFAA 1IMBA 1F1ZA 2NVXJ 4BY1J 2B7EA 3WGIA 2V3QA 4MLQA 2CV0A 4PJNA 2DT6A 2A5SA 1HW5A 3HOSA 1NV6A 4KHZE 5LEJA 1IMCA 1JHFA 1FPDA 5IKBA 3DP7A 1SPIA 4II3A 2D5WA 2W85A 5CQGA 3TELA 1LEAA 5CMBA 2OQRA 1W36D 1X1PA 1BI1A 2B65A 4EM0B 1R58A 3BFUA 3DV8A 2YLNA 3CC7I 4D7NA 5HLHA 4XTCQ 4G7HF 1O7LA 2UVGA 3H36A 4N4OB 1OCTC 1TW2A 1N3WA 3ELKA 1FPFA 3A0HC 1FSHA 3IOTA 4PETA 3MFKA 1K79A 2IEKA 3FX3A 4RB1A 1Y3PA 3FXOA 4IHVA 2R6GE 2R0QC 1NMUA 3GFJA 1XC1A 2MLGA 4QXDA 2BZTA 2M34A 5JI6A 1P1WA 4XNFA 3GZGA 2KP6A 4GRIA 3TKDA 3LSIA 5TP9B 3IV5A 3ECOA 2DYRH 4MGRA 1VQMI 2LR8A 1Y8QB 3FISA 4DZJA 1N75A 1X4OA 3W2WA 2M8EA 3O8HA 1MY3A 4DW6A 2F5XA 2F5FA 4IQJA 4ZE9A 3BG7A 1UG2A 2DBBA 3SDBA 2XGDA 2R93J 5HS8A 4C1UA 2ETHA 3P7NA 5GTHC 2HOAA 3U8QA 3MZ8A 3GTGJ 4Y52J 4WXJA 1OJLA 4KT5C 5I7IA 2OCEA 1IRGA 4DOZA 3PUXE 4H5FA 1I39A 5I57A 1G3YA 1HSLA 5DW8A 3DM0A 3RPUD 1QHGA 1IGNA 2X26A 1FBUA 1T33A 1Z67A 1IRXA 4EQQA 3J7AY 2W4SA 3BIGA 4GFRA 1ORKA 4MTDA 5DM7F 2EINH 4L17A 5KDTA 1EZOA 4XKVA 3NOHA 1LJ9A 5EZHA 1B5HA 3WODF 4PJ0C 4GD5A 2H1KA 1A40A 1B4ZA 4JVDA 4DCXA 4GYGA 3ML6A 2D2WA 3HSTA 4GLIA 3BR1A 4WXDA 3E97A 5F1RA 1MMNA 1EU8A 5CPRB 2BXZA 2W24A 3H0GJ 2X0LA 4PSXA 2XXQA 3M9AA 4AIKA 3A1YA 3UKGA 2PFZA 1M5CA 2DP8A 2PMSA 5HDKA 2OJED 4FEBA 2UVIA 3OSFA 2MBFA 2DWHA 3ODBA 1MNDA 1RNLA 3K4NA 3QIMA 1G6NA 3FK7A 4G7ZF 1G4DA 4GFBA 3K7AJ 5D8KB 4KITB 3J81Z 1RUOA 2I4CA 4QPOA 3EKIA 4GF8A 4XL9A 3AKZA 3U92A 1B1BA 2WADA 4DGWB 2E7WA 4AIJA 3AL0B 2JT1A 3I9V2 1U9NA 4H45A 2GA2A 1E3OC 2EB7A 1SD7A 3OYDA 3TTMA 2VC1A 2Q89A 1IN6A 3TTLA 1MKMA 3FGSA 1UHSA 5IP6A 2L7ZA 1EYJA 3GBBA 2OWSA 4HCYA 5HVQC 2KIFA 4GL0A 1LAHE 4CSWA 3TDZC 3Q26A 2VKVA 4I6ZA 3W2AA 2XHDA 5LHHA 2XF7A 2QQ8A 1I1GA 1MXXA 2QQ9A 1KYZA 1V54H 2BHYA 2QWWA 3RNNA 3I4PA 5M5XJ 2VB6A 1JJ8C 2L5QA 3T93B 1OYWA 3R0AA 4ITVA 4ZZLA 3VYRB 2OTLI 2Y7PA 4IY6A 4C0RA 3M8UA 1HDDC 2X4HA 1VQKI 2IS1A 3VSLA 2XB0X 1NV0A 4QFPA 2KQRA 3TEPA 4HE0A 3SZTA 3WTWC 3PUFA 5F27A 1ZKBA 3F6VA 1K4TA 3H06B 4AYBN 4MFIA 2K86A 4R6KA 3K9TA 2R7DA 4PFPA 2YSRA 3OYGA 2CJJA 4A5NA 4NC7A 3OXNA 3K4BA 4YEJA 5FJ8J 1AOYA 1FSEA 1R49A 3IL2A 2P5LC 4CCMA 3HB9A 2CSOA 1O3QA 4B4CA 3VE1B 1JGSA 2F2EA 1LB8A 4NF0A 4I3YA 3OR1C 1LSTA 4E7ZA 4RXLA 5BUUA 3HKZN 1OVTA 3KJTA 1UTBB 4LQ2A 2DWIA 4XIGQ 5TISC 4GRKA 3HDDA 5ITOA 3D1NI 4LOCA 4BDLA 2IEEA 2A5TA 3G71I 4PQJA 4KMUX 1YLFA 3B8BA 3MBPA 3U2RA 4PDHA 2MKZA 3KN7A 1U78A 3Q29A 2E1MB 1B51A 2P3VA 4YFXF 1B0HA 3FWEA 1EJ9A 1EZ9A 2GIZA 2WAFA 4OAZA 3O97A 4F3PA 3BTCA 1UTHA 3AL0C 4AVZA 2HNHA 1G8XA 2FUG2 4XRFA 4N9IA 1VF9A 1E0EA 2XA5A 3MP1A 4GXAA 1ZTYA 3IAZA 3MZHA 4PAKA 1V5FA 1SD5A 2IPQX 3DEUA 3P9CA 3C2HA 4AC0A 3OO7A 5EYGA 4GCVA 4Z2YA 3BR6A 2LKPA 2NS7A 2Y48A 4RAFA 4AWXB 2A5TB 3GF2A 2V84A 1SVMA 2H4IA 2EV0A 4X1BA 4XOTA 1P1OA 3BPXA 1F36A 3RYRA 1KGSA 3ZPLA 2WKYA 5F0CA 1SW5A 3B6QA 4A6DA 2WA0A 4G4PA 1LDJA 1I3QJ 1AWBA 1BIBA 2MFZA 1LPQA 4D5CA 4QF9A 2DXYA 1D3KA 1JI8A 1Z3YA 3H0DA 1UTHB 1RKMA 5LOMA 2P7VB 4IVNA 1W7PD 2F5EA 1I1SA 4PFTA 4DQ2A 3RUMA 3ONQA 4P11A 1TWFJ 2FBKA 4ON0A 3RPUA 4FT8A 4HNTA 3FM3A 4BBRJ 2CQ7A 5CI5A 1BOBA 2OF7A 3DCFA 3W6KB 1MPDA 5FRNA 3C31A 3ZKLA 3I71A 3PGFA 3E6BA 5TGTA 3BROA 5D4SA 3BLYA 4ZDPA 2P81A 2IA0A 3VVDA 2J5OA 3U94A 3U93A 3QOEA 3HHFA 4FEDA 2PMHA 1PP8F 2FIEA 1XPXA 2GXGA 1G0HA 3M1EA 5AIPA 3C32A 3C1DA 5F1QA 2GLOA 3NARA 4BXFA 1VQLI 2ZNZA 4EM1A 2O68A 1AKHA 4ZZEA 2IGKA 1ZLQA 1A55A 2FX0A 1SDXA 3VDFA 2EBIA 1Y1VJ 2XV4S 1YO5C 4BQAA 1A99A 3VLVA 1D0XA 4DZ1A 5TRDA 5BOXA 2B4LA 1ZR2A 3CVGA 5EGOB 2V25A 2FEZA 3VSKA 5JTYA 4O5VA 5LTCA 1BJZA 3O9PA 5M2VA 2HQRA 4WEDA 1FYKA 1USYH 3UA8A 1FQCA 5J8FA 3FK6A 2VE8A 3HRSA 1VQ8I 4HRIA 4PGPA 4BUPA 4EM2A 4NC8A 1XMKA 4E7IA 3OOAA 2UV1A 3T9UA 1STZA 1AKHB 1FPKA 2G93A 3TDUC 4MCOA 3SEWA 4U7DA 3CD6I 1U0JA 5GAEJ 1HBXG 3FBNB 1W36C 4Q5SF 2HS5A 5GAGJ 1M5EA 2OX3A 2RINA 3ZKKA 1LVAA 5FB2A 1K9ZA 5DTDA 1T56A 1WI9A 1DU0A 3WE2A 4ENNA 4G61A 3LQRA 1D4NA 2PYYA 1FTTA 1NTCA 5EQ9A 2R3SA 4OIRF 3TOAA 2QQAA 1DUXC 5HOOA 1JEVA 3BR0A 4IR8A 2JPCA 3BTJA 2H6CA 2HZKA 1GV8A 2Q2EA 4FATA 3TW6A 2TCTA 3B6AA 2IS2A 4LP2B 1FOKA 5LHGA 2ZZWA 1QRYA 1ODDA 4P96A 2XAUA 4U87A 1IITA 1VQ5I 3T9HB 2CZIA 3D5RC 2R7SA 5IT9K 2VL8A 4FE8A 3FATA 4IEJA 1S72I 3JAMZ 3HGGA 3GLBA 4N4UA 2K3PA 1G3SA 4RAZA 4BXXJ 3IO6A 1XS9A 1ETOA 3MN2A 1NG7A 3MQ0A 3W2VA 1KU3A 4I01A 5E8GA 3HSFA 3U1DA 1PBQA 4HE2A 1A6QA 4YICA 2V1UA 2Q2EB 2NAZA 3KP2A 2FBPA 4P55A 2O6AA 3O6IA 2NXNB 2V1DA 5FLVA 4U21A 1H88C 4O8MA 5H8FA 3RYPA 1GVCA 1A6IA 1IAWA 1D8JA 2P3NA 3RT8A 3T9XB 2JWTA 2RAEA 3ZOBA 4XLCA 3Q9SA 4A3MJ 2QZ8A 1FQEA 3O6BB 3KX2A 2W57A 4MEVA 1B72A 4KICA 3LWFA 2L4MA 1RIOH 1IXHA 1FSAA 2FQ3A 2H25A 2VQLA 3ZQGA 3CRBA 4DXBA 3OENA 1LAFE 2BVMA 4A93J 2K9SA 2B4MA 3BTLA 4HS7A 5H8FB 4B48A 5GAHJ 5H8HA 2QQBA 3ZCOA 3EQLF 2F6CA 3ILUB 5EQ7A 3G3JA 1MJAA 3RKXA 3LSRA 5B3SH 3JRGA 4HYEA 1B3LA 1LBZA 2I6EA 2LNBA 4I98B 5D8LB 2UZKA 3CIJA 3HOTA 1U2WA 4WKMA 4LB6B 1B72B 4EJTA 1O64A 4NBQA 1LE8B 2A6EF 4MIJA 1ZHFA 2UXAA 1YE9A 3ASOH 2QBYA 1UIVA 2DA2A 5D4RA 2LP0A 1H9GA 3GZ5A 1MD0A 4YZZA 4H65A 2LK2A 4QSHA 3H6VA 2EFWA 3JZJA 4O7MA 3FMRA 2BHZA 5H8HB 1R36A 1W7PA 3KN3A 5LLQA 2V3TA 3MVYA 4ELQA 1B4HA 2ZXJA 1G59A 2O84X 2O1MA 4EGYA 2XC7A 2D5VA 3LV0A 5H8NB 2E7XA 3QU3A 4HXVA 4ESWA 1OLAA 2OD5A 2YPRA 4GWUA 3J80K 4LVQA 1Z77A 2DE4A 3H3UA 4XLNF 4UB8C 3DKXA 3W6VA 2QBYB 1T98A 4M3EA 3CFXA 1NH3A 2HGCA 1TFDA 4YKPA 3HOXJ 2RVCA 2X48A 2WB1N 4EJVA 3KJ7A 1LCFA 3DLLF 3L09A 9ANTA 2EWNA 2VT3A 4RB0A 1K7AA 1R1NA 1HCRA 1I6BA 3CCVI 3J7AO 2DYXA 1TWHJ 1XX5A 2KJBA 1F4KA 5LHIA 1NV5A 3SERA 3B6CA 5JK4A 5K1YA 5CMKA 4LK0F 2RC9A 4IY5A 1XCVA 2CYYA 1PVEA 3TP3A 4OHNA 1X3ZB 1DP3A 2KZVA 3TL4X 4RB2C 4EUOA 1OYIA 2O9LA 4CYDA 5BQTA 5KDTB 1QVTA 1TNSA 1DSNA 3IB1A 4KUMA 2Q88A 1JUMA 4XSXF 2W48A 4MEYF 4MNCA 2NOJB 3QAXA 4R1HA 4EJUA 1LFHA 5CMCA 2F8DA 5L3GA 1W5CC 1S6LA 3ZMDA 1RETA 3HPGA 4OENA 3HPHA 4GWOA 5K2YA 5CLSA 1XHYA 5E18F 3FBPA 3Q25A 3SXYA 4FQGA 2QKMB 3IOVA 3MSTA 5IP7J 5KCJA 1Z0XA 2WX9A 3M7GA 1FQAA 2HZDA 4QFKA 4F91B 5TJJA 1IXGA 1X1AA 4PFUA 1S9HA 3HRUA 1BKAA 3DPTA 4F3QA 5J8CA 3BG9A 1K61A 3MAJA 4U4XA 2A6TA 4XIDA 2Q8MA 3TTNA 4LD5A 2EZIA 2YS9A 1LNWA 4GO1A 1J75A 1M5DA 2NOOA 4F52A 3L2QA 2X7PA 2DOEA 3VB2A 2B63J 4R73A 1LBYA 2HCAA 3SQNA 1APLC 4ND9A 4I7HA 1OKRA 4CCOA 1FPGA 2GIVA 1BJAA 4KD5A 2MG4A 3K1MA 1M5FA 5D5XB 4L9TA 1EA3A 1BR4A 4U1ZA 4F31B 4DLDA 3DFGA 4OMYA 1FQDA 3W9VA 4JYKA 2FE3A 4B1RA 1GDTA 4RGXA 4WK8F 2E2IJ 1ZBMA 4IO2A 3N05A 1SBPA 1DPRA 3AAFA 1Y0UA 5ICQA 4ZDLA 2A07F 4DE8A 3OO6A 2X1DA 3FXUA 1WSUA 4QFNA 2IGOA 3ZGKA 5ET6A 3OIQA 1B52A 2W1OA 1EH3A 1TP4A 1IQ7A 4HSRA 4GDFA 4LG0A 3B73A 2ZYKA 5HODA 1MXVA 3JSPA 5H6QA 2F35A 1D1AA 4I0AA 5CVUA 2PJRB 1DTGA 4ZC3A 3CCJI 4M71A 4UUVA 2JMWA 2ACJA 2ZB9A 1XSDA 2ZXHA 1RYOA 1YZ0A 3PUWE 5E3LA 2LF8A 5CJ9A 4XOPA 4KN4X 4THIA 3M8EA 3JRBA 2K7LA 1POTA 1FIAA 2PT2A 2DPUA 4B44A 4QSDA 5HDNA 5EEGA 1FPLA 4QSEA 3U72A 2M4GA 1BI3A 2UXXA 3CESA 5E20A 4BU2A 2JJKA 1PUEE 1OLCA 2AXLA 3HC7A 4UNOA 2MYSA 4AM3A 5E17F 5FFZA 2XXHA 3H3GA 2X9DA 1MNMC 5EHMA 2FQ4A 1YCJA 1ETQA 4HF2A 1MXUA 4Z7EA 1R6ZA 4KXPA 1D0ZA 1RUNA 2NYXA 4AIHA 2QCOA 2BY0A 2VI6A 4XLEA 3BR2A 1NNFA 2O6GE 2NRAC 4KYSA 3TMGA 5IYDJ 1LVKA 1P99A 4E7SA 3BR5A 1BR2A 4P47A 4MHGA 2GXBA 1UQWA 1QA6A 4X04A 2ANJA 1TQMA 1ZR4A 1VSOA 4R79A 1FC3A 1JUPA 4HF1A 3H3VK 2DFIA 3H5NA 5GADJ 4CYCA 5FHNA 3RPQA 2HZTA 1J1NA 4ZJZA 1JNFA 5F24A 4L0YB 3ILTB 1JUSA 3GBGA 2DOFA 3G1LA 5HS9A 2A5WA 3CCLI 4HTGA 2ELHA 1QHHD 1HXDA 3KP7A 1RC9A 4HEA2 3RY3A 4LUBA 1ZN2A 3ZQFA 1TL8A 3O2PE 2OA4A 4OU0A 4A0XA 1DPEA 1KQ9A 1FTKA 3CG3A 4MX6A 2R7OA 1NV2A 4CICA 3T0YA 3GX4X 2OWZA 2R7RA 1QKAA 3ECRA 5DUKA 3OYHA 2RF1A 3WTXC 1JT0A 5H6RA 4BHPA 4OVJA 5AA4A 4CYCB 3QUFA 2XXRA 3HPIA 3BC8A 2UWMA 2VN2A 3MD2A 5F0FA 4MTEA 2Y7IA 3IORA 4HNUA 2MABA 2XRLA 4H0EA 1XVYA 3H5AA 1JEUA 1A8FA 1QBJA 1NG6A 3EPEA 2KIMA 1IRZA 3I5OA 4NF4A 5EJCA 1SVLA 1WZ2A 1SEUA 3E6MA 4LZ7A 5EG0A 2DYSH 4PSWA 4RGRA 3RDIA 4C3JJ 2WYKA 3VV5A 2EA2A 2OLBA 4RPNA 1POY1 5HBCA 4CGZA 1ETKA 2XSJC 4PFRA 1TTYA 1IEJA 2HKOA 4MQVA 3REOA 5AA4B 1U9OA 1MJBA 1Z05A 4EXLA 4ZTJA 1IMAA 3CLQA 3MVPA 4HF0A 1FJLA 2RN7A 4O3CA 1I50J 1R1UA 1TBXA 1NHAA 1WI3A 3BR3A 2ADUA 4JX6A 4BH9A 4F93B 5GTIC 2HDDA 2F4OB 3TPAA 4CA0A 1WCMJ 1YS6A 2MSYA 3DPUA 3MKWB 2E0SA 1I6AA 1LQ1A 4RY1A 1MSFC 2L9RA 2L4AA 2XUBA 3I58A 1UFMA 4CXFA 2DA3A 4E7JA 1TWYA 2EFQA 4NF4B 5ED4A 1I69A 5L8DA 5EG0B 3CP2A 2ZNSA 5DDGA 4GX4A 2EK5A 4JQFA 4BS9A 2ZJ2A 1GR2A 4YRVA 1A7LA 4K2EA 3L6HA 3HM5A 1X3UA 1UHMA 3ZR8X 3ZMTA 1QPIA 3U9GA 3ZN1A 3U65A 2FOKA 3CCQI 1RYXA 3MVZA 4XEQA 3QPLA 1ZRCA 3PPNA 4MNPA 2NS8A 3FXRA 2AO9A 2Q8JA 5DYHA 2R7TA 2OQGA 3TEDA 4N4NB 3PFYA 3LAJA 4G6DA 5CQEA 1GGGA 1ON2A 4FE7A 1NK3P 3LSKA 4GWXA 2DJIA 3PPOA 3QK6A 4POXA 3OS2A 1B7HA 1GT0C 3VLUA 1XGMA 3EHTA 2O7IA 2CWEA 5I2KA 1UCRA 1MBFA 1TC3C 3EHUA 4L5EA 1Z7ME 4Q4ZF 3O3KA 2X6XA 2AL4A 3PMXA 4PAFA 1ZAOA 5DS9A 2R7FA 3CI8A 4N07A 4HPQA 1MQGA 2RV8A 5LGTA 1PDNC 2AS5F 4S05A 3A2KA 4JWYA 1HLVA 1WVRA 3ABLH 1W5SA 1XGSA 1BR1A 3H3ZA 3N97A 4C2MJ 2HVSA 3W3CA 3FM5A 4CCLA 3I3LA 1PB8A 1PUFA 2XXWA 3N5LA 4OESA 2KKOA 3G3FA 3V7CA 5J47A 5LD2C 3OYCA 1JKOC 4HA8A 2CUEA 3WU1B 5I2KB 1I6XA 3KYDB 3VEPA 3ZMSA 2CUFA 1MNEA 4WWCA 1K78A 3FKJA 1INPA 2OJTA 3E3KA 1TWAJ 3DBRB 3IJOB 3DU6A 3MPKA 1PYVA 3G3ZA 3H35A 5ICFA 4BE0A 2Y9ZA 3K2DA 4OEUA 2LFBA 4YFNF 1X3WB 2KFDA 2L01A 4M6YA 5J1YA 5ELVA 4P1EA 3DPLC 3OYEA 4F1YA 5I59A 1Y1ZA 4QFOA 4UHTA 3TFLA 2RNGA 1ZG1A 3DELB 3I6VA 5EF6A 1PUFB 4GYIA 3I3VA 4H5GA 4KR5A 1R4NB 4TQUQ 1YPNA 4I09A 2YR2A 2XPWA 5DYMA 3ZQCA 1B46A 1AL3A 3W9WA 1K78B 2VJIA 1R00A 1OPCA 3ISPA 3FVGA 4JVIA 5BWJA 4XRSA 3VXCA 1R5GA 4YMAA 2KLOA 1JKPC 4QBAA 2ZNYA 3COAC 3E7LA 1ZGWA 3HSRA 5E8IA 3S14J 4C30A 4PZJA 5I59B 4Y15A 2PX1A 5TP9A 3WTYC 2XKPA 4FISA 2I0BA 5J4YA 4KI0E 1X2MA 4PJLA 5A5LA 4G77A 1ZG3A 4RM3A 2Y69H 4ZTFA 1JKQC 2E2JJ 3HOWJ 1D1CA 1JQFA 1OMIA 2XWKA 2H8WA 2JRMA 5CYVA 4XONA 2PN6A 3ZQQA 3QOPA 4WX9A 4JSOA 4LLNA 2XXVA 5ILVA 3G3IA 5L9SA 1LB2A 3WU2C 1BW5A 3ZS6A 2DPDA 4R74A 4I8CA 1T6SA 4PGHA 1LAXA 1FP2A 3JRFA 3GZ6A 1NV7A 1VDWA 2Q2CA 4PC9A 3MCZA 3M3FA 5JLWA 3F0CA 3FHNA 3E5QA 1KONA 2GXAA 2VBWA 4JBAA 3ASNH 2J5PA 3EUKL 5EDNA 4AS4A 5J16A 3C2BA 1FYMA 3KN8A 5HLGA 4ISUA 2ONSA 2XSDC 4G2ZA 5E79C 5B1BH 1V5GA 4M73A 3HHHA 1OIBA 4KYWA 5H2FC 5IOYA 1Y9UA 1LUJB 3A4CA 1OCCH 3IOWA 5LEKA 4MJOA 2Z8FA 3TYHA 4JB7A 2GFEA 1PEBA 3OYFA 2G0EA 2FOWA 2XVCA 3VYSB 2Q2AA 4LQ5A 2EPFA 3QYEA 4JSDA 2V93A 4DNCA 1URSA 1LFUP 3DU5A 1UAAA 3DP8A 3PIPF 1B3FA 5KNLA 3DBHB 4HLXA 3OYKA 1I6QA 3DWLE 4OVTA 1A54A 2OBPA 2OZUA 1IXIA 3SESA 3CSBA 3THIA 3V8XB 3OL3A 2RC7A 2Z3YA 4QLCU 5DCMA 5A2QZ 2ZYNA 4UACA 3JRHA 3HOVJ 1YW7A 1VE4A 3JAMK 2YX4A 4MFEA 4BDOA 4NC6A 1TQIA 2F5VA 2BJIA 4I9DA 3KETA 2M30A 3OY9A 4B3XA 1H43A 4Y17A 1JT6A 2CU7A 3OYJA 3BQYA 2O1LA 5LRSA 4BLAA 1USTA 4MQ9F 5FKKA 3FHZA 2I3VA 2DAOA 1UELB 3S1QJ 1QU3A 3N26A 3R26A 5CRYA 1LDDA 1B1XA 2CRGA 2K85A 1PDAA 2H99A 3KCCA 1BLFA 5DCMB 1IF1A 1CGPA 3OS1A 2PT1A 4N6PA 3UN6A 3T8RA 4OTEA 2M8CA 5FLXZ 3JR9A 2OPTA 4ZEBA 3CCMI 3Q5FA 1WH5A 2UYFA 2FMYA 2DWAA 2WAQA 4WXCA 4IO4A 1S7YA 5DEXA 2OZ6A 2E2HJ 1MMGA 1ZKGA 4IPAA 2O8KA 1KZ8A 1RDYA 3OEMA 5CBSA 1NV3A 3LA3A 3P9KA 4G12A 4QPQA 2VJ5A 1RDZA 1DP7P 2DQRA 3EETA 2L9SA 3P5JA 3C3WA 2PI0A 2VUMJ 1A31A 3UP9A 2Y5KA 3QAHA 2W7YA 1RR7A 3HHGA 4IHTA 2ZXTA 2DK8A 2NVYJ 4X48A 5DT6A 2X85A 1VFDA 2VOOA 3KZGA 1S8NA 4IO6A 1MH3A 1MH4A 4AVPA 3UK4A 1P9QC 2DFHA 1K83J 5M3MJ 5DEXB 3CLOA 3LAPA 3F8FA 2VPOA 2ZNUA 1WKMA 1D9VA 3S4UA 1N76A 1UTBA 2Q74A 2DDAA 2DK5A 1HKQA 2PMZA 2X51A 3MKLA 4PK4A 3ABMH 4F18A 2VBZA 3ROUA 1VQ7I 4NWCA 1BOAA 1B4AA 4ENKA 3HOYJ 3S1MJ 5EQAA 4PBHA 2P2AA 1R5ID 4Y4RA 3MZ9A 3TKYA 1FYLA 4OWDA 3LSTA 1YITI 4ESBA 1GV2A 1TFAA 1YXIA 2WC2A 5FKLA 1YIJI 4FASD 1FOWA 4RGUA 3MWMA 4F3BA 4F2QA 4B47A 4HW8A 3WTUC 3WHCA 4D9JA 3FF5A 1BC8C 2XX8A 3FV1A 4YKKA 1ETWA 2X6YA 3UGWA 4BDNA 3ZXSA 3K70C 1VQPI 4F22A 4BL0B 1ERDA 3R60A 1LB9A 4U0WA 2V3UA 3DTEA 1SFKA 2LDUA 3HEFA 4XLPF 2A5YB 3SEZA 4RDUA 2V6CA 1B9NA 2RGVA 1VI0A 2ECBA 2IJLA 2E35A 1CNQA 1JHHA 1Q35A 4XQFA 2OWTA 3ROJA 1XN7A 1TZLA 3Q9VA 2F34A 2OCUA 4U88A 3QODA 3KGCA 3FIWA 3OD7A 3U1OA 4JDFA 1DK4A 2DMTA 1ZLKA 4PFOA 1ONVA 2GAUA 4LIUA 4NE4A 4EDPA 2I58A 4MFDA 2LC2A 1YIOA 4IHXA 2K5CA 3IRQA 3JCUC 4U7BA 3PJRA 1RKWA 4R6HA 5DVFA 3HUGB 4A3JJ 2MH2A 4NG7A 3MAMA 1HF0A 4NTLA 4RYAA 4JOMA 2R71A 1YQAA 3VODA 2F48A 2JK3A 4QIWN 1NNPA 4LA9A 3HG9A 2KISA 2QLZA 3O66A 4Q48A 3WE3A 3DKWA 4E4HA 1OMPA 1JE8A 2MC4A 5CM6A 3GUDA 4EJOA 2YPNA 1FTJA 3LL7A 2O5RA 4M72A 2Y84A 4G6TB 4ABZA 5AA3A 1L0OC 1V4RA 3LSLA 1N77A 2EV6A 3NWTA 4DBQA 3S2HJ 4PF8A 3GFIA 5I84A 4ZEKA 2FNAA 2XXUA 5CC2A 2WBDA 1SW1A 1MZBA 3RCOA 3FKIJ 1IMDA 3PIOF 4M6XA 3S3OA 2I10A 2OBGA 4GX6A 1F9NA 2DODA 3BJ6A 1MPCA 3IB2A 2ECCA 2VE9A 3DTKA 4U23A 1NI9A 5ITPA 1OR7C 5EGOA 2ZSIB 3KZIC 4BBSJ 1ZRDA 1EKEA 4IO3A 3JV9A 3RTFB 2PX9A 2WYPA 5CMMA 4EQBA 1TNTA 1FBGA 4BDQA 5FGMA 5ICCA 3D0SA 4UVBA 1LBVA 1X58A 1T08B 4LFUA 5H20A 4ZECA 5KVRA 1XB4A 4G6QA 5FRMA 4IOAF 3ZQ7A 3K0LA 1YAEA 4ELOA 1D5YA 1IZ1A 4UB6C 1IDZA 1EF4A 3K4MA 2E5NA 4XM3A 4DDDA 2PBIA 2EZHA 1W0UA 4EF2A 1Q1HA 2F6PA 3O2AA 5HS7A 1IXSB 3WGHA 2ZCWA 1SFOJ 5E3OA 2ID6A 1ZMGA 3KPHA 4S0HB 1KU9A 2LRDA 2LREA 3M3KA 3PD9A 4M1VA 2XWOA 4RNSA 2XWVA 2ABHA 1T2KA 1IN4A 2F5DA 5GP9A 2V26A 3OYNA 1RR8C 3QWLA 2FBIA 3IR1A 3K01A 1SFXA 3IOUA 4KIBA 3T66A 3ZQIA 3PSIA 2L7MP 5F1JA 1G3TA 3ERED 2NS0A 2ESHA 4N9HA 4PGNA 2E34A 4I62A 2ONRA 4BHCA 1ZG5A 1FOYA 4A3CJ 2XIGA 1R9LA 2XXIA 3MPLA 4PDKA 2A68F 3R6SA 1VR5A 4WXHA 2IT0A 3FV2A 1J5YA 4NWDA 4YU0A 1K9YA 1XG1A 4BHBA 1LCTA 2F6GA 3FVOA 4HQMA 3HGYA 2YX7A 1ANFA 1FTOA 4H4KC 4NQWA 1ZLJA 2KJCA 3C33A 3IO4A 1WWXA 2DA7A 4M3FA 3F23A 3LR1A 3SFZA 5HM4B 5HPQA 3IC7A 3L2VA 4KNYA 2I48A 2O8XA 4RBOA 2ELJA 4BYYA 3QP5A 3TP0A 2ZJRF 2D45A 1FBCA 1PC3A 3N6TA 3R6UA 3BTIA 4PFBA 2DE2A 4F1UA 1MY4A 1WPKA 2KRFA 2DTZA 2W00A 5CVJA 4ASNA 1JW5A 2Z8DA 1IDYA 2ZZXA 1TXFA 1TT0A 1W4MA 1KQ8A 2DN0A 3K02A 1XD7A 2K3FA 4A12A 3FIRA 4U0VA 5JVTA 3HSEA 4NF8A 1DQUA 3G3GA 2E36A 1SYHA 4NDLA 1YS7A 4NQWB 4XBFA 5K7HA 5C4JJ 1MQDA 1WJEA 2BEOA 5FD6A 2OUMA 1A5JA 2UVHA 5LGNA 3Q3SA 2QF7A 2I5UA 3GEZA 2XAQA 3GW2A 2KRHA 1F43A 2FYIA 3VDXA 3G73A 2Z23A 1M1EB 3K00A 2QSFX 1O63A 4A0YA 1Y3QA 2L3DA 2STWA 1ITYA 4I99C 3BT9A 1SD3A 2DSFA 2VGQA 1QW0A 2HWVA 3HBLA 2CG4A 3BWGA 3SDGA 3RJPA 1LE8A 3IH2A 4IJAA 2M2EA 4AUXA 4ONYA 5EEHA 2L2OA 3E9XA 1HW2A 2GRVA 4NF8B 1XT8A 2DVZA 2M0MA 1TLHB 4IOCF 2XD2A 2G7UA 3SDFA 2FA5A 1W1WE 1TQPA 3E6DA 3CDLA 4UA8A 1FTMA 5AA2D 3VXBA 2LKXA 6PAXA 3EDPA 3CCRI 4PF6A 2ELKA 5J1UA 4IHWA 3HO7A 5E3MA 3IL1B 4KFQA 5ET7A 4PUSA 4A0ZA 2RDPA 2WTEA 3S3MA 2RC8A 4U22A 5AA2A 4E7LA 1XOCA 1R9QA 5IGAA 4H67A 4BEHB 2FIXA 5DVJA 1P92A 4JP0A 4NAPA 5H8NA 2CV1A 3F8NA 4E0WA 4H8JA 1LFIA 3FMQA 3OSRA 3D5SC 1YW9A 2Q9TA 1IUYA 3WAFA 4XSZF 1SW4A 5ICTA 4RA1A 2JUGA 2M7AA 2HXOA 4E70A 3FBIB 3AG1H 4XXUA 3BOQA 4ZDOA 2VHAA 1T0KA 3Q0UA 4MAGA 1B59A 2EJRA 4Y13A 3JRCA 3ABUA 2O7OA 1II5A 1W5TA 3I0TA 1CB6A 1QZEA 4N6DA 3W15C 5AA2B 1HQCA 1ENHA 4ENJA 2XHKA 5DM6F 3B6TA 2RC4A 1BM9A 3RPWA 2Y0MA 2IVMA 2R5ZA 1D0YA 1SI1A 5HNHA 1MXYA 5FO5A 2EIJH 1P1QA 2HAVA 3ABKH 3CUOA 3K69A 3VOEA 3OS0A 1YRNA 4HDVA 3PPQA 2HTSA 5FROA 3G3KA 3TODA 4JVCA 2F78A 1SMYF 2ICWG 4ZEDA 3E78A 2HVRA 3H03A 2QMWA 4JWXA 5LDZA 3BCBA 2JA7J 2HFBA 5FKNA 2MA3A 3CC4I 1ZJLA 3IWFA 1YG2A 4HV6A 3CCYA 1OCZH 3LSPA 1ZQ3P 5ILUA 5K5QA 1FTLA 3AFHA 4MBPA 5I2NA 4A69C 1JW1A 3DQVC 2FXAA 3FXQA 4ELRA 4G8XA 4LG3A 5DV5A 2HQAA 3MYUA 4LLGF 2OK2A 5ET5A 2K9LA 2R5ZB 2Y2ZA 4BDRA 3C2GA 1NKXA 4M3GA 4V2GA 3OSGA 1YRNB 5F0HA 4RJZA 2Z9OA 3K4JA 2QSGX 1MMSA 4R72A 3T0JA 2DA5A 1D9YA 5I3SA 1X1BA 3SETA 3EYIA 3CJNA 1B7UA 3TDJA 3QXMA 2EIMH 4FCYA 1WJ5A 2REGA 3QYBA 3KP3A 4OVQA 3E5UA 1YTVA 3K0VA 2IS4A 3OYLA 2O3FA 2PG4A 3CUQB 3MZYA 5I2NB 3G6EI 1GHCA 2DOJA 1X1DA 1B05A 5B1AH 2PVUA 2JRTA 2DQLA 2XXYA 2LY9A 4IXAA 3Q27A 1MBHA 2HYFA 3S1RJ 4MNIA 4ZEIA 4DIGA 2LYCA 3JREA 1U5TC 1DBZA 3IHUA 5L3FA 4G68A 2D1VA 2VD2A 1KA0A 1LFBA 3IP4B 4CDGA 3E79A 1I27A 1OFCX 1WQ2A 2V7FA 4C3IJ 4OIQF 1VFEA 3TTKA 3LSFB 1FPEA 2QMXA 4OERA 2MC3A 4Q30B 4AIDA 3K4UA 4NGUA 2QS4A 2KQZA 4TLLB 1MMDA 3DP6A 3H6TA 2QFLA 2NWJA 3CP8A 2WBMA 4C3HJ 5D5WB 5ICEA 3MKYB 1R71A 2H8RA 4MF3A 1O7FA 1G0IA 3RGYA 4DJAA 2DS9A 1B2HA 2GHBA 3S2DJ 3K4KA 4MHFA 1XSVA 2HFHA 2JTVA 3TBIA 3TO7A 2ZO4A 4EGZA 2JA8J 4MO7A 3S17J 1S50A 1J09A 3S93A 2XX9A 4G68B 3DKYA 5EZGA 4LONB 2GA1A 5BPIA 3S3NA 1FWZA 2ISZA 3H1CA 2HOSA 4X9TA 4MLVA 2PJRA 1NUWA 3PPRA 3Q0VA 1NUXA 2PBWA 2XXXA 4F3GA 1T39A 2R8TA 2HPIA 4R2FA 4NB5A 3LOCA 2REJA 1XDUA 2M1BA 3LNQA 1YJWI 1ULYA 2ZKZA 4KFCA 1Q9DA 4ZYAA 1WJDA 1DPPA 4K3FA 1R23A 3GTKJ 1QUIA 3LBSA 2C6YA 1HW1A 1YHQI 1FNNA 1OLTA 4H46A 1R1VA 3PU5A 1QGXA 3RKQA 3V8JA 4RPOA 2QUFA 3PV0E 3FASA 1QZYA 3FVNA 4OQOA 1DGRM 4M9SA 3S16J 2UXNA 4UUSB 4OFOA 2IGNA 3O8GA 1ETVA 1P6RA 1BA5A 3A3CA 3MJNA 2BY2A 2FMLA 3X2QH 4YIIA 2AL5A 2EFNA 1US5A 3IX1A 4AS5A 2XXPA 5I56A 3RPLA 3LA7A 3SEYA 2R7WA 1IG7A 3C9HA 3G1OA 4MH5A 4R6YA 4Y3OA 1MBEA 2O0YA 2M5WA 1OQYA 3CUQC 1CQTA 3IKVA 2DTRA 4D5FA 3WTVC 2MW8A 3E13X 4F1VA 2WWYA 3T9VA 1SC7A 5TPAA 2P1SA 3GBAA 1USSA 2CFOA 1FLIA 1TWGJ 1RKTA 1DOTA 4I02A 1OQGA 4ZS9A 1BN5A 4GXSB 1MJ9A 1WJAA 3RTWB 2XGXA 4NN3A 5I56B 2M0CA 3RPLB 3PNVA 1KYWA 3VFZA 1Y56A 4O7IA 1LBXA 4OOIA 2E71A 4DBRA 4P0IA 1VNDA 2P6TA 1XTAA 2KL4A 2O61A 2XAHA 4L9JA 3HCQA 3QYTA 3GLLA 2HEUA 4GWSA 3K2AA 1B3GA 5TPAB 4NF6A 2V1XA 3T8TA 3TO6A 2B9SA 2JA6J 2VONA 3KSJA 2XKOA 1IUDA 1UHWA 4B8XA 4RB3C 3I55I 2HOTA 1NK2P 3VLWA 2LF7A 1DU6A 5J6XA 4G68C 4I1DA 1KU7A 2BYVE 1BIAA 1EH8A 2WAEA 3F8CA 2BV6A 3PM1A 4M3BA 5FD5A 2Y7RA 3K6WA 1TW3A 2WAQN 4HNVA 3MEXA 4F3SA 1KA1A 3OEKA 2FNCA 5L9MA 4CZCA 2ZFUA 2GBYA 4HSTA 1B3HA 2QENA 1KZHA 1XMAA 5JLXA 5A2QK 4NF6B 3FXLA 2K9NA 5I58B 4Y33A 3UORA 4IO5A 3PFIA 4O3BA 2HTJA 2GM4A 1B5JA 5H8QA 4FECA 2E1OA 4Q8RA 1HSTA 1TT5B 1REPC 3LC8A 3IWZA 4EF1A 1O7TA 4GXOA 2Y30A 2F7BA 2P4WA 4BQOA 3J81K 2AIXA 3QUJA 4NX1A 1MM6A 4DYQA 3L00A 2CGPA 5DD8A 3IK6B 1AWCA 2OTJI 1GTKA 1YFHA 4NHBA 4BAYA 1B8IA 3K4CA 2PMZN 2EZKA 5J1RA 5D5UB 1FJ6A 2KMUA 4WF2A 3PNTA 4XLAA 1T38A 5FLXK 4P3LA 2NUVA 2CMPA 5DTBA 3F6OA 3NWSA 3K4LA 3PL8A 2I8DA 3SZPA 2ME6A 5H8QB 4P8BA 4XR6A 3SYTA 5BNGA 1NUZA 1URGA 5FLMJ 5KHDA 2A05A 3K70D 2KLFA 4EQ9A 2FHYA 5C44J 2MLKA 1MPBA 1P7JA 4XN3A 2QS2A 4ZZDA 1R6RA 2Y9YA 3F9KA 4OMZA 1Z91A 4G8HA 3KEIA 1FMVA 1NL5A 4BY7J 1B8IB 1ZARA 1QNTA 4RLFA 5LRRA 5M5YJ 2L9NA 4OIOF 5FTHA 2ONKE 3PUYE 5ISUA 3WHBA 2Z5UA 3M07A 3EHSA 2CUJA 3CFLA 4POWA 3LMMA 1RZ4A 1WVJA 2PJPA 2HXIA 2TRTA 5J40A 3HV1A 3OELA 2DA4A 2NVTJ 1Z6RA 3QMFA 1IUFA 2QVUA 1S29A 2Z33A 3DLNA 5JVGF 3RKYA 1BI2A 3TMOA 4XLHA 2LOOA 3QPSA 2B0LA 5B70A 3V83A 3HYIA 2VQGA 4II2A 1FW0A 1BTJA 2DOAA 3KYLA 2R7VA 4Q47A 3JRDA 3GXAA 1R7JA 5E1XA 4XF5A 1BI0A 3KP5A 4XICA 5IAIA 1GUUA 4XKWA 1BBYA 3OYMA 4YKIA 3OYIA 2FNPA 4FX0A 4X1DA 4XKBA 3KEQA 3L2UA 4OFJA 5F08A 2V9VA 1MDP1 2R7XA 2W25A 2PFYA 2M9HA 4V2FA 2DLLA 2HDWA 2MGQA 1YI2I 4KIGA 4L5IA 1OCRH 1FY7A 2HYJA 1YYZA 4DYCA 3FVKA 1AA7A 1WJCA 1XC5A 2COMA 2M7BA 1HOMA 1MY0A 2PCRA 3QPTA 3GFLA 3MUQA 4O3AA 1Z7NE 3GTJJ 2P6SA 1E3PA 3HXLA 3I59A 3OIPA 2PFBA 5HNFA 1PP7U 3RTRA 3H6UA 4N8YA 3GYYA 2V4CA 2IA2A 4HE1A 3RI4A 4HG2A 4HBLA 3MMYB 4RA2A 2IRFG 3EF7A 1NV1A 4XKQA 5GPAA 2DDBA 3WTTC 3ABTA 5KAIC 4EEFG 2QA4I 1X19A 5JEIA 3IB0A 3GVAA 1U8RA 4QSCA 1B58A 3Q28A 2EIKH 3E4RA 2H9BA 4P0GA 1D1BA 3V8KA 5IP9J 4F29A 1FX7A 5CVVA 2BVLA 3KEYA 3I59B 5BPDA 1NNTA 2QS3A 1IXCA 2XXKA 1MMAA 5E1ZB 2XAGA 2Z16A 1B40A 1PB7A 2CQKA 4IX7A 4HX4A 4AD9A 4PE5B 2VJ4A 1FBEA 1QPMA 2DO7A 2P5VA 2VT2A 5KCMA 2L9VA 3K1PA 3KC1A 3DEWA 2CS3A 4ZYHA 2MD5A 3GMEA 5FKOA 4V19K 2THIA 3H9QA 4HLYA 2VQCA 2ZMEA 2ZJPF 2V79A 3CHGA 3ZQHA 3ZSFA 1AHDP 1N7WA 5D6EA 1Q1VA 4L9NA 4DIQA 4N91A 2L54A 4EVIA 1L3LA 1R1TA 1BW6A 1WJBA 4E6KG 1DTZA 1MS7A 3U21A 1VQ9I 2WY8Q 2R9JA 2ZYMA 2RREA 4KYEA 1ETXA 2BY1A 4HW0A 3FUZA 1H76A 1K6YA 1O3SA 2ME0A 3A09A 1MQIA 3HRTA 4LB5A
chains in the Genus database with same CATH topology
1EYIA 3OOPA 1Z6TA 2ZMEB 3ZN0A 3I5UA 4WCGA 1LDKB 4B09A 3WTZA 3TOBA 4XFEA 1P4XA 3C7JA 4HCWA 2JPBA 3KLOA 1E17A 4RGSA 1NUYA 2IW5A 3GWZA 4ETSA 3R61A 5ICGA 1SAXA 3V4GA 1VTNC 5L3EA 4FBPA 2W84A 1IMEA 1WRJA 3V7RA 1XGOA 2L5VA 3DXJF 4DI3D 1G3WA 1EH7A 4A5MA 4KIFA 4GWYA 3A29A 2CZKA 3IKTA 3BJOA 3B02A 3B50A 3F8MA 3R4KA 1DDNA 2JZYA 4PAIA 3OV8A 1IN7A 1P2FA 2FRHA 1ZREA 3GFMA 2WEFA 4FHTA 3L2CA 3E6CC 4GGGA 5I5PA 1U6GA 4TV7A 2RNJA 4L5JA 1ON1A 3ECHA 2O03A 3JTHA 3TGNA 1OR7A 1BC7C 3HTSB 5L3DA 4LK1F 1IN5A 1O3RA 2CFXA 4P5OA 1O57A 2JSCA 3BDDA 1HSJA 5BS6A 4IRGA 1R22A 3KEOA 1D5VA 4GBVA 2KR0A 3JSOA 1XI6A 3BP8A 1K6OA 2Y5LA 2NNYA 4BNCA 3E5XA 3GLXA 1FBHA 4PTKA 4IRHA 4OVRA 3HUGA 4N15A 2GQ1A 4IF4A 2VT5A 4QWQA 2XROA 3NEUA 2QPQA 4HDUA 4P56A 1FT9A 1S7AA 2L02A 4HQEA 4F7ZA 3FMSA 2A61A 1Z1DA 3CTAA 3NRVA 3QPHA 4O6JA 5D5VB 4U0YA 3K1NA 1BK4A 2IA1A 1IW7F 2OU2A 1EH6A 5DD4A 3F22A 4M9XA 2WBBA 2ZZVA 1ZGJA 3RYDA 2QVRA 1ZYRF 3V8LA 4O94A 5ESYA 2ZBKA 2RKHA 4LJZF 1J9IA 2XWIA 5IZ3A 1FPIA 1C0WA 1ZH5A 4UXNA 4I40A 2Z99A 1U3EM 4M74A 2KIUA 3IRRA 2BGCA 4HAMA 2DU9A 1A04A 2H09A 5BMZA 3NQOA 2F5CA 2HEOA 5IZ3B 3I54A 1MGTA 1QQIA 4N0BA 4G7OF 3KZYA 3CDHA 3HFUA 5JR3A 5J1DA 4CO8A 4D0PA 3WU0A 4EV0A 5T3JA 1KU2A 2HYGD 4N8GA 1J59A 2RQPA 5K5RA 4L18B 4NQ8A 1IMFA 3GXOA 2HHMA 2VC0A 3PTYA 1FZPB 4ZH4F 1J0RA 1B6AA 3F72A 1MDMA 3F21A 3LA2A 2DI3A 2H6BA 2CO5A 4YIFA 1KQ0A 2ESNA 4MEXF 3EYYA 4UV9A 1MDMB 3LFKA 2XASA 3T5XA 3F3XA 1E2XA 1D8KA 1LEVA 4GWZA 4OIPF 1ZRFA 3LUZA 4NHJA 2FVZA 2F3BA 5JHUA 2CZHA 1D9QA 2NNNA 4PE3A 1B9MA 3D1RA 4EJWA 2A6HF 3R0JA 4ESJA 2H27A 1U5TA 4P1LA 4ENMA 4DI4B 3TO9A 2GQQA 1SD6A 4YG2F 1GXQA 2K27A 5K5OA 1JXSA 4IRIA 4LMYA 1FP1D 3TQNA 1XGNA 2BBYA 2IP2A 4KMFA 3L7WA 1U5TB 1D3YA 2E1CA 5LGUA 4PCQA 4OANA 3HIFA 4UVAA 1T0FA 4RAYA 2CEXA 3LQQA 3D5LA 1DCUA 2GZWA 2WV0A 1SFUA 2CW0F 3GYHX 1XCBA 3WGGA 1FBSA 2PMUA 3ZMUA 2HPGA 5JFRA 2M45A 2E1NA 2STTA 4GX3A 1IRFA 4MNUA 2QM3A 5ILSA 5DCFA 3CUQA 5ET8A 3IFAA 3QRFF 1S7OA 1H0MA 5L3CA 1QO0D 2VXZA 3FXBA 1RI7A 2K4JA 2K02A 4OA4A 2ISYA 4LLLA 1HKSA 2K4BA 1QGPA 1NV4A 4P9KA 2FF4A 3KP6A 4PFIA 4EMSA 2HXRA 1W7PB 1P4AA 3KC0A