3T1BA

Crystal structure of the full-length aphb n100e variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSELTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
total genus 84
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t1bA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t1bA02
1Z6RA 1OYIA 2A61A 2AXLA 2CWEA 2DU9A 4R8HA 5CVJA 3IL2A 4PGHA 1XDUA 1T6SA 1ONVA 1TW3A 3W6KB 2TDXA 2XKPA 5FD6A 1QPMA 4MQ9F 3CUQB 1K78B 1D8KA 4P5OA 2XUBA 3F8CA 4N9HA 3E3VA 1OR7A 2FMYA 3I4PA 4RGSA 2NNNA 1R5HA 1Z7UA 3N4MA 1F5TA 4L9NA 1LB2A 4S04A 3E6MA 4HOBA 1FT9A 1DUXC 2HTSA 3LA3A 1YW9A 4KMUX 1VTNC 3FXRA 4WXCA 2ACJA 3EYYA 4IRIA 4OMYA 1R1TA 4Q47A 3GFLA 1TTYA 4AWXB 1H9GA 5DCFA 2UXNA 2VOOA 3I0TA 4JVDA 2H09A 3S2WA 2O6GE 2AS5F 3MEXA 2CYYA 1FYKA 3RPUA 2UZKA 3QU3A 4MNUA 1BI3A 3CLOA 3U1DA 4IRGA 1SD7A 2RC4A 3DF8A 1MKMA 2ZBKA 2NNYA 1JGSA 1WQ2A 1NHAA 2Z9OA 4HF2A 4EJOA 5D8LB 5DUKA 2FEZA 3FHZA 5FB2A 1BOAA 2P4WA 1YQAA 4LB5A 1MDMB 2VE9A 3PQKA 2P6TA 2GQQA 3MFKA 4EMSA 4LK0F 4JVIA 3TOAA 1B4AA 2KIMA 3VB2A 2LF7A 2RKHA 2V9VA 5D5UB 4HQMA 3T1BA 1SMTA 3MQ0A 1R36A 2LNBA 2B0LA 2STTA 3DP7A 2IA0A 2W57A 2HWVA 4ENJA 2P8TA 1DP7P 2FE3A 2FQ3A 4FT8A 3GWZA 2GXBA 5HLGA 3LA2A 4JBAA 3I64A 3R61A 5E17F 1AWCA 1F9NA 2V1XA 2PN6A 1DPUA 1R00A 3HHHA 4LMYA 1JXSA 2H6CA 2CQKA 4OINF 2K4BA 2F5EA 3F22A 2IW5A 4F7ZA 4LLGF 2QQ9A 4ZYDA 3V7CA 3ZP5A 1GVJA 1P4XA 5CYVA 4XLNF 2W25A 4O6JA 2XVCA 4Z2YA 4M6YA 4JQFA 3V7SA 1O3TA 3P9CA 3M1EA 1LDJA 4RGXA 2Z33A 1XSDA 2NAZA 3FZVA 2LF8A 3DQVC 5LEKA 1RUNA 3MZHA 1XGMA 2CO5A 1GHCA 2DAOA 2IP2A 5E1XA 3IC7A 1HQCA 5D4SA 2PMUA 2V1UA 2HKXA 4EJTA 2ZO4A 4P9UA 3ROUA 2D2WA 1TW2A 2VC0A 3GX4X 2IVMA 3ZMTA 5L3BA 3KCCA 2L4MA 2QM3A 3EDPA 3FXUA 3I71A 2MD5A 4YIFA 1T39A 4HLYA 3I53A 1F4KA 2Q0OA 1IN7A 2VBXA 4EV0A 4QBAA 5D6EA 2V79A 3SZPA 4JVCA 5DYMA 3RI4A 3G73A 4KFCA 4WXHA 2GA2A 3BZ6A 4GXOA 5F64A 2PEXA 1SD6A 4BNCA 2EFWA 2GZWA 2XIGA 4IHSA 2IA2A 1FWZA 1QZYA 3LAPA 2K02A 1WKMA 1LVAA 4KNYA 2RDPA 2PG4A 4ESJA 1FYLA 4ZYHA 4MEXF 3QU6A 3MWMA 1CF7B 4ENKA 2F2EA 1O7FA 4L0YB 3TO7A 2YR2A 3C1DA 4A6EA 2EV6A 1QO0D 2EJRA 4A2UA 2A07F 1KGSA 1I27A 1MJAA 1TNTA 5BPIA 2XAQA 4E70A 3VODA 3KFWX 4UHTA 5JI6A 1TBXA 2KIFA 1ZHFA 4M74A 2M30A 2ZCWA 3FF5A 2VONA 2F5DA 2MA3A 3RPQA 4A5NA 3RTRA 2G7UA 3CDHA 4LFUA 3MZYA 1KYZA 4IRHA 2HKOA 4WX9A 3F6OA 1ZG5A 1YIOA 3DEUA 2QLZA 5JHUA 2DFIA 1ZN2A 2BV6A 3TO9A 1R5GA 1LEBA 1ZG1A 4A0YA 1D8JA 4BYYA 1SFXA 2QYOA 4U7BA 1B59A 4EGYA 1SD5A 3EQLF 2DO7A 4KDPA 3RYRA 2ESNA 5L3GA 3R0JA 4A6DA 4Q4ZF 2EFQA 3P7NA 1HW5A 3K69A 4R1HA 4ENNA 4WWCA 3F23A 4CYDA 3F8FA 3H92A 2F5FA 4FX0A 2FSWA 3GZ5A 2M87A 3J80Z 1IXCA 5K5QA 2XROA 4EJWA 1YG2A 5HS9A 4UV9A 1IN6A 1JHHA 1MJBA 2W24A 2ZMEA 1T0FA 4HYEA 1W5TA 1KA8A 4AVPA 2JZYA 4HV6A 1KU2A 4IJAA 2RVCA 1YW8A 2O8XA 4HA8A 4HV5A 1I1SA 1BC8C 3ZMZA 1U2WA 3M9AA 2VOPA 4D0PA 3FM5A 2XAJA 4DNCA 1EH7A 2CFXA 3C3WA 3DFGA 5AIPA 1KQ9A 5CLSA 1IF1A 3ABTA 1TQPA 1H0MA 5ICCA 3JAMZ 3F8BA 1LDKB 2NRAC 4I0BA 2J5PA 4U0YA 2BE5F 4WK8F 3NRVA 2WV0A 4GYGA 5L3EA 1OKRA 3ELKA 5LGNA 3GXOA 1PP7U 3P9KA 3RJPA 1ZGAA 4IPAA 3ZQ7A 1ZYRF 1FSHA 3K0LA 1YS6A 2Y48A 3LQQA 1YLFA 3C18A 2VBZA 2QQBA 1FLIA 2A6HF 3F6VA 3R6SA 4GYIA 2JTVA 1HSJA 3QP5A 1HW1A 5TRDA 1P4WA 1IXSB 5D5VB 5HDKA 3L09A 2DQLA 2M45A 4M9XA 4KT5C 2ISZA 5AONA 2VODA 3HRTA 2FBIA 4RS8A 2PJPA 4KIFA 1U5TC 3I5UA 2E7XA 3WU1B 3HRSA 5K5OA 1FP2A 1J7KA 2FXAA 2ELHA 3ZN1A 2WC2A 3KP3A 2K4JA 4FX4A 1WI9A 5H6RA 5ICFA 4U88A 2HYGD 1BN5A 1RNLA 2BBYA 3QPTA 2L02A 2YPRA 5CVUA 1I1GA 4L9JA 3KP4A 1KQ0A 1XDSA 5A2QZ 1S7OA 3GYHX 2HEOA 2EB7A 3TDUC 3O2PE 3CTAA 3SFZA 1QZZA 2V1DA 1J59A 5AIQA 4ZYGA 1SAXA 4OMZA 3HOTA 4M9ZA 1HKSA 1JE8A 1ZG3A 2P6SA 3L9FA 4RGRA 3L2CA 2COMA 2NS0A 3TOBA 3NQOA 3V8KA 5LRRA 4BHPA 1TQMA 2KRFA 4P96A 3E6BA 1PP8F 1DPRA 2FA5A 5IT9Z 3Q9VA 2GAUA 2FBKA 5LHIA 1H9TA 1G6NA 1X3UA 3FX3A 1U8RA 1IN5A 1J0RA 5EEGA 3EETA 4XSZF 2KIUA 2STWA 2DBBA 3HHGA 2OA4A 4IVNA 3GW2A 2ZJ2A 3IKTA 3M8FA 5D6FA 4YIIA 3SHFA 4YFXF 1MJ9A 5DCMA 2JT1A 1ZRFA 2PMHA 4EM2A 4HDUA 1IXRC 2XAHA 5ED4A 1Z91A 2OQRA 3K2ZA 5FGMA 1SMYF 5LHHA 2F5CA 4G9YA 3JSPA 3FMRA 3J80K 4XRFA 4EVIA 4UVAA 2QWWA 4EQQA 4AIKA 1WSUA 1IW7F 1R1UA 3F8NA 4BH9A 3PFIA 4A12A 3WGIA 1DDNA 2XASA 5HS8A 1ZH5A 2OZ6A 1USTA 5K5RA 1ZRDA 1WRJA 4N0BA 3ZMSA 1XGNA 2MLGA 3BOQA 2HTJA 2R7DA 4LK1F 2H94A 2HOEA 3WU0A 5HOOA 4BXUA 2DW4A 2FU4A 3CUOA 3KLNA 3SXYA 4QLCU 1IRGA 3C7JA 2ZMEB 2E1CA 5L3DA 2VN2A 2IT0A 4PGGA 4G7HF 3VFZA 3B73A 4ON0A 3JAMK 3LA7A 1EV7A 2HZTA 1BC7C 4HAMA 4CO8A 1E2XA 5JVTA 4TV7A 4IF4A 5FLXZ 5FD5A 3J81Z 1KU7A 1HKQA 2YX7A 2CG4A 2CGPA 4UVBA 1MD0A 4PZJA 2CW0F 4KMFA 2A3SA 3M7GA 1BBYA 4EM1A 3GFMA 4YFKF 3Q9SA 2JRTA 3K9TA 2Q8KA 3IRQA 4UNOA 2E1NA 1GXQA 5HDGA 2DPDA 2XAFA 2DQRA 3WTTC 3RKWA 3KP5A 2QZ8A 4AIHA 2GWRA 4HX8A 5LGUA 4LG0A 2RGVA 4MHGA 4G6DA 3WGGA 5BPDA 2W84A 3ZMDA 3HRUA 3V7RA 4A5MA 1P92A 1W7PA 4OIPF 4G6QA 2FF4A 1FC3A 3B02A 1YO5C 4IHTA 2HQNA 3WODF 4MEYF 1I6XA 2GXGA 4R79A 2EV5A 4GGGA 2HDCA 3BROA 3GEZA 4Y15A 1G3WA 1RZ4A 1XCBA 5ERIA 3T8RA 2ESHA 2IRFG 1S8NA 2R3SA 1YFHA 4HQEA 3FMQA 1HBXG 5HS7A 3ZMVA 3R4KA 3ECOA 4OIOF 2KJBA 1FYMA 5E18F 4MQVA 1FX7A 5HLIA 4OU0A 1S7AA 2ETHA 4S05A 1MDMA 4U0VA 1OYYA 1KU3A 1IZ1A 2HFHA 2VXZA 5CVVA 3CUQC 1UHWA 3KZYA 3RDIA 3LQRA 3VOEA 2XGXA 3I58A 1UHMA 4G94A 5HVQC 3M8EA 1FSEA 2K7LA 4ZZLA 5IT9K 3FXQA 1Y0UA 4L0ZB 4CGZA 1OMIA 2XHKA 2DT5A 3EYIA 3L00A 2BYVE 1P2FA 4UV8A 1FBUA 3DXJF 3ECHA 4IXAA 3WTZA 2QUFA 2PLYA 2JSCA 3WTVC 5D5XB 4Q48A 2GA1A 2P5LC 1L0OC 1WWXA 1IAWA 2GIVA 1O7LA 1J2XA 3TGNA 1FOKA 1TNSA 4KN4X 5E8GA 4EJVA 1R1VA 4GO1A 2RN7A 3QOPA 2LSOA 1RI7A 4PDKA 1T98A 1U78A 2X0LA 1XCVA 1LEAA 4U7DA 3LFKA 4CZZA 4AD9A 1BJAA 1U5TA 2OAZA 3I59A 3DPTA 4I01A 1IRFA 3T8TA 5DUIA 1L3LA 2K86A 1J75A 2XAGA 4LJZF 2RQPA 3FMSA 5HLHA 2VT2A 4LLLA 2YU3A 4BQAA 1BI2A 4HF0A 1ZAOA 3TKYA 2M5WA 2EFNA 4I7HA 5ICGA 2QBYA 2HYFA 5L3CA 2E7WA 5F6FA 4ENMA 2M8EA 4OOIA 2C6YA 5F1RA 2DK8A 4NB5A 3FM3A 4P9FA 4L5IA 2DTRA 5CVRA 4ZZDA 3SZTA 5FFXA 4M6XA 2MH9A 1OPCA 1P6RA 3SQNA 2BEOA 5LEJA 2FMLA 4EJUA 1T38A 2MBFA 4HX7A 4XSXF 2ZNZA 2DI3A 4UVCA 5H20A 1AOYA 5DV5A 3GF2A 5E1ZB 2L4AA 3V8LA 3F8MA 4CHUA 2K27A 3D5LA 3VEPA 5E20A 4WF2A 1Z1DA 5ILSA 5J8FA 1U3EM 1Z05A 3OV8A 4RB0A 3WGHA 3KP2A 1KYWA 4LD5A 2D45A 2Q2EA 2OD5A 3COAC 1V3FA 1T2KA 3ZN0A 1FBSA 4N9IA 1KQ8A 3KP7A 2NYXA 3F21A 2VC1A 4M73A 4HBLA 2EA4A 3OOPA 3E6CC 2LKPA 3E5UA 1XMKA 1A04A 2O03A 5ILUA 1RUOA 2O0YA 3LSTA 3BJOA 1B1BA 4G7OF 1EH6A 2KKOA 5LGTA 2Z3YA 5JFRA 1ZGJA 2L3DA 2PI0A 1K6OA 4A0XA 4LG0B 5KVRA 3HSRA 2LDUA 1LDDA 5D5WB 1OYWA 4L18B 1ZLKA 5DEQA 1W7PB 2EFOA 2DK5A 1Z6TA 1R58A 1FP1D 4XBFA 1PDNC 2A69F 2G7HA 1STZA 4ESBA 4P55A 1SD4A 1ON2A 5LLQA 1ODDA 2VBYA 2FNPA 1FPQA 3KEOA 1O3SA 4I02A 5DD8A 4KN7X 4WXDA 1YYVA 5CJ9A 5D4RA 3K1MA 3BDDA 4I98B 2BGCA 4MTEA 1FZPB 1K79A 2HS5A 1ULYA 1XB4A 5DD4A 2JPCA 1B9NA 3HFUA 2VT3A 2OQGA 4RAYA 1Z9CA 4KIBA 4KIGA 2P5KA 3JSOA 1ZLJA 3T5XA 1YW7A 2IA1A 4O3MA 2ZKZA 4ZYEA 3QP6A 3JTHA 3ML6A 4A0ZA 1U6GA 1SFEA 3F3XA 2QENA 4NHJA 2ZNYA 2A5YB 3P9IA 3HTUA 3IWZA 3REOA 4AIJA 2UWMA 3K1PA 5LRSA 3KP6A 1SFUA 1BIAA 2WWYA 1HW2A 1ON1A 2PQ8A 4I2OA 2H27A 2FOKA 3KEQA 2M1BA 1XGSA 2IPQX 2EFPA 2MC3A 3RKYA 3QRFF 1W4MA 3GLXA 1UFMA 1MZBA 3BJAA 3DV8A 4G7ZF 1XSVA 2ADUA 3E97A 5L3FA 5KK1A 4RGUA 2YX4A 4B8XA 2MH2A 3MCZA 3K1NA 4ETSA 2QQAA 2G9WA 4O5VA 3BPXA 4RB1A 1CGPA 3LAJA 2P5VA 3FWEA 4KA4A 3BY6A 1IN4A 4U0WA 3HOSA 4Q5SF 4BHBA 1U5TB 3I59B 3ABUA 3HYIA 1BM9A 1G3SA 3GFJA 3E5QA 1O3RA 1G3YA 2D1HA 3Q5FA 2KJCA 3N97A 3CJNA 2D1VA 4I0AA 2Y75A 4K2EA 1W7PD 1P4AA 1HXDA 2L54A 4RB2C 3I54A 5E8IA 2QBYB 4M9SA 4Y13A 3CUQA 3BWGA 4H0EA 1K78A 2ZXJA 1ZREA 1S6LA 3GO5A 3WTSC 3ERED 2FBHA 2Z5UA 3H3UA 3T0YA 4RB3C 4CXFA 2EWNA 2UXXA 2A68F 1XD7A 1IN8A 1LQ1A 2V6CA 1J5YA 4HDVA 3GZ6A 4RAZA 4CDGA 3GVAA 4HX4A 4GCVA 4B09A 2DPUA 1HKTA 4ESFA 4YG2F 1JHFA 3ZPLA 1QNTA 1S3JA 2PBIA 4G8XA 2FNAA 4XLPF 1GXPA 3WE3A 4L5JA 2CSOA 2P7VB 3GUDA 1FY7A 2MLKA 2IJLA 4FHTA 3PQJA 5A2QK 2RV8A 4KICA 3GFIA 2XRNA 2JPBA 1S29A 1C0WA 3G3ZA 3KETA 1W5SA 2ISYA 3W6JB 1O57A 5E1WA 2HGCA 3V8JA 3O3KA 5LBQA 1EH8A 3J7AO 3ZMUA 2A6EF 5HDNA 2FRHA 2RNJA 1B6AA 1B9MA 5IT3A 1YS7A 3WG9A 4DQ2A 2WTEA 3MAJA 1R22A 3E5XA 1V4RA 3HSFA 3CO6C 1PUEE 2OZUA 3WTYC 4UUVA 4M71A 1YTYA 4I09A 5BQTA 1TLHB 1FNNA 2J5OA 1XSXA 3F72A 3BJ6A 4PCQA 1D5VA 3KLOA 1USSA 3HSEA 5ICEA 1IUYA 1REPC 3O6BB 1J9IA 3WTWC 1UCRA 1BIBA 2EK5A 4UXNA 2QVOA 3TO6A 3E6DA 3RYPA 2P7CB 1MGTA 5CVIA 3L7WA 3U9GA 2W85A 3LWFA 1E17A 3ULQB 3DKWA 1UB9A 3H3ZA 1D3YA 2HR3A 5J8CA 4ASNA 4MTDA 4LB6B 5BS6A 1BI0A 3CO7C 2L01A 4HZFA 3HTSB 2HXRA 4WCGA 4Y17A 4HF1A 5D8KB 5FFZA 2O3FA 2X4HA 3TDZC 3V4GA 4LLNA 1XN7A 5DCMB 2R7FA 1O3QA 4NQWA 1FBQA 4OIRF 2VBWA 3QPHA 1QGPA 2VE8A 3HUGA 2PFBA 3JTGA 1LNWA 4MGRA 3U2RA 2OBPA 5EEHA 4LGWA 3WTUC 5K1YA 4CICA 5LHGA 3KZZA 2EV0A 1R7JA 1K7AA 1HSTA 4L9TA 1QBJA 1ZARA 3IKVA 4ZH4F 1I5ZA 4BHCA 5H6QA 2EA2A 5ILVA 3IWFA 2XV4S 4OIQF 4KYWA 2Y0MA 2YSRA 4KUMA 3KE2A 1R23A 2H6BA 2HQRA 5DDGA 3TQNA 3QAHA 1KU9A 3DPLC 5FLXK 2OU2A 3J81K 3NEUA 1Q1HA 3EUHA 4JK1X 2Z99A 3D0SA 1RIOH 3AAFA 4HW0A 1G3TA 2DLLA 3BP8A 3RKXA 3R60A 4EGZA 1G4DA 5JR3A 1QQIA 3IHUA 3JW4A 5J6XA 4L9VA 4QWQA 2XKOA 2ZFWA 1F1ZA 5FO5A 4M72A 4HLXA 4BAYA 3HRMA 1BI1A 3RIRA 1TQIA 4EM0B 1CF7A 1ZRCA 4YFNF 3WE2A 5BMZA 3BPVA 3ISPA 5TJJA 3WTXC 1XGOA 3IRRA 3R0AA 6PAXA 2O61A 1XMAA 3HIFA 5BOXA 1LJ9A
chains in the Genus database with same CATH superfamily
1A99A 1Z6RA 1OYIA 2A61A 1W36D 1B8IB 2AXLA 2JQ7A 5EF6A 3IJXB 4KYEA 4OVTA 2CWEA 2UVIA 2DU9A 4R8HA 5CVJA 3IL2A 2Z8DA 1FTMA 2DTZA 3T0JA 2DN0A 4PGHA 1XDUA 1T6SA 1ONVA 1RETA 1TW3A 3W6KB 2TDXA 4QF9A 2XKPA 5FD6A 1XS9A 3U65A 1QPMA 4MQ9F 3CUQB 5F08A 5I57B 2LRDA 5TISC 1K78B 1D8KA 4P5OA 2Q2CA 2VT5A 4FAJA 4Z7EA 3L2WA 2XUBA 5C4XJ 4XORA 1XC1A 4PQJA 1OQGA 3M1CA 2Y69H 3F8CA 3K2DA 3RPUD 2XWKA 2F5VA 3BG7A 4N9HA 3P7IA 3E3VA 2BW3A 2Y7IA 1OR7A 2FMYA 3I4PA 1UQWA 4RGSA 2NNNA 2B4MA 3PUVE 4DYQA 1R5HA 1E3OC 3ABLH 4U23A 1SFKA 1Z7UA 3N4MA 1F5TA 1VQKI 4ND9A 4L9NA 1LB2A 2DQVA 4S04A 1JTXA 1POGA 3E6MA 4PE5B 2KZGA 4HOBA 1FT9A 3UK4A 1DUXC 4DDDA 1MXYA 1Y1VJ 3GBBA 2HTSA 3LA3A 3ZR8X 3LSLA 1YW9A 4KMUX 1VTNC 2VKDA 4NF0A 1CQTA 3USDA 3E4RA 1YE9A 3FXRA 4WXCA 2ACJA 1FJLA 2WB1A 3EYYA 3PO3J 1AOVA 3H36A 1B9JA 1AMFA 1H43A 4OZ9A 3ESWB 1N77A 3CCJI 4IRIA 4II2A 4OMYA 3HKZA 4A3LJ 1KZ8A 1QUKA 5ELVA 4OFOA 1R1TA 4Q47A 1WHUA 3GFLA 4BU2A 1NV0A 1TTYA 4AWXB 4OEVA 3PSFA 2JVHA 1H9GA 5ET7A 4WEPA 4C3IJ 5JEIA 5DCFA 1Y0NA 2XWIA 2LG4A 2NOOA 4H8IA 2UXNA 2VOOA 3I0TA 2DS9A 1LSTA 4JVDA 2H09A 1ZTYA 5GPAA 3OYLA 2Q9TA 3W9VA 4O7MA 1LB9A 2GQ1A 1MXVA 2DDAA 2D5VA 3S2WA 1KA0A 3DLAA 1P1WA 1SW5A 4OENA 4OVRA 1RESA 4Y52J 4C3JJ 3BR0A 1LPQA 3H5NA 2V26A 2O6GE 2AS5F 3MEXA 1G8XA 2EZKA 4DYCA 1TC3C 5FRMA 2CZKA 3Q0WA 4N6DA 3BG5A 2DSFA 3CHGA 2QF7A 4PAFA 4G4PA 5HBCA 1ORKA 4XONA 1TT1A 2KLFA 2CYYA 4FEBA 3ZQIA 1FYKA 4JDFA 4E7KA 3RPUA 1GV2A 1K61A 4PF8A 2UZKA 3VDFA 3QU3A 1UELB 4MNUA 1BI3A 2VXDA 3FDYA 3CLOA 4JB7A 3U1DA 4LZ5A 5JLXA 4ZEFA 4QTRA 4IRGA 3RN8A 1MQGA 2M9HA 2DE2A 4D5FA 3PNYA 3KX2A 1LCTA 3OYAA 5J1YA 3BG9A 2MW8A 1PUFB 1WODA 4ZE9A 1SD7A 2RC4A 3DF8A 3ONQA 2M7AA 1MKMA 3PUFA 1B4ZA 3S1RJ 4OESA 2ZBKA 1URDA 2DYSH 2NNYA 4RNSA 1JGSA 1WQ2A 1NHAA 3HKZN 2ZNSA 2Z9OA 4MFDA 4XKWA 4HF2A 2AL4A 4F1VA 4EJOA 1NV7A 5D8LB 2UYEA 4NMYA 5DUKA 1TT5B 2FEZA 1JT0A 2R7SA 3E9XA 4MFIA 2CS3A 2BY2A 3FHZA 3CDIA 4M3BA 3RQ4A 3CI8A 4MNIA 1IC8A 4PETA 2YU9J 3FISA 2PX9A 4XICA 3K4UA 5FB2A 1BOAA 2P4WA 2FVZA 4CZCA 1JGGA 1ZQ3P 3DBHB 1YQAA 2DYRH 4LB5A 1MDMB 4PUSA 2VE9A 2GHBA 3HOXJ 4YAHX 1ETKA 3BR2A 3PQKA 4GVOA 1BR1A 2P6TA 1NL5A 2GQQA 2P2AA 3MFKA 4EMSA 3PUXE 4LK0F 4JVIA 2Y2ZA 3TOAA 3ONMA 5FBPA 1DP3A 1B4AA 3ZQQA 3IO6A 2JMWA 2KIMA 4W1UA 3VB2A 2QMXA 4HCWA 4RPNA 2ELKA 2CV1A 4EQBA 3OSRA 1TWCJ 3AFHA 3S32A 3DP8A 1FQEA 3ILTB 1Y8RB 2LF7A 1MY3A 1T0KA 5FKMA 3DWLE 2RKHA 2V9VA 5D5UB 2REGA 4HQMA 3T1BA 1SMTA 3MQ0A 2RREA 1R36A 1TWYA 3G4SI 1INPA 1P9QC 2LNBA 1ETOA 2B0LA 2STTA 3DP7A 4QSEA 3OYIA 3OOAA 1XX5A 3P5JA 2IA0A 1VZ0A 2W57A 2IBDA 2HWVA 4A3BJ 4ENJA 2QVRA 3OL4A 2P8TA 1A31A 1WGXA 1JEUA 2XXXA 1DP7P 2FE3A 2FQ3A 4FT8A 1NNTA 3K6WA 3MP1A 3PPOA 1SVMA 1WDNA 1ZIUA 4BDLA 5IP7J 3GWZA 2GXBA 3HOYJ 5HLGA 2ALUA 3LL7A 3LA2A 4JBAA 1LAXA 4OVQA 5ICQA 1GLNA 3I64A 3R61A 5E17F 4KYDA 2E2JJ 4I76A 3DTKA 1D9QA 1SI1A 2XX9A 4AS5A 1NMUA 1TL8A 1AWCA 1N0TA 5TP9B 1F9BA 3TMOA 1F9NA 2XF5A 4LOCA 2V1XA 1RDZA 3PUYE 1UZCA 2PN6A 1DPUA 2NOJB 5KCJA 1R00A 4MH5A 2O68A 3HHHA 5H8QA 4LMYA 3BR3A 1JXSA 1BJZA 4P47A 3F0CA 2H6CA 3K6VA 3MPLA 4BEHB 2CQKA 2JA8J 1ZMGA 1L5TA 1WFXA 2E34A 4OINF 3TAJA 4F52A 5CC2A 2K4BA 2F5EA 1FTJA 3F22A 1P99A 2HZLA 2IW5A 3Q28A 1JTYA 4MNCA 1K9YA 4F7ZA 5CBSA 4LLGF 3O29A 3OYMA 5I2NB 2QQ9A 2OJED 3V7CA 4ZYDA 5A5XA 3ZP5A 3RSNA 1GVJA 1P4XA 4BQQA 5CYVA 3FBIB 4XLNF 2Z23A 2QJEA 2W25A 4O6JA 2XVCA 4Z2YA 4M6YA 5F04A 3C2BA 1IMBA 1S9TA 2L7KA 2YJPA 1VSOA 4BGDA 4JQFA 3V7SA 5B7DA 4ELRA 3MMYB 5F0HA 1O3TA 2R7VA 1E3HA 3P9CA 3M1EA 3HO7A 1LDJA 4YKPA 4RGXA 1K4TA 4E4HA 1MNMC 2Z33A 3CSBA 5ITOA 1XSDA 2NAZA 1R1NA 2Q74A 4IO6A 3ERMA 3O9PA 5DYHA 3FZVA 4IOCF 1N25A 2LF8A 3CCQI 3IUOA 2VQLA 3C36A 4K3FA 1A36A 2RCBA 4P1LA 3DQVC 5LEKA 1RUNA 4LN5A 3MZHA 4ZE8A 4II3A 1XGMA 1A5JA 1BLFA 4NQWB 2CO5A 2DA4A 1GHCA 1R9LA 3BT9A 3OL3A 5DM7F 2DAOA 4MIJA 2IP2A 4ELPA 5E1XA 3KYLA 1S50A 2LAOA 2CZIA 3IC7A 3DELB 4EQ9A 1HQCA 2VKEA 4M3EA 3OS0A 3QUJA 1IGNA 5D4SA 4KCCA 2PMUA 3S9MC 2V1UA 2CEYA 4PFYA 2HKXA 4EJTA 3HUGB 5GTIC 3GTGJ 5A5LA 2ZO4A 4P9UA 3ROUA 5IZ3A 2QMWA 3PMWA 2D2WA 5JK4A 1LBWA 1TW2A 2VC0A 2LOOA 3GX4X 2Y7RA 2IVMA 2DWHA 1WVRA 3ZMTA 5L3BA 4TQUQ 3Q27A 1LBXA 3LUZA 4EDPA 3QQAA 3KCCA 2L4MA 2QM3A 1JP4A 3C34A 3KN7A 1V5EA 5FLVA 3EDPA 3FXUA 1SW1A 4UUSA 3I71A 4O3BA 5CPRB 4G8HA 4R72A 2XXKA 2MD5A 5H8FA 4YIFA 1WJBA 1T39A 3DM0A 4B48A 1MMDA 5EG0B 2CQ7A 4HLYA 3HHFA 4N07A 2R6GE 2KR0A 5FHOA 3I53A 4NQ8A 1LKXA 1F4KA 2Q0OA 1YI2I 1Y1WJ 1IIWA 3KIOA 3UIFA 1K4SA 4F39A 2V84A 1IN7A 1I3AA 2VBXA 4EV0A 3DLLF 3GMEA 1PB9A 2RKMA 2ZYMA 1LAFE 3CMAI 5CQEA 4QBAA 5JTYB 4YMAA 4X48A 3ECRA 5D6EA 3CMYA 2EH3A 2V79A 2XD3A 4N13A 1FMWA 3WU2C 1FPLA 4BXFA 3SZPA 1OMPA 4JVCA 3R26A 5DYMA 4P1EA 4MCOA 3W15C 3A29A 3PSIA 3RI4A 3S1MJ 3G73A 4KFCA 4WXHA 2F6PA 2H9BA 1B3LA 3PU5A 2GA2A 2JJKA 4BBRJ 4RAGA 3BZ6A 5IP6A 1ETXA 4GXOA 3BIHA 5F64A 2PEXA 2WAEA 1MXXA 1SD6A 3H06B 4OTEA 1WPKA 4BNCA 2EFWA 1URGA 3W2WA 4QPOA 2YPNA 3FKIJ 1EYIA 4UABA 2GZWA 3VVDA 1NH8A 2XIGA 4F55A 4IHSA 3N05A 4XKCA 2IA2A 1FWZA 5M5WJ 2E60A 1B51A 5ITPA 1XVXA 2HPIA 1QZYA 4X6AJ 4ZEBA 4PBHA 4N4OB 1YRNB 3LAPA 2K02A 5F0FA 5F27A 1WKMA 4JWYA 1LVAA 2V9PA 4DOZA 4KNYA 4XQFA 3BKIB 1X58A 4R6YA 4LIVA 2Z22A 1NH7A 2RDPA 2R0QC 1FCKA 4UUTA 3TEPA 2NOGA 2PG4A 4ESJA 1FYLA 3CJQB 4DI3D 2M8GX 4ZYHA 4MEXF 2ZXHA 4BDNA 3RLFE 4GF8A 1VNDA 3QU6A 4YKJA 2V4CA 3TODA 3MWMA 1CF7B 4ENKA 3TTLA 2PJRA 3PD9A 2R4GA 2F2EA 1O7FA 2O51A 3V89B 2ZJRF 2DT7B 3TO7A 4L0YB 2YR2A 3C1DA 3FVNA 2RQQA 4A6EA 2EV6A 4IHVA 3K2AA 1QO0D 2EJRA 3C4MA 4A2UA 3NOHA 3ZSFA 4G68C 2NS8A 4XL9A 2HOAA 2VQCA 1WJ5A 5I7IA 4W97A 1UTBB 2A07F 1N75A 4IX7A 3GTMJ 3KC1A 1KGSA 2GXAA 1I27A 3TPAA 1X2MA 1MJAA 1TNTA 4DZPA 1M5DA 4H65A 3G6EI 5BPIA 2XAQA 2O9LA 1MDP1 4E70A 1VR5A 4OERA 3VODA 3KFWX 4UHTA 1NV5A 2F35A 1B3FA 5JI6A 1TBXA 2HXIA 2OF7A 2KIFA 1ZHFA 4M74A 2M30A 2VD2A 1NV1A 2FA7A 1G0HA 1OCOH 3H03A 2ZCWA 1EYJA 4ZECA 3FF5A 4DIGA 2XGCA 4M3GA 2VONA 4HE0A 2E2IJ 1MXZA 2F5DA 2WBBA 2O7UA 4A3KJ 2MA3A 1SFOJ 3RPQA 2PFZA 1MM6A 1X1CA 2DOAA 2KQZA 1B5IA 4A5NA 2BW3B 1B0HA 4GRKA 4JSOA 1VFDA 1QUIA 3RTRA 2DXIA 2G7UA 3C33A 1M5FA 3CDHA 4LFUA 1ERDA 3B50A 3MZYA 2NVXJ 5AA2D 1KYZA 3CF2A 3QXMA 4IRHA 2O84X 3SETA 2HKOA 1S7EA 2ID3A 1POY1 4DXCA 2L9NA 4WX9A 1OCTC 2NUVA 3F6OA 1J1NA 2R9JA 1MQDA 1QUJA 3KGCA 1ZG5A 4MLQA 4F22A 1YIOA 1R71A 3DEUA 2PT1A 1FBEA 1DSNA 3L2VA 1B46A 2PMZA 1FPJA 3OYGA 2QLZA 2EIMH 2DFIA 2OUMA 5JHUA 2LFBA 2ZSIB 5GAGJ 5I56A 2KP6A 1ZN2A 4HS7A 4I40A 4XFEA 2BV6A 3TO9A 1R5GA 1LEBA 2HHMA 1ZG1A 1U0JA 3BG6A 3OEKA 4A0YA 1IMCA 4XLHA 2DP8A 1AWBA 4QSDA 3L1PA 1D8JA 5I5PA 4BYYA 1SFXA 2DA6A 4OYVA 3S2VA 2QYOA 4U7BA 2OK2A 1FJ9A 4EEFG 3H6VA 1B59A 5KNLA 4EGYA 2KRHA 1SD5A 3K4NA 4XLAA 3EQLF 3S2DJ 2G93A 4XIGQ 1WI3A 2DO7A 4KDPA 1BIYA 3OD7A 4B47A 2K3PA 3CCUI 4N8YA 3TQWA 4OFLA 1RR8C 1LFIA 2Z8FA 1NK3P 1UJ8A 3RYRA 2UYFA 3H7MA 2ESNA 3M3FA 4G8NA 5L3GA 4U1ZA 3R0JA 3JZJA 1A6IA 2NVQJ 4A6DA 4AC0A 4Q4ZF 1G2HA 2EFQA 2F78A 4F31B 1I3QJ 1PJRA 1S5LC 3SFIA 3P7NA 1HW5A 4EF1A 3K69A 4R1HA 3KPHA 2X6XA 4ENNA 4WWCA 3F23A 1JEVA 4NAPA 1QGXA 1S7YA 3FV2A 3D1NI 2ZNTA 3QOEA 4CYDA 3MP6A 2JA6J 2F3BA 2MC4A 3L6HA 3F8FA 1X19A 2BHYA 1Q1KA 3BFUA 4RY1A 1ZELA 5IZ1A 3H92A 1MG1A 2PMZN 1X3ZB 2F5FA 4FX0A 2FSWA 3GZ5A 2M87A 1SVXB 3J80Z 1MBGA 2LKSA 2ZNUA 1IXCA 4OVPA 2M4GA 2XSJC 5K5QA 4N8GA 2ID6A 1T95A 4H5GA 2XROA 4EJWA 5E3MA 3KYCB 2RF1A 4HTGA 1NUZA 2WV1A 5B70A 1IRXA 1K83J 1MBKA 1YG2A 3N6TA 2G29A 2VIXA 2D5WA 5HS9A 4UV9A 3HPIA 3VVFA 1IN6A 3FXMA 3TEDA 4MLVA 3MKZA 1JHHA 1MJBA 2W24A 2ZMEA 3DP4A 1TWAJ 1Z7ME 4BE2A 2VJ5A 3NWSA 1T0FA 1I6QA 4HYEA 1IEJA 3ZQCA 3PUBA 2XF6A 2KLOA 4NHBA 4IB2A 3MZ1A 3O6HA 5CI5A 1W5TA 4GX4A 2WADA 2XXHA 1A6QA 2R7WA 1EF4A 3U8QA 3EUKL 3DCFA 3PM1A 3PL8A 4X1BA 3WAFA 1N3WA 3HV1A 2CW7A 1BW5A 3R7XA 1KA8A 5J3LA 5JVGF 2WYPA 2V93A 4AVPA 1CB6A 4RMNA 1B1HA 2JZYA 4HV6A 2QSXA 4OWDA 1HA8A 1LAGE 2ZFUA 1MQIA 3CQZJ 1KU2A 2N8GA 4IJAA 3UR3C 2VI6A 2ONSA 2RVCA 3MW0A 5DEXA 1YW8A 2O8XA 4HA8A 4HV5A 1FPDA 2TCTA 4RLQA 2ZJQF 1I1SA 4EXKA 1OJLA 5CM6A 1BC8C 2HI3A 1ELJA 3D4CA 1PB8A 1LVKA 3IOWA 4G61A 3ZMZA 4GWWA 4H67A 4PAKA 1MH4A 1U2WA 4GWXA 5B1AH 2R8TA 1XG1A 1Y8QB 1ZTRA 3FVGA 4PGPA 4PFUA 2HVRA 4LATA 1MSEC 3M9AA 3HOUJ 1FQAA 2FNCA 1X2NA 2AQEA 4D0PA 2VOPA 4LP2B 4QFNA 3IFCA 2HPMA 4E6KG 4C30A 1F43A 2FQ4A 3FM5A 1D0ZA 2XAJA 4DNCA 4DW6A 3EHTA 1EH7A 2CFXA 3QODA 3MVXA 3C3WA 2Y9YA 3DFGA 5AIPA 2XSDC 1I6HJ 4D5CA 1RDYA 2X7PA 5DM6F 2DWAA 1WJEA 1MY2A 3DPUA 4FATA 1ATGA 1KQ9A 1MW7A 1V5GA 4FISA 3CESA 1HOMA 1JW4A 3KYDB 5CLSA 3GZNB 1YAEA 3MC2A 3MVYA 4HXVA 4NG7A 1IF1A 3ABTA 2QKMB 1TQPA 1H0MA 4GFBA 5ICCA 1N3XA 3JAMZ 3F8BA 5BNGA 4YKKA 5IYCJ 1T8IA 1Y6IA 2R7QA 3ZQFA 1LDKB 4KJZA 4I0BA 2NRAC 1ETWA 3OS1A 5B66C 2J5PA 2V6EA 1NV6A 2X1EA 3ABMH 3J7ZI 1VQ8I 4PFPA 1B6HA 2H98A 4H45A 2O1MA 5I58B 4U0YA 2BE5F 2OPTA 2RNGA 4WK8F 3NRVA 3VXBA 2WV0A 4GYGA 3MVPA 1LBVA 3AG3H 1LE8A 1B7UA 5L3EA 4AB5A 1OKRA 5KCJB 5M3MJ 5H8QB 4NF4A 1TWGJ 1RKWA 3ELKA 5LGNA 4PBQA 1DU6A 2MG4A 2RCAA 2XXWA 2HCAA 5FRNA 3GXOA 1PP7U 1H45A 3G1MA 3P9KA 4Q8RA 1QHGA 3RJPA 2GFEA 3H6TA 1NG6A 3AL0B 2H8WA 1ZGAA 4IPAA 4BY7J 3OOUA 3ZQ7A 3MAMA 1ZYRF 5GAEJ 5IY5H 3G3HA 4MEVA 3ZKKA 2MSYA 1FSHA 3F9KA 3MUQA 4A3MJ 5A5XB 2M3AA 3DEEA 2XWOA 3K0LA 4KITB 3FJMA 3LSJA 1YS6A 1MXUA 3RZOJ 4LG3A 4GDFA 2Y48A 3UORA 3LQQA 1YLFA 3N6UA 3RPLA 2Y5KA 2EILH 3C18A 3W6VA 4YZZA 2LKXA 2VBZA 2PBWA 1G59A 2QQBA 1FLIA 2A6HF 3F6VA 4ZS9A 2XB5A 3CIJA 3R6SA 4GIZA 4GYIA 4AS4A 1D3KA 4PAIA 1H89C 4GOTA 5E3OA 1GR2A 2JTVA 4CA0A 2LD5A 1HSJA 1Q1VA 3QP5A 1Z7LA 1HW1A 1X1DA 2YUSA 5TRDA 1P4WA 4NEDA 5EQ9A 1QRYA 2THIA 2DVZA 1IXSB 2LY2A 3H5RA 5D5VB 1R6RA 2M0MA 1J09A 5HDKA 2F6CA 5FLMJ 3CCRI 2A5TA 3L09A 2NXOA 2DQLA 2M45A 4OA4A 2GBYA 4AYBA 4M9XA 1FPGA 3G1OA 4KT5C 3MD2A 2ISZA 1OIBA 1JUPA 3IJOB 5AONA 4HSTA 2VODA 1FBGA 5L9SA 3HRTA 2FBIA 4RS8A 3W2VA 2PJPA 1LGBC 1XS5A 5IZ3B 3SKPA 4KIFA 1U5TC 3I5UA 2HZKA 4LZ7A 2DMPA 4E0XA 1HC8A 2E7XA 4CYCA 4B3AA 3LSKA 1S72I 4GWUA 4PFIA 4YIRX 4XRSG 3NWTA 3WU1B 2QL3A 3HRSA 4P56A 5K5OA 1FP2A 2CFOA 1IMAA 4EF2A 1J7KA 2FXAA 2ELHA 3A2KA 3LOCA 3ZN1A 4XKPA 2WC2A 3KP3A 5DTDA 4B43A 2FBPA 2K4JA 3EQ1A 4FEDA 2MKZA 3CR9A 2KHMA 3H9QA 4UUSB 4FX4A 2Q2AA 2PT2A 3B7DA 4XKVA 1P1QA 1WI9A 5H6RA 2Q89A 1YHQI 3FV1A 4PFWA 5ICFA 5H8FB 5KAIC 2Q8MA 3D5SC 4U88A 2HYGD 1APLC 1IRZA 1BN5A 1RNLA 5IOZA 1LLSA 2B3BA 2E0SA 3KFMA 3L2RA 1OLAA 5KCMA 1NNPA 2BBYA 1P1OA 3QPTA 2BY0A 2ONRA 2LK2A 2GOMA 2L02A 2YPRA 1NNFA 5CVUA 4FCYA 3A01A 1I1GA 5K2XA 4P3LA 4L9JA 3KP4A 1M5BA 2DYXA 2DA2A 4RJZA 4I9DA 1FBCA 1KQ0A 1XDSA 2IGNA 3DEWA 1P1NA 4AYBN 5JHFA 5A2QZ 3IL1B 4HG2A 2KZVA 2Y9ZA 3LSFB 1I69A 3MYUA 2ECCA 3MJNA 1S7OA 1LFPA 3BR6A 2DT6A 3GYHX 2V7FA 2HEOA 3VWBA 2HAUA 2EB7A 3TDUC 3O2PE 3K10A 4ZJZA 2YS9A 3CTAA 3SFZA 3BTLA 1S9HA 1QZZA 4J01A 3TW7A 4C9YA 4OXVA 2A5WA 2HXWA 2HU9A 5FJ8J 4RA1A 2E19A 2LP0A 2V1DA 2EZIA 1IXIA 1J59A 4BACA 5AIQA 4ZYGA 4X04A 5L9MA 2ZZVA 1R4NB 1LBYA 1RYOA 2IA4A 1SAXA 4OMZA 3HOTA 4P0GA 4F19A 4N4NB 4M9ZA 1IQ7A 5IOYA 2M0CA 2HNHA 1HKSA 3DBRB 1JE8A 2L9VA 4U2RA 4C1UA 5J16A 2PVUA 4BQOA 1ZG3A 2W7NA 2P6SA 2FIXA 2WKYA 3L9FA 2X9DA 4RGRA 4HNVA 3L2CA 2BJJX 2COMA 2NS0A 3TOBA 2I10A 3K01A 2I5UA 3ZQHA 1EYKA 2M7BA 5F7VA 2LREA 3NQOA 1UMQA 3V8KA 3Q29A 3RGYA 5LRRA 2CV0A 5K7FA 3OSFA 4BHPA 2OWZA 5M2VA 3WAEA 2PJRB 4IQ4A 1MDQA 2I58A 1NUWA 1TQMA 3TMGA 2KRFA 4P96A 3E6BA 4BLAA 3OYBA 1PP8F 3B8BA 1DPRA 2WB1N 2R7UA 4ZYAA 2FA5A 5IT9Z 3VSLA 3VLUA 3Q9VA 4POXA 2GAUA 4A3DJ 2FBKA 2QS1A 3ODBA 5LHIA 1H9TA 4LQ2A 3DU6A 3ZGKA 1G6NA 4DI4B 3CMEI 1ETYA 1X3UA 1SBPA 3KG2A 3FX3A 4ZEIA 4BY1J 3PFYA 4GL0A 1U8RA 5TU0A 1JNFA 3JRAA 1IN5A 2XXTA 1J0RA 4ZDLA 5EEGA 3FIWA 2GRVA 3EETA 3C35A 4I1DA 4MMPA 4CSWA 3K4CA 1FTOA 1FPFA 4HE1A 1OCRH 2Y31A 2DA5A 4X1EA 3H9JA 4XSZF 3K70C 2KIUA 2STWA 3FASA 3IAZA 4WKMA 3TDJA 2DBBA 3U94A 1WVJA 2W48A 3HHGA 3PV0E 2OA4A 4IVNA 3GW2A 3S93A 1UIUA 4AIDA 2ZJ2A 4BS9A 3IKTA 4C2TA 3M8FA 2TRTA 2Y5LA 1JKRC 4LUBA 5AA1A 5D6FA 4V2FA 1MH3A 1ZKBA 3S8PA 4YIIA 3SHFA 4V19K 3G3JA 4YFXF 5F1JA 1MJ9A 2L5QA 3EPEA 1IJWC 5DCMA 2JT1A 4LONB 1T08B 1ZRFA 3OIPA 2PMHA 1WJDA 4EM2A 4L17A 3C9HA 4OQOA 4HDUA 1W5CC 1IXRC 2XAHA 3RQTA 4NNJA 5ED4A 3A0HC 1BOBA 3CC4I 3O8HA 3S3MA 1Z91A 2OQRA 2LLKA 3K2ZA 1VQ4I 3QMFA 1TWFJ 5I56B 5FGMA 1SMYF 2EINH 4PE3A 3KEIA 3TQLA 5LHHA 1YJ9I 3IK6B 1Y1ZA 1D1BA 2F5CA 4G9YA 3JSPA 3FMRA 3J80K 4XRFA 1AH5A 4EVIA 1IUFA 1OR7C 1TP4A 4NUBA 2QWWA 4UVAA 1DCUA 4EQQA 3S17J 3OO9A 4AIKA 4IY6A 9ANTA 1XI6A 4CUGA 4E7JA 1WSUA 4G8MA 1JUMA 1IW7F 4JOMA 1R1UA 3F8NA 5J1UA 4BH9A 2RC9A 5EYFA 3PFIA 4GWOA 1D0XA 4IGTA 1XVYA 4A12A 2H4IA 4HE2A 4GRIA 3WGIA 3FXOA 3S4UA 4BDZA 2BY1A 3GTQJ 1DDNA 1VQ6I 2H1LA 4XN3A 4IY5A 2XASA 1SI0A 5HS8A 3KN3A 1Z21A 3AG4H 4NDLA 2ZSHB 2ZYOA 4NTLA 5ISUA 2AHQA 1W0UA 3MVWA 1ZH5A 5KZTA 2OZ6A 2M8CA 3RTFB 4BE0A 1BR4A 2OC6A 2QS2A 3AKZA 3QYEA 4H1XA 5E3NA 1NUXA 1USTA 3TCHA 5K5RA 5J47A 3GLBA 2O7IA 2DJNA 4XEQA 5J1DA 1F36A 1ZRDA 1W36C 1WRJA 4YU0A 4N0BA 3PMXA 4MX6A 2DFEA 3ZMSA 5JLWA 1USYH 1XGNA 2LC2A 2MLGA 2ONKE 1R5ID 3OO8A 5AA2B 2W1OA 4R74A 3BOQA 4ESXA 3ZRGA 3T66A 3OENA 1LB8A 2HTJA 1XMXA 2R7DA 2CQNA 4LK1F 5J40A 2IS6A 1MPDA 3QUFA 2H94A 4ISUA 2HOEA 3WU0A 5HOOA 4BXUA 2DW4A 4LIUA 2YLNA 2FU4A 1D5YA 4KT6A 3CUOA 1A35A 2DFHA 3KLNA 2KT0A 3SXYA 4QLCU 3OO7A 1IRGA 1A8FA 1US5A 2DA3A 1MS7A 3C7JA 2A6TA 2ZMEB 2CZHA 1YOVB 2WA0A 2JSPA 2VN2A 5L3DA 2E1CA 4Q30B 4HNTA 2IT0A 3K4MA 4I3EA 4JX5A 4LZ8A 2Z2SB 4PGGA 3RPWA 4G7HF 2NWJA 2X6YA 3VFZA 3B73A 4E7HA 4ZZAA 4ON0A 3MSTA 5EQAA 3VYTB 3JAMK 3LA7A 3H0DA 4U4SA 4HEA2 2Y0SA 4RK2A 5DT6A 3BFTA 1EV7A 1N84A 2HZTA 1BKAA 4GX6A 1BC7C 2QCOA 4HAMA 4CO8A 1B32A 1E2XA 3AG1H 3CCYA 3DKXA 3SYTA 5JVTA 4TV7A 3HOWJ 4XN0A 3S1QJ 3BLYA 4IF4A 3ASNH 2BXYA 4G12A 3WHBA 5M3FJ 5FLXZ 1TXFA 2QPQA 5FD5A 4B3XA 3J81Z 5LD2C 2P0SA 1SW4A 4U87A 1KU7A 1YITI 5I2KA 4QFOA 2NXNB 1HKQA 2KL4A 2YX7A 1JVXA 2QVVA 2CG4A 4LVQA 4XOPA 3KSJA 3F11A 1RC9A 2CGPA 4R75A 3H9GA 3HM5A 4UVBA 1MD0A 4PZJA 2CW0F 4KMFA 3C31A 2DMQA 2JA5J 3U93A 2A3SA 3M7GA 2B3FA 1B58A 3BR1A 1BBYA 4EM1A 4O7IA 3GFMA 4MBPA 3E7LA 4PFOA 3AXFA 1FQBA 5K7ZA 1RYXA 2B4LA 3V42A 3GCMA 4DE8A 1SVOA 1KZHA 4YFKF 4RYAA 3PPNA 3OR2C 3Q9SA 2W00A 1FBHA 3K6UA 2NS7A 1E0EA 2CUZA 2JRTA 3K9TA 4OAYA 1FQDA 2Q8KA 4BUPA 3IRQA 2OWSA 1P1UA 4CCMA 1OLCA 4UNOA 2XPUA 2E1NA 2Y0SN 1B2HA 1GXQA 1IG7A 2COBA 5HDGA 2DPDA 4N91A 1LE8B 3SEVA 3A3UA 4KD5A 2XD2A 2XAFA 2E36A 1Z67A 1MM7A 2DQRA 3SDGA 3WTTC 5CMCA 3RKWA 2XGDA 3TBIA 5M5XJ 4NF4B 2LVSA 3KP5A 3OIQA 3S3NA 2F7CA 2QZ8A 1X3WB 4AIHA 4Y7NJ 1OVBA 2GWRA 1JW1A 4DCYA 1LUJB 4HX8A 5M5YJ 2QSGX 1JJ8C 2VPLA 4IKFA 5LGUA 2Y7WA 3M3KA 5EGOA 3BCBA 2IGKA 5EHMA 4R73A 4LG0A 4ZDMA 2I4CA 4KQPA 4E7SA 3TL4X 4DCXA 2JWTA 1VQ7I 2BXZA 3PUZE 3SEYA 1B3GA 2V4JC 3TW6A 2RGVA 2KRCA 4MHGA 4I6ZA 1JKQC 4G6DA 2I8DA 3WGGA 5BPDA 2W84A 2IS1A 3B6CA 3HRUA 3ZMDA 1BTJA 1MY1A 2FYIA 4JWOA 3RPLB 3V7RA 4H4KC 4A5MA 1PEBA 4GFRA 1P92A 1W7PA 3KC0A 4C3HJ 4YB7A 1ZGWA 2IAIA 4G6QA 1D1CA 1Z3YA 2FF4A 4OIPF 2QVUA 1FC3A 3B02A 1YO5C 4IHTA 2ZXTA 3K7AJ 1MQJA 2DXYA 3OIOA 2HQNA 3WODF 2CMOA 4MEYF 1I6XA 2GXGA 1D0YA 4PJ0C 1GT0C 3PIOF 3AL0C 2XXRA 3KJTA 3FXJA 3M4OJ 4IHWA 4R79A 2EV5A 1B40A 2A5TB 3LC8A 1EKEA 1JKPC 1I50J 4GGGA 2LR8A 4QSHA 1A40A 2UVHA 2HDCA 3BROA 3CF5F 1FQFA 1EH3A 3BC8A 1H44A 3GEZA 2HOSA 1Y4TA 4A3FJ 2AL5A 2QRYA 4Y15A 3S15J 1G3WA 3GTOJ 4O94A 1RZ4A 1XCBA 5ERIA 3B6WA 3VYUB 3T8RA 4ZTFA 3FBPA 2ESHA 4F18A 5BUUA 4RDUA 5K7HA 2IRFG 4PJLA 1S8NA 2R3SA 1YFHA 3TCFA 1GV8A 2IS2A 1MMGA 4CYCB 2O5RA 2JA2A 5B3SH 1U9NA 4RM2A 2WBMA 4ZDPA 3FMQA 4CCKA 4HQEA 2VASA 2VPOA 3BQYA 4BDYA 2R5ZA 5HS7A 1HBXG 2K9LA 3ZMVA 2XHDA 1H76A 2CUJA 4E7LA 3DU5A 2O8KA 3K4BA 3CMMA 3R4KA 3RCOA 4XK4A 4OEUA 3ECOA 2ZXIA 2UUZA 3HXLA 3L2QA 1HSLA 4YEJA 3MKLA 2H25A 4M4GA 4OIOF 4BL0B 3E13X 3MWBA 2F4IA 2KJBA 4XTCQ 1FYMA 5E18F 4MQVA 1OFCX 3ROJA 3FHNA 1FX7A 5HLIA 4OU0A 1S7AA 1Y56A 2ETHA 2CU7A 3A01B 3THIA 4S05A 3EHUA 5GP9A 4ZDOA 1MDMA 3HN0A 4U0VA 1OYYA 1KU3A 1IZ1A 5FKNA 1IDYA 2HFHA 2VXZA 4A69C 4XRSA 1W0TA 5CVVA 3CUQC 1UHWA 3MKYB 3BTJA 3KZYA 4MHFA 3TELA 3RDIA 1XPXA 3G3KA 3LQRA 3VOEA 1FOYA 1SDXA 2WX9A 2XGXA 3I58A 1UHMA 2UV1A 4M3FA 4G94A 5HVQC 2ZYKA 4P9KA 3D5RC 3M8EA 3ZKLA 1Y1MA 4GXSB 1FSEA 2K7LA 2BVMA 3OSQA 4GBWA 4QSCA 4ZZLA 4NF5A 3IB2A 1Q9DA 4ONYA 5IT9K 4IO2A 3FXQA 3D1RA 1Y0UA 1EZPA 4L0ZB 2OTJI 3RTWB 4XR6A 3OYCA 5C4JJ 4CGZA 1DMBA 1OMIA 1OQHA 2JK3A 2EIJH 3H3GA 2XHKA 3GYYA 2DT5A 3EYIA 1US4A 3LSXA 5EQ7A 3L00A 5CMKA 1MBEA 2BYVE 1MMAA 1P2FA 4UV8A 1FBUA 3DXJF 4IZZA 1Y3PA 3FJGA 3ECHA 4IXAA 5GAHJ 2HQAA 3WTZA 1AHDP 1YJWI 4G6TB 2QUFA 2UXAA 5F1QA 4S0HB 2PLYA 1GV5A 4IL6C 2JSCA 3ZOBA 3WTVC 4N15A 4A3JJ 4NE4A 4BDRA 5D5XB 4Q48A 3OY9A 2GA1A 5AA4A 1SW2A 4F3BA 2WBDA 2P5LC 1A8EA 1NKXA 1L0OC 1WWXA 3OELA 1IAWA 4FECA 2DMNA 2GIVA 2VJ4A 1O7LA 5EHSA 4BDMA 3JV9A 3ZXSA 2WAQA 1J2XA 5E3LA 4HNUA 2L7MP 2EZLA 4A93J 1LCFA 2AO9A 3LSWA 3BR5A 1N7XA 4IGRA 1U8BA 1JQFA 5FKLA 3TGNA 1FOKA 3MZBA 2L9RA 5H8SA 1TNSA 3S9NC 4P1WA 4DYRA 4KN4X 3HBLA 2KQRA 5E8GA 4EJVA 1G0IA 4O3CA 1XTAA 2ELJA 1DGRM 1R1VA 2B63J 4GO1A 1I6AA 3PPQA 4H46A 5DVFA 3TP0A 5HNFA 2L7FP 2RN7A 2Y7KA 1PBQA 1B52A 3QOPA 1ZK8A 2IXSA 2DDKA 3G2BA 2K85A 4QFKA 3HDDA 2LSOA 2KDZA 2Z16A 3HGYA 4QRZA 1MY4A 4HPQA 1RI7A 3X2QH 2DA1A 2LY9A 4PDKA 1T98A 1U78A 2X0LA 5HLTA 1V55H 1XCVA 1DPPA 2F7AA 3L2UA 1LEAA 3WHCA 4U7DA 5ET6A 4BKXA 1FPIA 1ZR4A 1LFUP 3K0VA 1FBDA 4WEDA 3PPPA 1YCJA 3TUSA 2X6OA 3LFKA 4FE7A 4CZZA 4PSWA 4UA8A 3RUMA 4Y4RA 4AD9A 2KIQA 1BJAA 4QHQA 1U5TA 2OAZA 3I59A 3DPTA 4I01A 1IRFA 3T8TA 3JRCA 5DUIA 2O6AA 3CCEI 4XF5A 1L3LA 1H8AC 2K86A 2OZZA 5IM2A 1J75A 3W2AA 4JWXA 2WY7Q 2XAGA 2NVUB 2P1SA 1LFHA 5F0CA 3TKDA 2WAQN 4LJZF 4FASD 1IV6A 2MABA 3CLQA 4IQJA 4U22A 2DMTA 2QEXI 2R7ZJ 1AU7A 1EU8A 3IOVA 5LOMA 2RQPA 1IUDA 5ICTA 3FMSA 4NGUA 1Y3NA 2QA4I 5HLHA 2VT2A 2MFZA 3LSGA 2VL8A 1DK4A 1YTVA 1VQNI 4FORA 4F92B 1QVSA 4LLLA 1NNKA 3HGGA 4PTKA 2YU3A 3FIRA 4BQAA 5FKOA 3W9WA 1BI2A 4HF0A 1ZAOA 3OS2A 3TKYA 2M5WA 2EFNA 3I9V2 4I7HA 5ICGA 2HYFA 3J7YJ 2QBYA 1PVEA 3OO6A 3TTKA 1MNDA 5L3CA 2E7WA 1VQ9I 4AB6A 5F6FA 1H88C 4ENMA 2M8EA 4OOIA 2ZMBA 2LH9A 2CZLA 2C6YA 1OQYA 4FETA 3FATA 1OISA 3A0BC 5F1RA 1BL0A 2DK8A 4NB5A 1ITYA 3Q0UA 1IMFA 3N5LA 2E1MB 3FM3A 4O8MA 3M8JA 1UAAA 3HCQA 2XC7A 1TFAA 3SEWA 4P9FA 2L9SA 4L5IA 4GXAA 1ZLQA 4KYSA 1MPBA 5H8HB 2DTRA 1FTTA 5CVRA 5FTIA 1B7ZA 3JCUC 3G3IA 4IHYA 3IAM2 2KMUA 4ZZDA 2DE4A 3SZTA 4XOTA 3CVGA 1V54H 5FFXA 2OX3A 2HFBA 3IAS2 1MMNA 3MBPA 4M6XA 2R5YA 3QIMA 4D7MA 4E7ZA 2MH9A 2VB6A 1SYIA 1OPCA 2X51A 4RA2A 1QU3A 1YZ0A 2CJJA 1P6RA 1NV3A 3SQNA 1OVTA 1QW0A 5DEXB 4DZJA 3AG2H 3BQZA 2BEOA 4XKQA 2NVYJ 2HDDA 5LEJA 3KZIC 2OLBA 2FMLA 4EJUA 2X1DA 1T38A 2L5VA 4F2OA 5H8NA 3HEFA 4OANA 2MBFA 4HX7A 1X4PA 4XSXF 2ZNZA 3KEYA 2DI3A 2I49A 4UVCA 5H20A 5GPCA 3R6UA 1AOYA 5DV5A 2E2HJ 2Q8JA 5HPQA 1DGWY 3GF2A 1NV2A 2XXYA 4HCYA 5FHNA 5E1ZB 2RC8A 3M3YJ 2L4AA 1TFDA 3FVOA 1DBZA 3LR1A 4C2MJ 2DJIA 4KI0E 3K6XA 3V8LA 4NF8A 3F8MA 4CHUA 1EZ9A 2F36A 1FW0A 2K27A 2M2EA 3D5LA 5HNHA 4KHZE 4DBRA 4FQGA 5E20A 4WF2A 3VEPA 1QULA 1Z1DA 5ILSA 3KOTA 4DXBA 5J8FA 1I39A 4F3SA 3SEXA 1U3EM 1ANFA 3O6GA 3TYHA 2JJ7A 4PDDA 1OLTA 2OJTA 1D9VA 1Z05A 2E1OA 3OV8A 3SEQA 4B1RA 4RB0A 4QIWN 3WGHA 4CCLA 3KP2A 3WG7H 3SDBA 1KYWA 4LD5A 4MAGA 2D45A 2XWVA 2Q2EA 5FROA 4CCNA 4F3QA 2OD5A 1B7HA 3UKGA 2VOZA 3K4KA 3DLNA 4RM3A 2QGUA 1QKAA 1M1EB 2AIXA 2ZMEC 3COAC 2DOJA 2Q88A 2M4KA 2CQQA 1V3FA 1T0FC 2HPGA 3HSTA 3SJMA 1DQUA 5I2KB 4XNFA 2B65A 4Y3OA 2X6WA 1QPIA 3UGWA 1P7IA 3JR9A 4RPOA 1VDWA 2R7XA 4RXLA 1T2KA 2V25A 3O8GA 3PGFA 1FSAA 3ZN0A 4OETA 5IKBA 2EQRA 2HZDA 2Z8EA 1FBSA 4N9IA 1KQ8A 1VI0A 3KP7A 3VE1B 4OVSA 2FX0A 3S14J 2NYXA 3F21A 1CE2A 2VC1A 5K2YA 4M73A 2QSHX 4HBLA 4XLCA 2EA4A 4YKIA 4C0RA 3OOPA 3E6CC 2LKPA 1K9ZA 1MRPA 4ABZA 1AKHA 3VYSB 1DPEA 5DVJA 2FUG2 2W4SA 3E5UA 5H2FC 1XMKA 1SD3A 3V5AA 3GTKJ 3V8XB 3JRGA 1B3EA 1A04A 2O03A 5ILUA 1RUOA 1FPKA 3FKJA 1LBCA 5ET5A 1B0LA 2O0YA 2HXOA 3LSTA 4I99C 3BJOA 1NUYA 4NC8A 2VJIA 2P3VA 3K4LA 1Q35A 3M3LA 3QYTA 5L8DA 4A3GJ 1Z7NE 1B1BA 2MYSA 4G7OF 1A55A 2H99A 1EH6A 2XRLA 2KKOA 2F7BA 2IEKA 2Z3YA 5LGTA 1FBPA 3FK7A 5JFRA 2JVGA 2Q1ZB 3UA8A 1ZGJA 2L3DA 2H5YA 2VPNA 3VYRB 1EJ9A 2GM4A 3OWTA 5EGOB 3CCLI 1K6OA 2PI0A 2R92J 4A0XA 2K3FA 4M1VA 5GADJ 2AYSA 4N6PA 4LG0B 3N94A 5KVRA 1D1AA 1LFGA 2V3TA 1NG7A 3HSRA 3KZGA 2LDUA 2GHAA 3FK6A 1LDDA 2X48A 3QPSA 2X26A 5D5WB 1OYWA 5EJCA 4L18B 4MIMA 1A7LA 4FIMA 4MF3A 4NN3A 4YICA 4MJOA 2VJJA 1ZLKA 3CD6I 3EUHC 4PSXA 5DEQA 1MBFA 5TGTA 3GZGA 1W7PB 3JRFA 3O66A 1WH7A 2QFLA 4KISA 2W82A 1O64A 2GOXB 3VLWA 2EFOA 5ESYA 2DK5A 4YB5A 4OMBA 3T93B 3RKQA 1Z6TA 1R58A 1FP1D 4N4UA 4XBFA 4J00A 1IITA 1PDNC 5F24A 4HW8A 2A69F 4RK9A 2G7HA 4DXUA 1STZA 4ESBA 2CMPA 2L7ZA 3CG1A 5C44J 4GLIA 3VLVA 2CUEA 2MD0A 4P55A 1O7TA 1JETA 4MFEA 1SD4A 1ON2A 5IYBJ 3NAUA 1JI8A 5LLQA 2VQHA 5DW8A 1ODDA 3DTIA 2VBYA 1FRPA 4ZC3A 4KR5A 2FNPA 1FPQA 3KEOA 3CJTB 2GLOA 4C2UA 1IDZA 4NWDA 4P8BA 3RYDA 1O3SA 3C2GA 2V3UA 4I02A 5DD8A 3VV5A 4M3DA 3T9XB 4KN7X 4WXDA 1YYVA 5CJ9A 4PGNA 2LY1A 3MPKA 4G2ZA 1GUUA 2XX7A 4PP0A 1RKTA 2R5ZB 4GBVA 2ICWG 5CQGA 3Q26A 4LA9A 5D4RA 3K1MA 1NK2P 1B1XA 3BDDA 4I98B 3S9LC 2BGCA 4MTEA 1FZPB 1K79A 4MO7A 1IMEA 1UTHA 2QS3A 5CMMA 2E5NA 1QJMA 2HS5A 4E7IA 2AXTC 2KFDA 3IB1A 2R7TA 3ZCOA 3QWLA 1ULYA 5J4VA 1BR2A 1XB4A 2BJIA 3Q3SA 4R6HA 1OCCH 3U72A 5DD4A 1TWHJ 1JW5A 1IMDA 5GTHC 2VP1A 1ZBMA 2JPCA 2XPVA 1XOCA 3OSGA 4GQOA 3IORA 1X1BA 1B9NA 4I3YA 3HFUA 1R4MB 2DOFA 2VT3A 5DS9A 1B05A 2OQGA 1W1WE 4RAYA 3C2HA 4KIBA 1Z9CA 2BVLA 2HQ5A 3CG3A 4P11A 3H0GJ 4PFRA 4GWYA 4KIGA 2P5KA 3GTPJ 3JSOA 4PJNA 1USYE 1ZLJA 4IO5A 4LITA 3T5XA 3OMYA 1YW7A 3MVZA 5TPAA 2IA1A 5HODA 2UVJA 3KBZA 4QPQA 4O3MA 4NC7A 5KDTA 2ZKZA 4EUOA 1LBZA 4NF5B 4ZYEA 3CFLA 3RT6B 2QQ8A 2VPRA 3KOSA 3QP6A 1NI9A 2GH9A 3JTHA 4R9GA 1YX3A 3ML6A 4A0ZA 1U6GA 2BHZA 1SFEA 3F3XA 2QENA 3A1YA 4NHJA 4DIQA 3S3OA 2ZNYA 2A5YB 1U9OA 2L2OA 2CW8A 3G7WA 3P9IA 2ZZXA 3L6GA 4KPTA 2JN6A 3HPGA 3HTUA 3IWZA 1Y3QA 1ZJLA 3IB0A 3JYRA 2WAFA 3REOA 4AIJA 2UWMA 2K9QA 3IOUA 3BCAA 3K1PA 4DJAA 1QKBA 4NF6A 5I59B 1T33A 4BE1A 4GX3A 4XKBA 5LRSA 3KP6A 1SFUA 1BIAA 3KJ7A 2KPMA 2WWYA 1HW2A 1BA5A 1ON1A 2Z1DA 3GBGA 4THIA 1GVDA 3KSXA 2PQ8A 3MZ9A 4I2OA 4QXDA 3T9HB 5AA4B 3IOTA 3LFUA 4JYKA 2H27A 1AL3A 2FOKA 2BZTA 3KEQA 2M1BA 1SYHA 3T22A 4JBZA 1XGSA 4BDOA 1VFCA 2IPQX 3EN3A 1NFTA 3S9EA 2Y30A 2D21A 2F48A 2ZC2A 2I0CA 4E0WA 2EFPA 2MC3A 4XXUA 3LSHA 2P81A 1SAUA 3RKYA 3RT8A 4XM3A 3QRFF 5I58A 1IV8A 5EQ8A 1W4MA 3GLXA 2R7OA 1FOWA 3QAXA 1UFMA 3FUZA 2OBGA 2F4OB 1MZBA 4XMYA 3S1NJ 3BJAA 5L9OA 3DV8A 4CH7A 4G7ZF 1R9QA 1XSVA 4X9TA 1X1AA 2ADUA 1POTA 3GLLA 3E97A 3OYNA 3A3CA 5L3FA 5KK1A 5BWJA 2DXRA 4RGUA 5I59A 2E5ZA 2DOEA 2DA7A 2VGQA 2YX4A 3H5AA 2OWTA 3S2HJ 3A09A 3O97A 3QSLA 5FKKA 4B8XA 2I48A 2MH2A 3MCZA 2H8RA 3K1NA 1M5CA 3BG3A 3G71I 1KONA 1YIJI 4ETSA 1K6YA 4CCOA 3IR1A 4NBQA 1DTZA 1JVYA 3H6WA 2QQAA 2LBFA 3A02A 2G9WA 4O5VA 1HDDC 2XB0X 2HOTA 2ME0A 3DBLB 2XX8A 3BPXA 4G68A 4N81A 4BBSJ 4RB1A 5CRYA 4F91B 1CGPA 3LAJA 2P5VA 3VXCA 3NARA 3QPLA 3FWEA 2EZHA 1BK4A 4TLMB 3TTRA 4KA4A 4ZTJA 2XXPA 3BY6A 3VDXA 1IN4A 3SESA 4U0WA 2A05A 3HOSA 2CUFA 2EIKH 1D9YA 2CQXA 3PNTA 4BHBA 4Q5SF 1FTAA 1U5TB 3I59B 1GVCA 3VSKA 4PK4A 4A3IJ 4GL8A 4R6KA 2X1CA 3EHSA 3G3GA 2MGQA 2F4MB 5ET8A 3VPRA 3ABUA 1V5FA 1BM9A 3HYIA 4RLFA 3JREA 2Y7PA 3CFXA 1G3SA 3GFJA 4FJPA 4FBPA 3E5QA 1B72A 4H6DA 4OFJA 3V83A 1FTLA 2XXQA 1WJCA 3DKYA 5H8HA 5EZHA 3GTJJ 2M34A 1G3YA 2D1HA 1O3RA 3GTLJ 4A3CJ 3Q5FA 3OYDA 3B6TA 1FTZA 5FHMA 3FBNB 3CCVI 2KJCA 2E1SA 4JP0A 4BJ6C 3CJNA 3N97A 1VE4A 4IO3A 2DMUA 2D1VA 4I0AA 4XLFA 2Y75A 1II5A 1PBPA 4GD5A 4K2EA 5DTBA 1W7PD 1B8IA 3BZKA 1P4AA 2K9SA 1HXDA 1PC3A 4YB6A 1PB7A 2L54A 4RB2C 3CRBA 3I54A 4PC9A 4PDHA 5E8IA 3H6UA 1NH3A 2QBYB 3S16J 3O6IA 4H8JA 4IO4A 2WY8Q 5KHDA 5IZZA 2OCCH 2HYJA 2DFFA 4M9SA 4XKNA 2DE3A 4Y13A 3CUQA 5I57A 5T3JA 1BW6A 3BWGA 5C3EJ 2CV2A 1RPWA 4H0EA 1B5HA 4ELOA 3H3VK 1K78A 2FHYA 2ZXJA 2XAUA 1ZREA 1S6LA 3MZ8A 1B4HA 3HOVJ 2PMSA 3I5OA 4X1DA 3IV5A 4D9JA 1UG0A 4A3EJ 3GO5A 3WTSC 1ACIA 3D4GA 3ERED 1YYZA 1VF9A 5I3SA 2FBHA 2Z5UA 2IEEA 3H3UA 3T0YA 3SEUA 3BTIA 5AE4A 4DZ1A 2EPFA 3M07A 4CXFA 4RB3C 1N76A 2EWNA 4RAFA 3I56I 1WZ2A 1FPEA 2UXXA 2ZZWA 4OWRB 2DWJA 2A68F 2R5YB 1XD7A 4XRMA 3JRIA 2HAVA 2XXIA 1IN8A 4U1OA 4EATA 1LQ1A 4B4CA 2F3DA 1YX5A 3HJEA 1QVTA 2V6CA 3C32A 1X1PA 4PFBA 1J5YA 1P7JA 4HDVA 2E1MC 3GZ6A 2E35A 5H8NB 2OV7A 5J4YA 4RAZA 4Q5TA 4ECFA 3DP6A 3ZS6A 4KFQA 5IPAA 5B5EC 1MQHA 3IH2A 4CDGA 3CDLA 1FIPA 3GVAA 4HX4A 3BBRA 3K02A 4I62A 3U1OA 3TFLA 4GCVA 4B09A 1WH5A 2DPUA 3RZDJ 2PX1A 2JA7J 3O28A 2QSFX 3IH4A 1HKTA 4ESFA 4YG2F 3QYBA 2GIZA 1QHHD 4I8CA 4D1QA 1JHFA 3ZPLA 5KAFC 3CZ6A 4TOZA 1QNTA 1S3JA 4NF8B 2PBIA 3EKIA 4G8XA 3ABKH 2VHAA 2FNAA 3BZCA 5B1BH 4XLPF 1RRJA 2HQ0A 5I84A 1GXPA 2VKVA 3WE3A 4IOAF 1RDXA 4L5JA 4YMBA 2CSOA 2P7VB 3CCMI 4Q0CA 5FTHA 3GUDA 3UP9A 1FY7A 2AQFA 2MLKA 3OYJA 2IJLA 1WCMJ 3FXKA 2FD5A 3OR1C 4FHTA 3PQJA 2HVSA 5A2QK 2FIEA 3G1LA 2Q2EB 2IGMA 4H0WA 2RV8A 1GDTA 5CMBA 4KICA 3GFIA 1Z0XA 4DBQA 2XRNA 3I6VA 2JPBA 1S29A 1C0WA 1TT0A 2HEUA 3G3ZA 3KETA 3PPRA 1W5SA 3MQ9A 3OEMA 2ISYA 3W6JB 1PUFA 2F6GA 3J7AY 2REJA 3HC7A 3CC7I 1Y9UA 1N78A 1WJFA 1FMVA 3I3LA 1GGGA 4BDQA 2K9MA 2P3NA 1O57A 4PFTA 2DVCA 5E1WA 1YJNI 4ITVA 3EUAA 2F97A 4AUXA 1VQOI 1Y39A 1Z77A 2HGCA 3V8JA 3TTNA 3O3KA 5LBQA 1EH8A 3J7AO 4V2GA 4JX4A 3ZMUA 2CH0A 2A6EF 1LAHE 1VQ5I 2PFYA 3PD8A 4ZEKA 1AIVA 3K4JA 5HDNA 2Y84A 1H3DA 3SERA 4BXXJ 3Q0VA 5CBRA 2FRHA 1AKHB 3G3FA 4RBOA 1UIVA 2RNJA 3A4CA 1B6AA 1B9MA 5IT3A 1LBBA 2RC7A 1FOXA 1YS7A 4Y33A 2XXVA 4Z6YA 3WG9A 1AA7A 2F5XA 4DQ2A 1B5JA 2I4BA 3CFZA 2PYYA 2WTEA 2ZXWH 3EPZA 3M8UA 3MAJA 3LSMA 3E3KA 3IX1A 4F3GA 4YRVA 3CSGA 2A5SA 1R22A 3E5XA 2OCUA 1V4RA 3HSFA 4N6KA 3CO6C 5HM4B 4U21A 1XHYA 1PUEE 3LUYA 2OZUA 1HF0A 4BJTA 3PO2J 3K00A 4OHNA 2HDWA 2OCEA 1ENHA 3U21A 3WTYC 5J1RA 2H1KA 4IHXA 1NV4A 3OXNA 4DLDA 4UUVA 1KA1A 4M71A 1FIAA 1RR7A 1YTYA 4I09A 1R6ZA 4KXPA 4N17A 4J19A 5BQTA 3T9UA 3T9VA 3N26A 1TLHB 2EBIA 4JX6A 1GTKA 1FNNA 1MBJA 5EYHA 4UACA 1DTGA 2J5OA 2K40A 1XSXA 4LQ5A 3F72A 3BJ6A 4PJMA 4M6VA 4PCQA 1FPBA 4R2FA 2ANJA 4NWCA 1D5VA 3KLOA 1USSA 3ASOH 1E3PA 2RINA 2CRGA 3MKWB 2VLAA 3HSEA 4HSRA 3ZQGA 2LTPA 3T96B 3ZQLA 5EZGA 5ICEA 1REPC 1HLVA 1IUYA 3O6BB 1J9IA 3B6QA 3WTWC 2DODA 1ETVA 1UCRA 1BIBA 2B7EA 3K6GA 2EK5A 4UXNA 2I3WA 2XGEA 3U1KA 2BY3A 3UN6A 2QVOA 4JSDA 3E79A 3CCSI 5IAIA 1TZLA 3TCGA 3HPHA 3TO6A 1MIJA 2F8DA 3E6DA 3HG9A 4R9FA 1MSFC 5TP9A 1SEUA 2CEXA 3LMMA 3OYKA 2F34A 2IGOA 2WEFA 3VFJA 3PIPF 4F2QA 3BIGA 4F1UA 3RYPA 1R49A 4PCDA 1ETQA 2I3VA 1MBHA 3DTEA 1SPIA 4PF6A 3HZJA 3H1CA 1R9TJ 1EZOA 3LV0A 4BEHA 2P7CB 2OTLI 5DVIA 1MGTA 3TP3A 4L5EA 4ESWA 1CNQA 5CVIA 3SDFA 2I6EA 3L7WA 1HSEA 2DWIA 1VQLI 3IH3A 3U9GA 4F3PA 2W85A 3LSRA 3OYEA 2WYKA 3LWFA 1MPCA 2XA5A 1SANA 1E17A 3ULQB 3O2AA 5I2NA 3DKWA 3HB9A 1UB9A 3H3ZA 4FTHA 1D3YA 3OYFA 1SC7A 1O4XA 1FBFA 1KWHA 2D3IA 4QFPA 5AA2A 2HR3A 5J8CA 1DOTA 3TZAA 2FOWA 4ASNA 4F93B 4MTDA 4ZZEA 1SVLA 4LB6B 3SEZA 5EEAA 1D4NA 1UTHB 5LDZA 5BS6A 2IS4A 1BI0A 1O63A 4IO7A 3MP8A 3CO7C 2L01A 1PYVA 4HZFA 3W3CA 4H5FA 3HTSB 2DDBA 2KISA 4D7NA 1URSA 2HXRA 4NX1A 5E79C 3Q25A 1I6BA 3KBRA 1VQMI 3H35A 4WCGA 2E71A 4Y17A 4HF1A 5D8KB 3I3VA 1FTKA 2JUCA 5FFZA 2I0BA 3VVEA 2O3FA 2X4HA 3E1SA 3TDZC 3V4GA 1IO2A 1MMSA 1FQCA 2V1NA 4C1TA 4EQ7A 4LLNA 1JJ6C 4UB6C 1XN7A 5DCMB 3LBSA 4IEJA 1NTCA 2R7FA 2XDVA 1JT6A 2W7YA 4JXIA 1O3QA 1M5EA 4NQWA 4ZEDA 1FBQA 4MLOA 4OIRF 2VBWA 5EDNA 1QVUA 2LYCA 5EYGA 1UHSA 3QPHA 4PJJA 1RKMA 1QGPA 4KCDA 3E78A 2X7QA 2VE8A 3RNNA 3HUGA 2V3QA 3FXBA 4R2BA 2PFBA 3JTGA 5TPAB 3RY3A 2R93J 2O1LA 4TLLB 1LNWA 5KDTB 2G0EA 2QKLB 5IYDJ 3GBAA 4CCJA 2ZJPF 1VFEA 3I4MJ 4MGRA 3U2RA 2OBPA 5EEHA 4X0GA 3PJRA 1B3HA 2QS4A 3JRHA 4LGWA 3WTUC 5K1YA 3LNQA 4ELQA 4XLEA 4CICA 1WJAA 3CP2A 3BTCA 2K9NA 2ZB9A 2ECBA 5LHGA 4BJ5C 2JRMA 3E0JB 5CKTA 3KZZA 2PCRA 2ABHA 2EV0A 3H4ZA 3PMVA 5IGAA 3B6AA 1R7JA 2BOLA 1HSTA 1K7AA 4NF6B 2DCEA 4L9TA 3PTYA 1QBJA 2JUGA 1ZARA 3IKVA 4ZH4F 5EG0A 4GWZA 1I5ZA 4AQ4A 4BHCA 3FXLA 1MXWA 1Z3XA 5H6QA 2EA2A 3K70D 3CP8A 3OMBA 3HOZJ 5ILVA 3IWFA 2XV4S 2O7OA 3CJRB 3OYHA 4OIQF 4UY8I 4KYWA 5JTYA 1VQPI 2Y0MA 1HDPA 2YSRA 4QFLA 3MN2A 1DU0A 4POWA 4KUMA 5AA3A 3KE2A 1R23A 3HL2A 2H6BA 2HQRA 4OAZA 3I4NJ 4X8RA 2B9SA 4BQNA 3QYFA 2V9KA 3FJ7A 5DDGA 3I55I 4GWSA 3TQNA 3U92A 1PDAA 3QAHA 4OVJA 4NC6A 1KU9A 3DPLC 5FLXK 1YPNA 5EYRA 1EA3A 2OU2A 3J81K 3FGSA 2RAEA 2KDOA 2XF7A 1Q1HA 3EUHA 3NEUA 1QA6A 4O3AA 3FVKA 1XT8A 4JK1X 3IO4A 2Z99A 3D0SA 1RIOH 3KN8A 3TTMA 3AAFA 4HW0A 4XIDA 1G3TA 2DLLA 2HVQA 2VQGA 4AM3A 1MY0A 1BP5A 3BP8A 1Y20A 1YXIA 5IP9J 2R7RA 2UVGA 1QZEA 4Z0IA 3ILUB 3IP4B 2XPWA 3R60A 3RKXA 4IO9F 4EGZA 1JUSA 3PUWE 1IXGA 4F1YA 1G4DA 2LBFB 2VD3A 5LTCA 4G77A 3LSPA 2K5CA 1YRNA 5JR3A 2NVTJ 2X85A 1QQIA 2ZYNA 3IHUA 3LSIA 3JW4A 5J6XA 4G68B 4MNPA 2XXUA 4WXJA 1ZKGA 2P0WA 4XKRA 4L9VA 1LEVA 2L0KA 2XKOA 2ZFWA 1LFBA 1OCZH 4QWQA 1F1ZA 5FO5A 3PNVA 4AVZA 5LFAA 3JRDA 4HRIA 1A54A 3EF7A 1Y4CA 3QK6A 1T56A 4M72A 2O69A 3RQIA 2R71A 1XC5A 1X4OA 4AU7A 1FEXA 4HLXA 4BAYA 3JRBA 3HRMA 3CC2I 3GXAA 3FD3A 1BI1A 4ANJA 1JKOC 1ZU0A 2VKHA 4YELA 4B44A 1HCRA 3RIRA 1SQYA 4UB8C 4EXLA 1TQIA 2LMDA 4EM0B 1CF7A 4U4XA 1IXHA 3SZGA 3A03A 4FE4A 4YFNF 1B72B 2ME6A 3WE2A 5BMZA 3BPVA 1ZRCA 1OCPA 1N7WA 1N04A 3ISPA 5TJJA 3WTXC 1XGOA 3IRRA 3R0AA 6PAXA 2O61A 1XMAA 1FJ6A 3IFAA 4FE8A 2FJ1A 4P0IA 2VUMJ 3HIFA 4IR8A 4F29A 3UNGC 1MNEA 5BOXA 1LJ9A 1ZR2A 4DGWB 1UG2A 1UTBA
chains in the Genus database with same CATH topology
1Z6RA 1OYIA 2A61A 2AXLA 4OVTA 2CWEA 2DU9A 4R8HA 5CVJA 3IL2A 3T0JA 4PGHA 1XDUA 1T6SA 1ONVA 1TW3A 3W6KB 2TDXA 2XKPA 5FD6A 3U65A 1QPMA 4MQ9F 3CUQB 1K78B 1D8KA 4P5OA 2VT5A 2XUBA 3F8CA 2XWKA 4N9HA 3E3VA 1OR7A 2FMYA 3I4PA 4RGSA 2NNNA 2B4MA 1R5HA 1Z7UA 3N4MA 1F5TA 4L9NA 1LB2A 4S04A 3E6MA 4HOBA 1FT9A 1DUXC 2HTSA 3LA3A 1YW9A 4KMUX 1VTNC 4NF0A 3FXRA 4WXCA 2ACJA 3EYYA 4IRIA 4OMYA 1KZ8A 1R1TA 4Q47A 3GFLA 1NV0A 1TTYA 4AWXB 1H9GA 5ET7A 5DCFA 2XWIA 2UXNA 2VOOA 3I0TA 4JVDA 2H09A 3W9VA 2Q9TA 4O7MA 2GQ1A 3S2WA 1KA0A 4OVRA 2O6GE 2AS5F 3MEXA 2CZKA 4N6DA 3CHGA 4PAFA 2CYYA 1FYKA 3RPUA 4PF8A 2UZKA 3QU3A 4MNUA 1BI3A 3CLOA 3U1DA 4IRGA 2DE2A 1SD7A 2RC4A 3DF8A 1MKMA 2ZBKA 2NNYA 1JGSA 1WQ2A 1NHAA 2Z9OA 4HF2A 4F1VA 4EJOA 1NV7A 5D8LB 5DUKA 2FEZA 3FHZA 4PETA 5FB2A 1BOAA 2P4WA 2FVZA 1YQAA 4LB5A 1MDMB 2VE9A 3PQKA 2P6TA 2GQQA 3MFKA 4EMSA 4LK0F 4JVIA 3TOAA 1B4AA 2KIMA 3VB2A 4HCWA 2LF7A 2RKHA 2V9VA 5D5UB 4HQMA 3T1BA 1SMTA 3MQ0A 1R36A 1INPA 2LNBA 2B0LA 2STTA 3DP7A 2IA0A 2W57A 2HWVA 4ENJA 2QVRA 2P8TA 1DP7P 2FE3A 2FQ3A 4FT8A 3GWZA 2GXBA 5HLGA 3LA2A 4JBAA 4OVQA 3I64A 3R61A 5E17F 1D9QA 4AS5A 1AWCA 1F9NA 2V1XA 1RDZA 2PN6A 1DPUA 1R00A 3HHHA 4LMYA 1JXSA 4P47A 2H6CA 2CQKA 4OINF 2K4BA 2F5EA 3F22A 2HZLA 2IW5A 4MNCA 1K9YA 4F7ZA 4LLGF 2QQ9A 4ZYDA 3V7CA 3ZP5A 1GVJA 1P4XA 5CYVA 4XLNF 2W25A 4O6JA 2XVCA 4Z2YA 4M6YA 1IMBA 4JQFA 3V7SA 1O3TA 3P9CA 3M1EA 1LDJA 4RGXA 2Z33A 1XSDA 2NAZA 2Q74A 3FZVA 2LF8A 4P1LA 3DQVC 5LEKA 1RUNA 4LN5A 3MZHA 1XGMA 2CO5A 1GHCA 4MIJA 2DAOA 2IP2A 5E1XA 2CZIA 3IC7A 1HQCA 5D4SA 2PMUA 2V1UA 2CEYA 2HKXA 4EJTA 5A5LA 2ZO4A 4P9UA 3ROUA 5IZ3A 2D2WA 5JK4A 1LBWA 1TW2A 2VC0A 3GX4X 2IVMA 3ZMTA 5L3BA 1LBXA 3LUZA 3KCCA 2L4MA 2QM3A 1JP4A 3EDPA 3FXUA 3I71A 2XXKA 2MD5A 4YIFA 1T39A 4HLYA 2KR0A 3I53A 4NQ8A 1F4KA 2Q0OA 1IN7A 2VBXA 4EV0A 4QBAA 5D6EA 2V79A 1FPLA 3SZPA 4JVCA 5DYMA 4P1EA 4MCOA 3A29A 3RI4A 3G73A 4KFCA 4WXHA 2GA2A 2JJKA 3BZ6A 4GXOA 3BIHA 5F64A 2PEXA 1SD6A 4BNCA 2EFWA 1EYIA 4UABA 2GZWA 2XIGA 4IHSA 2IA2A 1FWZA 1QZYA 4PBHA 3LAPA 2K02A 1WKMA 1LVAA 4KNYA 2RDPA 2PG4A 4ESJA 1FYLA 4DI3D 4ZYHA 4MEXF 3QU6A 2V4CA 3MWMA