3T1BA

Crystal structure of the full-length aphb n100e variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSELTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
total genus 84
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t1bA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t1bA02
1A04A 4MGRA 4IPAA 1JE8A 3KP4A 1YQAA 1LEAA 2DK8A 4RGUA 1KU7A 3SZTA 5JVTA 3EYYA 1U78A 2QUFA 2JSCA 2VODA 3CO7C 5CVUA 4EGYA 1FBSA 3KETA 4ZYEA 1ZRCA 4HX4A 4N9IA 1KYZA 1TQIA 1Z6RA 3BY6A 3KP6A 3RI4A 3EETA 4G8XA 3V7RA 2KIUA 4DQ2A 5AIQA 1B9NA 1HW5A 4A0XA 2Q0OA 3P7NA 2A68F 2E7XA 4FT8A 5H6RA 5E8IA 2UXXA 5BPDA 1HW1A 2P5VA 4NB5A 2QQ9A 2FMLA 4AIHA 1YW7A 3HTSB 5H20A 1B4AA 1KQ9A 2XVCA 4G94A 3TDUC 5HOOA 3WGIA 2GXBA 2WV0A 1UHWA 4IRGA 3KLOA 3IRQA 5D6FA 2IT0A 2HEOA 3GLXA 2LKPA 1C0WA 4P9UA 4PZJA 5E1WA 2FMYA 3ELKA 1BI0A 5DUIA 5CJ9A 2GAUA 1S29A 1ONVA 1QZYA 4CO8A 1FC3A 3CO6C 2P6TA 1T98A 2MH9A 1ZLKA 1HKSA 5LGTA 5E1ZB 3FMQA 4LG0B 1O57A 1J0RA 2HGCA 1YLFA 1FYMA 3MCZA 5K5RA 3I5UA 2P5KA 5EEGA 5BMZA 1PP8F 2YX7A 4BHBA 3FF5A 5E17F 3J81Z 1O3TA 2XASA 2K02A 1QO0D 1S7OA 3CUOA 1KYWA 3O6BB 3N4MA 2RN7A 2VC1A 1WQ2A 2EFQA 2M87A 5E1XA 3O3KA 2JPBA 3EYIA 1Z91A 4KICA 3I0TA 4I02A 2H09A 2X4HA 2MLGA 2HR3A 3E5QA 3D0SA 6PAXA 2O61A 4M6XA 2KKOA 5F6FA 4A5MA 2MH2A 3VOEA 1XMAA 5L3CA 3D5LA 2G9WA 4RAZA 3E6BA 2QBYA 5J8FA 2NNNA 2NRAC 4HW0A 1W5TA 1XB4A 1HW2A 2F5CA 2XAFA 3WGHA 1ULYA 1USSA 2HKXA 5AONA 2ELHA 2LF8A 1JHHA 2VOOA 4P9FA 2EFWA 3GEZA 5LHHA 3HYIA 4MQ9F 1T39A 4GCVA 2PBIA 3EQLF 5BQTA 1R5GA 2OZUA 4IJAA 4PDKA 3LFKA 2BEOA 5BOXA 5D5UB 4U0VA 3RJPA 1PP7U 2O03A 1Y0UA 1HSJA 3L00A 2P8TA 2STTA 1G3YA 5ERIA 2HS5A 2HZTA 4R8HA 1XN7A 2EV6A 1K7AA 1LQ1A 2EB7A 2BV6A 2FNAA 3MFKA 1DPUA 3WTZA 1FNNA 4WCGA 1W7PB 2M30A 4YIIA 1FP2A 5DCFA 3I53A 2HQRA 4YFKF 2XAJA 1TBXA 2QVOA 2OA4A 4K2EA 2STWA 3T8RA 1AOYA 2MA3A 3W6KB 4YIFA 5DV5A 3E6DA 2P5LC 2HKOA 2OZ6A 2L3DA 2X0LA 3IKTA 4B8XA 2QQAA 1I1GA 1TQMA 3ECOA 5JHUA 4XLPF 2IVMA 1U5TB 4MEYF 2DLLA 2A69F 1IZ1A 2L4MA 3VFZA 2PN6A 3SXYA 2O3FA 1IN7A 3HRTA 4Y17A 5E20A 1U5TA 2JT1A 3B73A 3BJ6A 3CTAA 4Y15A 5LBQA 2DAOA 1EH8A 1R1UA 1ZARA 4D0PA 3CUQB 4R79A 1XGOA 3ZMSA 2DFIA 3GFIA 4BYYA 3M8EA 3R4KA 4IHTA 4ENKA 1P4WA 2L02A 3LAJA 4HLYA 2O6GE 4A0YA 2H27A 2A6EF 3GXOA 2PG4A 1RI7A 1BM9A 5DCMB 3GW2A 5AIPA 4LK1F 1JXSA 1U8RA 2FBKA 2G7HA 2KJBA 3DFGA 4GO1A 2F5EA 3WG9A 2MD5A 2P7VB 2G7UA 2TDXA 4U7BA 1U2WA 2W57A 1H9TA 4EMSA 1RUOA 3JAMZ 3F23A 4IHSA 4ON0A 2D2WA 1FOKA 3JSOA 4CZZA 3TO9A 2GZWA 3F8CA 2RQPA 3S2WA 3HHGA 2M1BA 1SD4A 2XAQA 1D8JA 2V1UA 1RUNA 5ICFA 1BJAA 1MJAA 3IC7A 2XKOA 3FXRA 3F8BA 4RB2C 3BDDA 3RIRA 3QPTA 1KU3A 1MJBA 3K2ZA 4KIBA 2A6HF 2UZKA 2QBYB 3JTHA 1O3RA 2VONA 2JZYA 1E2XA 1G3SA 1MJ9A 4HLXA 2ZO4A 5FD5A 1TNSA 2EFOA 4Y13A 2FBIA 4PCQA 1I1SA 5LHGA 1BIAA 2A5YB 2LNBA 1I5ZA 4EM1A 3ZMZA 5CVRA 1WI9A 1EH6A 5HLHA 2XIGA 1TQPA 2R7FA 2PMUA 4I01A 2YX4A 4EJVA 4FX4A 1ZHFA 3ZMVA 4RGRA 3DP7A 1SFUA 5L3FA 1LEBA 3SHFA 3MWMA 4BHPA 2FBHA 2FNPA 1XDUA 4KA4A 1UCRA 3J7AO 1T6SA 4AIKA 4KDPA 3E3VA 4KN4X 4LD5A 4HAMA 4KFCA 3HIFA 3M1EA 1XGSA 2A61A 2CQKA 3DXJF 3MAJA 2W85A 2Y0MA 4I0BA 4LB6B 5DD8A 1IUYA 2EA2A 4EGZA 1TNTA 4RB3C 1QZZA 3CUQC 4G7ZF 5CLSA 3R0JA 4G9YA 5KVRA 3P9IA 2ZXJA 4JK1X 4G7HF 1Q1HA 4MQVA 3WE2A 4ASNA 2ZMEB 2VE8A 1BBYA 3F3XA 4M73A 3KLNA 3H3ZA 3WTYC 1T38A 5ILSA 5ED4A 2UXNA 3I59B 3WTUC 1LDKB 3E6CC 3PFIA 1DP7P 4JBAA 3F8MA 1IN5A 2M5WA 4L9VA 4RB1A 3OV8A 3GYHX 4FX0A 1LB2A 3M9AA 2L01A 2D45A 2NNYA 3LSTA 4I09A 1PUEE 5IT3A 3N97A 4A6EA 2ISZA 2DPUA 2CW0F 2W25A 3K0LA 2PQ8A 2IA0A 3GF2A 1USTA 4RB0A 3BP8A 1J2XA 3R60A 4M9XA 4ZH4F 4F7ZA 2K4BA 5FO5A 2W84A 3WTTC 2EFNA 2EJRA 1TLHB 1B9MA 3JSPA 2DTRA 4JVDA 3QP6A 4YG2F 1Z6TA 1XD7A 5K1YA 4WWCA 2E7WA 3NRVA 5FGMA 1G3TA 4OMYA 3IRRA 3HRSA 2IP2A 4A12A 4OIOF 5HDGA 1GHCA 3F6VA 1R36A 1QBJA 3LA7A 2KIFA 1P2FA 3ABTA 2GXGA 4OMZA 1Z7UA 1P4AA 4M71A 5IT9Z 4EM2A 3K1MA 5LGUA 4LG0A 4MTDA 2BBYA 4BHCA 1CF7A 4N9HA 3HHHA 2EFPA 4HA8A 2QLZA 3V7SA 4QWQA 2RV8A 1G4DA 3K69A 5EEHA 1FP1D 4LFUA 3MEXA 3R6SA 1R1VA 4EJUA 1W7PA 4U7DA 1K78B 2KRFA 2PI0A 3ZN1A 2O0YA 4WF2A 2ZKZA 3T5XA 3P9KA 3ERED 2OQGA 1FSHA 2VOPA 1EH7A 5J8CA 2ACJA 1MDMB 4XLNF 4KIGA 1DDNA 2E1NA 5HS8A 4BXUA 3FHZA 2EWNA 1IN6A 2LDUA 4KUMA 2Z9OA 2V79A 2YU3A 2J5PA 2O8XA 1FLIA 2OQRA 1SMYF 4WXDA 2DW4A 4BH9A 2R3SA 4HV5A 3ZN0A 3EUHA 4E70A 3Q5FA 5BPIA 2CFXA 2XROA 3Q9VA 3V8JA 1YO5C 2B0LA 4M9ZA 4UNOA 3GVAA 1SD5A 2CSOA 1SD6A 2VXZA 2WTEA 2DBBA 1YTYA 1OR7A 1X3UA 2YSRA 4L5IA 2BYVE 5K5QA 2QYOA 5TJJA 4M72A 4S05A 1IRFA 4LLNA 1R22A 2VT3A 3QP5A 4BQAA 2HYFA 4L0YB 2DPDA 3ZPLA 3LA3A 1CF7B 1YYVA 2V6CA 3T0YA 5D5XB 5L3BA 3QRFF 4OIPF 1ON1A 4AWXB 4A0ZA 3QU3A 2XHKA 3WGGA 3DQVC 3TKYA 1R5HA 3IL2A 5JI6A 2OD5A 4KN7X 2HFHA 1IF1A 1VTNC 5ICCA 3P9CA 2ZFWA 5E8GA 2VBZA 2XAHA 1REPC 1FBQA 4RGXA 3F72A 3BJAA 1ZRFA 4UXNA 3ZMDA 1YW8A 1HXDA 3L2CA 4EJTA 1V4RA 4A6DA 3C7JA 5JR3A 5LRSA 1J7KA 3U2RA 2FA5A 3I64A 4CGZA 2JTVA 4BAYA 3SQNA 5LLQA 4OIQF 5ILVA 1TW3A 3LQRA 4EJWA 2H6BA 2E1CA 1YS7A 3F22A 4CHUA 3K9TA 3VEPA 2NAZA 2LF7A 4KNYA 4XSXF 3FXUA 2RDPA 3WTVC 1STZA 5HLGA 2IA2A 3FX3A 4RGSA 1MD0A 2OBPA 2ZNYA 5HVQC 3QPHA 3J80K 1KU2A 3C18A 3TGNA 4WX9A 1R7JA 4KYWA 3ZMTA 3E5UA 1KGSA 2EA4A 2K27A 4UV8A 5D6EA 4ENMA 4HF2A 2XGXA 1L3LA 3DKWA 3HRUA 1OKRA 3R0AA 3K1NA 1UFMA 3MZYA 1ZYRF 2JRTA 2KIMA 2ZNZA 2VC0A 2RC4A 4U0YA 3TDZC 2YR2A 4A2UA 1OYWA 4IF4A 3GO5A 1DPRA 1FT9A 1S7AA 4UVBA 4HDUA 1R00A 4I7HA 2V1XA 2QM3A 2Z33A 1I27A 2V9VA 2XRNA 4GYGA 4LLLA 1SMTA 4KMFA 3GZ6A 1LNWA 3PQKA 4ESFA 3I4PA 4WXHA 5HDNA 2HXRA 3FM5A 3JAMK 1UHMA 1XMKA 2MC3A 1BOAA 2EK5A 4B09A 3GX4X 1W7PD 2QWWA 1BI1A 2Z5UA 2VT2A 3I58A 1K79A 4H0EA 4L18B 4DNCA 5ICEA 3HSRA 2DK5A 3B02A 1OYIA 2BE5F 4P5OA 3L09A 1BN5A 1KU9A 1B59A 2K86A 4MEXF 1XSDA 4HQEA 1L0OC 2W24A 5TRDA 4JVIA 2EV5A 1OPCA 4HQMA 5L3DA 4U88A 4G6DA 2FOKA 3IHUA 3I59A 1OYYA 5L3GA 2QENA 1F5TA 1BI3A 2D1VA 3OOPA 1FX7A 1IN8A 2FRHA 4HV6A 5IT9K 2A07F 1TW2A 3V8KA 1HKQA 1LJ9A 3BROA 3KP5A 3WE3A 4P96A 4HF0A 3LQQA 2OU2A 5DCMA 1J75A 3TOAA 1YIOA 4RS8A 4JQFA 2GA1A 2RVCA 3G73A 3K1PA 3M7GA 2UWMA 1WSUA 4LMYA 1ZRDA 1B6AA 1SFXA 5DD4A 1O7FA 2IPQX 4IRIA 3JTGA 3KE2A 5J6XA 3COAC 3RTRA 4CDGA 1FY7A 1MZBA 3HFUA 1ZLJA 2DI3A 3KFWX 2PJPA 2PLYA 4XBFA 1XCBA 3BZ6A 3BPXA 3V4GA 4KMUX 4UVCA 3V7CA 3F8FA 2HTJA 1WWXA 2BGCA 4U0WA 4ESJA 5A2QK 4HYEA 2WC2A 3RYRA 1G3WA 3ZQ7A 2XKPA 2EV0A 3E97A 4LJZF 1J9IA 1FPQA 2ZCWA 3RPQA 3H92A 5LGNA 4AVPA 1HKTA 1JHFA 2IRFG 2FU4A 3F8NA 5FLXK 1NHAA 1ZREA 2ESHA 4HBLA 2Y75A 3FZVA 3FWEA 1RNLA 4HDVA 4YFNF 1SD7A 3KCCA 3BWGA 2CO5A 4Q47A 3LWFA 3F21A 4HOBA 3ZP5A 3KP7A 3NEUA 2K4JA 4N0BA 1IW7F 3KEOA 4Q48A 2QQBA 4ZZDA 2FE3A 4IVNA 3BOQA 1XSVA 1ZGJA 4MNUA 3MZHA 2ZMEA 3QAHA 3WU0A 1ZGAA 1G6NA 4GGGA 2HYGD 4AD9A 4L5JA 2L4AA 2K7LA 3J80Z 5D8LB 3ULQB 3FM3A 1K78A 3QOPA 1JGSA 4CICA 3KZZA 3J81K 5F1RA 5DDGA 2ZBKA 5BS6A 3U1DA 3ZMUA 2A3SA 3HOTA 1FBUA 1D8KA 1V3FA 4JVCA 4TV7A 5D8KB 4QBAA 1KQ8A 3KEQA 2LSOA 3I54A 3CJNA 2F5DA 4ENNA 1KQ0A 3GZ5A 1BIBA 3GWZA 4ZYHA 4EV0A 2FF4A 2DQRA 3TOBA 2VBWA 5JFRA 3TQNA 2CYYA 2P6SA 4O5VA 3KZYA 4OOIA 1YW9A 2P7CB 1XGMA 1U6GA 2IA1A 1P4XA 5HLIA 3T8TA 3HTUA 3C3WA 3MQ0A 2GIVA 1KA8A 2V1DA 1QQIA 4GYIA 1RZ4A 4WK8F 5A2QZ 1XCVA 3HSEA 2VN2A 3SFZA 3WTXC 1ZH5A 1S6LA 3RKXA 2VBXA 4NQWA 2WWYA 3ISPA 5L3EA 2GWRA 1E17A 5D5VB 1O3SA 2YPRA 3JW4A 2J5OA 5DYMA 4QLCU 1YG2A 1MKMA 4PGGA 4ZYDA 4EQQA 1D3YA 2MLKA 3T1BA 5D4RA 2OAZA 2PMHA 5HS7A 2RKHA 1UB9A 5K5OA 2RGVA 4ETSA 1FYLA 4LGWA 4HF1A 1SFEA 2IJLA 1W4MA 1IAWA 5H6QA 3HSFA 1BC8C 5CVIA 2GA2A 1SAXA 3FMSA 2FXAA 5CVVA 4BNCA 3Q9SA 2F5FA 1RIOH 1YS6A 4ZYGA 4MHGA 2IW5A 3C1DA 3RDIA 3PQJA 3ROUA 2M45A 4G6QA 3KP3A 1IN4A 4MTEA 1FWZA 4IRHA 1F9NA 4M74A 2CG4A 3BJOA 3CUQA 2HDCA 1U3EM 1J5YA 2FQ3A 2XUBA 4OIRF 1F1ZA 5HS9A 5E18F 1MGTA 5KK1A 2DU9A 5LHIA 4P55A 1S3JA 2XV4S 5CYVA 5FLXZ 2ZJ2A 3M8FA 1WRJA 3DPTA 1W5SA 1O3QA 3FXQA 1D5VA 3KP2A 4L0ZB 4XRFA 4I0AA 3DEUA 1IRGA 5FFZA 1Z9CA 1MDMA 1R23A 4ESBA 3R61A 2F2EA 3WODF 4I2OA 2C6YA 2Y48A 2L54A 1P6RA 1R1TA 3HRMA 5LEKA 1Z1DA 3AAFA 4L9TA 3GFMA 2DT5A 3CDHA 3WTWC 2FSWA 4R1HA 1F4KA 4ZZLA 3GUDA 4HX8A 3W6JB 2CGPA 4IXAA 1ZG1A 1P92A 1EV7A 3O2PE 4ENJA 1TTYA 3E6MA 1AWCA 4S04A 4UV9A 1FYKA 1ZG3A 3WTSC 1HSTA 1XGNA 4O3MA 3LA2A 5ILUA 3GFLA 1I6XA 1IXRC 1XDSA 3V8LA 4PGHA 2HWVA 4CXFA 3HUGA 1T0FA 3DF8A 4GXOA 2H94A 2DQLA 4HX7A 3VB2A 3WU1B 1GXQA 2VBYA 1IXSB 4HZFA 1XSXA 1GVJA 1IXCA 3RYPA 3G3ZA 3TO6A 4FHTA 1OMIA 5FFXA 4WXCA 4OU0A 1YFHA 1CGPA 3L9FA 3VODA 4NHJA 3ECHA 3RPUA 1QGPA 2Q2EA 2MBFA 1LDJA 2GQQA 5LEJA 3BPVA 2QZ8A 4LLGF 2RNJA 4A5NA 1J59A 1LVAA 1O7LA 3IKVA 1H9GA 3U9GA 2Q8KA 4EVIA 3TO7A 2P4WA 1Z05A 4L9JA 5FB2A 3IWZA 2R7DA 5HDKA 3RKYA 4G7OF 3ABUA 5CVJA 2XAGA 2PFBA 2Z3YA 2DO7A 2ETHA 2ISYA 1BI2A 2HQNA 1H0MA 3L7WA 1FSEA 4M6YA 2HTSA 4O6JA 4RAYA 1K6OA 1DUXC 2D1HA 4Q5SF 3HOSA 1QNTA 2AS5F 1T2KA 2COMA 2NYXA 4UUVA 1ZAOA 4EJOA 4YFXF 4KT5C 2M8EA 5LRRA 5DEQA 4LB5A 5DUKA 1ZN2A 2FEZA 1HQCA 1U5TC 4KIFA 3DV8A 3REOA 3H3UA 5D4SA 2NS0A 2Z99A 3GFJA 4EM0B 3F6OA 3NQOA 2ADUA 4UVAA 1S8NA 2PEXA 1BC7C 1WKMA 2CWEA 3RKWA 5ICGA 5D5WB 3CLOA 2HOEA 3IWFA 1ZG5A 4L9NA 4Q4ZF 1QPMA 3QU6A 3EDPA 3FMRA 2KJCA 2VE9A 1PDNC 2AXLA 5FD6A 3ML6A 4LK0F 1B1BA 4UHTA 1GXPA 2JPCA 4OINF 1LDDA 4AIJA 5F64A 3LAPA 2ESNA 1R58A 1HBXG 3I71A 2H6CA 4XSZF 3SZPA 4CYDA 1ODDA 4Z2YA 4M9SA 3DPLC 1ON2A 4I98B 1FZPB 3E5XA
chains in the Genus database with same CATH superfamily
2LYCA 3A3CA 4MNIA 1A04A 4MGRA 4E0WA 4IPAA 1JE8A 2WYKA 4GL8A 3KP4A 1N3XA 1YQAA 1LEAA 2DK8A 1KZHA 4RGUA 2QSFX 2ELKA 4LONB 1KU7A 2OK2A 1WJ5A 2V25A 3SZTA 1Q35A 5I57B 5JVTA 5EQ8A 3EYYA 1U78A 2IS4A 3ONMA 2W48A 1PDAA 3FV1A 2QUFA 2JSCA 2VODA 2BXZA 3PNYA 3CO7C 2I6EA 1RPWA 4CSWA 4IEJA 4MIMA 3CCLI 3G7WA 4QHQA 2NOGA 5CVUA 4QPOA 4EGYA 1FBSA 3GCMA 3J7YJ 2N8GA 3KETA 4FTHA 2R93J 1QHHD 1MDQA 3PNTA 4ZYEA 3SEVA 1SBPA 1ZRCA 2W7YA 4HX4A 4N9IA 1KYZA 1H43A 1TQIA 2QMWA 1Z6RA 3Q3SA 1R4MB 4KYEA 3BY6A 3PJRA 4AQ4A 3KP6A 2I49A 3RI4A 3EETA 4G8XA 3V7RA 5GTHC 3OYDA 3ZQLA 5K7HA 4FCYA 2KIUA 2BY1A 4DQ2A 5AIQA 3M3LA 1B9NA 2XAUA 5HNFA 1FPBA 3ZCOA 2ONRA 1HW5A 3GZNB 1ZIUA 4A0XA 3HXLA 2F6PA 2Q0OA 3P7NA 3AL0C 2A68F 2E7XA 3F9KA 2M9HA 4FT8A 1UQWA 1JUMA 4E7JA 2ZXTA 4XRMA 4NF6A 4N8GA 1ETOA 5H6RA 1XVYA 2X48A 2DE2A 3LSPA 1PB8A 2VJ4A 2LH9A 5E8IA 2XD3A 1JW4A 1H8AC 3SKPA 2UXXA 4CCOA 2RF1A 1UMQA 5BPDA 1HW1A 2P5VA 4NB5A 5KCJB 3B6QA 1XOCA 5I59A 3ZSFA 2QQ9A 1NUZA 5DT6A 2FMLA 4AIHA 1B7HA 1WJFA 1YW7A 4A3KJ 3HTSB 1VFEA 4F1VA 4GFRA 3KZGA 1FPJA 5H20A 3RTFB 1B4AA 1FPIA 1KQ9A 2XVCA 2PMZN 4G94A 1Z0XA 4XLFA 3TDUC 5HOOA 4XIGQ 3WGIA 1SD3A 4JB7A 1SDXA 1FQDA 5DVFA 1CB6A 4E7IA 4CCLA 2ZYKA 2GXBA 2ME6A 4X04A 2WV0A 4LOCA 5FLMJ 1UHWA 1Y1ZA 4IRGA 3KLOA 3ZQFA 1ETWA 2Y9YA 3IRQA 1MXYA 3TTKA 2ZYOA 4GLIA 2WB1A 5D6FA 2HXWA 1INPA 3USDA 2E60A 2IT0A 4MH5A 4XIDA 3FXJA 2HEOA 5F24A 3GLXA 2Z23A 4H0WA 2LKPA 2KZVA 1C0WA 4R75A 3QPSA 4P9UA 1Z77A 3LSRA 4PZJA 5E1WA 2FMYA 3ELKA 2ZSIB 1BI0A 1E0EA 4MIJA 5DUIA 3OR2C 5CJ9A 1V5EA 4DIQA 1MY4A 4EXLA 2GAUA 4JYKA 2K9NA 3ZQQA 1S29A 1NG6A 1ONVA 1FBDA 2ZZXA 1DOTA 3D4CA 5M2VA 3LBSA 3K01A 2VJ5A 1BJZA 1QZYA 5ICTA 2WBBA 2JA2A 3BR6A 4CO8A 1FC3A 5B66C 3CO6C 2B65A 2O68A 1I50J 3ZR8X 1EZ9A 2P6TA 3PSIA 1WODA 1T98A 2F36A 2WYPA 4ZE9A 2MH9A 3K4MA 3S3OA 4KISA 1ZLKA 1MY1A 1HKSA 1CNQA 2FHYA 5LGTA 2V4CA 1A55A 5E1ZB 4XR6A 3FMQA 4LG0B 1O57A 5ISUA 3VE1B 2RKMA 3M8UA 1J0RA 2HGCA 3K4KA 4H8IA 1OFCX 1A8FA 1YLFA 5B1AH 1FYMA 3MCZA 2R7UA 3P7IA 5TU0A 3LSIA 5H8HA 1AA7A 5K5RA 3I5UA 2P5KA 5EEGA 5BMZA 1VQNI 2FIEA 3GYYA 1PP8F 4FEBA 4DIGA 3G1LA 2YX7A 1TWYA 4BHBA 2OX3A 3FF5A 1K61A 4LUBA 5E17F 1V54H 1A5JA 2X85A 3J81Z 3HKZA 4L17A 3D1NI 4XK4A 4BQOA 1O3TA 2EPFA 1FTLA 3CI8A 2ZFUA 1S7YA 1TXFA 2XASA 3CQZJ 4NGUA 2K02A 1QO0D 1S7OA 3CUOA 3GTGJ 2V3TA 5IGAA 4PQJA 1ORKA 5EGOA 3FXKA 3G6EI 1KYWA 3O6BB 1QU3A 3N4MA 1MMAA 1A6QA 2RN7A 4FISA 2VC1A 1WQ2A 4F91B 3O8GA 1D0XA 2EFQA 2M87A 2BZTA 5E1XA 5CC2A 3O3KA 2JPBA 3T9XB 2NVTJ 1MBFA 3FVOA 3EYIA 3B6AA 1Z91A 4THIA 3IOWA 5I56A 2UV1A 4KICA 2HQAA 2R5ZA 3I0TA 4I02A 1J1NA 2H09A 1DTGA 4X1DA 1RR7A 4NF8B 1JUPA 2X4HA 1PEBA 4OA4A 3BR1A 2MLGA 3DU6A 5F0CA 2DA4A 2HR3A 2IAIA 4U2RA 2WADA 4RXLA 1D9QA 3Q29A 3TBIA 3KN8A 3E5QA 3D0SA 6PAXA 4AM3A 1JT0A 2O61A 4M6XA 3V5AA 2KKOA 2VB6A 5F6FA 4A5MA 3OOAA 2MH2A 3VOEA 5H8NA 1XMAA 5LTCA 5L3CA 1IITA 1VE4A 3D5LA 1OVBA 2VPNA 3MVYA 3C35A 3VXCA 2G9WA 4C3JJ 4RAZA 3CC4I 4DZ1A 3E6BA 2QBYA 5J8FA 4UB6C 2NNNA 3EPZA 2NRAC 4YIRX 4HW0A 1AKHB 1W5TA 1XB4A 1XPXA 1HW2A 3ZXSA 2F5CA 3R26A 2XAFA 4N07A 4OVPA 3G3KA 3WGHA 3LSFB 4II3A 1IRXA 1ULYA 2K9MA 1USSA 3S3MA 2E2IJ 3K00A 1Y3QA 1FTZA 3KJ7A 5F0HA 4XRSG 2HKXA 5AONA 1R49A 4U87A 2ELHA 2IS2A 1TT1A 3HPIA 2K5CA 2LF8A 1URDA 1JHHA 2VQCA 2VOOA 2JK3A 1FCKA 4GXSB 4P9FA 2EFWA 1SANA 3GEZA 1B3EA 5LHHA 4U4XA 1RDYA 3R7XA 3DTKA 3HYIA 4MQ9F 3VYUB 2XXRA 1T39A 4GCVA 2NOJB 2PBIA 1UTHA 3EQLF 1ETVA 4PJLA 1B4HA 5BQTA 2COBA 4OAZA 1YPNA 1R5GA 2OZUA 2VOZA 2ID3A 3IB2A 4IJAA 2DTZA 1LFBA 4PDKA 3O66A 4KR5A 4XEQA 3LFKA 3RLFE 2EZHA 4F29A 2BEOA 4F3BA 3C33A 5BOXA 5D5UB 2VASA 3BFTA 4ZTJA 2OPTA 4YELA 4C2UA 4U0VA 3RJPA 5IPAA 3CJQB 1PP7U 3B7DA 2XGDA 4K3FA 3U93A 1LCFA 2JQ7A 4IO4A 2O03A 4HSTA 3AG3H 1G0IA 2NXOA 1Y0UA 4LITA 2QJEA 3L2WA 4TOZA 4PFWA 1HSJA 3L00A 1UTHB 2P8TA 2KHMA 3V83A 1BR1A 2Y0SA 2STTA 1G3YA 2AQFA 3C2HA 3HC7A 2ZNSA 2BY3A 4BDZA 4RJZA 3C2GA 5IYDJ 5BUUA 3HEFA 4QFNA 4IHVA 3QYBA 4BDOA 4PFYA 2EQRA 5ERIA 1A8EA 2HS5A 2HZTA 2PX9A 4R8HA 1XN7A 4BJ6C 2EV6A 3JRCA 4OENA 2XPVA 1K7AA 3RPWA 1N76A 1LQ1A 2PJRA 3U8QA 2QGUA 3FBNB 2DJNA 2EB7A 3BFUA 5B70A 3T66A 1SQYA 2BV6A 2FNAA 3MFKA 3BTLA 1MS7A 1DPUA 3TFLA 3AG1H 3WTZA 1BTJA 1LBZA 1FNNA 2UVHA 4NC6A 2EIJH 4WCGA 1ZGWA 1W7PB 3IB1A 3UIFA 2M30A 4YIIA 1FP2A 4RMNA 5TISC 5DCFA 3RT8A 3KPHA 3GBAA 3I53A 1LBXA 3IFAA 1P9QC 1MXUA 2HQRA 4X48A 3WG7H 4YFKF 2WEFA 5IP7J 3BTJA 4BBSJ 2XAJA 2ZMEC 1TBXA 2K40A 2QVOA 2OCUA 1JGGA 1AWBA 2NUVA 3P5JA 2OA4A 5K7ZA 3ZRGA 4K2EA 2STWA 3T8RA 2ONSA 2E34A 4A3LJ 1AOYA 1ZKBA 2JVHA 3IOUA 2MA3A 2HI3A 3W6KB 4YIFA 5DV5A 2MSYA 1YE9A 3E6DA 2AHQA 3ZQIA 2P5LC 2DT7B 1OCPA 2HKOA 2OZ6A 4BEHA 2H1LA 2L3DA 2X0LA 1BW6A 2VKHA 3Q25A 4JBZA 3IKTA 1N78A 4KYSA 2DA6A 2K3PA 4B8XA 1A35A 2QQAA 4MF3A 2E5ZA 1P7JA 4GWXA 1I1GA 3FJ7A 4FEDA 1TQMA 3ODBA 3ECOA 3KZIC 5JHUA 2IVMA 4XLPF 3GXAA 1U5TB 4MEYF 5L8DA 2DLLA 3OYCA 2A69F 5J47A 1IZ1A 1B4ZA 1DBZA 3J7AY 1I39A 2L4MA 2AL4A 1P1OA 4LZ8A 3VFZA 2DA3A 5TGTA 3ECRA 4XNFA 3CG1A 4KHZE 1J09A 1HOMA 2PN6A 2MYSA 4XN3A 3SXYA 1OVTA 2I4CA 2O3FA 4BDYA 3C4MA 2Y0SN 1IN7A 1R5ID 3LSMA 1XHYA 1NTCA 1APLC 3A0HC 2FUG2 4PJMA 1EYJA 1SYIA 2GH9A 1T08B 3H1CA 3HRTA 4Y17A 1NI9A 2EIKH 5E20A 1U5TA 4CCMA 2JT1A 4UACA 3B73A 1GUUA 1FTOA 2DT6A 1UG0A 3BJ6A 3QQAA 2E5NA 3CTAA 3VLWA 4Y15A 3TELA 5LBQA 3PUZE 3O9PA 1DPPA 2AXTC 5TP9B 2DAOA 3BTCA 1EH8A 1R1UA 1H89C 1RESA 1ZARA 4D0PA 1D4NA 1X3WB 1PB7A 3PUVE 3A09A 3CUQB 1WJCA 4R79A 1XGOA 3IAM2 5JK4A 3ZMSA 3RT6B 3RCOA 2VJJA 1JKPC 2EIMH 4XRSA 1B0LA 3H35A 2DMNA 2P2AA 4G77A 1IMAA 4M4GA 2BHYA 2DFIA 4BYYA 3GFIA 2HAUA 3PUYE 3TMGA 3DEEA 3M8EA 2LRDA 2O6AA 5GADJ 3MPLA 3R4KA 3DBLB 4IHTA 4LVQA 4ENKA 1YJNI 4RK9A 1P4WA 2L02A 3I3LA 3LAJA 2R5YB 4HLYA 4QXDA 4NWCA 4DE8A 2QS4A 4OVRA 3DELB 4A0YA 2O6GE 4R6YA 4BUPA 2A6EF 2H27A 4OEVA 1O63A 3OYIA 3GXOA 3G3GA 2LG4A 1JEUA 1NV0A 2HXOA 1RI7A 2PG4A 2CEXA 1BM9A 3HHFA 2LREA 3GTJJ 4MHFA 5I84A 4BDNA 5DCMB 5IZ1A 3KC1A 2I10A 1JKQC 4KYDA 2LAOA 2M8GX 3GW2A 5IOZA 5I2KB 4KCDA 5AIPA 3K0VA 4B43A 2M34A 1FBGA 1MSEC 1AIVA 4LK1F 1TL8A 1SAUA 1JXSA 2FBKA 2G7HA 2KJBA 1U8RA 3DFGA 1A99A 3CFZA 4GO1A 1VNDA 2F5EA 4NHBA 2P3NA 3WG9A 4NTLA 4O3BA 2DOAA 3OD7A 2MD5A 1IMDA 3G3IA 1GT0C 3ROJA 1WJDA 1MQHA 2P7VB 3CCVI 4P3LA 4GWUA 2OCEA 4U21A 2G7UA 2TDXA 3H9GA 3HUGB 2XWIA 3I3VA 2NWJA 5F0FA 4U7BA 1U2WA 4OAYA 1LPQA 1FMWA 2Q2CA 1B9JA 2W57A 1H9TA 4ZZEA 4EMSA 1LBCA 1RUOA 3JAMZ 5IZ3A 4DJAA 3F23A 4GWZA 4IHSA 4ON0A 4GRKA 3A01A 2D2WA 4R2BA 1MY3A 1IRZA 3LSJA 1GLNA 1FOKA 5ESYA 4HEA2 2DA5A 1AHDP 5EG0B 3JSOA 5EYGA 3LV0A 4YKPA 3G4SI 3MWBA 5IZ3B 3X2QH 4CZZA 3TO9A 1OLCA 2GZWA 4XKNA 3OS2A 1MQDA 5JLWA 1Q1KA 3F8CA 2RQPA 4PK4A 5EJCA 4DBQA 4BQNA 3FKJA 3JRIA 2G0EA 1FPFA 1SPIA 4O7IA 3S2WA 2M2EA 4XICA 1FJLA 3HHGA 3IP4B 2XPUA 1XX5A 3FIRA 2M1BA 1SD4A 2XAQA 1D8JA 4XLHA 4O7MA 2V1UA 1T56A 3QSLA 1RUNA 5ICFA 1BJAA 1MJAA 4MMPA 3VXBA 3WHCA 3PTYA 3IC7A 1IIWA 1RDZA 4R73A 2B7EA 2XKOA 2ELJA 1GV2A 3FXRA 1LFUP 1LSTA 3I4NJ 4NQWB 3F8BA 5FKNA 4RB2C 1B46A 3BDDA 3QYTA 4OFLA 3RIRA 3N6TA 5CRYA 2QVUA 3KN7A 2QEXI 1MQJA 1Y56A 2Z22A 3QPTA 1KU3A 3UK4A 1MJBA 3K2ZA 4KIBA 3HCQA 4P56A 4KITB 2A6HF 1EF4A 2UZKA 5J16A 2QBYB 2AIXA 4IOCF 1WJAA 3JTHA 2XXUA 1JI8A 3Q28A 1X1AA 4XKWA 1O3RA 1PB9A 3L6GA 4OYVA 3QOEA 1JP4A 2VONA 2JZYA 5IY5H 1E2XA 1G3SA 1MJ9A 1JVXA 3MUQA 1DP3A 2PCRA 2QSGX 1D3KA 4HLXA 2ZO4A 4LATA 3IX1A 3S9NC 2ZZVA 5FD5A 3GBGA 4GVOA 1TNSA 2EFOA 1K9ZA 4DZPA 5DEXB 1MBJA 4Y13A 2FBIA 4PCQA 1I1SA 4OANA 2K9LA 5LHGA 1BIAA 2A5YB 4ITVA 5J3LA 2LNBA 3CF5F 3KN3A 2DFFA 4NX1A 3FJMA 1QGXA 1JEVA 4NF5B 4QFOA 1RKTA 1I5ZA 1DTZA 4F39A 4QFPA 2LTPA 3ZMZA 3CJRB 1X1CA 4EM1A 3S15J 4QSCA 5CVRA 1WI9A 1JNFA 4XTCQ 4YMAA 1EH6A 2LBFA 5HLHA 1B5IA 3E7LA 4NG7A 4O8MA 3CP2A 1VI0A 3UP9A 1KZ8A 5FRMA 2XIGA 1TQPA 2R7FA 1Y20A 2JA5J 2PMUA 4M3FA 4PFBA 3QYEA 3L2RA 4I01A 3DLNA 2YX4A 4H1XA 4EJVA 2ZSHB 4FX4A 2NVXJ 2V3UA 4GDFA 3JR9A 1ZHFA 5M5WJ 4R74A 3ZMVA 3EHSA 1FEXA 1HLVA 4YU0A 2RCBA 4RGRA 2RCAA 2EZLA 3DP7A 1SFUA 3RTWB 1QHGA 3JYRA 5L3FA 1LEBA 2M4KA 3B6TA 3SHFA 3MWMA 4NC7A 2FBHA 4BHPA 4A3GJ 2JMWA 2FNPA 3DTIA 2R7QA 4F92B 4IL6C 4E7KA 2XX9A 2VLAA 2DMQA 4GX6A 1EA3A 1XDUA 2K9QA 4KA4A 1UCRA 3J7AO 4UY8I 1K9YA 3BIGA 4GD5A 2G93A 2Y84A 1N0TA 4RAFA 1T6SA 4AIKA 4KDPA 3E3VA 4KN4X 3FIWA 4LD5A 4HAMA 2KZGA 2VGQA 4DCXA 4FBPA 4FASD 4KFCA 4BDLA 3HIFA 3FKIJ 3M1EA 1XGSA 2A61A 2CQKA 5I3SA 1P1QA 3DXJF 1ATGA 4HCYA 3MAJA 2W85A 2Y0MA 5AA3A 4I0BA 4MFDA 3FBPA 4LB6B 2ZXWH 2LD5A 3O6GA 5DD8A 1E3HA 3T9HB 1IUYA 4POWA 2EA2A 1U9OA 3TL4X 4EGZA 3DBHB 4DCYA 4HW8A 1TNTA 4RB3C 1QZZA 3CUQC 3FDYA 5JVGF 1N7WA 3K70D 4G7ZF 3S1MJ 1KONA 4MX6A 5CLSA 4PF6A 3R0JA 2DWHA 1YYZA 3JZJA 4G9YA 5KVRA 1NL5A 2F7BA 4C3IJ 1ZBMA 3P9IA 3KC0A 2ZXJA 3HOVJ 3OIOA 4JK1X 4G7HF 3CCYA 1IMBA 3PPNA 2HHMA 1Q1HA 1TWHJ 4MQVA 3F11A 1AL3A 3S17J 3WE2A 2BJIA 5CQEA 3IORA 4PE3A 4ASNA 2ZMEB 2ZJRF 2VE8A 1LB8A 3DP6A 1BBYA 4F3PA 3F3XA 4M73A 2ANJA 5J1RA 3KLNA 3CR9A 4IHYA 3PUBA 3CSGA 2NVQJ 3QUJA 4N81A 3H3ZA 3I9V2 1IC8A 3WTYC 3U92A 4AB5A 1T38A 2WAFA 1VSOA 2F5VA 2XXKA 3CC7I 1IGNA 2A5TA 3KYLA 3CDLA 3LFUA 2OCCH 1NV2A 2E71A 4BJ5C 2LMDA 1ETKA 3A01B 5ILSA 4MCOA 5ED4A 2UXNA 3E1SA 3I59B 2IGMA 1BKAA 2XHDA 4UUSB 3WTUC 3EPEA 4X9TA 1LDKB 3PPRA 2WY7Q 4HPQA 3A2KA 3A02A 3E6CC 1ZLQA 3PFIA 1DP7P 2XF7A 4JBAA 3MC2A 5TPAA 1NV6A 2I4BA 3F8MA 5F1QA 1IN5A 2W82A 4DYCA 2M5WA 3MN2A 4B1RA 5FHOA 2ID6A 2L7KA 4L9VA 4A3JJ 1GGGA 4RB1A 4ESWA 3OV8A 2GXAA 3GYHX 4MNCA 3RKQA 4FX0A 3A0BC 1JTXA 2RQQA 4M3DA 4GRIA 1LB2A 2GRVA 5EYHA 4JDFA 4LQ2A 2KQRA 1IDZA 3M9AA 3CRBA 2L01A 4JX6A 2QS3A 3K2DA 2D45A 4HG2A 1E3OC 1EU8A 1X58A 2NNYA 3LSTA 4I09A 2O51A 2TCTA 2FIXA 2VP1A 1VQPI 1PUEE 3KBZA 4G61A 5IT3A 3K4JA 3N97A 1SFKA 4A6EA 2IGNA 2LOOA 1D9YA 5I57A 3C2BA 1WI3A 1D1BA 4B44A 2DPUA 2ISZA 3S16J 1B3HA 2X7PA 3OO7A 2HCAA 5I5PA 5CMCA 2CW0F 4XKBA 5FKMA 3RPUD 1UIUA 2Y31A 4NC8A 1SFOJ 2V6EA 2W25A 3K0LA 3PV0E 4FIMA 2ZC2A 1NV1A 2UXAA 2WAQN 4DGWB 1BK4A 4CH7A 2D21A 3HOXJ 5H8NB 2PQ8A 1VQMI 1PUFA 3RY3A 2IA0A 2Y2ZA 3GF2A 2HPIA 1USTA 3UR3C 3LR1A 2DE3A 3HN0A 2GHBA 4RB0A 3E13X 4RM2A 4NMYA 2DWIA 3BP8A 1J2XA 2NS8A 2YS9A 3NARA 2XF5A 2VKEA 3R60A 4NF8A 4M9XA 2QF7A 4JX5A 3HOUJ 1H3DA 4GX3A 3TP0A 4ZH4F 4F7ZA 3TEPA 2K4BA 3JCUC 2RC7A 4PBQA 5FO5A 3MVZA 3H03A 5I56B 2IEKA 2W84A 4M6VA 1S50A 5TP9A 2QA4I 3WTTC 2BW3B 1MG1A 4WEDA 2EFNA 2EJRA 1TLHB 1B9MA 1HA8A 2XF6A 2VHAA 3JSPA 1VQ6I 2QS1A 3OR1C 5JLXA 2DTRA 4JVDA 2VI6A 3DP8A 4N91A 2H4IA 3QP6A 4YG2F 3PU5A 1Z6TA 1XD7A 2WAQA 5K1YA 5EGOB 4J19A 1W1WE 1VFCA 3H4ZA 4WWCA 3BTIA 3JRFA 5DYHA 2ZYMA 3W3CA 5EZHA 2E7WA 3NRVA 5FGMA 1G3TA 4OMYA 3PMWA 3VYTB 5EQ9A 5GP9A 2PMSA 4GWOA 3IRRA 3HRSA 3TW7A 4ZEDA 1LEVA 1NV5A 4E4HA 2IP2A 4A12A 4OIOF 1NH7A 5HDGA 1NV3A 4NF0A 1GHCA 3F6VA 1R36A 1QBJA 3LA7A 2KIFA 1P2FA 3CZ6A 3HGGA 3ABTA 3OYJA 4PTKA 2GXGA 1MXXA 4OMZA 5JHFA 3W2AA 2IS6A 4V2FA 2ABHA 3H6WA 1Z7UA 1Z7LA 2XPWA 2ZNUA 4ZEIA 1P4AA 1URSA 2Q8JA 4M71A 3A1YA 5IT9Z 4EM2A 3K1MA 2QQ8A 3H9QA 5LGUA 4LG0A 4MTDA 2BBYA 2V3QA 2DN0A 4BHCA 1CF7A 1B3LA 4N9HA 3HHHA 4MFIA 2A5SA 2EFPA 2CFOA 4HA8A 1BW5A 2QLZA 2LVSA 1UHSA 1JUSA 1A36A 4ZC3A 2CMOA 2F7AA 1QUKA 3SDBA 1IMFA 3V7SA 3TKDA 5I2NB 3RYDA 5M5YJ 4ZEFA 1HSLA 2LY2A 4QWQA 2RV8A 4CCKA 2K3FA 4RLFA 1Y39A 1G4DA 1FJ9A 3OYHA 1DPEA 1SW4A 4ZECA 3K69A 5EEHA 1FP1D 3LUYA 3H6VA 4G8NA 4LFUA 3MEXA 3R6SA 1R1VA 1R4NB 5J4YA 4PAKA 4DYQA 4EJUA 4F2OA 3OYKA 1W7PA 4U7DA 2DXRA 4RK2A 3TCGA 2EH3A 4NAPA 1MXVA 1K78B 2KRFA 1S9TA 2PI0A 2CZLA 1BL0A 5CBRA 4IY5A 3MPKA 2DA2A 3ZN1A 4N4OB 1YHQI 2HZLA 1JETA 3IV5A 2E0SA 4IO9F 2O0YA 1ZQ3P 3PO2J 1SVXB 4WF2A 3LSHA 5C4XJ 4RA1A 2ZKZA 3B6WA 2GOMA 2KFDA 2FA7A 4PGNA 3T5XA 3BG3A 3HSTA 3P9KA 1VQLI 3GTKJ 2W00A 2ZNTA 3ERED 2OQGA 1FSHA 4XORA 2VOPA 3C31A 1EH7A 1ERDA 1FTJA 2VIXA 5B5EC 5J8CA 5J1UA 3O8HA 1NNPA 1VF9A 5CKTA 3TP3A 2ACJA 1XVXA 5DW8A 1Z3XA 1MDMB 3QIMA 4XLNF 1MY2A 1POGA 1JKRC 1ZELA 1N04A 3GMEA 4U4SA 5KCJA 2CW7A 2CQXA 4KIGA 1DDNA 2E1NA 2XC7A 1CQTA 2I0BA 3FK7A 5HS8A 2FJ1A 4Y4RA 4BXUA 3FHZA 2WBMA 3N5LA 3DP4A 5DVIA 4EQBA 2EWNA 4NF6B 1H76A 1IN6A 2EBIA 2Z16A 1Y8RB 4F1YA 1LUJB 5DVJA 2LDUA 3OSQA 3A03A 2WAEA 4KUMA 2HAVA 2LKSA 3CCSI 4R9FA 4ZDPA 4D7MA 1I6BA 2Z9OA 2VD3A 1R9TJ 2X1DA 2V79A 2YU3A 2YLNA 4Y33A 2J5PA 3C9HA 2HYJA 3K6GA 3M4OJ 4XLEA 2XXTA 4MJOA 1QUJA 5A5LA 2WBDA 4YEJA 1USYH 2A05A 2O8XA 1FLIA 2OQRA 4DW6A 3OO8A 3ESWB 1FTKA 1SMYF 4WXDA 2DW4A 3OENA 4BH9A 4QIWN 4C9YA 1S7EA 2R3SA 1B40A 1TZLA 4HV5A 3TZAA 3ZN0A 2W4SA 1MH3A 3EUHA 4E70A 4BGDA 2VXDA 4A3BJ 2DSFA 2PYYA 4XONA 3Q5FA 5BPIA 2BXYA 3T0JA 2CFXA 3TODA 2JJ7A 2XROA 3KJTA 5GAGJ 2I3WA 1MMDA 3Q9VA 2EILH 2KISA 4F22A 3BR5A 4KD5A 3V8JA 4RY1A 1YO5C 2F5XA 2VQGA 1SI0A 2B0LA 3K70C 1FPEA 2F34A 2F7CA 3K4UA 4M9ZA 1N84A 4F2QA 2VPOA 4UNOA 1I6AA 2IA4A 1AMFA 3GVAA 1SD5A 1QVTA 1YCJA 2RC9A 3I6VA 3IJXB 5JEIA 1X1PA 2VJIA 3UKGA 1ENHA 1I3AA 2WX9A 4YB7A 4A69C 4XKVA 2WV1A 2CSOA 2V93A 1SD6A 2VXZA 2WTEA 2DBBA 2KLOA 1YTYA 1OR7A 2BOLA 4MNPA 1X3UA 3S32A 2YSRA 1OLTA 4L5IA 1HCRA 2BYVE 4I3YA 3K10A 3N05A 4OTEA 3IB0A 1VQ4I 1NUXA 1BLFA 2OUMA 2FQ4A 2HDDA 1OISA 5K5QA 2QYOA 1MPDA 3PPQA 2X6OA 5DTDA 5IP6A 5TJJA 4M72A 4S05A 4GFBA 4Y52J 4D9JA 4EEFG 2B3FA 1IRFA 4LLNA 3M3KA 4TLLB 1R22A 1LKXA 1FW0A 2DVCA 2VT3A 2ZZWA 2XB5A 5J40A 1XT8A 5AA2A 4JWXA 3QP5A 3JRAA 3KSJA 4BQAA 1QRYA 1MMSA 3OL4A 2HYFA 3AL0B 4N6DA 4L0YB 2DPDA 4OHNA 4PETA 4KT6A 3CLQA 3ZPLA 1JKOC 1SW2A 2FNCA 1X1BA 3LA3A 2LFBA 2B4LA 1CF7B 2F3BA 2P3VA 4OVTA 3U72A 2I0CA 1YYVA 3ASNH 2ICWG 4B47A 5CMBA 2V6CA 3T0YA 2F3DA 4GBVA 5D5XB 1NK3P 1MDP1 4C2TA 5L3BA 3QRFF 1ON1A 2BVLA 4AWXB 4A0ZA 4OIPF 3QU3A 1YAEA 1B51A 5FHNA 2XHKA 3Q0VA 3VWBA 4A93J 3SDGA 4BLAA 4IO2A 3WGGA 3GZGA 3QAXA 1POY1 3DQVC 3TKYA 4F55A 1R5HA 4ZS9A 3IL2A 5JI6A 1G59A 1HF0A 4ESXA 3OELA 4I62A 4B3AA 2Q8MA 3OYMA 2OD5A 4R6HA 4KN7X 2HFHA 4J01A 1IF1A 3LMMA 1D0ZA 4II2A 4ANJA 2YU9J 1SI1A 5CI5A 4DXBA 2I3VA 4PJ0C 3D5RC 4BS9A 3PIOF 1VTNC 2QPQA 5ICCA 2EZKA 3P9CA 4W1UA 5B1BH 3E78A 1DGWY 2ZFWA 4HE2A 5E8GA 2XXIA 5AA1A 2VBZA 3U1KA 3HDDA 4Z0IA 3TPAA 2RNGA 4QSHA 2XAHA 1FOYA 1REPC 4RYAA 1FBQA 3VSKA 1RKMA 1OIBA 3UORA 4ZTFA 1LBYA 2XB0X 4RGXA 1YJ9I 4IHXA 3JRGA 3D1RA 1K4SA 1LFGA 2HPMA 2DDKA 2NVYJ 2DYRH 3F72A 3S8PA 3BJAA 4E7LA 1ZRFA 4UXNA 1P1WA 3ZMDA 1YW8A 3IUOA 4AVZA 3MVXA 1HXDA 1Y3NA 3L2CA 4GBWA 4EJTA 1V4RA 4BBRJ 4A6DA 4JWYA 3IFCA 2HNHA 4P11A 2Y7IA 1YOVB 3C7JA 5EZGA 5JR3A 5LRSA 3WAEA 1J7KA 2GOXB 5IYBJ 4CCNA 4ZDOA 3D5SC 4HCWA 5H8QB 4EUOA 3U2RA 3FK6A 3IR1A 1CE2A 2FA5A 1T0FC 1MY0A 3I64A 4CGZA 3CCJI 2JTVA 4BAYA 2KLFA 1IUFA 3L2UA 5LDZA 1LFHA 3SQNA 1XG1A 5LLQA 4OIQF 5ILVA 3PMVA 5EQ7A 1TFAA 1B05A 1TW3A 3SEQA 4F93B 3LQRA 4UABA 4EJWA 4YKKA 4JWOA 1YTVA 2OWSA 4RPOA 4EXKA 2H6BA 3R6UA 5GPAA 2E1CA 1SW5A 1YS7A 2M7AA 4FATA 2R6GE 3EQ1A 5HM4B 3MQ9A 3F22A 2Z8EA 4IX7A 4CHUA 5J1YA 1SEUA 4AC0A 2LC2A 1TWFJ 4U1ZA 1T0KA 3K9TA 2HEUA 3VEPA 3OMYA 2NAZA 4XQFA 4C3HJ 5M5XJ 4HTGA 2LF7A 4KNYA 4XSXF 3FXUA 2RDPA 3M07A 3WTVC 3SEYA 1X3ZB 2X1CA 1B72B 1STZA 1FQCA 5FRNA 2G29A 2QCOA 5HLGA 5K2XA 4ELPA 2IA2A 3ASOH 1D9VA 3FX3A 3O6HA 1FIPA 3HL2A 3K6WA 4RGSA 4HNUA 1MD0A 5EYRA 4X1EA 1B7ZA 1FBPA 2OBPA 1H44A 2ZNYA 4N4UA 4HSRA 3WHBA 1YX5A 2CUFA 2JRMA 5HVQC 1WHUA 3O6IA 2DS9A 1DCUA 4DXCA 4PJNA 4RBOA 4JOMA 2Q2EB 3QPHA 3J80K 1KU2A 1A31A 2VQHA 3C18A 1A6IA 3TGNA 1Y0NA 3LNQA 1V5GA 1O64A 2REGA 1DGRM 4UB8C 2KL4A 1R7JA 2L9SA 4XOPA 3ZMTA 3E5UA 4WX9A 4KYWA 4BXXJ 2AQEA 1GR2A 3MAMA 3N6UA 3M3YJ 2F4OB 1KGSA 5I58B 4KCCA 2EA4A 4IHWA 4H6DA 2K27A 4UV8A 5D6EA 4ENMA 4HF2A 1IUDA 4PAFA 2JVGA 2H1KA 3BKIB 2CJJA 2XGXA 3FHNA 3DKWA 1L3LA 1NKXA 1I3QJ 3MZ9A 5ITOA 3HRUA 2WA0A 1OKRA 3TQLA 3R0AA 3K1NA 1US4A 2DE4A 2CH0A 3V42A 3SEWA 1TFDA 3I56I 1UFMA 1EJ9A 1OCRH 3MZYA 2DDBA 2KIQA 5K7FA 1ZYRF 3KX2A 4Y7NJ 2VPLA 1WFXA 2JRTA 3PO3J 1V5FA 1JQFA 2LR8A 3OL3A 5FROA 2KIMA 2ZNZA 2VC0A 4BDQA 3JREA 2RC4A 3IOTA 4U0YA 3TDZC 1PYVA 3A3UA 4B4CA 2YR2A 2Z2SB 4A2UA 2P1SA 4RPNA 2CUZA 4WEPA 1OYWA 2REJA 4IF4A 3GO5A 3IAS2 5ET7A 2H8WA 5F08A 4Q8RA 1DPRA 1FT9A 4XKQA 5A5XA 1S7AA 3SZGA 4A3DJ 1F9BA 2XDVA 4UVBA 2GIZA 4HDUA 2DWAA 1R00A 4HNVA 4F3SA 3CMEI 1Q9DA 2O7UA 4I7HA 2V1XA 2YPNA 3FBIB 3F0CA 2QM3A 4IO3A 3ILUB 2L7ZA 4PJJA 1WJBA 2Z33A 2IS1A 3FUZA 4GWWA 2OJTA 1I27A 2V9VA 2R9JA 2XRNA 3DKXA 2O9LA 2DXYA 4OZ9A 3AG2H 4M3BA 2RAEA 4E0XA 4GYGA 4LLLA 1M5EA 1MNEA 4G12A 1SMTA 1DU6A 3SDFA 4KMFA 1WCMJ 2X9DA 3GZ6A 1LNWA 3PQKA 4X1BA 2JUGA 4ESFA 4PFUA 1FTMA 1LAFE 3I4PA 3QPLA 3E79A 2L2OA 4WXHA 5HDNA 3OSGA 1ZR2A 1ZU0A 4C30A 5ELVA 5AA2B 2HXRA 1RKWA 3FM5A 3JAMK 1UHMA 3PUFA 2KT0A 1XMKA 2MC3A 1BOAA 3BT9A 1B52A 3PD9A 2EK5A 4B09A 3GX4X 4Y3OA 2H25A 5F7VA 1W7PD 2EINH 2QWWA 1BI1A 5EQAA 1D0YA 2LKXA 1QULA 1WDNA 1B8IB 2OTJI 4G8HA 2Z5UA 3FGSA 5DEXA 3J7ZI 3CCUI 4W97A 3TYHA 4DI4B 2VT2A 3I58A 1K79A 4H0EA 5L9SA 3MZBA 4L18B 2LLKA 4DNCA 5ICEA 3W6VA 1MH4A 2R7TA 4GF8A 2PT1A 3HSRA 2OJED 2DK5A 3B02A 2KDOA 1ZTRA 1OYIA 2BE5F 3ZQCA 2FX0A 4P5OA 1OCTC 4LIUA 3EN3A 1YITI 3KGCA 3LL7A 3L09A 4XKPA 4OFOA 1BN5A 1B6HA 3OSFA 2R71A 1UTBA 1KU9A 4IKFA 3TEDA 1AH5A 1BR4A 1B59A 5CMMA 2K86A 4RM3A 2W1OA 4MEXF 2DOJA 4RAGA 1VQ7I 1B3FA 1NH3A 1IDYA 1MBKA 3BR0A 2XGEA 3TTNA 1M5FA 2OLBA 5KAFC 1XSDA 1L5TA 3JRHA 4HQEA 1LCTA 1VFDA 1L0OC 2W24A 3OS1A 4PGPA 1WJEA 5TRDA 1NV4A 1M5CA 1Q1VA 5FKOA 3MW0A 2E1MB 1IEJA 2QVVA 5ET5A 2JUCA 1LE8A 1N3WA 1ZMGA 4JVIA 2EV5A 4POXA 1X1DA 1OPCA 4HQMA 5L3DA 3K4BA 4GQOA 4V2GA 5KHDA 1MM6A 3S4UA 3PM1A 3WU2C 4DYRA 2I58A 2ZJQF 3LSWA 4BDRA 4U88A 3AKZA 1D1CA 1GVDA 4H4KC 5GAEJ 4G6DA 2FOKA 3IHUA 3OO9A 2M0MA 3PMXA 2V1NA 3OWTA 3K6VA 4XKRA 4NNJA 2JA6J 4PSWA 4P1EA 3O29A 5AA2D 3I59A 4OESA 2H5YA 2HOTA 1OYYA 5E3NA 5EG0A 2E1SA 1V55H 5L3GA 2XX7A 2ZMBA 2QENA 3DM0A 4KI0E 2XXXA 1Y1VJ 1F5TA 3OSRA 2KP6A 2Y7KA 3CFLA 1BI3A 4G2ZA 3U94A 1TWAJ 4H46A 4A3MJ 2I5UA 2D1VA 2V9PA 1R9QA 5T3JA 3OOPA 1FX7A 1IN8A 2FRHA 3HM5A 4OMBA 4PBHA 4HV6A 3PSFA 1P1UA 5IT9K 4ZE8A 2X1EA 3MVPA 1TW2A 3SFIA 4B48A 2A07F 2QL3A 3V8KA 3CVGA 3H3GA 5H8QA 1HKQA 4LN5A 2JSPA 3PL8A 4NWDA 2X6XA 3CCRI 1LJ9A 3BROA 3KP5A 1VR5A 3OMBA 3VSLA 2E1OA 3WE3A 2IGOA 4P96A 1P1NA 4HF0A 1S72I 4GX4A 3LQQA 1Y1WJ 4I3EA 4P1LA 3MKYB 2CZHA 1QJMA 2OU2A 2ZXHA 1FQFA 4I76A 3MP8A 3TQWA 5DCMA 1J75A 2GQ1A 3ONQA 2X7QA 3QK6A 5C44J 2V7FA 3TOAA 2GLOA 4C2MJ 2OC6A 1FQBA 3KFMA 4H8JA 1K83J 1YIOA 4RS8A 4JQFA 3SEZA 4MBPA 2DA1A 2R5YA 5BWJA 2GA1A 1UELB 1IV8A 2RVCA 1MSFC 1LAHE 4H65A 5FTIA 5GTIC 3L2QA 2Y9ZA 2HVQA 2V9KA 3G73A 3K1PA 3M7GA 3CCMI 3FXBA 5HBCA 2XD2A 2E1MC 1NNFA 2UWMA 1ETQA 2L5VA 4M3GA 3FVGA 4OVQA 1WSUA 4LMYA 1ZRDA 4ECFA 1QUIA 1GV5A 4A3EJ 2OWZA 3KIOA 3UA8A 1B6AA 4PDDA 5HLTA 1SFXA 2HXIA 5DD4A 1O7FA 2B9SA 4OXVA 3U1OA 1W5CC 1RDXA 1FIAA 3CFXA 4I1DA 2O7IA 1PVEA 2IPQX 3O97A 4IRIA 3JTGA 1T8IA 3KE2A 1ZK8A 5AE4A 1QKBA 5J6XA 1NUWA 4FQGA 3H5NA 3COAC 2WY8Q 2O1LA 1ETXA 3BQYA 2VPRA 2UVJA 2XXWA 3H6TA 3IO4A 3Q26A 4IGRA 3RTRA 4CDGA 1EH3A 1FY7A 1MZBA 2E35A 2R8TA 4IO7A 4AS5A 1G0HA 2BY2A 1DSNA 4IOAF 1B3GA 3HFUA 1ZLJA 2DOFA 4BE2A 1RYOA 3VVDA 2XRLA 3JV9A 2BHZA 2DI3A 3KFWX 1ZJLA 4PF8A 2P0WA 2PJPA 3PD8A 2PLYA 4XBFA 3HOZJ 4H5GA 3B6CA 1W0TA 1XCBA 2NXNB 4X6AJ 2X6WA 2Y7PA 3BZ6A 2NOOA 3BPXA 2CV2A 3V4GA 3PUXE 4LG3A 1YRNB 4QPQA 2JJKA 4KMUX 4UVCA 3V7CA 1T33A 4NF5A 3F8FA 4BE1A 2AYSA 2UYEA 4XF5A 1X4OA 1MXZA 2CW8A 1FMVA 2O7OA 4N15A 3T22A 1G8XA 3ZGKA 1F43A 1MBEA 2HTJA 2VKDA 1WWXA 2BGCA 2F48A 2MC4A 1B58A 3K2AA 3B50A 1A54A 3RPLB 4U0WA 2KDZA 2M3AA 2R7XA 3TW6A 4ESJA 1Y8QB 5A2QK 1MRPA 2Z8DA 1Y1MA 4HYEA 1FOWA 2WC2A 3RYRA 2F78A 1G3WA 2LP0A 2DYSH 5I7IA 3PGFA 4FAJA 1IXIA 3SERA 3ZQ7A 2PFZA 3G71I 4IZZA 3OEMA 1Y4CA 4NEDA 2XKPA 1TT0A 3GTMJ 2EV0A 3E97A 1PUFB 4LJZF 1J9IA 1FPQA 4MLQA 2ZCWA 1Z67A 4XLAA 3RPQA 3H92A 4PFPA 1PBPA 5LGNA 3DKYA 3S2VA 3I4MJ 3PFYA 4YB6A 3LSKA 5IZZA 5JTYB 3CC2I 1ACIA 2WB1N 4L5EA 3OXNA 2IBDA 4AVPA 2DFEA 2DWJA 3IO6A 1USYE 1RR8C 4KFQA 4F52A 2XGCA 1HKTA 1JHFA 4U1OA 2IRFG 1Y3PA 3VV5A 3C34A 2FU4A 4DOZA 3F8NA 5F27A 2OZZA 3IL1B 1QKAA 3G3FA 2HOSA 4GL0A 3TCHA 1MNDA 3W2VA 3MZ1A 5FLXK 1NHAA 1ZREA 2ESHA 4HBLA 2Y75A 3FZVA 5H2FC 1NMUA 3FWEA 1RNLA 4KXPA 1NNTA 3FXOA 2NVUB 5CPRB 4HDVA 4YFNF 5F1JA 1SD7A 3VVFA 3MKZA 2QKLB 4NF4B 3KCCA 3BWGA 2CO5A 4Q47A 3THIA 3LWFA 5M3FJ 4WXJA 1MMNA 3CMYA 3QYFA 2H9BA 3F21A 4S0HB 3ABLH 4HOBA 3ZP5A 1EYIA 5ICQA 3KP7A 4YMBA 2QFLA 3NEUA 2K4JA 2CZKA 3TCFA 3UN6A 2VD2A 4QTRA 3EF7A 4N0BA 1I6HJ 1KWHA 1IW7F 1QA6A 2A5TB 3KEOA 3QXMA 4Q48A 2MGQA 2QQBA 3H06B 3NWTA 4LQ5A 4ZZDA 2QRYA 2FE3A 4Q5TA 4IVNA 5KDTB 3BOQA 1XSVA 1VQKI 4BQQA 2W7NA 4G8MA 5C4JJ 1IO2A 1ZGJA 3FISA 2UYFA 4ZEBA 4NDLA 2V84A 2XX8A 3N26A 2XXPA 5CBSA 4MNUA 3MZHA 2ZMEA 3QAHA 2NS7A 3WU0A 2KPMA 5GAHJ 1XTAA 3CG3A 1ZGAA 1G6NA 3CP8A 4GGGA 5EF6A 2HYGD 4AD9A 3E0JB 1XS5A 1Y9UA 3H7MA 3SETA 2DODA 4L5JA 3KYCB 5I2KA 2RC8A 1GTKA 5HPQA 2L4AA 4RA2A 3UGWA 3S93A 2K7LA 2QS2A 4NN3A 3J80Z 3Q0UA 3RSNA 5D8LB 3A29A 1BOBA 3ULQB 3FD3A 4R6KA 5I58A 3FM3A 1K78A 2CRGA 1W36C 2M8CA 3CMAI 1FRPA 3QOPA 3LSXA 4YKIA 1URGA 2CEYA 2A6TA 2IXSA 1B7UA 3FASA 1ETYA 2PFYA 4KPTA 3W15C 2ZJPF 4P1WA 3VDXA 4BU2A 1JGSA 3D4GA 1OQGA 4CICA 4XOTA 2R4GA 1PC3A 3KZZA 3KBRA 3BCBA 3J81K 5F1RA 5DDGA 4D1QA 4EATA 2ZBKA 2CS3A 5BS6A 3S3NA 4ISUA 3S14J 3CDIA 4PAIA 1UG2A 3OY9A 3EUHC 3U1DA 3ZMUA 4ZZAA 2A3SA 4BDMA 3RQTA 3HOTA 1FBUA 1D8KA 4AUXA 5I2NA 1V3FA 4JVCA 4TQUQ 1LFIA 2Q9TA 4TV7A 2D3IA 5D8KB 4QBAA 1B2HA 3N94A 4XMYA 3RNNA 1KQ8A 3KEQA 2LSOA 3I54A 4B3XA 3CJNA 3KEYA 2DP8A 2B3BA 2V26A 3DCFA 3RGYA 2F5DA 1B72A 3KOSA 4ENNA 1KQ0A 4A3FJ 3GZ5A 1MBGA 4I40A 3AFHA 2OBGA 2Q89A 1LLSA 4NF4A 2M4GA 1BIBA 4FE4A 3GWZA 2QSHX 4ZYHA 2CZIA 5J1DA 2GM4A 2XXQA 4FETA 1YXIA 4OETA 1SVMA 1ANFA 1BP5A 4PSXA 4RLQA 4PP0A 4TLMB 1LE8B 3RZDJ 2PBWA 4EV0A 2FF4A 2K85A 1LBWA 1Z21A 4NUBA 2H98A 2DQRA 3TOBA 2LBFB 2VBWA 4DZJA 5JFRA 3RUMA 3B8BA 3BQZA 1XI6A 3TQNA 2XXVA 3EHTA 3GTQJ 2CYYA 3ILTB 1P99A 2B63J 4OVJA 2P6SA 5H8HB 5JTYA 4O5VA 4PC9A 3KZYA 3PPOA 5J4VA 2LY9A 1WH5A 1S9HA 1JJ6C 1SW1A 3OYFA 2XA5A 2RINA 3TTLA 5BNGA 2F35A 4OQOA 3CHGA 3OIPA 2O8KA 1OCZH 3BG7A 4OOIA 1YW9A 2P7CB 2AL5A 3H5AA 2CUEA 1LBBA 3HB9A 1U0JA 1QZEA 1XGMA 1U6GA 2FYIA 3MVWA 1UTBB 2IA1A 1P4XA 1TWGJ 5HLIA 3HTUA 2X6YA 3T8TA 1IJWC 2JA8J 2FOWA 3VLVA 3C3WA 3VPRA 3S2HJ 3MQ0A 1A7LA 2GIVA 1KA8A 2LK2A 3K4NA 1G2HA 2V1DA 1QQIA 4M3EA 4GYIA 1YZ0A 1RZ4A 1MNMC 5FKKA 4IQJA 4JXIA 4LA9A 4O94A 1R1NA 4IB2A 4WK8F 2LY1A 3VYRB 5A2QZ 1NK2P 1XCVA 4N4NB 2DXIA 2MFZA 3HSEA 3MYUA 1QW0A 1LBVA 4QFLA 3H36A 1U8BA 2ECCA 2VN2A 1FJ6A 2F4MB 3DPUA 3SFZA 5C3EJ 4G68C 4DDDA 1H45A 1MPCA 4QF9A 4BXFA 3WTXC 3BZCA 1ZH5A 3HV1A 3GLLA 2QMXA 5DS9A 4H5FA 1S6LA 3RKXA 4BY1J 3GBBA 4F1UA 1NV7A 2HQ5A 2VBXA 4NQWA 2WWYA 1MW7A 1YJWI 3ISPA 4AYBN 1IMEA 5L3EA 2GWRA 1E17A 5D5VB 4PFTA 1O3SA 5GPCA 3A4CA 1ZTYA 2JWTA 2YPRA 1I6QA 2WKYA 3L1PA 2BY0A 1B32A 3FXMA 1EYKA 2YJPA 3I5OA 3K6UA 5FTHA 2QKMB 3PIPF 1SVLA 3JW4A 4JX4A 2DA7A 2E36A 1QPIA 2DVZA 1UJ8A 2MKZA 1MXWA 3BC8A 5E3LA 1LB9A 2GBYA 1RYXA 2XWKA 2Z1DA 2DQVA 3TDJA 1MIJA 2J5OA 4YKJA 4I6ZA 2VUMJ 1Y6IA 5DYMA 2HQ0A 4QLCU 2HVSA 1YG2A 1MKMA 4PGGA 4AU7A 4YRVA 4X8RA 4ZYDA 1NFTA 4YICA 4MLVA 4EQQA 5IM2A 1D3YA 4G68A 2QVRA 2MLKA 3T1BA 5D4RA 1IMCA 2OAZA 1R9LA 2R7WA 3C36A 4FE8A 4G6TB 2PMHA 5HS7A 3U65A 5E3MA 3S9LC 2RKHA 3MKLA 1N77A 1IQ7A 4EQ9A 3H0GJ 1AU7A 3GTPJ 2QSXA 2ZYNA 4P47A 2ECBA 1MQIA 4PCDA 2OTLI 2OV7A 2Y5KA 2ZB9A 3HJEA 4QFKA 1UB9A 5K5OA 2RGVA 4ETSA 3S1NJ 1FYLA 4OWDA 2CU7A 4LGWA 2I48A 4HXVA 4P0GA 2Y7RA 2TRTA 1SFEA 2IJLA 1W4MA 5CQGA 4HF1A 4FORA 4GIZA 1IAWA 4KQPA 5H6QA 3HSFA 1BC8C 1B1HA 5CVIA 1OR7C 2GA2A 3CF2A 3FMSA 1SAXA 2AO9A 2CQ7A 2IGKA 2H99A 3RN8A 5FBPA 4JP0A 2FXAA 4A3CJ 5CVVA 1W36D 2ZXIA 3HG9A 1RC9A 4BNCA 4Q30B 4MFEA 3ZOBA 3Q9SA 2F5FA 1RIOH 4H67A 1M5BA 2IEEA 2L9RA 2M7BA 1UIVA 1YS6A 4BKXA 3MSTA 4ND9A 2Q74A 4ZYGA 4MHGA 3V8XB 2IW5A 1TT5B 2L9VA 3C1DA 3SESA 3RDIA 5KZTA 1OMPA 3PQJA 1VZ0A 2P81A 3ROUA 2M45A 4BY7J 4YB5A 1M5DA 4PFRA 3BZKA 4G6QA 4A3IJ 4ONYA 2M0CA 3MKWB 3WAFA 3KP3A 1QVUA 2R7OA 1EKEA 1IN4A 1Z7NE 4N8YA 1B0HA 4MTEA 1SC7A 1FWZA 2VKVA 4XL9A 1BA5A 2KQZA 3FJGA 2ALUA 1EZOA 3H6UA 4O3AA 1FBFA 4IRHA 1A40A 3TAJA 1F9NA 4M74A 1MMGA 2CG4A 5E79C 3BJOA 3CUQA 2KRCA 3OO6A 2HDCA 2R5ZB 4MAGA 1U3EM 2F6CA 3ERMA 4DBRA 1J5YA 4PUSA 2E2JJ 1II5A 3CSBA 2FQ3A 5IKBA 3K6XA 2XUBA 4E7ZA 4OIRF 2DFHA 1F1ZA 5HS9A 3S9EA 5E18F 2F8DA 1MGTA 3PNVA 5KK1A 2DU9A 3PPPA 1DMBA 1HSEA 3BR3A 3JRDA 4NE4A 5LHIA 3ZKKA 4QRZA 3HZJA 2X51A 4N6PA 4P55A 2UUZA 1TC3C 2FVZA 3S1QJ 1WVJA 2XSJC 1S3JA 3BG5A 2FD5A 1VQ8I 2XV4S 1AOVA 3QWLA 5CYVA 5FLXZ 2ZJ2A 1PBQA 5K2YA 1UZCA 1D1AA 1TWCJ 1FOXA 4R2FA 4Q0CA 4RDUA 3M8FA 3G3HA 1MBHA 1U9NA 3IOVA 3SJMA 4LZ5A 4DXUA 3LC8A 4HE0A 1P7IA 5LD2C 1I69A 1WRJA 3DPTA 1W5SA 1O3QA 4D7NA 2H8RA 1R6ZA 1X19A 3FXQA 1D5VA 3KP2A 5H8FB 4ELQA 5FLVA 3AXFA 4L0ZB 4C1TA 4HNTA 1MM7A 4XRFA 4I0AA 3DEUA 1IRGA 5FFZA 5B3SH 3RQ4A 3E9XA 5EHMA 4E6KG 4KJZA 4X0GA 3KG2A 3OOUA 4YZZA 1Z9CA 1HDPA 1R23A 1MDMA 3MP1A 1UAAA 2B4MA 4ZDMA 4ESBA 2MD0A 3R61A 2F2EA 3WODF 4BEHB 3H0DA 4LP2B 4QSDA 4AB6A 3T9UA 2DOEA 1B5JA 4F3GA 2Y5LA 4I2OA 4P0IA 2CV1A 4CUGA 3FVNA 2C6YA 4F18A 2HZKA 2Y69H 1H88C 2Y48A 5LOMA 3S2DJ 2L54A 1FQEA 3M8JA 3C32A 4GOTA 3T93B 3O2AA 1P6RA 1R1TA 1Y4TA 1R71A 1FSAA 2BVMA 1TP4A 3HRMA 1KA1A 5LEKA 2HVRA 1FTAA 1Z1DA 4FECA 3K4LA 2A5WA 4BE0A 3AAFA 3RPLA 4L9TA 3GFMA 1WH7A 2DT5A 1Z3YA 2X26A 3CDHA 1N75A 3WTWC 5EYFA 3VVEA 5L9OA 2FSWA 3W2WA 1ELJA 1RRJA 3NOHA 2JA7J 4R1HA 3CMMA 1F4KA 3DEWA 4ZZLA 1VQ5I 1KA0A 1OCOH 3L6HA 3GUDA 1K4TA 4HX8A 4U23A 2K9SA 3W6JB 4IXAA 1YRNA 2CGPA 1BIYA 1N7XA 2O69A 5FKLA 2CV0A 3EKIA 3MJNA 2MG4A 1JTYA 3OYLA 1ZG1A 2DMPA 4ZJZA 5ET8A 2PJRB 3MD2A 3VYSB 3IH4A 4DLDA 1P92A 4IR8A 4QSEA 1PJRA 5M3MJ 5HODA 4EF1A 1EV7A 2R7ZJ 3QMFA 4V19K 2BJJX 4I9DA 3KOTA 1R6RA 3GTLJ 2KMUA 2I8DA 3O2PE 3MBPA 3OYBA 4HE1A 4ENJA 3ZS6A 3TUSA 3OS0A 3IK6B 4U22A 1TTYA 3E6MA 2GFEA 4R9GA 3S9MC 1W0UA 5I59B 4XN0A 1AWCA 4C0RA 4D5FA 1WZ2A 4S04A 4JSOA 3H5RA 3I55I 4UV9A 4ELRA 2XWOA 2Z8FA 1FYKA 1ZG3A 3K4CA 3WTSC 5LFAA 1HSTA 1LGBC 2PMZA 4UUTA 4ZYAA 3CJTB 4XFEA 5CM6A 1XGNA 3MZ8A 4O3MA 3LA2A 3QUFA 5KCMA 2HZDA 4MO7A 5ILUA 2HOAA 1ITYA 5EEAA 3GFLA 3LUZA 1I6XA 1IXRC 1XDSA 3V8LA 4PGHA 2HWVA 4F19A 3HBLA 4CXFA 3HUGA 4OVSA 1T0FA 2O5RA 1VQOI 3DF8A 4GXOA 2H94A 2DQLA 4HX7A 3CCEI 3VB2A 3CESA 3HOYJ 3BLYA 2E2HJ 5ET6A 3W9WA 1YI2I 2UVIA 3WU1B 4N17A 1GXQA 4F31B 2VBYA 1XS9A 2CQQA 1IXSB 4HZFA 1MPBA 4OFJA 1YIJI 1XSXA 1GVJA 1M1EB 1IG7A 4EDPA 1RETA 1IXCA 4ABZA 1FPLA 2DYXA 4PDHA 3RYPA 3DBRB 3G3ZA 3KYDB 4E7HA 2XXYA 5KDTA 3TO6A 1SVOA 4RNSA 4FHTA 4CCJA 1ZR4A 2UVGA 1LAGE 1OMIA 3OYGA 5FFXA 4WXCA 2F6GA 2F97A 4OU0A 3BR2A 3HPHA 5F04A 1YFHA 1AKHA 1CGPA 4PE5B 4H45A 3L9FA 1B1XA 3VODA 4NHJA 3ECHA 4BJTA 1IXGA 1NUYA 4IY6A 3RPUA 3QODA 5FJ8J 1T95A 1QGPA 5DM6F 2Q2EA 4BL0B 1X4PA 2MBFA 3O28A 1LDJA 5IAIA 4OWRB 3EUKL 3DLAA 1E3PA 1XMXA 2GQQA 1LAXA 4ELOA 5IYCJ 3HO7A 3OYEA 3FATA 1B5HA 5LEJA 3BPVA 3NAUA 3E3KA 1VQ9I 2D5WA 2QZ8A 4LLGF 4E7SA 2Q1ZB 4XKCA 3Q27A 2RNJA 3VLUA 4A5NA 1J59A 4ZDLA 3FXLA 1LVAA 4IQ4A 3ZKLA 1O7LA 3IKVA 2DCEA 3HKZN 3H9JA 1HDDC 3BBRA 1H9GA 1FPGA 3G1OA 1DU0A 2YUSA 4IO6A 3U9GA 2PVUA 2R7SA 2ME0A 2Q8KA 4EVIA 3TO7A 2DMUA 4MLOA 3NWSA 1OQHA 2L0KA 2P4WA 3IH3A 1NG7A 3LSGA 2R7VA 3HPGA 2GHAA 2L9NA 1Z05A 4G68B 5CMKA 4L9JA 5FB2A 5TPAB 3M3FA 3HGYA 1NNKA 3DU5A 4UUSA 3IWZA 3EUAA 2R7DA 5HDKA 4G4PA 4MEVA 4PFIA 3RKYA 2KRHA 4G7OF 4IGTA 3CIJA 4EF2A 4CYCB 5DM7F 3ABUA 5CVJA 2XAGA 2PFBA 2Z3YA 2L7MP 3BG6A 3HOWJ 4GWSA 2DO7A 2ETHA 2ISYA 4LIVA 3T96B 1SYHA 1GV8A 1ZKGA 3OYNA 2HU9A 3DWLE 1BI2A 3G3JA 5KNLA 2RREA 4XXUA 2HQNA 1H0MA 1LFPA 3L7WA 2DDAA 1FSEA 1X2NA 4M6YA 3E4RA 3GLBA 2OWTA 2HTSA 3IH2A 5E3OA 2FBPA 4O6JA 4RAYA 1K6OA 5AA4A 1DUXC 1JJ8C 4DI3D 2D1HA 5IOYA 4EQ7A 3BG9A 4Q5SF 4F3QA 1LVKA 3HOSA 3FV2A 1QNTA 2CUJA 4FE7A 3KSXA 2AS5F 3SEUA 1T2KA 4HRIA 2COMA 4NBQA 4ZEKA 2NYXA 4AYBA 2EZIA 1OQYA 3FVKA 3SEXA 4UUVA 1IXHA 1ZAOA 3MMYB 5IP9J 3OEKA 3G1MA 3IJOB 3OIQA 1WVRA 4XM3A 4EJOA 4YFXF 4CZCA 4KT5C 4D5CA 4UA8A 2M8EA 1FBHA 4Z7EA 5LRRA 3L2VA 3S1RJ 1JW5A 1OJLA 5DEQA 3H3VK 1B8IA 4LB5A 1FTTA 3GTOJ 5DUKA 2O1MA 2P0SA 3EHUA 1ZN2A 2FEZA 1HQCA 4GWYA 1FQAA 4HS7A 1U5TC 3IAZA 1X2MA 4KIFA 4M1VA 5L9MA 2ONKE 3DV8A 3REOA 1IV6A 1OCCH 3AG4H 4OEUA 1XC5A 1FPDA 3H3UA 5D4SA 3CD6I 3PUWE 2NS0A 2Q88A 4O3CA 3V89B 5EDNA 2Z99A 3GFJA 2O84X 3KEIA 4EM0B 1K6YA 3TMOA 3F6OA 2R7RA 4I8CA 1N25A 1WGXA 2DMTA 3NQOA 3CCQI 2XWVA 5DTBA 1YX3A 2ADUA 4UVAA 3ZQGA 4IO5A 3BCAA 1S8NA 2Y7WA 3JRBA 2PEXA 1BC7C 1WKMA 4BACA 1VDWA 1JT6A 4R72A 3TTRA 2R92J 5AA4B 1O4XA 2XSDC 4AIDA 3RZOJ 2PT2A 3RQIA 2HPGA 2OF7A 4GXAA 3ABMH 4N13A 1POTA 2CWEA 2VL8A 5KAIC 3OYAA 4C1UA 3Q0WA 3TTMA 3RKWA 5ICGA 5D5WB 5H8FA 3CLOA 1OLAA 1S5LC 2HOEA 3IWFA 2KR0A 1ZG5A 4L9NA 9ANTA 1Z7ME 1EZPA 2R0QC 2CMPA 4N6KA 4P9KA 4Q4ZF 3SYTA 1QPMA 1JW1A 4P8BA 2HDWA 2JN6A 1FPKA 1XC1A 5B7DA 3QU6A 4CYCA 4Z6YA 1GDTA 3EDPA 3UNGC 2VT5A 3FMRA 4FJPA 2KJCA 2E19A 2VE9A 1HC8A 2F4IA 2Y30A 5A5XB 2D5VA 1PDNC 4I99C 1MQGA 2DJIA 4YAHX 4AS4A 2HFBA 4JSDA 1F36A 2CQNA 2AXLA 2L5QA 3T9VA 3G2BA 5FD6A 5HNHA 1JVYA 4LZ7A 3K7AJ 3ML6A 4LK0F 1DK4A 3DTEA 1B1BA 3LOCA 2MABA 2MW8A 1WPKA 4UHTA 2BW3A 4CA0A 1GXPA 2JPCA 1NH8A 3K02A 3MP6A 1D5YA 4OINF 2L7FP 1LDDA 4PFOA 4AIJA 5FHMA 5F64A 3LAPA 1FBEA 3BIHA 3VFJA 4J00A 3M1CA 3ABKH 5EHSA 2Q2AA 2XXHA 2ESNA 3U21A 4WKMA 3W9VA 1BR2A 1GVCA 4XLCA 3LSLA 1R58A 1HBXG 1US5A 2THIA 1DQUA 2V4JC 3I71A 5ITPA 2H6CA 4XSZF 3SZPA 4CYDA 1QVSA 3DLLF 2PX1A 4NQ8A 4OERA 1ODDA 3ZQHA 1O7TA 4Z2YA 4M9SA 1FBCA 3DPLC 1ON2A 2VQLA 5H8SA 3VDFA 4I98B 1FZPB 3E5XA
chains in the Genus database with same CATH topology
4MNIA 1A04A 4MGRA 4IPAA 1JE8A 2WYKA 3KP4A 1YQAA 1LEAA 2DK8A 4RGUA 1KU7A 3SZTA 5JVTA 5EQ8A 3EYYA 1U78A 2QUFA 2JSCA 2VODA 3CO7C 5CVUA 4EGYA 1FBSA 3KETA 4ZYEA 1ZRCA 4HX4A 4N9IA 1KYZA 1TQIA 1Z6RA 3BY6A 3KP6A 3RI4A 3EETA 4G8XA 3V7RA 2KIUA 4DQ2A 5AIQA 1B9NA 1FPBA 1HW5A 4A0XA 2Q0OA 3P7NA 2A68F 2E7XA 4FT8A 4N8GA 5H6RA 2DE2A 5E8IA 2UXXA 5BPDA 1HW1A 2P5VA 4NB5A 2QQ9A 1NUZA 2FMLA 4AIHA 1YW7A 3HTSB 4F1VA 1FPJA 5H20A 1B4AA 1FPIA 1KQ9A 2XVCA 4G94A 3TDUC 5HOOA 3WGIA 2GXBA 4X04A 2WV0A 1UHWA 4IRGA 3KLOA 3IRQA 5D6FA 1INPA 2IT0A 2HEOA 5F24A 3GLXA 2LKPA 1C0WA 4P9UA 4PZJA 5E1WA 2FMYA 3ELKA 1BI0A 4MIJA 5DUIA 5CJ9A 2GAUA 2ZZXA 1S29A 1FBDA 1ONVA 1QZYA 2WBBA 4CO8A 1FC3A 3CO6C 2P6TA 1T98A 2WYPA 2MH9A 1ZLKA 1HKSA 1CNQA 2FHYA 5LGTA 2V4CA 5E1ZB 3FMQA 4LG0B 1O57A 1J0RA 2HGCA 1YLFA 1FYMA 3MCZA 2FIEA 5K5RA 3I5UA 2P5KA 5EEGA 5BMZA 3GYYA 1PP8F 2YX7A 2OX3A 4BHBA 3FF5A 5E17F 3J81Z 1O3TA 2XASA 4NGUA 2K02A 1QO0D 1S7OA 3CUOA 5IGAA 1KYWA 3O6BB 3N4MA 2RN7A 2VC1A 1WQ2A 2EFQA 2M87A 5E1XA 3O3KA 2JPBA 3EYIA 1Z91A 4KICA 3I0TA 4I02A 2H09A 2X4HA 4OA4A 2MLGA 2HR3A 1D9QA 3E5QA 3D0SA 6PAXA 2O61A 4M6XA 2KKOA 5F6FA 4A5MA 2MH2A 3VOEA 1XMAA 5LTCA 5L3CA 3D5LA 2VPNA 2G9WA 4RAZA 3E6BA 2QBYA 5J8FA 2NNNA 2NRAC 4HW0A 1W5TA 1XB4A 1HW2A 2F5CA 2XAFA 4OVPA 3WGHA 1ULYA 1USSA 2HKXA 5AONA 2ELHA 2LF8A 1JHHA 2VOOA 4P9FA 2EFWA 3GEZA 5LHHA 1RDYA 3HYIA 4MQ9F 1T39A 4GCVA 2PBIA 3EQLF 5BQTA 1R5GA 2OZUA 4IJAA 4PDKA 4XEQA 3LFKA 2BEOA 5BOXA 5D5UB 4U0VA 3RJPA 1PP7U 2O03A 1G0IA 1Y0UA 1HSJA 3L00A 2P8TA 2STTA 1G3YA 5ERIA 2HS5A 2HZTA 4R8HA 1XN7A 2EV6A 1K7AA 1LQ1A 2EB7A 2BV6A 2FNAA 3MFKA 1DPUA 3WTZA 1LBZA 1FNNA 4WCGA 1W7PB 2M30A 4YIIA 1FP2A 5DCFA 3I53A 1LBXA 3IFAA 2HQRA 4YFKF 2WEFA 2XAJA 1TBXA 2QVOA 1AWBA 2OA4A 4K2EA 2STWA 3T8RA 1AOYA 2MA3A 3W6KB 4YIFA 5DV5A 3E6DA 2P5LC 2HKOA 2OZ6A 2L3DA 2X0LA 3IKTA 4B8XA 2QQAA 4GWXA 1I1GA 1TQMA 3ECOA 5JHUA 4XLPF 2IVMA 1U5TB 4MEYF 2DLLA 2A69F 1IZ1A 1DBZA 2L4MA 3VFZA 2PN6A 3SXYA 2O3FA 1IN7A 1EYJA 3HRTA 4Y17A 1NI9A 4GWWA 5DW8A 5E20A 1U5TA 2JT1A 3B73A 3BJ6A 3CTAA 4Y15A 5LBQA 2DAOA 1EH8A 1R1UA 1ZARA 4D0PA 3CUQB 4R79A 1XGOA 5JK4A</