3T1BA

Crystal structure of the full-length aphb n100e variant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
MKLDDLNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHARKLTLTEAGERFYKDCSPLLERLASMTEEITDECRGASGRIRISAPSELTKRMMMPMFNAFMEKYPDIHIELMMSNQADDLDPTEWDVIFRVGPQRDSSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKGYPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFLEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, LysR family
publication title The crystal structure of AphB, a virulence gene activator from Vibrio cholerae, reveals residues that influence its response to oxygen and pH.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 84
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t1bA01
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3t1bA02
4FHTA 5D5XB 2UZKA 1DPUA 3M1EA 1G3WA 1PP8F 2CGPA 4P55A 2F5CA 3M7GA 2FBHA 2IJLA 1IXRC 2M5WA 1V4RA 1XCVA 3DQVC 1B9NA 1T39A 2EFQA 1B9MA 4UVCA 3K69A 3QAHA 2KJBA 3K2ZA 2K27A 1BIBA 3KLOA 3OOPA 3GYHX 3W6KB 2RV8A 2HS5A 4L5IA 4L9TA 2Q2EA 1OPCA 4Y15A 1ZRDA 4LK0F 3FHZA 1R1TA 1R5GA 3WGHA 3C1DA 1XMAA 2XGXA 2FBIA 2HGCA 3BZ6A 1YTYA 4CDGA 3CUOA 4XBFA 3CLOA 2Q0OA 2K4JA 3WTVC 4HF0A 1R1UA 4U88A 3GO5A 4ESBA 4KN4X 5FO5A 2ZCWA 3E6DA 1SFEA 2ZMEB 3LAJA 4G9YA 3FM5A 1ODDA 1YW7A 2NNYA 5JHUA 1HSJA 3BJ6A 1SD4A 2IT0A 5BS6A 2MH2A 2KKOA 5ERIA 1H9TA 1FBQA 3GVAA 3LFKA 2JZYA 4E70A 4M6XA 5LHHA 3KP6A 2YU3A 2FQ3A 3RDIA 2DQRA 2L4MA 2AXLA 3NRVA 1T98A 2QQAA 2XHKA 3I0TA 5ILSA 3L7WA 4PDKA 4LB6B 1QBJA 2E1NA 3QPTA 4CXFA 1VTNC 1XN7A 4EM1A 3GX4X 2VOPA 3C18A 4KICA 3ZMUA 1FC3A 4IXAA 4BNCA 3PQJA 3BY6A 3ABUA 4OINF 4MEXF 4G7ZF 4CYDA 1QPMA 3J80K 1YG2A 2WWYA 2A07F 4RGUA 2Q8KA 1KA8A 4YG2F 2OD5A 4L18B 4HQMA 4WK8F 1YW8A 5KK1A 2KIUA 1SFXA 1B6AA 1S7OA 4Q4ZF 1SFUA 4M74A 2ACJA 3GF2A 3F23A 1ZARA 2OA4A 4EJOA 3V4GA 5DEQA 1XCBA 3IKTA 3IRRA 2QQ9A 1KU2A 2JT1A 2XAHA 3U9GA 3P9CA 3KE2A 1U6GA 2A3SA 4MQVA 2VE9A 5J8FA 4WXHA 1ZG3A 2CO5A 1BI3A 4JVCA 3JSPA 2LF8A 4UVBA 2GZWA 2FXAA 3MWMA 4XRFA 5FLXK 2V79A 4RAZA 5BQTA 4IRHA 1ZN2A 2HFHA 3BWGA 2FF4A 5CYVA 2ZXJA 3M9AA 2DU9A 3MZHA 4CICA 1FT9A 4M9XA 3JW4A 5E1ZB 3R60A 4ON0A 3E5QA 3BP8A 2ZMEA 2FOKA 4P96A 4A0ZA 4AIKA 1WSUA 1ZH5A 4HX8A 3V7CA 1KYZA 4XSZF 1ZLKA 4AVPA 2W57A 4ZYEA 3FMRA 4O6JA 2TDXA 3E97A 1LDDA 1TQMA 1QZYA 2PMHA 3E6MA 2CQKA 2PFBA 4LK1F 3F8MA 2M30A 3I4PA 3IRQA 5D4RA 3QRFF 5D4SA 1E17A 5L3GA 1FLIA 1ZGJA 4K2EA 1T38A 2XVCA 1FYKA 3E6BA 4P9UA 3U2RA 4GYIA 2PEXA 2FU4A 2K7LA 1ZLJA 3BDDA 4MNUA 1Q1HA 1WRJA 1GXQA 3V7SA 2KJCA 4ENJA 2RN7A 4CO8A 1IZ1A 2IA0A 4LLNA 1ON2A 2FMYA 1B4AA 2YR2A 4LFUA 5DUIA 5EEHA 4RB1A 5DD4A 1ULYA 3TDUC 5FFXA 4JVDA 4ESJA 2GXGA 1ONVA 1DP7P 1K79A 2IA2A 4HX7A 1HQCA 2FA5A 2J5PA 3KLNA 3I71A 4IRGA 1U8RA 2VC1A 1MD0A 1Z9CA 4A12A 4BQAA 3CJNA 3G3ZA 1IXSB 4LG0B 3ZP5A 4GO1A 2D1VA 3GZ6A 4IF4A 3WE2A 4XLPF 1J59A 5HS9A 4GYGA 5LGNA 1JHFA 2JSCA 1O3RA 3KZZA 1RZ4A 3GEZA 1QGPA 2JRTA 2XAFA 4R1HA 3TQNA 2VC0A 2XASA 4HYEA 2XKOA 1GXPA 3HRMA 3V8JA 1G6NA 4KFCA 3FXUA 3HHGA 3V8KA 2HOEA 1SMYF 4LGWA 1HKSA 5D6EA 1W5SA 3ZPLA 3DEUA 2E7WA 5CVUA 2RDPA 4EM0B 2OQGA 1O3QA 1L3LA 1HW2A 1LB2A 2XAQA 4NHJA 5IT9Z 2VONA 2XV4S 5BMZA 4JK1X 1MJ9A 2CWEA 2PBIA 1OYWA 2STWA 4U0WA 1QNTA 3SXYA 2LNBA 1EH6A 2O61A 3RKYA 3WG9A 3M8EA 1DDNA 3CDHA 4RGXA 2YSRA 2YX7A 4KMFA 3HSRA 2ISZA 4CGZA 3HRSA 3KETA 4NQWA 3TO7A 1HW5A 3QU6A 4UHTA 3BOQA 3KP2A 2EA2A 4I09A 1KYWA 4L9VA 5F64A 2EV6A 2GAUA 1L0OC 3HUGA 1R00A 2LDUA 2ZNYA 1R23A 3RPUA 4ZYHA 1FBSA 1XGMA 4ZZDA 3TOBA 2XIGA 1CGPA 4KIFA 1MJAA 2CYYA 4S05A 1YW9A 2V1DA 4HF1A 1TNSA 4I02A 1SD6A 3WTYC 2COMA 4LG0A 3I59B 3EETA 3ULQB 4G6DA 4QBAA 3WTTC 5CJ9A 1TW2A 3FMQA 2HEOA 3B73A 1FP1D 4IHTA 3EYYA 4BHPA 5LGTA 5E17F 5A2QZ 1BI1A 2MC3A 1LEAA 2FE3A 2F5EA 5D5WB 3WTWC 1HXDA 2FMLA 5H6RA 4EVIA 2OZUA 1YIOA 4XSXF 4BHBA 4ASNA 2P5LC 3LSTA 4LJZF 2EFNA 5L3BA 1OYYA 2HKXA 1AOYA 1OMIA 4KUMA 3WGIA 1S6LA 4ZH4F 5LBQA 2ZBKA 5E8IA 2FBKA 1Z6TA 2VXZA 4MHGA 2XUBA 3M8FA 1G3TA 1BN5A 2DAOA 1YQAA 1P4WA 1F5TA 2XKPA 4L5JA 1XDUA 3J7AO 2ZFWA 3F8BA 1W7PD 3MEXA 1P2FA 1F4KA 1P4AA 3H3UA 4RB2C 1YLFA 3JSOA 2HQRA 3GW2A 3RI4A 5BPIA 5F6FA 2R7DA 4B8XA 4AD9A 5EEGA 5TJJA 3REOA 2OBPA 2FNAA 3RKWA 1IUYA 1D3YA 1P4XA 5JVTA 1BC8C 3F8NA 3TKYA 4RGRA 1XSVA 4Y13A 3SZPA 2Y75A 2H6CA 2NNNA 4B09A 2CSOA 2VBXA 4KNYA 3KCCA 3K1PA 3HSFA 5LLQA 3RYRA 1B1BA 2O8XA 5AIQA 3WTZA 3I59A 2DTRA 1IRGA 1PDNC 4M6YA 2PQ8A 3IWZA 3EDPA 1W4MA 4I2OA 1O57A 3ZMTA 1LDKB 3GZ5A 2MH9A 5HDGA 2R7FA 5CVIA 4BYYA 1XGOA 2L3DA 2PN6A 4R79A 2GXBA 2XAGA 3ZMSA 1I6XA 2QLZA 4WXCA 1D8JA 2FSWA 5ICCA 2HTSA 3KZYA 4U7DA 4LLLA 4OIRF 1UCRA 4KT5C 3WTUC 1KQ0A 1A04A 1P92A 5DV5A 3FXQA 2UXXA 3E3VA 2MBFA 4ENKA 1TBXA 3HIFA 4F7ZA 5BPDA 4O3MA 1K6OA 3VFZA 4L0YB 3GFJA 3RKXA 1HSTA 2Z33A 1UB9A 3HRUA 4G6QA 4UV8A 4LLGF 1Z05A 2NAZA 2NRAC 2M1BA 1FPQA 4OOIA 5AIPA 5J8CA 2CG4A 3TGNA 4KN7X 1T6SA 1R58A 4JQFA 1NHAA 1W7PA 3R61A 2QBYB 3F72A 4RGSA 3DPTA 1MDMB 1SMTA 3QPHA 4A5NA 4HV6A 5HOOA 4XLNF 3HSEA 5JFRA 5DDGA 3J80Z 2HR3A 4HV5A 1U3EM 3ECHA 5FGMA 5FB2A 1XGSA 1BI0A 1LJ9A 3WODF 2ELHA 2QYOA 2STTA 1J2XA 2GWRA 1KQ9A 2AS5F 5HVQC 1IAWA 4HLXA 3NQOA 5F1RA 3WU1B 3E6CC 1D5VA 4TV7A 4JBAA 1ZGAA 1HKQA 4A6DA 4RB3C 3IWFA 3J81Z 2K02A 1BBYA 2QZ8A 3QOPA 2BGCA 4D0PA 5E20A 5J6XA 3RIRA 1LVAA 4I7HA 4EGYA 1OKRA 2QVOA 1EH7A 1IN8A 4YIFA 3ERED 4A0XA 5FLXZ 3P9KA 1QQIA 1ON1A 2EA4A 2Z5UA 4M71A 1EV7A 4Q48A 3F22A 1TTYA 2L4AA 5L3EA 3GFIA 4PGGA 2D2WA 5LHIA 5HLHA 1TW3A 1KU7A 2E7XA 3MZYA 2GIVA 4MGRA 3Q9SA 4N9HA 4I0AA 1K78B 2L02A 5AONA 3DP7A 3V8LA 2A68F 5ILUA 3E5UA 5KVRA 3GFLA 3FWEA 3DXJF 4LMYA 3E5XA 2FRHA 4RS8A 3SHFA 3F3XA 1UHMA 5ICEA 1YYVA 4EJVA 2HTJA 4HDVA 1TNTA 2DO7A 5DCMB 2DQLA 5TRDA 2P4WA 5JR3A 5ILVA 2EFOA 1F1ZA 2P5KA 2X4HA 4KYWA 5CLSA 4IHSA 2V1XA 4YFXF 3ELKA 4DNCA 4CZZA 2QBYA 3L00A 2EFPA 1G4DA 2G7UA 1MDMA 3B02A 3RTRA 2BV6A 1ZRCA 4ENMA 2R3SA 3ROUA 4WX9A 3JAMZ 1W5TA 2HYFA 1ZAOA 3KP7A 4CHUA 2BBYA 4IRIA 5D5UB 2GA2A 4L9JA 2RNJA 1SD5A 4EJUA 3FX3A 1FBUA 4P9FA 4ESFA 1MGTA 3R6SA 1EH8A 3T1BA 2EWNA 2DT5A 1IN6A 5LRSA 2Y48A 3HFUA 1LDJA 1I1SA 4HLYA 4HF2A 3CUQC 1JGSA 2P7VB 3RJPA 2VODA 1KQ8A 4ENNA 3PQKA 4G7OF 3KP3A 2P8TA 4S04A 4FX0A 2CW0F 1BC7C 3OV8A 3SZTA 1QZZA 5ICGA 1UHWA 5CVVA 1IF1A 1H9GA 3ZQ7A 2DPUA 3LQRA 1JXSA 1K78A 2ETHA 2L01A 4O5VA 3EYIA 2W84A 3P9IA 1LEBA 5A2QK 3SQNA 2EFWA 2Z9OA 5K5OA 2QWWA 2A6HF 4A6EA 4HW0A 2J5OA 2K4BA 3L2CA 4MEYF 3I54A 2ZNZA 5DCMA 3GFMA 4P5OA 2F5FA 2VT3A 5ICFA 1LNWA 1WWXA 2DK8A 4BAYA 4EJWA 1GVJA 2EK5A 3DKWA 1J0RA 2L54A 1CF7A 5FD6A 3N97A 2HDCA 4UVAA 1O7FA 1U78A 4Y17A 3VOEA 3TDZC 3TO6A 1BM9A 5H6QA 3ZN1A 2JTVA 1MZBA 4WWCA 2H6BA 4OIOF 2HKOA 2A5YB 4OIQF 3BROA 4HOBA 2BEOA 2V1UA 2W85A 2DPDA 4IJAA 4HBLA 1YS6A 1REPC 2EB7A 2P7CB 4G94A 4LB5A 3LA7A 4EQQA 2Z99A 3S2WA 3ABTA 1U2WA 1IXCA 3I58A 3QP6A 2XAJA 5HLGA 5HS7A 2WTEA 3RYPA 3F8FA 1GHCA 5L3CA 2WC2A 1P6RA 1S3JA 3EUHA 2JPCA 4BH9A 2DBBA 1T0FA 1S8NA 3T5XA 3P7NA 1W7PB 2FNPA 5CVJA 2O03A 3BPXA 1RIOH 2G9WA 2LSOA 4ZYGA 1IN4A 3H92A 1B59A 4MQ9F 1ZHFA 1U5TC 2KIFA 4HDUA 3F6VA 1YS7A 1BOAA 1ZREA 5BOXA 2PLYA 4U0YA 5IT3A 2V9VA 2HZTA 4G7HF 2Y0MA 4M9SA 2ESNA 3BJAA 1U5TA 3DF8A 1FYLA 1Z91A 2NYXA 1WKMA 5LEJA 1I27A 4EGZA 3WGGA 2FEZA 2KRFA 3ECOA 3F8CA 3I64A 3EQLF 4Z2YA 2IP2A 2OAZA 4KIGA 2MLKA 1TLHB 4HAMA 4N9IA 2IA1A 1FOKA 4RB0A 1I5ZA 2V6CA 3H3ZA 4R8HA 3F6OA 5JI6A 5ED4A 4QLCU 4UUVA 2RVCA 1XSXA 4A2UA 1FNNA 4AWXB 2RKHA 4YIIA 3DV8A 2OQRA 2D1HA 2KIMA 4G8XA 3WTXC 3D0SA 1O7LA 3WE3A 1Y0UA 1J75A 4PCQA 3C7JA 4Q5SF 4ETSA 3QU3A 5K5QA 2GA1A 5DUKA 5FFZA 4A0YA 4OIPF 5CVRA 3CO6C 1BIAA 5D8KB 3R0JA 2RC4A 1RUOA 2XRNA 1RNLA 1RI7A 1FSEA 3AAFA 6PAXA 2PJPA 3L09A 4U7BA 2DI3A 3Q9VA 2RGVA 2A69F 1I1GA 1DUXC 1IRFA 3ZMZA 4U0VA 2E1CA 3MFKA 3HYIA 2YX4A 3ZN0A 2VN2A 3FXRA 4NB5A 4AIHA 5LEKA 1TQIA 3J81K 1AWCA 5K1YA 1E2XA 1G3YA 3FF5A 1G3SA 1Z6RA 1V3FA 2QENA 1IW7F 2HWVA 3LAPA 1RUNA 2DFIA 2K86A 2QM3A 5E1XA 1IN7A 2VE8A 5H20A 1JHHA 3TO9A 3HRTA 1S7AA 2F5DA 1FP2A 2IVMA 4YFKF 3VB2A 1FSHA 1STZA 1FWZA 3K1MA 3IC7A 1KU9A 5K5RA 3O2PE 3I5UA 1HBXG 2UXNA 4GXOA 3IKVA 2PMUA 2ISYA 1FX7A 3ZMDA 2X0LA 2VBZA 2WV0A 2IRFG 2VT2A 3F21A 2EJRA 1R22A 3LQQA 1HW1A 5L3FA 2P6SA 3KEOA 1J5YA 3R0AA 2O0YA 1PP7U 1R36A 5LGUA 1IN5A 3RPQA 1ZG1A 3K9TA 3CUQB 2ZJ2A 4DQ2A 4YFNF 2IPQX 4PGHA 3T8TA 3LWFA 5E1WA 2NS0A 4IPAA 2P5VA 4KMUX 4BHCA 4UNOA 2JPBA 1FYMA 1XSDA 2QUFA 5DYMA 4UXNA 1WQ2A 4M9ZA 1MKMA 3JAMK 2P6TA 3D5LA 1XB4A 1S29A 1H0MA 2DLLA 2M45A 2MD5A 3VODA 1OR7A 1O3TA 3QP5A 2VBWA 4MTEA 3T0YA 1XD7A 1TQPA 2G7HA 3K0LA 1USTA 5LRRA 4ZZLA 3JTHA 2M87A 3VEPA 1SD7A 4EM2A 2F2EA 2OU2A 3CTAA 5IT9K 2A61A 1XMKA 4HA8A 3ZMVA 2ADUA 3HTUA 3MCZA 1CF7B 2DK5A 3TOAA 4EV0A 2XROA 2C6YA 2H27A 2OZ6A 3CO7C 1UFMA 4KIBA 5HDKA 5D8LB 4OU0A 3W6JB 1YO5C 3R4KA 4QWQA 2EV5A 1KGSA 1FY7A 4EMSA 1T2KA 4M73A 1BJAA 1BI2A 2M8EA 3G73A 3PFIA 3C3WA 4Q47A 3FM3A 2GQQA 2BYVE 2ZKZA 5LHGA 3BPVA 3HHHA 5HDNA 3HOTA 4KDPA 1DPRA 4AIJA 3GXOA 1ZG5A 2D45A 3T8RA 2B0LA 3FZVA 2IW5A 2VBYA 1YFHA 4OMYA 4JVIA 2EV0A 2QQBA 1HKTA 2H94A 3BJOA 4EJTA 1XGNA 1J7KA 3U1DA 1C0WA 3FMSA 3WTSC 4MTDA 4KA4A 2PI0A 2BE5F 3MAJA 3ISPA 4IVNA 2O3FA 1X3UA 3HTSB 3KP4A 2LKPA 2UWMA 4OMZA 2Z3YA 3CUQA 2W24A 3O3KA 4PZJA 4WCGA 2H09A 1PUEE 4I98B 1LQ1A 2MA3A 4L9NA 2A6EF 5DCFA 1WI9A 1USSA 1D8KA 2DW4A 4GGGA 1OYIA 3DPLC 3IHUA 4HQEA 4A5MA 1Z7UA 3GLXA 5DD8A 3JTGA 3KEQA 3LA3A 1J9IA 3ML6A 2VOOA 1XDSA 1U5TB 4M72A 1Z1DA 5D6FA 4N0BA 2PG4A 2W25A 4I0BA 4HZFA 1MJBA 3HOSA 2YPRA 1SAXA 4FT8A 3V7RA 2HYGD 3KP5A 3GUDA 3MQ0A 3COAC 2ESHA 3N4MA 4LD5A 2O6GE 1ZRFA 3DFGA 5E8GA 4L0ZB 2ZO4A 4UV9A 1K7AA 4GCVA 3SFZA 4BXUA 4ZYDA 2HXRA 2LF7A 3IL2A 3Q5FA 4RAYA 3L9FA 3O6BB 3I53A 2HQNA 3NEUA 5HS8A 1JE8A 5FD5A 3KFWX 4WF2A 4I01A 1KU3A 1R1VA 1FZPB 5D5VB 4HX4A 2RQPA 1R5HA 1QO0D 1ZYRF 3K1NA 3WU0A 4WXDA 2MLGA 3GWZA 5HLIA 3LA2A 1R7JA 1O3SA 5E18F 2CFXA 4FX4A 1F9NA 5L3DA 4H0EA
chains in the Genus database with same CATH superfamily
4FHTA 2BHYA 4PFUA 2Z23A 1MY1A 5D5XB 3OR2C 2UZKA 1DPUA 3RT6B 3M1EA 1G3WA 1PP8F 2CGPA 2M2EA 5CMCA 1B8IB 4BEHA 4P55A 2Z2SB 4NMYA 4BKXA 3HPGA 3HHFA 1NG7A 4HXVA 2VLAA 1A36A 3OSGA 3G3IA 4HE1A 2F5CA 3M7GA 1TWFJ 2FBHA 1OJLA 3ZQCA 2IJLA 1IXRC 2M5WA 2E2HJ 4MBPA 3DEWA 4N4UA 1V4RA 1XCVA 2F7CA 4YICA 3DQVC 1JKRC 1B9NA 2ZJPF 4NQ8A 1T39A 2EFQA 1B9MA 2CUFA 4UVCA 4V19K 2HCAA 3K69A 3BIHA 2NOJB 3QAHA 3RN8A 2KJBA 2V7FA 4LQ2A 2NVUB 2M8GX 3BIGA 3K2ZA 3CR9A 4PFIA 2K27A 1BIBA 3C2BA 2D21A 2OJTA 3KLOA 3OOPA 1A6IA 4HPQA 2RV8A 3W6KB 3GYHX 2R7ZJ 1BW6A 1S5LC 2HS5A 4L5IA 4L9TA 4MH5A 4PP0A 1M1EB 1XX5A 1JUSA 2Q2EA 4BJ5C 1OPCA 4NC7A 3K01A 4RYAA 5B3SH 2JSPA 1V54H 2KPMA 2JA5J 4Y15A 1WCMJ 1ZRDA 3TFLA 4LK0F 1TFDA 2CZHA 3FHZA 1R1TA 1R5GA 5J40A 5EJCA 3S32A 3WGHA 3ZXSA 5KCMA 3OO7A 1NV4A 3C1DA 4XRMA 4DXUA 3LUYA 1YOVB 4MFEA 1XMAA 2XGXA 4XN3A 2FBIA 5E79C 2HGCA 4OZ9A 1ZR4A 5JTYA 3BZ6A 4MIMA 1YTYA 2P2AA 4CDGA 3CQZJ 3CUOA 2DMNA 2EQRA 3CLOA 2Q0OA 2K4JA 2V9KA 2XPWA 1TWAJ 4XBFA 4BL0B 3WTVC 1OVTA 3RUMA 1B52A 1BJZA 4C1UA 3JCUC 2LY2A 3TYHA 4OENA 1VNDA 4HF0A 3TQWA 1ETKA 1R1UA 4U88A 3GO5A 1A31A 4ESBA 2IS4A 4KN4X 1APLC 4E7SA 4RLQA 5FO5A 2XSDC 1ZBMA 2ZCWA 4O3AA 3TMGA 3D5RC 1FBDA 3E6DA 3D4GA 2IS2A 4XXUA 1SFEA 2LBFB 4G68C 2ZMEB 4FE8A 5J16A 1R4NB 3LAJA 4G9YA 4UABA 3FM5A 1ODDA 1YW7A 4ITVA 2NNYA 3GTGJ 3S2DJ 1B46A 4JVCA 3ONQA 5JHUA 1HSJA 2QSGX 3H0GJ 2ZZVA 4FECA 3KBZA 3BJ6A 1SD4A 2IT0A 2HAVA 2QA4I 5BS6A 4RNSA 2MH2A 2QEXI 2KKOA 2XWKA 3BTIA 5GAEJ 3H3VK 5ERIA 3TMOA 1H9TA 2PT1A 1FBQA 4QSCA 3MBPA 3NAUA 2V6EA 2FYIA 5I59A 3GVAA 4H65A 3LFKA 1FOWA 2JZYA 4Y4RA 3S3MA 4XM3A 4E70A 3QMFA 4M6XA 5LHHA 1FTZA 3BR2A 4PFWA 5CBSA 3C4MA 3KP6A 3S1NJ 2B3FA 3RZOJ 1MXVA 2YU3A 2FQ3A 4IHYA 3CIJA 3RDIA 2E1MB 2DQRA 4PUSA 5EGOB 2L4MA 2F3DA 1B4ZA 1R71A 2QVUA 3S1MJ 1SPIA 2X7PA 3MVYA 2AXLA 5IY5H 3NRVA 1T98A 2QQAA 2XHKA 3GTKJ 1UQWA 4WKMA 1VQMI 2K9MA 3ABLH 3LSLA 2FJ1A 2LKXA 5BUUA 3I0TA 5ILSA 1JW1A 3L7WA 4PDKA 2PMZN 2X48A 4LB6B 3IH4A 1QBJA 2I48A 1DPPA 1SC7A 2E1NA 4MO7A 3QPTA 1DP3A 1FOXA 1NUWA 2OK2A 3N5LA 4D7NA 1IIWA 4B48A 3OOAA 3S9LC 1RPWA 1VF9A 3QIMA 4CXFA 5EG0B 1VTNC 2VJ5A 4FCYA 2X6OA 4AUXA 1N75A 4E7IA 5GAGJ 3DBRB 1YZ0A 4GQOA 1XN7A 2XAUA 4EM1A 4LQ5A 3GX4X 4A3CJ 2K9NA 1U9OA 1MW7A 2VOPA 3C18A 4KICA 3Q26A 3ZSFA 3ZMUA 1IQ7A 4J00A 2OV7A 2DDKA 1FC3A 4IXAA 4BNCA 3PQJA 3BY6A 1FQEA 1FJ9A 3O2AA 1MIJA 2DE2A 2EIKH 4FORA 1WH5A 3VVDA 1S50A 4G2ZA 3ABUA 4OINF 4GD5A 1FPIA 4MEXF 4G7ZF 1OCZH 4CYDA 1P99A 3L2WA 3TP0A 1QPMA 1D9QA 3J80K 2HYJA 4KQPA 4DYCA 1YG2A 2WWYA 2A07F 2LVSA 4RGUA 3LR1A 2Q8KA 1A99A 4H67A 4PETA 2MGQA 5HPQA 1KA8A 4FE7A 3UNGC 1ITYA 3S1QJ 3HOWJ 1NUXA 1MMDA 3MC2A 4YG2F 4MHFA 4F3PA 5KAFC 2OD5A 2BZTA 3F9KA 2XGDA 1EJ9A 4IZZA 2XWVA 3E3KA 4L18B 3MJNA 1B8IA 3BBRA 3JZJA 3I6VA 4JXIA 2CUZA 2CFOA 5C4XJ 4HQMA 2E2IJ 1MNEA 3BG3A 4WK8F 3ERMA 1YW8A 3SJMA 1JEVA 3D4CA 5KK1A 2KIUA 4CCOA 2UVJA 1SFXA 1B6AA 1S7OA 3PL8A 2I4CA 3E9XA 2JN6A 4Q4ZF 4IHWA 1O63A 4AB6A 4XONA 2OWSA 1K83J 1SFUA 4M74A 1BR1A 2ACJA 2K3PA 3FXOA 4BDQA 3ZQGA 3GF2A 4A3GJ 4UB8C 3F23A 3S2HJ 1MNDA 1ZARA 2OA4A 3Q0VA 4EJOA 1U9NA 3V4GA 1OLAA 5E3OA 2PBWA 2Q9TA 5DEQA 4Z6YA 1B4HA 1PBPA 3CSBA 4X48A 1XCBA 3PSFA 3IKTA 2QQ9A 3IRRA 5IZ1A 1KU2A 1HOMA 1ZIUA 1D4NA 1WFXA 2JT1A 1QHGA 3GTQJ 2XAHA 3U9GA 3P9CA 3CJRB 1Y3QA 3ZOBA 3KE2A 1U6GA 5AA2D 2CMOA 4OVQA 2LY9A 2A3SA 1MXWA 3C9HA 1M5FA 1T08B 3O8GA 4MQVA 5J8FA 3JREA 4WXHA 2VE9A 1BP5A 3FATA 5A5LA 3R7XA 2VPLA 5AA2B 1ZG3A 2CO5A 1BI3A 3BR5A 2P0WA 4BE0A 3JSPA 4QPOA 2LF8A 1WJBA 3LSRA 4UVBA 5FLVA 2Y30A 5C4JJ 1Z7ME 2DTZA 4Y7NJ 2GZWA 4UACA 3QK6A 3I9V2 4BQQA 2X7QA 2YS9A 4C3IJ 2FXAA 3MWMA 4XRFA 5FKOA 2DA2A 2AXTC 2HDDA 5FLXK 2DMUA 3ONMA 2V79A 4RAZA 4ISUA 5BQTA 1VQ5I 2F5VA 4IRHA 1ZN2A 3BCAA 4QIWN 1FTAA 2HFHA 3BWGA 1Z77A 3HGGA 4RBOA 4FISA 3H0DA 1ZTYA 4U1OA 4M3EA 4LN5A 1SFKA 2FF4A 2ZXJA 5CYVA 2B63J 2ZNTA 3G3HA 4GWWA 4BDMA 3GLLA 3M9AA 3CC4I 3BR0A 1VQPI 1Y1ZA 3KN7A 4LATA 2DU9A 4OHNA 1NV5A 1NI9A 2F7AA 4OERA 2L7ZA 3MZHA 2OCUA 3BR1A 5LD2C 4CICA 1FT9A 4M9XA 2F35A 5EZHA 5EEAA 3BFTA 5CMBA 1IUFA 3T66A 1FQBA 4EQBA 3JW4A 4NHBA 5E1ZB 1T0KA 3R60A 4CZCA 5JLXA 2LFBA 2RNGA 4EF2A 4ON0A 3G7WA 5I57B 3OYGA 2KDOA 3E5QA 3GTLJ 2DMQA 3BP8A 2ZMEA 4F22A 2FOKA 4P96A 2I0CA 4ZEBA 2VI6A 4A0ZA 1SQYA 4AIKA 1WSUA 3HO7A 1DCUA 5IM2A 2A5TB 1MBJA 4O8MA 2Y9ZA 1A5JA 3C33A 1ZH5A 4HX8A 3V7CA 5IP7J 1KYZA 4XSZF 1WDNA 3IOWA 1NV2A 1ZLKA 4AVPA 2W57A 2REJA 2YJPA 4ZYEA 3FMRA 4O6JA 2TDXA 1YRNB 3E97A 1LDDA 1TQMA 5FKLA 1QZYA 4KI0E 5HNHA 1US4A 4F3GA 2MG4A 2PMHA 1N3XA 3T9XB 3E6MA 2ZYKA 3FVOA 2VHAA 2CQKA 1PYVA 2PFBA 3OYAA 2L5QA 4LK1F 3AL0C 2KIQA 4HEA2 3F8MA 3LFUA 3MWBA 2M30A 3I4PA 1QHHD 3IRQA 3PUZE 5D4RA 4H0WA 2CZLA 1DGWY 4YMAA 2A6TA 3OWTA 4YZZA 4GWZA 2JVHA 4FEBA 3R26A 4MNIA 3QRFF 2EPFA 5EGOA 2EH3A 2JA8J 2YLNA 2THIA 5D4SA 1E17A 1Q35A 3N05A 3H3GA 5L3GA 2CQNA 1FLIA 3M3KA 3SESA 1ZGJA 1LLSA 4ZE8A 1K6YA 3I3LA 1IGNA 3PV0E 4K2EA 2Z16A 4M3GA 4BACA 4D5CA 1T38A 4YIRX 2VJIA 4C3JJ 2VOZA 2XVCA 5DTBA 4PSXA 3VYUB 1FYKA 1MQIA 5CBRA 4YB7A 3E6BA 4P9UA 3U2RA 4II2A 1OQHA 5EG0A 4GYIA 4Y3OA 2XC7A 2PEXA 2VD2A 3BZCA 3CJQB 3K4LA 4N4OB 1R9TJ 2R92J 4P11A 3OS1A 2FU4A 2K7LA 1ZLJA 4D9JA 3MVXA 3BDDA 1K4SA 3A0BC 2ECCA 3G3KA 4N6PA 4PGNA 3TTRA 4MNUA 1Q1HA 1WRJA 4NQWB 3H9QA 1CE2A 1GXQA 4G61A 2Y0SA 2ECBA 2HPMA 1N77A 1IC8A 3V7SA 3VXCA 2KJCA 2MC4A 2RN7A 4ENJA 2Y7IA 1IMEA 1X1CA 3VDXA 1I6QA 3KGCA 4R2BA 4ONYA 1Z3YA 4CO8A 1IZ1A 2IA0A 2E2JJ 3FHNA 1ON2A 2FMYA 4LLNA 4NX1A 1B4AA 2YR2A 1DOTA 1MH3A 1H45A 1TWCJ 5J4VA 3WG7H 2QFLA 2W7NA 2QMXA 3EUAA 4HCWA 4LFUA 3LSPA 5DUIA 4AU7A 4I6ZA 5EEHA 4RB1A 5DD4A 5CKTA 5K2XA 1ULYA 3TDUC 2DYXA 2VKDA 5ICTA 2FOWA 3RPUD 1W36D 1QVSA 5FFXA 1VQ7I 3HUGB 3KBRA 3UK4A 2LTPA 4JVDA 1FTJA 1DU0A 2QPQA 4GX3A 3SEXA 3TL4X 2KP6A 4ESJA 1NV3A 2GXGA 1ONVA 3KG2A 1XI6A 4F2OA 4JDFA 1MMSA 1DP7P 1K79A 1UZCA 2IA2A 1II5A 1GUUA 1SYHA 4HX7A 1HQCA 2BHZA 4A3FJ 4ELQA 1WJCA 4CCJA 3CDIA 1YXIA 2Q88A 2QL3A 4A93J 2FA5A 4PFOA 1IMBA 2J5PA 4GXAA 2OX3A 1LAHE 3OSQA 4JBZA 3KLNA 4FJPA 2H98A 1N3WA 5DYHA 2RAEA 1NNFA 3I71A 3D1NI 4ZZAA 4IRGA 1JW4A 4NF5A 1U8RA 2VC1A 4PF8A 3F0CA 3ZQIA 2OCCH 1MD0A 1RR7A 1Z9CA 2MKZA 4A12A 4G6TB 3FD3A 4BQAA 1NL5A 4O94A 3CJNA 3G3ZA 3WU2C 5AA2A 1IXSB 1MDP1 4LG0B 1EYJA 3OD7A 2Y0SN 3DLLF 3ZP5A 4P1EA 1MMAA 3K4KA 2VD3A 2B7EA 2D1VA 3BQYA 4GO1A 1ACIA 1MRPA 2XD3A 3VXBA 4AC0A 3GZ6A 4IF4A 2F4MB 1Y9UA 1P7JA 3WE2A 4XLPF 1J59A 4B47A 1MMNA 2AO9A 2NVTJ 4LZ8A 1Y4CA 4U4XA 1LVKA 5HS9A 5CM6A 3O29A 4KHZE 4U23A 4GYGA 4JWXA 1I6BA 1N25A 2VPNA 4KJZA 5LGNA 4G8HA 1JHFA 2R0QC 5M5WJ 2JSCA 1O3RA 2F6GA 2VB6A 4AQ4A 4DXBA 1MY0A 2DSFA 4CSWA 1JNFA 3CMMA 2O8KA 4POXA 1A7LA 3KZZA 1G8XA 4ZDPA 1K4TA 3T0JA 1MSFC 3QXMA 1Q1VA 5J1RA 3JRDA 1B3EA 1B05A 3GBAA 3MQ9A 2RCAA 1AH5A 4YU0A 4F55A 1RZ4A 3GEZA 5GPAA 4GX4A 1QGPA 4A3IJ 2JRTA 3IP4B 1BL0A 2XAFA 4R1HA 3TQNA 2XGCA 3OXNA 4XKRA 4GL8A 3CCYA 3FISA 5ET6A 2VC0A 2XASA 4HYEA 1SBPA 4QFKA 2XKOA 1GXPA 3H6VA 3HRMA 3V8JA 4XTCQ 3FIWA 1G6NA 1FTTA 2A5TA 2NOOA 3PTYA 4KFCA 4I76A 3FXUA 3HHGA 5J47A 1KA1A 2CS3A 2VT5A 3V8KA 2D5WA 2HOEA 1SMYF 4LGWA 5EQ8A 1HKSA 4Q0CA 5D6EA 1W5SA 2ZYNA 1FTOA 3ZPLA 1YRNA 3DEUA 1SVLA 4W97A 2E7WA 1UAAA 4G4PA 5CVUA 1LCFA 1VFDA 2RDPA 4EM0B 5KDTB 3HOUJ 1BLFA 2OQGA 3CCMI 1O3QA 1FW0A 2XXQA 2X6WA 4HE0A 1L3LA 1FQDA 2CUEA 2MFZA 1SEUA 1HW2A 1LB2A 2XAQA 4NHJA 2FNCA 3TAJA 5F08A 3I55I 5IT9Z 1LGBC 4B3XA 2VONA 2DXRA 2KFDA 3DU6A 5TISC 2XV4S 4BQOA 3DBHB 3GTOJ 3H1CA 5FJ8J 1NMUA 1QA6A 2I4BA 3RQIA 3SEWA 2IS1A 3DTEA 4EDPA 2DT6A 1LBCA 5BMZA 1B5JA 2F6PA 4JK1X 2E0SA 1IXIA 1MJ9A 2LK2A 2CWEA 1PDAA 2PBIA 3T22A 4ESWA 2BY1A 1OYWA 4DBQA 2STWA 2EIJH 4Y33A 4U0WA 1QNTA 4C2TA 2IS6A 4F93B 4YKKA 4R6HA 1FIPA 3SXYA 2LNBA 4XRSG 2X6YA 1EH6A 5BNGA 2O61A 3GTJJ 3RKYA 3QSLA 4M4GA 2CEXA 1B32A 3HJEA 3WG9A 3BG6A 3DTIA 4HCYA 1B58A 3M8EA 3SDBA 1DDNA 2DVCA 3CDHA 4RGXA 2DN0A 2YSRA 2YX7A 4XKVA 4KMFA 5GTHC 2K9LA 2NVXJ 3HSRA 4KD5A 4F1YA 1XMXA 2ISZA 1INPA 2XRLA 4CGZA 3HRSA 3KETA 4NQWA 1ORKA 3PM1A 3TO7A 3K10A 1HW5A 2CH0A 2UVGA 2Y5LA 1W36C 4C2UA 2PT2A 3QU6A 1ETQA 4PE5B 4UHTA 3BOQA 2KLOA 2CZKA 3M8JA 3LL7A 3KP2A 2EA2A 3BCBA 4I09A 2R7WA 3I5OA 4MCOA 4O3CA 1SI1A 1KYWA 4L9VA 1MG1A 2DYRH 3VSLA 4E6KG 3OL4A 1SD3A 4U21A 2O9LA 2W7YA 5CI5A 3Q28A 5F64A 2EV6A 2GAUA 4DIGA 1XTAA 1L0OC 2NOGA 3HC7A 4X1BA 1UIUA 3OO6A 3HUGA 1R00A 2LDUA 2ZNYA 2KQRA 1R23A 2LG4A 1CQTA 3H06B 5AA1A 3RPUA 1YCJA 1LBZA 1R9QA 5E3NA 4ZYHA 4IO3A 1FBSA 1XGMA 4ZZDA 4MNPA 5ESYA 1YI2I 3DCFA 3TOBA 4D5FA 2GLOA 3FXLA 3FDYA 2XIGA 4ZZEA 1QZEA 4IOCF 3CG3A 1SW1A 2Y7KA 5FHNA 5AA3A 1CGPA 4FTHA 4KIFA 1MJAA 4P1LA 2F5XA 2ZXIA 2CYYA 3QQAA 4S05A 5CMMA 2X26A 3PJRA 2VQGA 5I59B 1Y0NA 1I6HJ 3A29A 1YW9A 1Z3XA 2V1DA 2DWIA 4HF1A 3S15J 2PCRA 1TNSA 4BU2A 2LH9A 1J1NA 1JW5A 3PMWA 1FPDA 4NAPA 1YE9A 1PJRA 3UIFA 2X1DA 2D3IA 1A6QA 1TC3C 2MABA 4I02A 2R71A 3GCMA 4G68B 4X1DA 4CUGA 1SD6A 3WTYC 3LSKA 3CC7I 2COMA 4LG0A 2E71A 3I59B 3EETA 1RDZA 3C34A 3N94A 3ULQB 5LTCA 1TT0A 1HLVA 1ETOA 2GFEA 2NXOA 1GVDA 3TEDA 1BR2A 2JVGA 4G6DA 4QBAA 4YB6A 3WTTC 1MBHA 1DU6A 4YEJA 5CJ9A 3DKXA 1TW2A 2R7SA 3H7MA 3FMQA 1VQ4I 2LAOA 3MSTA 3SERA 2E19A 2HEOA 1A35A 1FEXA 3B73A 1FIAA 3FGSA 3IOTA 1FP1D 4IHTA 3OSFA 1D9YA 4GOTA 4XN0A 3EYYA 1G0HA 1R6ZA 4BHPA 5DEXA 5LGTA 4AYBN 5E17F 4OVJA 2K3FA 5A2QZ 4RK2A 2OUMA 2Z8EA 5ET5A 4F3BA 2QS2A 1BI1A 3FK6A 1V55H 2MC3A 1BA5A 1TFAA 2RINA 4I99C 1OLTA 3Q0UA 1FQFA 1SAUA 1VI0A 4NGUA 4NUBA 5F1JA 4U4SA 3GXAA 2GM4A 1LEAA 2FE3A 2F5EA 2DJNA 5D5WB 3WTWC 2DT7B 2NS7A 4F2QA 2K5CA 1LBBA 1HXDA 2LD5A 4GF8A 2QCOA 2ZZWA 3OO9A 2FMLA 1S9HA 5H6RA 4EVIA 2OZUA 2B4MA 1YIOA 3DKYA 2DJIA 4XSXF 3SEQA 1K9YA 5IZZA 2YUSA 2CV1A 4BHBA 4FATA 2DMPA 4ASNA 3G1OA 2P5LC 4RMNA 4RK9A 2M9HA 4UB6C 3CMAI 3LSTA 4LJZF 4GWOA 4B3AA 2A5SA 2EFNA 5L3BA 2HQ0A 2P81A 1DTZA 3CI8A 3U8QA 5KDTA 1OYYA 3CJTB 2HKXA 4DZJA 1AOYA 2WAEA 4F29A 4HSTA 1OMIA 3IFAA 4KUMA 3WGIA 1Y3PA 4JOMA 2R7QA 2PMSA 3MZ1A 1S6LA 4ZH4F 5LBQA 4KFQA 1R9LA 3E0JB 3RPWA 1R4MB 1A40A 3CC2I 2ZBKA 4M6VA 5J3LA 1ZKGA 3HXLA 1RKMA 2BW3B 5E8IA 2FBKA 1Z6TA 2VXZA 4MHGA 3LSFB 2XUBA 1Z7NE 2I3WA 3EUHC 1KZHA 2DFEA 4QPQA 1UMQA 1D9VA 4XOPA 1T0FC 1JKQC 5ITOA 4X9TA 2JRMA 1B0LA 1WZ2A 3M8FA 4JX5A 3VPRA 1G3TA 1NK3P 1BN5A 2DAOA 3NWTA 4DZPA 4XKCA 2ZFUA 4BJ6C 2R7VA 1P1OA 3BFUA 4IY5A 3G6EI 1YQAA 1P4WA 3OIOA 2XDVA 4NN3A 1VQNI 1F5TA 3LC8A 1LBWA 4N6DA 4L17A 3G3JA 2XKPA 4LVQA 2FIXA 3KEYA 4L5JA 3OYEA 2HI3A 1XDUA 4N91A 1SDXA 4E4HA 3M1CA 3J7AO 4JSDA 1EZOA 2ZFWA 1QVTA 3E1SA 3F8BA 1W7PD 5B1BH 3FVGA 4NF6B 3MEXA 4BS9A 1LAGE 1P2FA 1F4KA 2HXIA 1SVMA 1P4AA 1XHYA 3MP1A 3H3UA 4S0HB 1X4PA 4RB2C 1FTMA 1YLFA 3LSGA 3S1RJ 2HOTA 2DE4A 3JSOA 1Z67A 2DWAA 2KISA 2DA4A 3FV1A 5EQAA 2HQRA 3GW2A 3A01B 1QUJA 5CQEA 1ZGWA 4J01A 3RI4A 1MPDA 3G3FA 1MNMC 5F0CA 5EYFA 2I10A 3VYTB 5H8HA 5BPIA 2ZXHA 5F6FA 2K9QA 4MAGA 2PMZA 2R7DA 3H9GA 4B8XA 2VP1A 4AD9A 5EEGA 1VSOA 2P3VA 3BQZA 5TJJA 2JA6J 4NNJA 3REOA 2WBDA 2Y84A 2EZIA 2OBPA 5F04A 2ONKE 5F7VA 2WAFA 2FNAA 1RRJA 3RKWA 1IUYA 1D3YA 3ECRA 1P4XA 3MVZA 2DOAA 4GBVA 5JVTA 2AL4A 4EQ7A 2FHYA 2L7KA 1BC8C 4YAHX 2CEYA 1XG1A 3F8NA 3TKYA 2MYSA 4RGRA 1XSVA 4Y13A 3SZPA 1B7UA 2Y75A 3CHGA 1S72I 2H6CA 3MKZA 1Y3NA 2NNNA 5IZ3B 3FKIJ 4R9GA 1S7YA 4B09A 3J7ZI 3H6UA 2XXYA 5IYDJ 2CSOA 5TP9B 2L2OA 5I2KA 3B50A 3A0HC 2VBXA 2DVZA 1IMAA 2IEEA 2RF1A 2Z8FA 1B7HA 1S9TA 3TW7A 5IPAA 4KNYA 3KCCA 4PDDA 4ZEDA 2L9SA 3K1PA 2HNHA 3HSFA 5LLQA 1VE4A 1YYZA 3RYRA 3S93A 1B1BA 1YX5A 4G68A 3S9EA 2O8XA 5AIQA 3WTZA 3OYNA 3FBNB 3I59A 4AS5A 2DTRA 4O7MA 1TWYA 4GWSA 1WI3A 4NF8B 1IRGA 1PDNC 3HM5A 4ZJZA 2ZZXA 1I50J 2PQ8A 3A02A 4M6YA 4DI3D 4RM3A 1IUDA 3LSJA 3ZRGA 3IWZA 5IP9J 2Y7WA 3B6WA 2A5WA 3EDPA 1W4MA 4I2OA 4F1UA 1NH3A 2DOFA 1TWHJ 2V9PA 1QPIA 2DWJA 4XF5A 1O57A 1MQDA 3LOCA 3ZMTA 2H25A 3AL0B 5M5YJ 1MQGA 1IG7A 1LDKB 3GZ5A 4ND9A 5B5EC 2P3NA 2MH9A 3CF2A 2QSFX 5HDGA 2R7FA 1FBFA 2XXRA 3FK7A 5CVIA 4BYYA 3BG7A 1RDYA 1XGOA 2NXNB 1O7TA 3PUBA 3HDDA 3FUZA 2L3DA 2HFBA 2PN6A 2CZIA 4RA1A 4R79A 2GXBA 2XAGA 1MXUA 2XXXA 3ZMSA 3EPEA 3PUWE 5H8QA 4GL0A 1I6XA 2QLZA 4WXCA 3C36A 4OXVA 1D8JA 2ELKA 4PAKA 2FSWA 2Z22A 3S17J 5ICCA 2HTSA 3KZYA 4BE1A 2YU9J 4U7DA 4LLLA 4NE4A 4XEQA 5I84A 4OIRF 1UG0A 3HPIA 2HXWA 1UCRA 3H35A 4IO2A 4KT5C 4ELRA 3WTUC 1B5IA 1KQ0A 2JWTA 2R7TA 1A04A 1P92A 1FPEA 3GZGA 5DV5A 3SEVA 3VV5A 3HKZN 5EQ9A 5ICQA 1X1AA 3FXQA 2F4OB 4IO5A 4PFPA 3K4JA 4V2GA 3L2VA 5AA4B 2UXXA 3E3VA 2QMWA 1B1HA 2MBFA 2Y5KA 3TUSA 3PD8A 3IB1A 2DA1A 5JEIA 4ENKA 1RESA 1TBXA 5EYGA 3HIFA 4F7ZA 2Q8MA 5BPDA 4O3MA 1LFGA 1K6OA 1IMDA 1NK2P 3W9VA 2BW3A 3VFZA 4L0YB 3GFJA 3PFYA 3RKXA 5EDNA 4XR6A 1HSTA 2Z33A 2XHDA 1UB9A 3HRUA 3SETA 4G6QA 5DW8A 4JYKA 4UV8A 2FIEA 2ID6A 4LLGF 2EBIA 2M3AA 4XMYA 3MVWA 4GRIA 3ZQFA 4W1UA 1Z05A 2HVRA 4A3BJ 2M4KA 2NAZA 3KSJA 4ESXA 1NH8A 4NF5B 4NF0A 2F4IA 3IAZA 2NRAC 2M1BA 2BVMA 1FPQA 2NS8A 4LIUA 4OOIA 3MKLA 3W2VA 1FJ6A 2W00A 5AIPA 5J8CA 4CYCB 3OSRA 4RPOA 2OCEA 2KDZA 1EYKA 1LFHA 3U21A 2ZC2A 3OS2A 1N7XA 2CU7A 3Q25A 4R72A 2DFFA 2CG4A 3TGNA 4KN7X 2DS9A 1EZPA 2GHAA 4P9KA 1T6SA 4NF6A 4PTKA 3MP6A 3U65A 1W1WE 1R58A 1IXHA 4ANJA 4KYDA 4JQFA 1NHAA 2L9VA 1MBKA 1W7PA 3R61A 4GRKA 1T56A 2QBYB 2ZMBA 3CSGA 1TZLA 3F72A 3V89B 4RGSA 5K7HA 3A01A 3QYTA 2CQQA 3DPTA 1MDMB 5DVJA 1LFBA 1SMTA 2REGA 2UVHA 3BT9A 3QPHA 1D1CA 4A5NA 4HV6A 5HOOA 2NWJA 3A3UA 3FXKA 5KHDA 4PBQA 5GTIC 4XLNF 2LKSA 3HSEA 3OIQA 1HDDC 3CCJI 5JFRA 5DDGA 3J80Z 1FMVA 2HR3A 3CZ6A 4BGDA 3B6CA 1V5FA 2G93A 4HV5A 2LRDA 2BXZA 3GYYA 1PUFA 3N26A 1U3EM 5L9SA 3C32A 3ECHA 3GLBA 3KOTA 4YRVA 1WJ5A 5FGMA 5FB2A 1XGSA 3HN0A 1FPGA 3IJOB 4IGTA 1SW2A 1BI0A 1LJ9A 5F27A 3WODF 2ELHA 3K6UA 2QYOA 3M3FA 3OYCA 2AHQA 1Y56A 2OTJI 3OYLA 1J2XA 2GWRA 3HBLA 2STTA 5AE4A 1KQ9A 2AS5F 5IOYA 5IZ3A 3QWLA 4NTLA 5HVQC 4PJ0C 3VE1B 1IAWA 5TP9A 4HLXA 3NQOA 4F52A 3RNNA 5F1RA 2CUJA 3WU1B 5IYBJ 1H88C 3FXJA 4FE4A 3AKZA 3W6VA 2JUGA 3EF7A 3E6CC 1D5VA 2O84X 1EA3A 4TV7A 1AL3A 2HOAA 4JBAA 1ZGAA 4BJTA 4MF3A 4XFEA 2OJED 5JLWA 2VUMJ 4N8YA 1AA7A 1HKQA 4A6DA 3GZNB 3OYMA 3ZQHA 1JP4A 5B1AH 1CB6A 3K4UA 4RB3C 3IWFA 4NF8A 4DE8A 3J81Z 2K02A 1BBYA 2QZ8A 3QOPA 2BGCA 4D0PA 2AQFA 5E20A 4EEFG 5J6XA 3RIRA 3GTMJ 1LVAA 4KYEA 2LP0A 4I7HA 5K7ZA 1JJ8C 4GDFA 5LDZA 4QTRA 4PCDA 3BTCA 4EGYA 1JVXA 1OKRA 2QVOA 2LYCA 3FV2A 3O6HA 3BLYA 5M3MJ 4QSDA 3O8HA 2M8CA 4LZ5A 3LUZA 2EILH 4PJLA 4XL9A 2O68A 3CG1A 4E0XA 2AQEA 1EH7A 1IN8A 1I3AA 4YIFA 1JETA 1O64A 3ERED 1YJNI 4A0XA 2JA7J 2L9RA 3HOYJ 3K2DA 5FLXZ 4DOZA 2OF7A 1QQIA 1ON1A 2EA4A 3P9KA 3A1YA 1H76A 3PD9A 2Z5UA 4YKPA 3T9UA 1SFOJ 2QVVA 3THIA 2VQLA 3RTFB 3A2KA 3PSIA 4F31B 3QPSA 4M71A 2JJKA 2ME0A 1YHQI 3FBIB 2BOLA 4BDZA 2XX9A 3PNTA 2KMUA 1EV7A 1MBFA 4Q48A 3K7AJ 3F22A 4JWOA 3BZKA 4A3JJ 4V2FA 3O6GA 2R5ZB 2ZXWH 3H6TA 1TTYA 3MZ9A 2L4AA 5L3EA 3GFIA 4EQ9A 4M3FA 3ROJA 1TWGJ 2D2WA 4PGGA 5LHIA 1XVXA 5HLHA 1TW3A 1KU7A 1D1AA 2R7UA 4OYVA 2RC8A 4GIZA 2E7XA 3MZYA 1P1NA 2GIVA 4MGRA 5F0FA 4HS7A 5I57A 3Q9SA 4N9HA 1AU7A 4ZECA 5AA4A 1E0EA 3TELA 4I0AA 1K78B 2HPIA 2D5VA 2O7IA 2L02A 1OR7C 5AONA 1Z0XA 3IB2A 2JA2A 1GV2A 1MXXA 4QF9A 2DOEA 3DP7A 2IGMA 3V8LA 4H46A 2A68F 2DWHA 5ILUA 1LSTA 4ZE9A 4EUOA 3E5UA 5KVRA 5I7IA 2Y9YA 3GFLA 3FWEA 1A8FA 1XC1A 2L5VA 4BDNA 4DBRA 3DXJF 4LMYA 3E5XA 1HSLA 3KX2A 2I58A 3KYDB 2FRHA 4RS8A 4F1VA 3SHFA 1Y6IA 4C0RA 4LOCA 3TTKA 3F3XA 3OIPA 4R6KA 2VQHA 3FXMA 1W0TA 4JP0A 1UHMA 5ICEA 1YYVA 3R6UA 2X51A 4EJVA 2F8DA 2HTJA 1NNPA 5GP9A 2AYSA 5DVFA 1VR5A 4HDVA 2XXUA 1TNTA 2DO7A 4O3BA 2BVLA 3CCUI 2COBA 3HGYA 1P7IA 5DCMB 4CYCA 2DQLA 5TRDA 5B7DA 3A4CA 2P4WA 2CW8A 4BDYA 1SVXB 5JR3A 1LAFE 5ILVA 2EFOA 1XVYA 3H5RA 4LIVA 2B3BA 3IR1A 2MSYA 3SFIA 2JUCA 1OCPA 1H8AC 1F1ZA 2P5KA 4KITB 5IYCJ 2X4HA 3S3OA 2OLBA 2QRYA 3P7IA 2KRCA 5I56B 5CRYA 3OEMA 4KYWA 1B7ZA 5DVIA 5CLSA 4IHSA 2V1XA 4YFXF 2R7RA 3MYUA 1G59A 3ELKA 4DNCA 3VWBA 1WPKA 2M34A 1P1UA 4CZZA 2QBYA 3L00A 2EFPA 2PX1A 2Z8DA 2QSXA 1G4DA 2G7UA 1MDMA 3BTJA 4YELA 3B02A 3RTRA 2PJRB 2VPRA 2DP8A 1CNQA 5IAIA 5DEXB 2BV6A 3RYDA 3P5JA 1ZRCA 4ENMA 2ALUA 1MBEA 2R3SA 2XXIA 3G2BA 2H1LA 3ROUA 4WX9A 3L6GA 2ELJA 1X3WB 4PE3A 2OBGA 3JAMZ 1W5TA 2WAQN 2UYFA 2HYFA 3B6QA 1ZU0A 1ZAOA 1QUKA 3KP7A 2HQ5A 2KZVA 4R74A 2O1LA 4OVSA 4CHUA 4WEDA 4ZDMA 3B7DA 2BBYA 2WYPA 4DCXA 4IRIA 3K02A 1LFPA 5D5UB 1E3OC 3OYIA 1FPFA 3V83A 2QQ8A 3DBLB 2FA7A 2GA2A 1TP4A 3H36A 2F3BA 4PFYA 1KWHA 1HC8A 4LUBA 2RC9A 3TKDA 4HW8A 4XLHA 3RQ4A 2XXPA 3VLVA 3FASA 4L9JA 2RQQA 2RNJA 1T95A 3BR6A 1SD5A 4PSWA 4EJUA 1ZR2A 3FX3A 5HM4B 1OMPA 1FBUA 4XKNA 4P9FA 1IXGA 3AG4H 2LR8A 1MGTA 4ESFA 3R6SA 4CA0A 1EH8A 5F1QA 5HBCA 3QUJA 3T1BA 2Y69H 2EWNA 2DT5A 3K4NA 1KONA 1YITI 2I0BA 1IN6A 2DCEA 2HEUA 5LRSA 5EHMA 4OA4A 5DM7F 4B1RA 1VQ9I 2Y48A 1D3KA 1K9ZA 4DXCA 3HB9A 3UP9A 4ELPA 5GADJ 1IRZA 4XORA 1B2HA 3HFUA 1F43A 1LDJA 1I1SA 4HLYA 3EPZA 4HF2A 1AHDP 2IGNA 2I5UA 4NF4B 3IAM2 4TLMB 2AIXA 3CUQC 1JI8A 4G12A 3JV9A 1YJWI 2JJ7A 4Y52J 2B4LA 1F36A 2P1SA 1LB8A 2R4GA 2RREA 3MW0A 4THIA 1LAXA 1YPNA 4IGRA 1WGXA 3GBGA 3KFMA 3U1KA 1NFTA 5ITPA 5T3JA 3IX1A 2H99A 2I8DA 1JGSA 2KRHA 2P7VB 3RJPA 3TODA 3MMYB 3VVFA 3LSIA 3OY9A 2VODA 1KQ8A 2QS4A 4ENNA 4GWXA 4I1DA 4R2FA 3PQKA 4G7OF 4IQ4A 3KP3A 5H8FB 2P8TA 1PB8A 1Y39A 4S04A 4ELOA 1MY2A 2RKMA 4FX0A 1X58A 2CW0F 1BC7C 1UTBA 4QSEA 2R7OA 4X6AJ 4HTGA 1DTGA 1ETVA 2EIMH 3RY3A 5A5XA 1JT6A 4ZEFA 3OV8A 3SZTA 1QKBA 1P9QC 1QZZA 3B6AA 3IORA 5ICGA 1JKOC 1UHWA 5L9OA 5CVVA 1Y1VJ 4RLFA 1SI0A 2XPUA 3A3CA 5ELVA 1IF1A 3T9HB 2R5ZA 1H9GA 1YJ9I 3HEFA 3ZQ7A 3HOXJ 2XWOA 4HG2A 3LQRA 2DPUA 2R5YB 1PB9A 5H8HB 1LB9A 1VQKI 3I4NJ 4KYSA 1ZKBA 1JXSA 1AWBA 1K78A 2ETHA 2VKHA 3KJ7A 2L01A 4O5VA 3EYIA 2QGUA 2W84A 1IV8A 5GAHJ 3P9IA 1LEBA 4AYBA 2M7AA 5A2QK 3SQNA 3JR9A 3FVNA 1VZ0A 2FUG2 2ZB9A 2EFWA 1BW5A 4B4CA 1UG2A 5K5OA 3ABMH 2Z9OA 2QWWA 2A6HF 4R9FA 3VDFA 4A6EA 1M5CA 1T33A 1ZELA 2A05A 2WADA 4HW0A 1G0IA 4Q30B 4R73A 4RAFA 1FTLA 2J5OA 2K4BA 5TGTA 1R5ID 1N76A 1S7EA 1RC9A 3PNYA 2WEFA 3QUFA 2GH9A 4GWUA 3PUXE 2Q2AA 4CCKA 2Y7RA 3L2CA 4A3MJ 1A8EA 3J7YJ 5I2KB 4MEYF 3CCQI 3I54A 1VDWA 2ZNZA 4A3LJ 1GDTA 4OWDA 5DCMA 3GFMA 4I40A 4P5OA 2F5FA 4XKPA 2M0MA 5ISUA 2AL5A 4ZDOA 4JX6A 3W15C 2IA4A 2L7FP 2VT3A 4GLIA 4MFIA 4F39A 5JK4A 2HPGA 3BC8A 1FTKA 2VQCA 4CH7A 5EHSA 4ZS9A 5ICFA 1LNWA 1OCOH 2VKEA 2CJJA 5IP6A 1WWXA 2DK8A 4BAYA 1D0YA 4EJWA 3PO2J 4YKIA 2WX9A 3A03A 2O7UA 2ONRA 1GVJA 2Q89A 4GX6A 2EK5A 3DKWA 1J0RA 2DDBA 5EF6A 1SW4A 2O7OA 3Q27A 1FCKA 2E60A 1X1PA 4BXFA 5HNFA 2L54A 4D1QA 1PB7A 2XD2A 5F0HA 4QXDA 3ZQQA 3UGWA 1CF7A 3GBBA 5FD6A 3N97A 4BE2A 2HDCA 1GGGA 4UVAA 1O7FA 1JQFA 1U78A 4Y17A 5FLMJ 3VOEA 2FD5A 2MD0A 3TDZC 3TO6A 4P0IA 3SDFA 4MFDA 4XLFA 3TP3A 2PJRA 3OMBA 3KIOA 2XXTA 4MJOA 2Q74A 1VQLI 4OTEA 1BM9A 5H6QA 4C3HJ 4IO6A 5IGAA 4ZYAA 4C9YA 4MX6A 2WBBA 4N8GA 4PQJA 1ZJLA 2PYYA 2GHBA 2VJ4A 4FEDA 3IOUA 1MQHA 3ZN1A 4DW6A 2E1OA 5H8QB 1IMFA 5I58B 2JK3A 2F36A 2GRVA 1AMFA 3W2AA 2ZSHB 5K7FA 3CMEI 4UY8I 2JTVA 1WJEA 1MZBA 4C30A 3M3YJ 1B5HA 4WWCA 5TU0A 1IV6A 2H6BA 4OIOF 2R93J 3B8BA 5CMKA 4I9DA 2HKOA 3F11A 2A5YB 5LFAA 2IEKA 3PUYE 2B65A 4OIQF 2K85A 2VL8A 3BROA 4I3EA 3S9MC 4HOBA 2R6GE 2HVSA 4Z7EA 1I69A 4UUTA 4OFJA 2XB0X 2BEOA 4OAZA 3ASOH 3CF5F 2H1KA 1Y4TA 4NBQA 1ZMGA 3V8XB 4BQNA 1GVCA 2V1UA 1I6AA 5CQGA 1B3HA 3CCLI 3KZGA 3G1MA 2W85A 3C2HA 1WVJA 3BKIB 4HSRA 1YAEA 3HSTA 2DPDA 4AM3A 1JUPA 3PPNA 1DBZA 3LSXA 1MQJA 5KCJB 1BKAA 4IJAA 1ELJA 4X0GA 2QKLB 1DPEA 4HBLA 5CPRB 1YS6A 1RETA 4XIDA 1GTKA 3PNVA 1REPC 2L9NA 2V25A 2EB7A 4N17A 3UA8A 2P7CB 4NC6A 4G94A 4LB5A 3IJXB 2K9SA 3PMVA 4Z0IA 3LA7A 3DPUA 2Z99A 3S2WA 4EQQA 2O69A 3FXBA 4NF4A 3ABTA 3DP6A 4E0WA 1IITA 1FBPA 4F91B 4RXLA 1LE8B 1U2WA 1X19A 2BY3A 4OEVA 4KR5A 1V5GA 3H4ZA 2EZKA 4E7HA 2V3UA 1IXCA 1QUIA 1X3ZB 2ZYOA 3I58A 4OWRB 3JRFA 2WY7Q 1B72A 1GLNA 3BG9A 3S4UA 2WB1A 3BR3A 2OC6A 3QP6A 3N6UA 4XKWA 2XAJA 2KQZA 5HS7A 5HLGA 1H3DA 2WTEA 3RYPA 5LOMA 3F8FA 1GHCA 5L3CA 5H8FA 2WC2A 3CCEI 3CRBA 3KZIC 2DODA 3MN2A 1P6RA 4OETA 1S3JA 3EUHA 2JPCA 2GOMA 1B6HA 4BH9A 2DBBA 4IHXA 1T0FA 1S8NA 3T5XA 3P7NA 2OPTA 1IEJA 3DEEA 1W7PB 3QYEA 2F48A 3S14J 2FNPA 1Y8RB 5CVJA 3CDLA 3E7LA 3ZCOA 2XA5A 4P3LA 2O03A 2R7XA 3BPXA 1HF0A 3K6XA 3RGYA 4EXKA 1RIOH 3ZS6A 2G9WA 1UHSA 2PX9A 4NC8A 2GOXB 2DE3A 2LSOA 3K2AA 3M4OJ 1A55A 5E3LA 2R5YA 4ZYGA 2WY8Q 2ZSIB 4M3BA 3MAMA 3ILTB 4PAFA 1IN4A 2H4IA 4NG7A 1NH7A 3H92A 1B59A 4YMBA 4MQ9F 3MZ8A 1ZLQA 1ZHFA 3C35A 4BDLA 1M5DA 2NVQJ 3IUOA 3DELB 4PDHA 4ZTJA 3SKPA 1U5TC 2KIFA 4HDUA 4OESA 3SEYA 3F6VA 1YS7A 1PUFB 3HG9A 2O6AA 4AIDA 1BOAA 2VGQA 1ZREA 4DLDA 1QVUA 3ABKH 3MVPA 4IO9F 1LEVA 5BOXA 3I3VA 4XRSA 2PLYA 1D5YA 3CP8A 4KXPA 4UA8A 4A3DJ 2YPNA 4U0YA 5IT3A 2V9VA 1JT0A 4FASD 2HHMA 2HZTA 1FMWA 2WB1N 4BY7J 4G7HF 3DP4A 2Y0MA 1LFIA 3AXFA 4M9SA 1N84A 4C2MJ 3KN8A 2ESNA 3BJAA 2KHMA 2ICWG 2XX7A 2E35A 4HRIA 1U5TA 1MPBA 2F97A 4C1TA 4KISA 3DF8A 3IL1B 2IGKA 3HKZA 2WBMA 1FYLA 2L0KA 4J19A 1Z91A 2NYXA 1WKMA 5LEJA 2XF5A 4RA2A 4BXXJ 5M3FJ 1I27A 1LBVA 1Y20A 2KLFA 4EGZA 1NNKA 3IO6A 3WGGA 4LA9A 2FEZA 4X04A 3C2GA 3K70C 2KRFA 1YX3A 4DIQA 4DYRA 2V84A 2I3VA 3FVKA 5HODA 3RKQA 3ECOA 3F8CA 3I64A 3EQLF 4Z2YA 3I56I 2JQ7A 1A54A 1H43A 1MPCA 5DS9A 1FBCA 2DDAA 4F92B 4B43A 2IP2A 1X2NA 4F3QA 2OAZA 5C44J 4Q5TA 1NV6A 3D5SC 4KIGA 1O4XA 1IRXA 2MLKA 1TLHB 4CCNA 4HAMA 4N9IA 4FBPA 2DQVA 4K3FA 2IA1A 2X9DA 4PK4A 2H5YA 1FOKA 3AG3H 4F18A 4RB0A 3MPLA 1I5ZA 1WJDA 2V6CA 3DWLE 4HNTA 3JRIA 3E13X 3H3ZA 1W5CC 1IO2A 1R6RA 2V26A 1B9JA 3KC1A 5F24A 3UN6A 4KPTA 4R8HA 3F6OA 1URGA 5JI6A 5I58A 1XC5A 4N07A 5ED4A 1B3GA 4QLCU 4UUVA 1OCTC 2V4CA 2RVCA 1XSXA 3KYLA 4XQFA 1RDXA 2XGEA 4A2UA 4XLCA 1FNNA 1NUZA 4MMPA 5J1UA 4AWXB 2RKHA 4YIIA 3DV8A 4YKJA 4DI4B 2OQRA 2Y7PA 2IAIA 3O66A 2HZKA 4DZ1A 2D1HA 2BJJX 2KIMA 2DMTA 4G8XA 3WTXC 2PVUA 1JKPC 5B66C 2QS3A 3I4MJ 4RAGA 2BJIA 4OEUA 4IKFA 3D0SA 2GIZA 1O7LA 5J1YA 3ZQLA 2FQ4A 3WE3A 1EU8A 2OZZA 1Y0UA 1J75A 1MXZA 3T93B 4PCQA 3RZDJ 3C7JA 3C31A 3NOHA 3WHBA 3RPLB 4Q5SF 5I2NB 4ETSA 3TTMA 4ZC3A 2X6XA 5FKNA 3K6WA 3PUFA 2O5RA 1FPLA 1JJ6C 1ENHA 2EINH 5KCJA 1N7WA 3QU3A 5K5QA 2GA1A 2VXDA 3OO8A 5DUKA 1WJAA 5FFZA 4A0YA 1PVEA 1B0HA 3ZKLA 1T8IA 1IMCA 4OIPF 2UV1A 5CVRA 3CO6C 1G2HA 5ET7A 1BIAA 5D8KB 4RJZA 3R0JA 2RC4A 1RUOA 2XRNA 1RNLA 3TCHA 2W1OA 2E34A 1LE8A 1RI7A 1Z7LA 1FSEA 2M7BA 4XICA 4IX7A 4OAYA 3CVGA 2XSJC 3HOVJ 5EZGA 4IY6A 3G4SI 1U0JA 4HNVA 3BTLA 3JRAA 5FRNA 3AAFA 6PAXA 2W4SA 3HV1A 4OANA 2DA6A 3K6VA 2PJPA 3L09A 4IEJA 4OFOA 4U7BA 2DI3A 2LMDA 3OR1C 3Q9VA 3IAS2 1Q9DA 2PFZA 2WYKA 3RLFE 2RGVA 3OEKA 4RPNA 5H8NB 1K61A 4N6KA 2A69F 5HLTA 3IOVA 1I1GA 1NTCA 1DUXC 1JUMA 1IRFA 5DT6A 2CV0A 2BXYA 4ZEKA 4ABZA 3UKGA 2L7MP 5FROA 4U0VA 3ZMZA 2E1CA 4BDRA 3TW6A 5KNLA 3MFKA 1XS5A 2HVQA 3OYHA 1OCRH 3HYIA 3TTNA 2YX4A 2XXWA 3ZN0A 2VN2A 3FXRA 3MD2A 3K4MA 1MY4A 2O1MA 4NB5A 4AIHA 1OQGA 4U22A 5LEKA 1TQIA 3J81K 3VYRB 5K1YA 1AWCA 1FQCA 1E2XA 1G3YA 3FF5A 1G3SA 4G8NA 5EQ7A 1Z6RA 3OYDA 3AG2H 1V3FA 5L8DA 5I5PA 2QENA 3QPLA 2ABHA 1IW7F 2HWVA 3Q0WA 3CFXA 3K0VA 3PPRA 4KT6A 1MH4A 1SANA 3IV5A 2BY0A 4QHQA 4PFTA 5ET8A 3LAPA 5EYHA 4EXLA 1RUNA 2DFIA 2FX0A 2K86A 2QM3A 4A3EJ 1MM6A 2ZYMA 4P47A 3U72A 2X85A 5E1XA 1OCCH 3K6GA 1LBXA 1IN7A 1I39A 4OVRA 1B51A 4JWYA 2VE8A 2ZMEC 5H20A 1JHHA 3TO9A 1OQYA 3HRTA 3EHSA 1S7AA 2F5DA 1FP2A 3DU5A 3VLWA 1WVRA 2DFHA 4E7JA 1AKHB 2IBDA 1POTA 3SEUA 4FETA 2ZJRF 1X4OA 2IVMA 4YFKF 4MEVA 1OISA 3K4BA 3CLQA 3VB2A 1FSHA 3OELA 1STZA 1FWZA 1WJFA 3H9JA 2QJEA 3FIRA 3FJ7A 2DXYA 3MP8A 5BWJA 3K1MA 3IC7A 3KN3A 4OQOA 1KU9A 3Q3SA 3MKYB 3ESWB 3OYKA 2PFYA 2E36A 4IHVA 5K5RA 3O2PE 3OS0A 3I5UA 1LFUP 1KA0A 1DQUA 1HBXG 3G1LA 2UXNA 4TQUQ 4O7IA 2LBFA 4GXOA 3IKVA 4H4KC 1NNTA 2PMUA 3EUKL 1URSA 3K00A 3M8UA 1EZ9A 2OWZA 2ISYA 1FX7A 1BIYA 4PBHA 3ZMDA 2X0LA 4KCDA 1Q1KA 3GMEA 2DA7A 4GVOA 4H5FA 2E1MC 2HOSA 3PPPA 2VBZA 2WV0A 2F7BA 3TCFA 1GR2A 4BBRJ 5DM6F 3LV0A 3TQLA 4PJJA 2XF7A 2JMWA 2UXAA 3EHTA 3TTLA 3ODBA 1QKAA 5FBPA 3CMYA 2IRFG 2V3TA 2VT2A 4I8CA 1BOBA 3MKWB 4NEDA 3F21A 2EJRA 1BR4A 1R22A 4LONB 5IOZA 1ETXA 4E7LA 5J1DA 2H9BA 4LZ7A 3W3CA 2XB5A 1R1NA 3LQQA 2XF6A 1HW1A 3RSNA 1WODA 5L3FA 1P1WA 3VLUA 1US5A 2P6SA 3KEOA 3WAEA 1AOVA 3GTPJ 1J5YA 1USYH 3V42A 1Y1MA 3R0AA 2O0YA 1X1BA 2G0EA 5FHMA 4AB5A 1PP7U 1POGA 1NV7A 4PJMA 3CCVI 1R36A 5LGUA 3CP2A 1UJ8A 4M1VA 4DYQA 3JRGA 2V93A 1UTBB 3RTWB 1IN5A 4EF1A 4G8MA 3RPQA 5E3MA 1ZG1A 2CRGA 3K9TA 4MLOA 5A5XB 3CUQB 5C3EJ 4QFPA 3U92A 2ZJ2A 4CCMA 1URDA 2HAUA 3ILUB 4IR8A 4U2RA 4DQ2A 4YFNF 3E78A 3EQ1A 2IPQX 1V5EA 3JRCA 3RQTA 3B6TA 1R49A 1H89C 4PGHA 3HZJA 1DK4A 1F9BA 3OENA 1FSAA 1D0ZA 2GBYA 3CCSI 3T8TA 5TPAB 3LWFA 4XOTA 3FJGA 1RR8C 4XKBA 5E1WA 1NV0A 4A3KJ 4U1ZA 2NS0A 4IPAA 2P5VA 3OL3A 1HA8A 3LBSA 4KMUX 4BHCA 3H03A 3O9PA 4JX4A 1SVOA 2F6CA 4AVZA 4UNOA 3L1PA 2XXHA 3RPLA 1OVBA 4HE2A 1B40A 2JPBA 1FYMA 1XSDA 4I3YA 5I2NA 2QUFA 4NDLA 2NVYJ 2TRTA 3Q29A 1IJWC 4D7MA 5M2VA 5DYMA 1MY3A 4F3SA 1OFCX 4UXNA 1GV5A 1TT1A 1WQ2A 4M9ZA 1MKMA 1RKWA 1WH7A 2CW7A 4L5EA 4IQJA 4HNUA 3ZKKA 1POY1 2WAQA 3JAMK 2P6TA 3D5LA 4BUPA 4OMBA 1FJLA 1XB4A 3FBPA 1S29A 2IGOA 2LLKA 1H0MA 2DLLA 1BTJA 2B9SA 3PGFA 4M3DA 1N04A 1MXYA 4IOAF 2OTLI 2M45A 2FVZA 4II3A 4F19A 2MD5A 4QFLA 3VODA 1ZK8A 4EATA 1OR7A 3LMMA 2WV1A 5CC2A 1XPXA 1DMBA 1O3TA 3QP5A 2XX8A 1XS9A 4GFRA 2VBWA 3BG5A 4MTEA 3T0YA 3KOSA 4R75A 4FAJA 3AG1H 3DP8A 1XD7A 3VSKA 4MLVA 1TQPA 2G7HA 3K0LA 5FRMA 1EF4A 1NV1A 4H8JA 5FTIA 1USTA 5LRRA 1WHUA 2G29A 1FBGA 5H8NA 2V4JC 3UORA 4ZZLA 4BBSJ 3QYBA 3JTHA 3DLAA 1MDQA 2M87A 2M4GA 1Y8QB 3VEPA 1SD7A 4NWDA 3N6TA 4EM2A 1GT0C 3V5AA 2F2EA 2OU2A 3CTAA 3FKJA 5IT9K 2Q2CA 2A61A 2NUVA 5KZTA 4BDOA 4P1WA 2P0SA 2VKVA 1XMKA 4HA8A 3LNQA 3ZMVA 4FIMA 2ADUA 3HTUA 3MCZA 4RM2A 1JTYA 3J7AY 1CF7B 2DK5A 4IL6C 3TOAA 5JVGF 4N4NB 3U93A 3ZGKA 4EV0A 2WA0A 3X2QH 2XROA 1B1XA 2GXAA 2C6YA 2H27A 2OZ6A 3CO7C 1UFMA 2XWIA 3D1RA 4KIBA 5HDKA 5D8LB 1XOCA 1USYE 4TOZA 4OU0A 3W6JB 4A69C 4GXSB 3TBIA 1YO5C 3R4KA 4XLAA 1N0TA 1LUJB 4OVTA 5M5XJ 4QWQA 1ETWA 3CFZA 5FTHA 2M0CA 3L2UA 1X2MA 2EV5A 2MW8A 2H8RA 1SYIA 1KGSA 3EN3A 3VVEA 3G71I 1FY7A 1MS7A 4EMSA 1T2KA 4DGWB 1JVYA 5L9MA 4UUSB 4M73A 4RY1A 1BJAA 1AKHA 1W0UA 2KT0A 1EYIA 1BI2A 2M8EA 3G73A 2E1SA 3PFIA 1ATGA 1B3LA 4NWCA 3C3WA 4Q47A 2O51A 4IB2A 3FM3A 2QF7A 2DXIA 2GQQA 1AIVA 4IO4A 3JRBA 2BYVE 2ZKZA 2HQAA 3S3NA 5LHGA 3BPVA 3L2QA 3LSWA 4XLEA 3SDGA 3PPQA 1SW5A 1TXFA 4N13A 1E3HA 3HHHA 5HDNA 4H8IA 2F78A 2WKYA 3JYRA 1D1BA 3HOTA 4KDPA 3KC0A 1DPRA 2KR0A 4AIJA 3GXOA 3LSMA 1ZG5A 3T8RA 2D45A 1ZQ3P 3KSXA 2VJJA 4N81A 2Z1DA 3VFJA 2ME6A 2B0LA 3FZVA 3H5NA 2IW5A 2VBYA 2HXOA 1YFHA 4OMYA 2R9JA 4N15A 4JVIA 3S16J 3W2WA 2EV0A 5EYRA 3G3GA 1UTHB 2QQBA 1HKTA 2H94A 2UUZA 3AFHA 2CQ7A 4QFOA 1QU3A 3TCGA 3BJOA 4EJTA 1TT5B 1LCTA 1XGNA 4GBWA 1J7KA 3HCQA 4QFNA 3MPKA 4I62A 2V3QA 3OMYA 1JEUA 3U1DA 1YTVA 3L2RA 1C0WA 3FMSA 3QAXA 1JGGA 3WTSC 1VFCA 1RYOA 3CFLA 1RKTA 2VASA 2FBPA 4MTDA 3UR3C 3RCOA 2DOJA 2X1CA 3K4CA 4AS4A 3NWSA 4BEHB 2HU9A 3PU5A 3EKIA 1M5BA 3TPAA 2EZHA 4KA4A 1B72B 2PI0A 1Y1WJ 3OYFA 3MZBA 2BE5F 1VQOI 3MAJA 3ISPA 4IVNA 2VIXA 2O3FA 1X3UA 2Y2ZA 3HTSB 3KP4A 3M3LA 2IXSA 3DTKA 2EZLA 2DA3A 3VYSB 2CV2A 2CQXA 4G77A 1LPQA 2OWTA 2LKPA 4XKQA 2UWMA 3U1OA 4OMZA 2Q8JA 3T9VA 2Z3YA 3CUQA 5FHOA 2W24A 4IO7A 2E5NA 1QW0A 3O3KA 4PGPA 2XPVA 3ZR8X 3SZGA 3O6IA 2QS1A 3DM0A 1L5TA 4PZJA 4MLQA 1PC3A 3WHCA 4WCGA 3IFCA 3HOZJ 2ZNSA 2H09A 4LITA 3IB0A 5TPAA 2QSHX 3H6WA 1B3FA 4DCYA 1PUEE 5H8SA 4U87A 2Q2EB 1QJMA 3WAFA 4I98B 4CCLA 1LQ1A 4GWYA 4P8BA 2MA3A 4L9NA 3SEZA 2HZLA 2A6EF 2ANJA 1OLCA 2XXVA 3RT8A 2DA5A 1FPBA 5DCFA 3PIPF 3TDJA 4PF6A 4LG3A 1WI9A 3MUQA 1MBGA 1USSA 1UELB 2BY2A 1D8KA 2X1EA 4TLLB 3PO3J 2DW4A 2QKMB 4GGGA 1ETYA 4JB7A 3FJMA 2CMPA 1OYIA 2HDWA 1FQAA 3QODA 1KZ8A 3DPLC 3IHUA 4HQEA 4A5MA 1FBHA 2N8GA 1FRPA 5JTYB 1BK4A 1QGXA 3CESA 4H1XA 1Z7UA 2KZGA 3E79A 1MM7A 3T96B 4Q8RA 1LBYA 3GLXA 1E3PA 3LSHA 2W48A 2Q1ZB 5DD8A 2F34A 4LP2B 3JTGA 1N78A 3KEQA 4XK4A 4JSOA 4QRZA 5I56A 1JTXA 3LA3A 4PAIA 3S9NC 1J9IA 3S2VA 3KJTA 2W82A 1QRYA 3S8PA 3ML6A 4OVPA 3PIOF 4H45A 4PFRA 2VOOA 5IKBA 1TL8A 1VFEA 1XDSA 1PEBA 1IDZA 1EH3A 1QULA 1U5TB 2UYEA 4XIGQ 1VQ8I 3CCRI 2QVRA 4ZEIA 4H5GA 4M72A 2HZDA 1Z1DA 2Y31A 3M07A 5D6FA 3QOEA 4N0BA 2RCBA 2PG4A 3QYFA 2VPOA 2W25A 4GFBA 4OFLA 3W9WA 1X1DA 1J09A 2K40A 4XNFA 5J4YA 3EHUA 4I0BA 5K2YA 4ECFA 4HZFA 4MNCA 1MJBA 3HOSA 2YPRA 1Z21A 1U8BA 3E4RA 4PJNA 4BLAA 3O28A 1SAXA 3IO4A 4FT8A 3V7RA 4YB5A 2E5ZA 2HYGD 3U94A 3KP5A 3GUDA 3MQ0A 1FPJA 5H2FC 4ZTFA 4P56A 3COAC 2GQ1A 1DSNA 2ESHA 3N4MA 3O97A 1HCRA 1HSEA 1MMGA 5DTDA 2KL4A 4LD5A 1H44A 1PBQA 1D0XA 2TCTA 1IDYA 3TZAA 2ZNUA 4ZDLA 5JHFA 2O6GE 3ASNH 1NG6A 3KPHA 1ZRFA 2ONSA 1NUYA 3DFGA 5E8GA 4L0ZB 2ZO4A 2LOOA 5KAIC 4H6DA 4UV9A 3K70D 3L6HA 1YIJI 2XXKA 2H8WA 1M5EA 4X1EA 1K7AA 1MSEC 3PUVE 2LREA 4GCVA 3SFZA 2ID3A 3NARA 3SYTA 4BXUA 2LF7A 4ZYDA 2HXRA 4X8RA 3CD6I 3IL2A 5GPCA 3Q5FA 4PC9A 5B70A 3PMXA 4RAYA 3L9FA 3DLNA 2LC2A 2DYSH 3KYCB 4WEPA 4UUSA 3PPOA 4R6YA 3USDA 3O6BB 4WXJA 3I53A 2I6EA 2HQNA 3NEUA 5HS8A 3JRHA 1XT8A 1JE8A 4DDDA 5FD5A 1FBEA 2R8TA 3KFWX 3A09A 4P0GA 4POWA 3TEPA 4FQGA 3IH2A 5FKKA 4WF2A 3HPHA 3IK6B 4I01A 1KU3A 1R1VA 1GV8A 1ERDA 2UVIA 3OYBA 1FZPB 3KEIA 5D5VB 4HX4A 4KCCA 2RQPA 1NKXA 4RDUA 1R5HA 1LKXA 3IH3A 1UIVA 1P1QA 2ZJQF 1DGRM 1QO0D 1ZYRF 3OOUA 3K1NA 3WU0A 3OYJA 3HL2A 1I3QJ 4BY1J 4MIJA 4WXDA 2I49A 2MLGA 1HDPA 4PFBA 4DJAA 2V1NA 3GWZA 5HLIA 4E7ZA 3H5AA 3LA2A 4E7KA 1ANFA 1UTHA 4QSHA 1EKEA 1R7JA 1O3SA 1VQ6I 5E18F 2ZXTA 2CFXA 1FOYA 2LY1A 4FX4A 5FKMA 1F9NA 1ZTRA 2RC7A 5I3SA 5L3DA 9ANTA 1OIBA 4H0EA 1RYXA 1FPKA 4B44A
chains in the Genus database with same CATH topology
4FHTA 5D5XB 2UZKA 1DPUA 3M1EA 1G3WA 1PP8F 2CGPA 4P55A 4HXVA 4HE1A 2F5CA 3M7GA 2FBHA 2IJLA 1IXRC 2M5WA 4N4UA 1V4RA 1XCVA 4YICA 3DQVC 1B9NA 4NQ8A 1T39A 2EFQA 1B9MA 4UVCA 3K69A 3BIHA 3QAHA 2KJBA 3BIGA 3K2ZA 4PFIA 2K27A 1BIBA 3KLOA 3OOPA 3GYHX 3W6KB 2RV8A 2HS5A 4L5IA 4L9TA 2Q2EA 1OPCA 4Y15A 1ZRDA 4LK0F 2CZHA 3FHZA 1R1TA 1R5GA 3WGHA 1NV4A 3C1DA 1XMAA 2XGXA 2FBIA 2HGCA 3BZ6A 1YTYA 4CDGA 3CUOA 4XBFA 3CLOA 2Q0OA 2K4JA 3WTVC 4HF0A 1R1UA 4U88A 3GO5A 4ESBA 4KN4X 5FO5A 2ZCWA 1FBDA 3E6DA 1SFEA 2ZMEB 5J16A 3LAJA 4G9YA 4UABA 3FM5A 1ODDA 1YW7A 2NNYA 5JHUA 1HSJA 2ZZVA 3KBZA 3BJ6A 1SD4A 2IT0A 5BS6A 2MH2A 2KKOA 2XWKA 5ERIA 1H9TA 1FBQA 3GVAA 3LFKA 2JZYA 4E70A 3QMFA 4M6XA 5LHHA 3KP6A 2YU3A 2FQ3A 3RDIA 2DQRA 2L4MA 2F3DA 2QVUA 1SPIA 2AXLA 3NRVA 1T98A 2QQAA 2XHKA 3I0TA 5ILSA 3L7WA 4PDKA 4LB6B 1QBJA 2E1NA 3QPTA 1NUWA 4CXFA 1VTNC 1YZ0A 1XN7A 4EM1A 3GX4X 2VOPA 3C18A 4KICA 3ZMUA 2DDKA 1FC3A 4IXAA 4BNCA 3PQJA 3BY6A 1FJ9A 2DE2A 3ABUA 4OINF 1FPIA 4MEXF 4G7ZF 4CYDA 1QPMA 1D9QA 3J80K 1YG2A 2WWYA 2A07F 4RGUA 2Q8KA 4PETA 1KA8A 1NUXA 4MHFA 4YG2F 2OD5A 2XWVA 4L18B 4HQMA 4WK8F 1YW8A 5KK1A 2KIUA 1SFXA 1B6AA 1S7OA 4Q4ZF 1SFUA 4M74A 2ACJA 3GF2A 3F23A 1ZARA 2OA4A 4EJOA 3V4GA 2Q9TA 5DEQA 1XCBA 3IKTA 3IRRA 2QQ9A 5IZ1A 1KU2A 2JT1A 2XAHA 3U9GA 3P9CA 3KE2A 1U6GA 4OVQA 2A3SA 4MQVA 2VE9A 5J8FA 5A5LA 4WXHA 1ZG3A 2CO5A 1BI3A 4JVCA 3JSPA 2LF8A 4UVBA 2GZWA 2FXAA 3MWMA 4XRFA 5FLXK 2V79A 4RAZA 5BQTA 4IRHA 1ZN2A 1FTAA 2HFHA 3BWGA 4LN5A 2FF4A 5CYVA 2ZXJA 4GWWA 3M9AA 2DU9A 1NV5A 1NI9A 3MZHA 4CICA 1FT9A 4M9XA 3JW4A 4NHBA 5E1ZB 3R60A 4ON0A 3E5QA 3BP8A 2ZMEA 2FOKA 4P96A 4A0ZA 4AIKA 1WSUA 5IM2A 1DCUA 4O8MA 1ZH5A 4HX8A 3V7CA 1KYZA 4XSZF 1NV2A 1ZLKA 4AVPA 2W57A 4ZYEA 3FMRA 4O6JA 2TDXA 3E97A 1LDDA 1TQMA 1QZYA 2PMHA 3E6MA 2CQKA 2PFBA 4LK1F 3F8MA 2M30A 3I4PA 3IRQA 5D4RA 4YZZA 4GWZA 4MNIA 3QRFF 5D4SA 1E17A 5L3GA 1FLIA 1ZGJA 4K2EA 1T38A 2XVCA 1FYKA 3E6BA 4P9UA 3U2RA 4GYIA 2PEXA 2FU4A 2K7LA 1ZLJA 3BDDA 4PGNA 4MNUA 1Q1HA 1WRJA 1GXQA 4G61A 3V7SA 2KJCA 4ENJA 2RN7A 1IMEA 4CO8A 1IZ1A 2IA0A 4NX1A 4LLNA 1ON2A 2FMYA 1B4AA 2YR2A 2QFLA 4HCWA 4LFUA