1ATGA

Azotobacter vinelandii periplasmic molybdate-binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
231
structure length
231
Chain Sequence
ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYVLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords PERIPLASMIC MOLYBDATE-BINDING PROTEIN
publication title Ligand size is a major determinant of specificity in periplasmic oxyanion-binding proteins: the 1.2 A resolution crystal structure of Azotobacter vinelandii ModA.
pubmed doi rcsb
total genus 80
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA02
4ZECA 4KQPA 4YAHX 2O7UA 2VGQA 1HSLA 4R72A 3MVYA 2I0BA 3I3VA 3IO6A 4WKMA 4DCXA 1MY4A 5L9SA 4OFOA 1GVCA 3TCHA 1R1NA 1DPEA 1N3WA 4R6KA 3JYRA 1Y4CA 1IUDA 4YKPA 4P0IA 1UTBB 1AOVA 3MP1A 1EZOA 3SKPA 3HPIA 3KN3A 1Q1KA 2D21A 1FTLA 1B52A 2OZZA 1OLAA 2QPQA 3TELA 4HCYA 4M1VA 1I6BA 3ONMA 3FV2A 1B3HA 3Q29A 4G68A 1PB7A 1IXIA 1SYHA 1NH8A 1B1XA 4RK9A 1EH3A 5B70A 2RC8A 1NMUA 1BKAA 3USDA 4XKPA 1FTOA 1F9BA 2DWAA 1O64A 5JTYB 2O1LA 1MM7A 3BBRA 5AE4A 1B7HA 4G8HA 2D5WA 1IXHA 2D3IA 2XXPA 1RYXA 3MC2A 3JZJA 2Q9TA 2R9JA 2QS1A 4C1TA 3K6UA 3MVXA 2ZXTA 3LR1A 4LATA 2RCAA 4N07A 3O6GA 1I69A 1N84A 3ZKLA 4F3SA 5FHNA 2P2AA 3IB0A 4DXUA 3C34A 3MW0A 1Z7ME 1B9JA 3PUWE 3PUZE 3UGWA 2QMWA 1B3LA 4OENA 4EF1A 1RKMA 4I8CA 4FEBA 3JV9A 4JSDA 2OJTA 1USYE 5HBCA 2H5YA 4F3PA 2PT1A 1MY3A 3TEPA 3VE1B 3KGCA 3QUFA 3VV5A 4FJPA 4POWA 1MY2A 1S9TA 5I56B 4H8IA 4GXSB 4HTGA 5TPAB 4DLDA 4ZE9A 5JK4A 3V8XB 4GFRA 3LSLA 1EU8A 2XXWA 5CC2A 3E3KA 3R7XA 3O97A 1D3KA 2FA7A 1YPNA 4ZZEA 5H8QB 5CMBA 3K01A 3HHFA 1NKXA 3H7MA 3O66A 3DP6A 1B5JA 2RF1A 5DVJA 2ZYOA 3Q28A 1B3EA 4EXLA 3R26A 2LAOA 4R9GA 1HSEA 2DSFA 4JWXA 1IEJA 2PX1A 4E0WA 5BUUA 4OHNA 3IOVA 3CFLA 1QJMA 1QKBA 4KI0E 4LONB 4EUOA 3S9EA 4OETA 2ALUA 1MPCA 2Q88A 2PMSA 2AYSA 4H6DA 4YICA 3N94A 3UP9A 3HO7A 4KYDA 4O3CA 4F1YA 1BIYA 1SW5A 2HZLA 1LFGA 2GH9A 1Q35A 1PC3A 2CMOA 5I59B 2I49A 4F2OA 4PETA 2DVZA 1MXYA 4FORA 2H4IA 3TTMA 4OMBA 4LZ7A 1DTZA 4QFOA 4THIA 2Y7RA 3MZBA 1Y4TA 2AIXA 3WAFA 1QUIA 1B32A 2DE3A 1SW1A 1A8EA 4PFYA 1OIBA 2F7BA 3OENA 2Q8JA 2IA4A 4OZ9A 3QSLA 1OQHA 3IAZA 3CSBA 1NNTA 3PUXE 1LBCA 3IO4A 1IZ1A 1SQYA 5HM4B 4AB5A 1N7XA 3RN8A 4XKRA 4QFNA 4GVOA 3S9NC 3U92A 2HFBA 2F6PA 5FTHA 3PPQA 1FQCA 3ILTB 3MUQA 4IO6A 3A3CA 3W9VA 4EXKA 5CMMA 4NF4B 3TDJA 3QIMA 3FVOA 3QXMA 1OLCA 2NWJA 1MDQA 3PPOA 1B4HA 5A5XA 2QS3A 4FATA 3OMBA 1QKAA 2F35A 2F36A 3W15C 4NF8B 3FXQA 1OVTA 3T9UA 3SEYA 1B5HA 2DYXA 3IJOB 2O68A 1KWHA 2OWSA 1FTKA 1BP5A 4OYVA 2F8DA 2ESNA 1ZJLA 2BJJX 4BDOA 4F31B 3W9WA 4IO3A 4R75A 3MJNA 3CR9A 2QSXA 4Q30B 3TPAA 3N5LA 5CRYA 3HCQA 3IX1A 5H8NB 1PB9A 3IK6B 1ZMGA 1NL5A 4ZEIA 2XX7A 1MXUA 2Y7PA 3FVKA 5AA2A 2I4CA 4RPNA 3CG3A 4GOTA 2DWHA 3UORA 2PBWA 3OEKA 1MXXA 5FHOA 3SESA 3H06B 2O69A 3Q25A 5H8HA 4ISUA 1MQHA 4IO4A 2ZNUA 4EQBA 2XXIA 4R74A 1PDAA 3FATA 1MQDA 1FQBA 4HS7A 4F22A 3VFJA 1P1WA 1O63A 4TOZA 1LCFA 4RA1A 5ELVA 3U1OA 4I62A 1FW0A 1NNFA 1JQFA 3N26A 2O7IA 4X48A 1J1NA 3E13X 1LAGE 3VLVA 4F39A 3OD7A 4KR5A 1SYIA 3VXBA 2R71A 4C1UA 1POTA 3B6QA 3OELA 3R6UA 4MLVA 4LA9A 4Q8RA 3RGYA 4JWOA 3FJMA 3DELB 3PV0E 4YB5A 3TCGA 2GRVA 3G3HA 3C9HA 1JETA 4ELRA 2RKMA 2H25A 2UXAA 2Z8FA 4ZEFA 4KCDA 1US4A 4U23A 2UVGA 4IY6A 2I4BA 2B3FA 3O2AA 1LFHA 1II5A 1PB8A 3PD8A 1UTHA 4XIGQ 1R9LA 4RJZA 3K02A 4XKNA 1IITA 3V5AA 3EHUA 3G3GA 3TZAA 3K00A 4ELPA 4G2ZA 2H98A 1MY1A 4MBPA 5DTBA 1O7TA 2I3VA 1A40A 3O29A 3B6WA 4YZZA 3UA8A 1B1HA 3KN7A 5TP9A 1TT1A 2ONSA 3U94A 5DVIA 3K1MA 4DXCA 2XD3A 4PQJA 4IO2A 2Y7KA 1UIVA 5CBRA 4QSDA 4X1BA 3SEXA 1B3GA 3N6TA 2THIA 1GV8A 3SDFA 5LOMA 1IIWA 2O84X 1LAXA 1M5EA 4O3BA 1XVYA 1VFDA 2XXRA 4G8MA 2B65A 3TQLA 3K6VA 1QUKA 3OO7A 3SERA 2NUVA 5ICTA 1Y9UA 3MBPA 1P1QA 3RT8A 3OO9A 4ECFA 4OEVA 2KLFA 2REJA 3MPKA 1UQWA 1RYOA 1Y3PA 2F78A 4HCWA 5ICQA 4OESA 1IXCA 1URGA 3LSWA 2V25A 5KDTA 4U22A 3T9XB 3V89B 5H8FA 4LZ5A 2H99A 3N6UA 1NFTA 2NVUB 3TAJA 1L5TA 3H6VA 1SW4A 3H3GA 2V3UA 4QHQA 3C31A 2X7PA 4RYAA 4XKQA 3DM0A 1B5IA 2HAVA 1N3XA 1MDP1 1JVXA 2I58A 3LSXA 4GL8A 3O28A 2OLBA 4G77A 4DIGA 3Q27A 1R9QA 3FASA 1IQ7A 4QFPA 1WDNA 4GL0A 3M8UA 1GGGA 4UACA 5F1QA 1JW5A 3HV1A 1SI0A 3LBSA 2DWIA 4U4SA 2F5XA 5JTYA 3H6WA 3RY3A 3TCFA 1M5DA 3FJGA 4ZEBA 4I1DA 1XS5A 3TTNA 4DCYA 3VVFA 2F97A 3O6IA 1B0LA 3VDFA 3T9HB 3TTLA 5CBSA 1D4NA 4M4GA 4YU0A 1OVBA 1P99A 4GLIA 1URDA 3MP8A 3RUMA 2OBGA 4KYSA 1OQGA 4NF5A 1FTJA 3FGSA 3KEIA 3GBAA 2RCBA 3D4GA 5L9OA 3C33A 1LB9A 1SW2A 3ILUB 2OCUA 4Z0IA 1MH4A 3B7DA 1MM6A 4EQ9A 3A3UA 1QUJA 3FZVA 2HEUA 4AQ4A 3TMGA 2I0CA 4JXIA 5IKBA 1FQEA 1US5A 4IO7A 1N0TA 2I48A 1MPDA 2DVCA 1JW4A 4DZ1A 4NF6A 3CRBA 2F34A 4FE8A 4BLAA 3GZGA 3MVWA 4DE8A 1B7ZA 1YTVA 1LFIA 3H6TA 1YCJA 3F11A 3G3KA 4OQOA 2UYEA 5L9MA 3TQWA 3H4ZA 5H8QA 4NWDA 1VSOA 5DYHA 3FD3A 2NOOA 4AB6A 1B46A 1AL3A 2P1SA 1DTGA 2O6AA 3U72A 1AMFA 2XHDA 4U21A 4KFQA 1H76A 3BFUA 5I2NA 1M5CA 2Q2CA 3L6GA 3PUVE 1FQAA 1D9YA 5AA3A 4F2QA 3TODA 4BDMA 1S50A 4GQOA 4UA8A 4PFTA 1ANFA 5A5XB 3BFTA 1B58A 5I58A 2DE4A 3IL1B 4ESXA 1R6ZA 3RQTA 1LB8A 1EZ9A 5ITOA 3U93A 5CM6A 5I2KA 5KZTA 3PUYE 3UK4A 4PE5B 2H9BA 4YB6A 4F19A 2A5SA 2ZNSA 4E0XA 5L8DA 5DEXB 4N13A 1B7UA 1NH7A 3HHGA 2HAUA 4ELQA 2DXRA 3WAEA 3FVNA 3CVGA 1FQFA 2WKYA 3DP4A 4U1ZA 4EQ7A 1QW0A 3DP8A 2E1SA 1P1NA 5BWJA 1M5BA 3VVEA 3IOWA 1TWYA 5AA2B 4KHZE 1XT8A 3K2DA 2DE2A 5KCJB 4OWDA 4IO5A 4RPOA 3TYHA 2XXHA 2I3WA 2RC7A 3KBRA 4Z7EA 2YPNA 1DMBA 4F29A 1A8FA 5IAIA 5H8HB 3RNNA 2Z8EA 2Z23A 2Y7IA 3C35A 4RK2A 4F3GA 3GBBA 4FECA 4R73A 5CMCA 4Q5TA 3T93B 5I57A 2Q89A 5HPQA 2GHBA 4G8NA 1B4ZA 4L17A 1BLFA 3OEMA 3K0VA 5F7VA 1D9VA 2AL5A 1HSJA 4MLQA 4OTEA 1Y1ZA 3KOSA 1MY0A 4O3AA 3CSGA 4QRZA 3ZS6A 4GWOA 3SEUA 4MF3A 1VE4A 1PEBA 1EZPA 3IJXB 2XXXA 1JNFA 2DOJA 4XXUA 3IORA 3K1NA 3L6HA 5ITPA 3IR1A 2QJEA 3G3FA 2QS4A 1M5FA 2OK2A 3T96B 3DLNA 2A5TA 1B3FA 3KN8A 2HXWA 2ONRA 4RXLA 3MZ1A 4PFUA 5H8NA 4H1XA 3CIJA 3RLFE 1N04A 3S9LC 1UTHB 1Y3NA 1S7YA 3HN0A 3MWBA 4GXAA 2R6GE 5AA4A 1Y3QA 2OWTA 3MAMA 2VD3A 2XXUA 4MFIA 1SDXA 4YMBA 1LBBA 1DOTA 4BDNA 2Y7WA 5H8SA 4JB7A 3EN3A 1H44A 3PD9A 1AIVA 3UIFA 3FUZA 2QRYA 1H45A 3U8QA 5CI5A 3KOTA 1MQGA 2O51A 3SEVA 1FQDA 1I6QA 4ZS9A 1B2HA 1XOCA 3OXNA 4GF8A 3M3KA 2B3BA 3CI8A 4G68B 1Z7NE 2M8CA 2REGA 4LVQA 4DXBA 3KJ7A 1LAFE 3FXUA 4N6PA 4TLMB 2V93A 1CE2A 3RPWA 4U4XA 4OXVA 4QFKA 1MS7A 4P0GA 3Q26A 3PMWA 5KDTB 1I6AA 4EDPA 4ONYA 3AXFA 3D4CA 3H6UA 5H8FB 1LSTA 1ELJA 4LQ2A 3KSXA 2UVIA 2VD2A 4K3FA 2GFEA 4YMAA 2DP8A 4PFWA 1ZIUA 4NTLA 1P1OA 2VOZA 4FIMA 2ABHA 3E9XA 1AH5A 1JEUA 1B40A 5M2VA 5J1DA 2PVUA 2YJPA 1MQJA 4H0WA 3O6HA 5CMKA 1URSA 2UYFA 3TFLA 4OFJA 1XC1A 4LP2B 3K6WA 1LLSA 3CG1A 4IB2A 1BTJA 2FYIA 3BKIB 3KFMA 3CFXA 2AL4A 1WVJA 3PGFA 2XXVA 4TQUQ 2IEEA 4NMYA 1UIUA 1MRPA 3OOAA 3UN6A 2QL3A 5FTIA 1UTBA 4NWCA 1MH3A 3HSTA 3ECRA 4WXJA 2UVJA 4I9DA 4H67A 3TUSA 1T0KA 4C0RA 2ZMBA 3ODBA 4H5GA 3S2VA 2ONKE 4XTCQ 4NF5B 2HQ0A 4RNSA 4BDLA 3H03A 3ZKKA 4BDQA 3P7IA 2XX8A 5DVFA 1OMPA 1MXVA 4H8JA 3K1PA 1PBPA 3PU5A 1N7WA 4KCCA 5FHMA 3OO8A 1MXWA 1A54A 1LGBC 2UVHA 3A09A 2Q2AA 4WEDA 1MQIA 3RT6B 2DQVA 3I6VA 3T66A 4QSCA 1USYH 3EHSA 3PPRA 4NF6B 1NNKA 4DDDA 3IB1A 3KZGA 2G93A 4RY1A 3OSRA 3KSJA 3IOUA 2GHAA 4IGRA 4H65A 1B05A 4MH5A 1QVSA 2XX9A 2DXYA 2FNCA 4U2RA 3SETA 2ZYKA 4F18A 4Q0CA 1MG1A 4HW8A 1FTMA 4ZDMA 3TTRA 4QSEA 4JBZA 3RTFB 4IY5A 1TFDA 1XHYA 4OFLA 3THIA 5I56A 4X1DA 1DSNA 3GLBA 4F1UA 1IXGA 2ZNTA 5TPAA 4JWYA 5I2NB 4KPTA 1MPBA 2XXYA 2DS9A 2ZYNA 4ZZAA 1SBPA 2QMXA 2PT2A 4F3BA 1SI1A 5JEIA 2V84A 5I58B 3E4RA 5ISUA 3GXAA 3FIRA 1PBQA 2F6GA 5I2KB 4OEUA 2VHAA 1WODA 3PPNA 4X9TA 2V3QA 4F1VA 2F7CA 4JDFA 3FVGA 1SVXB 1VR5A 4R6HA 2RINA 2ANJA 3IOTA 3ZSFA 4R2BA 2XXTA 5DT6A 3KJTA 3SEWA 1A99A 4R9FA 1CB6A 3S9MC 4KYEA 4ZEKA 2VP1A 1H43A 4QF9A 2I6EA 3MVZA 2PYYA 5EYFA 1JEVA 1B0HA 4WEPA 5I59A 1FCKA 4G68C 1B51A 3M3LA 4FEDA 1ZKBA 3IB2A 1Y1MA 1TXFA 5EHSA 3LUYA 3G3IA 3K4UA 3LSFB 4NE4A 3S4UA 2O1MA 2NXOA 1A7LA 1JVYA 3C36A 3B6TA 5B7DA 3FV1A 5I57B 2X7QA 3M3FA 5K2YA 4FAJA 1LAHE 4KD5A 2HZKA 4ESWA 5AA1A 4GRKA 1SD3A 4LQ5A 2Z8DA 3C4MA 3QUJA 1MXZA 4OVJA 2Y84A 1GTKA 4H5FA 2X26A 4POXA 4ELOA 2RC9A 4LZ8A 4IGTA 3VLWA 5DEXA 1ZBMA 3EPEA 1ZU0A 1B6HA 4NF4A 4U1OA 4G4PA 5K2XA 2F7AA 4ND9A 2A5TB 1NNPA 1JW1A 4YKJA 1TFAA 3O9PA 1LCTA 4NF8A 5AA2D 3RTWB 3PMXA 1XVXA 5TU0A 1POY1 4R2FA 5AA4B 5KCJA 4PP0A 3EHTA 3C32A 4R6YA 4YKIA 3EF7A 3TTKA 4P11A 3PMVA 4ZE8A 3MP6A 3TKDA 3LC8A 1ZLQA 2QS2A 1QULA 1Y20A 3QK6A 4QFLA 4NEDA 2YLNA 4GIZA 4TLLB 4BDRA 2V3TA 2G29A 3MQ9A 3CFZA 3I5OA 4ZEDA 1N76A 2XXQA 3T9VA 3MZ9A 2HCAA 3QAXA 4YKKA 4OERA 1H3DA 4YB7A 1VFEA 5TP9B 1ATGA 5I84A 3EQ1A 3MPLA 3G3JA 3OSQA 3G7WA 4LUBA 3KG2A 3FXRA 2E0SA 3T22A 1P1UA 2ZYMA 2W7YA 2CZLA 1A55A 3VXCA 3V83A 3OO6A 1GR2A 1YAEA 3K6XA 3VLUA 5EHMA 2Z22A 3FJ7A 3VVDA 2P0SA 2XD2A 3PPPA 4GD5A 1ZTYA 4JSOA 1DPPA 4EF2A 3QYTA 2DWJA
chains in the Genus database with same CATH superfamily
4ZECA 4KQPA 4YAHX 3T0JA 2O7UA 2VGQA 1HSLA 4R72A 3MVYA 2I0BA 1NV2A 3I3VA 3IO6A 4MNPA 4WKMA 4PF8A 4DCXA 1MY4A 5L9SA 4OFOA 1GVCA 1Q9DA 3TCHA 1R1NA 1DPEA 1N3WA 4R6KA 3JYRA 1Y4CA 1IUDA 4YKPA 4P0IA 4XEQA 1UTBB 1AOVA 3MP1A 1EZOA 3SKPA 3HPIA 3KN3A 1Q1KA 2D21A 1FPKA 4NHBA 1FTLA 1B52A 2OZZA 1OLAA 2QPQA 4PAFA 1VDWA 3TELA 4HCYA 4M1VA 4AS4A 1I6BA 3ONMA 5I7IA 3FV2A 1B3HA 3Q29A 4G68A 1PB7A 1IXIA 4GWXA 1SYHA 1D9QA 1NH8A 1B1XA 4RK9A 1LBYA 3PTYA 1EH3A 5B70A 1IMEA 3MSTA 2RC8A 1NMUA 3E79A 1BKAA 3USDA 1FSAA 4XKPA 1FTOA 1F9BA 2DWAA 1FJ9A 1O64A 4GWWA 5JTYB 5IZZA 2O1LA 1MM7A 3BBRA 5AE4A 1B7HA 4PAIA 4G8HA 2D5WA 1IXHA 2P3NA 2D3IA 2XXPA 3EKIA 1RYXA 3MC2A 3JZJA 2Q9TA 2R9JA 2QS1A 4C1TA 3K6UA 3MVXA 5IZ1A 4P56A 2ZXTA 3LR1A 2F3BA 4DI3D 1NUXA 2ZZXA 4LATA 2RCAA 4N07A 3FXBA 3O6GA 1I69A 1FPGA 1N84A 3ZKLA 4F3SA 5FHNA 2P2AA 3IB0A 4DXUA 3C34A 3MW0A 1Z7ME 1B9JA 3PUWE 3PUZE 4UABA 3UGWA 2QMWA 1B3LA 2R8TA 4OENA 4EF1A 1RKMA 4I8CA 4FEBA 2CEYA 3JV9A 4JSDA 2OJTA 1USYE 4DI4B 5HBCA 2H5YA 4F3PA 1BK4A 2PT1A 1MY3A 3TEPA 3VE1B 3KGCA 3QUFA 3VV5A 4FJPA 4POWA 1MY2A 4X04A 1S9TA 5I56B 4H8IA 4GXSB 4HTGA 5TPAB 4DLDA 4ZE9A 5JK4A 3V8XB 4GFRA 3LSLA 1EU8A 2XXWA 5CC2A 3E3KA 3R7XA 3O97A 1D3KA 1LBVA 2FA7A 1YPNA 4ZZEA 5H8QB 4I3EA 5CMBA 3K01A 1INPA 3HHFA 1NKXA 3H7MA 2DDKA 3O66A 3DP6A 1B5JA 2RF1A 5DVJA 2ZYOA 5ET5A 3Q28A 5ET8A 1B3EA 4EXLA 3R26A 2LAOA 4R9GA 1HSEA 2DSFA 4JWXA 1IEJA 2PX1A 4E0WA 5BUUA 4OHNA 1FBDA 3IOVA 3CFLA 1QJMA 1QKBA 4KI0E 4LONB 4EUOA 5EQ7A 4OETA 3S9EA 2ALUA 1MPCA 2Q88A 2PMSA 2AYSA 4GWZA 4H6DA 4YICA 3N94A 3UP9A 3HO7A 4KYDA 3LUZA 4O3CA 4F1YA 4MAGA 1BIYA 1SW5A 2HZLA 1LFGA 2QVUA 4O8MA 2GH9A 2QVRA 1Q35A 1PC3A 2CMOA 5I59B 1YXIA 2I49A 4F2OA 4PETA 2DVZA 3D1RA 1MXYA 4FORA 4MNIA 2H4IA 3TTMA 4OMBA 4LZ7A 4OVSA 1DTZA 4QFOA 4THIA 2Y7RA 3MZBA 1Y4TA 2AIXA 3WAFA 1QUIA 1B32A 2DE3A 1SW1A 1A8EA 4PFYA 5DW8A 1OIBA 2F7BA 3OENA 2Q8JA 2IA4A 4OZ9A 3QSLA 1OQHA 3IAZA 3CSBA 1NNTA 3PUXE 1LBCA 3IO4A 1IZ1A 1FBHA 1SQYA 5HM4B 4AB5A 1N7XA 3RN8A 4XKRA 4MX6A 4QFNA 4GVOA 3S9NC 3U92A 2P3VA 2HFBA 2F6PA 5FTHA 3PPQA 1FQCA 3ILTB 3MUQA 4GWSA 4IO6A 1EYJA 1KA1A 3A3CA 3W9VA 1EYKA 4EXKA 4PFBA 5CMMA 3FBPA 4NF4B 3TDJA 3QIMA 3FVOA 3QXMA 1OLCA 2NWJA 1FBPA 1MDQA 3PPOA 1B4HA 2XWOA 5A5XA 2KQZA 2QS3A 4FATA 3OMBA 1QKAA 1NV1A 2F35A 2F36A 3IFAA 3W15C 4O7MA 4I3YA 4NF8B 3FXQA 4MHFA 1OVTA 3T9UA 1YYZA 5T3JA 3SEYA 1B5HA 2DYXA 3IJOB 2O68A 1FBGA 1KWHA 2XWKA 2OWSA 1FTKA 1BP5A 4OYVA 2F8DA 2ESNA 2ZZWA 1ZJLA 2BJJX 4BDOA 4F31B 3W9WA 4IO3A 4OVQA 4R75A 3MJNA 3CR9A 3U65A 2QSXA 4Q30B 3TPAA 3N5LA 5CRYA 3HCQA 1LBXA 5F24A 3IX1A 5H8NB 1PB9A 3IK6B 1ZMGA 1NL5A 4ZEIA 2XX7A 4PDHA 1MXUA 2Y7PA 4XFEA 3FVKA 5AA2A 2I4CA 4RPNA 3CG3A 4GOTA 2DWHA 3UORA 2PBWA 1NUYA 3OEKA 1MXXA 5FHOA 3SESA 4P1LA 3H06B 2O69A 3Q25A 5H8HA 4ISUA 1MQHA 4IO4A 2ZNUA 4EQBA 2XXIA 4R74A 3BIGA 1PDAA 3FATA 1MQDA 1FQBA 4HS7A 4F22A 2B4LA 3VFJA 1P1WA 1O63A 4TOZA 1LCFA 4RA1A 5ELVA 3U1OA 3QMFA 4I62A 1FW0A 1FTAA 1NNFA 1JQFA 3N26A 2O7IA 4X48A 1J1NA 3E13X 1LAGE 3VLVA 1NV5A 4F39A 3OD7A 4KR5A 1NV3A 1SYIA 3VXBA 2R71A 2XXKA 4C1UA 1POTA 3B6QA 3OELA 3R6UA 4MLVA 4P8BA 4LA9A 4Q8RA 3RGYA 4JWOA 3FJMA 2L5VA 5EQ9A 3DELB 3PV0E 4PCDA 4YB5A 3TCGA 2WYPA 4MJOA 2GRVA 3G3HA 3C9HA 1JETA 4ELRA 2RKMA 2H25A 2UXAA 2Z8FA 4ZEFA 4KCDA 1US4A 4U23A 2UVGA 4IY6A 4MMPA 2I4BA 2B3FA 3O2AA 1LFHA 1II5A 1PB8A 3PD8A 4PFIA 1UTHA 4XIGQ 1R9LA 4RJZA 3K02A 4XKNA 1IITA 3V5AA 3EHUA 3G3GA 3TZAA 3K00A 4ELPA 4G2ZA 4MEVA 2H98A 1MY1A 4MBPA 5DTBA 1O7TA 2I3VA 1A40A 3O29A 3B6WA 4YZZA 3UA8A 1B1HA 4N6KA 3KN7A 5TP9A 4OANA 1TT1A 2ONSA 3U94A 5DVIA 3E78A 3K1MA 4DXCA 2XD3A 1IMBA 4PQJA 4IO2A 2Y7KA 1UIVA 5CBRA 2F3DA 4QSDA 4X1BA 3SEXA 2QFLA 1B3GA 3N6TA 2THIA 1GV8A 3SDFA 5LOMA 1IIWA 2O84X 1LAXA 1M5EA 4O3BA 2XA5A 1XVYA 1VFDA 2FVZA 2XXRA 4G8MA 2B65A 3TQLA 3K6VA 1QUKA 3NOHA 3OO7A 1RDYA 3SERA 2NUVA 5ICTA 1KZ8A 1Y9UA 2FHYA 3MBPA 1P1QA 3RT8A 3OO9A 4ECFA 4OEVA 2KLFA 2REJA 3MPKA 1UQWA 1RYOA 1Y3PA 2F78A 4HCWA 5ICQA 4OESA 1IXCA 1URGA 3LSWA 2V25A 5KDTA 4U22A 3T9XB 4PFRA 3V89B 5H8FA 4LZ5A 2H99A 3N6UA 1NFTA 2NVUB 3TAJA 5EYGA 1L5TA 3H6VA 4P1EA 1SW4A 3H3GA 2V3UA 4QHQA 3C31A 2X7PA 4RYAA 4XKQA 3DM0A 1B5IA 2HAVA 1N3XA 1MDP1 1JVXA 2I58A 3LSXA 4GL8A 3O28A 2OLBA 4G77A 1FRPA 4DIGA 3Q27A 1R9QA 2CZKA 4NF0A 3FASA 1IQ7A 4QFPA 1WDNA 4GL0A 3M8UA 1GGGA 4UACA 5F1QA 1JW5A 3HV1A 1SI0A 3LBSA 2DWIA 2WX9A 4U4SA 2F5XA 2KR0A 3H6WA 3RY3A 3TCFA 5JTYA 1M5DA 3FJGA 4ZEBA 4I1DA 1XS5A 3TTNA 4DCYA 3VVFA 3CHGA 4JVIA 2F97A 3O6IA 1B0LA 4OVPA 1NV4A 3VDFA 3T9HB 3TTLA 5CBSA 1D4NA 4M4GA 4YU0A 1OVBA 1P99A 4GLIA 1URDA 3MP8A 1NV0A 3RUMA 2OBGA 4KYSA 1OQGA 4NF5A 1FTJA 1FPDA 3FGSA 3KEIA 3GBAA 2RCBA 3D4GA 1FPBA 5LDZA 5L9OA 3C33A 1LB9A 1SW2A 3ILUB 2OCUA 4Z0IA 1MH4A 3B7DA 1MM6A 4EQ9A 3A3UA 1QUJA 3FZVA 2HEUA 4AQ4A 3TMGA 2I0CA 4JXIA 5IKBA 1FQEA 1US5A 4IO7A 1N0TA 2I48A 1MPDA 2DVCA 1JW4A 4DZ1A 4NF6A 2XWVA 3CRBA 2F34A 3KC0A 4FE8A 4BLAA 3GZGA 3MVWA 4DE8A 1B7ZA 1AWBA 1YTVA 1LFIA 3H6TA 1YCJA 3F11A 3G3KA 4O94A 4OQOA 2WBBA 2UYEA 5L9MA 2OWZA 3H4ZA 5H8QA 3TQWA 4NWDA 1VSOA 5DYHA 1FBEA 2B4MA 1FPIA 1G0HA 2NOOA 3FD3A 4AB6A 4MCOA 1B46A 1AL3A 2P1SA 1DTGA 2O6AA 3U72A 1AMFA 3GYYA 2XHDA 4NN3A 4U21A 1EYIA 4KFQA 1H76A 3BFUA 4FBPA 5I2NA 1M5CA 2Q2CA 3L6GA 3RPLB 3PUVE 1FQAA 1D9YA 5AA3A 1NI9A 4F2QA 3TODA 2VPNA 4BDMA 1S50A 1YZ0A 4GQOA 4IR8A 4UA8A 4PFTA 1ANFA 5A5XB 3BFTA 1B58A 1K9ZA 2DE4A 5I58A 3BIHA 3IL1B 4ESXA 1R6ZA 3RQTA 3KC1A 1LB8A 1EZ9A 5ITOA 3U93A 5CM6A 5I2KA 5KZTA 3PUYE 3UK4A 4PE5B 2H9BA 4YB6A 4JVDA 1FPEA 4F19A 2A5SA 1RDZA 2ZNSA 4E0XA 4GBVA 5L8DA 5DEXB 4N13A 1B7UA 4NAPA 2Y5KA 1NH7A 3HHGA 2HAUA 4ELQA 2DXRA 3WAEA 3FVNA 3CVGA 1FQFA 2WKYA 3DP4A 4U1ZA 4EQ7A 1QW0A 3DP8A 2E1SA 1P1NA 4HE2A 5EQ8A 5BWJA 1M5BA 5IZ3B 3VVEA 3IOWA 1TWYA 5AA2B 4KHZE 1XT8A 4XF5A 3K2DA 2DE2A 5KCJB 4OWDA 4IO5A 4MIJA 4RPOA 3TYHA 3MYUA 2XXHA 1IMAA 2I3WA 2RC7A 3KBRA 4Z7EA 2YPNA 1DMBA 1FPFA 4F29A 1A8FA 5IAIA 5H8HB 3RNNA 2Z8EA 2Z23A 2Y7IA 3C35A 4RK2A 4F3GA 3GBBA 2CZIA 4FECA 4R73A 3ROJA 5CMCA 4Q5TA 4GWYA 4QXDA 3T93B 5I57A 2Q89A 5HPQA 2GHBA 4G8NA 1B4ZA 4L17A 1BLFA 3OEMA 3K0VA 5F7VA 1D9VA 2AL5A 1HSJA 4MLQA 4OTEA 1Y1ZA 3KOSA 1MY0A 4O3AA 3CSGA 4QRZA 2JJKA 3ZS6A 4GWOA 3SEUA 4MF3A 1VE4A 4G61A 5A5LA 1PEBA 1EZPA 3IJXB 2XXXA 1JNFA 2DOJA 4XXUA 3IORA 5I3SA 3K1NA 3L6HA 5ITPA 4PTKA 3IR1A 2QJEA 3G3FA 2QS4A 4NG7A 1M5FA 4GX6A 2OK2A 3T96B 3DLNA 2A5TA 1B3FA 3KN8A 2HXWA 2ONRA 5ET7A 2Q8MA 4PGNA 4RXLA 3MZ1A 4PFUA 5H8NA 4H1XA 3CIJA 3RLFE 1N04A 3S9LC 3KBZA 1UTHB 1Y3NA 1S7YA 3HN0A 3MWBA 4GXAA 2GQ1A 2R6GE 5AA4A 1Y3QA 2OWTA 1DK4A 1JP4A 3MAMA 2VD3A 2XXUA 4MFIA 1SDXA 4YMBA 1LBBA 1DOTA 4BDNA 2Y7WA 5H8SA 4JB7A 3EN3A 1H44A 4HE0A 1LBZA 3PD9A 4GX3A 1AIVA 3UIFA 3FUZA 3HFUA 2QRYA 4P9KA 2FBPA 1H45A 3U8QA 5CI5A 3KOTA 1IMDA 5I5PA 1MQGA 2O51A 3SEVA 1FQDA 1I6QA 4ZS9A 1B2HA 1NUZA 1XOCA 3OXNA 4GF8A 3M3KA 2B3BA 3CI8A 4G68B 1Z7NE 4PDDA 2M8CA 2PCRA 2REGA 4LVQA 4DXBA 3KJ7A 2XWIA 1LAFE 3FXUA 4N6PA 4TLMB 2V93A 1CE2A 3RPWA 4U4XA 4OXVA 4N6DA 4QFKA 1MS7A 4P0GA 3Q26A 3PMWA 5KDTB 1I6AA 4EDPA 4PAKA 4ONYA 2OX3A 3AXFA 3D4CA 3H6UA 5H8FB 4I40A 5EYHA 1LSTA 1ELJA 4LQ2A 5IM2A 5EQAA 3KSXA 2CEXA 2UVIA 2VD2A 4K3FA 4LN5A 4OA4A 2GFEA 4YMAA 2DP8A 4P47A 4PFWA 1ZIUA 4NTLA 1P1OA 2VOZA 4FIMA 2ABHA 3E9XA 1XI6A 1AH5A 1JEUA 1B40A 5M2VA 5J1DA 2PVUA 2YJPA 1MQJA 4PBHA 4H0WA 3O6HA 5CMKA 1URSA 2UYFA 3TFLA 5ESYA 4OFJA 1XC1A 4LP2B 3K6WA 1LLSA 2ZZVA 3CG1A 4IB2A 2WYKA 2Q74A 1BTJA 2FYIA 4OVRA 3BKIB 3KFMA 4O7IA 3CFXA 2AL4A 1WVJA 3PGFA 2XXVA 4TQUQ 2IEEA 4NMYA 1UIUA 1MRPA 3OOAA 4N81A 4NQ8A 5ET6A 3UN6A 2QL3A 5LTCA 2FIXA 2PFZA 5FTIA 1UTBA 4NWCA 1MH3A 3HSTA 3ECRA 4WXJA 2UVJA 4I9DA 4H67A 3TUSA 1T0KA 1LBWA 4C0RA 2ZMBA 3ODBA 4H5GA 3S2VA 2ONKE 4XTCQ 2Y5LA 2FIEA 1KA0A 4NF5B 1CNQA 2HQ0A 4RNSA 3H03A 3ZKKA 4BDQA 4BDLA 3P7IA 2XX8A 5DVFA 1OMPA 1MXVA 4OVTA 2WBDA 4H8JA 3K1PA 2VPOA 1PBPA 3PU5A 1N7WA 4KCCA 5FHMA 3OO8A 1MXWA 1A54A 1LGBC 2UVHA 3A09A 2Q2AA 4WEDA 1MQIA 3RT6B 2DQVA 3I6VA 3T66A 4QSCA 1USYH 3EHSA 3PPRA 4H46A 4NF6B 1NNKA 4DDDA 3IB1A 3KZGA 2G93A 4GBWA 3OSRA 4RY1A 3KSJA 3IOUA 2GHAA 4IGRA 4H65A 1B05A 4MH5A 1QVSA 2XX9A 2DXYA 2QVVA 2FNCA 4U2RA 3SETA 2ZYKA 4F18A 4Q0CA 1MG1A 4HW8A 1FTMA 4ZDMA 3TTRA 4QSEA 4JBZA 3RTFB 4IY5A 1TFDA 1XHYA 4OFLA 3THIA 1IMFA 5I56A 4X1DA 1DSNA 3GLBA 4F1UA 1IXGA 2ZNTA 5TPAA 4JWYA 1NV6A 5I2NB 4KPTA 1MPBA 2XXYA 2DS9A 2ZYNA 4ZZAA 5IGAA 1SBPA 2QMXA 2PT2A 4F3BA 1SI1A 5JEIA 2V84A 5I58B 3E4RA 5ISUA 3GXAA 3FIRA 1PBQA 2F6GA 5I2KB 4OEUA 2VHAA 1WODA 3T1BA 3PPNA 4X9TA 2V3QA 4F1VA 2F7CA 4JDFA 3FVGA 1SVXB 1VR5A 4R6HA 2RINA 2ANJA 3IOTA 3ZSFA 4R2BA 2XXTA 5DT6A 3KJTA 3SEWA 4PF6A 1A99A 1DCUA 1FPLA 4R9FA 4JVCA 4NX1A 1CB6A 3S9MC 4KYEA 3LV0A 4ZEKA 2VP1A 1H43A 4QF9A 2I6EA 3MVZA 2PYYA 2CZHA 5EYFA 1JEVA 1B0HA 4WEPA 5I59A 1FCKA 4G68C 1B51A 3M3LA 2HXRA 4FEDA 1ZKBA 2BJIA 3IB2A 1QGXA 1Y1MA 1TXFA 5EHSA 3LUYA 3G3IA 3K4UA 4HE1A 3LSFB 4NE4A 3S4UA 2O1MA 3IFCA 2NXOA 4PC9A 1A7LA 1JVYA 3C36A 3B6TA 5B7DA 3RPLA 3FV1A 5I57B 2X7QA 3M3FA 5K2YA 4FAJA 1LAHE 4KD5A 1IMCA 2HZKA 4ESWA 5AA1A 4GRKA 1SD3A 4LQ5A 2Z8DA 3C4MA 4NGUA 3QUJA 4KXPA 1MXZA 4OVJA 2Y84A 1GTKA 4H5FA 2X26A 4POXA 4ELOA 2MKZA 2RC9A 2WEFA 4LZ8A 4P3LA 4IGTA 3VLWA 3SZPA 1G0IA 5DEXA 1ZBMA 3EPEA 4N4UA 1ZU0A 1B6HA 4NF4A 4GX4A 5FBPA 4U1OA 1NUWA 4G4PA 5K2XA 2F7AA 4ND9A 2A5TB 1NNPA 3ISPA 1JW1A 4YKJA 1TFAA 1FBCA 3O9PA 1LCTA 4NF8A 4AS5A 5AA2D 5IZ3A 3RTWB 3PMXA 4H45A 1XVXA 5TU0A 1POY1 4HXVA 4R2FA 5AA4B 5KCJA 4PP0A 4PGPA 3EHTA 3C32A 4R6YA 4YKIA 3EF7A 3TTKA 4P11A 1SPIA 1DBZA 3PMVA 1LEVA 4ZE8A 3MP6A 5J16A 3TKDA 3LC8A 1ZLQA 2QS2A 1QULA 2HHMA 1Y20A 3QK6A 4QFLA 3B8BA 1FJ6A 4NEDA 2YLNA 4GIZA 4TLLB 4BDRA 2V3TA 1FBFA 2G29A 3MQ9A 4PE3A 3CFZA 3I5OA 4ZEDA 1FPJA 1N76A 4N8GA 4GWUA 2XXQA 3T9VA 3MZ9A 2HCAA 3QAXA 4YKKA 4OERA 1H3DA 4YB7A 1VFEA 3RYDA 5TP9B 1ATGA 4N91A 5I84A 3EQ1A 3MPLA 3B50A 4PBQA 4N15A 3G3JA 3OSQA 3G7WA 4LUBA 3KG2A 3FXRA 2E0SA 3T22A 1P1UA 2ZYMA 2V4CA 2VT5A 2HPGA 2W7YA 2CZLA 1A55A 3VXCA 2PFYA 3A29A 4QBAA 3V83A 3OO6A 1GR2A 1K9YA 4N8YA 1YAEA 3K6XA 3VLUA 5EHMA 4N17A 1RDXA 2Z22A 3FJ7A 3VVDA 2P0SA 2XD2A 1NV7A 3PPPA 4GD5A 1ZTYA 4JSOA 4X8RA 1DPPA 4EF2A 3QYTA 4MNCA 2DWJA
chains in the Genus database with same CATH topology
4ZECA 4KQPA 4YAHX 2O7UA 2VGQA 1HSLA 4R72A 3MVYA 2I0BA 3I3VA 3IO6A 4WKMA 4DCXA 1MY4A 5L9SA 4OFOA 1GVCA 3TCHA 1R1NA 1DPEA 1N3WA 4R6KA 3JYRA 1Y4CA 1IUDA 4YKPA 4P0IA 1UTBB 1AOVA 3MP1A 1EZOA 3SKPA 3HPIA 3KN3A 1Q1KA 2D21A 1FTLA 1B52A 2OZZA 1OLAA 2QPQA 3TELA 4HCYA 4M1VA 1I6BA 3ONMA 3FV2A 1B3HA 3Q29A 4G68A 1PB7A 1IXIA 1SYHA 1NH8A 1B1XA 4RK9A 1EH3A 5B70A 2RC8A 1NMUA 1BKAA 3USDA 4XKPA 1FTOA 1F9BA 2DWAA 1O64A 5JTYB 2O1LA 1MM7A 3BBRA 5AE4A 1B7HA 4G8HA 2D5WA 1IXHA 2D3IA 2XXPA 1RYXA 3MC2A 3JZJA 2Q9TA 2R9JA 2QS1A 4C1TA 3K6UA 3MVXA 2ZXTA 3LR1A 4LATA 2RCAA 4N07A 3O6GA 1I69A 1N84A 3ZKLA 4F3SA 5FHNA 2P2AA 3IB0A 4DXUA 3C34A 3MW0A 1Z7ME 1B9JA 3PUWE 3PUZE 3UGWA 2QMWA 1B3LA 4OENA 4EF1A 1RKMA 4I8CA 4FEBA 3JV9A 4JSDA 2OJTA 1USYE 5HBCA 2H5YA 4F3PA 2PT1A 1MY3A 3TEPA 3VE1B 3KGCA 3QUFA 3VV5A 4FJPA 4POWA 1MY2A 1S9TA 5I56B 4H8IA 4GXSB 4HTGA 5TPAB 4DLDA 4ZE9A 5JK4A 3V8XB 4GFRA 3LSLA 1EU8A 2XXWA 5CC2A 3E3KA 3R7XA 3O97A 1D3KA 2FA7A 1YPNA 4ZZEA 5H8QB 5CMBA 3K01A 3HHFA 1NKXA 3H7MA 3O66A 3DP6A 1B5JA 2RF1A 5DVJA 2ZYOA 3Q28A 1B3EA 4EXLA 3R26A 2LAOA 4R9GA 1HSEA 2DSFA 4JWXA 1IEJA 2PX1A 4E0WA 5BUUA 4OHNA 3IOVA 3CFLA 1QJMA 1QKBA 4KI0E 4LONB 4EUOA 3S9EA 4OETA 2ALUA 1MPCA 2Q88A 2PMSA 2AYSA 4H6DA 4YICA 3N94A 3UP9A 3HO7A 4KYDA 4O3CA 4F1YA 1BIYA 1SW5A 2HZLA 1LFGA 2GH9A 1Q35A 1PC3A 2CMOA 5I59B 2I49A 4F2OA 4PETA 2DVZA 1MXYA 4FORA 2H4IA 3TTMA 4OMBA 4LZ7A 1DTZA 4QFOA 4THIA 2Y7RA 3MZBA 1Y4TA 2AIXA 3WAFA 1QUIA 1B32A 2DE3A 1SW1A 1A8EA 4PFYA 1OIBA 2F7BA 3OENA 2Q8JA 2IA4A 4OZ9A 3QSLA 1OQHA 3IAZA 3CSBA 1NNTA 3PUXE 1LBCA 3IO4A 1IZ1A 1SQYA 5HM4B 4AB5A 1N7XA 3RN8A 4XKRA 4QFNA 4GVOA 3S9NC 3U92A 2HFBA 2F6PA 5FTHA 3PPQA 1FQCA 3ILTB 3MUQA 4IO6A 3A3CA 3W9VA 4EXKA 5CMMA 4NF4B 3TDJA 3QIMA 3FVOA 3QXMA 1OLCA 2NWJA 1MDQA 3PPOA 1B4HA 5A5XA 2QS3A 4FATA 3OMBA 1QKAA 2F35A 2F36A 3W15C 4NF8B 3FXQA 1OVTA 3T9UA 3SEYA 1B5HA 2DYXA 3IJOB 2O68A 1KWHA 2OWSA 1FTKA 1BP5A 4OYVA 2F8DA 2ESNA 1ZJLA 2BJJX 4BDOA 4F31B 3W9WA 4IO3A 4R75A 3MJNA 3CR9A 2QSXA 4Q30B 3TPAA 3N5LA 5CRYA 3HCQA 3IX1A 5H8NB 1PB9A 3IK6B 1ZMGA 1NL5A 4ZEIA 2XX7A 1MXUA 2Y7PA 3FVKA 5AA2A 2I4CA 4RPNA 3CG3A 4GOTA 2DWHA 3UORA 2PBWA 3OEKA 1MXXA 5FHOA 3SESA 3H06B 2O69A 3Q25A 5H8HA 4ISUA 1MQHA 4IO4A 2ZNUA 4EQBA 2XXIA 4R74A 1PDAA 3FATA 1MQDA 1FQBA 4HS7A 4F22A 3VFJA 1P1WA 1O63A 4TOZA 1LCFA 4RA1A 5ELVA 3U1OA 4I62A 1FW0A 1NNFA 1JQFA 3N26A 2O7IA 4X48A 1J1NA 3E13X 1LAGE 3VLVA 4F39A 3OD7A 4KR5A 1SYIA 3VXBA 2R71A 4C1UA 1POTA 3B6QA 3OELA 3R6UA 4MLVA 4LA9A 4Q8RA 3RGYA 4JWOA 3FJMA 3DELB 3PV0E 4YB5A 3TCGA 2GRVA 3G3HA 3C9HA 1JETA 4ELRA 2RKMA 2H25A 2UXAA 2Z8FA 4ZEFA 4KCDA 1US4A 4U23A 2UVGA 4IY6A 2I4BA 2B3FA 3O2AA 1LFHA 1II5A 1PB8A 3PD8A 1UTHA 4XIGQ 1R9LA 4RJZA 3K02A 4XKNA 1IITA 3V5AA 3EHUA 3G3GA 3TZAA 3K00A 4ELPA 4G2ZA 2H98A 1MY1A 4MBPA 5DTBA 1O7TA 2I3VA 1A40A 3O29A 3B6WA 4YZZA 3UA8A 1B1HA 3KN7A 5TP9A 1TT1A 2ONSA 3U94A 5DVIA 3K1MA 4DXCA 2XD3A 4PQJA 4IO2A 2Y7KA 1UIVA 5CBRA 4QSDA 4X1BA 3SEXA 1B3GA 3N6TA 2THIA 1GV8A 3SDFA 5LOMA 1IIWA 2O84X 1LAXA 1M5EA 4O3BA 1XVYA 1VFDA 2XXRA 4G8MA 2B65A 3TQLA 3K6VA 1QUKA 3OO7A 3SERA 2NUVA 5ICTA 1Y9UA 3MBPA 1P1QA 3RT8A 3OO9A 4ECFA 4OEVA 2KLFA 2REJA 3MPKA 1UQWA 1RYOA 1Y3PA 2F78A 4HCWA 5ICQA 4OESA 1IXCA 1URGA 3LSWA 2V25A 5KDTA 4U22A 3T9XB 3V89B 5H8FA 4LZ5A 2H99A 3N6UA 1NFTA 2NVUB 3TAJA 1L5TA 3H6VA 1SW4A 3H3GA 2V3UA 4QHQA 3C31A 2X7PA 4RYAA 4XKQA 3DM0A 1B5IA 2HAVA 1N3XA 1MDP1 1JVXA 2I58A 3LSXA 4GL8A 3O28A 2OLBA 4G77A 4DIGA 3Q27A 1R9QA 3FASA 1IQ7A 4QFPA 1WDNA 4GL0A 3M8UA 1GGGA 4UACA 5F1QA 1JW5A 3HV1A 1SI0A 3LBSA 2DWIA 4U4SA 2F5XA 5JTYA 3H6WA 3RY3A 3TCFA 1M5DA 3FJGA 4ZEBA 4I1DA 1XS5A 3TTNA 4DCYA 3VVFA 2F97A 3O6IA 1B0LA 3VDFA 3T9HB 3TTLA 5CBSA 1D4NA 4M4GA 4YU0A 1OVBA 1P99A 4GLIA 1URDA 3MP8A 3RUMA 2OBGA 4KYSA 1OQGA 4NF5A 1FTJA 3FGSA 3KEIA 3GBAA 2RCBA 3D4GA 5L9OA 3C33A 1LB9A 1SW2A 3ILUB 2OCUA 4Z0IA 1MH4A 3B7DA 1MM6A 4EQ9A 3A3UA 1QUJA 3FZVA 2HEUA 4AQ4A 3TMGA 2I0CA 4JXIA 5IKBA 1FQEA 1US5A 4IO7A 1N0TA 2I48A 1MPDA 2DVCA 1JW4A 4DZ1A 4NF6A 3CRBA 2F34A 4FE8A 4BLAA 3GZGA 3MVWA 4DE8A 1B7ZA 1YTVA 1LFIA 3H6TA 1YCJA 3F11A 3G3KA 4OQOA 2UYEA 5L9MA 3TQWA 3H4ZA 5H8QA 4NWDA 1VSOA 5DYHA 3FD3A 2NOOA 4AB6A 1B46A 1AL3A 2P1SA 1DTGA 2O6AA 3U72A 1AMFA 2XHDA 4U21A 4KFQA 1H76A 3BFUA 5I2NA 1M5CA 2Q2CA 3L6GA 3PUVE 1FQAA 1D9YA 5AA3A 4F2QA 3TODA 4BDMA 1S50A 4GQOA 4UA8A 4PFTA 1ANFA 5A5XB 3BFTA 1B58A 5I58A 2DE4A 3IL1B 4ESXA 1R6ZA 3RQTA 1LB8A 1EZ9A 5ITOA 3U93A 5CM6A 5I2KA 5KZTA 3PUYE 3UK4A 4PE5B 2H9BA 4YB6A 4F19A 2A5SA 2ZNSA 4E0XA 5L8DA 5DEXB 4N13A 1B7UA 1NH7A 3HHGA 2HAUA 4ELQA 2DXRA 3WAEA 3FVNA 3CVGA 1FQFA 2WKYA 3DP4A 4U1ZA 4EQ7A 1QW0A 3DP8A 2E1SA 1P1NA 5BWJA 1M5BA 3VVEA 3IOWA 1TWYA 5AA2B 4KHZE 1XT8A 3K2DA 2DE2A 5KCJB 4OWDA 4IO5A 4RPOA 3TYHA 2XXHA 2I3WA 2RC7A 3KBRA 4Z7EA 2YPNA 1DMBA 4F29A 1A8FA 5IAIA 5H8HB 3RNNA 2Z8EA 2Z23A 2Y7IA 3C35A 4RK2A 4F3GA 3GBBA 4FECA 4R73A 5CMCA 4Q5TA 3T93B 5I57A 2Q89A 5HPQA 2GHBA 4G8NA 1B4ZA 4L17A 1BLFA 3OEMA 3K0VA 5F7VA 1D9VA 2AL5A 1HSJA 4MLQA 4OTEA 1Y1ZA 3KOSA 1MY0A 4O3AA 3CSGA 4QRZA 3ZS6A 4GWOA 3SEUA 4MF3A 1VE4A 1PEBA 1EZPA 3IJXB 2XXXA 1JNFA 2DOJA 4XXUA 3IORA 3K1NA 3L6HA 5ITPA 3IR1A 2QJEA 3G3FA 2QS4A 1M5FA 2OK2A 3T96B 3DLNA 2A5TA 1B3FA 3KN8A 2HXWA 2ONRA 4RXLA 3MZ1A 4PFUA 5H8NA 4H1XA 3CIJA 3RLFE 1N04A 3S9LC 1UTHB 1Y3NA 1S7YA 3HN0A 3MWBA 4GXAA 2R6GE 5AA4A 1Y3QA 2OWTA 3MAMA 2VD3A 2XXUA 4MFIA 1SDXA 4YMBA 1LBBA 1DOTA 4BDNA 2Y7WA 5H8SA 4JB7A 3EN3A 1H44A 3PD9A 1AIVA 3UIFA 3FUZA 2QRYA 1H45A 3U8QA 5CI5A 3KOTA 1MQGA 2O51A 3SEVA 1FQDA 1I6QA 4ZS9A 1B2HA 1XOCA 3OXNA 4GF8A 3M3KA 2B3BA 3CI8A 4G68B 1Z7NE 2M8CA 2REGA 4LVQA 4DXBA 3KJ7A 1LAFE 3FXUA 4N6PA 4TLMB 2V93A 1CE2A 3RPWA 4U4XA 4OXVA 4QFKA 1MS7A 4P0GA 3Q26A 3PMWA 5KDTB 1I6AA 4EDPA 4ONYA 3AXFA 3D4CA 3H6UA 5H8FB 1LSTA 1ELJA 4LQ2A 3KSXA 2UVIA 2VD2A 4K3FA 2GFEA 4YMAA 2DP8A 4PFWA 1ZIUA 4NTLA 1P1OA 2VOZA 4FIMA 2ABHA 3E9XA 1AH5A 1JEUA 1B40A 5M2VA 5J1DA 2PVUA 2YJPA 1MQJA 4H0WA 3O6HA 5CMKA 1URSA 2UYFA 3TFLA 4OFJA 1XC1A 4LP2B 3K6WA 1LLSA 3CG1A 4IB2A 1BTJA 2FYIA 3BKIB 3KFMA 3CFXA 2AL4A 1WVJA 3PGFA 2XXVA 4TQUQ 2IEEA 4NMYA 1UIUA 1MRPA 3OOAA 3UN6A 2QL3A 5FTIA 1UTBA 4NWCA 1MH3A 3HSTA 3ECRA 4WXJA 2UVJA 4I9DA 4H67A 3TUSA 1T0KA 4C0RA 2ZMBA 3ODBA 4H5GA 3S2VA 2ONKE 4XTCQ 4NF5B 2HQ0A 4RNSA 4BDLA 3H03A 3ZKKA 4BDQA 3P7IA 2XX8A 5DVFA 1OMPA 1MXVA 4H8JA 3K1PA 1PBPA 3PU5A 1N7WA 4KCCA 5FHMA 3OO8A 1MXWA 1A54A 1LGBC 2UVHA 3A09A 2Q2AA 4WEDA 1MQIA 3RT6B 2DQVA 3I6VA 3T66A 4QSCA 1USYH 3EHSA 3PPRA 4NF6B 1NNKA 4DDDA 3IB1A 3KZGA 2G93A 4RY1A 3OSRA 3KSJA 3IOUA 2GHAA 4IGRA 4H65A 1B05A 4MH5A 1QVSA 2XX9A 2DXYA 2FNCA 4U2RA 3SETA 2ZYKA 4F18A 4Q0CA 1MG1A 4HW8A 1FTMA 4ZDMA 3TTRA 4QSEA 4JBZA 3RTFB 4IY5A 1TFDA 1XHYA 4OFLA 3THIA 5I56A 4X1DA 1DSNA 3GLBA 4F1UA 1IXGA 2ZNTA 5TPAA 4JWYA 5I2NB 4KPTA 1MPBA 2XXYA 2DS9A 2ZYNA 4ZZAA 1SBPA 2QMXA 2PT2A 4F3BA 1SI1A 5JEIA 2V84A 5I58B 3E4RA 5ISUA 3GXAA 3FIRA 1PBQA 2F6GA 5I2KB 4OEUA 2VHAA 1WODA 3PPNA 4X9TA 2V3QA 4F1VA 2F7CA 4JDFA 3FVGA 1SVXB 1VR5A 4R6HA 2RINA 2ANJA 3IOTA 3ZSFA 4R2BA 2XXTA 5DT6A 3KJTA 3SEWA 1A99A 4R9FA 1CB6A 3S9MC 4KYEA 4ZEKA 2VP1A 1H43A 4QF9A 2I6EA 3MVZA 2PYYA 5EYFA 1JEVA 1B0HA 4WEPA 5I59A 1FCKA 4G68C 1B51A 3M3LA 4FEDA 1ZKBA 3IB2A 1Y1MA 1TXFA 5EHSA 3LUYA 3G3IA 3K4UA 3LSFB 4NE4A 3S4UA 2O1MA 2NXOA 1A7LA 1JVYA 3C36A 3B6TA 5B7DA 3FV1A 5I57B 2X7QA 3M3FA 5K2YA 4FAJA 1LAHE 4KD5A 2HZKA 4ESWA 5AA1A 4GRKA 1SD3A 4LQ5A 2Z8DA 3C4MA 3QUJA 1MXZA 4OVJA 2Y84A 1GTKA 4H5FA 2X26A 4POXA 4ELOA 2RC9A 4LZ8A 4IGTA 3VLWA 5DEXA 1ZBMA 3EPEA 1ZU0A 1B6HA 4NF4A 4U1OA 4G4PA 5K2XA 2F7AA 4ND9A 2A5TB 1NNPA 1JW1A 4YKJA 1TFAA 3O9PA 1LCTA 4NF8A 5AA2D 3RTWB 3PMXA 1XVXA 5TU0A 1POY1 4R2FA 5AA4B 5KCJA 4PP0A 3EHTA 3C32A 4R6YA 4YKIA 3EF7A 3TTKA 4P11A 3PMVA 4ZE8A 3MP6A 3TKDA 3LC8A 1ZLQA 2QS2A 1QULA 1Y20A 3QK6A 4QFLA 4NEDA 2YLNA 4GIZA 4TLLB 4BDRA 2V3TA 2G29A 3MQ9A 3CFZA 3I5OA 4ZEDA 1N76A 2XXQA 3T9VA 3MZ9A 2HCAA 3QAXA 4YKKA 4OERA 1H3DA 4YB7A 1VFEA 5TP9B 1ATGA 5I84A 3EQ1A 3MPLA 3G3JA 3OSQA 3G7WA 4LUBA 3KG2A 3FXRA 2E0SA 3T22A 1P1UA 2ZYMA 2W7YA 2CZLA 1A55A 3VXCA 3V83A 3OO6A 1GR2A 1YAEA 3K6XA 3VLUA 5EHMA 2Z22A 3FJ7A 3VVDA 2P0SA 2XD2A 3PPPA 4GD5A 1ZTYA 4JSOA 1DPPA 4EF2A 3QYTA 2DWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEC A;  4KQP A;  4YAH X;  2O7U A;  2VGQ A;  1HSL A;  4R72 A;  3MVY A;  2I0B A;  3I3V A;  3IO6 A;  4WKM A;  4DCX A;  1MY4 A;  5L9S A;  4OFO A;  1GVC A;  3TCH A;  1R1N A;  1DPE A;  1N3W A;  4R6K A;  3JYR A;  1Y4C A;  1IUD A;  4YKP A;  4P0I A;  1UTB B;  1AOV A;  3MP1 A;  1EZO A;  3SKP A;  3HPI A;  3KN3 A;  1Q1K A;  2D21 A;  1FTL A;  1B52 A;  2OZZ A;  1OLA A;  2QPQ A;  3TEL A;  4HCY A;  4M1V A;  1I6B A;  3ONM A;  3FV2 A;  1B3H A;  3Q29 A;  4G68 A;  1PB7 A;  1IXI A;  1SYH A;  1NH8 A;  1B1X A;  4RK9 A;  1EH3 A;  5B70 A;  2RC8 A;  1NMU A;  1BKA A;  3USD A;  4XKP A;  1FTO A;  1F9B A;  2DWA A;  1O64 A;  5JTY B;  2O1L A;  1MM7 A;  3BBR A;  5AE4 A;  1B7H A;  4G8H A;  2D5W A;  1IXH A;  2D3I A;  2XXP A;  1RYX A;  3MC2 A;  3JZJ A;  2Q9T A;  2R9J A;  2QS1 A;  4C1T A;  3K6U A;  3MVX A;  2ZXT A;  3LR1 A;  4LAT A;  2RCA A;  4N07 A;  3O6G A;  1I69 A;  1N84 A;  3ZKL A;  4F3S A;  5FHN A;  2P2A A;  3IB0 A;  4DXU A;  3C34 A;  3MW0 A;  1Z7M E;  1B9J A;  3PUW E;  3PUZ E;  3UGW A;  2QMW A;  1B3L A;  4OEN A;  4EF1 A;  1RKM A;  4I8C A;  4FEB A;  3JV9 A;  4JSD A;  2OJT A;  1USY E;  5HBC A;  2H5Y A;  4F3P A;  2PT1 A;  1MY3 A;  3TEP A;  3VE1 B;  3KGC A;  3QUF A;  3VV5 A;  4FJP A;  4POW A;  1MY2 A;  1S9T A;  5I56 B;  4H8I A;  4GXS B;  4HTG A;  5TPA B;  4DLD A;  4ZE9 A;  5JK4 A;  3V8X B;  4GFR A;  3LSL A;  1EU8 A;  2XXW A;  5CC2 A;  3E3K A;  3R7X A;  3O97 A;  1D3K A;  2FA7 A;  1YPN A;  4ZZE A;  5H8Q B;  5CMB A;  3K01 A;  3HHF A;  1NKX A;  3H7M A;  3O66 A;  3DP6 A;  1B5J A;  2RF1 A;  5DVJ A;  2ZYO A;  3Q28 A;  1B3E A;  4EXL A;  3R26 A;  2LAO A;  4R9G A;  1HSE A;  2DSF A;  4JWX A;  1IEJ A;  2PX1 A;  4E0W A;  5BUU A;  4OHN A;  3IOV A;  3CFL A;  1QJM A;  1QKB A;  4KI0 E;  4LON B;  4EUO A;  3S9E A;  4OET A;  2ALU A;  1MPC A;  2Q88 A;  2PMS A;  2AYS A;  4H6D A;  4YIC A;  3N94 A;  3UP9 A;  3HO7 A;  4KYD A;  4O3C A;  4F1Y A;  1BIY A;  1SW5 A;  2HZL A;  1LFG A;  2GH9 A;  1Q35 A;  1PC3 A;  2CMO A;  5I59 B;  2I49 A;  4F2O A;  4PET A;  2DVZ A;  1MXY A;  4FOR A;  2H4I A;  3TTM A;  4OMB A;  4LZ7 A;  1DTZ A;  4QFO A;  4THI A;  2Y7R A;  3MZB A;  1Y4T A;  2AIX A;  3WAF A;  1QUI A;  1B32 A;  2DE3 A;  1SW1 A;  1A8E A;  4PFY A;  1OIB A;  2F7B A;  3OEN A;  2Q8J A;  2IA4 A;  4OZ9 A;  3QSL A;  1OQH A;  3IAZ A;  3CSB A;  1NNT A;  3PUX E;  1LBC A;  3IO4 A;  1IZ1 A;  1SQY A;  5HM4 B;  4AB5 A;  1N7X A;  3RN8 A;  4XKR A;  4QFN A;  4GVO A;  3S9N C;  3U92 A;  2HFB A;  2F6P A;  5FTH A;  3PPQ A;  1FQC A;  3ILT B;  3MUQ A;  4IO6 A;  3A3C A;  3W9V A;  4EXK A;  5CMM A;  4NF4 B;  3TDJ A;  3QIM A;  3FVO A;  3QXM A;  1OLC A;  2NWJ A;  1MDQ A;  3PPO A;  1B4H A;  5A5X A;  2QS3 A;  4FAT A;  3OMB A;  1QKA A;  2F35 A;  2F36 A;  3W15 C;  4NF8 B;  3FXQ A;  1OVT A;  3T9U A;  3SEY A;  1B5H A;  2DYX A;  3IJO B;  2O68 A;  1KWH A;  2OWS A;  1FTK A;  1BP5 A;  4OYV A;  2F8D A;  2ESN A;  1ZJL A;  2BJJ X;  4BDO A;  4F31 B;  3W9W A;  4IO3 A;  4R75 A;  3MJN A;  3CR9 A;  2QSX A;  4Q30 B;  3TPA A;  3N5L A;  5CRY A;  3HCQ A;  3IX1 A;  5H8N B;  1PB9 A;  3IK6 B;  1ZMG A;  1NL5 A;  4ZEI A;  2XX7 A;  1MXU A;  2Y7P A;  3FVK A;  5AA2 A;  2I4C A;  4RPN A;  3CG3 A;  4GOT A;  2DWH A;  3UOR A;  2PBW A;  3OEK A;  1MXX A;  5FHO A;  3SES A;  3H06 B;  2O69 A;  3Q25 A;  5H8H A;  4ISU A;  1MQH A;  4IO4 A;  2ZNU A;  4EQB A;  2XXI A;  4R74 A;  1PDA A;  3FAT A;  1MQD A;  1FQB A;  4HS7 A;  4F22 A;  3VFJ A;  1P1W A;  1O63 A;  4TOZ A;  1LCF A;  4RA1 A;  5ELV A;  3U1O A;  4I62 A;  1FW0 A;  1NNF A;  1JQF A;  3N26 A;  2O7I A;  4X48 A;  1J1N A;  3E13 X;  1LAG E;  3VLV A;  4F39 A;  3OD7 A;  4KR5 A;  1SYI A;  3VXB A;  2R71 A;  4C1U A;  1POT A;  3B6Q A;  3OEL A;  3R6U A;  4MLV A;  4LA9 A;  4Q8R A;  3RGY A;  4JWO A;  3FJM A;  3DEL B;  3PV0 E;  4YB5 A;  3TCG A;  2GRV A;  3G3H A;  3C9H A;  1JET A;  4ELR A;  2RKM A;  2H25 A;  2UXA A;  2Z8F A;  4ZEF A;  4KCD A;  1US4 A;  4U23 A;  2UVG A;  4IY6 A;  2I4B A;  2B3F A;  3O2A A;  1LFH A;  1II5 A;  1PB8 A;  3PD8 A;  1UTH A;  4XIG Q;  1R9L A;  4RJZ A;  3K02 A;  4XKN A;  1IIT A;  3V5A A;  3EHU A;  3G3G A;  3TZA A;  3K00 A;  4ELP A;  4G2Z A;  2H98 A;  1MY1 A;  4MBP A;  5DTB A;  1O7T A;  2I3V A;  1A40 A;  3O29 A;  3B6W A;  4YZZ A;  3UA8 A;  1B1H A;  3KN7 A;  5TP9 A;  1TT1 A;  2ONS A;  3U94 A;  5DVI A;  3K1M A;  4DXC A;  2XD3 A;  4PQJ A;  4IO2 A;  2Y7K A;  1UIV A;  5CBR A;  4QSD A;  4X1B A;  3SEX A;  1B3G A;  3N6T A;  2THI A;  1GV8 A;  3SDF A;  5LOM A;  1IIW A;  2O84 X;  1LAX A;  1M5E A;  4O3B A;  1XVY A;  1VFD A;  2XXR A;  4G8M A;  2B65 A;  3TQL A;  3K6V A;  1QUK A;  3OO7 A;  3SER A;  2NUV A;  5ICT A;  1Y9U A;  3MBP A;  1P1Q A;  3RT8 A;  3OO9 A;  4ECF A;  4OEV A;  2KLF A;  2REJ A;  3MPK A;  1UQW A;  1RYO A;  1Y3P A;  2F78 A;  4HCW A;  5ICQ A;  4OES A;  1IXC A;  1URG A;  3LSW A;  2V25 A;  5KDT A;  4U22 A;  3T9X B;  3V89 B;  5H8F A;  4LZ5 A;  2H99 A;  3N6U A;  1NFT A;  2NVU B;  3TAJ A;  1L5T A;  3H6V A;  1SW4 A;  3H3G A;  2V3U A;  4QHQ A;  3C31 A;  2X7P A;  4RYA A;  4XKQ A;  3DM0 A;  1B5I A;  2HAV A;  1N3X A;  1MDP 1;  1JVX A;  2I58 A;  3LSX A;  4GL8 A;  3O28 A;  2OLB A;  4G77 A;  4DIG A;  3Q27 A;  1R9Q A;  3FAS A;  1IQ7 A;  4QFP A;  1WDN A;  4GL0 A;  3M8U A;  1GGG A;  4UAC A;  5F1Q A;  1JW5 A;  3HV1 A;  1SI0 A;  3LBS A;  2DWI A;  4U4S A;  2F5X A;  5JTY A;  3H6W A;  3RY3 A;  3TCF A;  1M5D A;  3FJG A;  4ZEB A;  4I1D A;  1XS5 A;  3TTN A;  4DCY A;  3VVF A;  2F97 A;  3O6I A;  1B0L A;  3VDF A;  3T9H B;  3TTL A;  5CBS A;  1D4N A;  4M4G A;  4YU0 A;  1OVB A;  1P99 A;  4GLI A;  1URD A;  3MP8 A;  3RUM A;  2OBG A;  4KYS A;  1OQG A;  4NF5 A;  1FTJ A;  3FGS A;  3KEI A;  3GBA A;  2RCB A;  3D4G A;  5L9O A;  3C33 A;  1LB9 A;  1SW2 A;  3ILU B;  2OCU A;  4Z0I A;  1MH4 A;  3B7D A;  1MM6 A;  4EQ9 A;  3A3U A;  1QUJ A;  3FZV A;  2HEU A;  4AQ4 A;  3TMG A;  2I0C A;  4JXI A;  5IKB A;  1FQE A;  1US5 A;  4IO7 A;  1N0T A;  2I48 A;  1MPD A;  2DVC A;  1JW4 A;  4DZ1 A;  4NF6 A;  3CRB A;  2F34 A;  4FE8 A;  4BLA A;  3GZG A;  3MVW A;  4DE8 A;  1B7Z A;  1YTV A;  1LFI A;  3H6T A;  1YCJ A;  3F11 A;  3G3K A;  4OQO A;  2UYE A;  5L9M A;  3TQW A;  3H4Z A;  5H8Q A;  4NWD A;  1VSO A;  5DYH A;  3FD3 A;  2NOO A;  4AB6 A;  1B46 A;  1AL3 A;  2P1S A;  1DTG A;  2O6A A;  3U72 A;  1AMF A;  2XHD A;  4U21 A;  4KFQ A;  1H76 A;  3BFU A;  5I2N A;  1M5C A;  2Q2C A;  3L6G A;  3PUV E;  1FQA A;  1D9Y A;  5AA3 A;  4F2Q A;  3TOD A;  4BDM A;  1S50 A;  4GQO A;  4UA8 A;  4PFT A;  1ANF A;  5A5X B;  3BFT A;  1B58 A;  5I58 A;  2DE4 A;  3IL1 B;  4ESX A;  1R6Z A;  3RQT A;  1LB8 A;  1EZ9 A;  5ITO A;  3U93 A;  5CM6 A;  5I2K A;  5KZT A;  3PUY E;  3UK4 A;  4PE5 B;  2H9B A;  4YB6 A;  4F19 A;  2A5S A;  2ZNS A;  4E0X A;  5L8D A;  5DEX B;  4N13 A;  1B7U A;  1NH7 A;  3HHG A;  2HAU A;  4ELQ A;  2DXR A;  3WAE A;  3FVN A;  3CVG A;  1FQF A;  2WKY A;  3DP4 A;  4U1Z A;  4EQ7 A;  1QW0 A;  3DP8 A;  2E1S A;  1P1N A;  5BWJ A;  1M5B A;  3VVE A;  3IOW A;  1TWY A;  5AA2 B;  4KHZ E;  1XT8 A;  3K2D A;  2DE2 A;  5KCJ B;  4OWD A;  4IO5 A;  4RPO A;  3TYH A;  2XXH A;  2I3W A;  2RC7 A;  3KBR A;  4Z7E A;  2YPN A;  1DMB A;  4F29 A;  1A8F A;  5IAI A;  5H8H B;  3RNN A;  2Z8E A;  2Z23 A;  2Y7I A;  3C35 A;  4RK2 A;  4F3G A;  3GBB A;  4FEC A;  4R73 A;  5CMC A;  4Q5T A;  3T93 B;  5I57 A;  2Q89 A;  5HPQ A;  2GHB A;  4G8N A;  1B4Z A;  4L17 A;  1BLF A;  3OEM A;  3K0V A;  5F7V A;  1D9V A;  2AL5 A;  1HSJ A;  4MLQ A;  4OTE A;  1Y1Z A;  3KOS A;  1MY0 A;  4O3A A;  3CSG A;  4QRZ A;  3ZS6 A;  4GWO A;  3SEU A;  4MF3 A;  1VE4 A;  1PEB A;  1EZP A;  3IJX B;  2XXX A;  1JNF A;  2DOJ A;  4XXU A;  3IOR A;  3K1N A;  3L6H A;  5ITP A;  3IR1 A;  2QJE A;  3G3F A;  2QS4 A;  1M5F A;  2OK2 A;  3T96 B;  3DLN A;  2A5T A;  1B3F A;  3KN8 A;  2HXW A;  2ONR A;  4RXL A;  3MZ1 A;  4PFU A;  5H8N A;  4H1X A;  3CIJ A;  3RLF E;  1N04 A;  3S9L C;  1UTH B;  1Y3N A;  1S7Y A;  3HN0 A;  3MWB A;  4GXA A;  2R6G E;  5AA4 A;  1Y3Q A;  2OWT A;  3MAM A;  2VD3 A;  2XXU A;  4MFI A;  1SDX A;  4YMB A;  1LBB A;  1DOT A;  4BDN A;  2Y7W A;  5H8S A;  4JB7 A;  3EN3 A;  1H44 A;  3PD9 A;  1AIV A;  3UIF A;  3FUZ A;  2QRY A;  1H45 A;  3U8Q A;  5CI5 A;  3KOT A;  1MQG A;  2O51 A;  3SEV A;  1FQD A;  1I6Q A;  4ZS9 A;  1B2H A;  1XOC A;  3OXN A;  4GF8 A;  3M3K A;  2B3B A;  3CI8 A;  4G68 B;  1Z7N E;  2M8C A;  2REG A;  4LVQ A;  4DXB A;  3KJ7 A;  1LAF E;  3FXU A;  4N6P A;  4TLM B;  2V93 A;  1CE2 A;  3RPW A;  4U4X A;  4OXV A;  4QFK A;  1MS7 A;  4P0G A;  3Q26 A;  3PMW A;  5KDT B;  1I6A A;  4EDP A;  4ONY A;  3AXF A;  3D4C A;  3H6U A;  5H8F B;  1LST A;  1ELJ A;  4LQ2 A;  3KSX A;  2UVI A;  2VD2 A;  4K3F A;  2GFE A;  4YMA A;  2DP8 A;  4PFW A;  1ZIU A;  4NTL A;  1P1O A;  2VOZ A;  4FIM A;  2ABH A;  3E9X A;  1AH5 A;  1JEU A;  1B40 A;  5M2V A;  5J1D A;  2PVU A;  2YJP A;  1MQJ A;  4H0W A;  3O6H A;  5CMK A;  1URS A;  2UYF A;  3TFL A;  4OFJ A;  1XC1 A;  4LP2 B;  3K6W A;  1LLS A;  3CG1 A;  4IB2 A;  1BTJ A;  2FYI A;  3BKI B;  3KFM A;  3CFX A;  2AL4 A;  1WVJ A;  3PGF A;  2XXV A;  4TQU Q;  2IEE A;  4NMY A;  1UIU A;  1MRP A;  3OOA A;  3UN6 A;  2QL3 A;  5FTI A;  1UTB A;  4NWC A;  1MH3 A;  3HST A;  3ECR A;  4WXJ A;  2UVJ A;  4I9D A;  4H67 A;  3TUS A;  1T0K A;  4C0R A;  2ZMB A;  3ODB A;  4H5G A;  3S2V A;  2ONK E;  4XTC Q;  4NF5 B;  2HQ0 A;  4RNS A;  4BDL A;  3H03 A;  3ZKK A;  4BDQ A;  3P7I A;  2XX8 A;  5DVF A;  1OMP A;  1MXV A;  4H8J A;  3K1P A;  1PBP A;  3PU5 A;  1N7W A;  4KCC A;  5FHM A;  3OO8 A;  1MXW A;  1A54 A;  1LGB C;  2UVH A;  3A09 A;  2Q2A A;  4WED A;  1MQI A;  3RT6 B;  2DQV A;  3I6V A;  3T66 A;  4QSC A;  1USY H;  3EHS A;  3PPR A;  4NF6 B;  1NNK A;  4DDD A;  3IB1 A;  3KZG A;  2G93 A;  4RY1 A;  3OSR A;  3KSJ A;  3IOU A;  2GHA A;  4IGR A;  4H65 A;  1B05 A;  4MH5 A;  1QVS A;  2XX9 A;  2DXY A;  2FNC A;  4U2R A;  3SET A;  2ZYK A;  4F18 A;  4Q0C A;  1MG1 A;  4HW8 A;  1FTM A;  4ZDM A;  3TTR A;  4QSE A;  4JBZ A;  3RTF B;  4IY5 A;  1TFD A;  1XHY A;  4OFL A;  3THI A;  5I56 A;  4X1D A;  1DSN A;  3GLB A;  4F1U A;  1IXG A;  2ZNT A;  5TPA A;  4JWY A;  5I2N B;  4KPT A;  1MPB A;  2XXY A;  2DS9 A;  2ZYN A;  4ZZA A;  1SBP A;  2QMX A;  2PT2 A;  4F3B A;  1SI1 A;  5JEI A;  2V84 A;  5I58 B;  3E4R A;  5ISU A;  3GXA A;  3FIR A;  1PBQ A;  2F6G A;  5I2K B;  4OEU A;  2VHA A;  1WOD A;  3PPN A;  4X9T A;  2V3Q A;  4F1V A;  2F7C A;  4JDF A;  3FVG A;  1SVX B;  1VR5 A;  4R6H A;  2RIN A;  2ANJ A;  3IOT A;  3ZSF A;  4R2B A;  2XXT A;  5DT6 A;  3KJT A;  3SEW A;  1A99 A;  4R9F A;  1CB6 A;  3S9M C;  4KYE A;  4ZEK A;  2VP1 A;  1H43 A;  4QF9 A;  2I6E A;  3MVZ A;  2PYY A;  5EYF A;  1JEV A;  1B0H A;  4WEP A;  5I59 A;  1FCK A;  4G68 C;  1B51 A;  3M3L A;  4FED A;  1ZKB A;  3IB2 A;  1Y1M A;  1TXF A;  5EHS A;  3LUY A;  3G3I A;  3K4U A;  3LSF B;  4NE4 A;  3S4U A;  2O1M A;  2NXO A;  1A7L A;  1JVY A;  3C36 A;  3B6T A;  5B7D A;  3FV1 A;  5I57 B;  2X7Q A;  3M3F A;  5K2Y A;  4FAJ A;  1LAH E;  4KD5 A;  2HZK A;  4ESW A;  5AA1 A;  4GRK A;  1SD3 A;  4LQ5 A;  2Z8D A;  3C4M A;  3QUJ A;  1MXZ A;  4OVJ A;  2Y84 A;  1GTK A;  4H5F A;  2X26 A;  4POX A;  4ELO A;  2RC9 A;  4LZ8 A;  4IGT A;  3VLW A;  5DEX A;  1ZBM A;  3EPE A;  1ZU0 A;  1B6H A;  4NF4 A;  4U1O A;  4G4P A;  5K2X A;  2F7A A;  4ND9 A;  2A5T B;  1NNP A;  1JW1 A;  4YKJ A;  1TFA A;  3O9P A;  1LCT A;  4NF8 A;  5AA2 D;  3RTW B;  3PMX A;  1XVX A;  5TU0 A;  1POY 1;  4R2F A;  5AA4 B;  5KCJ A;  4PP0 A;  3EHT A;  3C32 A;  4R6Y A;  4YKI A;  3EF7 A;  3TTK A;  4P11 A;  3PMV A;  4ZE8 A;  3MP6 A;  3TKD A;  3LC8 A;  1ZLQ A;  2QS2 A;  1QUL A;  1Y20 A;  3QK6 A;  4QFL A;  4NED A;  2YLN A;  4GIZ A;  4TLL B;  4BDR A;  2V3T A;  2G29 A;  3MQ9 A;  3CFZ A;  3I5O A;  4ZED A;  1N76 A;  2XXQ A;  3T9V A;  3MZ9 A;  2HCA A;  3QAX A;  4YKK A;  4OER A;  1H3D A;  4YB7 A;  1VFE A;  5TP9 B;  1ATG A;  5I84 A;  3EQ1 A;  3MPL A;  3G3J A;  3OSQ A;  3G7W A;  4LUB A;  3KG2 A;  3FXR A;  2E0S A;  3T22 A;  1P1U A;  2ZYM A;  2W7Y A;  2CZL A;  1A55 A;  3VXC A;  3V83 A;  3OO6 A;  1GR2 A;  1YAE A;  3K6X A;  3VLU A;  5EHM A;  2Z22 A;  3FJ7 A;  3VVD A;  2P0S A;  2XD2 A;  3PPP A;  4GD5 A;  1ZTY A;  4JSO A;  1DPP A;  4EF2 A;  3QYT A;  2DWJ A; 
#chains in the Genus database with same CATH topology
 4ZEC A;  4KQP A;  4YAH X;  3T0J A;  2O7U A;  2VGQ A;  1HSL A;  4R72 A;  3MVY A;  2I0B A;  1NV2 A;  3I3V A;  3IO6 A;  4MNP A;  4WKM A;  4PF8 A;  4DCX A;  1MY4 A;  5L9S A;  4OFO A;  1GVC A;  1Q9D A;  3TCH A;  1R1N A;  1DPE A;  1N3W A;  4R6K A;  3JYR A;  1Y4C A;  1IUD A;  4YKP A;  4P0I A;  4XEQ A;  1UTB B;  1AOV A;  3MP1 A;  1EZO A;  3SKP A;  3HPI A;  3KN3 A;  1Q1K A;  2D21 A;  1FPK A;  4NHB A;  1FTL A;  1B52 A;  2OZZ A;  1OLA A;  2QPQ A;  4PAF A;  1VDW A;  3TEL A;  4HCY A;  4M1V A;  4AS4 A;  1I6B A;  3ONM A;  5I7I A;  3FV2 A;  1B3H A;  3Q29 A;  4G68 A;  1PB7 A;  1IXI A;  4GWX A;  1SYH A;  1D9Q A;  1NH8 A;  1B1X A;  4RK9 A;  1LBY A;  3PTY A;  1EH3 A;  5B70 A;  1IME A;  3MST A;  2RC8 A;  1NMU A;  3E79 A;  1BKA A;  3USD A;  1FSA A;  4XKP A;  1FTO A;  1F9B A;  2DWA A;  1FJ9 A;  1O64 A;  4GWW A;  5JTY B;  5IZZ A;  2O1L A;  1MM7 A;  3BBR A;  5AE4 A;  1B7H A;  4PAI A;  4G8H A;  2D5W A;  1IXH A;  2P3N A;  2D3I A;  2XXP A;  3EKI A;  1RYX A;  3MC2 A;  3JZJ A;  2Q9T A;  2R9J A;  2QS1 A;  4C1T A;  3K6U A;  3MVX A;  5IZ1 A;  4P56 A;  2ZXT A;  3LR1 A;  2F3B A;  4DI3 D;  1NUX A;  2ZZX A;  4LAT A;  2RCA A;  4N07 A;  3FXB A;  3O6G A;  1I69 A;  1FPG A;  1N84 A;  3ZKL A;  4F3S A;  5FHN A;  2P2A A;  3IB0 A;  4DXU A;  3C34 A;  3MW0 A;  1Z7M E;  1B9J A;  3PUW E;  3PUZ E;  4UAB A;  3UGW A;  2QMW A;  1B3L A;  2R8T A;  4OEN A;  4EF1 A;  1RKM A;  4I8C A;  4FEB A;  2CEY A;  3JV9 A;  4JSD A;  2OJT A;  1USY E;  4DI4 B;  5HBC A;  2H5Y A;  4F3P A;  1BK4 A;  2PT1 A;  1MY3 A;  3TEP A;  3VE1 B;  3KGC A;  3QUF A;  3VV5 A;  4FJP A;  4POW A;  1MY2 A;  4X04 A;  1S9T A;  5I56 B;  4H8I A;  4GXS B;  4HTG A;  5TPA B;  4DLD A;  4ZE9 A;  5JK4 A;  3V8X B;  4GFR A;  3LSL A;  1EU8 A;  2XXW A;  5CC2 A;  3E3K A;  3R7X A;  3O97 A;  1D3K A;  1LBV A;  2FA7 A;  1YPN A;  4ZZE A;  5H8Q B;  4I3E A;  5CMB A;  3K01 A;  1INP A;  3HHF A;  1NKX A;  3H7M A;  2DDK A;  3O66 A;  3DP6 A;  1B5J A;  2RF1 A;  5DVJ A;  2ZYO A;  5ET5 A;  3Q28 A;  5ET8 A;  1B3E A;  4EXL A;  3R26 A;  2LAO A;  4R9G A;  1HSE A;  2DSF A;  4JWX A;  1IEJ A;  2PX1 A;  4E0W A;  5BUU A;  4OHN A;  1FBD A;  3IOV A;  3CFL A;  1QJM A;  1QKB A;  4KI0 E;  4LON B;  4EUO A;  5EQ7 A;  4OET A;  3S9E A;  2ALU A;  1MPC A;  2Q88 A;  2PMS A;  2AYS A;  4GWZ A;  4H6D A;  4YIC A;  3N94 A;  3UP9 A;  3HO7 A;  4KYD A;  3LUZ A;  4O3C A;  4F1Y A;  4MAG A;  1BIY A;  1SW5 A;  2HZL A;  1LFG A;  2QVU A;  4O8M A;  2GH9 A;  2QVR A;  1Q35 A;  1PC3 A;  2CMO A;  5I59 B;  1YXI A;  2I49 A;  4F2O A;  4PET A;  2DVZ A;  3D1R A;  1MXY A;  4FOR A;  4MNI A;  2H4I A;  3TTM A;  4OMB A;  4LZ7 A;  4OVS A;  1DTZ A;  4QFO A;  4THI A;  2Y7R A;  3MZB A;  1Y4T A;  2AIX A;  3WAF A;  1QUI A;  1B32 A;  2DE3 A;  1SW1 A;  1A8E A;  4PFY A;  5DW8 A;  1OIB A;  2F7B A;  3OEN A;  2Q8J A;  2IA4 A;  4OZ9 A;  3QSL A;  1OQH A;  3IAZ A;  3CSB A;  1NNT A;  3PUX E;  1LBC A;  3IO4 A;  1IZ1 A;  1FBH A;  1SQY A;  5HM4 B;  4AB5 A;  1N7X A;  3RN8 A;  4XKR A;  4MX6 A;  4QFN A;  4GVO A;  3S9N C;  3U92 A;  2P3V A;  2HFB A;  2F6P A;  5FTH A;  3PPQ A;  1FQC A;  3ILT B;  3MUQ A;  4GWS A;  4IO6 A;  1EYJ A;  1KA1 A;  3A3C A;  3W9V A;  1EYK A;  4EXK A;  4PFB A;  5CMM A;  3FBP A;  4NF4 B;  3TDJ A;  3QIM A;  3FVO A;  3QXM A;  1OLC A;  2NWJ A;  1FBP A;  1MDQ A;  3PPO A;  1B4H A;  2XWO A;  5A5X A;  2KQZ A;  2QS3 A;  4FAT A;  3OMB A;  1QKA A;  1NV1 A;  2F35 A;  2F36 A;  3IFA A;  3W15 C;  4O7M A;  4I3Y A;  4NF8 B;  3FXQ A;  4MHF A;  1OVT A;  3T9U A;  1YYZ A;  5T3J A;  3SEY A;  1B5H A;  2DYX A;  3IJO B;  2O68 A;  1FBG A;  1KWH A;  2XWK A;  2OWS A;  1FTK A;  1BP5 A;  4OYV A;  2F8D A;  2ESN A;  2ZZW A;  1ZJL A;  2BJJ X;  4BDO A;  4F31 B;  3W9W A;  4IO3 A;  4OVQ A;  4R75 A;  3MJN A;  3CR9 A;  3U65 A;  2QSX A;  4Q30 B;  3TPA A;  3N5L A;  5CRY A;  3HCQ A;  1LBX A;  5F24 A;  3IX1 A;  5H8N B;  1PB9 A;  3IK6 B;  1ZMG A;  1NL5 A;  4ZEI A;  2XX7 A;  4PDH A;  1MXU A;  2Y7P A;  4XFE A;  3FVK A;  5AA2 A;  2I4C A;  4RPN A;  3CG3 A;  4GOT A;  2DWH A;  3UOR A;  2PBW A;  1NUY A;  3OEK A;  1MXX A;  5FHO A;  3SES A;  4P1L A;  3H06 B;  2O69 A;  3Q25 A;  5H8H A;  4ISU A;  1MQH A;  4IO4 A;  2ZNU A;  4EQB A;  2XXI A;  4R74 A;  3BIG A;  1PDA A;  3FAT A;  1MQD A;  1FQB A;  4HS7 A;  4F22 A;  2B4L A;  3VFJ A;  1P1W A;  1O63 A;  4TOZ A;  1LCF A;  4RA1 A;  5ELV A;  3U1O A;  3QMF A;  4I62 A;  1FW0 A;  1FTA A;  1NNF A;  1JQF A;  3N26 A;  2O7I A;  4X48 A;  1J1N A;  3E13 X;  1LAG E;  3VLV A;  1NV5 A;  4F39 A;  3OD7 A;  4KR5 A;  1NV3 A;  1SYI A;  3VXB A;  2R71 A;  2XXK A;  4C1U A;  1POT A;  3B6Q A;  3OEL A;  3R6U A;  4MLV A;  4P8B A;  4LA9 A;  4Q8R A;  3RGY A;  4JWO A;  3FJM A;  2L5V A;  5EQ9 A;  3DEL B;  3PV0 E;  4PCD A;  4YB5 A;  3TCG A;  2WYP A;  4MJO A;  2GRV A;  3G3H A;  3C9H A;  1JET A;  4ELR A;  2RKM A;  2H25 A;  2UXA A;  2Z8F A;  4ZEF A;  4KCD A;  1US4 A;  4U23 A;  2UVG A;  4IY6 A;  4MMP A;  2I4B A;  2B3F A;  3O2A A;  1LFH A;  1II5 A;  1PB8 A;  3PD8 A;  4PFI A;  1UTH A;  4XIG Q;  1R9L A;  4RJZ A;  3K02 A;  4XKN A;  1IIT A;  3V5A A;  3EHU A;  3G3G A;  3TZA A;  3K00 A;  4ELP A;  4G2Z A;  4MEV A;  2H98 A;  1MY1 A;  4MBP A;  5DTB A;  1O7T A;  2I3V A;  1A40 A;  3O29 A;  3B6W A;  4YZZ A;  3UA8 A;  1B1H A;  4N6K A;  3KN7 A;  5TP9 A;  4OAN A;  1TT1 A;  2ONS A;  3U94 A;  5DVI A;  3E78 A;  3K1M A;  4DXC A;  2XD3 A;  1IMB A;  4PQJ A;  4IO2 A;  2Y7K A;  1UIV A;  5CBR A;  2F3D A;  4QSD A;  4X1B A;  3SEX A;  2QFL A;  1B3G A;  3N6T A;  2THI A;  1GV8 A;  3SDF A;  5LOM A;  1IIW A;  2O84 X;  1LAX A;  1M5E A;  4O3B A;  2XA5 A;  1XVY A;  1VFD A;  2FVZ A;  2XXR A;  4G8M A;  2B65 A;  3TQL A;  3K6V A;  1QUK A;  3NOH A;  3OO7 A;  1RDY A;  3SER A;  2NUV A;  5ICT A;  1KZ8 A;  1Y9U A;  2FHY A;  3MBP A;  1P1Q A;  3RT8 A;  3OO9 A;  4ECF A;  4OEV A;  2KLF A;  2REJ A;  3MPK A;  1UQW A;  1RYO A;  1Y3P A;  2F78 A;  4HCW A;  5ICQ A;  4OES A;  1IXC A;  1URG A;  3LSW A;  2V25 A;  5KDT A;  4U22 A;  3T9X B;  4PFR A;  3V89 B;  5H8F A;  4LZ5 A;  2H99 A;  3N6U A;  1NFT A;  2NVU B;  3TAJ A;  5EYG A;  1L5T A;  3H6V A;  4P1E A;  1SW4 A;  3H3G A;  2V3U A;  4QHQ A;  3C31 A;  2X7P A;  4RYA A;  4XKQ A;  3DM0 A;  1B5I A;  2HAV A;  1N3X A;  1MDP 1;  1JVX A;  2I58 A;  3LSX A;  4GL8 A;  3O28 A;  2OLB A;  4G77 A;  1FRP A;  4DIG A;  3Q27 A;  1R9Q A;  2CZK A;  4NF0 A;  3FAS A;  1IQ7 A;  4QFP A;  1WDN A;  4GL0 A;  3M8U A;  1GGG A;  4UAC A;  5F1Q A;  1JW5 A;  3HV1 A;  1SI0 A;  3LBS A;  2DWI A;  2WX9 A;  4U4S A;  2F5X A;  2KR0 A;  3H6W A;  3RY3 A;  3TCF A;  5JTY A;  1M5D A;  3FJG A;  4ZEB A;  4I1D A;  1XS5 A;  3TTN A;  4DCY A;  3VVF A;  3CHG A;  4JVI A;  2F97 A;  3O6I A;  1B0L A;  4OVP A;  1NV4 A;  3VDF A;  3T9H B;  3TTL A;  5CBS A;  1D4N A;  4M4G A;  4YU0 A;  1OVB A;  1P99 A;  4GLI A;  1URD A;  3MP8 A;  1NV0 A;  3RUM A;  2OBG A;  4KYS A;  1OQG A;  4NF5 A;  1FTJ A;  1FPD A;  3FGS A;  3KEI A;  3GBA A;  2RCB A;  3D4G A;  1FPB A;  5LDZ A;  5L9O A;  3C33 A;  1LB9 A;  1SW2 A;  3ILU B;  2OCU A;  4Z0I A;  1MH4 A;  3B7D A;  1MM6 A;  4EQ9 A;  3A3U A;  1QUJ A;  3FZV A;  2HEU A;  4AQ4 A;  3TMG A;  2I0C A;  4JXI A;  5IKB A;  1FQE A;  1US5 A;  4IO7 A;  1N0T A;  2I48 A;  1MPD A;  2DVC A;  1JW4 A;  4DZ1 A;  4NF6 A;  2XWV A;  3CRB A;  2F34 A;  3KC0 A;  4FE8 A;  4BLA A;  3GZG A;  3MVW A;  4DE8 A;  1B7Z A;  1AWB A;  1YTV A;  1LFI A;  3H6T A;  1YCJ A;  3F11 A;  3G3K A;  4O94 A;  4OQO A;  2WBB A;  2UYE A;  5L9M A;  2OWZ A;  3H4Z A;  5H8Q A;  3TQW A;  4NWD A;  1VSO A;  5DYH A;  1FBE A;  2B4M A;  1FPI A;  1G0H A;  2NOO A;  3FD3 A;  4AB6 A;  4MCO A;  1B46 A;  1AL3 A;  2P1S A;  1DTG A;  2O6A A;  3U72 A;  1AMF A;  3GYY A;  2XHD A;  4NN3 A;  4U21 A;  1EYI A;  4KFQ A;  1H76 A;  3BFU A;  4FBP A;  5I2N A;  1M5C A;  2Q2C A;  3L6G A;  3RPL B;  3PUV E;  1FQA A;  1D9Y A;  5AA3 A;  1NI9 A;  4F2Q A;  3TOD A;  2VPN A;  4BDM A;  1S50 A;  1YZ0 A;  4GQO A;  4IR8 A;  4UA8 A;  4PFT A;  1ANF A;  5A5X B;  3BFT A;  1B58 A;  1K9Z A;  2DE4 A;  5I58 A;  3BIH A;  3IL1 B;  4ESX A;  1R6Z A;  3RQT A;  3KC1 A;  1LB8 A;  1EZ9 A;  5ITO A;  3U93 A;  5CM6 A;  5I2K A;  5KZT A;  3PUY E;  3UK4 A;  4PE5 B;  2H9B A;  4YB6 A;  4JVD A;  1FPE A;  4F19 A;  2A5S A;  1RDZ A;  2ZNS A;  4E0X A;  4GBV A;  5L8D A;  5DEX B;  4N13 A;  1B7U A;  4NAP A;  2Y5K A;  1NH7 A;  3HHG A;  2HAU A;  4ELQ A;  2DXR A;  3WAE A;  3FVN A;  3CVG A;  1FQF A;  2WKY A;  3DP4 A;  4U1Z A;  4EQ7 A;  1QW0 A;  3DP8 A;  2E1S A;  1P1N A;  4HE2 A;  5EQ8 A;  5BWJ A;  1M5B A;  5IZ3 B;  3VVE A;  3IOW A;  1TWY A;  5AA2 B;  4KHZ E;  1XT8 A;  4XF5 A;  3K2D A;  2DE2 A;  5KCJ B;  4OWD A;  4IO5 A;  4MIJ A;  4RPO A;  3TYH A;  3MYU A;  2XXH A;  1IMA A;  2I3W A;  2RC7 A;  3KBR A;  4Z7E A;  2YPN A;  1DMB A;  1FPF A;  4F29 A;  1A8F A;  5IAI A;  5H8H B;  3RNN A;  2Z8E A;  2Z23 A;  2Y7I A;  3C35 A;  4RK2 A;  4F3G A;  3GBB A;  2CZI A;  4FEC A;  4R73 A;  3ROJ A;  5CMC A;  4Q5T A;  4GWY A;  4QXD A;  3T93 B;  5I57 A;  2Q89 A;  5HPQ A;  2GHB A;  4G8N A;  1B4Z A;  4L17 A;  1BLF A;  3OEM A;  3K0V A;  5F7V A;  1D9V A;  2AL5 A;  1HSJ A;  4MLQ A;  4OTE A;  1Y1Z A;  3KOS A;  1MY0 A;  4O3A A;  3CSG A;  4QRZ A;  2JJK A;  3ZS6 A;  4GWO A;  3SEU A;  4MF3 A;  1VE4 A;  4G61 A;  5A5L A;  1PEB A;  1EZP A;  3IJX B;  2XXX A;  1JNF A;  2DOJ A;  4XXU A;  3IOR A;  5I3S A;  3K1N A;  3L6H A;  5ITP A;  4PTK A;  3IR1 A;  2QJE A;  3G3F A;  2QS4 A;  4NG7 A;  1M5F A;  4GX6 A;  2OK2 A;  3T96 B;  3DLN A;  2A5T A;  1B3F A;  3KN8 A;  2HXW A;  2ONR A;  5ET7 A;  2Q8M A;  4PGN A;  4RXL A;  3MZ1 A;  4PFU A;  5H8N A;  4H1X A;  3CIJ A;  3RLF E;  1N04 A;  3S9L C;  3KBZ A;  1UTH B;  1Y3N A;  1S7Y A;  3HN0 A;  3MWB A;  4GXA A;  2GQ1 A;  2R6G E;  5AA4 A;  1Y3Q A;  2OWT A;  1DK4 A;  1JP4 A;  3MAM A;  2VD3 A;  2XXU A;  4MFI A;  1SDX A;  4YMB A;  1LBB A;  1DOT A;  4BDN A;  2Y7W A;  5H8S A;  4JB7 A;  3EN3 A;  1H44 A;  4HE0 A;  1LBZ A;  3PD9 A;  4GX3 A;  1AIV A;  3UIF A;  3FUZ A;  3HFU A;  2QRY A;  4P9K A;  2FBP A;  1H45 A;  3U8Q A;  5CI5 A;  3KOT A;  1IMD A;  5I5P A;  1MQG A;  2O51 A;  3SEV A;  1FQD A;  1I6Q A;  4ZS9 A;  1B2H A;  1NUZ A;  1XOC A;  3OXN A;  4GF8 A;  3M3K A;  2B3B A;  3CI8 A;  4G68 B;  1Z7N E;  4PDD A;  2M8C A;  2PCR A;  2REG A;  4LVQ A;  4DXB A;  3KJ7 A;  2XWI A;  1LAF E;  3FXU A;  4N6P A;  4TLM B;  2V93 A;  1CE2 A;  3RPW A;  4U4X A;  4OXV A;  4N6D A;  4QFK A;  1MS7 A;  4P0G A;  3Q26 A;  3PMW A;  5KDT B;  1I6A A;  4EDP A;  4PAK A;  4ONY A;  2OX3 A;  3AXF A;  3D4C A;  3H6U A;  5H8F B;  4I40 A;  5EYH A;  1LST A;  1ELJ A;  4LQ2 A;  5IM2 A;  5EQA A;  3KSX A;  2CEX A;  2UVI A;  2VD2 A;  4K3F A;  4LN5 A;  4OA4 A;  2GFE A;  4YMA A;  2DP8 A;  4P47 A;  4PFW A;  1ZIU A;  4NTL A;  1P1O A;  2VOZ A;  4FIM A;  2ABH A;  3E9X A;  1XI6 A;  1AH5 A;  1JEU A;  1B40 A;  5M2V A;  5J1D A;  2PVU A;  2YJP A;  1MQJ A;  4PBH A;  4H0W A;  3O6H A;  5CMK A;  1URS A;  2UYF A;  3TFL A;  5ESY A;  4OFJ A;  1XC1 A;  4LP2 B;  3K6W A;  1LLS A;  2ZZV A;  3CG1 A;  4IB2 A;  2WYK A;  2Q74 A;  1BTJ A;  2FYI A;  4OVR A;  3BKI B;  3KFM A;  4O7I A;  3CFX A;  2AL4 A;  1WVJ A;  3PGF A;  2XXV A;  4TQU Q;  2IEE A;  4NMY A;  1UIU A;  1MRP A;  3OOA A;  4N81 A;  4NQ8 A;  5ET6 A;  3UN6 A;  2QL3 A;  5LTC A;  2FIX A;  2PFZ A;  5FTI A;  1UTB A;  4NWC A;  1MH3 A;  3HST A;  3ECR A;  4WXJ A;  2UVJ A;  4I9D A;  4H67 A;  3TUS A;  1T0K A;  1LBW A;  4C0R A;  2ZMB A;  3ODB A;  4H5G A;  3S2V A;  2ONK E;  4XTC Q;  2Y5L A;  2FIE A;  1KA0 A;  4NF5 B;  1CNQ A;  2HQ0 A;  4RNS A;  3H03 A;  3ZKK A;  4BDQ A;  4BDL A;  3P7I A;  2XX8 A;  5DVF A;  1OMP A;  1MXV A;  4OVT A;  2WBD A;  4H8J A;  3K1P A;  2VPO A;  1PBP A;  3PU5 A;  1N7W A;  4KCC A;  5FHM A;  3OO8 A;  1MXW A;  1A54 A;  1LGB C;  2UVH A;  3A09 A;  2Q2A A;  4WED A;  1MQI A;  3RT6 B;  2DQV A;  3I6V A;  3T66 A;  4QSC A;  1USY H;  3EHS A;  3PPR A;  4H46 A;  4NF6 B;  1NNK A;  4DDD A;  3IB1 A;  3KZG A;  2G93 A;  4GBW A;  3OSR A;  4RY1 A;  3KSJ A;  3IOU A;  2GHA A;  4IGR A;  4H65 A;  1B05 A;  4MH5 A;  1QVS A;  2XX9 A;  2DXY A;  2QVV A;  2FNC A;  4U2R A;  3SET A;  2ZYK A;  4F18 A;  4Q0C A;  1MG1 A;  4HW8 A;  1FTM A;  4ZDM A;  3TTR A;  4QSE A;  4JBZ A;  3RTF B;  4IY5 A;  1TFD A;  1XHY A;  4OFL A;  3THI A;  1IMF A;  5I56 A;  4X1D A;  1DSN A;  3GLB A;  4F1U A;  1IXG A;  2ZNT A;  5TPA A;  4JWY A;  1NV6 A;  5I2N B;  4KPT A;  1MPB A;  2XXY A;  2DS9 A;  2ZYN A;  4ZZA A;  5IGA A;  1SBP A;  2QMX A;  2PT2 A;  4F3B A;  1SI1 A;  5JEI A;  2V84 A;  5I58 B;  3E4R A;  5ISU A;  3GXA A;  3FIR A;  1PBQ A;  2F6G A;  5I2K B;  4OEU A;  2VHA A;  1WOD A;  3T1B A;  3PPN A;  4X9T A;  2V3Q A;  4F1V A;  2F7C A;  4JDF A;  3FVG A;  1SVX B;  1VR5 A;  4R6H A;  2RIN A;  2ANJ A;  3IOT A;  3ZSF A;  4R2B A;  2XXT A;  5DT6 A;  3KJT A;  3SEW A;  4PF6 A;  1A99 A;  1DCU A;  1FPL A;  4R9F A;  4JVC A;  4NX1 A;  1CB6 A;  3S9M C;  4KYE A;  3LV0 A;  4ZEK A;  2VP1 A;  1H43 A;  4QF9 A;  2I6E A;  3MVZ A;  2PYY A;  2CZH A;  5EYF A;  1JEV A;  1B0H A;  4WEP A;  5I59 A;  1FCK A;  4G68 C;  1B51 A;  3M3L A;  2HXR A;  4FED A;  1ZKB A;  2BJI A;  3IB2 A;  1QGX A;  1Y1M A;  1TXF A;  5EHS A;  3LUY A;  3G3I A;  3K4U A;  4HE1 A;  3LSF B;  4NE4 A;  3S4U A;  2O1M A;  3IFC A;  2NXO A;  4PC9 A;  1A7L A;  1JVY A;  3C36 A;  3B6T A;  5B7D A;  3RPL A;  3FV1 A;  5I57 B;  2X7Q A;  3M3F A;  5K2Y A;  4FAJ A;  1LAH E;  4KD5 A;  1IMC A;  2HZK A;  4ESW A;  5AA1 A;  4GRK A;  1SD3 A;  4LQ5 A;  2Z8D A;  3C4M A;  4NGU A;  3QUJ A;  4KXP A;  1MXZ A;  4OVJ A;  2Y84 A;  1GTK A;  4H5F A;  2X26 A;  4POX A;  4ELO A;  2MKZ A;  2RC9 A;  2WEF A;  4LZ8 A;  4P3L A;  4IGT A;  3VLW A;  3SZP A;  1G0I A;  5DEX A;  1ZBM A;  3EPE A;  4N4U A;  1ZU0 A;  1B6H A;  4NF4 A;  4GX4 A;  5FBP A;  4U1O A;  1NUW A;  4G4P A;  5K2X A;  2F7A A;  4ND9 A;  2A5T B;  1NNP A;  3ISP A;  1JW1 A;  4YKJ A;  1TFA A;  1FBC A;  3O9P A;  1LCT A;  4NF8 A;  4AS5 A;  5AA2 D;  5IZ3 A;  3RTW B;  3PMX A;  4H45 A;  1XVX A;  5TU0 A;  1POY 1;  4HXV A;  4R2F A;  5AA4 B;  5KCJ A;  4PP0 A;  4PGP A;  3EHT A;  3C32 A;  4R6Y A;  4YKI A;  3EF7 A;  3TTK A;  4P11 A;  1SPI A;  1DBZ A;  3PMV A;  1LEV A;  4ZE8 A;  3MP6 A;  5J16 A;  3TKD A;  3LC8 A;  1ZLQ A;  2QS2 A;  1QUL A;  2HHM A;  1Y20 A;  3QK6 A;  4QFL A;  3B8B A;  1FJ6 A;  4NED A;  2YLN A;  4GIZ A;  4TLL B;  4BDR A;  2V3T A;  1FBF A;  2G29 A;  3MQ9 A;  4PE3 A;  3CFZ A;  3I5O A;  4ZED A;  1FPJ A;  1N76 A;  4N8G A;  4GWU A;  2XXQ A;  3T9V A;  3MZ9 A;  2HCA A;  3QAX A;  4YKK A;  4OER A;  1H3D A;  4YB7 A;  1VFE A;  3RYD A;  5TP9 B;  1ATG A;  4N91 A;  5I84 A;  3EQ1 A;  3MPL A;  3B50 A;  4PBQ A;  4N15 A;  3G3J A;  3OSQ A;  3G7W A;  4LUB A;  3KG2 A;  3FXR A;  2E0S A;  3T22 A;  1P1U A;  2ZYM A;  2V4C A;  2VT5 A;  2HPG A;  2W7Y A;  2CZL A;  1A55 A;  3VXC A;  2PFY A;  3A29 A;  4QBA A;  3V83 A;  3OO6 A;  1GR2 A;  1K9Y A;  4N8Y A;  1YAE A;  3K6X A;  3VLU A;  5EHM A;  4N17 A;  1RDX A;  2Z22 A;  3FJ7 A;  3VVD A;  2P0S A;  2XD2 A;  1NV7 A;  3PPP A;  4GD5 A;  1ZTY A;  4JSO A;  4X8R A;  1DPP A;  4EF2 A;  3QYT A;  4MNC A;  2DWJ A; 
#chains in the Genus database with same CATH homology
 4ZEC A;  4KQP A;  4YAH X;  2O7U A;  2VGQ A;  1HSL A;  4R72 A;  3MVY A;  2I0B A;  3I3V A;  3IO6 A;  4WKM A;  4DCX A;  1MY4 A;  5L9S A;  4OFO A;  1GVC A;  3TCH A;  1R1N A;  1DPE A;  1N3W A;  4R6K A;  3JYR A;  1Y4C A;  1IUD A;  4YKP A;  4P0I A;  1UTB B;  1AOV A;  3MP1 A;  1EZO A;  3SKP A;  3HPI A;  3KN3 A;  1Q1K A;  2D21 A;  1FTL A;  1B52 A;  2OZZ A;  1OLA A;  2QPQ A;  3TEL A;  4HCY A;  4M1V A;  1I6B A;  3ONM A;  3FV2 A;  1B3H A;  3Q29 A;  4G68 A;  1PB7 A;  1IXI A;  1SYH A;  1NH8 A;  1B1X A;  4RK9 A;  1EH3 A;  5B70 A;  2RC8 A;  1NMU A;  1BKA A;  3USD A;  4XKP A;  1FTO A;  1F9B A;  2DWA A;  1O64 A;  5JTY B;  2O1L A;  1MM7 A;  3BBR A;  5AE4 A;  1B7H A;  4G8H A;  2D5W A;  1IXH A;  2D3I A;  2XXP A;  1RYX A;  3MC2 A;  3JZJ A;  2Q9T A;  2R9J A;  2QS1 A;  4C1T A;  3K6U A;  3MVX A;  2ZXT A;  3LR1 A;  4LAT A;  2RCA A;  4N07 A;  3O6G A;  1I69 A;  1N84 A;  3ZKL A;  4F3S A;  5FHN A;  2P2A A;  3IB0 A;  4DXU A;  3C34 A;  3MW0 A;  1Z7M E;  1B9J A;  3PUW E;  3PUZ E;  3UGW A;  2QMW A;  1B3L A;  4OEN A;  4EF1 A;  1RKM A;  4I8C A;  4FEB A;  3JV9 A;  4JSD A;  2OJT A;  1USY E;  5HBC A;  2H5Y A;  4F3P A;  2PT1 A;  1MY3 A;  3TEP A;  3VE1 B;  3KGC A;  3QUF A;  3VV5 A;  4FJP A;  4POW A;  1MY2 A;  1S9T A;  5I56 B;  4H8I A;  4GXS B;  4HTG A;  5TPA B;  4DLD A;  4ZE9 A;  5JK4 A;  3V8X B;  4GFR A;  3LSL A;  1EU8 A;  2XXW A;  5CC2 A;  3E3K A;  3R7X A;  3O97 A;  1D3K A;  2FA7 A;  1YPN A;  4ZZE A;  5H8Q B;  5CMB A;  3K01 A;  3HHF A;  1NKX A;  3H7M A;  3O66 A;  3DP6 A;  1B5J A;  2RF1 A;  5DVJ A;  2ZYO A;  3Q28 A;  1B3E A;  4EXL A;  3R26 A;  2LAO A;  4R9G A;  1HSE A;  2DSF A;  4JWX A;  1IEJ A;  2PX1 A;  4E0W A;  5BUU A;  4OHN A;  3IOV A;  3CFL A;  1QJM A;  1QKB A;  4KI0 E;  4LON B;  4EUO A;  3S9E A;  4OET A;  2ALU A;  1MPC A;  2Q88 A;  2PMS A;  2AYS A;  4H6D A;  4YIC A;  3N94 A;  3UP9 A;  3HO7 A;  4KYD A;  4O3C A;  4F1Y A;  1BIY A;  1SW5 A;  2HZL A;  1LFG A;  2GH9 A;  1Q35 A;  1PC3 A;  2CMO A;  5I59 B;  2I49 A;  4F2O A;  4PET A;  2DVZ A;  1MXY A;  4FOR A;  2H4I A;  3TTM A;  4OMB A;  4LZ7 A;  1DTZ A;  4QFO A;  4THI A;  2Y7R A;  3MZB A;  1Y4T A;  2AIX A;  3WAF A;  1QUI A;  1B32 A;  2DE3 A;  1SW1 A;  1A8E A;  4PFY A;  1OIB A;  2F7B A;  3OEN A;  2Q8J A;  2IA4 A;  4OZ9 A;  3QSL A;  1OQH A;  3IAZ A;  3CSB A;  1NNT A;  3PUX E;  1LBC A;  3IO4 A;  1IZ1 A;  1SQY A;  5HM4 B;  4AB5 A;  1N7X A;  3RN8 A;  4XKR A;  4QFN A;  4GVO A;  3S9N C;  3U92 A;  2HFB A;  2F6P A;  5FTH A;  3PPQ A;  1FQC A;  3ILT B;  3MUQ A;  4IO6 A;  3A3C A;  3W9V A;  4EXK A;  5CMM A;  4NF4 B;  3TDJ A;  3QIM A;  3FVO A;  3QXM A;  1OLC A;  2NWJ A;  1MDQ A;  3PPO A;  1B4H A;  5A5X A;  2QS3 A;  4FAT A;  3OMB A;  1QKA A;  2F35 A;  2F36 A;  3W15 C;  4NF8 B;  3FXQ A;  1OVT A;  3T9U A;  3SEY A;  1B5H A;  2DYX A;  3IJO B;  2O68 A;  1KWH A;  2OWS A;  1FTK A;  1BP5 A;  4OYV A;  2F8D A;  2ESN A;  1ZJL A;  2BJJ X;  4BDO A;  4F31 B;  3W9W A;  4IO3 A;  4R75 A;  3MJN A;  3CR9 A;  2QSX A;  4Q30 B;  3TPA A;  3N5L A;  5CRY A;  3HCQ A;  3IX1 A;  5H8N B;  1PB9 A;  3IK6 B;  1ZMG A;  1NL5 A;  4ZEI A;  2XX7 A;  1MXU A;  2Y7P A;  3FVK A;  5AA2 A;  2I4C A;  4RPN A;  3CG3 A;  4GOT A;  2DWH A;  3UOR A;  2PBW A;  3OEK A;  1MXX A;  5FHO A;  3SES A;  3H06 B;  2O69 A;  3Q25 A;  5H8H A;  4ISU A;  1MQH A;  4IO4 A;  2ZNU A;  4EQB A;  2XXI A;  4R74 A;  1PDA A;  3FAT A;  1MQD A;  1FQB A;  4HS7 A;  4F22 A;  3VFJ A;  1P1W A;  1O63 A;  4TOZ A;  1LCF A;  4RA1 A;  5ELV A;  3U1O A;  4I62 A;  1FW0 A;  1NNF A;  1JQF A;  3N26 A;  2O7I A;  4X48 A;  1J1N A;  3E13 X;  1LAG E;  3VLV A;  4F39 A;  3OD7 A;  4KR5 A;  1SYI A;  3VXB A;  2R71 A;  4C1U A;  1POT A;  3B6Q A;  3OEL A;  3R6U A;  4MLV A;  4LA9 A;  4Q8R A;  3RGY A;  4JWO A;  3FJM A;  3DEL B;  3PV0 E;  4YB5 A;  3TCG A;  2GRV A;  3G3H A;  3C9H A;  1JET A;  4ELR A;  2RKM A;  2H25 A;  2UXA A;  2Z8F A;  4ZEF A;  4KCD A;  1US4 A;  4U23 A;  2UVG A;  4IY6 A;  2I4B A;  2B3F A;  3O2A A;  1LFH A;  1II5 A;  1PB8 A;  3PD8 A;  1UTH A;  4XIG Q;  1R9L A;  4RJZ A;  3K02 A;  4XKN A;  1IIT A;  3V5A A;  3EHU A;  3G3G A;  3TZA A;  3K00 A;  4ELP A;  4G2Z A;  2H98 A;  1MY1 A;  4MBP A;  5DTB A;  1O7T A;  2I3V A;  1A40 A;  3O29 A;  3B6W A;  4YZZ A;  3UA8 A;  1B1H A;  3KN7 A;  5TP9 A;  1TT1 A;  2ONS A;  3U94 A;  5DVI A;  3K1M A;  4DXC A;  2XD3 A;  4PQJ A;  4IO2 A;  2Y7K A;  1UIV A;  5CBR A;  4QSD A;  4X1B A;  3SEX A;  1B3G A;  3N6T A;  2THI A;  1GV8 A;  3SDF A;  5LOM A;  1IIW A;  2O84 X;  1LAX A;  1M5E A;  4O3B A;  1XVY A;  1VFD A;  2XXR A;  4G8M A;  2B65 A;  3TQL A;  3K6V A;  1QUK A;  3OO7 A;  3SER A;  2NUV A;  5ICT A;  1Y9U A;  3MBP A;  1P1Q A;  3RT8 A;  3OO9 A;  4ECF A;  4OEV A;  2KLF A;  2REJ A;  3MPK A;  1UQW A;  1RYO A;  1Y3P A;  2F78 A;  4HCW A;  5ICQ A;  4OES A;  1IXC A;  1URG A;  3LSW A;  2V25 A;  5KDT A;  4U22 A;  3T9X B;  3V89 B;  5H8F A;  4LZ5 A;  2H99 A;  3N6U A;  1NFT A;  2NVU B;  3TAJ A;  1L5T A;  3H6V A;  1SW4 A;  3H3G A;  2V3U A;  4QHQ A;  3C31 A;  2X7P A;  4RYA A;  4XKQ A;  3DM0 A;  1B5I A;  2HAV A;  1N3X A;  1MDP 1;  1JVX A;  2I58 A;  3LSX A;  4GL8 A;  3O28 A;  2OLB A;  4G77 A;  4DIG A;  3Q27 A;  1R9Q A;  3FAS A;  1IQ7 A;  4QFP A;  1WDN A;  4GL0 A;  3M8U A;  1GGG A;  4UAC A;  5F1Q A;  1JW5 A;  3HV1 A;  1SI0 A;  3LBS A;  2DWI A;  4U4S A;  2F5X A;  5JTY A;  3H6W A;  3RY3 A;  3TCF A;  1M5D A;  3FJG A;  4ZEB A;  4I1D A;  1XS5 A;  3TTN A;  4DCY A;  3VVF A;  2F97 A;  3O6I A;  1B0L A;  3VDF A;  3T9H B;  3TTL A;  5CBS A;  1D4N A;  4M4G A;  4YU0 A;  1OVB A;  1P99 A;  4GLI A;  1URD A;  3MP8 A;  3RUM A;  2OBG A;  4KYS A;  1OQG A;  4NF5 A;  1FTJ A;  3FGS A;  3KEI A;  3GBA A;  2RCB A;  3D4G A;  5L9O A;  3C33 A;  1LB9 A;  1SW2 A;  3ILU B;  2OCU A;  4Z0I A;  1MH4 A;  3B7D A;  1MM6 A;  4EQ9 A;  3A3U A;  1QUJ A;  3FZV A;  2HEU A;  4AQ4 A;  3TMG A;  2I0C A;  4JXI A;  5IKB A;  1FQE A;  1US5 A;  4IO7 A;  1N0T A;  2I48 A;  1MPD A;  2DVC A;  1JW4 A;  4DZ1 A;  4NF6 A;  3CRB A;  2F34 A;  4FE8 A;  4BLA A;  3GZG A;  3MVW A;  4DE8 A;  1B7Z A;  1YTV A;  1LFI A;  3H6T A;  1YCJ A;  3F11 A;  3G3K A;  4OQO A;  2UYE A;  5L9M A;  3TQW A;  3H4Z A;  5H8Q A;  4NWD A;  1VSO A;  5DYH A;  3FD3 A;  2NOO A;  4AB6 A;  1B46 A;  1AL3 A;  2P1S A;  1DTG A;  2O6A A;  3U72 A;  1AMF A;  2XHD A;  4U21 A;  4KFQ A;  1H76 A;  3BFU A;  5I2N A;  1M5C A;  2Q2C A;  3L6G A;  3PUV E;  1FQA A;  1D9Y A;  5AA3 A;  4F2Q A;  3TOD A;  4BDM A;  1S50 A;  4GQO A;  4UA8 A;  4PFT A;  1ANF A;  5A5X B;  3BFT A;  1B58 A;  5I58 A;  2DE4 A;  3IL1 B;  4ESX A;  1R6Z A;  3RQT A;  1LB8 A;  1EZ9 A;  5ITO A;  3U93 A;  5CM6 A;  5I2K A;  5KZT A;  3PUY E;  3UK4 A;  4PE5 B;  2H9B A;  4YB6 A;  4F19 A;  2A5S A;  2ZNS A;  4E0X A;  5L8D A;  5DEX B;  4N13 A;  1B7U A;  1NH7 A;  3HHG A;  2HAU A;  4ELQ A;  2DXR A;  3WAE A;  3FVN A;  3CVG A;  1FQF A;  2WKY A;  3DP4 A;  4U1Z A;  4EQ7 A;  1QW0 A;  3DP8 A;  2E1S A;  1P1N A;  5BWJ A;  1M5B A;  3VVE A;  3IOW A;  1TWY A;  5AA2 B;  4KHZ E;  1XT8 A;  3K2D A;  2DE2 A;  5KCJ B;  4OWD A;  4IO5 A;  4RPO A;  3TYH A;  2XXH A;  2I3W A;  2RC7 A;  3KBR A;  4Z7E A;  2YPN A;  1DMB A;  4F29 A;  1A8F A;  5IAI A;  5H8H B;  3RNN A;  2Z8E A;  2Z23 A;  2Y7I A;  3C35 A;  4RK2 A;  4F3G A;  3GBB A;  4FEC A;  4R73 A;  5CMC A;  4Q5T A;  3T93 B;  5I57 A;  2Q89 A;  5HPQ A;  2GHB A;  4G8N A;  1B4Z A;  4L17 A;  1BLF A;  3OEM A;  3K0V A;  5F7V A;  1D9V A;  2AL5 A;  1HSJ A;  4MLQ A;  4OTE A;  1Y1Z A;  3KOS A;  1MY0 A;  4O3A A;  3CSG A;  4QRZ A;  3ZS6 A;  4GWO A;  3SEU A;  4MF3 A;  1VE4 A;  1PEB A;  1EZP A;  3IJX B;  2XXX A;  1JNF A;  2DOJ A;  4XXU A;  3IOR A;  3K1N A;  3L6H A;  5ITP A;  3IR1 A;  2QJE A;  3G3F A;  2QS4 A;  1M5F A;  2OK2 A;  3T96 B;  3DLN A;  2A5T A;  1B3F A;  3KN8 A;  2HXW A;  2ONR A;  4RXL A;  3MZ1 A;  4PFU A;  5H8N A;  4H1X A;  3CIJ A;  3RLF E;  1N04 A;  3S9L C;  1UTH B;  1Y3N A;  1S7Y A;  3HN0 A;  3MWB A;  4GXA A;  2R6G E;  5AA4 A;  1Y3Q A;  2OWT A;  3MAM A;  2VD3 A;  2XXU A;  4MFI A;  1SDX A;  4YMB A;  1LBB A;  1DOT A;  4BDN A;  2Y7W A;  5H8S A;  4JB7 A;  3EN3 A;  1H44 A;  3PD9 A;  1AIV A;  3UIF A;  3FUZ A;  2QRY A;  1H45 A;  3U8Q A;  5CI5 A;  3KOT A;  1MQG A;  2O51 A;  3SEV A;  1FQD A;  1I6Q A;  4ZS9 A;  1B2H A;  1XOC A;  3OXN A;  4GF8 A;  3M3K A;  2B3B A;  3CI8 A;  4G68 B;  1Z7N E;  2M8C A;  2REG A;  4LVQ A;  4DXB A;  3KJ7 A;  1LAF E;  3FXU A;  4N6P A;  4TLM B;  2V93 A;  1CE2 A;  3RPW A;  4U4X A;  4OXV A;  4QFK A;  1MS7 A;  4P0G A;  3Q26 A;  3PMW A;  5KDT B;  1I6A A;  4EDP A;  4ONY A;  3AXF A;  3D4C A;  3H6U A;  5H8F B;  1LST A;  1ELJ A;  4LQ2 A;  3KSX A;  2UVI A;  2VD2 A;  4K3F A;  2GFE A;  4YMA A;  2DP8 A;  4PFW A;  1ZIU A;  4NTL A;  1P1O A;  2VOZ A;  4FIM A;  2ABH A;  3E9X A;  1AH5 A;  1JEU A;  1B40 A;  5M2V A;  5J1D A;  2PVU A;  2YJP A;  1MQJ A;  4H0W A;  3O6H A;  5CMK A;  1URS A;  2UYF A;  3TFL A;  4OFJ A;  1XC1 A;  4LP2 B;  3K6W A;  1LLS A;  3CG1 A;  4IB2 A;  1BTJ A;  2FYI A;  3BKI B;  3KFM A;  3CFX A;  2AL4 A;  1WVJ A;  3PGF A;  2XXV A;  4TQU Q;  2IEE A;  4NMY A;  1UIU A;  1MRP A;  3OOA A;  3UN6 A;  2QL3 A;  5FTI A;  1UTB A;  4NWC A;  1MH3 A;  3HST A;  3ECR A;  4WXJ A;  2UVJ A;  4I9D A;  4H67 A;  3TUS A;  1T0K A;  4C0R A;  2ZMB A;  3ODB A;  4H5G A;  3S2V A;  2ONK E;  4XTC Q;  4NF5 B;  2HQ0 A;  4RNS A;  4BDL A;  3H03 A;  3ZKK A;  4BDQ A;  3P7I A;  2XX8 A;  5DVF A;  1OMP A;  1MXV A;  4H8J A;  3K1P A;  1PBP A;  3PU5 A;  1N7W A;  4KCC A;  5FHM A;  3OO8 A;  1MXW A;  1A54 A;  1LGB C;  2UVH A;  3A09 A;  2Q2A A;  4WED A;  1MQI A;  3RT6 B;  2DQV A;  3I6V A;  3T66 A;  4QSC A;  1USY H;  3EHS A;  3PPR A;  4NF6 B;  1NNK A;  4DDD A;  3IB1 A;  3KZG A;  2G93 A;  4RY1 A;  3OSR A;  3KSJ A;  3IOU A;  2GHA A;  4IGR A;  4H65 A;  1B05 A;  4MH5 A;  1QVS A;  2XX9 A;  2DXY A;  2FNC A;  4U2R A;  3SET A;  2ZYK A;  4F18 A;  4Q0C A;  1MG1 A;  4HW8 A;  1FTM A;  4ZDM A;  3TTR A;  4QSE A;  4JBZ A;  3RTF B;  4IY5 A;  1TFD A;  1XHY A;  4OFL A;  3THI A;  5I56 A;  4X1D A;  1DSN A;  3GLB A;  4F1U A;  1IXG A;  2ZNT A;  5TPA A;  4JWY A;  5I2N B;  4KPT A;  1MPB A;  2XXY A;  2DS9 A;  2ZYN A;  4ZZA A;  1SBP A;  2QMX A;  2PT2 A;  4F3B A;  1SI1 A;  5JEI A;  2V84 A;  5I58 B;  3E4R A;  5ISU A;  3GXA A;  3FIR A;  1PBQ A;  2F6G A;  5I2K B;  4OEU A;  2VHA A;  1WOD A;  3PPN A;  4X9T A;  2V3Q A;  4F1V A;  2F7C A;  4JDF A;  3FVG A;  1SVX B;  1VR5 A;  4R6H A;  2RIN A;  2ANJ A;  3IOT A;  3ZSF A;  4R2B A;  2XXT A;  5DT6 A;  3KJT A;  3SEW A;  1A99 A;  4R9F A;  1CB6 A;  3S9M C;  4KYE A;  4ZEK A;  2VP1 A;  1H43 A;  4QF9 A;  2I6E A;  3MVZ A;  2PYY A;  5EYF A;  1JEV A;  1B0H A;  4WEP A;  5I59 A;  1FCK A;  4G68 C;  1B51 A;  3M3L A;  4FED A;  1ZKB A;  3IB2 A;  1Y1M A;  1TXF A;  5EHS A;  3LUY A;  3G3I A;  3K4U A;  3LSF B;  4NE4 A;  3S4U A;  2O1M A;  2NXO A;  1A7L A;  1JVY A;  3C36 A;  3B6T A;  5B7D A;  3FV1 A;  5I57 B;  2X7Q A;  3M3F A;  5K2Y A;  4FAJ A;  1LAH E;  4KD5 A;  2HZK A;  4ESW A;  5AA1 A;  4GRK A;  1SD3 A;  4LQ5 A;  2Z8D A;  3C4M A;  3QUJ A;  1MXZ A;  4OVJ A;  2Y84 A;  1GTK A;  4H5F A;  2X26 A;  4POX A;  4ELO A;  2RC9 A;  4LZ8 A;  4IGT A;  3VLW A;  5DEX A;  1ZBM A;  3EPE A;  1ZU0 A;  1B6H A;  4NF4 A;  4U1O A;  4G4P A;  5K2X A;  2F7A A;  4ND9 A;  2A5T B;  1NNP A;  1JW1 A;  4YKJ A;  1TFA A;  3O9P A;  1LCT A;  4NF8 A;  5AA2 D;  3RTW B;  3PMX A;  1XVX A;  5TU0 A;  1POY 1;  4R2F A;  5AA4 B;  5KCJ A;  4PP0 A;  3EHT A;  3C32 A;  4R6Y A;  4YKI A;  3EF7 A;  3TTK A;  4P11 A;  3PMV A;  4ZE8 A;  3MP6 A;  3TKD A;  3LC8 A;  1ZLQ A;  2QS2 A;  1QUL A;  1Y20 A;  3QK6 A;  4QFL A;  4NED A;  2YLN A;  4GIZ A;  4TLL B;  4BDR A;  2V3T A;  2G29 A;  3MQ9 A;  3CFZ A;  3I5O A;  4ZED A;  1N76 A;  2XXQ A;  3T9V A;  3MZ9 A;  2HCA A;  3QAX A;  4YKK A;  4OER A;  1H3D A;  4YB7 A;  1VFE A;  5TP9 B;  1ATG A;  5I84 A;  3EQ1 A;  3MPL A;  3G3J A;  3OSQ A;  3G7W A;  4LUB A;  3KG2 A;  3FXR A;  2E0S A;  3T22 A;  1P1U A;  2ZYM A;  2W7Y A;  2CZL A;  1A55 A;  3VXC A;  3V83 A;  3OO6 A;  1GR2 A;  1YAE A;  3K6X A;  3VLU A;  5EHM A;  2Z22 A;  3FJ7 A;  3VVD A;  2P0S A;  2XD2 A;  3PPP A;  4GD5 A;  1ZTY A;  4JSO A;  1DPP A;  4EF2 A;  3QYT A;  2DWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...