1ATGA

Azotobacter vinelandii periplasmic molybdate-binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
231
structure length
231
Chain Sequence
ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYVLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand size is a major determinant of specificity in periplasmic oxyanion-binding proteins: the 1.2 A resolution crystal structure of Azotobacter vinelandii ModA.
pubmed doi rcsb
molecule tags Binding protein
molecule keywords PERIPLASMIC MOLYBDATE-BINDING PROTEIN
total genus 80
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA02
3G3KA 3VLUA 1A8EA 1MY4A 2QRYA 3S9NC 3FVGA 1D9VA 1SYIA 2QMXA 1AIVA 2REGA 2V25A 4JSDA 5FHNA 1MQGA 5I59A 1A55A 1SVXB 1LB9A 2F7BA 2VHAA 4GD5A 5ICQA 3A09A 4KR5A 4R2BA 3ODBA 2IA4A 3PMWA 1QKAA 4U1OA 3FASA 5AA2B 1DMBA 2NUVA 4FJPA 4EQBA 1B7UA 4IGRA 1ZLQA 3RQTA 3IORA 3EQ1A 5KCJB 3E3KA 1IEJA 3EHUA 3K00A 3RGYA 1I6BA 3IJOB 3PUXE 3CFLA 1DOTA 1MQDA 3A3CA 4ONYA 4GF8A 5H8QB 3BFTA 1BIYA 2G93A 3CG1A 1GVCA 3VXBA 3HV1A 2ZYNA 4P0GA 1LFHA 1SW2A 3TCFA 1Q35A 1ZU0A 3C34A 2Y7PA 3QUFA 3SEWA 2Y84A 4KYSA 1QW0A 1BKAA 1B0HA 2M8CA 3MVZA 3TZAA 3H6TA 4TOZA 4BDRA 3H7MA 1PBPA 3PPNA 3TTLA 2P1SA 2ESNA 2I4CA 3MVXA 4M4GA 4RPNA 3IOWA 5H8FA 5KCJA 3PU5A 3V83A 2VD3A 3KJ7A 1CE2A 1Y9UA 2HEUA 2H5YA 4IGTA 1MH3A 1PDAA 3FJMA 4I9DA 4RJZA 5CRYA 3A3UA 2VD2A 2PYYA 4DXUA 4GOTA 4DXCA 3IAZA 1UTBA 3G7WA 5L9OA 1T0KA 2XXQA 2P2AA 4NF4B 1URDA 1B32A 4ELOA 5I58B 1LAHE 3U72A 2V93A 2DXRA 3PD9A 2I4BA 2KLFA 1ZBMA 2ZNTA 1Z7ME 2A5TA 5AA2D 1ZTYA 1BP5A 1Y4TA 3OO6A 3QXMA 3VLWA 3C9HA 4R2FA 1OVBA 4IO2A 1FQAA 4G68B 3EN3A 2H25A 1A54A 1FQDA 1I6QA 1USYH 1QJMA 4BDQA 1SW5A 1NMUA 2I0CA 3FIRA 3S4UA 1SD3A 1IQ7A 1YCJA 5KDTB 4GQOA 1B3HA 1S50A 4JB7A 2Q2CA 4Z0IA 3RNNA 1ANFA 4GFRA 1MH4A 2DVZA 3ZSFA 3D4CA 1M5FA 4E0XA 2GFEA 1M5CA 4POWA 3Q27A 4Q30B 1L5TA 3CSBA 3SERA 1LGBC 1USYE 1D3KA 3KOSA 3MW0A 1XOCA 1B1HA 4ZEIA 3G3FA 3PMXA 4R6YA 2V3QA 4KCDA 1A40A 2HFBA 3L6GA 4FEDA 5I57B 5TP9A 1IXGA 2QPQA 4LA9A 3PUVE 4PFTA 5JTYA 3G3GA 3VVDA 2UYEA 3OENA 4BDLA 4EQ7A 1ZIUA 4K3FA 5CM6A 4YZZA 3VXCA 1LBCA 1UIVA 4ESWA 4WXJA 4O3BA 2ALUA 1LFIA 3K1MA 3O28A 4IO4A 5CI5A 4OXVA 1VFDA 3VVFA 1H44A 1MXYA 2I48A 1VR5A 5I2NB 2OK2A 4LUBA 2CZLA 4ELQA 3VE1B 1LAFE 4F3GA 4KFQA 2AIXA 1XVYA 1QUIA 1PB9A 1NNPA 2F78A 4H5FA 1P1UA 4QFKA 5DVFA 1UQWA 1Q1KA 4PFWA 5TU0A 1SW1A 3QK6A 3O9PA 2Y7WA 4DE8A 2LAOA 3EPEA 4F22A 1SI0A 3G3IA 1JEVA 2OJTA 3OO9A 2ONKE 3Q25A 4G8MA 1NNTA 5K2YA 4PE5B 3T9VA 2PBWA 3S2VA 1ATGA 2HAVA 1FTOA 1NL5A 3RN8A 4X1BA 3OEMA 5ISUA 3I5OA 3SESA 3M8UA 3E4RA 4FEBA 2DE2A 5L8DA 2O84X 4ZS9A 2F5XA 4RNSA 1JQFA 1DTZA 3OD7A 4LATA 5EHSA 3ZKLA 1MY2A 3BKIB 3EF7A 1TT1A 4G4PA 5EHMA 4OFJA 3CG3A 1NH8A 1IZ1A 3HO7A 1XVXA 3JV9A 4BDNA 5HM4B 1Y1ZA 3K02A 1MPDA 1MY3A 3MC2A 5DVJA 2XX8A 4MH5A 4RPOA 2OCUA 3FVNA 4AB5A 4F3BA 2YPNA 4RYAA 4F1UA 4O3AA 3K01A 4IB2A 1FQBA 3TTRA 3SEVA 3OSRA 5JEIA 2OWTA 2DWAA 3C36A 4U4XA 3KN3A 3TCHA 3LBSA 3FJ7A 4OMBA 3MZBA 4OETA 3E9XA 1LFGA 1A99A 1B5IA 1LAGE 2O1LA 1GV8A 4ELRA 2ANJA 2E0SA 2ZYMA 3IO6A 5ITPA 4KYDA 2QS1A 3IB0A 5F7VA 1JVYA 2F7AA 3RLFE 4NF5B 4EUOA 2ZMBA 3GBAA 4N13A 3V5AA 4Q8RA 4GL8A 3I6VA 2QSXA 3HN0A 4ZEKA 2A5SA 2I6EA 2AL4A 1MDQA 3CI8A 1LSTA 1B3LA 2V3UA 4WKMA 4ELPA 3N94A 4JXIA 3K1NA 3IB1A 3KZGA 4QSEA 3T9HB 3K6UA 4QF9A 3U93A 2D5WA 3OO8A 3B6WA 1B9JA 4RA1A 1MXWA 3MP6A 2PT2A 1POTA 3B6QA 4OQOA 1JW4A 1VSOA 4YB5A 3SEYA 2HXWA 2ONSA 1D4NA 2QL3A 1Y20A 1YAEA 4G2ZA 1DPEA 4YKIA 5H8HA 4JWXA 3BBRA 1PEBA 3FD3A 3TMGA 3UORA 3HSTA 1DTGA 1JW1A 4OTEA 2GH9A 2B3FA 3FV2A 1B05A 1O7TA 1F9BA 2R6GE 1Y3QA 2F34A 3MWBA 3GXAA 4ISUA 4OVJA 3UN6A 5IAIA 4XKNA 3RTWB 2PMSA 2BJJX 1IXHA 2RCBA 2O1MA 2FA7A 4KYEA 2RCAA 4OEUA 3T9XB 4ESXA 3I3VA 1QVSA 4H8JA 4F2OA 3HHFA 1FQCA 1MPCA 4H1XA 2F36A 5I59B 1GR2A 3O6IA 1LCTA 4ZEBA 1IUDA 2Y7RA 1OQGA 3KG2A 3TYHA 3TPAA 2AL5A 4IO7A 4OYVA 5FHMA 4FIMA 4FE8A 1IIWA 1O63A 3O6HA 1JW5A 1P99A 3O66A 3KEIA 1S9TA 4IY5A 4R6HA 5I2KA 3KFMA 1B1XA 3LSLA 4OWDA 1FQEA 2ABHA 2Q2AA 2Z8EA 4QRZA 2B65A 5AA3A 2DYXA 2HZKA 3TKDA 4BLAA 3O6GA 2NXOA 2X26A 2XX9A 3LC8A 2AYSA 3K6XA 3QUJA 1N76A 3T96B 4F1YA 5I2NA 2NVUB 5A5XA 1HSEA 5KZTA 5H8QA 1QUKA 1R9QA 1VE4A 2B3BA 2F8DA 2ZNUA 4X48A 5H8FB 4LP2B 3MUQA 4H8IA 2UVJA 1MM6A 1QULA 1PC3A 4QSDA 1FTMA 4X9TA 3OXNA 3IL1B 5F1QA 4KI0E 2XXIA 3O97A 3MJNA 4RXLA 4XKPA 4EQ9A 4IO3A 4RY1A 5B70A 3SEXA 2HCAA 2YJPA 2W7YA 3JYRA 2HZLA 2XXPA 3TDJA 3CFZA 3TFLA 4N07A 4U22A 2I58A 4ZZEA 4IO6A 1BTJA 3L6HA 4GXAA 2A5TB 3TTKA 4AQ4A 5TP9B 5L9SA 1CB6A 1UTHB 1IITA 4PQJA 1Y3PA 4LONB 4QFOA 2PVUA 4G68A 2Q8JA 5ELVA 4MFIA 3ILTB 1FQFA 4EDPA 4P11A 1GGGA 3TTMA 3QYTA 1XHYA 1OIBA 2XXUA 2DQVA 3C35A 5DEXA 5L9MA 2GRVA 2XXXA 2R9JA 4F31B 2RC9A 2DSFA 1B46A 2OBGA 3RUMA 5I58A 2VP1A 4GVOA 4H5GA 1LCFA 4HCYA 2F7CA 2Z8DA 4AB6A 1MQJA 4MLVA 4F39A 4EF2A 1N84A 4QFLA 3VLVA 1RYXA 3IK6B 3D4GA 4O3CA 3PD8A 3PV0E 2V3TA 4IY6A 2YLNA 4UACA 5I84A 1NH7A 2DOJA 5H8SA 4C0RA 5LOMA 3EHTA 5AA2A 3TAJA 3TEPA 3ONMA 3U94A 4ZEFA 2RF1A 1OVTA 4U2RA 2THIA 5H8HB 1N3WA 2D3IA 4LVQA 3T22A 2Q89A 1MS7A 1MXXA 1P1NA 4OERA 3OO7A 5TPAA 5M2VA 2HQ0A 1B3FA 3TQLA 2VGQA 5I57A 1B4ZA 4R9GA 1I69A 2VOZA 3B7DA 3TODA 3T93B 4DCYA 3G3HA 4JSOA 3P7IA 3PMVA 4OZ9A 5JK4A 2DP8A 1SDXA 4L17A 3WAEA 1US5A 4KCCA 5BWJA 2H99A 2XXWA 5DT6A 2Y7KA 3VVEA 1B7HA 1SI1A 2Z22A 2XHDA 3IO4A 3OELA 2ZYOA 2XXHA 3C4MA 4I1DA 1WDNA 4KHZE 2Y7IA 1DPPA 1LLSA 4E0WA 3VFJA 2Z23A 3KJTA 3SKPA 1AL3A 3HCQA 1NNFA 3QSLA 1OMPA 3IOTA 4GIZA 5I56A 4NF6A 5CMMA 3K6VA 1AH5A 4G8HA 3MVYA 2H4IA 5AA1A 3VDFA 2R71A 4FATA 3M3LA 4C1UA 2DWJA 2DXYA 1VFEA 1I6AA 4NEDA 4R74A 4YB7A 1B40A 1MG1A 1P1OA 1Y1MA 2GHBA 3M3KA 3MVWA 4GXSB 2I3WA 3K0VA 3H6WA 4YICA 3RPWA 3FXQA 3FVOA 1S7YA 3S9EA 2F97A 1IXCA 4F2QA 4YAHX 3T9UA 1QKBA 4ZE8A 5CBRA 5KDTA 1JEUA 1POY1 4GL0A 3Q29A 5AA4B 1B0LA 1XT8A 3LSFB 4NF5A 4P0IA 3IB2A 3KBRA 3OOAA 4R75A 3TQWA 4R6KA 2DWIA 5FTHA 3THIA 4HW8A 3MPKA 3PUYE 4LZ5A 4R72A 4IO5A 4PETA 1TFAA 3OSQA 3PUWE 2WKYA 4GWOA 1MXVA 4KD5A 4U1ZA 3K4UA 3IJXB 4C1TA 3LSXA 4Q0CA 4QHQA 1B52A 1YTVA 1B58A 2UYFA 3M3FA 4F3PA 1M5BA 4HTGA 4GRKA 4FAJA 3H06B 3ZS6A 2ZYKA 3JZJA 4H6DA 3U8QA 5DYHA 1JETA 3SEUA 1D9YA 2DS9A 3W9VA 1IXIA 1SBPA 1FW0A 4RK9A 3RY3A 3FATA 4UA8A 1M5EA 1M5DA 3DP8A 4NF8B 1FTJA 3KN8A 4XIGQ 1UTBB 3F11A 1B7ZA 3FZVA 4H65A 1JVXA 5DEXB 1AOVA 4DCXA 3E13X 5AE4A 2X7QA 1SYHA 3CR9A 4G8NA 4EF1A 3PPQA 1EZOA 3LR1A 1SW4A 1B2HA 4XKQA 1TFDA 2XX7A 4XXUA 3FJGA 3N5LA 3OEKA 4ZECA 3O29A 1OLCA 4R73A 3DM0A 1HSJA 4U4SA 1R6ZA 4FECA 5DTBA 4JBZA 3RT8A 1FTLA 4NF4A 2PX1A 2XXVA 5AA4A 4I8CA 1LBBA 4THIA 4RK2A 4YKKA 3FVKA 3GZGA 2O51A 2NOOA 3KSJA 3UGWA 3W9WA 4H0WA 5H8NB 1WVJA 2I3VA 5CMKA 3HPIA 1H3DA 1PBQA 1NKXA 2O69A 2ZXTA 3BFUA 1B5HA 3H03A 3QIMA 4GLIA 4G77A 4TLLB 3RT6B 2XXYA 4G68C 4YMBA 5J1DA 1ZKBA 2QJEA 2O7IA 3GBBA 3WAFA 1XS5A 5K2XA 3VV5A 4LQ5A 4YMAA 4MF3A 4PFUA 5A5XB 1FCKA 4TQUQ 4JDFA 4HS7A 4YKPA 5BUUA 2Z8FA 4BDMA 4DXBA 1LB8A 1DSNA 3ILUB 4ZDMA 2OWSA 2Q9TA 4U23A 4DLDA 3V8XB 4ECFA 2O7UA 1MXZA 3PPOA 4OHNA 4PP0A 4EXKA 2QS2A 3O2AA 1R1NA 4HCWA 4YU0A 2FYIA 4OFOA 3RTFB 3S9LC 2REJA 1P1WA 2F35A 1MQIA 2DWHA 2UVIA 2XXRA 3MZ1A 1ZJLA 5I2KB 4Z7EA 2ONRA 3UA8A 2D21A 3N6UA 4MLQA 3KN7A 1R9LA 3MP8A 5B7DA 1N0TA 3R26A 1O64A 3B6TA 3H4ZA 2HAUA 1B3GA 4ZE9A 5CMBA 1MXUA 3V89B 1A7LA 5HBCA 1URSA 1MDP1 2RC8A 3SDFA 2GHAA 2DVCA 2OZZA 3AXFA 3MAMA 1LAXA 1SQYA 4Q5TA 2F6PA 4JWYA 1OQHA 1B5JA 2RINA 2Q88A 4NMYA 3LSWA 3TUSA 1EZ9A 1B3EA 3C32A 3IOUA 3ZKKA 1H43A 3N26A 2NWJA 1GTKA 3T66A 3Q28A 1YPNA 4POXA 4QFNA 1MY0A 3CSGA 4H67A 3KSXA 3GLBA 1JNFA 2IEEA 4I62A 1XC1A 1B4HA 4YKJA 4DIGA 3DLNA 2H9BA 5ITOA 2UVGA 1NNKA 2G29A 2E1SA 3PPRA 2FNCA 3EHSA 1MPBA 3LUYA 5FTIA 4BDOA 3S9MC 4YB6A 1N7XA 2OLBA 3CRBA 1ELJA 2CMOA 2H98A 2XD3A 5HPQA 5I56B 3PPPA 5DVIA 4XKRA 3UP9A 1N04A 1ZMGA 3TELA 4F29A 3ECRA 3PUZE 3OMBA 4N6PA 3MPLA 4JWOA 2RC7A 3MBPA 4FORA 4WEDA 2UXAA 2UVHA 3H6VA 3IOVA 2QMWA 1UTHA 3CIJA 5EYFA 3TTNA 1QUJA 4TLMB 1PB8A 1II5A 4OENA 3HHGA 4NWCA 5FHOA 4QSCA 4M1VA 4DZ1A 3FV1A 1RKMA 1N3XA 3C33A 3MP1A 1WODA 1MM7A 2RKMA 4LZ7A 4F18A 1URGA 4MBPA 2V84A 5H8NA 4F3SA 3C31A 3DELB 3U1OA 1FTKA 1J1NA 3IR1A 2DE4A 2DE3A 1A8FA 3IX1A 1PB7A 3KOTA 3MZ9A 4QFPA 4XTCQ 3CFXA 1KWHA 5CMCA 3Q26A 4KQPA 4OFLA 1Y4CA 3G3JA 3N6TA 1EH3A 2I49A 4DDDA 3W15C 1P1QA 4OEVA 4NTLA 2X7PA 1H76A 3FXRA 2I0BA 3DP4A 4EXLA 4F19A 2O6AA 3R6UA 1TXFA 2PT1A 4F1VA 1AMFA 2P0SA 3FUZA 1Z7NE 3DP6A 4U21A 1NFTA 1Y3NA 4X1DA 1TWYA 5TPAB 5ICTA 2O68A 3MQ9A 4PFYA 3H6UA 3TCGA 1UIUA 5IKBA 3QAXA 1RYOA 1HSLA 4NF8A 3R7XA 2XXTA 3K2DA 1MY1A 4NE4A 1MQHA 2QS3A 1US4A 3PGFA 4R9FA 4NWDA 4NF6B 4ZZAA 4ND9A 1BLFA 3KGCA 5JTYB 1MRPA 1H45A 3CVGA 4OESA 4WEPA 2XD2A 1OLAA 3UIFA 1N7WA 2F6GA 4ZEDA 3SETA 1B51A 2ZNSA 3K6WA 5CC2A 1B6HA 4LZ8A 3UK4A 3H3GA 2QS4A 3FXUA 1EU8A 4KPTA 5CBSA 4LQ2A 3FGSA 1EZPA 3U92A 3K1PA 3USDA
chains in the Genus database with same CATH superfamily
5A5LA 1VDWA 2QRYA 3FVGA 1D9VA 1SYIA 1AIVA 1MQGA 1A55A 2VHAA 1LB9A 5ICQA 3ODBA 2IA4A 3FASA 4FJPA 3RQTA 3EQ1A 3EHUA 5I2NB 3BFTA 3CG1A 2Y84A 1QW0A 1RDYA 3TZAA 3H6TA 2XXKA 4TOZA 3V83A 1Y9UA 1MH3A 3FJMA 3MYUA 3IAZA 1UTBA 2XXQA 4NF4B 5I58B 2KLFA 5AA2D 3VLWA 4R2FA 3NOHA 4IO2A 4G68B 1A54A 1FPJA 3FIRA 3S4UA 1SD3A 1B3HA 4Z0IA 3D4CA 3CSBA 4G61A 1LGBC 3MW0A 1D3KA 2P3VA 1XOCA 3G3FA 2V3QA 1A40A 5I57B 5TP9A 1IXGA 5FBPA 3MSTA 4OXVA 3VVFA 1VR5A 1KA1A 4ELQA 4F3GA 2AIXA 1QUIA 1P1UA 5TU0A 1SW1A 3EPEA 4DI3D 1JEVA 2PBWA 3RN8A 3M8UA 5L8DA 2O84X 1JQFA 1MY2A 1IZ1A 1XVXA 4OVSA 2XX8A 2JJKA 2OCUA 2YPNA 4O3AA 4IB2A 3RYDA 3OSRA 4H45A 2OWTA 4PBHA 3MZBA 2CEYA 3E9XA 2QVRA 1B5IA 2F7AA 4NF5B 5EYHA 3GBAA 2QSXA 2V3UA 5LTCA 3KZGA 4QSEA 5IZ3B 4QF9A 3B6WA 3KBZA 4OQOA 1NV1A 1VSOA 3U65A 4YKIA 4FBPA 1NV3A 3BBRA 1DTGA 5I5PA 3FV2A 3MWBA 1O7TA 4OVJA 1F9BA 2F34A 2O1MA 5I59B 1EYJA 4H1XA 2F36A 2AL5A 5FHMA 4FE8A 1IIWA 1JW5A 3IFAA 4JVDA 4R6HA 1B1XA 2ABHA 4BLAA 1R9QA 1VE4A 4LP2B 4H8IA 3IL1B 1FBGA 2XXIA 4RY1A 2B4MA 3SEXA 2HCAA 3TDJA 4U22A 4PGPA 2I58A 3TTKA 1FQFA 4P11A 1XHYA 5F24A 5DEXA 4HCYA 4MLVA 1LBWA 3VLVA 3PD8A 4IY6A 4ZEFA 4U2RA 5H8HB 2Q89A 1FPDA 1MXXA 2WYKA 4PDHA 1B3FA 3TQLA 3T93B 4JSOA 3P7IA 4L17A 3WAEA 2H99A 5KCJB 3BIGA 3OELA 3C4MA 4I1DA 4E0WA 1IMBA 1NNFA 5I56A 3K6VA 3MVYA 5IZ1A 4FATA 2DXYA 1I6AA 1P1OA 3M3KA 3MVWA 3K0VA 1S7YA 3S9EA 2F97A 3T9UA 1JEUA 1XT8A 4P0IA 4NF5A 3IB2A 3KBRA 3TQWA 1FPLA 4LZ5A 4IO5A 1FBDA 3OSQA 4C1TA 3IJXB 2GQ1A 4AS5A 4QHQA 1B58A 2ZZVA 3M3FA 3ZS6A 3W9VA 3RY3A 1FW0A 4UA8A 4MNIA 4NF8B 4OVRA 1AOVA 3F11A 1B7ZA 3FZVA 5AE4A 4G8NA 2XX7A 3OEKA 4R73A 4U4SA 4FECA 4JBZA 3W9WA 2NOOA 3KSJA 5H8NB 3SZPA 2VT5A 3BFUA 1B5HA 4YMBA 4G68C 2CZKA 3GBBA 1XS5A 4YKPA 1DSNA 4U23A 1MXZA 2PFYA 3O2AA 2KQZA 2REJA 1P1WA 4PF8A 2D21A 1R9LA 5B7DA 1N0TA 1O64A 3B6TA 3H4ZA 1B3GA 1YYZA 2GHAA 2DVCA 2OZZA 4LN5A 1B5JA 4N8YA 3T66A 2WX9A 1NNKA 2G29A 1N7XA 2XD3A 3UP9A 1N04A 4F29A 3ECRA 1JP4A 3PUZE 2RC7A 4MNPA 3H6VA 3IOVA 1II5A 4LZ7A 3C33A 1URGA 3A29A 4F3SA 1PB7A 3MZ9A 4XTCQ 3E79A 1Y4CA 2X7PA 2I0BA 4EXLA 1LBXA 2PT1A 4F1VA 2P0SA 4U21A 5TPAB 3H6UA 1UIUA 3QAXA 1HSLA 2XXTA 4ZZAA 5JTYB 1MRPA 4WEPA 2XD2A 1OLAA 2F6GA 4ZEDA 3SETA 4HE1A 2FIXA 4PFRA 4JSDA 3A09A 4KR5A 4U1OA 4PE3A 1B7UA 4IGRA 4PAKA 4EQBA 1I6BA 3CFLA 1DOTA 5H8QB 3HV1A 2ZYNA 1LFHA 3TCFA 1KA0A 1Q35A 3QUFA 2Y7PA 4KYSA 3PPNA 2ESNA 4M4GA 1YXIA 5H8FA 3IOWA 5KCJA 3PU5A 1Q9DA 4OANA 2HEUA 4RJZA 4I9DA 2VD2A 2PYYA 4DXCA 3G7WA 1D9QA 1FSAA 1URDA 4O7MA 2V93A 2DXRA 2I4BA 2ZNTA 1ZBMA 1Z7ME 1BP5A 1FQAA 1FQDA 1QJMA 4MHFA 1IQ7A 2Q2CA 3ZSFA 4E0XA 1M5FA 1NV6A 4POWA 3KOSA 1B1HA 2OWZA 4KCDA 2HFBA 2QPQA 4LA9A 3PUVE 3OENA 5CM6A 3VXCA 1LFIA 3O28A 4IO4A 2XWIA 1MXYA 4LUBA 2CZLA 1LAFE 1PB9A 1NNPA 2F78A 4QFKA 5DVFA 5LDZA 4PFWA 3O9PA 2Q8MA 2Y7WA 4DE8A 4F22A 5K2YA 4OVPA 4PE5B 3S2VA 2HAVA 3I5OA 4ZS9A 2F5XA 3CG3A 1NH8A 2FBPA 3JV9A 5HM4B 4PAFA 1MPDA 4OA4A 3FVNA 4AB5A 1FQBA 4U4XA 3KN3A 4OETA 2ZZWA 1A99A 1GV8A 1LEVA 4KYDA 5F7VA 2ZMBA 4OVTA 3I6VA 3HN0A 4ZEKA 4JXIA 3K6UA 4XFEA 5IZZA 2D5WA 3B6QA 4PC9A 3SEYA 2ONSA 1SPIA 3GYYA 1Y20A 2QVUA 4G2ZA 4JWXA 3HSTA 1JW1A 4OTEA 3UN6A 1Y3QA 3GXAA 1YZ0A 3RTWB 2BJJX 1IXHA 4KYEA 4H8JA 1NV7A 1QVSA 1FQCA 4NN3A 3KG2A 3TYHA 3TPAA 4X04A 4OYVA 1O63A 1INPA 3O66A 1NV2A 4IY5A 3QMFA 3KFMA 4QRZA 2Q2AA 5ET5A 2B65A 1AWBA 3TKDA 2NXOA 3T96B 4P1LA 3K6XA 1HSEA 5KZTA 3S9NC 2B3BA 2ZNUA 1QULA 1PC3A 4QSDA 1FTMA 5F1QA 4XKPA 4EQ9A 3MJNA 5EQ8A 2YJPA 2W7YA 2HZLA 4ZZEA 5ET6A 1QGXA 2PCRA 5TP9B 1IITA 2PVUA 4G68A 4MIJA 2Q8JA 3TTMA 3C35A 2XXUA 2DQVA 4PFIA 2GRVA 2XWKA 4MMPA 2Z8DA 5I3SA 4EF2A 4UACA 3D4GA 5I84A 2V3TA 5LOMA 5AA2A 3TAJA 3TEPA 3ONMA 3U94A 2RF1A 1N3WA 4LVQA 1MS7A 2FHYA 5M2VA 2HQ0A 5I57A 2VOZA 3B7DA 5JK4A 4KCCA 2XXWA 2Y7KA 1SI1A 3IO4A 1EYIA 1WDNA 2Y7IA 4PTKA 3VFJA 3KJTA 3SKPA 1AL3A 3HCQA 4NF0A 5EQ9A 4GIZA 4G8HA 5AA1A 2H4IA 3M3LA 4OVQA 4R74A 1VFEA 4NEDA 3U72A 2VPOA 1B40A 2GHBA 1Y1MA 3H6WA 4YICA 1IXCA 4F2QA 4GL0A 5AA4B 1LBYA 3KC0A 3OOAA 4R6KA 3THIA 3MPKA 1TFAA 4GWOA 3RPLB 1B52A 1YTVA 1NUWA 2UYFA 4HTGA 4GRKA 3JZJA 4H6DA 3U8QA 1JETA 4GBWA 1IXIA 4RK9A 5ESYA 5CMMA 1FTJA 3KN8A 1UTBB 3E13X 1NUYA 3CR9A 3PPQA 3LR1A 3FJGA 3O29A 1OLCA 1R6ZA 4NHBA 5AA4A 4I8CA 1LBBA 3KC1A 4RK2A 2O51A 1PBQA 3QIMA 1NKXA 2O69A 2ZXTA 3H03A 4GLIA 4G77A 4MNCA 2QJEA 2O7IA 5K2XA 3VV5A 4LQ5A 4YMAA 1FCKA 4BDMA 4DXBA 1LB8A 3ILUB 4ZDMA 2OWSA 4ECFA 3PPOA 4EXKA 4HCWA 1R1NA 4OFOA 3RTFB 2UVIA 2XXRA 4Z7EA 3UA8A 1IMCA 3MP8A 1K9ZA 5HBCA 2RC8A 1LAXA 1SQYA 2F6PA 4JWYA 1H43A 3N26A 3Q28A 1YPNA 4QFNA 3CSGA 1JNFA 2PFZA 5ITOA 3PPRA 1MPBA 1ELJA 2H98A 2R8TA 5HPQA 5I56B 5DVIA 2ZZXA 4XKRA 4P47A 2HHMA 3OMBA 4N6PA 4N4UA 3MBPA 4FORA 4WEDA 2Y5KA 2QMWA 3CIJA 1QUJA 5FHOA 4I40A 4M1VA 2VPNA 3FV1A 1N3XA 3MP1A 4HXVA 3DELB 4N17A 1G0IA 2DE4A 1A8FA 4N6KA 3CFXA 4DDDA 4N91A 3G3JA 4PBQA 3B8BA 2WYPA 1H76A 3DP4A 2B4LA 3R6UA 1AMFA 4X1DA 5ICTA 1TWYA 3TCGA 5IKBA 1BLFA 3KGCA 4OESA 4GWUA 4GWSA 2ZNSA 4LZ8A 5CBSA 3FGSA 3USDA 3VLUA 1A8EA 1MY4A 1FPIA 4MAGA 2QMXA 2V25A 5FHNA 1FBHA 4R2BA 1QKAA 5AA2B 1ZLQA 3IORA 3E3KA 4JVCA 3IJOB 3PUXE 4ZEBA 3A3CA 3VXBA 4P0GA 1SW2A 4JVIA 1B0HA 2M8CA 3MVZA 2QVVA 1PBPA 2P1SA 2I4CA 3MVXA 4RPNA 4P56A 2VD3A 3IFCA 1CE2A 4IGTA 1PDAA 5CRYA 3A3UA 4GOTA 1T0KA 4NG7A 2A5TA 3C9HA 4BDQA 1NMUA 2WBBA 1YCJA 5KDTB 4GQOA 1S50A 4JB7A 3RNNA 1MH4A 4KXPA 1FBPA 3Q27A 4Q30B 4ZEIA 2CZIA 3PMXA 4R6YA 1FPBA 3BIHA 4PFTA 3G3GA 3VVDA 2UYEA 4BDLA 1ZIUA 4K3FA 1FPFA 4PAIA 3E78A 1LBCA 4O3BA 2ALUA 5EYGA 4PFBA 2OK2A 3VE1B 4KFQA 1XVYA 2WEFA 2ONKE 3Q25A 3T9VA 1ATGA 1FTOA 1NL5A 5ISUA 3OEMA 3SESA 3E4RA 4FEBA 2DE2A 3OD7A 4LATA 1TT1A 4G4PA 5EHMA 4OFJA 1RDZA 1Y1ZA 3K02A 1MY3A 1NUXA 3MC2A 4RPOA 3K01A 3TTRA 3SEVA 5JEIA 4GWYA 4I3YA 1LFGA 2ZYMA 3IB0A 1JVYA 3RLFE 4N13A 3V5AA 4GL8A 2A5SA 1LSTA 2F3DA 3N94A 3OO8A 3LUZA 4RA1A 1MXWA 1K9YA 1POTA 4YB5A 1D4NA 1DPEA 5H8HA 3FD3A 3UORA 4GX4A 1FJ9A 2B3FA 2R6GE 1IMDA 4ISUA 4XKNA 4PGNA 5EQAA 2RCBA 3T9XB 2RCAA 4F2OA 3HHFA 1GR2A 1LCTA 2Y7RA 1OQGA 3T1BA 3O6HA 1P99A 3KEIA 3LSLA 4OWDA 1FQEA 2Z8EA 2DYXA 2HZKA 3LC8A 2AYSA 3QUJA 1N76A 5I2NA 2NVUB 5A5XA 5H8QA 1QUKA 2F8DA 5H8FB 1G0HA 3MUQA 4N81A 1RDXA 2OX3A 3CHGA 4KI0E 4N15A 5B70A 3CFZA 3L6HA 5L9SA 4QFOA 4PQJA 4LONB 5ELVA 1GGGA 4F31B 2RC9A 1B46A 2OBGA 4GVOA 4H5GA 1LCFA 2F7CA 4AB6A 1N84A 1RYXA 3IK6B 4MX6A 4O3CA 2YLNA 2DOJA 4C0RA 3EHTA 3ROJA 2XWOA 1OVTA 4X8RA 2THIA 4P8BA 2D3IA 4AS4A 1P1NA 3OO7A 5TPAA 2P3NA 1B4ZA 4DCYA 4OZ9A 2DP8A 3EKIA 3VVEA 2XHDA 4KHZE 1LLSA 1OMPA 4NF6A 1AH5A 3VDFA 2I3WA 3RPWA 3FXQA 5KDTA 4ZE8A 5CBRA 1POY1 1B0LA 3LSFB 4P3LA 5FTHA 2WKYA 1MXVA 4KD5A 3LSXA 4Q0CA 1FPKA 1M5BA 4F3PA 5ET7A 1NV4A 5J16A 1NI9A 1D9YA 1M5EA 3DP8A 5DEXB 1JVXA 2X7QA 4EF1A 1B2HA 4XXUA 3N5LA 1HSJA 2FVZA 4NF4A 2PX1A 4THIA 3FVKA 3GZGA 3UGWA 1FBCA 3FBPA 5CMKA 2I3VA 5DW8A 1H3DA 4QXDA 5J1DA 5ET8A 4TQUQ 4JDFA 1DK4A 2Q9TA 3V8XB 4PP0A 2QS2A 1FBFA 4YU0A 3S9LC 2F35A 2DWHA 4MLQA 3LV0A 3KN7A 1CNQA 3R26A 4QBAA 4XEQA 5CMBA 1MXUA 3V89B 1MDP1 2BJIA 4Q5TA 1OQHA 2Q88A 3TUSA 2NWJA 1GTKA 1MY0A 4H67A 3GLBA 4YKJA 4DIGA 2UVGA 2E1SA 2FNCA 3EHSA 3LUYA 5FTIA 4YB6A 2CMOA 2CEXA 3PPPA 1ZMGA 3TELA 4JWOA 1LBZA 1NUZA 2UXAA 2UVHA 5EYFA 1UTHA 3PTYA 4O8MA 1PB8A 4NWCA 4QSCA 4DZ1A 1RKMA 4F18A 2RKMA 5H8NA 3C31A 3U1OA 1J1NA 3IX1A 4DI4B 3KOTA 4QFPA 1KWHA 5CMCA 4OFLA 2I49A 1P1QA 4OEVA 3FXRA 2O6AA 1TXFA 1DBZA 1NFTA 1Y3NA 4NF8A 1MQHA 2QS3A 3PGFA 4R9FA 4NWDA 4ND9A 2XWVA 3CVGA 1H45A 3UIFA 1B51A 3K6WA 1EU8A 4LQ2A 3U92A 3G3KA 2REGA 5I59A 1SVXB 2F7BA 4GD5A 5IZ3A 3PMWA 1DMBA 2NUVA 1IEJA 3K00A 3RGYA 1MQDA 4ONYA 4GF8A 1BIYA 2G93A 1GVCA 3RPLA 4HE2A 1ZU0A 3C34A 3ISPA 3SEWA 1BKAA 4BDRA 3H7MA 3TTLA 3HFUA 2CZHA 3KJ7A 4AQ4A 2H5YA 4DXUA 5L9OA 2P2AA 1NV5A 1B32A 4ELOA 1LAHE 3PD9A 4NAPA 1ZTYA 1Y4TA 3OO6A 3QXMA 1OVBA 3EN3A 2H25A 1I6QA 1USYH 1SW5A 2I0CA 1ANFA 4GFRA 2DVZA 4GX3A 2GFEA 1M5CA 1L5TA 3SERA 1USYE 3L6GA 4FEDA 3T0JA 1FBEA 5JTYA 4EQ7A 5EQ7A 4YZZA 1UIVA 4ESWA 4WXJA 3K1MA 5CI5A 1EYKA 1VFDA 1H44A 2I48A 4PCDA 4H5FA 1UQWA 1Q1KA 4NGUA 3QK6A 2F3BA 2LAOA 1SI0A 3G3IA 2OJTA 3OO9A 4PF6A 4G8MA 1NNTA 4X1BA 4P1EA 4RNSA 1DTZA 4HE0A 4N6DA 3ZKLA 5EHSA 3BKIB 3EF7A 2DDKA 3HO7A 4BDNA 5DVJA 4MH5A 4F3BA 4RYAA 4F1UA 1FTAA 2DWAA 3C36A 3TCHA 3LBSA 4OMBA 3FJ7A 1KZ8A 1LAGE 2O1LA 4ELRA 2Y5LA 2ANJA 2E0SA 5ITPA 3IO6A 2Q74A 2QS1A 4EUOA 4Q8RA 2I6EA 2AL4A 1MDQA 3CI8A 1B3LA 4WKMA 4ELPA 3K1NA 3IB1A 3T9HB 4MJOA 3U93A 1B9JA 4NX1A 3MP6A 2PT2A 1JW4A 4GWXA 2HXWA 2QL3A 1YAEA 1FPGA 1PEBA 3TMGA 2GH9A 1B05A 5IAIA 4O7IA 4GWZA 2QFLA 2PMSA 1LBVA 2FA7A 4OEUA 5T3JA 4ESXA 3I3VA 1MPCA 3O6IA 1IUDA 4NQ8A 4IO7A 1DCUA 3FXBA 4FIMA 4P9KA 1FRPA 1S9TA 5I2KA 5AA3A 3O6GA 2XX9A 2X26A 4F1YA 4X48A 2UVJA 1MM6A 4X9TA 3OXNA 3O97A 4RXLA 4IO3A 3JYRA 2XXPA 2HXRA 3TFLA 4N07A 1IMFA 1BTJA 4IO6A 4GXAA 2A5TB 1CB6A 1UTHB 1Y3PA 4MFIA 3ILTB 4EDPA 3QYTA 1OIBA 5L9MA 2XXXA 2R9JA 2L5VA 2DSFA 3RUMA 5I58A 2VP1A 1BK4A 2MKZA 1MQJA 4F39A 4QFLA 3PV0E 1NH7A 5H8SA 1IMEA 4O94A 2XA5A 3T22A 4OERA 2VGQA 4I3EA 4R9GA 1I69A 3TODA 3G3HA 3PMVA 1SDXA 1US5A 5BWJA 5DT6A 1B7HA 2Z22A 2ZYOA 2XXHA 1DPPA 2Z23A 3QSLA 4UABA 3IOTA 2R71A 4C1UA 2DWJA 4YB7A 1MG1A 4GXSB 3FVOA 2FIEA 4YAHX 1QKBA 1FPEA 3Q29A 4R75A 5I7IA 2V4CA 2DWIA 4HW8A 3PUYE 4R72A 4H46A 4PETA 3PUWE 4U1ZA 3K4UA 4FAJA 3H06B 2ZYKA 1FJ6A 5DYHA 3SEUA 2DS9A 1SBPA 2HPGA 3FATA 1M5DA 4XIGQ 4H65A 4DCXA 1SYHA 1EZOA 1SW4A 4XKQA 4ZECA 1TFDA 3DM0A 5DTBA 3RT8A 1FTLA 5IM2A 2XXVA 4YKKA 4H0WA 1WVJA 3HPIA 4TLLB 3RT6B 2XXYA 1ZKBA 3WAFA 1NV0A 5IGAA 4MF3A 4PFUA 5A5XB 4HS7A 5BUUA 2Z8FA 4DLDA 2O7UA 4OHNA 2FYIA 1MQIA 4N8GA 5I2KB 3MZ1A 1ZJLA 2ONRA 3N6UA 4MCOA 2HAUA 4ZE9A 1A7LA 4IR8A 1URSA 3SDFA 3AXFA 3MAMA 2RINA 3D1RA 4PDDA 4NMYA 3LSWA 1EZ9A 1B3EA 3C32A 3IOUA 3ZKKA 4POXA 3B50A 3KSXA 4I62A 2IEEA 1XC1A 4GWWA 1B4HA 3DLNA 2H9BA 4GBVA 4BDOA 3S9MC 3CRBA 2OLBA 3MPLA 3TTNA 4TLMB 4OENA 3HHGA 1WODA 1MM7A 4MBPA 2V84A 1FTKA 3IR1A 2DE3A 2WBDA 3Q26A 4KQPA 3N6TA 1EH3A 3W15C 4NTLA 4F19A 2KR0A 3FUZA 1Z7NE 3DP6A 2O68A 3MQ9A 4PFYA 1RYOA 3R7XA 3K2DA 1MY1A 4NE4A 1IMAA 1US4A 4XF5A 4NF6B 4MEVA 1N7WA 5CC2A 4GX6A 1B6HA 3UK4A 3H3GA 2QS4A 1XI6A 3FXUA 4KPTA 1EZPA 3K1PA
chains in the Genus database with same CATH topology
3G3KA 3VLUA 1A8EA 1MY4A 2QRYA 3S9NC 3FVGA 1D9VA 1SYIA 2QMXA 1AIVA 2REGA 2V25A 4JSDA 5FHNA 1MQGA 5I59A 1A55A 1SVXB 1LB9A 2F7BA 2VHAA 4GD5A 5ICQA 3A09A 4KR5A 4R2BA 3ODBA 2IA4A 3PMWA 1QKAA 4U1OA 3FASA 5AA2B 1DMBA 2NUVA 4FJPA 4EQBA 1B7UA 4IGRA 1ZLQA 3RQTA 3IORA 3EQ1A 5KCJB 3E3KA 1IEJA 3EHUA 3K00A 3RGYA 1I6BA 3IJOB 3PUXE 3CFLA 1DOTA 1MQDA 3A3CA 4ONYA 4GF8A 5H8QB 3BFTA 1BIYA 2G93A 3CG1A 1GVCA 3VXBA 3HV1A 2ZYNA 4P0GA 1LFHA 1SW2A 3TCFA 1Q35A 1ZU0A 3C34A 2Y7PA 3QUFA 3SEWA 2Y84A 4KYSA 1QW0A 1BKAA 1B0HA 2M8CA 3MVZA 3TZAA 3H6TA 4TOZA 4BDRA 3H7MA 1PBPA 3PPNA 3TTLA 2P1SA 2ESNA 2I4CA 3MVXA 4M4GA 4RPNA 3IOWA 5H8FA 5KCJA 3PU5A 3V83A 2VD3A 3KJ7A 1CE2A 1Y9UA 2HEUA 2H5YA 4IGTA 1MH3A 1PDAA 3FJMA 4I9DA 4RJZA 5CRYA 3A3UA 2VD2A 2PYYA 4DXUA 4GOTA 4DXCA 3IAZA 1UTBA 3G7WA 5L9OA 1T0KA 2XXQA 2P2AA 4NF4B 1URDA 1B32A 4ELOA 5I58B 1LAHE 3U72A 2V93A 2DXRA 3PD9A 2I4BA 2KLFA 1ZBMA 2ZNTA 1Z7ME 2A5TA 5AA2D 1ZTYA 1BP5A 1Y4TA 3OO6A 3QXMA 3VLWA 3C9HA 4R2FA 1OVBA 4IO2A 1FQAA 4G68B 3EN3A 2H25A 1A54A 1FQDA 1I6QA 1USYH 1QJMA 4BDQA 1SW5A 1NMUA 2I0CA 3FIRA 3S4UA 1SD3A 1IQ7A 1YCJA 5KDTB 4GQOA 1B3HA 1S50A 4JB7A 2Q2CA 4Z0IA 3RNNA 1ANFA 4GFRA 1MH4A 2DVZA 3ZSFA 3D4CA 1M5FA 4E0XA 2GFEA 1M5CA 4POWA 3Q27A 4Q30B 1L5TA 3CSBA 3SERA 1LGBC 1USYE 1D3KA 3KOSA 3MW0A 1XOCA 1B1HA 4ZEIA 3G3FA 3PMXA 4R6YA 2V3QA 4KCDA 1A40A 2HFBA 3L6GA 4FEDA 5I57B 5TP9A 1IXGA 2QPQA 4LA9A 3PUVE 4PFTA 5JTYA 3G3GA 3VVDA 2UYEA 3OENA 4BDLA 4EQ7A 1ZIUA 4K3FA 5CM6A 4YZZA 3VXCA 1LBCA 1UIVA 4ESWA 4WXJA 4O3BA 2ALUA 1LFIA 3K1MA 3O28A 4IO4A 5CI5A 4OXVA 1VFDA 3VVFA 1H44A 1MXYA 2I48A 1VR5A 5I2NB 2OK2A 4LUBA 2CZLA 4ELQA 3VE1B 1LAFE 4F3GA 4KFQA 2AIXA 1XVYA 1QUIA 1PB9A 1NNPA 2F78A 4H5FA 1P1UA 4QFKA 5DVFA 1UQWA 1Q1KA 4PFWA 5TU0A 1SW1A 3QK6A 3O9PA 2Y7WA 4DE8A 2LAOA 3EPEA 4F22A 1SI0A 3G3IA 1JEVA 2OJTA 3OO9A 2ONKE 3Q25A 4G8MA 1NNTA 5K2YA 4PE5B 3T9VA 2PBWA 3S2VA 1ATGA 2HAVA 1FTOA 1NL5A 3RN8A 4X1BA 3OEMA 5ISUA 3I5OA 3SESA 3M8UA 3E4RA 4FEBA 2DE2A 5L8DA 2O84X 4ZS9A 2F5XA 4RNSA 1JQFA 1DTZA 3OD7A 4LATA 5EHSA 3ZKLA 1MY2A 3BKIB 3EF7A 1TT1A 4G4PA 5EHMA 4OFJA 3CG3A 1NH8A 1IZ1A 3HO7A 1XVXA 3JV9A 4BDNA 5HM4B 1Y1ZA 3K02A 1MPDA 1MY3A 3MC2A 5DVJA 2XX8A 4MH5A 4RPOA 2OCUA 3FVNA 4AB5A 4F3BA 2YPNA 4RYAA 4F1UA 4O3AA 3K01A 4IB2A 1FQBA 3TTRA 3SEVA 3OSRA 5JEIA 2OWTA 2DWAA 3C36A 4U4XA 3KN3A 3TCHA 3LBSA 3FJ7A 4OMBA 3MZBA 4OETA 3E9XA 1LFGA 1A99A 1B5IA 1LAGE 2O1LA 1GV8A 4ELRA 2ANJA 2E0SA 2ZYMA 3IO6A 5ITPA 4KYDA 2QS1A 3IB0A 5F7VA 1JVYA 2F7AA 3RLFE 4NF5B 4EUOA 2ZMBA 3GBAA 4N13A 3V5AA 4Q8RA 4GL8A 3I6VA 2QSXA 3HN0A 4ZEKA 2A5SA 2I6EA 2AL4A 1MDQA 3CI8A 1LSTA 1B3LA 2V3UA 4WKMA 4ELPA 3N94A 4JXIA 3K1NA 3IB1A 3KZGA 4QSEA 3T9HB 3K6UA 4QF9A 3U93A 2D5WA 3OO8A 3B6WA 1B9JA 4RA1A 1MXWA 3MP6A 2PT2A 1POTA 3B6QA 4OQOA 1JW4A 1VSOA 4YB5A 3SEYA 2HXWA 2ONSA 1D4NA 2QL3A 1Y20A 1YAEA 4G2ZA 1DPEA 4YKIA 5H8HA 4JWXA 3BBRA 1PEBA 3FD3A 3TMGA 3UORA 3HSTA 1DTGA 1JW1A 4OTEA 2GH9A 2B3FA 3FV2A 1B05A 1O7TA 1F9BA 2R6GE 1Y3QA 2F34A 3MWBA 3GXAA 4ISUA 4OVJA 3UN6A 5IAIA 4XKNA 3RTWB 2PMSA 2BJJX 1IXHA 2RCBA 2O1MA 2FA7A 4KYEA 2RCAA 4OEUA 3T9XB 4ESXA 3I3VA 1QVSA 4H8JA 4F2OA 3HHFA 1FQCA 1MPCA 4H1XA 2F36A 5I59B 1GR2A 3O6IA 1LCTA 4ZEBA 1IUDA 2Y7RA 1OQGA 3KG2A 3TYHA 3TPAA 2AL5A 4IO7A 4OYVA 5FHMA 4FIMA 4FE8A 1IIWA 1O63A 3O6HA 1JW5A 1P99A 3O66A 3KEIA 1S9TA 4IY5A 4R6HA 5I2KA 3KFMA 1B1XA 3LSLA 4OWDA 1FQEA 2ABHA 2Q2AA 2Z8EA 4QRZA 2B65A 5AA3A 2DYXA 2HZKA 3TKDA 4BLAA 3O6GA 2NXOA 2X26A 2XX9A 3LC8A 2AYSA 3K6XA 3QUJA 1N76A 3T96B 4F1YA 5I2NA 2NVUB 5A5XA 1HSEA 5KZTA 5H8QA 1QUKA 1R9QA 1VE4A 2B3BA 2F8DA 2ZNUA 4X48A 5H8FB 4LP2B 3MUQA 4H8IA 2UVJA 1MM6A 1QULA 1PC3A 4QSDA 1FTMA 4X9TA 3OXNA 3IL1B 5F1QA 4KI0E 2XXIA 3O97A 3MJNA 4RXLA 4XKPA 4EQ9A 4IO3A 4RY1A 5B70A 3SEXA 2HCAA 2YJPA 2W7YA 3JYRA 2HZLA 2XXPA 3TDJA 3CFZA 3TFLA 4N07A 4U22A 2I58A 4ZZEA 4IO6A 1BTJA 3L6HA 4GXAA 2A5TB 3TTKA 4AQ4A 5TP9B 5L9SA 1CB6A 1UTHB 1IITA 4PQJA 1Y3PA 4LONB 4QFOA 2PVUA 4G68A 2Q8JA 5ELVA 4MFIA 3ILTB 1FQFA 4EDPA 4P11A 1GGGA 3TTMA 3QYTA 1XHYA 1OIBA 2XXUA 2DQVA 3C35A 5DEXA 5L9MA 2GRVA 2XXXA 2R9JA 4F31B 2RC9A 2DSFA 1B46A 2OBGA 3RUMA 5I58A 2VP1A 4GVOA 4H5GA 1LCFA 4HCYA 2F7CA 2Z8DA 4AB6A 1MQJA 4MLVA 4F39A 4EF2A 1N84A 4QFLA 3VLVA 1RYXA 3IK6B 3D4GA 4O3CA 3PD8A 3PV0E 2V3TA 4IY6A 2YLNA 4UACA 5I84A 1NH7A 2DOJA 5H8SA 4C0RA 5LOMA 3EHTA 5AA2A 3TAJA 3TEPA 3ONMA 3U94A 4ZEFA 2RF1A 1OVTA 4U2RA 2THIA 5H8HB 1N3WA 2D3IA 4LVQA 3T22A 2Q89A 1MS7A 1MXXA 1P1NA 4OERA 3OO7A 5TPAA 5M2VA 2HQ0A 1B3FA 3TQLA 2VGQA 5I57A 1B4ZA 4R9GA 1I69A 2VOZA 3B7DA 3TODA 3T93B 4DCYA 3G3HA 4JSOA 3P7IA 3PMVA 4OZ9A 5JK4A 2DP8A 1SDXA 4L17A 3WAEA 1US5A 4KCCA 5BWJA 2H99A 2XXWA 5DT6A 2Y7KA 3VVEA 1B7HA 1SI1A 2Z22A 2XHDA 3IO4A 3OELA 2ZYOA 2XXHA 3C4MA 4I1DA 1WDNA 4KHZE 2Y7IA 1DPPA 1LLSA 4E0WA 3VFJA 2Z23A 3KJTA 3SKPA 1AL3A 3HCQA 1NNFA 3QSLA 1OMPA 3IOTA 4GIZA 5I56A 4NF6A 5CMMA 3K6VA 1AH5A 4G8HA 3MVYA 2H4IA 5AA1A 3VDFA 2R71A 4FATA 3M3LA 4C1UA 2DWJA 2DXYA 1VFEA 1I6AA 4NEDA 4R74A 4YB7A 1B40A 1MG1A 1P1OA 1Y1MA 2GHBA 3M3KA 3MVWA 4GXSB 2I3WA 3K0VA 3H6WA 4YICA 3RPWA 3FXQA 3FVOA 1S7YA 3S9EA 2F97A 1IXCA 4F2QA 4YAHX 3T9UA 1QKBA 4ZE8A 5CBRA 5KDTA 1JEUA 1POY1 4GL0A 3Q29A 5AA4B 1B0LA 1XT8A 3LSFB 4NF5A 4P0IA 3IB2A 3KBRA 3OOAA 4R75A 3TQWA 4R6KA 2DWIA 5FTHA 3THIA 4HW8A 3MPKA 3PUYE 4LZ5A 4R72A 4IO5A 4PETA 1TFAA 3OSQA 3PUWE 2WKYA 4GWOA 1MXVA 4KD5A 4U1ZA 3K4UA 3IJXB 4C1TA 3LSXA 4Q0CA 4QHQA 1B52A 1YTVA 1B58A 2UYFA 3M3FA 4F3PA 1M5BA 4HTGA 4GRKA 4FAJA 3H06B 3ZS6A 2ZYKA 3JZJA 4H6DA 3U8QA 5DYHA 1JETA 3SEUA 1D9YA 2DS9A 3W9VA 1IXIA 1SBPA 1FW0A 4RK9A 3RY3A 3FATA 4UA8A 1M5EA 1M5DA 3DP8A 4NF8B 1FTJA 3KN8A 4XIGQ 1UTBB 3F11A 1B7ZA 3FZVA 4H65A 1JVXA 5DEXB 1AOVA 4DCXA 3E13X 5AE4A 2X7QA 1SYHA 3CR9A 4G8NA 4EF1A 3PPQA 1EZOA 3LR1A 1SW4A 1B2HA 4XKQA 1TFDA 2XX7A 4XXUA 3FJGA 3N5LA 3OEKA 4ZECA 3O29A 1OLCA 4R73A 3DM0A 1HSJA 4U4SA 1R6ZA 4FECA 5DTBA 4JBZA 3RT8A 1FTLA 4NF4A 2PX1A 2XXVA 5AA4A 4I8CA 1LBBA 4THIA 4RK2A 4YKKA 3FVKA 3GZGA 2O51A 2NOOA 3KSJA 3UGWA 3W9WA 4H0WA 5H8NB 1WVJA 2I3VA 5CMKA 3HPIA 1H3DA 1PBQA 1NKXA 2O69A 2ZXTA 3BFUA 1B5HA 3H03A 3QIMA 4GLIA 4G77A 4TLLB 3RT6B 2XXYA 4G68C 4YMBA 5J1DA 1ZKBA 2QJEA 2O7IA 3GBBA 3WAFA 1XS5A 5K2XA 3VV5A 4LQ5A 4YMAA 4MF3A 4PFUA 5A5XB 1FCKA 4TQUQ 4JDFA 4HS7A 4YKPA 5BUUA 2Z8FA 4BDMA 4DXBA 1LB8A 1DSNA 3ILUB 4ZDMA 2OWSA 2Q9TA 4U23A 4DLDA 3V8XB 4ECFA 2O7UA 1MXZA 3PPOA 4OHNA 4PP0A 4EXKA 2QS2A 3O2AA 1R1NA 4HCWA 4YU0A 2FYIA 4OFOA 3RTFB 3S9LC 2REJA 1P1WA 2F35A 1MQIA 2DWHA 2UVIA 2XXRA 3MZ1A 1ZJLA 5I2KB 4Z7EA 2ONRA 3UA8A 2D21A 3N6UA 4MLQA 3KN7A 1R9LA 3MP8A 5B7DA 1N0TA 3R26A 1O64A 3B6TA 3H4ZA 2HAUA 1B3GA 4ZE9A 5CMBA 1MXUA 3V89B 1A7LA 5HBCA 1URSA 1MDP1 2RC8A 3SDFA 2GHAA 2DVCA 2OZZA 3AXFA 3MAMA 1LAXA 1SQYA 4Q5TA 2F6PA 4JWYA 1OQHA 1B5JA 2RINA 2Q88A 4NMYA 3LSWA 3TUSA 1EZ9A 1B3EA 3C32A 3IOUA 3ZKKA 1H43A 3N26A 2NWJA 1GTKA 3T66A 3Q28A 1YPNA 4POXA 4QFNA 1MY0A 3CSGA 4H67A 3KSXA 3GLBA 1JNFA 2IEEA 4I62A 1XC1A 1B4HA 4YKJA 4DIGA 3DLNA 2H9BA 5ITOA 2UVGA 1NNKA 2G29A 2E1SA 3PPRA 2FNCA 3EHSA 1MPBA 3LUYA 5FTIA 4BDOA 3S9MC 4YB6A 1N7XA 2OLBA 3CRBA 1ELJA 2CMOA 2H98A 2XD3A 5HPQA 5I56B 3PPPA 5DVIA 4XKRA 3UP9A 1N04A 1ZMGA 3TELA 4F29A 3ECRA 3PUZE 3OMBA 4N6PA 3MPLA 4JWOA 2RC7A 3MBPA 4FORA 4WEDA 2UXAA 2UVHA 3H6VA 3IOVA 2QMWA 1UTHA 3CIJA 5EYFA 3TTNA 1QUJA 4TLMB 1PB8A 1II5A 4OENA 3HHGA 4NWCA 5FHOA 4QSCA 4M1VA 4DZ1A 3FV1A 1RKMA 1N3XA 3C33A 3MP1A 1WODA 1MM7A 2RKMA 4LZ7A 4F18A 1URGA 4MBPA 2V84A 5H8NA 4F3SA 3C31A 3DELB 3U1OA 1FTKA 1J1NA 3IR1A 2DE4A 2DE3A 1A8FA 3IX1A 1PB7A 3KOTA 3MZ9A 4QFPA 4XTCQ 3CFXA 1KWHA 5CMCA 3Q26A 4KQPA 4OFLA 1Y4CA 3G3JA 3N6TA 1EH3A 2I49A 4DDDA 3W15C 1P1QA 4OEVA 4NTLA 2X7PA 1H76A 3FXRA 2I0BA 3DP4A 4EXLA 4F19A 2O6AA 3R6UA 1TXFA 2PT1A 4F1VA 1AMFA 2P0SA 3FUZA 1Z7NE 3DP6A 4U21A 1NFTA 1Y3NA 4X1DA 1TWYA 5TPAB 5ICTA 2O68A 3MQ9A 4PFYA 3H6UA 3TCGA 1UIUA 5IKBA 3QAXA 1RYOA 1HSLA 4NF8A 3R7XA 2XXTA 3K2DA 1MY1A 4NE4A 1MQHA 2QS3A 1US4A 3PGFA 4R9FA 4NWDA 4NF6B 4ZZAA 4ND9A 1BLFA 3KGCA 5JTYB 1MRPA 1H45A 3CVGA 4OESA 4WEPA 2XD2A 1OLAA 3UIFA 1N7WA 2F6GA 4ZEDA 3SETA 1B51A 2ZNSA 3K6WA 5CC2A 1B6HA 4LZ8A 3UK4A 3H3GA 2QS4A 3FXUA 1EU8A 4KPTA 5CBSA 4LQ2A 3FGSA 1EZPA 3U92A 3K1PA 3USDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3K A;  3VLU A;  1A8E A;  1MY4 A;  2QRY A;  3S9N C;  3FVG A;  1D9V A;  1SYI A;  2QMX A;  1AIV A;  2REG A;  2V25 A;  4JSD A;  5FHN A;  1MQG A;  5I59 A;  1A55 A;  1SVX B;  1LB9 A;  2F7B A;  2VHA A;  4GD5 A;  5ICQ A;  3A09 A;  4KR5 A;  4R2B A;  3ODB A;  2IA4 A;  3PMW A;  1QKA A;  4U1O A;  3FAS A;  5AA2 B;  1DMB A;  2NUV A;  4FJP A;  4EQB A;  1B7U A;  4IGR A;  1ZLQ A;  3RQT A;  3IOR A;  3EQ1 A;  5KCJ B;  3E3K A;  1IEJ A;  3EHU A;  3K00 A;  3RGY A;  1I6B A;  3IJO B;  3PUX E;  3CFL A;  1DOT A;  1MQD A;  3A3C A;  4ONY A;  4GF8 A;  5H8Q B;  3BFT A;  1BIY A;  2G93 A;  3CG1 A;  1GVC A;  3VXB A;  3HV1 A;  2ZYN A;  4P0G A;  1LFH A;  1SW2 A;  3TCF A;  1Q35 A;  1ZU0 A;  3C34 A;  2Y7P A;  3QUF A;  3SEW A;  2Y84 A;  4KYS A;  1QW0 A;  1BKA A;  1B0H A;  2M8C A;  3MVZ A;  3TZA A;  3H6T A;  4TOZ A;  4BDR A;  3H7M A;  1PBP A;  3PPN A;  3TTL A;  2P1S A;  2ESN A;  2I4C A;  3MVX A;  4M4G A;  4RPN A;  3IOW A;  5H8F A;  5KCJ A;  3PU5 A;  3V83 A;  2VD3 A;  3KJ7 A;  1CE2 A;  1Y9U A;  2HEU A;  2H5Y A;  4IGT A;  1MH3 A;  1PDA A;  3FJM A;  4I9D A;  4RJZ A;  5CRY A;  3A3U A;  2VD2 A;  2PYY A;  4DXU A;  4GOT A;  4DXC A;  3IAZ A;  1UTB A;  3G7W A;  5L9O A;  1T0K A;  2XXQ A;  2P2A A;  4NF4 B;  1URD A;  1B32 A;  4ELO A;  5I58 B;  1LAH E;  3U72 A;  2V93 A;  2DXR A;  3PD9 A;  2I4B A;  2KLF A;  1ZBM A;  2ZNT A;  1Z7M E;  2A5T A;  5AA2 D;  1ZTY A;  1BP5 A;  1Y4T A;  3OO6 A;  3QXM A;  3VLW A;  3C9H A;  4R2F A;  1OVB A;  4IO2 A;  1FQA A;  4G68 B;  3EN3 A;  2H25 A;  1A54 A;  1FQD A;  1I6Q A;  1USY H;  1QJM A;  4BDQ A;  1SW5 A;  1NMU A;  2I0C A;  3FIR A;  3S4U A;  1SD3 A;  1IQ7 A;  1YCJ A;  5KDT B;  4GQO A;  1B3H A;  1S50 A;  4JB7 A;  2Q2C A;  4Z0I A;  3RNN A;  1ANF A;  4GFR A;  1MH4 A;  2DVZ A;  3ZSF A;  3D4C A;  1M5F A;  4E0X A;  2GFE A;  1M5C A;  4POW A;  3Q27 A;  4Q30 B;  1L5T A;  3CSB A;  3SER A;  1LGB C;  1USY E;  1D3K A;  3KOS A;  3MW0 A;  1XOC A;  1B1H A;  4ZEI A;  3G3F A;  3PMX A;  4R6Y A;  2V3Q A;  4KCD A;  1A40 A;  2HFB A;  3L6G A;  4FED A;  5I57 B;  5TP9 A;  1IXG A;  2QPQ A;  4LA9 A;  3PUV E;  4PFT A;  5JTY A;  3G3G A;  3VVD A;  2UYE A;  3OEN A;  4BDL A;  4EQ7 A;  1ZIU A;  4K3F A;  5CM6 A;  4YZZ A;  3VXC A;  1LBC A;  1UIV A;  4ESW A;  4WXJ A;  4O3B A;  2ALU A;  1LFI A;  3K1M A;  3O28 A;  4IO4 A;  5CI5 A;  4OXV A;  1VFD A;  3VVF A;  1H44 A;  1MXY A;  2I48 A;  1VR5 A;  5I2N B;  2OK2 A;  4LUB A;  2CZL A;  4ELQ A;  3VE1 B;  1LAF E;  4F3G A;  4KFQ A;  2AIX A;  1XVY A;  1QUI A;  1PB9 A;  1NNP A;  2F78 A;  4H5F A;  1P1U A;  4QFK A;  5DVF A;  1UQW A;  1Q1K A;  4PFW A;  5TU0 A;  1SW1 A;  3QK6 A;  3O9P A;  2Y7W A;  4DE8 A;  2LAO A;  3EPE A;  4F22 A;  1SI0 A;  3G3I A;  1JEV A;  2OJT A;  3OO9 A;  2ONK E;  3Q25 A;  4G8M A;  1NNT A;  5K2Y A;  4PE5 B;  3T9V A;  2PBW A;  3S2V A;  1ATG A;  2HAV A;  1FTO A;  1NL5 A;  3RN8 A;  4X1B A;  3OEM A;  5ISU A;  3I5O A;  3SES A;  3M8U A;  3E4R A;  4FEB A;  2DE2 A;  5L8D A;  2O84 X;  4ZS9 A;  2F5X A;  4RNS A;  1JQF A;  1DTZ A;  3OD7 A;  4LAT A;  5EHS A;  3ZKL A;  1MY2 A;  3BKI B;  3EF7 A;  1TT1 A;  4G4P A;  5EHM A;  4OFJ A;  3CG3 A;  1NH8 A;  1IZ1 A;  3HO7 A;  1XVX A;  3JV9 A;  4BDN A;  5HM4 B;  1Y1Z A;  3K02 A;  1MPD A;  1MY3 A;  3MC2 A;  5DVJ A;  2XX8 A;  4MH5 A;  4RPO A;  2OCU A;  3FVN A;  4AB5 A;  4F3B A;  2YPN A;  4RYA A;  4F1U A;  4O3A A;  3K01 A;  4IB2 A;  1FQB A;  3TTR A;  3SEV A;  3OSR A;  5JEI A;  2OWT A;  2DWA A;  3C36 A;  4U4X A;  3KN3 A;  3TCH A;  3LBS A;  3FJ7 A;  4OMB A;  3MZB A;  4OET A;  3E9X A;  1LFG A;  1A99 A;  1B5I A;  1LAG E;  2O1L A;  1GV8 A;  4ELR A;  2ANJ A;  2E0S A;  2ZYM A;  3IO6 A;  5ITP A;  4KYD A;  2QS1 A;  3IB0 A;  5F7V A;  1JVY A;  2F7A A;  3RLF E;  4NF5 B;  4EUO A;  2ZMB A;  3GBA A;  4N13 A;  3V5A A;  4Q8R A;  4GL8 A;  3I6V A;  2QSX A;  3HN0 A;  4ZEK A;  2A5S A;  2I6E A;  2AL4 A;  1MDQ A;  3CI8 A;  1LST A;  1B3L A;  2V3U A;  4WKM A;  4ELP A;  3N94 A;  4JXI A;  3K1N A;  3IB1 A;  3KZG A;  4QSE A;  3T9H B;  3K6U A;  4QF9 A;  3U93 A;  2D5W A;  3OO8 A;  3B6W A;  1B9J A;  4RA1 A;  1MXW A;  3MP6 A;  2PT2 A;  1POT A;  3B6Q A;  4OQO A;  1JW4 A;  1VSO A;  4YB5 A;  3SEY A;  2HXW A;  2ONS A;  1D4N A;  2QL3 A;  1Y20 A;  1YAE A;  4G2Z A;  1DPE A;  4YKI A;  5H8H A;  4JWX A;  3BBR A;  1PEB A;  3FD3 A;  3TMG A;  3UOR A;  3HST A;  1DTG A;  1JW1 A;  4OTE A;  2GH9 A;  2B3F A;  3FV2 A;  1B05 A;  1O7T A;  1F9B A;  2R6G E;  1Y3Q A;  2F34 A;  3MWB A;  3GXA A;  4ISU A;  4OVJ A;  3UN6 A;  5IAI A;  4XKN A;  3RTW B;  2PMS A;  2BJJ X;  1IXH A;  2RCB A;  2O1M A;  2FA7 A;  4KYE A;  2RCA A;  4OEU A;  3T9X B;  4ESX A;  3I3V A;  1QVS A;  4H8J A;  4F2O A;  3HHF A;  1FQC A;  1MPC A;  4H1X A;  2F36 A;  5I59 B;  1GR2 A;  3O6I A;  1LCT A;  4ZEB A;  1IUD A;  2Y7R A;  1OQG A;  3KG2 A;  3TYH A;  3TPA A;  2AL5 A;  4IO7 A;  4OYV A;  5FHM A;  4FIM A;  4FE8 A;  1IIW A;  1O63 A;  3O6H A;  1JW5 A;  1P99 A;  3O66 A;  3KEI A;  1S9T A;  4IY5 A;  4R6H A;  5I2K A;  3KFM A;  1B1X A;  3LSL A;  4OWD A;  1FQE A;  2ABH A;  2Q2A A;  2Z8E A;  4QRZ A;  2B65 A;  5AA3 A;  2DYX A;  2HZK A;  3TKD A;  4BLA A;  3O6G A;  2NXO A;  2X26 A;  2XX9 A;  3LC8 A;  2AYS A;  3K6X A;  3QUJ A;  1N76 A;  3T96 B;  4F1Y A;  5I2N A;  2NVU B;  5A5X A;  1HSE A;  5KZT A;  5H8Q A;  1QUK A;  1R9Q A;  1VE4 A;  2B3B A;  2F8D A;  2ZNU A;  4X48 A;  5H8F B;  4LP2 B;  3MUQ A;  4H8I A;  2UVJ A;  1MM6 A;  1QUL A;  1PC3 A;  4QSD A;  1FTM A;  4X9T A;  3OXN A;  3IL1 B;  5F1Q A;  4KI0 E;  2XXI A;  3O97 A;  3MJN A;  4RXL A;  4XKP A;  4EQ9 A;  4IO3 A;  4RY1 A;  5B70 A;  3SEX A;  2HCA A;  2YJP A;  2W7Y A;  3JYR A;  2HZL A;  2XXP A;  3TDJ A;  3CFZ A;  3TFL A;  4N07 A;  4U22 A;  2I58 A;  4ZZE A;  4IO6 A;  1BTJ A;  3L6H A;  4GXA A;  2A5T B;  3TTK A;  4AQ4 A;  5TP9 B;  5L9S A;  1CB6 A;  1UTH B;  1IIT A;  4PQJ A;  1Y3P A;  4LON B;  4QFO A;  2PVU A;  4G68 A;  2Q8J A;  5ELV A;  4MFI A;  3ILT B;  1FQF A;  4EDP A;  4P11 A;  1GGG A;  3TTM A;  3QYT A;  1XHY A;  1OIB A;  2XXU A;  2DQV A;  3C35 A;  5DEX A;  5L9M A;  2GRV A;  2XXX A;  2R9J A;  4F31 B;  2RC9 A;  2DSF A;  1B46 A;  2OBG A;  3RUM A;  5I58 A;  2VP1 A;  4GVO A;  4H5G A;  1LCF A;  4HCY A;  2F7C A;  2Z8D A;  4AB6 A;  1MQJ A;  4MLV A;  4F39 A;  4EF2 A;  1N84 A;  4QFL A;  3VLV A;  1RYX A;  3IK6 B;  3D4G A;  4O3C A;  3PD8 A;  3PV0 E;  2V3T A;  4IY6 A;  2YLN A;  4UAC A;  5I84 A;  1NH7 A;  2DOJ A;  5H8S A;  4C0R A;  5LOM A;  3EHT A;  5AA2 A;  3TAJ A;  3TEP A;  3ONM A;  3U94 A;  4ZEF A;  2RF1 A;  1OVT A;  4U2R A;  2THI A;  5H8H B;  1N3W A;  2D3I A;  4LVQ A;  3T22 A;  2Q89 A;  1MS7 A;  1MXX A;  1P1N A;  4OER A;  3OO7 A;  5TPA A;  5M2V A;  2HQ0 A;  1B3F A;  3TQL A;  2VGQ A;  5I57 A;  1B4Z A;  4R9G A;  1I69 A;  2VOZ A;  3B7D A;  3TOD A;  3T93 B;  4DCY A;  3G3H A;  4JSO A;  3P7I A;  3PMV A;  4OZ9 A;  5JK4 A;  2DP8 A;  1SDX A;  4L17 A;  3WAE A;  1US5 A;  4KCC A;  5BWJ A;  2H99 A;  2XXW A;  5DT6 A;  2Y7K A;  3VVE A;  1B7H A;  1SI1 A;  2Z22 A;  2XHD A;  3IO4 A;  3OEL A;  2ZYO A;  2XXH A;  3C4M A;  4I1D A;  1WDN A;  4KHZ E;  2Y7I A;  1DPP A;  1LLS A;  4E0W A;  3VFJ A;  2Z23 A;  3KJT A;  3SKP A;  1AL3 A;  3HCQ A;  1NNF A;  3QSL A;  1OMP A;  3IOT A;  4GIZ A;  5I56 A;  4NF6 A;  5CMM A;  3K6V A;  1AH5 A;  4G8H A;  3MVY A;  2H4I A;  5AA1 A;  3VDF A;  2R71 A;  4FAT A;  3M3L A;  4C1U A;  2DWJ A;  2DXY A;  1VFE A;  1I6A A;  4NED A;  4R74 A;  4YB7 A;  1B40 A;  1MG1 A;  1P1O A;  1Y1M A;  2GHB A;  3M3K A;  3MVW A;  4GXS B;  2I3W A;  3K0V A;  3H6W A;  4YIC A;  3RPW A;  3FXQ A;  3FVO A;  1S7Y A;  3S9E A;  2F97 A;  1IXC A;  4F2Q A;  4YAH X;  3T9U A;  1QKB A;  4ZE8 A;  5CBR A;  5KDT A;  1JEU A;  1POY 1;  4GL0 A;  3Q29 A;  5AA4 B;  1B0L A;  1XT8 A;  3LSF B;  4NF5 A;  4P0I A;  3IB2 A;  3KBR A;  3OOA A;  4R75 A;  3TQW A;  4R6K A;  2DWI A;  5FTH A;  3THI A;  4HW8 A;  3MPK A;  3PUY E;  4LZ5 A;  4R72 A;  4IO5 A;  4PET A;  1TFA A;  3OSQ A;  3PUW E;  2WKY A;  4GWO A;  1MXV A;  4KD5 A;  4U1Z A;  3K4U A;  3IJX B;  4C1T A;  3LSX A;  4Q0C A;  4QHQ A;  1B52 A;  1YTV A;  1B58 A;  2UYF A;  3M3F A;  4F3P A;  1M5B A;  4HTG A;  4GRK A;  4FAJ A;  3H06 B;  3ZS6 A;  2ZYK A;  3JZJ A;  4H6D A;  3U8Q A;  5DYH A;  1JET A;  3SEU A;  1D9Y A;  2DS9 A;  3W9V A;  1IXI A;  1SBP A;  1FW0 A;  4RK9 A;  3RY3 A;  3FAT A;  4UA8 A;  1M5E A;  1M5D A;  3DP8 A;  4NF8 B;  1FTJ A;  3KN8 A;  4XIG Q;  1UTB B;  3F11 A;  1B7Z A;  3FZV A;  4H65 A;  1JVX A;  5DEX B;  1AOV A;  4DCX A;  3E13 X;  5AE4 A;  2X7Q A;  1SYH A;  3CR9 A;  4G8N A;  4EF1 A;  3PPQ A;  1EZO A;  3LR1 A;  1SW4 A;  1B2H A;  4XKQ A;  1TFD A;  2XX7 A;  4XXU A;  3FJG A;  3N5L A;  3OEK A;  4ZEC A;  3O29 A;  1OLC A;  4R73 A;  3DM0 A;  1HSJ A;  4U4S A;  1R6Z A;  4FEC A;  5DTB A;  4JBZ A;  3RT8 A;  1FTL A;  4NF4 A;  2PX1 A;  2XXV A;  5AA4 A;  4I8C A;  1LBB A;  4THI A;  4RK2 A;  4YKK A;  3FVK A;  3GZG A;  2O51 A;  2NOO A;  3KSJ A;  3UGW A;  3W9W A;  4H0W A;  5H8N B;  1WVJ A;  2I3V A;  5CMK A;  3HPI A;  1H3D A;  1PBQ A;  1NKX A;  2O69 A;  2ZXT A;  3BFU A;  1B5H A;  3H03 A;  3QIM A;  4GLI A;  4G77 A;  4TLL B;  3RT6 B;  2XXY A;  4G68 C;  4YMB A;  5J1D A;  1ZKB A;  2QJE A;  2O7I A;  3GBB A;  3WAF A;  1XS5 A;  5K2X A;  3VV5 A;  4LQ5 A;  4YMA A;  4MF3 A;  4PFU A;  5A5X B;  1FCK A;  4TQU Q;  4JDF A;  4HS7 A;  4YKP A;  5BUU A;  2Z8F A;  4BDM A;  4DXB A;  1LB8 A;  1DSN A;  3ILU B;  4ZDM A;  2OWS A;  2Q9T A;  4U23 A;  4DLD A;  3V8X B;  4ECF A;  2O7U A;  1MXZ A;  3PPO A;  4OHN A;  4PP0 A;  4EXK A;  2QS2 A;  3O2A A;  1R1N A;  4HCW A;  4YU0 A;  2FYI A;  4OFO A;  3RTF B;  3S9L C;  2REJ A;  1P1W A;  2F35 A;  1MQI A;  2DWH A;  2UVI A;  2XXR A;  3MZ1 A;  1ZJL A;  5I2K B;  4Z7E A;  2ONR A;  3UA8 A;  2D21 A;  3N6U A;  4MLQ A;  3KN7 A;  1R9L A;  3MP8 A;  5B7D A;  1N0T A;  3R26 A;  1O64 A;  3B6T A;  3H4Z A;  2HAU A;  1B3G A;  4ZE9 A;  5CMB A;  1MXU A;  3V89 B;  1A7L A;  5HBC A;  1URS A;  1MDP 1;  2RC8 A;  3SDF A;  2GHA A;  2DVC A;  2OZZ A;  3AXF A;  3MAM A;  1LAX A;  1SQY A;  4Q5T A;  2F6P A;  4JWY A;  1OQH A;  1B5J A;  2RIN A;  2Q88 A;  4NMY A;  3LSW A;  3TUS A;  1EZ9 A;  1B3E A;  3C32 A;  3IOU A;  3ZKK A;  1H43 A;  3N26 A;  2NWJ A;  1GTK A;  3T66 A;  3Q28 A;  1YPN A;  4POX A;  4QFN A;  1MY0 A;  3CSG A;  4H67 A;  3KSX A;  3GLB A;  1JNF A;  2IEE A;  4I62 A;  1XC1 A;  1B4H A;  4YKJ A;  4DIG A;  3DLN A;  2H9B A;  5ITO A;  2UVG A;  1NNK A;  2G29 A;  2E1S A;  3PPR A;  2FNC A;  3EHS A;  1MPB A;  3LUY A;  5FTI A;  4BDO A;  3S9M C;  4YB6 A;  1N7X A;  2OLB A;  3CRB A;  1ELJ A;  2CMO A;  2H98 A;  2XD3 A;  5HPQ A;  5I56 B;  3PPP A;  5DVI A;  4XKR A;  3UP9 A;  1N04 A;  1ZMG A;  3TEL A;  4F29 A;  3ECR A;  3PUZ E;  3OMB A;  4N6P A;  3MPL A;  4JWO A;  2RC7 A;  3MBP A;  4FOR A;  4WED A;  2UXA A;  2UVH A;  3H6V A;  3IOV A;  2QMW A;  1UTH A;  3CIJ A;  5EYF A;  3TTN A;  1QUJ A;  4TLM B;  1PB8 A;  1II5 A;  4OEN A;  3HHG A;  4NWC A;  5FHO A;  4QSC A;  4M1V A;  4DZ1 A;  3FV1 A;  1RKM A;  1N3X A;  3C33 A;  3MP1 A;  1WOD A;  1MM7 A;  2RKM A;  4LZ7 A;  4F18 A;  1URG A;  4MBP A;  2V84 A;  5H8N A;  4F3S A;  3C31 A;  3DEL B;  3U1O A;  1FTK A;  1J1N A;  3IR1 A;  2DE4 A;  2DE3 A;  1A8F A;  3IX1 A;  1PB7 A;  3KOT A;  3MZ9 A;  4QFP A;  4XTC Q;  3CFX A;  1KWH A;  5CMC A;  3Q26 A;  4KQP A;  4OFL A;  1Y4C A;  3G3J A;  3N6T A;  1EH3 A;  2I49 A;  4DDD A;  3W15 C;  1P1Q A;  4OEV A;  4NTL A;  2X7P A;  1H76 A;  3FXR A;  2I0B A;  3DP4 A;  4EXL A;  4F19 A;  2O6A A;  3R6U A;  1TXF A;  2PT1 A;  4F1V A;  1AMF A;  2P0S A;  3FUZ A;  1Z7N E;  3DP6 A;  4U21 A;  1NFT A;  1Y3N A;  4X1D A;  1TWY A;  5TPA B;  5ICT A;  2O68 A;  3MQ9 A;  4PFY A;  3H6U A;  3TCG A;  1UIU A;  5IKB A;  3QAX A;  1RYO A;  1HSL A;  4NF8 A;  3R7X A;  2XXT A;  3K2D A;  1MY1 A;  4NE4 A;  1MQH A;  2QS3 A;  1US4 A;  3PGF A;  4R9F A;  4NWD A;  4NF6 B;  4ZZA A;  4ND9 A;  1BLF A;  3KGC A;  5JTY B;  1MRP A;  1H45 A;  3CVG A;  4OES A;  4WEP A;  2XD2 A;  1OLA A;  3UIF A;  1N7W A;  2F6G A;  4ZED A;  3SET A;  1B51 A;  2ZNS A;  3K6W A;  5CC2 A;  1B6H A;  4LZ8 A;  3UK4 A;  3H3G A;  2QS4 A;  3FXU A;  1EU8 A;  4KPT A;  5CBS A;  4LQ2 A;  3FGS A;  1EZP A;  3U92 A;  3K1P A;  3USD A; 
#chains in the Genus database with same CATH topology
 5A5L A;  1VDW A;  2QRY A;  3FVG A;  1D9V A;  1SYI A;  1AIV A;  1MQG A;  1A55 A;  2VHA A;  1LB9 A;  5ICQ A;  3ODB A;  2IA4 A;  3FAS A;  4FJP A;  3RQT A;  3EQ1 A;  3EHU A;  5I2N B;  3BFT A;  3CG1 A;  2Y84 A;  1QW0 A;  1RDY A;  3TZA A;  3H6T A;  2XXK A;  4TOZ A;  3V83 A;  1Y9U A;  1MH3 A;  3FJM A;  3MYU A;  3IAZ A;  1UTB A;  2XXQ A;  4NF4 B;  5I58 B;  2KLF A;  5AA2 D;  3VLW A;  4R2F A;  3NOH A;  4IO2 A;  4G68 B;  1A54 A;  1FPJ A;  3FIR A;  3S4U A;  1SD3 A;  1B3H A;  4Z0I A;  3D4C A;  3CSB A;  4G61 A;  1LGB C;  3MW0 A;  1D3K A;  2P3V A;  1XOC A;  3G3F A;  2V3Q A;  1A40 A;  5I57 B;  5TP9 A;  1IXG A;  5FBP A;  3MST A;  4OXV A;  3VVF A;  1VR5 A;  1KA1 A;  4ELQ A;  4F3G A;  2AIX A;  1QUI A;  1P1U A;  5TU0 A;  1SW1 A;  3EPE A;  4DI3 D;  1JEV A;  2PBW A;  3RN8 A;  3M8U A;  5L8D A;  2O84 X;  1JQF A;  1MY2 A;  1IZ1 A;  1XVX A;  4OVS A;  2XX8 A;  2JJK A;  2OCU A;  2YPN A;  4O3A A;  4IB2 A;  3RYD A;  3OSR A;  4H45 A;  2OWT A;  4PBH A;  3MZB A;  2CEY A;  3E9X A;  2QVR A;  1B5I A;  2F7A A;  4NF5 B;  5EYH A;  3GBA A;  2QSX A;  2V3U A;  5LTC A;  3KZG A;  4QSE A;  5IZ3 B;  4QF9 A;  3B6W A;  3KBZ A;  4OQO A;  1NV1 A;  1VSO A;  3U65 A;  4YKI A;  4FBP A;  1NV3 A;  3BBR A;  1DTG A;  5I5P A;  3FV2 A;  3MWB A;  1O7T A;  4OVJ A;  1F9B A;  2F34 A;  2O1M A;  5I59 B;  1EYJ A;  4H1X A;  2F36 A;  2AL5 A;  5FHM A;  4FE8 A;  1IIW A;  1JW5 A;  3IFA A;  4JVD A;  4R6H A;  1B1X A;  2ABH A;  4BLA A;  1R9Q A;  1VE4 A;  4LP2 B;  4H8I A;  3IL1 B;  1FBG A;  2XXI A;  4RY1 A;  2B4M A;  3SEX A;  2HCA A;  3TDJ A;  4U22 A;  4PGP A;  2I58 A;  3TTK A;  1FQF A;  4P11 A;  1XHY A;  5F24 A;  5DEX A;  4HCY A;  4MLV A;  1LBW A;  3VLV A;  3PD8 A;  4IY6 A;  4ZEF A;  4U2R A;  5H8H B;  2Q89 A;  1FPD A;  1MXX A;  2WYK A;  4PDH A;  1B3F A;  3TQL A;  3T93 B;  4JSO A;  3P7I A;  4L17 A;  3WAE A;  2H99 A;  5KCJ B;  3BIG A;  3OEL A;  3C4M A;  4I1D A;  4E0W A;  1IMB A;  1NNF A;  5I56 A;  3K6V A;  3MVY A;  5IZ1 A;  4FAT A;  2DXY A;  1I6A A;  1P1O A;  3M3K A;  3MVW A;  3K0V A;  1S7Y A;  3S9E A;  2F97 A;  3T9U A;  1JEU A;  1XT8 A;  4P0I A;  4NF5 A;  3IB2 A;  3KBR A;  3TQW A;  1FPL A;  4LZ5 A;  4IO5 A;  1FBD A;  3OSQ A;  4C1T A;  3IJX B;  2GQ1 A;  4AS5 A;  4QHQ A;  1B58 A;  2ZZV A;  3M3F A;  3ZS6 A;  3W9V A;  3RY3 A;  1FW0 A;  4UA8 A;  4MNI A;  4NF8 B;  4OVR A;  1AOV A;  3F11 A;  1B7Z A;  3FZV A;  5AE4 A;  4G8N A;  2XX7 A;  3OEK A;  4R73 A;  4U4S A;  4FEC A;  4JBZ A;  3W9W A;  2NOO A;  3KSJ A;  5H8N B;  3SZP A;  2VT5 A;  3BFU A;  1B5H A;  4YMB A;  4G68 C;  2CZK A;  3GBB A;  1XS5 A;  4YKP A;  1DSN A;  4U23 A;  1MXZ A;  2PFY A;  3O2A A;  2KQZ A;  2REJ A;  1P1W A;  4PF8 A;  2D21 A;  1R9L A;  5B7D A;  1N0T A;  1O64 A;  3B6T A;  3H4Z A;  1B3G A;  1YYZ A;  2GHA A;  2DVC A;  2OZZ A;  4LN5 A;  1B5J A;  4N8Y A;  3T66 A;  2WX9 A;  1NNK A;  2G29 A;  1N7X A;  2XD3 A;  3UP9 A;  1N04 A;  4F29 A;  3ECR A;  1JP4 A;  3PUZ E;  2RC7 A;  4MNP A;  3H6V A;  3IOV A;  1II5 A;  4LZ7 A;  3C33 A;  1URG A;  3A29 A;  4F3S A;  1PB7 A;  3MZ9 A;  4XTC Q;  3E79 A;  1Y4C A;  2X7P A;  2I0B A;  4EXL A;  1LBX A;  2PT1 A;  4F1V A;  2P0S A;  4U21 A;  5TPA B;  3H6U A;  1UIU A;  3QAX A;  1HSL A;  2XXT A;  4ZZA A;  5JTY B;  1MRP A;  4WEP A;  2XD2 A;  1OLA A;  2F6G A;  4ZED A;  3SET A;  4HE1 A;  2FIX A;  4PFR A;  4JSD A;  3A09 A;  4KR5 A;  4U1O A;  4PE3 A;  1B7U A;  4IGR A;  4PAK A;  4EQB A;  1I6B A;  3CFL A;  1DOT A;  5H8Q B;  3HV1 A;  2ZYN A;  1LFH A;  3TCF A;  1KA0 A;  1Q35 A;  3QUF A;  2Y7P A;  4KYS A;  3PPN A;  2ESN A;  4M4G A;  1YXI A;  5H8F A;  3IOW A;  5KCJ A;  3PU5 A;  1Q9D A;  4OAN A;  2HEU A;  4RJZ A;  4I9D A;  2VD2 A;  2PYY A;  4DXC A;  3G7W A;  1D9Q A;  1FSA A;  1URD A;  4O7M A;  2V93 A;  2DXR A;  2I4B A;  2ZNT A;  1ZBM A;  1Z7M E;  1BP5 A;  1FQA A;  1FQD A;  1QJM A;  4MHF A;  1IQ7 A;  2Q2C A;  3ZSF A;  4E0X A;  1M5F A;  1NV6 A;  4POW A;  3KOS A;  1B1H A;  2OWZ A;  4KCD A;  2HFB A;  2QPQ A;  4LA9 A;  3PUV E;  3OEN A;  5CM6 A;  3VXC A;  1LFI A;  3O28 A;  4IO4 A;  2XWI A;  1MXY A;  4LUB A;  2CZL A;  1LAF E;  1PB9 A;  1NNP A;  2F78 A;  4QFK A;  5DVF A;  5LDZ A;  4PFW A;  3O9P A;  2Q8M A;  2Y7W A;  4DE8 A;  4F22 A;  5K2Y A;  4OVP A;  4PE5 B;  3S2V A;  2HAV A;  3I5O A;  4ZS9 A;  2F5X A;  3CG3 A;  1NH8 A;  2FBP A;  3JV9 A;  5HM4 B;  4PAF A;  1MPD A;  4OA4 A;  3FVN A;  4AB5 A;  1FQB A;  4U4X A;  3KN3 A;  4OET A;  2ZZW A;  1A99 A;  1GV8 A;  1LEV A;  4KYD A;  5F7V A;  2ZMB A;  4OVT A;  3I6V A;  3HN0 A;  4ZEK A;  4JXI A;  3K6U A;  4XFE A;  5IZZ A;  2D5W A;  3B6Q A;  4PC9 A;  3SEY A;  2ONS A;  1SPI A;  3GYY A;  1Y20 A;  2QVU A;  4G2Z A;  4JWX A;  3HST A;  1JW1 A;  4OTE A;  3UN6 A;  1Y3Q A;  3GXA A;  1YZ0 A;  3RTW B;  2BJJ X;  1IXH A;  4KYE A;  4H8J A;  1NV7 A;  1QVS A;  1FQC A;  4NN3 A;  3KG2 A;  3TYH A;  3TPA A;  4X04 A;  4OYV A;  1O63 A;  1INP A;  3O66 A;  1NV2 A;  4IY5 A;  3QMF A;  3KFM A;  4QRZ A;  2Q2A A;  5ET5 A;  2B65 A;  1AWB A;  3TKD A;  2NXO A;  3T96 B;  4P1L A;  3K6X A;  1HSE A;  5KZT A;  3S9N C;  2B3B A;  2ZNU A;  1QUL A;  1PC3 A;  4QSD A;  1FTM A;  5F1Q A;  4XKP A;  4EQ9 A;  3MJN A;  5EQ8 A;  2YJP A;  2W7Y A;  2HZL A;  4ZZE A;  5ET6 A;  1QGX A;  2PCR A;  5TP9 B;  1IIT A;  2PVU A;  4G68 A;  4MIJ A;  2Q8J A;  3TTM A;  3C35 A;  2XXU A;  2DQV A;  4PFI A;  2GRV A;  2XWK A;  4MMP A;  2Z8D A;  5I3S A;  4EF2 A;  4UAC A;  3D4G A;  5I84 A;  2V3T A;  5LOM A;  5AA2 A;  3TAJ A;  3TEP A;  3ONM A;  3U94 A;  2RF1 A;  1N3W A;  4LVQ A;  1MS7 A;  2FHY A;  5M2V A;  2HQ0 A;  5I57 A;  2VOZ A;  3B7D A;  5JK4 A;  4KCC A;  2XXW A;  2Y7K A;  1SI1 A;  3IO4 A;  1EYI A;  1WDN A;  2Y7I A;  4PTK A;  3VFJ A;  3KJT A;  3SKP A;  1AL3 A;  3HCQ A;  4NF0 A;  5EQ9 A;  4GIZ A;  4G8H A;  5AA1 A;  2H4I A;  3M3L A;  4OVQ A;  4R74 A;  1VFE A;  4NED A;  3U72 A;  2VPO A;  1B40 A;  2GHB A;  1Y1M A;  3H6W A;  4YIC A;  1IXC A;  4F2Q A;  4GL0 A;  5AA4 B;  1LBY A;  3KC0 A;  3OOA A;  4R6K A;  3THI A;  3MPK A;  1TFA A;  4GWO A;  3RPL B;  1B52 A;  1YTV A;  1NUW A;  2UYF A;  4HTG A;  4GRK A;  3JZJ A;  4H6D A;  3U8Q A;  1JET A;  4GBW A;  1IXI A;  4RK9 A;  5ESY A;  5CMM A;  1FTJ A;  3KN8 A;  1UTB B;  3E13 X;  1NUY A;  3CR9 A;  3PPQ A;  3LR1 A;  3FJG A;  3O29 A;  1OLC A;  1R6Z A;  4NHB A;  5AA4 A;  4I8C A;  1LBB A;  3KC1 A;  4RK2 A;  2O51 A;  1PBQ A;  3QIM A;  1NKX A;  2O69 A;  2ZXT A;  3H03 A;  4GLI A;  4G77 A;  4MNC A;  2QJE A;  2O7I A;  5K2X A;  3VV5 A;  4LQ5 A;  4YMA A;  1FCK A;  4BDM A;  4DXB A;  1LB8 A;  3ILU B;  4ZDM A;  2OWS A;  4ECF A;  3PPO A;  4EXK A;  4HCW A;  1R1N A;  4OFO A;  3RTF B;  2UVI A;  2XXR A;  4Z7E A;  3UA8 A;  1IMC A;  3MP8 A;  1K9Z A;  5HBC A;  2RC8 A;  1LAX A;  1SQY A;  2F6P A;  4JWY A;  1H43 A;  3N26 A;  3Q28 A;  1YPN A;  4QFN A;  3CSG A;  1JNF A;  2PFZ A;  5ITO A;  3PPR A;  1MPB A;  1ELJ A;  2H98 A;  2R8T A;  5HPQ A;  5I56 B;  5DVI A;  2ZZX A;  4XKR A;  4P47 A;  2HHM A;  3OMB A;  4N6P A;  4N4U A;  3MBP A;  4FOR A;  4WED A;  2Y5K A;  2QMW A;  3CIJ A;  1QUJ A;  5FHO A;  4I40 A;  4M1V A;  2VPN A;  3FV1 A;  1N3X A;  3MP1 A;  4HXV A;  3DEL B;  4N17 A;  1G0I A;  2DE4 A;  1A8F A;  4N6K A;  3CFX A;  4DDD A;  4N91 A;  3G3J A;  4PBQ A;  3B8B A;  2WYP A;  1H76 A;  3DP4 A;  2B4L A;  3R6U A;  1AMF A;  4X1D A;  5ICT A;  1TWY A;  3TCG A;  5IKB A;  1BLF A;  3KGC A;  4OES A;  4GWU A;  4GWS A;  2ZNS A;  4LZ8 A;  5CBS A;  3FGS A;  3USD A;  3VLU A;  1A8E A;  1MY4 A;  1FPI A;  4MAG A;  2QMX A;  2V25 A;  5FHN A;  1FBH A;  4R2B A;  1QKA A;  5AA2 B;  1ZLQ A;  3IOR A;  3E3K A;  4JVC A;  3IJO B;  3PUX E;  4ZEB A;  3A3C A;  3VXB A;  4P0G A;  1SW2 A;  4JVI A;  1B0H A;  2M8C A;  3MVZ A;  2QVV A;  1PBP A;  2P1S A;  2I4C A;  3MVX A;  4RPN A;  4P56 A;  2VD3 A;  3IFC A;  1CE2 A;  4IGT A;  1PDA A;  5CRY A;  3A3U A;  4GOT A;  1T0K A;  4NG7 A;  2A5T A;  3C9H A;  4BDQ A;  1NMU A;  2WBB A;  1YCJ A;  5KDT B;  4GQO A;  1S50 A;  4JB7 A;  3RNN A;  1MH4 A;  4KXP A;  1FBP A;  3Q27 A;  4Q30 B;  4ZEI A;  2CZI A;  3PMX A;  4R6Y A;  1FPB A;  3BIH A;  4PFT A;  3G3G A;  3VVD A;  2UYE A;  4BDL A;  1ZIU A;  4K3F A;  1FPF A;  4PAI A;  3E78 A;  1LBC A;  4O3B A;  2ALU A;  5EYG A;  4PFB A;  2OK2 A;  3VE1 B;  4KFQ A;  1XVY A;  2WEF A;  2ONK E;  3Q25 A;  3T9V A;  1ATG A;  1FTO A;  1NL5 A;  5ISU A;  3OEM A;  3SES A;  3E4R A;  4FEB A;  2DE2 A;  3OD7 A;  4LAT A;  1TT1 A;  4G4P A;  5EHM A;  4OFJ A;  1RDZ A;  1Y1Z A;  3K02 A;  1MY3 A;  1NUX A;  3MC2 A;  4RPO A;  3K01 A;  3TTR A;  3SEV A;  5JEI A;  4GWY A;  4I3Y A;  1LFG A;  2ZYM A;  3IB0 A;  1JVY A;  3RLF E;  4N13 A;  3V5A A;  4GL8 A;  2A5S A;  1LST A;  2F3D A;  3N94 A;  3OO8 A;  3LUZ A;  4RA1 A;  1MXW A;  1K9Y A;  1POT A;  4YB5 A;  1D4N A;  1DPE A;  5H8H A;  3FD3 A;  3UOR A;  4GX4 A;  1FJ9 A;  2B3F A;  2R6G E;  1IMD A;  4ISU A;  4XKN A;  4PGN A;  5EQA A;  2RCB A;  3T9X B;  2RCA A;  4F2O A;  3HHF A;  1GR2 A;  1LCT A;  2Y7R A;  1OQG A;  3T1B A;  3O6H A;  1P99 A;  3KEI A;  3LSL A;  4OWD A;  1FQE A;  2Z8E A;  2DYX A;  2HZK A;  3LC8 A;  2AYS A;  3QUJ A;  1N76 A;  5I2N A;  2NVU B;  5A5X A;  5H8Q A;  1QUK A;  2F8D A;  5H8F B;  1G0H A;  3MUQ A;  4N81 A;  1RDX A;  2OX3 A;  3CHG A;  4KI0 E;  4N15 A;  5B70 A;  3CFZ A;  3L6H A;  5L9S A;  4QFO A;  4PQJ A;  4LON B;  5ELV A;  1GGG A;  4F31 B;  2RC9 A;  1B46 A;  2OBG A;  4GVO A;  4H5G A;  1LCF A;  2F7C A;  4AB6 A;  1N84 A;  1RYX A;  3IK6 B;  4MX6 A;  4O3C A;  2YLN A;  2DOJ A;  4C0R A;  3EHT A;  3ROJ A;  2XWO A;  1OVT A;  4X8R A;  2THI A;  4P8B A;  2D3I A;  4AS4 A;  1P1N A;  3OO7 A;  5TPA A;  2P3N A;  1B4Z A;  4DCY A;  4OZ9 A;  2DP8 A;  3EKI A;  3VVE A;  2XHD A;  4KHZ E;  1LLS A;  1OMP A;  4NF6 A;  1AH5 A;  3VDF A;  2I3W A;  3RPW A;  3FXQ A;  5KDT A;  4ZE8 A;  5CBR A;  1POY 1;  1B0L A;  3LSF B;  4P3L A;  5FTH A;  2WKY A;  1MXV A;  4KD5 A;  3LSX A;  4Q0C A;  1FPK A;  1M5B A;  4F3P A;  5ET7 A;  1NV4 A;  5J16 A;  1NI9 A;  1D9Y A;  1M5E A;  3DP8 A;  5DEX B;  1JVX A;  2X7Q A;  4EF1 A;  1B2H A;  4XXU A;  3N5L A;  1HSJ A;  2FVZ A;  4NF4 A;  2PX1 A;  4THI A;  3FVK A;  3GZG A;  3UGW A;  1FBC A;  3FBP A;  5CMK A;  2I3V A;  5DW8 A;  1H3D A;  4QXD A;  5J1D A;  5ET8 A;  4TQU Q;  4JDF A;  1DK4 A;  2Q9T A;  3V8X B;  4PP0 A;  2QS2 A;  1FBF A;  4YU0 A;  3S9L C;  2F35 A;  2DWH A;  4MLQ A;  3LV0 A;  3KN7 A;  1CNQ A;  3R26 A;  4QBA A;  4XEQ A;  5CMB A;  1MXU A;  3V89 B;  1MDP 1;  2BJI A;  4Q5T A;  1OQH A;  2Q88 A;  3TUS A;  2NWJ A;  1GTK A;  1MY0 A;  4H67 A;  3GLB A;  4YKJ A;  4DIG A;  2UVG A;  2E1S A;  2FNC A;  3EHS A;  3LUY A;  5FTI A;  4YB6 A;  2CMO A;  2CEX A;  3PPP A;  1ZMG A;  3TEL A;  4JWO A;  1LBZ A;  1NUZ A;  2UXA A;  2UVH A;  5EYF A;  1UTH A;  3PTY A;  4O8M A;  1PB8 A;  4NWC A;  4QSC A;  4DZ1 A;  1RKM A;  4F18 A;  2RKM A;  5H8N A;  3C31 A;  3U1O A;  1J1N A;  3IX1 A;  4DI4 B;  3KOT A;  4QFP A;  1KWH A;  5CMC A;  4OFL A;  2I49 A;  1P1Q A;  4OEV A;  3FXR A;  2O6A A;  1TXF A;  1DBZ A;  1NFT A;  1Y3N A;  4NF8 A;  1MQH A;  2QS3 A;  3PGF A;  4R9F A;  4NWD A;  4ND9 A;  2XWV A;  3CVG A;  1H45 A;  3UIF A;  1B51 A;  3K6W A;  1EU8 A;  4LQ2 A;  3U92 A;  3G3K A;  2REG A;  5I59 A;  1SVX B;  2F7B A;  4GD5 A;  5IZ3 A;  3PMW A;  1DMB A;  2NUV A;  1IEJ A;  3K00 A;  3RGY A;  1MQD A;  4ONY A;  4GF8 A;  1BIY A;  2G93 A;  1GVC A;  3RPL A;  4HE2 A;  1ZU0 A;  3C34 A;  3ISP A;  3SEW A;  1BKA A;  4BDR A;  3H7M A;  3TTL A;  3HFU A;  2CZH A;  3KJ7 A;  4AQ4 A;  2H5Y A;  4DXU A;  5L9O A;  2P2A A;  1NV5 A;  1B32 A;  4ELO A;  1LAH E;  3PD9 A;  4NAP A;  1ZTY A;  1Y4T A;  3OO6 A;  3QXM A;  1OVB A;  3EN3 A;  2H25 A;  1I6Q A;  1USY H;  1SW5 A;  2I0C A;  1ANF A;  4GFR A;  2DVZ A;  4GX3 A;  2GFE A;  1M5C A;  1L5T A;  3SER A;  1USY E;  3L6G A;  4FED A;  3T0J A;  1FBE A;  5JTY A;  4EQ7 A;  5EQ7 A;  4YZZ A;  1UIV A;  4ESW A;  4WXJ A;  3K1M A;  5CI5 A;  1EYK A;  1VFD A;  1H44 A;  2I48 A;  4PCD A;  4H5F A;  1UQW A;  1Q1K A;  4NGU A;  3QK6 A;  2F3B A;  2LAO A;  1SI0 A;  3G3I A;  2OJT A;  3OO9 A;  4PF6 A;  4G8M A;  1NNT A;  4X1B A;  4P1E A;  4RNS A;  1DTZ A;  4HE0 A;  4N6D A;  3ZKL A;  5EHS A;  3BKI B;  3EF7 A;  2DDK A;  3HO7 A;  4BDN A;  5DVJ A;  4MH5 A;  4F3B A;  4RYA A;  4F1U A;  1FTA A;  2DWA A;  3C36 A;  3TCH A;  3LBS A;  4OMB A;  3FJ7 A;  1KZ8 A;  1LAG E;  2O1L A;  4ELR A;  2Y5L A;  2ANJ A;  2E0S A;  5ITP A;  3IO6 A;  2Q74 A;  2QS1 A;  4EUO A;  4Q8R A;  2I6E A;  2AL4 A;  1MDQ A;  3CI8 A;  1B3L A;  4WKM A;  4ELP A;  3K1N A;  3IB1 A;  3T9H B;  4MJO A;  3U93 A;  1B9J A;  4NX1 A;  3MP6 A;  2PT2 A;  1JW4 A;  4GWX A;  2HXW A;  2QL3 A;  1YAE A;  1FPG A;  1PEB A;  3TMG A;  2GH9 A;  1B05 A;  5IAI A;  4O7I A;  4GWZ A;  2QFL A;  2PMS A;  1LBV A;  2FA7 A;  4OEU A;  5T3J A;  4ESX A;  3I3V A;  1MPC A;  3O6I A;  1IUD A;  4NQ8 A;  4IO7 A;  1DCU A;  3FXB A;  4FIM A;  4P9K A;  1FRP A;  1S9T A;  5I2K A;  5AA3 A;  3O6G A;  2XX9 A;  2X26 A;  4F1Y A;  4X48 A;  2UVJ A;  1MM6 A;  4X9T A;  3OXN A;  3O97 A;  4RXL A;  4IO3 A;  3JYR A;  2XXP A;  2HXR A;  3TFL A;  4N07 A;  1IMF A;  1BTJ A;  4IO6 A;  4GXA A;  2A5T B;  1CB6 A;  1UTH B;  1Y3P A;  4MFI A;  3ILT B;  4EDP A;  3QYT A;  1OIB A;  5L9M A;  2XXX A;  2R9J A;  2L5V A;  2DSF A;  3RUM A;  5I58 A;  2VP1 A;  1BK4 A;  2MKZ A;  1MQJ A;  4F39 A;  4QFL A;  3PV0 E;  1NH7 A;  5H8S A;  1IME A;  4O94 A;  2XA5 A;  3T22 A;  4OER A;  2VGQ A;  4I3E A;  4R9G A;  1I69 A;  3TOD A;  3G3H A;  3PMV A;  1SDX A;  1US5 A;  5BWJ A;  5DT6 A;  1B7H A;  2Z22 A;  2ZYO A;  2XXH A;  1DPP A;  2Z23 A;  3QSL A;  4UAB A;  3IOT A;  2R71 A;  4C1U A;  2DWJ A;  4YB7 A;  1MG1 A;  4GXS B;  3FVO A;  2FIE A;  4YAH X;  1QKB A;  1FPE A;  3Q29 A;  4R75 A;  5I7I A;  2V4C A;  2DWI A;  4HW8 A;  3PUY E;  4R72 A;  4H46 A;  4PET A;  3PUW E;  4U1Z A;  3K4U A;  4FAJ A;  3H06 B;  2ZYK A;  1FJ6 A;  5DYH A;  3SEU A;  2DS9 A;  1SBP A;  2HPG A;  3FAT A;  1M5D A;  4XIG Q;  4H65 A;  4DCX A;  1SYH A;  1EZO A;  1SW4 A;  4XKQ A;  4ZEC A;  1TFD A;  3DM0 A;  5DTB A;  3RT8 A;  1FTL A;  5IM2 A;  2XXV A;  4YKK A;  4H0W A;  1WVJ A;  3HPI A;  4TLL B;  3RT6 B;  2XXY A;  1ZKB A;  3WAF A;  1NV0 A;  5IGA A;  4MF3 A;  4PFU A;  5A5X B;  4HS7 A;  5BUU A;  2Z8F A;  4DLD A;  2O7U A;  4OHN A;  2FYI A;  1MQI A;  4N8G A;  5I2K B;  3MZ1 A;  1ZJL A;  2ONR A;  3N6U A;  4MCO A;  2HAU A;  4ZE9 A;  1A7L A;  4IR8 A;  1URS A;  3SDF A;  3AXF A;  3MAM A;  2RIN A;  3D1R A;  4PDD A;  4NMY A;  3LSW A;  1EZ9 A;  1B3E A;  3C32 A;  3IOU A;  3ZKK A;  4POX A;  3B50 A;  3KSX A;  4I62 A;  2IEE A;  1XC1 A;  4GWW A;  1B4H A;  3DLN A;  2H9B A;  4GBV A;  4BDO A;  3S9M C;  3CRB A;  2OLB A;  3MPL A;  3TTN A;  4TLM B;  4OEN A;  3HHG A;  1WOD A;  1MM7 A;  4MBP A;  2V84 A;  1FTK A;  3IR1 A;  2DE3 A;  2WBD A;  3Q26 A;  4KQP A;  3N6T A;  1EH3 A;  3W15 C;  4NTL A;  4F19 A;  2KR0 A;  3FUZ A;  1Z7N E;  3DP6 A;  2O68 A;  3MQ9 A;  4PFY A;  1RYO A;  3R7X A;  3K2D A;  1MY1 A;  4NE4 A;  1IMA A;  1US4 A;  4XF5 A;  4NF6 B;  4MEV A;  1N7W A;  5CC2 A;  4GX6 A;  1B6H A;  3UK4 A;  3H3G A;  2QS4 A;  1XI6 A;  3FXU A;  4KPT A;  1EZP A;  3K1P A; 
#chains in the Genus database with same CATH homology
 3G3K A;  3VLU A;  1A8E A;  1MY4 A;  2QRY A;  3S9N C;  3FVG A;  1D9V A;  1SYI A;  2QMX A;  1AIV A;  2REG A;  2V25 A;  4JSD A;  5FHN A;  1MQG A;  5I59 A;  1A55 A;  1SVX B;  1LB9 A;  2F7B A;  2VHA A;  4GD5 A;  5ICQ A;  3A09 A;  4KR5 A;  4R2B A;  3ODB A;  2IA4 A;  3PMW A;  1QKA A;  4U1O A;  3FAS A;  5AA2 B;  1DMB A;  2NUV A;  4FJP A;  4EQB A;  1B7U A;  4IGR A;  1ZLQ A;  3RQT A;  3IOR A;  3EQ1 A;  5KCJ B;  3E3K A;  1IEJ A;  3EHU A;  3K00 A;  3RGY A;  1I6B A;  3IJO B;  3PUX E;  3CFL A;  1DOT A;  1MQD A;  3A3C A;  4ONY A;  4GF8 A;  5H8Q B;  3BFT A;  1BIY A;  2G93 A;  3CG1 A;  1GVC A;  3VXB A;  3HV1 A;  2ZYN A;  4P0G A;  1LFH A;  1SW2 A;  3TCF A;  1Q35 A;  1ZU0 A;  3C34 A;  2Y7P A;  3QUF A;  3SEW A;  2Y84 A;  4KYS A;  1QW0 A;  1BKA A;  1B0H A;  2M8C A;  3MVZ A;  3TZA A;  3H6T A;  4TOZ A;  4BDR A;  3H7M A;  1PBP A;  3PPN A;  3TTL A;  2P1S A;  2ESN A;  2I4C A;  3MVX A;  4M4G A;  4RPN A;  3IOW A;  5H8F A;  5KCJ A;  3PU5 A;  3V83 A;  2VD3 A;  3KJ7 A;  1CE2 A;  1Y9U A;  2HEU A;  2H5Y A;  4IGT A;  1MH3 A;  1PDA A;  3FJM A;  4I9D A;  4RJZ A;  5CRY A;  3A3U A;  2VD2 A;  2PYY A;  4DXU A;  4GOT A;  4DXC A;  3IAZ A;  1UTB A;  3G7W A;  5L9O A;  1T0K A;  2XXQ A;  2P2A A;  4NF4 B;  1URD A;  1B32 A;  4ELO A;  5I58 B;  1LAH E;  3U72 A;  2V93 A;  2DXR A;  3PD9 A;  2I4B A;  2KLF A;  1ZBM A;  2ZNT A;  1Z7M E;  2A5T A;  5AA2 D;  1ZTY A;  1BP5 A;  1Y4T A;  3OO6 A;  3QXM A;  3VLW A;  3C9H A;  4R2F A;  1OVB A;  4IO2 A;  1FQA A;  4G68 B;  3EN3 A;  2H25 A;  1A54 A;  1FQD A;  1I6Q A;  1USY H;  1QJM A;  4BDQ A;  1SW5 A;  1NMU A;  2I0C A;  3FIR A;  3S4U A;  1SD3 A;  1IQ7 A;  1YCJ A;  5KDT B;  4GQO A;  1B3H A;  1S50 A;  4JB7 A;  2Q2C A;  4Z0I A;  3RNN A;  1ANF A;  4GFR A;  1MH4 A;  2DVZ A;  3ZSF A;  3D4C A;  1M5F A;  4E0X A;  2GFE A;  1M5C A;  4POW A;  3Q27 A;  4Q30 B;  1L5T A;  3CSB A;  3SER A;  1LGB C;  1USY E;  1D3K A;  3KOS A;  3MW0 A;  1XOC A;  1B1H A;  4ZEI A;  3G3F A;  3PMX A;  4R6Y A;  2V3Q A;  4KCD A;  1A40 A;  2HFB A;  3L6G A;  4FED A;  5I57 B;  5TP9 A;  1IXG A;  2QPQ A;  4LA9 A;  3PUV E;  4PFT A;  5JTY A;  3G3G A;  3VVD A;  2UYE A;  3OEN A;  4BDL A;  4EQ7 A;  1ZIU A;  4K3F A;  5CM6 A;  4YZZ A;  3VXC A;  1LBC A;  1UIV A;  4ESW A;  4WXJ A;  4O3B A;  2ALU A;  1LFI A;  3K1M A;  3O28 A;  4IO4 A;  5CI5 A;  4OXV A;  1VFD A;  3VVF A;  1H44 A;  1MXY A;  2I48 A;  1VR5 A;  5I2N B;  2OK2 A;  4LUB A;  2CZL A;  4ELQ A;  3VE1 B;  1LAF E;  4F3G A;  4KFQ A;  2AIX A;  1XVY A;  1QUI A;  1PB9 A;  1NNP A;  2F78 A;  4H5F A;  1P1U A;  4QFK A;  5DVF A;  1UQW A;  1Q1K A;  4PFW A;  5TU0 A;  1SW1 A;  3QK6 A;  3O9P A;  2Y7W A;  4DE8 A;  2LAO A;  3EPE A;  4F22 A;  1SI0 A;  3G3I A;  1JEV A;  2OJT A;  3OO9 A;  2ONK E;  3Q25 A;  4G8M A;  1NNT A;  5K2Y A;  4PE5 B;  3T9V A;  2PBW A;  3S2V A;  1ATG A;  2HAV A;  1FTO A;  1NL5 A;  3RN8 A;  4X1B A;  3OEM A;  5ISU A;  3I5O A;  3SES A;  3M8U A;  3E4R A;  4FEB A;  2DE2 A;  5L8D A;  2O84 X;  4ZS9 A;  2F5X A;  4RNS A;  1JQF A;  1DTZ A;  3OD7 A;  4LAT A;  5EHS A;  3ZKL A;  1MY2 A;  3BKI B;  3EF7 A;  1TT1 A;  4G4P A;  5EHM A;  4OFJ A;  3CG3 A;  1NH8 A;  1IZ1 A;  3HO7 A;  1XVX A;  3JV9 A;  4BDN A;  5HM4 B;  1Y1Z A;  3K02 A;  1MPD A;  1MY3 A;  3MC2 A;  5DVJ A;  2XX8 A;  4MH5 A;  4RPO A;  2OCU A;  3FVN A;  4AB5 A;  4F3B A;  2YPN A;  4RYA A;  4F1U A;  4O3A A;  3K01 A;  4IB2 A;  1FQB A;  3TTR A;  3SEV A;  3OSR A;  5JEI A;  2OWT A;  2DWA A;  3C36 A;  4U4X A;  3KN3 A;  3TCH A;  3LBS A;  3FJ7 A;  4OMB A;  3MZB A;  4OET A;  3E9X A;  1LFG A;  1A99 A;  1B5I A;  1LAG E;  2O1L A;  1GV8 A;  4ELR A;  2ANJ A;  2E0S A;  2ZYM A;  3IO6 A;  5ITP A;  4KYD A;  2QS1 A;  3IB0 A;  5F7V A;  1JVY A;  2F7A A;  3RLF E;  4NF5 B;  4EUO A;  2ZMB A;  3GBA A;  4N13 A;  3V5A A;  4Q8R A;  4GL8 A;  3I6V A;  2QSX A;  3HN0 A;  4ZEK A;  2A5S A;  2I6E A;  2AL4 A;  1MDQ A;  3CI8 A;  1LST A;  1B3L A;  2V3U A;  4WKM A;  4ELP A;  3N94 A;  4JXI A;  3K1N A;  3IB1 A;  3KZG A;  4QSE A;  3T9H B;  3K6U A;  4QF9 A;  3U93 A;  2D5W A;  3OO8 A;  3B6W A;  1B9J A;  4RA1 A;  1MXW A;  3MP6 A;  2PT2 A;  1POT A;  3B6Q A;  4OQO A;  1JW4 A;  1VSO A;  4YB5 A;  3SEY A;  2HXW A;  2ONS A;  1D4N A;  2QL3 A;  1Y20 A;  1YAE A;  4G2Z A;  1DPE A;  4YKI A;  5H8H A;  4JWX A;  3BBR A;  1PEB A;  3FD3 A;  3TMG A;  3UOR A;  3HST A;  1DTG A;  1JW1 A;  4OTE A;  2GH9 A;  2B3F A;  3FV2 A;  1B05 A;  1O7T A;  1F9B A;  2R6G E;  1Y3Q A;  2F34 A;  3MWB A;  3GXA A;  4ISU A;  4OVJ A;  3UN6 A;  5IAI A;  4XKN A;  3RTW B;  2PMS A;  2BJJ X;  1IXH A;  2RCB A;  2O1M A;  2FA7 A;  4KYE A;  2RCA A;  4OEU A;  3T9X B;  4ESX A;  3I3V A;  1QVS A;  4H8J A;  4F2O A;  3HHF A;  1FQC A;  1MPC A;  4H1X A;  2F36 A;  5I59 B;  1GR2 A;  3O6I A;  1LCT A;  4ZEB A;  1IUD A;  2Y7R A;  1OQG A;  3KG2 A;  3TYH A;  3TPA A;  2AL5 A;  4IO7 A;  4OYV A;  5FHM A;  4FIM A;  4FE8 A;  1IIW A;  1O63 A;  3O6H A;  1JW5 A;  1P99 A;  3O66 A;  3KEI A;  1S9T A;  4IY5 A;  4R6H A;  5I2K A;  3KFM A;  1B1X A;  3LSL A;  4OWD A;  1FQE A;  2ABH A;  2Q2A A;  2Z8E A;  4QRZ A;  2B65 A;  5AA3 A;  2DYX A;  2HZK A;  3TKD A;  4BLA A;  3O6G A;  2NXO A;  2X26 A;  2XX9 A;  3LC8 A;  2AYS A;  3K6X A;  3QUJ A;  1N76 A;  3T96 B;  4F1Y A;  5I2N A;  2NVU B;  5A5X A;  1HSE A;  5KZT A;  5H8Q A;  1QUK A;  1R9Q A;  1VE4 A;  2B3B A;  2F8D A;  2ZNU A;  4X48 A;  5H8F B;  4LP2 B;  3MUQ A;  4H8I A;  2UVJ A;  1MM6 A;  1QUL A;  1PC3 A;  4QSD A;  1FTM A;  4X9T A;  3OXN A;  3IL1 B;  5F1Q A;  4KI0 E;  2XXI A;  3O97 A;  3MJN A;  4RXL A;  4XKP A;  4EQ9 A;  4IO3 A;  4RY1 A;  5B70 A;  3SEX A;  2HCA A;  2YJP A;  2W7Y A;  3JYR A;  2HZL A;  2XXP A;  3TDJ A;  3CFZ A;  3TFL A;  4N07 A;  4U22 A;  2I58 A;  4ZZE A;  4IO6 A;  1BTJ A;  3L6H A;  4GXA A;  2A5T B;  3TTK A;  4AQ4 A;  5TP9 B;  5L9S A;  1CB6 A;  1UTH B;  1IIT A;  4PQJ A;  1Y3P A;  4LON B;  4QFO A;  2PVU A;  4G68 A;  2Q8J A;  5ELV A;  4MFI A;  3ILT B;  1FQF A;  4EDP A;  4P11 A;  1GGG A;  3TTM A;  3QYT A;  1XHY A;  1OIB A;  2XXU A;  2DQV A;  3C35 A;  5DEX A;  5L9M A;  2GRV A;  2XXX A;  2R9J A;  4F31 B;  2RC9 A;  2DSF A;  1B46 A;  2OBG A;  3RUM A;  5I58 A;  2VP1 A;  4GVO A;  4H5G A;  1LCF A;  4HCY A;  2F7C A;  2Z8D A;  4AB6 A;  1MQJ A;  4MLV A;  4F39 A;  4EF2 A;  1N84 A;  4QFL A;  3VLV A;  1RYX A;  3IK6 B;  3D4G A;  4O3C A;  3PD8 A;  3PV0 E;  2V3T A;  4IY6 A;  2YLN A;  4UAC A;  5I84 A;  1NH7 A;  2DOJ A;  5H8S A;  4C0R A;  5LOM A;  3EHT A;  5AA2 A;  3TAJ A;  3TEP A;  3ONM A;  3U94 A;  4ZEF A;  2RF1 A;  1OVT A;  4U2R A;  2THI A;  5H8H B;  1N3W A;  2D3I A;  4LVQ A;  3T22 A;  2Q89 A;  1MS7 A;  1MXX A;  1P1N A;  4OER A;  3OO7 A;  5TPA A;  5M2V A;  2HQ0 A;  1B3F A;  3TQL A;  2VGQ A;  5I57 A;  1B4Z A;  4R9G A;  1I69 A;  2VOZ A;  3B7D A;  3TOD A;  3T93 B;  4DCY A;  3G3H A;  4JSO A;  3P7I A;  3PMV A;  4OZ9 A;  5JK4 A;  2DP8 A;  1SDX A;  4L17 A;  3WAE A;  1US5 A;  4KCC A;  5BWJ A;  2H99 A;  2XXW A;  5DT6 A;  2Y7K A;  3VVE A;  1B7H A;  1SI1 A;  2Z22 A;  2XHD A;  3IO4 A;  3OEL A;  2ZYO A;  2XXH A;  3C4M A;  4I1D A;  1WDN A;  4KHZ E;  2Y7I A;  1DPP A;  1LLS A;  4E0W A;  3VFJ A;  2Z23 A;  3KJT A;  3SKP A;  1AL3 A;  3HCQ A;  1NNF A;  3QSL A;  1OMP A;  3IOT A;  4GIZ A;  5I56 A;  4NF6 A;  5CMM A;  3K6V A;  1AH5 A;  4G8H A;  3MVY A;  2H4I A;  5AA1 A;  3VDF A;  2R71 A;  4FAT A;  3M3L A;  4C1U A;  2DWJ A;  2DXY A;  1VFE A;  1I6A A;  4NED A;  4R74 A;  4YB7 A;  1B40 A;  1MG1 A;  1P1O A;  1Y1M A;  2GHB A;  3M3K A;  3MVW A;  4GXS B;  2I3W A;  3K0V A;  3H6W A;  4YIC A;  3RPW A;  3FXQ A;  3FVO A;  1S7Y A;  3S9E A;  2F97 A;  1IXC A;  4F2Q A;  4YAH X;  3T9U A;  1QKB A;  4ZE8 A;  5CBR A;  5KDT A;  1JEU A;  1POY 1;  4GL0 A;  3Q29 A;  5AA4 B;  1B0L A;  1XT8 A;  3LSF B;  4NF5 A;  4P0I A;  3IB2 A;  3KBR A;  3OOA A;  4R75 A;  3TQW A;  4R6K A;  2DWI A;  5FTH A;  3THI A;  4HW8 A;  3MPK A;  3PUY E;  4LZ5 A;  4R72 A;  4IO5 A;  4PET A;  1TFA A;  3OSQ A;  3PUW E;  2WKY A;  4GWO A;  1MXV A;  4KD5 A;  4U1Z A;  3K4U A;  3IJX B;  4C1T A;  3LSX A;  4Q0C A;  4QHQ A;  1B52 A;  1YTV A;  1B58 A;  2UYF A;  3M3F A;  4F3P A;  1M5B A;  4HTG A;  4GRK A;  4FAJ A;  3H06 B;  3ZS6 A;  2ZYK A;  3JZJ A;  4H6D A;  3U8Q A;  5DYH A;  1JET A;  3SEU A;  1D9Y A;  2DS9 A;  3W9V A;  1IXI A;  1SBP A;  1FW0 A;  4RK9 A;  3RY3 A;  3FAT A;  4UA8 A;  1M5E A;  1M5D A;  3DP8 A;  4NF8 B;  1FTJ A;  3KN8 A;  4XIG Q;  1UTB B;  3F11 A;  1B7Z A;  3FZV A;  4H65 A;  1JVX A;  5DEX B;  1AOV A;  4DCX A;  3E13 X;  5AE4 A;  2X7Q A;  1SYH A;  3CR9 A;  4G8N A;  4EF1 A;  3PPQ A;  1EZO A;  3LR1 A;  1SW4 A;  1B2H A;  4XKQ A;  1TFD A;  2XX7 A;  4XXU A;  3FJG A;  3N5L A;  3OEK A;  4ZEC A;  3O29 A;  1OLC A;  4R73 A;  3DM0 A;  1HSJ A;  4U4S A;  1R6Z A;  4FEC A;  5DTB A;  4JBZ A;  3RT8 A;  1FTL A;  4NF4 A;  2PX1 A;  2XXV A;  5AA4 A;  4I8C A;  1LBB A;  4THI A;  4RK2 A;  4YKK A;  3FVK A;  3GZG A;  2O51 A;  2NOO A;  3KSJ A;  3UGW A;  3W9W A;  4H0W A;  5H8N B;  1WVJ A;  2I3V A;  5CMK A;  3HPI A;  1H3D A;  1PBQ A;  1NKX A;  2O69 A;  2ZXT A;  3BFU A;  1B5H A;  3H03 A;  3QIM A;  4GLI A;  4G77 A;  4TLL B;  3RT6 B;  2XXY A;  4G68 C;  4YMB A;  5J1D A;  1ZKB A;  2QJE A;  2O7I A;  3GBB A;  3WAF A;  1XS5 A;  5K2X A;  3VV5 A;  4LQ5 A;  4YMA A;  4MF3 A;  4PFU A;  5A5X B;  1FCK A;  4TQU Q;  4JDF A;  4HS7 A;  4YKP A;  5BUU A;  2Z8F A;  4BDM A;  4DXB A;  1LB8 A;  1DSN A;  3ILU B;  4ZDM A;  2OWS A;  2Q9T A;  4U23 A;  4DLD A;  3V8X B;  4ECF A;  2O7U A;  1MXZ A;  3PPO A;  4OHN A;  4PP0 A;  4EXK A;  2QS2 A;  3O2A A;  1R1N A;  4HCW A;  4YU0 A;  2FYI A;  4OFO A;  3RTF B;  3S9L C;  2REJ A;  1P1W A;  2F35 A;  1MQI A;  2DWH A;  2UVI A;  2XXR A;  3MZ1 A;  1ZJL A;  5I2K B;  4Z7E A;  2ONR A;  3UA8 A;  2D21 A;  3N6U A;  4MLQ A;  3KN7 A;  1R9L A;  3MP8 A;  5B7D A;  1N0T A;  3R26 A;  1O64 A;  3B6T A;  3H4Z A;  2HAU A;  1B3G A;  4ZE9 A;  5CMB A;  1MXU A;  3V89 B;  1A7L A;  5HBC A;  1URS A;  1MDP 1;  2RC8 A;  3SDF A;  2GHA A;  2DVC A;  2OZZ A;  3AXF A;  3MAM A;  1LAX A;  1SQY A;  4Q5T A;  2F6P A;  4JWY A;  1OQH A;  1B5J A;  2RIN A;  2Q88 A;  4NMY A;  3LSW A;  3TUS A;  1EZ9 A;  1B3E A;  3C32 A;  3IOU A;  3ZKK A;  1H43 A;  3N26 A;  2NWJ A;  1GTK A;  3T66 A;  3Q28 A;  1YPN A;  4POX A;  4QFN A;  1MY0 A;  3CSG A;  4H67 A;  3KSX A;  3GLB A;  1JNF A;  2IEE A;  4I62 A;  1XC1 A;  1B4H A;  4YKJ A;  4DIG A;  3DLN A;  2H9B A;  5ITO A;  2UVG A;  1NNK A;  2G29 A;  2E1S A;  3PPR A;  2FNC A;  3EHS A;  1MPB A;  3LUY A;  5FTI A;  4BDO A;  3S9M C;  4YB6 A;  1N7X A;  2OLB A;  3CRB A;  1ELJ A;  2CMO A;  2H98 A;  2XD3 A;  5HPQ A;  5I56 B;  3PPP A;  5DVI A;  4XKR A;  3UP9 A;  1N04 A;  1ZMG A;  3TEL A;  4F29 A;  3ECR A;  3PUZ E;  3OMB A;  4N6P A;  3MPL A;  4JWO A;  2RC7 A;  3MBP A;  4FOR A;  4WED A;  2UXA A;  2UVH A;  3H6V A;  3IOV A;  2QMW A;  1UTH A;  3CIJ A;  5EYF A;  3TTN A;  1QUJ A;  4TLM B;  1PB8 A;  1II5 A;  4OEN A;  3HHG A;  4NWC A;  5FHO A;  4QSC A;  4M1V A;  4DZ1 A;  3FV1 A;  1RKM A;  1N3X A;  3C33 A;  3MP1 A;  1WOD A;  1MM7 A;  2RKM A;  4LZ7 A;  4F18 A;  1URG A;  4MBP A;  2V84 A;  5H8N A;  4F3S A;  3C31 A;  3DEL B;  3U1O A;  1FTK A;  1J1N A;  3IR1 A;  2DE4 A;  2DE3 A;  1A8F A;  3IX1 A;  1PB7 A;  3KOT A;  3MZ9 A;  4QFP A;  4XTC Q;  3CFX A;  1KWH A;  5CMC A;  3Q26 A;  4KQP A;  4OFL A;  1Y4C A;  3G3J A;  3N6T A;  1EH3 A;  2I49 A;  4DDD A;  3W15 C;  1P1Q A;  4OEV A;  4NTL A;  2X7P A;  1H76 A;  3FXR A;  2I0B A;  3DP4 A;  4EXL A;  4F19 A;  2O6A A;  3R6U A;  1TXF A;  2PT1 A;  4F1V A;  1AMF A;  2P0S A;  3FUZ A;  1Z7N E;  3DP6 A;  4U21 A;  1NFT A;  1Y3N A;  4X1D A;  1TWY A;  5TPA B;  5ICT A;  2O68 A;  3MQ9 A;  4PFY A;  3H6U A;  3TCG A;  1UIU A;  5IKB A;  3QAX A;  1RYO A;  1HSL A;  4NF8 A;  3R7X A;  2XXT A;  3K2D A;  1MY1 A;  4NE4 A;  1MQH A;  2QS3 A;  1US4 A;  3PGF A;  4R9F A;  4NWD A;  4NF6 B;  4ZZA A;  4ND9 A;  1BLF A;  3KGC A;  5JTY B;  1MRP A;  1H45 A;  3CVG A;  4OES A;  4WEP A;  2XD2 A;  1OLA A;  3UIF A;  1N7W A;  2F6G A;  4ZED A;  3SET A;  1B51 A;  2ZNS A;  3K6W A;  5CC2 A;  1B6H A;  4LZ8 A;  3UK4 A;  3H3G A;  2QS4 A;  3FXU A;  1EU8 A;  4KPT A;  5CBS A;  4LQ2 A;  3FGS A;  1EZP A;  3U92 A;  3K1P A;  3USD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...