1ATGA

Azotobacter vinelandii periplasmic molybdate-binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
231
structure length
231
Chain Sequence
b'ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYVLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMIC MOLYBDATE-BINDING PROTEIN
publication title Ligand size is a major determinant of specificity in periplasmic oxyanion-binding proteins: the 1.2 A resolution crystal structure of Azotobacter vinelandii ModA.
pubmed doi rcsb
molecule tags Binding protein
total genus 80
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA02
5DEXB 3TCFA 2I0CA 5DYHA 4TLLB 5I59A 2NOOA 2QL3A 1II5A 3ZKLA 3BFTA 1B1XA 2Q2AA 1BP5A 2Q9TA 4F19A 3HHFA 4F3SA 5AA3A 5I56B 1USYH 4GWOA 2M8CA 4NF5B 2RC9A 3KN7A 3G3HA 1KWHA 5CMBA 3VLWA 1PB7A 4OWDA 2ONSA 2Y7PA 4MBPA 1Q1KA 2I58A 3VVFA 5BWJA 2DYXA 4C1TA 1ATGA 4NWCA 2NWJA 2XXIA 1SW5A 3MVXA 4OETA 3GZGA 4GRKA 4I62A 5I58A 1Y4TA 2O68A 2GRVA 5EHMA 4TQUQ 2B3FA 3PUVE 4H65A 4YMAA 1US4A 4F39A 4RXLA 4WEDA 2NUVA 2O7UA 1N76A 4C0RA 3RNNA 3SDFA 3MP6A 5K2XA 3EHUA 2DXRA 1EZPA 5L8DA 3FXUA 5CRYA 5AA2D 2E0SA 3TEPA 1SI0A 1FQDA 3O97A 5A5XB 2KLFA 4IO5A 1AH5A 2UYEA 2F6PA 3G3FA 3IORA 3JYRA 1DTZA 3M3KA 1JETA 4R74A 3EHTA 4FECA 1JW5A 1B0HA 1D9VA 3UA8A 4FEBA 1I69A 3KGCA 3MPKA 4DLDA 4JWXA 3MP8A 1QKAA 4AB6A 2REGA 5H8NA 1MY1A 4OHNA 3FZVA 2I48A 1O64A 3R6UA 3RUMA 3TKDA 3H6VA 5DEXA 2V3QA 2V84A 4O3CA 1TT1A 5IAIA 1MG1A 1PDAA 4BDLA 3OENA 2DWHA 1DPEA 1JW1A 4WXJA 2H98A 4IY6A 4NF5A 4XKQA 2O84X 4KCDA 1IITA 3SKPA 4Z0IA 3CFXA 1LBCA 1DOTA 3MUQA 2Z23A 1ZMGA 4KYEA 3VE1B 3H6TA 5LOMA 1OMPA 1JVXA 1EZOA 4ZZAA 1IXHA 4KFQA 2G29A 5TP9B 3PMVA 4FEDA 3T66A 1R9QA 3FV2A 4DDDA 4RNSA 1MQHA 2RINA 4ZEIA 3DLNA 3O6HA 4PFTA 1Y20A 1QW0A 2Y7KA 4OYVA 3M3FA 1QVSA 3TPAA 4PFWA 4EXKA 4KD5A 4YKIA 4U4SA 4QFPA 5TPAB 3N5LA 2XXWA 1DSNA 4MLQA 4HW8A 3TTRA 3K00A 2F7CA 5I57B 3K0VA 5A5XA 1SQYA 3C34A 2P2AA 3O6GA 4X9TA 4IO7A 3MJNA 5L9MA 4EF1A 1T0KA 2QS1A 4MF3A 1OQGA 3QXMA 3KOTA 4NF8B 3M8UA 3CSBA 4YKPA 3FASA 2AL5A 4GVOA 2UVHA 4DZ1A 1WODA 4RK9A 3N26A 5DTBA 5IKBA 1US5A 1LFGA 3CI8A 3Q26A 3CR9A 1MXYA 3LR1A 3WAEA 4GFRA 3H03A 3TMGA 2GHAA 1A7LA 5F1QA 3U92A 4OTEA 4XKPA 3C9HA 4RY1A 1POTA 2DWAA 4IB2A 2FA7A 1MDQA 1SBPA 1NH7A 2XXUA 1B5IA 3E13X 1POY1 2X26A 1GGGA 3ILTB 3MP1A 3E9XA 2F7BA 3PUXE 1IZ1A 1N04A 2QS3A 3CSGA 4OZ9A 2ZXTA 3CG1A 3PU5A 1AIVA 2VP1A 4X48A 3FV1A 1P1OA 3DP6A 3TQWA 2F34A 2PX1A 4U1OA 4PFYA 4IY5A 3HV1A 4EXLA 3TCHA 1UQWA 4F3BA 5L9OA 2ANJA 4H67A 2I3VA 4U23A 3RTWB 3ZKKA 3K2DA 1TWYA 1MXWA 4DIGA 4TOZA 1IEJA 1Y9UA 1AL3A 4M4GA 3KSXA 4I9DA 4N07A 4QSCA 3PPNA 4JWYA 5TPAA 1OIBA 3KN8A 2F6GA 2PT1A 1B05A 3R26A 1FQFA 2H5YA 5I57A 5I58B 1QJMA 3I6VA 3OD7A 2PT2A 4RYAA 3O28A 1SYIA 1EU8A 4MH5A 1LFHA 4LONB 2HCAA 3RPWA 3Q28A 3Q25A 4NF8A 3S9MC 3RGYA 4H5FA 2P1SA 3IO6A 4POWA 4DE8A 3OO6A 3CVGA 3VXCA 1MQDA 4X1BA 2P0SA 1F9BA 4YKJA 3KN3A 2ZNSA 1M5CA 1D4NA 4HCYA 1NFTA 2XXHA 4RK2A 3U94A 4KR5A 3LUYA 4OVJA 4FIMA 2XX7A 4R6HA 3TTKA 1VFEA 1I6BA 1FTMA 3K6XA 4FAJA 5HPQA 2A5SA 1B32A 3IX1A 3TAJA 5BUUA 1MY3A 1P99A 1RYXA 1NL5A 2Q2CA 1P1NA 5DVJA 2OJTA 3B7DA 4FE8A 3LSLA 1MPCA 2OWTA 4ESXA 3TDJA 5JEIA 4OXVA 4NMYA 1LCFA 3VVEA 1ZIUA 5CMCA 4IO2A 1O7TA 1LAFE 1MS7A 2YJPA 3RT6B 3U8QA 3N6TA 1TXFA 3PD8A 4ZS9A 1OLCA 2AYSA 3VLUA 1N3XA 5B70A 4JB7A 2Y7WA 4GQOA 2X7QA 4PQJA 4YMBA 3DM0A 2FYIA 1Z7NE 5J1DA 2Z8DA 5EYFA 4YKKA 4HCWA 3QUFA 5H8FA 3UK4A 4F18A 1M5BA 3SEYA 2GHBA 4ECFA 1Y1ZA 3S4UA 1XT8A 4DXCA 4PP0A 4LP2B 3C35A 3IJOB 4U22A 4OFJA 3O2AA 1AOVA 4RJZA 2R9JA 2NVUB 2XX8A 2LAOA 2Z22A 3MW0A 1ANFA 1MXUA 2RCBA 3PUZE 4P11A 3MWBA 5CMKA 2DE4A 3SESA 5JK4A 3D4CA 3PMXA 1H43A 2D21A 5AA4B 2O1LA 4Q30B 1IQ7A 3VFJA 1L5TA 1LSTA 2V93A 3H3GA 1JEVA 3TZAA 4IO4A 2Q89A 1XVXA 1N7XA 1ELJA 1TFAA 3JZJA 1VSOA 5FHNA 3T9UA 1SW1A 5ELVA 4L17A 2HXWA 3K1MA 4U2RA 2XXPA 3HHGA 1IXCA 4KCCA 2V3UA 3MVWA 3KSJA 5FTIA 1OLAA 4K3FA 5I84A 4YB5A 3FXRA 1LFIA 3OELA 1QKBA 3OO8A 2O6AA 1JVYA 2OK2A 3U1OA 1GR2A 2F7AA 2HZLA 2F97A 2F5XA 3FJMA 1XS5A 1MY4A 2UYFA 4KHZE 1B2HA 1Y3NA 2UVGA 4R75A 2DXYA 3A09A 1BIYA 4F3GA 1IXGA 2VOZA 4F1VA 3IB2A 4JSOA 5AE4A 1MDP1 1GTKA 3RT8A 3EF7A 2ZYOA 3RTFB 3MZBA 4G8NA 5ITPA 4Q5TA 1ZBMA 3EQ1A 5KZTA 4JXIA 1NNKA 4O3BA 4LZ7A 4QFOA 3H6WA 1H44A 3W9VA 2THIA 4F2QA 2Y7RA 3G7WA 5AA2A 1JEUA 1LAXA 2NXOA 3K02A 1D3KA 1CB6A 3FJ7A 2AIXA 2F8DA 4TLMB 2ZYMA 3H7MA 3FVOA 3CFLA 1MQIA 1MRPA 4XXUA 1EZ9A 2OCUA 1R1NA 1S7YA 2PVUA 3OSQA 3JV9A 3OO7A 1QULA 3SEXA 3ECRA 1B4ZA 4I8CA 1YTVA 1LLSA 1Q35A 3FATA 2VGQA 5DVIA 4QF9A 3N6UA 1FTOA 4P0IA 4ELOA 1I6QA 1XOCA 2HAVA 2ZYKA 2GH9A 4DCYA 3IOVA 1AMFA 1Y3QA 3CG3A 3I3VA 3ODBA 4E0XA 1M5DA 5JTYB 4WEPA 4QFNA 4H8IA 5AA4A 3LBSA 3G3IA 2DWIA 4JSDA 4GLIA 2RCAA 2ALUA 1A54A 4ZZEA 2B3BA 3IOWA 1TFDA 4OESA 1FQCA 3K4UA 2HAUA 1M5EA 4ELQA 4XKRA 1P1UA 4E0WA 2QJEA 2UXAA 3RLFE 3QUJA 4GXAA 4F2OA 1MXXA 1NNFA 4ZEBA 3FXQA 2O1MA 2H4IA 3FJGA 2XX9A 4EQ9A 4F22A 4ZEDA 4POXA 2O7IA 1A8EA 3TTNA 2B65A 4ELRA 2DE3A 2QMXA 2QPQA 2QS4A 2HZKA 3FUZA 1URDA 2ONRA 4F1UA 5I2NB 5CMMA 3OEKA 3FIRA 4QFLA 3N94A 3W15C 4BLAA 1BKAA 3EHSA 2WKYA 3BKIB 1A55A 3O29A 3TUSA 3PD9A 3T96B 4GOTA 3HSTA 1MM7A 5CBSA 1N7WA 4OFLA 3WAFA 3KJTA 5CC2A 3THIA 5ISUA 2CMOA 4YAHX 1OVTA 3IO4A 4R2FA 2RC8A 4WKMA 3S2VA 3IR1A 4KPTA 4H8JA 3T9HB 3P7IA 5H8HB 3S9NC 2YLNA 5TU0A 3G3JA 4ZEKA 4AQ4A 3SERA 4KYSA 2GFEA 2VHAA 1H45A 4YICA 4GL8A 1YCJA 3TELA 4X1DA 3B6QA 4QSEA 1J1NA 1A8FA 4XTCQ 5JTYA 5H8FB 4I1DA 5CM6A 3QYTA 3GBAA 1LCTA 3H06B 3ONMA 1SD3A 3USDA 4BDOA 2E1SA 3EPEA 1B9JA 3G3KA 3OOAA 1MH3A 1LGBC 1PB9A 3IB1A 1UTBB 4IGRA 2DSFA 1YPNA 1MPDA 3PUYE 3V8XB 1FQBA 1P1WA 3TFLA 4IO6A 1B5HA 1WVJA 4ZEFA 5I2NA 1B7ZA 1B1HA 3UGWA 2IA4A 3S9LC 3H4ZA 1PBPA 1SW2A 2DQVA 3IJXB 2OZZA 2HEUA 3U93A 2I49A 3MZ1A 4M1VA 1MQJA 4OMBA 3CFZA 5HBCA 1M5FA 3R7XA 1S50A 4HTGA 3ZSFA 4NF4B 4G8HA 4EQ7A 3OEMA 4H6DA 4YU0A 4LATA 4THIA 4GD5A 1N0TA 4FATA 2XHDA 2G93A 1GVCA 3KZGA 3OMBA 5EHSA 1OVBA 2Q88A 5ITOA 3FVKA 3IB0A 4R9GA 3SEUA 2A5TA 3I5OA 4QHQA 2OLBA 2RC7A 5H8HA 1N84A 3RY3A 3U72A 4OFOA 1NNTA 3D4GA 1B0LA 1B46A 1CE2A 3MC2A 1BLFA 5ICQA 2Z8EA 2Z8FA 3S9EA 1UIUA 1B52A 1HSLA 5AA2B 1URSA 2F35A 1MPBA 3T93B 2Y7IA 4EUOA 3L6GA 5M2VA 3QAXA 5KDTB 4JWOA 2ZMBA 4LQ5A 3SEVA 2PBWA 5HM4B 1QUIA 1B3HA 4G77A 1B7HA 3K6VA 1YAEA 4KYDA 3OXNA 1MM6A 1NKXA 3MVZA 2QS2A 1LBBA 2ZNUA 1MH4A 4H0WA 2HQ0A 4N6PA 4MFIA 4LA9A 1B5JA 3PGFA 4Z7EA 2XXVA 1WDNA 3ILUB 3T22A 4U4XA 4AB5A 4NE4A 3O9PA 5FHOA 4EQBA 2DVZA 1FCKA 1UTBA 4LVQA 4R9FA 4F3PA 2H9BA 3MPLA 4NF6B 4Q0CA 3VLVA 1P1QA 4RPOA 3LC8A 2BJJX 4DCXA 3EN3A 4QSDA 3TYHA 1FQEA 2XXTA 2H99A 1ZLQA 3K1NA 1VFDA 3HPIA 3PMWA 3HN0A 3MQ9A 4NWDA 3UORA 3PPOA 3V83A 3TQLA 3UP9A 2I4CA 4NF4A 2R71A 1ZJLA 1SW4A 3F11A 4G8MA 3QIMA 5AA1A 3A3CA 3C4MA 1PC3A 4U1ZA 2DWJA 3L6HA 3FVGA 3G3GA 4U21A 2V3TA 2Y84A 3KJ7A 3Q29A 4P0GA 1MXZA 2DVCA 3IL1B 2I6EA 3VXBA 3FVNA 1XC1A 2XXXA 3PPPA 1IIWA 3LSXA 3VV5A 4NTLA 3TODA 3MAMA 4GL0A 4H1XA 3SETA 1FTJA 5H8QB 4BDQA 3KBRA 3LSFB 1XVYA 5KDTA 4GF8A 2IEEA 2DS9A 1ZU0A 3PV0E 2I4BA 4LZ5A 3K1PA 1VR5A 2H25A 5I56A 3IOUA 4F1YA 4R72A 2AL4A 3BBRA 2ZYNA 4HS7A 1A40A 5ICTA 4IO3A 2XD2A 2PYYA 1DPPA 1I6AA 3QK6A 1A99A 4KI0E 1B58A 1QUKA 3O6IA 1DTGA 4PETA 1ZTYA 3KEIA 1USYE 3DELB 1NMUA 4R6YA 3K6UA 3PUWE 1PBQA 4NF6A 5F7VA 4LUBA 2VD2A 4YZZA 3VVDA 3GXAA 3RQTA 1B3EA 3V5AA 3K01A 1LB8A 1R9LA 4ONYA 2O51A 1JNFA 3C31A 1B6HA 3C33A 3TCGA 1DMBA 1UTHB 1B3FA 4PFUA 4R6KA 2Q8JA 5H8SA 3SEWA 2V25A 1MXVA 3FD3A 4ZE8A 3A3UA 3ZS6A 4EDPA 1PB8A 3CRBA 4IGTA 3T9VA 3OO9A 2QRYA 2REJA 5DT6A 2OBGA 2DE2A 4UACA 1SI1A 4H5GA 2UVIA 1O63A 1S9TA 3UIFA 5I2KB 4G4PA 1MQGA 4KQPA 4G68B 1EH3A 5KCJB 1FTKA 2VD3A 1RKMA 3KG2A 3KOSA 4RPNA 3CIJA 3DP4A 5FHMA 3IAZA 1Z7ME 1XHYA 3RN8A 4DXUA 1H76A 4G68C 2YPNA 4C1UA 2ONKE 1B7UA 3VDFA 4OENA 1OQHA 5B7DA 2XXRA 3LSWA 5H8QA 4QRZA 2XXYA 4YB6A 3FGSA 4GIZA 2A5TB 2HFBA 4G2ZA 4OQOA 3C36A 3HO7A 4BDMA 1B40A 4JDFA 4PE5B 3UN6A 4ZECA 3TTMA 1JQFA 4XIGQ 4NEDA 1R6ZA 3BFUA 3GLBA 5I59B 1LB9A 2R6GE 1Y1MA 3B6WA 4ZE9A 5TP9A 2W7YA 1B4HA 1RYOA 4ISUA 2PMSA 4EF2A 3DP8A 4R73A 3V89B 3MBPA 4GXSB 1HSEA 1MY2A 1PEBA 3PPQA 4F31B 2ESNA 4MLVA 2I3WA 1QUJA 5K2YA 3H6UA 4BDNA 2RKMA 3IK6B 2DOJA 4DXBA 3OSRA 4FJPA 3W9WA 4LZ8A 3IOTA 2I0BA 4XKNA 1SDXA 3HCQA 2FNCA 1NNPA 2ZNTA 1UTHA 4OEVA 2QSXA 3Q27A 3AXFA 4ND9A 3E3KA 4FORA 4QFKA 3E4RA 3KFMA 5CBRA 1H3DA 2F78A 4ESWA 2DP8A 5FTHA 1IUDA 5L9SA 4N13A 4LQ2A 2D3IA 3MZ9A 4YB7A 3MVYA 4Q8RA 5I2KA 1SYHA 4R2BA 4G68A 1FW0A 3B6TA 5KCJA 4UA8A 1B3LA 3C32A 4OEUA 4RA1A 4ELPA 2OWSA 3TTLA 1FTLA 1VE4A 1Y3PA 3GBBA 1JW4A 1NH8A 2XD3A 3QSLA 3M3LA 1UIVA 4OERA 4ZDMA 5CI5A 1N3WA 2CZLA 1ZKBA 5DVFA 1MY0A 1LAHE 4O3AA 2O69A 1LAGE 1D9YA 1URGA 3K6WA 2F36A 2QMWA 3PPRA 3O66A 1B51A 1B3GA 1GV8A 4BDRA 4F29A 1BTJA 1HSJA 2XXQA 2RF1A 1Y4CA 2D5WA 1IXIA 5H8NB 1FQAA 4JBZA 3T9XB 1SVXB 2ABHA 2X7PA 2UVJA
chains in the Genus database with same CATH superfamily
5DEXB 3TCFA 2I0CA 3GYYA 5DYHA 4TLLB 5I59A 2NOOA 2QL3A 1II5A 3ZKLA 3BFTA 1B1XA 2Q2AA 1BP5A 4PFIA 2Q9TA 4F19A 3HHFA 1NUWA 1DBZA 4F3SA 5AA3A 5I56B 1USYH 4GWOA 2M8CA 4NF5B 2RC9A 3KN7A 3G3HA 4XEQA 4H46A 1KWHA 5CMBA 3VLWA 1PB7A 4OWDA 2ONSA 2Y7PA 4MBPA 4MNCA 1D9QA 5LDZA 1Q1KA 2I58A 3VVFA 5BWJA 2DYXA 4C1TA 1ATGA 4NWCA 1FPFA 2NWJA 2XXIA 1SW5A 2VT5A 3MVXA 4OETA 3GZGA 4GRKA 4I62A 5I58A 1G0HA 4MIJA 1Y4TA 2O68A 2GRVA 5EHMA 4I3EA 4TQUQ 2B3FA 3PUVE 5IZ1A 4H65A 4YMAA 1US4A 2BJIA 2V4CA 4F39A 4RXLA 4WEDA 2NUVA 2O7UA 1FBDA 1N76A 4C0RA 3RNNA 3SDFA 3MP6A 5K2XA 3EHUA 2DXRA 1EZPA 1VDWA 5L8DA 1NV0A 3FXUA 1NV7A 4N81A 5CRYA 4HE2A 5AA2D 5A5LA 2E0SA 3TEPA 1SI0A 1FQDA 4GWYA 3O97A 5A5XB 1YXIA 1IMAA 2KLFA 4IO5A 1AH5A 2UYEA 2F6PA 2VPNA 3G3FA 4P1EA 4GBVA 3IORA 3JYRA 1DTZA 3M3KA 1JETA 4R74A 3EHTA 4FECA 1JW5A 1FPIA 1B0HA 1D9VA 3UA8A 4FEBA 1I69A 1NV5A 3KGCA 3MPKA 4DLDA 4JWXA 3MP8A 1QKAA 2FVZA 1FRPA 4AB6A 2REGA 5H8NA 1MY1A 4OHNA 3FZVA 2I48A 1O64A 3R6UA 3RUMA 3TKDA 3H6VA 5DEXA 2V3QA 1NV3A 2V84A 4O3CA 1TT1A 4HXVA 5IAIA 1MG1A 2B4MA 1PDAA 4BDLA 4P8BA 3OENA 2DWHA 1DPEA 4N8YA 1JW1A 4WXJA 3A29A 1RDZA 2H98A 4IY6A 4NF5A 4XKQA 2O84X 4KCDA 4PC9A 1BK4A 1IITA 3SKPA 4Z0IA 3CFXA 4I3YA 4X04A 1LBCA 1DOTA 3MUQA 2Z23A 1ZMGA 4KYEA 1EYJA 3VE1B 3H6TA 5LOMA 1OMPA 4MAGA 1JVXA 1EZOA 4ZZAA 1IXHA 4P9KA 4KFQA 2G29A 4UABA 5TP9B 3PMVA 4FEDA 5IGAA 3T66A 1R9QA 3FV2A 2Q74A 4H45A 4RNSA 4DDDA 4GWUA 2HHMA 1MQHA 4NG7A 2RINA 4ZEIA 3DLNA 3O6HA 4PFTA 2ZZXA 4PFRA 1Y20A 1QW0A 2Y7KA 4OYVA 3M3FA 1QVSA 3TPAA 4PFWA 4KD5A 4YKIA 4EXKA 4AS4A 4U4SA 4QFPA 3B8BA 5TPAB 2XXKA 3N5LA 5I3SA 1FBHA 2XXWA 2HPGA 1DSNA 4MLQA 4P56A 4HW8A 3TTRA 3K00A 2F7CA 5I57B 1KZ8A 3K0VA 4O8MA 5A5XA 1SQYA 3C34A 2P2AA 3O6GA 4X9TA 4IO7A 3MJNA 5L9MA 4EF1A 1T0KA 2QS1A 4MF3A 1OQGA 3QXMA 3KOTA 4NF8B 3M8UA 3CSBA 4YKPA 3FASA 2AL5A 4GVOA 2UVHA 4DZ1A 1WODA 4P3LA 4RK9A 3N26A 5DTBA 5IKBA 5EYGA 1US5A 1LFGA 3CI8A 3Q26A 3CR9A 4JVDA 1MXYA 3LR1A 3WAEA 4GFRA 1DK4A 3H03A 3TMGA 2GHAA 1NI9A 1A7LA 5F1QA 5ET8A 3U92A 2QFLA 4OTEA 4XKPA 3C9HA 4RY1A 1POTA 2DWAA 4PF8A 4IB2A 2FA7A 1MDQA 1SBPA 1NH7A 2XXUA 1B5IA 3E13X 1POY1 2X26A 1GGGA 3ILTB 4MX6A 3MP1A 3E9XA 2F7BA 3PUXE 1IZ1A 1NUZA 1N04A 2QS3A 3CSGA 4OZ9A 1CNQA 2ZXTA 5ET7A 3CG1A 3PU5A 1AIVA 2VP1A 4X48A 3FV1A 1P1OA 3DP6A 3TQWA 2F34A 2PX1A 4U1OA 2F3DA 4PFYA 4IY5A 3HV1A 4EXLA 3TCHA 1UQWA 4F3BA 5L9OA 4NHBA 2ANJA 4H67A 2I3VA 4U23A 3RTWB 3ZKKA 3K2DA 1TWYA 1MXWA 4DIGA 4TOZA 1IEJA 1Y9UA 1AL3A 5ESYA 4M4GA 3KSXA 4I9DA 4N07A 4QSCA 3PPNA 4JWYA 5TPAA 1OIBA 3KN8A 2F6GA 4OVTA 2PT1A 1B05A 3R26A 1FQFA 2H5YA 5I57A 4GX6A 5I58B 1QJMA 3I6VA 3OD7A 2PT2A 4RYAA 3O28A 1SYIA 1EU8A 4MH5A 1LFHA 4LONB 2HCAA 3RPWA 4JVIA 3Q28A 3Q25A 4NF8A 3S9MC 2CZKA 3RGYA 4H5FA 2P1SA 2FIXA 3IO6A 4POWA 1NUXA 1FSAA 4DE8A 3OO6A 3CVGA 3VXCA 1MQDA 3PTYA 2P0SA 4IR8A 4X1BA 1F9BA 4YKJA 3KN3A 2ZNSA 1M5CA 1D4NA 4HCYA 1NFTA 2XXHA 4RK2A 3U94A 4KR5A 3LUYA 4OVJA 4GWSA 4FIMA 2XX7A 4R6HA 5EQAA 3TTKA 1VFEA 1I6BA 1FTMA 3K6XA 4FAJA 5HPQA 2A5SA 1B32A 3IX1A 3TAJA 1LBZA 5BUUA 1MY3A 1P99A 1RYXA 1NL5A 2Q2CA 1P1NA 3E78A 5DVJA 2OJTA 3B7DA 4FE8A 3LSLA 1MPCA 2OWTA 4ESXA 3TDJA 5JEIA 4OXVA 1Q9DA 4NMYA 1LCFA 3VVEA 1ZIUA 5CMCA 4IO2A 1O7TA 1LAFE 1MS7A 2YJPA 3RT6B 3U8QA 3N6TA 1TXFA 3PD8A 4ZS9A 2ZZWA 4PCDA 1OLCA 2AYSA 3VLUA 1N3XA 3LUZA 5B70A 1FBFA 4PBQA 4JB7A 2Y7WA 1YYZA 3LV0A 4NX1A 4GQOA 2XA5A 2X7QA 4PQJA 4HE0A 3DM0A 4YMBA 2FYIA 1Z7NE 5J1DA 2Z8DA 5EYFA 4YKKA 4HCWA 3QUFA 5H8FA 3UK4A 4F18A 4HE1A 1M5BA 2QVVA 4NF0A 3SEYA 2GHBA 4ECFA 1Y1ZA 3S4UA 1XT8A 4DXCA 1EYIA 4PP0A 4LP2B 3C35A 3IJOB 4U22A 4OFJA 3O2AA 1AOVA 4RJZA 3KC1A 2R9JA 1INPA 2NVUB 2XX8A 2LAOA 2Z22A 3MW0A 1ANFA 1MXUA 2RCBA 3PUZE 4P11A 3MWBA 5CMKA 2DE4A 3CHGA 3SESA 5JK4A 1FPBA 3D4CA 3PMXA 1H43A 2D21A 5AA4B 2O1LA 4Q30B 1IQ7A 3VFJA 1L5TA 1LSTA 2V93A 2ZZVA 3H3GA 1JEVA 3TZAA 4IO4A 4PDHA 2Q89A 1XVXA 1N7XA 1ELJA 5EYHA 1TFAA 3JZJA 1VSOA 5FHNA 3T9UA 1SW1A 4NN3A 5ELVA 4L17A 2HXWA 3K1MA 4U2RA 2XXPA 3HHGA 1IXCA 4KCCA 2V3UA 2HXRA 3MVWA 4PE3A 3KSJA 2L5VA 4MNIA 5FTIA 1OLAA 4K3FA 5I84A 3RYDA 4YB5A 3FXRA 1LFIA 3OELA 1QKBA 4PGNA 4QBAA 3OO8A 2O6AA 1JVYA 2OK2A 3U1OA 1GR2A 2F7AA 2HZLA 4PF6A 2F97A 5EQ8A 1FJ6A 2F5XA 1XS5A 3FJMA 1MY4A 2UYFA 4KHZE 1B2HA 1Y3NA 2UVGA 2WYKA 4R75A 2DXYA 3A09A 1BIYA 4F3GA 1IXGA 2VOZA 4F1VA 3IB2A 1FPGA 1QGXA 4JSOA 5AE4A 1MDP1 4PTKA 1GTKA 3RT8A 3EF7A 2MKZA 2ZYOA 3RTFB 3MZBA 4G8NA 4MNPA 5ITPA 4Q5TA 1ZBMA 3EQ1A 5KZTA 4JXIA 1NNKA 4O3BA 4LZ7A 4QFOA 3H6WA 1KA0A 1H44A 1EYKA 5EQ9A 3W9VA 2THIA 4F2QA 2Y7RA 3G7WA 5AA2A 5FBPA 4PAKA 2PCRA 1JEUA 1LAXA 2NXOA 3K02A 1D3KA 1CB6A 2XWVA 3FJ7A 2AIXA 2F8DA 4TLMB 2ZYMA 3H7MA 3FVOA 3CFLA 1MQIA 1MRPA 4XXUA 1EZ9A 2OCUA 1R1NA 1S7YA 2PVUA 3OSQA 3JV9A 3OO7A 1QULA 3SEXA 3ECRA 1B4ZA 4I8CA 1YTVA 1LLSA 1Q35A 3FATA 2VGQA 5DVIA 4QF9A 3N6UA 1FTOA 1FPEA 4P0IA 4ELOA 1I6QA 1XOCA 2HAVA 2ZYKA 1SPIA 2P3NA 2FHYA 2GH9A 4DCYA 3IOVA 1AMFA 1Y3QA 3CG3A 3I3VA 3ODBA 4E0XA 1M5DA 5JTYB 4WEPA 2CEYA 4QFNA 4H8IA 5AA4A 3LBSA 1NUYA 3G3IA 4OANA 2DWIA 4JSDA 4GLIA 2RCAA 1LBVA 2ALUA 1A54A 4ZZEA 2B3BA 3IOWA 1TFDA 4OESA 1FQCA 3K4UA 2HAUA 1M5EA 4ELQA 4XKRA 1P1UA 4E0WA 2QJEA 2UXAA 3RLFE 3QUJA 4GXAA 2WEFA 1DCUA 1MXXA 1NNFA 4ZEBA 4F2OA 5LTCA 3FXQA 2O1MA 2H4IA 3FJGA 2XX9A 4EQ9A 4F22A 4ZEDA 4POXA 2O7IA 1A8EA 3TTNA 2B65A 4ELRA 2DE3A 2QMXA 2QPQA 2QS4A 1G0IA 2HZKA 3FUZA 1URDA 2ONRA 4F1UA 5I2NB 5CMMA 3OEKA 3FIRA 4QFLA 5IZZA 3N94A 3W15C 4BLAA 1BKAA 3EHSA 2WKYA 3BKIB 1A55A 3O29A 3TUSA 3PD9A 3T96B 4GOTA 3HSTA 1MM7A 5CBSA 4I40A 1N7WA 4OFLA 3WAFA 3KJTA 5CC2A 3THIA 5ISUA 2CMOA 4YAHX 2FBPA 1OVTA 3IO4A 4R2FA 2RC8A 4AS5A 4WKMA 2JJKA 4P1LA 3S2VA 3IR1A 4KPTA 4H8JA 3T9HB 3P7IA 1FPLA 2Y5KA 5H8HB 1FBPA 3S9NC 2YLNA 5TU0A 1RDXA 3G3JA 4ZEKA 4AQ4A 1FBCA 3SERA 4KYSA 2GFEA 2VHAA 1H45A 4YICA 5EQ7A 4N17A 4GL8A 1YCJA 3TELA 4X1DA 3B6QA 4QSEA 1J1NA 1A8FA 4XTCQ 5JTYA 3NOHA 5H8FB 4I1DA 5CM6A 2PFYA 3QYTA 4PAIA 3GBAA 1LCTA 3H06B 3ONMA 1SD3A 3USDA 4BDOA 2E1SA 3EPEA 1B9JA 5ET6A 3G3KA 4MJOA 3OOAA 1MH3A 4N4UA 1LGBC 1PB9A 3IB1A 3KC0A 1FTAA 1UTBB 4IGRA 2DSFA 1YPNA 1JP4A 1MPDA 3PUYE 3V8XB 1FQBA 1P1WA 4OVQA 3TFLA 4IO6A 1B5HA 1WVJA 4ZEFA 5I2NA 1FPJA 1B7ZA 1B1HA 3UGWA 2IA4A 3S9LC 2KR0A 3H4ZA 1PBPA 1SW2A 2DQVA 3IJXB 2OZZA 2HEUA 3U93A 1RDYA 2I49A 3MZ1A 4M1VA 1MQJA 4OMBA 3CFZA 5HBCA 1M5FA 3R7XA 4LN5A 1S50A 4HTGA 3ZSFA 4PAFA 4NF4B 4G8HA 5F24A 4EQ7A 3OEMA 4H6DA 4YU0A 4OVSA 4LATA 4THIA 4O7IA 4OVPA 1LBXA 4GD5A 1N0TA 4FATA 2XHDA 5IM2A 2G93A 1GVCA 3KZGA 3OMBA 3B50A 5EHSA 3T1BA 1OVBA 2Q88A 5ITOA 3FVKA 3IB0A 4R9GA 3SEUA 1FBEA 2A5TA 3I5OA 4QHQA 2OLBA 2RC7A 5H8HA 1N84A 3RY3A 3U72A 4OFOA 1NNTA 3RPLB 3D4GA 1B0LA 1B46A 1CE2A 3MC2A 5I7IA 2WBBA 1BLFA 5ICQA 2Z8EA 2Z8FA 3S9EA 1IMBA 1UIUA 4PFBA 1B52A 1HSLA 5AA2B 1URSA 2F35A 1MPBA 3T93B 2Y7IA 4EUOA 3L6GA 5M2VA 3QAXA 5KDTB 4JWOA 1NV1A 2ZMBA 4OA4A 4LQ5A 3SEVA 2PBWA 5HM4B 1QUIA 1B3HA 3FBPA 4MEVA 4G77A 3T0JA 1B7HA 3K6VA 1YAEA 4KYDA 2CEXA 1LBYA 4PDDA 4MCOA 3OXNA 4GBWA 1MM6A 1NKXA 3MVZA 2OWZA 2QS2A 1LBBA 2ZNUA 1MH4A 4H0WA 2HQ0A 4N6PA 4MFIA 4LA9A 1B5JA 4X8RA 3PGFA 4Z7EA 2XXVA 1LBWA 1WDNA 3ILUB 3T22A 4U4XA 4AB5A 4NE4A 3O9PA 4MHFA 1FJ9A 2F3BA 5FHOA 4EQBA 4DI4B 2DVZA 1FCKA 4PGPA 1UTBA 4LVQA 4R9FA 4F3PA 2H9BA 3MPLA 4NF6B 4Q0CA 3VLVA 1P1QA 1AWBA 4RPOA 3LC8A 2BJJX 4DCXA 3EN3A 4QSDA 3TYHA 1FQEA 2XXTA 2H99A 1ZLQA 3K1NA 4PBHA 1VFDA 3HPIA 3PMWA 3HN0A 3IFCA 3MQ9A 1IMEA 4NWDA 3UORA 3PPOA 3V83A 3TQLA 3UP9A 2I4CA 4NF4A 2B4LA 2R71A 1ZJLA 4GWWA 2WBDA 1SW4A 3F11A 3KBZA 4G8MA 3QIMA 5AA1A 3A3CA 3C4MA 1PC3A 2R8TA 4U1ZA 2DWJA 3L6HA 3FVGA 3G3GA 4U21A 2V3TA 2Y84A 3KJ7A 3Q29A 4P0GA 1MXZA 2DVCA 2XWKA 3IL1B 2I6EA 3VXBA 3FVNA 1XC1A 3RPLA 2XXXA 3PPPA 2OX3A 1IIWA 3LSXA 3VV5A 4NTLA 3TODA 3MAMA 4GL0A 4H1XA 3SETA 4OVRA 1FTJA 5H8QB 4BDQA 3KBRA 3LSFB 1XVYA 3IFAA 5KDTA 3MYUA 1K9ZA 4GF8A 2IEEA 2VPOA 2DS9A 1ZU0A 3PV0E 2I4BA 4LZ5A 3K1PA 1VR5A 2H25A 4N8GA 5I56A 3IOUA 4F1YA 4R72A 2AL4A 3BBRA 2Y5LA 2ZYNA 4HS7A 1NV4A 4KXPA 1A40A 5ICTA 4IO3A 2XD2A 2PYYA 2FIEA 5DW8A 1DPPA 1I6AA 3QK6A 1A99A 4KI0E 1B58A 1QUKA 3O6IA 1DTGA 4PETA 1ZTYA 3KEIA 1USYE 3BIGA 3DELB 1NMUA 4R6YA 4QXDA 3K6UA 3PUWE 1NV2A 1PBQA 4NF6A 5F7VA 4LUBA 2VD2A 4YZZA 4DI3D 3VVDA 3GXAA 3RQTA 1B3EA 3V5AA 3K01A 1LB8A 1R9LA 4ONYA 2O51A 2DDKA 1JNFA 3C31A 1B6HA 4N91A 3C33A 3TCGA 1DMBA 1UTHB 1B3FA 2CZIA 2P3VA 4PFUA 4R6KA 2Q8JA 5H8SA 3SEWA 2V25A 2QVRA 1MXVA 3FD3A 4ZE8A 1IMDA 3A3UA 3HFUA 3MSTA 2QVUA 3ZS6A 4EDPA 2Q8MA 1PB8A 3CRBA 4IGTA 3T9VA 4O94A 3OO9A 2QRYA 2REJA 5I5PA 5DT6A 2OBGA 2DE2A 4UACA 1SI1A 4P47A 4H5GA 2UVIA 1O63A 1S9TA 3UIFA 5I2KB 1LEVA 4G4PA 1MQGA 1FPKA 4KQPA 4G68B 1EH3A 5KCJB 1FTKA 2VD3A 1RKMA 3KG2A 4FBPA 3KOSA 4RPNA 3CIJA 5ET5A 3SZPA 4N6KA 2CZHA 3DP4A 5FHMA 3IAZA 1Z7ME 1XHYA 3RN8A 4DXUA 1H76A 4G68C 4N6DA 2YPNA 4C1UA 2WYPA 2ONKE 1B7UA 4NGUA 3VDFA 4XF5A 4OENA 1OQHA 5B7DA 2XXRA 3LSWA 2WX9A 5H8QA 4QRZA 2XXYA 3ISPA 4XFEA 4YB6A 3FGSA 4GIZA 2A5TB 2HFBA 4G2ZA 4OQOA 3C36A 1FPDA 5IZ3B 3HO7A 4BDMA 1B40A 4JDFA 4PE5B 3UN6A 4ZECA 3D1RA 3TTMA 1JQFA 4MMPA 3U65A 4NQ8A 4XIGQ 4NAPA 4NEDA 1R6ZA 3EKIA 3BFUA 4O7MA 3GLBA 5I59B 1LB9A 2R6GE 1Y1MA 3B6WA 4ZE9A 5TP9A 2W7YA 1B4HA 1RYOA 4ISUA 2PMSA 4EF2A 3DP8A 4R73A 3V89B 3MBPA 4GXSB 1HSEA 1MY2A 1PEBA 5T3JA 3PPQA 2PFZA 4F31B 2ESNA 4MLVA 1XI6A 2I3WA 4G61A 1KA1A 1QUJA 5K2YA 3H6UA 4BDNA 2RKMA 3IK6B 2DOJA 4DXBA 4GX3A 3OSRA 4FJPA 3W9WA 4LZ8A 3IOTA 2I0BA 4XKNA 1SDXA 4GX4A 3HCQA 1IMCA 2FNCA 1NNPA 2ZNTA 1UTHA 4OEVA 2QSXA 3Q27A 3AXFA 4ND9A 3E3KA 4N15A 4FORA 4QFKA 3E4RA 3KFMA 5CBRA 1H3DA 2F78A 1IMFA 4ESWA 2DP8A 5FTHA 1IUDA 5L9SA 2XWOA 4N13A 4LQ2A 1NV6A 2D3IA 3BIHA 3MZ9A 4YB7A 1K9YA 3MVYA 4Q8RA 5I2KA 1SYHA 4R2BA 4G68A 1FW0A 3B6TA 3ROJA 5KCJA 4UA8A 1B3LA 3C32A 4OEUA 4RA1A 4ELPA 2GQ1A 2OWSA 3TTLA 4JVCA 1FTLA 1VE4A 1Y3PA 3GBBA 1JW4A 1NH8A 4GWZA 2XD3A 3QSLA 1FBGA 3M3LA 1UIVA 4OERA 4ZDMA 5J16A 5CI5A 1N3WA 2CZLA 1ZKBA 5DVFA 1MY0A 1LAHE 4O3AA 2O69A 1YZ0A 1LAGE 1D9YA 1URGA 2KQZA 3QMFA 3K6WA 2F36A 2QMWA 3PPRA 3O66A 1B51A 3E79A 1B3GA 1GV8A 5IZ3A 4BDRA 4F29A 4GWXA 1BTJA 1HSJA 2XXQA 2RF1A 1Y4CA 2D5WA 1IXIA 5H8NB 1FQAA 2XWIA 3FXBA 4JBZA 3T9XB 1SVXB 2ABHA 2X7PA 2UVJA
chains in the Genus database with same CATH topology
5DEXB 3TCFA 2I0CA 5DYHA 4TLLB 5I59A 2NOOA 2QL3A 1II5A 3ZKLA 3BFTA 1B1XA 2Q2AA 1BP5A 2Q9TA 4F19A 3HHFA 4F3SA 5AA3A 5I56B 1USYH 4GWOA 2M8CA 4NF5B 2RC9A 3KN7A 3G3HA 1KWHA 5CMBA 3VLWA 1PB7A 4OWDA 2ONSA 2Y7PA 4MBPA 1Q1KA 2I58A 3VVFA 5BWJA 2DYXA 4C1TA 1ATGA 4NWCA 2NWJA 2XXIA 1SW5A 3MVXA 4OETA 3GZGA 4GRKA 4I62A 5I58A 1Y4TA 2O68A 2GRVA 5EHMA 4TQUQ 2B3FA 3PUVE 4H65A 4YMAA 1US4A 4F39A 4RXLA 4WEDA 2NUVA 2O7UA 1N76A 4C0RA 3RNNA 3SDFA 3MP6A 5K2XA 3EHUA 2DXRA 1EZPA 5L8DA 3FXUA 5CRYA 5AA2D 2E0SA 3TEPA 1SI0A 1FQDA 3O97A 5A5XB 2KLFA 4IO5A 1AH5A 2UYEA 2F6PA 3G3FA 3IORA 3JYRA 1DTZA 3M3KA 1JETA 4R74A 3EHTA 4FECA 1JW5A 1B0HA 1D9VA 3UA8A 4FEBA 1I69A 3KGCA 3MPKA 4DLDA 4JWXA 3MP8A 1QKAA 4AB6A 2REGA 5H8NA 1MY1A 4OHNA 3FZVA 2I48A 1O64A 3R6UA 3RUMA 3TKDA 3H6VA 5DEXA 2V3QA 2V84A 4O3CA 1TT1A 5IAIA 1MG1A 1PDAA 4BDLA 3OENA 2DWHA 1DPEA 1JW1A 4WXJA 2H98A 4IY6A 4NF5A 4XKQA 2O84X 4KCDA 1IITA 3SKPA 4Z0IA 3CFXA 1LBCA 1DOTA 3MUQA 2Z23A 1ZMGA 4KYEA 3VE1B 3H6TA 5LOMA 1OMPA 1JVXA 1EZOA 4ZZAA 1IXHA 4KFQA 2G29A 5TP9B 3PMVA 4FEDA 3T66A 1R9QA 3FV2A 4DDDA 4RNSA 1MQHA 2RINA 4ZEIA 3DLNA 3O6HA 4PFTA 1Y20A 1QW0A 2Y7KA 4OYVA 3M3FA 1QVSA 3TPAA 4PFWA 4EXKA 4KD5A 4YKIA 4U4SA 4QFPA 5TPAB 3N5LA 2XXWA 1DSNA 4MLQA 4HW8A 3TTRA 3K00A 2F7CA 5I57B 3K0VA 5A5XA 1SQYA 3C34A 2P2AA 3O6GA 4X9TA 4IO7A 3MJNA 5L9MA 4EF1A 1T0KA 2QS1A 4MF3A 1OQGA 3QXMA 3KOTA 4NF8B 3M8UA 3CSBA 4YKPA 3FASA 2AL5A 4GVOA 2UVHA 4DZ1A 1WODA 4RK9A 3N26A 5DTBA 5IKBA 1US5A 1LFGA 3CI8A 3Q26A 3CR9A 1MXYA 3LR1A 3WAEA 4GFRA 3H03A 3TMGA 2GHAA 1A7LA 5F1QA 3U92A 4OTEA 4XKPA 3C9HA 4RY1A 1POTA 2DWAA 4IB2A 2FA7A 1MDQA 1SBPA 1NH7A 2XXUA 1B5IA 3E13X 1POY1 2X26A 1GGGA 3ILTB 3MP1A 3E9XA 2F7BA 3PUXE 1IZ1A 1N04A 2QS3A 3CSGA 4OZ9A 2ZXTA 3CG1A 3PU5A 1AIVA 2VP1A 4X48A 3FV1A 1P1OA 3DP6A 3TQWA 2F34A 2PX1A 4U1OA 4PFYA 4IY5A 3HV1A 4EXLA 3TCHA 1UQWA 4F3BA 5L9OA 2ANJA 4H67A 2I3VA 4U23A 3RTWB 3ZKKA 3K2DA 1TWYA 1MXWA 4DIGA 4TOZA 1IEJA 1Y9UA 1AL3A 4M4GA 3KSXA 4I9DA 4N07A 4QSCA 3PPNA 4JWYA 5TPAA 1OIBA 3KN8A 2F6GA 2PT1A 1B05A 3R26A 1FQFA 2H5YA 5I57A 5I58B 1QJMA 3I6VA 3OD7A 2PT2A 4RYAA 3O28A 1SYIA 1EU8A 4MH5A 1LFHA 4LONB 2HCAA 3RPWA 3Q28A 3Q25A 4NF8A 3S9MC 3RGYA 4H5FA 2P1SA 3IO6A 4POWA 4DE8A 3OO6A 3CVGA 3VXCA 1MQDA 4X1BA 2P0SA 1F9BA 4YKJA 3KN3A 2ZNSA 1M5CA 1D4NA 4HCYA 1NFTA 2XXHA 4RK2A 3U94A 4KR5A 3LUYA 4OVJA 4FIMA 2XX7A 4R6HA 3TTKA 1VFEA 1I6BA 1FTMA 3K6XA 4FAJA 5HPQA 2A5SA 1B32A 3IX1A 3TAJA 5BUUA 1MY3A 1P99A 1RYXA 1NL5A 2Q2CA 1P1NA 5DVJA 2OJTA 3B7DA 4FE8A 3LSLA 1MPCA 2OWTA 4ESXA 3TDJA 5JEIA 4OXVA 4NMYA 1LCFA 3VVEA 1ZIUA 5CMCA 4IO2A 1O7TA 1LAFE 1MS7A 2YJPA 3RT6B 3U8QA 3N6TA 1TXFA 3PD8A 4ZS9A 1OLCA 2AYSA 3VLUA 1N3XA 5B70A 4JB7A 2Y7WA 4GQOA 2X7QA 4PQJA 4YMBA 3DM0A 2FYIA 1Z7NE 5J1DA 2Z8DA 5EYFA 4YKKA 4HCWA 3QUFA 5H8FA 3UK4A 4F18A 1M5BA 3SEYA 2GHBA 4ECFA 1Y1ZA 3S4UA 1XT8A 4DXCA 4PP0A 4LP2B 3C35A 3IJOB 4U22A 4OFJA 3O2AA 1AOVA 4RJZA 2R9JA 2NVUB 2XX8A 2LAOA 2Z22A 3MW0A 1ANFA 1MXUA 2RCBA 3PUZE 4P11A 3MWBA 5CMKA 2DE4A 3SESA 5JK4A 3D4CA 3PMXA 1H43A 2D21A 5AA4B 2O1LA 4Q30B 1IQ7A 3VFJA 1L5TA 1LSTA 2V93A 3H3GA 1JEVA 3TZAA 4IO4A 2Q89A 1XVXA 1N7XA 1ELJA 1TFAA 3JZJA 1VSOA 5FHNA 3T9UA 1SW1A 5ELVA 4L17A 2HXWA 3K1MA 4U2RA 2XXPA 3HHGA 1IXCA 4KCCA 2V3UA 3MVWA 3KSJA 5FTIA 1OLAA 4K3FA 5I84A 4YB5A 3FXRA 1LFIA 3OELA 1QKBA 3OO8A 2O6AA 1JVYA 2OK2A 3U1OA 1GR2A 2F7AA 2HZLA 2F97A 2F5XA 3FJMA 1XS5A 1MY4A 2UYFA 4KHZE 1B2HA 1Y3NA 2UVGA 4R75A 2DXYA 3A09A 1BIYA 4F3GA 1IXGA 2VOZA 4F1VA 3IB2A 4JSOA 5AE4A 1MDP1 1GTKA 3RT8A 3EF7A 2ZYOA 3RTFB 3MZBA 4G8NA 5ITPA 4Q5TA 1ZBMA 3EQ1A 5KZTA 4JXIA 1NNKA 4O3BA 4LZ7A 4QFOA 3H6WA 1H44A 3W9VA 2THIA 4F2QA 2Y7RA 3G7WA 5AA2A 1JEUA 1LAXA 2NXOA 3K02A 1D3KA 1CB6A 3FJ7A 2AIXA 2F8DA 4TLMB 2ZYMA 3H7MA 3FVOA 3CFLA 1MQIA 1MRPA 4XXUA 1EZ9A 2OCUA 1R1NA 1S7YA 2PVUA 3OSQA 3JV9A 3OO7A 1QULA 3SEXA 3ECRA 1B4ZA 4I8CA 1YTVA 1LLSA 1Q35A 3FATA 2VGQA 5DVIA 4QF9A 3N6UA 1FTOA 4P0IA 4ELOA 1I6QA 1XOCA 2HAVA 2ZYKA 2GH9A 4DCYA 3IOVA 1AMFA 1Y3QA 3CG3A 3I3VA 3ODBA 4E0XA 1M5DA 5JTYB 4WEPA 4QFNA 4H8IA 5AA4A 3LBSA 3G3IA 2DWIA 4JSDA 4GLIA 2RCAA 2ALUA 1A54A 4ZZEA 2B3BA 3IOWA 1TFDA 4OESA 1FQCA 3K4UA 2HAUA 1M5EA 4ELQA 4XKRA 1P1UA 4E0WA 2QJEA 2UXAA 3RLFE 3QUJA 4GXAA 4F2OA 1MXXA 1NNFA 4ZEBA 3FXQA 2O1MA 2H4IA 3FJGA 2XX9A 4EQ9A 4F22A 4ZEDA 4POXA 2O7IA 1A8EA 3TTNA 2B65A 4ELRA 2DE3A 2QMXA 2QPQA 2QS4A 2HZKA 3FUZA 1URDA 2ONRA 4F1UA 5I2NB 5CMMA 3OEKA 3FIRA 4QFLA 3N94A 3W15C 4BLAA 1BKAA 3EHSA 2WKYA 3BKIB 1A55A 3O29A 3TUSA 3PD9A 3T96B 4GOTA 3HSTA 1MM7A 5CBSA 1N7WA 4OFLA 3WAFA 3KJTA 5CC2A 3THIA 5ISUA 2CMOA 4YAHX 1OVTA 3IO4A 4R2FA 2RC8A 4WKMA 3S2VA 3IR1A 4KPTA 4H8JA 3T9HB 3P7IA 5H8HB 3S9NC 2YLNA 5TU0A 3G3JA 4ZEKA 4AQ4A 3SERA 4KYSA 2GFEA 2VHAA 1H45A 4YICA 4GL8A 1YCJA 3TELA 4X1DA 3B6QA 4QSEA 1J1NA 1A8FA 4XTCQ 5JTYA 5H8FB 4I1DA 5CM6A 3QYTA 3GBAA 1LCTA 3H06B 3ONMA 1SD3A 3USDA 4BDOA 2E1SA 3EPEA 1B9JA 3G3KA 3OOAA 1MH3A 1LGBC 1PB9A 3IB1A 1UTBB 4IGRA 2DSFA 1YPNA 1MPDA 3PUYE 3V8XB 1FQBA 1P1WA 3TFLA 4IO6A 1B5HA 1WVJA 4ZEFA 5I2NA 1B7ZA 1B1HA 3UGWA 2IA4A 3S9LC 3H4ZA 1PBPA 1SW2A 2DQVA 3IJXB 2OZZA 2HEUA 3U93A 2I49A 3MZ1A 4M1VA 1MQJA 4OMBA 3CFZA 5HBCA 1M5FA 3R7XA 1S50A 4HTGA 3ZSFA 4NF4B 4G8HA 4EQ7A 3OEMA 4H6DA 4YU0A 4LATA 4THIA 4GD5A 1N0TA 4FATA 2XHDA 2G93A 1GVCA 3KZGA 3OMBA 5EHSA 1OVBA 2Q88A 5ITOA 3FVKA 3IB0A 4R9GA 3SEUA 2A5TA 3I5OA 4QHQA 2OLBA 2RC7A 5H8HA 1N84A 3RY3A 3U72A 4OFOA 1NNTA 3D4GA 1B0LA 1B46A 1CE2A 3MC2A 1BLFA 5ICQA 2Z8EA 2Z8FA 3S9EA 1UIUA 1B52A 1HSLA 5AA2B 1URSA 2F35A 1MPBA 3T93B 2Y7IA 4EUOA 3L6GA 5M2VA 3QAXA 5KDTB 4JWOA 2ZMBA 4LQ5A 3SEVA 2PBWA 5HM4B 1QUIA 1B3HA 4G77A 1B7HA 3K6VA 1YAEA 4KYDA 3OXNA 1MM6A 1NKXA 3MVZA 2QS2A 1LBBA 2ZNUA 1MH4A 4H0WA 2HQ0A 4N6PA 4MFIA 4LA9A 1B5JA 3PGFA 4Z7EA 2XXVA 1WDNA 3ILUB 3T22A 4U4XA 4AB5A 4NE4A 3O9PA 5FHOA 4EQBA 2DVZA 1FCKA 1UTBA 4LVQA 4R9FA 4F3PA 2H9BA 3MPLA 4NF6B 4Q0CA 3VLVA 1P1QA 4RPOA 3LC8A 2BJJX 4DCXA 3EN3A 4QSDA 3TYHA 1FQEA 2XXTA 2H99A 1ZLQA 3K1NA 1VFDA 3HPIA 3PMWA 3HN0A 3MQ9A 4NWDA 3UORA 3PPOA 3V83A 3TQLA 3UP9A 2I4CA 4NF4A 2R71A 1ZJLA 1SW4A 3F11A 4G8MA 3QIMA 5AA1A 3A3CA 3C4MA 1PC3A 4U1ZA 2DWJA 3L6HA 3FVGA 3G3GA 4U21A 2V3TA 2Y84A 3KJ7A 3Q29A 4P0GA 1MXZA 2DVCA 3IL1B 2I6EA 3VXBA 3FVNA 1XC1A 2XXXA 3PPPA 1IIWA 3LSXA 3VV5A 4NTLA 3TODA 3MAMA 4GL0A 4H1XA 3SETA 1FTJA 5H8QB 4BDQA 3KBRA 3LSFB 1XVYA 5KDTA 4GF8A 2IEEA 2DS9A 1ZU0A 3PV0E 2I4BA 4LZ5A 3K1PA 1VR5A 2H25A 5I56A 3IOUA 4F1YA 4R72A 2AL4A 3BBRA 2ZYNA 4HS7A 1A40A 5ICTA 4IO3A 2XD2A 2PYYA 1DPPA 1I6AA 3QK6A 1A99A 4KI0E 1B58A 1QUKA 3O6IA 1DTGA 4PETA 1ZTYA 3KEIA 1USYE 3DELB 1NMUA 4R6YA 3K6UA 3PUWE 1PBQA 4NF6A 5F7VA 4LUBA 2VD2A 4YZZA 3VVDA 3GXAA 3RQTA 1B3EA 3V5AA 3K01A 1LB8A 1R9LA 4ONYA 2O51A 1JNFA 3C31A 1B6HA 3C33A 3TCGA 1DMBA 1UTHB 1B3FA 4PFUA 4R6KA 2Q8JA 5H8SA 3SEWA 2V25A 1MXVA 3FD3A 4ZE8A 3A3UA 3ZS6A 4EDPA 1PB8A 3CRBA 4IGTA 3T9VA 3OO9A 2QRYA 2REJA 5DT6A 2OBGA 2DE2A 4UACA 1SI1A 4H5GA 2UVIA 1O63A 1S9TA 3UIFA 5I2KB 4G4PA 1MQGA 4KQPA 4G68B 1EH3A 5KCJB 1FTKA 2VD3A 1RKMA 3KG2A 3KOSA 4RPNA 3CIJA 3DP4A 5FHMA 3IAZA 1Z7ME 1XHYA 3RN8A 4DXUA 1H76A 4G68C 2YPNA 4C1UA 2ONKE 1B7UA 3VDFA 4OENA 1OQHA 5B7DA 2XXRA 3LSWA 5H8QA 4QRZA 2XXYA 4YB6A 3FGSA 4GIZA 2A5TB 2HFBA 4G2ZA 4OQOA 3C36A 3HO7A 4BDMA 1B40A 4JDFA 4PE5B 3UN6A 4ZECA 3TTMA 1JQFA 4XIGQ 4NEDA 1R6ZA 3BFUA 3GLBA 5I59B 1LB9A 2R6GE 1Y1MA 3B6WA 4ZE9A 5TP9A 2W7YA 1B4HA 1RYOA 4ISUA 2PMSA 4EF2A 3DP8A 4R73A 3V89B 3MBPA 4GXSB 1HSEA 1MY2A 1PEBA 3PPQA 4F31B 2ESNA 4MLVA 2I3WA 1QUJA 5K2YA 3H6UA 4BDNA 2RKMA 3IK6B 2DOJA 4DXBA 3OSRA 4FJPA 3W9WA 4LZ8A 3IOTA 2I0BA 4XKNA 1SDXA 3HCQA 2FNCA 1NNPA 2ZNTA 1UTHA 4OEVA 2QSXA 3Q27A 3AXFA 4ND9A 3E3KA 4FORA 4QFKA 3E4RA 3KFMA 5CBRA 1H3DA 2F78A 4ESWA 2DP8A 5FTHA 1IUDA 5L9SA 4N13A 4LQ2A 2D3IA 3MZ9A 4YB7A 3MVYA 4Q8RA 5I2KA 1SYHA 4R2BA 4G68A 1FW0A 3B6TA 5KCJA 4UA8A 1B3LA 3C32A 4OEUA 4RA1A 4ELPA 2OWSA 3TTLA 1FTLA 1VE4A 1Y3PA 3GBBA 1JW4A 1NH8A 2XD3A 3QSLA 3M3LA 1UIVA 4OERA 4ZDMA 5CI5A 1N3WA 2CZLA 1ZKBA 5DVFA 1MY0A 1LAHE 4O3AA 2O69A 1LAGE 1D9YA 1URGA 3K6WA 2F36A 2QMWA 3PPRA 3O66A 1B51A 1B3GA 1GV8A 4BDRA 4F29A 1BTJA 1HSJA 2XXQA 2RF1A 1Y4CA 2D5WA 1IXIA 5H8NB 1FQAA 4JBZA 3T9XB 1SVXB 2ABHA 2X7PA 2UVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEX B;  3TCF A;  2I0C A;  5DYH A;  4TLL B;  5I59 A;  2NOO A;  2QL3 A;  1II5 A;  3ZKL A;  3BFT A;  1B1X A;  2Q2A A;  1BP5 A;  2Q9T A;  4F19 A;  3HHF A;  4F3S A;  5AA3 A;  5I56 B;  1USY H;  4GWO A;  2M8C A;  4NF5 B;  2RC9 A;  3KN7 A;  3G3H A;  1KWH A;  5CMB A;  3VLW A;  1PB7 A;  4OWD A;  2ONS A;  2Y7P A;  4MBP A;  1Q1K A;  2I58 A;  3VVF A;  5BWJ A;  2DYX A;  4C1T A;  1ATG A;  4NWC A;  2NWJ A;  2XXI A;  1SW5 A;  3MVX A;  4OET A;  3GZG A;  4GRK A;  4I62 A;  5I58 A;  1Y4T A;  2O68 A;  2GRV A;  5EHM A;  4TQU Q;  2B3F A;  3PUV E;  4H65 A;  4YMA A;  1US4 A;  4F39 A;  4RXL A;  4WED A;  2NUV A;  2O7U A;  1N76 A;  4C0R A;  3RNN A;  3SDF A;  3MP6 A;  5K2X A;  3EHU A;  2DXR A;  1EZP A;  5L8D A;  3FXU A;  5CRY A;  5AA2 D;  2E0S A;  3TEP A;  1SI0 A;  1FQD A;  3O97 A;  5A5X B;  2KLF A;  4IO5 A;  1AH5 A;  2UYE A;  2F6P A;  3G3F A;  3IOR A;  3JYR A;  1DTZ A;  3M3K A;  1JET A;  4R74 A;  3EHT A;  4FEC A;  1JW5 A;  1B0H A;  1D9V A;  3UA8 A;  4FEB A;  1I69 A;  3KGC A;  3MPK A;  4DLD A;  4JWX A;  3MP8 A;  1QKA A;  4AB6 A;  2REG A;  5H8N A;  1MY1 A;  4OHN A;  3FZV A;  2I48 A;  1O64 A;  3R6U A;  3RUM A;  3TKD A;  3H6V A;  5DEX A;  2V3Q A;  2V84 A;  4O3C A;  1TT1 A;  5IAI A;  1MG1 A;  1PDA A;  4BDL A;  3OEN A;  2DWH A;  1DPE A;  1JW1 A;  4WXJ A;  2H98 A;  4IY6 A;  4NF5 A;  4XKQ A;  2O84 X;  4KCD A;  1IIT A;  3SKP A;  4Z0I A;  3CFX A;  1LBC A;  1DOT A;  3MUQ A;  2Z23 A;  1ZMG A;  4KYE A;  3VE1 B;  3H6T A;  5LOM A;  1OMP A;  1JVX A;  1EZO A;  4ZZA A;  1IXH A;  4KFQ A;  2G29 A;  5TP9 B;  3PMV A;  4FED A;  3T66 A;  1R9Q A;  3FV2 A;  4DDD A;  4RNS A;  1MQH A;  2RIN A;  4ZEI A;  3DLN A;  3O6H A;  4PFT A;  1Y20 A;  1QW0 A;  2Y7K A;  4OYV A;  3M3F A;  1QVS A;  3TPA A;  4PFW A;  4EXK A;  4KD5 A;  4YKI A;  4U4S A;  4QFP A;  5TPA B;  3N5L A;  2XXW A;  1DSN A;  4MLQ A;  4HW8 A;  3TTR A;  3K00 A;  2F7C A;  5I57 B;  3K0V A;  5A5X A;  1SQY A;  3C34 A;  2P2A A;  3O6G A;  4X9T A;  4IO7 A;  3MJN A;  5L9M A;  4EF1 A;  1T0K A;  2QS1 A;  4MF3 A;  1OQG A;  3QXM A;  3KOT A;  4NF8 B;  3M8U A;  3CSB A;  4YKP A;  3FAS A;  2AL5 A;  4GVO A;  2UVH A;  4DZ1 A;  1WOD A;  4RK9 A;  3N26 A;  5DTB A;  5IKB A;  1US5 A;  1LFG A;  3CI8 A;  3Q26 A;  3CR9 A;  1MXY A;  3LR1 A;  3WAE A;  4GFR A;  3H03 A;  3TMG A;  2GHA A;  1A7L A;  5F1Q A;  3U92 A;  4OTE A;  4XKP A;  3C9H A;  4RY1 A;  1POT A;  2DWA A;  4IB2 A;  2FA7 A;  1MDQ A;  1SBP A;  1NH7 A;  2XXU A;  1B5I A;  3E13 X;  1POY 1;  2X26 A;  1GGG A;  3ILT B;  3MP1 A;  3E9X A;  2F7B A;  3PUX E;  1IZ1 A;  1N04 A;  2QS3 A;  3CSG A;  4OZ9 A;  2ZXT A;  3CG1 A;  3PU5 A;  1AIV A;  2VP1 A;  4X48 A;  3FV1 A;  1P1O A;  3DP6 A;  3TQW A;  2F34 A;  2PX1 A;  4U1O A;  4PFY A;  4IY5 A;  3HV1 A;  4EXL A;  3TCH A;  1UQW A;  4F3B A;  5L9O A;  2ANJ A;  4H67 A;  2I3V A;  4U23 A;  3RTW B;  3ZKK A;  3K2D A;  1TWY A;  1MXW A;  4DIG A;  4TOZ A;  1IEJ A;  1Y9U A;  1AL3 A;  4M4G A;  3KSX A;  4I9D A;  4N07 A;  4QSC A;  3PPN A;  4JWY A;  5TPA A;  1OIB A;  3KN8 A;  2F6G A;  2PT1 A;  1B05 A;  3R26 A;  1FQF A;  2H5Y A;  5I57 A;  5I58 B;  1QJM A;  3I6V A;  3OD7 A;  2PT2 A;  4RYA A;  3O28 A;  1SYI A;  1EU8 A;  4MH5 A;  1LFH A;  4LON B;  2HCA A;  3RPW A;  3Q28 A;  3Q25 A;  4NF8 A;  3S9M C;  3RGY A;  4H5F A;  2P1S A;  3IO6 A;  4POW A;  4DE8 A;  3OO6 A;  3CVG A;  3VXC A;  1MQD A;  4X1B A;  2P0S A;  1F9B A;  4YKJ A;  3KN3 A;  2ZNS A;  1M5C A;  1D4N A;  4HCY A;  1NFT A;  2XXH A;  4RK2 A;  3U94 A;  4KR5 A;  3LUY A;  4OVJ A;  4FIM A;  2XX7 A;  4R6H A;  3TTK A;  1VFE A;  1I6B A;  1FTM A;  3K6X A;  4FAJ A;  5HPQ A;  2A5S A;  1B32 A;  3IX1 A;  3TAJ A;  5BUU A;  1MY3 A;  1P99 A;  1RYX A;  1NL5 A;  2Q2C A;  1P1N A;  5DVJ A;  2OJT A;  3B7D A;  4FE8 A;  3LSL A;  1MPC A;  2OWT A;  4ESX A;  3TDJ A;  5JEI A;  4OXV A;  4NMY A;  1LCF A;  3VVE A;  1ZIU A;  5CMC A;  4IO2 A;  1O7T A;  1LAF E;  1MS7 A;  2YJP A;  3RT6 B;  3U8Q A;  3N6T A;  1TXF A;  3PD8 A;  4ZS9 A;  1OLC A;  2AYS A;  3VLU A;  1N3X A;  5B70 A;  4JB7 A;  2Y7W A;  4GQO A;  2X7Q A;  4PQJ A;  4YMB A;  3DM0 A;  2FYI A;  1Z7N E;  5J1D A;  2Z8D A;  5EYF A;  4YKK A;  4HCW A;  3QUF A;  5H8F A;  3UK4 A;  4F18 A;  1M5B A;  3SEY A;  2GHB A;  4ECF A;  1Y1Z A;  3S4U A;  1XT8 A;  4DXC A;  4PP0 A;  4LP2 B;  3C35 A;  3IJO B;  4U22 A;  4OFJ A;  3O2A A;  1AOV A;  4RJZ A;  2R9J A;  2NVU B;  2XX8 A;  2LAO A;  2Z22 A;  3MW0 A;  1ANF A;  1MXU A;  2RCB A;  3PUZ E;  4P11 A;  3MWB A;  5CMK A;  2DE4 A;  3SES A;  5JK4 A;  3D4C A;  3PMX A;  1H43 A;  2D21 A;  5AA4 B;  2O1L A;  4Q30 B;  1IQ7 A;  3VFJ A;  1L5T A;  1LST A;  2V93 A;  3H3G A;  1JEV A;  3TZA A;  4IO4 A;  2Q89 A;  1XVX A;  1N7X A;  1ELJ A;  1TFA A;  3JZJ A;  1VSO A;  5FHN A;  3T9U A;  1SW1 A;  5ELV A;  4L17 A;  2HXW A;  3K1M A;  4U2R A;  2XXP A;  3HHG A;  1IXC A;  4KCC A;  2V3U A;  3MVW A;  3KSJ A;  5FTI A;  1OLA A;  4K3F A;  5I84 A;  4YB5 A;  3FXR A;  1LFI A;  3OEL A;  1QKB A;  3OO8 A;  2O6A A;  1JVY A;  2OK2 A;  3U1O A;  1GR2 A;  2F7A A;  2HZL A;  2F97 A;  2F5X A;  3FJM A;  1XS5 A;  1MY4 A;  2UYF A;  4KHZ E;  1B2H A;  1Y3N A;  2UVG A;  4R75 A;  2DXY A;  3A09 A;  1BIY A;  4F3G A;  1IXG A;  2VOZ A;  4F1V A;  3IB2 A;  4JSO A;  5AE4 A;  1MDP 1;  1GTK A;  3RT8 A;  3EF7 A;  2ZYO A;  3RTF B;  3MZB A;  4G8N A;  5ITP A;  4Q5T A;  1ZBM A;  3EQ1 A;  5KZT A;  4JXI A;  1NNK A;  4O3B A;  4LZ7 A;  4QFO A;  3H6W A;  1H44 A;  3W9V A;  2THI A;  4F2Q A;  2Y7R A;  3G7W A;  5AA2 A;  1JEU A;  1LAX A;  2NXO A;  3K02 A;  1D3K A;  1CB6 A;  3FJ7 A;  2AIX A;  2F8D A;  4TLM B;  2ZYM A;  3H7M A;  3FVO A;  3CFL A;  1MQI A;  1MRP A;  4XXU A;  1EZ9 A;  2OCU A;  1R1N A;  1S7Y A;  2PVU A;  3OSQ A;  3JV9 A;  3OO7 A;  1QUL A;  3SEX A;  3ECR A;  1B4Z A;  4I8C A;  1YTV A;  1LLS A;  1Q35 A;  3FAT A;  2VGQ A;  5DVI A;  4QF9 A;  3N6U A;  1FTO A;  4P0I A;  4ELO A;  1I6Q A;  1XOC A;  2HAV A;  2ZYK A;  2GH9 A;  4DCY A;  3IOV A;  1AMF A;  1Y3Q A;  3CG3 A;  3I3V A;  3ODB A;  4E0X A;  1M5D A;  5JTY B;  4WEP A;  4QFN A;  4H8I A;  5AA4 A;  3LBS A;  3G3I A;  2DWI A;  4JSD A;  4GLI A;  2RCA A;  2ALU A;  1A54 A;  4ZZE A;  2B3B A;  3IOW A;  1TFD A;  4OES A;  1FQC A;  3K4U A;  2HAU A;  1M5E A;  4ELQ A;  4XKR A;  1P1U A;  4E0W A;  2QJE A;  2UXA A;  3RLF E;  3QUJ A;  4GXA A;  4F2O A;  1MXX A;  1NNF A;  4ZEB A;  3FXQ A;  2O1M A;  2H4I A;  3FJG A;  2XX9 A;  4EQ9 A;  4F22 A;  4ZED A;  4POX A;  2O7I A;  1A8E A;  3TTN A;  2B65 A;  4ELR A;  2DE3 A;  2QMX A;  2QPQ A;  2QS4 A;  2HZK A;  3FUZ A;  1URD A;  2ONR A;  4F1U A;  5I2N B;  5CMM A;  3OEK A;  3FIR A;  4QFL A;  3N94 A;  3W15 C;  4BLA A;  1BKA A;  3EHS A;  2WKY A;  3BKI B;  1A55 A;  3O29 A;  3TUS A;  3PD9 A;  3T96 B;  4GOT A;  3HST A;  1MM7 A;  5CBS A;  1N7W A;  4OFL A;  3WAF A;  3KJT A;  5CC2 A;  3THI A;  5ISU A;  2CMO A;  4YAH X;  1OVT A;  3IO4 A;  4R2F A;  2RC8 A;  4WKM A;  3S2V A;  3IR1 A;  4KPT A;  4H8J A;  3T9H B;  3P7I A;  5H8H B;  3S9N C;  2YLN A;  5TU0 A;  3G3J A;  4ZEK A;  4AQ4 A;  3SER A;  4KYS A;  2GFE A;  2VHA A;  1H45 A;  4YIC A;  4GL8 A;  1YCJ A;  3TEL A;  4X1D A;  3B6Q A;  4QSE A;  1J1N A;  1A8F A;  4XTC Q;  5JTY A;  5H8F B;  4I1D A;  5CM6 A;  3QYT A;  3GBA A;  1LCT A;  3H06 B;  3ONM A;  1SD3 A;  3USD A;  4BDO A;  2E1S A;  3EPE A;  1B9J A;  3G3K A;  3OOA A;  1MH3 A;  1LGB C;  1PB9 A;  3IB1 A;  1UTB B;  4IGR A;  2DSF A;  1YPN A;  1MPD A;  3PUY E;  3V8X B;  1FQB A;  1P1W A;  3TFL A;  4IO6 A;  1B5H A;  1WVJ A;  4ZEF A;  5I2N A;  1B7Z A;  1B1H A;  3UGW A;  2IA4 A;  3S9L C;  3H4Z A;  1PBP A;  1SW2 A;  2DQV A;  3IJX B;  2OZZ A;  2HEU A;  3U93 A;  2I49 A;  3MZ1 A;  4M1V A;  1MQJ A;  4OMB A;  3CFZ A;  5HBC A;  1M5F A;  3R7X A;  1S50 A;  4HTG A;  3ZSF A;  4NF4 B;  4G8H A;  4EQ7 A;  3OEM A;  4H6D A;  4YU0 A;  4LAT A;  4THI A;  4GD5 A;  1N0T A;  4FAT A;  2XHD A;  2G93 A;  1GVC A;  3KZG A;  3OMB A;  5EHS A;  1OVB A;  2Q88 A;  5ITO A;  3FVK A;  3IB0 A;  4R9G A;  3SEU A;  2A5T A;  3I5O A;  4QHQ A;  2OLB A;  2RC7 A;  5H8H A;  1N84 A;  3RY3 A;  3U72 A;  4OFO A;  1NNT A;  3D4G A;  1B0L A;  1B46 A;  1CE2 A;  3MC2 A;  1BLF A;  5ICQ A;  2Z8E A;  2Z8F A;  3S9E A;  1UIU A;  1B52 A;  1HSL A;  5AA2 B;  1URS A;  2F35 A;  1MPB A;  3T93 B;  2Y7I A;  4EUO A;  3L6G A;  5M2V A;  3QAX A;  5KDT B;  4JWO A;  2ZMB A;  4LQ5 A;  3SEV A;  2PBW A;  5HM4 B;  1QUI A;  1B3H A;  4G77 A;  1B7H A;  3K6V A;  1YAE A;  4KYD A;  3OXN A;  1MM6 A;  1NKX A;  3MVZ A;  2QS2 A;  1LBB A;  2ZNU A;  1MH4 A;  4H0W A;  2HQ0 A;  4N6P A;  4MFI A;  4LA9 A;  1B5J A;  3PGF A;  4Z7E A;  2XXV A;  1WDN A;  3ILU B;  3T22 A;  4U4X A;  4AB5 A;  4NE4 A;  3O9P A;  5FHO A;  4EQB A;  2DVZ A;  1FCK A;  1UTB A;  4LVQ A;  4R9F A;  4F3P A;  2H9B A;  3MPL A;  4NF6 B;  4Q0C A;  3VLV A;  1P1Q A;  4RPO A;  3LC8 A;  2BJJ X;  4DCX A;  3EN3 A;  4QSD A;  3TYH A;  1FQE A;  2XXT A;  2H99 A;  1ZLQ A;  3K1N A;  1VFD A;  3HPI A;  3PMW A;  3HN0 A;  3MQ9 A;  4NWD A;  3UOR A;  3PPO A;  3V83 A;  3TQL A;  3UP9 A;  2I4C A;  4NF4 A;  2R71 A;  1ZJL A;  1SW4 A;  3F11 A;  4G8M A;  3QIM A;  5AA1 A;  3A3C A;  3C4M A;  1PC3 A;  4U1Z A;  2DWJ A;  3L6H A;  3FVG A;  3G3G A;  4U21 A;  2V3T A;  2Y84 A;  3KJ7 A;  3Q29 A;  4P0G A;  1MXZ A;  2DVC A;  3IL1 B;  2I6E A;  3VXB A;  3FVN A;  1XC1 A;  2XXX A;  3PPP A;  1IIW A;  3LSX A;  3VV5 A;  4NTL A;  3TOD A;  3MAM A;  4GL0 A;  4H1X A;  3SET A;  1FTJ A;  5H8Q B;  4BDQ A;  3KBR A;  3LSF B;  1XVY A;  5KDT A;  4GF8 A;  2IEE A;  2DS9 A;  1ZU0 A;  3PV0 E;  2I4B A;  4LZ5 A;  3K1P A;  1VR5 A;  2H25 A;  5I56 A;  3IOU A;  4F1Y A;  4R72 A;  2AL4 A;  3BBR A;  2ZYN A;  4HS7 A;  1A40 A;  5ICT A;  4IO3 A;  2XD2 A;  2PYY A;  1DPP A;  1I6A A;  3QK6 A;  1A99 A;  4KI0 E;  1B58 A;  1QUK A;  3O6I A;  1DTG A;  4PET A;  1ZTY A;  3KEI A;  1USY E;  3DEL B;  1NMU A;  4R6Y A;  3K6U A;  3PUW E;  1PBQ A;  4NF6 A;  5F7V A;  4LUB A;  2VD2 A;  4YZZ A;  3VVD A;  3GXA A;  3RQT A;  1B3E A;  3V5A A;  3K01 A;  1LB8 A;  1R9L A;  4ONY A;  2O51 A;  1JNF A;  3C31 A;  1B6H A;  3C33 A;  3TCG A;  1DMB A;  1UTH B;  1B3F A;  4PFU A;  4R6K A;  2Q8J A;  5H8S A;  3SEW A;  2V25 A;  1MXV A;  3FD3 A;  4ZE8 A;  3A3U A;  3ZS6 A;  4EDP A;  1PB8 A;  3CRB A;  4IGT A;  3T9V A;  3OO9 A;  2QRY A;  2REJ A;  5DT6 A;  2OBG A;  2DE2 A;  4UAC A;  1SI1 A;  4H5G A;  2UVI A;  1O63 A;  1S9T A;  3UIF A;  5I2K B;  4G4P A;  1MQG A;  4KQP A;  4G68 B;  1EH3 A;  5KCJ B;  1FTK A;  2VD3 A;  1RKM A;  3KG2 A;  3KOS A;  4RPN A;  3CIJ A;  3DP4 A;  5FHM A;  3IAZ A;  1Z7M E;  1XHY A;  3RN8 A;  4DXU A;  1H76 A;  4G68 C;  2YPN A;  4C1U A;  2ONK E;  1B7U A;  3VDF A;  4OEN A;  1OQH A;  5B7D A;  2XXR A;  3LSW A;  5H8Q A;  4QRZ A;  2XXY A;  4YB6 A;  3FGS A;  4GIZ A;  2A5T B;  2HFB A;  4G2Z A;  4OQO A;  3C36 A;  3HO7 A;  4BDM A;  1B40 A;  4JDF A;  4PE5 B;  3UN6 A;  4ZEC A;  3TTM A;  1JQF A;  4XIG Q;  4NED A;  1R6Z A;  3BFU A;  3GLB A;  5I59 B;  1LB9 A;  2R6G E;  1Y1M A;  3B6W A;  4ZE9 A;  5TP9 A;  2W7Y A;  1B4H A;  1RYO A;  4ISU A;  2PMS A;  4EF2 A;  3DP8 A;  4R73 A;  3V89 B;  3MBP A;  4GXS B;  1HSE A;  1MY2 A;  1PEB A;  3PPQ A;  4F31 B;  2ESN A;  4MLV A;  2I3W A;  1QUJ A;  5K2Y A;  3H6U A;  4BDN A;  2RKM A;  3IK6 B;  2DOJ A;  4DXB A;  3OSR A;  4FJP A;  3W9W A;  4LZ8 A;  3IOT A;  2I0B A;  4XKN A;  1SDX A;  3HCQ A;  2FNC A;  1NNP A;  2ZNT A;  1UTH A;  4OEV A;  2QSX A;  3Q27 A;  3AXF A;  4ND9 A;  3E3K A;  4FOR A;  4QFK A;  3E4R A;  3KFM A;  5CBR A;  1H3D A;  2F78 A;  4ESW A;  2DP8 A;  5FTH A;  1IUD A;  5L9S A;  4N13 A;  4LQ2 A;  2D3I A;  3MZ9 A;  4YB7 A;  3MVY A;  4Q8R A;  5I2K A;  1SYH A;  4R2B A;  4G68 A;  1FW0 A;  3B6T A;  5KCJ A;  4UA8 A;  1B3L A;  3C32 A;  4OEU A;  4RA1 A;  4ELP A;  2OWS A;  3TTL A;  1FTL A;  1VE4 A;  1Y3P A;  3GBB A;  1JW4 A;  1NH8 A;  2XD3 A;  3QSL A;  3M3L A;  1UIV A;  4OER A;  4ZDM A;  5CI5 A;  1N3W A;  2CZL A;  1ZKB A;  5DVF A;  1MY0 A;  1LAH E;  4O3A A;  2O69 A;  1LAG E;  1D9Y A;  1URG A;  3K6W A;  2F36 A;  2QMW A;  3PPR A;  3O66 A;  1B51 A;  1B3G A;  1GV8 A;  4BDR A;  4F29 A;  1BTJ A;  1HSJ A;  2XXQ A;  2RF1 A;  1Y4C A;  2D5W A;  1IXI A;  5H8N B;  1FQA A;  4JBZ A;  3T9X B;  1SVX B;  2ABH A;  2X7P A;  2UVJ A; 
#chains in the Genus database with same CATH topology
 5DEX B;  3TCF A;  2I0C A;  3GYY A;  5DYH A;  4TLL B;  5I59 A;  2NOO A;  2QL3 A;  1II5 A;  3ZKL A;  3BFT A;  1B1X A;  2Q2A A;  1BP5 A;  4PFI A;  2Q9T A;  4F19 A;  3HHF A;  1NUW A;  1DBZ A;  4F3S A;  5AA3 A;  5I56 B;  1USY H;  4GWO A;  2M8C A;  4NF5 B;  2RC9 A;  3KN7 A;  3G3H A;  4XEQ A;  4H46 A;  1KWH A;  5CMB A;  3VLW A;  1PB7 A;  4OWD A;  2ONS A;  2Y7P A;  4MBP A;  4MNC A;  1D9Q A;  5LDZ A;  1Q1K A;  2I58 A;  3VVF A;  5BWJ A;  2DYX A;  4C1T A;  1ATG A;  4NWC A;  1FPF A;  2NWJ A;  2XXI A;  1SW5 A;  2VT5 A;  3MVX A;  4OET A;  3GZG A;  4GRK A;  4I62 A;  5I58 A;  1G0H A;  4MIJ A;  1Y4T A;  2O68 A;  2GRV A;  5EHM A;  4I3E A;  4TQU Q;  2B3F A;  3PUV E;  5IZ1 A;  4H65 A;  4YMA A;  1US4 A;  2BJI A;  2V4C A;  4F39 A;  4RXL A;  4WED A;  2NUV A;  2O7U A;  1FBD A;  1N76 A;  4C0R A;  3RNN A;  3SDF A;  3MP6 A;  5K2X A;  3EHU A;  2DXR A;  1EZP A;  1VDW A;  5L8D A;  1NV0 A;  3FXU A;  1NV7 A;  4N81 A;  5CRY A;  4HE2 A;  5AA2 D;  5A5L A;  2E0S A;  3TEP A;  1SI0 A;  1FQD A;  4GWY A;  3O97 A;  5A5X B;  1YXI A;  1IMA A;  2KLF A;  4IO5 A;  1AH5 A;  2UYE A;  2F6P A;  2VPN A;  3G3F A;  4P1E A;  4GBV A;  3IOR A;  3JYR A;  1DTZ A;  3M3K A;  1JET A;  4R74 A;  3EHT A;  4FEC A;  1JW5 A;  1FPI A;  1B0H A;  1D9V A;  3UA8 A;  4FEB A;  1I69 A;  1NV5 A;  3KGC A;  3MPK A;  4DLD A;  4JWX A;  3MP8 A;  1QKA A;  2FVZ A;  1FRP A;  4AB6 A;  2REG A;  5H8N A;  1MY1 A;  4OHN A;  3FZV A;  2I48 A;  1O64 A;  3R6U A;  3RUM A;  3TKD A;  3H6V A;  5DEX A;  2V3Q A;  1NV3 A;  2V84 A;  4O3C A;  1TT1 A;  4HXV A;  5IAI A;  1MG1 A;  2B4M A;  1PDA A;  4BDL A;  4P8B A;  3OEN A;  2DWH A;  1DPE A;  4N8Y A;  1JW1 A;  4WXJ A;  3A29 A;  1RDZ A;  2H98 A;  4IY6 A;  4NF5 A;  4XKQ A;  2O84 X;  4KCD A;  4PC9 A;  1BK4 A;  1IIT A;  3SKP A;  4Z0I A;  3CFX A;  4I3Y A;  4X04 A;  1LBC A;  1DOT A;  3MUQ A;  2Z23 A;  1ZMG A;  4KYE A;  1EYJ A;  3VE1 B;  3H6T A;  5LOM A;  1OMP A;  4MAG A;  1JVX A;  1EZO A;  4ZZA A;  1IXH A;  4P9K A;  4KFQ A;  2G29 A;  4UAB A;  5TP9 B;  3PMV A;  4FED A;  5IGA A;  3T66 A;  1R9Q A;  3FV2 A;  2Q74 A;  4H45 A;  4RNS A;  4DDD A;  4GWU A;  2HHM A;  1MQH A;  4NG7 A;  2RIN A;  4ZEI A;  3DLN A;  3O6H A;  4PFT A;  2ZZX A;  4PFR A;  1Y20 A;  1QW0 A;  2Y7K A;  4OYV A;  3M3F A;  1QVS A;  3TPA A;  4PFW A;  4KD5 A;  4YKI A;  4EXK A;  4AS4 A;  4U4S A;  4QFP A;  3B8B A;  5TPA B;  2XXK A;  3N5L A;  5I3S A;  1FBH A;  2XXW A;  2HPG A;  1DSN A;  4MLQ A;  4P56 A;  4HW8 A;  3TTR A;  3K00 A;  2F7C A;  5I57 B;  1KZ8 A;  3K0V A;  4O8M A;  5A5X A;  1SQY A;  3C34 A;  2P2A A;  3O6G A;  4X9T A;  4IO7 A;  3MJN A;  5L9M A;  4EF1 A;  1T0K A;  2QS1 A;  4MF3 A;  1OQG A;  3QXM A;  3KOT A;  4NF8 B;  3M8U A;  3CSB A;  4YKP A;  3FAS A;  2AL5 A;  4GVO A;  2UVH A;  4DZ1 A;  1WOD A;  4P3L A;  4RK9 A;  3N26 A;  5DTB A;  5IKB A;  5EYG A;  1US5 A;  1LFG A;  3CI8 A;  3Q26 A;  3CR9 A;  4JVD A;  1MXY A;  3LR1 A;  3WAE A;  4GFR A;  1DK4 A;  3H03 A;  3TMG A;  2GHA A;  1NI9 A;  1A7L A;  5F1Q A;  5ET8 A;  3U92 A;  2QFL A;  4OTE A;  4XKP A;  3C9H A;  4RY1 A;  1POT A;  2DWA A;  4PF8 A;  4IB2 A;  2FA7 A;  1MDQ A;  1SBP A;  1NH7 A;  2XXU A;  1B5I A;  3E13 X;  1POY 1;  2X26 A;  1GGG A;  3ILT B;  4MX6 A;  3MP1 A;  3E9X A;  2F7B A;  3PUX E;  1IZ1 A;  1NUZ A;  1N04 A;  2QS3 A;  3CSG A;  4OZ9 A;  1CNQ A;  2ZXT A;  5ET7 A;  3CG1 A;  3PU5 A;  1AIV A;  2VP1 A;  4X48 A;  3FV1 A;  1P1O A;  3DP6 A;  3TQW A;  2F34 A;  2PX1 A;  4U1O A;  2F3D A;  4PFY A;  4IY5 A;  3HV1 A;  4EXL A;  3TCH A;  1UQW A;  4F3B A;  5L9O A;  4NHB A;  2ANJ A;  4H67 A;  2I3V A;  4U23 A;  3RTW B;  3ZKK A;  3K2D A;  1TWY A;  1MXW A;  4DIG A;  4TOZ A;  1IEJ A;  1Y9U A;  1AL3 A;  5ESY A;  4M4G A;  3KSX A;  4I9D A;  4N07 A;  4QSC A;  3PPN A;  4JWY A;  5TPA A;  1OIB A;  3KN8 A;  2F6G A;  4OVT A;  2PT1 A;  1B05 A;  3R26 A;  1FQF A;  2H5Y A;  5I57 A;  4GX6 A;  5I58 B;  1QJM A;  3I6V A;  3OD7 A;  2PT2 A;  4RYA A;  3O28 A;  1SYI A;  1EU8 A;  4MH5 A;  1LFH A;  4LON B;  2HCA A;  3RPW A;  4JVI A;  3Q28 A;  3Q25 A;  4NF8 A;  3S9M C;  2CZK A;  3RGY A;  4H5F A;  2P1S A;  2FIX A;  3IO6 A;  4POW A;  1NUX A;  1FSA A;  4DE8 A;  3OO6 A;  3CVG A;  3VXC A;  1MQD A;  3PTY A;  2P0S A;  4IR8 A;  4X1B A;  1F9B A;  4YKJ A;  3KN3 A;  2ZNS A;  1M5C A;  1D4N A;  4HCY A;  1NFT A;  2XXH A;  4RK2 A;  3U94 A;  4KR5 A;  3LUY A;  4OVJ A;  4GWS A;  4FIM A;  2XX7 A;  4R6H A;  5EQA A;  3TTK A;  1VFE A;  1I6B A;  1FTM A;  3K6X A;  4FAJ A;  5HPQ A;  2A5S A;  1B32 A;  3IX1 A;  3TAJ A;  1LBZ A;  5BUU A;  1MY3 A;  1P99 A;  1RYX A;  1NL5 A;  2Q2C A;  1P1N A;  3E78 A;  5DVJ A;  2OJT A;  3B7D A;  4FE8 A;  3LSL A;  1MPC A;  2OWT A;  4ESX A;  3TDJ A;  5JEI A;  4OXV A;  1Q9D A;  4NMY A;  1LCF A;  3VVE A;  1ZIU A;  5CMC A;  4IO2 A;  1O7T A;  1LAF E;  1MS7 A;  2YJP A;  3RT6 B;  3U8Q A;  3N6T A;  1TXF A;  3PD8 A;  4ZS9 A;  2ZZW A;  4PCD A;  1OLC A;  2AYS A;  3VLU A;  1N3X A;  3LUZ A;  5B70 A;  1FBF A;  4PBQ A;  4JB7 A;  2Y7W A;  1YYZ A;  3LV0 A;  4NX1 A;  4GQO A;  2XA5 A;  2X7Q A;  4PQJ A;  4HE0 A;  3DM0 A;  4YMB A;  2FYI A;  1Z7N E;  5J1D A;  2Z8D A;  5EYF A;  4YKK A;  4HCW A;  3QUF A;  5H8F A;  3UK4 A;  4F18 A;  4HE1 A;  1M5B A;  2QVV A;  4NF0 A;  3SEY A;  2GHB A;  4ECF A;  1Y1Z A;  3S4U A;  1XT8 A;  4DXC A;  1EYI A;  4PP0 A;  4LP2 B;  3C35 A;  3IJO B;  4U22 A;  4OFJ A;  3O2A A;  1AOV A;  4RJZ A;  3KC1 A;  2R9J A;  1INP A;  2NVU B;  2XX8 A;  2LAO A;  2Z22 A;  3MW0 A;  1ANF A;  1MXU A;  2RCB A;  3PUZ E;  4P11 A;  3MWB A;  5CMK A;  2DE4 A;  3CHG A;  3SES A;  5JK4 A;  1FPB A;  3D4C A;  3PMX A;  1H43 A;  2D21 A;  5AA4 B;  2O1L A;  4Q30 B;  1IQ7 A;  3VFJ A;  1L5T A;  1LST A;  2V93 A;  2ZZV A;  3H3G A;  1JEV A;  3TZA A;  4IO4 A;  4PDH A;  2Q89 A;  1XVX A;  1N7X A;  1ELJ A;  5EYH A;  1TFA A;  3JZJ A;  1VSO A;  5FHN A;  3T9U A;  1SW1 A;  4NN3 A;  5ELV A;  4L17 A;  2HXW A;  3K1M A;  4U2R A;  2XXP A;  3HHG A;  1IXC A;  4KCC A;  2V3U A;  2HXR A;  3MVW A;  4PE3 A;  3KSJ A;  2L5V A;  4MNI A;  5FTI A;  1OLA A;  4K3F A;  5I84 A;  3RYD A;  4YB5 A;  3FXR A;  1LFI A;  3OEL A;  1QKB A;  4PGN A;  4QBA A;  3OO8 A;  2O6A A;  1JVY A;  2OK2 A;  3U1O A;  1GR2 A;  2F7A A;  2HZL A;  4PF6 A;  2F97 A;  5EQ8 A;  1FJ6 A;  2F5X A;  1XS5 A;  3FJM A;  1MY4 A;  2UYF A;  4KHZ E;  1B2H A;  1Y3N A;  2UVG A;  2WYK A;  4R75 A;  2DXY A;  3A09 A;  1BIY A;  4F3G A;  1IXG A;  2VOZ A;  4F1V A;  3IB2 A;  1FPG A;  1QGX A;  4JSO A;  5AE4 A;  1MDP 1;  4PTK A;  1GTK A;  3RT8 A;  3EF7 A;  2MKZ A;  2ZYO A;  3RTF B;  3MZB A;  4G8N A;  4MNP A;  5ITP A;  4Q5T A;  1ZBM A;  3EQ1 A;  5KZT A;  4JXI A;  1NNK A;  4O3B A;  4LZ7 A;  4QFO A;  3H6W A;  1KA0 A;  1H44 A;  1EYK A;  5EQ9 A;  3W9V A;  2THI A;  4F2Q A;  2Y7R A;  3G7W A;  5AA2 A;  5FBP A;  4PAK A;  2PCR A;  1JEU A;  1LAX A;  2NXO A;  3K02 A;  1D3K A;  1CB6 A;  2XWV A;  3FJ7 A;  2AIX A;  2F8D A;  4TLM B;  2ZYM A;  3H7M A;  3FVO A;  3CFL A;  1MQI A;  1MRP A;  4XXU A;  1EZ9 A;  2OCU A;  1R1N A;  1S7Y A;  2PVU A;  3OSQ A;  3JV9 A;  3OO7 A;  1QUL A;  3SEX A;  3ECR A;  1B4Z A;  4I8C A;  1YTV A;  1LLS A;  1Q35 A;  3FAT A;  2VGQ A;  5DVI A;  4QF9 A;  3N6U A;  1FTO A;  1FPE A;  4P0I A;  4ELO A;  1I6Q A;  1XOC A;  2HAV A;  2ZYK A;  1SPI A;  2P3N A;  2FHY A;  2GH9 A;  4DCY A;  3IOV A;  1AMF A;  1Y3Q A;  3CG3 A;  3I3V A;  3ODB A;  4E0X A;  1M5D A;  5JTY B;  4WEP A;  2CEY A;  4QFN A;  4H8I A;  5AA4 A;  3LBS A;  1NUY A;  3G3I A;  4OAN A;  2DWI A;  4JSD A;  4GLI A;  2RCA A;  1LBV A;  2ALU A;  1A54 A;  4ZZE A;  2B3B A;  3IOW A;  1TFD A;  4OES A;  1FQC A;  3K4U A;  2HAU A;  1M5E A;  4ELQ A;  4XKR A;  1P1U A;  4E0W A;  2QJE A;  2UXA A;  3RLF E;  3QUJ A;  4GXA A;  2WEF A;  1DCU A;  1MXX A;  1NNF A;  4ZEB A;  4F2O A;  5LTC A;  3FXQ A;  2O1M A;  2H4I A;  3FJG A;  2XX9 A;  4EQ9 A;  4F22 A;  4ZED A;  4POX A;  2O7I A;  1A8E A;  3TTN A;  2B65 A;  4ELR A;  2DE3 A;  2QMX A;  2QPQ A;  2QS4 A;  1G0I A;  2HZK A;  3FUZ A;  1URD A;  2ONR A;  4F1U A;  5I2N B;  5CMM A;  3OEK A;  3FIR A;  4QFL A;  5IZZ A;  3N94 A;  3W15 C;  4BLA A;  1BKA A;  3EHS A;  2WKY A;  3BKI B;  1A55 A;  3O29 A;  3TUS A;  3PD9 A;  3T96 B;  4GOT A;  3HST A;  1MM7 A;  5CBS A;  4I40 A;  1N7W A;  4OFL A;  3WAF A;  3KJT A;  5CC2 A;  3THI A;  5ISU A;  2CMO A;  4YAH X;  2FBP A;  1OVT A;  3IO4 A;  4R2F A;  2RC8 A;  4AS5 A;  4WKM A;  2JJK A;  4P1L A;  3S2V A;  3IR1 A;  4KPT A;  4H8J A;  3T9H B;  3P7I A;  1FPL A;  2Y5K A;  5H8H B;  1FBP A;  3S9N C;  2YLN A;  5TU0 A;  1RDX A;  3G3J A;  4ZEK A;  4AQ4 A;  1FBC A;  3SER A;  4KYS A;  2GFE A;  2VHA A;  1H45 A;  4YIC A;  5EQ7 A;  4N17 A;  4GL8 A;  1YCJ A;  3TEL A;  4X1D A;  3B6Q A;  4QSE A;  1J1N A;  1A8F A;  4XTC Q;  5JTY A;  3NOH A;  5H8F B;  4I1D A;  5CM6 A;  2PFY A;  3QYT A;  4PAI A;  3GBA A;  1LCT A;  3H06 B;  3ONM A;  1SD3 A;  3USD A;  4BDO A;  2E1S A;  3EPE A;  1B9J A;  5ET6 A;  3G3K A;  4MJO A;  3OOA A;  1MH3 A;  4N4U A;  1LGB C;  1PB9 A;  3IB1 A;  3KC0 A;  1FTA A;  1UTB B;  4IGR A;  2DSF A;  1YPN A;  1JP4 A;  1MPD A;  3PUY E;  3V8X B;  1FQB A;  1P1W A;  4OVQ A;  3TFL A;  4IO6 A;  1B5H A;  1WVJ A;  4ZEF A;  5I2N A;  1FPJ A;  1B7Z A;  1B1H A;  3UGW A;  2IA4 A;  3S9L C;  2KR0 A;  3H4Z A;  1PBP A;  1SW2 A;  2DQV A;  3IJX B;  2OZZ A;  2HEU A;  3U93 A;  1RDY A;  2I49 A;  3MZ1 A;  4M1V A;  1MQJ A;  4OMB A;  3CFZ A;  5HBC A;  1M5F A;  3R7X A;  4LN5 A;  1S50 A;  4HTG A;  3ZSF A;  4PAF A;  4NF4 B;  4G8H A;  5F24 A;  4EQ7 A;  3OEM A;  4H6D A;  4YU0 A;  4OVS A;  4LAT A;  4THI A;  4O7I A;  4OVP A;  1LBX A;  4GD5 A;  1N0T A;  4FAT A;  2XHD A;  5IM2 A;  2G93 A;  1GVC A;  3KZG A;  3OMB A;  3B50 A;  5EHS A;  3T1B A;  1OVB A;  2Q88 A;  5ITO A;  3FVK A;  3IB0 A;  4R9G A;  3SEU A;  1FBE A;  2A5T A;  3I5O A;  4QHQ A;  2OLB A;  2RC7 A;  5H8H A;  1N84 A;  3RY3 A;  3U72 A;  4OFO A;  1NNT A;  3RPL B;  3D4G A;  1B0L A;  1B46 A;  1CE2 A;  3MC2 A;  5I7I A;  2WBB A;  1BLF A;  5ICQ A;  2Z8E A;  2Z8F A;  3S9E A;  1IMB A;  1UIU A;  4PFB A;  1B52 A;  1HSL A;  5AA2 B;  1URS A;  2F35 A;  1MPB A;  3T93 B;  2Y7I A;  4EUO A;  3L6G A;  5M2V A;  3QAX A;  5KDT B;  4JWO A;  1NV1 A;  2ZMB A;  4OA4 A;  4LQ5 A;  3SEV A;  2PBW A;  5HM4 B;  1QUI A;  1B3H A;  3FBP A;  4MEV A;  4G77 A;  3T0J A;  1B7H A;  3K6V A;  1YAE A;  4KYD A;  2CEX A;  1LBY A;  4PDD A;  4MCO A;  3OXN A;  4GBW A;  1MM6 A;  1NKX A;  3MVZ A;  2OWZ A;  2QS2 A;  1LBB A;  2ZNU A;  1MH4 A;  4H0W A;  2HQ0 A;  4N6P A;  4MFI A;  4LA9 A;  1B5J A;  4X8R A;  3PGF A;  4Z7E A;  2XXV A;  1LBW A;  1WDN A;  3ILU B;  3T22 A;  4U4X A;  4AB5 A;  4NE4 A;  3O9P A;  4MHF A;  1FJ9 A;  2F3B A;  5FHO A;  4EQB A;  4DI4 B;  2DVZ A;  1FCK A;  4PGP A;  1UTB A;  4LVQ A;  4R9F A;  4F3P A;  2H9B A;  3MPL A;  4NF6 B;  4Q0C A;  3VLV A;  1P1Q A;  1AWB A;  4RPO A;  3LC8 A;  2BJJ X;  4DCX A;  3EN3 A;  4QSD A;  3TYH A;  1FQE A;  2XXT A;  2H99 A;  1ZLQ A;  3K1N A;  4PBH A;  1VFD A;  3HPI A;  3PMW A;  3HN0 A;  3IFC A;  3MQ9 A;  1IME A;  4NWD A;  3UOR A;  3PPO A;  3V83 A;  3TQL A;  3UP9 A;  2I4C A;  4NF4 A;  2B4L A;  2R71 A;  1ZJL A;  4GWW A;  2WBD A;  1SW4 A;  3F11 A;  3KBZ A;  4G8M A;  3QIM A;  5AA1 A;  3A3C A;  3C4M A;  1PC3 A;  2R8T A;  4U1Z A;  2DWJ A;  3L6H A;  3FVG A;  3G3G A;  4U21 A;  2V3T A;  2Y84 A;  3KJ7 A;  3Q29 A;  4P0G A;  1MXZ A;  2DVC A;  2XWK A;  3IL1 B;  2I6E A;  3VXB A;  3FVN A;  1XC1 A;  3RPL A;  2XXX A;  3PPP A;  2OX3 A;  1IIW A;  3LSX A;  3VV5 A;  4NTL A;  3TOD A;  3MAM A;  4GL0 A;  4H1X A;  3SET A;  4OVR A;  1FTJ A;  5H8Q B;  4BDQ A;  3KBR A;  3LSF B;  1XVY A;  3IFA A;  5KDT A;  3MYU A;  1K9Z A;  4GF8 A;  2IEE A;  2VPO A;  2DS9 A;  1ZU0 A;  3PV0 E;  2I4B A;  4LZ5 A;  3K1P A;  1VR5 A;  2H25 A;  4N8G A;  5I56 A;  3IOU A;  4F1Y A;  4R72 A;  2AL4 A;  3BBR A;  2Y5L A;  2ZYN A;  4HS7 A;  1NV4 A;  4KXP A;  1A40 A;  5ICT A;  4IO3 A;  2XD2 A;  2PYY A;  2FIE A;  5DW8 A;  1DPP A;  1I6A A;  3QK6 A;  1A99 A;  4KI0 E;  1B58 A;  1QUK A;  3O6I A;  1DTG A;  4PET A;  1ZTY A;  3KEI A;  1USY E;  3BIG A;  3DEL B;  1NMU A;  4R6Y A;  4QXD A;  3K6U A;  3PUW E;  1NV2 A;  1PBQ A;  4NF6 A;  5F7V A;  4LUB A;  2VD2 A;  4YZZ A;  4DI3 D;  3VVD A;  3GXA A;  3RQT A;  1B3E A;  3V5A A;  3K01 A;  1LB8 A;  1R9L A;  4ONY A;  2O51 A;  2DDK A;  1JNF A;  3C31 A;  1B6H A;  4N91 A;  3C33 A;  3TCG A;  1DMB A;  1UTH B;  1B3F A;  2CZI A;  2P3V A;  4PFU A;  4R6K A;  2Q8J A;  5H8S A;  3SEW A;  2V25 A;  2QVR A;  1MXV A;  3FD3 A;  4ZE8 A;  1IMD A;  3A3U A;  3HFU A;  3MST A;  2QVU A;  3ZS6 A;  4EDP A;  2Q8M A;  1PB8 A;  3CRB A;  4IGT A;  3T9V A;  4O94 A;  3OO9 A;  2QRY A;  2REJ A;  5I5P A;  5DT6 A;  2OBG A;  2DE2 A;  4UAC A;  1SI1 A;  4P47 A;  4H5G A;  2UVI A;  1O63 A;  1S9T A;  3UIF A;  5I2K B;  1LEV A;  4G4P A;  1MQG A;  1FPK A;  4KQP A;  4G68 B;  1EH3 A;  5KCJ B;  1FTK A;  2VD3 A;  1RKM A;  3KG2 A;  4FBP A;  3KOS A;  4RPN A;  3CIJ A;  5ET5 A;  3SZP A;  4N6K A;  2CZH A;  3DP4 A;  5FHM A;  3IAZ A;  1Z7M E;  1XHY A;  3RN8 A;  4DXU A;  1H76 A;  4G68 C;  4N6D A;  2YPN A;  4C1U A;  2WYP A;  2ONK E;  1B7U A;  4NGU A;  3VDF A;  4XF5 A;  4OEN A;  1OQH A;  5B7D A;  2XXR A;  3LSW A;  2WX9 A;  5H8Q A;  4QRZ A;  2XXY A;  3ISP A;  4XFE A;  4YB6 A;  3FGS A;  4GIZ A;  2A5T B;  2HFB A;  4G2Z A;  4OQO A;  3C36 A;  1FPD A;  5IZ3 B;  3HO7 A;  4BDM A;  1B40 A;  4JDF A;  4PE5 B;  3UN6 A;  4ZEC A;  3D1R A;  3TTM A;  1JQF A;  4MMP A;  3U65 A;  4NQ8 A;  4XIG Q;  4NAP A;  4NED A;  1R6Z A;  3EKI A;  3BFU A;  4O7M A;  3GLB A;  5I59 B;  1LB9 A;  2R6G E;  1Y1M A;  3B6W A;  4ZE9 A;  5TP9 A;  2W7Y A;  1B4H A;  1RYO A;  4ISU A;  2PMS A;  4EF2 A;  3DP8 A;  4R73 A;  3V89 B;  3MBP A;  4GXS B;  1HSE A;  1MY2 A;  1PEB A;  5T3J A;  3PPQ A;  2PFZ A;  4F31 B;  2ESN A;  4MLV A;  1XI6 A;  2I3W A;  4G61 A;  1KA1 A;  1QUJ A;  5K2Y A;  3H6U A;  4BDN A;  2RKM A;  3IK6 B;  2DOJ A;  4DXB A;  4GX3 A;  3OSR A;  4FJP A;  3W9W A;  4LZ8 A;  3IOT A;  2I0B A;  4XKN A;  1SDX A;  4GX4 A;  3HCQ A;  1IMC A;  2FNC A;  1NNP A;  2ZNT A;  1UTH A;  4OEV A;  2QSX A;  3Q27 A;  3AXF A;  4ND9 A;  3E3K A;  4N15 A;  4FOR A;  4QFK A;  3E4R A;  3KFM A;  5CBR A;  1H3D A;  2F78 A;  1IMF A;  4ESW A;  2DP8 A;  5FTH A;  1IUD A;  5L9S A;  2XWO A;  4N13 A;  4LQ2 A;  1NV6 A;  2D3I A;  3BIH A;  3MZ9 A;  4YB7 A;  1K9Y A;  3MVY A;  4Q8R A;  5I2K A;  1SYH A;  4R2B A;  4G68 A;  1FW0 A;  3B6T A;  3ROJ A;  5KCJ A;  4UA8 A;  1B3L A;  3C32 A;  4OEU A;  4RA1 A;  4ELP A;  2GQ1 A;  2OWS A;  3TTL A;  4JVC A;  1FTL A;  1VE4 A;  1Y3P A;  3GBB A;  1JW4 A;  1NH8 A;  4GWZ A;  2XD3 A;  3QSL A;  1FBG A;  3M3L A;  1UIV A;  4OER A;  4ZDM A;  5J16 A;  5CI5 A;  1N3W A;  2CZL A;  1ZKB A;  5DVF A;  1MY0 A;  1LAH E;  4O3A A;  2O69 A;  1YZ0 A;  1LAG E;  1D9Y A;  1URG A;  2KQZ A;  3QMF A;  3K6W A;  2F36 A;  2QMW A;  3PPR A;  3O66 A;  1B51 A;  3E79 A;  1B3G A;  1GV8 A;  5IZ3 A;  4BDR A;  4F29 A;  4GWX A;  1BTJ A;  1HSJ A;  2XXQ A;  2RF1 A;  1Y4C A;  2D5W A;  1IXI A;  5H8N B;  1FQA A;  2XWI A;  3FXB A;  4JBZ A;  3T9X B;  1SVX B;  2ABH A;  2X7P A;  2UVJ A; 
#chains in the Genus database with same CATH homology
 5DEX B;  3TCF A;  2I0C A;  5DYH A;  4TLL B;  5I59 A;  2NOO A;  2QL3 A;  1II5 A;  3ZKL A;  3BFT A;  1B1X A;  2Q2A A;  1BP5 A;  2Q9T A;  4F19 A;  3HHF A;  4F3S A;  5AA3 A;  5I56 B;  1USY H;  4GWO A;  2M8C A;  4NF5 B;  2RC9 A;  3KN7 A;  3G3H A;  1KWH A;  5CMB A;  3VLW A;  1PB7 A;  4OWD A;  2ONS A;  2Y7P A;  4MBP A;  1Q1K A;  2I58 A;  3VVF A;  5BWJ A;  2DYX A;  4C1T A;  1ATG A;  4NWC A;  2NWJ A;  2XXI A;  1SW5 A;  3MVX A;  4OET A;  3GZG A;  4GRK A;  4I62 A;  5I58 A;  1Y4T A;  2O68 A;  2GRV A;  5EHM A;  4TQU Q;  2B3F A;  3PUV E;  4H65 A;  4YMA A;  1US4 A;  4F39 A;  4RXL A;  4WED A;  2NUV A;  2O7U A;  1N76 A;  4C0R A;  3RNN A;  3SDF A;  3MP6 A;  5K2X A;  3EHU A;  2DXR A;  1EZP A;  5L8D A;  3FXU A;  5CRY A;  5AA2 D;  2E0S A;  3TEP A;  1SI0 A;  1FQD A;  3O97 A;  5A5X B;  2KLF A;  4IO5 A;  1AH5 A;  2UYE A;  2F6P A;  3G3F A;  3IOR A;  3JYR A;  1DTZ A;  3M3K A;  1JET A;  4R74 A;  3EHT A;  4FEC A;  1JW5 A;  1B0H A;  1D9V A;  3UA8 A;  4FEB A;  1I69 A;  3KGC A;  3MPK A;  4DLD A;  4JWX A;  3MP8 A;  1QKA A;  4AB6 A;  2REG A;  5H8N A;  1MY1 A;  4OHN A;  3FZV A;  2I48 A;  1O64 A;  3R6U A;  3RUM A;  3TKD A;  3H6V A;  5DEX A;  2V3Q A;  2V84 A;  4O3C A;  1TT1 A;  5IAI A;  1MG1 A;  1PDA A;  4BDL A;  3OEN A;  2DWH A;  1DPE A;  1JW1 A;  4WXJ A;  2H98 A;  4IY6 A;  4NF5 A;  4XKQ A;  2O84 X;  4KCD A;  1IIT A;  3SKP A;  4Z0I A;  3CFX A;  1LBC A;  1DOT A;  3MUQ A;  2Z23 A;  1ZMG A;  4KYE A;  3VE1 B;  3H6T A;  5LOM A;  1OMP A;  1JVX A;  1EZO A;  4ZZA A;  1IXH A;  4KFQ A;  2G29 A;  5TP9 B;  3PMV A;  4FED A;  3T66 A;  1R9Q A;  3FV2 A;  4DDD A;  4RNS A;  1MQH A;  2RIN A;  4ZEI A;  3DLN A;  3O6H A;  4PFT A;  1Y20 A;  1QW0 A;  2Y7K A;  4OYV A;  3M3F A;  1QVS A;  3TPA A;  4PFW A;  4EXK A;  4KD5 A;  4YKI A;  4U4S A;  4QFP A;  5TPA B;  3N5L A;  2XXW A;  1DSN A;  4MLQ A;  4HW8 A;  3TTR A;  3K00 A;  2F7C A;  5I57 B;  3K0V A;  5A5X A;  1SQY A;  3C34 A;  2P2A A;  3O6G A;  4X9T A;  4IO7 A;  3MJN A;  5L9M A;  4EF1 A;  1T0K A;  2QS1 A;  4MF3 A;  1OQG A;  3QXM A;  3KOT A;  4NF8 B;  3M8U A;  3CSB A;  4YKP A;  3FAS A;  2AL5 A;  4GVO A;  2UVH A;  4DZ1 A;  1WOD A;  4RK9 A;  3N26 A;  5DTB A;  5IKB A;  1US5 A;  1LFG A;  3CI8 A;  3Q26 A;  3CR9 A;  1MXY A;  3LR1 A;  3WAE A;  4GFR A;  3H03 A;  3TMG A;  2GHA A;  1A7L A;  5F1Q A;  3U92 A;  4OTE A;  4XKP A;  3C9H A;  4RY1 A;  1POT A;  2DWA A;  4IB2 A;  2FA7 A;  1MDQ A;  1SBP A;  1NH7 A;  2XXU A;  1B5I A;  3E13 X;  1POY 1;  2X26 A;  1GGG A;  3ILT B;  3MP1 A;  3E9X A;  2F7B A;  3PUX E;  1IZ1 A;  1N04 A;  2QS3 A;  3CSG A;  4OZ9 A;  2ZXT A;  3CG1 A;  3PU5 A;  1AIV A;  2VP1 A;  4X48 A;  3FV1 A;  1P1O A;  3DP6 A;  3TQW A;  2F34 A;  2PX1 A;  4U1O A;  4PFY A;  4IY5 A;  3HV1 A;  4EXL A;  3TCH A;  1UQW A;  4F3B A;  5L9O A;  2ANJ A;  4H67 A;  2I3V A;  4U23 A;  3RTW B;  3ZKK A;  3K2D A;  1TWY A;  1MXW A;  4DIG A;  4TOZ A;  1IEJ A;  1Y9U A;  1AL3 A;  4M4G A;  3KSX A;  4I9D A;  4N07 A;  4QSC A;  3PPN A;  4JWY A;  5TPA A;  1OIB A;  3KN8 A;  2F6G A;  2PT1 A;  1B05 A;  3R26 A;  1FQF A;  2H5Y A;  5I57 A;  5I58 B;  1QJM A;  3I6V A;  3OD7 A;  2PT2 A;  4RYA A;  3O28 A;  1SYI A;  1EU8 A;  4MH5 A;  1LFH A;  4LON B;  2HCA A;  3RPW A;  3Q28 A;  3Q25 A;  4NF8 A;  3S9M C;  3RGY A;  4H5F A;  2P1S A;  3IO6 A;  4POW A;  4DE8 A;  3OO6 A;  3CVG A;  3VXC A;  1MQD A;  4X1B A;  2P0S A;  1F9B A;  4YKJ A;  3KN3 A;  2ZNS A;  1M5C A;  1D4N A;  4HCY A;  1NFT A;  2XXH A;  4RK2 A;  3U94 A;  4KR5 A;  3LUY A;  4OVJ A;  4FIM A;  2XX7 A;  4R6H A;  3TTK A;  1VFE A;  1I6B A;  1FTM A;  3K6X A;  4FAJ A;  5HPQ A;  2A5S A;  1B32 A;  3IX1 A;  3TAJ A;  5BUU A;  1MY3 A;  1P99 A;  1RYX A;  1NL5 A;  2Q2C A;  1P1N A;  5DVJ A;  2OJT A;  3B7D A;  4FE8 A;  3LSL A;  1MPC A;  2OWT A;  4ESX A;  3TDJ A;  5JEI A;  4OXV A;  4NMY A;  1LCF A;  3VVE A;  1ZIU A;  5CMC A;  4IO2 A;  1O7T A;  1LAF E;  1MS7 A;  2YJP A;  3RT6 B;  3U8Q A;  3N6T A;  1TXF A;  3PD8 A;  4ZS9 A;  1OLC A;  2AYS A;  3VLU A;  1N3X A;  5B70 A;  4JB7 A;  2Y7W A;  4GQO A;  2X7Q A;  4PQJ A;  4YMB A;  3DM0 A;  2FYI A;  1Z7N E;  5J1D A;  2Z8D A;  5EYF A;  4YKK A;  4HCW A;  3QUF A;  5H8F A;  3UK4 A;  4F18 A;  1M5B A;  3SEY A;  2GHB A;  4ECF A;  1Y1Z A;  3S4U A;  1XT8 A;  4DXC A;  4PP0 A;  4LP2 B;  3C35 A;  3IJO B;  4U22 A;  4OFJ A;  3O2A A;  1AOV A;  4RJZ A;  2R9J A;  2NVU B;  2XX8 A;  2LAO A;  2Z22 A;  3MW0 A;  1ANF A;  1MXU A;  2RCB A;  3PUZ E;  4P11 A;  3MWB A;  5CMK A;  2DE4 A;  3SES A;  5JK4 A;  3D4C A;  3PMX A;  1H43 A;  2D21 A;  5AA4 B;  2O1L A;  4Q30 B;  1IQ7 A;  3VFJ A;  1L5T A;  1LST A;  2V93 A;  3H3G A;  1JEV A;  3TZA A;  4IO4 A;  2Q89 A;  1XVX A;  1N7X A;  1ELJ A;  1TFA A;  3JZJ A;  1VSO A;  5FHN A;  3T9U A;  1SW1 A;  5ELV A;  4L17 A;  2HXW A;  3K1M A;  4U2R A;  2XXP A;  3HHG A;  1IXC A;  4KCC A;  2V3U A;  3MVW A;  3KSJ A;  5FTI A;  1OLA A;  4K3F A;  5I84 A;  4YB5 A;  3FXR A;  1LFI A;  3OEL A;  1QKB A;  3OO8 A;  2O6A A;  1JVY A;  2OK2 A;  3U1O A;  1GR2 A;  2F7A A;  2HZL A;  2F97 A;  2F5X A;  3FJM A;  1XS5 A;  1MY4 A;  2UYF A;  4KHZ E;  1B2H A;  1Y3N A;  2UVG A;  4R75 A;  2DXY A;  3A09 A;  1BIY A;  4F3G A;  1IXG A;  2VOZ A;  4F1V A;  3IB2 A;  4JSO A;  5AE4 A;  1MDP 1;  1GTK A;  3RT8 A;  3EF7 A;  2ZYO A;  3RTF B;  3MZB A;  4G8N A;  5ITP A;  4Q5T A;  1ZBM A;  3EQ1 A;  5KZT A;  4JXI A;  1NNK A;  4O3B A;  4LZ7 A;  4QFO A;  3H6W A;  1H44 A;  3W9V A;  2THI A;  4F2Q A;  2Y7R A;  3G7W A;  5AA2 A;  1JEU A;  1LAX A;  2NXO A;  3K02 A;  1D3K A;  1CB6 A;  3FJ7 A;  2AIX A;  2F8D A;  4TLM B;  2ZYM A;  3H7M A;  3FVO A;  3CFL A;  1MQI A;  1MRP A;  4XXU A;  1EZ9 A;  2OCU A;  1R1N A;  1S7Y A;  2PVU A;  3OSQ A;  3JV9 A;  3OO7 A;  1QUL A;  3SEX A;  3ECR A;  1B4Z A;  4I8C A;  1YTV A;  1LLS A;  1Q35 A;  3FAT A;  2VGQ A;  5DVI A;  4QF9 A;  3N6U A;  1FTO A;  4P0I A;  4ELO A;  1I6Q A;  1XOC A;  2HAV A;  2ZYK A;  2GH9 A;  4DCY A;  3IOV A;  1AMF A;  1Y3Q A;  3CG3 A;  3I3V A;  3ODB A;  4E0X A;  1M5D A;  5JTY B;  4WEP A;  4QFN A;  4H8I A;  5AA4 A;  3LBS A;  3G3I A;  2DWI A;  4JSD A;  4GLI A;  2RCA A;  2ALU A;  1A54 A;  4ZZE A;  2B3B A;  3IOW A;  1TFD A;  4OES A;  1FQC A;  3K4U A;  2HAU A;  1M5E A;  4ELQ A;  4XKR A;  1P1U A;  4E0W A;  2QJE A;  2UXA A;  3RLF E;  3QUJ A;  4GXA A;  4F2O A;  1MXX A;  1NNF A;  4ZEB A;  3FXQ A;  2O1M A;  2H4I A;  3FJG A;  2XX9 A;  4EQ9 A;  4F22 A;  4ZED A;  4POX A;  2O7I A;  1A8E A;  3TTN A;  2B65 A;  4ELR A;  2DE3 A;  2QMX A;  2QPQ A;  2QS4 A;  2HZK A;  3FUZ A;  1URD A;  2ONR A;  4F1U A;  5I2N B;  5CMM A;  3OEK A;  3FIR A;  4QFL A;  3N94 A;  3W15 C;  4BLA A;  1BKA A;  3EHS A;  2WKY A;  3BKI B;  1A55 A;  3O29 A;  3TUS A;  3PD9 A;  3T96 B;  4GOT A;  3HST A;  1MM7 A;  5CBS A;  1N7W A;  4OFL A;  3WAF A;  3KJT A;  5CC2 A;  3THI A;  5ISU A;  2CMO A;  4YAH X;  1OVT A;  3IO4 A;  4R2F A;  2RC8 A;  4WKM A;  3S2V A;  3IR1 A;  4KPT A;  4H8J A;  3T9H B;  3P7I A;  5H8H B;  3S9N C;  2YLN A;  5TU0 A;  3G3J A;  4ZEK A;  4AQ4 A;  3SER A;  4KYS A;  2GFE A;  2VHA A;  1H45 A;  4YIC A;  4GL8 A;  1YCJ A;  3TEL A;  4X1D A;  3B6Q A;  4QSE A;  1J1N A;  1A8F A;  4XTC Q;  5JTY A;  5H8F B;  4I1D A;  5CM6 A;  3QYT A;  3GBA A;  1LCT A;  3H06 B;  3ONM A;  1SD3 A;  3USD A;  4BDO A;  2E1S A;  3EPE A;  1B9J A;  3G3K A;  3OOA A;  1MH3 A;  1LGB C;  1PB9 A;  3IB1 A;  1UTB B;  4IGR A;  2DSF A;  1YPN A;  1MPD A;  3PUY E;  3V8X B;  1FQB A;  1P1W A;  3TFL A;  4IO6 A;  1B5H A;  1WVJ A;  4ZEF A;  5I2N A;  1B7Z A;  1B1H A;  3UGW A;  2IA4 A;  3S9L C;  3H4Z A;  1PBP A;  1SW2 A;  2DQV A;  3IJX B;  2OZZ A;  2HEU A;  3U93 A;  2I49 A;  3MZ1 A;  4M1V A;  1MQJ A;  4OMB A;  3CFZ A;  5HBC A;  1M5F A;  3R7X A;  1S50 A;  4HTG A;  3ZSF A;  4NF4 B;  4G8H A;  4EQ7 A;  3OEM A;  4H6D A;  4YU0 A;  4LAT A;  4THI A;  4GD5 A;  1N0T A;  4FAT A;  2XHD A;  2G93 A;  1GVC A;  3KZG A;  3OMB A;  5EHS A;  1OVB A;  2Q88 A;  5ITO A;  3FVK A;  3IB0 A;  4R9G A;  3SEU A;  2A5T A;  3I5O A;  4QHQ A;  2OLB A;  2RC7 A;  5H8H A;  1N84 A;  3RY3 A;  3U72 A;  4OFO A;  1NNT A;  3D4G A;  1B0L A;  1B46 A;  1CE2 A;  3MC2 A;  1BLF A;  5ICQ A;  2Z8E A;  2Z8F A;  3S9E A;  1UIU A;  1B52 A;  1HSL A;  5AA2 B;  1URS A;  2F35 A;  1MPB A;  3T93 B;  2Y7I A;  4EUO A;  3L6G A;  5M2V A;  3QAX A;  5KDT B;  4JWO A;  2ZMB A;  4LQ5 A;  3SEV A;  2PBW A;  5HM4 B;  1QUI A;  1B3H A;  4G77 A;  1B7H A;  3K6V A;  1YAE A;  4KYD A;  3OXN A;  1MM6 A;  1NKX A;  3MVZ A;  2QS2 A;  1LBB A;  2ZNU A;  1MH4 A;  4H0W A;  2HQ0 A;  4N6P A;  4MFI A;  4LA9 A;  1B5J A;  3PGF A;  4Z7E A;  2XXV A;  1WDN A;  3ILU B;  3T22 A;  4U4X A;  4AB5 A;  4NE4 A;  3O9P A;  5FHO A;  4EQB A;  2DVZ A;  1FCK A;  1UTB A;  4LVQ A;  4R9F A;  4F3P A;  2H9B A;  3MPL A;  4NF6 B;  4Q0C A;  3VLV A;  1P1Q A;  4RPO A;  3LC8 A;  2BJJ X;  4DCX A;  3EN3 A;  4QSD A;  3TYH A;  1FQE A;  2XXT A;  2H99 A;  1ZLQ A;  3K1N A;  1VFD A;  3HPI A;  3PMW A;  3HN0 A;  3MQ9 A;  4NWD A;  3UOR A;  3PPO A;  3V83 A;  3TQL A;  3UP9 A;  2I4C A;  4NF4 A;  2R71 A;  1ZJL A;  1SW4 A;  3F11 A;  4G8M A;  3QIM A;  5AA1 A;  3A3C A;  3C4M A;  1PC3 A;  4U1Z A;  2DWJ A;  3L6H A;  3FVG A;  3G3G A;  4U21 A;  2V3T A;  2Y84 A;  3KJ7 A;  3Q29 A;  4P0G A;  1MXZ A;  2DVC A;  3IL1 B;  2I6E A;  3VXB A;  3FVN A;  1XC1 A;  2XXX A;  3PPP A;  1IIW A;  3LSX A;  3VV5 A;  4NTL A;  3TOD A;  3MAM A;  4GL0 A;  4H1X A;  3SET A;  1FTJ A;  5H8Q B;  4BDQ A;  3KBR A;  3LSF B;  1XVY A;  5KDT A;  4GF8 A;  2IEE A;  2DS9 A;  1ZU0 A;  3PV0 E;  2I4B A;  4LZ5 A;  3K1P A;  1VR5 A;  2H25 A;  5I56 A;  3IOU A;  4F1Y A;  4R72 A;  2AL4 A;  3BBR A;  2ZYN A;  4HS7 A;  1A40 A;  5ICT A;  4IO3 A;  2XD2 A;  2PYY A;  1DPP A;  1I6A A;  3QK6 A;  1A99 A;  4KI0 E;  1B58 A;  1QUK A;  3O6I A;  1DTG A;  4PET A;  1ZTY A;  3KEI A;  1USY E;  3DEL B;  1NMU A;  4R6Y A;  3K6U A;  3PUW E;  1PBQ A;  4NF6 A;  5F7V A;  4LUB A;  2VD2 A;  4YZZ A;  3VVD A;  3GXA A;  3RQT A;  1B3E A;  3V5A A;  3K01 A;  1LB8 A;  1R9L A;  4ONY A;  2O51 A;  1JNF A;  3C31 A;  1B6H A;  3C33 A;  3TCG A;  1DMB A;  1UTH B;  1B3F A;  4PFU A;  4R6K A;  2Q8J A;  5H8S A;  3SEW A;  2V25 A;  1MXV A;  3FD3 A;  4ZE8 A;  3A3U A;  3ZS6 A;  4EDP A;  1PB8 A;  3CRB A;  4IGT A;  3T9V A;  3OO9 A;  2QRY A;  2REJ A;  5DT6 A;  2OBG A;  2DE2 A;  4UAC A;  1SI1 A;  4H5G A;  2UVI A;  1O63 A;  1S9T A;  3UIF A;  5I2K B;  4G4P A;  1MQG A;  4KQP A;  4G68 B;  1EH3 A;  5KCJ B;  1FTK A;  2VD3 A;  1RKM A;  3KG2 A;  3KOS A;  4RPN A;  3CIJ A;  3DP4 A;  5FHM A;  3IAZ A;  1Z7M E;  1XHY A;  3RN8 A;  4DXU A;  1H76 A;  4G68 C;  2YPN A;  4C1U A;  2ONK E;  1B7U A;  3VDF A;  4OEN A;  1OQH A;  5B7D A;  2XXR A;  3LSW A;  5H8Q A;  4QRZ A;  2XXY A;  4YB6 A;  3FGS A;  4GIZ A;  2A5T B;  2HFB A;  4G2Z A;  4OQO A;  3C36 A;  3HO7 A;  4BDM A;  1B40 A;  4JDF A;  4PE5 B;  3UN6 A;  4ZEC A;  3TTM A;  1JQF A;  4XIG Q;  4NED A;  1R6Z A;  3BFU A;  3GLB A;  5I59 B;  1LB9 A;  2R6G E;  1Y1M A;  3B6W A;  4ZE9 A;  5TP9 A;  2W7Y A;  1B4H A;  1RYO A;  4ISU A;  2PMS A;  4EF2 A;  3DP8 A;  4R73 A;  3V89 B;  3MBP A;  4GXS B;  1HSE A;  1MY2 A;  1PEB A;  3PPQ A;  4F31 B;  2ESN A;  4MLV A;  2I3W A;  1QUJ A;  5K2Y A;  3H6U A;  4BDN A;  2RKM A;  3IK6 B;  2DOJ A;  4DXB A;  3OSR A;  4FJP A;  3W9W A;  4LZ8 A;  3IOT A;  2I0B A;  4XKN A;  1SDX A;  3HCQ A;  2FNC A;  1NNP A;  2ZNT A;  1UTH A;  4OEV A;  2QSX A;  3Q27 A;  3AXF A;  4ND9 A;  3E3K A;  4FOR A;  4QFK A;  3E4R A;  3KFM A;  5CBR A;  1H3D A;  2F78 A;  4ESW A;  2DP8 A;  5FTH A;  1IUD A;  5L9S A;  4N13 A;  4LQ2 A;  2D3I A;  3MZ9 A;  4YB7 A;  3MVY A;  4Q8R A;  5I2K A;  1SYH A;  4R2B A;  4G68 A;  1FW0 A;  3B6T A;  5KCJ A;  4UA8 A;  1B3L A;  3C32 A;  4OEU A;  4RA1 A;  4ELP A;  2OWS A;  3TTL A;  1FTL A;  1VE4 A;  1Y3P A;  3GBB A;  1JW4 A;  1NH8 A;  2XD3 A;  3QSL A;  3M3L A;  1UIV A;  4OER A;  4ZDM A;  5CI5 A;  1N3W A;  2CZL A;  1ZKB A;  5DVF A;  1MY0 A;  1LAH E;  4O3A A;  2O69 A;  1LAG E;  1D9Y A;  1URG A;  3K6W A;  2F36 A;  2QMW A;  3PPR A;  3O66 A;  1B51 A;  1B3G A;  1GV8 A;  4BDR A;  4F29 A;  1BTJ A;  1HSJ A;  2XXQ A;  2RF1 A;  1Y4C A;  2D5W A;  1IXI A;  5H8N B;  1FQA A;  4JBZ A;  3T9X B;  1SVX B;  2ABH A;  2X7P A;  2UVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...