1ATGA

Azotobacter vinelandii periplasmic molybdate-binding protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
231
structure length
231
Chain Sequence
ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYVLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand size is a major determinant of specificity in periplasmic oxyanion-binding proteins: the 1.2 A resolution crystal structure of Azotobacter vinelandii ModA.
pubmed doi rcsb
molecule tags Binding protein
molecule keywords PERIPLASMIC MOLYBDATE-BINDING PROTEIN
total genus 80
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1atgA02
2DXYA 4HCWA 4ZEFA 2Q89A 4F3SA 5AA2A 3CFLA 1JW5A 4OWDA 3HHGA 1JEUA 2ONKE 3KZGA 4Q5TA 4LUBA 3OXNA 3TTKA 4C0RA 3MW0A 1B6HA 3O66A 1SBPA 3K2DA 2QS2A 4FE8A 1H3DA 4OEVA 3DLNA 1D3KA 1A40A 2I3WA 3VE1B 2H99A 3RTWB 1UIVA 3E9XA 4KYDA 4OYVA 1SD3A 1NL5A 3CFXA 5LOMA 1M5DA 3K1NA 2THIA 3C9HA 4LZ7A 3U93A 4ZECA 1O7TA 1IEJA 5AE4A 3E3KA 1FQEA 4GXAA 4MFIA 2Q9TA 4XIGQ 4DCYA 3K0VA 3RQTA 1VFDA 5HPQA 1XVYA 3CG1A 3KSJA 3PUYE 1OQGA 4O3BA 1LAXA 1KWHA 1D9VA 2Z8EA 3RGYA 2UYEA 1P1WA 3KN3A 4RPNA 2HZKA 1MXUA 2DOJA 3P7IA 3OEKA 1UQWA 4RNSA 2V84A 1B58A 2GH9A 1MQHA 1WDNA 2XXYA 2YLNA 2VP1A 3A3UA 2DE3A 3FV2A 2H9BA 4YKJA 2Z23A 5TPAB 3LSXA 3RY3A 1B1HA 1TFAA 4HW8A 4QSCA 4E0WA 2O7IA 2D3IA 4R6YA 3E13X 4U21A 2GFEA 3VXCA 5KCJB 4KPTA 1TT1A 3PV0E 1PBQA 1PDAA 1A7LA 1NH7A 4WEDA 3KGCA 4DE8A 3M3LA 1Z7ME 1USYE 4X1DA 3G3FA 3N6UA 4G68C 3ZKLA 2HXWA 1HSJA 5JTYA 2XXTA 2ZNUA 3M8UA 3C31A 2QSXA 4ZEKA 4H8IA 4LQ2A 4DIGA 3CG3A 3IK6B 3RTFB 1UTHB 4OFJA 3T9HB 3MVXA 1MQIA 1J1NA 2NXOA 2Y7RA 4K3FA 3KFMA 4ZS9A 2Q8JA 4NF4A 4NE4A 5FTIA 2DQVA 2Q2CA 4TLLB 3IB2A 4ELRA 3MVYA 3T96B 5BUUA 4ESXA 4RXLA 2V3QA 4MBPA 3SEWA 3VFJA 1MDQA 4UA8A 4O3AA 2IA4A 5I56A 1FTKA 4ZEIA 5ICTA 3Q28A 5CRYA 3S9EA 2RC9A 3C34A 4KYEA 4F1YA 4PQJA 2HCAA 5L9MA 1ZIUA 2ESNA 3ODBA 1SI1A 4GXSB 2RINA 3KOTA 3MP8A 2P0SA 4H67A 4FORA 2X26A 4H6DA 4C1TA 4PFTA 4F3GA 1PC3A 5I59B 3LUYA 3K1MA 5HBCA 1R6ZA 3CVGA 2H5YA 2HEUA 1SW4A 1II5A 2VD3A 3MP1A 3R6UA 4I9DA 4ECFA 4F2OA 3IX1A 4R9GA 4F3BA 1B0LA 1GR2A 3CI8A 1R1NA 3LSWA 4OVJA 3RUMA 3TAJA 1FQBA 3FATA 1QKBA 3H7MA 4PFYA 3T66A 3K6VA 4OXVA 3IO6A 3KG2A 3SEXA 1SQYA 3OSRA 4GFRA 2PX1A 3TPAA 1IXHA 4QF9A 4IO5A 4XKPA 3GLBA 4BDRA 1POY1 1B05A 3DELB 4R9FA 2BJJX 3PU5A 3ONMA 1ZU0A 3W15C 4ZE8A 3MUQA 1Y3NA 2Z8DA 3R7XA 4EF1A 5CMKA 1A8EA 5EHSA 3PD8A 1BP5A 4BDLA 1UIUA 2UVJA 2GHAA 1PB7A 1MY1A 3A09A 3QXMA 4YB7A 4YMAA 2UXAA 1MQGA 1HSEA 2OLBA 1HSLA 2NWJA 2V93A 3S4UA 1I6QA 1B40A 3MPKA 5CBSA 3EHSA 3ILTB 4JDFA 2DWHA 5AA4B 5IAIA 4RPOA 5KZTA 1I6AA 3SEYA 1Y3PA 2QRYA 2F6GA 2OZZA 2XD2A 3IOVA 4IO4A 1URSA 4X1BA 4X9TA 3O6HA 3O2AA 4IO7A 3PMWA 4RY1A 3IO4A 4F1VA 2OWSA 2VOZA 4RYAA 1VFEA 3GXAA 1B5HA 4ELPA 1LCFA 2I4CA 4NWCA 4BLAA 4N6PA 2QPQA 1QULA 3ZSFA 3BKIB 3PMVA 5I2NA 2QS3A 4BDMA 3ILUB 5EYFA 1B3FA 2PT1A 4U23A 3PPRA 3UK4A 4MLQA 3TKDA 1AH5A 3TQLA 5A5XA 3B6QA 1B7ZA 2O6AA 1R9QA 3CR9A 4NF5A 2V3TA 4R75A 5DEXA 3FGSA 3SETA 4F31B 3B7DA 3FXQA 2ALUA 3IR1A 4MLVA 4M4GA 5DYHA 5H8FB 5I57B 1CB6A 2O51A 5AA3A 1B2HA 3C4MA 3PPQA 5ICQA 1O64A 3UN6A 4XTCQ 5CMMA 4KCDA 2W7YA 3K1PA 5H8FA 3TFLA 2DWIA 2F7AA 3FV1A 3TUSA 3I6VA 3PUVE 4KFQA 3ZS6A 5I2KA 2ANJA 1MG1A 3FXUA 3EHUA 1AIVA 3E4RA 4IY5A 1US5A 1SVXB 4YU0A 4GL0A 3Q27A 4GF8A 3RT8A 4AB6A 3MJNA 3B6TA 1JETA 2REGA 2XX7A 4M1VA 4NF8B 2O1LA 3TODA 2ZXTA 3EQ1A 4NEDA 1R9LA 3CRBA 1MY4A 1NKXA 1SYIA 1GGGA 1ZMGA 4Q0CA 5F7VA 3UGWA 4GLIA 5H8NA 4YKPA 5CMBA 3TTMA 1JVXA 2DWJA 1DTZA 2H4IA 2P2AA 3MZ1A 4NTLA 1Z7NE 1TXFA 2YJPA 2R71A 2QS1A 1MY3A 2ZMBA 4TQUQ 4JB7A 5TP9A 4F2QA 3O97A 3F11A 3TEPA 4JWOA 3KJTA 1IITA 4H0WA 4EQBA 1MH3A 2B65A 3KN8A 3G3IA 4EQ7A 4OHNA 1B7UA 3MQ9A 2F35A 5DT6A 2Q88A 1DSNA 4HCYA 1SYHA 2PYYA 4GIZA 4O3CA 2QMWA 4QFNA 4DXUA 2F97A 4U22A 3QUFA 3T9XB 1N3XA 3JZJA 2HAUA 3FJMA 4FJPA 1P1QA 4H5GA 4JXIA 3U94A 4BDOA 3FZVA 5H8QA 4G68A 1OQHA 3FVGA 1A55A 3O6IA 1N7XA 1MQDA 1S9TA 4GVOA 3S9LC 1QUIA 1M5BA 1MRPA 2OK2A 3HV1A 3IAZA 4OFLA 4Q8RA 1YAEA 3K01A 2AYSA 4JSDA 4PFWA 5CI5A 2B3FA 2I0CA 4H65A 2DE4A 5CBRA 3BFTA 4EQ9A 4R74A 2XXVA 2R6GE 1M5CA 1MY0A 5BWJA 4POXA 2ZNTA 3MVZA 4FIMA 2I48A 2V25A 5L8DA 2A5TA 1PB8A 4F39A 1RYXA 1P1NA 2M8CA 3QSLA 1NNTA 3S9NC 5KDTB 5I56B 2NOOA 3H3GA 5JK4A 5L9OA 1Q35A 3VLWA 4PE5B 3T9VA 3LSLA 2XXXA 3TYHA 4BDNA 1FTJA 4OFOA 1SW2A 2H98A 4ISUA 4PFUA 4YKIA 4IGTA 4ZE9A 1H45A 3K6WA 5FTHA 3GBBA 5DVJA 2I4BA 3OO9A 1TWYA 4R2FA 4XKRA 1LFIA 5ITOA 3S9MC 1NNPA 2F7CA 3IORA 1JQFA 2X7QA 3K00A 3OELA 3V89B 1URDA 1DPEA 2AL4A 4G2ZA 3H03A 4QRZA 2F6PA 1JEVA 4LA9A 4I8CA 4YB5A 4JWYA 5F1QA 1EH3A 3W9WA 1Y3QA 2ZYKA 1FQCA 4QHQA 1MXZA 4IB2A 1MXWA 1XVXA 1B3EA 1MQJA 4I1DA 3OSQA 1MPCA 1Y1ZA 1N7WA 2QL3A 2V3UA 3HN0A 1QVSA 3K6XA 2E0SA 3N26A 3O9PA 4IGRA 4NF8A 3UORA 4EXLA 2F34A 1ZTYA 2HZLA 1Y20A 1SW1A 2ABHA 2R9JA 3H6WA 4UACA 2XXQA 3FJ7A 3MPLA 3PUXE 2DXRA 2UYFA 3FXRA 4QFLA 4LVQA 3CSBA 3VVFA 2XX9A 3FASA 4G8MA 3C35A 4X48A 1ANFA 4PETA 4NF6A 1XT8A 5FHNA 1OMPA 4U2RA 1M5EA 1GV8A 1QKAA 1MXYA 3SESA 4KI0E 4DXCA 1EU8A 4KR5A 2RC8A 4ONYA 2X7PA 1IXCA 1MM7A 1BIYA 2KLFA 2WKYA 2H25A 2Y7IA 2O84X 3IOTA 4IO2A 5I58B 3TTNA 1JW1A 2DVCA 3I3VA 4DZ1A 4EXKA 3I5OA 3D4CA 3MZBA 4F3PA 2E1SA 2D21A 2PT2A 1JVYA 3FUZA 4ELOA 4GL8A 2RC7A 2OWTA 4N07A 4PP0A 5B7DA 2RKMA 4HTGA 3VVDA 5A5XB 1P1OA 4OZ9A 4ZEBA 5K2YA 2UVGA 3FVNA 4AB5A 3RT6B 4DLDA 1NH8A 3THIA 4TOZA 4JWXA 4KQPA 1BLFA 1WVJA 3TMGA 1VE4A 5DTBA 2DVZA 1EZ9A 1US4A 4G4PA 1B3LA 4RJZA 5ISUA 1BTJA 1IZ1A 3C32A 1IQ7A 5DVFA 2F78A 2ZNSA 2I6EA 1MM6A 4QSEA 2Y7KA 3SDFA 1QW0A 4G77A 1FTOA 4FECA 3RLFE 4RK2A 3RN8A 4NF5B 1B0HA 4GRKA 4KD5A 3U92A 3KSXA 4AQ4A 3L6HA 1B5IA 1DPPA 2D5WA 1YCJA 4DDDA 1VSOA 2O69A 1FTMA 2A5TB 2P1SA 1LB8A 1CE2A 1OLCA 1RKMA 1Y4TA 3M3FA 4OQOA 3O28A 4Q30B 4R73A 4IO3A 3OD7A 1LLSA 5CMCA 2F36A 4WEPA 5AA4A 4ZZAA 2G29A 3GZGA 1LAGE 2AL5A 1FTLA 1LBBA 2HAVA 3MC2A 4LZ8A 1JW4A 5JTYB 1OVBA 3S2VA 5AA2D 1FQAA 1NNFA 1A8FA 1L5TA 4LONB 5H8HB 1MPBA 2ZYNA 5KCJA 2LAOA 4R72A 3PPPA 1B32A 4POWA 3EHTA 1OIBA 4QFOA 1LAFE 3EN3A 3QAXA 1T0KA 2AIXA 3G3HA 4Z7EA 1FW0A 1MS7A 4XKNA 4Z0IA 1XC1A 1MXVA 3IJXB 3Q29A 5I2NB 1IUDA 3N94A 2HQ0A 4H8JA 3N5LA 3MBPA 3SERA 3PPOA 1UTBA 4G8NA 3QIMA 4KYSA 3HO7A 2I3VA 1MH4A 2RCBA 3N6TA 4NF4B 1XS5A 5I84A 1FQDA 2DSFA 1N76A 2XXPA 3T93B 5I57A 1LFGA 2I0BA 1F9BA 3CIJA 4IO6A 1LB9A 1N0TA 2DP8A 2I49A 3LR1A 4R6HA 5M2VA 1EZOA 1B9JA 1B4HA 3EF7A 3KEIA 3HSTA 3IB0A 4L17A 5H8SA 3WAEA 4ELQA 1B52A 4P0GA 4WKMA 5ITPA 2XXIA 5TPAA 1LSTA 4OEUA 1USYH 2Y84A 5I2KB 4FEBA 1P99A 2XXUA 2XXHA 2ZYMA 1H76A 1N3WA 3IB1A 3TELA 1B3GA 3SEUA 4EUOA 4FATA 3G3JA 4MH5A 4R6KA 3SKPA 4WXJA 2Z8FA 3UIFA 3L6GA 3VVEA 5K2XA 4GWOA 2RF1A 3FVOA 1ATGA 1B51A 3KJ7A 5B70A 5L9SA 5CM6A 2XXWA 4OENA 2Y7PA 1LCTA 3OO7A 4G68B 3MP6A 1A99A 2PVUA 3ECRA 3IL1B 1S50A 3LBSA 4JBZA 1SI0A 1AL3A 2FNCA 4RK9A 2GHBA 3K6UA 1JNFA 3C36A 2FA7A 4KHZE 4YICA 4IY6A 5DVIA 1Y4CA 1MPDA 3FIRA 1ZJLA 3OMBA 4LQ5A 1LAHE 4OMBA 3UA8A 1N84A 3IOUA 4ZEDA 3TCGA 5TP9B 3T9UA 1QJMA 4LZ5A 2ZYOA 4LATA 2NVUB 2UVHA 3K02A 3A3CA 3FD3A 4YMBA 4NWDA 4XXUA 2G93A 2XD3A 3DP8A 1D9YA 1XOCA 2VD2A 5H8NB 2B3BA 2QJEA 4FAJA 3JYRA 3SEVA 2ONRA 1LGBC 1YTVA 3V8XB 2VGQA 3R26A 3Q25A 3TCHA 3VDFA 4OESA 3GBAA 4NMYA 5I59A 4H5FA 5EHMA 2RCAA 2VHAA 4N13A 1PBPA 1DTGA 3U72A 5AA2B 3MVWA 3TDJA 4BDQA 1EZPA 4OTEA 1DOTA 1VR5A 3OO8A 3VLVA 3TTRA 1OLAA 3DM0A 2IEEA 3OEMA 4U4SA 5H8QB 4ESWA 4F1UA 3KOSA 4EF2A 1I6BA 1FCKA 4YAHX 4KCCA 3KBRA 3ZKKA 1YPNA 4EDPA 3JV9A 4QSDA 3OO6A 4GD5A 1Y1MA 1PEBA 3H06B 4JSOA 1O63A 5H8HA 2REJA 4OETA 1ZLQA 3RNNA 2OCUA 3WAFA 4MF3A 4GOTA 1IXIA 5DEXB 1H43A 2GRVA 3EPEA 2UVIA 4RA1A 2YPNA 2PMSA 3K4UA 3D4GA 2Q2AA 4TLMB 3RPWA 4E0XA 3H6UA 3O29A 5AA1A 4F22A 2F7BA 4ZZEA 1I69A 3IOWA 1OVTA 1M5FA 3PMXA 4P0IA 1IIWA 1N04A 1QUJA 1S7YA 1B1XA 1SW5A 1WODA 2OBGA 3OENA 3Q26A 2NUVA 4HS7A 1NNKA 1ELJA 4XKQA 5HM4B 4C1UA 1UTBB 3FVKA 4QFPA 5J1DA 4NF6B 1QUKA 3G3KA 4R2BA 1TFDA 2OJTA 4LP2B 4U4XA 2XXRA 4YZZA 4F18A 2XX8A 1SDXA 4YB6A 1AMFA 1A54A 2DE2A 5KDTA 1D4NA 3PUWE 4P11A 2QS4A 3O6GA 1RYOA 4YKKA 2F5XA 2A5SA 3BBRA 1XHYA 3PGFA 3U8QA 3M3KA 3C33A 3PUZE 2DS9A 3DP6A 3IJOB 3V5AA 2O1MA 3BFUA 4F29A 4F19A 3UP9A 1LFHA 1NFTA 4ZDMA 3FJGA 1ZBMA 3TCFA 3HPIA 3AXFA 1BKAA 1UTHA 3MWBA 3TTLA 1DMBA 3VXBA 4DXBA 5JEIA 3V83A 2F8DA 4ND9A 3QK6A 1Y9UA 3CFZA 1POTA 3LSFB 4U1ZA 4FEDA 3MAMA 3U1OA 5TU0A 1URGA 3PPNA 1GVCA 3USDA 3H6VA 1PB9A 1FQFA 2HFBA 1IXGA 3G7WA 1MXXA 2XHDA 2DWAA 3H6TA 3OOAA 3G3GA 2Y7WA 1B7HA 1MDP1 1ZKBA 4U1OA 3VLUA 3QYTA 5FHOA 5IKBA 3HHFA 1MY2A 1NMUA 2FYIA 5ELVA 1B3HA 1Q1KA 2CMOA 2O68A 3HCQA 4GQOA 4H1XA 4DCXA 3TZAA 4THIA 3W9VA 2QMXA 2I58A 5CC2A 4QFKA 3LC8A 3H4ZA 2Z22A 3DP4A 1B4ZA 2O7UA 3CSGA 3KN7A 5FHMA 4OERA 3MZ9A 2PBWA 2ONSA 3T22A 1B46A 4I62A 3TQWA 4G8HA 5I58A 1AOVA 1H44A 1P1UA 3PD9A 3QUJA 1B5JA 1LBCA 1GTKA 3B6WA 3VV5A 2CZLA 2DYXA
chains in the Genus database with same CATH superfamily
4I3EA 4ZEFA 2Q89A 1QGXA 1JW5A 3KZGA 3OXNA 1SBPA 1RDZA 4OEVA 1D3KA 2I3WA 2H99A 1UIVA 4KYDA 4OYVA 1NL5A 3C9HA 1IEJA 3E3KA 4DCYA 1XVYA 1KWHA 1D9VA 2Z8EA 3RGYA 1FPKA 1MXUA 1UQWA 5I5PA 1JP4A 2VP1A 2H9BA 3RY3A 4HW8A 4E0WA 4U21A 2BJIA 4KPTA 1TT1A 1PDAA 2HXWA 1FPJA 3C31A 4NHBA 1D9QA 3RTFB 1UTHB 3MVXA 2NXOA 2DQVA 4QBAA 1FBGA 4ESXA 2V3QA 3VFJA 5ICTA 3S9EA 4F1YA 5L9MA 3MP8A 5I59B 4GX3A 3BIGA 3CVGA 2HEUA 2VD3A 3FXBA 1KA0A 2KR0A 3IX1A 4F3BA 1R1NA 3RUMA 5FBPA 4GFRA 3TPAA 3W15C 1Y3NA 4MX6A 4GX6A 2UVJA 1MY1A 4O8MA 4YB7A 2UXAA 1HSEA 3KBZA 1HSLA 5IZZA 1FPLA 5AA4B 2DWHA 2B4LA 4RPOA 5IZ1A 2F6GA 4X9TA 3MYUA 4RY1A 2OWSA 4RYAA 1VFEA 4ELPA 4BLAA 3ZSFA 3BKIB 5I2NA 4BDMA 1AH5A 4R75A 3CR9A 3SETA 5DEXA 3FGSA 5ESYA 4F31B 2FHYA 3FXQA 5H8FB 1CB6A 5AA3A 1B2HA 1O64A 2P3NA 3TUSA 5EYGA 3EHUA 4IY5A 1SVXB 4GL0A 4AB6A 3B6TA 1JETA 2CEYA 2REGA 4NF8B 4P56A 2O1LA 3TODA 1MY4A 4GLIA 5CMBA 3TTMA 3MZ1A 1Z7NE 5TP9A 1MY3A 4F2QA 1LBXA 1IITA 4H0WA 4NG7A 3MQ9A 4DXUA 2QMWA 4OVPA 4U22A 3T9XB 1N3XA 3JZJA 3FJMA 4H5GA 3O6IA 1A55A 4GWSA 1MRPA 2CEXA 1YAEA 1NV4A 4PFWA 4JSDA 2I0CA 4EQ9A 5J1DA 4F39A 2V25A 5L8DA 2A5TA 2QVRA 1RYXA 1P1NA 2M8CA 3QSLA 1NNTA 2KQZA 4N4UA 1FPDA 4MIJA 3H3GA 3GYYA 5L9OA 3VLWA 1FTJA 2QVVA 4ISUA 4IGTA 1INPA 3K6WA 5FTHA 3GBBA 2I4BA 4R2FA 1RDXA 3OELA 1JQFA 3K00A 2HXRA 3V83A 5F1QA 1Y3QA 1FQCA 1MXZA 2NWJA 1MPCA 1Y1ZA 3N26A 4GWUA 2F34A 1SW1A 3LUZA 2XXQA 3MPLA 3FXRA 4XEQA 3CSBA 3VVFA 4G8MA 4U2RA 1GV8A 1FBHA 3SESA 4DXCA 1BIYA 2Y7IA 2O84X 3T0JA 4EXKA 3LV0A 3I5OA 4F3PA 2D21A 4PAIA 4HTGA 5K2YA 4OZ9A 4AB5A 2UVGA 4LN5A 5DTBA 1B3LA 3SDFA 4RK2A 3KSXA 1VSOA 2O69A 4Q30B 3OD7A 4OVSA 4HE0A 2AL5A 1FTLA 1JW4A 3S2VA 1OVBA 5AA2D 1FQAA 4LONB 1MPBA 2LAOA 1K9YA 1NUXA 4POWA 1MXVA 3Q29A 3N5LA 3PPOA 4N6KA 2Q74A 4KYSA 5I84A 1MH4A 2DSFA 1N76A 1AWBA 2I0BA 3CIJA 1B9JA 3IB0A 4P0GA 4OEUA 1USYH 5H8FA 5I2KB 1NV1A 1N3WA 1B3GA 4WXJA 3L6GA 3FVOA 4MEVA 5B70A 2ZZWA 1BK4A 1LCTA 4G68B 3MP6A 1A99A 3IL1B 1S50A 4JBZA 1SI0A 2FNCA 1JNFA 4PGPA 1Y4CA 3OMBA 1N84A 3T9UA 4LATA 2NVUB 3K02A 3A3CA 1VDWA 2XD3A 3DP8A 2VD2A 2QJEA 2ONRA 3Q25A 4N13A 5AA2B 3MVWA 3TDJA 1DOTA 3VLVA 1OLAA 2XXKA 3OEMA 3KBRA 1DBZA 4GD5A 1NV5A 2REJA 4OETA 1ZLQA 3WAFA 4OVRA 1H43A 3K4UA 4F22A 3H6UA 2XWVA 3IOWA 1IIWA 1B1XA 1SW5A 3Q26A 4XFEA 4C1UA 1UTBB 4NF6B 1TFDA 2OJTA 4U4XA 4N17A 4HE2A 1IMFA 1D4NA 2QS4A 2F5XA 3PGFA 3U8QA 3MSTA 3C33A 2DS9A 3IJOB 3BFUA 1NFTA 3TCFA 3HPIA 1BKAA 4P1LA 5ET5A 4U1ZA 4FEDA 3MAMA 3USDA 2HFBA 1IXGA 1MXXA 2DWAA 1EYIA 1B7HA 1MDP1 1NV7A 3VLUA 5ELVA 4MAGA 2O68A 4DCXA 2QMXA 3DP4A 5FHMA 4OERA 2WBBA 2ONSA 4G8HA 2JJKA 4HCWA 3TTKA 4Q5TA 1YXIA 4C0RA 2QS2A 4FE8A 1H3DA 1CNQA 3VE1B 1A40A 5LOMA 3CFXA 1M5DA 2THIA 4ZECA 4GXAA 4XIGQ 4NF0A 5HPQA 3KSJA 3PUYE 5F24A 4O3BA 1LAXA 4RPNA 3KN3A 2V84A 1B58A 2XXYA 1MQHA 1WDNA 4WKMA 4QFKA 2DE3A 2Z23A 5KCJB 2D3IA 1G0HA 3E13X 1PBQA 4WEDA 3M3LA 3G3FA 4G68C 3ZKLA 1HSJA 2ZNUA 3M8UA 2QSXA 4ZEKA 3CG3A 1KZ8A 4JVCA 4OFJA 1MQIA 4K3FA 4ZS9A 3KFMA 5ET8A 1NUYA 4NF4A 5FTIA 2Q2CA 4TLLB 5BUUA 1NV6A 5I56A 1FTKA 3Q28A 5CRYA 2HCAA 1ZIUA 3B50A 4GXSB 2RINA 3KOTA 2P0SA 4H6DA 4FORA 2X26A 4C1TA 4P3LA 2H5YA 1II5A 4F2OA 4R9GA 1B0LA 3CI8A 3FATA 4GWXA 1QKBA 4QF9A 2PFYA 4IO5A 3GLBA 4PC9A 4BDRA 1POY1 1B05A 3DELB 4R9FA 3MUQA 1A8EA 1UIUA 2GHAA 4YMAA 1I6QA 1FRPA 5EQ7A 1FPGA 5IAIA 5KZTA 2QRYA 3IO4A 1B5HA 1LCFA 4NWCA 4PFRA 2WYPA 4U23A 3UK4A 3PPRA 5A5XA 2HPGA 3B6QA 4NF5A 1R9QA 2V3TA 4M4GA 5I57B 4KCDA 3IFCA 1FJ9A 3TFLA 3FV1A 3E78A 2ANJA 1MG1A 2PCRA 1US5A 3MJNA 2ZXTA 1NKXA 4N8YA 3UGWA 4YKPA 4PAFA 2P2AA 1FSAA 1TXFA 2YJPA 4JB7A 3IFAA 3KJTA 1MH3A 2B65A 3D1RA 5ET7A 4QFNA 3B8BA 2F97A 3QUFA 3U94A 4JXIA 1DK4A 5H8QA 1OQHA 1N7XA 1MQDA 1S9TA 4GVOA 2AYSA 5CI5A 4H65A 3BFTA 1M5CA 3MVZA 4FIMA 2I48A 4P1EA 5EYHA 2NOOA 3LSLA 2WBDA 2H98A 4PFUA 2VPOA 1H45A 3OO9A 1TWYA 4N91A 1URDA 1DPEA 3H03A 4YB5A 2F6PA 1EH3A 4I1DA 1MQJA 1N7WA 2QL3A 3O9PA 3UORA 2E0SA 2V4CA 4NF8A 1Y20A 2ABHA 4UACA 3PUXE 4LVQA 2XX9A 4XF5A 1ANFA 2DDKA 4OVTA 4KI0E 1LBZA 4KR5A 4MNIA 1MM7A 3IOTA 5I58B 2PT2A 1DCUA 2FBPA 2OWTA 2RKMA 3FVNA 3TMGA 1EZ9A 5ISUA 1IZ1A 3C32A 1IQ7A 5DVFA 2F78A 2Y7KA 4PBQA 4FECA 3RLFE 3U92A 4KD5A 4AQ4A 2D5WA 1YCJA 2A5TB 3M3FA 1LBYA 4R73A 4N15A 2F36A 3RPLA 1LAGE 3MC2A 4NQ8A 5H8HB 2ZYNA 4R72A 1OIBA 4QFOA 4PDHA 3EN3A 4MJOA 1T0KA 2AIXA 1FW0A 1MS7A 1FPFA 4PGNA 4Z0IA 2HQ0A 4H8JA 3HO7A 2I3VA 3N6TA 1XS5A 1FQDA 3T93B 5M2VA 1EZOA 5H8SA 3HSTA 5EQ8A 2XXIA 1P99A 2XXUA 2XXHA 2ZYMA 1H76A 3TELA 4EUOA 3SEUA 3T1BA 4MH5A 4GWZA 4OENA 3OO7A 3ECRA 3LBSA 1AL3A 3K6UA 3C36A 2FA7A 4IY6A 1AIVA 2F3DA 1LAHE 4OMBA 3UA8A 4ZEDA 2ZYOA 4N81A 2UVHA 4XXUA 2G93A 2VPNA 1LGBC 2VGQA 3VDFA 4OESA 5I59A 2VHAA 1PBPA 1DTGA 4BDQA 3OO8A 1VR5A 4U4SA 4F1UA 4ESWA 5IGAA 1FCKA 4YAHX 4KCCA 1YPNA 4JSOA 3RNNA 2OCUA 4GOTA 2GRVA 3EPEA 2UVIA 2PMSA 2Q2AA 4E0XA 1I69A 2WEFA 1N04A 2NUVA 4QFPA 1QUKA 4LP2B 4F18A 1A54A 1NUWA 3O6GA 3BBRA 3UP9A 3FJGA 1DMBA 3VXBA 4DXBA 4ND9A 5J16A 3G7WA 4HXVA 3H6TA 1ZKBA 3QYTA 1NMUA 1B3HA 1Q1KA 4H1XA 3W9VA 2I58A 2P3VA 3LC8A 5LDZA 3H4ZA 2PBWA 3TQWA 1AOVA 1P1UA 3QUJA 4DI3D 4DI4B 3B6WA 3VV5A 5AA2A 4F3SA 3CFLA 4OWDA 3HHGA 4LUBA 3MW0A 1B6HA 3O66A 3RTWB 3E9XA 3K1NA 4LZ7A 3U93A 1O7TA 5AE4A 1FQEA 4MFIA 2Q9TA 3K0VA 3RQTA 1VFDA 3CG1A 2Y5KA 1OQGA 2UYEA 1P1WA 2DOJA 3OEKA 4RNSA 4YKJA 5TPAB 3LSXA 2O7IA 2GFEA 1FBPA 1NH7A 4PBHA 4DE8A 1Z7ME 1USYE 3N6UA 4DIGA 4LQ2A 2Y7RA 1J1NA 4NE4A 3IB2A 3T96B 4RXLA 3SEWA 4GWYA 1MDQA 4O3AA 2IA4A 4ZEIA 3BIHA 3C34A 3ODBA 1SI1A 5IZ3A 4NAPA 1PC3A 5I7IA 1R6ZA 4PFBA 3R6UA 4I9DA 4ECFA 3LSWA 4OVJA 3H7MA 4PFYA 3T66A 3K6VA 3KG2A 1SQYA 2PX1A 1IXHA 4I40A 4XKPA 3ONMA 1ZU0A 2ZZVA 3R7XA 5CMKA 4N8GA 5EHSA 3PD8A 1PB7A 3A09A 3CHGA 4OANA 1B40A 3MPKA 5CBSA 3EHSA 3ILTB 3NOHA 1I6AA 3SEYA 1Y3PA 3IOVA 2XD2A 4X1BA 3O6HA 5T3JA 4IO7A 5ET6A 3PMWA 1FJ6A 4MLQA 1B7ZA 2ALUA 3IR1A 5DYHA 2O51A 3PPQA 3UN6A 1IMBA 4XTCQ 2W7YA 3ISPA 2F7AA 4IR8A 3ZS6A 5I2KA 3E4RA 3Q27A 2XX7A 4M1VA 3CRBA 1ZMGA 4MNCA 4Q0CA 5F7VA 5H8NA 1RDYA 2DWJA 2R71A 3O97A 2FVZA 2QVUA 1FBDA 4EQBA 4MCOA 3KN8A 4EQ7A 4H45A 1B7UA 2F35A 2Q88A 1DSNA 4O3CA 4GIZA 2PYYA 4PAKA 4FJPA 4BDOA 4G68A 1FBEA 1QUIA 2OK2A 3IAZA 4OFLA 3K01A 2B3FA 2DE4A 4R74A 2XXVA 1MY0A 4POXA 2ZNTA 1PB8A 5JK4A 1Q35A 2XXXA 1SW2A 2CZKA 1IMDA 5DVJA 5ITOA 3S9MC 2F7CA 3IORA 4G2ZA 4LA9A 4I8CA 4QHQA 1KA1A 1MXWA 1B3EA 4AS4A 3OSQA 3E79A 2V3UA 4IGRA 1QVSA 2HZLA 2UYFA 4QFLA 2CZIA 3A29A 4X48A 4MMPA 4NF6A 5FHNA 1OMPA 1MXYA 2PFZA 2RC8A 4ONYA 2X7PA 2KLFA 2H25A 4IO2A 1JW1A 2DVCA 3I3VA 3MZBA 5B7DA 1YZ0A 1P1OA 1XI6A 4TOZA 4JWXA 1SPIA 4KQPA 1VE4A 2DVZA 4OA4A 4NN3A 1NV0A 2I6EA 1MM6A 2DYXA 1QW0A 4G77A 1FTOA 4GRKA 1DPPA 4DDDA 1FTMA 1Y4TA 1RKMA 3O28A 4IO3A 5CMCA 1LLSA 5AA4A 4ZZAA 4O94A 2G29A 1LBBA 4P47A 4LZ8A 5JTYB 1A8FA 1NUZA 5KCJA 3EHTA 1FTAA 3KC1A 3QAXA 4Z7EA 1K9ZA 1LEVA 1XC1A 5I2NB 1IUDA 3N94A 3MBPA 3QIMA 4NF4B 5I3SA 3U65A 1LBWA 1LFGA 1LB9A 1N0TA 2I49A 4R6HA 1NI9A 3EF7A 4L17A 3WAEA 4ELQA 1B52A 2CZHA 3SKPA 2Z8FA 3UIFA 3VVEA 5K2XA 2RF1A 5CM6A 2XXWA 4PE3A 1YYZA 2PVUA 4RK9A 4KHZE 4YICA 1MPDA 3FIRA 3IOUA 5TP9B 1QJMA 3FD3A 5H8NB 1D9YA 4FAJA 3JYRA 3V8XB 3R26A 3TCHA 4H5FA 2RCAA 1I6BA 3RPLB 3ZKKA 3JV9A 4QSDA 3OO6A 1Y1MA 3H06B 3ROJA 5H8HA 1FBCA 4JVIA 2F3BA 1IXIA 4P9KA 4RA1A 3RPWA 3O29A 4PF8A 5AA1A 2F7BA 1OVTA 1M5FA 4P0IA 4EF1A 1S7YA 5A5XB 2OBGA 4HS7A 1ELJA 4XKQA 3FVKA 3G3KA 4P8BA 2XXRA 4YZZA 4YB6A 1AMFA 2DE2A 3PUWE 4P11A 1RYOA 2OWZA 4YKKA 2A5SA 3DP6A 3V5AA 5LTCA 4F29A 4F19A 1LFHA 4ZDMA 1ZBMA 3AXFA 1LBVA 1UTHA 2WX9A 5JEIA 2F8DA 5DW8A 3QK6A 1POTA 4PFIA 5TU0A 1GVCA 1FPIA 1FQFA 2XHDA 4AS5A 2XWKA 4U1OA 3HHFA 3HCQA 4GQOA 3T22A 1B46A 3PD9A 1B5JA 5EQ9A 2DXYA 1JEUA 2L5VA 2ONKE 3K2DA 3DLNA 1SD3A 5EQAA 4PTKA 2HZKA 3P7IA 2GH9A 2YLNA 3A3UA 3FV2A 1B1HA 1TFAA 1EYKA 4QSCA 3VXCA 4R6YA 3PV0E 1A7LA 3KGCA 2GQ1A 4X1DA 5JTYA 2XXTA 1IMCA 4H8IA 3IK6B 5A5LA 2WYKA 2Q8JA 1G0IA 2MKZA 4ELRA 3MVYA 4MBPA 4UA8A 2RC9A 2XWIA 4KYEA 4PQJA 2ESNA 4H67A 4F3GA 4PFTA 3LUYA 3K1MA 5HBCA 4O7IA 1SW4A 3MP1A 1GR2A 3TAJA 4GBWA 1FQBA 2VT5A 4OXVA 3SEXA 3IO6A 3OSRA 2QFLA 2BJJX 3PU5A 4ZE8A 2Z8DA 1BP5A 4BDLA 4NX1A 2FIEA 3QXMA 1MQGA 2OLBA 3S4UA 2V93A 4JDFA 2OZZA 4IO4A 1URSA 3O2AA 4F1VA 2VOZA 3GXAA 2I4CA 4N6PA 2QPQA 1QULA 5IM2A 3PMVA 2QS3A 4GWWA 3QMFA 3ILUB 5EYFA 1B3FA 2PT1A 3TQLA 3TKDA 2O6AA 3B7DA 4MLVA 3C4MA 5ICQA 3K1PA 3PTYA 2DWIA 3I6VA 3PUVE 4KFQA 3FXUA 4YU0A 4GF8A 3RT8A 4JVDA 4X04A 4PF6A 4GBVA 3EQ1A 4NEDA 1R9LA 1SYIA 1GGGA 1JVXA 1DTZA 2H4IA 4TQUQ 4NTLA 3RYDA 2QS1A 2ZMBA 3F11A 3TEPA 4JWOA 4FBPA 3G3IA 4OHNA 5DT6A 4HCYA 1SYHA 1IMEA 2HAUA 1P1QA 3FZVA 4HE1A 3FVGA 4UABA 3S9LC 4Q8RA 1M5BA 3HV1A 1FPBA 2FIXA 5CBRA 2R6GE 2OX3A 5BWJA 3EKIA 4QXDA 4N6DA 3S9NC 5KDTB 5I56B 4PE5B 3T9VA 3TYHA 4BDNA 4OFOA 2ZZXA 4YKIA 4ZE9A 4XKRA 1LFIA 1NNPA 2X7QA 3V89B 2AL4A 4QRZA 1JEVA 4JWYA 3W9WA 2ZYKA 5CMMA 4IB2A 1XVXA 4O7MA 3K6XA 3HN0A 3FBPA 4EXLA 1ZTYA 2R9JA 3H6WA 3SZPA 3FJ7A 2DXRA 3FASA 3C35A 4I3YA 4PETA 1XT8A 1M5EA 1QKAA 1EU8A 4H46A 1IXCA 2WKYA 3TTNA 4DZ1A 3D4CA 2E1SA 1JVYA 3FUZA 4ELOA 1FPEA 4GL8A 2RC7A 4N07A 4PP0A 3VVDA 4ZEBA 4DLDA 3RT6B 1NH8A 3THIA 1BLFA 1WVJA 3KC0A 4G4PA 4RJZA 1US4A 1BTJA 2ZNSA 4QSEA 4MHFA 3RN8A 4NF5B 1B0HA 3L6HA 1B5IA 2P1SA 1LB8A 1CE2A 1OLCA 4OQOA 4WEPA 3GZGA 2B4MA 2HAVA 1NNFA 1L5TA 3PPPA 1B32A 1LAFE 1IMAA 3G3HA 4XKNA 3IJXB 3SERA 1UTBA 4G8NA 2RCBA 1EYJA 5I57A 2XXPA 4IO6A 1F9BA 2DP8A 3LR1A 2XA5A 1B4HA 3KEIA 5ITPA 5TPAA 1LSTA 2Y84A 4FEBA 3IB1A 4X8RA 4FATA 5IZ3B 3G3JA 4R6KA 4GWOA 4PDDA 1ATGA 1B51A 3KJ7A 5L9SA 2R8TA 2HHMA 2Y7PA 2GHBA 5DVIA 4LQ5A 1ZJLA 3TCGA 4LZ5A 4YMBA 4NWDA 1XOCA 2B3BA 3SEVA 1YTVA 3GBAA 4NMYA 5EHMA 3U72A 1EZPA 4OTEA 2Y5LA 3TTRA 3DM0A 2IEEA 5H8QB 3KOSA 4EF2A 1Q9DA 4EDPA 1FBFA 2Q8MA 1PEBA 1O63A 4MF3A 2XWOA 5DEXB 2YPNA 4MNPA 4TLMB 3D4GA 4ZZEA 3PMXA 1QUJA 1WODA 3OENA 5HM4B 1NNKA 4R2BA 2XX8A 1SDXA 5KDTA 1XHYA 4G61A 3M3KA 3PUZE 2O1MA 3MWBA 3TTLA 4KXPA 1NV3A 1Y9UA 3CFZA 3LSFB 3U1OA 1URGA 3PPNA 4NGUA 3H6VA 1PB9A 3OOAA 3G3GA 2Y7WA 4OVQA 4GX4A 5IKBA 5FHOA 1MY2A 2FYIA 2CMOA 3TZAA 4THIA 5CC2A 4PCDA 2Z22A 1B4ZA 2O7UA 3CSGA 3KN7A 1NV2A 3MZ9A 4I62A 5I58A 1H44A 1LBCA 1GTKA 3T9HB 2CZLA 3HFUA
chains in the Genus database with same CATH topology
2DXYA 4HCWA 4ZEFA 2Q89A 4F3SA 5AA2A 3CFLA 1JW5A 4OWDA 3HHGA 1JEUA 2ONKE 3KZGA 4Q5TA 4LUBA 3OXNA 3TTKA 4C0RA 3MW0A 1B6HA 3O66A 1SBPA 3K2DA 2QS2A 4FE8A 1H3DA 4OEVA 3DLNA 1D3KA 1A40A 2I3WA 3VE1B 2H99A 3RTWB 1UIVA 3E9XA 4KYDA 4OYVA 1SD3A 1NL5A 3CFXA 5LOMA 1M5DA 3K1NA 2THIA 3C9HA 4LZ7A 3U93A 4ZECA 1O7TA 1IEJA 5AE4A 3E3KA 1FQEA 4GXAA 4MFIA 2Q9TA 4XIGQ 4DCYA 3K0VA 3RQTA 1VFDA 5HPQA 1XVYA 3CG1A 3KSJA 3PUYE 1OQGA 4O3BA 1LAXA 1KWHA 1D9VA 2Z8EA 3RGYA 2UYEA 1P1WA 3KN3A 4RPNA 2HZKA 1MXUA 2DOJA 3P7IA 3OEKA 1UQWA 4RNSA 2V84A 1B58A 2GH9A 1MQHA 1WDNA 2XXYA 2YLNA 2VP1A 3A3UA 2DE3A 3FV2A 2H9BA 4YKJA 2Z23A 5TPAB 3LSXA 3RY3A 1B1HA 1TFAA 4HW8A 4QSCA 4E0WA 2O7IA 2D3IA 4R6YA 3E13X 4U21A 2GFEA 3VXCA 5KCJB 4KPTA 1TT1A 3PV0E 1PBQA 1PDAA 1A7LA 1NH7A 4WEDA 3KGCA 4DE8A 3M3LA 1Z7ME 1USYE 4X1DA 3G3FA 3N6UA 4G68C 3ZKLA 2HXWA 1HSJA 5JTYA 2XXTA 2ZNUA 3M8UA 3C31A 2QSXA 4ZEKA 4H8IA 4LQ2A 4DIGA 3CG3A 3IK6B 3RTFB 1UTHB 4OFJA 3T9HB 3MVXA 1MQIA 1J1NA 2NXOA 2Y7RA 4K3FA 3KFMA 4ZS9A 2Q8JA 4NF4A 4NE4A 5FTIA 2DQVA 2Q2CA 4TLLB 3IB2A 4ELRA 3MVYA 3T96B 5BUUA 4ESXA 4RXLA 2V3QA 4MBPA 3SEWA 3VFJA 1MDQA 4UA8A 4O3AA 2IA4A 5I56A 1FTKA 4ZEIA 5ICTA 3Q28A 5CRYA 3S9EA 2RC9A 3C34A 4KYEA 4F1YA 4PQJA 2HCAA 5L9MA 1ZIUA 2ESNA 3ODBA 1SI1A 4GXSB 2RINA 3KOTA 3MP8A 2P0SA 4H67A 4FORA 2X26A 4H6DA 4C1TA 4PFTA 4F3GA 1PC3A 5I59B 3LUYA 3K1MA 5HBCA 1R6ZA 3CVGA 2H5YA 2HEUA 1SW4A 1II5A 2VD3A 3MP1A 3R6UA 4I9DA 4ECFA 4F2OA 3IX1A 4R9GA 4F3BA 1B0LA 1GR2A 3CI8A 1R1NA 3LSWA 4OVJA 3RUMA 3TAJA 1FQBA 3FATA 1QKBA 3H7MA 4PFYA 3T66A 3K6VA 4OXVA 3IO6A 3KG2A 3SEXA 1SQYA 3OSRA 4GFRA 2PX1A 3TPAA 1IXHA 4QF9A 4IO5A 4XKPA 3GLBA 4BDRA 1POY1 1B05A 3DELB 4R9FA 2BJJX 3PU5A 3ONMA 1ZU0A 3W15C 4ZE8A 3MUQA 1Y3NA 2Z8DA 3R7XA 4EF1A 5CMKA 1A8EA 5EHSA 3PD8A 1BP5A 4BDLA 1UIUA 2UVJA 2GHAA 1PB7A 1MY1A 3A09A 3QXMA 4YB7A 4YMAA 2UXAA 1MQGA 1HSEA 2OLBA 1HSLA 2NWJA 2V93A 3S4UA 1I6QA 1B40A 3MPKA 5CBSA 3EHSA 3ILTB 4JDFA 2DWHA 5AA4B 5IAIA 4RPOA 5KZTA 1I6AA 3SEYA 1Y3PA 2QRYA 2F6GA 2OZZA 2XD2A 3IOVA 4IO4A 1URSA 4X1BA 4X9TA 3O6HA 3O2AA 4IO7A 3PMWA 4RY1A 3IO4A 4F1VA 2OWSA 2VOZA 4RYAA 1VFEA 3GXAA 1B5HA 4ELPA 1LCFA 2I4CA 4NWCA 4BLAA 4N6PA 2QPQA 1QULA 3ZSFA 3BKIB 3PMVA 5I2NA 2QS3A 4BDMA 3ILUB 5EYFA 1B3FA 2PT1A 4U23A 3PPRA 3UK4A 4MLQA 3TKDA 1AH5A 3TQLA 5A5XA 3B6QA 1B7ZA 2O6AA 1R9QA 3CR9A 4NF5A 2V3TA 4R75A 5DEXA 3FGSA 3SETA 4F31B 3B7DA 3FXQA 2ALUA 3IR1A 4MLVA 4M4GA 5DYHA 5H8FB 5I57B 1CB6A 2O51A 5AA3A 1B2HA 3C4MA 3PPQA 5ICQA 1O64A 3UN6A 4XTCQ 5CMMA 4KCDA 2W7YA 3K1PA 5H8FA 3TFLA 2DWIA 2F7AA 3FV1A 3TUSA 3I6VA 3PUVE 4KFQA 3ZS6A 5I2KA 2ANJA 1MG1A 3FXUA 3EHUA 1AIVA 3E4RA 4IY5A 1US5A 1SVXB 4YU0A 4GL0A 3Q27A 4GF8A 3RT8A 4AB6A 3MJNA 3B6TA 1JETA 2REGA 2XX7A 4M1VA 4NF8B 2O1LA 3TODA 2ZXTA 3EQ1A 4NEDA 1R9LA 3CRBA 1MY4A 1NKXA 1SYIA 1GGGA 1ZMGA 4Q0CA 5F7VA 3UGWA 4GLIA 5H8NA 4YKPA 5CMBA 3TTMA 1JVXA 2DWJA 1DTZA 2H4IA 2P2AA 3MZ1A 4NTLA 1Z7NE 1TXFA 2YJPA 2R71A 2QS1A 1MY3A 2ZMBA 4TQUQ 4JB7A 5TP9A 4F2QA 3O97A 3F11A 3TEPA 4JWOA 3KJTA 1IITA 4H0WA 4EQBA 1MH3A 2B65A 3KN8A 3G3IA 4EQ7A 4OHNA 1B7UA 3MQ9A 2F35A 5DT6A 2Q88A 1DSNA 4HCYA 1SYHA 2PYYA 4GIZA 4O3CA 2QMWA 4QFNA 4DXUA 2F97A 4U22A 3QUFA 3T9XB 1N3XA 3JZJA 2HAUA 3FJMA 4FJPA 1P1QA 4H5GA 4JXIA 3U94A 4BDOA 3FZVA 5H8QA 4G68A 1OQHA 3FVGA 1A55A 3O6IA 1N7XA 1MQDA 1S9TA 4GVOA 3S9LC 1QUIA 1M5BA 1MRPA 2OK2A 3HV1A 3IAZA 4OFLA 4Q8RA 1YAEA 3K01A 2AYSA 4JSDA 4PFWA 5CI5A 2B3FA 2I0CA 4H65A 2DE4A 5CBRA 3BFTA 4EQ9A 4R74A 2XXVA 2R6GE 1M5CA 1MY0A 5BWJA 4POXA 2ZNTA 3MVZA 4FIMA 2I48A 2V25A 5L8DA 2A5TA 1PB8A 4F39A 1RYXA 1P1NA 2M8CA 3QSLA 1NNTA 3S9NC 5KDTB 5I56B 2NOOA 3H3GA 5JK4A 5L9OA 1Q35A 3VLWA 4PE5B 3T9VA 3LSLA 2XXXA 3TYHA 4BDNA 1FTJA 4OFOA 1SW2A 2H98A 4ISUA 4PFUA 4YKIA 4IGTA 4ZE9A 1H45A 3K6WA 5FTHA 3GBBA 5DVJA 2I4BA 3OO9A 1TWYA 4R2FA 4XKRA 1LFIA 5ITOA 3S9MC 1NNPA 2F7CA 3IORA 1JQFA 2X7QA 3K00A 3OELA 3V89B 1URDA 1DPEA 2AL4A 4G2ZA 3H03A 4QRZA 2F6PA 1JEVA 4LA9A 4I8CA 4YB5A 4JWYA 5F1QA 1EH3A 3W9WA 1Y3QA 2ZYKA 1FQCA 4QHQA 1MXZA 4IB2A 1MXWA 1XVXA 1B3EA 1MQJA 4I1DA 3OSQA 1MPCA 1Y1ZA 1N7WA 2QL3A 2V3UA 3HN0A 1QVSA 3K6XA 2E0SA 3N26A 3O9PA 4IGRA 4NF8A 3UORA 4EXLA 2F34A 1ZTYA 2HZLA 1Y20A 1SW1A 2ABHA 2R9JA 3H6WA 4UACA 2XXQA 3FJ7A 3MPLA 3PUXE 2DXRA 2UYFA 3FXRA 4QFLA 4LVQA 3CSBA 3VVFA 2XX9A 3FASA 4G8MA 3C35A 4X48A 1ANFA 4PETA 4NF6A 1XT8A 5FHNA 1OMPA 4U2RA 1M5EA 1GV8A 1QKAA 1MXYA 3SESA 4KI0E 4DXCA 1EU8A 4KR5A 2RC8A 4ONYA 2X7PA 1IXCA 1MM7A 1BIYA 2KLFA 2WKYA 2H25A 2Y7IA 2O84X 3IOTA 4IO2A 5I58B 3TTNA 1JW1A 2DVCA 3I3VA 4DZ1A 4EXKA 3I5OA 3D4CA 3MZBA 4F3PA 2E1SA 2D21A 2PT2A 1JVYA 3FUZA 4ELOA 4GL8A 2RC7A 2OWTA 4N07A 4PP0A 5B7DA 2RKMA 4HTGA 3VVDA 5A5XB 1P1OA 4OZ9A 4ZEBA 5K2YA 2UVGA 3FVNA 4AB5A 3RT6B 4DLDA 1NH8A 3THIA 4TOZA 4JWXA 4KQPA 1BLFA 1WVJA 3TMGA 1VE4A 5DTBA 2DVZA 1EZ9A 1US4A 4G4PA 1B3LA 4RJZA 5ISUA 1BTJA 1IZ1A 3C32A 1IQ7A 5DVFA 2F78A 2ZNSA 2I6EA 1MM6A 4QSEA 2Y7KA 3SDFA 1QW0A 4G77A 1FTOA 4FECA 3RLFE 4RK2A 3RN8A 4NF5B 1B0HA 4GRKA 4KD5A 3U92A 3KSXA 4AQ4A 3L6HA 1B5IA 1DPPA 2D5WA 1YCJA 4DDDA 1VSOA 2O69A 1FTMA 2A5TB 2P1SA 1LB8A 1CE2A 1OLCA 1RKMA 1Y4TA 3M3FA 4OQOA 3O28A 4Q30B 4R73A 4IO3A 3OD7A 1LLSA 5CMCA 2F36A 4WEPA 5AA4A 4ZZAA 2G29A 3GZGA 1LAGE 2AL5A 1FTLA 1LBBA 2HAVA 3MC2A 4LZ8A 1JW4A 5JTYB 1OVBA 3S2VA 5AA2D 1FQAA 1NNFA 1A8FA 1L5TA 4LONB 5H8HB 1MPBA 2ZYNA 5KCJA 2LAOA 4R72A 3PPPA 1B32A 4POWA 3EHTA 1OIBA 4QFOA 1LAFE 3EN3A 3QAXA 1T0KA 2AIXA 3G3HA 4Z7EA 1FW0A 1MS7A 4XKNA 4Z0IA 1XC1A 1MXVA 3IJXB 3Q29A 5I2NB 1IUDA 3N94A 2HQ0A 4H8JA 3N5LA 3MBPA 3SERA 3PPOA 1UTBA 4G8NA 3QIMA 4KYSA 3HO7A 2I3VA 1MH4A 2RCBA 3N6TA 4NF4B 1XS5A 5I84A 1FQDA 2DSFA 1N76A 2XXPA 3T93B 5I57A 1LFGA 2I0BA 1F9BA 3CIJA 4IO6A 1LB9A 1N0TA 2DP8A 2I49A 3LR1A 4R6HA 5M2VA 1EZOA 1B9JA 1B4HA 3EF7A 3KEIA 3HSTA 3IB0A 4L17A 5H8SA 3WAEA 4ELQA 1B52A 4P0GA 4WKMA 5ITPA 2XXIA 5TPAA 1LSTA 4OEUA 1USYH 2Y84A 5I2KB 4FEBA 1P99A 2XXUA 2XXHA 2ZYMA 1H76A 1N3WA 3IB1A 3TELA 1B3GA 3SEUA 4EUOA 4FATA 3G3JA 4MH5A 4R6KA 3SKPA 4WXJA 2Z8FA 3UIFA 3L6GA 3VVEA 5K2XA 4GWOA 2RF1A 3FVOA 1ATGA 1B51A 3KJ7A 5B70A 5L9SA 5CM6A 2XXWA 4OENA 2Y7PA 1LCTA 3OO7A 4G68B 3MP6A 1A99A 2PVUA 3ECRA 3IL1B 1S50A 3LBSA 4JBZA 1SI0A 1AL3A 2FNCA 4RK9A 2GHBA 3K6UA 1JNFA 3C36A 2FA7A 4KHZE 4YICA 4IY6A 5DVIA 1Y4CA 1MPDA 3FIRA 1ZJLA 3OMBA 4LQ5A 1LAHE 4OMBA 3UA8A 1N84A 3IOUA 4ZEDA 3TCGA 5TP9B 3T9UA 1QJMA 4LZ5A 2ZYOA 4LATA 2NVUB 2UVHA 3K02A 3A3CA 3FD3A 4YMBA 4NWDA 4XXUA 2G93A 2XD3A 3DP8A 1D9YA 1XOCA 2VD2A 5H8NB 2B3BA 2QJEA 4FAJA 3JYRA 3SEVA 2ONRA 1LGBC 1YTVA 3V8XB 2VGQA 3R26A 3Q25A 3TCHA 3VDFA 4OESA 3GBAA 4NMYA 5I59A 4H5FA 5EHMA 2RCAA 2VHAA 4N13A 1PBPA 1DTGA 3U72A 5AA2B 3MVWA 3TDJA 4BDQA 1EZPA 4OTEA 1DOTA 1VR5A 3OO8A 3VLVA 3TTRA 1OLAA 3DM0A 2IEEA 3OEMA 4U4SA 5H8QB 4ESWA 4F1UA 3KOSA 4EF2A 1I6BA 1FCKA 4YAHX 4KCCA 3KBRA 3ZKKA 1YPNA 4EDPA 3JV9A 4QSDA 3OO6A 4GD5A 1Y1MA 1PEBA 3H06B 4JSOA 1O63A 5H8HA 2REJA 4OETA 1ZLQA 3RNNA 2OCUA 3WAFA 4MF3A 4GOTA 1IXIA 5DEXB 1H43A 2GRVA 3EPEA 2UVIA 4RA1A 2YPNA 2PMSA 3K4UA 3D4GA 2Q2AA 4TLMB 3RPWA 4E0XA 3H6UA 3O29A 5AA1A 4F22A 2F7BA 4ZZEA 1I69A 3IOWA 1OVTA 1M5FA 3PMXA 4P0IA 1IIWA 1N04A 1QUJA 1S7YA 1B1XA 1SW5A 1WODA 2OBGA 3OENA 3Q26A 2NUVA 4HS7A 1NNKA 1ELJA 4XKQA 5HM4B 4C1UA 1UTBB 3FVKA 4QFPA 5J1DA 4NF6B 1QUKA 3G3KA 4R2BA 1TFDA 2OJTA 4LP2B 4U4XA 2XXRA 4YZZA 4F18A 2XX8A 1SDXA 4YB6A 1AMFA 1A54A 2DE2A 5KDTA 1D4NA 3PUWE 4P11A 2QS4A 3O6GA 1RYOA 4YKKA 2F5XA 2A5SA 3BBRA 1XHYA 3PGFA 3U8QA 3M3KA 3C33A 3PUZE 2DS9A 3DP6A 3IJOB 3V5AA 2O1MA 3BFUA 4F29A 4F19A 3UP9A 1LFHA 1NFTA 4ZDMA 3FJGA 1ZBMA 3TCFA 3HPIA 3AXFA 1BKAA 1UTHA 3MWBA 3TTLA 1DMBA 3VXBA 4DXBA 5JEIA 3V83A 2F8DA 4ND9A 3QK6A 1Y9UA 3CFZA 1POTA 3LSFB 4U1ZA 4FEDA 3MAMA 3U1OA 5TU0A 1URGA 3PPNA 1GVCA 3USDA 3H6VA 1PB9A 1FQFA 2HFBA 1IXGA 3G7WA 1MXXA 2XHDA 2DWAA 3H6TA 3OOAA 3G3GA 2Y7WA 1B7HA 1MDP1 1ZKBA 4U1OA 3VLUA 3QYTA 5FHOA 5IKBA 3HHFA 1MY2A 1NMUA 2FYIA 5ELVA 1B3HA 1Q1KA 2CMOA 2O68A 3HCQA 4GQOA 4H1XA 4DCXA 3TZAA 4THIA 3W9VA 2QMXA 2I58A 5CC2A 4QFKA 3LC8A 3H4ZA 2Z22A 3DP4A 1B4ZA 2O7UA 3CSGA 3KN7A 5FHMA 4OERA 3MZ9A 2PBWA 2ONSA 3T22A 1B46A 4I62A 3TQWA 4G8HA 5I58A 1AOVA 1H44A 1P1UA 3PD9A 3QUJA 1B5JA 1LBCA 1GTKA 3B6WA 3VV5A 2CZLA 2DYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXY A;  4HCW A;  4ZEF A;  2Q89 A;  4F3S A;  5AA2 A;  3CFL A;  1JW5 A;  4OWD A;  3HHG A;  1JEU A;  2ONK E;  3KZG A;  4Q5T A;  4LUB A;  3OXN A;  3TTK A;  4C0R A;  3MW0 A;  1B6H A;  3O66 A;  1SBP A;  3K2D A;  2QS2 A;  4FE8 A;  1H3D A;  4OEV A;  3DLN A;  1D3K A;  1A40 A;  2I3W A;  3VE1 B;  2H99 A;  3RTW B;  1UIV A;  3E9X A;  4KYD A;  4OYV A;  1SD3 A;  1NL5 A;  3CFX A;  5LOM A;  1M5D A;  3K1N A;  2THI A;  3C9H A;  4LZ7 A;  3U93 A;  4ZEC A;  1O7T A;  1IEJ A;  5AE4 A;  3E3K A;  1FQE A;  4GXA A;  4MFI A;  2Q9T A;  4XIG Q;  4DCY A;  3K0V A;  3RQT A;  1VFD A;  5HPQ A;  1XVY A;  3CG1 A;  3KSJ A;  3PUY E;  1OQG A;  4O3B A;  1LAX A;  1KWH A;  1D9V A;  2Z8E A;  3RGY A;  2UYE A;  1P1W A;  3KN3 A;  4RPN A;  2HZK A;  1MXU A;  2DOJ A;  3P7I A;  3OEK A;  1UQW A;  4RNS A;  2V84 A;  1B58 A;  2GH9 A;  1MQH A;  1WDN A;  2XXY A;  2YLN A;  2VP1 A;  3A3U A;  2DE3 A;  3FV2 A;  2H9B A;  4YKJ A;  2Z23 A;  5TPA B;  3LSX A;  3RY3 A;  1B1H A;  1TFA A;  4HW8 A;  4QSC A;  4E0W A;  2O7I A;  2D3I A;  4R6Y A;  3E13 X;  4U21 A;  2GFE A;  3VXC A;  5KCJ B;  4KPT A;  1TT1 A;  3PV0 E;  1PBQ A;  1PDA A;  1A7L A;  1NH7 A;  4WED A;  3KGC A;  4DE8 A;  3M3L A;  1Z7M E;  1USY E;  4X1D A;  3G3F A;  3N6U A;  4G68 C;  3ZKL A;  2HXW A;  1HSJ A;  5JTY A;  2XXT A;  2ZNU A;  3M8U A;  3C31 A;  2QSX A;  4ZEK A;  4H8I A;  4LQ2 A;  4DIG A;  3CG3 A;  3IK6 B;  3RTF B;  1UTH B;  4OFJ A;  3T9H B;  3MVX A;  1MQI A;  1J1N A;  2NXO A;  2Y7R A;  4K3F A;  3KFM A;  4ZS9 A;  2Q8J A;  4NF4 A;  4NE4 A;  5FTI A;  2DQV A;  2Q2C A;  4TLL B;  3IB2 A;  4ELR A;  3MVY A;  3T96 B;  5BUU A;  4ESX A;  4RXL A;  2V3Q A;  4MBP A;  3SEW A;  3VFJ A;  1MDQ A;  4UA8 A;  4O3A A;  2IA4 A;  5I56 A;  1FTK A;  4ZEI A;  5ICT A;  3Q28 A;  5CRY A;  3S9E A;  2RC9 A;  3C34 A;  4KYE A;  4F1Y A;  4PQJ A;  2HCA A;  5L9M A;  1ZIU A;  2ESN A;  3ODB A;  1SI1 A;  4GXS B;  2RIN A;  3KOT A;  3MP8 A;  2P0S A;  4H67 A;  4FOR A;  2X26 A;  4H6D A;  4C1T A;  4PFT A;  4F3G A;  1PC3 A;  5I59 B;  3LUY A;  3K1M A;  5HBC A;  1R6Z A;  3CVG A;  2H5Y A;  2HEU A;  1SW4 A;  1II5 A;  2VD3 A;  3MP1 A;  3R6U A;  4I9D A;  4ECF A;  4F2O A;  3IX1 A;  4R9G A;  4F3B A;  1B0L A;  1GR2 A;  3CI8 A;  1R1N A;  3LSW A;  4OVJ A;  3RUM A;  3TAJ A;  1FQB A;  3FAT A;  1QKB A;  3H7M A;  4PFY A;  3T66 A;  3K6V A;  4OXV A;  3IO6 A;  3KG2 A;  3SEX A;  1SQY A;  3OSR A;  4GFR A;  2PX1 A;  3TPA A;  1IXH A;  4QF9 A;  4IO5 A;  4XKP A;  3GLB A;  4BDR A;  1POY 1;  1B05 A;  3DEL B;  4R9F A;  2BJJ X;  3PU5 A;  3ONM A;  1ZU0 A;  3W15 C;  4ZE8 A;  3MUQ A;  1Y3N A;  2Z8D A;  3R7X A;  4EF1 A;  5CMK A;  1A8E A;  5EHS A;  3PD8 A;  1BP5 A;  4BDL A;  1UIU A;  2UVJ A;  2GHA A;  1PB7 A;  1MY1 A;  3A09 A;  3QXM A;  4YB7 A;  4YMA A;  2UXA A;  1MQG A;  1HSE A;  2OLB A;  1HSL A;  2NWJ A;  2V93 A;  3S4U A;  1I6Q A;  1B40 A;  3MPK A;  5CBS A;  3EHS A;  3ILT B;  4JDF A;  2DWH A;  5AA4 B;  5IAI A;  4RPO A;  5KZT A;  1I6A A;  3SEY A;  1Y3P A;  2QRY A;  2F6G A;  2OZZ A;  2XD2 A;  3IOV A;  4IO4 A;  1URS A;  4X1B A;  4X9T A;  3O6H A;  3O2A A;  4IO7 A;  3PMW A;  4RY1 A;  3IO4 A;  4F1V A;  2OWS A;  2VOZ A;  4RYA A;  1VFE A;  3GXA A;  1B5H A;  4ELP A;  1LCF A;  2I4C A;  4NWC A;  4BLA A;  4N6P A;  2QPQ A;  1QUL A;  3ZSF A;  3BKI B;  3PMV A;  5I2N A;  2QS3 A;  4BDM A;  3ILU B;  5EYF A;  1B3F A;  2PT1 A;  4U23 A;  3PPR A;  3UK4 A;  4MLQ A;  3TKD A;  1AH5 A;  3TQL A;  5A5X A;  3B6Q A;  1B7Z A;  2O6A A;  1R9Q A;  3CR9 A;  4NF5 A;  2V3T A;  4R75 A;  5DEX A;  3FGS A;  3SET A;  4F31 B;  3B7D A;  3FXQ A;  2ALU A;  3IR1 A;  4MLV A;  4M4G A;  5DYH A;  5H8F B;  5I57 B;  1CB6 A;  2O51 A;  5AA3 A;  1B2H A;  3C4M A;  3PPQ A;  5ICQ A;  1O64 A;  3UN6 A;  4XTC Q;  5CMM A;  4KCD A;  2W7Y A;  3K1P A;  5H8F A;  3TFL A;  2DWI A;  2F7A A;  3FV1 A;  3TUS A;  3I6V A;  3PUV E;  4KFQ A;  3ZS6 A;  5I2K A;  2ANJ A;  1MG1 A;  3FXU A;  3EHU A;  1AIV A;  3E4R A;  4IY5 A;  1US5 A;  1SVX B;  4YU0 A;  4GL0 A;  3Q27 A;  4GF8 A;  3RT8 A;  4AB6 A;  3MJN A;  3B6T A;  1JET A;  2REG A;  2XX7 A;  4M1V A;  4NF8 B;  2O1L A;  3TOD A;  2ZXT A;  3EQ1 A;  4NED A;  1R9L A;  3CRB A;  1MY4 A;  1NKX A;  1SYI A;  1GGG A;  1ZMG A;  4Q0C A;  5F7V A;  3UGW A;  4GLI A;  5H8N A;  4YKP A;  5CMB A;  3TTM A;  1JVX A;  2DWJ A;  1DTZ A;  2H4I A;  2P2A A;  3MZ1 A;  4NTL A;  1Z7N E;  1TXF A;  2YJP A;  2R71 A;  2QS1 A;  1MY3 A;  2ZMB A;  4TQU Q;  4JB7 A;  5TP9 A;  4F2Q A;  3O97 A;  3F11 A;  3TEP A;  4JWO A;  3KJT A;  1IIT A;  4H0W A;  4EQB A;  1MH3 A;  2B65 A;  3KN8 A;  3G3I A;  4EQ7 A;  4OHN A;  1B7U A;  3MQ9 A;  2F35 A;  5DT6 A;  2Q88 A;  1DSN A;  4HCY A;  1SYH A;  2PYY A;  4GIZ A;  4O3C A;  2QMW A;  4QFN A;  4DXU A;  2F97 A;  4U22 A;  3QUF A;  3T9X B;  1N3X A;  3JZJ A;  2HAU A;  3FJM A;  4FJP A;  1P1Q A;  4H5G A;  4JXI A;  3U94 A;  4BDO A;  3FZV A;  5H8Q A;  4G68 A;  1OQH A;  3FVG A;  1A55 A;  3O6I A;  1N7X A;  1MQD A;  1S9T A;  4GVO A;  3S9L C;  1QUI A;  1M5B A;  1MRP A;  2OK2 A;  3HV1 A;  3IAZ A;  4OFL A;  4Q8R A;  1YAE A;  3K01 A;  2AYS A;  4JSD A;  4PFW A;  5CI5 A;  2B3F A;  2I0C A;  4H65 A;  2DE4 A;  5CBR A;  3BFT A;  4EQ9 A;  4R74 A;  2XXV A;  2R6G E;  1M5C A;  1MY0 A;  5BWJ A;  4POX A;  2ZNT A;  3MVZ A;  4FIM A;  2I48 A;  2V25 A;  5L8D A;  2A5T A;  1PB8 A;  4F39 A;  1RYX A;  1P1N A;  2M8C A;  3QSL A;  1NNT A;  3S9N C;  5KDT B;  5I56 B;  2NOO A;  3H3G A;  5JK4 A;  5L9O A;  1Q35 A;  3VLW A;  4PE5 B;  3T9V A;  3LSL A;  2XXX A;  3TYH A;  4BDN A;  1FTJ A;  4OFO A;  1SW2 A;  2H98 A;  4ISU A;  4PFU A;  4YKI A;  4IGT A;  4ZE9 A;  1H45 A;  3K6W A;  5FTH A;  3GBB A;  5DVJ A;  2I4B A;  3OO9 A;  1TWY A;  4R2F A;  4XKR A;  1LFI A;  5ITO A;  3S9M C;  1NNP A;  2F7C A;  3IOR A;  1JQF A;  2X7Q A;  3K00 A;  3OEL A;  3V89 B;  1URD A;  1DPE A;  2AL4 A;  4G2Z A;  3H03 A;  4QRZ A;  2F6P A;  1JEV A;  4LA9 A;  4I8C A;  4YB5 A;  4JWY A;  5F1Q A;  1EH3 A;  3W9W A;  1Y3Q A;  2ZYK A;  1FQC A;  4QHQ A;  1MXZ A;  4IB2 A;  1MXW A;  1XVX A;  1B3E A;  1MQJ A;  4I1D A;  3OSQ A;  1MPC A;  1Y1Z A;  1N7W A;  2QL3 A;  2V3U A;  3HN0 A;  1QVS A;  3K6X A;  2E0S A;  3N26 A;  3O9P A;  4IGR A;  4NF8 A;  3UOR A;  4EXL A;  2F34 A;  1ZTY A;  2HZL A;  1Y20 A;  1SW1 A;  2ABH A;  2R9J A;  3H6W A;  4UAC A;  2XXQ A;  3FJ7 A;  3MPL A;  3PUX E;  2DXR A;  2UYF A;  3FXR A;  4QFL A;  4LVQ A;  3CSB A;  3VVF A;  2XX9 A;  3FAS A;  4G8M A;  3C35 A;  4X48 A;  1ANF A;  4PET A;  4NF6 A;  1XT8 A;  5FHN A;  1OMP A;  4U2R A;  1M5E A;  1GV8 A;  1QKA A;  1MXY A;  3SES A;  4KI0 E;  4DXC A;  1EU8 A;  4KR5 A;  2RC8 A;  4ONY A;  2X7P A;  1IXC A;  1MM7 A;  1BIY A;  2KLF A;  2WKY A;  2H25 A;  2Y7I A;  2O84 X;  3IOT A;  4IO2 A;  5I58 B;  3TTN A;  1JW1 A;  2DVC A;  3I3V A;  4DZ1 A;  4EXK A;  3I5O A;  3D4C A;  3MZB A;  4F3P A;  2E1S A;  2D21 A;  2PT2 A;  1JVY A;  3FUZ A;  4ELO A;  4GL8 A;  2RC7 A;  2OWT A;  4N07 A;  4PP0 A;  5B7D A;  2RKM A;  4HTG A;  3VVD A;  5A5X B;  1P1O A;  4OZ9 A;  4ZEB A;  5K2Y A;  2UVG A;  3FVN A;  4AB5 A;  3RT6 B;  4DLD A;  1NH8 A;  3THI A;  4TOZ A;  4JWX A;  4KQP A;  1BLF A;  1WVJ A;  3TMG A;  1VE4 A;  5DTB A;  2DVZ A;  1EZ9 A;  1US4 A;  4G4P A;  1B3L A;  4RJZ A;  5ISU A;  1BTJ A;  1IZ1 A;  3C32 A;  1IQ7 A;  5DVF A;  2F78 A;  2ZNS A;  2I6E A;  1MM6 A;  4QSE A;  2Y7K A;  3SDF A;  1QW0 A;  4G77 A;  1FTO A;  4FEC A;  3RLF E;  4RK2 A;  3RN8 A;  4NF5 B;  1B0H A;  4GRK A;  4KD5 A;  3U92 A;  3KSX A;  4AQ4 A;  3L6H A;  1B5I A;  1DPP A;  2D5W A;  1YCJ A;  4DDD A;  1VSO A;  2O69 A;  1FTM A;  2A5T B;  2P1S A;  1LB8 A;  1CE2 A;  1OLC A;  1RKM A;  1Y4T A;  3M3F A;  4OQO A;  3O28 A;  4Q30 B;  4R73 A;  4IO3 A;  3OD7 A;  1LLS A;  5CMC A;  2F36 A;  4WEP A;  5AA4 A;  4ZZA A;  2G29 A;  3GZG A;  1LAG E;  2AL5 A;  1FTL A;  1LBB A;  2HAV A;  3MC2 A;  4LZ8 A;  1JW4 A;  5JTY B;  1OVB A;  3S2V A;  5AA2 D;  1FQA A;  1NNF A;  1A8F A;  1L5T A;  4LON B;  5H8H B;  1MPB A;  2ZYN A;  5KCJ A;  2LAO A;  4R72 A;  3PPP A;  1B32 A;  4POW A;  3EHT A;  1OIB A;  4QFO A;  1LAF E;  3EN3 A;  3QAX A;  1T0K A;  2AIX A;  3G3H A;  4Z7E A;  1FW0 A;  1MS7 A;  4XKN A;  4Z0I A;  1XC1 A;  1MXV A;  3IJX B;  3Q29 A;  5I2N B;  1IUD A;  3N94 A;  2HQ0 A;  4H8J A;  3N5L A;  3MBP A;  3SER A;  3PPO A;  1UTB A;  4G8N A;  3QIM A;  4KYS A;  3HO7 A;  2I3V A;  1MH4 A;  2RCB A;  3N6T A;  4NF4 B;  1XS5 A;  5I84 A;  1FQD A;  2DSF A;  1N76 A;  2XXP A;  3T93 B;  5I57 A;  1LFG A;  2I0B A;  1F9B A;  3CIJ A;  4IO6 A;  1LB9 A;  1N0T A;  2DP8 A;  2I49 A;  3LR1 A;  4R6H A;  5M2V A;  1EZO A;  1B9J A;  1B4H A;  3EF7 A;  3KEI A;  3HST A;  3IB0 A;  4L17 A;  5H8S A;  3WAE A;  4ELQ A;  1B52 A;  4P0G A;  4WKM A;  5ITP A;  2XXI A;  5TPA A;  1LST A;  4OEU A;  1USY H;  2Y84 A;  5I2K B;  4FEB A;  1P99 A;  2XXU A;  2XXH A;  2ZYM A;  1H76 A;  1N3W A;  3IB1 A;  3TEL A;  1B3G A;  3SEU A;  4EUO A;  4FAT A;  3G3J A;  4MH5 A;  4R6K A;  3SKP A;  4WXJ A;  2Z8F A;  3UIF A;  3L6G A;  3VVE A;  5K2X A;  4GWO A;  2RF1 A;  3FVO A;  1ATG A;  1B51 A;  3KJ7 A;  5B70 A;  5L9S A;  5CM6 A;  2XXW A;  4OEN A;  2Y7P A;  1LCT A;  3OO7 A;  4G68 B;  3MP6 A;  1A99 A;  2PVU A;  3ECR A;  3IL1 B;  1S50 A;  3LBS A;  4JBZ A;  1SI0 A;  1AL3 A;  2FNC A;  4RK9 A;  2GHB A;  3K6U A;  1JNF A;  3C36 A;  2FA7 A;  4KHZ E;  4YIC A;  4IY6 A;  5DVI A;  1Y4C A;  1MPD A;  3FIR A;  1ZJL A;  3OMB A;  4LQ5 A;  1LAH E;  4OMB A;  3UA8 A;  1N84 A;  3IOU A;  4ZED A;  3TCG A;  5TP9 B;  3T9U A;  1QJM A;  4LZ5 A;  2ZYO A;  4LAT A;  2NVU B;  2UVH A;  3K02 A;  3A3C A;  3FD3 A;  4YMB A;  4NWD A;  4XXU A;  2G93 A;  2XD3 A;  3DP8 A;  1D9Y A;  1XOC A;  2VD2 A;  5H8N B;  2B3B A;  2QJE A;  4FAJ A;  3JYR A;  3SEV A;  2ONR A;  1LGB C;  1YTV A;  3V8X B;  2VGQ A;  3R26 A;  3Q25 A;  3TCH A;  3VDF A;  4OES A;  3GBA A;  4NMY A;  5I59 A;  4H5F A;  5EHM A;  2RCA A;  2VHA A;  4N13 A;  1PBP A;  1DTG A;  3U72 A;  5AA2 B;  3MVW A;  3TDJ A;  4BDQ A;  1EZP A;  4OTE A;  1DOT A;  1VR5 A;  3OO8 A;  3VLV A;  3TTR A;  1OLA A;  3DM0 A;  2IEE A;  3OEM A;  4U4S A;  5H8Q B;  4ESW A;  4F1U A;  3KOS A;  4EF2 A;  1I6B A;  1FCK A;  4YAH X;  4KCC A;  3KBR A;  3ZKK A;  1YPN A;  4EDP A;  3JV9 A;  4QSD A;  3OO6 A;  4GD5 A;  1Y1M A;  1PEB A;  3H06 B;  4JSO A;  1O63 A;  5H8H A;  2REJ A;  4OET A;  1ZLQ A;  3RNN A;  2OCU A;  3WAF A;  4MF3 A;  4GOT A;  1IXI A;  5DEX B;  1H43 A;  2GRV A;  3EPE A;  2UVI A;  4RA1 A;  2YPN A;  2PMS A;  3K4U A;  3D4G A;  2Q2A A;  4TLM B;  3RPW A;  4E0X A;  3H6U A;  3O29 A;  5AA1 A;  4F22 A;  2F7B A;  4ZZE A;  1I69 A;  3IOW A;  1OVT A;  1M5F A;  3PMX A;  4P0I A;  1IIW A;  1N04 A;  1QUJ A;  1S7Y A;  1B1X A;  1SW5 A;  1WOD A;  2OBG A;  3OEN A;  3Q26 A;  2NUV A;  4HS7 A;  1NNK A;  1ELJ A;  4XKQ A;  5HM4 B;  4C1U A;  1UTB B;  3FVK A;  4QFP A;  5J1D A;  4NF6 B;  1QUK A;  3G3K A;  4R2B A;  1TFD A;  2OJT A;  4LP2 B;  4U4X A;  2XXR A;  4YZZ A;  4F18 A;  2XX8 A;  1SDX A;  4YB6 A;  1AMF A;  1A54 A;  2DE2 A;  5KDT A;  1D4N A;  3PUW E;  4P11 A;  2QS4 A;  3O6G A;  1RYO A;  4YKK A;  2F5X A;  2A5S A;  3BBR A;  1XHY A;  3PGF A;  3U8Q A;  3M3K A;  3C33 A;  3PUZ E;  2DS9 A;  3DP6 A;  3IJO B;  3V5A A;  2O1M A;  3BFU A;  4F29 A;  4F19 A;  3UP9 A;  1LFH A;  1NFT A;  4ZDM A;  3FJG A;  1ZBM A;  3TCF A;  3HPI A;  3AXF A;  1BKA A;  1UTH A;  3MWB A;  3TTL A;  1DMB A;  3VXB A;  4DXB A;  5JEI A;  3V83 A;  2F8D A;  4ND9 A;  3QK6 A;  1Y9U A;  3CFZ A;  1POT A;  3LSF B;  4U1Z A;  4FED A;  3MAM A;  3U1O A;  5TU0 A;  1URG A;  3PPN A;  1GVC A;  3USD A;  3H6V A;  1PB9 A;  1FQF A;  2HFB A;  1IXG A;  3G7W A;  1MXX A;  2XHD A;  2DWA A;  3H6T A;  3OOA A;  3G3G A;  2Y7W A;  1B7H A;  1MDP 1;  1ZKB A;  4U1O A;  3VLU A;  3QYT A;  5FHO A;  5IKB A;  3HHF A;  1MY2 A;  1NMU A;  2FYI A;  5ELV A;  1B3H A;  1Q1K A;  2CMO A;  2O68 A;  3HCQ A;  4GQO A;  4H1X A;  4DCX A;  3TZA A;  4THI A;  3W9V A;  2QMX A;  2I58 A;  5CC2 A;  4QFK A;  3LC8 A;  3H4Z A;  2Z22 A;  3DP4 A;  1B4Z A;  2O7U A;  3CSG A;  3KN7 A;  5FHM A;  4OER A;  3MZ9 A;  2PBW A;  2ONS A;  3T22 A;  1B46 A;  4I62 A;  3TQW A;  4G8H A;  5I58 A;  1AOV A;  1H44 A;  1P1U A;  3PD9 A;  3QUJ A;  1B5J A;  1LBC A;  1GTK A;  3B6W A;  3VV5 A;  2CZL A;  2DYX A; 
#chains in the Genus database with same CATH topology
 4I3E A;  4ZEF A;  2Q89 A;  1QGX A;  1JW5 A;  3KZG A;  3OXN A;  1SBP A;  1RDZ A;  4OEV A;  1D3K A;  2I3W A;  2H99 A;  1UIV A;  4KYD A;  4OYV A;  1NL5 A;  3C9H A;  1IEJ A;  3E3K A;  4DCY A;  1XVY A;  1KWH A;  1D9V A;  2Z8E A;  3RGY A;  1FPK A;  1MXU A;  1UQW A;  5I5P A;  1JP4 A;  2VP1 A;  2H9B A;  3RY3 A;  4HW8 A;  4E0W A;  4U21 A;  2BJI A;  4KPT A;  1TT1 A;  1PDA A;  2HXW A;  1FPJ A;  3C31 A;  4NHB A;  1D9Q A;  3RTF B;  1UTH B;  3MVX A;  2NXO A;  2DQV A;  4QBA A;  1FBG A;  4ESX A;  2V3Q A;  3VFJ A;  5ICT A;  3S9E A;  4F1Y A;  5L9M A;  3MP8 A;  5I59 B;  4GX3 A;  3BIG A;  3CVG A;  2HEU A;  2VD3 A;  3FXB A;  1KA0 A;  2KR0 A;  3IX1 A;  4F3B A;  1R1N A;  3RUM A;  5FBP A;  4GFR A;  3TPA A;  3W15 C;  1Y3N A;  4MX6 A;  4GX6 A;  2UVJ A;  1MY1 A;  4O8M A;  4YB7 A;  2UXA A;  1HSE A;  3KBZ A;  1HSL A;  5IZZ A;  1FPL A;  5AA4 B;  2DWH A;  2B4L A;  4RPO A;  5IZ1 A;  2F6G A;  4X9T A;  3MYU A;  4RY1 A;  2OWS A;  4RYA A;  1VFE A;  4ELP A;  4BLA A;  3ZSF A;  3BKI B;  5I2N A;  4BDM A;  1AH5 A;  4R75 A;  3CR9 A;  3SET A;  5DEX A;  3FGS A;  5ESY A;  4F31 B;  2FHY A;  3FXQ A;  5H8F B;  1CB6 A;  5AA3 A;  1B2H A;  1O64 A;  2P3N A;  3TUS A;  5EYG A;  3EHU A;  4IY5 A;  1SVX B;  4GL0 A;  4AB6 A;  3B6T A;  1JET A;  2CEY A;  2REG A;  4NF8 B;  4P56 A;  2O1L A;  3TOD A;  1MY4 A;  4GLI A;  5CMB A;  3TTM A;  3MZ1 A;  1Z7N E;  5TP9 A;  1MY3 A;  4F2Q A;  1LBX A;  1IIT A;  4H0W A;  4NG7 A;  3MQ9 A;  4DXU A;  2QMW A;  4OVP A;  4U22 A;  3T9X B;  1N3X A;  3JZJ A;  3FJM A;  4H5G A;  3O6I A;  1A55 A;  4GWS A;  1MRP A;  2CEX A;  1YAE A;  1NV4 A;  4PFW A;  4JSD A;  2I0C A;  4EQ9 A;  5J1D A;  4F39 A;  2V25 A;  5L8D A;  2A5T A;  2QVR A;  1RYX A;  1P1N A;  2M8C A;  3QSL A;  1NNT A;  2KQZ A;  4N4U A;  1FPD A;  4MIJ A;  3H3G A;  3GYY A;  5L9O A;  3VLW A;  1FTJ A;  2QVV A;  4ISU A;  4IGT A;  1INP A;  3K6W A;  5FTH A;  3GBB A;  2I4B A;  4R2F A;  1RDX A;  3OEL A;  1JQF A;  3K00 A;  2HXR A;  3V83 A;  5F1Q A;  1Y3Q A;  1FQC A;  1MXZ A;  2NWJ A;  1MPC A;  1Y1Z A;  3N26 A;  4GWU A;  2F34 A;  1SW1 A;  3LUZ A;  2XXQ A;  3MPL A;  3FXR A;  4XEQ A;  3CSB A;  3VVF A;  4G8M A;  4U2R A;  1GV8 A;  1FBH A;  3SES A;  4DXC A;  1BIY A;  2Y7I A;  2O84 X;  3T0J A;  4EXK A;  3LV0 A;  3I5O A;  4F3P A;  2D21 A;  4PAI A;  4HTG A;  5K2Y A;  4OZ9 A;  4AB5 A;  2UVG A;  4LN5 A;  5DTB A;  1B3L A;  3SDF A;  4RK2 A;  3KSX A;  1VSO A;  2O69 A;  4Q30 B;  3OD7 A;  4OVS A;  4HE0 A;  2AL5 A;  1FTL A;  1JW4 A;  3S2V A;  1OVB A;  5AA2 D;  1FQA A;  4LON B;  1MPB A;  2LAO A;  1K9Y A;  1NUX A;  4POW A;  1MXV A;  3Q29 A;  3N5L A;  3PPO A;  4N6K A;  2Q74 A;  4KYS A;  5I84 A;  1MH4 A;  2DSF A;  1N76 A;  1AWB A;  2I0B A;  3CIJ A;  1B9J A;  3IB0 A;  4P0G A;  4OEU A;  1USY H;  5H8F A;  5I2K B;  1NV1 A;  1N3W A;  1B3G A;  4WXJ A;  3L6G A;  3FVO A;  4MEV A;  5B70 A;  2ZZW A;  1BK4 A;  1LCT A;  4G68 B;  3MP6 A;  1A99 A;  3IL1 B;  1S50 A;  4JBZ A;  1SI0 A;  2FNC A;  1JNF A;  4PGP A;  1Y4C A;  3OMB A;  1N84 A;  3T9U A;  4LAT A;  2NVU B;  3K02 A;  3A3C A;  1VDW A;  2XD3 A;  3DP8 A;  2VD2 A;  2QJE A;  2ONR A;  3Q25 A;  4N13 A;  5AA2 B;  3MVW A;  3TDJ A;  1DOT A;  3VLV A;  1OLA A;  2XXK A;  3OEM A;  3KBR A;  1DBZ A;  4GD5 A;  1NV5 A;  2REJ A;  4OET A;  1ZLQ A;  3WAF A;  4OVR A;  1H43 A;  3K4U A;  4F22 A;  3H6U A;  2XWV A;  3IOW A;  1IIW A;  1B1X A;  1SW5 A;  3Q26 A;  4XFE A;  4C1U A;  1UTB B;  4NF6 B;  1TFD A;  2OJT A;  4U4X A;  4N17 A;  4HE2 A;  1IMF A;  1D4N A;  2QS4 A;  2F5X A;  3PGF A;  3U8Q A;  3MST A;  3C33 A;  2DS9 A;  3IJO B;  3BFU A;  1NFT A;  3TCF A;  3HPI A;  1BKA A;  4P1L A;  5ET5 A;  4U1Z A;  4FED A;  3MAM A;  3USD A;  2HFB A;  1IXG A;  1MXX A;  2DWA A;  1EYI A;  1B7H A;  1MDP 1;  1NV7 A;  3VLU A;  5ELV A;  4MAG A;  2O68 A;  4DCX A;  2QMX A;  3DP4 A;  5FHM A;  4OER A;  2WBB A;  2ONS A;  4G8H A;  2JJK A;  4HCW A;  3TTK A;  4Q5T A;  1YXI A;  4C0R A;  2QS2 A;  4FE8 A;  1H3D A;  1CNQ A;  3VE1 B;  1A40 A;  5LOM A;  3CFX A;  1M5D A;  2THI A;  4ZEC A;  4GXA A;  4XIG Q;  4NF0 A;  5HPQ A;  3KSJ A;  3PUY E;  5F24 A;  4O3B A;  1LAX A;  4RPN A;  3KN3 A;  2V84 A;  1B58 A;  2XXY A;  1MQH A;  1WDN A;  4WKM A;  4QFK A;  2DE3 A;  2Z23 A;  5KCJ B;  2D3I A;  1G0H A;  3E13 X;  1PBQ A;  4WED A;  3M3L A;  3G3F A;  4G68 C;  3ZKL A;  1HSJ A;  2ZNU A;  3M8U A;  2QSX A;  4ZEK A;  3CG3 A;  1KZ8 A;  4JVC A;  4OFJ A;  1MQI A;  4K3F A;  4ZS9 A;  3KFM A;  5ET8 A;  1NUY A;  4NF4 A;  5FTI A;  2Q2C A;  4TLL B;  5BUU A;  1NV6 A;  5I56 A;  1FTK A;  3Q28 A;  5CRY A;  2HCA A;  1ZIU A;  3B50 A;  4GXS B;  2RIN A;  3KOT A;  2P0S A;  4H6D A;  4FOR A;  2X26 A;  4C1T A;  4P3L A;  2H5Y A;  1II5 A;  4F2O A;  4R9G A;  1B0L A;  3CI8 A;  3FAT A;  4GWX A;  1QKB A;  4QF9 A;  2PFY A;  4IO5 A;  3GLB A;  4PC9 A;  4BDR A;  1POY 1;  1B05 A;  3DEL B;  4R9F A;  3MUQ A;  1A8E A;  1UIU A;  2GHA A;  4YMA A;  1I6Q A;  1FRP A;  5EQ7 A;  1FPG A;  5IAI A;  5KZT A;  2QRY A;  3IO4 A;  1B5H A;  1LCF A;  4NWC A;  4PFR A;  2WYP A;  4U23 A;  3UK4 A;  3PPR A;  5A5X A;  2HPG A;  3B6Q A;  4NF5 A;  1R9Q A;  2V3T A;  4M4G A;  5I57 B;  4KCD A;  3IFC A;  1FJ9 A;  3TFL A;  3FV1 A;  3E78 A;  2ANJ A;  1MG1 A;  2PCR A;  1US5 A;  3MJN A;  2ZXT A;  1NKX A;  4N8Y A;  3UGW A;  4YKP A;  4PAF A;  2P2A A;  1FSA A;  1TXF A;  2YJP A;  4JB7 A;  3IFA A;  3KJT A;  1MH3 A;  2B65 A;  3D1R A;  5ET7 A;  4QFN A;  3B8B A;  2F97 A;  3QUF A;  3U94 A;  4JXI A;  1DK4 A;  5H8Q A;  1OQH A;  1N7X A;  1MQD A;  1S9T A;  4GVO A;  2AYS A;  5CI5 A;  4H65 A;  3BFT A;  1M5C A;  3MVZ A;  4FIM A;  2I48 A;  4P1E A;  5EYH A;  2NOO A;  3LSL A;  2WBD A;  2H98 A;  4PFU A;  2VPO A;  1H45 A;  3OO9 A;  1TWY A;  4N91 A;  1URD A;  1DPE A;  3H03 A;  4YB5 A;  2F6P A;  1EH3 A;  4I1D A;  1MQJ A;  1N7W A;  2QL3 A;  3O9P A;  3UOR A;  2E0S A;  2V4C A;  4NF8 A;  1Y20 A;  2ABH A;  4UAC A;  3PUX E;  4LVQ A;  2XX9 A;  4XF5 A;  1ANF A;  2DDK A;  4OVT A;  4KI0 E;  1LBZ A;  4KR5 A;  4MNI A;  1MM7 A;  3IOT A;  5I58 B;  2PT2 A;  1DCU A;  2FBP A;  2OWT A;  2RKM A;  3FVN A;  3TMG A;  1EZ9 A;  5ISU A;  1IZ1 A;  3C32 A;  1IQ7 A;  5DVF A;  2F78 A;  2Y7K A;  4PBQ A;  4FEC A;  3RLF E;  3U92 A;  4KD5 A;  4AQ4 A;  2D5W A;  1YCJ A;  2A5T B;  3M3F A;  1LBY A;  4R73 A;  4N15 A;  2F36 A;  3RPL A;  1LAG E;  3MC2 A;  4NQ8 A;  5H8H B;  2ZYN A;  4R72 A;  1OIB A;  4QFO A;  4PDH A;  3EN3 A;  4MJO A;  1T0K A;  2AIX A;  1FW0 A;  1MS7 A;  1FPF A;  4PGN A;  4Z0I A;  2HQ0 A;  4H8J A;  3HO7 A;  2I3V A;  3N6T A;  1XS5 A;  1FQD A;  3T93 B;  5M2V A;  1EZO A;  5H8S A;  3HST A;  5EQ8 A;  2XXI A;  1P99 A;  2XXU A;  2XXH A;  2ZYM A;  1H76 A;  3TEL A;  4EUO A;  3SEU A;  3T1B A;  4MH5 A;  4GWZ A;  4OEN A;  3OO7 A;  3ECR A;  3LBS A;  1AL3 A;  3K6U A;  3C36 A;  2FA7 A;  4IY6 A;  1AIV A;  2F3D A;  1LAH E;  4OMB A;  3UA8 A;  4ZED A;  2ZYO A;  4N81 A;  2UVH A;  4XXU A;  2G93 A;  2VPN A;  1LGB C;  2VGQ A;  3VDF A;  4OES A;  5I59 A;  2VHA A;  1PBP A;  1DTG A;  4BDQ A;  3OO8 A;  1VR5 A;  4U4S A;  4F1U A;  4ESW A;  5IGA A;  1FCK A;  4YAH X;  4KCC A;  1YPN A;  4JSO A;  3RNN A;  2OCU A;  4GOT A;  2GRV A;  3EPE A;  2UVI A;  2PMS A;  2Q2A A;  4E0X A;  1I69 A;  2WEF A;  1N04 A;  2NUV A;  4QFP A;  1QUK A;  4LP2 B;  4F18 A;  1A54 A;  1NUW A;  3O6G A;  3BBR A;  3UP9 A;  3FJG A;  1DMB A;  3VXB A;  4DXB A;  4ND9 A;  5J16 A;  3G7W A;  4HXV A;  3H6T A;  1ZKB A;  3QYT A;  1NMU A;  1B3H A;  1Q1K A;  4H1X A;  3W9V A;  2I58 A;  2P3V A;  3LC8 A;  5LDZ A;  3H4Z A;  2PBW A;  3TQW A;  1AOV A;  1P1U A;  3QUJ A;  4DI3 D;  4DI4 B;  3B6W A;  3VV5 A;  5AA2 A;  4F3S A;  3CFL A;  4OWD A;  3HHG A;  4LUB A;  3MW0 A;  1B6H A;  3O66 A;  3RTW B;  3E9X A;  3K1N A;  4LZ7 A;  3U93 A;  1O7T A;  5AE4 A;  1FQE A;  4MFI A;  2Q9T A;  3K0V A;  3RQT A;  1VFD A;  3CG1 A;  2Y5K A;  1OQG A;  2UYE A;  1P1W A;  2DOJ A;  3OEK A;  4RNS A;  4YKJ A;  5TPA B;  3LSX A;  2O7I A;  2GFE A;  1FBP A;  1NH7 A;  4PBH A;  4DE8 A;  1Z7M E;  1USY E;  3N6U A;  4DIG A;  4LQ2 A;  2Y7R A;  1J1N A;  4NE4 A;  3IB2 A;  3T96 B;  4RXL A;  3SEW A;  4GWY A;  1MDQ A;  4O3A A;  2IA4 A;  4ZEI A;  3BIH A;  3C34 A;  3ODB A;  1SI1 A;  5IZ3 A;  4NAP A;  1PC3 A;  5I7I A;  1R6Z A;  4PFB A;  3R6U A;  4I9D A;  4ECF A;  3LSW A;  4OVJ A;  3H7M A;  4PFY A;  3T66 A;  3K6V A;  3KG2 A;  1SQY A;  2PX1 A;  1IXH A;  4I40 A;  4XKP A;  3ONM A;  1ZU0 A;  2ZZV A;  3R7X A;  5CMK A;  4N8G A;  5EHS A;  3PD8 A;  1PB7 A;  3A09 A;  3CHG A;  4OAN A;  1B40 A;  3MPK A;  5CBS A;  3EHS A;  3ILT B;  3NOH A;  1I6A A;  3SEY A;  1Y3P A;  3IOV A;  2XD2 A;  4X1B A;  3O6H A;  5T3J A;  4IO7 A;  5ET6 A;  3PMW A;  1FJ6 A;  4MLQ A;  1B7Z A;  2ALU A;  3IR1 A;  5DYH A;  2O51 A;  3PPQ A;  3UN6 A;  1IMB A;  4XTC Q;  2W7Y A;  3ISP A;  2F7A A;  4IR8 A;  3ZS6 A;  5I2K A;  3E4R A;  3Q27 A;  2XX7 A;  4M1V A;  3CRB A;  1ZMG A;  4MNC A;  4Q0C A;  5F7V A;  5H8N A;  1RDY A;  2DWJ A;  2R71 A;  3O97 A;  2FVZ A;  2QVU A;  1FBD A;  4EQB A;  4MCO A;  3KN8 A;  4EQ7 A;  4H45 A;  1B7U A;  2F35 A;  2Q88 A;  1DSN A;  4O3C A;  4GIZ A;  2PYY A;  4PAK A;  4FJP A;  4BDO A;  4G68 A;  1FBE A;  1QUI A;  2OK2 A;  3IAZ A;  4OFL A;  3K01 A;  2B3F A;  2DE4 A;  4R74 A;  2XXV A;  1MY0 A;  4POX A;  2ZNT A;  1PB8 A;  5JK4 A;  1Q35 A;  2XXX A;  1SW2 A;  2CZK A;  1IMD A;  5DVJ A;  5ITO A;  3S9M C;  2F7C A;  3IOR A;  4G2Z A;  4LA9 A;  4I8C A;  4QHQ A;  1KA1 A;  1MXW A;  1B3E A;  4AS4 A;  3OSQ A;  3E79 A;  2V3U A;  4IGR A;  1QVS A;  2HZL A;  2UYF A;  4QFL A;  2CZI A;  3A29 A;  4X48 A;  4MMP A;  4NF6 A;  5FHN A;  1OMP A;  1MXY A;  2PFZ A;  2RC8 A;  4ONY A;  2X7P A;  2KLF A;  2H25 A;  4IO2 A;  1JW1 A;  2DVC A;  3I3V A;  3MZB A;  5B7D A;  1YZ0 A;  1P1O A;  1XI6 A;  4TOZ A;  4JWX A;  1SPI A;  4KQP A;  1VE4 A;  2DVZ A;  4OA4 A;  4NN3 A;  1NV0 A;  2I6E A;  1MM6 A;  2DYX A;  1QW0 A;  4G77 A;  1FTO A;  4GRK A;  1DPP A;  4DDD A;  1FTM A;  1Y4T A;  1RKM A;  3O28 A;  4IO3 A;  5CMC A;  1LLS A;  5AA4 A;  4ZZA A;  4O94 A;  2G29 A;  1LBB A;  4P47 A;  4LZ8 A;  5JTY B;  1A8F A;  1NUZ A;  5KCJ A;  3EHT A;  1FTA A;  3KC1 A;  3QAX A;  4Z7E A;  1K9Z A;  1LEV A;  1XC1 A;  5I2N B;  1IUD A;  3N94 A;  3MBP A;  3QIM A;  4NF4 B;  5I3S A;  3U65 A;  1LBW A;  1LFG A;  1LB9 A;  1N0T A;  2I49 A;  4R6H A;  1NI9 A;  3EF7 A;  4L17 A;  3WAE A;  4ELQ A;  1B52 A;  2CZH A;  3SKP A;  2Z8F A;  3UIF A;  3VVE A;  5K2X A;  2RF1 A;  5CM6 A;  2XXW A;  4PE3 A;  1YYZ A;  2PVU A;  4RK9 A;  4KHZ E;  4YIC A;  1MPD A;  3FIR A;  3IOU A;  5TP9 B;  1QJM A;  3FD3 A;  5H8N B;  1D9Y A;  4FAJ A;  3JYR A;  3V8X B;  3R26 A;  3TCH A;  4H5F A;  2RCA A;  1I6B A;  3RPL B;  3ZKK A;  3JV9 A;  4QSD A;  3OO6 A;  1Y1M A;  3H06 B;  3ROJ A;  5H8H A;  1FBC A;  4JVI A;  2F3B A;  1IXI A;  4P9K A;  4RA1 A;  3RPW A;  3O29 A;  4PF8 A;  5AA1 A;  2F7B A;  1OVT A;  1M5F A;  4P0I A;  4EF1 A;  1S7Y A;  5A5X B;  2OBG A;  4HS7 A;  1ELJ A;  4XKQ A;  3FVK A;  3G3K A;  4P8B A;  2XXR A;  4YZZ A;  4YB6 A;  1AMF A;  2DE2 A;  3PUW E;  4P11 A;  1RYO A;  2OWZ A;  4YKK A;  2A5S A;  3DP6 A;  3V5A A;  5LTC A;  4F29 A;  4F19 A;  1LFH A;  4ZDM A;  1ZBM A;  3AXF A;  1LBV A;  1UTH A;  2WX9 A;  5JEI A;  2F8D A;  5DW8 A;  3QK6 A;  1POT A;  4PFI A;  5TU0 A;  1GVC A;  1FPI A;  1FQF A;  2XHD A;  4AS5 A;  2XWK A;  4U1O A;  3HHF A;  3HCQ A;  4GQO A;  3T22 A;  1B46 A;  3PD9 A;  1B5J A;  5EQ9 A;  2DXY A;  1JEU A;  2L5V A;  2ONK E;  3K2D A;  3DLN A;  1SD3 A;  5EQA A;  4PTK A;  2HZK A;  3P7I A;  2GH9 A;  2YLN A;  3A3U A;  3FV2 A;  1B1H A;  1TFA A;  1EYK A;  4QSC A;  3VXC A;  4R6Y A;  3PV0 E;  1A7L A;  3KGC A;  2GQ1 A;  4X1D A;  5JTY A;  2XXT A;  1IMC A;  4H8I A;  3IK6 B;  5A5L A;  2WYK A;  2Q8J A;  1G0I A;  2MKZ A;  4ELR A;  3MVY A;  4MBP A;  4UA8 A;  2RC9 A;  2XWI A;  4KYE A;  4PQJ A;  2ESN A;  4H67 A;  4F3G A;  4PFT A;  3LUY A;  3K1M A;  5HBC A;  4O7I A;  1SW4 A;  3MP1 A;  1GR2 A;  3TAJ A;  4GBW A;  1FQB A;  2VT5 A;  4OXV A;  3SEX A;  3IO6 A;  3OSR A;  2QFL A;  2BJJ X;  3PU5 A;  4ZE8 A;  2Z8D A;  1BP5 A;  4BDL A;  4NX1 A;  2FIE A;  3QXM A;  1MQG A;  2OLB A;  3S4U A;  2V93 A;  4JDF A;  2OZZ A;  4IO4 A;  1URS A;  3O2A A;  4F1V A;  2VOZ A;  3GXA A;  2I4C A;  4N6P A;  2QPQ A;  1QUL A;  5IM2 A;  3PMV A;  2QS3 A;  4GWW A;  3QMF A;  3ILU B;  5EYF A;  1B3F A;  2PT1 A;  3TQL A;  3TKD A;  2O6A A;  3B7D A;  4MLV A;  3C4M A;  5ICQ A;  3K1P A;  3PTY A;  2DWI A;  3I6V A;  3PUV E;  4KFQ A;  3FXU A;  4YU0 A;  4GF8 A;  3RT8 A;  4JVD A;  4X04 A;  4PF6 A;  4GBV A;  3EQ1 A;  4NED A;  1R9L A;  1SYI A;  1GGG A;  1JVX A;  1DTZ A;  2H4I A;  4TQU Q;  4NTL A;  3RYD A;  2QS1 A;  2ZMB A;  3F11 A;  3TEP A;  4JWO A;  4FBP A;  3G3I A;  4OHN A;  5DT6 A;  4HCY A;  1SYH A;  1IME A;  2HAU A;  1P1Q A;  3FZV A;  4HE1 A;  3FVG A;  4UAB A;  3S9L C;  4Q8R A;  1M5B A;  3HV1 A;  1FPB A;  2FIX A;  5CBR A;  2R6G E;  2OX3 A;  5BWJ A;  3EKI A;  4QXD A;  4N6D A;  3S9N C;  5KDT B;  5I56 B;  4PE5 B;  3T9V A;  3TYH A;  4BDN A;  4OFO A;  2ZZX A;  4YKI A;  4ZE9 A;  4XKR A;  1LFI A;  1NNP A;  2X7Q A;  3V89 B;  2AL4 A;  4QRZ A;  1JEV A;  4JWY A;  3W9W A;  2ZYK A;  5CMM A;  4IB2 A;  1XVX A;  4O7M A;  3K6X A;  3HN0 A;  3FBP A;  4EXL A;  1ZTY A;  2R9J A;  3H6W A;  3SZP A;  3FJ7 A;  2DXR A;  3FAS A;  3C35 A;  4I3Y A;  4PET A;  1XT8 A;  1M5E A;  1QKA A;  1EU8 A;  4H46 A;  1IXC A;  2WKY A;  3TTN A;  4DZ1 A;  3D4C A;  2E1S A;  1JVY A;  3FUZ A;  4ELO A;  1FPE A;  4GL8 A;  2RC7 A;  4N07 A;  4PP0 A;  3VVD A;  4ZEB A;  4DLD A;  3RT6 B;  1NH8 A;  3THI A;  1BLF A;  1WVJ A;  3KC0 A;  4G4P A;  4RJZ A;  1US4 A;  1BTJ A;  2ZNS A;  4QSE A;  4MHF A;  3RN8 A;  4NF5 B;  1B0H A;  3L6H A;  1B5I A;  2P1S A;  1LB8 A;  1CE2 A;  1OLC A;  4OQO A;  4WEP A;  3GZG A;  2B4M A;  2HAV A;  1NNF A;  1L5T A;  3PPP A;  1B32 A;  1LAF E;  1IMA A;  3G3H A;  4XKN A;  3IJX B;  3SER A;  1UTB A;  4G8N A;  2RCB A;  1EYJ A;  5I57 A;  2XXP A;  4IO6 A;  1F9B A;  2DP8 A;  3LR1 A;  2XA5 A;  1B4H A;  3KEI A;  5ITP A;  5TPA A;  1LST A;  2Y84 A;  4FEB A;  3IB1 A;  4X8R A;  4FAT A;  5IZ3 B;  3G3J A;  4R6K A;  4GWO A;  4PDD A;  1ATG A;  1B51 A;  3KJ7 A;  5L9S A;  2R8T A;  2HHM A;  2Y7P A;  2GHB A;  5DVI A;  4LQ5 A;  1ZJL A;  3TCG A;  4LZ5 A;  4YMB A;  4NWD A;  1XOC A;  2B3B A;  3SEV A;  1YTV A;  3GBA A;  4NMY A;  5EHM A;  3U72 A;  1EZP A;  4OTE A;  2Y5L A;  3TTR A;  3DM0 A;  2IEE A;  5H8Q B;  3KOS A;  4EF2 A;  1Q9D A;  4EDP A;  1FBF A;  2Q8M A;  1PEB A;  1O63 A;  4MF3 A;  2XWO A;  5DEX B;  2YPN A;  4MNP A;  4TLM B;  3D4G A;  4ZZE A;  3PMX A;  1QUJ A;  1WOD A;  3OEN A;  5HM4 B;  1NNK A;  4R2B A;  2XX8 A;  1SDX A;  5KDT A;  1XHY A;  4G61 A;  3M3K A;  3PUZ E;  2O1M A;  3MWB A;  3TTL A;  4KXP A;  1NV3 A;  1Y9U A;  3CFZ A;  3LSF B;  3U1O A;  1URG A;  3PPN A;  4NGU A;  3H6V A;  1PB9 A;  3OOA A;  3G3G A;  2Y7W A;  4OVQ A;  4GX4 A;  5IKB A;  5FHO A;  1MY2 A;  2FYI A;  2CMO A;  3TZA A;  4THI A;  5CC2 A;  4PCD A;  2Z22 A;  1B4Z A;  2O7U A;  3CSG A;  3KN7 A;  1NV2 A;  3MZ9 A;  4I62 A;  5I58 A;  1H44 A;  1LBC A;  1GTK A;  3T9H B;  2CZL A;  3HFU A; 
#chains in the Genus database with same CATH homology
 2DXY A;  4HCW A;  4ZEF A;  2Q89 A;  4F3S A;  5AA2 A;  3CFL A;  1JW5 A;  4OWD A;  3HHG A;  1JEU A;  2ONK E;  3KZG A;  4Q5T A;  4LUB A;  3OXN A;  3TTK A;  4C0R A;  3MW0 A;  1B6H A;  3O66 A;  1SBP A;  3K2D A;  2QS2 A;  4FE8 A;  1H3D A;  4OEV A;  3DLN A;  1D3K A;  1A40 A;  2I3W A;  3VE1 B;  2H99 A;  3RTW B;  1UIV A;  3E9X A;  4KYD A;  4OYV A;  1SD3 A;  1NL5 A;  3CFX A;  5LOM A;  1M5D A;  3K1N A;  2THI A;  3C9H A;  4LZ7 A;  3U93 A;  4ZEC A;  1O7T A;  1IEJ A;  5AE4 A;  3E3K A;  1FQE A;  4GXA A;  4MFI A;  2Q9T A;  4XIG Q;  4DCY A;  3K0V A;  3RQT A;  1VFD A;  5HPQ A;  1XVY A;  3CG1 A;  3KSJ A;  3PUY E;  1OQG A;  4O3B A;  1LAX A;  1KWH A;  1D9V A;  2Z8E A;  3RGY A;  2UYE A;  1P1W A;  3KN3 A;  4RPN A;  2HZK A;  1MXU A;  2DOJ A;  3P7I A;  3OEK A;  1UQW A;  4RNS A;  2V84 A;  1B58 A;  2GH9 A;  1MQH A;  1WDN A;  2XXY A;  2YLN A;  2VP1 A;  3A3U A;  2DE3 A;  3FV2 A;  2H9B A;  4YKJ A;  2Z23 A;  5TPA B;  3LSX A;  3RY3 A;  1B1H A;  1TFA A;  4HW8 A;  4QSC A;  4E0W A;  2O7I A;  2D3I A;  4R6Y A;  3E13 X;  4U21 A;  2GFE A;  3VXC A;  5KCJ B;  4KPT A;  1TT1 A;  3PV0 E;  1PBQ A;  1PDA A;  1A7L A;  1NH7 A;  4WED A;  3KGC A;  4DE8 A;  3M3L A;  1Z7M E;  1USY E;  4X1D A;  3G3F A;  3N6U A;  4G68 C;  3ZKL A;  2HXW A;  1HSJ A;  5JTY A;  2XXT A;  2ZNU A;  3M8U A;  3C31 A;  2QSX A;  4ZEK A;  4H8I A;  4LQ2 A;  4DIG A;  3CG3 A;  3IK6 B;  3RTF B;  1UTH B;  4OFJ A;  3T9H B;  3MVX A;  1MQI A;  1J1N A;  2NXO A;  2Y7R A;  4K3F A;  3KFM A;  4ZS9 A;  2Q8J A;  4NF4 A;  4NE4 A;  5FTI A;  2DQV A;  2Q2C A;  4TLL B;  3IB2 A;  4ELR A;  3MVY A;  3T96 B;  5BUU A;  4ESX A;  4RXL A;  2V3Q A;  4MBP A;  3SEW A;  3VFJ A;  1MDQ A;  4UA8 A;  4O3A A;  2IA4 A;  5I56 A;  1FTK A;  4ZEI A;  5ICT A;  3Q28 A;  5CRY A;  3S9E A;  2RC9 A;  3C34 A;  4KYE A;  4F1Y A;  4PQJ A;  2HCA A;  5L9M A;  1ZIU A;  2ESN A;  3ODB A;  1SI1 A;  4GXS B;  2RIN A;  3KOT A;  3MP8 A;  2P0S A;  4H67 A;  4FOR A;  2X26 A;  4H6D A;  4C1T A;  4PFT A;  4F3G A;  1PC3 A;  5I59 B;  3LUY A;  3K1M A;  5HBC A;  1R6Z A;  3CVG A;  2H5Y A;  2HEU A;  1SW4 A;  1II5 A;  2VD3 A;  3MP1 A;  3R6U A;  4I9D A;  4ECF A;  4F2O A;  3IX1 A;  4R9G A;  4F3B A;  1B0L A;  1GR2 A;  3CI8 A;  1R1N A;  3LSW A;  4OVJ A;  3RUM A;  3TAJ A;  1FQB A;  3FAT A;  1QKB A;  3H7M A;  4PFY A;  3T66 A;  3K6V A;  4OXV A;  3IO6 A;  3KG2 A;  3SEX A;  1SQY A;  3OSR A;  4GFR A;  2PX1 A;  3TPA A;  1IXH A;  4QF9 A;  4IO5 A;  4XKP A;  3GLB A;  4BDR A;  1POY 1;  1B05 A;  3DEL B;  4R9F A;  2BJJ X;  3PU5 A;  3ONM A;  1ZU0 A;  3W15 C;  4ZE8 A;  3MUQ A;  1Y3N A;  2Z8D A;  3R7X A;  4EF1 A;  5CMK A;  1A8E A;  5EHS A;  3PD8 A;  1BP5 A;  4BDL A;  1UIU A;  2UVJ A;  2GHA A;  1PB7 A;  1MY1 A;  3A09 A;  3QXM A;  4YB7 A;  4YMA A;  2UXA A;  1MQG A;  1HSE A;  2OLB A;  1HSL A;  2NWJ A;  2V93 A;  3S4U A;  1I6Q A;  1B40 A;  3MPK A;  5CBS A;  3EHS A;  3ILT B;  4JDF A;  2DWH A;  5AA4 B;  5IAI A;  4RPO A;  5KZT A;  1I6A A;  3SEY A;  1Y3P A;  2QRY A;  2F6G A;  2OZZ A;  2XD2 A;  3IOV A;  4IO4 A;  1URS A;  4X1B A;  4X9T A;  3O6H A;  3O2A A;  4IO7 A;  3PMW A;  4RY1 A;  3IO4 A;  4F1V A;  2OWS A;  2VOZ A;  4RYA A;  1VFE A;  3GXA A;  1B5H A;  4ELP A;  1LCF A;  2I4C A;  4NWC A;  4BLA A;  4N6P A;  2QPQ A;  1QUL A;  3ZSF A;  3BKI B;  3PMV A;  5I2N A;  2QS3 A;  4BDM A;  3ILU B;  5EYF A;  1B3F A;  2PT1 A;  4U23 A;  3PPR A;  3UK4 A;  4MLQ A;  3TKD A;  1AH5 A;  3TQL A;  5A5X A;  3B6Q A;  1B7Z A;  2O6A A;  1R9Q A;  3CR9 A;  4NF5 A;  2V3T A;  4R75 A;  5DEX A;  3FGS A;  3SET A;  4F31 B;  3B7D A;  3FXQ A;  2ALU A;  3IR1 A;  4MLV A;  4M4G A;  5DYH A;  5H8F B;  5I57 B;  1CB6 A;  2O51 A;  5AA3 A;  1B2H A;  3C4M A;  3PPQ A;  5ICQ A;  1O64 A;  3UN6 A;  4XTC Q;  5CMM A;  4KCD A;  2W7Y A;  3K1P A;  5H8F A;  3TFL A;  2DWI A;  2F7A A;  3FV1 A;  3TUS A;  3I6V A;  3PUV E;  4KFQ A;  3ZS6 A;  5I2K A;  2ANJ A;  1MG1 A;  3FXU A;  3EHU A;  1AIV A;  3E4R A;  4IY5 A;  1US5 A;  1SVX B;  4YU0 A;  4GL0 A;  3Q27 A;  4GF8 A;  3RT8 A;  4AB6 A;  3MJN A;  3B6T A;  1JET A;  2REG A;  2XX7 A;  4M1V A;  4NF8 B;  2O1L A;  3TOD A;  2ZXT A;  3EQ1 A;  4NED A;  1R9L A;  3CRB A;  1MY4 A;  1NKX A;  1SYI A;  1GGG A;  1ZMG A;  4Q0C A;  5F7V A;  3UGW A;  4GLI A;  5H8N A;  4YKP A;  5CMB A;  3TTM A;  1JVX A;  2DWJ A;  1DTZ A;  2H4I A;  2P2A A;  3MZ1 A;  4NTL A;  1Z7N E;  1TXF A;  2YJP A;  2R71 A;  2QS1 A;  1MY3 A;  2ZMB A;  4TQU Q;  4JB7 A;  5TP9 A;  4F2Q A;  3O97 A;  3F11 A;  3TEP A;  4JWO A;  3KJT A;  1IIT A;  4H0W A;  4EQB A;  1MH3 A;  2B65 A;  3KN8 A;  3G3I A;  4EQ7 A;  4OHN A;  1B7U A;  3MQ9 A;  2F35 A;  5DT6 A;  2Q88 A;  1DSN A;  4HCY A;  1SYH A;  2PYY A;  4GIZ A;  4O3C A;  2QMW A;  4QFN A;  4DXU A;  2F97 A;  4U22 A;  3QUF A;  3T9X B;  1N3X A;  3JZJ A;  2HAU A;  3FJM A;  4FJP A;  1P1Q A;  4H5G A;  4JXI A;  3U94 A;  4BDO A;  3FZV A;  5H8Q A;  4G68 A;  1OQH A;  3FVG A;  1A55 A;  3O6I A;  1N7X A;  1MQD A;  1S9T A;  4GVO A;  3S9L C;  1QUI A;  1M5B A;  1MRP A;  2OK2 A;  3HV1 A;  3IAZ A;  4OFL A;  4Q8R A;  1YAE A;  3K01 A;  2AYS A;  4JSD A;  4PFW A;  5CI5 A;  2B3F A;  2I0C A;  4H65 A;  2DE4 A;  5CBR A;  3BFT A;  4EQ9 A;  4R74 A;  2XXV A;  2R6G E;  1M5C A;  1MY0 A;  5BWJ A;  4POX A;  2ZNT A;  3MVZ A;  4FIM A;  2I48 A;  2V25 A;  5L8D A;  2A5T A;  1PB8 A;  4F39 A;  1RYX A;  1P1N A;  2M8C A;  3QSL A;  1NNT A;  3S9N C;  5KDT B;  5I56 B;  2NOO A;  3H3G A;  5JK4 A;  5L9O A;  1Q35 A;  3VLW A;  4PE5 B;  3T9V A;  3LSL A;  2XXX A;  3TYH A;  4BDN A;  1FTJ A;  4OFO A;  1SW2 A;  2H98 A;  4ISU A;  4PFU A;  4YKI A;  4IGT A;  4ZE9 A;  1H45 A;  3K6W A;  5FTH A;  3GBB A;  5DVJ A;  2I4B A;  3OO9 A;  1TWY A;  4R2F A;  4XKR A;  1LFI A;  5ITO A;  3S9M C;  1NNP A;  2F7C A;  3IOR A;  1JQF A;  2X7Q A;  3K00 A;  3OEL A;  3V89 B;  1URD A;  1DPE A;  2AL4 A;  4G2Z A;  3H03 A;  4QRZ A;  2F6P A;  1JEV A;  4LA9 A;  4I8C A;  4YB5 A;  4JWY A;  5F1Q A;  1EH3 A;  3W9W A;  1Y3Q A;  2ZYK A;  1FQC A;  4QHQ A;  1MXZ A;  4IB2 A;  1MXW A;  1XVX A;  1B3E A;  1MQJ A;  4I1D A;  3OSQ A;  1MPC A;  1Y1Z A;  1N7W A;  2QL3 A;  2V3U A;  3HN0 A;  1QVS A;  3K6X A;  2E0S A;  3N26 A;  3O9P A;  4IGR A;  4NF8 A;  3UOR A;  4EXL A;  2F34 A;  1ZTY A;  2HZL A;  1Y20 A;  1SW1 A;  2ABH A;  2R9J A;  3H6W A;  4UAC A;  2XXQ A;  3FJ7 A;  3MPL A;  3PUX E;  2DXR A;  2UYF A;  3FXR A;  4QFL A;  4LVQ A;  3CSB A;  3VVF A;  2XX9 A;  3FAS A;  4G8M A;  3C35 A;  4X48 A;  1ANF A;  4PET A;  4NF6 A;  1XT8 A;  5FHN A;  1OMP A;  4U2R A;  1M5E A;  1GV8 A;  1QKA A;  1MXY A;  3SES A;  4KI0 E;  4DXC A;  1EU8 A;  4KR5 A;  2RC8 A;  4ONY A;  2X7P A;  1IXC A;  1MM7 A;  1BIY A;  2KLF A;  2WKY A;  2H25 A;  2Y7I A;  2O84 X;  3IOT A;  4IO2 A;  5I58 B;  3TTN A;  1JW1 A;  2DVC A;  3I3V A;  4DZ1 A;  4EXK A;  3I5O A;  3D4C A;  3MZB A;  4F3P A;  2E1S A;  2D21 A;  2PT2 A;  1JVY A;  3FUZ A;  4ELO A;  4GL8 A;  2RC7 A;  2OWT A;  4N07 A;  4PP0 A;  5B7D A;  2RKM A;  4HTG A;  3VVD A;  5A5X B;  1P1O A;  4OZ9 A;  4ZEB A;  5K2Y A;  2UVG A;  3FVN A;  4AB5 A;  3RT6 B;  4DLD A;  1NH8 A;  3THI A;  4TOZ A;  4JWX A;  4KQP A;  1BLF A;  1WVJ A;  3TMG A;  1VE4 A;  5DTB A;  2DVZ A;  1EZ9 A;  1US4 A;  4G4P A;  1B3L A;  4RJZ A;  5ISU A;  1BTJ A;  1IZ1 A;  3C32 A;  1IQ7 A;  5DVF A;  2F78 A;  2ZNS A;  2I6E A;  1MM6 A;  4QSE A;  2Y7K A;  3SDF A;  1QW0 A;  4G77 A;  1FTO A;  4FEC A;  3RLF E;  4RK2 A;  3RN8 A;  4NF5 B;  1B0H A;  4GRK A;  4KD5 A;  3U92 A;  3KSX A;  4AQ4 A;  3L6H A;  1B5I A;  1DPP A;  2D5W A;  1YCJ A;  4DDD A;  1VSO A;  2O69 A;  1FTM A;  2A5T B;  2P1S A;  1LB8 A;  1CE2 A;  1OLC A;  1RKM A;  1Y4T A;  3M3F A;  4OQO A;  3O28 A;  4Q30 B;  4R73 A;  4IO3 A;  3OD7 A;  1LLS A;  5CMC A;  2F36 A;  4WEP A;  5AA4 A;  4ZZA A;  2G29 A;  3GZG A;  1LAG E;  2AL5 A;  1FTL A;  1LBB A;  2HAV A;  3MC2 A;  4LZ8 A;  1JW4 A;  5JTY B;  1OVB A;  3S2V A;  5AA2 D;  1FQA A;  1NNF A;  1A8F A;  1L5T A;  4LON B;  5H8H B;  1MPB A;  2ZYN A;  5KCJ A;  2LAO A;  4R72 A;  3PPP A;  1B32 A;  4POW A;  3EHT A;  1OIB A;  4QFO A;  1LAF E;  3EN3 A;  3QAX A;  1T0K A;  2AIX A;  3G3H A;  4Z7E A;  1FW0 A;  1MS7 A;  4XKN A;  4Z0I A;  1XC1 A;  1MXV A;  3IJX B;  3Q29 A;  5I2N B;  1IUD A;  3N94 A;  2HQ0 A;  4H8J A;  3N5L A;  3MBP A;  3SER A;  3PPO A;  1UTB A;  4G8N A;  3QIM A;  4KYS A;  3HO7 A;  2I3V A;  1MH4 A;  2RCB A;  3N6T A;  4NF4 B;  1XS5 A;  5I84 A;  1FQD A;  2DSF A;  1N76 A;  2XXP A;  3T93 B;  5I57 A;  1LFG A;  2I0B A;  1F9B A;  3CIJ A;  4IO6 A;  1LB9 A;  1N0T A;  2DP8 A;  2I49 A;  3LR1 A;  4R6H A;  5M2V A;  1EZO A;  1B9J A;  1B4H A;  3EF7 A;  3KEI A;  3HST A;  3IB0 A;  4L17 A;  5H8S A;  3WAE A;  4ELQ A;  1B52 A;  4P0G A;  4WKM A;  5ITP A;  2XXI A;  5TPA A;  1LST A;  4OEU A;  1USY H;  2Y84 A;  5I2K B;  4FEB A;  1P99 A;  2XXU A;  2XXH A;  2ZYM A;  1H76 A;  1N3W A;  3IB1 A;  3TEL A;  1B3G A;  3SEU A;  4EUO A;  4FAT A;  3G3J A;  4MH5 A;  4R6K A;  3SKP A;  4WXJ A;  2Z8F A;  3UIF A;  3L6G A;  3VVE A;  5K2X A;  4GWO A;  2RF1 A;  3FVO A;  1ATG A;  1B51 A;  3KJ7 A;  5B70 A;  5L9S A;  5CM6 A;  2XXW A;  4OEN A;  2Y7P A;  1LCT A;  3OO7 A;  4G68 B;  3MP6 A;  1A99 A;  2PVU A;  3ECR A;  3IL1 B;  1S50 A;  3LBS A;  4JBZ A;  1SI0 A;  1AL3 A;  2FNC A;  4RK9 A;  2GHB A;  3K6U A;  1JNF A;  3C36 A;  2FA7 A;  4KHZ E;  4YIC A;  4IY6 A;  5DVI A;  1Y4C A;  1MPD A;  3FIR A;  1ZJL A;  3OMB A;  4LQ5 A;  1LAH E;  4OMB A;  3UA8 A;  1N84 A;  3IOU A;  4ZED A;  3TCG A;  5TP9 B;  3T9U A;  1QJM A;  4LZ5 A;  2ZYO A;  4LAT A;  2NVU B;  2UVH A;  3K02 A;  3A3C A;  3FD3 A;  4YMB A;  4NWD A;  4XXU A;  2G93 A;  2XD3 A;  3DP8 A;  1D9Y A;  1XOC A;  2VD2 A;  5H8N B;  2B3B A;  2QJE A;  4FAJ A;  3JYR A;  3SEV A;  2ONR A;  1LGB C;  1YTV A;  3V8X B;  2VGQ A;  3R26 A;  3Q25 A;  3TCH A;  3VDF A;  4OES A;  3GBA A;  4NMY A;  5I59 A;  4H5F A;  5EHM A;  2RCA A;  2VHA A;  4N13 A;  1PBP A;  1DTG A;  3U72 A;  5AA2 B;  3MVW A;  3TDJ A;  4BDQ A;  1EZP A;  4OTE A;  1DOT A;  1VR5 A;  3OO8 A;  3VLV A;  3TTR A;  1OLA A;  3DM0 A;  2IEE A;  3OEM A;  4U4S A;  5H8Q B;  4ESW A;  4F1U A;  3KOS A;  4EF2 A;  1I6B A;  1FCK A;  4YAH X;  4KCC A;  3KBR A;  3ZKK A;  1YPN A;  4EDP A;  3JV9 A;  4QSD A;  3OO6 A;  4GD5 A;  1Y1M A;  1PEB A;  3H06 B;  4JSO A;  1O63 A;  5H8H A;  2REJ A;  4OET A;  1ZLQ A;  3RNN A;  2OCU A;  3WAF A;  4MF3 A;  4GOT A;  1IXI A;  5DEX B;  1H43 A;  2GRV A;  3EPE A;  2UVI A;  4RA1 A;  2YPN A;  2PMS A;  3K4U A;  3D4G A;  2Q2A A;  4TLM B;  3RPW A;  4E0X A;  3H6U A;  3O29 A;  5AA1 A;  4F22 A;  2F7B A;  4ZZE A;  1I69 A;  3IOW A;  1OVT A;  1M5F A;  3PMX A;  4P0I A;  1IIW A;  1N04 A;  1QUJ A;  1S7Y A;  1B1X A;  1SW5 A;  1WOD A;  2OBG A;  3OEN A;  3Q26 A;  2NUV A;  4HS7 A;  1NNK A;  1ELJ A;  4XKQ A;  5HM4 B;  4C1U A;  1UTB B;  3FVK A;  4QFP A;  5J1D A;  4NF6 B;  1QUK A;  3G3K A;  4R2B A;  1TFD A;  2OJT A;  4LP2 B;  4U4X A;  2XXR A;  4YZZ A;  4F18 A;  2XX8 A;  1SDX A;  4YB6 A;  1AMF A;  1A54 A;  2DE2 A;  5KDT A;  1D4N A;  3PUW E;  4P11 A;  2QS4 A;  3O6G A;  1RYO A;  4YKK A;  2F5X A;  2A5S A;  3BBR A;  1XHY A;  3PGF A;  3U8Q A;  3M3K A;  3C33 A;  3PUZ E;  2DS9 A;  3DP6 A;  3IJO B;  3V5A A;  2O1M A;  3BFU A;  4F29 A;  4F19 A;  3UP9 A;  1LFH A;  1NFT A;  4ZDM A;  3FJG A;  1ZBM A;  3TCF A;  3HPI A;  3AXF A;  1BKA A;  1UTH A;  3MWB A;  3TTL A;  1DMB A;  3VXB A;  4DXB A;  5JEI A;  3V83 A;  2F8D A;  4ND9 A;  3QK6 A;  1Y9U A;  3CFZ A;  1POT A;  3LSF B;  4U1Z A;  4FED A;  3MAM A;  3U1O A;  5TU0 A;  1URG A;  3PPN A;  1GVC A;  3USD A;  3H6V A;  1PB9 A;  1FQF A;  2HFB A;  1IXG A;  3G7W A;  1MXX A;  2XHD A;  2DWA A;  3H6T A;  3OOA A;  3G3G A;  2Y7W A;  1B7H A;  1MDP 1;  1ZKB A;  4U1O A;  3VLU A;  3QYT A;  5FHO A;  5IKB A;  3HHF A;  1MY2 A;  1NMU A;  2FYI A;  5ELV A;  1B3H A;  1Q1K A;  2CMO A;  2O68 A;  3HCQ A;  4GQO A;  4H1X A;  4DCX A;  3TZA A;  4THI A;  3W9V A;  2QMX A;  2I58 A;  5CC2 A;  4QFK A;  3LC8 A;  3H4Z A;  2Z22 A;  3DP4 A;  1B4Z A;  2O7U A;  3CSG A;  3KN7 A;  5FHM A;  4OER A;  3MZ9 A;  2PBW A;  2ONS A;  3T22 A;  1B46 A;  4I62 A;  3TQW A;  4G8H A;  5I58 A;  1AOV A;  1H44 A;  1P1U A;  3PD9 A;  3QUJ A;  1B5J A;  1LBC A;  1GTK A;  3B6W A;  3VV5 A;  2CZL A;  2DYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...