5IAIA

Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
399
structure length
399
Chain Sequence
KPLDGVTLTLASQNDPFGAVLTKLAAEFKQDTGADLKVEVMDYGTLLTKTTADFVGKTKGYDLVTMDIVWAGAYQANGYSVDLTDWVKRDAAELDLDDIYPVILQSLGQYKGHYVAFPFAAYANVLAYRKDLFQAAGLPVPTTVEELVSDAKKLTDPSKKQYGFVANGQKGPAVAQDWMQYNNQMGGSILDNDGKPALNSPENVKSLTVYKQLFVETAPPGAIEYDWGGREESFRQGAAAMMQTWSVGAPGYSDPASSNVVGKVGITTAPVGKGVPPQYGVGGWGMAINADIDPKQKEAAWTFIKWLVSKKIHKEFNMDGAGSFMRKSQMTDPDLTAKFDFLPVVAKTYENGNGEYRPRIPEYPEIQDILGSAVNSVLAGAAEPQAALDEAQVEAKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute-binding protein
molecule keywords Sugar ABC transporter
publication title Crystal structure of ABC transporter Solute Binding Protein Arad_9887 from Agrobacterium radiobacter K84, target EFI-510945 in complex with Ribitol
rcsb
source organism Agrobacterium radiobacter
total genus 142
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5iaiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5iaiA02
3FZVA 3UN6A 3VFJA 1I69A 3OELA 4AB6A 1OLAA 1A7LA 1MDQA 1LBCA 4POXA 4EQ7A 4NF4B 3CSGA 3IOTA 2F36A 4QRZA 4ZEFA 3LC8A 4F3SA 2I4BA 2GFEA 2Q88A 4U4SA 5I2KB 3RGYA 3U8QA 4PFTA 1FQEA 5K2YA 2QSXA 2GRVA 3RT8A 2RF1A 3FV1A 4OEVA 4NF6A 3OD7A 1PC3A 2OZZA 1I6QA 1RKMA 2DQVA 1EU8A 4RYAA 2ZYNA 3EHTA 4ZECA 4JSOA 4EF2A 3ONMA 1TXFA 3CFXA 3MZBA 1MQHA 4KPTA 2Z8EA 3SESA 1LAXA 5AA4A 3IOUA 2DYXA 4OESA 3KN7A 2HXWA 1JEVA 2AYSA 3TZAA 3MVYA 3FGSA 2FYIA 3E9XA 1UTHA 3DLNA 4IGRA 3HN0A 4R73A 2R71A 1B58A 2YJPA 1MPDA 2REGA 4NEDA 3EPEA 5ICQA 5AA1A 3TPAA 4G8HA 4NF4A 5L9OA 1MXXA 2Z8FA 3U1OA 1B9JA 2IA4A 1B5JA 4H8JA 3PD9A 1SBPA 1LFIA 3T96B 2HQ0A 3IX1A 4YKPA 3S9MC 5I2KA 5B7DA 5ICTA 4X9TA 2CMOA 4IO4A 1R1NA 4OWDA 4XKRA 3Q28A 4MLVA 2Z23A 1WODA 1WVJA 1B0LA 3LR1A 4MBPA 4RPOA 2UVGA 3IJOB 4NF5B 1MY3A 3O97A 4ESXA 5CRYA 4AB5A 2ZMBA 2ANJA 1MY1A 2NXOA 1VFDA 5LOMA 5K2XA 3C31A 1R9QA 4ZEKA 2F35A 3HHGA 1T0KA 3O6HA 1JW1A 1XHYA 1A40A 1ZMGA 5DVFA 3FUZA 4IO2A 1MXVA 4UA8A 3TAJA 3PUWE 1M5CA 2I3VA 3IORA 2XXXA 2UYEA 4DE8A 3JV9A 3PGFA 1MPBA 1XVYA 1FQAA 2VP1A 4KYDA 5F7VA 2IEEA 1XS5A 3WAFA 1Y4TA 1RYOA 1AOVA 3S9NC 3IO4A 3QUJA 4F1YA 4GVOA 2VGQA 1B6HA 1MM7A 3OO7A 1EZ9A 3FATA 2OJTA 3G3FA 5A5XA 1LFHA 3UGWA 4Q8RA 1BKAA 4GL8A 4Q0CA 4FEDA 1XT8A 2ZXTA 2WKYA 2E0SA 2OK2A 1USYH 3IOWA 2YPNA 4F3BA 5JK4A 4P11A 2R6GE 3HV1A 3N6TA 5H8QB 4QFLA 4TQUQ 3RN8A 3KEIA 4YKJA 3TUSA 3PUZE 4U2RA 2FA7A 3N5LA 1B0HA 4FECA 4XKPA 3C32A 2DWAA 3S2VA 1LB9A 1Y1MA 3A09A 2HEUA 2PBWA 2ZNTA 4ZEBA 3C33A 1L5TA 1SW4A 5IKBA 1NNTA 1FCKA 2V3TA 4YAHX 3R7XA 4N07A 3MP6A 4OTEA 5EYFA 4RY1A 4TLLB 2QS3A 3KBRA 4P0IA 3QUFA 3MZ9A 4OMBA 2YLNA 1OVTA 3FVGA 1PBQA 2VOZA 3IOVA 1URSA 2O1LA 2RKMA 1OIBA 3OXNA 5DEXB 4C1UA 3LBSA 2HAUA 1ANFA 1Y20A 3R26A 3U72A 3TKDA 1H76A 2I0BA 5H8QA 2I0CA 2PYYA 2ZNSA 1MPCA 3K6XA 3CG1A 3R6UA 3RLFE 1GTKA 2Q2AA 4OFLA 4BLAA 4IO6A 3UIFA 3HCQA 3CSBA 5CMMA 1DOTA 2CZLA 3H03A 1J1NA 4YZZA 5FTHA 1YCJA 1LBBA 1GGGA 2X26A 3O6IA 3MPKA 1YTVA 1IZ1A 4PFYA 5I59B 4FAJA 4Z0IA 1MXUA 4IO3A 2RC8A 2V3QA 1Y3QA 3LSXA 3TDJA 4OZ9A 1MQGA 5I57B 1IITA 3CG3A 3UK4A 5DVIA 4O3AA 5DEXA 3C4MA 5L9SA 2F6GA 3H6TA 1PEBA 1BTJA 4G8MA 1LAHE 1P1OA 4R2FA 1O64A 3TTLA 1FTJA 2QRYA 1UQWA 4R6YA 3A3UA 1D9YA 2F97A 4LQ2A 5I2NB 3MWBA 1KWHA 4QSEA 1MH4A 2I3WA 4MLQA 3M8UA 3IB2A 2NVUB 4ELOA 1FQFA 4GXAA 2OCUA 4GFRA 2OWSA 1B32A 3FD3A 4WXJA 4O3CA 1VSOA 2FNCA 3K1MA 2VD2A 4HTGA 1SW5A 1VE4A 3RTWB 4ONYA 3TTNA 4F31B 3B6TA 1S9TA 4ZS9A 4MF3A 5CBSA 4QF9A 1ZBMA 5I58B 3PPQA 1HSEA 1A99A 2H99A 1IUDA 5I56A 5DYHA 4ZE9A 3U93A 3GBAA 1NH7A 1OQHA 5AA2A 2G29A 4Q30B 4GF8A 4X1DA 2XX8A 1LSTA 2DP8A 1P99A 1SI1A 3MAMA 3QAXA 2OBGA 4QFOA 3T9UA 3W15C 1RYXA 4TLMB 4YU0A 4NTLA 2XXUA 1GVCA 5DT6A 5FTIA 4GQOA 5CMKA 5I2NA 1SW2A 5DVJA 4PP0A 4EXLA 4OQOA 3PU5A 1XOCA 3DP6A 4OERA 1R9LA 3PUVE 2O51A 1S50A 2E1SA 1N04A 2RCBA 2D21A 2P2AA 2PMSA 3KGCA 1DTGA 2ALUA 3BFTA 4GOTA 4DLDA 2QS4A 3KN8A 2ZNUA 5CMBA 1AH5A 1FQDA 4F2QA 3SKPA 5I58A 4F39A 2XXVA 1B3EA 2HZLA 4LATA 1H44A 3CR9A 4ECFA 3KOTA 4H65A 4YB7A 2QJEA 3ZKKA 3I6VA 2PT1A 1N0TA 1PB7A 3TCHA 3M3FA 4BDOA 1HSLA 3O2AA 1ZIUA 1UTBA 3PMVA 1DMBA 4FATA 1NKXA 1AMFA 3S9EA 1XVXA 5H8HA 2XHDA 3FVNA 3O66A 4KCDA 4JXIA 4R9FA 3VVDA 3W9VA 4M1VA 2QPQA 2O68A 4GLIA 3GZGA 4I8CA 1LB8A 3USDA 1OVBA 3P7IA 4WKMA 2OWTA 3PPRA 4EXKA 2NOOA 3OO9A 1FTOA 3V5AA 3K1PA 3U92A 3VDFA 2RINA 3TTRA 4OXVA 5CI5A 4QFKA 4RK2A 3K01A 1MG1A 3BFUA 3Q26A 2XXHA 2ZYOA 3TMGA 1SQYA 5A5XB 4K3FA 2VD3A 3G3GA 3TTMA 4WEPA 3OO6A 3L6HA 3DELB 5TP9B 3RTFB 3PPOA 3FVOA 4ISUA 1II5A 4FE8A 5EHMA 3TYHA 1TWYA 3C34A 4OETA 4EQBA 4FORA 2HCAA 4XTCQ 4QSCA 1JVYA 3FVKA 3UORA 4IO7A 5CBRA 5CC2A 2DE3A 5TPAA 1SD3A 4OYVA 4G68B 1A55A 5H8NB 3KG2A 4EUOA 3V89B 2Y7PA 2I58A 3EHSA 2NWJA 3IB0A 3FJGA 1LLSA 4BDMA 3O6GA 1N76A 2DXRA 2ZYMA 1I6AA 1NNPA 2QL3A 3KSXA 3RT6B 4LZ8A 3MP8A 1FTLA 2V84A 4C0RA 1OMPA 3C35A 1POTA 5DTBA 3C9HA 1SYHA 5TU0A 3ZSFA 1B52A 1OLCA 5TP9A 2R9JA 2XX7A 2Y7WA 2P0SA 4U23A 2AL4A 3TCFA 2X7PA 1F9BA 3CI8A 4NF8B 2V25A 3RNNA 3L6GA 3IAZA 1Z7ME 1A8EA 2Y7IA 4YKIA 4LA9A 3K1NA 1MXYA 3BBRA 4PFWA 2D5WA 3TEPA 4G77A 2PVUA 3K4UA 3SEVA 3SEUA 3CVGA 2B65A 1H45A 3W9WA 1B3GA 4G68A 5H8NA 3UA8A 2B3BA 5KZTA 4KFQA 5JEIA 3RQTA 3H7MA 4RXLA 2F7CA 3U94A 2O1MA 1QUIA 1JW4A 2DE4A 1B4ZA 3CRBA 1Q35A 1EH3A 1P1UA 1WDNA 1DPEA 1PBPA 4JWXA 2RCAA 4IB2A 4OENA 2F7AA 1UIUA 5HBCA 2UVIA 4F3GA 2PX1A 1O7TA 1QUJA 1ZLQA 1I6BA 2H4IA 3H3GA 1LAGE 1B51A 2B3FA 2DWHA 5EHSA 4YKKA 5ISUA 3K6UA 2DWJA 3K6WA 3OMBA 1S7YA 3BKIB 3ODBA 3GLBA 1QUKA 2ABHA 4NF8A 4PFUA 3QIMA 4BDQA 3DM0A 1QW0A 1ZKBA 3B6QA 4F3PA 3LUYA 1LCTA 4F29A 2XXRA 1URDA 4QSDA 3A3CA 1SI0A 2H25A 3TELA 1ZTYA 3IK6B 4RJZA 4MFIA 4QHQA 3CFLA 2AIXA 5HM4B 5ITPA 3N94A 1US4A 4R75A 5FHMA 3OENA 1QVSA 4HS7A 2H9BA 3RUMA 4BDRA 4N13A 3FXUA 2HAVA 1MH3A 1MDP1 5AA3A 5KDTA 2VHAA 1QULA 3PV0E 3CIJA 4GL0A 1IQ7A 3I5OA 4GWOA 1UIVA 4YMAA 4ELPA 3TCGA 3TODA 2DOJA 3TQLA 4XKQA 3OEMA 4ZDMA 1ATGA 4DZ1A 4OFJA 4NWCA 2V93A 1Y3PA 5I56B 2UYFA 2F5XA 3OSRA 1JEUA 1IXGA 5AA2B 3THIA 2DWIA 4F1UA 3SEYA 4JB7A 3Q25A 4GD5A 3LSWA 3OOAA 3FASA 4JSDA 4ZZEA 3KJ7A 2M8CA 2DS9A 3IR1A 5L9MA 4R2BA 4JWOA 1TFAA 1FW0A 4H8IA 1IEJA 4DXCA 3KJTA 4PQJA 1QJMA 3KSJA 3E13X 1FQCA 4TOZA 3VVFA 1PB9A 3MVZA 3S9LC 4R6KA 2O7IA 2XD3A 4H67A 2RC7A 4P0GA 2ESNA 2DE2A 3HHFA 4LZ5A 3HO7A 4QFNA 1MY4A 1BLFA 4ZEIA 5ITOA 1MY2A 2PT2A 3G3JA 3C36A 3H6VA 5H8SA 4POWA 1N7XA 2THIA 4OEUA 3EN3A 3FJMA 4IGTA 3EHUA 5H8FA 5J1DA 3SDFA 4OHNA 1BIYA 4G68C 1YAEA 4ND9A 4FIMA 4THIA 1LCFA 1UTBB 4QFPA 3ZKLA 2H98A 3M3LA 4UACA 4F1VA 3T22A 2RC9A 2REJA 3T9VA 5H8HB 4KD5A 3ILUB 3LSFB 3FXQA 2NUVA 2O6AA 2Q89A 1B5IA 3MVWA 4WEDA 4U21A 4HCYA 3SERA 1POY1 2Q8JA 5AA2D 3WAEA 5F1QA 2F8DA 3MUQA 1B2HA 1B1XA 4H0WA 1N84A 2KLFA 1MRPA 1A8FA 2Z8DA 3OSQA 2OLBA 4KQPA 1M5EA 3VXCA 1QKBA 1AIVA 4FEBA 4ELQA 2V3UA 2XXWA 5L8DA 4DCXA 4F22A 3SEWA 4RA1A 4R6HA 3M3KA 3Q27A 4XXUA 4DCYA 1B7UA 3D4GA 4YMBA 2QMWA 3B7DA 3G3KA 4C1TA 1EZOA 1TT1A 1MXWA 1D4NA 1MQIA 2HFBA 4Z7EA 3T93B 3VV5A 3KFMA 4RK9A 1QKAA 5TPAB 1CE2A 1NFTA 1OQGA 3RPWA 1SVXB 4NMYA 3H06B 4R74A 1N7WA 1LFGA 2I48A 2H5YA 2XXTA 3MJNA 1B7HA 1B05A 3K6VA 2F78A 1VR5A 1B7ZA 4X1BA 3H4ZA 2D3IA 1US5A 5HPQA 1USYE 4BDLA 3EF7A 4ZZAA 4PETA 4MH5A 2O69A 4O3BA 3E3KA 3N6UA 1A54A 1NL5A 1FTKA 4LONB 3OEKA 2GHAA 1M5BA 3N26A 3IJXB 3O29A 2W7YA 1SW1A 2ZYKA 3S4UA 4EQ9A 3JZJA 3G3IA 3K00A 1URGA 4IY6A 1YPNA 4RPNA 1Z7NE 4KCCA 4KR5A 4NE4A 4G4PA 1B40A 5I84A 3EQ1A 3I3VA 4I62A 1H3DA 2XXIA 3PMXA 3VLVA 3K02A 1LGBC 1NNFA 2DXYA 2G93A 4I9DA 3T66A 4BDNA 1ZU0A 2Q2CA 3CFZA 3QSLA 4F19A 1N3WA 1SYIA 4OFOA 3T9XB 4EF1A 3PMWA 4Q5TA 4ELRA 4DDDA 3QK6A 1IIWA 2Y84A 2I4CA 4XIGQ 4U1ZA 4ESWA 2LAOA 5BUUA 2F7BA 3H6WA 1M5DA 4E0WA 2XXPA 3IO6A 5AE4A 3AXFA 4GXSB 1O63A 4R9GA 2DVCA 4M4GA 2I6EA 4DXUA 4NF5A 2XXQA 5JTYB 2QS1A 1MS7A 4F18A 3V83A 1P1QA 3QXMA 3FJ7A 3MZ1A 4ZEDA 3DP4A 2A5SA 5BWJA 4KYEA 2A5TB 1D3KA 3UP9A 3IB1A 3VLWA 4JWYA 4LVQA 4G8NA 4PE5B 4YB5A 4YICA 2O7UA 2GH9A 3VE1B 4HW8A 1Y4CA 1TFDA 1FQBA 2Y7RA 3ECRA 4AQ4A 1DTZA 1EZPA 1B3FA 3ILTB 5KDTB 2Y7KA 1N3XA 5FHOA 2GHBA 3MQ9A 4JDFA 1B5HA 3VVEA 3O28A 4LUBA 3K2DA 1NNKA 4H1XA 3LSLA 3GXAA 3B6WA 2X7QA 1CB6A 2XX9A 3PUXE 3VXBA 1DSNA 2O84X 5JTYA 1JW5A 1B1HA 3FIRA 4U22A 1B4HA 4GRKA 2I49A 2A5TA 1LAFE 4OVJA 4NWDA 1D9VA 5ELVA 5IAIA 2DVZA 3DP8A 1MXZA 5FHNA 4ZE8A 3HSTA 2XXYA 3D4CA 3KN3A 1JVXA 3MC2A 1R6ZA 4H5FA 4I1DA 1P1NA 3PD8A 1JQFA 1MY0A 4H5GA 5CM6A 1H43A 2HZKA 1Y3NA 2BJJX 4FJPA 4HCWA 1P1WA 3PPNA 4LP2B 2QMXA 4IO5A 1NMUA 3TTKA 5M2VA 3ZS6A 3IL1B 1Y9UA 4R72A 3H6UA 1B3LA 2AL5A 1PB8A 5H8FB 3MP1A 2ONKE 1M5FA 3V8XB 3HPIA 3PUYE 4KYSA 2Q9TA 3SETA 3TQWA 5KCJB 1VFEA 4DXBA 4E0XA 4U1OA 1GV8A 1B3HA 3MVXA 1GR2A 3GBBA 1NH8A 1JNFA 1JETA 2ONSA 1ELJA 2UXAA 4GIZA 2QS2A 3K0VA 3MBPA 3PPPA 4EDPA 1IXCA 3KZGA 4KHZE 3FV2A 4KI0E 4RNSA 1MM6A 1FTMA 1Q1KA 4L17A 2F34A 2P1SA 4DIGA 3T9HB 2XD2A 4N6PA 1XC1A 3RY3A 3TFLA 3O9PA 1AL3A 3VLUA 1BP5A 3JYRA 4LZ7A 1Y1ZA 2F6PA 4JBZA 1SDXA 5B70A 3Q29A 4G2ZA 1DPPA 1PDAA 1B46A 5I59A 3E4RA 4XKNA 3KOSA 1ZJLA 3F11A 4X48A 4NF6B 4LQ5A 3SEXA 4F2OA 5KCJA 3G3HA 1IXHA 4IY5A 3FXRA 2Z22A 2UVHA 1MQDA 3QYTA 5CMCA 1MQJA 2ONRA 5I57A 2UVJA 3G7WA 4H6DA 5AA4B 4U4XA 4YB6A 3MPLA 3MW0A 3OO8A 1HSJA 2DSFA 1IXIA 1UTHB
chains in the Genus database with same CATH superfamily
3FZVA 3UN6A 3VFJA 4PTKA 1I69A 3OELA 4AB6A 1OLAA 5ET5A 1A7LA 1MDQA 1FPJA 1LBCA 4POXA 4EQ7A 4NF4B 3BIHA 1IMFA 3KC1A 3CSGA 4OVPA 3IOTA 2F36A 4QRZA 4ZEFA 3LC8A 4F3SA 1IMEA 2I4BA 2GFEA 2Q88A 4U4SA 5I2KB 1NV4A 3RGYA 3U8QA 4PFTA 1FQEA 5K2YA 3B50A 2QSXA 2GRVA 3RT8A 2RF1A 3FV1A 4OEVA 4NF6A 3OD7A 1PC3A 2OZZA 1I6QA 1RKMA 2DQVA 1EU8A 3BIGA 4RYAA 2ZYNA 3EHTA 4ZECA 4JSOA 4EF2A 3ONMA 1TXFA 4GWYA 3CFXA 3MZBA 1MQHA 1LEVA 4KPTA 2Z8EA 3SESA 1LAXA 5AA4A 3IOUA 2DYXA 4OESA 3KN7A 2HXWA 1JEVA 2AYSA 3TZAA 4N6KA 3MVYA 3FGSA 2FYIA 3E9XA 1UTHA 3DLNA 3GYYA 3HN0A 4IGRA 4R73A 2R71A 1B58A 2YJPA 1FPKA 1MPDA 2REGA 4NEDA 3EPEA 5ICQA 5AA1A 2JJKA 3TPAA 4G8HA 4NF4A 5L9OA 1MXXA 4PC9A 2Z8FA 3U1OA 1B9JA 2IA4A 1B5JA 4H8JA 3PD9A 1SBPA 1LFIA 3T96B 2HQ0A 3IX1A 4YKPA 3S9MC 5I2KA 5B7DA 5ICTA 4X9TA 2CMOA 4IO4A 1R1NA 1FRPA 4OWDA 4XKRA 3Q28A 4MLVA 2Z23A 1WODA 1WVJA 2XWKA 5J16A 1B0LA 2FIXA 3LR1A 4MBPA 4RPOA 2UVGA 3IJOB 4NF5B 1MY3A 3O97A 4PAKA 4ESXA 5CRYA 4AB5A 2ZMBA 2ANJA 1MY1A 2NXOA 1VFDA 5LOMA 4NHBA 4O7IA 5K2XA 3C31A 1R9QA 1LBYA 4ZEKA 2F35A 3HHGA 1T0KA 3O6HA 1JW1A 1XHYA 1A40A 1ZMGA 5DVFA 3FUZA 3U65A 4IO2A 1MXVA 4UA8A 2XWOA 3TAJA 1EYJA 3PUWE 2FBPA 1DCUA 1M5CA 2F3BA 2I3VA 3IORA 2XXXA 2UYEA 4N8YA 4DE8A 3JV9A 3PGFA 1MPBA 1XVYA 1FQAA 2VP1A 4KYDA 5F7VA 2IEEA 1XS5A 3WAFA 3KBZA 1Y4TA 4QXDA 1RYOA 4KXPA 1AOVA 3S9NC 3IO4A 3QUJA 4F1YA 4GVOA 2VGQA 1B6HA 1MM7A 3OO7A 1EZ9A 3FATA 3RPLA 2OJTA 3G3FA 5A5XA 1LFHA 3UGWA 4Q8RA 1BKAA 4GL8A 4Q0CA 4FEDA 1XT8A 2ZXTA 2WKYA 1FJ9A 1SPIA 2E0SA 4GBWA 2OK2A 4OANA 1USYH 2CEYA 3IOWA 2YPNA 4F3BA 5JK4A 4PF8A 1FPLA 4GX4A 4P11A 2QFLA 2R6GE 3HV1A 3N6TA 5H8QB 4QFLA 2WBDA 4TQUQ 3RN8A 3KEIA 4YKJA 1DBZA 3TUSA 4PF6A 3PUZE 4U2RA 2FA7A 3N5LA 1B0HA 4FECA 4XKPA 3C32A 2DWAA 3S2VA 1LB9A 2L5VA 1Y1MA 3A09A 2HEUA 2PBWA 2ZNTA 4ZEBA 3C33A 1L5TA 1SW4A 5IKBA 1LBXA 1NNTA 1FCKA 2V3TA 4YAHX 3R7XA 4OA4A 4N07A 3MP6A 4OTEA 2VPNA 5EYFA 4RY1A 1LBWA 4TLLB 2QS3A 3KBRA 4P0IA 3QUFA 3MZ9A 4OMBA 2YLNA 1OVTA 3FVGA 1PBQA 2VOZA 3IOVA 1URSA 2O1LA 2RKMA 1OIBA 3OXNA 5DEXB 4C1UA 3LBSA 2HAUA 1ANFA 1Y20A 4GWZA 3R26A 3U72A 3TKDA 1H76A 2I0BA 2CZHA 5H8QA 2I0CA 2PYYA 2ZNSA 1MPCA 3K6XA 3CG1A 3R6UA 3RLFE 1GTKA 2Q2AA 4OFLA 4BLAA 4IO6A 3UIFA 3HCQA 4P47A 3T1BA 3CSBA 5CMMA 1DOTA 2CZLA 3H03A 4JVDA 1J1NA 4YZZA 5FTHA 1YCJA 1LBBA 1GGGA 2WYPA 2X26A 3O6IA 3MPKA 1YTVA 1IZ1A 4PFYA 5I59B 4GBVA 4FAJA 4Z0IA 1MXUA 4IO3A 2WX9A 3ISPA 2RC8A 2V3QA 1Y3QA 3LSXA 3TDJA 4OZ9A 1YZ0A 1MQGA 5I57B 1IITA 3CG3A 3UK4A 5DVIA 4O3AA 5DEXA 3C4MA 5L9SA 2F6GA 3H6TA 1PEBA 1BTJA 4G8MA 1LAHE 1P1OA 1JP4A 4R2FA 1O64A 3TTLA 1FTJA 2QRYA 1UQWA 4R6YA 3A3UA 1D9YA 2F97A 4LQ2A 5I2NB 3MWBA 1KWHA 4QSEA 1MH4A 2I3WA 4MLQA 3M8UA 3IB2A 4NGUA 2NVUB 4ELOA 1FQFA 4GXAA 4N15A 2OCUA 4GFRA 2OWSA 1B32A 3FD3A 4WXJA 4O3CA 1VSOA 1IMAA 2FNCA 3K1MA 2VD2A 4HTGA 1IMCA 1SW5A 1VE4A 3RTWB 4ONYA 3TTNA 4F31B 3B6TA 1S9TA 4ZS9A 4MF3A 5CBSA 4QF9A 4O7MA 1ZBMA 5I58B 3PPQA 1HSEA 1A99A 5EYHA 2H99A 1IUDA 4N91A 2MKZA 2WBBA 5I56A 5DYHA 4ZE9A 3U93A 3GBAA 1NH7A 1OQHA 5AA2A 2G29A 4Q30B 4GF8A 4X1DA 2XX8A 4MNCA 1LSTA 2DP8A 1P99A 1SI1A 5EQAA 3MAMA 3QAXA 2OBGA 4QFOA 3T9UA 3W15C 1RYXA 4TLMB 4YU0A 4NTLA 2XXUA 1GVCA 5DT6A 2Q74A 5FTIA 4GQOA 5CMKA 5I2NA 1SW2A 5DVJA 4PP0A 4EXLA 4OQOA 3PU5A 1XOCA 3DP6A 3E78A 4N17A 4OERA 4I3EA 1R9LA 3PUVE 2O51A 2WYKA 1S50A 2E1SA 1N04A 2BJIA 4OVRA 5IZ1A 2RCBA 2D21A 2P2AA 2PMSA 3KGCA 4P1LA 1DTGA 2ALUA 3BFTA 4GOTA 4DLDA 2QS4A 3KN8A 3QMFA 4AS4A 2ZNUA 5CMBA 1AH5A 1FQDA 4F2QA 3SKPA 2QVUA 5I58A 4F39A 2XXVA 1B3EA 1NV1A 2HZLA 4LATA 1H44A 3CR9A 4ECFA 3KOTA 4H65A 1FBPA 4YB7A 4MCOA 2QJEA 3ZKKA 3I6VA 2PT1A 5ET8A 1N0TA 1PB7A 2V4CA 1NUXA 3TCHA 3M3FA 4BDOA 2VPOA 2Y5LA 1HSLA 3O2AA 5EQ9A 1ZIUA 1UTBA 2B4LA 3PMVA 1DMBA 4FATA 1NKXA 1AMFA 4P56A 3S9EA 1XVXA 5H8HA 2XHDA 3FVNA 2Y5KA 3O66A 4KCDA 4JXIA 4R9FA 4XEQA 2ZZXA 3VVDA 4H45A 3W9VA 4M1VA 2QPQA 2O68A 4I3YA 4GLIA 3GZGA 4I8CA 5LTCA 1LB8A 3E79A 3USDA 1FBHA 1OVBA 4N81A 2DDKA 3P7IA 4WKMA 2OWTA 3PPRA 4EXKA 2NOOA 3OO9A 1FTOA 1FBDA 3V5AA 1NV7A 3K1PA 3U92A 3IFAA 3VDFA 2RINA 3TTRA 4OXVA 5CI5A 4QFKA 2FVZA 4RK2A 3K01A 1MG1A 4JVIA 3BFUA 2P3VA 3Q26A 2XXHA 2ZYOA 3RPLB 3TMGA 1SQYA 5A5XB 1FPGA 4K3FA 2VD3A 3G3GA 3TTMA 1QGXA 4WEPA 3OO6A 3L6HA 3DELB 5TP9B 3RTFB 3PPOA 3FVOA 4ISUA 1II5A 4FE8A 5EHMA 3TYHA 1TWYA 3C34A 4OETA 4EQBA 4FORA 4OVTA 2HCAA 4XTCQ 1FPEA 2P3NA 4QSCA 1FBFA 1JVYA 4MX6A 3FVKA 3UORA 4IO7A 5CBRA 2GQ1A 4N4UA 5CC2A 2DE3A 3SZPA 5TPAA 1SD3A 1FBGA 4OYVA 4G68B 1A55A 5H8NB 3KG2A 2XA5A 4EUOA 3V89B 2Y7PA 2I58A 3EHSA 2NWJA 3IB0A 5I3SA 3FJGA 1LLSA 4BDMA 3O6GA 1N76A 2DXRA 2ZYMA 1I6AA 1NNPA 2QL3A 3B8BA 3KSXA 3RT6B 4LZ8A 3MP8A 1FTLA 2V84A 4C0RA 5EQ8A 1G0HA 1OMPA 3C35A 1POTA 5DTBA 5IZ3B 3C9HA 1SYHA 5TU0A 1FSAA 3ZSFA 4N6DA 1B52A 1OLCA 5TP9A 2R9JA 2XX7A 2Y7WA 2P0SA 4DI3D 4U23A 2AL4A 3TCFA 2X7PA 1F9BA 3CI8A 1KZ8A 4NF8B 2V25A 3RNNA 3L6GA 1NV0A 3IAZA 3RYDA 1Z7ME 1A8EA 1NUWA 2Y7IA 4YKIA 4LA9A 1FPDA 3K1NA 1MXYA 3BBRA 4O94A 4PFWA 2D5WA 4PCDA 3TEPA 4G77A 4G61A 2PVUA 3K4UA 3SEVA 3SEUA 3CVGA 1K9YA 2B65A 4PFBA 1H45A 3W9WA 1B3GA 4G68A 5H8NA 3UA8A 1DK4A 2B3BA 1NV5A 5A5LA 5KZTA 4KFQA 1RDZA 5JEIA 3RQTA 3H7MA 4RXLA 2F7CA 3U94A 2O1MA 1QUIA 1JW4A 2DE4A 3T0JA 1B4ZA 3CRBA 1Q35A 1EH3A 1P1UA 1WDNA 4FBPA 1DPEA 1PBPA 4P3LA 4JWXA 2RCAA 4IB2A 4OENA 2F7AA 1UIUA 5HBCA 2UVIA 3IFCA 4F3GA 2PX1A 1O7TA 5IZ3A 1QUJA 1ZLQA 1I6BA 2H4IA 3H3GA 1LAGE 1B51A 2B3FA 2DWHA 4YKKA 5EHSA 5ISUA 3K6UA 4GWXA 2DWJA 3K6WA 3OMBA 1FTAA 1S7YA 3BKIB 3ODBA 3GLBA 1QUKA 2ABHA 1IMDA 5I7IA 4NF8A 4PFUA 3QIMA 4BDQA 3DM0A 1QW0A 1ZKBA 3B6QA 4F3PA 3LUYA 1KA1A 1LCTA 4F29A 2XXRA 1URDA 4QSDA 3A3CA 1SI0A 2H25A 3TELA 1ZTYA 3IK6B 4RJZA 4MFIA 4QHQA 4I40A 3CFLA 2AIXA 5HM4B 5ITPA 3N94A 1US4A 4R75A 5FHMA 1VDWA 3OENA 1NV6A 1QVSA 4HS7A 2H9BA 3RUMA 4BDRA 4N13A 3FXUA 2HAVA 1MH3A 1MDP1 5EYGA 5AA3A 1YYZA 5KDTA 2VHAA 1QULA 3PV0E 3CIJA 4GL0A 5FBPA 1IQ7A 4PAFA 3I5OA 4GWOA 1UIVA 4YMAA 4ELPA 3HFUA 3TCGA 3TODA 2DOJA 3TQLA 2OX3A 4XKQA 3D1RA 4PGNA 3OEMA 1RDXA 4ZDMA 1ATGA 4DZ1A 5I5PA 4OFJA 1NI9A 4NWCA 2V93A 1Y3PA 4AS5A 5I56B 2UYFA 2F5XA 3OSRA 1JEUA 1IXGA 5AA2B 3THIA 2DWIA 4F1UA 3SEYA 4JB7A 3Q25A 4GD5A 1FBEA 3LSWA 3OOAA 3FASA 5IGAA 4JSDA 4ZZEA 3KJ7A 4PBQA 2M8CA 2DS9A 3IR1A 5L9MA 4R2BA 4JWOA 1TFAA 1FW0A 4H8IA 1IEJA 4DXCA 3KJTA 4PQJA 1QJMA 3KSJA 5ESYA 3E13X 1FQCA 4TOZA 3VVFA 1PB9A 2CEXA 3MVZA 3S9LC 4R6KA 2O7IA 2XD3A 4H67A 2RC7A 4P0GA 2ESNA 2DE2A 3HHFA 2HHMA 5ET7A 4LZ5A 2KR0A 3HO7A 4QFNA 2XWVA 1MY4A 4P9KA 1BLFA 4ZEIA 5ITOA 1MY2A 2PT2A 3G3JA 3C36A 3H6VA 5H8SA 4POWA 1N7XA 2THIA 1D9QA 4OEUA 3EN3A 3FJMA 4IGTA 3EHUA 4HXVA 5H8FA 1NV3A 5J1DA 3SDFA 4OHNA 2KQZA 1BIYA 4G68C 1NV2A 1YAEA 4ND9A 4FIMA 4THIA 4MJOA 1LCFA 1UTBB 2R8TA 4QFPA 3ZKLA 4XFEA 2H98A 3M3LA 4UACA 4F1VA 3T22A 2RC9A 1G0IA 2REJA 3T9VA 5H8HB 4KD5A 4OVQA 4PFRA 3LV0A 3ILUB 3LSFB 3FXQA 2NUVA 2O6AA 2WEFA 4GWWA 2Q89A 1B5IA 3MVWA 4WEDA 4U21A 4HCYA 3SERA 1POY1 2Q8JA 5AA2D 3WAEA 5F1QA 2F8DA 3MUQA 1B2HA 1B1XA 4H0WA 4PFIA 1N84A 2KLFA 1MRPA 1A8FA 2Z8DA 3OSQA 4DI4B 2OLBA 4KQPA 1M5EA 3VXCA 1QKBA 1AIVA 2HXRA 4PDHA 4FEBA 4ELQA 2V3UA 2XXWA 4NG7A 5L8DA 4PAIA 4DCXA 4F22A 3SEWA 4RA1A 4R6HA 3M3KA 3Q27A 2FIEA 4XXUA 4DCYA 1B7UA 3D4GA 4YMBA 1EYIA 4X8RA 5IM2A 4MAGA 2QMWA 3B7DA 4HE1A 3G3KA 4C1TA 3ROJA 1FBCA 1EZOA 1KA0A 4P8BA 1TT1A 1MXWA 1D4NA 4JVCA 1MQIA 2HFBA 4Z7EA 3T93B 3VV5A 3KFMA 4RK9A 4NF0A 1QKAA 5TPAB 5LDZA 1CE2A 1NFTA 1OQGA 3RPWA 1SVXB 4NMYA 3H06B 4R74A 1N7WA 1LFGA 2VT5A 2I48A 2H5YA 2XXTA 3MJNA 1B7HA 1B05A 3K6VA 2F78A 1VR5A 1B7ZA 4X1BA 3H4ZA 2D3IA 1US5A 5HPQA 1USYE 4BDLA 3EF7A 4ZZAA 4PETA 4MH5A 2O69A 4O3BA 3E3KA 1AWBA 3N6UA 1A54A 1NL5A 1FTKA 4LONB 1NUZA 3OEKA 2GHAA 3NOHA 1M5BA 3N26A 3IJXB 3O29A 2W7YA 1SW1A 2ZYKA 3S4UA 4EQ9A 3JZJA 3G3IA 3K00A 1URGA 4IY6A 1YPNA 4RPNA 1Z7NE 4KCCA 4KR5A 4XF5A 4NE4A 4G4PA 1B40A 4IR8A 5I84A 3EQ1A 3I3VA 4I62A 1H3DA 2XXIA 3PMXA 3KC0A 3VLVA 3K02A 1LGBC 1NNFA 2DXYA 2G93A 4I9DA 3T66A 5IZZA 4BDNA 1ZU0A 2Q2CA 3CFZA 3QSLA 4F19A 1N3WA 1SYIA 4OFOA 3T9XB 4EF1A 3PMWA 4Q5TA 4ELRA 4DDDA 3QK6A 4MNPA 1IIWA 4P1EA 1FJ6A 2Y84A 2I4CA 4XIGQ 4U1ZA 4ESWA 2LAOA 1EYKA 5BUUA 2F7BA 3LUZA 3H6WA 1M5DA 2QVRA 4E0WA 2XXPA 4PBHA 3IO6A 5AE4A 3AXFA 2PCRA 3FBPA 4GXSB 1O63A 4R9GA 2DVCA 4M4GA 2I6EA 4OVSA 4DXUA 4NF5A 2XXQA 5JTYB 2QS1A 1MS7A 4F18A 3V83A 1P1QA 3QXMA 3FJ7A 3MZ1A 2Q8MA 4ZEDA 3DP4A 2A5SA 4GX3A 5BWJA 4KYEA 2A5TB 4HE0A 1D3KA 3UP9A 3IB1A 3VLWA 1XI6A 5F24A 4JWYA 4LVQA 4G8NA 2HPGA 4PE5B 4YB5A 2PFZA 3FXBA 4YICA 2O7UA 2GH9A 3VE1B 4HW8A 1Y4CA 1TFDA 1FQBA 2Y7RA 4PGPA 3ECRA 4PE3A 4AQ4A 1DTZA 1EZPA 1B3FA 2CZKA 3ILTB 5KDTB 1INPA 2Y7KA 1N3XA 5FHOA 2GHBA 3MQ9A 4JDFA 2F3DA 1B5HA 3VVEA 3O28A 4LUBA 3K2DA 2ZZWA 1NNKA 4H1XA 3LSLA 1K9ZA 3GXAA 3MSTA 3B6WA 2X7QA 1CB6A 2XX9A 3PUXE 1YXIA 3VXBA 1DSNA 2O84X 5JTYA 1JW5A 1B1HA 3FIRA 4U22A 4N8GA 2CZIA 1B4HA 4GRKA 2I49A 2A5TA 1FPIA 1LAFE 4MIJA 4OVJA 4NWDA 2QVVA 1D9VA 5ELVA 1FPBA 3EKIA 5IAIA 2DVZA 3DP8A 1MXZA 5FHNA 4ZE8A 3HSTA 2XXYA 3CHGA 3D4CA 3KN3A 1JVXA 4MNIA 3MC2A 1R6ZA 4H5FA 4I1DA 1P1NA 4GWSA 3PD8A 1JQFA 1MY0A 4H5GA 4H46A 5CM6A 1H43A 2HZKA 1Y3NA 2BJJX 4FJPA 4HCWA 4O8MA 1P1WA 5EQ7A 3PPNA 4LP2B 2QMXA 4IO5A 4UABA 1NMUA 3TTKA 5DW8A 5M2VA 3ZS6A 1CNQA 3IL1B 1Y9UA 4R72A 3H6UA 1B3LA 2AL5A 1PB8A 5H8FB 3MP1A 2ONKE 4NQ8A 1M5FA 3V8XB 4PDDA 2XWIA 3HPIA 4HE2A 3PUYE 4KYSA 1Q9DA 2Q9TA 3SETA 3TQWA 5KCJB 1VFEA 4DXBA 4E0XA 4U1OA 1GV8A 1B3HA 3MVXA 4QBAA 1GR2A 3GBBA 5T3JA 1NH8A 1JNFA 4NX1A 2OWZA 1JETA 2ONSA 1ELJA 3PTYA 2UXAA 4GIZA 2QS2A 3K0VA 4X04A 4GX6A 1BK4A 3MBPA 2B4MA 4LN5A 1NUYA 3PPPA 4EDPA 1IXCA 3KZGA 4KHZE 3FV2A 4KI0E 4RNSA 1MM6A 1FTMA 1Q1KA 4L17A 4NAPA 2F34A 2P1SA 4DIGA 2ZZVA 3T9HB 2XD2A 1IMBA 4N6PA 1XC1A 3RY3A 3TFLA 3MYUA 3O9PA 1FPFA 1AL3A 3VLUA 1BP5A 3JYRA 5ET6A 4LZ7A 4MHFA 1Y1ZA 2XXKA 2F6PA 4JBZA 1SDXA 5B70A 3Q29A 4G2ZA 1DPPA 1PDAA 1B46A 1LBZA 2FHYA 4NN3A 1RDYA 5I59A 4GWUA 3E4RA 4XKNA 3KOSA 1LBVA 4MEVA 1ZJLA 3F11A 4MMPA 4X48A 4NF6B 2PFYA 4LQ5A 3SEXA 4F2OA 5KCJA 3G3HA 1IXHA 4IY5A 3FXRA 2Z22A 2UVHA 1MQDA 3QYTA 5CMCA 1MQJA 2ONRA 5I57A 2UVJA 3G7WA 4H6DA 5AA4B 4U4XA 4YB6A 3MPLA 3MW0A 3A29A 3OO8A 1HSJA 2DSFA 1IXIA 1UTHB
chains in the Genus database with same CATH topology
3FZVA 3UN6A 3VFJA 1I69A 3OELA 4AB6A 1OLAA 1A7LA 1MDQA 1LBCA 4POXA 4EQ7A 4NF4B 3CSGA 3IOTA 2F36A 4QRZA 4ZEFA 3LC8A 4F3SA 2I4BA 2GFEA 2Q88A 4U4SA 5I2KB 3RGYA 3U8QA 4PFTA 1FQEA 5K2YA 2QSXA 2GRVA 3RT8A 2RF1A 3FV1A 4OEVA 4NF6A 3OD7A 1PC3A 2OZZA 1I6QA 1RKMA 2DQVA 1EU8A 4RYAA 2ZYNA 3EHTA 4ZECA 4JSOA 4EF2A 3ONMA 1TXFA 3CFXA 3MZBA 1MQHA 4KPTA 2Z8EA 3SESA 1LAXA 5AA4A 3IOUA 2DYXA 4OESA 3KN7A 2HXWA 1JEVA 2AYSA 3TZAA 3MVYA 3FGSA 2FYIA 3E9XA 1UTHA 3DLNA 4IGRA 3HN0A 4R73A 2R71A 1B58A 2YJPA 1MPDA 2REGA 4NEDA 3EPEA 5ICQA 5AA1A 3TPAA 4G8HA 4NF4A 5L9OA 1MXXA 2Z8FA 3U1OA 1B9JA 2IA4A 1B5JA 4H8JA 3PD9A 1SBPA 1LFIA 3T96B 2HQ0A 3IX1A 4YKPA 3S9MC 5I2KA 5B7DA 5ICTA 4X9TA 2CMOA 4IO4A 1R1NA 4OWDA 4XKRA 3Q28A 4MLVA 2Z23A 1WODA 1WVJA 1B0LA 3LR1A 4MBPA 4RPOA 2UVGA 3IJOB 4NF5B 1MY3A 3O97A 4ESXA 5CRYA 4AB5A 2ZMBA 2ANJA 1MY1A 2NXOA 1VFDA 5LOMA 5K2XA 3C31A 1R9QA 4ZEKA 2F35A 3HHGA 1T0KA 3O6HA 1JW1A 1XHYA 1A40A 1ZMGA 5DVFA 3FUZA 4IO2A 1MXVA 4UA8A 3TAJA 3PUWE 1M5CA 2I3VA 3IORA 2XXXA 2UYEA 4DE8A 3JV9A 3PGFA 1MPBA 1XVYA 1FQAA 2VP1A 4KYDA 5F7VA 2IEEA 1XS5A 3WAFA 1Y4TA 1RYOA 1AOVA 3S9NC 3IO4A 3QUJA 4F1YA 4GVOA 2VGQA 1B6HA 1MM7A 3OO7A 1EZ9A 3FATA 2OJTA 3G3FA 5A5XA 1LFHA 3UGWA 4Q8RA 1BKAA 4GL8A 4Q0CA 4FEDA 1XT8A 2ZXTA 2WKYA 2E0SA 2OK2A 1USYH 3IOWA 2YPNA 4F3BA 5JK4A 4P11A 2R6GE 3HV1A 3N6TA 5H8QB 4QFLA 4TQUQ 3RN8A 3KEIA 4YKJA 3TUSA 3PUZE 4U2RA 2FA7A 3N5LA 1B0HA 4FECA 4XKPA 3C32A 2DWAA 3S2VA 1LB9A 1Y1MA 3A09A 2HEUA 2PBWA 2ZNTA 4ZEBA 3C33A 1L5TA 1SW4A 5IKBA 1NNTA 1FCKA 2V3TA 4YAHX 3R7XA 4N07A 3MP6A 4OTEA 5EYFA 4RY1A 4TLLB 2QS3A 3KBRA 4P0IA 3QUFA 3MZ9A 4OMBA 2YLNA 1OVTA 3FVGA 1PBQA 2VOZA 3IOVA 1URSA 2O1LA 2RKMA 1OIBA 3OXNA 5DEXB 4C1UA 3LBSA 2HAUA 1ANFA 1Y20A 3R26A 3U72A 3TKDA 1H76A 2I0BA 5H8QA 2I0CA 2PYYA 2ZNSA 1MPCA 3K6XA 3CG1A 3R6UA 3RLFE 1GTKA 2Q2AA 4OFLA 4BLAA 4IO6A 3UIFA 3HCQA 3CSBA 5CMMA 1DOTA 2CZLA 3H03A 1J1NA 4YZZA 5FTHA 1YCJA 1LBBA 1GGGA 2X26A 3O6IA 3MPKA 1YTVA 1IZ1A 4PFYA 5I59B 4FAJA 4Z0IA 1MXUA 4IO3A 2RC8A 2V3QA 1Y3QA 3LSXA 3TDJA 4OZ9A 1MQGA 5I57B 1IITA 3CG3A 3UK4A 5DVIA 4O3AA 5DEXA 3C4MA 5L9SA 2F6GA 3H6TA 1PEBA 1BTJA 4G8MA 1LAHE 1P1OA 4R2FA 1O64A 3TTLA 1FTJA 2QRYA 1UQWA 4R6YA 3A3UA 1D9YA 2F97A 4LQ2A 5I2NB 3MWBA 1KWHA 4QSEA 1MH4A 2I3WA 4MLQA 3M8UA 3IB2A 2NVUB 4ELOA 1FQFA 4GXAA 2OCUA 4GFRA 2OWSA 1B32A 3FD3A 4WXJA 4O3CA 1VSOA 2FNCA 3K1MA 2VD2A 4HTGA 1SW5A 1VE4A 3RTWB 4ONYA 3TTNA 4F31B 3B6TA 1S9TA 4ZS9A 4MF3A 5CBSA 4QF9A 1ZBMA 5I58B 3PPQA 1HSEA 1A99A 2H99A 1IUDA 5I56A 5DYHA 4ZE9A 3U93A 3GBAA 1NH7A 1OQHA 5AA2A 2G29A 4Q30B 4GF8A 4X1DA 2XX8A 1LSTA 2DP8A 1P99A 1SI1A 3MAMA 3QAXA 2OBGA 4QFOA 3T9UA 3W15C 1RYXA 4TLMB 4YU0A 4NTLA 2XXUA 1GVCA 5DT6A 5FTIA 4GQOA 5CMKA 5I2NA 1SW2A 5DVJA 4PP0A 4EXLA 4OQOA 3PU5A 1XOCA 3DP6A 4OERA 1R9LA 3PUVE 2O51A 1S50A 2E1SA 1N04A 2RCBA 2D21A 2P2AA 2PMSA 3KGCA 1DTGA 2ALUA 3BFTA 4GOTA 4DLDA 2QS4A 3KN8A 2ZNUA 5CMBA 1AH5A 1FQDA 4F2QA 3SKPA 5I58A 4F39A 2XXVA 1B3EA 2HZLA 4LATA 1H44A 3CR9A 4ECFA 3KOTA 4H65A 4YB7A 2QJEA 3ZKKA 3I6VA 2PT1A 1N0TA 1PB7A 3TCHA 3M3FA 4BDOA 1HSLA 3O2AA 1ZIUA 1UTBA 3PMVA 1DMBA 4FATA 1NKXA 1AMFA 3S9EA 1XVXA 5H8HA 2XHDA 3FVNA 3O66A 4KCDA 4JXIA 4R9FA 3VVDA 3W9VA 4M1VA 2QPQA 2O68A 4GLIA 3GZGA 4I8CA 1LB8A 3USDA 1OVBA 3P7IA 4WKMA 2OWTA 3PPRA 4EXKA 2NOOA 3OO9A 1FTOA 3V5AA 3K1PA 3U92A 3VDFA 2RINA 3TTRA 4OXVA 5CI5A 4QFKA 4RK2A 3K01A 1MG1A 3BFUA 3Q26A 2XXHA 2ZYOA 3TMGA 1SQYA 5A5XB 4K3FA 2VD3A 3G3GA 3TTMA 4WEPA 3OO6A 3L6HA 3DELB 5TP9B 3RTFB 3PPOA 3FVOA 4ISUA 1II5A 4FE8A 5EHMA 3TYHA 1TWYA 3C34A 4OETA 4EQBA 4FORA 2HCAA 4XTCQ 4QSCA 1JVYA 3FVKA 3UORA 4IO7A 5CBRA 5CC2A 2DE3A 5TPAA 1SD3A 4OYVA 4G68B 1A55A 5H8NB 3KG2A 4EUOA 3V89B 2Y7PA 2I58A 3EHSA 2NWJA 3IB0A 3FJGA 1LLSA 4BDMA 3O6GA 1N76A 2DXRA 2ZYMA 1I6AA 1NNPA 2QL3A 3KSXA 3RT6B 4LZ8A 3MP8A 1FTLA 2V84A 4C0RA 1OMPA 3C35A 1POTA 5DTBA 3C9HA 1SYHA 5TU0A 3ZSFA 1B52A 1OLCA 5TP9A 2R9JA 2XX7A 2Y7WA 2P0SA 4U23A 2AL4A 3TCFA 2X7PA 1F9BA 3CI8A 4NF8B 2V25A 3RNNA 3L6GA 3IAZA 1Z7ME 1A8EA 2Y7IA 4YKIA 4LA9A 3K1NA 1MXYA 3BBRA 4PFWA 2D5WA 3TEPA 4G77A 2PVUA 3K4UA 3SEVA 3SEUA 3CVGA 2B65A 1H45A 3W9WA 1B3GA 4G68A 5H8NA 3UA8A 2B3BA 5KZTA 4KFQA 5JEIA 3RQTA 3H7MA 4RXLA 2F7CA 3U94A 2O1MA 1QUIA 1JW4A 2DE4A 1B4ZA 3CRBA 1Q35A 1EH3A 1P1UA 1WDNA 1DPEA 1PBPA 4JWXA 2RCAA 4IB2A 4OENA 2F7AA 1UIUA 5HBCA 2UVIA 4F3GA 2PX1A 1O7TA 1QUJA 1ZLQA 1I6BA 2H4IA 3H3GA 1LAGE 1B51A 2B3FA 2DWHA 5EHSA 4YKKA 5ISUA 3K6UA 2DWJA 3K6WA 3OMBA 1S7YA 3BKIB 3ODBA 3GLBA 1QUKA 2ABHA 4NF8A 4PFUA 3QIMA 4BDQA 3DM0A 1QW0A 1ZKBA 3B6QA 4F3PA 3LUYA 1LCTA 4F29A 2XXRA 1URDA 4QSDA 3A3CA 1SI0A 2H25A 3TELA 1ZTYA 3IK6B 4RJZA 4MFIA 4QHQA 3CFLA 2AIXA 5HM4B 5ITPA 3N94A 1US4A 4R75A 5FHMA 3OENA 1QVSA 4HS7A 2H9BA 3RUMA 4BDRA 4N13A 3FXUA 2HAVA 1MH3A 1MDP1 5AA3A 5KDTA 2VHAA 1QULA 3PV0E 3CIJA 4GL0A 1IQ7A 3I5OA 4GWOA 1UIVA 4YMAA 4ELPA 3TCGA 3TODA 2DOJA 3TQLA 4XKQA 3OEMA 4ZDMA 1ATGA 4DZ1A 4OFJA 4NWCA 2V93A 1Y3PA 5I56B 2UYFA 2F5XA 3OSRA 1JEUA 1IXGA 5AA2B 3THIA 2DWIA 4F1UA 3SEYA 4JB7A 3Q25A 4GD5A 3LSWA 3OOAA 3FASA 4JSDA 4ZZEA 3KJ7A 2M8CA 2DS9A 3IR1A 5L9MA 4R2BA 4JWOA 1TFAA 1FW0A 4H8IA 1IEJA 4DXCA 3KJTA 4PQJA 1QJMA 3KSJA 3E13X 1FQCA 4TOZA 3VVFA 1PB9A 3MVZA 3S9LC 4R6KA 2O7IA 2XD3A 4H67A 2RC7A 4P0GA 2ESNA 2DE2A 3HHFA 4LZ5A 3HO7A 4QFNA 1MY4A 1BLFA 4ZEIA 5ITOA 1MY2A 2PT2A 3G3JA 3C36A 3H6VA 5H8SA 4POWA 1N7XA 2THIA 4OEUA 3EN3A 3FJMA 4IGTA 3EHUA 5H8FA 5J1DA 3SDFA 4OHNA 1BIYA 4G68C 1YAEA 4ND9A 4FIMA 4THIA 1LCFA 1UTBB 4QFPA 3ZKLA 2H98A 3M3LA 4UACA 4F1VA 3T22A 2RC9A 2REJA 3T9VA 5H8HB 4KD5A 3ILUB 3LSFB 3FXQA 2NUVA 2O6AA 2Q89A 1B5IA 3MVWA 4WEDA 4U21A 4HCYA 3SERA 1POY1 2Q8JA 5AA2D 3WAEA 5F1QA 2F8DA 3MUQA 1B2HA 1B1XA 4H0WA 1N84A 2KLFA 1MRPA 1A8FA 2Z8DA 3OSQA 2OLBA 4KQPA 1M5EA 3VXCA 1QKBA 1AIVA 4FEBA 4ELQA 2V3UA 2XXWA 5L8DA 4DCXA 4F22A 3SEWA 4RA1A 4R6HA 3M3KA 3Q27A 4XXUA 4DCYA 1B7UA 3D4GA 4YMBA 2QMWA 3B7DA 3G3KA 4C1TA 1EZOA 1TT1A 1MXWA 1D4NA 1MQIA 2HFBA 4Z7EA 3T93B 3VV5A 3KFMA 4RK9A 1QKAA 5TPAB 1CE2A 1NFTA 1OQGA 3RPWA 1SVXB 4NMYA 3H06B 4R74A 1N7WA 1LFGA 2I48A 2H5YA 2XXTA 3MJNA 1B7HA 1B05A 3K6VA 2F78A 1VR5A 1B7ZA 4X1BA 3H4ZA 2D3IA 1US5A 5HPQA 1USYE 4BDLA 3EF7A 4ZZAA 4PETA 4MH5A 2O69A 4O3BA 3E3KA 3N6UA 1A54A 1NL5A 1FTKA 4LONB 3OEKA 2GHAA 1M5BA 3N26A 3IJXB 3O29A 2W7YA 1SW1A 2ZYKA 3S4UA 4EQ9A 3JZJA 3G3IA 3K00A 1URGA 4IY6A 1YPNA 4RPNA 1Z7NE 4KCCA 4KR5A 4NE4A 4G4PA 1B40A 5I84A 3EQ1A 3I3VA 4I62A 1H3DA 2XXIA 3PMXA 3VLVA 3K02A 1LGBC 1NNFA 2DXYA 2G93A 4I9DA 3T66A 4BDNA 1ZU0A 2Q2CA 3CFZA 3QSLA 4F19A 1N3WA 1SYIA 4OFOA 3T9XB 4EF1A 3PMWA 4Q5TA 4ELRA 4DDDA 3QK6A 1IIWA 2Y84A 2I4CA 4XIGQ 4U1ZA 4ESWA 2LAOA 5BUUA 2F7BA 3H6WA 1M5DA 4E0WA 2XXPA 3IO6A 5AE4A 3AXFA 4GXSB 1O63A 4R9GA 2DVCA 4M4GA 2I6EA 4DXUA 4NF5A 2XXQA 5JTYB 2QS1A 1MS7A 4F18A 3V83A 1P1QA 3QXMA 3FJ7A 3MZ1A 4ZEDA 3DP4A 2A5SA 5BWJA 4KYEA 2A5TB 1D3KA 3UP9A 3IB1A 3VLWA 4JWYA 4LVQA 4G8NA 4PE5B 4YB5A 4YICA 2O7UA 2GH9A 3VE1B 4HW8A 1Y4CA 1TFDA 1FQBA 2Y7RA 3ECRA 4AQ4A 1DTZA 1EZPA 1B3FA 3ILTB 5KDTB 2Y7KA 1N3XA 5FHOA 2GHBA 3MQ9A 4JDFA 1B5HA 3VVEA 3O28A 4LUBA 3K2DA 1NNKA 4H1XA 3LSLA 3GXAA 3B6WA 2X7QA 1CB6A 2XX9A 3PUXE 3VXBA 1DSNA 2O84X 5JTYA 1JW5A 1B1HA 3FIRA 4U22A 1B4HA 4GRKA 2I49A 2A5TA 1LAFE 4OVJA 4NWDA 1D9VA 5ELVA 5IAIA 2DVZA 3DP8A 1MXZA 5FHNA 4ZE8A 3HSTA 2XXYA 3D4CA 3KN3A 1JVXA 3MC2A 1R6ZA 4H5FA 4I1DA 1P1NA 3PD8A 1JQFA 1MY0A 4H5GA 5CM6A 1H43A 2HZKA 1Y3NA 2BJJX 4FJPA 4HCWA 1P1WA 3PPNA 4LP2B 2QMXA 4IO5A 1NMUA 3TTKA 5M2VA 3ZS6A 3IL1B 1Y9UA 4R72A 3H6UA 1B3LA 2AL5A 1PB8A 5H8FB 3MP1A 2ONKE 1M5FA 3V8XB 3HPIA 3PUYE 4KYSA 2Q9TA 3SETA 3TQWA 5KCJB 1VFEA 4DXBA 4E0XA 4U1OA 1GV8A 1B3HA 3MVXA 1GR2A 3GBBA 1NH8A 1JNFA 1JETA 2ONSA 1ELJA 2UXAA 4GIZA 2QS2A 3K0VA 3MBPA 3PPPA 4EDPA 1IXCA 3KZGA 4KHZE 3FV2A 4KI0E 4RNSA 1MM6A 1FTMA 1Q1KA 4L17A 2F34A 2P1SA 4DIGA 3T9HB 2XD2A 4N6PA 1XC1A 3RY3A 3TFLA 3O9PA 1AL3A 3VLUA 1BP5A 3JYRA 4LZ7A 1Y1ZA 2F6PA 4JBZA 1SDXA 5B70A 3Q29A 4G2ZA 1DPPA 1PDAA 1B46A 5I59A 3E4RA 4XKNA 3KOSA 1ZJLA 3F11A 4X48A 4NF6B 4LQ5A 3SEXA 4F2OA 5KCJA 3G3HA 1IXHA 4IY5A 3FXRA 2Z22A 2UVHA 1MQDA 3QYTA 5CMCA 1MQJA 2ONRA 5I57A 2UVJA 3G7WA 4H6DA 5AA4B 4U4XA 4YB6A 3MPLA 3MW0A 3OO8A 1HSJA 2DSFA 1IXIA 1UTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZV A;  3UN6 A;  3VFJ A;  1I69 A;  3OEL A;  4AB6 A;  1OLA A;  1A7L A;  1MDQ A;  1LBC A;  4POX A;  4EQ7 A;  4NF4 B;  3CSG A;  3IOT A;  2F36 A;  4QRZ A;  4ZEF A;  3LC8 A;  4F3S A;  2I4B A;  2GFE A;  2Q88 A;  4U4S A;  5I2K B;  3RGY A;  3U8Q A;  4PFT A;  1FQE A;  5K2Y A;  2QSX A;  2GRV A;  3RT8 A;  2RF1 A;  3FV1 A;  4OEV A;  4NF6 A;  3OD7 A;  1PC3 A;  2OZZ A;  1I6Q A;  1RKM A;  2DQV A;  1EU8 A;  4RYA A;  2ZYN A;  3EHT A;  4ZEC A;  4JSO A;  4EF2 A;  3ONM A;  1TXF A;  3CFX A;  3MZB A;  1MQH A;  4KPT A;  2Z8E A;  3SES A;  1LAX A;  5AA4 A;  3IOU A;  2DYX A;  4OES A;  3KN7 A;  2HXW A;  1JEV A;  2AYS A;  3TZA A;  3MVY A;  3FGS A;  2FYI A;  3E9X A;  1UTH A;  3DLN A;  4IGR A;  3HN0 A;  4R73 A;  2R71 A;  1B58 A;  2YJP A;  1MPD A;  2REG A;  4NED A;  3EPE A;  5ICQ A;  5AA1 A;  3TPA A;  4G8H A;  4NF4 A;  5L9O A;  1MXX A;  2Z8F A;  3U1O A;  1B9J A;  2IA4 A;  1B5J A;  4H8J A;  3PD9 A;  1SBP A;  1LFI A;  3T96 B;  2HQ0 A;  3IX1 A;  4YKP A;  3S9M C;  5I2K A;  5B7D A;  5ICT A;  4X9T A;  2CMO A;  4IO4 A;  1R1N A;  4OWD A;  4XKR A;  3Q28 A;  4MLV A;  2Z23 A;  1WOD A;  1WVJ A;  1B0L A;  3LR1 A;  4MBP A;  4RPO A;  2UVG A;  3IJO B;  4NF5 B;  1MY3 A;  3O97 A;  4ESX A;  5CRY A;  4AB5 A;  2ZMB A;  2ANJ A;  1MY1 A;  2NXO A;  1VFD A;  5LOM A;  5K2X A;  3C31 A;  1R9Q A;  4ZEK A;  2F35 A;  3HHG A;  1T0K A;  3O6H A;  1JW1 A;  1XHY A;  1A40 A;  1ZMG A;  5DVF A;  3FUZ A;  4IO2 A;  1MXV A;  4UA8 A;  3TAJ A;  3PUW E;  1M5C A;  2I3V A;  3IOR A;  2XXX A;  2UYE A;  4DE8 A;  3JV9 A;  3PGF A;  1MPB A;  1XVY A;  1FQA A;  2VP1 A;  4KYD A;  5F7V A;  2IEE A;  1XS5 A;  3WAF A;  1Y4T A;  1RYO A;  1AOV A;  3S9N C;  3IO4 A;  3QUJ A;  4F1Y A;  4GVO A;  2VGQ A;  1B6H A;  1MM7 A;  3OO7 A;  1EZ9 A;  3FAT A;  2OJT A;  3G3F A;  5A5X A;  1LFH A;  3UGW A;  4Q8R A;  1BKA A;  4GL8 A;  4Q0C A;  4FED A;  1XT8 A;  2ZXT A;  2WKY A;  2E0S A;  2OK2 A;  1USY H;  3IOW A;  2YPN A;  4F3B A;  5JK4 A;  4P11 A;  2R6G E;  3HV1 A;  3N6T A;  5H8Q B;  4QFL A;  4TQU Q;  3RN8 A;  3KEI A;  4YKJ A;  3TUS A;  3PUZ E;  4U2R A;  2FA7 A;  3N5L A;  1B0H A;  4FEC A;  4XKP A;  3C32 A;  2DWA A;  3S2V A;  1LB9 A;  1Y1M A;  3A09 A;  2HEU A;  2PBW A;  2ZNT A;  4ZEB A;  3C33 A;  1L5T A;  1SW4 A;  5IKB A;  1NNT A;  1FCK A;  2V3T A;  4YAH X;  3R7X A;  4N07 A;  3MP6 A;  4OTE A;  5EYF A;  4RY1 A;  4TLL B;  2QS3 A;  3KBR A;  4P0I A;  3QUF A;  3MZ9 A;  4OMB A;  2YLN A;  1OVT A;  3FVG A;  1PBQ A;  2VOZ A;  3IOV A;  1URS A;  2O1L A;  2RKM A;  1OIB A;  3OXN A;  5DEX B;  4C1U A;  3LBS A;  2HAU A;  1ANF A;  1Y20 A;  3R26 A;  3U72 A;  3TKD A;  1H76 A;  2I0B A;  5H8Q A;  2I0C A;  2PYY A;  2ZNS A;  1MPC A;  3K6X A;  3CG1 A;  3R6U A;  3RLF E;  1GTK A;  2Q2A A;  4OFL A;  4BLA A;  4IO6 A;  3UIF A;  3HCQ A;  3CSB A;  5CMM A;  1DOT A;  2CZL A;  3H03 A;  1J1N A;  4YZZ A;  5FTH A;  1YCJ A;  1LBB A;  1GGG A;  2X26 A;  3O6I A;  3MPK A;  1YTV A;  1IZ1 A;  4PFY A;  5I59 B;  4FAJ A;  4Z0I A;  1MXU A;  4IO3 A;  2RC8 A;  2V3Q A;  1Y3Q A;  3LSX A;  3TDJ A;  4OZ9 A;  1MQG A;  5I57 B;  1IIT A;  3CG3 A;  3UK4 A;  5DVI A;  4O3A A;  5DEX A;  3C4M A;  5L9S A;  2F6G A;  3H6T A;  1PEB A;  1BTJ A;  4G8M A;  1LAH E;  1P1O A;  4R2F A;  1O64 A;  3TTL A;  1FTJ A;  2QRY A;  1UQW A;  4R6Y A;  3A3U A;  1D9Y A;  2F97 A;  4LQ2 A;  5I2N B;  3MWB A;  1KWH A;  4QSE A;  1MH4 A;  2I3W A;  4MLQ A;  3M8U A;  3IB2 A;  2NVU B;  4ELO A;  1FQF A;  4GXA A;  2OCU A;  4GFR A;  2OWS A;  1B32 A;  3FD3 A;  4WXJ A;  4O3C A;  1VSO A;  2FNC A;  3K1M A;  2VD2 A;  4HTG A;  1SW5 A;  1VE4 A;  3RTW B;  4ONY A;  3TTN A;  4F31 B;  3B6T A;  1S9T A;  4ZS9 A;  4MF3 A;  5CBS A;  4QF9 A;  1ZBM A;  5I58 B;  3PPQ A;  1HSE A;  1A99 A;  2H99 A;  1IUD A;  5I56 A;  5DYH A;  4ZE9 A;  3U93 A;  3GBA A;  1NH7 A;  1OQH A;  5AA2 A;  2G29 A;  4Q30 B;  4GF8 A;  4X1D A;  2XX8 A;  1LST A;  2DP8 A;  1P99 A;  1SI1 A;  3MAM A;  3QAX A;  2OBG A;  4QFO A;  3T9U A;  3W15 C;  1RYX A;  4TLM B;  4YU0 A;  4NTL A;  2XXU A;  1GVC A;  5DT6 A;  5FTI A;  4GQO A;  5CMK A;  5I2N A;  1SW2 A;  5DVJ A;  4PP0 A;  4EXL A;  4OQO A;  3PU5 A;  1XOC A;  3DP6 A;  4OER A;  1R9L A;  3PUV E;  2O51 A;  1S50 A;  2E1S A;  1N04 A;  2RCB A;  2D21 A;  2P2A A;  2PMS A;  3KGC A;  1DTG A;  2ALU A;  3BFT A;  4GOT A;  4DLD A;  2QS4 A;  3KN8 A;  2ZNU A;  5CMB A;  1AH5 A;  1FQD A;  4F2Q A;  3SKP A;  5I58 A;  4F39 A;  2XXV A;  1B3E A;  2HZL A;  4LAT A;  1H44 A;  3CR9 A;  4ECF A;  3KOT A;  4H65 A;  4YB7 A;  2QJE A;  3ZKK A;  3I6V A;  2PT1 A;  1N0T A;  1PB7 A;  3TCH A;  3M3F A;  4BDO A;  1HSL A;  3O2A A;  1ZIU A;  1UTB A;  3PMV A;  1DMB A;  4FAT A;  1NKX A;  1AMF A;  3S9E A;  1XVX A;  5H8H A;  2XHD A;  3FVN A;  3O66 A;  4KCD A;  4JXI A;  4R9F A;  3VVD A;  3W9V A;  4M1V A;  2QPQ A;  2O68 A;  4GLI A;  3GZG A;  4I8C A;  1LB8 A;  3USD A;  1OVB A;  3P7I A;  4WKM A;  2OWT A;  3PPR A;  4EXK A;  2NOO A;  3OO9 A;  1FTO A;  3V5A A;  3K1P A;  3U92 A;  3VDF A;  2RIN A;  3TTR A;  4OXV A;  5CI5 A;  4QFK A;  4RK2 A;  3K01 A;  1MG1 A;  3BFU A;  3Q26 A;  2XXH A;  2ZYO A;  3TMG A;  1SQY A;  5A5X B;  4K3F A;  2VD3 A;  3G3G A;  3TTM A;  4WEP A;  3OO6 A;  3L6H A;  3DEL B;  5TP9 B;  3RTF B;  3PPO A;  3FVO A;  4ISU A;  1II5 A;  4FE8 A;  5EHM A;  3TYH A;  1TWY A;  3C34 A;  4OET A;  4EQB A;  4FOR A;  2HCA A;  4XTC Q;  4QSC A;  1JVY A;  3FVK A;  3UOR A;  4IO7 A;  5CBR A;  5CC2 A;  2DE3 A;  5TPA A;  1SD3 A;  4OYV A;  4G68 B;  1A55 A;  5H8N B;  3KG2 A;  4EUO A;  3V89 B;  2Y7P A;  2I58 A;  3EHS A;  2NWJ A;  3IB0 A;  3FJG A;  1LLS A;  4BDM A;  3O6G A;  1N76 A;  2DXR A;  2ZYM A;  1I6A A;  1NNP A;  2QL3 A;  3KSX A;  3RT6 B;  4LZ8 A;  3MP8 A;  1FTL A;  2V84 A;  4C0R A;  1OMP A;  3C35 A;  1POT A;  5DTB A;  3C9H A;  1SYH A;  5TU0 A;  3ZSF A;  1B52 A;  1OLC A;  5TP9 A;  2R9J A;  2XX7 A;  2Y7W A;  2P0S A;  4U23 A;  2AL4 A;  3TCF A;  2X7P A;  1F9B A;  3CI8 A;  4NF8 B;  2V25 A;  3RNN A;  3L6G A;  3IAZ A;  1Z7M E;  1A8E A;  2Y7I A;  4YKI A;  4LA9 A;  3K1N A;  1MXY A;  3BBR A;  4PFW A;  2D5W A;  3TEP A;  4G77 A;  2PVU A;  3K4U A;  3SEV A;  3SEU A;  3CVG A;  2B65 A;  1H45 A;  3W9W A;  1B3G A;  4G68 A;  5H8N A;  3UA8 A;  2B3B A;  5KZT A;  4KFQ A;  5JEI A;  3RQT A;  3H7M A;  4RXL A;  2F7C A;  3U94 A;  2O1M A;  1QUI A;  1JW4 A;  2DE4 A;  1B4Z A;  3CRB A;  1Q35 A;  1EH3 A;  1P1U A;  1WDN A;  1DPE A;  1PBP A;  4JWX A;  2RCA A;  4IB2 A;  4OEN A;  2F7A A;  1UIU A;  5HBC A;  2UVI A;  4F3G A;  2PX1 A;  1O7T A;  1QUJ A;  1ZLQ A;  1I6B A;  2H4I A;  3H3G A;  1LAG E;  1B51 A;  2B3F A;  2DWH A;  5EHS A;  4YKK A;  5ISU A;  3K6U A;  2DWJ A;  3K6W A;  3OMB A;  1S7Y A;  3BKI B;  3ODB A;  3GLB A;  1QUK A;  2ABH A;  4NF8 A;  4PFU A;  3QIM A;  4BDQ A;  3DM0 A;  1QW0 A;  1ZKB A;  3B6Q A;  4F3P A;  3LUY A;  1LCT A;  4F29 A;  2XXR A;  1URD A;  4QSD A;  3A3C A;  1SI0 A;  2H25 A;  3TEL A;  1ZTY A;  3IK6 B;  4RJZ A;  4MFI A;  4QHQ A;  3CFL A;  2AIX A;  5HM4 B;  5ITP A;  3N94 A;  1US4 A;  4R75 A;  5FHM A;  3OEN A;  1QVS A;  4HS7 A;  2H9B A;  3RUM A;  4BDR A;  4N13 A;  3FXU A;  2HAV A;  1MH3 A;  1MDP 1;  5AA3 A;  5KDT A;  2VHA A;  1QUL A;  3PV0 E;  3CIJ A;  4GL0 A;  1IQ7 A;  3I5O A;  4GWO A;  1UIV A;  4YMA A;  4ELP A;  3TCG A;  3TOD A;  2DOJ A;  3TQL A;  4XKQ A;  3OEM A;  4ZDM A;  1ATG A;  4DZ1 A;  4OFJ A;  4NWC A;  2V93 A;  1Y3P A;  5I56 B;  2UYF A;  2F5X A;  3OSR A;  1JEU A;  1IXG A;  5AA2 B;  3THI A;  2DWI A;  4F1U A;  3SEY A;  4JB7 A;  3Q25 A;  4GD5 A;  3LSW A;  3OOA A;  3FAS A;  4JSD A;  4ZZE A;  3KJ7 A;  2M8C A;  2DS9 A;  3IR1 A;  5L9M A;  4R2B A;  4JWO A;  1TFA A;  1FW0 A;  4H8I A;  1IEJ A;  4DXC A;  3KJT A;  4PQJ A;  1QJM A;  3KSJ A;  3E13 X;  1FQC A;  4TOZ A;  3VVF A;  1PB9 A;  3MVZ A;  3S9L C;  4R6K A;  2O7I A;  2XD3 A;  4H67 A;  2RC7 A;  4P0G A;  2ESN A;  2DE2 A;  3HHF A;  4LZ5 A;  3HO7 A;  4QFN A;  1MY4 A;  1BLF A;  4ZEI A;  5ITO A;  1MY2 A;  2PT2 A;  3G3J A;  3C36 A;  3H6V A;  5H8S A;  4POW A;  1N7X A;  2THI A;  4OEU A;  3EN3 A;  3FJM A;  4IGT A;  3EHU A;  5H8F A;  5J1D A;  3SDF A;  4OHN A;  1BIY A;  4G68 C;  1YAE A;  4ND9 A;  4FIM A;  4THI A;  1LCF A;  1UTB B;  4QFP A;  3ZKL A;  2H98 A;  3M3L A;  4UAC A;  4F1V A;  3T22 A;  2RC9 A;  2REJ A;  3T9V A;  5H8H B;  4KD5 A;  3ILU B;  3LSF B;  3FXQ A;  2NUV A;  2O6A A;  2Q89 A;  1B5I A;  3MVW A;  4WED A;  4U21 A;  4HCY A;  3SER A;  1POY 1;  2Q8J A;  5AA2 D;  3WAE A;  5F1Q A;  2F8D A;  3MUQ A;  1B2H A;  1B1X A;  4H0W A;  1N84 A;  2KLF A;  1MRP A;  1A8F A;  2Z8D A;  3OSQ A;  2OLB A;  4KQP A;  1M5E A;  3VXC A;  1QKB A;  1AIV A;  4FEB A;  4ELQ A;  2V3U A;  2XXW A;  5L8D A;  4DCX A;  4F22 A;  3SEW A;  4RA1 A;  4R6H A;  3M3K A;  3Q27 A;  4XXU A;  4DCY A;  1B7U A;  3D4G A;  4YMB A;  2QMW A;  3B7D A;  3G3K A;  4C1T A;  1EZO A;  1TT1 A;  1MXW A;  1D4N A;  1MQI A;  2HFB A;  4Z7E A;  3T93 B;  3VV5 A;  3KFM A;  4RK9 A;  1QKA A;  5TPA B;  1CE2 A;  1NFT A;  1OQG A;  3RPW A;  1SVX B;  4NMY A;  3H06 B;  4R74 A;  1N7W A;  1LFG A;  2I48 A;  2H5Y A;  2XXT A;  3MJN A;  1B7H A;  1B05 A;  3K6V A;  2F78 A;  1VR5 A;  1B7Z A;  4X1B A;  3H4Z A;  2D3I A;  1US5 A;  5HPQ A;  1USY E;  4BDL A;  3EF7 A;  4ZZA A;  4PET A;  4MH5 A;  2O69 A;  4O3B A;  3E3K A;  3N6U A;  1A54 A;  1NL5 A;  1FTK A;  4LON B;  3OEK A;  2GHA A;  1M5B A;  3N26 A;  3IJX B;  3O29 A;  2W7Y A;  1SW1 A;  2ZYK A;  3S4U A;  4EQ9 A;  3JZJ A;  3G3I A;  3K00 A;  1URG A;  4IY6 A;  1YPN A;  4RPN A;  1Z7N E;  4KCC A;  4KR5 A;  4NE4 A;  4G4P A;  1B40 A;  5I84 A;  3EQ1 A;  3I3V A;  4I62 A;  1H3D A;  2XXI A;  3PMX A;  3VLV A;  3K02 A;  1LGB C;  1NNF A;  2DXY A;  2G93 A;  4I9D A;  3T66 A;  4BDN A;  1ZU0 A;  2Q2C A;  3CFZ A;  3QSL A;  4F19 A;  1N3W A;  1SYI A;  4OFO A;  3T9X B;  4EF1 A;  3PMW A;  4Q5T A;  4ELR A;  4DDD A;  3QK6 A;  1IIW A;  2Y84 A;  2I4C A;  4XIG Q;  4U1Z A;  4ESW A;  2LAO A;  5BUU A;  2F7B A;  3H6W A;  1M5D A;  4E0W A;  2XXP A;  3IO6 A;  5AE4 A;  3AXF A;  4GXS B;  1O63 A;  4R9G A;  2DVC A;  4M4G A;  2I6E A;  4DXU A;  4NF5 A;  2XXQ A;  5JTY B;  2QS1 A;  1MS7 A;  4F18 A;  3V83 A;  1P1Q A;  3QXM A;  3FJ7 A;  3MZ1 A;  4ZED A;  3DP4 A;  2A5S A;  5BWJ A;  4KYE A;  2A5T B;  1D3K A;  3UP9 A;  3IB1 A;  3VLW A;  4JWY A;  4LVQ A;  4G8N A;  4PE5 B;  4YB5 A;  4YIC A;  2O7U A;  2GH9 A;  3VE1 B;  4HW8 A;  1Y4C A;  1TFD A;  1FQB A;  2Y7R A;  3ECR A;  4AQ4 A;  1DTZ A;  1EZP A;  1B3F A;  3ILT B;  5KDT B;  2Y7K A;  1N3X A;  5FHO A;  2GHB A;  3MQ9 A;  4JDF A;  1B5H A;  3VVE A;  3O28 A;  4LUB A;  3K2D A;  1NNK A;  4H1X A;  3LSL A;  3GXA A;  3B6W A;  2X7Q A;  1CB6 A;  2XX9 A;  3PUX E;  3VXB A;  1DSN A;  2O84 X;  5JTY A;  1JW5 A;  1B1H A;  3FIR A;  4U22 A;  1B4H A;  4GRK A;  2I49 A;  2A5T A;  1LAF E;  4OVJ A;  4NWD A;  1D9V A;  5ELV A;  5IAI A;  2DVZ A;  3DP8 A;  1MXZ A;  5FHN A;  4ZE8 A;  3HST A;  2XXY A;  3D4C A;  3KN3 A;  1JVX A;  3MC2 A;  1R6Z A;  4H5F A;  4I1D A;  1P1N A;  3PD8 A;  1JQF A;  1MY0 A;  4H5G A;  5CM6 A;  1H43 A;  2HZK A;  1Y3N A;  2BJJ X;  4FJP A;  4HCW A;  1P1W A;  3PPN A;  4LP2 B;  2QMX A;  4IO5 A;  1NMU A;  3TTK A;  5M2V A;  3ZS6 A;  3IL1 B;  1Y9U A;  4R72 A;  3H6U A;  1B3L A;  2AL5 A;  1PB8 A;  5H8F B;  3MP1 A;  2ONK E;  1M5F A;  3V8X B;  3HPI A;  3PUY E;  4KYS A;  2Q9T A;  3SET A;  3TQW A;  5KCJ B;  1VFE A;  4DXB A;  4E0X A;  4U1O A;  1GV8 A;  1B3H A;  3MVX A;  1GR2 A;  3GBB A;  1NH8 A;  1JNF A;  1JET A;  2ONS A;  1ELJ A;  2UXA A;  4GIZ A;  2QS2 A;  3K0V A;  3MBP A;  3PPP A;  4EDP A;  1IXC A;  3KZG A;  4KHZ E;  3FV2 A;  4KI0 E;  4RNS A;  1MM6 A;  1FTM A;  1Q1K A;  4L17 A;  2F34 A;  2P1S A;  4DIG A;  3T9H B;  2XD2 A;  4N6P A;  1XC1 A;  3RY3 A;  3TFL A;  3O9P A;  1AL3 A;  3VLU A;  1BP5 A;  3JYR A;  4LZ7 A;  1Y1Z A;  2F6P A;  4JBZ A;  1SDX A;  5B70 A;  3Q29 A;  4G2Z A;  1DPP A;  1PDA A;  1B46 A;  5I59 A;  3E4R A;  4XKN A;  3KOS A;  1ZJL A;  3F11 A;  4X48 A;  4NF6 B;  4LQ5 A;  3SEX A;  4F2O A;  5KCJ A;  3G3H A;  1IXH A;  4IY5 A;  3FXR A;  2Z22 A;  2UVH A;  1MQD A;  3QYT A;  5CMC A;  1MQJ A;  2ONR A;  5I57 A;  2UVJ A;  3G7W A;  4H6D A;  5AA4 B;  4U4X A;  4YB6 A;  3MPL A;  3MW0 A;  3OO8 A;  1HSJ A;  2DSF A;  1IXI A;  1UTH B; 
#chains in the Genus database with same CATH topology
 3FZV A;  3UN6 A;  3VFJ A;  4PTK A;  1I69 A;  3OEL A;  4AB6 A;  1OLA A;  5ET5 A;  1A7L A;  1MDQ A;  1FPJ A;  1LBC A;  4POX A;  4EQ7 A;  4NF4 B;  3BIH A;  1IMF A;  3KC1 A;  3CSG A;  4OVP A;  3IOT A;  2F36 A;  4QRZ A;  4ZEF A;  3LC8 A;  4F3S A;  1IME A;  2I4B A;  2GFE A;  2Q88 A;  4U4S A;  5I2K B;  1NV4 A;  3RGY A;  3U8Q A;  4PFT A;  1FQE A;  5K2Y A;  3B50 A;  2QSX A;  2GRV A;  3RT8 A;  2RF1 A;  3FV1 A;  4OEV A;  4NF6 A;  3OD7 A;  1PC3 A;  2OZZ A;  1I6Q A;  1RKM A;  2DQV A;  1EU8 A;  3BIG A;  4RYA A;  2ZYN A;  3EHT A;  4ZEC A;  4JSO A;  4EF2 A;  3ONM A;  1TXF A;  4GWY A;  3CFX A;  3MZB A;  1MQH A;  1LEV A;  4KPT A;  2Z8E A;  3SES A;  1LAX A;  5AA4 A;  3IOU A;  2DYX A;  4OES A;  3KN7 A;  2HXW A;  1JEV A;  2AYS A;  3TZA A;  4N6K A;  3MVY A;  3FGS A;  2FYI A;  3E9X A;  1UTH A;  3DLN A;  3GYY A;  3HN0 A;  4IGR A;  4R73 A;  2R71 A;  1B58 A;  2YJP A;  1FPK A;  1MPD A;  2REG A;  4NED A;  3EPE A;  5ICQ A;  5AA1 A;  2JJK A;  3TPA A;  4G8H A;  4NF4 A;  5L9O A;  1MXX A;  4PC9 A;  2Z8F A;  3U1O A;  1B9J A;  2IA4 A;  1B5J A;  4H8J A;  3PD9 A;  1SBP A;  1LFI A;  3T96 B;  2HQ0 A;  3IX1 A;  4YKP A;  3S9M C;  5I2K A;  5B7D A;  5ICT A;  4X9T A;  2CMO A;  4IO4 A;  1R1N A;  1FRP A;  4OWD A;  4XKR A;  3Q28 A;  4MLV A;  2Z23 A;  1WOD A;  1WVJ A;  2XWK A;  5J16 A;  1B0L A;  2FIX A;  3LR1 A;  4MBP A;  4RPO A;  2UVG A;  3IJO B;  4NF5 B;  1MY3 A;  3O97 A;  4PAK A;  4ESX A;  5CRY A;  4AB5 A;  2ZMB A;  2ANJ A;  1MY1 A;  2NXO A;  1VFD A;  5LOM A;  4NHB A;  4O7I A;  5K2X A;  3C31 A;  1R9Q A;  1LBY A;  4ZEK A;  2F35 A;  3HHG A;  1T0K A;  3O6H A;  1JW1 A;  1XHY A;  1A40 A;  1ZMG A;  5DVF A;  3FUZ A;  3U65 A;  4IO2 A;  1MXV A;  4UA8 A;  2XWO A;  3TAJ A;  1EYJ A;  3PUW E;  2FBP A;  1DCU A;  1M5C A;  2F3B A;  2I3V A;  3IOR A;  2XXX A;  2UYE A;  4N8Y A;  4DE8 A;  3JV9 A;  3PGF A;  1MPB A;  1XVY A;  1FQA A;  2VP1 A;  4KYD A;  5F7V A;  2IEE A;  1XS5 A;  3WAF A;  3KBZ A;  1Y4T A;  4QXD A;  1RYO A;  4KXP A;  1AOV A;  3S9N C;  3IO4 A;  3QUJ A;  4F1Y A;  4GVO A;  2VGQ A;  1B6H A;  1MM7 A;  3OO7 A;  1EZ9 A;  3FAT A;  3RPL A;  2OJT A;  3G3F A;  5A5X A;  1LFH A;  3UGW A;  4Q8R A;  1BKA A;  4GL8 A;  4Q0C A;  4FED A;  1XT8 A;  2ZXT A;  2WKY A;  1FJ9 A;  1SPI A;  2E0S A;  4GBW A;  2OK2 A;  4OAN A;  1USY H;  2CEY A;  3IOW A;  2YPN A;  4F3B A;  5JK4 A;  4PF8 A;  1FPL A;  4GX4 A;  4P11 A;  2QFL A;  2R6G E;  3HV1 A;  3N6T A;  5H8Q B;  4QFL A;  2WBD A;  4TQU Q;  3RN8 A;  3KEI A;  4YKJ A;  1DBZ A;  3TUS A;  4PF6 A;  3PUZ E;  4U2R A;  2FA7 A;  3N5L A;  1B0H A;  4FEC A;  4XKP A;  3C32 A;  2DWA A;  3S2V A;  1LB9 A;  2L5V A;  1Y1M A;  3A09 A;  2HEU A;  2PBW A;  2ZNT A;  4ZEB A;  3C33 A;  1L5T A;  1SW4 A;  5IKB A;  1LBX A;  1NNT A;  1FCK A;  2V3T A;  4YAH X;  3R7X A;  4OA4 A;  4N07 A;  3MP6 A;  4OTE A;  2VPN A;  5EYF A;  4RY1 A;  1LBW A;  4TLL B;  2QS3 A;  3KBR A;  4P0I A;  3QUF A;  3MZ9 A;  4OMB A;  2YLN A;  1OVT A;  3FVG A;  1PBQ A;  2VOZ A;  3IOV A;  1URS A;  2O1L A;  2RKM A;  1OIB A;  3OXN A;  5DEX B;  4C1U A;  3LBS A;  2HAU A;  1ANF A;  1Y20 A;  4GWZ A;  3R26 A;  3U72 A;  3TKD A;  1H76 A;  2I0B A;  2CZH A;  5H8Q A;  2I0C A;  2PYY A;  2ZNS A;  1MPC A;  3K6X A;  3CG1 A;  3R6U A;  3RLF E;  1GTK A;  2Q2A A;  4OFL A;  4BLA A;  4IO6 A;  3UIF A;  3HCQ A;  4P47 A;  3T1B A;  3CSB A;  5CMM A;  1DOT A;  2CZL A;  3H03 A;  4JVD A;  1J1N A;  4YZZ A;  5FTH A;  1YCJ A;  1LBB A;  1GGG A;  2WYP A;  2X26 A;  3O6I A;  3MPK A;  1YTV A;  1IZ1 A;  4PFY A;  5I59 B;  4GBV A;  4FAJ A;  4Z0I A;  1MXU A;  4IO3 A;  2WX9 A;  3ISP A;  2RC8 A;  2V3Q A;  1Y3Q A;  3LSX A;  3TDJ A;  4OZ9 A;  1YZ0 A;  1MQG A;  5I57 B;  1IIT A;  3CG3 A;  3UK4 A;  5DVI A;  4O3A A;  5DEX A;  3C4M A;  5L9S A;  2F6G A;  3H6T A;  1PEB A;  1BTJ A;  4G8M A;  1LAH E;  1P1O A;  1JP4 A;  4R2F A;  1O64 A;  3TTL A;  1FTJ A;  2QRY A;  1UQW A;  4R6Y A;  3A3U A;  1D9Y A;  2F97 A;  4LQ2 A;  5I2N B;  3MWB A;  1KWH A;  4QSE A;  1MH4 A;  2I3W A;  4MLQ A;  3M8U A;  3IB2 A;  4NGU A;  2NVU B;  4ELO A;  1FQF A;  4GXA A;  4N15 A;  2OCU A;  4GFR A;  2OWS A;  1B32 A;  3FD3 A;  4WXJ A;  4O3C A;  1VSO A;  1IMA A;  2FNC A;  3K1M A;  2VD2 A;  4HTG A;  1IMC A;  1SW5 A;  1VE4 A;  3RTW B;  4ONY A;  3TTN A;  4F31 B;  3B6T A;  1S9T A;  4ZS9 A;  4MF3 A;  5CBS A;  4QF9 A;  4O7M A;  1ZBM A;  5I58 B;  3PPQ A;  1HSE A;  1A99 A;  5EYH A;  2H99 A;  1IUD A;  4N91 A;  2MKZ A;  2WBB A;  5I56 A;  5DYH A;  4ZE9 A;  3U93 A;  3GBA A;  1NH7 A;  1OQH A;  5AA2 A;  2G29 A;  4Q30 B;  4GF8 A;  4X1D A;  2XX8 A;  4MNC A;  1LST A;  2DP8 A;  1P99 A;  1SI1 A;  5EQA A;  3MAM A;  3QAX A;  2OBG A;  4QFO A;  3T9U A;  3W15 C;  1RYX A;  4TLM B;  4YU0 A;  4NTL A;  2XXU A;  1GVC A;  5DT6 A;  2Q74 A;  5FTI A;  4GQO A;  5CMK A;  5I2N A;  1SW2 A;  5DVJ A;  4PP0 A;  4EXL A;  4OQO A;  3PU5 A;  1XOC A;  3DP6 A;  3E78 A;  4N17 A;  4OER A;  4I3E A;  1R9L A;  3PUV E;  2O51 A;  2WYK A;  1S50 A;  2E1S A;  1N04 A;  2BJI A;  4OVR A;  5IZ1 A;  2RCB A;  2D21 A;  2P2A A;  2PMS A;  3KGC A;  4P1L A;  1DTG A;  2ALU A;  3BFT A;  4GOT A;  4DLD A;  2QS4 A;  3KN8 A;  3QMF A;  4AS4 A;  2ZNU A;  5CMB A;  1AH5 A;  1FQD A;  4F2Q A;  3SKP A;  2QVU A;  5I58 A;  4F39 A;  2XXV A;  1B3E A;  1NV1 A;  2HZL A;  4LAT A;  1H44 A;  3CR9 A;  4ECF A;  3KOT A;  4H65 A;  1FBP A;  4YB7 A;  4MCO A;  2QJE A;  3ZKK A;  3I6V A;  2PT1 A;  5ET8 A;  1N0T A;  1PB7 A;  2V4C A;  1NUX A;  3TCH A;  3M3F A;  4BDO A;  2VPO A;  2Y5L A;  1HSL A;  3O2A A;  5EQ9 A;  1ZIU A;  1UTB A;  2B4L A;  3PMV A;  1DMB A;  4FAT A;  1NKX A;  1AMF A;  4P56 A;  3S9E A;  1XVX A;  5H8H A;  2XHD A;  3FVN A;  2Y5K A;  3O66 A;  4KCD A;  4JXI A;  4R9F A;  4XEQ A;  2ZZX A;  3VVD A;  4H45 A;  3W9V A;  4M1V A;  2QPQ A;  2O68 A;  4I3Y A;  4GLI A;  3GZG A;  4I8C A;  5LTC A;  1LB8 A;  3E79 A;  3USD A;  1FBH A;  1OVB A;  4N81 A;  2DDK A;  3P7I A;  4WKM A;  2OWT A;  3PPR A;  4EXK A;  2NOO A;  3OO9 A;  1FTO A;  1FBD A;  3V5A A;  1NV7 A;  3K1P A;  3U92 A;  3IFA A;  3VDF A;  2RIN A;  3TTR A;  4OXV A;  5CI5 A;  4QFK A;  2FVZ A;  4RK2 A;  3K01 A;  1MG1 A;  4JVI A;  3BFU A;  2P3V A;  3Q26 A;  2XXH A;  2ZYO A;  3RPL B;  3TMG A;  1SQY A;  5A5X B;  1FPG A;  4K3F A;  2VD3 A;  3G3G A;  3TTM A;  1QGX A;  4WEP A;  3OO6 A;  3L6H A;  3DEL B;  5TP9 B;  3RTF B;  3PPO A;  3FVO A;  4ISU A;  1II5 A;  4FE8 A;  5EHM A;  3TYH A;  1TWY A;  3C34 A;  4OET A;  4EQB A;  4FOR A;  4OVT A;  2HCA A;  4XTC Q;  1FPE A;  2P3N A;  4QSC A;  1FBF A;  1JVY A;  4MX6 A;  3FVK A;  3UOR A;  4IO7 A;  5CBR A;  2GQ1 A;  4N4U A;  5CC2 A;  2DE3 A;  3SZP A;  5TPA A;  1SD3 A;  1FBG A;  4OYV A;  4G68 B;  1A55 A;  5H8N B;  3KG2 A;  2XA5 A;  4EUO A;  3V89 B;  2Y7P A;  2I58 A;  3EHS A;  2NWJ A;  3IB0 A;  5I3S A;  3FJG A;  1LLS A;  4BDM A;  3O6G A;  1N76 A;  2DXR A;  2ZYM A;  1I6A A;  1NNP A;  2QL3 A;  3B8B A;  3KSX A;  3RT6 B;  4LZ8 A;  3MP8 A;  1FTL A;  2V84 A;  4C0R A;  5EQ8 A;  1G0H A;  1OMP A;  3C35 A;  1POT A;  5DTB A;  5IZ3 B;  3C9H A;  1SYH A;  5TU0 A;  1FSA A;  3ZSF A;  4N6D A;  1B52 A;  1OLC A;  5TP9 A;  2R9J A;  2XX7 A;  2Y7W A;  2P0S A;  4DI3 D;  4U23 A;  2AL4 A;  3TCF A;  2X7P A;  1F9B A;  3CI8 A;  1KZ8 A;  4NF8 B;  2V25 A;  3RNN A;  3L6G A;  1NV0 A;  3IAZ A;  3RYD A;  1Z7M E;  1A8E A;  1NUW A;  2Y7I A;  4YKI A;  4LA9 A;  1FPD A;  3K1N A;  1MXY A;  3BBR A;  4O94 A;  4PFW A;  2D5W A;  4PCD A;  3TEP A;  4G77 A;  4G61 A;  2PVU A;  3K4U A;  3SEV A;  3SEU A;  3CVG A;  1K9Y A;  2B65 A;  4PFB A;  1H45 A;  3W9W A;  1B3G A;  4G68 A;  5H8N A;  3UA8 A;  1DK4 A;  2B3B A;  1NV5 A;  5A5L A;  5KZT A;  4KFQ A;  1RDZ A;  5JEI A;  3RQT A;  3H7M A;  4RXL A;  2F7C A;  3U94 A;  2O1M A;  1QUI A;  1JW4 A;  2DE4 A;  3T0J A;  1B4Z A;  3CRB A;  1Q35 A;  1EH3 A;  1P1U A;  1WDN A;  4FBP A;  1DPE A;  1PBP A;  4P3L A;  4JWX A;  2RCA A;  4IB2 A;  4OEN A;  2F7A A;  1UIU A;  5HBC A;  2UVI A;  3IFC A;  4F3G A;  2PX1 A;  1O7T A;  5IZ3 A;  1QUJ A;  1ZLQ A;  1I6B A;  2H4I A;  3H3G A;  1LAG E;  1B51 A;  2B3F A;  2DWH A;  4YKK A;  5EHS A;  5ISU A;  3K6U A;  4GWX A;  2DWJ A;  3K6W A;  3OMB A;  1FTA A;  1S7Y A;  3BKI B;  3ODB A;  3GLB A;  1QUK A;  2ABH A;  1IMD A;  5I7I A;  4NF8 A;  4PFU A;  3QIM A;  4BDQ A;  3DM0 A;  1QW0 A;  1ZKB A;  3B6Q A;  4F3P A;  3LUY A;  1KA1 A;  1LCT A;  4F29 A;  2XXR A;  1URD A;  4QSD A;  3A3C A;  1SI0 A;  2H25 A;  3TEL A;  1ZTY A;  3IK6 B;  4RJZ A;  4MFI A;  4QHQ A;  4I40 A;  3CFL A;  2AIX A;  5HM4 B;  5ITP A;  3N94 A;  1US4 A;  4R75 A;  5FHM A;  1VDW A;  3OEN A;  1NV6 A;  1QVS A;  4HS7 A;  2H9B A;  3RUM A;  4BDR A;  4N13 A;  3FXU A;  2HAV A;  1MH3 A;  1MDP 1;  5EYG A;  5AA3 A;  1YYZ A;  5KDT A;  2VHA A;  1QUL A;  3PV0 E;  3CIJ A;  4GL0 A;  5FBP A;  1IQ7 A;  4PAF A;  3I5O A;  4GWO A;  1UIV A;  4YMA A;  4ELP A;  3HFU A;  3TCG A;  3TOD A;  2DOJ A;  3TQL A;  2OX3 A;  4XKQ A;  3D1R A;  4PGN A;  3OEM A;  1RDX A;  4ZDM A;  1ATG A;  4DZ1 A;  5I5P A;  4OFJ A;  1NI9 A;  4NWC A;  2V93 A;  1Y3P A;  4AS5 A;  5I56 B;  2UYF A;  2F5X A;  3OSR A;  1JEU A;  1IXG A;  5AA2 B;  3THI A;  2DWI A;  4F1U A;  3SEY A;  4JB7 A;  3Q25 A;  4GD5 A;  1FBE A;  3LSW A;  3OOA A;  3FAS A;  5IGA A;  4JSD A;  4ZZE A;  3KJ7 A;  4PBQ A;  2M8C A;  2DS9 A;  3IR1 A;  5L9M A;  4R2B A;  4JWO A;  1TFA A;  1FW0 A;  4H8I A;  1IEJ A;  4DXC A;  3KJT A;  4PQJ A;  1QJM A;  3KSJ A;  5ESY A;  3E13 X;  1FQC A;  4TOZ A;  3VVF A;  1PB9 A;  2CEX A;  3MVZ A;  3S9L C;  4R6K A;  2O7I A;  2XD3 A;  4H67 A;  2RC7 A;  4P0G A;  2ESN A;  2DE2 A;  3HHF A;  2HHM A;  5ET7 A;  4LZ5 A;  2KR0 A;  3HO7 A;  4QFN A;  2XWV A;  1MY4 A;  4P9K A;  1BLF A;  4ZEI A;  5ITO A;  1MY2 A;  2PT2 A;  3G3J A;  3C36 A;  3H6V A;  5H8S A;  4POW A;  1N7X A;  2THI A;  1D9Q A;  4OEU A;  3EN3 A;  3FJM A;  4IGT A;  3EHU A;  4HXV A;  5H8F A;  1NV3 A;  5J1D A;  3SDF A;  4OHN A;  2KQZ A;  1BIY A;  4G68 C;  1NV2 A;  1YAE A;  4ND9 A;  4FIM A;  4THI A;  4MJO A;  1LCF A;  1UTB B;  2R8T A;  4QFP A;  3ZKL A;  4XFE A;  2H98 A;  3M3L A;  4UAC A;  4F1V A;  3T22 A;  2RC9 A;  1G0I A;  2REJ A;  3T9V A;  5H8H B;  4KD5 A;  4OVQ A;  4PFR A;  3LV0 A;  3ILU B;  3LSF B;  3FXQ A;  2NUV A;  2O6A A;  2WEF A;  4GWW A;  2Q89 A;  1B5I A;  3MVW A;  4WED A;  4U21 A;  4HCY A;  3SER A;  1POY 1;  2Q8J A;  5AA2 D;  3WAE A;  5F1Q A;  2F8D A;  3MUQ A;  1B2H A;  1B1X A;  4H0W A;  4PFI A;  1N84 A;  2KLF A;  1MRP A;  1A8F A;  2Z8D A;  3OSQ A;  4DI4 B;  2OLB A;  4KQP A;  1M5E A;  3VXC A;  1QKB A;  1AIV A;  2HXR A;  4PDH A;  4FEB A;  4ELQ A;  2V3U A;  2XXW A;  4NG7 A;  5L8D A;  4PAI A;  4DCX A;  4F22 A;  3SEW A;  4RA1 A;  4R6H A;  3M3K A;  3Q27 A;  2FIE A;  4XXU A;  4DCY A;  1B7U A;  3D4G A;  4YMB A;  1EYI A;  4X8R A;  5IM2 A;  4MAG A;  2QMW A;  3B7D A;  4HE1 A;  3G3K A;  4C1T A;  3ROJ A;  1FBC A;  1EZO A;  1KA0 A;  4P8B A;  1TT1 A;  1MXW A;  1D4N A;  4JVC A;  1MQI A;  2HFB A;  4Z7E A;  3T93 B;  3VV5 A;  3KFM A;  4RK9 A;  4NF0 A;  1QKA A;  5TPA B;  5LDZ A;  1CE2 A;  1NFT A;  1OQG A;  3RPW A;  1SVX B;  4NMY A;  3H06 B;  4R74 A;  1N7W A;  1LFG A;  2VT5 A;  2I48 A;  2H5Y A;  2XXT A;  3MJN A;  1B7H A;  1B05 A;  3K6V A;  2F78 A;  1VR5 A;  1B7Z A;  4X1B A;  3H4Z A;  2D3I A;  1US5 A;  5HPQ A;  1USY E;  4BDL A;  3EF7 A;  4ZZA A;  4PET A;  4MH5 A;  2O69 A;  4O3B A;  3E3K A;  1AWB A;  3N6U A;  1A54 A;  1NL5 A;  1FTK A;  4LON B;  1NUZ A;  3OEK A;  2GHA A;  3NOH A;  1M5B A;  3N26 A;  3IJX B;  3O29 A;  2W7Y A;  1SW1 A;  2ZYK A;  3S4U A;  4EQ9 A;  3JZJ A;  3G3I A;  3K00 A;  1URG A;  4IY6 A;  1YPN A;  4RPN A;  1Z7N E;  4KCC A;  4KR5 A;  4XF5 A;  4NE4 A;  4G4P A;  1B40 A;  4IR8 A;  5I84 A;  3EQ1 A;  3I3V A;  4I62 A;  1H3D A;  2XXI A;  3PMX A;  3KC0 A;  3VLV A;  3K02 A;  1LGB C;  1NNF A;  2DXY A;  2G93 A;  4I9D A;  3T66 A;  5IZZ A;  4BDN A;  1ZU0 A;  2Q2C A;  3CFZ A;  3QSL A;  4F19 A;  1N3W A;  1SYI A;  4OFO A;  3T9X B;  4EF1 A;  3PMW A;  4Q5T A;  4ELR A;  4DDD A;  3QK6 A;  4MNP A;  1IIW A;  4P1E A;  1FJ6 A;  2Y84 A;  2I4C A;  4XIG Q;  4U1Z A;  4ESW A;  2LAO A;  1EYK A;  5BUU A;  2F7B A;  3LUZ A;  3H6W A;  1M5D A;  2QVR A;  4E0W A;  2XXP A;  4PBH A;  3IO6 A;  5AE4 A;  3AXF A;  2PCR A;  3FBP A;  4GXS B;  1O63 A;  4R9G A;  2DVC A;  4M4G A;  2I6E A;  4OVS A;  4DXU A;  4NF5 A;  2XXQ A;  5JTY B;  2QS1 A;  1MS7 A;  4F18 A;  3V83 A;  1P1Q A;  3QXM A;  3FJ7 A;  3MZ1 A;  2Q8M A;  4ZED A;  3DP4 A;  2A5S A;  4GX3 A;  5BWJ A;  4KYE A;  2A5T B;  4HE0 A;  1D3K A;  3UP9 A;  3IB1 A;  3VLW A;  1XI6 A;  5F24 A;  4JWY A;  4LVQ A;  4G8N A;  2HPG A;  4PE5 B;  4YB5 A;  2PFZ A;  3FXB A;  4YIC A;  2O7U A;  2GH9 A;  3VE1 B;  4HW8 A;  1Y4C A;  1TFD A;  1FQB A;  2Y7R A;  4PGP A;  3ECR A;  4PE3 A;  4AQ4 A;  1DTZ A;  1EZP A;  1B3F A;  2CZK A;  3ILT B;  5KDT B;  1INP A;  2Y7K A;  1N3X A;  5FHO A;  2GHB A;  3MQ9 A;  4JDF A;  2F3D A;  1B5H A;  3VVE A;  3O28 A;  4LUB A;  3K2D A;  2ZZW A;  1NNK A;  4H1X A;  3LSL A;  1K9Z A;  3GXA A;  3MST A;  3B6W A;  2X7Q A;  1CB6 A;  2XX9 A;  3PUX E;  1YXI A;  3VXB A;  1DSN A;  2O84 X;  5JTY A;  1JW5 A;  1B1H A;  3FIR A;  4U22 A;  4N8G A;  2CZI A;  1B4H A;  4GRK A;  2I49 A;  2A5T A;  1FPI A;  1LAF E;  4MIJ A;  4OVJ A;  4NWD A;  2QVV A;  1D9V A;  5ELV A;  1FPB A;  3EKI A;  5IAI A;  2DVZ A;  3DP8 A;  1MXZ A;  5FHN A;  4ZE8 A;  3HST A;  2XXY A;  3CHG A;  3D4C A;  3KN3 A;  1JVX A;  4MNI A;  3MC2 A;  1R6Z A;  4H5F A;  4I1D A;  1P1N A;  4GWS A;  3PD8 A;  1JQF A;  1MY0 A;  4H5G A;  4H46 A;  5CM6 A;  1H43 A;  2HZK A;  1Y3N A;  2BJJ X;  4FJP A;  4HCW A;  4O8M A;  1P1W A;  5EQ7 A;  3PPN A;  4LP2 B;  2QMX A;  4IO5 A;  4UAB A;  1NMU A;  3TTK A;  5DW8 A;  5M2V A;  3ZS6 A;  1CNQ A;  3IL1 B;  1Y9U A;  4R72 A;  3H6U A;  1B3L A;  2AL5 A;  1PB8 A;  5H8F B;  3MP1 A;  2ONK E;  4NQ8 A;  1M5F A;  3V8X B;  4PDD A;  2XWI A;  3HPI A;  4HE2 A;  3PUY E;  4KYS A;  1Q9D A;  2Q9T A;  3SET A;  3TQW A;  5KCJ B;  1VFE A;  4DXB A;  4E0X A;  4U1O A;  1GV8 A;  1B3H A;  3MVX A;  4QBA A;  1GR2 A;  3GBB A;  5T3J A;  1NH8 A;  1JNF A;  4NX1 A;  2OWZ A;  1JET A;  2ONS A;  1ELJ A;  3PTY A;  2UXA A;  4GIZ A;  2QS2 A;  3K0V A;  4X04 A;  4GX6 A;  1BK4 A;  3MBP A;  2B4M A;  4LN5 A;  1NUY A;  3PPP A;  4EDP A;  1IXC A;  3KZG A;  4KHZ E;  3FV2 A;  4KI0 E;  4RNS A;  1MM6 A;  1FTM A;  1Q1K A;  4L17 A;  4NAP A;  2F34 A;  2P1S A;  4DIG A;  2ZZV A;  3T9H B;  2XD2 A;  1IMB A;  4N6P A;  1XC1 A;  3RY3 A;  3TFL A;  3MYU A;  3O9P A;  1FPF A;  1AL3 A;  3VLU A;  1BP5 A;  3JYR A;  5ET6 A;  4LZ7 A;  4MHF A;  1Y1Z A;  2XXK A;  2F6P A;  4JBZ A;  1SDX A;  5B70 A;  3Q29 A;  4G2Z A;  1DPP A;  1PDA A;  1B46 A;  1LBZ A;  2FHY A;  4NN3 A;  1RDY A;  5I59 A;  4GWU A;  3E4R A;  4XKN A;  3KOS A;  1LBV A;  4MEV A;  1ZJL A;  3F11 A;  4MMP A;  4X48 A;  4NF6 B;  2PFY A;  4LQ5 A;  3SEX A;  4F2O A;  5KCJ A;  3G3H A;  1IXH A;  4IY5 A;  3FXR A;  2Z22 A;  2UVH A;  1MQD A;  3QYT A;  5CMC A;  1MQJ A;  2ONR A;  5I57 A;  2UVJ A;  3G7W A;  4H6D A;  5AA4 B;  4U4X A;  4YB6 A;  3MPL A;  3MW0 A;  3A29 A;  3OO8 A;  1HSJ A;  2DSF A;  1IXI A;  1UTH B; 
#chains in the Genus database with same CATH homology
 3FZV A;  3UN6 A;  3VFJ A;  1I69 A;  3OEL A;  4AB6 A;  1OLA A;  1A7L A;  1MDQ A;  1LBC A;  4POX A;  4EQ7 A;  4NF4 B;  3CSG A;  3IOT A;  2F36 A;  4QRZ A;  4ZEF A;  3LC8 A;  4F3S A;  2I4B A;  2GFE A;  2Q88 A;  4U4S A;  5I2K B;  3RGY A;  3U8Q A;  4PFT A;  1FQE A;  5K2Y A;  2QSX A;  2GRV A;  3RT8 A;  2RF1 A;  3FV1 A;  4OEV A;  4NF6 A;  3OD7 A;  1PC3 A;  2OZZ A;  1I6Q A;  1RKM A;  2DQV A;  1EU8 A;  4RYA A;  2ZYN A;  3EHT A;  4ZEC A;  4JSO A;  4EF2 A;  3ONM A;  1TXF A;  3CFX A;  3MZB A;  1MQH A;  4KPT A;  2Z8E A;  3SES A;  1LAX A;  5AA4 A;  3IOU A;  2DYX A;  4OES A;  3KN7 A;  2HXW A;  1JEV A;  2AYS A;  3TZA A;  3MVY A;  3FGS A;  2FYI A;  3E9X A;  1UTH A;  3DLN A;  4IGR A;  3HN0 A;  4R73 A;  2R71 A;  1B58 A;  2YJP A;  1MPD A;  2REG A;  4NED A;  3EPE A;  5ICQ A;  5AA1 A;  3TPA A;  4G8H A;  4NF4 A;  5L9O A;  1MXX A;  2Z8F A;  3U1O A;  1B9J A;  2IA4 A;  1B5J A;  4H8J A;  3PD9 A;  1SBP A;  1LFI A;  3T96 B;  2HQ0 A;  3IX1 A;  4YKP A;  3S9M C;  5I2K A;  5B7D A;  5ICT A;  4X9T A;  2CMO A;  4IO4 A;  1R1N A;  4OWD A;  4XKR A;  3Q28 A;  4MLV A;  2Z23 A;  1WOD A;  1WVJ A;  1B0L A;  3LR1 A;  4MBP A;  4RPO A;  2UVG A;  3IJO B;  4NF5 B;  1MY3 A;  3O97 A;  4ESX A;  5CRY A;  4AB5 A;  2ZMB A;  2ANJ A;  1MY1 A;  2NXO A;  1VFD A;  5LOM A;  5K2X A;  3C31 A;  1R9Q A;  4ZEK A;  2F35 A;  3HHG A;  1T0K A;  3O6H A;  1JW1 A;  1XHY A;  1A40 A;  1ZMG A;  5DVF A;  3FUZ A;  4IO2 A;  1MXV A;  4UA8 A;  3TAJ A;  3PUW E;  1M5C A;  2I3V A;  3IOR A;  2XXX A;  2UYE A;  4DE8 A;  3JV9 A;  3PGF A;  1MPB A;  1XVY A;  1FQA A;  2VP1 A;  4KYD A;  5F7V A;  2IEE A;  1XS5 A;  3WAF A;  1Y4T A;  1RYO A;  1AOV A;  3S9N C;  3IO4 A;  3QUJ A;  4F1Y A;  4GVO A;  2VGQ A;  1B6H A;  1MM7 A;  3OO7 A;  1EZ9 A;  3FAT A;  2OJT A;  3G3F A;  5A5X A;  1LFH A;  3UGW A;  4Q8R A;  1BKA A;  4GL8 A;  4Q0C A;  4FED A;  1XT8 A;  2ZXT A;  2WKY A;  2E0S A;  2OK2 A;  1USY H;  3IOW A;  2YPN A;  4F3B A;  5JK4 A;  4P11 A;  2R6G E;  3HV1 A;  3N6T A;  5H8Q B;  4QFL A;  4TQU Q;  3RN8 A;  3KEI A;  4YKJ A;  3TUS A;  3PUZ E;  4U2R A;  2FA7 A;  3N5L A;  1B0H A;  4FEC A;  4XKP A;  3C32 A;  2DWA A;  3S2V A;  1LB9 A;  1Y1M A;  3A09 A;  2HEU A;  2PBW A;  2ZNT A;  4ZEB A;  3C33 A;  1L5T A;  1SW4 A;  5IKB A;  1NNT A;  1FCK A;  2V3T A;  4YAH X;  3R7X A;  4N07 A;  3MP6 A;  4OTE A;  5EYF A;  4RY1 A;  4TLL B;  2QS3 A;  3KBR A;  4P0I A;  3QUF A;  3MZ9 A;  4OMB A;  2YLN A;  1OVT A;  3FVG A;  1PBQ A;  2VOZ A;  3IOV A;  1URS A;  2O1L A;  2RKM A;  1OIB A;  3OXN A;  5DEX B;  4C1U A;  3LBS A;  2HAU A;  1ANF A;  1Y20 A;  3R26 A;  3U72 A;  3TKD A;  1H76 A;  2I0B A;  5H8Q A;  2I0C A;  2PYY A;  2ZNS A;  1MPC A;  3K6X A;  3CG1 A;  3R6U A;  3RLF E;  1GTK A;  2Q2A A;  4OFL A;  4BLA A;  4IO6 A;  3UIF A;  3HCQ A;  3CSB A;  5CMM A;  1DOT A;  2CZL A;  3H03 A;  1J1N A;  4YZZ A;  5FTH A;  1YCJ A;  1LBB A;  1GGG A;  2X26 A;  3O6I A;  3MPK A;  1YTV A;  1IZ1 A;  4PFY A;  5I59 B;  4FAJ A;  4Z0I A;  1MXU A;  4IO3 A;  2RC8 A;  2V3Q A;  1Y3Q A;  3LSX A;  3TDJ A;  4OZ9 A;  1MQG A;  5I57 B;  1IIT A;  3CG3 A;  3UK4 A;  5DVI A;  4O3A A;  5DEX A;  3C4M A;  5L9S A;  2F6G A;  3H6T A;  1PEB A;  1BTJ A;  4G8M A;  1LAH E;  1P1O A;  4R2F A;  1O64 A;  3TTL A;  1FTJ A;  2QRY A;  1UQW A;  4R6Y A;  3A3U A;  1D9Y A;  2F97 A;  4LQ2 A;  5I2N B;  3MWB A;  1KWH A;  4QSE A;  1MH4 A;  2I3W A;  4MLQ A;  3M8U A;  3IB2 A;  2NVU B;  4ELO A;  1FQF A;  4GXA A;  2OCU A;  4GFR A;  2OWS A;  1B32 A;  3FD3 A;  4WXJ A;  4O3C A;  1VSO A;  2FNC A;  3K1M A;  2VD2 A;  4HTG A;  1SW5 A;  1VE4 A;  3RTW B;  4ONY A;  3TTN A;  4F31 B;  3B6T A;  1S9T A;  4ZS9 A;  4MF3 A;  5CBS A;  4QF9 A;  1ZBM A;  5I58 B;  3PPQ A;  1HSE A;  1A99 A;  2H99 A;  1IUD A;  5I56 A;  5DYH A;  4ZE9 A;  3U93 A;  3GBA A;  1NH7 A;  1OQH A;  5AA2 A;  2G29 A;  4Q30 B;  4GF8 A;  4X1D A;  2XX8 A;  1LST A;  2DP8 A;  1P99 A;  1SI1 A;  3MAM A;  3QAX A;  2OBG A;  4QFO A;  3T9U A;  3W15 C;  1RYX A;  4TLM B;  4YU0 A;  4NTL A;  2XXU A;  1GVC A;  5DT6 A;  5FTI A;  4GQO A;  5CMK A;  5I2N A;  1SW2 A;  5DVJ A;  4PP0 A;  4EXL A;  4OQO A;  3PU5 A;  1XOC A;  3DP6 A;  4OER A;  1R9L A;  3PUV E;  2O51 A;  1S50 A;  2E1S A;  1N04 A;  2RCB A;  2D21 A;  2P2A A;  2PMS A;  3KGC A;  1DTG A;  2ALU A;  3BFT A;  4GOT A;  4DLD A;  2QS4 A;  3KN8 A;  2ZNU A;  5CMB A;  1AH5 A;  1FQD A;  4F2Q A;  3SKP A;  5I58 A;  4F39 A;  2XXV A;  1B3E A;  2HZL A;  4LAT A;  1H44 A;  3CR9 A;  4ECF A;  3KOT A;  4H65 A;  4YB7 A;  2QJE A;  3ZKK A;  3I6V A;  2PT1 A;  1N0T A;  1PB7 A;  3TCH A;  3M3F A;  4BDO A;  1HSL A;  3O2A A;  1ZIU A;  1UTB A;  3PMV A;  1DMB A;  4FAT A;  1NKX A;  1AMF A;  3S9E A;  1XVX A;  5H8H A;  2XHD A;  3FVN A;  3O66 A;  4KCD A;  4JXI A;  4R9F A;  3VVD A;  3W9V A;  4M1V A;  2QPQ A;  2O68 A;  4GLI A;  3GZG A;  4I8C A;  1LB8 A;  3USD A;  1OVB A;  3P7I A;  4WKM A;  2OWT A;  3PPR A;  4EXK A;  2NOO A;  3OO9 A;  1FTO A;  3V5A A;  3K1P A;  3U92 A;  3VDF A;  2RIN A;  3TTR A;  4OXV A;  5CI5 A;  4QFK A;  4RK2 A;  3K01 A;  1MG1 A;  3BFU A;  3Q26 A;  2XXH A;  2ZYO A;  3TMG A;  1SQY A;  5A5X B;  4K3F A;  2VD3 A;  3G3G A;  3TTM A;  4WEP A;  3OO6 A;  3L6H A;  3DEL B;  5TP9 B;  3RTF B;  3PPO A;  3FVO A;  4ISU A;  1II5 A;  4FE8 A;  5EHM A;  3TYH A;  1TWY A;  3C34 A;  4OET A;  4EQB A;  4FOR A;  2HCA A;  4XTC Q;  4QSC A;  1JVY A;  3FVK A;  3UOR A;  4IO7 A;  5CBR A;  5CC2 A;  2DE3 A;  5TPA A;  1SD3 A;  4OYV A;  4G68 B;  1A55 A;  5H8N B;  3KG2 A;  4EUO A;  3V89 B;  2Y7P A;  2I58 A;  3EHS A;  2NWJ A;  3IB0 A;  3FJG A;  1LLS A;  4BDM A;  3O6G A;  1N76 A;  2DXR A;  2ZYM A;  1I6A A;  1NNP A;  2QL3 A;  3KSX A;  3RT6 B;  4LZ8 A;  3MP8 A;  1FTL A;  2V84 A;  4C0R A;  1OMP A;  3C35 A;  1POT A;  5DTB A;  3C9H A;  1SYH A;  5TU0 A;  3ZSF A;  1B52 A;  1OLC A;  5TP9 A;  2R9J A;  2XX7 A;  2Y7W A;  2P0S A;  4U23 A;  2AL4 A;  3TCF A;  2X7P A;  1F9B A;  3CI8 A;  4NF8 B;  2V25 A;  3RNN A;  3L6G A;  3IAZ A;  1Z7M E;  1A8E A;  2Y7I A;  4YKI A;  4LA9 A;  3K1N A;  1MXY A;  3BBR A;  4PFW A;  2D5W A;  3TEP A;  4G77 A;  2PVU A;  3K4U A;  3SEV A;  3SEU A;  3CVG A;  2B65 A;  1H45 A;  3W9W A;  1B3G A;  4G68 A;  5H8N A;  3UA8 A;  2B3B A;  5KZT A;  4KFQ A;  5JEI A;  3RQT A;  3H7M A;  4RXL A;  2F7C A;  3U94 A;  2O1M A;  1QUI A;  1JW4 A;  2DE4 A;  1B4Z A;  3CRB A;  1Q35 A;  1EH3 A;  1P1U A;  1WDN A;  1DPE A;  1PBP A;  4JWX A;  2RCA A;  4IB2 A;  4OEN A;  2F7A A;  1UIU A;  5HBC A;  2UVI A;  4F3G A;  2PX1 A;  1O7T A;  1QUJ A;  1ZLQ A;  1I6B A;  2H4I A;  3H3G A;  1LAG E;  1B51 A;  2B3F A;  2DWH A;  5EHS A;  4YKK A;  5ISU A;  3K6U A;  2DWJ A;  3K6W A;  3OMB A;  1S7Y A;  3BKI B;  3ODB A;  3GLB A;  1QUK A;  2ABH A;  4NF8 A;  4PFU A;  3QIM A;  4BDQ A;  3DM0 A;  1QW0 A;  1ZKB A;  3B6Q A;  4F3P A;  3LUY A;  1LCT A;  4F29 A;  2XXR A;  1URD A;  4QSD A;  3A3C A;  1SI0 A;  2H25 A;  3TEL A;  1ZTY A;  3IK6 B;  4RJZ A;  4MFI A;  4QHQ A;  3CFL A;  2AIX A;  5HM4 B;  5ITP A;  3N94 A;  1US4 A;  4R75 A;  5FHM A;  3OEN A;  1QVS A;  4HS7 A;  2H9B A;  3RUM A;  4BDR A;  4N13 A;  3FXU A;  2HAV A;  1MH3 A;  1MDP 1;  5AA3 A;  5KDT A;  2VHA A;  1QUL A;  3PV0 E;  3CIJ A;  4GL0 A;  1IQ7 A;  3I5O A;  4GWO A;  1UIV A;  4YMA A;  4ELP A;  3TCG A;  3TOD A;  2DOJ A;  3TQL A;  4XKQ A;  3OEM A;  4ZDM A;  1ATG A;  4DZ1 A;  4OFJ A;  4NWC A;  2V93 A;  1Y3P A;  5I56 B;  2UYF A;  2F5X A;  3OSR A;  1JEU A;  1IXG A;  5AA2 B;  3THI A;  2DWI A;  4F1U A;  3SEY A;  4JB7 A;  3Q25 A;  4GD5 A;  3LSW A;  3OOA A;  3FAS A;  4JSD A;  4ZZE A;  3KJ7 A;  2M8C A;  2DS9 A;  3IR1 A;  5L9M A;  4R2B A;  4JWO A;  1TFA A;  1FW0 A;  4H8I A;  1IEJ A;  4DXC A;  3KJT A;  4PQJ A;  1QJM A;  3KSJ A;  3E13 X;  1FQC A;  4TOZ A;  3VVF A;  1PB9 A;  3MVZ A;  3S9L C;  4R6K A;  2O7I A;  2XD3 A;  4H67 A;  2RC7 A;  4P0G A;  2ESN A;  2DE2 A;  3HHF A;  4LZ5 A;  3HO7 A;  4QFN A;  1MY4 A;  1BLF A;  4ZEI A;  5ITO A;  1MY2 A;  2PT2 A;  3G3J A;  3C36 A;  3H6V A;  5H8S A;  4POW A;  1N7X A;  2THI A;  4OEU A;  3EN3 A;  3FJM A;  4IGT A;  3EHU A;  5H8F A;  5J1D A;  3SDF A;  4OHN A;  1BIY A;  4G68 C;  1YAE A;  4ND9 A;  4FIM A;  4THI A;  1LCF A;  1UTB B;  4QFP A;  3ZKL A;  2H98 A;  3M3L A;  4UAC A;  4F1V A;  3T22 A;  2RC9 A;  2REJ A;  3T9V A;  5H8H B;  4KD5 A;  3ILU B;  3LSF B;  3FXQ A;  2NUV A;  2O6A A;  2Q89 A;  1B5I A;  3MVW A;  4WED A;  4U21 A;  4HCY A;  3SER A;  1POY 1;  2Q8J A;  5AA2 D;  3WAE A;  5F1Q A;  2F8D A;  3MUQ A;  1B2H A;  1B1X A;  4H0W A;  1N84 A;  2KLF A;  1MRP A;  1A8F A;  2Z8D A;  3OSQ A;  2OLB A;  4KQP A;  1M5E A;  3VXC A;  1QKB A;  1AIV A;  4FEB A;  4ELQ A;  2V3U A;  2XXW A;  5L8D A;  4DCX A;  4F22 A;  3SEW A;  4RA1 A;  4R6H A;  3M3K A;  3Q27 A;  4XXU A;  4DCY A;  1B7U A;  3D4G A;  4YMB A;  2QMW A;  3B7D A;  3G3K A;  4C1T A;  1EZO A;  1TT1 A;  1MXW A;  1D4N A;  1MQI A;  2HFB A;  4Z7E A;  3T93 B;  3VV5 A;  3KFM A;  4RK9 A;  1QKA A;  5TPA B;  1CE2 A;  1NFT A;  1OQG A;  3RPW A;  1SVX B;  4NMY A;  3H06 B;  4R74 A;  1N7W A;  1LFG A;  2I48 A;  2H5Y A;  2XXT A;  3MJN A;  1B7H A;  1B05 A;  3K6V A;  2F78 A;  1VR5 A;  1B7Z A;  4X1B A;  3H4Z A;  2D3I A;  1US5 A;  5HPQ A;  1USY E;  4BDL A;  3EF7 A;  4ZZA A;  4PET A;  4MH5 A;  2O69 A;  4O3B A;  3E3K A;  3N6U A;  1A54 A;  1NL5 A;  1FTK A;  4LON B;  3OEK A;  2GHA A;  1M5B A;  3N26 A;  3IJX B;  3O29 A;  2W7Y A;  1SW1 A;  2ZYK A;  3S4U A;  4EQ9 A;  3JZJ A;  3G3I A;  3K00 A;  1URG A;  4IY6 A;  1YPN A;  4RPN A;  1Z7N E;  4KCC A;  4KR5 A;  4NE4 A;  4G4P A;  1B40 A;  5I84 A;  3EQ1 A;  3I3V A;  4I62 A;  1H3D A;  2XXI A;  3PMX A;  3VLV A;  3K02 A;  1LGB C;  1NNF A;  2DXY A;  2G93 A;  4I9D A;  3T66 A;  4BDN A;  1ZU0 A;  2Q2C A;  3CFZ A;  3QSL A;  4F19 A;  1N3W A;  1SYI A;  4OFO A;  3T9X B;  4EF1 A;  3PMW A;  4Q5T A;  4ELR A;  4DDD A;  3QK6 A;  1IIW A;  2Y84 A;  2I4C A;  4XIG Q;  4U1Z A;  4ESW A;  2LAO A;  5BUU A;  2F7B A;  3H6W A;  1M5D A;  4E0W A;  2XXP A;  3IO6 A;  5AE4 A;  3AXF A;  4GXS B;  1O63 A;  4R9G A;  2DVC A;  4M4G A;  2I6E A;  4DXU A;  4NF5 A;  2XXQ A;  5JTY B;  2QS1 A;  1MS7 A;  4F18 A;  3V83 A;  1P1Q A;  3QXM A;  3FJ7 A;  3MZ1 A;  4ZED A;  3DP4 A;  2A5S A;  5BWJ A;  4KYE A;  2A5T B;  1D3K A;  3UP9 A;  3IB1 A;  3VLW A;  4JWY A;  4LVQ A;  4G8N A;  4PE5 B;  4YB5 A;  4YIC A;  2O7U A;  2GH9 A;  3VE1 B;  4HW8 A;  1Y4C A;  1TFD A;  1FQB A;  2Y7R A;  3ECR A;  4AQ4 A;  1DTZ A;  1EZP A;  1B3F A;  3ILT B;  5KDT B;  2Y7K A;  1N3X A;  5FHO A;  2GHB A;  3MQ9 A;  4JDF A;  1B5H A;  3VVE A;  3O28 A;  4LUB A;  3K2D A;  1NNK A;  4H1X A;  3LSL A;  3GXA A;  3B6W A;  2X7Q A;  1CB6 A;  2XX9 A;  3PUX E;  3VXB A;  1DSN A;  2O84 X;  5JTY A;  1JW5 A;  1B1H A;  3FIR A;  4U22 A;  1B4H A;  4GRK A;  2I49 A;  2A5T A;  1LAF E;  4OVJ A;  4NWD A;  1D9V A;  5ELV A;  5IAI A;  2DVZ A;  3DP8 A;  1MXZ A;  5FHN A;  4ZE8 A;  3HST A;  2XXY A;  3D4C A;  3KN3 A;  1JVX A;  3MC2 A;  1R6Z A;  4H5F A;  4I1D A;  1P1N A;  3PD8 A;  1JQF A;  1MY0 A;  4H5G A;  5CM6 A;  1H43 A;  2HZK A;  1Y3N A;  2BJJ X;  4FJP A;  4HCW A;  1P1W A;  3PPN A;  4LP2 B;  2QMX A;  4IO5 A;  1NMU A;  3TTK A;  5M2V A;  3ZS6 A;  3IL1 B;  1Y9U A;  4R72 A;  3H6U A;  1B3L A;  2AL5 A;  1PB8 A;  5H8F B;  3MP1 A;  2ONK E;  1M5F A;  3V8X B;  3HPI A;  3PUY E;  4KYS A;  2Q9T A;  3SET A;  3TQW A;  5KCJ B;  1VFE A;  4DXB A;  4E0X A;  4U1O A;  1GV8 A;  1B3H A;  3MVX A;  1GR2 A;  3GBB A;  1NH8 A;  1JNF A;  1JET A;  2ONS A;  1ELJ A;  2UXA A;  4GIZ A;  2QS2 A;  3K0V A;  3MBP A;  3PPP A;  4EDP A;  1IXC A;  3KZG A;  4KHZ E;  3FV2 A;  4KI0 E;  4RNS A;  1MM6 A;  1FTM A;  1Q1K A;  4L17 A;  2F34 A;  2P1S A;  4DIG A;  3T9H B;  2XD2 A;  4N6P A;  1XC1 A;  3RY3 A;  3TFL A;  3O9P A;  1AL3 A;  3VLU A;  1BP5 A;  3JYR A;  4LZ7 A;  1Y1Z A;  2F6P A;  4JBZ A;  1SDX A;  5B70 A;  3Q29 A;  4G2Z A;  1DPP A;  1PDA A;  1B46 A;  5I59 A;  3E4R A;  4XKN A;  3KOS A;  1ZJL A;  3F11 A;  4X48 A;  4NF6 B;  4LQ5 A;  3SEX A;  4F2O A;  5KCJ A;  3G3H A;  1IXH A;  4IY5 A;  3FXR A;  2Z22 A;  2UVH A;  1MQD A;  3QYT A;  5CMC A;  1MQJ A;  2ONR A;  5I57 A;  2UVJ A;  3G7W A;  4H6D A;  5AA4 B;  4U4X A;  4YB6 A;  3MPL A;  3MW0 A;  3OO8 A;  1HSJ A;  2DSF A;  1IXI A;  1UTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...