5IAIA

Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
399
structure length
399
Chain Sequence
KPLDGVTLTLASQNDPFGAVLTKLAAEFKQDTGADLKVEVMDYGTLLTKTTADFVGKTKGYDLVTMDIVWAGAYQANGYSVDLTDWVKRDAAELDLDDIYPVILQSLGQYKGHYVAFPFAAYANVLAYRKDLFQAAGLPVPTTVEELVSDAKKLTDPSKKQYGFVANGQKGPAVAQDWMQYNNQMGGSILDNDGKPALNSPENVKSLTVYKQLFVETAPPGAIEYDWGGREESFRQGAAAMMQTWSVGAPGYSDPASSNVVGKVGITTAPVGKGVPPQYGVGGWGMAINADIDPKQKEAAWTFIKWLVSKKIHKEFNMDGAGSFMRKSQMTDPDLTAKFDFLPVVAKTYENGNGEYRPRIPEYPEIQDILGSAVNSVLAGAAEPQAALDEAQVEAKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ABC transporter Solute Binding Protein Arad_9887 from Agrobacterium radiobacter K84, target EFI-510945 in complex with Ribitol
rcsb
source organism Agrobacterium radiobacter
molecule tags Solute-binding protein
molecule keywords Sugar ABC transporter
total genus 142
structure length 399
sequence length 399
ec nomenclature
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5iaiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5iaiA02
4ESWA 1N7WA 5ITPA 1ZIUA 4QFNA 2G29A 3GZGA 2Q88A 2X7PA 4NF5A 1MPDA 4N13A 1Z7NE 4OENA 2ZNUA 4U22A 5H8HB 3EHUA 5CMKA 1N0TA 1IITA 3MVYA 5I58A 1DPEA 1FCKA 1MM7A 3CFLA 1HSJA 3IL1B 5DVFA 4DE8A 1Y4CA 4EF2A 3HN0A 1MXYA 3I6VA 2Z8FA 1B3GA 1I6AA 3BBRA 4GFRA 4GF8A 2XD2A 3CR9A 2AYSA 1B0LA 4IO6A 2HCAA 3ECRA 2ALUA 3EPEA 3KN7A 4O3AA 2IA4A 4RK9A 5EHSA 3N5LA 3U1OA 1PB7A 2H5YA 3E3KA 2R6GE 4FAJA 3K00A 1Y1ZA 1POY1 1Y3QA 2A5TA 3OOAA 1PB8A 4KD5A 4QSDA 4OESA 3OO6A 3WAFA 3CVGA 5K2XA 4WEPA 3E4RA 3HO7A 2Y7WA 2ONRA 4ZE9A 5AA2B 3RNNA 1OVBA 4R9GA 3KZGA 3DELB 4F3BA 1Y4TA 4TLLB 4U23A 1TT1A 4AB6A 5I58B 1JVYA 5KDTA 1PC3A 1YAEA 4ISUA 1LCTA 2ZXTA 3E9XA 3K1PA 4GL0A 1MXUA 4OEUA 5A5XB 1LAHE 1MXWA 4QFKA 1FTKA 1FQBA 1B0HA 2ZNTA 4JB7A 2XXIA 1FQFA 4G2ZA 4KQPA 2DE2A 2Q8JA 4H6DA 4OZ9A 2DE4A 1FQAA 1B7ZA 2Q89A 1JQFA 4IO7A 4FEDA 5I57B 3DM0A 4R75A 4RPNA 1OLCA 4XKNA 4G68B 1LBBA 1N3XA 3OELA 4GVOA 1GGGA 2E0SA 2XXYA 3CFXA 1B3LA 2XHDA 5L8DA 3SEUA 4DLDA 1A8EA 3IORA 4RA1A 3RTFB 4H5FA 4NF8B 1LFIA 1N84A 3VLUA 3PGFA 3D4CA 3MVZA 3PUWE 5IKBA 2QMXA 5AA1A 5JEIA 2HAVA 1AH5A 3G3FA 1UTHA 3IO4A 4RK2A 2YLNA 3EQ1A 4RYAA 4DCXA 1M5DA 1LSTA 4LATA 3RT8A 2NXOA 2DOJA 5KCJB 2OJTA 4KI0E 4NEDA 5TU0A 5I59A 1LAGE 3MVXA 1ATGA 4G8NA 3TTKA 2DP8A 2YPNA 5DVJA 4LZ8A 5DTBA 2R9JA 3IX1A 1II5A 4FIMA 4QFPA 1M5CA 1QULA 3MVWA 1YPNA 1MY0A 3HCQA 3LUYA 2F36A 1P1QA 4XXUA 1I6QA 3KSJA 3PV0E 1MY1A 2PBWA 2QS4A 4YZZA 2O68A 2RC7A 3O2AA 4NF6A 1R9LA 2DWJA 2F7BA 1Y3PA 2Q2CA 1TFDA 3G3GA 3JYRA 3PMWA 3HSTA 2DS9A 3G3KA 1P1OA 3PUZE 1B1HA 1LAFE 4R9FA 5TPAB 2FA7A 3RT6B 1AMFA 4DXUA 4ELPA 4DZ1A 1YCJA 4N6PA 3PUVE 3C34A 1MY3A 3MWBA 1VFDA 3TELA 4F1VA 4H5GA 4U21A 4F19A 3I3VA 4IO3A 4F2QA 1NH8A 5H8SA 4ZZEA 4XKRA 3TCHA 2O84X 4EQ7A 5I2KA 4FATA 1MY4A 2B65A 4YB5A 4G8HA 2F78A 3QYTA 4YICA 4NF8A 5HPQA 2ZYOA 1SYIA 2QS2A 3MZBA 1UTBB 1BP5A 3VLVA 2PT1A 3VFJA 4JSOA 4YMBA 1LFHA 3PU5A 4RPOA 3OMBA 4GOTA 5ISUA 1ZJLA 4NMYA 4H8IA 4PFUA 4HCYA 2GH9A 1JW1A 1UIVA 2RKMA 1B46A 2XXUA 3N6TA 2XXQA 4RJZA 4F18A 4GXSB 2HZLA 1OIBA 1PBPA 2WKYA 1NNKA 3G3JA 3ILUB 3KG2A 5B70A 3CIJA 3TODA 3A3CA 2FNCA 2ONSA 3A09A 2QPQA 3TPAA 3S9EA 2F7CA 3FXQA 1UQWA 3MJNA 4NWCA 1H43A 2ZYMA 4IGTA 4YKIA 2DVZA 4QSEA 2M8CA 3MUQA 3PPRA 4EXLA 3V83A 3U93A 2XXXA 3K6VA 3VDFA 1AOVA 3N26A 5IAIA 2LAOA 2YJPA 2NUVA 5KCJA 2CMOA 4OMBA 2NWJA 1MM6A 1GV8A 2ZYKA 3FIRA 1D9VA 3H03A 3KN3A 4C1UA 3PD9A 4QF9A 3OEKA 5CM6A 1QVSA 1XC1A 3DP6A 3N6UA 2HFBA 3P7IA 3C31A 4ZEIA 5I84A 1EZOA 4GWOA 3FVGA 4IY6A 4P11A 2DE3A 1QJMA 3DP8A 2F35A 3QSLA 4F3SA 1SD3A 3F11A 2Y84A 3QUJA 5TPAA 3O29A 1B4HA 2V3UA 4ND9A 3PMXA 2VGQA 3A3UA 2UVHA 4EQBA 3FV2A 3GLBA 2O51A 3QIMA 3SETA 3MP6A 3TZAA 3OD7A 2Y7RA 3G3IA 2Z22A 1XT8A 4XKPA 4DCYA 4ELOA 4R6YA 4MLQA 4R6HA 1AIVA 1ZU0A 1IZ1A 1VFEA 2RC9A 3U92A 1CB6A 3EHSA 1KWHA 4Q0CA 3VE1B 1PB9A 3W9VA 1IXCA 5CBRA 4OERA 4GD5A 5AA3A 2QS1A 3TDJA 3FXRA 1LBCA 3RLFE 3ODBA 3SERA 4C0RA 1WVJA 1Z7ME 3M8UA 4JWOA 1A8FA 2F34A 1BLFA 2P0SA 3IB2A 3ILTB 1M5EA 1NNFA 3IOTA 1S7YA 3LBSA 4LZ5A 4QHQA 1MXXA 1CE2A 2D21A 1H45A 3DP4A 2RCBA 1B5IA 1OQHA 4L17A 4JWXA 3ZSFA 5DT6A 1BTJA 1IXGA 3LC8A 4KYSA 4TOZA 2HZKA 1TWYA 4EQ9A 1MS7A 1QKBA 1ANFA 3Q25A 3K6WA 4ESXA 4P0GA 3K01A 1ZKBA 4NF4A 5EHMA 5TP9A 4F31B 5FHOA 1NKXA 2DVCA 4POXA 3OO7A 2OWSA 4ZEFA 1MRPA 2ZNSA 4R6KA 1B40A 5H8HA 1SI1A 1Y20A 1T0KA 2O6AA 4KYEA 5JK4A 4PFWA 5ITOA 1A40A 5EYFA 2V84A 3S9LC 2OWTA 4PFTA 2I3WA 3ZKLA 2REJA 1B51A 1B05A 3TKDA 4DXBA 1O64A 3LSXA 5ICQA 1RYXA 4BDLA 4U1OA 3TTLA 3Q28A 3USDA 3IJOB 4H67A 1MQDA 4OFLA 3QUFA 1WDNA 2ONKE 2PVUA 4R74A 2DXRA 1NFTA 3H06B 1R6ZA 2I48A 3FJ7A 4JBZA 1ZBMA 3FVNA 4Z0IA 3T66A 3T9UA 1B3FA 2F6PA 3C36A 3FZVA 3K1MA 5I56A 1B1XA 1MH3A 1A55A 4O3BA 2NOOA 1URSA 1Q35A 2ANJA 1SQYA 1LCFA 2XX8A 4OVJA 3FUZA 2F97A 3RTWB 2DWAA 2OLBA 2XXHA 4H65A 2A5SA 4OXVA 2XXWA 3SEWA 3ZS6A 2PMSA 3LSWA 5CBSA 2QMWA 5I2NB 2DQVA 3KOTA 4R2BA 4H1XA 2HQ0A 3H4ZA 4YKKA 1B6HA 2P1SA 2V3QA 4GQOA 1A99A 1FQEA 3PMVA 2QL3A 1Y3NA 3H6TA 3TTMA 3EF7A 1PDAA 4F2OA 1YTVA 4ZEDA 4O3CA 3KGCA 3BFUA 1US5A 1GTKA 3MBPA 4YMAA 1FTLA 3SDFA 1MPCA 1P1UA 4Z7EA 4LQ2A 2H98A 2UVIA 1IUDA 4HS7A 3OEMA 1B4ZA 1Q1KA 3KBRA 3RUMA 1NNPA 2A5TB 3FVOA 2RC8A 5H8NA 4ZEBA 1D3KA 1DPPA 4LZ7A 1B2HA 5DVIA 1NL5A 1B7HA 3HHFA 4U1ZA 5BWJA 2BJJX 1OQGA 2XXVA 1FQDA 3M3LA 4RXLA 2I0BA 2ZMBA 3O28A 2O7UA 4M4GA 5CI5A 3TMGA 4G77A 1QUIA 2REGA 2XX7A 4MF3A 1UIUA 2P2AA 4OFOA 1XS5A 4PFYA 1B3HA 2THIA 5H8QA 5JTYB 3MPLA 3AXFA 5M2VA 3FJMA 1SW4A 3K0VA 4H0WA 2VOZA 4E0XA 4NF4B 5I56B 1H44A 1SI0A 4ELRA 5I57A 3BKIB 3V89B 4DXCA 1IQ7A 2I4CA 3HV1A 1HSEA 1ZLQA 3LSFB 2V3TA 1M5FA 3T9VA 3IB0A 5H8FB 1FQCA 3H6WA 3E13X 1GVCA 3S9MC 3CSBA 2VD2A 2X26A 4AQ4A 2PYYA 2QS3A 3UN6A 5CC2A 4WKMA 3KN8A 1I69A 1MQJA 4HCWA 4IGRA 4I1DA 2OK2A 2IEEA 2D3IA 2GRVA 4I62A 3O97A 4OQOA 3CI8A 4WXJA 1EU8A 3Q29A 2O1LA 2I4BA 3R6UA 3IO6A 2W7YA 3OO9A 3PUYE 1JW5A 3U72A 1XVXA 1P99A 3VXBA 2I3VA 3Q27A 4NWDA 2XXRA 3H7MA 4MLVA 1Y9UA 3L6HA 5F7VA 4AB5A 1R9QA 2H25A 1IIWA 4BDOA 1MG1A 5J1DA 4NTLA 4OETA 5CRYA 3RY3A 2AL5A 2QRYA 3B6TA 3K4UA 2O69A 3TYHA 2RCAA 3K6XA 3SEXA 1SVXB 3H3GA 2F6GA 3MC2A 4BDRA 4JWYA 3FASA 4KHZE 5ELVA 3THIA 3VLWA 3QAXA 5CMBA 5DEXA 3S4UA 3CRBA 3EN3A 3RPWA 2B3FA 1USYH 1NMUA 4TQUQ 1NH7A 3VXCA 2VHAA 5BUUA 3KJTA 4JSDA 1RYOA 4FORA 1JNFA 1VE4A 1VSOA 4PQJA 5FTHA 2Z23A 1J1NA 1I6BA 1D4NA 2DSFA 3BFTA 4IO4A 4XIGQ 5I2NA 3G3HA 4R2FA 1UTBA 2UYEA 4X1BA 4YKJA 1B52A 1JEVA 3K6UA 4DDDA 1EZPA 1MQGA 3B6QA 3C33A 1HSLA 1MPBA 5L9OA 3EHTA 2UVGA 1XVYA 4IB2A 4NE4A 4QSCA 5F1QA 1S50A 2FYIA 2QJEA 5HBCA 4OTEA 3SEVA 3TCFA 4PETA 3U8QA 2F7AA 3TFLA 3OENA 3B7DA 3ONMA 1JW4A 4KCDA 4X9TA 4YU0A 4EUOA 4NF5B 3V5AA 3MP8A 3TQLA 1BIYA 1M5BA 3K02A 4U2RA 3C4MA 3R7XA 4GRKA 1MQHA 3LR1A 1NNTA 1TFAA 4KCCA 3T96B 4ZECA 4FJPA 3TCGA 3C35A 1A7LA 2OBGA 2H9BA 3O9PA 5FHNA 2NVUB 5KZTA 3O6GA 3UIFA 2X7QA 2I49A 3QK6A 3VVEA 1ZTYA 4ZE8A 2H4IA 5AA4A 2UXAA 4MFIA 3TAJA 1PEBA 2DWHA 1FTMA 3FGSA 3FXUA 3H6VA 3IB1A 1QW0A 3G7WA 3PPNA 5TP9B 4F22A 2ABHA 2G93A 4EXKA 5L9SA 1GR2A 1POTA 2Y7PA 3HHGA 3FJGA 4H8JA 3K2DA 1RKMA 4GL8A 3WAEA 2XXPA 3RN8A 3FV1A 4QRZA 4POWA 5CMMA 1DMBA 5AA2D 2O1MA 3IOVA 2CZLA 3TUSA 2DXYA 1FTOA 3JZJA 2O7IA 1JETA 2OCUA 3ZKKA 4F39A 1Y1MA 3B6WA 4ECFA 1S9TA 1IEJA 3TQWA 1FTJA 4N07A 4OWDA 3UP9A 5I2KB 1MXVA 1LAXA 1FW0A 4Q5TA 1QUJA 2ZYNA 3MAMA 4I8CA 4OYVA 3M3FA 3O6HA 1B58A 4XTCQ 4HTGA 3IJXB 3GXAA 4THIA 5AE4A 1H3DA 2HAUA 3FVKA 3O6IA 5DYHA 4EDPA 3I5OA 4WEDA 3V8XB 4KYDA 1B5JA 3TEPA 5B7DA 5LOMA 2DYXA 4LP2B 4F29A 3GBAA 5ICTA 1B9JA 2RF1A 1SBPA 2Z8DA 4LQ5A 1LFGA 2UYFA 4IO2A 3M3KA 1N3WA 1MQIA 4KFQA 4YAHX 4BDMA 3MZ9A 4G4PA 3H6UA 4UACA 1DTGA 1USYE 2R71A 3HPIA 1VR5A 1XOCA 4F1UA 3RQTA 2Q9TA 1B5HA 3DLNA 3MW0A 4MBPA 4G8MA 2XD3A 3JV9A 1LB9A 4F1YA 4YB6A 5HM4B 3IAZA 3LSLA 4IO5A 4I9DA 3W15C 1MXZA 2F5XA 3CFZA 3Q26A 1LGBC 3UA8A 2DWIA 3SKPA 2PT2A 3VVFA 3CSGA 3VV5A 4FEBA 5K2YA 2OZZA 3L6GA 2AL4A 3S9NC 4HW8A 1F9BA 4LONB 1B3EA 1US4A 3MQ9A 3OXNA 4ZZAA 1URGA 2VP1A 4LVQA 3OO8A 2Y7IA 4QFLA 5DEXB 5H8FA 1MY2A 4G68A 4LUBA 4OEVA 5FHMA 2E1SA 1OVTA 1JVXA 3OSQA 4Q30B 4ZEKA 4NF6B 1IXHA 3IK6B 4BLAA 1D9YA 2UVJA 5L9MA 4F3PA 4Q8RA 3GBBA 3PPOA 4P0IA 4UA8A 4X48A 4TLMB 1O7TA 4X1DA 3SEYA 5AA2A 4M1VA 1EZ9A 4F3GA 5H8QB 3RGYA 1UTHB 3KJ7A 3CG3A 4U4XA 2F8DA 2B3BA 2V25A 5H8NB 1WODA 2RINA 3K1NA 3N94A 2KLFA 1B7UA 1BKAA 4GXAA 4U4SA 2I0CA 4ZDMA 2Y7KA 4G68C 2AIXA 4JXIA 4GIZA 3FD3A 1DSNA 3QXMA 3U94A 3D4GA 3UORA 3T93B 1DTZA 1H76A 3FATA 3PUXE 4MH5A 1B32A 5KDTB 1N7XA 4QFOA 3IOUA 4ONYA 4FECA 4R73A 1LB8A 2D5WA 2HXWA 3IOWA 1IXIA 1ZMGA 3MZ1A 3UK4A 3MPKA 4RY1A 4E0WA 3O66A 3VVDA 4BDQA 5A5XA 3MP1A 4ELQA 1MDP1 3UGWA 3T22A 1EH3A 1MDQA 5CMCA 1SW5A 4KR5A 4PP0A 1N76A 4YB7A 4JDFA 3KOSA 1URDA 2XXTA 1SW2A 2Q2AA 3C32A 5JTYA 4C1TA 3KSXA 1N04A 3PD8A 4XKQA 3OSRA 1L5TA 4PE5B 2GHBA 1SDXA 4OFJA 4EF1A 3R26A 3PPPA 1MH4A 3TTRA 1PBQA 2I6EA 4IY5A 1QUKA 1XHYA 1SYHA 2I58A 2XX9A 3CG1A 3IR1A 5FTIA 3S2VA 3C9HA 5I59B 2Z8EA 4BDNA 1ELJA 2HEUA 1JEUA 2H99A 3W9WA 1P1WA 4ZS9A 4RNSA 2V93A 1QKAA 3KFMA 3TTNA 2ESNA 2QSXA 5AA4B 4OHNA 4YKPA 1SW1A 2PX1A 4GLIA 1O63A 3T9HB 1TXFA 3PPQA 1R1NA 2GFEA 2GHAA 3KEIA 4K3FA 1AL3A 1P1NA 4KPTA 3SESA 4DIGA 1DOTA 1A54A 4R72A 4LA9A 4FE8A 3T9XB 2VD3A 1OMPA 1LLSA 1OLAA
chains in the Genus database with same CATH superfamily
1ZIUA 4X04A 5T3JA 4QFNA 1MPDA 5H8HB 4U22A 1N0TA 1Y4CA 1I6AA 4IO6A 2HCAA 4O3AA 3N5LA 3U1OA 1PB7A 2R6GE 1Y1ZA 1POY1 3OOAA 2Y7WA 4ZE9A 4R9GA 3KZGA 1Y4TA 4U23A 1JVYA 2ZXTA 3E9XA 5A5XB 1B0HA 4G2ZA 4KQPA 2DE2A 2Q8JA 4OZ9A 1JQFA 4FEDA 3DM0A 1OLCA 4XKNA 3OELA 2XXYA 5L8DA 3EKIA 3SEUA 4DLDA 1A8EA 4NF8B 1N84A 3PGFA 3D4CA 2QMXA 5AA1A 1AH5A 3IO4A 4DCXA 1M5DA 1LSTA 4LATA 2OJTA 4KI0E 4NEDA 4G8NA 4N15A 5DTBA 2L5VA 1II5A 3LUYA 2F36A 1IMAA 4XXUA 3PV0E 2PBWA 4OVPA 4NF6A 2Q2CA 2F7BA 3JYRA 2DS9A 3RT6B 1AMFA 4DZ1A 3TELA 4IO3A 4GWUA 4YB5A 5EQ9A 1CNQA 2F78A 4NF8A 2QS2A 3MZBA 1UTBB 4YMBA 4RPOA 5ISUA 5ESYA 1JW1A 1B46A 4RJZA 1FBCA 5I56A 3S9MC 3S9EA 3CIJA 2ONSA 2F7CA 1UQWA 1H43A 4OA4A 1AOVA 2YJPA 4OMBA 4C1UA 5CM6A 2HFBA 4IY6A 3DP8A 3QSLA 2Y84A 3QUJA 3O29A 4ND9A 3TZAA 3OD7A 2Z22A 4ELOA 4MLQA 2Q74A 1CB6A 1KWHA 1IXCA 5AA3A 3FXRA 3RLFE 3ODBA 4C0RA 1NUYA 4JWOA 1Z7ME 1A8FA 2F34A 1M5EA 1S7YA 1CE2A 4JWXA 4KYSA 2HZKA 1ANFA 4P0GA 4PC9A 2DVCA 4POXA 1MRPA 1Y20A 1T0KA 2O6AA 2XWOA 1A40A 2V84A 4PFTA 3ZKLA 4BDLA 3TTLA 3Q28A 4NN3A 3USDA 1NFTA 3H06B 1B3FA 1A55A 1SQYA 3RTWB 4H65A 4GBWA 4OXVA 4PFRA 2QMWA 4H1XA 3H4ZA 4YKKA 2P1SA 3EF7A 4ZEDA 1FTLA 1NI9A 4NHBA 4OVSA 2A5TB 1DPPA 4LZ7A 1B2HA 4GWSA 1OQGA 1FQDA 4G77A 2REGA 1KZ8A 4MF3A 4OFOA 5H8QA 4H0WA 2V4CA 4NF4B 1HSEA 2P3NA 1M5FA 3T9VA 3IB0A 4AQ4A 3CI8A 1DBZA 3U72A 4UABA 3H7MA 1IIWA 1MG1A 2MKZA 4OETA 5CRYA 4H45A 3SEXA 4BDRA 3MC2A 5IZ3A 3THIA 3QAXA 3EN3A 3KJTA 1JNFA 1VSOA 5FTHA 4PCDA 1UTBA 1B52A 3B6QA 3C33A 4GWXA 1XVYA 5IGAA 4OTEA 4PETA 3U8QA 2F7AA 3OENA 1LBVA 1BIYA 1M5BA 3C4MA 3R7XA 3LR1A 4KCCA 1TFAA 3C35A 2H9BA 5FHNA 2X7QA 2I49A 4ZE8A 2H4IA 5AA4A 1PEBA 3H6VA 3G7WA 1POTA 3HHGA 4H8JA 3WAEA 5CMMA 4QRZA 3TUSA 2DXYA 2O7IA 3ZKKA 1S9TA 3TQWA 5I2KB 4I8CA 3M3FA 3IJXB 3GXAA 1H3DA 5EQ7A 4EDPA 5LDZA 3MSTA 5LOMA 2DYXA 1RDZA 2RF1A 2Z8DA 4LQ5A 3M3KA 4BDMA 4G4PA 1K9YA 3MYUA 2R71A 4MNPA 4F1UA 1VR5A 3RQTA 1NUWA 3JV9A 3W15C 1MXZA 2CZKA 2F5XA 1LGBC 3CSGA 4FEBA 3S9NC 2HPGA 1B3EA 1DCUA 3OO8A 5H8FA 1JVXA 4BLAA 2UVJA 5L9MA 1BK4A 4F3PA 4X48A 4X1DA 4TLMB 1O7TA 4M1VA 2B3BA 3K1NA 1IMDA 2KLFA 1BKAA 4ZDMA 2I0CA 2Y7KA 3FD3A 1DSNA 3QXMA 4HE2A 3UORA 1DTZA 4DI3D 3MZ1A 4E0WA 3O66A 5A5XA 1EH3A 5CMCA 4KR5A 1IMFA 4JDFA 1FBDA 1URDA 1SW2A 5JTYA 3PD8A 1N04A 2P3VA 1EYIA 3R26A 5FTIA 5I59B 5EYHA 1JEUA 1P1WA 4RNSA 1SPIA 2ESNA 2OX3A 2PX1A 4GLIA 3PPQA 1R1NA 3SESA 3T9XB 1LLSA 1JP4A 3GZGA 4N91A 2Q88A 4N13A 1Z7NE 1EYKA 3EHUA 4PE3A 1IITA 5KDTB 1MM7A 3I6VA 1B3GA 4GFRA 3CR9A 1B0LA 3KN7A 2ALUA 2IA4A 3K00A 4QSDA 1PB8A 3OO6A 3E4RA 1LEVA 2WBDA 5AA2B 3DELB 4F3BA 5I58B 1PC3A 3K1PA 4MMPA 4QFKA 1FTKA 1FQBA 2ZZVA 1FQFA 2DE4A 4RPNA 4G68B 4OVQA 2XHDA 5ET7A 4NAPA 2CEXA 4AS5A 5KCJB 2DOJA 2F3DA 1LAGE 4PBQA 2DP8A 4LZ8A 3IX1A 4QFPA 1G0IA 1QULA 1YPNA 3HCQA 4AB6A 1FTAA 4YZZA 2O68A 1LBYA 3PMWA 1TFDA 4DXUA 1YZ0A 4ELPA 1YCJA 4N6PA 4F1VA 4U21A 2Y5LA 5H8SA 3TCHA 2O84X 4EQ7A 4FATA 1MY4A 5HPQA 2ZYOA 1SYIA 4I40A 4JSOA 4PFUA 2GH9A 1UIVA 2RKMA 2XXUA 4GXSB 3G3JA 1YXIA 3A09A 3TPAA 3FXQA 4NF0A 2WYKA 4QSEA 3V83A 4AS4A 3U93A 2XXXA 3K6VA 5KCJA 1MM6A 1D9VA 1QVSA 1XC1A 3DP6A 3N6UA 4ZEIA 3C31A 1EZOA 2CZHA 1QJMA 2F35A 1LBXA 4F3SA 3BIGA 2B4MA 4HE0A 2VGQA 3A3UA 3GLBA 3G3IA 1AIVA 1VFEA 4Q0CA 3VE1B 1PB9A 4OERA 2QS1A 3TDJA 3HFUA 1BLFA 1NNFA 4QHQA 1MXXA 3KC0A 2D21A 1H45A 2RCBA 1OQHA 3ZSFA 1BTJA 1IXGA 4TOZA 4GX4A 4EQ9A 1MS7A 3Q25A 4F31B 1NKXA 1FPGA 4KYEA 5JK4A 5EYFA 3S9LC 2OWTA 4NGUA 4FBPA 1O64A 3LSXA 5ICQA 4U1OA 4H67A 4OFLA 1MQDA 1K9ZA 1WDNA 2PVUA 4R74A 4JBZA 4Z0IA 2I48A 3C36A 3K1MA 1MH3A 1URSA 2FHYA 2ANJA 2XX8A 2Q8MA 2XXHA 2XXWA 4PFBA 2PMSA 5CBSA 2DQVA 2HQ0A 1B6HA 4GQOA 1FQEA 3H6TA 3TTMA 4PAKA 3KGCA 4P1EA 1NV2A 4YMAA 1Q1KA 3KBRA 4MHFA 3FVOA 5H8NA 5DVIA 2BJJX 2I0BA 4PFIA 5EQ8A 5CI5A 3TMGA 1QUIA 1UIUA 2P2AA 4PFYA 3MPLA 3K0VA 4E0XA 2FIEA 4ELRA 3BKIB 3NOHA 1IQ7A 2I4CA 3LSFB 2Y5KA 5H8FB 4N8YA 3UN6A 1MQJA 4HCWA 4IGRA 4I1DA 2WX9A 3R6UA 3IO6A 2W7YA 1JW5A 1XVXA 3VXBA 4NWDA 5F7VA 4I3YA 4NTLA 3RY3A 1VDWA 3B6TA 3TYHA 2RCAA 1FJ9A 1SVXB 3H3GA 5ELVA 4NG7A 5CMBA 5DEXA 3S4UA 3CRBA 3RPWA 1NMUA 4TQUQ 1NH7A 1VE4A 5I2NA 4IO4A 1D4NA 4XIGQ 3G3HA 2CZIA 4YKJA 4DDDA 5L9OA 2UVGA 4IB2A 4NE4A 4QSCA 5F1QA 1S50A 2FYIA 1FPFA 4X9TA 4OVRA 4YU0A 4NF5B 2PFZA 4FJPA 3TCGA 2OBGA 3O6GA 3VVEA 2DWHA 1FTMA 3IB1A 5TP9B 2G93A 3RPLA 3FJGA 4PAFA 2ZZXA 4GWZA 4ECFA 4OWDA 4QBAA 1MXVA 1LAXA 1FW0A 4Q5TA 1QUJA 2HAUA 3O6IA 3I5OA 1B5JA 5ET5A 1SBPA 1LFGA 1DTGA 1USYE 1LB9A 4YB6A 4I9DA 3CFZA 2DWIA 1XI6A 5K2YA 4ZZAA 4GWWA 1US4A 3MQ9A 3OXNA 1NV3A 4OEVA 4Q30B 4NF6B 1IXHA 3IK6B 1D9YA 3SEYA 5AA2A 5H8QB 1UTHB 3KJ7A 4MIJA 4U4SA 4G68C 4MNCA 3T93B 1N7XA 4ONYA 4FECA 4OANA 4RY1A 4BDQA 4MEVA 1MDP1 3UGWA 3KOSA 2Q2AA 3C32A 4C1TA 3KSXA 1L5TA 4PE5B 2GHBA 1SDXA 5EYGA 4OFJA 4PGNA 1RDYA 1PBQA 1XHYA 1SYHA 3S2VA 2Z8EA 1ELJA 2V93A 2XXKA 4YKPA 1O63A 3T9HB 1TXFA 3KEIA 4DIGA 1DOTA 1A54A 4LA9A 1OMPA 4YB7A 1INPA 2G29A 2X7PA 4NF5A 4OENA 2ZNUA 3MVYA 1DPEA 1FCKA 1QGXA 3IL1B 4DE8A 1MXYA 3LV0A 2AYSA 3ECRA 3EPEA 5EHSA 2H5YA 3E3KA 3KC1A 4GX6A 1Y3QA 2A5TA 4KD5A 3CVGA 4P56A 3HO7A 3RNNA 1IMBA 4TLLB 1TT1A 4ISUA 1LCTA 4P3LA 4OEUA 4G61A 1LAHE 1FBEA 1MXWA 2ZNTA 2XXIA 3TFLA 1FQAA 1B7ZA 2Q89A 4IO7A 4R75A 1LBBA 2E0SA 1NV7A 3CFXA 3IORA 4H5FA 1LFIA 5JEIA 1NV4A 4JVDA 4GWYA 4RK2A 4QXDA 2YLNA 3EQ1A 1LBWA 2FIXA 4PGPA 2R9JA 2KQZA 1P1QA 1MY1A 2QS4A 2RC7A 3O2AA 3HSTA 3G3KA 3PUZE 5TPAB 4R9FA 3C34A 1VFDA 1NH8A 4ZZEA 4YICA 1NV5A 1BP5A 4O7IA 2PT1A 1LFHA 3OMBA 1ZJLA 4H8IA 4HCYA 4X8RA 2XXQA 1NV6A 2HZLA 1OIBA 5B70A 1NNKA 3TODA 3A3CA 2QPQA 4P47A 4NWCA 2DVZA 4EXLA 2M8CA 5F24A 2CMOA 1GV8A 2ZYKA 3H03A 1IMCA 4GWOA 3FVGA 4P11A 2DE3A 1SD3A 3F11A 5TPAA 2V3UA 1FPBA 3PMXA 5J16A 4XF5A 2UVHA 4EQBA 3FV2A 2VT5A 3QIMA 3MP6A 1FRPA 4XKPA 4DCYA 4R6YA 4R6HA 1ZU0A 1IZ1A 2RC9A 3W9VA 5CBRA 1LBCA 3QMFA 3SERA 3IOTA 3IB2A 3LBSA 5I7IA 1B5IA 5DT6A 1TWYA 3K01A 1ZKBA 4NF4A 5EHMA 5TP9A 2OWSA 4ZEFA 4R6KA 2WBBA 1B40A 5H8HA 1SI1A 2WEFA 1B05A 3IJOB 3QUFA 1FJ6A 1R6ZA 3T66A 3FJ7A 2KR0A 1ZBMA 4JVCA 3FZVA 1B1XA 3T0JA 2F97A 2DWAA 2OLBA 2A5SA 3LSWA 5I2NB 3KOTA 1A99A 2QL3A 5I3SA 1YTVA 1US5A 3SDFA 1MPCA 1P1UA 4Z7EA 2UVIA 1IUDA 4I3EA 1NV1A 4IR8A 4N4UA 3RUMA 2RC8A 4ZEBA 1RDXA 1B7HA 4U1ZA 5BWJA 2WYPA 3O28A 2O7UA 4M4GA 2XX7A 4XEQA 1B3HA 3FJMA 5I56B 1H44A 1SI0A 5I57A 4XFEA 2V3TA 1KA1A 3H6WA 3CSBA 1KA0A 2VD2A 2X26A 2PYYA 3BIHA 2QS3A 4WKMA 2IEEA 2GRVA 4I62A 4WXJA 3Q29A 3U65A 3OO9A 1P99A 2I3VA 4MLVA 2QVVA 4JVIA 3RPLB 3T1BA 3GYYA 2AL5A 3LUZA 2O69A 4KXPA 3VLWA 2B3FA 1USYH 2VHAA 4JSDA 1J1NA 3BFTA 2DSFA 5IM2A 3K6UA 3ROJA 1EZPA 1HSLA 3EHTA 2QJEA 4O7MA 1IMEA 3B7DA 4KCDA 2QVRA 5A5LA 1D9QA 3K02A 3T96B 1NNTA 4ZECA 5KZTA 3UIFA 3QK6A 4PF6A 4DI4B 4MFIA 3TAJA 3FXUA 3PPNA 1QW0A 2ABHA 1GR2A 2F3BA 3K2DA 1RKMA 4GL8A 2XXPA 3RN8A 3FV1A 4POWA 4N17A 1DMBA 2O1MA 3IOVA 1NUZA 2CZLA 1FTOA 2R8TA 3JZJA 1JETA 3B6WA 1FTJA 4N07A 3RYDA 2OWZA 4O94A 3B8BA 4XTCQ 4THIA 5AE4A 5DYHA 4WEDA 3V8XB 4F29A 1B9JA 4KFQA 4YAHX 1MQIA 1XOCA 2Q9TA 1B5HA 4MBPA 2PCRA 4NQ8A 4F1YA 3IAZA 4IO5A 2PT2A 3VV5A 2VP1A 2Y7IA 5DEXB 1MY2A 4G68A 4LUBA 5FHMA 4MNIA 2QVUA 4ZEKA 4Q8RA 4P0IA 4UA8A 5ET8A 4F3GA 3IFAA 3CG3A 2F8DA 2V25A 1WODA 2RINA 3N94A 4GXAA 2AIXA 4JXIA 4GIZA 3U94A 3D4GA 1H76A 3PUXE 4MH5A 1B32A 4QFOA 3IOUA 4PDHA 4R73A 1LB8A 2D5WA 3IOWA 1ZMGA 3UK4A 1NUXA 3MPKA 3T22A 2XXTA 4XKQA 3OSRA 2XWIA 2XWKA 4EF1A 3PPPA 1MH4A 3TTRA 4IY5A 3IR1A 1G0HA 4P8BA 2H99A 4GBVA 1QKAA 3TTNA 2QSXA 5AA4B 4OHNA 1SW1A 2GHAA 2GFEA 1AL3A 1P1NA 4HXVA 3ISPA 4FE8A 1F9BA 4ESWA 1N7WA 5ITPA 2XA5A 5CMKA 5I58A 3CFLA 1HSJA 5DVFA 4EF2A 3HN0A 5FBPA 2Z8FA 4GF8A 3BBRA 2XD2A 4RK9A 4FAJA 3SZPA 4OESA 3WAFA 5K2XA 4WEPA 2ONRA 1OVBA 1FPJA 3E79A 4P1LA 5KDTA 1YAEA 4GL0A 1MXUA 4JB7A 3D1RA 4H6DA 4HW8A 5I57B 5EQAA 1N3XA 4GVOA 1GGGA 1B3LA 4RA1A 3RTFB 2CEYA 3VLUA 5IKBA 3PUWE 3MVZA 2HAVA 3G3FA 1UTHA 2GQ1A 4RYAA 3RT8A 2NXOA 5TU0A 5I59A 3MVXA 1ATGA 3TTKA 5DVJA 2YPNA 4FIMA 1M5CA 3MVWA 1MY0A 1I6QA 3KSJA 1R9LA 2DWJA 1Y3PA 3G3GA 1P1OA 1B1HA 1LAFE 2FA7A 3PUVE 1MY3A 3MWBA 4H5GA 4F19A 3I3VA 4F2QA 2VPNA 4XKRA 3PTYA 5I2KA 2B65A 3IFCA 4G8HA 3QYTA 3VLVA 3VFJA 3PU5A 4GOTA 4NMYA 5IZZA 3N6TA 4F18A 3KG2A 1PBPA 2WKYA 3ILUB 4H46A 2FNCA 3MJNA 2ZYMA 4IGTA 4YKIA 3MUQA 3PPRA 3VDFA 3CHGA 3N26A 5IAIA 2LAOA 2NUVA 4N6DA 2NWJA 3FIRA 3KN3A 3PD9A 4QF9A 3OEKA 3P7IA 1FPKA 4N81A 5I84A 1FBGA 1B4HA 1FPLA 2O51A 3SETA 2Y7RA 1XT8A 3U92A 3EHSA 4GD5A 1WVJA 3M8UA 1FPIA 2P0SA 3RGYA 3ILTB 4LZ5A 3DP4A 5DW8A 4L17A 3LC8A 2XWVA 1QKBA 4ESXA 1FBFA 3K6WA 5FHOA 3OO7A 2ZNSA 4PFWA 5ITOA 2I3WA 2REJA 1B51A 3TKDA 4DXBA 1RYXA 2ONKE 2DXRA 3FVNA 3T9UA 2F6PA 4O3BA 2NOOA 1Q35A 1LCFA 4OVJA 3FUZA 3ZS6A 3SEWA 4R2BA 2V3QA 3PMVA 1Y3NA 1PDAA 4F2OA 4MAGA 4O3CA 3BFUA 5IZ3B 1GTKA 3MBPA 4PBHA 4LQ2A 2H98A 4HS7A 3OEMA 1B4ZA 4PTKA 3E78A 1NNPA 1FPDA 1D3KA 1NL5A 3HHFA 4P9KA 2XXVA 3M3LA 4RXLA 2ZMBA 1XS5A 2THIA 5JTYB 1AWBA 2FVZA 3AXFA 5M2VA 1SW4A 2VOZA 4MJOA 3FXBA 4HE1A 3V89B 4DXCA 3HV1A 1ZLQA 1FQCA 3E13X 4PF8A 1GVCA 5CC2A 3KN8A 1I69A 2OK2A 2D3IA 2PFYA 3O97A 4OQOA 1EU8A 2O1LA 2I4BA 3PUYE 3Q27A 2XXRA 4AB5A 1Y9UA 3L6HA 4GX3A 1R9QA 2H25A 4BDOA 5J1DA 2QRYA 5ET6A 3K4UA 5LTCA 3K6XA 2F6GA 4LN5A 4JWYA 3FASA 4KHZE 2JJKA 4NX1A 1YYZA 3VXCA 5BUUA 1RYOA 4FORA 4PQJA 2Z23A 1I6BA 4R2FA 2UYEA 4X1BA 1JEVA 1MQGA 1MPBA 5HBCA 3TCFA 3SEVA 3TQLA 3ONMA 2HXRA 4EUOA 1JW4A 4PAIA 3V5AA 3MP8A 1DK4A 4U2RA 4GRKA 1MQHA 2NVUB 1A7LA 3O9PA 1ZTYA 5IZ1A 2UXAA 2QFLA 3FGSA 4F22A 4EXKA 5L9SA 2HHMA 2Y7PA 5AA2D 2OCUA 4F39A 1Y1MA 1IEJA 3UP9A 3MAMA 2ZYNA 4OYVA 3O6HA 1B58A 4HTGA 1FBHA 3FVKA 4KYDA 1FBPA 3TEPA 5B7DA 4LP2B 5ICTA 3GBAA 4N6KA 2UYFA 4IO2A 1FPEA 1N3WA 3MZ9A 3H6UA 4UACA 1EYJA 4OVTA 3HPIA 3DLNA 3MW0A 4MX6A 4G8MA 2XD3A 5HM4B 3LSLA 3Q26A 3UA8A 2FBPA 3SKPA 3VVFA 2OZZA 3L6GA 2AL4A 4LONB 1URGA 4LVQA 4QFLA 2ZZWA 2E1SA 1OVTA 3OSQA 3FBPA 3GBBA 3PPOA 1FSAA 4MCOA 1EZ9A 4U4XA 5H8NB 1NV0A 1B7UA 2VPOA 2B4LA 4N8GA 3B50A 3FATA 2BJIA 2HXWA 1IXIA 3VVDA 3MP1A 4ELQA 1MDQA 1SW5A 4PP0A 1N76A 2DDKA 2I6EA 1Q9DA 1QUKA 2I58A 2XX9A 3CG1A 3C9HA 4BDNA 3KBZA 2HEUA 3W9WA 4O8MA 3A29A 4ZS9A 3KFMA 4PDDA 1LBZA 5I5PA 4K3FA 4KPTA 4R72A 2VD3A 1OLAA
chains in the Genus database with same CATH topology
4ESWA 1N7WA 5ITPA 1ZIUA 4QFNA 2G29A 3GZGA 2Q88A 2X7PA 4NF5A 1MPDA 4N13A 1Z7NE 4OENA 2ZNUA 4U22A 5H8HB 3EHUA 5CMKA 1N0TA 1IITA 3MVYA 5I58A 1DPEA 1FCKA 1MM7A 3CFLA 1HSJA 3IL1B 5DVFA 4DE8A 1Y4CA 4EF2A 3HN0A 1MXYA 3I6VA 2Z8FA 1B3GA 1I6AA 3BBRA 4GFRA 4GF8A 2XD2A 3CR9A 2AYSA 1B0LA 4IO6A 2HCAA 3ECRA 2ALUA 3EPEA 3KN7A 4O3AA 2IA4A 4RK9A 5EHSA 3N5LA 3U1OA 1PB7A 2H5YA 3E3KA 2R6GE 4FAJA 3K00A 1Y1ZA 1POY1 1Y3QA 2A5TA 3OOAA 1PB8A 4KD5A 4QSDA 4OESA 3OO6A 3WAFA 3CVGA 5K2XA 4WEPA 3E4RA 3HO7A 2Y7WA 2ONRA 4ZE9A 5AA2B 3RNNA 1OVBA 4R9GA 3KZGA 3DELB 4F3BA 1Y4TA 4TLLB 4U23A 1TT1A 4AB6A 5I58B 1JVYA 5KDTA 1PC3A 1YAEA 4ISUA 1LCTA 2ZXTA 3E9XA 3K1PA 4GL0A 1MXUA 4OEUA 5A5XB 1LAHE 1MXWA 4QFKA 1FTKA 1FQBA 1B0HA 2ZNTA 4JB7A 2XXIA 1FQFA 4G2ZA 4KQPA 2DE2A 2Q8JA 4H6DA 4OZ9A 2DE4A 1FQAA 1B7ZA 2Q89A 1JQFA 4IO7A 4FEDA 5I57B 3DM0A 4R75A 4RPNA 1OLCA 4XKNA 4G68B 1LBBA 1N3XA 3OELA 4GVOA 1GGGA 2E0SA 2XXYA 3CFXA 1B3LA 2XHDA 5L8DA 3SEUA 4DLDA 1A8EA 3IORA 4RA1A 3RTFB 4H5FA 4NF8B 1LFIA 1N84A 3VLUA 3PGFA 3D4CA 3MVZA 3PUWE 5IKBA 2QMXA 5AA1A 5JEIA 2HAVA 1AH5A 3G3FA 1UTHA 3IO4A 4RK2A 2YLNA 3EQ1A 4RYAA 4DCXA 1M5DA 1LSTA 4LATA 3RT8A 2NXOA 2DOJA 5KCJB 2OJTA 4KI0E 4NEDA 5TU0A 5I59A 1LAGE 3MVXA 1ATGA 4G8NA 3TTKA 2DP8A 2YPNA 5DVJA 4LZ8A 5DTBA 2R9JA 3IX1A 1II5A 4FIMA 4QFPA 1M5CA 1QULA 3MVWA 1YPNA 1MY0A 3HCQA 3LUYA 2F36A 1P1QA 4XXUA 1I6QA 3KSJA 3PV0E 1MY1A 2PBWA 2QS4A 4YZZA 2O68A 2RC7A 3O2AA 4NF6A 1R9LA 2DWJA 2F7BA 1Y3PA 2Q2CA 1TFDA 3G3GA 3JYRA 3PMWA 3HSTA 2DS9A 3G3KA 1P1OA 3PUZE 1B1HA 1LAFE 4R9FA 5TPAB 2FA7A 3RT6B 1AMFA 4DXUA 4ELPA 4DZ1A 1YCJA 4N6PA 3PUVE 3C34A 1MY3A 3MWBA 1VFDA 3TELA 4F1VA 4H5GA 4U21A 4F19A 3I3VA 4IO3A 4F2QA 1NH8A 5H8SA 4ZZEA 4XKRA 3TCHA 2O84X 4EQ7A 5I2KA 4FATA 1MY4A 2B65A 4YB5A 4G8HA 2F78A 3QYTA 4YICA 4NF8A 5HPQA 2ZYOA 1SYIA 2QS2A 3MZBA 1UTBB 1BP5A 3VLVA 2PT1A 3VFJA 4JSOA 4YMBA 1LFHA 3PU5A 4RPOA 3OMBA 4GOTA 5ISUA 1ZJLA 4NMYA 4H8IA 4PFUA 4HCYA 2GH9A 1JW1A 1UIVA 2RKMA 1B46A 2XXUA 3N6TA 2XXQA 4RJZA 4F18A 4GXSB 2HZLA 1OIBA 1PBPA 2WKYA 1NNKA 3G3JA 3ILUB 3KG2A 5B70A 3CIJA 3TODA 3A3CA 2FNCA 2ONSA 3A09A 2QPQA 3TPAA 3S9EA 2F7CA 3FXQA 1UQWA 3MJNA 4NWCA 1H43A 2ZYMA 4IGTA 4YKIA 2DVZA 4QSEA 2M8CA 3MUQA 3PPRA 4EXLA 3V83A 3U93A 2XXXA 3K6VA 3VDFA 1AOVA 3N26A 5IAIA 2LAOA 2YJPA 2NUVA 5KCJA 2CMOA 4OMBA 2NWJA 1MM6A 1GV8A 2ZYKA 3FIRA 1D9VA 3H03A 3KN3A 4C1UA 3PD9A 4QF9A 3OEKA 5CM6A 1QVSA 1XC1A 3DP6A 3N6UA 2HFBA 3P7IA 3C31A 4ZEIA 5I84A 1EZOA 4GWOA 3FVGA 4IY6A 4P11A 2DE3A 1QJMA 3DP8A 2F35A 3QSLA 4F3SA 1SD3A 3F11A 2Y84A 3QUJA 5TPAA 3O29A 1B4HA 2V3UA 4ND9A 3PMXA 2VGQA 3A3UA 2UVHA 4EQBA 3FV2A 3GLBA 2O51A 3QIMA 3SETA 3MP6A 3TZAA 3OD7A 2Y7RA 3G3IA 2Z22A 1XT8A 4XKPA 4DCYA 4ELOA 4R6YA 4MLQA 4R6HA 1AIVA 1ZU0A 1IZ1A 1VFEA 2RC9A 3U92A 1CB6A 3EHSA 1KWHA 4Q0CA 3VE1B 1PB9A 3W9VA 1IXCA 5CBRA 4OERA 4GD5A 5AA3A 2QS1A 3TDJA 3FXRA 1LBCA 3RLFE 3ODBA 3SERA 4C0RA 1WVJA 1Z7ME 3M8UA 4JWOA 1A8FA 2F34A 1BLFA 2P0SA 3IB2A 3ILTB 1M5EA 1NNFA 3IOTA 1S7YA 3LBSA 4LZ5A 4QHQA 1MXXA 1CE2A 2D21A 1H45A 3DP4A 2RCBA 1B5IA 1OQHA 4L17A 4JWXA 3ZSFA 5DT6A 1BTJA 1IXGA 3LC8A 4KYSA 4TOZA 2HZKA 1TWYA 4EQ9A 1MS7A 1QKBA 1ANFA 3Q25A 3K6WA 4ESXA 4P0GA 3K01A 1ZKBA 4NF4A 5EHMA 5TP9A 4F31B 5FHOA 1NKXA 2DVCA 4POXA 3OO7A 2OWSA 4ZEFA 1MRPA 2ZNSA 4R6KA 1B40A 5H8HA 1SI1A 1Y20A 1T0KA 2O6AA 4KYEA 5JK4A 4PFWA 5ITOA 1A40A 5EYFA 2V84A 3S9LC 2OWTA 4PFTA 2I3WA 3ZKLA 2REJA 1B51A 1B05A 3TKDA 4DXBA 1O64A 3LSXA 5ICQA 1RYXA 4BDLA 4U1OA 3TTLA 3Q28A 3USDA 3IJOB 4H67A 1MQDA 4OFLA 3QUFA 1WDNA 2ONKE 2PVUA 4R74A 2DXRA 1NFTA 3H06B 1R6ZA 2I48A 3FJ7A 4JBZA 1ZBMA 3FVNA 4Z0IA 3T66A 3T9UA 1B3FA 2F6PA 3C36A 3FZVA 3K1MA 5I56A 1B1XA 1MH3A 1A55A 4O3BA 2NOOA 1URSA 1Q35A 2ANJA 1SQYA 1LCFA 2XX8A 4OVJA 3FUZA 2F97A 3RTWB 2DWAA 2OLBA 2XXHA 4H65A 2A5SA 4OXVA 2XXWA 3SEWA 3ZS6A 2PMSA 3LSWA 5CBSA 2QMWA 5I2NB 2DQVA 3KOTA 4R2BA 4H1XA 2HQ0A 3H4ZA 4YKKA 1B6HA 2P1SA 2V3QA 4GQOA 1A99A 1FQEA 3PMVA 2QL3A 1Y3NA 3H6TA 3TTMA 3EF7A 1PDAA 4F2OA 1YTVA 4ZEDA 4O3CA 3KGCA 3BFUA 1US5A 1GTKA 3MBPA 4YMAA 1FTLA 3SDFA 1MPCA 1P1UA 4Z7EA 4LQ2A 2H98A 2UVIA 1IUDA 4HS7A 3OEMA 1B4ZA 1Q1KA 3KBRA 3RUMA 1NNPA 2A5TB 3FVOA 2RC8A 5H8NA 4ZEBA 1D3KA 1DPPA 4LZ7A 1B2HA 5DVIA 1NL5A 1B7HA 3HHFA 4U1ZA 5BWJA 2BJJX 1OQGA 2XXVA 1FQDA 3M3LA 4RXLA 2I0BA 2ZMBA 3O28A 2O7UA 4M4GA 5CI5A 3TMGA 4G77A 1QUIA 2REGA 2XX7A 4MF3A 1UIUA 2P2AA 4OFOA 1XS5A 4PFYA 1B3HA 2THIA 5H8QA 5JTYB 3MPLA 3AXFA 5M2VA 3FJMA 1SW4A 3K0VA 4H0WA 2VOZA 4E0XA 4NF4B 5I56B 1H44A 1SI0A 4ELRA 5I57A 3BKIB 3V89B 4DXCA 1IQ7A 2I4CA 3HV1A 1HSEA 1ZLQA 3LSFB 2V3TA 1M5FA 3T9VA 3IB0A 5H8FB 1FQCA 3H6WA 3E13X 1GVCA 3S9MC 3CSBA 2VD2A 2X26A 4AQ4A 2PYYA 2QS3A 3UN6A 5CC2A 4WKMA 3KN8A 1I69A 1MQJA 4HCWA 4IGRA 4I1DA 2OK2A 2IEEA 2D3IA 2GRVA 4I62A 3O97A 4OQOA 3CI8A 4WXJA 1EU8A 3Q29A 2O1LA 2I4BA 3R6UA 3IO6A 2W7YA 3OO9A 3PUYE 1JW5A 3U72A 1XVXA 1P99A 3VXBA 2I3VA 3Q27A 4NWDA 2XXRA 3H7MA 4MLVA 1Y9UA 3L6HA 5F7VA 4AB5A 1R9QA 2H25A 1IIWA 4BDOA 1MG1A 5J1DA 4NTLA 4OETA 5CRYA 3RY3A 2AL5A 2QRYA 3B6TA 3K4UA 2O69A 3TYHA 2RCAA 3K6XA 3SEXA 1SVXB 3H3GA 2F6GA 3MC2A 4BDRA 4JWYA 3FASA 4KHZE 5ELVA 3THIA 3VLWA 3QAXA 5CMBA 5DEXA 3S4UA 3CRBA 3EN3A 3RPWA 2B3FA 1USYH 1NMUA 4TQUQ 1NH7A 3VXCA 2VHAA 5BUUA 3KJTA 4JSDA 1RYOA 4FORA 1JNFA 1VE4A 1VSOA 4PQJA 5FTHA 2Z23A 1J1NA 1I6BA 1D4NA 2DSFA 3BFTA 4IO4A 4XIGQ 5I2NA 3G3HA 4R2FA 1UTBA 2UYEA 4X1BA 4YKJA 1B52A 1JEVA 3K6UA 4DDDA 1EZPA 1MQGA 3B6QA 3C33A 1HSLA 1MPBA 5L9OA 3EHTA 2UVGA 1XVYA 4IB2A 4NE4A 4QSCA 5F1QA 1S50A 2FYIA 2QJEA 5HBCA 4OTEA 3SEVA 3TCFA 4PETA 3U8QA 2F7AA 3TFLA 3OENA 3B7DA 3ONMA 1JW4A 4KCDA 4X9TA 4YU0A 4EUOA 4NF5B 3V5AA 3MP8A 3TQLA 1BIYA 1M5BA 3K02A 4U2RA 3C4MA 3R7XA 4GRKA 1MQHA 3LR1A 1NNTA 1TFAA 4KCCA 3T96B 4ZECA 4FJPA 3TCGA 3C35A 1A7LA 2OBGA 2H9BA 3O9PA 5FHNA 2NVUB 5KZTA 3O6GA 3UIFA 2X7QA 2I49A 3QK6A 3VVEA 1ZTYA 4ZE8A 2H4IA 5AA4A 2UXAA 4MFIA 3TAJA 1PEBA 2DWHA 1FTMA 3FGSA 3FXUA 3H6VA 3IB1A 1QW0A 3G7WA 3PPNA 5TP9B 4F22A 2ABHA 2G93A 4EXKA 5L9SA 1GR2A 1POTA 2Y7PA 3HHGA 3FJGA 4H8JA 3K2DA 1RKMA 4GL8A 3WAEA 2XXPA 3RN8A 3FV1A 4QRZA 4POWA 5CMMA 1DMBA 5AA2D 2O1MA 3IOVA 2CZLA 3TUSA 2DXYA 1FTOA 3JZJA 2O7IA 1JETA 2OCUA 3ZKKA 4F39A 1Y1MA 3B6WA 4ECFA 1S9TA 1IEJA 3TQWA 1FTJA 4N07A 4OWDA 3UP9A 5I2KB 1MXVA 1LAXA 1FW0A 4Q5TA 1QUJA 2ZYNA 3MAMA 4I8CA 4OYVA 3M3FA 3O6HA 1B58A 4XTCQ 4HTGA 3IJXB 3GXAA 4THIA 5AE4A 1H3DA 2HAUA 3FVKA 3O6IA 5DYHA 4EDPA 3I5OA 4WEDA 3V8XB 4KYDA 1B5JA 3TEPA 5B7DA 5LOMA 2DYXA 4LP2B 4F29A 3GBAA 5ICTA 1B9JA 2RF1A 1SBPA 2Z8DA 4LQ5A 1LFGA 2UYFA 4IO2A 3M3KA 1N3WA 1MQIA 4KFQA 4YAHX 4BDMA 3MZ9A 4G4PA 3H6UA 4UACA 1DTGA 1USYE 2R71A 3HPIA 1VR5A 1XOCA 4F1UA 3RQTA 2Q9TA 1B5HA 3DLNA 3MW0A 4MBPA 4G8MA 2XD3A 3JV9A 1LB9A 4F1YA 4YB6A 5HM4B 3IAZA 3LSLA 4IO5A 4I9DA 3W15C 1MXZA 2F5XA 3CFZA 3Q26A 1LGBC 3UA8A 2DWIA 3SKPA 2PT2A 3VVFA 3CSGA 3VV5A 4FEBA 5K2YA 2OZZA 3L6GA 2AL4A 3S9NC 4HW8A 1F9BA 4LONB 1B3EA 1US4A 3MQ9A 3OXNA 4ZZAA 1URGA 2VP1A 4LVQA 3OO8A 2Y7IA 4QFLA 5DEXB 5H8FA 1MY2A 4G68A 4LUBA 4OEVA 5FHMA 2E1SA 1OVTA 1JVXA 3OSQA 4Q30B 4ZEKA 4NF6B 1IXHA 3IK6B 4BLAA 1D9YA 2UVJA 5L9MA 4F3PA 4Q8RA 3GBBA 3PPOA 4P0IA 4UA8A 4X48A 4TLMB 1O7TA 4X1DA 3SEYA 5AA2A 4M1VA 1EZ9A 4F3GA 5H8QB 3RGYA 1UTHB 3KJ7A 3CG3A 4U4XA 2F8DA 2B3BA 2V25A 5H8NB 1WODA 2RINA 3K1NA 3N94A 2KLFA 1B7UA 1BKAA 4GXAA 4U4SA 2I0CA 4ZDMA 2Y7KA 4G68C 2AIXA 4JXIA 4GIZA 3FD3A 1DSNA 3QXMA 3U94A 3D4GA 3UORA 3T93B 1DTZA 1H76A 3FATA 3PUXE 4MH5A 1B32A 5KDTB 1N7XA 4QFOA 3IOUA 4ONYA 4FECA 4R73A 1LB8A 2D5WA 2HXWA 3IOWA 1IXIA 1ZMGA 3MZ1A 3UK4A 3MPKA 4RY1A 4E0WA 3O66A 3VVDA 4BDQA 5A5XA 3MP1A 4ELQA 1MDP1 3UGWA 3T22A 1EH3A 1MDQA 5CMCA 1SW5A 4KR5A 4PP0A 1N76A 4YB7A 4JDFA 3KOSA 1URDA 2XXTA 1SW2A 2Q2AA 3C32A 5JTYA 4C1TA 3KSXA 1N04A 3PD8A 4XKQA 3OSRA 1L5TA 4PE5B 2GHBA 1SDXA 4OFJA 4EF1A 3R26A 3PPPA 1MH4A 3TTRA 1PBQA 2I6EA 4IY5A 1QUKA 1XHYA 1SYHA 2I58A 2XX9A 3CG1A 3IR1A 5FTIA 3S2VA 3C9HA 5I59B 2Z8EA 4BDNA 1ELJA 2HEUA 1JEUA 2H99A 3W9WA 1P1WA 4ZS9A 4RNSA 2V93A 1QKAA 3KFMA 3TTNA 2ESNA 2QSXA 5AA4B 4OHNA 4YKPA 1SW1A 2PX1A 4GLIA 1O63A 3T9HB 1TXFA 3PPQA 1R1NA 2GFEA 2GHAA 3KEIA 4K3FA 1AL3A 1P1NA 4KPTA 3SESA 4DIGA 1DOTA 1A54A 4R72A 4LA9A 4FE8A 3T9XB 2VD3A 1OMPA 1LLSA 1OLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESW A;  1N7W A;  5ITP A;  1ZIU A;  4QFN A;  2G29 A;  3GZG A;  2Q88 A;  2X7P A;  4NF5 A;  1MPD A;  4N13 A;  1Z7N E;  4OEN A;  2ZNU A;  4U22 A;  5H8H B;  3EHU A;  5CMK A;  1N0T A;  1IIT A;  3MVY A;  5I58 A;  1DPE A;  1FCK A;  1MM7 A;  3CFL A;  1HSJ A;  3IL1 B;  5DVF A;  4DE8 A;  1Y4C A;  4EF2 A;  3HN0 A;  1MXY A;  3I6V A;  2Z8F A;  1B3G A;  1I6A A;  3BBR A;  4GFR A;  4GF8 A;  2XD2 A;  3CR9 A;  2AYS A;  1B0L A;  4IO6 A;  2HCA A;  3ECR A;  2ALU A;  3EPE A;  3KN7 A;  4O3A A;  2IA4 A;  4RK9 A;  5EHS A;  3N5L A;  3U1O A;  1PB7 A;  2H5Y A;  3E3K A;  2R6G E;  4FAJ A;  3K00 A;  1Y1Z A;  1POY 1;  1Y3Q A;  2A5T A;  3OOA A;  1PB8 A;  4KD5 A;  4QSD A;  4OES A;  3OO6 A;  3WAF A;  3CVG A;  5K2X A;  4WEP A;  3E4R A;  3HO7 A;  2Y7W A;  2ONR A;  4ZE9 A;  5AA2 B;  3RNN A;  1OVB A;  4R9G A;  3KZG A;  3DEL B;  4F3B A;  1Y4T A;  4TLL B;  4U23 A;  1TT1 A;  4AB6 A;  5I58 B;  1JVY A;  5KDT A;  1PC3 A;  1YAE A;  4ISU A;  1LCT A;  2ZXT A;  3E9X A;  3K1P A;  4GL0 A;  1MXU A;  4OEU A;  5A5X B;  1LAH E;  1MXW A;  4QFK A;  1FTK A;  1FQB A;  1B0H A;  2ZNT A;  4JB7 A;  2XXI A;  1FQF A;  4G2Z A;  4KQP A;  2DE2 A;  2Q8J A;  4H6D A;  4OZ9 A;  2DE4 A;  1FQA A;  1B7Z A;  2Q89 A;  1JQF A;  4IO7 A;  4FED A;  5I57 B;  3DM0 A;  4R75 A;  4RPN A;  1OLC A;  4XKN A;  4G68 B;  1LBB A;  1N3X A;  3OEL A;  4GVO A;  1GGG A;  2E0S A;  2XXY A;  3CFX A;  1B3L A;  2XHD A;  5L8D A;  3SEU A;  4DLD A;  1A8E A;  3IOR A;  4RA1 A;  3RTF B;  4H5F A;  4NF8 B;  1LFI A;  1N84 A;  3VLU A;  3PGF A;  3D4C A;  3MVZ A;  3PUW E;  5IKB A;  2QMX A;  5AA1 A;  5JEI A;  2HAV A;  1AH5 A;  3G3F A;  1UTH A;  3IO4 A;  4RK2 A;  2YLN A;  3EQ1 A;  4RYA A;  4DCX A;  1M5D A;  1LST A;  4LAT A;  3RT8 A;  2NXO A;  2DOJ A;  5KCJ B;  2OJT A;  4KI0 E;  4NED A;  5TU0 A;  5I59 A;  1LAG E;  3MVX A;  1ATG A;  4G8N A;  3TTK A;  2DP8 A;  2YPN A;  5DVJ A;  4LZ8 A;  5DTB A;  2R9J A;  3IX1 A;  1II5 A;  4FIM A;  4QFP A;  1M5C A;  1QUL A;  3MVW A;  1YPN A;  1MY0 A;  3HCQ A;  3LUY A;  2F36 A;  1P1Q A;  4XXU A;  1I6Q A;  3KSJ A;  3PV0 E;  1MY1 A;  2PBW A;  2QS4 A;  4YZZ A;  2O68 A;  2RC7 A;  3O2A A;  4NF6 A;  1R9L A;  2DWJ A;  2F7B A;  1Y3P A;  2Q2C A;  1TFD A;  3G3G A;  3JYR A;  3PMW A;  3HST A;  2DS9 A;  3G3K A;  1P1O A;  3PUZ E;  1B1H A;  1LAF E;  4R9F A;  5TPA B;  2FA7 A;  3RT6 B;  1AMF A;  4DXU A;  4ELP A;  4DZ1 A;  1YCJ A;  4N6P A;  3PUV E;  3C34 A;  1MY3 A;  3MWB A;  1VFD A;  3TEL A;  4F1V A;  4H5G A;  4U21 A;  4F19 A;  3I3V A;  4IO3 A;  4F2Q A;  1NH8 A;  5H8S A;  4ZZE A;  4XKR A;  3TCH A;  2O84 X;  4EQ7 A;  5I2K A;  4FAT A;  1MY4 A;  2B65 A;  4YB5 A;  4G8H A;  2F78 A;  3QYT A;  4YIC A;  4NF8 A;  5HPQ A;  2ZYO A;  1SYI A;  2QS2 A;  3MZB A;  1UTB B;  1BP5 A;  3VLV A;  2PT1 A;  3VFJ A;  4JSO A;  4YMB A;  1LFH A;  3PU5 A;  4RPO A;  3OMB A;  4GOT A;  5ISU A;  1ZJL A;  4NMY A;  4H8I A;  4PFU A;  4HCY A;  2GH9 A;  1JW1 A;  1UIV A;  2RKM A;  1B46 A;  2XXU A;  3N6T A;  2XXQ A;  4RJZ A;  4F18 A;  4GXS B;  2HZL A;  1OIB A;  1PBP A;  2WKY A;  1NNK A;  3G3J A;  3ILU B;  3KG2 A;  5B70 A;  3CIJ A;  3TOD A;  3A3C A;  2FNC A;  2ONS A;  3A09 A;  2QPQ A;  3TPA A;  3S9E A;  2F7C A;  3FXQ A;  1UQW A;  3MJN A;  4NWC A;  1H43 A;  2ZYM A;  4IGT A;  4YKI A;  2DVZ A;  4QSE A;  2M8C A;  3MUQ A;  3PPR A;  4EXL A;  3V83 A;  3U93 A;  2XXX A;  3K6V A;  3VDF A;  1AOV A;  3N26 A;  5IAI A;  2LAO A;  2YJP A;  2NUV A;  5KCJ A;  2CMO A;  4OMB A;  2NWJ A;  1MM6 A;  1GV8 A;  2ZYK A;  3FIR A;  1D9V A;  3H03 A;  3KN3 A;  4C1U A;  3PD9 A;  4QF9 A;  3OEK A;  5CM6 A;  1QVS A;  1XC1 A;  3DP6 A;  3N6U A;  2HFB A;  3P7I A;  3C31 A;  4ZEI A;  5I84 A;  1EZO A;  4GWO A;  3FVG A;  4IY6 A;  4P11 A;  2DE3 A;  1QJM A;  3DP8 A;  2F35 A;  3QSL A;  4F3S A;  1SD3 A;  3F11 A;  2Y84 A;  3QUJ A;  5TPA A;  3O29 A;  1B4H A;  2V3U A;  4ND9 A;  3PMX A;  2VGQ A;  3A3U A;  2UVH A;  4EQB A;  3FV2 A;  3GLB A;  2O51 A;  3QIM A;  3SET A;  3MP6 A;  3TZA A;  3OD7 A;  2Y7R A;  3G3I A;  2Z22 A;  1XT8 A;  4XKP A;  4DCY A;  4ELO A;  4R6Y A;  4MLQ A;  4R6H A;  1AIV A;  1ZU0 A;  1IZ1 A;  1VFE A;  2RC9 A;  3U92 A;  1CB6 A;  3EHS A;  1KWH A;  4Q0C A;  3VE1 B;  1PB9 A;  3W9V A;  1IXC A;  5CBR A;  4OER A;  4GD5 A;  5AA3 A;  2QS1 A;  3TDJ A;  3FXR A;  1LBC A;  3RLF E;  3ODB A;  3SER A;  4C0R A;  1WVJ A;  1Z7M E;  3M8U A;  4JWO A;  1A8F A;  2F34 A;  1BLF A;  2P0S A;  3IB2 A;  3ILT B;  1M5E A;  1NNF A;  3IOT A;  1S7Y A;  3LBS A;  4LZ5 A;  4QHQ A;  1MXX A;  1CE2 A;  2D21 A;  1H45 A;  3DP4 A;  2RCB A;  1B5I A;  1OQH A;  4L17 A;  4JWX A;  3ZSF A;  5DT6 A;  1BTJ A;  1IXG A;  3LC8 A;  4KYS A;  4TOZ A;  2HZK A;  1TWY A;  4EQ9 A;  1MS7 A;  1QKB A;  1ANF A;  3Q25 A;  3K6W A;  4ESX A;  4P0G A;  3K01 A;  1ZKB A;  4NF4 A;  5EHM A;  5TP9 A;  4F31 B;  5FHO A;  1NKX A;  2DVC A;  4POX A;  3OO7 A;  2OWS A;  4ZEF A;  1MRP A;  2ZNS A;  4R6K A;  1B40 A;  5H8H A;  1SI1 A;  1Y20 A;  1T0K A;  2O6A A;  4KYE A;  5JK4 A;  4PFW A;  5ITO A;  1A40 A;  5EYF A;  2V84 A;  3S9L C;  2OWT A;  4PFT A;  2I3W A;  3ZKL A;  2REJ A;  1B51 A;  1B05 A;  3TKD A;  4DXB A;  1O64 A;  3LSX A;  5ICQ A;  1RYX A;  4BDL A;  4U1O A;  3TTL A;  3Q28 A;  3USD A;  3IJO B;  4H67 A;  1MQD A;  4OFL A;  3QUF A;  1WDN A;  2ONK E;  2PVU A;  4R74 A;  2DXR A;  1NFT A;  3H06 B;  1R6Z A;  2I48 A;  3FJ7 A;  4JBZ A;  1ZBM A;  3FVN A;  4Z0I A;  3T66 A;  3T9U A;  1B3F A;  2F6P A;  3C36 A;  3FZV A;  3K1M A;  5I56 A;  1B1X A;  1MH3 A;  1A55 A;  4O3B A;  2NOO A;  1URS A;  1Q35 A;  2ANJ A;  1SQY A;  1LCF A;  2XX8 A;  4OVJ A;  3FUZ A;  2F97 A;  3RTW B;  2DWA A;  2OLB A;  2XXH A;  4H65 A;  2A5S A;  4OXV A;  2XXW A;  3SEW A;  3ZS6 A;  2PMS A;  3LSW A;  5CBS A;  2QMW A;  5I2N B;  2DQV A;  3KOT A;  4R2B A;  4H1X A;  2HQ0 A;  3H4Z A;  4YKK A;  1B6H A;  2P1S A;  2V3Q A;  4GQO A;  1A99 A;  1FQE A;  3PMV A;  2QL3 A;  1Y3N A;  3H6T A;  3TTM A;  3EF7 A;  1PDA A;  4F2O A;  1YTV A;  4ZED A;  4O3C A;  3KGC A;  3BFU A;  1US5 A;  1GTK A;  3MBP A;  4YMA A;  1FTL A;  3SDF A;  1MPC A;  1P1U A;  4Z7E A;  4LQ2 A;  2H98 A;  2UVI A;  1IUD A;  4HS7 A;  3OEM A;  1B4Z A;  1Q1K A;  3KBR A;  3RUM A;  1NNP A;  2A5T B;  3FVO A;  2RC8 A;  5H8N A;  4ZEB A;  1D3K A;  1DPP A;  4LZ7 A;  1B2H A;  5DVI A;  1NL5 A;  1B7H A;  3HHF A;  4U1Z A;  5BWJ A;  2BJJ X;  1OQG A;  2XXV A;  1FQD A;  3M3L A;  4RXL A;  2I0B A;  2ZMB A;  3O28 A;  2O7U A;  4M4G A;  5CI5 A;  3TMG A;  4G77 A;  1QUI A;  2REG A;  2XX7 A;  4MF3 A;  1UIU A;  2P2A A;  4OFO A;  1XS5 A;  4PFY A;  1B3H A;  2THI A;  5H8Q A;  5JTY B;  3MPL A;  3AXF A;  5M2V A;  3FJM A;  1SW4 A;  3K0V A;  4H0W A;  2VOZ A;  4E0X A;  4NF4 B;  5I56 B;  1H44 A;  1SI0 A;  4ELR A;  5I57 A;  3BKI B;  3V89 B;  4DXC A;  1IQ7 A;  2I4C A;  3HV1 A;  1HSE A;  1ZLQ A;  3LSF B;  2V3T A;  1M5F A;  3T9V A;  3IB0 A;  5H8F B;  1FQC A;  3H6W A;  3E13 X;  1GVC A;  3S9M C;  3CSB A;  2VD2 A;  2X26 A;  4AQ4 A;  2PYY A;  2QS3 A;  3UN6 A;  5CC2 A;  4WKM A;  3KN8 A;  1I69 A;  1MQJ A;  4HCW A;  4IGR A;  4I1D A;  2OK2 A;  2IEE A;  2D3I A;  2GRV A;  4I62 A;  3O97 A;  4OQO A;  3CI8 A;  4WXJ A;  1EU8 A;  3Q29 A;  2O1L A;  2I4B A;  3R6U A;  3IO6 A;  2W7Y A;  3OO9 A;  3PUY E;  1JW5 A;  3U72 A;  1XVX A;  1P99 A;  3VXB A;  2I3V A;  3Q27 A;  4NWD A;  2XXR A;  3H7M A;  4MLV A;  1Y9U A;  3L6H A;  5F7V A;  4AB5 A;  1R9Q A;  2H25 A;  1IIW A;  4BDO A;  1MG1 A;  5J1D A;  4NTL A;  4OET A;  5CRY A;  3RY3 A;  2AL5 A;  2QRY A;  3B6T A;  3K4U A;  2O69 A;  3TYH A;  2RCA A;  3K6X A;  3SEX A;  1SVX B;  3H3G A;  2F6G A;  3MC2 A;  4BDR A;  4JWY A;  3FAS A;  4KHZ E;  5ELV A;  3THI A;  3VLW A;  3QAX A;  5CMB A;  5DEX A;  3S4U A;  3CRB A;  3EN3 A;  3RPW A;  2B3F A;  1USY H;  1NMU A;  4TQU Q;  1NH7 A;  3VXC A;  2VHA A;  5BUU A;  3KJT A;  4JSD A;  1RYO A;  4FOR A;  1JNF A;  1VE4 A;  1VSO A;  4PQJ A;  5FTH A;  2Z23 A;  1J1N A;  1I6B A;  1D4N A;  2DSF A;  3BFT A;  4IO4 A;  4XIG Q;  5I2N A;  3G3H A;  4R2F A;  1UTB A;  2UYE A;  4X1B A;  4YKJ A;  1B52 A;  1JEV A;  3K6U A;  4DDD A;  1EZP A;  1MQG A;  3B6Q A;  3C33 A;  1HSL A;  1MPB A;  5L9O A;  3EHT A;  2UVG A;  1XVY A;  4IB2 A;  4NE4 A;  4QSC A;  5F1Q A;  1S50 A;  2FYI A;  2QJE A;  5HBC A;  4OTE A;  3SEV A;  3TCF A;  4PET A;  3U8Q A;  2F7A A;  3TFL A;  3OEN A;  3B7D A;  3ONM A;  1JW4 A;  4KCD A;  4X9T A;  4YU0 A;  4EUO A;  4NF5 B;  3V5A A;  3MP8 A;  3TQL A;  1BIY A;  1M5B A;  3K02 A;  4U2R A;  3C4M A;  3R7X A;  4GRK A;  1MQH A;  3LR1 A;  1NNT A;  1TFA A;  4KCC A;  3T96 B;  4ZEC A;  4FJP A;  3TCG A;  3C35 A;  1A7L A;  2OBG A;  2H9B A;  3O9P A;  5FHN A;  2NVU B;  5KZT A;  3O6G A;  3UIF A;  2X7Q A;  2I49 A;  3QK6 A;  3VVE A;  1ZTY A;  4ZE8 A;  2H4I A;  5AA4 A;  2UXA A;  4MFI A;  3TAJ A;  1PEB A;  2DWH A;  1FTM A;  3FGS A;  3FXU A;  3H6V A;  3IB1 A;  1QW0 A;  3G7W A;  3PPN A;  5TP9 B;  4F22 A;  2ABH A;  2G93 A;  4EXK A;  5L9S A;  1GR2 A;  1POT A;  2Y7P A;  3HHG A;  3FJG A;  4H8J A;  3K2D A;  1RKM A;  4GL8 A;  3WAE A;  2XXP A;  3RN8 A;  3FV1 A;  4QRZ A;  4POW A;  5CMM A;  1DMB A;  5AA2 D;  2O1M A;  3IOV A;  2CZL A;  3TUS A;  2DXY A;  1FTO A;  3JZJ A;  2O7I A;  1JET A;  2OCU A;  3ZKK A;  4F39 A;  1Y1M A;  3B6W A;  4ECF A;  1S9T A;  1IEJ A;  3TQW A;  1FTJ A;  4N07 A;  4OWD A;  3UP9 A;  5I2K B;  1MXV A;  1LAX A;  1FW0 A;  4Q5T A;  1QUJ A;  2ZYN A;  3MAM A;  4I8C A;  4OYV A;  3M3F A;  3O6H A;  1B58 A;  4XTC Q;  4HTG A;  3IJX B;  3GXA A;  4THI A;  5AE4 A;  1H3D A;  2HAU A;  3FVK A;  3O6I A;  5DYH A;  4EDP A;  3I5O A;  4WED A;  3V8X B;  4KYD A;  1B5J A;  3TEP A;  5B7D A;  5LOM A;  2DYX A;  4LP2 B;  4F29 A;  3GBA A;  5ICT A;  1B9J A;  2RF1 A;  1SBP A;  2Z8D A;  4LQ5 A;  1LFG A;  2UYF A;  4IO2 A;  3M3K A;  1N3W A;  1MQI A;  4KFQ A;  4YAH X;  4BDM A;  3MZ9 A;  4G4P A;  3H6U A;  4UAC A;  1DTG A;  1USY E;  2R71 A;  3HPI A;  1VR5 A;  1XOC A;  4F1U A;  3RQT A;  2Q9T A;  1B5H A;  3DLN A;  3MW0 A;  4MBP A;  4G8M A;  2XD3 A;  3JV9 A;  1LB9 A;  4F1Y A;  4YB6 A;  5HM4 B;  3IAZ A;  3LSL A;  4IO5 A;  4I9D A;  3W15 C;  1MXZ A;  2F5X A;  3CFZ A;  3Q26 A;  1LGB C;  3UA8 A;  2DWI A;  3SKP A;  2PT2 A;  3VVF A;  3CSG A;  3VV5 A;  4FEB A;  5K2Y A;  2OZZ A;  3L6G A;  2AL4 A;  3S9N C;  4HW8 A;  1F9B A;  4LON B;  1B3E A;  1US4 A;  3MQ9 A;  3OXN A;  4ZZA A;  1URG A;  2VP1 A;  4LVQ A;  3OO8 A;  2Y7I A;  4QFL A;  5DEX B;  5H8F A;  1MY2 A;  4G68 A;  4LUB A;  4OEV A;  5FHM A;  2E1S A;  1OVT A;  1JVX A;  3OSQ A;  4Q30 B;  4ZEK A;  4NF6 B;  1IXH A;  3IK6 B;  4BLA A;  1D9Y A;  2UVJ A;  5L9M A;  4F3P A;  4Q8R A;  3GBB A;  3PPO A;  4P0I A;  4UA8 A;  4X48 A;  4TLM B;  1O7T A;  4X1D A;  3SEY A;  5AA2 A;  4M1V A;  1EZ9 A;  4F3G A;  5H8Q B;  3RGY A;  1UTH B;  3KJ7 A;  3CG3 A;  4U4X A;  2F8D A;  2B3B A;  2V25 A;  5H8N B;  1WOD A;  2RIN A;  3K1N A;  3N94 A;  2KLF A;  1B7U A;  1BKA A;  4GXA A;  4U4S A;  2I0C A;  4ZDM A;  2Y7K A;  4G68 C;  2AIX A;  4JXI A;  4GIZ A;  3FD3 A;  1DSN A;  3QXM A;  3U94 A;  3D4G A;  3UOR A;  3T93 B;  1DTZ A;  1H76 A;  3FAT A;  3PUX E;  4MH5 A;  1B32 A;  5KDT B;  1N7X A;  4QFO A;  3IOU A;  4ONY A;  4FEC A;  4R73 A;  1LB8 A;  2D5W A;  2HXW A;  3IOW A;  1IXI A;  1ZMG A;  3MZ1 A;  3UK4 A;  3MPK A;  4RY1 A;  4E0W A;  3O66 A;  3VVD A;  4BDQ A;  5A5X A;  3MP1 A;  4ELQ A;  1MDP 1;  3UGW A;  3T22 A;  1EH3 A;  1MDQ A;  5CMC A;  1SW5 A;  4KR5 A;  4PP0 A;  1N76 A;  4YB7 A;  4JDF A;  3KOS A;  1URD A;  2XXT A;  1SW2 A;  2Q2A A;  3C32 A;  5JTY A;  4C1T A;  3KSX A;  1N04 A;  3PD8 A;  4XKQ A;  3OSR A;  1L5T A;  4PE5 B;  2GHB A;  1SDX A;  4OFJ A;  4EF1 A;  3R26 A;  3PPP A;  1MH4 A;  3TTR A;  1PBQ A;  2I6E A;  4IY5 A;  1QUK A;  1XHY A;  1SYH A;  2I58 A;  2XX9 A;  3CG1 A;  3IR1 A;  5FTI A;  3S2V A;  3C9H A;  5I59 B;  2Z8E A;  4BDN A;  1ELJ A;  2HEU A;  1JEU A;  2H99 A;  3W9W A;  1P1W A;  4ZS9 A;  4RNS A;  2V93 A;  1QKA A;  3KFM A;  3TTN A;  2ESN A;  2QSX A;  5AA4 B;  4OHN A;  4YKP A;  1SW1 A;  2PX1 A;  4GLI A;  1O63 A;  3T9H B;  1TXF A;  3PPQ A;  1R1N A;  2GFE A;  2GHA A;  3KEI A;  4K3F A;  1AL3 A;  1P1N A;  4KPT A;  3SES A;  4DIG A;  1DOT A;  1A54 A;  4R72 A;  4LA9 A;  4FE8 A;  3T9X B;  2VD3 A;  1OMP A;  1LLS A;  1OLA A; 
#chains in the Genus database with same CATH topology
 1ZIU A;  4X04 A;  5T3J A;  4QFN A;  1MPD A;  5H8H B;  4U22 A;  1N0T A;  1Y4C A;  1I6A A;  4IO6 A;  2HCA A;  4O3A A;  3N5L A;  3U1O A;  1PB7 A;  2R6G E;  1Y1Z A;  1POY 1;  3OOA A;  2Y7W A;  4ZE9 A;  4R9G A;  3KZG A;  1Y4T A;  4U23 A;  1JVY A;  2ZXT A;  3E9X A;  5A5X B;  1B0H A;  4G2Z A;  4KQP A;  2DE2 A;  2Q8J A;  4OZ9 A;  1JQF A;  4FED A;  3DM0 A;  1OLC A;  4XKN A;  3OEL A;  2XXY A;  5L8D A;  3EKI A;  3SEU A;  4DLD A;  1A8E A;  4NF8 B;  1N84 A;  3PGF A;  3D4C A;  2QMX A;  5AA1 A;  1AH5 A;  3IO4 A;  4DCX A;  1M5D A;  1LST A;  4LAT A;  2OJT A;  4KI0 E;  4NED A;  4G8N A;  4N15 A;  5DTB A;  2L5V A;  1II5 A;  3LUY A;  2F36 A;  1IMA A;  4XXU A;  3PV0 E;  2PBW A;  4OVP A;  4NF6 A;  2Q2C A;  2F7B A;  3JYR A;  2DS9 A;  3RT6 B;  1AMF A;  4DZ1 A;  3TEL A;  4IO3 A;  4GWU A;  4YB5 A;  5EQ9 A;  1CNQ A;  2F78 A;  4NF8 A;  2QS2 A;  3MZB A;  1UTB B;  4YMB A;  4RPO A;  5ISU A;  5ESY A;  1JW1 A;  1B46 A;  4RJZ A;  1FBC A;  5I56 A;  3S9M C;  3S9E A;  3CIJ A;  2ONS A;  2F7C A;  1UQW A;  1H43 A;  4OA4 A;  1AOV A;  2YJP A;  4OMB A;  4C1U A;  5CM6 A;  2HFB A;  4IY6 A;  3DP8 A;  3QSL A;  2Y84 A;  3QUJ A;  3O29 A;  4ND9 A;  3TZA A;  3OD7 A;  2Z22 A;  4ELO A;  4MLQ A;  2Q74 A;  1CB6 A;  1KWH A;  1IXC A;  5AA3 A;  3FXR A;  3RLF E;  3ODB A;  4C0R A;  1NUY A;  4JWO A;  1Z7M E;  1A8F A;  2F34 A;  1M5E A;  1S7Y A;  1CE2 A;  4JWX A;  4KYS A;  2HZK A;  1ANF A;  4P0G A;  4PC9 A;  2DVC A;  4POX A;  1MRP A;  1Y20 A;  1T0K A;  2O6A A;  2XWO A;  1A40 A;  2V84 A;  4PFT A;  3ZKL A;  4BDL A;  3TTL A;  3Q28 A;  4NN3 A;  3USD A;  1NFT A;  3H06 B;  1B3F A;  1A55 A;  1SQY A;  3RTW B;  4H65 A;  4GBW A;  4OXV A;  4PFR A;  2QMW A;  4H1X A;  3H4Z A;  4YKK A;  2P1S A;  3EF7 A;  4ZED A;  1FTL A;  1NI9 A;  4NHB A;  4OVS A;  2A5T B;  1DPP A;  4LZ7 A;  1B2H A;  4GWS A;  1OQG A;  1FQD A;  4G77 A;  2REG A;  1KZ8 A;  4MF3 A;  4OFO A;  5H8Q A;  4H0W A;  2V4C A;  4NF4 B;  1HSE A;  2P3N A;  1M5F A;  3T9V A;  3IB0 A;  4AQ4 A;  3CI8 A;  1DBZ A;  3U72 A;  4UAB A;  3H7M A;  1IIW A;  1MG1 A;  2MKZ A;  4OET A;  5CRY A;  4H45 A;  3SEX A;  4BDR A;  3MC2 A;  5IZ3 A;  3THI A;  3QAX A;  3EN3 A;  3KJT A;  1JNF A;  1VSO A;  5FTH A;  4PCD A;  1UTB A;  1B52 A;  3B6Q A;  3C33 A;  4GWX A;  1XVY A;  5IGA A;  4OTE A;  4PET A;  3U8Q A;  2F7A A;  3OEN A;  1LBV A;  1BIY A;  1M5B A;  3C4M A;  3R7X A;  3LR1 A;  4KCC A;  1TFA A;  3C35 A;  2H9B A;  5FHN A;  2X7Q A;  2I49 A;  4ZE8 A;  2H4I A;  5AA4 A;  1PEB A;  3H6V A;  3G7W A;  1POT A;  3HHG A;  4H8J A;  3WAE A;  5CMM A;  4QRZ A;  3TUS A;  2DXY A;  2O7I A;  3ZKK A;  1S9T A;  3TQW A;  5I2K B;  4I8C A;  3M3F A;  3IJX B;  3GXA A;  1H3D A;  5EQ7 A;  4EDP A;  5LDZ A;  3MST A;  5LOM A;  2DYX A;  1RDZ A;  2RF1 A;  2Z8D A;  4LQ5 A;  3M3K A;  4BDM A;  4G4P A;  1K9Y A;  3MYU A;  2R71 A;  4MNP A;  4F1U A;  1VR5 A;  3RQT A;  1NUW A;  3JV9 A;  3W15 C;  1MXZ A;  2CZK A;  2F5X A;  1LGB C;  3CSG A;  4FEB A;  3S9N C;  2HPG A;  1B3E A;  1DCU A;  3OO8 A;  5H8F A;  1JVX A;  4BLA A;  2UVJ A;  5L9M A;  1BK4 A;  4F3P A;  4X48 A;  4X1D A;  4TLM B;  1O7T A;  4M1V A;  2B3B A;  3K1N A;  1IMD A;  2KLF A;  1BKA A;  4ZDM A;  2I0C A;  2Y7K A;  3FD3 A;  1DSN A;  3QXM A;  4HE2 A;  3UOR A;  1DTZ A;  4DI3 D;  3MZ1 A;  4E0W A;  3O66 A;  5A5X A;  1EH3 A;  5CMC A;  4KR5 A;  1IMF A;  4JDF A;  1FBD A;  1URD A;  1SW2 A;  5JTY A;  3PD8 A;  1N04 A;  2P3V A;  1EYI A;  3R26 A;  5FTI A;  5I59 B;  5EYH A;  1JEU A;  1P1W A;  4RNS A;  1SPI A;  2ESN A;  2OX3 A;  2PX1 A;  4GLI A;  3PPQ A;  1R1N A;  3SES A;  3T9X B;  1LLS A;  1JP4 A;  3GZG A;  4N91 A;  2Q88 A;  4N13 A;  1Z7N E;  1EYK A;  3EHU A;  4PE3 A;  1IIT A;  5KDT B;  1MM7 A;  3I6V A;  1B3G A;  4GFR A;  3CR9 A;  1B0L A;  3KN7 A;  2ALU A;  2IA4 A;  3K00 A;  4QSD A;  1PB8 A;  3OO6 A;  3E4R A;  1LEV A;  2WBD A;  5AA2 B;  3DEL B;  4F3B A;  5I58 B;  1PC3 A;  3K1P A;  4MMP A;  4QFK A;  1FTK A;  1FQB A;  2ZZV A;  1FQF A;  2DE4 A;  4RPN A;  4G68 B;  4OVQ A;  2XHD A;  5ET7 A;  4NAP A;  2CEX A;  4AS5 A;  5KCJ B;  2DOJ A;  2F3D A;  1LAG E;  4PBQ A;  2DP8 A;  4LZ8 A;  3IX1 A;  4QFP A;  1G0I A;  1QUL A;  1YPN A;  3HCQ A;  4AB6 A;  1FTA A;  4YZZ A;  2O68 A;  1LBY A;  3PMW A;  1TFD A;  4DXU A;  1YZ0 A;  4ELP A;  1YCJ A;  4N6P A;  4F1V A;  4U21 A;  2Y5L A;  5H8S A;  3TCH A;  2O84 X;  4EQ7 A;  4FAT A;  1MY4 A;  5HPQ A;  2ZYO A;  1SYI A;  4I40 A;  4JSO A;  4PFU A;  2GH9 A;  1UIV A;  2RKM A;  2XXU A;  4GXS B;  3G3J A;  1YXI A;  3A09 A;  3TPA A;  3FXQ A;  4NF0 A;  2WYK A;  4QSE A;  3V83 A;  4AS4 A;  3U93 A;  2XXX A;  3K6V A;  5KCJ A;  1MM6 A;  1D9V A;  1QVS A;  1XC1 A;  3DP6 A;  3N6U A;  4ZEI A;  3C31 A;  1EZO A;  2CZH A;  1QJM A;  2F35 A;  1LBX A;  4F3S A;  3BIG A;  2B4M A;  4HE0 A;  2VGQ A;  3A3U A;  3GLB A;  3G3I A;  1AIV A;  1VFE A;  4Q0C A;  3VE1 B;  1PB9 A;  4OER A;  2QS1 A;  3TDJ A;  3HFU A;  1BLF A;  1NNF A;  4QHQ A;  1MXX A;  3KC0 A;  2D21 A;  1H45 A;  2RCB A;  1OQH A;  3ZSF A;  1BTJ A;  1IXG A;  4TOZ A;  4GX4 A;  4EQ9 A;  1MS7 A;  3Q25 A;  4F31 B;  1NKX A;  1FPG A;  4KYE A;  5JK4 A;  5EYF A;  3S9L C;  2OWT A;  4NGU A;  4FBP A;  1O64 A;  3LSX A;  5ICQ A;  4U1O A;  4H67 A;  4OFL A;  1MQD A;  1K9Z A;  1WDN A;  2PVU A;  4R74 A;  4JBZ A;  4Z0I A;  2I48 A;  3C36 A;  3K1M A;  1MH3 A;  1URS A;  2FHY A;  2ANJ A;  2XX8 A;  2Q8M A;  2XXH A;  2XXW A;  4PFB A;  2PMS A;  5CBS A;  2DQV A;  2HQ0 A;  1B6H A;  4GQO A;  1FQE A;  3H6T A;  3TTM A;  4PAK A;  3KGC A;  4P1E A;  1NV2 A;  4YMA A;  1Q1K A;  3KBR A;  4MHF A;  3FVO A;  5H8N A;  5DVI A;  2BJJ X;  2I0B A;  4PFI A;  5EQ8 A;  5CI5 A;  3TMG A;  1QUI A;  1UIU A;  2P2A A;  4PFY A;  3MPL A;  3K0V A;  4E0X A;  2FIE A;  4ELR A;  3BKI B;  3NOH A;  1IQ7 A;  2I4C A;  3LSF B;  2Y5K A;  5H8F B;  4N8Y A;  3UN6 A;  1MQJ A;  4HCW A;  4IGR A;  4I1D A;  2WX9 A;  3R6U A;  3IO6 A;  2W7Y A;  1JW5 A;  1XVX A;  3VXB A;  4NWD A;  5F7V A;  4I3Y A;  4NTL A;  3RY3 A;  1VDW A;  3B6T A;  3TYH A;  2RCA A;  1FJ9 A;  1SVX B;  3H3G A;  5ELV A;  4NG7 A;  5CMB A;  5DEX A;  3S4U A;  3CRB A;  3RPW A;  1NMU A;  4TQU Q;  1NH7 A;  1VE4 A;  5I2N A;  4IO4 A;  1D4N A;  4XIG Q;  3G3H A;  2CZI A;  4YKJ A;  4DDD A;  5L9O A;  2UVG A;  4IB2 A;  4NE4 A;  4QSC A;  5F1Q A;  1S50 A;  2FYI A;  1FPF A;  4X9T A;  4OVR A;  4YU0 A;  4NF5 B;  2PFZ A;  4FJP A;  3TCG A;  2OBG A;  3O6G A;  3VVE A;  2DWH A;  1FTM A;  3IB1 A;  5TP9 B;  2G93 A;  3RPL A;  3FJG A;  4PAF A;  2ZZX A;  4GWZ A;  4ECF A;  4OWD A;  4QBA A;  1MXV A;  1LAX A;  1FW0 A;  4Q5T A;  1QUJ A;  2HAU A;  3O6I A;  3I5O A;  1B5J A;  5ET5 A;  1SBP A;  1LFG A;  1DTG A;  1USY E;  1LB9 A;  4YB6 A;  4I9D A;  3CFZ A;  2DWI A;  1XI6 A;  5K2Y A;  4ZZA A;  4GWW A;  1US4 A;  3MQ9 A;  3OXN A;  1NV3 A;  4OEV A;  4Q30 B;  4NF6 B;  1IXH A;  3IK6 B;  1D9Y A;  3SEY A;  5AA2 A;  5H8Q B;  1UTH B;  3KJ7 A;  4MIJ A;  4U4S A;  4G68 C;  4MNC A;  3T93 B;  1N7X A;  4ONY A;  4FEC A;  4OAN A;  4RY1 A;  4BDQ A;  4MEV A;  1MDP 1;  3UGW A;  3KOS A;  2Q2A A;  3C32 A;  4C1T A;  3KSX A;  1L5T A;  4PE5 B;  2GHB A;  1SDX A;  5EYG A;  4OFJ A;  4PGN A;  1RDY A;  1PBQ A;  1XHY A;  1SYH A;  3S2V A;  2Z8E A;  1ELJ A;  2V93 A;  2XXK A;  4YKP A;  1O63 A;  3T9H B;  1TXF A;  3KEI A;  4DIG A;  1DOT A;  1A54 A;  4LA9 A;  1OMP A;  4YB7 A;  1INP A;  2G29 A;  2X7P A;  4NF5 A;  4OEN A;  2ZNU A;  3MVY A;  1DPE A;  1FCK A;  1QGX A;  3IL1 B;  4DE8 A;  1MXY A;  3LV0 A;  2AYS A;  3ECR A;  3EPE A;  5EHS A;  2H5Y A;  3E3K A;  3KC1 A;  4GX6 A;  1Y3Q A;  2A5T A;  4KD5 A;  3CVG A;  4P56 A;  3HO7 A;  3RNN A;  1IMB A;  4TLL B;  1TT1 A;  4ISU A;  1LCT A;  4P3L A;  4OEU A;  4G61 A;  1LAH E;  1FBE A;  1MXW A;  2ZNT A;  2XXI A;  3TFL A;  1FQA A;  1B7Z A;  2Q89 A;  4IO7 A;  4R75 A;  1LBB A;  2E0S A;  1NV7 A;  3CFX A;  3IOR A;  4H5F A;  1LFI A;  5JEI A;  1NV4 A;  4JVD A;  4GWY A;  4RK2 A;  4QXD A;  2YLN A;  3EQ1 A;  1LBW A;  2FIX A;  4PGP A;  2R9J A;  2KQZ A;  1P1Q A;  1MY1 A;  2QS4 A;  2RC7 A;  3O2A A;  3HST A;  3G3K A;  3PUZ E;  5TPA B;  4R9F A;  3C34 A;  1VFD A;  1NH8 A;  4ZZE A;  4YIC A;  1NV5 A;  1BP5 A;  4O7I A;  2PT1 A;  1LFH A;  3OMB A;  1ZJL A;  4H8I A;  4HCY A;  4X8R A;  2XXQ A;  1NV6 A;  2HZL A;  1OIB A;  5B70 A;  1NNK A;  3TOD A;  3A3C A;  2QPQ A;  4P47 A;  4NWC A;  2DVZ A;  4EXL A;  2M8C A;  5F24 A;  2CMO A;  1GV8 A;  2ZYK A;  3H03 A;  1IMC A;  4GWO A;  3FVG A;  4P11 A;  2DE3 A;  1SD3 A;  3F11 A;  5TPA A;  2V3U A;  1FPB A;  3PMX A;  5J16 A;  4XF5 A;  2UVH A;  4EQB A;  3FV2 A;  2VT5 A;  3QIM A;  3MP6 A;  1FRP A;  4XKP A;  4DCY A;  4R6Y A;  4R6H A;  1ZU0 A;  1IZ1 A;  2RC9 A;  3W9V A;  5CBR A;  1LBC A;  3QMF A;  3SER A;  3IOT A;  3IB2 A;  3LBS A;  5I7I A;  1B5I A;  5DT6 A;  1TWY A;  3K01 A;  1ZKB A;  4NF4 A;  5EHM A;  5TP9 A;  2OWS A;  4ZEF A;  4R6K A;  2WBB A;  1B40 A;  5H8H A;  1SI1 A;  2WEF A;  1B05 A;  3IJO B;  3QUF A;  1FJ6 A;  1R6Z A;  3T66 A;  3FJ7 A;  2KR0 A;  1ZBM A;  4JVC A;  3FZV A;  1B1X A;  3T0J A;  2F97 A;  2DWA A;  2OLB A;  2A5S A;  3LSW A;  5I2N B;  3KOT A;  1A99 A;  2QL3 A;  5I3S A;  1YTV A;  1US5 A;  3SDF A;  1MPC A;  1P1U A;  4Z7E A;  2UVI A;  1IUD A;  4I3E A;  1NV1 A;  4IR8 A;  4N4U A;  3RUM A;  2RC8 A;  4ZEB A;  1RDX A;  1B7H A;  4U1Z A;  5BWJ A;  2WYP A;  3O28 A;  2O7U A;  4M4G A;  2XX7 A;  4XEQ A;  1B3H A;  3FJM A;  5I56 B;  1H44 A;  1SI0 A;  5I57 A;  4XFE A;  2V3T A;  1KA1 A;  3H6W A;  3CSB A;  1KA0 A;  2VD2 A;  2X26 A;  2PYY A;  3BIH A;  2QS3 A;  4WKM A;  2IEE A;  2GRV A;  4I62 A;  4WXJ A;  3Q29 A;  3U65 A;  3OO9 A;  1P99 A;  2I3V A;  4MLV A;  2QVV A;  4JVI A;  3RPL B;  3T1B A;  3GYY A;  2AL5 A;  3LUZ A;  2O69 A;  4KXP A;  3VLW A;  2B3F A;  1USY H;  2VHA A;  4JSD A;  1J1N A;  3BFT A;  2DSF A;  5IM2 A;  3K6U A;  3ROJ A;  1EZP A;  1HSL A;  3EHT A;  2QJE A;  4O7M A;  1IME A;  3B7D A;  4KCD A;  2QVR A;  5A5L A;  1D9Q A;  3K02 A;  3T96 B;  1NNT A;  4ZEC A;  5KZT A;  3UIF A;  3QK6 A;  4PF6 A;  4DI4 B;  4MFI A;  3TAJ A;  3FXU A;  3PPN A;  1QW0 A;  2ABH A;  1GR2 A;  2F3B A;  3K2D A;  1RKM A;  4GL8 A;  2XXP A;  3RN8 A;  3FV1 A;  4POW A;  4N17 A;  1DMB A;  2O1M A;  3IOV A;  1NUZ A;  2CZL A;  1FTO A;  2R8T A;  3JZJ A;  1JET A;  3B6W A;  1FTJ A;  4N07 A;  3RYD A;  2OWZ A;  4O94 A;  3B8B A;  4XTC Q;  4THI A;  5AE4 A;  5DYH A;  4WED A;  3V8X B;  4F29 A;  1B9J A;  4KFQ A;  4YAH X;  1MQI A;  1XOC A;  2Q9T A;  1B5H A;  4MBP A;  2PCR A;  4NQ8 A;  4F1Y A;  3IAZ A;  4IO5 A;  2PT2 A;  3VV5 A;  2VP1 A;  2Y7I A;  5DEX B;  1MY2 A;  4G68 A;  4LUB A;  5FHM A;  4MNI A;  2QVU A;  4ZEK A;  4Q8R A;  4P0I A;  4UA8 A;  5ET8 A;  4F3G A;  3IFA A;  3CG3 A;  2F8D A;  2V25 A;  1WOD A;  2RIN A;  3N94 A;  4GXA A;  2AIX A;  4JXI A;  4GIZ A;  3U94 A;  3D4G A;  1H76 A;  3PUX E;  4MH5 A;  1B32 A;  4QFO A;  3IOU A;  4PDH A;  4R73 A;  1LB8 A;  2D5W A;  3IOW A;  1ZMG A;  3UK4 A;  1NUX A;  3MPK A;  3T22 A;  2XXT A;  4XKQ A;  3OSR A;  2XWI A;  2XWK A;  4EF1 A;  3PPP A;  1MH4 A;  3TTR A;  4IY5 A;  3IR1 A;  1G0H A;  4P8B A;  2H99 A;  4GBV A;  1QKA A;  3TTN A;  2QSX A;  5AA4 B;  4OHN A;  1SW1 A;  2GHA A;  2GFE A;  1AL3 A;  1P1N A;  4HXV A;  3ISP A;  4FE8 A;  1F9B A;  4ESW A;  1N7W A;  5ITP A;  2XA5 A;  5CMK A;  5I58 A;  3CFL A;  1HSJ A;  5DVF A;  4EF2 A;  3HN0 A;  5FBP A;  2Z8F A;  4GF8 A;  3BBR A;  2XD2 A;  4RK9 A;  4FAJ A;  3SZP A;  4OES A;  3WAF A;  5K2X A;  4WEP A;  2ONR A;  1OVB A;  1FPJ A;  3E79 A;  4P1L A;  5KDT A;  1YAE A;  4GL0 A;  1MXU A;  4JB7 A;  3D1R A;  4H6D A;  4HW8 A;  5I57 B;  5EQA A;  1N3X A;  4GVO A;  1GGG A;  1B3L A;  4RA1 A;  3RTF B;  2CEY A;  3VLU A;  5IKB A;  3PUW E;  3MVZ A;  2HAV A;  3G3F A;  1UTH A;  2GQ1 A;  4RYA A;  3RT8 A;  2NXO A;  5TU0 A;  5I59 A;  3MVX A;  1ATG A;  3TTK A;  5DVJ A;  2YPN A;  4FIM A;  1M5C A;  3MVW A;  1MY0 A;  1I6Q A;  3KSJ A;  1R9L A;  2DWJ A;  1Y3P A;  3G3G A;  1P1O A;  1B1H A;  1LAF E;  2FA7 A;  3PUV E;  1MY3 A;  3MWB A;  4H5G A;  4F19 A;  3I3V A;  4F2Q A;  2VPN A;  4XKR A;  3PTY A;  5I2K A;  2B65 A;  3IFC A;  4G8H A;  3QYT A;  3VLV A;  3VFJ A;  3PU5 A;  4GOT A;  4NMY A;  5IZZ A;  3N6T A;  4F18 A;  3KG2 A;  1PBP A;  2WKY A;  3ILU B;  4H46 A;  2FNC A;  3MJN A;  2ZYM A;  4IGT A;  4YKI A;  3MUQ A;  3PPR A;  3VDF A;  3CHG A;  3N26 A;  5IAI A;  2LAO A;  2NUV A;  4N6D A;  2NWJ A;  3FIR A;  3KN3 A;  3PD9 A;  4QF9 A;  3OEK A;  3P7I A;  1FPK A;  4N81 A;  5I84 A;  1FBG A;  1B4H A;  1FPL A;  2O51 A;  3SET A;  2Y7R A;  1XT8 A;  3U92 A;  3EHS A;  4GD5 A;  1WVJ A;  3M8U A;  1FPI A;  2P0S A;  3RGY A;  3ILT B;  4LZ5 A;  3DP4 A;  5DW8 A;  4L17 A;  3LC8 A;  2XWV A;  1QKB A;  4ESX A;  1FBF A;  3K6W A;  5FHO A;  3OO7 A;  2ZNS A;  4PFW A;  5ITO A;  2I3W A;  2REJ A;  1B51 A;  3TKD A;  4DXB A;  1RYX A;  2ONK E;  2DXR A;  3FVN A;  3T9U A;  2F6P A;  4O3B A;  2NOO A;  1Q35 A;  1LCF A;  4OVJ A;  3FUZ A;  3ZS6 A;  3SEW A;  4R2B A;  2V3Q A;  3PMV A;  1Y3N A;  1PDA A;  4F2O A;  4MAG A;  4O3C A;  3BFU A;  5IZ3 B;  1GTK A;  3MBP A;  4PBH A;  4LQ2 A;  2H98 A;  4HS7 A;  3OEM A;  1B4Z A;  4PTK A;  3E78 A;  1NNP A;  1FPD A;  1D3K A;  1NL5 A;  3HHF A;  4P9K A;  2XXV A;  3M3L A;  4RXL A;  2ZMB A;  1XS5 A;  2THI A;  5JTY B;  1AWB A;  2FVZ A;  3AXF A;  5M2V A;  1SW4 A;  2VOZ A;  4MJO A;  3FXB A;  4HE1 A;  3V89 B;  4DXC A;  3HV1 A;  1ZLQ A;  1FQC A;  3E13 X;  4PF8 A;  1GVC A;  5CC2 A;  3KN8 A;  1I69 A;  2OK2 A;  2D3I A;  2PFY A;  3O97 A;  4OQO A;  1EU8 A;  2O1L A;  2I4B A;  3PUY E;  3Q27 A;  2XXR A;  4AB5 A;  1Y9U A;  3L6H A;  4GX3 A;  1R9Q A;  2H25 A;  4BDO A;  5J1D A;  2QRY A;  5ET6 A;  3K4U A;  5LTC A;  3K6X A;  2F6G A;  4LN5 A;  4JWY A;  3FAS A;  4KHZ E;  2JJK A;  4NX1 A;  1YYZ A;  3VXC A;  5BUU A;  1RYO A;  4FOR A;  4PQJ A;  2Z23 A;  1I6B A;  4R2F A;  2UYE A;  4X1B A;  1JEV A;  1MQG A;  1MPB A;  5HBC A;  3TCF A;  3SEV A;  3TQL A;  3ONM A;  2HXR A;  4EUO A;  1JW4 A;  4PAI A;  3V5A A;  3MP8 A;  1DK4 A;  4U2R A;  4GRK A;  1MQH A;  2NVU B;  1A7L A;  3O9P A;  1ZTY A;  5IZ1 A;  2UXA A;  2QFL A;  3FGS A;  4F22 A;  4EXK A;  5L9S A;  2HHM A;  2Y7P A;  5AA2 D;  2OCU A;  4F39 A;  1Y1M A;  1IEJ A;  3UP9 A;  3MAM A;  2ZYN A;  4OYV A;  3O6H A;  1B58 A;  4HTG A;  1FBH A;  3FVK A;  4KYD A;  1FBP A;  3TEP A;  5B7D A;  4LP2 B;  5ICT A;  3GBA A;  4N6K A;  2UYF A;  4IO2 A;  1FPE A;  1N3W A;  3MZ9 A;  3H6U A;  4UAC A;  1EYJ A;  4OVT A;  3HPI A;  3DLN A;  3MW0 A;  4MX6 A;  4G8M A;  2XD3 A;  5HM4 B;  3LSL A;  3Q26 A;  3UA8 A;  2FBP A;  3SKP A;  3VVF A;  2OZZ A;  3L6G A;  2AL4 A;  4LON B;  1URG A;  4LVQ A;  4QFL A;  2ZZW A;  2E1S A;  1OVT A;  3OSQ A;  3FBP A;  3GBB A;  3PPO A;  1FSA A;  4MCO A;  1EZ9 A;  4U4X A;  5H8N B;  1NV0 A;  1B7U A;  2VPO A;  2B4L A;  4N8G A;  3B50 A;  3FAT A;  2BJI A;  2HXW A;  1IXI A;  3VVD A;  3MP1 A;  4ELQ A;  1MDQ A;  1SW5 A;  4PP0 A;  1N76 A;  2DDK A;  2I6E A;  1Q9D A;  1QUK A;  2I58 A;  2XX9 A;  3CG1 A;  3C9H A;  4BDN A;  3KBZ A;  2HEU A;  3W9W A;  4O8M A;  3A29 A;  4ZS9 A;  3KFM A;  4PDD A;  1LBZ A;  5I5P A;  4K3F A;  4KPT A;  4R72 A;  2VD3 A;  1OLA A; 
#chains in the Genus database with same CATH homology
 4ESW A;  1N7W A;  5ITP A;  1ZIU A;  4QFN A;  2G29 A;  3GZG A;  2Q88 A;  2X7P A;  4NF5 A;  1MPD A;  4N13 A;  1Z7N E;  4OEN A;  2ZNU A;  4U22 A;  5H8H B;  3EHU A;  5CMK A;  1N0T A;  1IIT A;  3MVY A;  5I58 A;  1DPE A;  1FCK A;  1MM7 A;  3CFL A;  1HSJ A;  3IL1 B;  5DVF A;  4DE8 A;  1Y4C A;  4EF2 A;  3HN0 A;  1MXY A;  3I6V A;  2Z8F A;  1B3G A;  1I6A A;  3BBR A;  4GFR A;  4GF8 A;  2XD2 A;  3CR9 A;  2AYS A;  1B0L A;  4IO6 A;  2HCA A;  3ECR A;  2ALU A;  3EPE A;  3KN7 A;  4O3A A;  2IA4 A;  4RK9 A;  5EHS A;  3N5L A;  3U1O A;  1PB7 A;  2H5Y A;  3E3K A;  2R6G E;  4FAJ A;  3K00 A;  1Y1Z A;  1POY 1;  1Y3Q A;  2A5T A;  3OOA A;  1PB8 A;  4KD5 A;  4QSD A;  4OES A;  3OO6 A;  3WAF A;  3CVG A;  5K2X A;  4WEP A;  3E4R A;  3HO7 A;  2Y7W A;  2ONR A;  4ZE9 A;  5AA2 B;  3RNN A;  1OVB A;  4R9G A;  3KZG A;  3DEL B;  4F3B A;  1Y4T A;  4TLL B;  4U23 A;  1TT1 A;  4AB6 A;  5I58 B;  1JVY A;  5KDT A;  1PC3 A;  1YAE A;  4ISU A;  1LCT A;  2ZXT A;  3E9X A;  3K1P A;  4GL0 A;  1MXU A;  4OEU A;  5A5X B;  1LAH E;  1MXW A;  4QFK A;  1FTK A;  1FQB A;  1B0H A;  2ZNT A;  4JB7 A;  2XXI A;  1FQF A;  4G2Z A;  4KQP A;  2DE2 A;  2Q8J A;  4H6D A;  4OZ9 A;  2DE4 A;  1FQA A;  1B7Z A;  2Q89 A;  1JQF A;  4IO7 A;  4FED A;  5I57 B;  3DM0 A;  4R75 A;  4RPN A;  1OLC A;  4XKN A;  4G68 B;  1LBB A;  1N3X A;  3OEL A;  4GVO A;  1GGG A;  2E0S A;  2XXY A;  3CFX A;  1B3L A;  2XHD A;  5L8D A;  3SEU A;  4DLD A;  1A8E A;  3IOR A;  4RA1 A;  3RTF B;  4H5F A;  4NF8 B;  1LFI A;  1N84 A;  3VLU A;  3PGF A;  3D4C A;  3MVZ A;  3PUW E;  5IKB A;  2QMX A;  5AA1 A;  5JEI A;  2HAV A;  1AH5 A;  3G3F A;  1UTH A;  3IO4 A;  4RK2 A;  2YLN A;  3EQ1 A;  4RYA A;  4DCX A;  1M5D A;  1LST A;  4LAT A;  3RT8 A;  2NXO A;  2DOJ A;  5KCJ B;  2OJT A;  4KI0 E;  4NED A;  5TU0 A;  5I59 A;  1LAG E;  3MVX A;  1ATG A;  4G8N A;  3TTK A;  2DP8 A;  2YPN A;  5DVJ A;  4LZ8 A;  5DTB A;  2R9J A;  3IX1 A;  1II5 A;  4FIM A;  4QFP A;  1M5C A;  1QUL A;  3MVW A;  1YPN A;  1MY0 A;  3HCQ A;  3LUY A;  2F36 A;  1P1Q A;  4XXU A;  1I6Q A;  3KSJ A;  3PV0 E;  1MY1 A;  2PBW A;  2QS4 A;  4YZZ A;  2O68 A;  2RC7 A;  3O2A A;  4NF6 A;  1R9L A;  2DWJ A;  2F7B A;  1Y3P A;  2Q2C A;  1TFD A;  3G3G A;  3JYR A;  3PMW A;  3HST A;  2DS9 A;  3G3K A;  1P1O A;  3PUZ E;  1B1H A;  1LAF E;  4R9F A;  5TPA B;  2FA7 A;  3RT6 B;  1AMF A;  4DXU A;  4ELP A;  4DZ1 A;  1YCJ A;  4N6P A;  3PUV E;  3C34 A;  1MY3 A;  3MWB A;  1VFD A;  3TEL A;  4F1V A;  4H5G A;  4U21 A;  4F19 A;  3I3V A;  4IO3 A;  4F2Q A;  1NH8 A;  5H8S A;  4ZZE A;  4XKR A;  3TCH A;  2O84 X;  4EQ7 A;  5I2K A;  4FAT A;  1MY4 A;  2B65 A;  4YB5 A;  4G8H A;  2F78 A;  3QYT A;  4YIC A;  4NF8 A;  5HPQ A;  2ZYO A;  1SYI A;  2QS2 A;  3MZB A;  1UTB B;  1BP5 A;  3VLV A;  2PT1 A;  3VFJ A;  4JSO A;  4YMB A;  1LFH A;  3PU5 A;  4RPO A;  3OMB A;  4GOT A;  5ISU A;  1ZJL A;  4NMY A;  4H8I A;  4PFU A;  4HCY A;  2GH9 A;  1JW1 A;  1UIV A;  2RKM A;  1B46 A;  2XXU A;  3N6T A;  2XXQ A;  4RJZ A;  4F18 A;  4GXS B;  2HZL A;  1OIB A;  1PBP A;  2WKY A;  1NNK A;  3G3J A;  3ILU B;  3KG2 A;  5B70 A;  3CIJ A;  3TOD A;  3A3C A;  2FNC A;  2ONS A;  3A09 A;  2QPQ A;  3TPA A;  3S9E A;  2F7C A;  3FXQ A;  1UQW A;  3MJN A;  4NWC A;  1H43 A;  2ZYM A;  4IGT A;  4YKI A;  2DVZ A;  4QSE A;  2M8C A;  3MUQ A;  3PPR A;  4EXL A;  3V83 A;  3U93 A;  2XXX A;  3K6V A;  3VDF A;  1AOV A;  3N26 A;  5IAI A;  2LAO A;  2YJP A;  2NUV A;  5KCJ A;  2CMO A;  4OMB A;  2NWJ A;  1MM6 A;  1GV8 A;  2ZYK A;  3FIR A;  1D9V A;  3H03 A;  3KN3 A;  4C1U A;  3PD9 A;  4QF9 A;  3OEK A;  5CM6 A;  1QVS A;  1XC1 A;  3DP6 A;  3N6U A;  2HFB A;  3P7I A;  3C31 A;  4ZEI A;  5I84 A;  1EZO A;  4GWO A;  3FVG A;  4IY6 A;  4P11 A;  2DE3 A;  1QJM A;  3DP8 A;  2F35 A;  3QSL A;  4F3S A;  1SD3 A;  3F11 A;  2Y84 A;  3QUJ A;  5TPA A;  3O29 A;  1B4H A;  2V3U A;  4ND9 A;  3PMX A;  2VGQ A;  3A3U A;  2UVH A;  4EQB A;  3FV2 A;  3GLB A;  2O51 A;  3QIM A;  3SET A;  3MP6 A;  3TZA A;  3OD7 A;  2Y7R A;  3G3I A;  2Z22 A;  1XT8 A;  4XKP A;  4DCY A;  4ELO A;  4R6Y A;  4MLQ A;  4R6H A;  1AIV A;  1ZU0 A;  1IZ1 A;  1VFE A;  2RC9 A;  3U92 A;  1CB6 A;  3EHS A;  1KWH A;  4Q0C A;  3VE1 B;  1PB9 A;  3W9V A;  1IXC A;  5CBR A;  4OER A;  4GD5 A;  5AA3 A;  2QS1 A;  3TDJ A;  3FXR A;  1LBC A;  3RLF E;  3ODB A;  3SER A;  4C0R A;  1WVJ A;  1Z7M E;  3M8U A;  4JWO A;  1A8F A;  2F34 A;  1BLF A;  2P0S A;  3IB2 A;  3ILT B;  1M5E A;  1NNF A;  3IOT A;  1S7Y A;  3LBS A;  4LZ5 A;  4QHQ A;  1MXX A;  1CE2 A;  2D21 A;  1H45 A;  3DP4 A;  2RCB A;  1B5I A;  1OQH A;  4L17 A;  4JWX A;  3ZSF A;  5DT6 A;  1BTJ A;  1IXG A;  3LC8 A;  4KYS A;  4TOZ A;  2HZK A;  1TWY A;  4EQ9 A;  1MS7 A;  1QKB A;  1ANF A;  3Q25 A;  3K6W A;  4ESX A;  4P0G A;  3K01 A;  1ZKB A;  4NF4 A;  5EHM A;  5TP9 A;  4F31 B;  5FHO A;  1NKX A;  2DVC A;  4POX A;  3OO7 A;  2OWS A;  4ZEF A;  1MRP A;  2ZNS A;  4R6K A;  1B40 A;  5H8H A;  1SI1 A;  1Y20 A;  1T0K A;  2O6A A;  4KYE A;  5JK4 A;  4PFW A;  5ITO A;  1A40 A;  5EYF A;  2V84 A;  3S9L C;  2OWT A;  4PFT A;  2I3W A;  3ZKL A;  2REJ A;  1B51 A;  1B05 A;  3TKD A;  4DXB A;  1O64 A;  3LSX A;  5ICQ A;  1RYX A;  4BDL A;  4U1O A;  3TTL A;  3Q28 A;  3USD A;  3IJO B;  4H67 A;  1MQD A;  4OFL A;  3QUF A;  1WDN A;  2ONK E;  2PVU A;  4R74 A;  2DXR A;  1NFT A;  3H06 B;  1R6Z A;  2I48 A;  3FJ7 A;  4JBZ A;  1ZBM A;  3FVN A;  4Z0I A;  3T66 A;  3T9U A;  1B3F A;  2F6P A;  3C36 A;  3FZV A;  3K1M A;  5I56 A;  1B1X A;  1MH3 A;  1A55 A;  4O3B A;  2NOO A;  1URS A;  1Q35 A;  2ANJ A;  1SQY A;  1LCF A;  2XX8 A;  4OVJ A;  3FUZ A;  2F97 A;  3RTW B;  2DWA A;  2OLB A;  2XXH A;  4H65 A;  2A5S A;  4OXV A;  2XXW A;  3SEW A;  3ZS6 A;  2PMS A;  3LSW A;  5CBS A;  2QMW A;  5I2N B;  2DQV A;  3KOT A;  4R2B A;  4H1X A;  2HQ0 A;  3H4Z A;  4YKK A;  1B6H A;  2P1S A;  2V3Q A;  4GQO A;  1A99 A;  1FQE A;  3PMV A;  2QL3 A;  1Y3N A;  3H6T A;  3TTM A;  3EF7 A;  1PDA A;  4F2O A;  1YTV A;  4ZED A;  4O3C A;  3KGC A;  3BFU A;  1US5 A;  1GTK A;  3MBP A;  4YMA A;  1FTL A;  3SDF A;  1MPC A;  1P1U A;  4Z7E A;  4LQ2 A;  2H98 A;  2UVI A;  1IUD A;  4HS7 A;  3OEM A;  1B4Z A;  1Q1K A;  3KBR A;  3RUM A;  1NNP A;  2A5T B;  3FVO A;  2RC8 A;  5H8N A;  4ZEB A;  1D3K A;  1DPP A;  4LZ7 A;  1B2H A;  5DVI A;  1NL5 A;  1B7H A;  3HHF A;  4U1Z A;  5BWJ A;  2BJJ X;  1OQG A;  2XXV A;  1FQD A;  3M3L A;  4RXL A;  2I0B A;  2ZMB A;  3O28 A;  2O7U A;  4M4G A;  5CI5 A;  3TMG A;  4G77 A;  1QUI A;  2REG A;  2XX7 A;  4MF3 A;  1UIU A;  2P2A A;  4OFO A;  1XS5 A;  4PFY A;  1B3H A;  2THI A;  5H8Q A;  5JTY B;  3MPL A;  3AXF A;  5M2V A;  3FJM A;  1SW4 A;  3K0V A;  4H0W A;  2VOZ A;  4E0X A;  4NF4 B;  5I56 B;  1H44 A;  1SI0 A;  4ELR A;  5I57 A;  3BKI B;  3V89 B;  4DXC A;  1IQ7 A;  2I4C A;  3HV1 A;  1HSE A;  1ZLQ A;  3LSF B;  2V3T A;  1M5F A;  3T9V A;  3IB0 A;  5H8F B;  1FQC A;  3H6W A;  3E13 X;  1GVC A;  3S9M C;  3CSB A;  2VD2 A;  2X26 A;  4AQ4 A;  2PYY A;  2QS3 A;  3UN6 A;  5CC2 A;  4WKM A;  3KN8 A;  1I69 A;  1MQJ A;  4HCW A;  4IGR A;  4I1D A;  2OK2 A;  2IEE A;  2D3I A;  2GRV A;  4I62 A;  3O97 A;  4OQO A;  3CI8 A;  4WXJ A;  1EU8 A;  3Q29 A;  2O1L A;  2I4B A;  3R6U A;  3IO6 A;  2W7Y A;  3OO9 A;  3PUY E;  1JW5 A;  3U72 A;  1XVX A;  1P99 A;  3VXB A;  2I3V A;  3Q27 A;  4NWD A;  2XXR A;  3H7M A;  4MLV A;  1Y9U A;  3L6H A;  5F7V A;  4AB5 A;  1R9Q A;  2H25 A;  1IIW A;  4BDO A;  1MG1 A;  5J1D A;  4NTL A;  4OET A;  5CRY A;  3RY3 A;  2AL5 A;  2QRY A;  3B6T A;  3K4U A;  2O69 A;  3TYH A;  2RCA A;  3K6X A;  3SEX A;  1SVX B;  3H3G A;  2F6G A;  3MC2 A;  4BDR A;  4JWY A;  3FAS A;  4KHZ E;  5ELV A;  3THI A;  3VLW A;  3QAX A;  5CMB A;  5DEX A;  3S4U A;  3CRB A;  3EN3 A;  3RPW A;  2B3F A;  1USY H;  1NMU A;  4TQU Q;  1NH7 A;  3VXC A;  2VHA A;  5BUU A;  3KJT A;  4JSD A;  1RYO A;  4FOR A;  1JNF A;  1VE4 A;  1VSO A;  4PQJ A;  5FTH A;  2Z23 A;  1J1N A;  1I6B A;  1D4N A;  2DSF A;  3BFT A;  4IO4 A;  4XIG Q;  5I2N A;  3G3H A;  4R2F A;  1UTB A;  2UYE A;  4X1B A;  4YKJ A;  1B52 A;  1JEV A;  3K6U A;  4DDD A;  1EZP A;  1MQG A;  3B6Q A;  3C33 A;  1HSL A;  1MPB A;  5L9O A;  3EHT A;  2UVG A;  1XVY A;  4IB2 A;  4NE4 A;  4QSC A;  5F1Q A;  1S50 A;  2FYI A;  2QJE A;  5HBC A;  4OTE A;  3SEV A;  3TCF A;  4PET A;  3U8Q A;  2F7A A;  3TFL A;  3OEN A;  3B7D A;  3ONM A;  1JW4 A;  4KCD A;  4X9T A;  4YU0 A;  4EUO A;  4NF5 B;  3V5A A;  3MP8 A;  3TQL A;  1BIY A;  1M5B A;  3K02 A;  4U2R A;  3C4M A;  3R7X A;  4GRK A;  1MQH A;  3LR1 A;  1NNT A;  1TFA A;  4KCC A;  3T96 B;  4ZEC A;  4FJP A;  3TCG A;  3C35 A;  1A7L A;  2OBG A;  2H9B A;  3O9P A;  5FHN A;  2NVU B;  5KZT A;  3O6G A;  3UIF A;  2X7Q A;  2I49 A;  3QK6 A;  3VVE A;  1ZTY A;  4ZE8 A;  2H4I A;  5AA4 A;  2UXA A;  4MFI A;  3TAJ A;  1PEB A;  2DWH A;  1FTM A;  3FGS A;  3FXU A;  3H6V A;  3IB1 A;  1QW0 A;  3G7W A;  3PPN A;  5TP9 B;  4F22 A;  2ABH A;  2G93 A;  4EXK A;  5L9S A;  1GR2 A;  1POT A;  2Y7P A;  3HHG A;  3FJG A;  4H8J A;  3K2D A;  1RKM A;  4GL8 A;  3WAE A;  2XXP A;  3RN8 A;  3FV1 A;  4QRZ A;  4POW A;  5CMM A;  1DMB A;  5AA2 D;  2O1M A;  3IOV A;  2CZL A;  3TUS A;  2DXY A;  1FTO A;  3JZJ A;  2O7I A;  1JET A;  2OCU A;  3ZKK A;  4F39 A;  1Y1M A;  3B6W A;  4ECF A;  1S9T A;  1IEJ A;  3TQW A;  1FTJ A;  4N07 A;  4OWD A;  3UP9 A;  5I2K B;  1MXV A;  1LAX A;  1FW0 A;  4Q5T A;  1QUJ A;  2ZYN A;  3MAM A;  4I8C A;  4OYV A;  3M3F A;  3O6H A;  1B58 A;  4XTC Q;  4HTG A;  3IJX B;  3GXA A;  4THI A;  5AE4 A;  1H3D A;  2HAU A;  3FVK A;  3O6I A;  5DYH A;  4EDP A;  3I5O A;  4WED A;  3V8X B;  4KYD A;  1B5J A;  3TEP A;  5B7D A;  5LOM A;  2DYX A;  4LP2 B;  4F29 A;  3GBA A;  5ICT A;  1B9J A;  2RF1 A;  1SBP A;  2Z8D A;  4LQ5 A;  1LFG A;  2UYF A;  4IO2 A;  3M3K A;  1N3W A;  1MQI A;  4KFQ A;  4YAH X;  4BDM A;  3MZ9 A;  4G4P A;  3H6U A;  4UAC A;  1DTG A;  1USY E;  2R71 A;  3HPI A;  1VR5 A;  1XOC A;  4F1U A;  3RQT A;  2Q9T A;  1B5H A;  3DLN A;  3MW0 A;  4MBP A;  4G8M A;  2XD3 A;  3JV9 A;  1LB9 A;  4F1Y A;  4YB6 A;  5HM4 B;  3IAZ A;  3LSL A;  4IO5 A;  4I9D A;  3W15 C;  1MXZ A;  2F5X A;  3CFZ A;  3Q26 A;  1LGB C;  3UA8 A;  2DWI A;  3SKP A;  2PT2 A;  3VVF A;  3CSG A;  3VV5 A;  4FEB A;  5K2Y A;  2OZZ A;  3L6G A;  2AL4 A;  3S9N C;  4HW8 A;  1F9B A;  4LON B;  1B3E A;  1US4 A;  3MQ9 A;  3OXN A;  4ZZA A;  1URG A;  2VP1 A;  4LVQ A;  3OO8 A;  2Y7I A;  4QFL A;  5DEX B;  5H8F A;  1MY2 A;  4G68 A;  4LUB A;  4OEV A;  5FHM A;  2E1S A;  1OVT A;  1JVX A;  3OSQ A;  4Q30 B;  4ZEK A;  4NF6 B;  1IXH A;  3IK6 B;  4BLA A;  1D9Y A;  2UVJ A;  5L9M A;  4F3P A;  4Q8R A;  3GBB A;  3PPO A;  4P0I A;  4UA8 A;  4X48 A;  4TLM B;  1O7T A;  4X1D A;  3SEY A;  5AA2 A;  4M1V A;  1EZ9 A;  4F3G A;  5H8Q B;  3RGY A;  1UTH B;  3KJ7 A;  3CG3 A;  4U4X A;  2F8D A;  2B3B A;  2V25 A;  5H8N B;  1WOD A;  2RIN A;  3K1N A;  3N94 A;  2KLF A;  1B7U A;  1BKA A;  4GXA A;  4U4S A;  2I0C A;  4ZDM A;  2Y7K A;  4G68 C;  2AIX A;  4JXI A;  4GIZ A;  3FD3 A;  1DSN A;  3QXM A;  3U94 A;  3D4G A;  3UOR A;  3T93 B;  1DTZ A;  1H76 A;  3FAT A;  3PUX E;  4MH5 A;  1B32 A;  5KDT B;  1N7X A;  4QFO A;  3IOU A;  4ONY A;  4FEC A;  4R73 A;  1LB8 A;  2D5W A;  2HXW A;  3IOW A;  1IXI A;  1ZMG A;  3MZ1 A;  3UK4 A;  3MPK A;  4RY1 A;  4E0W A;  3O66 A;  3VVD A;  4BDQ A;  5A5X A;  3MP1 A;  4ELQ A;  1MDP 1;  3UGW A;  3T22 A;  1EH3 A;  1MDQ A;  5CMC A;  1SW5 A;  4KR5 A;  4PP0 A;  1N76 A;  4YB7 A;  4JDF A;  3KOS A;  1URD A;  2XXT A;  1SW2 A;  2Q2A A;  3C32 A;  5JTY A;  4C1T A;  3KSX A;  1N04 A;  3PD8 A;  4XKQ A;  3OSR A;  1L5T A;  4PE5 B;  2GHB A;  1SDX A;  4OFJ A;  4EF1 A;  3R26 A;  3PPP A;  1MH4 A;  3TTR A;  1PBQ A;  2I6E A;  4IY5 A;  1QUK A;  1XHY A;  1SYH A;  2I58 A;  2XX9 A;  3CG1 A;  3IR1 A;  5FTI A;  3S2V A;  3C9H A;  5I59 B;  2Z8E A;  4BDN A;  1ELJ A;  2HEU A;  1JEU A;  2H99 A;  3W9W A;  1P1W A;  4ZS9 A;  4RNS A;  2V93 A;  1QKA A;  3KFM A;  3TTN A;  2ESN A;  2QSX A;  5AA4 B;  4OHN A;  4YKP A;  1SW1 A;  2PX1 A;  4GLI A;  1O63 A;  3T9H B;  1TXF A;  3PPQ A;  1R1N A;  2GFE A;  2GHA A;  3KEI A;  4K3F A;  1AL3 A;  1P1N A;  4KPT A;  3SES A;  4DIG A;  1DOT A;  1A54 A;  4R72 A;  4LA9 A;  4FE8 A;  3T9X B;  2VD3 A;  1OMP A;  1LLS A;  1OLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...