3TMGA

Crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
LKSVKIGYVNWGGETAATNVLKVVFEKMGYNAEIFSVTTSIMYQYLASGKIDGTVSSWVPTADKFYYEKLKTKFVDLGANYEGTIQGFVVPSYVPISSISELKGKGDKFKNKMIGIDAGAGTQIVTEQALNYYGLSKEYELVPSSESVMLASLDSSIKRNEWILVPLWKPHWAFSRYDIKFLDDPDLIMGGIESVHTLVRLGLENDDFDAYYVFDHFYWSDDLILPLMDKNDKEPGKEYRNAVEFVEKNKEIVKTWVPEKYKTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein (ProX) from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transport protein
molecule keywords Glycine betaine, L-proline ABC transporter, glycine/betaine/
total genus 98
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tmgA01
3.40.190.100 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Glycine betaine-binding periplasmic protein; domain 2 3tmgA02
1Y3QA 5DTBA 1BKAA 4P0IA 4PFTA 4X1DA 3T93B 5FTIA 4EXKA 1MRPA 4FJPA 1HSEA 3AXFA 1UTBB 2DOJA 4KYSA 1MS7A 1D3KA 3QK6A 1I6AA 1XC1A 4TOZA 5DEXB 5I84A 4DZ1A 4H65A 4G8MA 4QSEA 5CMBA 2OBGA 3B6QA 4GLIA 1P99A 2F6PA 4G68A 4LONB 3UA8A 1S7YA 1T0KA 4MH5A 3TTRA 2UYFA 1A8FA 1N3WA 2OCUA 1GVCA 1MDQA 4DLDA 1B7UA 3PPNA 2R71A 1MXWA 3H06B 4ZDMA 3TFLA 3E3KA 3GXAA 3MPKA 3RPWA 4ZZAA 3VVDA 3QIMA 1POTA 1ZKBA 2UVGA 3OO7A 2IA4A 4AQ4A 2F34A 3K6UA 4YMAA 1GR2A 1JEVA 2XX8A 1FTKA 1D9YA 3PUWE 4Z0IA 4AB5A 5JK4A 1MG1A 1LBBA 5KZTA 4TLLB 2W7YA 2NVUB 1B9JA 5K2YA 4OWDA 2D3IA 3Q28A 1DTZA 5AA2B 4YZZA 2DVCA 3O2AA 1MY3A 2Y7RA 3VDFA 5H8QB 2XXUA 1UTBA 4BDOA 2NXOA 4C1TA 1FW0A 4KQPA 4YU0A 3PPQA 1P1NA 3MJNA 1N84A 2PMSA 1B0LA 2A5TA 2QS2A 2XXTA 5TU0A 1VSOA 5CBSA 1H76A 2I4CA 4XKNA 2DWIA 2REGA 2Y7PA 1DTGA 3N26A 3K6VA 4DE8A 3EN3A 4I1DA 1MXVA 1N3XA 2PVUA 1SQYA 5TP9A 1SW1A 3TKDA 3MVXA 2QMWA 3Q26A 1IQ7A 5DVFA 4OMBA 3GZGA 1EZ9A 2XHDA 4XTCQ 3PU5A 4IO2A 3RUMA 3TCFA 1MQIA 2HZLA 5FHOA 1B05A 2F97A 2RC8A 4WXJA 3RNNA 3H6WA 3C36A 5L9MA 4E0WA 4ND9A 1UTHA 2F6GA 1Z7NE 4FE8A 2X7PA 1Y3PA 4WEDA 1EU8A 3MZ9A 1B4ZA 3B6TA 2ZNTA 4HW8A 3FUZA 3KEIA 4XXUA 3C34A 3QYTA 4F1YA 1US5A 3ZSFA 2XXWA 1TWYA 3U93A 3MUQA 3PMVA 3C31A 1P1WA 1B6HA 4HCYA 4Q0CA 1LSTA 1YAEA 4KYDA 2ONRA 4OENA 2OJTA 4BDMA 1B32A 4MLQA 1P1UA 2H98A 5I2KB 1N7XA 1VFEA 2CZLA 5BWJA 3UGWA 1QW0A 1BP5A 1I6QA 1MH4A 4LZ5A 4OZ9A 4PFWA 4Q5TA 1B2HA 1B58A 3FVNA 3HV1A 4F3PA 5BUUA 1S9TA 3IL1B 2VD3A 1UTHB 3PPPA 2HXWA 1A7LA 2Q2AA 2H25A 1IZ1A 2Y7KA 2ZNUA 1Y4CA 3R26A 1CE2A 3KG2A 5DYHA 3MVYA 5TP9B 4E0XA 1Y1ZA 1WDNA 2PYYA 3OO6A 3CSBA 4G77A 3S9EA 1SD3A 1B52A 3T66A 4C1UA 3MPLA 3TELA 3KN7A 3S4UA 3RN8A 4BDNA 2KLFA 4XKQA 3LSLA 3PUVE 2DVZA 1NH8A 4FECA 3LSXA 2QJEA 3KFMA 5HPQA 5I56B 1OMPA 2GFEA 3FXQA 3BFTA 4ISUA 3RLFE 2O7UA 1B3HA 3ZKLA 1MY0A 2VP1A 4QFKA 2I58A 1B51A 5CMKA 1MXUA 4NF5B 4PP0A 4QF9A 1Q1KA 4GL0A 4OQOA 3IOWA 3QSLA 4GD5A 3FGSA 4GL8A 4U23A 3VVFA 5HM4B 2ALUA 3TQWA 4Q8RA 5I2KA 3G3JA 3RQTA 1Y20A 3G3FA 4ZEIA 1YPNA 3VVEA 1B7HA 1YTVA 1B1XA 4NMYA 1PB8A 3TUSA 2F7AA 3FVOA 1URGA 4RNSA 4ZEBA 4QFOA 3GBAA 3PUXE 2E0SA 1H3DA 4F39A 1M5DA 1ANFA 3MP6A 2XXYA 3OD7A 5CMCA 5ICTA 2E1SA 2O7IA 3KBRA 3T22A 2Q9TA 5I58A 1BIYA 3MP8A 3HCQA 2GH9A 4RJZA 2PBWA 5AA2D 4TQUQ 2ANJA 2F7CA 2O68A 4QRZA 4L17A 3IAZA 4M4GA 1M5FA 1H43A 4RY1A 2DXYA 2RCAA 1CB6A 1NFTA 4LP2B 4YMBA 4IGTA 2R9JA 3OEKA 1SYIA 4G4PA 4YKPA 4QFLA 4R6KA 3IK6B 4G8NA 4WKMA 4BDRA 3EHUA 3K00A 4F31B 3TTLA 3MZ1A 4OXVA 3CFXA 4F3GA 1RKMA 1URSA 3MP1A 4GIZA 3U92A 4F2OA 4DCXA 2V3UA 4RK2A 3HN0A 3LR1A 3O6HA 4PFYA 2H5YA 4JWYA 4QSCA 3UN6A 2GRVA 3EHTA 4GFRA 4GWOA 2UVIA 1AMFA 1FQBA 1B0HA 3DP8A 3G3KA 5H8HA 3Q27A 4H1XA 1XOCA 1TFDA 4Z7EA 3EF7A 4F3BA 4F2QA 1VFDA 4NF8B 3CI8A 2HCAA 3FVKA 4EDPA 1Y3NA 2ESNA 2QS1A 1JW5A 3O9PA 4F3SA 2VOZA 4EXLA 3TZAA 1R6ZA 1JQFA 2X7QA 4H8JA 4NF5A 4KFQA 4MBPA 4QFNA 5DT6A 2ONKE 3FVGA 2FA7A 4ZE8A 1O63A 3VXBA 2I49A 4DXCA 3FXUA 3H03A 3ZKKA 4IY5A 2F78A 1JVYA 3MWBA 5AE4A 1JW1A 2F5XA 3C9HA 2DWHA 3PUZE 1SVXB 2WKYA 1M5CA 2F7BA 3LBSA 4IO4A 2NOOA 1MH3A 2ZYKA 5TPAB 4DDDA 1DPEA 4EQBA 4GXSB 5I58B 1ELJA 5EHMA 3FV1A 4JXIA 1NH7A 3N6UA 4ZZEA 2O6AA 4POXA 1LAXA 2O1MA 3KOTA 3TPAA 1MPCA 3O28A 5A5XB 1TFAA 1H44A 3MAMA 4KPTA 1LAHE 4Q30B 3T9VA 4FIMA 1DMBA 1IXGA 3H6TA 1B4HA 1ZMGA 1XVYA 2DP8A 5HBCA 2FNCA 3IOVA 4R6HA 3ECRA 3HO7A 5ICQA 4U2RA 2NUVA 1MM7A 3T9UA 3TTNA 1LFHA 5F7VA 1OLCA 3K4UA 4PQJA 5H8NA 1ZLQA 3G3GA 3TAJA 5AA3A 2V84A 1AL3A 2XXHA 3D4GA 1S50A 2G93A 3DELB 1LCTA 2FYIA 5K2XA 2Z23A 1XHYA 2HAUA 1Y4TA 4GRKA 4KR5A 3LUYA 4MLVA 3TDJA 2Y7IA 4ELQA 1YCJA 5I2NB 3IOTA 5CC2A 3BFUA 3IX1A 4R9GA 4DXBA 1NKXA 4BDLA 4F18A 1ZIUA 3O6IA 3OMBA 4HTGA 3VFJA 4QFPA 1IXHA 2DQVA 1FQEA 2O51A 2UVJA 3TMGA 3DLNA 4DIGA 4ONYA 2XXVA 4F1UA 1QULA 2I3VA 4HS7A 3UP9A 2QS3A 5ISUA 2AYSA 5AA4A 2IEEA 2Y84A 4N07A 1QVSA 2OWTA 3DP6A 2UYEA 3P7IA 4EF1A 3H7MA 4TLMB 1SDXA 1FQFA 2AL5A 3FXRA 5JTYB 2G29A 4NF6B 5EHSA 2O84X 1ZTYA 1XT8A 1USYE 2ZYOA 4R6YA 1US4A 3V89B 2OZZA 3RTWB 3O6GA 4ZE9A 2YPNA 1MXXA 4P11A 3IR1A 4NWDA 2ZXTA 4OFLA 3EHSA 4X1BA 5CRYA 1A55A 2I6EA 4KCCA 3S2VA 3VLWA 4K3FA 1B3FA 3I6VA 4XKPA 1JETA 1R1NA 2O69A 3HSTA 4H8IA 4LUBA 4RA1A 1F9BA 2LAOA 3T9HB 2I0CA 4MF3A 1TT1A 3FD3A 2RCBA 3F11A 1B1HA 3T9XB 3ILUB 4F22A 1MY2A 4OEUA 1KWHA 1XVXA 2XX7A 4O3BA 3SEYA 3U72A 1B5IA 1MQGA 3E4RA 2PT1A 1DPPA 1JVXA 3KSJA 2F36A 2AIXA 5JEIA 2THIA 3SEVA 4IO6A 1A40A 1FTMA 1IXIA 1MQJA 2HZKA 3N94A 4GQOA 4H5FA 2XXPA 4IGRA 4X9TA 4YB5A 3UORA 4PETA 4PE5B 3TODA 2Q88A 4I9DA 3K1MA 5LOMA 4OFJA 3EPEA 3MW0A 4KHZE 5AA1A 1NNFA 4ECFA 1B5HA 4ESXA 5H8HB 4MFIA 2QS4A 2VD2A 4IY6A 2XXIA 5CM6A 3VLVA 1MY4A 2I0BA 2RF1A 3PUYE 3IO4A 3KN8A 3HHFA 3U1OA 4EQ7A 3V5AA 4ELOA 4JWXA 2PT2A 3H6VA 3V8XB 3G3IA 4OHNA 3K6WA 1QJMA 4RYAA 4G2ZA 3PPOA 4U4SA 3KSXA 4IO5A 3D4CA 4LATA 3S9LC 3K0VA 4H6DA 3M3KA 4HCWA 3W15C 1MM6A 3OXNA 1Y1MA 4H5GA 4NTLA 3SEUA 1SW4A 4FAJA 3RGYA 1HSLA 1Z7ME 5L9SA 3FJGA 5B7DA 1B40A 2Z8FA 1JEUA 1PC3A 2ZYMA 4U21A 5CMMA 1MXYA 3MZBA 3A09A 3UK4A 4YKJA 5KCJB 5ITPA 1PDAA 4KI0E 1FQDA 4RXLA 3SEXA 2DYXA 4EUOA 3ODBA 1ZBMA 1A54A 3M3FA 4OESA 1FCKA 1NNPA 1PEBA 3KZGA 4YB7A 4RPNA 4BDQA 5AA2A 3PMXA 3ILTB 1UIUA 2DXRA 5H8QA 1LCFA 1ZU0A 4LZ8A 3U8QA 3VLUA 4ESWA 1RYXA 1B3EA 2H9BA 1FQCA 3MQ9A 3KN3A 1N7WA 2I4BA 4R9FA 2UVHA 3FATA 5KCJA 1IUDA 2OK2A 3IOUA 3TTMA 1MXZA 1BTJA 2XXXA 3CFZA 2XXQA 3OO9A 4GXAA 4LQ5A 3MBPA 1MY1A 4G68C 4JDFA 5I2NA 3A3CA 3KGCA 5DVJA 2H99A 3O66A 4H0WA 4WEPA 5L8DA 3W9VA 2GHAA 3FASA 1AH5A 2QSXA 2XD2A 4ZEDA 2B3BA 3IORA 3N6TA 5EYFA 2XD3A 1WVJA 1NNTA 2H4IA 3FJ7A 4NF4B 4UA8A 3SERA 5H8NB 1MPBA 1P1QA 2CMOA 1UIVA 1IIWA 4XIGQ 5CBRA 4JSOA 1QKBA 4KCDA 2A5SA 3MC2A 4M1VA 1PBQA 1OVTA 4I8CA 1MPDA 1LBCA 3KJTA 3L6GA 3PGFA 2QL3A 3L6HA 2F35A 4U1ZA 3IB0A 1TXFA 4POWA 1DOTA 2HAVA 1OQHA 1DSNA 1MQDA 1PB9A 3K2DA 2ABHA 2VGQA 4YICA 1LB8A 3FV2A 2XXRA 2DE3A 4FATA 3S9MC 3H3GA 4F19A 5ELVA 1N76A 1IITA 1NMUA 1O7TA 4GOTA 4ZS9A 2UXAA 3OO8A 5FTHA 4R75A 4H67A 4FEDA 2Q89A 4ZEKA 3CIJA 1SI1A 2PX1A 1O64A 3VE1B 4F1VA 3Q29A 3GLBA 4NF8A 3TYHA 4THIA 4FORA 3QXMA 3RY3A 3LSWA 3C32A 2DWJA 2HQ0A 3PPRA 4R73A 2NWJA 1EZOA 4LVQA 2V93A 1B3LA 3EQ1A 3FIRA 4FEBA 4GVOA 2Y7WA 4NEDA 3G3HA 3WAFA 1JNFA 3C33A 1GV8A 3A3UA 2P0SA 1BLFA 1OIBA 3CSGA 3IO6A 1FTOA 2RC9A 3O97A 3CG1A 1FTLA 1SBPA 4I62A 4KYEA 1ATGA 3QAXA 2ZNSA 3GBBA 2Z22A 3IJOB 4NF4A 4U4XA 3PV0E 3SETA 4GF8A 3TQLA 3ONMA 4YB6A 1M5EA 3I5OA 1Q35A 3CRBA 1LAFE 4OERA 3S9NC 4U1OA 3TEPA 3VXCA 4OFOA 4P0GA 1LLSA 1NL5A 4RK9A 3E13X 4BLAA 2D21A 3IB1A 3B6WA 4EQ9A 1B7ZA 4N6PA 4ZEFA 1B46A 4IO3A 2F8DA 4PFUA 1FQAA 4R72A 3W9WA 3U94A 4R2FA 3PD9A 1R9QA 2ZYNA 5I59B 3V83A 2AL4A 1SW5A 1UQWA 3FJMA 5F1QA 1FTJA 1B5JA 2QMXA 4NWCA 5ITOA 3USDA 2A5TB 5I56A 1AIVA 1XS5A 4OEVA 1EZPA 3CR9A 5CI5A 1I69A 4YKIA 4JB7A 4JWOA 5J1DA 3H6UA 2BJJX 3OENA 5DVIA 5H8FB 1B3GA 1LFGA 3I3VA 2OWSA 2RKMA 3SDFA 3JYRA 1VR5A 1QUKA 4IO7A 4O3AA 3SKPA 2VHAA 3DM0A 5H8SA 3THIA 1PB7A 1QUIA 1USYH 5AA4B 2DSFA 2RINA 1N04A 3C35A 4G8HA 3TCGA 2GHBA 3CG3A 3R7XA 2Q2CA 4O3CA 3CVGA 1NNKA 5I59A 2V3QA 3R6UA 5KDTB 3RTFB 1URDA 3BBRA 1A99A 3N5LA 3RT6B 3SESA 5JTYA 3RT8A 3MVWA 1MQHA 2OLBA 4NE4A 3M8UA 3T96B 1SI0A 3WAEA 2I3WA 4ELPA 1L5TA 4LQ2A 5I57A 1WODA 4QSDA 4JSDA 3G7WA 3OSQA 2REJA 2V25A 1AOVA 4KD5A 4R74A 2YLNA 2I48A 3PD8A 1N0TA 2D5WA 2Z8EA 3KJ7A 1I6BA 1HSJA 4NF6A 1RYOA 3C4MA 1GGGA 2QPQA 3LSFB 3MVZA 3OEMA 3BKIB 4DCYA 1OQGA 1A8EA 1EH3A 1R9LA 1D9VA 2DWAA 2B3FA 2DE2A 2HFBA 4F29A 2Z8DA 3ZS6A 3E9XA 2YJPA 5KDTA 1OLAA 1II5A 4OTEA 1JW4A 1LB9A 2P2AA 3O29A 3VV5A 1IEJA 2ONSA 1IXCA 3PMWA 3QUFA 4C0RA 4YAHX 3SEWA 1SW2A 2DS9A 3JV9A 4ZECA 5FHMA 2P1SA 2QRYA 1QUJA 4UACA 3K6XA 5DEXA 5A5XA 1LAGE 1PBPA 4OETA 1POY1 3K1NA 3B7DA 2Q8JA 3LC8A 5L9OA 4OYVA 1M5BA 4QHQA 3OELA 4XKRA 4EF2A 1SYHA 3TCHA 5H8FA 4RPOA 3FZVA 4N13A 4LA9A 3DP4A 2V3TA 4JBZA 5TPAA 5FHNA 1J1NA 3HPIA 4AB6A 4YKKA 3JZJA 1D4NA 1MDP1 2B65A 2O1LA 2ZMBA 1H45A 4OVJA 1LFIA 3TTKA 4IB2A 4DXUA 4R2BA 2DE4A 3H4ZA 5B70A 3UIFA 5IAIA 2R6GE 3OSRA 1Y9UA 3HHGA 2HEUA 3CFLA 3K02A 3Q25A 3QUJA 5IKBA 3IJXB 3IB2A 1OVBA 2M8CA 4U22A 1P1OA 1QKAA 1ZJLA 1VE4A 4G68B 3K01A 4LZ7A 4X48A 3K1PA 5M2VA 5I57B 3OOAA 1GTKA 3M3LA 4ELRA 2X26A 2XX9A 2RC7A 1LGBC 3KOSA
chains in the Genus database with same CATH superfamily
1Y3QA 5DTBA 1BKAA 2FIXA 5FTIA 4FJPA 1I6AA 4DZ1A 4QSEA 2FVZA 1P99A 4LONB 1RDXA 2WBDA 1T0KA 4MH5A 3TTRA 1INPA 2UYFA 2R71A 3H06B 1DBZA 3MPKA 4ZZAA 3VVDA 3QIMA 1POTA 4AQ4A 1GR2A 1LBBA 4OWDA 2D3IA 5AA2B 2QVVA 2XXUA 1UTBA 4C1TA 4KQPA 4YU0A 2PMSA 2XXTA 4XKNA 5TP9A 1SW1A 3Q26A 1IQ7A 3GZGA 5FHOA 2Q74A 5EQAA 4WXJA 2Y5LA 4ND9A 2F6GA 1Z7NE 1EU8A 4F1YA 4XEQA 3PMVA 3C31A 1B6HA 4Q0CA 1IMAA 1YAEA 4MLQA 2H98A 3T0JA 1I6QA 1EYJA 3ROJA 2ZNUA 1Y4CA 1NUYA 3MPLA 3RN8A 2KLFA 3PUVE 4FECA 4NX1A 3FXQA 1FPLA 1B3HA 1FPJA 5IZZA 1MXUA 4QF9A 1Q1KA 4U23A 4OANA 4GL8A 5HM4B 2ALUA 3TQWA 2GQ1A 2F7AA 3FVOA 4RNSA 3GBAA 3PUXE 5CMCA 2E1SA 5AA2D 2F7CA 4L17A 4M4GA 4QFLA 4G8NA 4F31B 3TTLA 4OXVA 3CFXA 4F3GA 1RKMA 4GIZA 4DCXA 4RK2A 4QSCA 3EHTA 1B0HA 2OWZA 4PFIA 2PFZA 4NQ8A 1JW5A 2VOZA 5DT6A 4NF5A 2FA7A 4ZE8A 4DXCA 2I49A 3FXUA 2F5XA 4IR8A 4IO4A 1NUZA 5EHMA 4JXIA 2O1MA 5A5XB 3T9VA 1B4HA 3QMFA 1FPKA 5F7VA 1OLCA 5H8NA 2V84A 4PC9A 3BFUA 4DXBA 2DQVA 2O51A 2UVJA 2HXRA 5ISUA 1QVSA 4EF1A 2AL5A 5JTYB 2ZYOA 3RTWB 1NV6A 5CRYA 3EHSA 2JJKA 3VLWA 3I6VA 4LUBA 1FPDA 4G61A 1B1HA 2Q8MA 1FBGA 1MY2A 4HE1A 2XX7A 4O3BA 1B5IA 4AS4A 3E4RA 2PT1A 4OVTA 4MHFA 3SEVA 1IXIA 3N94A 2Q88A 3K1MA 4OFJA 1NNFA 4ESXA 4IY6A 2QVRA 2Y5KA 2RF1A 4JWXA 2PT2A 5ESYA 3K6WA 4U4SA 4LATA 3K0VA 4H5GA 3SEUA 4FAJA 1Z7ME 4U21A 5CMMA 1PC3A 1FRPA 4RXLA 3E79A 3KZGA 4RPNA 3PMXA 3CHGA 5H8QA 5J16A 2H9BA 2QVUA 3IOUA 1BTJA 2XXXA 4LQ5A 3MBPA 4G68C 3W9VA 1AH5A 2FBPA 4XFEA 1UIVA 1IIWA 1NV4A 1QKBA 2A5SA 3KC1A 4I8CA 1LBCA 5I3SA 4P8BA 3GYYA 3K2DA 1IMDA 2ABHA 2XXRA 2DE3A 4F19A 1N76A 1NMUA 2L5VA 4GWYA 2Q89A 4ZEKA 3B50A 1SI1A 1FJ6A 3GLBA 4FORA 2DWJA 2HQ0A 1EZOA 2V93A 1FBDA 3G3HA 3IO6A 2RC9A 1FTLA 1SBPA 1ATGA 2ZNSA 4GF8A 3TEPA 1M5EA 3I5OA 1LAFE 3VXCA 4OFOA 2D21A 4P9KA 4EQ9A 1B7ZA 4N6PA 1B46A 4IO3A 1FQAA 5I59B 1FJ9A 2AL4A 1RDYA 1FTJA 1B5JA 4PGPA 3CR9A 1FBFA 2RKMA 4O3AA 3SKPA 1QUIA 5AA4B 1N04A 4G8HA 3R7XA 4O3CA 3CVGA 5I59A 5KDTB 3RT6B 3RT8A 4ELPA 2OLBA 3WAEA 1L5TA 1RDZA 1WODA 4KD5A 2YLNA 2Z8EA 1I6BA 1HSJA 4QXDA 5KDTA 3E9XA 1OLAA 2CZKA 1SW2A 4ZECA 3LC8A 4QHQA 1M5BA 4EF2A 4N13A 3DP4A 2V3TA 5TPAA 1J1NA 3HPIA 3JZJA 1D4NA 4R2BA 2DE4A 5B70A 2CZIA 3UIFA 1Y9UA 3HHGA 3CFLA 3Q25A 5IKBA 3IJXB 2M8CA 4G68B 4GWZA 4LZ7A 4X48A 5I57B 2XX9A 4EXKA 4P0IA 4MMPA 1MRPA 3NOHA 2DOJA 4KYSA 5I84A 5DEXB 4H65A 5CMBA 2OBGA 1FSAA 4G68A 3ISPA 4DLDA 1MDQA 3TFLA 3FXBA 4PAFA 1FBCA 2UVGA 3OO7A 4AB5A 2NVUB 3BIGA 4JVIA 2VPNA 3Q28A 1MY3A 2NXOA 1FW0A 3PPQA 3MJNA 1B0LA 5TU0A 2DWIA 1DTGA 4I1DA 1N3XA 3MVXA 2QMWA 4IO2A 3RUMA 3MSTA 2F97A 3H6WA 4H45A 1Y3PA 4WEDA 4HW8A 3KEIA 3C34A 2XXWA 1TWYA 3U93A 2VPOA 3D1RA 5IGAA 5I2KB 1P1UA 4PFWA 4F39A 4Q5TA 1B2HA 5BUUA 1S9TA 2VD3A 2HXWA 1A7LA 2H25A 1IZ1A 4N81A 5TP9B 1Y1ZA 2PYYA 3OO6A 1SD3A 3S4UA 4XKQA 5IZ3A 1NH8A 5HPQA 5I56B 1OMPA 2HPGA 3BFTA 4ISUA 2BJIA 3ZKLA 1MY0A 2VP1A 4QFKA 2WYPA 3VVFA 4Q8RA 1YPNA 1PB8A 1FPGA 4OVPA 4QFOA 2B4MA 2E0SA 2XXYA 2O7IA 3KBRA 3HCQA 2GH9A 4N17A 1CB6A 4YMBA 4IGTA 4G4PA 4YKPA 4BDRA 3MP1A 3U92A 1LEVA 4F2OA 2V3UA 3HN0A 2WYKA 4GWOA 2UVIA 4NHBA 1FQBA 3DP8A 4MAGA 4N15A 4EDPA 1Y3NA 2ESNA 3O9PA 5FBPA 4QFNA 2ONKE 3H03A 4NF0A 2F78A 3MWBA 1JW1A 3C9HA 2DWHA 3PUZE 2WKYA 5TPAB 4DDDA 4EQBA 1DPEA 4GXSB 1NH7A 3N6UA 4ZZEA 3KOTA 3MAMA 1IXGA 4MEVA 3IOVA 5ICQA 4U2RA 1MM7A 1ZLQA 2G93A 2FYIA 3LUYA 4MLVA 1YCJA 5I2NB 3IOTA 5CC2A 1NKXA 4F18A 5LTCA 1FQEA 3DLNA 4F1UA 4HS7A 2I3VA 2AYSA 4PAIA 2OWTA 1NV7A 4NGUA 3FXRA 5EHSA 1ZTYA 1USYE 3IR1A 4NWDA 2ZXTA 3S2VA 4K3FA 4XKPA 2O69A 1F9BA 4MF3A 2RCBA 3F11A 1FPFA 4F22A 1KWHA 1DPPA 1JVXA 2AIXA 2THIA 1MQJA 4IGRA 4H5FA 4YB5A 4PETA 5LOMA 4ECFA 1B5HA 5H8HB 2FIEA 1MY4A 5I5PA 3HHFA 4EQ7A 5DW8A 3V8XB 3G3IA 3M3KA 3OXNA 1Y1MA 1SW4A 1HSLA 3HFUA 3UK4A 4YKJA 5ITPA 1PDAA 4HE0A 4KI0E 2DYXA 4EUOA 3ODBA 1A54A 4OESA 2MKZA 1FPBA 2DXRA 1LCFA 1RYXA 2I4BA 4R9FA 2OK2A 2XXQA 5F24A 1LBYA 4N8GA 4WEPA 5L8DA 2GHAA 2XD2A 2B3BA 2CEXA 1NNTA 4NF4B 4PAKA 4XIGQ 3MC2A 3KJTA 3PGFA 1YYZA 2VGQA 3FV2A 4MIJA 3S9MC 1O7TA 2UXAA 4O7MA 1FBHA 4OVSA 2PX1A 1Q9DA 3TYHA 1LBZA 2XWKA 3C32A 1B3LA 3O97A 3IJOB 2Z22A 1D9QA 3PV0E 3ONMA 4OERA 3S9NC 1LLSA 4BLAA 1KZ8A 4I3YA 4ZEFA 4PFUA 4R72A 1IMCA 1R9QA 3FJMA 5ITOA 2QMXA 4NWCA 1AIVA 1XS5A 5IZ1A 4JB7A 3H6UA 5DVIA 3OENA 5H8FB 1LFGA 3JYRA 5ET6A 5H8SA 1PB7A 1NNKA 3R6UA 1A99A 3SESA 5JTYA 4DI4B 1KA1A 3MVWA 2I3WA 2XWIA 4P47A 1AOVA 3RYDA 1G0HA 4R74A 3PD8A 2D5WA 3KJ7A 1RYOA 3LSFB 3MVZA 1OQGA 1A8EA 1EH3A 2DWAA 2DE2A 1LB9A 2P2AA 4PF6A 1IEJA 2CZHA 1IXCA 3QUFA 3SEWA 2P1SA 4UACA 3K6XA 1LAGE 1POY1 5IZ3B 4XKRA 3FZVA 1KA0A 2ZMBA 1H45A 4DXUA 1FBEA 1FBPA 3RPLA 5IAIA 2R6GE 3IB2A 1P1OA 3K01A 3K1PA 2X26A 3FJ7A 4UA8A 4X1DA 3A29A 1HSEA 3AXFA 4TOZA 4G8MA 4N8YA 3UA8A 5A5LA 1S7YA 1N3WA 2OCUA 1B7UA 1MXWA 3E3KA 4PE3A 3RPWA 4GBWA 4GX6A 2XWOA 2IA4A 3K6UA 1FTKA 1D9YA 3PUWE 1MG1A 5KZTA 4TLLB 2W7YA 1B9JA 5K2YA 1DTZA 4YZZA 2DVCA 3O2AA 2Y7RA 1G0IA 5H8QB 4BDOA 1N84A 2A5TA 2QS2A 4PCDA 2REGA 1SQYA 3TKDA 4OMBA 1EZ9A 3PU5A 3TCFA 2HZLA 1B05A 4GX3A 2RC8A 3RNNA 3C36A 1UTHA 4I3EA 4FE8A 3MZ9A 3B6TA 4XXUA 3ZSFA 4UABA 3MUQA 1LSTA 4KYDA 2ONRA 4OENA 2OJTA 4BDMA 1N7XA 1VFEA 2CZLA 5BWJA 2KQZA 1QW0A 1BP5A 1MH4A 4LZ5A 4OZ9A 1B58A 3HV1A 3PPPA 1UTHB 2Q2AA 3MVYA 4E0XA 1WDNA 3PTYA 4G77A 2KR0A 1B52A 3T66A 3KN7A 4BDNA 4N91A 1NUXA 2DVZA 3LSXA 3KFMA 2GFEA 1K9ZA 2I58A 1B51A 5CMKA 3IOWA 3FGSA 5I2KA 3RQTA 1Y20A 1B7HA 1YTVA 4NMYA 4X04A 1H3DA 3MP6A 3OD7A 4OVQA 3T22A 2Q9TA 5I58A 2PBWA 4QRZA 1H43A 4RY1A 2DXYA 2RCAA 2R9JA 3IK6B 1DCUA 5EQ8A 2GRVA 1AMFA 3Q27A 4H1XA 3EF7A 4F2QA 1VFDA 2P3VA 4H46A 2HCAA 2QS1A 4EXLA 3TZAA 4KFQA 3FVGA 1O63A 4ELRA 4IY5A 2VT5A 5AE4A 3LV0A 1LBVA 4PDDA 1SVXB 2F7BA 2ZYKA 1MH3A 4PTKA 4POXA 1MPCA 3O28A 1TFAA 4KPTA 4Q30B 1LAHE 4FIMA 3H6TA 4DI3D 5EYGA 1XVYA 2DP8A 2FNCA 4R6HA 2NUVA 3T9UA 1LFHA 4AS5A 5AA3A 2XXHA 1S50A 5K2XA 2Z23A 1XHYA 2HAUA 4GRKA 3TDJA 3O6IA 4HTGA 2R8TA 4QFPA 3TMGA 2WX9A 1QULA 4N6DA 2IEEA 4N07A 1YZ0A 3DP6A 1SDXA 1IMFA 4NF6B 2O84X 1XT8A 3KBZA 1US4A 3V89B 3O6GA 2YPNA 1MXXA 4X1BA 1A55A 2I6EA 1R1NA 3HSTA 4RA1A 1EYIA 2I0CA 3T9XB 4LN5A 4OEUA 1XVXA 2CEYA 1NV3A 3U72A 5JEIA 1A40A 1FTMA 2HZKA 5FTHA 4X9TA 4GQOA 2XXPA 3UORA 4I40A 3TODA 3EPEA 3MW0A 4KHZE 4MFIA 4GWSA 2XXIA 3PUYE 3U1OA 3V5AA 3H6VA 1QJMA 1FPEA 3S9LC 1K9YA 3EKIA 4HCWA 3W15C 5L9SA 3FJGA 5B7DA 4GWWA 1JEUA 3MZBA 5KCJB 1FQDA 3BIHA 1PEBA 4BDQA 5AA2A 3ILTB 4ESWA 3U8QA 1ZU0A 4LZ8A 4MX6A 1B3EA 1FQCA 3KN3A 2UVHA 3FATA 5KCJA 1IUDA 3TTMA 3OO9A 3CFZA 4GXAA 4JDFA 5DVJA 3O66A 4H0WA 3FASA 2PCRA 3N6TA 5EYFA 2XD3A 2H4IA 2DDKA 2CMOA 5CBRA 4JSOA 4KCDA 4M1VA 1PBQA 1FTAA 2QL3A 3L6HA 5LDZA 4U1ZA 4POWA 4PFRA 4FATA 1IITA 4GOTA 4MNIA 3OO8A 4R75A 4H67A 4FEDA 3CIJA 4FBPA 3QXMA 2NWJA 4LVQA 5EQ9A 4NEDA 3WAFA 3A3UA 1BLFA 4KYEA 4I62A 3CG1A 3QAXA 4U4XA 4NF4A 3SETA 1Q35A 4U1OA 4O94A 4MJOA 4P0GA 1NL5A 4GBVA 3IB1A 3W9WA 1NV0A 2ZZVA 1SW5A 1UQWA 5F1QA 3USDA 2A5TB 3SZPA 5CI5A 4JWOA 2BJJX 2OWSA 3THIA 1QUKA 1USYH 2DSFA 2RINA 3C35A 3TCGA 1FPIA 2FHYA 2V3QA 1URDA 3M8UA 1SI0A 1QGXA 4LQ2A 4QSDA 4JSDA 4OA4A 2V25A 2I48A 1N0TA 4NF6A 3C4MA 1GGGA 2B4LA 2QPQA 3BKIB 4DCYA 1R9LA 2B3FA 4PBHA 4F29A 3B8BA 4HE2A 4OTEA 1JW4A 3O29A 1YXIA 2DS9A 5FHMA 5A5XA 4OETA 1SYHA 5H8FA 4RPOA 4LA9A 4PFBA 4OVJA 1LFIA 4IB2A 3H4ZA 3OSRA 2HEUA 3K02A 3QUJA 4U22A 1ZJLA 3OOAA 1GTKA 3KOSA 4PFTA 3T93B 1UTBB 1MS7A 1D3KA 3QK6A 1XC1A 3FBPA 4PDHA 3B6QA 4GLIA 2F6PA 4GWXA 2F3BA 1BK4A 1A8FA 1GVCA 1SPIA 3PPNA 4JVDA 4ZDMA 3GXAA 1ZKBA 2F34A 4YMAA 1JEVA 2XX8A 4Z0IA 5JK4A 4O7IA 3VDFA 1P1NA 1VSOA 5CBSA 1H76A 2I4CA 4DE8A 2Y7PA 3N26A 3K6VA 3EN3A 1MXVA 2PVUA 2ZZXA 5DVFA 2XHDA 4XTCQ 4GX4A 1MQIA 5L9MA 4E0WA 2X7PA 1B4ZA 2ZNTA 3FUZA 3QYTA 1US5A 4HCYA 1P1WA 1B32A 3UGWA 4ELOA 4F3PA 3FVNA 2WEFA 3IL1B 2Y7KA 3R26A 1CE2A 3KG2A 5DYHA 4N4UA 3CSBA 3S9EA 4C1UA 3TELA 3LSLA 4P1LA 2QJEA 1NI9A 3RLFE 2O7UA 4NF5B 4PP0A 4GL0A 4OQOA 3QSLA 4GD5A 3G3JA 3G3FA 4ZEIA 3VVEA 1B1XA 4JVCA 3TUSA 4ZEBA 1URGA 1M5DA 1ANFA 5ICTA 1BIYA 3MP8A 4RJZA 4TQUQ 2ANJA 4MCOA 4NG7A 2O68A 3IAZA 1M5FA 1NFTA 4LP2B 3OEKA 1SYIA 4WKMA 4R6KA 3KC0A 3EHUA 3K00A 3MZ1A 1URSA 5ET5A 1XI6A 3O6HA 3LR1A 4PFYA 2H5YA 4JWYA 4P3LA 3UN6A 4GFRA 1DK4A 1NUWA 3G3KA 5H8HA 1XOCA 1TFDA 4Z7EA 4F3BA 2OX3A 4NF8B 4MNCA 3CI8A 3FVKA 4F3SA 1R6ZA 1JQFA 2P3NA 2X7QA 4H8JA 4MBPA 3VXBA 3E78A 3ZKKA 1JVYA 4NN3A 1M5CA 3LBSA 2NOOA 5I58B 1JP4A 4PBQA 1ELJA 3FV1A 2O6AA 1IMEA 1LAXA 3TPAA 1NV5A 1H44A 1NV2A 1DMBA 1ZMGA 5HBCA 3ECRA 3HO7A 3TTNA 3K4UA 4PQJA 3G3GA 3TAJA 3D4GA 1AL3A 3TCHA 3DELB 1LCTA 1EYKA 1Y4TA 4KR5A 2Y7IA 4ELQA 3IX1A 4R9GA 4BDLA 1ZIUA 3OMBA 3VFJA 1IXHA 4DIGA 4ONYA 2XXVA 3UP9A 2QS3A 5AA4A 2Y84A 2UYEA 3P7IA 3H7MA 4TLMB 1LBWA 1FQFA 2G29A 4R6YA 2OZZA 4ZE9A 4P11A 4OFLA 4KCCA 1B3FA 1JETA 4H8IA 2LAOA 3T9HB 1TT1A 3FD3A 3ILUB 2QFLA 3SEYA 1MQGA 3KSJA 4N6KA 2F36A 4IO6A 1NV1A 5EYHA 4PE5B 4I9DA 5AA1A 5ET8A 2QS4A 2VD2A 2XA5A 2ZZWA 5CM6A 3VLVA 2I0BA 3IO4A 3KN8A 4X8RA 2XXKA 4OHNA 4RYAA 4G2ZA 3PPOA 3KSXA 4IO5A 3D4CA 4P56A 4H6DA 1MM6A 4NTLA 1LBXA 3RGYA 1B40A 2Z8FA 2ZYMA 1MXYA 3A09A 3SEXA 3IFAA 1ZBMA 3M3FA 1FCKA 1NNPA 4YB7A 1VDWA 1UIUA 3VLUA 2F3DA 4MNPA 2PFYA 3MQ9A 3IFCA 1N7WA 2V4CA 1MXZA 1MY1A 5I2NA 3A3CA 3KGCA 2H99A 2QSXA 4ZEDA 3IORA 1WVJA 5H8NB 3SERA 1MPBA 1P1QA 4XF5A 1OVTA 2WBBA 1MPDA 3L6GA 2F35A 3IB0A 1TXFA 5T3JA 1DOTA 2HAVA 1OQHA 1DSNA 1MQDA 1PB9A 4YICA 4OVRA 1LB8A 3H3GA 5ELVA 4ZS9A 3RPLB 1O64A 3VE1B 4F1VA 3Q29A 4NF8A 4THIA 4O8MA 3RY3A 3LSWA 3PPRA 4R73A 1AWBA 3FIRA 3EQ1A 4FEBA 4GVOA 2Y7WA 1JNFA 3C33A 1GV8A 2HHMA 2P0SA 1OIBA 3CSGA 1FTOA 3GBBA 3TQLA 4YB6A 3CRBA 1CNQA 4RK9A 3E13X 3B6WA 4PGNA 2F8DA 3U94A 4R2FA 3PD9A 2ZYNA 3V83A 5I56A 4HXVA 4OEVA 1EZPA 1I69A 4YKIA 5J1DA 1B3GA 3I3VA 3SDFA 1VR5A 4IO7A 2VHAA 3DM0A 4P1EA 5I7IA 4NAPA 1IMBA 4PF8A 2GHBA 2Q2CA 3RTFB 3BBRA 3N5LA 1MQHA 3T96B 4NE4A 5I57A 3G7WA 3OSQA 2REJA 3OEMA 1D9VA 2HFBA 2Z8DA 3ZS6A 2YJPA 1II5A 3U65A 3VV5A 3PMWA 2ONSA 4C0RA 4YAHX 3JV9A 2QRYA 1QUJA 5DEXA 1PBPA 3K1NA 3B7DA 2Q8JA 4KXPA 5L9OA 4OYVA 3OELA 4JBZA 5FHNA 5IM2A 4AB6A 4YKKA 1MDP1 2O1LA 2B65A 3MYUA 3TTKA 4GWUA 1OVBA 1QKAA 1VE4A 5M2VA 3T1BA 4QBAA 5ET7A 3LUZA 5EQ7A 3M3LA 2XWVA 3CG3A 2RC7A 1LGBC
chains in the Genus database with same CATH topology
1Y3QA 5DTBA 1BKAA 4P0IA 4PFTA 4X1DA 3T93B 5FTIA 4EXKA 1MRPA 4FJPA 1HSEA 3AXFA 1UTBB 2DOJA 4KYSA 1MS7A 1D3KA 3QK6A 1I6AA 1XC1A 4TOZA 5DEXB 5I84A 4DZ1A 4H65A 4G8MA 4QSEA 5CMBA 2OBGA 3B6QA 4GLIA 1P99A 2F6PA 4G68A 4LONB 3UA8A 1S7YA 1T0KA 4MH5A 3TTRA 2UYFA 1A8FA 1N3WA 2OCUA 1GVCA 1MDQA 4DLDA 1B7UA 3PPNA 2R71A 1MXWA 3H06B 4ZDMA 3TFLA 3E3KA 3GXAA 3MPKA 3RPWA 4ZZAA 3VVDA 3QIMA 1POTA 1ZKBA 2UVGA 3OO7A 2IA4A 4AQ4A 2F34A 3K6UA 4YMAA 1GR2A 1JEVA 2XX8A 1FTKA 1D9YA 3PUWE 4Z0IA 4AB5A 5JK4A 1MG1A 1LBBA 5KZTA 4TLLB 2W7YA 2NVUB 1B9JA 5K2YA 4OWDA 2D3IA 3Q28A 1DTZA 5AA2B 4YZZA 2DVCA 3O2AA 1MY3A 2Y7RA 3VDFA 5H8QB 2XXUA 1UTBA 4BDOA 2NXOA 4C1TA 1FW0A 4KQPA 4YU0A 3PPQA 1P1NA 3MJNA 1N84A 2PMSA 1B0LA 2A5TA 2QS2A 2XXTA 5TU0A 1VSOA 5CBSA 1H76A 2I4CA 4XKNA 2DWIA 2REGA 2Y7PA 1DTGA 3N26A 3K6VA 4DE8A 3EN3A 4I1DA 1MXVA 1N3XA 2PVUA 1SQYA 5TP9A 1SW1A 3TKDA 3MVXA 2QMWA 3Q26A 1IQ7A 5DVFA 4OMBA 3GZGA 1EZ9A 2XHDA 4XTCQ 3PU5A 4IO2A 3RUMA 3TCFA 1MQIA 2HZLA 5FHOA 1B05A 2F97A 2RC8A 4WXJA 3RNNA 3H6WA 3C36A 5L9MA 4E0WA 4ND9A 1UTHA 2F6GA 1Z7NE 4FE8A 2X7PA 1Y3PA 4WEDA 1EU8A 3MZ9A 1B4ZA 3B6TA 2ZNTA 4HW8A 3FUZA 3KEIA 4XXUA 3C34A 3QYTA 4F1YA 1US5A 3ZSFA 2XXWA 1TWYA 3U93A 3MUQA 3PMVA 3C31A 1P1WA 1B6HA 4HCYA 4Q0CA 1LSTA 1YAEA 4KYDA 2ONRA 4OENA 2OJTA 4BDMA 1B32A 4MLQA 1P1UA 2H98A 5I2KB 1N7XA 1VFEA 2CZLA 5BWJA 3UGWA 1QW0A 1BP5A 1I6QA 1MH4A 4LZ5A 4OZ9A 4PFWA 4Q5TA 1B2HA 1B58A 3FVNA 3HV1A 4F3PA 5BUUA 1S9TA 3IL1B 2VD3A 1UTHB 3PPPA 2HXWA 1A7LA 2Q2AA 2H25A 1IZ1A 2Y7KA 2ZNUA 1Y4CA 3R26A 1CE2A 3KG2A 5DYHA 3MVYA 5TP9B 4E0XA 1Y1ZA 1WDNA 2PYYA 3OO6A 3CSBA 4G77A 3S9EA 1SD3A 1B52A 3T66A 4C1UA 3MPLA 3TELA 3KN7A 3S4UA 3RN8A 4BDNA 2KLFA 4XKQA 3LSLA 3PUVE 2DVZA 1NH8A 4FECA 3LSXA 2QJEA 3KFMA 5HPQA 5I56B 1OMPA 2GFEA 3FXQA 3BFTA 4ISUA 3RLFE 2O7UA 1B3HA 3ZKLA 1MY0A 2VP1A 4QFKA 2I58A 1B51A 5CMKA 1MXUA 4NF5B 4PP0A 4QF9A 1Q1KA 4GL0A 4OQOA 3IOWA 3QSLA 4GD5A 3FGSA 4GL8A 4U23A 3VVFA 5HM4B 2ALUA 3TQWA 4Q8RA 5I2KA 3G3JA 3RQTA 1Y20A 3G3FA 4ZEIA 1YPNA 3VVEA 1B7HA 1YTVA 1B1XA 4NMYA 1PB8A 3TUSA 2F7AA 3FVOA 1URGA 4RNSA 4ZEBA 4QFOA 3GBAA 3PUXE 2E0SA 1H3DA 4F39A 1M5DA 1ANFA 3MP6A 2XXYA 3OD7A 5CMCA 5ICTA 2E1SA 2O7IA 3KBRA 3T22A 2Q9TA 5I58A 1BIYA 3MP8A 3HCQA 2GH9A 4RJZA 2PBWA 5AA2D 4TQUQ 2ANJA 2F7CA 2O68A 4QRZA 4L17A 3IAZA 4M4GA 1M5FA 1H43A 4RY1A 2DXYA 2RCAA 1CB6A 1NFTA 4LP2B 4YMBA 4IGTA 2R9JA 3OEKA 1SYIA 4G4PA 4YKPA 4QFLA 4R6KA 3IK6B 4G8NA 4WKMA 4BDRA 3EHUA 3K00A 4F31B 3TTLA 3MZ1A 4OXVA 3CFXA 4F3GA 1RKMA 1URSA 3MP1A 4GIZA 3U92A 4F2OA 4DCXA 2V3UA 4RK2A 3HN0A 3LR1A 3O6HA 4PFYA 2H5YA 4JWYA 4QSCA 3UN6A 2GRVA 3EHTA 4GFRA 4GWOA 2UVIA 1AMFA 1FQBA 1B0HA 3DP8A 3G3KA 5H8HA 3Q27A 4H1XA 1XOCA 1TFDA 4Z7EA 3EF7A 4F3BA 4F2QA 1VFDA 4NF8B 3CI8A 2HCAA 3FVKA 4EDPA 1Y3NA 2ESNA 2QS1A 1JW5A 3O9PA 4F3SA 2VOZA 4EXLA 3TZAA 1R6ZA 1JQFA 2X7QA 4H8JA 4NF5A 4KFQA 4MBPA 4QFNA 5DT6A 2ONKE 3FVGA 2FA7A 4ZE8A 1O63A 3VXBA 2I49A 4DXCA 3FXUA 3H03A 3ZKKA 4IY5A 2F78A 1JVYA 3MWBA 5AE4A 1JW1A 2F5XA 3C9HA 2DWHA 3PUZE 1SVXB 2WKYA 1M5CA 2F7BA 3LBSA 4IO4A 2NOOA 1MH3A 2ZYKA 5TPAB 4DDDA 1DPEA 4EQBA 4GXSB 5I58B 1ELJA 5EHMA 3FV1A 4JXIA 1NH7A 3N6UA 4ZZEA 2O6AA 4POXA 1LAXA 2O1MA 3KOTA 3TPAA 1MPCA 3O28A 5A5XB 1TFAA 1H44A 3MAMA 4KPTA 1LAHE 4Q30B 3T9VA 4FIMA 1DMBA 1IXGA 3H6TA 1B4HA 1ZMGA 1XVYA 2DP8A 5HBCA 2FNCA 3IOVA 4R6HA 3ECRA 3HO7A 5ICQA 4U2RA 2NUVA 1MM7A 3T9UA 3TTNA 1LFHA 5F7VA 1OLCA 3K4UA 4PQJA 5H8NA 1ZLQA 3G3GA 3TAJA 5AA3A 2V84A 1AL3A 2XXHA 3D4GA 1S50A 2G93A 3DELB 1LCTA 2FYIA 5K2XA 2Z23A 1XHYA 2HAUA 1Y4TA 4GRKA 4KR5A 3LUYA 4MLVA 3TDJA 2Y7IA 4ELQA 1YCJA 5I2NB 3IOTA 5CC2A 3BFUA 3IX1A 4R9GA 4DXBA 1NKXA 4BDLA 4F18A 1ZIUA 3O6IA 3OMBA 4HTGA 3VFJA 4QFPA 1IXHA 2DQVA 1FQEA 2O51A 2UVJA 3TMGA 3DLNA 4DIGA 4ONYA 2XXVA 4F1UA 1QULA 2I3VA 4HS7A 3UP9A 2QS3A 5ISUA 2AYSA 5AA4A 2IEEA 2Y84A 4N07A 1QVSA 2OWTA 3DP6A 2UYEA 3P7IA 4EF1A 3H7MA 4TLMB 1SDXA 1FQFA 2AL5A 3FXRA 5JTYB 2G29A 4NF6B 5EHSA 2O84X 1ZTYA 1XT8A 1USYE 2ZYOA 4R6YA 1US4A 3V89B 2OZZA 3RTWB 3O6GA 4ZE9A 2YPNA 1MXXA 4P11A 3IR1A 4NWDA 2ZXTA 4OFLA 3EHSA 4X1BA 5CRYA 1A55A 2I6EA 4KCCA 3S2VA 3VLWA 4K3FA 1B3FA 3I6VA 4XKPA 1JETA 1R1NA 2O69A 3HSTA 4H8IA 4LUBA 4RA1A 1F9BA 2LAOA 3T9HB 2I0CA 4MF3A 1TT1A 3FD3A 2RCBA 3F11A 1B1HA 3T9XB 3ILUB 4F22A 1MY2A 4OEUA 1KWHA 1XVXA 2XX7A 4O3BA 3SEYA 3U72A 1B5IA 1MQGA 3E4RA 2PT1A 1DPPA 1JVXA 3KSJA 2F36A 2AIXA 5JEIA 2THIA 3SEVA 4IO6A 1A40A 1FTMA 1IXIA 1MQJA 2HZKA 3N94A 4GQOA 4H5FA 2XXPA 4IGRA 4X9TA 4YB5A 3UORA 4PETA 4PE5B 3TODA 2Q88A 4I9DA 3K1MA 5LOMA 4OFJA 3EPEA 3MW0A 4KHZE 5AA1A 1NNFA 4ECFA 1B5HA 4ESXA 5H8HB 4MFIA 2QS4A 2VD2A 4IY6A 2XXIA 5CM6A 3VLVA 1MY4A 2I0BA 2RF1A 3PUYE 3IO4A 3KN8A 3HHFA 3U1OA 4EQ7A 3V5AA 4ELOA 4JWXA 2PT2A 3H6VA 3V8XB 3G3IA 4OHNA 3K6WA 1QJMA 4RYAA 4G2ZA 3PPOA 4U4SA 3KSXA 4IO5A 3D4CA 4LATA 3S9LC 3K0VA 4H6DA 3M3KA 4HCWA 3W15C 1MM6A 3OXNA 1Y1MA 4H5GA 4NTLA 3SEUA 1SW4A 4FAJA 3RGYA 1HSLA 1Z7ME 5L9SA 3FJGA 5B7DA 1B40A 2Z8FA 1JEUA 1PC3A 2ZYMA 4U21A 5CMMA 1MXYA 3MZBA 3A09A 3UK4A 4YKJA 5KCJB 5ITPA 1PDAA 4KI0E 1FQDA 4RXLA 3SEXA 2DYXA 4EUOA 3ODBA 1ZBMA 1A54A 3M3FA 4OESA 1FCKA 1NNPA 1PEBA 3KZGA 4YB7A 4RPNA 4BDQA 5AA2A 3PMXA 3ILTB 1UIUA 2DXRA 5H8QA 1LCFA 1ZU0A 4LZ8A 3U8QA 3VLUA 4ESWA 1RYXA 1B3EA 2H9BA 1FQCA 3MQ9A 3KN3A 1N7WA 2I4BA 4R9FA 2UVHA 3FATA 5KCJA 1IUDA 2OK2A 3IOUA 3TTMA 1MXZA 1BTJA 2XXXA 3CFZA 2XXQA 3OO9A 4GXAA 4LQ5A 3MBPA 1MY1A 4G68C 4JDFA 5I2NA 3A3CA 3KGCA 5DVJA 2H99A 3O66A 4H0WA 4WEPA 5L8DA 3W9VA 2GHAA 3FASA 1AH5A 2QSXA 2XD2A 4ZEDA 2B3BA 3IORA 3N6TA 5EYFA 2XD3A 1WVJA 1NNTA 2H4IA 3FJ7A 4NF4B 4UA8A 3SERA 5H8NB 1MPBA 1P1QA 2CMOA 1UIVA 1IIWA 4XIGQ 5CBRA 4JSOA 1QKBA 4KCDA 2A5SA 3MC2A 4M1VA 1PBQA 1OVTA 4I8CA 1MPDA 1LBCA 3KJTA 3L6GA 3PGFA 2QL3A 3L6HA 2F35A 4U1ZA 3IB0A 1TXFA 4POWA 1DOTA 2HAVA 1OQHA 1DSNA 1MQDA 1PB9A 3K2DA 2ABHA 2VGQA 4YICA 1LB8A 3FV2A 2XXRA 2DE3A 4FATA 3S9MC 3H3GA 4F19A 5ELVA 1N76A 1IITA 1NMUA 1O7TA 4GOTA 4ZS9A 2UXAA 3OO8A 5FTHA 4R75A 4H67A 4FEDA 2Q89A 4ZEKA 3CIJA 1SI1A 2PX1A 1O64A 3VE1B 4F1VA 3Q29A 3GLBA 4NF8A 3TYHA 4THIA 4FORA 3QXMA 3RY3A 3LSWA 3C32A 2DWJA 2HQ0A 3PPRA 4R73A 2NWJA 1EZOA 4LVQA 2V93A 1B3LA 3EQ1A 3FIRA 4FEBA 4GVOA 2Y7WA 4NEDA 3G3HA 3WAFA 1JNFA 3C33A 1GV8A 3A3UA 2P0SA 1BLFA 1OIBA 3CSGA 3IO6A 1FTOA 2RC9A 3O97A 3CG1A 1FTLA 1SBPA 4I62A 4KYEA 1ATGA 3QAXA 2ZNSA 3GBBA 2Z22A 3IJOB 4NF4A 4U4XA 3PV0E 3SETA 4GF8A 3TQLA 3ONMA 4YB6A 1M5EA 3I5OA 1Q35A 3CRBA 1LAFE 4OERA 3S9NC 4U1OA 3TEPA 3VXCA 4OFOA 4P0GA 1LLSA 1NL5A 4RK9A 3E13X 4BLAA 2D21A 3IB1A 3B6WA 4EQ9A 1B7ZA 4N6PA 4ZEFA 1B46A 4IO3A 2F8DA 4PFUA 1FQAA 4R72A 3W9WA 3U94A 4R2FA 3PD9A 1R9QA 2ZYNA 5I59B 3V83A 2AL4A 1SW5A 1UQWA 3FJMA 5F1QA 1FTJA 1B5JA 2QMXA 4NWCA 5ITOA 3USDA 2A5TB 5I56A 1AIVA 1XS5A 4OEVA 1EZPA 3CR9A 5CI5A 1I69A 4YKIA 4JB7A 4JWOA 5J1DA 3H6UA 2BJJX 3OENA 5DVIA 5H8FB 1B3GA 1LFGA 3I3VA 2OWSA 2RKMA 3SDFA 3JYRA 1VR5A 1QUKA 4IO7A 4O3AA 3SKPA 2VHAA 3DM0A 5H8SA 3THIA 1PB7A 1QUIA 1USYH 5AA4B 2DSFA 2RINA 1N04A 3C35A 4G8HA 3TCGA 2GHBA 3CG3A 3R7XA 2Q2CA 4O3CA 3CVGA 1NNKA 5I59A 2V3QA 3R6UA 5KDTB 3RTFB 1URDA 3BBRA 1A99A 3N5LA 3RT6B 3SESA 5JTYA 3RT8A 3MVWA 1MQHA 2OLBA 4NE4A 3M8UA 3T96B 1SI0A 3WAEA 2I3WA 4ELPA 1L5TA 4LQ2A 5I57A 1WODA 4QSDA 4JSDA 3G7WA 3OSQA 2REJA 2V25A 1AOVA 4KD5A 4R74A 2YLNA 2I48A 3PD8A 1N0TA 2D5WA 2Z8EA 3KJ7A 1I6BA 1HSJA 4NF6A 1RYOA 3C4MA 1GGGA 2QPQA 3LSFB 3MVZA 3OEMA 3BKIB 4DCYA 1OQGA 1A8EA 1EH3A 1R9LA 1D9VA 2DWAA 2B3FA 2DE2A 2HFBA 4F29A 2Z8DA 3ZS6A 3E9XA 2YJPA 5KDTA 1OLAA 1II5A 4OTEA 1JW4A 1LB9A 2P2AA 3O29A 3VV5A 1IEJA 2ONSA 1IXCA 3PMWA 3QUFA 4C0RA 4YAHX 3SEWA 1SW2A 2DS9A 3JV9A 4ZECA 5FHMA 2P1SA 2QRYA 1QUJA 4UACA 3K6XA 5DEXA 5A5XA 1LAGE 1PBPA 4OETA 1POY1 3K1NA 3B7DA 2Q8JA 3LC8A 5L9OA 4OYVA 1M5BA 4QHQA 3OELA 4XKRA 4EF2A 1SYHA 3TCHA 5H8FA 4RPOA 3FZVA 4N13A 4LA9A 3DP4A 2V3TA 4JBZA 5TPAA 5FHNA 1J1NA 3HPIA 4AB6A 4YKKA 3JZJA 1D4NA 1MDP1 2B65A 2O1LA 2ZMBA 1H45A 4OVJA 1LFIA 3TTKA 4IB2A 4DXUA 4R2BA 2DE4A 3H4ZA 5B70A 3UIFA 5IAIA 2R6GE 3OSRA 1Y9UA 3HHGA 2HEUA 3CFLA 3K02A 3Q25A 3QUJA 5IKBA 3IJXB 3IB2A 1OVBA 2M8CA 4U22A 1P1OA 1QKAA 1ZJLA 1VE4A 4G68B 3K01A 4LZ7A 4X48A 3K1PA 5M2VA 5I57B 3OOAA 1GTKA 3M3LA 4ELRA 2X26A 2XX9A 2RC7A 1LGBC 3KOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y3Q A;  5DTB A;  1BKA A;  4P0I A;  4PFT A;  4X1D A;  3T93 B;  5FTI A;  4EXK A;  1MRP A;  4FJP A;  1HSE A;  3AXF A;  1UTB B;  2DOJ A;  4KYS A;  1MS7 A;  1D3K A;  3QK6 A;  1I6A A;  1XC1 A;  4TOZ A;  5DEX B;  5I84 A;  4DZ1 A;  4H65 A;  4G8M A;  4QSE A;  5CMB A;  2OBG A;  3B6Q A;  4GLI A;  1P99 A;  2F6P A;  4G68 A;  4LON B;  3UA8 A;  1S7Y A;  1T0K A;  4MH5 A;  3TTR A;  2UYF A;  1A8F A;  1N3W A;  2OCU A;  1GVC A;  1MDQ A;  4DLD A;  1B7U A;  3PPN A;  2R71 A;  1MXW A;  3H06 B;  4ZDM A;  3TFL A;  3E3K A;  3GXA A;  3MPK A;  3RPW A;  4ZZA A;  3VVD A;  3QIM A;  1POT A;  1ZKB A;  2UVG A;  3OO7 A;  2IA4 A;  4AQ4 A;  2F34 A;  3K6U A;  4YMA A;  1GR2 A;  1JEV A;  2XX8 A;  1FTK A;  1D9Y A;  3PUW E;  4Z0I A;  4AB5 A;  5JK4 A;  1MG1 A;  1LBB A;  5KZT A;  4TLL B;  2W7Y A;  2NVU B;  1B9J A;  5K2Y A;  4OWD A;  2D3I A;  3Q28 A;  1DTZ A;  5AA2 B;  4YZZ A;  2DVC A;  3O2A A;  1MY3 A;  2Y7R A;  3VDF A;  5H8Q B;  2XXU A;  1UTB A;  4BDO A;  2NXO A;  4C1T A;  1FW0 A;  4KQP A;  4YU0 A;  3PPQ A;  1P1N A;  3MJN A;  1N84 A;  2PMS A;  1B0L A;  2A5T A;  2QS2 A;  2XXT A;  5TU0 A;  1VSO A;  5CBS A;  1H76 A;  2I4C A;  4XKN A;  2DWI A;  2REG A;  2Y7P A;  1DTG A;  3N26 A;  3K6V A;  4DE8 A;  3EN3 A;  4I1D A;  1MXV A;  1N3X A;  2PVU A;  1SQY A;  5TP9 A;  1SW1 A;  3TKD A;  3MVX A;  2QMW A;  3Q26 A;  1IQ7 A;  5DVF A;  4OMB A;  3GZG A;  1EZ9 A;  2XHD A;  4XTC Q;  3PU5 A;  4IO2 A;  3RUM A;  3TCF A;  1MQI A;  2HZL A;  5FHO A;  1B05 A;  2F97 A;  2RC8 A;  4WXJ A;  3RNN A;  3H6W A;  3C36 A;  5L9M A;  4E0W A;  4ND9 A;  1UTH A;  2F6G A;  1Z7N E;  4FE8 A;  2X7P A;  1Y3P A;  4WED A;  1EU8 A;  3MZ9 A;  1B4Z A;  3B6T A;  2ZNT A;  4HW8 A;  3FUZ A;  3KEI A;  4XXU A;  3C34 A;  3QYT A;  4F1Y A;  1US5 A;  3ZSF A;  2XXW A;  1TWY A;  3U93 A;  3MUQ A;  3PMV A;  3C31 A;  1P1W A;  1B6H A;  4HCY A;  4Q0C A;  1LST A;  1YAE A;  4KYD A;  2ONR A;  4OEN A;  2OJT A;  4BDM A;  1B32 A;  4MLQ A;  1P1U A;  2H98 A;  5I2K B;  1N7X A;  1VFE A;  2CZL A;  5BWJ A;  3UGW A;  1QW0 A;  1BP5 A;  1I6Q A;  1MH4 A;  4LZ5 A;  4OZ9 A;  4PFW A;  4Q5T A;  1B2H A;  1B58 A;  3FVN A;  3HV1 A;  4F3P A;  5BUU A;  1S9T A;  3IL1 B;  2VD3 A;  1UTH B;  3PPP A;  2HXW A;  1A7L A;  2Q2A A;  2H25 A;  1IZ1 A;  2Y7K A;  2ZNU A;  1Y4C A;  3R26 A;  1CE2 A;  3KG2 A;  5DYH A;  3MVY A;  5TP9 B;  4E0X A;  1Y1Z A;  1WDN A;  2PYY A;  3OO6 A;  3CSB A;  4G77 A;  3S9E A;  1SD3 A;  1B52 A;  3T66 A;  4C1U A;  3MPL A;  3TEL A;  3KN7 A;  3S4U A;  3RN8 A;  4BDN A;  2KLF A;  4XKQ A;  3LSL A;  3PUV E;  2DVZ A;  1NH8 A;  4FEC A;  3LSX A;  2QJE A;  3KFM A;  5HPQ A;  5I56 B;  1OMP A;  2GFE A;  3FXQ A;  3BFT A;  4ISU A;  3RLF E;  2O7U A;  1B3H A;  3ZKL A;  1MY0 A;  2VP1 A;  4QFK A;  2I58 A;  1B51 A;  5CMK A;  1MXU A;  4NF5 B;  4PP0 A;  4QF9 A;  1Q1K A;  4GL0 A;  4OQO A;  3IOW A;  3QSL A;  4GD5 A;  3FGS A;  4GL8 A;  4U23 A;  3VVF A;  5HM4 B;  2ALU A;  3TQW A;  4Q8R A;  5I2K A;  3G3J A;  3RQT A;  1Y20 A;  3G3F A;  4ZEI A;  1YPN A;  3VVE A;  1B7H A;  1YTV A;  1B1X A;  4NMY A;  1PB8 A;  3TUS A;  2F7A A;  3FVO A;  1URG A;  4RNS A;  4ZEB A;  4QFO A;  3GBA A;  3PUX E;  2E0S A;  1H3D A;  4F39 A;  1M5D A;  1ANF A;  3MP6 A;  2XXY A;  3OD7 A;  5CMC A;  5ICT A;  2E1S A;  2O7I A;  3KBR A;  3T22 A;  2Q9T A;  5I58 A;  1BIY A;  3MP8 A;  3HCQ A;  2GH9 A;  4RJZ A;  2PBW A;  5AA2 D;  4TQU Q;  2ANJ A;  2F7C A;  2O68 A;  4QRZ A;  4L17 A;  3IAZ A;  4M4G A;  1M5F A;  1H43 A;  4RY1 A;  2DXY A;  2RCA A;  1CB6 A;  1NFT A;  4LP2 B;  4YMB A;  4IGT A;  2R9J A;  3OEK A;  1SYI A;  4G4P A;  4YKP A;  4QFL A;  4R6K A;  3IK6 B;  4G8N A;  4WKM A;  4BDR A;  3EHU A;  3K00 A;  4F31 B;  3TTL A;  3MZ1 A;  4OXV A;  3CFX A;  4F3G A;  1RKM A;  1URS A;  3MP1 A;  4GIZ A;  3U92 A;  4F2O A;  4DCX A;  2V3U A;  4RK2 A;  3HN0 A;  3LR1 A;  3O6H A;  4PFY A;  2H5Y A;  4JWY A;  4QSC A;  3UN6 A;  2GRV A;  3EHT A;  4GFR A;  4GWO A;  2UVI A;  1AMF A;  1FQB A;  1B0H A;  3DP8 A;  3G3K A;  5H8H A;  3Q27 A;  4H1X A;  1XOC A;  1TFD A;  4Z7E A;  3EF7 A;  4F3B A;  4F2Q A;  1VFD A;  4NF8 B;  3CI8 A;  2HCA A;  3FVK A;  4EDP A;  1Y3N A;  2ESN A;  2QS1 A;  1JW5 A;  3O9P A;  4F3S A;  2VOZ A;  4EXL A;  3TZA A;  1R6Z A;  1JQF A;  2X7Q A;  4H8J A;  4NF5 A;  4KFQ A;  4MBP A;  4QFN A;  5DT6 A;  2ONK E;  3FVG A;  2FA7 A;  4ZE8 A;  1O63 A;  3VXB A;  2I49 A;  4DXC A;  3FXU A;  3H03 A;  3ZKK A;  4IY5 A;  2F78 A;  1JVY A;  3MWB A;  5AE4 A;  1JW1 A;  2F5X A;  3C9H A;  2DWH A;  3PUZ E;  1SVX B;  2WKY A;  1M5C A;  2F7B A;  3LBS A;  4IO4 A;  2NOO A;  1MH3 A;  2ZYK A;  5TPA B;  4DDD A;  1DPE A;  4EQB A;  4GXS B;  5I58 B;  1ELJ A;  5EHM A;  3FV1 A;  4JXI A;  1NH7 A;  3N6U A;  4ZZE A;  2O6A A;  4POX A;  1LAX A;  2O1M A;  3KOT A;  3TPA A;  1MPC A;  3O28 A;  5A5X B;  1TFA A;  1H44 A;  3MAM A;  4KPT A;  1LAH E;  4Q30 B;  3T9V A;  4FIM A;  1DMB A;  1IXG A;  3H6T A;  1B4H A;  1ZMG A;  1XVY A;  2DP8 A;  5HBC A;  2FNC A;  3IOV A;  4R6H A;  3ECR A;  3HO7 A;  5ICQ A;  4U2R A;  2NUV A;  1MM7 A;  3T9U A;  3TTN A;  1LFH A;  5F7V A;  1OLC A;  3K4U A;  4PQJ A;  5H8N A;  1ZLQ A;  3G3G A;  3TAJ A;  5AA3 A;  2V84 A;  1AL3 A;  2XXH A;  3D4G A;  1S50 A;  2G93 A;  3DEL B;  1LCT A;  2FYI A;  5K2X A;  2Z23 A;  1XHY A;  2HAU A;  1Y4T A;  4GRK A;  4KR5 A;  3LUY A;  4MLV A;  3TDJ A;  2Y7I A;  4ELQ A;  1YCJ A;  5I2N B;  3IOT A;  5CC2 A;  3BFU A;  3IX1 A;  4R9G A;  4DXB A;  1NKX A;  4BDL A;  4F18 A;  1ZIU A;  3O6I A;  3OMB A;  4HTG A;  3VFJ A;  4QFP A;  1IXH A;  2DQV A;  1FQE A;  2O51 A;  2UVJ A;  3TMG A;  3DLN A;  4DIG A;  4ONY A;  2XXV A;  4F1U A;  1QUL A;  2I3V A;  4HS7 A;  3UP9 A;  2QS3 A;  5ISU A;  2AYS A;  5AA4 A;  2IEE A;  2Y84 A;  4N07 A;  1QVS A;  2OWT A;  3DP6 A;  2UYE A;  3P7I A;  4EF1 A;  3H7M A;  4TLM B;  1SDX A;  1FQF A;  2AL5 A;  3FXR A;  5JTY B;  2G29 A;  4NF6 B;  5EHS A;  2O84 X;  1ZTY A;  1XT8 A;  1USY E;  2ZYO A;  4R6Y A;  1US4 A;  3V89 B;  2OZZ A;  3RTW B;  3O6G A;  4ZE9 A;  2YPN A;  1MXX A;  4P11 A;  3IR1 A;  4NWD A;  2ZXT A;  4OFL A;  3EHS A;  4X1B A;  5CRY A;  1A55 A;  2I6E A;  4KCC A;  3S2V A;  3VLW A;  4K3F A;  1B3F A;  3I6V A;  4XKP A;  1JET A;  1R1N A;  2O69 A;  3HST A;  4H8I A;  4LUB A;  4RA1 A;  1F9B A;  2LAO A;  3T9H B;  2I0C A;  4MF3 A;  1TT1 A;  3FD3 A;  2RCB A;  3F11 A;  1B1H A;  3T9X B;  3ILU B;  4F22 A;  1MY2 A;  4OEU A;  1KWH A;  1XVX A;  2XX7 A;  4O3B A;  3SEY A;  3U72 A;  1B5I A;  1MQG A;  3E4R A;  2PT1 A;  1DPP A;  1JVX A;  3KSJ A;  2F36 A;  2AIX A;  5JEI A;  2THI A;  3SEV A;  4IO6 A;  1A40 A;  1FTM A;  1IXI A;  1MQJ A;  2HZK A;  3N94 A;  4GQO A;  4H5F A;  2XXP A;  4IGR A;  4X9T A;  4YB5 A;  3UOR A;  4PET A;  4PE5 B;  3TOD A;  2Q88 A;  4I9D A;  3K1M A;  5LOM A;  4OFJ A;  3EPE A;  3MW0 A;  4KHZ E;  5AA1 A;  1NNF A;  4ECF A;  1B5H A;  4ESX A;  5H8H B;  4MFI A;  2QS4 A;  2VD2 A;  4IY6 A;  2XXI A;  5CM6 A;  3VLV A;  1MY4 A;  2I0B A;  2RF1 A;  3PUY E;  3IO4 A;  3KN8 A;  3HHF A;  3U1O A;  4EQ7 A;  3V5A A;  4ELO A;  4JWX A;  2PT2 A;  3H6V A;  3V8X B;  3G3I A;  4OHN A;  3K6W A;  1QJM A;  4RYA A;  4G2Z A;  3PPO A;  4U4S A;  3KSX A;  4IO5 A;  3D4C A;  4LAT A;  3S9L C;  3K0V A;  4H6D A;  3M3K A;  4HCW A;  3W15 C;  1MM6 A;  3OXN A;  1Y1M A;  4H5G A;  4NTL A;  3SEU A;  1SW4 A;  4FAJ A;  3RGY A;  1HSL A;  1Z7M E;  5L9S A;  3FJG A;  5B7D A;  1B40 A;  2Z8F A;  1JEU A;  1PC3 A;  2ZYM A;  4U21 A;  5CMM A;  1MXY A;  3MZB A;  3A09 A;  3UK4 A;  4YKJ A;  5KCJ B;  5ITP A;  1PDA A;  4KI0 E;  1FQD A;  4RXL A;  3SEX A;  2DYX A;  4EUO A;  3ODB A;  1ZBM A;  1A54 A;  3M3F A;  4OES A;  1FCK A;  1NNP A;  1PEB A;  3KZG A;  4YB7 A;  4RPN A;  4BDQ A;  5AA2 A;  3PMX A;  3ILT B;  1UIU A;  2DXR A;  5H8Q A;  1LCF A;  1ZU0 A;  4LZ8 A;  3U8Q A;  3VLU A;  4ESW A;  1RYX A;  1B3E A;  2H9B A;  1FQC A;  3MQ9 A;  3KN3 A;  1N7W A;  2I4B A;  4R9F A;  2UVH A;  3FAT A;  5KCJ A;  1IUD A;  2OK2 A;  3IOU A;  3TTM A;  1MXZ A;  1BTJ A;  2XXX A;  3CFZ A;  2XXQ A;  3OO9 A;  4GXA A;  4LQ5 A;  3MBP A;  1MY1 A;  4G68 C;  4JDF A;  5I2N A;  3A3C A;  3KGC A;  5DVJ A;  2H99 A;  3O66 A;  4H0W A;  4WEP A;  5L8D A;  3W9V A;  2GHA A;  3FAS A;  1AH5 A;  2QSX A;  2XD2 A;  4ZED A;  2B3B A;  3IOR A;  3N6T A;  5EYF A;  2XD3 A;  1WVJ A;  1NNT A;  2H4I A;  3FJ7 A;  4NF4 B;  4UA8 A;  3SER A;  5H8N B;  1MPB A;  1P1Q A;  2CMO A;  1UIV A;  1IIW A;  4XIG Q;  5CBR A;  4JSO A;  1QKB A;  4KCD A;  2A5S A;  3MC2 A;  4M1V A;  1PBQ A;  1OVT A;  4I8C A;  1MPD A;  1LBC A;  3KJT A;  3L6G A;  3PGF A;  2QL3 A;  3L6H A;  2F35 A;  4U1Z A;  3IB0 A;  1TXF A;  4POW A;  1DOT A;  2HAV A;  1OQH A;  1DSN A;  1MQD A;  1PB9 A;  3K2D A;  2ABH A;  2VGQ A;  4YIC A;  1LB8 A;  3FV2 A;  2XXR A;  2DE3 A;  4FAT A;  3S9M C;  3H3G A;  4F19 A;  5ELV A;  1N76 A;  1IIT A;  1NMU A;  1O7T A;  4GOT A;  4ZS9 A;  2UXA A;  3OO8 A;  5FTH A;  4R75 A;  4H67 A;  4FED A;  2Q89 A;  4ZEK A;  3CIJ A;  1SI1 A;  2PX1 A;  1O64 A;  3VE1 B;  4F1V A;  3Q29 A;  3GLB A;  4NF8 A;  3TYH A;  4THI A;  4FOR A;  3QXM A;  3RY3 A;  3LSW A;  3C32 A;  2DWJ A;  2HQ0 A;  3PPR A;  4R73 A;  2NWJ A;  1EZO A;  4LVQ A;  2V93 A;  1B3L A;  3EQ1 A;  3FIR A;  4FEB A;  4GVO A;  2Y7W A;  4NED A;  3G3H A;  3WAF A;  1JNF A;  3C33 A;  1GV8 A;  3A3U A;  2P0S A;  1BLF A;  1OIB A;  3CSG A;  3IO6 A;  1FTO A;  2RC9 A;  3O97 A;  3CG1 A;  1FTL A;  1SBP A;  4I62 A;  4KYE A;  1ATG A;  3QAX A;  2ZNS A;  3GBB A;  2Z22 A;  3IJO B;  4NF4 A;  4U4X A;  3PV0 E;  3SET A;  4GF8 A;  3TQL A;  3ONM A;  4YB6 A;  1M5E A;  3I5O A;  1Q35 A;  3CRB A;  1LAF E;  4OER A;  3S9N C;  4U1O A;  3TEP A;  3VXC A;  4OFO A;  4P0G A;  1LLS A;  1NL5 A;  4RK9 A;  3E13 X;  4BLA A;  2D21 A;  3IB1 A;  3B6W A;  4EQ9 A;  1B7Z A;  4N6P A;  4ZEF A;  1B46 A;  4IO3 A;  2F8D A;  4PFU A;  1FQA A;  4R72 A;  3W9W A;  3U94 A;  4R2F A;  3PD9 A;  1R9Q A;  2ZYN A;  5I59 B;  3V83 A;  2AL4 A;  1SW5 A;  1UQW A;  3FJM A;  5F1Q A;  1FTJ A;  1B5J A;  2QMX A;  4NWC A;  5ITO A;  3USD A;  2A5T B;  5I56 A;  1AIV A;  1XS5 A;  4OEV A;  1EZP A;  3CR9 A;  5CI5 A;  1I69 A;  4YKI A;  4JB7 A;  4JWO A;  5J1D A;  3H6U A;  2BJJ X;  3OEN A;  5DVI A;  5H8F B;  1B3G A;  1LFG A;  3I3V A;  2OWS A;  2RKM A;  3SDF A;  3JYR A;  1VR5 A;  1QUK A;  4IO7 A;  4O3A A;  3SKP A;  2VHA A;  3DM0 A;  5H8S A;  3THI A;  1PB7 A;  1QUI A;  1USY H;  5AA4 B;  2DSF A;  2RIN A;  1N04 A;  3C35 A;  4G8H A;  3TCG A;  2GHB A;  3CG3 A;  3R7X A;  2Q2C A;  4O3C A;  3CVG A;  1NNK A;  5I59 A;  2V3Q A;  3R6U A;  5KDT B;  3RTF B;  1URD A;  3BBR A;  1A99 A;  3N5L A;  3RT6 B;  3SES A;  5JTY A;  3RT8 A;  3MVW A;  1MQH A;  2OLB A;  4NE4 A;  3M8U A;  3T96 B;  1SI0 A;  3WAE A;  2I3W A;  4ELP A;  1L5T A;  4LQ2 A;  5I57 A;  1WOD A;  4QSD A;  4JSD A;  3G7W A;  3OSQ A;  2REJ A;  2V25 A;  1AOV A;  4KD5 A;  4R74 A;  2YLN A;  2I48 A;  3PD8 A;  1N0T A;  2D5W A;  2Z8E A;  3KJ7 A;  1I6B A;  1HSJ A;  4NF6 A;  1RYO A;  3C4M A;  1GGG A;  2QPQ A;  3LSF B;  3MVZ A;  3OEM A;  3BKI B;  4DCY A;  1OQG A;  1A8E A;  1EH3 A;  1R9L A;  1D9V A;  2DWA A;  2B3F A;  2DE2 A;  2HFB A;  4F29 A;  2Z8D A;  3ZS6 A;  3E9X A;  2YJP A;  5KDT A;  1OLA A;  1II5 A;  4OTE A;  1JW4 A;  1LB9 A;  2P2A A;  3O29 A;  3VV5 A;  1IEJ A;  2ONS A;  1IXC A;  3PMW A;  3QUF A;  4C0R A;  4YAH X;  3SEW A;  1SW2 A;  2DS9 A;  3JV9 A;  4ZEC A;  5FHM A;  2P1S A;  2QRY A;  1QUJ A;  4UAC A;  3K6X A;  5DEX A;  5A5X A;  1LAG E;  1PBP A;  4OET A;  1POY 1;  3K1N A;  3B7D A;  2Q8J A;  3LC8 A;  5L9O A;  4OYV A;  1M5B A;  4QHQ A;  3OEL A;  4XKR A;  4EF2 A;  1SYH A;  3TCH A;  5H8F A;  4RPO A;  3FZV A;  4N13 A;  4LA9 A;  3DP4 A;  2V3T A;  4JBZ A;  5TPA A;  5FHN A;  1J1N A;  3HPI A;  4AB6 A;  4YKK A;  3JZJ A;  1D4N A;  1MDP 1;  2B65 A;  2O1L A;  2ZMB A;  1H45 A;  4OVJ A;  1LFI A;  3TTK A;  4IB2 A;  4DXU A;  4R2B A;  2DE4 A;  3H4Z A;  5B70 A;  3UIF A;  5IAI A;  2R6G E;  3OSR A;  1Y9U A;  3HHG A;  2HEU A;  3CFL A;  3K02 A;  3Q25 A;  3QUJ A;  5IKB A;  3IJX B;  3IB2 A;  1OVB A;  2M8C A;  4U22 A;  1P1O A;  1QKA A;  1ZJL A;  1VE4 A;  4G68 B;  3K01 A;  4LZ7 A;  4X48 A;  3K1P A;  5M2V A;  5I57 B;  3OOA A;  1GTK A;  3M3L A;  4ELR A;  2X26 A;  2XX9 A;  2RC7 A;  1LGB C;  3KOS A; 
#chains in the Genus database with same CATH topology
 1Y3Q A;  5DTB A;  1BKA A;  2FIX A;  5FTI A;  4FJP A;  1I6A A;  4DZ1 A;  4QSE A;  2FVZ A;  1P99 A;  4LON B;  1RDX A;  2WBD A;  1T0K A;  4MH5 A;  3TTR A;  1INP A;  2UYF A;  2R71 A;  3H06 B;  1DBZ A;  3MPK A;  4ZZA A;  3VVD A;  3QIM A;  1POT A;  4AQ4 A;  1GR2 A;  1LBB A;  4OWD A;  2D3I A;  5AA2 B;  2QVV A;  2XXU A;  1UTB A;  4C1T A;  4KQP A;  4YU0 A;  2PMS A;  2XXT A;  4XKN A;  5TP9 A;  1SW1 A;  3Q26 A;  1IQ7 A;  3GZG A;  5FHO A;  2Q74 A;  5EQA A;  4WXJ A;  2Y5L A;  4ND9 A;  2F6G A;  1Z7N E;  1EU8 A;  4F1Y A;  4XEQ A;  3PMV A;  3C31 A;  1B6H A;  4Q0C A;  1IMA A;  1YAE A;  4MLQ A;  2H98 A;  3T0J A;  1I6Q A;  1EYJ A;  3ROJ A;  2ZNU A;  1Y4C A;  1NUY A;  3MPL A;  3RN8 A;  2KLF A;  3PUV E;  4FEC A;  4NX1 A;  3FXQ A;  1FPL A;  1B3H A;  1FPJ A;  5IZZ A;  1MXU A;  4QF9 A;  1Q1K A;  4U23 A;  4OAN A;  4GL8 A;  5HM4 B;  2ALU A;  3TQW A;  2GQ1 A;  2F7A A;  3FVO A;  4RNS A;  3GBA A;  3PUX E;  5CMC A;  2E1S A;  5AA2 D;  2F7C A;  4L17 A;  4M4G A;  4QFL A;  4G8N A;  4F31 B;  3TTL A;  4OXV A;  3CFX A;  4F3G A;  1RKM A;  4GIZ A;  4DCX A;  4RK2 A;  4QSC A;  3EHT A;  1B0H A;  2OWZ A;  4PFI A;  2PFZ A;  4NQ8 A;  1JW5 A;  2VOZ A;  5DT6 A;  4NF5 A;  2FA7 A;  4ZE8 A;  4DXC A;  2I49 A;  3FXU A;  2F5X A;  4IR8 A;  4IO4 A;  1NUZ A;  5EHM A;  4JXI A;  2O1M A;  5A5X B;  3T9V A;  1B4H A;  3QMF A;  1FPK A;  5F7V A;  1OLC A;  5H8N A;  2V84 A;  4PC9 A;  3BFU A;  4DXB A;  2DQV A;  2O51 A;  2UVJ A;  2HXR A;  5ISU A;  1QVS A;  4EF1 A;  2AL5 A;  5JTY B;  2ZYO A;  3RTW B;  1NV6 A;  5CRY A;  3EHS A;  2JJK A;  3VLW A;  3I6V A;  4LUB A;  1FPD A;  4G61 A;  1B1H A;  2Q8M A;  1FBG A;  1MY2 A;  4HE1 A;  2XX7 A;  4O3B A;  1B5I A;  4AS4 A;  3E4R A;  2PT1 A;  4OVT A;  4MHF A;  3SEV A;  1IXI A;  3N94 A;  2Q88 A;  3K1M A;  4OFJ A;  1NNF A;  4ESX A;  4IY6 A;  2QVR A;  2Y5K A;  2RF1 A;  4JWX A;  2PT2 A;  5ESY A;  3K6W A;  4U4S A;  4LAT A;  3K0V A;  4H5G A;  3SEU A;  4FAJ A;  1Z7M E;  4U21 A;  5CMM A;  1PC3 A;  1FRP A;  4RXL A;  3E79 A;  3KZG A;  4RPN A;  3PMX A;  3CHG A;  5H8Q A;  5J16 A;  2H9B A;  2QVU A;  3IOU A;  1BTJ A;  2XXX A;  4LQ5 A;  3MBP A;  4G68 C;  3W9V A;  1AH5 A;  2FBP A;  4XFE A;  1UIV A;  1IIW A;  1NV4 A;  1QKB A;  2A5S A;  3KC1 A;  4I8C A;  1LBC A;  5I3S A;  4P8B A;  3GYY A;  3K2D A;  1IMD A;  2ABH A;  2XXR A;  2DE3 A;  4F19 A;  1N76 A;  1NMU A;  2L5V A;  4GWY A;  2Q89 A;  4ZEK A;  3B50 A;  1SI1 A;  1FJ6 A;  3GLB A;  4FOR A;  2DWJ A;  2HQ0 A;  1EZO A;  2V93 A;  1FBD A;  3G3H A;  3IO6 A;  2RC9 A;  1FTL A;  1SBP A;  1ATG A;  2ZNS A;  4GF8 A;  3TEP A;  1M5E A;  3I5O A;  1LAF E;  3VXC A;  4OFO A;  2D21 A;  4P9K A;  4EQ9 A;  1B7Z A;  4N6P A;  1B46 A;  4IO3 A;  1FQA A;  5I59 B;  1FJ9 A;  2AL4 A;  1RDY A;  1FTJ A;  1B5J A;  4PGP A;  3CR9 A;  1FBF A;  2RKM A;  4O3A A;  3SKP A;  1QUI A;  5AA4 B;  1N04 A;  4G8H A;  3R7X A;  4O3C A;  3CVG A;  5I59 A;  5KDT B;  3RT6 B;  3RT8 A;  4ELP A;  2OLB A;  3WAE A;  1L5T A;  1RDZ A;  1WOD A;  4KD5 A;  2YLN A;  2Z8E A;  1I6B A;  1HSJ A;  4QXD A;  5KDT A;  3E9X A;  1OLA A;  2CZK A;  1SW2 A;  4ZEC A;  3LC8 A;  4QHQ A;  1M5B A;  4EF2 A;  4N13 A;  3DP4 A;  2V3T A;  5TPA A;  1J1N A;  3HPI A;  3JZJ A;  1D4N A;  4R2B A;  2DE4 A;  5B70 A;  2CZI A;  3UIF A;  1Y9U A;  3HHG A;  3CFL A;  3Q25 A;  5IKB A;  3IJX B;  2M8C A;  4G68 B;  4GWZ A;  4LZ7 A;  4X48 A;  5I57 B;  2XX9 A;  4EXK A;  4P0I A;  4MMP A;  1MRP A;  3NOH A;  2DOJ A;  4KYS A;  5I84 A;  5DEX B;  4H65 A;  5CMB A;  2OBG A;  1FSA A;  4G68 A;  3ISP A;  4DLD A;  1MDQ A;  3TFL A;  3FXB A;  4PAF A;  1FBC A;  2UVG A;  3OO7 A;  4AB5 A;  2NVU B;  3BIG A;  4JVI A;  2VPN A;  3Q28 A;  1MY3 A;  2NXO A;  1FW0 A;  3PPQ A;  3MJN A;  1B0L A;  5TU0 A;  2DWI A;  1DTG A;  4I1D A;  1N3X A;  3MVX A;  2QMW A;  4IO2 A;  3RUM A;  3MST A;  2F97 A;  3H6W A;  4H45 A;  1Y3P A;  4WED A;  4HW8 A;  3KEI A;  3C34 A;  2XXW A;  1TWY A;  3U93 A;  2VPO A;  3D1R A;  5IGA A;  5I2K B;  1P1U A;  4PFW A;  4F39 A;  4Q5T A;  1B2H A;  5BUU A;  1S9T A;  2VD3 A;  2HXW A;  1A7L A;  2H25 A;  1IZ1 A;  4N81 A;  5TP9 B;  1Y1Z A;  2PYY A;  3OO6 A;  1SD3 A;  3S4U A;  4XKQ A;  5IZ3 A;  1NH8 A;  5HPQ A;  5I56 B;  1OMP A;  2HPG A;  3BFT A;  4ISU A;  2BJI A;  3ZKL A;  1MY0 A;  2VP1 A;  4QFK A;  2WYP A;  3VVF A;  4Q8R A;  1YPN A;  1PB8 A;  1FPG A;  4OVP A;  4QFO A;  2B4M A;  2E0S A;  2XXY A;  2O7I A;  3KBR A;  3HCQ A;  2GH9 A;  4N17 A;  1CB6 A;  4YMB A;  4IGT A;  4G4P A;  4YKP A;  4BDR A;  3MP1 A;  3U92 A;  1LEV A;  4F2O A;  2V3U A;  3HN0 A;  2WYK A;  4GWO A;  2UVI A;  4NHB A;  1FQB A;  3DP8 A;  4MAG A;  4N15 A;  4EDP A;  1Y3N A;  2ESN A;  3O9P A;  5FBP A;  4QFN A;  2ONK E;  3H03 A;  4NF0 A;  2F78 A;  3MWB A;  1JW1 A;  3C9H A;  2DWH A;  3PUZ E;  2WKY A;  5TPA B;  4DDD A;  4EQB A;  1DPE A;  4GXS B;  1NH7 A;  3N6U A;  4ZZE A;  3KOT A;  3MAM A;  1IXG A;  4MEV A;  3IOV A;  5ICQ A;  4U2R A;  1MM7 A;  1ZLQ A;  2G93 A;  2FYI A;  3LUY A;  4MLV A;  1YCJ A;  5I2N B;  3IOT A;  5CC2 A;  1NKX A;  4F18 A;  5LTC A;  1FQE A;  3DLN A;  4F1U A;  4HS7 A;  2I3V A;  2AYS A;  4PAI A;  2OWT A;  1NV7 A;  4NGU A;  3FXR A;  5EHS A;  1ZTY A;  1USY E;  3IR1 A;  4NWD A;  2ZXT A;  3S2V A;  4K3F A;  4XKP A;  2O69 A;  1F9B A;  4MF3 A;  2RCB A;  3F11 A;  1FPF A;  4F22 A;  1KWH A;  1DPP A;  1JVX A;  2AIX A;  2THI A;  1MQJ A;  4IGR A;  4H5F A;  4YB5 A;  4PET A;  5LOM A;  4ECF A;  1B5H A;  5H8H B;  2FIE A;  1MY4 A;  5I5P A;  3HHF A;  4EQ7 A;  5DW8 A;  3V8X B;  3G3I A;  3M3K A;  3OXN A;  1Y1M A;  1SW4 A;  1HSL A;  3HFU A;  3UK4 A;  4YKJ A;  5ITP A;  1PDA A;  4HE0 A;  4KI0 E;  2DYX A;  4EUO A;  3ODB A;  1A54 A;  4OES A;  2MKZ A;  1FPB A;  2DXR A;  1LCF A;  1RYX A;  2I4B A;  4R9F A;  2OK2 A;  2XXQ A;  5F24 A;  1LBY A;  4N8G A;  4WEP A;  5L8D A;  2GHA A;  2XD2 A;  2B3B A;  2CEX A;  1NNT A;  4NF4 B;  4PAK A;  4XIG Q;  3MC2 A;  3KJT A;  3PGF A;  1YYZ A;  2VGQ A;  3FV2 A;  4MIJ A;  3S9M C;  1O7T A;  2UXA A;  4O7M A;  1FBH A;  4OVS A;  2PX1 A;  1Q9D A;  3TYH A;  1LBZ A;  2XWK A;  3C32 A;  1B3L A;  3O97 A;  3IJO B;  2Z22 A;  1D9Q A;  3PV0 E;  3ONM A;  4OER A;  3S9N C;  1LLS A;  4BLA A;  1KZ8 A;  4I3Y A;  4ZEF A;  4PFU A;  4R72 A;  1IMC A;  1R9Q A;  3FJM A;  5ITO A;  2QMX A;  4NWC A;  1AIV A;  1XS5 A;  5IZ1 A;  4JB7 A;  3H6U A;  5DVI A;  3OEN A;  5H8F B;  1LFG A;  3JYR A;  5ET6 A;  5H8S A;  1PB7 A;  1NNK A;  3R6U A;  1A99 A;  3SES A;  5JTY A;  4DI4 B;  1KA1 A;  3MVW A;  2I3W A;  2XWI A;  4P47 A;  1AOV A;  3RYD A;  1G0H A;  4R74 A;  3PD8 A;  2D5W A;  3KJ7 A;  1RYO A;  3LSF B;  3MVZ A;  1OQG A;  1A8E A;  1EH3 A;  2DWA A;  2DE2 A;  1LB9 A;  2P2A A;  4PF6 A;  1IEJ A;  2CZH A;  1IXC A;  3QUF A;  3SEW A;  2P1S A;  4UAC A;  3K6X A;  1LAG E;  1POY 1;  5IZ3 B;  4XKR A;  3FZV A;  1KA0 A;  2ZMB A;  1H45 A;  4DXU A;  1FBE A;  1FBP A;  3RPL A;  5IAI A;  2R6G E;  3IB2 A;  1P1O A;  3K01 A;  3K1P A;  2X26 A;  3FJ7 A;  4UA8 A;  4X1D A;  3A29 A;  1HSE A;  3AXF A;  4TOZ A;  4G8M A;  4N8Y A;  3UA8 A;  5A5L A;  1S7Y A;  1N3W A;  2OCU A;  1B7U A;  1MXW A;  3E3K A;  4PE3 A;  3RPW A;  4GBW A;  4GX6 A;  2XWO A;  2IA4 A;  3K6U A;  1FTK A;  1D9Y A;  3PUW E;  1MG1 A;  5KZT A;  4TLL B;  2W7Y A;  1B9J A;  5K2Y A;  1DTZ A;  4YZZ A;  2DVC A;  3O2A A;  2Y7R A;  1G0I A;  5H8Q B;  4BDO A;  1N84 A;  2A5T A;  2QS2 A;  4PCD A;  2REG A;  1SQY A;  3TKD A;  4OMB A;  1EZ9 A;  3PU5 A;  3TCF A;  2HZL A;  1B05 A;  4GX3 A;  2RC8 A;  3RNN A;  3C36 A;  1UTH A;  4I3E A;  4FE8 A;  3MZ9 A;  3B6T A;  4XXU A;  3ZSF A;  4UAB A;  3MUQ A;  1LST A;  4KYD A;  2ONR A;  4OEN A;  2OJT A;  4BDM A;  1N7X A;  1VFE A;  2CZL A;  5BWJ A;  2KQZ A;  1QW0 A;  1BP5 A;  1MH4 A;  4LZ5 A;  4OZ9 A;  1B58 A;  3HV1 A;  3PPP A;  1UTH B;  2Q2A A;  3MVY A;  4E0X A;  1WDN A;  3PTY A;  4G77 A;  2KR0 A;  1B52 A;  3T66 A;  3KN7 A;  4BDN A;  4N91 A;  1NUX A;  2DVZ A;  3LSX A;  3KFM A;  2GFE A;  1K9Z A;  2I58 A;  1B51 A;  5CMK A;  3IOW A;  3FGS A;  5I2K A;  3RQT A;  1Y20 A;  1B7H A;  1YTV A;  4NMY A;  4X04 A;  1H3D A;  3MP6 A;  3OD7 A;  4OVQ A;  3T22 A;  2Q9T A;  5I58 A;  2PBW A;  4QRZ A;  1H43 A;  4RY1 A;  2DXY A;  2RCA A;  2R9J A;  3IK6 B;  1DCU A;  5EQ8 A;  2GRV A;  1AMF A;  3Q27 A;  4H1X A;  3EF7 A;  4F2Q A;  1VFD A;  2P3V A;  4H46 A;  2HCA A;  2QS1 A;  4EXL A;  3TZA A;  4KFQ A;  3FVG A;  1O63 A;  4ELR A;  4IY5 A;  2VT5 A;  5AE4 A;  3LV0 A;  1LBV A;  4PDD A;  1SVX B;  2F7B A;  2ZYK A;  1MH3 A;  4PTK A;  4POX A;  1MPC A;  3O28 A;  1TFA A;  4KPT A;  4Q30 B;  1LAH E;  4FIM A;  3H6T A;  4DI3 D;  5EYG A;  1XVY A;  2DP8 A;  2FNC A;  4R6H A;  2NUV A;  3T9U A;  1LFH A;  4AS5 A;  5AA3 A;  2XXH A;  1S50 A;  5K2X A;  2Z23 A;  1XHY A;  2HAU A;  4GRK A;  3TDJ A;  3O6I A;  4HTG A;  2R8T A;  4QFP A;  3TMG A;  2WX9 A;  1QUL A;  4N6D A;  2IEE A;  4N07 A;  1YZ0 A;  3DP6 A;  1SDX A;  1IMF A;  4NF6 B;  2O84 X;  1XT8 A;  3KBZ A;  1US4 A;  3V89 B;  3O6G A;  2YPN A;  1MXX A;  4X1B A;  1A55 A;  2I6E A;  1R1N A;  3HST A;  4RA1 A;  1EYI A;  2I0C A;  3T9X B;  4LN5 A;  4OEU A;  1XVX A;  2CEY A;  1NV3 A;  3U72 A;  5JEI A;  1A40 A;  1FTM A;  2HZK A;  5FTH A;  4X9T A;  4GQO A;  2XXP A;  3UOR A;  4I40 A;  3TOD A;  3EPE A;  3MW0 A;  4KHZ E;  4MFI A;  4GWS A;  2XXI A;  3PUY E;  3U1O A;  3V5A A;  3H6V A;  1QJM A;  1FPE A;  3S9L C;  1K9Y A;  3EKI A;  4HCW A;  3W15 C;  5L9S A;  3FJG A;  5B7D A;  4GWW A;  1JEU A;  3MZB A;  5KCJ B;  1FQD A;  3BIH A;  1PEB A;  4BDQ A;  5AA2 A;  3ILT B;  4ESW A;  3U8Q A;  1ZU0 A;  4LZ8 A;  4MX6 A;  1B3E A;  1FQC A;  3KN3 A;  2UVH A;  3FAT A;  5KCJ A;  1IUD A;  3TTM A;  3OO9 A;  3CFZ A;  4GXA A;  4JDF A;  5DVJ A;  3O66 A;  4H0W A;  3FAS A;  2PCR A;  3N6T A;  5EYF A;  2XD3 A;  2H4I A;  2DDK A;  2CMO A;  5CBR A;  4JSO A;  4KCD A;  4M1V A;  1PBQ A;  1FTA A;  2QL3 A;  3L6H A;  5LDZ A;  4U1Z A;  4POW A;  4PFR A;  4FAT A;  1IIT A;  4GOT A;  4MNI A;  3OO8 A;  4R75 A;  4H67 A;  4FED A;  3CIJ A;  4FBP A;  3QXM A;  2NWJ A;  4LVQ A;  5EQ9 A;  4NED A;  3WAF A;  3A3U A;  1BLF A;  4KYE A;  4I62 A;  3CG1 A;  3QAX A;  4U4X A;  4NF4 A;  3SET A;  1Q35 A;  4U1O A;  4O94 A;  4MJO A;  4P0G A;  1NL5 A;  4GBV A;  3IB1 A;  3W9W A;  1NV0 A;  2ZZV A;  1SW5 A;  1UQW A;  5F1Q A;  3USD A;  2A5T B;  3SZP A;  5CI5 A;  4JWO A;  2BJJ X;  2OWS A;  3THI A;  1QUK A;  1USY H;  2DSF A;  2RIN A;  3C35 A;  3TCG A;  1FPI A;  2FHY A;  2V3Q A;  1URD A;  3M8U A;  1SI0 A;  1QGX A;  4LQ2 A;  4QSD A;  4JSD A;  4OA4 A;  2V25 A;  2I48 A;  1N0T A;  4NF6 A;  3C4M A;  1GGG A;  2B4L A;  2QPQ A;  3BKI B;  4DCY A;  1R9L A;  2B3F A;  4PBH A;  4F29 A;  3B8B A;  4HE2 A;  4OTE A;  1JW4 A;  3O29 A;  1YXI A;  2DS9 A;  5FHM A;  5A5X A;  4OET A;  1SYH A;  5H8F A;  4RPO A;  4LA9 A;  4PFB A;  4OVJ A;  1LFI A;  4IB2 A;  3H4Z A;  3OSR A;  2HEU A;  3K02 A;  3QUJ A;  4U22 A;  1ZJL A;  3OOA A;  1GTK A;  3KOS A;  4PFT A;  3T93 B;  1UTB B;  1MS7 A;  1D3K A;  3QK6 A;  1XC1 A;  3FBP A;  4PDH A;  3B6Q A;  4GLI A;  2F6P A;  4GWX A;  2F3B A;  1BK4 A;  1A8F A;  1GVC A;  1SPI A;  3PPN A;  4JVD A;  4ZDM A;  3GXA A;  1ZKB A;  2F34 A;  4YMA A;  1JEV A;  2XX8 A;  4Z0I A;  5JK4 A;  4O7I A;  3VDF A;  1P1N A;  1VSO A;  5CBS A;  1H76 A;  2I4C A;  4DE8 A;  2Y7P A;  3N26 A;  3K6V A;  3EN3 A;  1MXV A;  2PVU A;  2ZZX A;  5DVF A;  2XHD A;  4XTC Q;  4GX4 A;  1MQI A;  5L9M A;  4E0W A;  2X7P A;  1B4Z A;  2ZNT A;  3FUZ A;  3QYT A;  1US5 A;  4HCY A;  1P1W A;  1B32 A;  3UGW A;  4ELO A;  4F3P A;  3FVN A;  2WEF A;  3IL1 B;  2Y7K A;  3R26 A;  1CE2 A;  3KG2 A;  5DYH A;  4N4U A;  3CSB A;  3S9E A;  4C1U A;  3TEL A;  3LSL A;  4P1L A;  2QJE A;  1NI9 A;  3RLF E;  2O7U A;  4NF5 B;  4PP0 A;  4GL0 A;  4OQO A;  3QSL A;  4GD5 A;  3G3J A;  3G3F A;  4ZEI A;  3VVE A;  1B1X A;  4JVC A;  3TUS A;  4ZEB A;  1URG A;  1M5D A;  1ANF A;  5ICT A;  1BIY A;  3MP8 A;  4RJZ A;  4TQU Q;  2ANJ A;  4MCO A;  4NG7 A;  2O68 A;  3IAZ A;  1M5F A;  1NFT A;  4LP2 B;  3OEK A;  1SYI A;  4WKM A;  4R6K A;  3KC0 A;  3EHU A;  3K00 A;  3MZ1 A;  1URS A;  5ET5 A;  1XI6 A;  3O6H A;  3LR1 A;  4PFY A;  2H5Y A;  4JWY A;  4P3L A;  3UN6 A;  4GFR A;  1DK4 A;  1NUW A;  3G3K A;  5H8H A;  1XOC A;  1TFD A;  4Z7E A;  4F3B A;  2OX3 A;  4NF8 B;  4MNC A;  3CI8 A;  3FVK A;  4F3S A;  1R6Z A;  1JQF A;  2P3N A;  2X7Q A;  4H8J A;  4MBP A;  3VXB A;  3E78 A;  3ZKK A;  1JVY A;  4NN3 A;  1M5C A;  3LBS A;  2NOO A;  5I58 B;  1JP4 A;  4PBQ A;  1ELJ A;  3FV1 A;  2O6A A;  1IME A;  1LAX A;  3TPA A;  1NV5 A;  1H44 A;  1NV2 A;  1DMB A;  1ZMG A;  5HBC A;  3ECR A;  3HO7 A;  3TTN A;  3K4U A;  4PQJ A;  3G3G A;  3TAJ A;  3D4G A;  1AL3 A;  3TCH A;  3DEL B;  1LCT A;  1EYK A;  1Y4T A;  4KR5 A;  2Y7I A;  4ELQ A;  3IX1 A;  4R9G A;  4BDL A;  1ZIU A;  3OMB A;  3VFJ A;  1IXH A;  4DIG A;  4ONY A;  2XXV A;  3UP9 A;  2QS3 A;  5AA4 A;  2Y84 A;  2UYE A;  3P7I A;  3H7M A;  4TLM B;  1LBW A;  1FQF A;  2G29 A;  4R6Y A;  2OZZ A;  4ZE9 A;  4P11 A;  4OFL A;  4KCC A;  1B3F A;  1JET A;  4H8I A;  2LAO A;  3T9H B;  1TT1 A;  3FD3 A;  3ILU B;  2QFL A;  3SEY A;  1MQG A;  3KSJ A;  4N6K A;  2F36 A;  4IO6 A;  1NV1 A;  5EYH A;  4PE5 B;  4I9D A;  5AA1 A;  5ET8 A;  2QS4 A;  2VD2 A;  2XA5 A;  2ZZW A;  5CM6 A;  3VLV A;  2I0B A;  3IO4 A;  3KN8 A;  4X8R A;  2XXK A;  4OHN A;  4RYA A;  4G2Z A;  3PPO A;  3KSX A;  4IO5 A;  3D4C A;  4P56 A;  4H6D A;  1MM6 A;  4NTL A;  1LBX A;  3RGY A;  1B40 A;  2Z8F A;  2ZYM A;  1MXY A;  3A09 A;  3SEX A;  3IFA A;  1ZBM A;  3M3F A;  1FCK A;  1NNP A;  4YB7 A;  1VDW A;  1UIU A;  3VLU A;  2F3D A;  4MNP A;  2PFY A;  3MQ9 A;  3IFC A;  1N7W A;  2V4C A;  1MXZ A;  1MY1 A;  5I2N A;  3A3C A;  3KGC A;  2H99 A;  2QSX A;  4ZED A;  3IOR A;  1WVJ A;  5H8N B;  3SER A;  1MPB A;  1P1Q A;  4XF5 A;  1OVT A;  2WBB A;  1MPD A;  3L6G A;  2F35 A;  3IB0 A;  1TXF A;  5T3J A;  1DOT A;  2HAV A;  1OQH A;  1DSN A;  1MQD A;  1PB9 A;  4YIC A;  4OVR A;  1LB8 A;  3H3G A;  5ELV A;  4ZS9 A;  3RPL B;  1O64 A;  3VE1 B;  4F1V A;  3Q29 A;  4NF8 A;  4THI A;  4O8M A;  3RY3 A;  3LSW A;  3PPR A;  4R73 A;  1AWB A;  3FIR A;  3EQ1 A;  4FEB A;  4GVO A;  2Y7W A;  1JNF A;  3C33 A;  1GV8 A;  2HHM A;  2P0S A;  1OIB A;  3CSG A;  1FTO A;  3GBB A;  3TQL A;  4YB6 A;  3CRB A;  1CNQ A;  4RK9 A;  3E13 X;  3B6W A;  4PGN A;  2F8D A;  3U94 A;  4R2F A;  3PD9 A;  2ZYN A;  3V83 A;  5I56 A;  4HXV A;  4OEV A;  1EZP A;  1I69 A;  4YKI A;  5J1D A;  1B3G A;  3I3V A;  3SDF A;  1VR5 A;  4IO7 A;  2VHA A;  3DM0 A;  4P1E A;  5I7I A;  4NAP A;  1IMB A;  4PF8 A;  2GHB A;  2Q2C A;  3RTF B;  3BBR A;  3N5L A;  1MQH A;  3T96 B;  4NE4 A;  5I57 A;  3G7W A;  3OSQ A;  2REJ A;  3OEM A;  1D9V A;  2HFB A;  2Z8D A;  3ZS6 A;  2YJP A;  1II5 A;  3U65 A;  3VV5 A;  3PMW A;  2ONS A;  4C0R A;  4YAH X;  3JV9 A;  2QRY A;  1QUJ A;  5DEX A;  1PBP A;  3K1N A;  3B7D A;  2Q8J A;  4KXP A;  5L9O A;  4OYV A;  3OEL A;  4JBZ A;  5FHN A;  5IM2 A;  4AB6 A;  4YKK A;  1MDP 1;  2O1L A;  2B65 A;  3MYU A;  3TTK A;  4GWU A;  1OVB A;  1QKA A;  1VE4 A;  5M2V A;  3T1B A;  4QBA A;  5ET7 A;  3LUZ A;  5EQ7 A;  3M3L A;  2XWV A;  3CG3 A;  2RC7 A;  1LGB C; 
#chains in the Genus database with same CATH homology
 1Y3Q A;  5DTB A;  1BKA A;  4P0I A;  4PFT A;  4X1D A;  3T93 B;  5FTI A;  4EXK A;  1MRP A;  4FJP A;  1HSE A;  3AXF A;  1UTB B;  2DOJ A;  4KYS A;  1MS7 A;  1D3K A;  3QK6 A;  1I6A A;  1XC1 A;  4TOZ A;  5DEX B;  5I84 A;  4DZ1 A;  4H65 A;  4G8M A;  4QSE A;  5CMB A;  2OBG A;  3B6Q A;  4GLI A;  1P99 A;  2F6P A;  4G68 A;  4LON B;  3UA8 A;  1S7Y A;  1T0K A;  4MH5 A;  3TTR A;  2UYF A;  1A8F A;  1N3W A;  2OCU A;  1GVC A;  1MDQ A;  4DLD A;  1B7U A;  3PPN A;  2R71 A;  1MXW A;  3H06 B;  4ZDM A;  3TFL A;  3E3K A;  3GXA A;  3MPK A;  3RPW A;  4ZZA A;  3VVD A;  3QIM A;  1POT A;  1ZKB A;  2UVG A;  3OO7 A;  2IA4 A;  4AQ4 A;  2F34 A;  3K6U A;  4YMA A;  1GR2 A;  1JEV A;  2XX8 A;  1FTK A;  1D9Y A;  3PUW E;  4Z0I A;  4AB5 A;  5JK4 A;  1MG1 A;  1LBB A;  5KZT A;  4TLL B;  2W7Y A;  2NVU B;  1B9J A;  5K2Y A;  4OWD A;  2D3I A;  3Q28 A;  1DTZ A;  5AA2 B;  4YZZ A;  2DVC A;  3O2A A;  1MY3 A;  2Y7R A;  3VDF A;  5H8Q B;  2XXU A;  1UTB A;  4BDO A;  2NXO A;  4C1T A;  1FW0 A;  4KQP A;  4YU0 A;  3PPQ A;  1P1N A;  3MJN A;  1N84 A;  2PMS A;  1B0L A;  2A5T A;  2QS2 A;  2XXT A;  5TU0 A;  1VSO A;  5CBS A;  1H76 A;  2I4C A;  4XKN A;  2DWI A;  2REG A;  2Y7P A;  1DTG A;  3N26 A;  3K6V A;  4DE8 A;  3EN3 A;  4I1D A;  1MXV A;  1N3X A;  2PVU A;  1SQY A;  5TP9 A;  1SW1 A;  3TKD A;  3MVX A;  2QMW A;  3Q26 A;  1IQ7 A;  5DVF A;  4OMB A;  3GZG A;  1EZ9 A;  2XHD A;  4XTC Q;  3PU5 A;  4IO2 A;  3RUM A;  3TCF A;  1MQI A;  2HZL A;  5FHO A;  1B05 A;  2F97 A;  2RC8 A;  4WXJ A;  3RNN A;  3H6W A;  3C36 A;  5L9M A;  4E0W A;  4ND9 A;  1UTH A;  2F6G A;  1Z7N E;  4FE8 A;  2X7P A;  1Y3P A;  4WED A;  1EU8 A;  3MZ9 A;  1B4Z A;  3B6T A;  2ZNT A;  4HW8 A;  3FUZ A;  3KEI A;  4XXU A;  3C34 A;  3QYT A;  4F1Y A;  1US5 A;  3ZSF A;  2XXW A;  1TWY A;  3U93 A;  3MUQ A;  3PMV A;  3C31 A;  1P1W A;  1B6H A;  4HCY A;  4Q0C A;  1LST A;  1YAE A;  4KYD A;  2ONR A;  4OEN A;  2OJT A;  4BDM A;  1B32 A;  4MLQ A;  1P1U A;  2H98 A;  5I2K B;  1N7X A;  1VFE A;  2CZL A;  5BWJ A;  3UGW A;  1QW0 A;  1BP5 A;  1I6Q A;  1MH4 A;  4LZ5 A;  4OZ9 A;  4PFW A;  4Q5T A;  1B2H A;  1B58 A;  3FVN A;  3HV1 A;  4F3P A;  5BUU A;  1S9T A;  3IL1 B;  2VD3 A;  1UTH B;  3PPP A;  2HXW A;  1A7L A;  2Q2A A;  2H25 A;  1IZ1 A;  2Y7K A;  2ZNU A;  1Y4C A;  3R26 A;  1CE2 A;  3KG2 A;  5DYH A;  3MVY A;  5TP9 B;  4E0X A;  1Y1Z A;  1WDN A;  2PYY A;  3OO6 A;  3CSB A;  4G77 A;  3S9E A;  1SD3 A;  1B52 A;  3T66 A;  4C1U A;  3MPL A;  3TEL A;  3KN7 A;  3S4U A;  3RN8 A;  4BDN A;  2KLF A;  4XKQ A;  3LSL A;  3PUV E;  2DVZ A;  1NH8 A;  4FEC A;  3LSX A;  2QJE A;  3KFM A;  5HPQ A;  5I56 B;  1OMP A;  2GFE A;  3FXQ A;  3BFT A;  4ISU A;  3RLF E;  2O7U A;  1B3H A;  3ZKL A;  1MY0 A;  2VP1 A;  4QFK A;  2I58 A;  1B51 A;  5CMK A;  1MXU A;  4NF5 B;  4PP0 A;  4QF9 A;  1Q1K A;  4GL0 A;  4OQO A;  3IOW A;  3QSL A;  4GD5 A;  3FGS A;  4GL8 A;  4U23 A;  3VVF A;  5HM4 B;  2ALU A;  3TQW A;  4Q8R A;  5I2K A;  3G3J A;  3RQT A;  1Y20 A;  3G3F A;  4ZEI A;  1YPN A;  3VVE A;  1B7H A;  1YTV A;  1B1X A;  4NMY A;  1PB8 A;  3TUS A;  2F7A A;  3FVO A;  1URG A;  4RNS A;  4ZEB A;  4QFO A;  3GBA A;  3PUX E;  2E0S A;  1H3D A;  4F39 A;  1M5D A;  1ANF A;  3MP6 A;  2XXY A;  3OD7 A;  5CMC A;  5ICT A;  2E1S A;  2O7I A;  3KBR A;  3T22 A;  2Q9T A;  5I58 A;  1BIY A;  3MP8 A;  3HCQ A;  2GH9 A;  4RJZ A;  2PBW A;  5AA2 D;  4TQU Q;  2ANJ A;  2F7C A;  2O68 A;  4QRZ A;  4L17 A;  3IAZ A;  4M4G A;  1M5F A;  1H43 A;  4RY1 A;  2DXY A;  2RCA A;  1CB6 A;  1NFT A;  4LP2 B;  4YMB A;  4IGT A;  2R9J A;  3OEK A;  1SYI A;  4G4P A;  4YKP A;  4QFL A;  4R6K A;  3IK6 B;  4G8N A;  4WKM A;  4BDR A;  3EHU A;  3K00 A;  4F31 B;  3TTL A;  3MZ1 A;  4OXV A;  3CFX A;  4F3G A;  1RKM A;  1URS A;  3MP1 A;  4GIZ A;  3U92 A;  4F2O A;  4DCX A;  2V3U A;  4RK2 A;  3HN0 A;  3LR1 A;  3O6H A;  4PFY A;  2H5Y A;  4JWY A;  4QSC A;  3UN6 A;  2GRV A;  3EHT A;  4GFR A;  4GWO A;  2UVI A;  1AMF A;  1FQB A;  1B0H A;  3DP8 A;  3G3K A;  5H8H A;  3Q27 A;  4H1X A;  1XOC A;  1TFD A;  4Z7E A;  3EF7 A;  4F3B A;  4F2Q A;  1VFD A;  4NF8 B;  3CI8 A;  2HCA A;  3FVK A;  4EDP A;  1Y3N A;  2ESN A;  2QS1 A;  1JW5 A;  3O9P A;  4F3S A;  2VOZ A;  4EXL A;  3TZA A;  1R6Z A;  1JQF A;  2X7Q A;  4H8J A;  4NF5 A;  4KFQ A;  4MBP A;  4QFN A;  5DT6 A;  2ONK E;  3FVG A;  2FA7 A;  4ZE8 A;  1O63 A;  3VXB A;  2I49 A;  4DXC A;  3FXU A;  3H03 A;  3ZKK A;  4IY5 A;  2F78 A;  1JVY A;  3MWB A;  5AE4 A;  1JW1 A;  2F5X A;  3C9H A;  2DWH A;  3PUZ E;  1SVX B;  2WKY A;  1M5C A;  2F7B A;  3LBS A;  4IO4 A;  2NOO A;  1MH3 A;  2ZYK A;  5TPA B;  4DDD A;  1DPE A;  4EQB A;  4GXS B;  5I58 B;  1ELJ A;  5EHM A;  3FV1 A;  4JXI A;  1NH7 A;  3N6U A;  4ZZE A;  2O6A A;  4POX A;  1LAX A;  2O1M A;  3KOT A;  3TPA A;  1MPC A;  3O28 A;  5A5X B;  1TFA A;  1H44 A;  3MAM A;  4KPT A;  1LAH E;  4Q30 B;  3T9V A;  4FIM A;  1DMB A;  1IXG A;  3H6T A;  1B4H A;  1ZMG A;  1XVY A;  2DP8 A;  5HBC A;  2FNC A;  3IOV A;  4R6H A;  3ECR A;  3HO7 A;  5ICQ A;  4U2R A;  2NUV A;  1MM7 A;  3T9U A;  3TTN A;  1LFH A;  5F7V A;  1OLC A;  3K4U A;  4PQJ A;  5H8N A;  1ZLQ A;  3G3G A;  3TAJ A;  5AA3 A;  2V84 A;  1AL3 A;  2XXH A;  3D4G A;  1S50 A;  2G93 A;  3DEL B;  1LCT A;  2FYI A;  5K2X A;  2Z23 A;  1XHY A;  2HAU A;  1Y4T A;  4GRK A;  4KR5 A;  3LUY A;  4MLV A;  3TDJ A;  2Y7I A;  4ELQ A;  1YCJ A;  5I2N B;  3IOT A;  5CC2 A;  3BFU A;  3IX1 A;  4R9G A;  4DXB A;  1NKX A;  4BDL A;  4F18 A;  1ZIU A;  3O6I A;  3OMB A;  4HTG A;  3VFJ A;  4QFP A;  1IXH A;  2DQV A;  1FQE A;  2O51 A;  2UVJ A;  3TMG A;  3DLN A;  4DIG A;  4ONY A;  2XXV A;  4F1U A;  1QUL A;  2I3V A;  4HS7 A;  3UP9 A;  2QS3 A;  5ISU A;  2AYS A;  5AA4 A;  2IEE A;  2Y84 A;  4N07 A;  1QVS A;  2OWT A;  3DP6 A;  2UYE A;  3P7I A;  4EF1 A;  3H7M A;  4TLM B;  1SDX A;  1FQF A;  2AL5 A;  3FXR A;  5JTY B;  2G29 A;  4NF6 B;  5EHS A;  2O84 X;  1ZTY A;  1XT8 A;  1USY E;  2ZYO A;  4R6Y A;  1US4 A;  3V89 B;  2OZZ A;  3RTW B;  3O6G A;  4ZE9 A;  2YPN A;  1MXX A;  4P11 A;  3IR1 A;  4NWD A;  2ZXT A;  4OFL A;  3EHS A;  4X1B A;  5CRY A;  1A55 A;  2I6E A;  4KCC A;  3S2V A;  3VLW A;  4K3F A;  1B3F A;  3I6V A;  4XKP A;  1JET A;  1R1N A;  2O69 A;  3HST A;  4H8I A;  4LUB A;  4RA1 A;  1F9B A;  2LAO A;  3T9H B;  2I0C A;  4MF3 A;  1TT1 A;  3FD3 A;  2RCB A;  3F11 A;  1B1H A;  3T9X B;  3ILU B;  4F22 A;  1MY2 A;  4OEU A;  1KWH A;  1XVX A;  2XX7 A;  4O3B A;  3SEY A;  3U72 A;  1B5I A;  1MQG A;  3E4R A;  2PT1 A;  1DPP A;  1JVX A;  3KSJ A;  2F36 A;  2AIX A;  5JEI A;  2THI A;  3SEV A;  4IO6 A;  1A40 A;  1FTM A;  1IXI A;  1MQJ A;  2HZK A;  3N94 A;  4GQO A;  4H5F A;  2XXP A;  4IGR A;  4X9T A;  4YB5 A;  3UOR A;  4PET A;  4PE5 B;  3TOD A;  2Q88 A;  4I9D A;  3K1M A;  5LOM A;  4OFJ A;  3EPE A;  3MW0 A;  4KHZ E;  5AA1 A;  1NNF A;  4ECF A;  1B5H A;  4ESX A;  5H8H B;  4MFI A;  2QS4 A;  2VD2 A;  4IY6 A;  2XXI A;  5CM6 A;  3VLV A;  1MY4 A;  2I0B A;  2RF1 A;  3PUY E;  3IO4 A;  3KN8 A;  3HHF A;  3U1O A;  4EQ7 A;  3V5A A;  4ELO A;  4JWX A;  2PT2 A;  3H6V A;  3V8X B;  3G3I A;  4OHN A;  3K6W A;  1QJM A;  4RYA A;  4G2Z A;  3PPO A;  4U4S A;  3KSX A;  4IO5 A;  3D4C A;  4LAT A;  3S9L C;  3K0V A;  4H6D A;  3M3K A;  4HCW A;  3W15 C;  1MM6 A;  3OXN A;  1Y1M A;  4H5G A;  4NTL A;  3SEU A;  1SW4 A;  4FAJ A;  3RGY A;  1HSL A;  1Z7M E;  5L9S A;  3FJG A;  5B7D A;  1B40 A;  2Z8F A;  1JEU A;  1PC3 A;  2ZYM A;  4U21 A;  5CMM A;  1MXY A;  3MZB A;  3A09 A;  3UK4 A;  4YKJ A;  5KCJ B;  5ITP A;  1PDA A;  4KI0 E;  1FQD A;  4RXL A;  3SEX A;  2DYX A;  4EUO A;  3ODB A;  1ZBM A;  1A54 A;  3M3F A;  4OES A;  1FCK A;  1NNP A;  1PEB A;  3KZG A;  4YB7 A;  4RPN A;  4BDQ A;  5AA2 A;  3PMX A;  3ILT B;  1UIU A;  2DXR A;  5H8Q A;  1LCF A;  1ZU0 A;  4LZ8 A;  3U8Q A;  3VLU A;  4ESW A;  1RYX A;  1B3E A;  2H9B A;  1FQC A;  3MQ9 A;  3KN3 A;  1N7W A;  2I4B A;  4R9F A;  2UVH A;  3FAT A;  5KCJ A;  1IUD A;  2OK2 A;  3IOU A;  3TTM A;  1MXZ A;  1BTJ A;  2XXX A;  3CFZ A;  2XXQ A;  3OO9 A;  4GXA A;  4LQ5 A;  3MBP A;  1MY1 A;  4G68 C;  4JDF A;  5I2N A;  3A3C A;  3KGC A;  5DVJ A;  2H99 A;  3O66 A;  4H0W A;  4WEP A;  5L8D A;  3W9V A;  2GHA A;  3FAS A;  1AH5 A;  2QSX A;  2XD2 A;  4ZED A;  2B3B A;  3IOR A;  3N6T A;  5EYF A;  2XD3 A;  1WVJ A;  1NNT A;  2H4I A;  3FJ7 A;  4NF4 B;  4UA8 A;  3SER A;  5H8N B;  1MPB A;  1P1Q A;  2CMO A;  1UIV A;  1IIW A;  4XIG Q;  5CBR A;  4JSO A;  1QKB A;  4KCD A;  2A5S A;  3MC2 A;  4M1V A;  1PBQ A;  1OVT A;  4I8C A;  1MPD A;  1LBC A;  3KJT A;  3L6G A;  3PGF A;  2QL3 A;  3L6H A;  2F35 A;  4U1Z A;  3IB0 A;  1TXF A;  4POW A;  1DOT A;  2HAV A;  1OQH A;  1DSN A;  1MQD A;  1PB9 A;  3K2D A;  2ABH A;  2VGQ A;  4YIC A;  1LB8 A;  3FV2 A;  2XXR A;  2DE3 A;  4FAT A;  3S9M C;  3H3G A;  4F19 A;  5ELV A;  1N76 A;  1IIT A;  1NMU A;  1O7T A;  4GOT A;  4ZS9 A;  2UXA A;  3OO8 A;  5FTH A;  4R75 A;  4H67 A;  4FED A;  2Q89 A;  4ZEK A;  3CIJ A;  1SI1 A;  2PX1 A;  1O64 A;  3VE1 B;  4F1V A;  3Q29 A;  3GLB A;  4NF8 A;  3TYH A;  4THI A;  4FOR A;  3QXM A;  3RY3 A;  3LSW A;  3C32 A;  2DWJ A;  2HQ0 A;  3PPR A;  4R73 A;  2NWJ A;  1EZO A;  4LVQ A;  2V93 A;  1B3L A;  3EQ1 A;  3FIR A;  4FEB A;  4GVO A;  2Y7W A;  4NED A;  3G3H A;  3WAF A;  1JNF A;  3C33 A;  1GV8 A;  3A3U A;  2P0S A;  1BLF A;  1OIB A;  3CSG A;  3IO6 A;  1FTO A;  2RC9 A;  3O97 A;  3CG1 A;  1FTL A;  1SBP A;  4I62 A;  4KYE A;  1ATG A;  3QAX A;  2ZNS A;  3GBB A;  2Z22 A;  3IJO B;  4NF4 A;  4U4X A;  3PV0 E;  3SET A;  4GF8 A;  3TQL A;  3ONM A;  4YB6 A;  1M5E A;  3I5O A;  1Q35 A;  3CRB A;  1LAF E;  4OER A;  3S9N C;  4U1O A;  3TEP A;  3VXC A;  4OFO A;  4P0G A;  1LLS A;  1NL5 A;  4RK9 A;  3E13 X;  4BLA A;  2D21 A;  3IB1 A;  3B6W A;  4EQ9 A;  1B7Z A;  4N6P A;  4ZEF A;  1B46 A;  4IO3 A;  2F8D A;  4PFU A;  1FQA A;  4R72 A;  3W9W A;  3U94 A;  4R2F A;  3PD9 A;  1R9Q A;  2ZYN A;  5I59 B;  3V83 A;  2AL4 A;  1SW5 A;  1UQW A;  3FJM A;  5F1Q A;  1FTJ A;  1B5J A;  2QMX A;  4NWC A;  5ITO A;  3USD A;  2A5T B;  5I56 A;  1AIV A;  1XS5 A;  4OEV A;  1EZP A;  3CR9 A;  5CI5 A;  1I69 A;  4YKI A;  4JB7 A;  4JWO A;  5J1D A;  3H6U A;  2BJJ X;  3OEN A;  5DVI A;  5H8F B;  1B3G A;  1LFG A;  3I3V A;  2OWS A;  2RKM A;  3SDF A;  3JYR A;  1VR5 A;  1QUK A;  4IO7 A;  4O3A A;  3SKP A;  2VHA A;  3DM0 A;  5H8S A;  3THI A;  1PB7 A;  1QUI A;  1USY H;  5AA4 B;  2DSF A;  2RIN A;  1N04 A;  3C35 A;  4G8H A;  3TCG A;  2GHB A;  3CG3 A;  3R7X A;  2Q2C A;  4O3C A;  3CVG A;  1NNK A;  5I59 A;  2V3Q A;  3R6U A;  5KDT B;  3RTF B;  1URD A;  3BBR A;  1A99 A;  3N5L A;  3RT6 B;  3SES A;  5JTY A;  3RT8 A;  3MVW A;  1MQH A;  2OLB A;  4NE4 A;  3M8U A;  3T96 B;  1SI0 A;  3WAE A;  2I3W A;  4ELP A;  1L5T A;  4LQ2 A;  5I57 A;  1WOD A;  4QSD A;  4JSD A;  3G7W A;  3OSQ A;  2REJ A;  2V25 A;  1AOV A;  4KD5 A;  4R74 A;  2YLN A;  2I48 A;  3PD8 A;  1N0T A;  2D5W A;  2Z8E A;  3KJ7 A;  1I6B A;  1HSJ A;  4NF6 A;  1RYO A;  3C4M A;  1GGG A;  2QPQ A;  3LSF B;  3MVZ A;  3OEM A;  3BKI B;  4DCY A;  1OQG A;  1A8E A;  1EH3 A;  1R9L A;  1D9V A;  2DWA A;  2B3F A;  2DE2 A;  2HFB A;  4F29 A;  2Z8D A;  3ZS6 A;  3E9X A;  2YJP A;  5KDT A;  1OLA A;  1II5 A;  4OTE A;  1JW4 A;  1LB9 A;  2P2A A;  3O29 A;  3VV5 A;  1IEJ A;  2ONS A;  1IXC A;  3PMW A;  3QUF A;  4C0R A;  4YAH X;  3SEW A;  1SW2 A;  2DS9 A;  3JV9 A;  4ZEC A;  5FHM A;  2P1S A;  2QRY A;  1QUJ A;  4UAC A;  3K6X A;  5DEX A;  5A5X A;  1LAG E;  1PBP A;  4OET A;  1POY 1;  3K1N A;  3B7D A;  2Q8J A;  3LC8 A;  5L9O A;  4OYV A;  1M5B A;  4QHQ A;  3OEL A;  4XKR A;  4EF2 A;  1SYH A;  3TCH A;  5H8F A;  4RPO A;  3FZV A;  4N13 A;  4LA9 A;  3DP4 A;  2V3T A;  4JBZ A;  5TPA A;  5FHN A;  1J1N A;  3HPI A;  4AB6 A;  4YKK A;  3JZJ A;  1D4N A;  1MDP 1;  2B65 A;  2O1L A;  2ZMB A;  1H45 A;  4OVJ A;  1LFI A;  3TTK A;  4IB2 A;  4DXU A;  4R2B A;  2DE4 A;  3H4Z A;  5B70 A;  3UIF A;  5IAI A;  2R6G E;  3OSR A;  1Y9U A;  3HHG A;  2HEU A;  3CFL A;  3K02 A;  3Q25 A;  3QUJ A;  5IKB A;  3IJX B;  3IB2 A;  1OVB A;  2M8C A;  4U22 A;  1P1O A;  1QKA A;  1ZJL A;  1VE4 A;  4G68 B;  3K01 A;  4LZ7 A;  4X48 A;  3K1P A;  5M2V A;  5I57 B;  3OOA A;  1GTK A;  3M3L A;  4ELR A;  2X26 A;  2XX9 A;  2RC7 A;  1LGB C;  3KOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...