3TMGA

Crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
LKSVKIGYVNWGGETAATNVLKVVFEKMGYNAEIFSVTTSIMYQYLASGKIDGTVSSWVPTADKFYYEKLKTKFVDLGANYEGTIQGFVVPSYVPISSISELKGKGDKFKNKMIGIDAGAGTQIVTEQALNYYGLSKEYELVPSSESVMLASLDSSIKRNEWILVPLWKPHWAFSRYDIKFLDDPDLIMGGIESVHTLVRLGLENDDFDAYYVFDHFYWSDDLILPLMDKNDKEPGKEYRNAVEFVEKNKEIVKTWVPEKYKTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein (ProX) from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transport protein
molecule keywords Glycine betaine, L-proline ABC transporter, glycine/betaine/
total genus 98
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tmgA01
3.40.190.100 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Glycine betaine-binding periplasmic protein; domain 2 3tmgA02
2I0CA 2RC9A 3MVYA 1QW0A 1FTLA 5FHNA 3M3LA 1YAEA 3K4UA 1USYE 4JSOA 1MM7A 3MBPA 1MXUA 3OD7A 3UGWA 2R71A 3V5AA 2H9BA 2IEEA 3BKIB 2PT2A 3FJGA 3L6HA 2XXUA 4JDFA 2F78A 4NF6A 4P0IA 1US4A 1GTKA 3H6UA 2I49A 2Y7IA 4KYEA 4PFUA 3LSXA 4ISUA 1L5TA 2ONSA 4AB6A 2OWSA 3A3CA 2DWHA 1ANFA 2DWIA 3O2AA 4GOTA 1M5BA 4YAHX 3K1NA 3IB0A 5AA4A 4DXCA 4EUOA 2HQ0A 4LVQA 1D9YA 1QUIA 1S7YA 3LBSA 4QFPA 1B2HA 2RCAA 3V8XB 5F7VA 4FECA 4XXUA 3CSGA 3FIRA 4JWOA 4LQ5A 4F19A 1GGGA 2F7AA 3IOVA 3MZ9A 1D4NA 1WDNA 3LC8A 4YMAA 1US5A 2Z23A 2A5TB 3T22A 1SD3A 4BLAA 3I6VA 2V3QA 5AA2D 2UVJA 3H3GA 5CRYA 3KGCA 4RNSA 4OVJA 2V93A 2ZNTA 3MPLA 2VP1A 1EU8A 5AA4B 1OQHA 1QULA 4U4XA 1POY1 3K1PA 2AIXA 2F6PA 2XD3A 4IO7A 2HEUA 3C33A 3C32A 4QFNA 5HM4B 4NF5B 3KEIA 1LFIA 2PBWA 3K00A 4G8HA 4R6YA 2Q89A 4RPOA 3MQ9A 3C4MA 1AMFA 2I6EA 4C1TA 3MAMA 4EF1A 3O66A 4DLDA 4Z7EA 1O7TA 4IO3A 3IR1A 1N0TA 1SW5A 1UIUA 2CZLA 3VDFA 3WAFA 3I5OA 1Y1ZA 2E0SA 5CBRA 1IITA 4WEDA 5DVIA 1P1QA 2P0SA 2HZLA 2CMOA 4OESA 5CC2A 3VLWA 5I56B 4R6KA 3TQLA 2PYYA 4G77A 1R1NA 1MPCA 1TFAA 3U1OA 4LZ7A 3LR1A 3TKDA 3Q25A 3OENA 4NWCA 3T96B 3PU5A 1SDXA 1JETA 5H8QA 2DWJA 4GD5A 4EQ9A 3GZGA 5LOMA 1LAHE 4O3BA 3MPKA 1OMPA 2DE4A 4KCDA 4QSCA 3TMGA 1MXWA 5CMCA 1H3DA 4PQJA 1FQEA 3WAEA 5HBCA 1IQ7A 3JYRA 1R9QA 1MS7A 4BDQA 2V84A 1B5IA 2XXXA 3C9HA 5TP9B 4FATA 4OERA 1SQYA 4DZ1A 5ICTA 3D4GA 3OSRA 2FYIA 2Z8EA 3DP6A 3KG2A 3RT6B 5CI5A 1CE2A 1S50A 4DXUA 3QK6A 3S9EA 1B0HA 2I4CA 3FASA 3PMWA 2DE2A 2H98A 3CVGA 3HO7A 3PPQA 3PGFA 4JWYA 3OSQA 4G68B 1OIBA 1A99A 1A40A 1URSA 1XT8A 5EHSA 3HPIA 3IO4A 4ZEFA 2ONKE 3DLNA 4YKIA 3K1MA 4C0RA 5BWJA 1Q1KA 4G4PA 4F1YA 1EZ9A 2DP8A 3QSLA 4H8IA 4ZEDA 3PMVA 1N7WA 1PB7A 4H5FA 3MWBA 2XXWA 4FEBA 1B3LA 4JBZA 5JK4A 3S9LC 4DXBA 1LLSA 2B65A 2XXQA 4ELPA 1MRPA 2GH9A 3H4ZA 4L17A 1MPDA 5H8NA 1ZMGA 4THIA 4OTEA 1M5DA 1OLCA 4KYSA 3T9XB 3N94A 1FQDA 4KR5A 4XKNA 2W7YA 1LGBC 2THIA 3KOTA 3R26A 1T0KA 3MVZA 1IXIA 5F1QA 3H06B 1B51A 2F35A 1AH5A 4U21A 3BFUA 3VVDA 3KZGA 3C34A 4YKPA 4F2QA 4F31B 5B70A 5I59A 1VSOA 3PUVE 4PE5B 1LBCA 1H44A 5I2KB 4DE8A 3OO9A 3SESA 1Y3QA 4OEUA 1B3HA 1Q35A 3MW0A 2G93A 4GVOA 4PFTA 4X1DA 2I4BA 2YPNA 5DEXA 5H8NB 3C36A 5L9OA 1LAXA 2DE3A 3LSFB 1BIYA 3HN0A 3M8UA 3HHFA 1QVSA 3OELA 5KCJB 3RPWA 2UYEA 3ONMA 4OFLA 1B40A 3TCHA 3USDA 2X7QA 5ICQA 2PMSA 2ZYKA 3TDJA 4KQPA 1FTMA 4JB7A 2XD2A 3PV0E 3T9HB 1MY1A 3S9NC 1MXXA 2Q8JA 3TYHA 3ZKLA 4ZE9A 5ISUA 3G7WA 1B05A 3E3KA 4NF8B 5CMMA 4DIGA 3FZVA 3O28A 3FV1A 3MP8A 5JTYB 1B32A 3RUMA 1MM6A 1ZKBA 5DVFA 3MZ1A 4E0WA 1PBQA 1XVYA 2AL4A 2ZXTA 1MPBA 4C1UA 4MBPA 2ESNA 4ESWA 4I8CA 4GXAA 1EH3A 3SEXA 2ONRA 3JZJA 3FXUA 3S2VA 4TOZA 4U1OA 4KHZE 3TFLA 3TODA 5I57B 4IY6A 3KN3A 2XX9A 3OEMA 4G8MA 4HCWA 4OFOA 2O69A 4RK9A 3IB1A 4WXJA 1IXHA 2UYFA 4KCCA 1MDQA 4ZEIA 5JTYA 1JVYA 4R2FA 2I3WA 3E4RA 1A7LA 4GQOA 4Z0IA 1R9LA 1SYHA 1TFDA 4H0WA 4TQUQ 3HCQA 1JW1A 3JV9A 2WKYA 4NF6B 5ITOA 1VR5A 1YCJA 3BFTA 4R9GA 1UQWA 3R7XA 5I57A 4Q0CA 1JEVA 2O1LA 1MY4A 4QHQA 5AA3A 4OQOA 3HHGA 3H03A 4IO4A 4YICA 4XKRA 5DEXB 1ZTYA 4P0GA 4R73A 1MQDA 3RTFB 3RTWB 5CM6A 1QUJA 1MXYA 2QJEA 3EHSA 4GWOA 1PEBA 1KWHA 2XXPA 3G3FA 3MP6A 3S4UA 5H8FB 5L9SA 5I56A 1BTJA 2HAVA 1B1XA 3I3VA 4F3SA 2XXHA 3PUWE 4GIZA 4YB7A 2UXAA 3GXAA 4I1DA 2QPQA 2G29A 4QSEA 4DCXA 4ONYA 4LA9A 1H76A 4ZS9A 2QS1A 1GR2A 3Q26A 1SI1A 4ECFA 5DVJA 2GHAA 4BDOA 3U93A 1N76A 3D4CA 5AA2A 2OWTA 1B3FA 4ZZEA 1DMBA 2R9JA 1IUDA 3K2DA 1POTA 1URGA 2XX8A 3FUZA 4M1VA 1HSLA 3K0VA 4HS7A 3FGSA 4GXSB 3IJXB 3QAXA 1BLFA 2DYXA 5EHMA 4DCYA 1JVXA 5M2VA 2O7IA 3CRBA 2I0BA 2F36A 3IOUA 3MVWA 1M5EA 2RKMA 1H43A 3K02A 3KSJA 3OO8A 1AL3A 4IGTA 1JW4A 1PC3A 1LCFA 3C35A 1MXVA 1BP5A 4X1BA 1B4HA 5FHMA 1VFDA 2PVUA 2DVZA 3GLBA 3SEWA 4LATA 1LFHA 1P99A 2OJTA 1RYOA 3IO6A 1PDAA 1RYXA 4XKQA 5KDTB 2AL5A 3RN8A 3ECRA 5I84A 2BJJX 1MY2A 1LB8A 3B7DA 4OYVA 3TCFA 5H8HB 1P1NA 2F8DA 2IA4A 3RNNA 4ZDMA 3GBBA 3UP9A 1NNTA 2VOZA 1I6QA 2V3UA 3L6GA 5H8QB 4POWA 4N6PA 3SDFA 2F6GA 1B46A 4BDLA 1ZU0A 2OBGA 3PPOA 4R75A 5L9MA 1FTJA 4YMBA 2OCUA 1MXZA 3QIMA 3H6WA 1PB8A 2QS3A 4OFJA 1ZJLA 2Y7WA 4UA8A 1DOTA 1B9JA 2RINA 4JSDA 2H4IA 2Q88A 4OETA 4XTCQ 3OO7A 4FE8A 3TEPA 1SVXB 2Q2AA 4ND9A 4MLVA 2Q2CA 4OEVA 5H8SA 4Q8RA 1R6ZA 5IAIA 2XX7A 3U94A 1CB6A 2P1SA 2OZZA 1TXFA 3SETA 3PUZE 4F29A 3THIA 1FQFA 3W15C 3VFJA 4ESXA 3SEVA 3FJ7A 4TLLB 3GBAA 5DT6A 5CBSA 2ZNUA 1B5JA 3PUXE 5AA2B 4X9TA 3FXRA 3SEYA 1O64A 3KJTA 3M3FA 1PBPA 3LUYA 2QL3A 1ZLQA 2UVGA 3FVKA 4MH5A 5TPAB 1GVCA 2HZKA 2O1MA 1MQGA 1QJMA 2NXOA 3ILUB 3ILTB 1VE4A 3MUQA 1OQGA 4BDRA 2I3VA 2Z22A 5B7DA 2Y7RA 3ODBA 3PUYE 1JNFA 3H7MA 1NKXA 3Q27A 1B6HA 3T66A 4RPNA 2DXYA 4YB6A 1TWYA 1MH3A 3PPRA 4NWDA 4RYAA 4F1UA 3O6GA 1IXCA 3OOAA 3PPNA 4MFIA 4NF8A 3UORA 4HTGA 4YZZA 1F9BA 4UACA 3EPEA 1JW5A 3H6TA 5FTIA 4ELQA 3MP1A 3IOTA 4N13A 3F11A 2YLNA 5A5XB 2RF1A 2F97A 3G3IA 4DDDA 2PX1A 2H5YA 4FAJA 2E1SA 4NF5A 3BBRA 4Q5TA 3P7IA 4ZEKA 5TP9A 4O3CA 4M4GA 2X26A 3KN7A 3LSWA 4IO5A 5EYFA 2I58A 1FQBA 2UVIA 3FJMA 4I62A 3T9VA 1B1HA 3A3UA 3DELB 3IX1A 3EN3A 1MH4A 4FEDA 3OMBA 1XVXA 4FIMA 4N07A 1A8EA 1URDA 2H25A 1IXGA 3E13X 4OMBA 3QXMA 4O3AA 4K3FA 2HFBA 3VVEA 1B7UA 4H8JA 2DQVA 1NNPA 1OVTA 3G3KA 3N26A 4P11A 3K6UA 3MVXA 2ZNSA 4G8NA 3B6TA 4H5GA 2VD3A 3PD9A 1VFEA 1MY3A 2AYSA 2VHAA 1A54A 2Q9TA 5AA1A 2B3FA 5I58B 2Y7PA 4JXIA 2P2AA 2NVUB 2FA7A 3CFLA 3N6TA 3IJOB 1QKAA 4U2RA 1EZPA 4U23A 5ITPA 2DXRA 1SW1A 2UVHA 1XHYA 3G3HA 3K6WA 4AQ4A 3TELA 4NMYA 1SW2A 1H45A 4LONB 2Z8DA 5TU0A 1Y4TA 5I2NA 5L8DA 3PD8A 1B0LA 1DSNA 3E9XA 3KBRA 3FV2A 1ATGA 2F5XA 3FD3A 1N3XA 3FVOA 1PB9A 1DTZA 4RK2A 1N84A 1UTBA 5I2KA 1MQJA 3TTMA 3CG1A 4H6DA 4KD5A 2OLBA 5DYHA 4GLIA 4QF9A 3U8QA 5A5XA 1MQHA 4KFQA 2QMWA 1SYIA 3MC2A 2DOJA 2V3TA 3N5LA 2QSXA 4NF4A 4H1XA 1DPPA 3VV5A 4KYDA 1ZIUA 3KOSA 4ZE8A 2RCBA 2XXVA 1MQIA 3TZAA 4EQBA 3IORA 4QFOA 3QYTA 3EQ1A 4F22A 2B3BA 2Z8FA 1LSTA 3O97A 3CI8A 4GF8A 2OK2A 1D3KA 4F1VA 1DPEA 1N3WA 1Y1MA 1ELJA 4IO2A 4LUBA 4ZECA 5BUUA 1M5FA 5FTHA 1MDP1 1FQAA 4KPTA 5CMBA 4ELOA 3IB2A 1WODA 2ZYOA 3FATA 1B58A 3SKPA 1SI0A 4OENA 2GHBA 3IOWA 4QFKA 3TTRA 3UIFA 3ZKKA 2NOOA 1II5A 1LBBA 1AOVA 1A55A 4NEDA 4PETA 1P1UA 1SBPA 3ZSFA 1A8FA 1ZBMA 1FQCA 1M5CA 3QUFA 2D21A 3UN6A 1B3EA 3KN8A 4R74A 1GV8A 1LCTA 3G3GA 3M3KA 3RY3A 1LFGA 1SW4A 2XXRA 4RA1A 2RC8A 4U4SA 4EQ7A 1AIVA 4FJPA 5FHOA 1XS5A 4GFRA 1N7XA 5KZTA 1P1WA 3IL1B 3O6IA 2YJPA 4IGRA 4LQ2A 3A09A 4QSDA 1Z7ME 2KLFA 3AXFA 3T9UA 3VLVA 5I2NB 1EZOA 4POXA 1I6AA 5DTBA 3O29A 3DP8A 3K01A 1UIVA 4WEPA 1B7ZA 1MY0A 2QMXA 4R6HA 2O84X 2ZYMA 4RY1A 3TCGA 3EHUA 3TQWA 1N04A 2GFEA 4YU0A 3RQTA 1QUKA 1B3GA 4U1ZA 3VXBA 1FW0A 1XC1A 1JQFA 3CFZA 1QKBA 3SERA 1TT1A 3K6XA 3VXCA 3ZS6A 1RKMA 1HSEA 1P1OA 3MJNA 1WVJA 1OVBA 4LZ8A 2I48A 4F2OA 3DM0A 3KJ7A 3B6WA 3KFMA 5H8FA 3DP4A 2DWAA 4BDMA 2V25A 4ZZAA 3QUJA 3OEKA 3CR9A 4QRZA 3PMXA 3RT8A 1NNKA 5I59B 5I58A 1D9VA 2H99A 4HCYA 3B6QA 3UK4A 3HV1A 2XXYA 3V83A 1IZ1A 3Q29A 3W9VA 1YTVA 3G3JA 3TTKA 3KSXA 3HSTA 4IO6A 4G68C 1Z7NE 4LP2B 2PT1A 3CG3A 3TTNA 4F18A 2XXTA 3U92A 3V89B 4HW8A 1NFTA 2HCAA 4YKJA 3Q28A 2R6GE 1NL5A 4Q30B 2DS9A 4EDPA 3EF7A 2A5TA 2D3IA 2Y84A 3N6UA 1FTOA 1USYH 3OO6A 4G68A 4H67A 1Y9UA 2FNCA 4YKKA 1JEUA 2RC7A 2REGA 2NUVA 2VD2A 2LAOA 4ELRA 4I9DA 3C31A 4R9FA 1UTBB 2O7UA 1FCKA 2O6AA 3H6VA 3K6VA 3O6HA 4GL8A 1LAGE 4H65A 3TPAA 1HSJA 2GRVA 2D5WA 1XOCA 4IY5A 2ALUA 3FXQA 5KDTA 1NH7A 4PP0A 4OHNA 4GRKA 5H8HA 3SEUA 4F3PA 2ZYNA 1LB9A 2F34A 4NE4A 3TUSA 3O9PA 4JWXA 1Y3PA 1Y20A 2M8CA 4XKPA 2XXIA 3IK6B 5CMKA 1BKAA 3TAJA 4XIGQ 4YB5A 4ZEBA 2ABHA 3MZBA 4LZ5A 4OZ9A 5K2YA 3T93B 3VLUA 2O51A 3EHTA 2A5SA 4NTLA 5ELVA 3CIJA 4AB5A 1FTKA 5JEIA 2QRYA 3RLFE 1Y4CA 4EXKA 4QFLA 4GL0A 1NNFA 4X48A 1S9TA 5HPQA 3FVGA 5KCJA 1UTHB 5IKBA 1MG1A 4TLMB 3FVNA 2VGQA 5J1DA 1IEJA 1YPNA 2REJA 2NWJA 1B52A 4R2BA 3R6UA 3OXNA 3VE1B 4F3GA 4PFWA 2F7CA 2HAUA 2DVCA 5AE4A 4MLQA 4R72A 1NH8A 3CFXA 2O68A 2XHDA 4BDNA 2QS2A 4NF4B 2ANJA 4IB2A 4U22A 4F39A 4RXLA 5K2XA 3UA8A 1Y3NA 3IAZA 3LSLA 4FORA 4EF2A 1B5HA 1UTHA 2F7BA 4KI0E 5TPAA 4PFYA 4OWDA 4E0XA 3U72A 4RJZA 1I6BA 3PPPA 1B4ZA 4G2ZA 3RGYA 4WKMA 1DTGA 1B7HA 1I69A 1NMUA 1O63A 1LAFE 1J1NA 3VVFA 4MF3A 1OLAA 4OXVA 2DSFA 2Y7KA 4EXLA 3S9MC 2HXWA 1IIWA 4F3BA 2ZMBA 2X7PA 2QS4A 3CSBA 3TTLA 3W9WA
chains in the Genus database with same CATH superfamily
1QW0A 4OA4A 4JSOA 1MM7A 4N91A 3BKIB 2IEEA 3MYUA 5F24A 4NF6A 3H6UA 2I49A 2OWSA 3A3CA 2DWIA 3K1NA 1S7YA 3LBSA 4QFPA 3CSGA 3FIRA 4JWOA 2F7AA 4MMPA 1D4NA 1WDNA 1FBDA 1SD3A 2V3QA 2UVJA 5CRYA 1FBEA 2HEUA 3C32A 4NF5B 4R6YA 1AMFA 4IO3A 1N0TA 1SW5A 3WAFA 4WEDA 5DVIA 1P1QA 5CC2A 5FBPA 2CMOA 3QMFA 3LR1A 2HPGA 3PU5A 1LAHE 1MXWA 4G61A 4PAKA 1H3DA 4PQJA 2KQZA 4P3LA 1NV3A 1LBVA 2CEYA 4GBWA 2V84A 3C9HA 5TP9B 5ICTA 3OSRA 4DXUA 1S50A 2DE2A 3CVGA 3PPQA 5I7IA 4JWYA 1A99A 1A40A 5I5PA 3IO4A 4ZEFA 3K1MA 4C0RA 3QSLA 4ZEDA 5IM2A 5ET8A 2XXWA 5JK4A 2GH9A 3H4ZA 5H8NA 1ZMGA 4THIA 1M5DA 3B50A 4HE1A 1OLCA 4KYSA 4KR5A 2THIA 3VVDA 2P3VA 4YKPA 4F2QA 3PUVE 1H44A 5I2KB 3MW0A 4PFTA 2I4BA 2YPNA 2X7QA 2PMSA 5EYGA 4KQPA 3PV0E 2VPOA 1MXXA 4ZE9A 3TYHA 5ISUA 4NF8B 5CMMA 3FZVA 1FSAA 5DVFA 1PBQA 4ESWA 4F3SA 5L9OA 3JZJA 1NUXA 3FXUA 3TFLA 5I57B 2XX9A 5JTYA 1JVYA 4R2FA 2I3WA 4GQOA 4Z0IA 1XI6A 1JW1A 2WKYA 4NF6B 1YCJA 5AA3A 4OQOA 3H03A 4IO4A 5DEXB 3LV0A 1DBZA 1QUJA 1KWHA 3S4UA 3BIGA 4ONYA 3Q26A 1GR2A 4ECFA 5DVJA 1N76A 4ZZEA 2R9JA 4M1VA 3K2DA 1URGA 4NHBA 4HS7A 4GXSB 1BLFA 2O7IA 1AL3A 4N8YA 1IMBA 1LCFA 3C35A 5FHMA 1B4HA 2DVZA 4QBAA 1P99A 2OJTA 5KDTB 3RN8A 5I84A 3B7DA 5H8HB 1NNTA 2V3UA 1RDYA 4POWA 1ZU0A 4N81A 1LBYA 4OFJA 1ZJLA 2RINA 4JSDA 4OETA 2Q2AA 4ND9A 4OEVA 2P1SA 2OZZA 4JVCA 4ESXA 3SEVA 3FJ7A 4TLLB 3PUXE 4X9TA 2HZKA 3MUQA 5B7DA 3D1RA 3PUYE 4RPNA 3ISPA 4YB6A 4NWDA 4RYAA 4F1UA 4HTGA 4YZZA 2WBDA 5FTIA 4ELQA 2VPNA 3MP1A 2RF1A 4O3CA 4PBQA 4OANA 1FQBA 3T9VA 3A3UA 4N07A 1MH4A 3OMBA 1KA1A 3E13X 4O3AA 4K3FA 1FBHA 4H8JA 3G3KA 5LDZA 1A54A 4PCDA 4N4UA 1QKAA 5ITPA 5TU0A 5L8DA 1DSNA 1ATGA 3FD3A 1N3XA 5ET5A 5I2KA 4H6DA 4KD5A 5DYHA 2OLBA 5A5XA 1MQHA 4KFQA 1SYIA 3MC2A 2QSXA 4H1XA 4NG7A 4KYDA 3KOSA 2RCBA 1MQIA 3IORA 1M5FA 1MDP1 4MJOA 3IB2A 3SKPA 1SI0A 4XEQA 1II5A 1LBBA 1ZBMA 3QUFA 1B3EA 4R74A 1LCTA 3G3GA 3O6IA 2L5VA 1I6AA 5DTBA 3O29A 3DP8A 3K01A 4WEPA 4HE2A 1B7ZA 1MY0A 2QMXA 4RY1A 1N04A 4YU0A 1B3GA 2ZZWA 3CFZA 3SERA 3VXCA 1WVJA 2DWAA 4ZZAA 5IZ3A 3OEKA 3CR9A 5I58A 3PMXA 2H99A 2XXYA 1IZ1A 3W9VA 1YTVA 3G3JA 3TTKA 4G68C 4LP2B 4MEVA 2PT1A 3U92A 1NFTA 2CEXA 3PTYA 3EF7A 4H67A 2A5TA 3N6UA 4YKKA 2LAOA 3O6HA 3TPAA 3FXQA 1NH7A 3SEUA 3TUSA 3O9PA 1Y20A 2M8CA 5CMKA 1NV2A 1NV5A 4XIGQ 4YB5A 4LZ5A 2QVRA 3EHTA 2A5SA 4AB5A 1FTKA 1NNFA 4OVPA 1S9TA 5IKBA 3R6UA 3VE1B 2F7CA 4MLQA 5K2XA 1CNQA 4FORA 1B5HA 4P56A 4RJZA 3PPPA 4WKMA 5J16A 1I69A 1LAFE 2Y7KA 4EXLA 4F3BA 2I0CA 4GBVA 1RDZA 1FTLA 3NOHA 1YAEA 1MXUA 3UGWA 4P0IA 3L6HA 4JDFA 4ZECA 1GTKA 2Y7IA 4KYEA 4PFUA 5IZ3B 2DWHA 1ANFA 4P47A 3O2AA 4PF8A 3IB0A 5AA4A 4DXCA 1B2HA 1AWBA 2QVVA 4LQ5A 1GGGA 3MZ9A 4YMAA 2A5TB 3I6VA 3KGCA 4OVJA 2V93A 3MPLA 1QULA 4IO7A 2PBWA 3K00A 4RPOA 4EF1A 3O66A 1UIUA 3VDFA 4O7MA 4OESA 4R6KA 2PYYA 1YYZA 3TKDA 4NQ8A 5H8QA 4DI4B 4GD5A 4O3BA 1OMPA 2WBBA 1FQEA 2XXXA 2PFZA 3D4GA 3DP6A 5CI5A 4I3EA 2H98A 1OIBA 1XT8A 2ONKE 3DLNA 1Q1KA 4F1YA 4H8IA 2HHMA 3MWBA 4OVTA 1B3LA 5IZ1A 1LLSA 2XXQA 1FJ9A 4L17A 1MPDA 4OTEA 3T9XB 4XKNA 1LGBC 3R26A 5F1QA 3H06B 1B51A 4U21A 2Y5LA 3C34A 4F31B 4DE8A 1B3HA 1Q35A 5DEXA 2G93A 3C36A 3LSFB 3HHFA 4OFLA 3TCHA 1B40A 5ICQA 2ZYKA 3ZKLA 3FV1A 3MP8A 5JTYB 3RUMA 1MM6A 1ZKBA 2ZXTA 4X04A 1FBPA 1MPBA 4N17A 4U1OA 3KN3A 5EQ8A 4RK9A 4WXJA 1IXHA 1R9LA 4OVSA 5I57A 4P8BA 4YICA 4XKRA 1ZTYA 4P0GA 4R73A 3RTFB 2V4CA 4AS5A 1PEBA 3MP6A 5I56A 1BTJA 3I3VA 3GXAA 2G29A 4QSEA 1SI1A 4BDOA 3D4CA 1DMBA 1IUDA 1HSLA 3FGSA 3IJXB 3QAXA 2VT5A 3KSJA 1MXVA 4PC9A 1RYOA 2AL5A 3ECRA 2BJJX 1MY2A 1LB8A 3TCFA 2IA4A 2FIXA 4PFIA 3UP9A 4N6PA 3SDFA 3PPOA 5L9MA 2OCUA 3H6WA 4LN5A 4UA8A 1DOTA 3IFCA 2Q88A 4FE8A 5H8SA 4Q8RA 2Q2CA 4F29A 3VFJA 3GBAA 5DT6A 5CBSA 2ZNUA 5AA2B 3SEYA 3ROJA 1O64A 3LUYA 2UVGA 5TPAB 2O1MA 3ILTB 4BDRA 1EZOA 1OQGA 1YXIA 2Z22A 2Y7RA 3H7MA 3T66A 1B6HA 1IXCA 4MFIA 3UORA 4AB6A 1EZPA 4DI3D 4XF5A 3IOTA 3F11A 4P1EA 3G3IA 2E1SA 3T1BA 3BBRA 3P7IA 2X26A 4O94A 4IO5A 1LBZA 2UVIA 4FBPA 4I62A 4FIMA 2H25A 1URDA 1IXGA 4NX1A 4GWYA 1B7UA 1OVTA 3N26A 3K6UA 3MVXA 2ZNSA 4NF0A 5ET6A 1FBCA 5AA1A 2WYPA 2B3FA 4JXIA 2NVUB 3CFLA 4U2RA 2DXRA 1SW1A 2UVHA 2XWOA 2Q74A 4AQ4A 3TELA 2Z8DA 2F5XA 3RPLB 4RK2A 4GLIA 3VV5A 1DPPA 1FBFA 3TZAA 4QFOA 2F3BA 1LSTA 3CI8A 2QVUA 4IO2A 5BUUA 5FTHA 5CMBA 4ELOA 3FATA 1B58A 3IOWA 4QFKA 3ZKKA 2NOOA 3UN6A 3RY3A 1LFGA 4RA1A 4GFRA 5KZTA 3IL1B 3A09A 3AXFA 1FPLA 1FPIA 3RPLA 1UIVA 2ZYMA 2GFEA 3RQTA 4U1ZA 1FW0A 1JQFA 3ZS6A 4HXVA 1RKMA 4XFEA 1Q9DA 2I48A 3KJ7A 3KFMA 5H8FA 4BDMA 3RT8A 4AS4A 3Q29A 2FVZA 4IO6A 2XWIA 3CG3A 3Q28A 1NL5A 4PDHA 3OO6A 2Y84A 2D3IA 2FNCA 3E78A 2NUVA 2VD2A 2O7UA 2O6AA 1IMFA 2D5WA 1YZ0A 4OHNA 1LB9A 2F34A 4JWXA 5LTCA 4I40A 4ZEBA 2O51A 5ELVA 2F3DA 3CIJA 5JEIA 2QRYA 3RLFE 4EXKA 4X48A 1UTHB 4TLMB 2VGQA 2REJA 2NWJA 4F3GA 4PFWA 2DVCA 4NF4B 4IB2A 4EF2A 1EYIA 4KI0E 5TPAA 4G2ZA 1J1NA 1VDWA 4MF3A 1FPFA 3S9MC 3E79A 2HXRA 2X7PA 3CSBA 2ZZVA 3TTLA 1INPA 3W9WA 3MVYA 5FHNA 3M3LA 3MBPA 2R71A 3FJGA 2PT2A 2XXUA 2F78A 1US4A 3LSXA 1L5TA 4GX3A 2HQ0A 4LVQA 1D9YA 3V8XB 2RCAA 5F7VA 4FECA 4MNIA 3IOVA 2Z23A 3T22A 3H3GA 4PFRA 4PBHA 1OQHA 1POY1 3K1PA 2AIXA 4GX6A 5HM4B 3KEIA 5DW8A 3MQ9A 4Z7EA 3IR1A 1FPEA 2CZLA 1NUYA 1NV1A 4GX4A 3I5OA 2E0SA 1IITA 1NI9A 2P0SA 3KC0A 3VLWA 5I56B 3TQLA 4G77A 1TFAA 4LZ7A 4H45A 4NWCA 3T96B 1NV4A 1SDXA 4EQ9A 3GZGA 5LOMA 2DE4A 3TMGA 4QSCA 5CMCA 3JYRA 4GWSA 4BDQA 1B5IA 4OERA 1SQYA 4DZ1A 2Z8EA 3KG2A 1B0HA 2I4CA 3FASA 3HO7A 3RYDA 3PGFA 4GWZA 4G68B 2FIEA 1URSA 4YKIA 5BWJA 4N6KA 4N8GA 2MKZA 1N7WA 4FEBA 4JBZA 3S9LC 2B65A 1NUWA 4ELPA 1MRPA 3N94A 1FQDA 1T0KA 3KOTA 3MVZA 2F35A 1AH5A 5B70A 1VSOA 4PE5B 4JVDA 3OO9A 1Y3QA 4OEUA 4MCOA 4X1DA 4KXPA 1BIYA 3OELA 3M8UA 4P9KA 5KCJB 2UYEA 2XD2A 1MY1A 3HFUA 3S9NC 2Q8JA 1B05A 4DIGA 4N6DA 3MZ1A 4E0WA 2R8TA 1XVYA 2AL4A 4MBPA 4I8CA 4GXAA 1EH3A 4F22A 2ONRA 3S2VA 4TOZA 1FTAA 3TODA 4PAIA 4GWWA 4HCWA 4OFOA 2O69A 2WX9A 1MDQA 3CHGA 1A7LA 1KZ8A 1TFDA 4TQUQ 5ITOA 3BFTA 4R9GA 1LBXA 4X8RA 3R7XA 2O1LA 1MY4A 4QHQA 1MQDA 5CM6A 2XXPA 5L9SA 2JJKA 2HAVA 1B1XA 4HE0A 2XXHA 3PUWE 4GIZA 2UXAA 4I1DA 4DCXA 4LA9A 1H76A 4ZS9A 1B3FA 1POTA 2XX8A 1IMEA 2DYXA 4DCYA 1G0HA 5M2VA 3CRBA 5EHMA 2I0BA 3IOUA 3OO8A 2RKMA 1JW4A 5T3JA 4X1BA 5A5LA 1VFDA 2GQ1A 3GLBA 3IO6A 4MNCA 4OYVA 4ZDMA 3EKIA 2VOZA 5H8QB 3L6GA 4JVIA 2F6GA 1B46A 1IMCA 4R75A 2CZIA 4YMBA 1MXZA 3QIMA 1PB8A 2QS3A 2Y7WA 1B9JA 3TEPA 1SVXB 4PF6A 4MLVA 5IAIA 2XX7A 2ZZXA 3U94A 3SETA 3W15C 1FQFA 3KJTA 3M3FA 1PBPA 3FVKA 4MH5A 3ILUB 1MQGA 2I3VA 3ODBA 1JNFA 1NKXA 3FXBA 2DXYA 3O6GA 3PPNA 1QGXA 4NF8A 1JW5A 4N13A 2YLNA 2F97A 4DDDA 1EYKA 1DK4A 4Q5TA 4ZEKA 5TP9A 4H46A 5I59B 5EYFA 2I58A 1IMDA 3IX1A 1A8EA 4OMBA 3IFAA 3QXMA 2HFBA 3U93A 1NNPA 4P11A 2Q8MA 2VD3A 3PD9A 2VHAA 2AYSA 5I58B 2P2AA 3N6TA 3IJOB 1XHYA 3BIHA 3G3HA 4NMYA 1H45A 3PD8A 1B0LA 1MQJA 3U8QA 4PE3A 4QF9A 4MAGA 2DOJA 2V3TA 3N5LA 4ZE8A 4EQBA 2XXVA 2B3BA 3O97A 4GF8A 2OK2A 2Y5KA 4LUBA 1Y1MA 1ELJA 1FQAA 4KPTA 2ZYOA 4MIJA 4N15A 4OENA 4NEDA 3ZSFA 1A8FA 3KN8A 4BLAA 1SW4A 4U4SA 4EQ7A 1AIVA 5FHOA 1XS5A 1EYJA 1N7XA 4PTKA 1Z7ME 2KLFA 5I2NB 4MX6A 3VLVA 4POXA 4R6HA 1NV0A 1HSEA 1P1OA 4LZ8A 3B6WA 3FBPA 4MNPA 3DP4A 1NV7A 2V25A 4QRZA 1NNKA 1D9VA 3V83A 3HV1A 5IZZA 1Z7NE 4F18A 5CBRA 2XXTA 3V89B 2PCRA 2HCAA 4EDPA 2R6GE 2DS9A 4G68A 1USYH 1JEUA 2RC7A 2REGA 4ELRA 4I9DA 3C31A 1UTBB 4GL8A 1HSJA 4IY5A 1XOCA 5KDTA 2ALUA 2ZYNA 1Y3PA 2XXIA 3IK6B 3TAJA 1FPDA 3MZBA 4OZ9A 3VLUA 4NTLA 5I3SA 4QFLA 3FVGA 5KCJA 3FVNA 3MSTA 1B52A 4R2BA 3OXNA 2HAUA 5AE4A 4R72A 1NH8A 3CFXA 2XHDA 4U22A 2ANJA 4F39A 3B8BA 4RXLA 3UA8A 1Y3NA 3KBZA 3LSLA 1UTHA 2F7BA 1I6BA 2DDKA 4MHFA 1DTGA 1B7HA 2P3NA 4OXVA 2HXWA 1IIWA 2ZMBA 2VP1A 2QS4A 1BK4A 2RC9A 3K4UA 1USYE 3V5AA 3OD7A 4NAPA 2H9BA 2XWVA 4PFBA 4ISUA 2ONSA 4GOTA 4YAHX 1M5BA 4EUOA 1QUIA 4P1LA 4XXUA 4NGUA 4F19A 3SZPA 3LC8A 1US5A 5AA2D 2B4LA 4RNSA 2ZNTA 1EU8A 5AA4B 4U4XA 2F6PA 2XD3A 3C33A 4QFNA 1LFIA 4G8HA 2Q89A 3C4MA 2I6EA 3MAMA 4DLDA 1O7TA 3T0JA 1Y1ZA 1DCUA 2HZLA 1R1NA 1MPCA 3U1OA 3Q25A 3OENA 1JETA 2DWJA 3MPKA 4KCDA 3WAEA 5HBCA 1IQ7A 1R9QA 1MS7A 1FBGA 4FATA 2FYIA 3RT6B 1CE2A 3QK6A 3S9EA 3PMWA 3OSQA 2XXKA 1FRPA 5EHSA 3HPIA 4G4PA 4IR8A 1EZ9A 2DP8A 3PMVA 1IMAA 1PB7A 4H5FA 4DXBA 4PGPA 4GWUA 2W7YA 1IXIA 4O8MA 3BFUA 3KZGA 5I59A 1LBCA 3SESA 4GVOA 4O7IA 5H8NB 1LAXA 2DE3A 3HN0A 1QVSA 3RPWA 3ONMA 3USDA 3TDJA 1FTMA 4JB7A 3T9HB 5EYHA 3G7WA 3E3KA 3O28A 1B32A 4C1UA 2ESNA 3SEXA 4KHZE 4IY6A 3OEMA 4G8MA 3IB1A 2UYFA 4KCCA 4ZEIA 1D9QA 3E4RA 3KC1A 1SYHA 4H0WA 3HCQA 3JV9A 1VR5A 3GYYA 1UQWA 4Q0CA 1JEVA 2OX3A 3HHGA 3RTWB 2QJEA 1MXYA 3EHSA 4GWOA 1NV6A 3G3FA 5H8FB 4YB7A 2QPQA 2QS1A 2GHAA 5AA2A 2OWTA 1K9ZA 3FUZA 3K0VA 1KA0A 1JVXA 2F36A 3MVWA 1M5EA 4IGTA 1H43A 3K02A 1PC3A 4PDDA 1BP5A 1FPJA 2PVUA 3SEWA 4LATA 1LFHA 2XWKA 2WYKA 1PDAA 1RYXA 4XKQA 1P1NA 2F8DA 1FPKA 3RNNA 3GBBA 1I6QA 4BDLA 2OBGA 4I3YA 1FTJA 2H4IA 4XTCQ 3OO7A 1R6ZA 2CZHA 1CB6A 2QFLA 1TXFA 3PUZE 3THIA 1B5JA 3FXRA 2FBPA 2QL3A 1ZLQA 1GVCA 1QJMA 2NXOA 1VE4A 1JP4A 3Q27A 4QXDA 1TWYA 1MH3A 3PPRA 3OOAA 4C1TA 1F9BA 4UACA 3EPEA 3H6TA 5A5XB 5EQ9A 3LUZA 4FAJA 2PX1A 2H5YA 4NF5A 4M4GA 3KN7A 3LSWA 3FJMA 1B1HA 3DELB 4FEDA 3EN3A 1XVXA 3VVEA 2DQVA 1LBWA 4G8NA 3B6TA 4H5GA 1VFEA 1MY3A 2WEFA 2Q9TA 1FPBA 2Y7PA 2PFYA 2FA7A 3U65A 4U23A 5EQAA 3K6WA 1SW2A 4LONB 1Y4TA 1RDXA 5I2NA 5ET7A 3E9XA 1FPGA 3KBRA 3FV2A 4GWXA 3FVOA 1PB9A 1DTZA 1N84A 1UTBA 3TTMA 3CG1A 1G0IA 2QMWA 4NF4A 1FJ6A 1ZIUA 3QYTA 3EQ1A 2B4MA 2Z8FA 1LEVA 1D3KA 4F1VA 1DPEA 1N3WA 2BJIA 1WODA 3TTRA 2GHBA 3UIFA 1AOVA 1A55A 4PETA 1P1UA 1SBPA 1FQCA 1M5CA 2D21A 1GV8A 3M3KA 2XXRA 2RC8A 4FJPA 1P1WA 2YJPA 4QSDA 4IGRA 4LQ2A 3T9UA 2O84X 3TCGA 3EHUA 3TQWA 1QUKA 3VXBA 1XC1A 5ESYA 1QKBA 1TT1A 3K6XA 3MJNA 1OVBA 4F2OA 3DM0A 2OWZA 3QUJA 4HCYA 3B6QA 3UK4A 3KSXA 3HSTA 3TTNA 4HW8A 4UABA 4YKJA 1K9YA 4Q30B 1FTOA 2XA5A 1Y9UA 4R9FA 1FCKA 3H6VA 3A29A 3K6VA 4H65A 1LAGE 2GRVA 4PP0A 4GRKA 2KR0A 5H8HA 4F3PA 4NE4A 4XKPA 1BKAA 5EQ7A 2ABHA 5K2YA 3T93B 5IGAA 1Y4CA 1NUZA 4GL0A 2FHYA 4PGNA 5HPQA 1MG1A 5J1DA 1IEJA 2CZKA 1YPNA 4OVQA 4BDNA 2O68A 2QS2A 3IAZA 4NN3A 4PFYA 4OWDA 4E0XA 3U72A 3RGYA 1B4ZA 4OVRA 1NMUA 1SPIA 1O63A 4PAFA 3VVFA 1OLAA 2DSFA
chains in the Genus database with same CATH topology
2I0CA 2RC9A 3MVYA 1QW0A 1FTLA 5FHNA 3M3LA 1YAEA 3K4UA 1USYE 4JSOA 1MM7A 3MBPA 1MXUA 3OD7A 3UGWA 2R71A 3V5AA 2H9BA 2IEEA 3BKIB 2PT2A 3FJGA 3L6HA 2XXUA 4JDFA 2F78A 4NF6A 4P0IA 1US4A 1GTKA 3H6UA 2I49A 2Y7IA 4KYEA 4PFUA 3LSXA 4ISUA 1L5TA 2ONSA 4AB6A 2OWSA 3A3CA 2DWHA 1ANFA 2DWIA 3O2AA 4GOTA 1M5BA 4YAHX 3K1NA 3IB0A 5AA4A 4DXCA 4EUOA 2HQ0A 4LVQA 1D9YA 1QUIA 1S7YA 3LBSA 4QFPA 1B2HA 2RCAA 3V8XB 5F7VA 4FECA 4XXUA 3CSGA 3FIRA 4JWOA 4LQ5A 4F19A 1GGGA 2F7AA 3IOVA 3MZ9A 1D4NA 1WDNA 3LC8A 4YMAA 1US5A 2Z23A 2A5TB 3T22A 1SD3A 4BLAA 3I6VA 2V3QA 5AA2D 2UVJA 3H3GA 5CRYA 3KGCA 4RNSA 4OVJA 2V93A 2ZNTA 3MPLA 2VP1A 1EU8A 5AA4B 1OQHA 1QULA 4U4XA 1POY1 3K1PA 2AIXA 2F6PA 2XD3A 4IO7A 2HEUA 3C33A 3C32A 4QFNA 5HM4B 4NF5B 3KEIA 1LFIA 2PBWA 3K00A 4G8HA 4R6YA 2Q89A 4RPOA 3MQ9A 3C4MA 1AMFA 2I6EA 4C1TA 3MAMA 4EF1A 3O66A 4DLDA 4Z7EA 1O7TA 4IO3A 3IR1A 1N0TA 1SW5A 1UIUA 2CZLA 3VDFA 3WAFA 3I5OA 1Y1ZA 2E0SA 5CBRA 1IITA 4WEDA 5DVIA 1P1QA 2P0SA 2HZLA 2CMOA 4OESA 5CC2A 3VLWA 5I56B 4R6KA 3TQLA 2PYYA 4G77A 1R1NA 1MPCA 1TFAA 3U1OA 4LZ7A 3LR1A 3TKDA 3Q25A 3OENA 4NWCA 3T96B 3PU5A 1SDXA 1JETA 5H8QA 2DWJA 4GD5A 4EQ9A 3GZGA 5LOMA 1LAHE 4O3BA 3MPKA 1OMPA 2DE4A 4KCDA 4QSCA 3TMGA 1MXWA 5CMCA 1H3DA 4PQJA 1FQEA 3WAEA 5HBCA 1IQ7A 3JYRA 1R9QA 1MS7A 4BDQA 2V84A 1B5IA 2XXXA 3C9HA 5TP9B 4FATA 4OERA 1SQYA 4DZ1A 5ICTA 3D4GA 3OSRA 2FYIA 2Z8EA 3DP6A 3KG2A 3RT6B 5CI5A 1CE2A 1S50A 4DXUA 3QK6A 3S9EA 1B0HA 2I4CA 3FASA 3PMWA 2DE2A 2H98A 3CVGA 3HO7A 3PPQA 3PGFA 4JWYA 3OSQA 4G68B 1OIBA 1A99A 1A40A 1URSA 1XT8A 5EHSA 3HPIA 3IO4A 4ZEFA 2ONKE 3DLNA 4YKIA 3K1MA 4C0RA 5BWJA 1Q1KA 4G4PA 4F1YA 1EZ9A 2DP8A 3QSLA 4H8IA 4ZEDA 3PMVA 1N7WA 1PB7A 4H5FA 3MWBA 2XXWA 4FEBA 1B3LA 4JBZA 5JK4A 3S9LC 4DXBA 1LLSA 2B65A 2XXQA 4ELPA 1MRPA 2GH9A 3H4ZA 4L17A 1MPDA 5H8NA 1ZMGA 4THIA 4OTEA 1M5DA 1OLCA 4KYSA 3T9XB 3N94A 1FQDA 4KR5A 4XKNA 2W7YA 1LGBC 2THIA 3KOTA 3R26A 1T0KA 3MVZA 1IXIA 5F1QA 3H06B 1B51A 2F35A 1AH5A 4U21A 3BFUA 3VVDA 3KZGA 3C34A 4YKPA 4F2QA 4F31B 5B70A 5I59A 1VSOA 3PUVE 4PE5B 1LBCA 1H44A 5I2KB 4DE8A 3OO9A 3SESA 1Y3QA 4OEUA 1B3HA 1Q35A 3MW0A 2G93A 4GVOA 4PFTA 4X1DA 2I4BA 2YPNA 5DEXA 5H8NB 3C36A 5L9OA 1LAXA 2DE3A 3LSFB 1BIYA 3HN0A 3M8UA 3HHFA 1QVSA 3OELA 5KCJB 3RPWA 2UYEA 3ONMA 4OFLA 1B40A 3TCHA 3USDA 2X7QA 5ICQA 2PMSA 2ZYKA 3TDJA 4KQPA 1FTMA 4JB7A 2XD2A 3PV0E 3T9HB 1MY1A 3S9NC 1MXXA 2Q8JA 3TYHA 3ZKLA 4ZE9A 5ISUA 3G7WA 1B05A 3E3KA 4NF8B 5CMMA 4DIGA 3FZVA 3O28A 3FV1A 3MP8A 5JTYB 1B32A 3RUMA 1MM6A 1ZKBA 5DVFA 3MZ1A 4E0WA 1PBQA 1XVYA 2AL4A 2ZXTA 1MPBA 4C1UA 4MBPA 2ESNA 4ESWA 4I8CA 4GXAA 1EH3A 3SEXA 2ONRA 3JZJA 3FXUA 3S2VA 4TOZA 4U1OA 4KHZE 3TFLA 3TODA 5I57B 4IY6A 3KN3A 2XX9A 3OEMA 4G8MA 4HCWA 4OFOA 2O69A 4RK9A 3IB1A 4WXJA 1IXHA 2UYFA 4KCCA 1MDQA 4ZEIA 5JTYA 1JVYA 4R2FA 2I3WA 3E4RA 1A7LA 4GQOA 4Z0IA 1R9LA 1SYHA 1TFDA 4H0WA 4TQUQ 3HCQA 1JW1A 3JV9A 2WKYA 4NF6B 5ITOA 1VR5A 1YCJA 3BFTA 4R9GA 1UQWA 3R7XA 5I57A 4Q0CA 1JEVA 2O1LA 1MY4A 4QHQA 5AA3A 4OQOA 3HHGA 3H03A 4IO4A 4YICA 4XKRA 5DEXB 1ZTYA 4P0GA 4R73A 1MQDA 3RTFB 3RTWB 5CM6A 1QUJA 1MXYA 2QJEA 3EHSA 4GWOA 1PEBA 1KWHA 2XXPA 3G3FA 3MP6A 3S4UA 5H8FB 5L9SA 5I56A 1BTJA 2HAVA 1B1XA 3I3VA 4F3SA 2XXHA 3PUWE 4GIZA 4YB7A 2UXAA 3GXAA 4I1DA 2QPQA 2G29A 4QSEA 4DCXA 4ONYA 4LA9A 1H76A 4ZS9A 2QS1A 1GR2A 3Q26A 1SI1A 4ECFA 5DVJA 2GHAA 4BDOA 3U93A 1N76A 3D4CA 5AA2A 2OWTA 1B3FA 4ZZEA 1DMBA 2R9JA 1IUDA 3K2DA 1POTA 1URGA 2XX8A 3FUZA 4M1VA 1HSLA 3K0VA 4HS7A 3FGSA 4GXSB 3IJXB 3QAXA 1BLFA 2DYXA 5EHMA 4DCYA 1JVXA 5M2VA 2O7IA 3CRBA 2I0BA 2F36A 3IOUA 3MVWA 1M5EA 2RKMA 1H43A 3K02A 3KSJA 3OO8A 1AL3A 4IGTA 1JW4A 1PC3A 1LCFA 3C35A 1MXVA 1BP5A 4X1BA 1B4HA 5FHMA 1VFDA 2PVUA 2DVZA 3GLBA 3SEWA 4LATA 1LFHA 1P99A 2OJTA 1RYOA 3IO6A 1PDAA 1RYXA 4XKQA 5KDTB 2AL5A 3RN8A 3ECRA 5I84A 2BJJX 1MY2A 1LB8A 3B7DA 4OYVA 3TCFA 5H8HB 1P1NA 2F8DA 2IA4A 3RNNA 4ZDMA 3GBBA 3UP9A 1NNTA 2VOZA 1I6QA 2V3UA 3L6GA 5H8QB 4POWA 4N6PA 3SDFA 2F6GA 1B46A 4BDLA 1ZU0A 2OBGA 3PPOA 4R75A 5L9MA 1FTJA 4YMBA 2OCUA 1MXZA 3QIMA 3H6WA 1PB8A 2QS3A 4OFJA 1ZJLA 2Y7WA 4UA8A 1DOTA 1B9JA 2RINA 4JSDA 2H4IA 2Q88A 4OETA 4XTCQ 3OO7A 4FE8A 3TEPA 1SVXB 2Q2AA 4ND9A 4MLVA 2Q2CA 4OEVA 5H8SA 4Q8RA 1R6ZA 5IAIA 2XX7A 3U94A 1CB6A 2P1SA 2OZZA 1TXFA 3SETA 3PUZE 4F29A 3THIA 1FQFA 3W15C 3VFJA 4ESXA 3SEVA 3FJ7A 4TLLB 3GBAA 5DT6A 5CBSA 2ZNUA 1B5JA 3PUXE 5AA2B 4X9TA 3FXRA 3SEYA 1O64A 3KJTA 3M3FA 1PBPA 3LUYA 2QL3A 1ZLQA 2UVGA 3FVKA 4MH5A 5TPAB 1GVCA 2HZKA 2O1MA 1MQGA 1QJMA 2NXOA 3ILUB 3ILTB 1VE4A 3MUQA 1OQGA 4BDRA 2I3VA 2Z22A 5B7DA 2Y7RA 3ODBA 3PUYE 1JNFA 3H7MA 1NKXA 3Q27A 1B6HA 3T66A 4RPNA 2DXYA 4YB6A 1TWYA 1MH3A 3PPRA 4NWDA 4RYAA 4F1UA 3O6GA 1IXCA 3OOAA 3PPNA 4MFIA 4NF8A 3UORA 4HTGA 4YZZA 1F9BA 4UACA 3EPEA 1JW5A 3H6TA 5FTIA 4ELQA 3MP1A 3IOTA 4N13A 3F11A 2YLNA 5A5XB 2RF1A 2F97A 3G3IA 4DDDA 2PX1A 2H5YA 4FAJA 2E1SA 4NF5A 3BBRA 4Q5TA 3P7IA 4ZEKA 5TP9A 4O3CA 4M4GA 2X26A 3KN7A 3LSWA 4IO5A 5EYFA 2I58A 1FQBA 2UVIA 3FJMA 4I62A 3T9VA 1B1HA 3A3UA 3DELB 3IX1A 3EN3A 1MH4A 4FEDA 3OMBA 1XVXA 4FIMA 4N07A 1A8EA 1URDA 2H25A 1IXGA 3E13X 4OMBA 3QXMA 4O3AA 4K3FA 2HFBA 3VVEA 1B7UA 4H8JA 2DQVA 1NNPA 1OVTA 3G3KA 3N26A 4P11A 3K6UA 3MVXA 2ZNSA 4G8NA 3B6TA 4H5GA 2VD3A 3PD9A 1VFEA 1MY3A 2AYSA 2VHAA 1A54A 2Q9TA 5AA1A 2B3FA 5I58B 2Y7PA 4JXIA 2P2AA 2NVUB 2FA7A 3CFLA 3N6TA 3IJOB 1QKAA 4U2RA 1EZPA 4U23A 5ITPA 2DXRA 1SW1A 2UVHA 1XHYA 3G3HA 3K6WA 4AQ4A 3TELA 4NMYA 1SW2A 1H45A 4LONB 2Z8DA 5TU0A 1Y4TA 5I2NA 5L8DA 3PD8A 1B0LA 1DSNA 3E9XA 3KBRA 3FV2A 1ATGA 2F5XA 3FD3A 1N3XA 3FVOA 1PB9A 1DTZA 4RK2A 1N84A 1UTBA 5I2KA 1MQJA 3TTMA 3CG1A 4H6DA 4KD5A 2OLBA 5DYHA 4GLIA 4QF9A 3U8QA 5A5XA 1MQHA 4KFQA 2QMWA 1SYIA 3MC2A 2DOJA 2V3TA 3N5LA 2QSXA 4NF4A 4H1XA 1DPPA 3VV5A 4KYDA 1ZIUA 3KOSA 4ZE8A 2RCBA 2XXVA 1MQIA 3TZAA 4EQBA 3IORA 4QFOA 3QYTA 3EQ1A 4F22A 2B3BA 2Z8FA 1LSTA 3O97A 3CI8A 4GF8A 2OK2A 1D3KA 4F1VA 1DPEA 1N3WA 1Y1MA 1ELJA 4IO2A 4LUBA 4ZECA 5BUUA 1M5FA 5FTHA 1MDP1 1FQAA 4KPTA 5CMBA 4ELOA 3IB2A 1WODA 2ZYOA 3FATA 1B58A 3SKPA 1SI0A 4OENA 2GHBA 3IOWA 4QFKA 3TTRA 3UIFA 3ZKKA 2NOOA 1II5A 1LBBA 1AOVA 1A55A 4NEDA 4PETA 1P1UA 1SBPA 3ZSFA 1A8FA 1ZBMA 1FQCA 1M5CA 3QUFA 2D21A 3UN6A 1B3EA 3KN8A 4R74A 1GV8A 1LCTA 3G3GA 3M3KA 3RY3A 1LFGA 1SW4A 2XXRA 4RA1A 2RC8A 4U4SA 4EQ7A 1AIVA 4FJPA 5FHOA 1XS5A 4GFRA 1N7XA 5KZTA 1P1WA 3IL1B 3O6IA 2YJPA 4IGRA 4LQ2A 3A09A 4QSDA 1Z7ME 2KLFA 3AXFA 3T9UA 3VLVA 5I2NB 1EZOA 4POXA 1I6AA 5DTBA 3O29A 3DP8A 3K01A 1UIVA 4WEPA 1B7ZA 1MY0A 2QMXA 4R6HA 2O84X 2ZYMA 4RY1A 3TCGA 3EHUA 3TQWA 1N04A 2GFEA 4YU0A 3RQTA 1QUKA 1B3GA 4U1ZA 3VXBA 1FW0A 1XC1A 1JQFA 3CFZA 1QKBA 3SERA 1TT1A 3K6XA 3VXCA 3ZS6A 1RKMA 1HSEA 1P1OA 3MJNA 1WVJA 1OVBA 4LZ8A 2I48A 4F2OA 3DM0A 3KJ7A 3B6WA 3KFMA 5H8FA 3DP4A 2DWAA 4BDMA 2V25A 4ZZAA 3QUJA 3OEKA 3CR9A 4QRZA 3PMXA 3RT8A 1NNKA 5I59B 5I58A 1D9VA 2H99A 4HCYA 3B6QA 3UK4A 3HV1A 2XXYA 3V83A 1IZ1A 3Q29A 3W9VA 1YTVA 3G3JA 3TTKA 3KSXA 3HSTA 4IO6A 4G68C 1Z7NE 4LP2B 2PT1A 3CG3A 3TTNA 4F18A 2XXTA 3U92A 3V89B 4HW8A 1NFTA 2HCAA 4YKJA 3Q28A 2R6GE 1NL5A 4Q30B 2DS9A 4EDPA 3EF7A 2A5TA 2D3IA 2Y84A 3N6UA 1FTOA 1USYH 3OO6A 4G68A 4H67A 1Y9UA 2FNCA 4YKKA 1JEUA 2RC7A 2REGA 2NUVA 2VD2A 2LAOA 4ELRA 4I9DA 3C31A 4R9FA 1UTBB 2O7UA 1FCKA 2O6AA 3H6VA 3K6VA 3O6HA 4GL8A 1LAGE 4H65A 3TPAA 1HSJA 2GRVA 2D5WA 1XOCA 4IY5A 2ALUA 3FXQA 5KDTA 1NH7A 4PP0A 4OHNA 4GRKA 5H8HA 3SEUA 4F3PA 2ZYNA 1LB9A 2F34A 4NE4A 3TUSA 3O9PA 4JWXA 1Y3PA 1Y20A 2M8CA 4XKPA 2XXIA 3IK6B 5CMKA 1BKAA 3TAJA 4XIGQ 4YB5A 4ZEBA 2ABHA 3MZBA 4LZ5A 4OZ9A 5K2YA 3T93B 3VLUA 2O51A 3EHTA 2A5SA 4NTLA 5ELVA 3CIJA 4AB5A 1FTKA 5JEIA 2QRYA 3RLFE 1Y4CA 4EXKA 4QFLA 4GL0A 1NNFA 4X48A 1S9TA 5HPQA 3FVGA 5KCJA 1UTHB 5IKBA 1MG1A 4TLMB 3FVNA 2VGQA 5J1DA 1IEJA 1YPNA 2REJA 2NWJA 1B52A 4R2BA 3R6UA 3OXNA 3VE1B 4F3GA 4PFWA 2F7CA 2HAUA 2DVCA 5AE4A 4MLQA 4R72A 1NH8A 3CFXA 2O68A 2XHDA 4BDNA 2QS2A 4NF4B 2ANJA 4IB2A 4U22A 4F39A 4RXLA 5K2XA 3UA8A 1Y3NA 3IAZA 3LSLA 4FORA 4EF2A 1B5HA 1UTHA 2F7BA 4KI0E 5TPAA 4PFYA 4OWDA 4E0XA 3U72A 4RJZA 1I6BA 3PPPA 1B4ZA 4G2ZA 3RGYA 4WKMA 1DTGA 1B7HA 1I69A 1NMUA 1O63A 1LAFE 1J1NA 3VVFA 4MF3A 1OLAA 4OXVA 2DSFA 2Y7KA 4EXLA 3S9MC 2HXWA 1IIWA 4F3BA 2ZMBA 2X7PA 2QS4A 3CSBA 3TTLA 3W9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0C A;  2RC9 A;  3MVY A;  1QW0 A;  1FTL A;  5FHN A;  3M3L A;  1YAE A;  3K4U A;  1USY E;  4JSO A;  1MM7 A;  3MBP A;  1MXU A;  3OD7 A;  3UGW A;  2R71 A;  3V5A A;  2H9B A;  2IEE A;  3BKI B;  2PT2 A;  3FJG A;  3L6H A;  2XXU A;  4JDF A;  2F78 A;  4NF6 A;  4P0I A;  1US4 A;  1GTK A;  3H6U A;  2I49 A;  2Y7I A;  4KYE A;  4PFU A;  3LSX A;  4ISU A;  1L5T A;  2ONS A;  4AB6 A;  2OWS A;  3A3C A;  2DWH A;  1ANF A;  2DWI A;  3O2A A;  4GOT A;  1M5B A;  4YAH X;  3K1N A;  3IB0 A;  5AA4 A;  4DXC A;  4EUO A;  2HQ0 A;  4LVQ A;  1D9Y A;  1QUI A;  1S7Y A;  3LBS A;  4QFP A;  1B2H A;  2RCA A;  3V8X B;  5F7V A;  4FEC A;  4XXU A;  3CSG A;  3FIR A;  4JWO A;  4LQ5 A;  4F19 A;  1GGG A;  2F7A A;  3IOV A;  3MZ9 A;  1D4N A;  1WDN A;  3LC8 A;  4YMA A;  1US5 A;  2Z23 A;  2A5T B;  3T22 A;  1SD3 A;  4BLA A;  3I6V A;  2V3Q A;  5AA2 D;  2UVJ A;  3H3G A;  5CRY A;  3KGC A;  4RNS A;  4OVJ A;  2V93 A;  2ZNT A;  3MPL A;  2VP1 A;  1EU8 A;  5AA4 B;  1OQH A;  1QUL A;  4U4X A;  1POY 1;  3K1P A;  2AIX A;  2F6P A;  2XD3 A;  4IO7 A;  2HEU A;  3C33 A;  3C32 A;  4QFN A;  5HM4 B;  4NF5 B;  3KEI A;  1LFI A;  2PBW A;  3K00 A;  4G8H A;  4R6Y A;  2Q89 A;  4RPO A;  3MQ9 A;  3C4M A;  1AMF A;  2I6E A;  4C1T A;  3MAM A;  4EF1 A;  3O66 A;  4DLD A;  4Z7E A;  1O7T A;  4IO3 A;  3IR1 A;  1N0T A;  1SW5 A;  1UIU A;  2CZL A;  3VDF A;  3WAF A;  3I5O A;  1Y1Z A;  2E0S A;  5CBR A;  1IIT A;  4WED A;  5DVI A;  1P1Q A;  2P0S A;  2HZL A;  2CMO A;  4OES A;  5CC2 A;  3VLW A;  5I56 B;  4R6K A;  3TQL A;  2PYY A;  4G77 A;  1R1N A;  1MPC A;  1TFA A;  3U1O A;  4LZ7 A;  3LR1 A;  3TKD A;  3Q25 A;  3OEN A;  4NWC A;  3T96 B;  3PU5 A;  1SDX A;  1JET A;  5H8Q A;  2DWJ A;  4GD5 A;  4EQ9 A;  3GZG A;  5LOM A;  1LAH E;  4O3B A;  3MPK A;  1OMP A;  2DE4 A;  4KCD A;  4QSC A;  3TMG A;  1MXW A;  5CMC A;  1H3D A;  4PQJ A;  1FQE A;  3WAE A;  5HBC A;  1IQ7 A;  3JYR A;  1R9Q A;  1MS7 A;  4BDQ A;  2V84 A;  1B5I A;  2XXX A;  3C9H A;  5TP9 B;  4FAT A;  4OER A;  1SQY A;  4DZ1 A;  5ICT A;  3D4G A;  3OSR A;  2FYI A;  2Z8E A;  3DP6 A;  3KG2 A;  3RT6 B;  5CI5 A;  1CE2 A;  1S50 A;  4DXU A;  3QK6 A;  3S9E A;  1B0H A;  2I4C A;  3FAS A;  3PMW A;  2DE2 A;  2H98 A;  3CVG A;  3HO7 A;  3PPQ A;  3PGF A;  4JWY A;  3OSQ A;  4G68 B;  1OIB A;  1A99 A;  1A40 A;  1URS A;  1XT8 A;  5EHS A;  3HPI A;  3IO4 A;  4ZEF A;  2ONK E;  3DLN A;  4YKI A;  3K1M A;  4C0R A;  5BWJ A;  1Q1K A;  4G4P A;  4F1Y A;  1EZ9 A;  2DP8 A;  3QSL A;  4H8I A;  4ZED A;  3PMV A;  1N7W A;  1PB7 A;  4H5F A;  3MWB A;  2XXW A;  4FEB A;  1B3L A;  4JBZ A;  5JK4 A;  3S9L C;  4DXB A;  1LLS A;  2B65 A;  2XXQ A;  4ELP A;  1MRP A;  2GH9 A;  3H4Z A;  4L17 A;  1MPD A;  5H8N A;  1ZMG A;  4THI A;  4OTE A;  1M5D A;  1OLC A;  4KYS A;  3T9X B;  3N94 A;  1FQD A;  4KR5 A;  4XKN A;  2W7Y A;  1LGB C;  2THI A;  3KOT A;  3R26 A;  1T0K A;  3MVZ A;  1IXI A;  5F1Q A;  3H06 B;  1B51 A;  2F35 A;  1AH5 A;  4U21 A;  3BFU A;  3VVD A;  3KZG A;  3C34 A;  4YKP A;  4F2Q A;  4F31 B;  5B70 A;  5I59 A;  1VSO A;  3PUV E;  4PE5 B;  1LBC A;  1H44 A;  5I2K B;  4DE8 A;  3OO9 A;  3SES A;  1Y3Q A;  4OEU A;  1B3H A;  1Q35 A;  3MW0 A;  2G93 A;  4GVO A;  4PFT A;  4X1D A;  2I4B A;  2YPN A;  5DEX A;  5H8N B;  3C36 A;  5L9O A;  1LAX A;  2DE3 A;  3LSF B;  1BIY A;  3HN0 A;  3M8U A;  3HHF A;  1QVS A;  3OEL A;  5KCJ B;  3RPW A;  2UYE A;  3ONM A;  4OFL A;  1B40 A;  3TCH A;  3USD A;  2X7Q A;  5ICQ A;  2PMS A;  2ZYK A;  3TDJ A;  4KQP A;  1FTM A;  4JB7 A;  2XD2 A;  3PV0 E;  3T9H B;  1MY1 A;  3S9N C;  1MXX A;  2Q8J A;  3TYH A;  3ZKL A;  4ZE9 A;  5ISU A;  3G7W A;  1B05 A;  3E3K A;  4NF8 B;  5CMM A;  4DIG A;  3FZV A;  3O28 A;  3FV1 A;  3MP8 A;  5JTY B;  1B32 A;  3RUM A;  1MM6 A;  1ZKB A;  5DVF A;  3MZ1 A;  4E0W A;  1PBQ A;  1XVY A;  2AL4 A;  2ZXT A;  1MPB A;  4C1U A;  4MBP A;  2ESN A;  4ESW A;  4I8C A;  4GXA A;  1EH3 A;  3SEX A;  2ONR A;  3JZJ A;  3FXU A;  3S2V A;  4TOZ A;  4U1O A;  4KHZ E;  3TFL A;  3TOD A;  5I57 B;  4IY6 A;  3KN3 A;  2XX9 A;  3OEM A;  4G8M A;  4HCW A;  4OFO A;  2O69 A;  4RK9 A;  3IB1 A;  4WXJ A;  1IXH A;  2UYF A;  4KCC A;  1MDQ A;  4ZEI A;  5JTY A;  1JVY A;  4R2F A;  2I3W A;  3E4R A;  1A7L A;  4GQO A;  4Z0I A;  1R9L A;  1SYH A;  1TFD A;  4H0W A;  4TQU Q;  3HCQ A;  1JW1 A;  3JV9 A;  2WKY A;  4NF6 B;  5ITO A;  1VR5 A;  1YCJ A;  3BFT A;  4R9G A;  1UQW A;  3R7X A;  5I57 A;  4Q0C A;  1JEV A;  2O1L A;  1MY4 A;  4QHQ A;  5AA3 A;  4OQO A;  3HHG A;  3H03 A;  4IO4 A;  4YIC A;  4XKR A;  5DEX B;  1ZTY A;  4P0G A;  4R73 A;  1MQD A;  3RTF B;  3RTW B;  5CM6 A;  1QUJ A;  1MXY A;  2QJE A;  3EHS A;  4GWO A;  1PEB A;  1KWH A;  2XXP A;  3G3F A;  3MP6 A;  3S4U A;  5H8F B;  5L9S A;  5I56 A;  1BTJ A;  2HAV A;  1B1X A;  3I3V A;  4F3S A;  2XXH A;  3PUW E;  4GIZ A;  4YB7 A;  2UXA A;  3GXA A;  4I1D A;  2QPQ A;  2G29 A;  4QSE A;  4DCX A;  4ONY A;  4LA9 A;  1H76 A;  4ZS9 A;  2QS1 A;  1GR2 A;  3Q26 A;  1SI1 A;  4ECF A;  5DVJ A;  2GHA A;  4BDO A;  3U93 A;  1N76 A;  3D4C A;  5AA2 A;  2OWT A;  1B3F A;  4ZZE A;  1DMB A;  2R9J A;  1IUD A;  3K2D A;  1POT A;  1URG A;  2XX8 A;  3FUZ A;  4M1V A;  1HSL A;  3K0V A;  4HS7 A;  3FGS A;  4GXS B;  3IJX B;  3QAX A;  1BLF A;  2DYX A;  5EHM A;  4DCY A;  1JVX A;  5M2V A;  2O7I A;  3CRB A;  2I0B A;  2F36 A;  3IOU A;  3MVW A;  1M5E A;  2RKM A;  1H43 A;  3K02 A;  3KSJ A;  3OO8 A;  1AL3 A;  4IGT A;  1JW4 A;  1PC3 A;  1LCF A;  3C35 A;  1MXV A;  1BP5 A;  4X1B A;  1B4H A;  5FHM A;  1VFD A;  2PVU A;  2DVZ A;  3GLB A;  3SEW A;  4LAT A;  1LFH A;  1P99 A;  2OJT A;  1RYO A;  3IO6 A;  1PDA A;  1RYX A;  4XKQ A;  5KDT B;  2AL5 A;  3RN8 A;  3ECR A;  5I84 A;  2BJJ X;  1MY2 A;  1LB8 A;  3B7D A;  4OYV A;  3TCF A;  5H8H B;  1P1N A;  2F8D A;  2IA4 A;  3RNN A;  4ZDM A;  3GBB A;  3UP9 A;  1NNT A;  2VOZ A;  1I6Q A;  2V3U A;  3L6G A;  5H8Q B;  4POW A;  4N6P A;  3SDF A;  2F6G A;  1B46 A;  4BDL A;  1ZU0 A;  2OBG A;  3PPO A;  4R75 A;  5L9M A;  1FTJ A;  4YMB A;  2OCU A;  1MXZ A;  3QIM A;  3H6W A;  1PB8 A;  2QS3 A;  4OFJ A;  1ZJL A;  2Y7W A;  4UA8 A;  1DOT A;  1B9J A;  2RIN A;  4JSD A;  2H4I A;  2Q88 A;  4OET A;  4XTC Q;  3OO7 A;  4FE8 A;  3TEP A;  1SVX B;  2Q2A A;  4ND9 A;  4MLV A;  2Q2C A;  4OEV A;  5H8S A;  4Q8R A;  1R6Z A;  5IAI A;  2XX7 A;  3U94 A;  1CB6 A;  2P1S A;  2OZZ A;  1TXF A;  3SET A;  3PUZ E;  4F29 A;  3THI A;  1FQF A;  3W15 C;  3VFJ A;  4ESX A;  3SEV A;  3FJ7 A;  4TLL B;  3GBA A;  5DT6 A;  5CBS A;  2ZNU A;  1B5J A;  3PUX E;  5AA2 B;  4X9T A;  3FXR A;  3SEY A;  1O64 A;  3KJT A;  3M3F A;  1PBP A;  3LUY A;  2QL3 A;  1ZLQ A;  2UVG A;  3FVK A;  4MH5 A;  5TPA B;  1GVC A;  2HZK A;  2O1M A;  1MQG A;  1QJM A;  2NXO A;  3ILU B;  3ILT B;  1VE4 A;  3MUQ A;  1OQG A;  4BDR A;  2I3V A;  2Z22 A;  5B7D A;  2Y7R A;  3ODB A;  3PUY E;  1JNF A;  3H7M A;  1NKX A;  3Q27 A;  1B6H A;  3T66 A;  4RPN A;  2DXY A;  4YB6 A;  1TWY A;  1MH3 A;  3PPR A;  4NWD A;  4RYA A;  4F1U A;  3O6G A;  1IXC A;  3OOA A;  3PPN A;  4MFI A;  4NF8 A;  3UOR A;  4HTG A;  4YZZ A;  1F9B A;  4UAC A;  3EPE A;  1JW5 A;  3H6T A;  5FTI A;  4ELQ A;  3MP1 A;  3IOT A;  4N13 A;  3F11 A;  2YLN A;  5A5X B;  2RF1 A;  2F97 A;  3G3I A;  4DDD A;  2PX1 A;  2H5Y A;  4FAJ A;  2E1S A;  4NF5 A;  3BBR A;  4Q5T A;  3P7I A;  4ZEK A;  5TP9 A;  4O3C A;  4M4G A;  2X26 A;  3KN7 A;  3LSW A;  4IO5 A;  5EYF A;  2I58 A;  1FQB A;  2UVI A;  3FJM A;  4I62 A;  3T9V A;  1B1H A;  3A3U A;  3DEL B;  3IX1 A;  3EN3 A;  1MH4 A;  4FED A;  3OMB A;  1XVX A;  4FIM A;  4N07 A;  1A8E A;  1URD A;  2H25 A;  1IXG A;  3E13 X;  4OMB A;  3QXM A;  4O3A A;  4K3F A;  2HFB A;  3VVE A;  1B7U A;  4H8J A;  2DQV A;  1NNP A;  1OVT A;  3G3K A;  3N26 A;  4P11 A;  3K6U A;  3MVX A;  2ZNS A;  4G8N A;  3B6T A;  4H5G A;  2VD3 A;  3PD9 A;  1VFE A;  1MY3 A;  2AYS A;  2VHA A;  1A54 A;  2Q9T A;  5AA1 A;  2B3F A;  5I58 B;  2Y7P A;  4JXI A;  2P2A A;  2NVU B;  2FA7 A;  3CFL A;  3N6T A;  3IJO B;  1QKA A;  4U2R A;  1EZP A;  4U23 A;  5ITP A;  2DXR A;  1SW1 A;  2UVH A;  1XHY A;  3G3H A;  3K6W A;  4AQ4 A;  3TEL A;  4NMY A;  1SW2 A;  1H45 A;  4LON B;  2Z8D A;  5TU0 A;  1Y4T A;  5I2N A;  5L8D A;  3PD8 A;  1B0L A;  1DSN A;  3E9X A;  3KBR A;  3FV2 A;  1ATG A;  2F5X A;  3FD3 A;  1N3X A;  3FVO A;  1PB9 A;  1DTZ A;  4RK2 A;  1N84 A;  1UTB A;  5I2K A;  1MQJ A;  3TTM A;  3CG1 A;  4H6D A;  4KD5 A;  2OLB A;  5DYH A;  4GLI A;  4QF9 A;  3U8Q A;  5A5X A;  1MQH A;  4KFQ A;  2QMW A;  1SYI A;  3MC2 A;  2DOJ A;  2V3T A;  3N5L A;  2QSX A;  4NF4 A;  4H1X A;  1DPP A;  3VV5 A;  4KYD A;  1ZIU A;  3KOS A;  4ZE8 A;  2RCB A;  2XXV A;  1MQI A;  3TZA A;  4EQB A;  3IOR A;  4QFO A;  3QYT A;  3EQ1 A;  4F22 A;  2B3B A;  2Z8F A;  1LST A;  3O97 A;  3CI8 A;  4GF8 A;  2OK2 A;  1D3K A;  4F1V A;  1DPE A;  1N3W A;  1Y1M A;  1ELJ A;  4IO2 A;  4LUB A;  4ZEC A;  5BUU A;  1M5F A;  5FTH A;  1MDP 1;  1FQA A;  4KPT A;  5CMB A;  4ELO A;  3IB2 A;  1WOD A;  2ZYO A;  3FAT A;  1B58 A;  3SKP A;  1SI0 A;  4OEN A;  2GHB A;  3IOW A;  4QFK A;  3TTR A;  3UIF A;  3ZKK A;  2NOO A;  1II5 A;  1LBB A;  1AOV A;  1A55 A;  4NED A;  4PET A;  1P1U A;  1SBP A;  3ZSF A;  1A8F A;  1ZBM A;  1FQC A;  1M5C A;  3QUF A;  2D21 A;  3UN6 A;  1B3E A;  3KN8 A;  4R74 A;  1GV8 A;  1LCT A;  3G3G A;  3M3K A;  3RY3 A;  1LFG A;  1SW4 A;  2XXR A;  4RA1 A;  2RC8 A;  4U4S A;  4EQ7 A;  1AIV A;  4FJP A;  5FHO A;  1XS5 A;  4GFR A;  1N7X A;  5KZT A;  1P1W A;  3IL1 B;  3O6I A;  2YJP A;  4IGR A;  4LQ2 A;  3A09 A;  4QSD A;  1Z7M E;  2KLF A;  3AXF A;  3T9U A;  3VLV A;  5I2N B;  1EZO A;  4POX A;  1I6A A;  5DTB A;  3O29 A;  3DP8 A;  3K01 A;  1UIV A;  4WEP A;  1B7Z A;  1MY0 A;  2QMX A;  4R6H A;  2O84 X;  2ZYM A;  4RY1 A;  3TCG A;  3EHU A;  3TQW A;  1N04 A;  2GFE A;  4YU0 A;  3RQT A;  1QUK A;  1B3G A;  4U1Z A;  3VXB A;  1FW0 A;  1XC1 A;  1JQF A;  3CFZ A;  1QKB A;  3SER A;  1TT1 A;  3K6X A;  3VXC A;  3ZS6 A;  1RKM A;  1HSE A;  1P1O A;  3MJN A;  1WVJ A;  1OVB A;  4LZ8 A;  2I48 A;  4F2O A;  3DM0 A;  3KJ7 A;  3B6W A;  3KFM A;  5H8F A;  3DP4 A;  2DWA A;  4BDM A;  2V25 A;  4ZZA A;  3QUJ A;  3OEK A;  3CR9 A;  4QRZ A;  3PMX A;  3RT8 A;  1NNK A;  5I59 B;  5I58 A;  1D9V A;  2H99 A;  4HCY A;  3B6Q A;  3UK4 A;  3HV1 A;  2XXY A;  3V83 A;  1IZ1 A;  3Q29 A;  3W9V A;  1YTV A;  3G3J A;  3TTK A;  3KSX A;  3HST A;  4IO6 A;  4G68 C;  1Z7N E;  4LP2 B;  2PT1 A;  3CG3 A;  3TTN A;  4F18 A;  2XXT A;  3U92 A;  3V89 B;  4HW8 A;  1NFT A;  2HCA A;  4YKJ A;  3Q28 A;  2R6G E;  1NL5 A;  4Q30 B;  2DS9 A;  4EDP A;  3EF7 A;  2A5T A;  2D3I A;  2Y84 A;  3N6U A;  1FTO A;  1USY H;  3OO6 A;  4G68 A;  4H67 A;  1Y9U A;  2FNC A;  4YKK A;  1JEU A;  2RC7 A;  2REG A;  2NUV A;  2VD2 A;  2LAO A;  4ELR A;  4I9D A;  3C31 A;  4R9F A;  1UTB B;  2O7U A;  1FCK A;  2O6A A;  3H6V A;  3K6V A;  3O6H A;  4GL8 A;  1LAG E;  4H65 A;  3TPA A;  1HSJ A;  2GRV A;  2D5W A;  1XOC A;  4IY5 A;  2ALU A;  3FXQ A;  5KDT A;  1NH7 A;  4PP0 A;  4OHN A;  4GRK A;  5H8H A;  3SEU A;  4F3P A;  2ZYN A;  1LB9 A;  2F34 A;  4NE4 A;  3TUS A;  3O9P A;  4JWX A;  1Y3P A;  1Y20 A;  2M8C A;  4XKP A;  2XXI A;  3IK6 B;  5CMK A;  1BKA A;  3TAJ A;  4XIG Q;  4YB5 A;  4ZEB A;  2ABH A;  3MZB A;  4LZ5 A;  4OZ9 A;  5K2Y A;  3T93 B;  3VLU A;  2O51 A;  3EHT A;  2A5S A;  4NTL A;  5ELV A;  3CIJ A;  4AB5 A;  1FTK A;  5JEI A;  2QRY A;  3RLF E;  1Y4C A;  4EXK A;  4QFL A;  4GL0 A;  1NNF A;  4X48 A;  1S9T A;  5HPQ A;  3FVG A;  5KCJ A;  1UTH B;  5IKB A;  1MG1 A;  4TLM B;  3FVN A;  2VGQ A;  5J1D A;  1IEJ A;  1YPN A;  2REJ A;  2NWJ A;  1B52 A;  4R2B A;  3R6U A;  3OXN A;  3VE1 B;  4F3G A;  4PFW A;  2F7C A;  2HAU A;  2DVC A;  5AE4 A;  4MLQ A;  4R72 A;  1NH8 A;  3CFX A;  2O68 A;  2XHD A;  4BDN A;  2QS2 A;  4NF4 B;  2ANJ A;  4IB2 A;  4U22 A;  4F39 A;  4RXL A;  5K2X A;  3UA8 A;  1Y3N A;  3IAZ A;  3LSL A;  4FOR A;  4EF2 A;  1B5H A;  1UTH A;  2F7B A;  4KI0 E;  5TPA A;  4PFY A;  4OWD A;  4E0X A;  3U72 A;  4RJZ A;  1I6B A;  3PPP A;  1B4Z A;  4G2Z A;  3RGY A;  4WKM A;  1DTG A;  1B7H A;  1I69 A;  1NMU A;  1O63 A;  1LAF E;  1J1N A;  3VVF A;  4MF3 A;  1OLA A;  4OXV A;  2DSF A;  2Y7K A;  4EXL A;  3S9M C;  2HXW A;  1IIW A;  4F3B A;  2ZMB A;  2X7P A;  2QS4 A;  3CSB A;  3TTL A;  3W9W A; 
#chains in the Genus database with same CATH topology
 1QW0 A;  4OA4 A;  4JSO A;  1MM7 A;  4N91 A;  3BKI B;  2IEE A;  3MYU A;  5F24 A;  4NF6 A;  3H6U A;  2I49 A;  2OWS A;  3A3C A;  2DWI A;  3K1N A;  1S7Y A;  3LBS A;  4QFP A;  3CSG A;  3FIR A;  4JWO A;  2F7A A;  4MMP A;  1D4N A;  1WDN A;  1FBD A;  1SD3 A;  2V3Q A;  2UVJ A;  5CRY A;  1FBE A;  2HEU A;  3C32 A;  4NF5 B;  4R6Y A;  1AMF A;  4IO3 A;  1N0T A;  1SW5 A;  3WAF A;  4WED A;  5DVI A;  1P1Q A;  5CC2 A;  5FBP A;  2CMO A;  3QMF A;  3LR1 A;  2HPG A;  3PU5 A;  1LAH E;  1MXW A;  4G61 A;  4PAK A;  1H3D A;  4PQJ A;  2KQZ A;  4P3L A;  1NV3 A;  1LBV A;  2CEY A;  4GBW A;  2V84 A;  3C9H A;  5TP9 B;  5ICT A;  3OSR A;  4DXU A;  1S50 A;  2DE2 A;  3CVG A;  3PPQ A;  5I7I A;  4JWY A;  1A99 A;  1A40 A;  5I5P A;  3IO4 A;  4ZEF A;  3K1M A;  4C0R A;  3QSL A;  4ZED A;  5IM2 A;  5ET8 A;  2XXW A;  5JK4 A;  2GH9 A;  3H4Z A;  5H8N A;  1ZMG A;  4THI A;  1M5D A;  3B50 A;  4HE1 A;  1OLC A;  4KYS A;  4KR5 A;  2THI A;  3VVD A;  2P3V A;  4YKP A;  4F2Q A;  3PUV E;  1H44 A;  5I2K B;  3MW0 A;  4PFT A;  2I4B A;  2YPN A;  2X7Q A;  2PMS A;  5EYG A;  4KQP A;  3PV0 E;  2VPO A;  1MXX A;  4ZE9 A;  3TYH A;  5ISU A;  4NF8 B;  5CMM A;  3FZV A;  1FSA A;  5DVF A;  1PBQ A;  4ESW A;  4F3S A;  5L9O A;  3JZJ A;  1NUX A;  3FXU A;  3TFL A;  5I57 B;  2XX9 A;  5JTY A;  1JVY A;  4R2F A;  2I3W A;  4GQO A;  4Z0I A;  1XI6 A;  1JW1 A;  2WKY A;  4NF6 B;  1YCJ A;  5AA3 A;  4OQO A;  3H03 A;  4IO4 A;  5DEX B;  3LV0 A;  1DBZ A;  1QUJ A;  1KWH A;  3S4U A;  3BIG A;  4ONY A;  3Q26 A;  1GR2 A;  4ECF A;  5DVJ A;  1N76 A;  4ZZE A;  2R9J A;  4M1V A;  3K2D A;  1URG A;  4NHB A;  4HS7 A;  4GXS B;  1BLF A;  2O7I A;  1AL3 A;  4N8Y A;  1IMB A;  1LCF A;  3C35 A;  5FHM A;  1B4H A;  2DVZ A;  4QBA A;  1P99 A;  2OJT A;  5KDT B;  3RN8 A;  5I84 A;  3B7D A;  5H8H B;  1NNT A;  2V3U A;  1RDY A;  4POW A;  1ZU0 A;  4N81 A;  1LBY A;  4OFJ A;  1ZJL A;  2RIN A;  4JSD A;  4OET A;  2Q2A A;  4ND9 A;  4OEV A;  2P1S A;  2OZZ A;  4JVC A;  4ESX A;  3SEV A;  3FJ7 A;  4TLL B;  3PUX E;  4X9T A;  2HZK A;  3MUQ A;  5B7D A;  3D1R A;  3PUY E;  4RPN A;  3ISP A;  4YB6 A;  4NWD A;  4RYA A;  4F1U A;  4HTG A;  4YZZ A;  2WBD A;  5FTI A;  4ELQ A;  2VPN A;  3MP1 A;  2RF1 A;  4O3C A;  4PBQ A;  4OAN A;  1FQB A;  3T9V A;  3A3U A;  4N07 A;  1MH4 A;  3OMB A;  1KA1 A;  3E13 X;  4O3A A;  4K3F A;  1FBH A;  4H8J A;  3G3K A;  5LDZ A;  1A54 A;  4PCD A;  4N4U A;  1QKA A;  5ITP A;  5TU0 A;  5L8D A;  1DSN A;  1ATG A;  3FD3 A;  1N3X A;  5ET5 A;  5I2K A;  4H6D A;  4KD5 A;  5DYH A;  2OLB A;  5A5X A;  1MQH A;  4KFQ A;  1SYI A;  3MC2 A;  2QSX A;  4H1X A;  4NG7 A;  4KYD A;  3KOS A;  2RCB A;  1MQI A;  3IOR A;  1M5F A;  1MDP 1;  4MJO A;  3IB2 A;  3SKP A;  1SI0 A;  4XEQ A;  1II5 A;  1LBB A;  1ZBM A;  3QUF A;  1B3E A;  4R74 A;  1LCT A;  3G3G A;  3O6I A;  2L5V A;  1I6A A;  5DTB A;  3O29 A;  3DP8 A;  3K01 A;  4WEP A;  4HE2 A;  1B7Z A;  1MY0 A;  2QMX A;  4RY1 A;  1N04 A;  4YU0 A;  1B3G A;  2ZZW A;  3CFZ A;  3SER A;  3VXC A;  1WVJ A;  2DWA A;  4ZZA A;  5IZ3 A;  3OEK A;  3CR9 A;  5I58 A;  3PMX A;  2H99 A;  2XXY A;  1IZ1 A;  3W9V A;  1YTV A;  3G3J A;  3TTK A;  4G68 C;  4LP2 B;  4MEV A;  2PT1 A;  3U92 A;  1NFT A;  2CEX A;  3PTY A;  3EF7 A;  4H67 A;  2A5T A;  3N6U A;  4YKK A;  2LAO A;  3O6H A;  3TPA A;  3FXQ A;  1NH7 A;  3SEU A;  3TUS A;  3O9P A;  1Y20 A;  2M8C A;  5CMK A;  1NV2 A;  1NV5 A;  4XIG Q;  4YB5 A;  4LZ5 A;  2QVR A;  3EHT A;  2A5S A;  4AB5 A;  1FTK A;  1NNF A;  4OVP A;  1S9T A;  5IKB A;  3R6U A;  3VE1 B;  2F7C A;  4MLQ A;  5K2X A;  1CNQ A;  4FOR A;  1B5H A;  4P56 A;  4RJZ A;  3PPP A;  4WKM A;  5J16 A;  1I69 A;  1LAF E;  2Y7K A;  4EXL A;  4F3B A;  2I0C A;  4GBV A;  1RDZ A;  1FTL A;  3NOH A;  1YAE A;  1MXU A;  3UGW A;  4P0I A;  3L6H A;  4JDF A;  4ZEC A;  1GTK A;  2Y7I A;  4KYE A;  4PFU A;  5IZ3 B;  2DWH A;  1ANF A;  4P47 A;  3O2A A;  4PF8 A;  3IB0 A;  5AA4 A;  4DXC A;  1B2H A;  1AWB A;  2QVV A;  4LQ5 A;  1GGG A;  3MZ9 A;  4YMA A;  2A5T B;  3I6V A;  3KGC A;  4OVJ A;  2V93 A;  3MPL A;  1QUL A;  4IO7 A;  2PBW A;  3K00 A;  4RPO A;  4EF1 A;  3O66 A;  1UIU A;  3VDF A;  4O7M A;  4OES A;  4R6K A;  2PYY A;  1YYZ A;  3TKD A;  4NQ8 A;  5H8Q A;  4DI4 B;  4GD5 A;  4O3B A;  1OMP A;  2WBB A;  1FQE A;  2XXX A;  2PFZ A;  3D4G A;  3DP6 A;  5CI5 A;  4I3E A;  2H98 A;  1OIB A;  1XT8 A;  2ONK E;  3DLN A;  1Q1K A;  4F1Y A;  4H8I A;  2HHM A;  3MWB A;  4OVT A;  1B3L A;  5IZ1 A;  1LLS A;  2XXQ A;  1FJ9 A;  4L17 A;  1MPD A;  4OTE A;  3T9X B;  4XKN A;  1LGB C;  3R26 A;  5F1Q A;  3H06 B;  1B51 A;  4U21 A;  2Y5L A;  3C34 A;  4F31 B;  4DE8 A;  1B3H A;  1Q35 A;  5DEX A;  2G93 A;  3C36 A;  3LSF B;  3HHF A;  4OFL A;  3TCH A;  1B40 A;  5ICQ A;  2ZYK A;  3ZKL A;  3FV1 A;  3MP8 A;  5JTY B;  3RUM A;  1MM6 A;  1ZKB A;  2ZXT A;  4X04 A;  1FBP A;  1MPB A;  4N17 A;  4U1O A;  3KN3 A;  5EQ8 A;  4RK9 A;  4WXJ A;  1IXH A;  1R9L A;  4OVS A;  5I57 A;  4P8B A;  4YIC A;  4XKR A;  1ZTY A;  4P0G A;  4R73 A;  3RTF B;  2V4C A;  4AS5 A;  1PEB A;  3MP6 A;  5I56 A;  1BTJ A;  3I3V A;  3GXA A;  2G29 A;  4QSE A;  1SI1 A;  4BDO A;  3D4C A;  1DMB A;  1IUD A;  1HSL A;  3FGS A;  3IJX B;  3QAX A;  2VT5 A;  3KSJ A;  1MXV A;  4PC9 A;  1RYO A;  2AL5 A;  3ECR A;  2BJJ X;  1MY2 A;  1LB8 A;  3TCF A;  2IA4 A;  2FIX A;  4PFI A;  3UP9 A;  4N6P A;  3SDF A;  3PPO A;  5L9M A;  2OCU A;  3H6W A;  4LN5 A;  4UA8 A;  1DOT A;  3IFC A;  2Q88 A;  4FE8 A;  5H8S A;  4Q8R A;  2Q2C A;  4F29 A;  3VFJ A;  3GBA A;  5DT6 A;  5CBS A;  2ZNU A;  5AA2 B;  3SEY A;  3ROJ A;  1O64 A;  3LUY A;  2UVG A;  5TPA B;  2O1M A;  3ILT B;  4BDR A;  1EZO A;  1OQG A;  1YXI A;  2Z22 A;  2Y7R A;  3H7M A;  3T66 A;  1B6H A;  1IXC A;  4MFI A;  3UOR A;  4AB6 A;  1EZP A;  4DI3 D;  4XF5 A;  3IOT A;  3F11 A;  4P1E A;  3G3I A;  2E1S A;  3T1B A;  3BBR A;  3P7I A;  2X26 A;  4O94 A;  4IO5 A;  1LBZ A;  2UVI A;  4FBP A;  4I62 A;  4FIM A;  2H25 A;  1URD A;  1IXG A;  4NX1 A;  4GWY A;  1B7U A;  1OVT A;  3N26 A;  3K6U A;  3MVX A;  2ZNS A;  4NF0 A;  5ET6 A;  1FBC A;  5AA1 A;  2WYP A;  2B3F A;  4JXI A;  2NVU B;  3CFL A;  4U2R A;  2DXR A;  1SW1 A;  2UVH A;  2XWO A;  2Q74 A;  4AQ4 A;  3TEL A;  2Z8D A;  2F5X A;  3RPL B;  4RK2 A;  4GLI A;  3VV5 A;  1DPP A;  1FBF A;  3TZA A;  4QFO A;  2F3B A;  1LST A;  3CI8 A;  2QVU A;  4IO2 A;  5BUU A;  5FTH A;  5CMB A;  4ELO A;  3FAT A;  1B58 A;  3IOW A;  4QFK A;  3ZKK A;  2NOO A;  3UN6 A;  3RY3 A;  1LFG A;  4RA1 A;  4GFR A;  5KZT A;  3IL1 B;  3A09 A;  3AXF A;  1FPL A;  1FPI A;  3RPL A;  1UIV A;  2ZYM A;  2GFE A;  3RQT A;  4U1Z A;  1FW0 A;  1JQF A;  3ZS6 A;  4HXV A;  1RKM A;  4XFE A;  1Q9D A;  2I48 A;  3KJ7 A;  3KFM A;  5H8F A;  4BDM A;  3RT8 A;  4AS4 A;  3Q29 A;  2FVZ A;  4IO6 A;  2XWI A;  3CG3 A;  3Q28 A;  1NL5 A;  4PDH A;  3OO6 A;  2Y84 A;  2D3I A;  2FNC A;  3E78 A;  2NUV A;  2VD2 A;  2O7U A;  2O6A A;  1IMF A;  2D5W A;  1YZ0 A;  4OHN A;  1LB9 A;  2F34 A;  4JWX A;  5LTC A;  4I40 A;  4ZEB A;  2O51 A;  5ELV A;  2F3D A;  3CIJ A;  5JEI A;  2QRY A;  3RLF E;  4EXK A;  4X48 A;  1UTH B;  4TLM B;  2VGQ A;  2REJ A;  2NWJ A;  4F3G A;  4PFW A;  2DVC A;  4NF4 B;  4IB2 A;  4EF2 A;  1EYI A;  4KI0 E;  5TPA A;  4G2Z A;  1J1N A;  1VDW A;  4MF3 A;  1FPF A;  3S9M C;  3E79 A;  2HXR A;  2X7P A;  3CSB A;  2ZZV A;  3TTL A;  1INP A;  3W9W A;  3MVY A;  5FHN A;  3M3L A;  3MBP A;  2R71 A;  3FJG A;  2PT2 A;  2XXU A;  2F78 A;  1US4 A;  3LSX A;  1L5T A;  4GX3 A;  2HQ0 A;  4LVQ A;  1D9Y A;  3V8X B;  2RCA A;  5F7V A;  4FEC A;  4MNI A;  3IOV A;  2Z23 A;  3T22 A;  3H3G A;  4PFR A;  4PBH A;  1OQH A;  1POY 1;  3K1P A;  2AIX A;  4GX6 A;  5HM4 B;  3KEI A;  5DW8 A;  3MQ9 A;  4Z7E A;  3IR1 A;  1FPE A;  2CZL A;  1NUY A;  1NV1 A;  4GX4 A;  3I5O A;  2E0S A;  1IIT A;  1NI9 A;  2P0S A;  3KC0 A;  3VLW A;  5I56 B;  3TQL A;  4G77 A;  1TFA A;  4LZ7 A;  4H45 A;  4NWC A;  3T96 B;  1NV4 A;  1SDX A;  4EQ9 A;  3GZG A;  5LOM A;  2DE4 A;  3TMG A;  4QSC A;  5CMC A;  3JYR A;  4GWS A;  4BDQ A;  1B5I A;  4OER A;  1SQY A;  4DZ1 A;  2Z8E A;  3KG2 A;  1B0H A;  2I4C A;  3FAS A;  3HO7 A;  3RYD A;  3PGF A;  4GWZ A;  4G68 B;  2FIE A;  1URS A;  4YKI A;  5BWJ A;  4N6K A;  4N8G A;  2MKZ A;  1N7W A;  4FEB A;  4JBZ A;  3S9L C;  2B65 A;  1NUW A;  4ELP A;  1MRP A;  3N94 A;  1FQD A;  1T0K A;  3KOT A;  3MVZ A;  2F35 A;  1AH5 A;  5B70 A;  1VSO A;  4PE5 B;  4JVD A;  3OO9 A;  1Y3Q A;  4OEU A;  4MCO A;  4X1D A;  4KXP A;  1BIY A;  3OEL A;  3M8U A;  4P9K A;  5KCJ B;  2UYE A;  2XD2 A;  1MY1 A;  3HFU A;  3S9N C;  2Q8J A;  1B05 A;  4DIG A;  4N6D A;  3MZ1 A;  4E0W A;  2R8T A;  1XVY A;  2AL4 A;  4MBP A;  4I8C A;  4GXA A;  1EH3 A;  4F22 A;  2ONR A;  3S2V A;  4TOZ A;  1FTA A;  3TOD A;  4PAI A;  4GWW A;  4HCW A;  4OFO A;  2O69 A;  2WX9 A;  1MDQ A;  3CHG A;  1A7L A;  1KZ8 A;  1TFD A;  4TQU Q;  5ITO A;  3BFT A;  4R9G A;  1LBX A;  4X8R A;  3R7X A;  2O1L A;  1MY4 A;  4QHQ A;  1MQD A;  5CM6 A;  2XXP A;  5L9S A;  2JJK A;  2HAV A;  1B1X A;  4HE0 A;  2XXH A;  3PUW E;  4GIZ A;  2UXA A;  4I1D A;  4DCX A;  4LA9 A;  1H76 A;  4ZS9 A;  1B3F A;  1POT A;  2XX8 A;  1IME A;  2DYX A;  4DCY A;  1G0H A;  5M2V A;  3CRB A;  5EHM A;  2I0B A;  3IOU A;  3OO8 A;  2RKM A;  1JW4 A;  5T3J A;  4X1B A;  5A5L A;  1VFD A;  2GQ1 A;  3GLB A;  3IO6 A;  4MNC A;  4OYV A;  4ZDM A;  3EKI A;  2VOZ A;  5H8Q B;  3L6G A;  4JVI A;  2F6G A;  1B46 A;  1IMC A;  4R75 A;  2CZI A;  4YMB A;  1MXZ A;  3QIM A;  1PB8 A;  2QS3 A;  2Y7W A;  1B9J A;  3TEP A;  1SVX B;  4PF6 A;  4MLV A;  5IAI A;  2XX7 A;  2ZZX A;  3U94 A;  3SET A;  3W15 C;  1FQF A;  3KJT A;  3M3F A;  1PBP A;  3FVK A;  4MH5 A;  3ILU B;  1MQG A;  2I3V A;  3ODB A;  1JNF A;  1NKX A;  3FXB A;  2DXY A;  3O6G A;  3PPN A;  1QGX A;  4NF8 A;  1JW5 A;  4N13 A;  2YLN A;  2F97 A;  4DDD A;  1EYK A;  1DK4 A;  4Q5T A;  4ZEK A;  5TP9 A;  4H46 A;  5I59 B;  5EYF A;  2I58 A;  1IMD A;  3IX1 A;  1A8E A;  4OMB A;  3IFA A;  3QXM A;  2HFB A;  3U93 A;  1NNP A;  4P11 A;  2Q8M A;  2VD3 A;  3PD9 A;  2VHA A;  2AYS A;  5I58 B;  2P2A A;  3N6T A;  3IJO B;  1XHY A;  3BIH A;  3G3H A;  4NMY A;  1H45 A;  3PD8 A;  1B0L A;  1MQJ A;  3U8Q A;  4PE3 A;  4QF9 A;  4MAG A;  2DOJ A;  2V3T A;  3N5L A;  4ZE8 A;  4EQB A;  2XXV A;  2B3B A;  3O97 A;  4GF8 A;  2OK2 A;  2Y5K A;  4LUB A;  1Y1M A;  1ELJ A;  1FQA A;  4KPT A;  2ZYO A;  4MIJ A;  4N15 A;  4OEN A;  4NED A;  3ZSF A;  1A8F A;  3KN8 A;  4BLA A;  1SW4 A;  4U4S A;  4EQ7 A;  1AIV A;  5FHO A;  1XS5 A;  1EYJ A;  1N7X A;  4PTK A;  1Z7M E;  2KLF A;  5I2N B;  4MX6 A;  3VLV A;  4POX A;  4R6H A;  1NV0 A;  1HSE A;  1P1O A;  4LZ8 A;  3B6W A;  3FBP A;  4MNP A;  3DP4 A;  1NV7 A;  2V25 A;  4QRZ A;  1NNK A;  1D9V A;  3V83 A;  3HV1 A;  5IZZ A;  1Z7N E;  4F18 A;  5CBR A;  2XXT A;  3V89 B;  2PCR A;  2HCA A;  4EDP A;  2R6G E;  2DS9 A;  4G68 A;  1USY H;  1JEU A;  2RC7 A;  2REG A;  4ELR A;  4I9D A;  3C31 A;  1UTB B;  4GL8 A;  1HSJ A;  4IY5 A;  1XOC A;  5KDT A;  2ALU A;  2ZYN A;  1Y3P A;  2XXI A;  3IK6 B;  3TAJ A;  1FPD A;  3MZB A;  4OZ9 A;  3VLU A;  4NTL A;  5I3S A;  4QFL A;  3FVG A;  5KCJ A;  3FVN A;  3MST A;  1B52 A;  4R2B A;  3OXN A;  2HAU A;  5AE4 A;  4R72 A;  1NH8 A;  3CFX A;  2XHD A;  4U22 A;  2ANJ A;  4F39 A;  3B8B A;  4RXL A;  3UA8 A;  1Y3N A;  3KBZ A;  3LSL A;  1UTH A;  2F7B A;  1I6B A;  2DDK A;  4MHF A;  1DTG A;  1B7H A;  2P3N A;  4OXV A;  2HXW A;  1IIW A;  2ZMB A;  2VP1 A;  2QS4 A;  1BK4 A;  2RC9 A;  3K4U A;  1USY E;  3V5A A;  3OD7 A;  4NAP A;  2H9B A;  2XWV A;  4PFB A;  4ISU A;  2ONS A;  4GOT A;  4YAH X;  1M5B A;  4EUO A;  1QUI A;  4P1L A;  4XXU A;  4NGU A;  4F19 A;  3SZP A;  3LC8 A;  1US5 A;  5AA2 D;  2B4L A;  4RNS A;  2ZNT A;  1EU8 A;  5AA4 B;  4U4X A;  2F6P A;  2XD3 A;  3C33 A;  4QFN A;  1LFI A;  4G8H A;  2Q89 A;  3C4M A;  2I6E A;  3MAM A;  4DLD A;  1O7T A;  3T0J A;  1Y1Z A;  1DCU A;  2HZL A;  1R1N A;  1MPC A;  3U1O A;  3Q25 A;  3OEN A;  1JET A;  2DWJ A;  3MPK A;  4KCD A;  3WAE A;  5HBC A;  1IQ7 A;  1R9Q A;  1MS7 A;  1FBG A;  4FAT A;  2FYI A;  3RT6 B;  1CE2 A;  3QK6 A;  3S9E A;  3PMW A;  3OSQ A;  2XXK A;  1FRP A;  5EHS A;  3HPI A;  4G4P A;  4IR8 A;  1EZ9 A;  2DP8 A;  3PMV A;  1IMA A;  1PB7 A;  4H5F A;  4DXB A;  4PGP A;  4GWU A;  2W7Y A;  1IXI A;  4O8M A;  3BFU A;  3KZG A;  5I59 A;  1LBC A;  3SES A;  4GVO A;  4O7I A;  5H8N B;  1LAX A;  2DE3 A;  3HN0 A;  1QVS A;  3RPW A;  3ONM A;  3USD A;  3TDJ A;  1FTM A;  4JB7 A;  3T9H B;  5EYH A;  3G7W A;  3E3K A;  3O28 A;  1B32 A;  4C1U A;  2ESN A;  3SEX A;  4KHZ E;  4IY6 A;  3OEM A;  4G8M A;  3IB1 A;  2UYF A;  4KCC A;  4ZEI A;  1D9Q A;  3E4R A;  3KC1 A;  1SYH A;  4H0W A;  3HCQ A;  3JV9 A;  1VR5 A;  3GYY A;  1UQW A;  4Q0C A;  1JEV A;  2OX3 A;  3HHG A;  3RTW B;  2QJE A;  1MXY A;  3EHS A;  4GWO A;  1NV6 A;  3G3F A;  5H8F B;  4YB7 A;  2QPQ A;  2QS1 A;  2GHA A;  5AA2 A;  2OWT A;  1K9Z A;  3FUZ A;  3K0V A;  1KA0 A;  1JVX A;  2F36 A;  3MVW A;  1M5E A;  4IGT A;  1H43 A;  3K02 A;  1PC3 A;  4PDD A;  1BP5 A;  1FPJ A;  2PVU A;  3SEW A;  4LAT A;  1LFH A;  2XWK A;  2WYK A;  1PDA A;  1RYX A;  4XKQ A;  1P1N A;  2F8D A;  1FPK A;  3RNN A;  3GBB A;  1I6Q A;  4BDL A;  2OBG A;  4I3Y A;  1FTJ A;  2H4I A;  4XTC Q;  3OO7 A;  1R6Z A;  2CZH A;  1CB6 A;  2QFL A;  1TXF A;  3PUZ E;  3THI A;  1B5J A;  3FXR A;  2FBP A;  2QL3 A;  1ZLQ A;  1GVC A;  1QJM A;  2NXO A;  1VE4 A;  1JP4 A;  3Q27 A;  4QXD A;  1TWY A;  1MH3 A;  3PPR A;  3OOA A;  4C1T A;  1F9B A;  4UAC A;  3EPE A;  3H6T A;  5A5X B;  5EQ9 A;  3LUZ A;  4FAJ A;  2PX1 A;  2H5Y A;  4NF5 A;  4M4G A;  3KN7 A;  3LSW A;  3FJM A;  1B1H A;  3DEL B;  4FED A;  3EN3 A;  1XVX A;  3VVE A;  2DQV A;  1LBW A;  4G8N A;  3B6T A;  4H5G A;  1VFE A;  1MY3 A;  2WEF A;  2Q9T A;  1FPB A;  2Y7P A;  2PFY A;  2FA7 A;  3U65 A;  4U23 A;  5EQA A;  3K6W A;  1SW2 A;  4LON B;  1Y4T A;  1RDX A;  5I2N A;  5ET7 A;  3E9X A;  1FPG A;  3KBR A;  3FV2 A;  4GWX A;  3FVO A;  1PB9 A;  1DTZ A;  1N84 A;  1UTB A;  3TTM A;  3CG1 A;  1G0I A;  2QMW A;  4NF4 A;  1FJ6 A;  1ZIU A;  3QYT A;  3EQ1 A;  2B4M A;  2Z8F A;  1LEV A;  1D3K A;  4F1V A;  1DPE A;  1N3W A;  2BJI A;  1WOD A;  3TTR A;  2GHB A;  3UIF A;  1AOV A;  1A55 A;  4PET A;  1P1U A;  1SBP A;  1FQC A;  1M5C A;  2D21 A;  1GV8 A;  3M3K A;  2XXR A;  2RC8 A;  4FJP A;  1P1W A;  2YJP A;  4QSD A;  4IGR A;  4LQ2 A;  3T9U A;  2O84 X;  3TCG A;  3EHU A;  3TQW A;  1QUK A;  3VXB A;  1XC1 A;  5ESY A;  1QKB A;  1TT1 A;  3K6X A;  3MJN A;  1OVB A;  4F2O A;  3DM0 A;  2OWZ A;  3QUJ A;  4HCY A;  3B6Q A;  3UK4 A;  3KSX A;  3HST A;  3TTN A;  4HW8 A;  4UAB A;  4YKJ A;  1K9Y A;  4Q30 B;  1FTO A;  2XA5 A;  1Y9U A;  4R9F A;  1FCK A;  3H6V A;  3A29 A;  3K6V A;  4H65 A;  1LAG E;  2GRV A;  4PP0 A;  4GRK A;  2KR0 A;  5H8H A;  4F3P A;  4NE4 A;  4XKP A;  1BKA A;  5EQ7 A;  2ABH A;  5K2Y A;  3T93 B;  5IGA A;  1Y4C A;  1NUZ A;  4GL0 A;  2FHY A;  4PGN A;  5HPQ A;  1MG1 A;  5J1D A;  1IEJ A;  2CZK A;  1YPN A;  4OVQ A;  4BDN A;  2O68 A;  2QS2 A;  3IAZ A;  4NN3 A;  4PFY A;  4OWD A;  4E0X A;  3U72 A;  3RGY A;  1B4Z A;  4OVR A;  1NMU A;  1SPI A;  1O63 A;  4PAF A;  3VVF A;  1OLA A;  2DSF A; 
#chains in the Genus database with same CATH homology
 2I0C A;  2RC9 A;  3MVY A;  1QW0 A;  1FTL A;  5FHN A;  3M3L A;  1YAE A;  3K4U A;  1USY E;  4JSO A;  1MM7 A;  3MBP A;  1MXU A;  3OD7 A;  3UGW A;  2R71 A;  3V5A A;  2H9B A;  2IEE A;  3BKI B;  2PT2 A;  3FJG A;  3L6H A;  2XXU A;  4JDF A;  2F78 A;  4NF6 A;  4P0I A;  1US4 A;  1GTK A;  3H6U A;  2I49 A;  2Y7I A;  4KYE A;  4PFU A;  3LSX A;  4ISU A;  1L5T A;  2ONS A;  4AB6 A;  2OWS A;  3A3C A;  2DWH A;  1ANF A;  2DWI A;  3O2A A;  4GOT A;  1M5B A;  4YAH X;  3K1N A;  3IB0 A;  5AA4 A;  4DXC A;  4EUO A;  2HQ0 A;  4LVQ A;  1D9Y A;  1QUI A;  1S7Y A;  3LBS A;  4QFP A;  1B2H A;  2RCA A;  3V8X B;  5F7V A;  4FEC A;  4XXU A;  3CSG A;  3FIR A;  4JWO A;  4LQ5 A;  4F19 A;  1GGG A;  2F7A A;  3IOV A;  3MZ9 A;  1D4N A;  1WDN A;  3LC8 A;  4YMA A;  1US5 A;  2Z23 A;  2A5T B;  3T22 A;  1SD3 A;  4BLA A;  3I6V A;  2V3Q A;  5AA2 D;  2UVJ A;  3H3G A;  5CRY A;  3KGC A;  4RNS A;  4OVJ A;  2V93 A;  2ZNT A;  3MPL A;  2VP1 A;  1EU8 A;  5AA4 B;  1OQH A;  1QUL A;  4U4X A;  1POY 1;  3K1P A;  2AIX A;  2F6P A;  2XD3 A;  4IO7 A;  2HEU A;  3C33 A;  3C32 A;  4QFN A;  5HM4 B;  4NF5 B;  3KEI A;  1LFI A;  2PBW A;  3K00 A;  4G8H A;  4R6Y A;  2Q89 A;  4RPO A;  3MQ9 A;  3C4M A;  1AMF A;  2I6E A;  4C1T A;  3MAM A;  4EF1 A;  3O66 A;  4DLD A;  4Z7E A;  1O7T A;  4IO3 A;  3IR1 A;  1N0T A;  1SW5 A;  1UIU A;  2CZL A;  3VDF A;  3WAF A;  3I5O A;  1Y1Z A;  2E0S A;  5CBR A;  1IIT A;  4WED A;  5DVI A;  1P1Q A;  2P0S A;  2HZL A;  2CMO A;  4OES A;  5CC2 A;  3VLW A;  5I56 B;  4R6K A;  3TQL A;  2PYY A;  4G77 A;  1R1N A;  1MPC A;  1TFA A;  3U1O A;  4LZ7 A;  3LR1 A;  3TKD A;  3Q25 A;  3OEN A;  4NWC A;  3T96 B;  3PU5 A;  1SDX A;  1JET A;  5H8Q A;  2DWJ A;  4GD5 A;  4EQ9 A;  3GZG A;  5LOM A;  1LAH E;  4O3B A;  3MPK A;  1OMP A;  2DE4 A;  4KCD A;  4QSC A;  3TMG A;  1MXW A;  5CMC A;  1H3D A;  4PQJ A;  1FQE A;  3WAE A;  5HBC A;  1IQ7 A;  3JYR A;  1R9Q A;  1MS7 A;  4BDQ A;  2V84 A;  1B5I A;  2XXX A;  3C9H A;  5TP9 B;  4FAT A;  4OER A;  1SQY A;  4DZ1 A;  5ICT A;  3D4G A;  3OSR A;  2FYI A;  2Z8E A;  3DP6 A;  3KG2 A;  3RT6 B;  5CI5 A;  1CE2 A;  1S50 A;  4DXU A;  3QK6 A;  3S9E A;  1B0H A;  2I4C A;  3FAS A;  3PMW A;  2DE2 A;  2H98 A;  3CVG A;  3HO7 A;  3PPQ A;  3PGF A;  4JWY A;  3OSQ A;  4G68 B;  1OIB A;  1A99 A;  1A40 A;  1URS A;  1XT8 A;  5EHS A;  3HPI A;  3IO4 A;  4ZEF A;  2ONK E;  3DLN A;  4YKI A;  3K1M A;  4C0R A;  5BWJ A;  1Q1K A;  4G4P A;  4F1Y A;  1EZ9 A;  2DP8 A;  3QSL A;  4H8I A;  4ZED A;  3PMV A;  1N7W A;  1PB7 A;  4H5F A;  3MWB A;  2XXW A;  4FEB A;  1B3L A;  4JBZ A;  5JK4 A;  3S9L C;  4DXB A;  1LLS A;  2B65 A;  2XXQ A;  4ELP A;  1MRP A;  2GH9 A;  3H4Z A;  4L17 A;  1MPD A;  5H8N A;  1ZMG A;  4THI A;  4OTE A;  1M5D A;  1OLC A;  4KYS A;  3T9X B;  3N94 A;  1FQD A;  4KR5 A;  4XKN A;  2W7Y A;  1LGB C;  2THI A;  3KOT A;  3R26 A;  1T0K A;  3MVZ A;  1IXI A;  5F1Q A;  3H06 B;  1B51 A;  2F35 A;  1AH5 A;  4U21 A;  3BFU A;  3VVD A;  3KZG A;  3C34 A;  4YKP A;  4F2Q A;  4F31 B;  5B70 A;  5I59 A;  1VSO A;  3PUV E;  4PE5 B;  1LBC A;  1H44 A;  5I2K B;  4DE8 A;  3OO9 A;  3SES A;  1Y3Q A;  4OEU A;  1B3H A;  1Q35 A;  3MW0 A;  2G93 A;  4GVO A;  4PFT A;  4X1D A;  2I4B A;  2YPN A;  5DEX A;  5H8N B;  3C36 A;  5L9O A;  1LAX A;  2DE3 A;  3LSF B;  1BIY A;  3HN0 A;  3M8U A;  3HHF A;  1QVS A;  3OEL A;  5KCJ B;  3RPW A;  2UYE A;  3ONM A;  4OFL A;  1B40 A;  3TCH A;  3USD A;  2X7Q A;  5ICQ A;  2PMS A;  2ZYK A;  3TDJ A;  4KQP A;  1FTM A;  4JB7 A;  2XD2 A;  3PV0 E;  3T9H B;  1MY1 A;  3S9N C;  1MXX A;  2Q8J A;  3TYH A;  3ZKL A;  4ZE9 A;  5ISU A;  3G7W A;  1B05 A;  3E3K A;  4NF8 B;  5CMM A;  4DIG A;  3FZV A;  3O28 A;  3FV1 A;  3MP8 A;  5JTY B;  1B32 A;  3RUM A;  1MM6 A;  1ZKB A;  5DVF A;  3MZ1 A;  4E0W A;  1PBQ A;  1XVY A;  2AL4 A;  2ZXT A;  1MPB A;  4C1U A;  4MBP A;  2ESN A;  4ESW A;  4I8C A;  4GXA A;  1EH3 A;  3SEX A;  2ONR A;  3JZJ A;  3FXU A;  3S2V A;  4TOZ A;  4U1O A;  4KHZ E;  3TFL A;  3TOD A;  5I57 B;  4IY6 A;  3KN3 A;  2XX9 A;  3OEM A;  4G8M A;  4HCW A;  4OFO A;  2O69 A;  4RK9 A;  3IB1 A;  4WXJ A;  1IXH A;  2UYF A;  4KCC A;  1MDQ A;  4ZEI A;  5JTY A;  1JVY A;  4R2F A;  2I3W A;  3E4R A;  1A7L A;  4GQO A;  4Z0I A;  1R9L A;  1SYH A;  1TFD A;  4H0W A;  4TQU Q;  3HCQ A;  1JW1 A;  3JV9 A;  2WKY A;  4NF6 B;  5ITO A;  1VR5 A;  1YCJ A;  3BFT A;  4R9G A;  1UQW A;  3R7X A;  5I57 A;  4Q0C A;  1JEV A;  2O1L A;  1MY4 A;  4QHQ A;  5AA3 A;  4OQO A;  3HHG A;  3H03 A;  4IO4 A;  4YIC A;  4XKR A;  5DEX B;  1ZTY A;  4P0G A;  4R73 A;  1MQD A;  3RTF B;  3RTW B;  5CM6 A;  1QUJ A;  1MXY A;  2QJE A;  3EHS A;  4GWO A;  1PEB A;  1KWH A;  2XXP A;  3G3F A;  3MP6 A;  3S4U A;  5H8F B;  5L9S A;  5I56 A;  1BTJ A;  2HAV A;  1B1X A;  3I3V A;  4F3S A;  2XXH A;  3PUW E;  4GIZ A;  4YB7 A;  2UXA A;  3GXA A;  4I1D A;  2QPQ A;  2G29 A;  4QSE A;  4DCX A;  4ONY A;  4LA9 A;  1H76 A;  4ZS9 A;  2QS1 A;  1GR2 A;  3Q26 A;  1SI1 A;  4ECF A;  5DVJ A;  2GHA A;  4BDO A;  3U93 A;  1N76 A;  3D4C A;  5AA2 A;  2OWT A;  1B3F A;  4ZZE A;  1DMB A;  2R9J A;  1IUD A;  3K2D A;  1POT A;  1URG A;  2XX8 A;  3FUZ A;  4M1V A;  1HSL A;  3K0V A;  4HS7 A;  3FGS A;  4GXS B;  3IJX B;  3QAX A;  1BLF A;  2DYX A;  5EHM A;  4DCY A;  1JVX A;  5M2V A;  2O7I A;  3CRB A;  2I0B A;  2F36 A;  3IOU A;  3MVW A;  1M5E A;  2RKM A;  1H43 A;  3K02 A;  3KSJ A;  3OO8 A;  1AL3 A;  4IGT A;  1JW4 A;  1PC3 A;  1LCF A;  3C35 A;  1MXV A;  1BP5 A;  4X1B A;  1B4H A;  5FHM A;  1VFD A;  2PVU A;  2DVZ A;  3GLB A;  3SEW A;  4LAT A;  1LFH A;  1P99 A;  2OJT A;  1RYO A;  3IO6 A;  1PDA A;  1RYX A;  4XKQ A;  5KDT B;  2AL5 A;  3RN8 A;  3ECR A;  5I84 A;  2BJJ X;  1MY2 A;  1LB8 A;  3B7D A;  4OYV A;  3TCF A;  5H8H B;  1P1N A;  2F8D A;  2IA4 A;  3RNN A;  4ZDM A;  3GBB A;  3UP9 A;  1NNT A;  2VOZ A;  1I6Q A;  2V3U A;  3L6G A;  5H8Q B;  4POW A;  4N6P A;  3SDF A;  2F6G A;  1B46 A;  4BDL A;  1ZU0 A;  2OBG A;  3PPO A;  4R75 A;  5L9M A;  1FTJ A;  4YMB A;  2OCU A;  1MXZ A;  3QIM A;  3H6W A;  1PB8 A;  2QS3 A;  4OFJ A;  1ZJL A;  2Y7W A;  4UA8 A;  1DOT A;  1B9J A;  2RIN A;  4JSD A;  2H4I A;  2Q88 A;  4OET A;  4XTC Q;  3OO7 A;  4FE8 A;  3TEP A;  1SVX B;  2Q2A A;  4ND9 A;  4MLV A;  2Q2C A;  4OEV A;  5H8S A;  4Q8R A;  1R6Z A;  5IAI A;  2XX7 A;  3U94 A;  1CB6 A;  2P1S A;  2OZZ A;  1TXF A;  3SET A;  3PUZ E;  4F29 A;  3THI A;  1FQF A;  3W15 C;  3VFJ A;  4ESX A;  3SEV A;  3FJ7 A;  4TLL B;  3GBA A;  5DT6 A;  5CBS A;  2ZNU A;  1B5J A;  3PUX E;  5AA2 B;  4X9T A;  3FXR A;  3SEY A;  1O64 A;  3KJT A;  3M3F A;  1PBP A;  3LUY A;  2QL3 A;  1ZLQ A;  2UVG A;  3FVK A;  4MH5 A;  5TPA B;  1GVC A;  2HZK A;  2O1M A;  1MQG A;  1QJM A;  2NXO A;  3ILU B;  3ILT B;  1VE4 A;  3MUQ A;  1OQG A;  4BDR A;  2I3V A;  2Z22 A;  5B7D A;  2Y7R A;  3ODB A;  3PUY E;  1JNF A;  3H7M A;  1NKX A;  3Q27 A;  1B6H A;  3T66 A;  4RPN A;  2DXY A;  4YB6 A;  1TWY A;  1MH3 A;  3PPR A;  4NWD A;  4RYA A;  4F1U A;  3O6G A;  1IXC A;  3OOA A;  3PPN A;  4MFI A;  4NF8 A;  3UOR A;  4HTG A;  4YZZ A;  1F9B A;  4UAC A;  3EPE A;  1JW5 A;  3H6T A;  5FTI A;  4ELQ A;  3MP1 A;  3IOT A;  4N13 A;  3F11 A;  2YLN A;  5A5X B;  2RF1 A;  2F97 A;  3G3I A;  4DDD A;  2PX1 A;  2H5Y A;  4FAJ A;  2E1S A;  4NF5 A;  3BBR A;  4Q5T A;  3P7I A;  4ZEK A;  5TP9 A;  4O3C A;  4M4G A;  2X26 A;  3KN7 A;  3LSW A;  4IO5 A;  5EYF A;  2I58 A;  1FQB A;  2UVI A;  3FJM A;  4I62 A;  3T9V A;  1B1H A;  3A3U A;  3DEL B;  3IX1 A;  3EN3 A;  1MH4 A;  4FED A;  3OMB A;  1XVX A;  4FIM A;  4N07 A;  1A8E A;  1URD A;  2H25 A;  1IXG A;  3E13 X;  4OMB A;  3QXM A;  4O3A A;  4K3F A;  2HFB A;  3VVE A;  1B7U A;  4H8J A;  2DQV A;  1NNP A;  1OVT A;  3G3K A;  3N26 A;  4P11 A;  3K6U A;  3MVX A;  2ZNS A;  4G8N A;  3B6T A;  4H5G A;  2VD3 A;  3PD9 A;  1VFE A;  1MY3 A;  2AYS A;  2VHA A;  1A54 A;  2Q9T A;  5AA1 A;  2B3F A;  5I58 B;  2Y7P A;  4JXI A;  2P2A A;  2NVU B;  2FA7 A;  3CFL A;  3N6T A;  3IJO B;  1QKA A;  4U2R A;  1EZP A;  4U23 A;  5ITP A;  2DXR A;  1SW1 A;  2UVH A;  1XHY A;  3G3H A;  3K6W A;  4AQ4 A;  3TEL A;  4NMY A;  1SW2 A;  1H45 A;  4LON B;  2Z8D A;  5TU0 A;  1Y4T A;  5I2N A;  5L8D A;  3PD8 A;  1B0L A;  1DSN A;  3E9X A;  3KBR A;  3FV2 A;  1ATG A;  2F5X A;  3FD3 A;  1N3X A;  3FVO A;  1PB9 A;  1DTZ A;  4RK2 A;  1N84 A;  1UTB A;  5I2K A;  1MQJ A;  3TTM A;  3CG1 A;  4H6D A;  4KD5 A;  2OLB A;  5DYH A;  4GLI A;  4QF9 A;  3U8Q A;  5A5X A;  1MQH A;  4KFQ A;  2QMW A;  1SYI A;  3MC2 A;  2DOJ A;  2V3T A;  3N5L A;  2QSX A;  4NF4 A;  4H1X A;  1DPP A;  3VV5 A;  4KYD A;  1ZIU A;  3KOS A;  4ZE8 A;  2RCB A;  2XXV A;  1MQI A;  3TZA A;  4EQB A;  3IOR A;  4QFO A;  3QYT A;  3EQ1 A;  4F22 A;  2B3B A;  2Z8F A;  1LST A;  3O97 A;  3CI8 A;  4GF8 A;  2OK2 A;  1D3K A;  4F1V A;  1DPE A;  1N3W A;  1Y1M A;  1ELJ A;  4IO2 A;  4LUB A;  4ZEC A;  5BUU A;  1M5F A;  5FTH A;  1MDP 1;  1FQA A;  4KPT A;  5CMB A;  4ELO A;  3IB2 A;  1WOD A;  2ZYO A;  3FAT A;  1B58 A;  3SKP A;  1SI0 A;  4OEN A;  2GHB A;  3IOW A;  4QFK A;  3TTR A;  3UIF A;  3ZKK A;  2NOO A;  1II5 A;  1LBB A;  1AOV A;  1A55 A;  4NED A;  4PET A;  1P1U A;  1SBP A;  3ZSF A;  1A8F A;  1ZBM A;  1FQC A;  1M5C A;  3QUF A;  2D21 A;  3UN6 A;  1B3E A;  3KN8 A;  4R74 A;  1GV8 A;  1LCT A;  3G3G A;  3M3K A;  3RY3 A;  1LFG A;  1SW4 A;  2XXR A;  4RA1 A;  2RC8 A;  4U4S A;  4EQ7 A;  1AIV A;  4FJP A;  5FHO A;  1XS5 A;  4GFR A;  1N7X A;  5KZT A;  1P1W A;  3IL1 B;  3O6I A;  2YJP A;  4IGR A;  4LQ2 A;  3A09 A;  4QSD A;  1Z7M E;  2KLF A;  3AXF A;  3T9U A;  3VLV A;  5I2N B;  1EZO A;  4POX A;  1I6A A;  5DTB A;  3O29 A;  3DP8 A;  3K01 A;  1UIV A;  4WEP A;  1B7Z A;  1MY0 A;  2QMX A;  4R6H A;  2O84 X;  2ZYM A;  4RY1 A;  3TCG A;  3EHU A;  3TQW A;  1N04 A;  2GFE A;  4YU0 A;  3RQT A;  1QUK A;  1B3G A;  4U1Z A;  3VXB A;  1FW0 A;  1XC1 A;  1JQF A;  3CFZ A;  1QKB A;  3SER A;  1TT1 A;  3K6X A;  3VXC A;  3ZS6 A;  1RKM A;  1HSE A;  1P1O A;  3MJN A;  1WVJ A;  1OVB A;  4LZ8 A;  2I48 A;  4F2O A;  3DM0 A;  3KJ7 A;  3B6W A;  3KFM A;  5H8F A;  3DP4 A;  2DWA A;  4BDM A;  2V25 A;  4ZZA A;  3QUJ A;  3OEK A;  3CR9 A;  4QRZ A;  3PMX A;  3RT8 A;  1NNK A;  5I59 B;  5I58 A;  1D9V A;  2H99 A;  4HCY A;  3B6Q A;  3UK4 A;  3HV1 A;  2XXY A;  3V83 A;  1IZ1 A;  3Q29 A;  3W9V A;  1YTV A;  3G3J A;  3TTK A;  3KSX A;  3HST A;  4IO6 A;  4G68 C;  1Z7N E;  4LP2 B;  2PT1 A;  3CG3 A;  3TTN A;  4F18 A;  2XXT A;  3U92 A;  3V89 B;  4HW8 A;  1NFT A;  2HCA A;  4YKJ A;  3Q28 A;  2R6G E;  1NL5 A;  4Q30 B;  2DS9 A;  4EDP A;  3EF7 A;  2A5T A;  2D3I A;  2Y84 A;  3N6U A;  1FTO A;  1USY H;  3OO6 A;  4G68 A;  4H67 A;  1Y9U A;  2FNC A;  4YKK A;  1JEU A;  2RC7 A;  2REG A;  2NUV A;  2VD2 A;  2LAO A;  4ELR A;  4I9D A;  3C31 A;  4R9F A;  1UTB B;  2O7U A;  1FCK A;  2O6A A;  3H6V A;  3K6V A;  3O6H A;  4GL8 A;  1LAG E;  4H65 A;  3TPA A;  1HSJ A;  2GRV A;  2D5W A;  1XOC A;  4IY5 A;  2ALU A;  3FXQ A;  5KDT A;  1NH7 A;  4PP0 A;  4OHN A;  4GRK A;  5H8H A;  3SEU A;  4F3P A;  2ZYN A;  1LB9 A;  2F34 A;  4NE4 A;  3TUS A;  3O9P A;  4JWX A;  1Y3P A;  1Y20 A;  2M8C A;  4XKP A;  2XXI A;  3IK6 B;  5CMK A;  1BKA A;  3TAJ A;  4XIG Q;  4YB5 A;  4ZEB A;  2ABH A;  3MZB A;  4LZ5 A;  4OZ9 A;  5K2Y A;  3T93 B;  3VLU A;  2O51 A;  3EHT A;  2A5S A;  4NTL A;  5ELV A;  3CIJ A;  4AB5 A;  1FTK A;  5JEI A;  2QRY A;  3RLF E;  1Y4C A;  4EXK A;  4QFL A;  4GL0 A;  1NNF A;  4X48 A;  1S9T A;  5HPQ A;  3FVG A;  5KCJ A;  1UTH B;  5IKB A;  1MG1 A;  4TLM B;  3FVN A;  2VGQ A;  5J1D A;  1IEJ A;  1YPN A;  2REJ A;  2NWJ A;  1B52 A;  4R2B A;  3R6U A;  3OXN A;  3VE1 B;  4F3G A;  4PFW A;  2F7C A;  2HAU A;  2DVC A;  5AE4 A;  4MLQ A;  4R72 A;  1NH8 A;  3CFX A;  2O68 A;  2XHD A;  4BDN A;  2QS2 A;  4NF4 B;  2ANJ A;  4IB2 A;  4U22 A;  4F39 A;  4RXL A;  5K2X A;  3UA8 A;  1Y3N A;  3IAZ A;  3LSL A;  4FOR A;  4EF2 A;  1B5H A;  1UTH A;  2F7B A;  4KI0 E;  5TPA A;  4PFY A;  4OWD A;  4E0X A;  3U72 A;  4RJZ A;  1I6B A;  3PPP A;  1B4Z A;  4G2Z A;  3RGY A;  4WKM A;  1DTG A;  1B7H A;  1I69 A;  1NMU A;  1O63 A;  1LAF E;  1J1N A;  3VVF A;  4MF3 A;  1OLA A;  4OXV A;  2DSF A;  2Y7K A;  4EXL A;  3S9M C;  2HXW A;  1IIW A;  4F3B A;  2ZMB A;  2X7P A;  2QS4 A;  3CSB A;  3TTL A;  3W9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...