3TMGA

Crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
LKSVKIGYVNWGGETAATNVLKVVFEKMGYNAEIFSVTTSIMYQYLASGKIDGTVSSWVPTADKFYYEKLKTKFVDLGANYEGTIQGFVVPSYVPISSISELKGKGDKFKNKMIGIDAGAGTQIVTEQALNYYGLSKEYELVPSSESVMLASLDSSIKRNEWILVPLWKPHWAFSRYDIKFLDDPDLIMGGIESVHTLVRLGLENDDFDAYYVFDHFYWSDDLILPLMDKNDKEPGKEYRNAVEFVEKNKEIVKTWVPEKYKTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine, L-proline ABC transporter, glycine/betaine/
publication title Crystal structure of Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein (ProX) from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transport protein
total genus 98
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tmgA01
3.40.190.100 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Glycine betaine-binding periplasmic protein; domain 2 3tmgA02
1VSOA 3DLNA 1RYXA 3W9WA 1JNFA 1SW1A 5H8HA 1ZBMA 4LONB 1B3EA 1B0LA 2HFBA 4DCXA 3HHFA 1HSLA 1XHYA 3PPQA 1SD3A 3KFMA 1FTLA 2ZYKA 2Y7WA 3KGCA 2ZMBA 3T9UA 2OLBA 5L9SA 5FTIA 3MVXA 3H6TA 3MP1A 1M5FA 3G3JA 4H5FA 1FTOA 5CRYA 5KCJB 1Q1KA 1QUIA 3FV1A 2NOOA 4OERA 1LBBA 1B4ZA 1Y3QA 1VFDA 1ZKBA 5AA3A 3LSLA 3CG3A 2UVHA 1QJMA 1VE4A 1SDXA 3HN0A 1URGA 4Z7EA 4ZEBA 2HAVA 3B6TA 4H67A 3O29A 1KWHA 1QKAA 2DWHA 5H8QA 3TUSA 2RKMA 4FIMA 5HBCA 5TU0A 2BJJX 3FUZA 3H7MA 4BDRA 4I9DA 3SKPA 3QIMA 1O63A 1SYHA 2QL3A 4GF8A 1LFHA 1N84A 4XXUA 3AXFA 3IX1A 2ZNSA 1R9LA 1MXYA 3TODA 2QMXA 1WVJA 3TCFA 3VVFA 2XHDA 5I59A 1ZTYA 4QSCA 1LAGE 3IJXB 1MQGA 1LCFA 2OBGA 1QUJA 3MZ9A 4ELRA 1UQWA 2O6AA 1MQHA 3EN3A 4OWDA 4Q5TA 4ZEFA 2NXOA 3C31A 5EHSA 3TQLA 1B5HA 1M5EA 4XKNA 5H8FA 3B7DA 1B3LA 4LZ8A 3C9HA 2FNCA 3MP6A 5I2KB 1NKXA 4OFLA 1MXUA 4NF8A 1SW2A 4OFJA 1O64A 4U4SA 3KN8A 3H4ZA 4NEDA 4YZZA 2I48A 3K6VA 5CMBA 3OMBA 3U93A 1FQFA 5AA1A 4G4PA 5TP9A 4LZ7A 3PD8A 4FORA 1PBQA 1ANFA 4LP2B 1N76A 3O9PA 5KDTB 1EZ9A 1EU8A 1QUKA 3U1OA 3K6UA 5ISUA 4OTEA 4X1DA 1UTHB 1DTGA 3UGWA 1YTVA 1Y3PA 4QRZA 2RCBA 1EZPA 4BDMA 4IGTA 3HV1A 4BDQA 2F6GA 1OIBA 4F2QA 4P11A 2FA7A 2H9BA 1FTKA 3K4UA 1MS7A 1GTKA 2R71A 4ELOA 3LSFB 5I84A 2QSXA 1FQDA 1UTBA 3DP8A 4RJZA 4GWOA 3FVKA 3KSJA 3V8XB 4GD5A 4QSEA 1R1NA 1P1WA 3TDJA 1JEUA 1PEBA 3HO7A 2HCAA 3FIRA 1RKMA 3IJOB 4ZE8A 3O97A 4OHNA 4WEDA 1B7ZA 1Z7NE 3KBRA 2A5TB 3RGYA 1ZMGA 1GVCA 1AOVA 1H43A 3KJTA 4IO4A 1TXFA 2V3UA 3IORA 2REGA 3ZKKA 3KZGA 3E13X 1QKBA 1Y4TA 2G93A 2VGQA 3VV5A 4XKQA 1IXGA 5I56B 4OENA 1B1XA 5CM6A 1FQEA 3H6UA 3VLWA 2OZZA 3D4CA 3TCGA 2HEUA 4F3GA 4AQ4A 1GR2A 4OYVA 1D9YA 1QW0A 4N07A 2Y84A 4EQ9A 1JEVA 4NTLA 1BIYA 1GV8A 3L6GA 1FW0A 1Z7ME 5L8DA 1LFGA 4L17A 4KYEA 4F3SA 1PB8A 3O6HA 1P1QA 4YU0A 3EQ1A 3IOWA 3TFLA 4F2OA 4JXIA 4O3BA 3IOUA 4GOTA 4LA9A 2DOJA 4R6YA 4OMBA 4NE4A 1AL3A 3G3IA 4MLVA 4R75A 1URSA 5HM4B 1MXVA 4F3PA 3VE1B 1IZ1A 2QS1A 3K02A 1M5CA 5AE4A 4DLDA 4I62A 2O1MA 4U1OA 3K00A 1NMUA 3FXUA 4K3FA 5A5XB 1MH4A 4KPTA 4C1TA 4PFTA 1FQAA 4OFOA 2RC8A 4DXBA 2GHBA 3RTFB 3B6WA 3CFXA 4TQUQ 1MM6A 1TT1A 4PFWA 2LAOA 5CC2A 3QAXA 3VFJA 1MH3A 4EUOA 3S9MC 1MQDA 2F8DA 3WAEA 1URDA 3FVOA 2F7CA 2V93A 3K1MA 3G3FA 3MPKA 1P99A 2RC7A 4R9GA 1USYH 4DIGA 1A55A 3OO6A 4WXJA 3RTWB 4KD5A 4QFPA 2I6EA 2I0BA 1IIWA 2V3TA 1DOTA 3U8QA 1LBCA 2V25A 4X48A 3K2DA 1I6BA 4EQ7A 2OJTA 2AL4A 4RA1A 4H8IA 4ND9A 1B3FA 4BDLA 1NL5A 2VD3A 3A09A 4RK9A 3UN6A 4FEBA 2DE4A 2OK2A 5DT6A 3N26A 4EDPA 3FJ7A 4YMAA 1H44A 3MWBA 4KQPA 3S2VA 5I58A 3SDFA 3SEYA 1BTJA 4KCDA 5K2YA 1LSTA 2XX7A 3T93B 3M3FA 4G8HA 3RQTA 3H6WA 2ESNA 2DVZA 4JSDA 4QF9A 1LAXA 4F3BA 1CE2A 4FECA 5JTYA 1O7TA 3W15C 4NWDA 5LOMA 3E3KA 3OEKA 1MXXA 4RY1A 3TTNA 3T96B 3S9EA 2VHAA 4KFQA 2O51A 1FCKA 1N3XA 3FJMA 1TFAA 3KOTA 1IXCA 4JSOA 4KI0E 2GHAA 5AA2D 4IGRA 5I2NA 1IITA 3UK4A 1SQYA 1ELJA 4XKRA 4JWOA 1SBPA 1TWYA 3N6TA 1B5JA 2Q89A 4NF6B 3VLUA 3TKDA 2IA4A 5BUUA 3G7WA 3CG1A 2YPNA 3N5LA 2XXRA 3ONMA 5FHMA 2I4BA 2D5WA 2F36A 4NF5B 2F35A 3OEMA 3SESA 3HHGA 3U72A 1B2HA 3M3LA 3FGSA 4IO7A 1IXHA 3GZGA 3W9VA 5L9OA 1A8EA 4R2BA 2O7IA 3FXQA 3PD9A 4YKKA 4MH5A 2H4IA 1XVXA 1H45A 2QS3A 4F1YA 3SETA 3R7XA 4DDDA 3CSBA 2XD2A 1H76A 4AB6A 4XTCQ 2D3IA 2QJEA 2NWJA 1WDNA 3RY3A 3EHUA 4F1VA 2NVUB 4F1UA 4QSDA 1MY1A 4PETA 4YAHX 5I57B 4H1XA 1US4A 2AL5A 1R9QA 3JZJA 3SEXA 2H25A 3KJ7A 2XXYA 2DP8A 2DQVA 1B5IA 3T9XB 3EPEA 3MVYA 2ZYNA 4OQOA 4YKJA 1HSEA 2ZNUA 2UYFA 2ABHA 2PVUA 1S50A 4M4GA 1US5A 4JDFA 3Q28A 2F5XA 4YKPA 1B4HA 3ILTB 4YB6A 3M8UA 4U21A 2OWSA 4IO5A 4OETA 5AA2B 5B7DA 1DPPA 3V89B 3N6UA 2G29A 1FQCA 2PT1A 4LVQA 1PBPA 2F7AA 1PB7A 1AH5A 3IR1A 4DXCA 4N13A 4U2RA 5CBSA 4M1VA 5TPAA 4OZ9A 3KG2A 3CSGA 5EYFA 1F9BA 2ZXTA 1B05A 2XXUA 3K6XA 3G3HA 3MW0A 4HCWA 5DEXA 2XXPA 1I69A 3DP6A 2ANJA 2AYSA 3PUWE 1JQFA 3CFLA 4G68B 3FD3A 4LATA 1M5DA 5ITPA 3JYRA 4LUBA 5H8NA 3BFTA 4GL8A 5CMCA 2PT2A 3FATA 2GH9A 3T66A 3TTKA 3LUYA 3EHSA 2HXWA 5H8HB 4ZEDA 1B52A 3MP8A 2ONRA 3RNNA 1MDP1 2XX8A 3BBRA 1JW1A 3TZAA 4RYAA 4F39A 3IK6B 2UXAA 2V3QA 1BLFA 3SEVA 4WEPA 3HSTA 2O69A 2F6PA 1USYE 3OELA 4U4XA 4ESWA 1CB6A 1HSJA 2Y7IA 3TYHA 2X7QA 4HW8A 4DE8A 2CMOA 1JVYA 3PMVA 2ONKE 2RCAA 1D9VA 1N7WA 4Q0CA 3OXNA 3DP4A 4YMBA 5H8QB 3F11A 3ZS6A 3QK6A 1YPNA 5F1QA 5CBRA 2HQ0A 3ZSFA 3QSLA 1Y3NA 1N3WA 1T0KA 3RPWA 4GXAA 2H5YA 3U92A 2I49A 5AA4A 3R26A 2VP1A 1XS5A 3FXRA 3VLVA 1H3DA 3DM0A 3V5AA 4F29A 4DXUA 5I59B 2Z23A 3Q26A 1B7UA 3E9XA 3MQ9A 3Q27A 1Q35A 3HCQA 2Y7KA 4ZEKA 4U22A 4R2FA 2NUVA 1Y1MA 1SI1A 1JETA 3EF7A 1UIUA 2XXXA 2XD3A 4ZECA 4E0WA 3CR9A 1LGBC 1MY3A 2OCUA 1NH8A 2UVJA 1JW4A 3PUXE 3O6GA 3THIA 3V83A 2Z8FA 1BP5A 1QVSA 3K0VA 2DS9A 3H6VA 4AB5A 2DWJA 1J1NA 5KCJA 5H8FB 4ZZAA 2DYXA 2GFEA 4EXLA 4NF8B 4PFUA 4DZ1A 4NF5A 4I8CA 1LAHE 4X1BA 2IEEA 3C36A 5DVFA 5BWJA 4FJPA 4PQJA 3IB2A 3N94A 4F18A 2PYYA 1MPBA 1NNPA 2B65A 1POTA 4RXLA 3LR1A 1A54A 5TP9B 2XXHA 5CMMA 1LAFE 4E0XA 3H06B 4JWXA 2DE3A 4R6HA 3Q29A 1B32A 4XKPA 4TOZA 4YB5A 2P0SA 1IEJA 2A5SA 3GBAA 2OWTA 3MVWA 4R74A 1ZU0A 4LQ2A 2R9JA 1MPDA 4HS7A 1DTZA 3T22A 4GRKA 1RYOA 4HTGA 3G3GA 4GFRA 2F7BA 3PU5A 3A3UA 3C4MA 1Y1ZA 1VFEA 4THIA 5DVIA 1II5A 1AMFA 1B3HA 2Q9TA 3TAJA 4OXVA 1I6QA 3R6UA 1UTBB 1B40A 5L9MA 3WAFA 4QFOA 5I2KA 1MRPA 3IAZA 3TQWA 3OSQA 4PP0A 3CI8A 1B7HA 3ECRA 2Q2AA 1ATGA 3MUQA 1R6ZA 2REJA 1PDAA 2B3FA 1MY2A 2ZYOA 2ZNTA 3MZ1A 4Q30B 2DXYA 4H8JA 4NF4B 2XXTA 4G77A 1JW5A 5IAIA 4UA8A 5KDTA 3CIJA 3TMGA 3MVZA 4RNSA 1B0HA 3O66A 2M8CA 4IO2A 1DMBA 2P1SA 4ZZEA 2KLFA 1UTHA 1EZOA 1D4NA 3KSXA 2XXIA 4FATA 4R6KA 3T9VA 3UIFA 4ELQA 1FTMA 1B6HA 4MBPA 3D4GA 3PMWA 4NMYA 2I58A 2Y7RA 1OVTA 3JV9A 4QFLA 2CZLA 4YICA 1MQJA 2I4CA 3OENA 5ITOA 4G8NA 1MPCA 3MAMA 4N6PA 3T9HB 3OO9A 3UORA 1MDQA 2DWIA 2RC9A 2UYEA 3MZBA 2QS2A 3OO7A 5J1DA 1A99A 4U1ZA 4LZ5A 2X7PA 2XXQA 2HZLA 2F97A 3I6VA 3TTLA 5ICQA 5K2XA 2P2AA 4U23A 3K1NA 4ZEIA 4KYDA 1SYIA 4ESXA 1YCJA 4PFYA 2QS4A 4POXA 2A5TA 4IB2A 3RUMA 4C0RA 4EXKA 1B58A 5KZTA 3PPNA 4FAJA 1MY0A 3L6HA 4G68C 3PPRA 1NH7A 3KN3A 3I5OA 5FHNA 3A3CA 3SEUA 1OQGA 3RT6B 3VVDA 4Q8RA 1SW4A 5EHMA 5I56A 1AIVA 4DCYA 1FQBA 4POWA 2I3VA 2H99A 5ICTA 4GVOA 1NFTA 1MG1A 4F22A 3IOTA 3LC8A 1MXZA 2GRVA 3PUZE 4F19A 4WKMA 1TFDA 3P7IA 3PUVE 2Q2CA 2ALUA 3MPLA 2I0CA 4Z0IA 1Y9UA 1MY4A 2XXVA 4KYSA 1NNKA 3O28A 1JVXA 2VOZA 1YAEA 3ZKLA 3S9NC 1FTJA 3I3VA 3IO6A 3SEWA 2O84X 3HPIA 2YLNA 3FVNA 1ZJLA 2Z8DA 4IY5A 4KCCA 1Y20A 3UA8A 4ZE9A 3TCHA 4FE8A 5A5XA 5I58B 2PX1A 3TTRA 3CRBA 3CFZA 5B70A 3PMXA 4GLIA 5DTBA 1ZLQA 2Y7PA 5CMKA 3LSXA 4EF2A 3QYTA 3O2AA 4GL0A 5JTYB 4IO3A 2DE2A 1WODA 4BDOA 2DVCA 2F34A 2QRYA 1S9TA 3OOAA 5HPQA 2V84A 3O6IA 3OO8A 4QHQA 3U94A 5CI5A 3C34A 1P1NA 1B46A 1MQIA 2Q88A 3C33A 1M5BA 1ZIUA 1OLAA 4RK2A 2O7UA 5I2NB 2I3WA 2X26A 1PB9A 2W7YA 3S4UA 4GIZA 4YB7A 4KHZE 3EHTA 1SVXB 3ILUB 3IL1B 3FZVA 4GQOA 3IB0A 4H5GA 1I6AA 2XXWA 3OD7A 3TEPA 1DSNA 1QULA 4GXSB 1A7LA 3GXAA 2R6GE 5DVJA 4C1UA 3FASA 3TELA 1SW5A 4P0IA 1BKAA 4ELPA 2Z22A 4JWYA 4MF3A 2THIA 3QUFA 2ZYMA 3K6WA 3SERA 3PPPA 4NF4A 4OVJA 3PV0E 2DSFA 1B3GA 1MXWA 4IO6A 3UP9A 2WKYA 2UVIA 4OEUA 4KR5A 4R73A 3M3KA 2VD2A 3MC2A 1B51A 5F7VA 3KN7A 4HCYA 4LQ5A 1LFIA 5FHOA 4YKIA 4JB7A 3TPAA 2PBWA 1GGGA 4QFNA 4RPNA 2DXRA 4TLLB 3C32A 1B9JA 1VR5A 3MJNA 4PE5B 4OESA 3RT8A 3LBSA 4RPOA 5JK4A 1D3KA 4H0WA 3IOVA 4JBZA 1LLSA 1XC1A 2RF1A 4NF6A 1A40A 3VVEA 3C35A 3OSRA 5DYHA 2B3BA 1LCTA 3H03A 2E0SA 3DELB 3K01A 3QUJA 2Z8EA 1L5TA 3B6QA 4H65A 3RLFE 2UVGA 2HAUA 1NNTA 1LB8A 1MM7A 3VDFA 3PUYE 3LSWA 1OVBA 2Q8JA 2AIXA 4G2ZA 4H6DA 4ZDMA 5M2VA 1LB9A 1N7XA 3QXMA 4OEVA 4BDNA 5ELVA 5TPAB 4P0GA 4R72A 2QPQA 4ZS9A 1IUDA 3H3GA 5DEXB 1SI0A 4R9FA 2XX9A 5I57A 1IXIA 1XT8A 4QFKA 3K1PA 4ONYA 4TLMB 5H8SA 1UIVA 5JEIA 3VXBA 2DWAA 4NWCA 1POY1 1XVYA 2YJPA 5H8NB 3KOSA 2O68A 4ECFA 4G8MA 3E4RA 1S7YA 3S9LC 2RINA 3IO4A 3G3KA 3TTMA 4EF1A 3USDA 4UACA 2QMWA 3MBPA 3VXCA 1OMPA 2O1LA 1N0TA 3IB1A 3BKIB 3GLBA 1DPEA 4MLQA 5AA2A 4MFIA 3PPOA 2D21A 4FEDA 4IY6A 1N04A 1P1UA 1OQHA 1A8FA 3BFUA 3KEIA 4O3CA 3FVGA 2PMSA 3FV2A 2HZKA 2ONSA 1PC3A 1EH3A 1XOCA 4X9TA 5IKBA 2F78A 3GBBA 3CVGA 1P1OA 2E1SA 3FJGA 3Q25A 4O3AA 3RN8A 4XIGQ 1B1HA 5FTHA 3ODBA 4G68A 1Y4CA 4ISUA 4EQBA 2H98A 5AA4B 1NNFA 1IQ7A 3PGFA 4F31B 1OLCA 4I1DA 2FYIA 4BLAA
chains in the Genus database with same CATH superfamily
1VSOA 3DLNA 1RYXA 3W9WA 1JNFA 1SW1A 5H8HA 5J16A 1FBFA 1ZBMA 4LONB 1FBHA 1B3EA 1B0LA 3RYDA 4JVDA 2HFBA 4DCXA 3HHFA 1HSLA 1XHYA 3PPQA 2Y5LA 1SD3A 3LV0A 1FTLA 2ZYKA 3KFMA 2Y7WA 5ET8A 3KGCA 2ZMBA 3T9UA 2OLBA 5L9SA 1SPIA 5FTIA 3MVXA 3H6TA 3MP1A 1M5FA 3G3JA 4AS4A 4H5FA 1FTOA 5CRYA 5KCJB 1KA0A 1Q1KA 1QUIA 3FV1A 2NOOA 4OERA 4GX3A 1LBBA 1B4ZA 4MIJA 1Y3QA 1VFDA 1ZKBA 5AA3A 3LSLA 3CG3A 2UVHA 1QJMA 1VE4A 1SDXA 3HN0A 1K9YA 1URGA 4Z7EA 4ZEBA 2HAVA 3B6TA 1NV7A 4H67A 3O29A 1KWHA 1QKAA 2DWHA 4I3EA 5IZ1A 5H8QA 3TUSA 2RKMA 4FIMA 5HBCA 5TU0A 2BJJX 3FUZA 3H7MA 4BDRA 4I9DA 3SKPA 3QIMA 1O63A 1SYHA 2QL3A 4GF8A 1LFHA 1N84A 4XXUA 3AXFA 3IX1A 1FPLA 2ZNSA 1R9LA 1MXYA 3TODA 2QMXA 1WVJA 3TCFA 3VVFA 2XHDA 5I59A 1ZTYA 4QSCA 1LAGE 1INPA 3IJXB 1MQGA 1LCFA 2OBGA 1QUJA 3MZ9A 1DK4A 4ELRA 1UQWA 4LN5A 2O6AA 1MQHA 3EN3A 4OWDA 4Q5TA 4ZEFA 4O94A 2NXOA 4OVSA 3C31A 5EHSA 3TQLA 1B5HA 1M5EA 4XKNA 5H8FA 5EQAA 3B7DA 1B3LA 4LZ8A 2F3BA 3C9HA 2FNCA 3MP6A 5I2KB 1NKXA 4OFLA 1MXUA 4NF8A 1SW2A 4OFJA 1O64A 4U4SA 3KN8A 3H4ZA 1NV3A 4NEDA 4YZZA 2I48A 3K6VA 5CMBA 2QVRA 3OMBA 3U93A 1FQFA 5AA1A 3PTYA 4G4PA 5TP9A 4LZ7A 3PD8A 4FORA 1PBQA 1ANFA 4LP2B 1N76A 3O9PA 4MJOA 5KDTB 1EZ9A 5EYGA 1DBZA 1EU8A 1QUKA 3U1OA 3K6UA 4PF8A 5ISUA 2B4LA 4OTEA 4X1DA 1UTHB 1DTGA 3UGWA 1YTVA 1Y3PA 4QRZA 2RCBA 2OWZA 1EZPA 4OVPA 4P1EA 4BDMA 4IGTA 3HV1A 4BDQA 2F6GA 1OIBA 5ET5A 4F2QA 1IMDA 4P11A 2FA7A 2H9BA 2Q8MA 1FTKA 4MEVA 3K4UA 3FBPA 1MS7A 1GTKA 2R71A 4ELOA 1IMBA 3LSFB 5I84A 4NGUA 2QSXA 1FQDA 3RPLB 1UTBA 3DP8A 2XWIA 4RJZA 4GWOA 5LDZA 3FVKA 3KSJA 3V8XB 4GD5A 4QSEA 1R1NA 1P1WA 3TDJA 1JEUA 1PEBA 4GX4A 3HO7A 2HCAA 3FIRA 1RKMA 3IJOB 4ZE8A 2WYPA 3O97A 4OA4A 4OHNA 4WEDA 1FPJA 1B7ZA 4O8MA 1Z7NE 3KBRA 2A5TB 3RGYA 4PBQA 1ZMGA 1GVCA 1AOVA 1H43A 3KJTA 4IO4A 1TXFA 2V3UA 3IORA 2REGA 4X8RA 3ZKKA 3KZGA 5LTCA 3E13X 1QKBA 1Y4TA 2G93A 1LBYA 2VGQA 3KC0A 3VV5A 4XKQA 1IXGA 3T1BA 5I56B 4OENA 1B1XA 5CM6A 1FQEA 3H6UA 3VLWA 2OZZA 3D4CA 3TCGA 2HEUA 4F3GA 4AQ4A 1GR2A 4OYVA 1D9YA 1QW0A 4N07A 5EQ8A 2Y84A 4EQ9A 1JEVA 4NTLA 2MKZA 1LBXA 1KZ8A 1BIYA 1GV8A 3L6GA 1FW0A 1Z7ME 4GBWA 4HXVA 1LFGA 4L17A 4KYEA 5L8DA 1NV2A 2VPNA 1LEVA 4F3SA 1PB8A 3O6HA 1P1QA 4YU0A 3EQ1A 3IOWA 3TFLA 4F2OA 4JXIA 4O3BA 3U65A 3IOUA 4GOTA 4LA9A 2DOJA 4R6YA 4OMBA 1RDYA 4NE4A 1AL3A 3G3IA 4MLVA 4R75A 1URSA 1NUYA 5HM4B 1MXVA 4F3PA 3VE1B 1IZ1A 2QS1A 5ET7A 3K02A 3IFAA 1M5CA 5FBPA 5AE4A 4DLDA 4I62A 2O1MA 4U1OA 3K00A 1NMUA 4N4UA 3EKIA 3FXUA 4DI3D 4K3FA 5A5XB 1MH4A 4KPTA 4C1TA 4PFTA 2JJKA 5I5PA 1FQAA 4OFOA 2FHYA 4PGPA 2RC8A 1G0HA 4DXBA 1Q9DA 1LBWA 2GHBA 3RTFB 3B6WA 3CFXA 4TQUQ 1EYKA 1MM6A 1TT1A 4PFWA 2LAOA 5CC2A 3QAXA 4I40A 3VFJA 1MH3A 4EUOA 3S9MC 1MQDA 2F8DA 3WAEA 2CZKA 1URDA 3FVOA 2F7CA 2V93A 3K1MA 3G3FA 1YXIA 3MPKA 4N8YA 1P99A 2RC7A 4R9GA 1USYH 2ZZWA 4DIGA 4GWWA 1A55A 3OO6A 4WXJA 3RTWB 4KD5A 4QFPA 2I6EA 2I0BA 1IIWA 2V3TA 1DOTA 3U8QA 1LBCA 2V25A 4X48A 3K2DA 1I6BA 4EQ7A 2OJTA 2AL4A 4RA1A 3BIGA 4H8IA 4ND9A 2ZZVA 1B3FA 4BDLA 1NL5A 4KXPA 2VD3A 3A09A 4RK9A 3UN6A 4FEBA 2DE4A 2OK2A 5DT6A 3N26A 4EDPA 3FJ7A 4YMAA 1H44A 3MWBA 4KQPA 4N15A 3S2VA 5I58A 3SDFA 3SEYA 1BTJA 4QXDA 4KCDA 5K2YA 1LSTA 2XX7A 3T93B 3M3FA 4G8HA 4JVCA 3RQTA 3H6WA 2ESNA 2DVZA 4JSDA 4QF9A 1LAXA 4F3BA 1CE2A 4PAIA 4GWSA 1NUXA 4FECA 5JTYA 1O7TA 3W15C 4NWDA 5LOMA 3E3KA 3OEKA 1MXXA 4RY1A 3A29A 3TTNA 2HHMA 3T96B 3S9EA 3FXBA 2VHAA 4KFQA 2O51A 1FCKA 1N3XA 3FJMA 1TFAA 3KOTA 1IXCA 4JSOA 4KI0E 1NUWA 2GHAA 5AA2D 4IGRA 3KC1A 5I2NA 1IITA 3UK4A 1SQYA 1ELJA 4XKRA 4JWOA 1SBPA 5A5LA 1TWYA 3N6TA 2PCRA 1B5JA 1NV5A 2Q89A 2Q74A 4NF6B 3VLUA 3TKDA 4MNCA 2IA4A 5BUUA 3G7WA 1AWBA 3CG1A 2YPNA 3N5LA 2XXRA 3ONMA 5FHMA 2I4BA 2D5WA 1QGXA 2F36A 1FPIA 4NF5B 2F35A 3OEMA 3SESA 1LBZA 3HHGA 2XXKA 4P9KA 3U72A 1B2HA 3M3LA 3FGSA 4IO7A 3MSTA 4NG7A 1IXHA 2OX3A 3GZGA 3W9VA 5L9OA 3ROJA 1A8EA 4R2BA 2O7IA 3FXQA 3PD9A 4YKKA 4MH5A 2H4IA 1XVXA 1H45A 2QS3A 4F1YA 3SETA 3R7XA 4DDDA 3CSBA 2XD2A 1H76A 4AB6A 4XTCQ 1XI6A 2L5VA 4X04A 2D3IA 2QJEA 2NWJA 1WDNA 3RY3A 3EHUA 2WYKA 4F1VA 2NVUB 4F1UA 4QSDA 1MY1A 4PETA 4YAHX 5I57B 4H1XA 1US4A 2PFZA 3HFUA 2AL5A 1R9QA 3JZJA 3SEXA 2H25A 4OANA 3KJ7A 2XXYA 2KR0A 2DP8A 2DQVA 1B5IA 3T9XB 1IMAA 3B50A 3EPEA 3MVYA 1LBVA 2ZYNA 4AS5A 4OQOA 4YKJA 1HSEA 2ZNUA 2UYFA 1BK4A 2ABHA 2PVUA 1S50A 4M4GA 1US5A 4JDFA 3Q28A 5EQ9A 2F5XA 4YKPA 1B4HA 3ILTB 1FPGA 4YB6A 3M8UA 4U21A 2OWSA 4IO5A 4OETA 5AA2B 5B7DA 1DPPA 3V89B 3N6UA 1FTAA 5IZ3A 2G29A 3ISPA 1FQCA 2PT1A 5I3SA 4PF6A 1CNQA 4LVQA 3T0JA 1PBPA 2F7AA 4G61A 1PB7A 1AH5A 2CZHA 3IR1A 4DXCA 4N13A 1FBGA 4U2RA 5CBSA 4M1VA 5TPAA 4OZ9A 3KG2A 3CSGA 5EYFA 1F9BA 5IM2A 2ZXTA 1FPBA 1B05A 2XXUA 3K6XA 3G3HA 3MW0A 4HCWA 5DEXA 2XXPA 1I69A 3DP6A 2CZIA 2ANJA 2AYSA 3PUWE 1JQFA 3CFLA 4G68B 3FD3A 4LATA 1M5DA 5ITPA 5DW8A 5F24A 3JYRA 4LUBA 5H8NA 3BFTA 4GL8A 5CMCA 2PT2A 3FATA 3E78A 2FIEA 2GH9A 3T66A 3TTKA 3LUYA 3EHSA 2HXWA 5H8HB 3B8BA 4NQ8A 4ZEDA 1B52A 3MP8A 2ONRA 3RNNA 1MDP1 2XX8A 3BBRA 1JW1A 3TZAA 2Y5KA 4RYAA 4PTKA 2V4CA 1FPKA 4F39A 3IK6B 2UXAA 3KBZA 2V3QA 1BLFA 3SEVA 4WEPA 5EYHA 1YZ0A 3HSTA 2O69A 2F6PA 1USYE 2WBDA 3OELA 4U4XA 4ESWA 1CB6A 1HSJA 4P1LA 2Y7IA 3TYHA 2X7QA 4HW8A 4DE8A 2CMOA 1JVYA 3PMVA 1RDXA 2ONKE 2RCAA 1D9VA 1N7WA 4Q0CA 3OXNA 3DP4A 4YMBA 5H8QB 3F11A 3ZS6A 3QK6A 1YPNA 5F1QA 5CBRA 2HQ0A 3ZSFA 3SZPA 3QSLA 1Y3NA 2XA5A 1N3WA 1T0KA 3RPWA 4GXAA 2H5YA 3U92A 2I49A 5AA4A 3R26A 2VP1A 1XS5A 2FVZA 3FXRA 3VLVA 1H3DA 3DM0A 3V5AA 4F29A 4DXUA 5I59B 2Z23A 2VT5A 3Q26A 1B7UA 4NX1A 3E9XA 3MQ9A 3Q27A 1Q35A 3HCQA 2Y7KA 4ZEKA 4U22A 4R2FA 2NUVA 3GYYA 1Y1MA 1SI1A 1JETA 3EF7A 1UIUA 2XXXA 2XD3A 4MX6A 4ZECA 4E0WA 3CR9A 1LGBC 1MY3A 4I3YA 2OCUA 1NH8A 2UVJA 1JW4A 3PUXE 3O6GA 3THIA 3V83A 2Z8FA 4PAFA 1BP5A 1QVSA 3K0VA 2DS9A 3H6VA 4AB5A 2DWJA 4GWUA 1J1NA 5KCJA 5H8FB 4ZZAA 2DYXA 2GFEA 4EXLA 4NF8B 4PFUA 4DZ1A 4NF5A 4I8CA 1LAHE 4X1BA 2IEEA 3C36A 5DVFA 5BWJA 4FJPA 1FBDA 4PQJA 3IB2A 3N94A 4F18A 2PYYA 1MPBA 4OVQA 1NNPA 2B65A 4HE1A 1POTA 4RXLA 3LR1A 1A54A 5TP9B 2XXHA 5CMMA 1LAFE 4E0XA 3H06B 2QVUA 4JWXA 2DE3A 4R6HA 3Q29A 1B32A 4XKPA 4TOZA 4YB5A 2FIXA 4PGNA 2P0SA 1IEJA 3CHGA 4GWYA 4PFBA 1FJ9A 2A5SA 3GBAA 2OWTA 3MVWA 1YYZA 4R74A 1ZU0A 3E79A 4LQ2A 1NUZA 2R9JA 1MPDA 4HS7A 5EQ7A 2HXRA 4QBAA 1DTZA 3T22A 4GRKA 1RYOA 3D1RA 4HTGA 2F3DA 2GQ1A 3G3GA 4GFRA 2F7BA 3PU5A 3A3UA 3C4MA 2XWVA 1Y1ZA 1VFEA 4THIA 5DVIA 1II5A 1AMFA 4MAGA 1B3HA 2Q9TA 3TAJA 2QVVA 4P8BA 4OXVA 4PAKA 1I6QA 3R6UA 1UTBB 1B40A 5L9MA 5IZZA 3WAFA 4QFOA 5I2KA 1MRPA 3IAZA 3TQWA 2PFYA 3OSQA 4PP0A 3CI8A 1B7HA 3ECRA 2Q2AA 1ATGA 3MUQA 4O7MA 1R6ZA 2REJA 1PDAA 4DI4B 2B3FA 1EYJA 1MY2A 2ZYOA 2ZNTA 3MZ1A 4Q30B 2DXYA 4H8JA 4NF4B 2XXTA 4G77A 1JW5A 5IAIA 4UA8A 4UABA 5KDTA 3CIJA 2R8TA 3TMGA 3MVZA 2VPOA 4RNSA 3NOHA 4MNIA 1B0HA 3O66A 2M8CA 4IO2A 1DMBA 2P1SA 4ZZEA 2KLFA 1UTHA 1EZOA 1D4NA 1EYIA 3KSXA 1FBCA 2XXIA 4FATA 4JVIA 4R6KA 3T9VA 3UIFA 1NV0A 4ELQA 1FTMA 1B6HA 2XWKA 4MBPA 1JP4A 3D4GA 3PMWA 4NMYA 2I58A 2Y7RA 1OVTA 3JV9A 4QFLA 2CZLA 4YICA 1IMCA 4N17A 1MQJA 2I4CA 1FPEA 3OENA 4H46A 5ITOA 4G8NA 3RPLA 1MPCA 3MAMA 4N6PA 3T9HB 3OO9A 3UORA 1MDQA 2DWIA 2RC9A 2WX9A 2UYEA 3MZBA 2QS2A 3OO7A 5J1DA 1A99A 4U1ZA 4LZ5A 2X7PA 2XXQA 2HZLA 2F97A 4PCDA 3I6VA 3TTLA 5ICQA 4XF5A 5K2XA 4NF0A 2P2AA 4NN3A 4U23A 3K1NA 4PBHA 4ZEIA 4KYDA 1SYIA 4ESXA 1YCJA 4PFYA 2QS4A 4POXA 5ESYA 2A5TA 4IB2A 3RUMA 4C0RA 4EXKA 1B58A 5KZTA 3PPNA 4FAJA 1NI9A 1MY0A 3L6HA 4G68C 3PPRA 1NH7A 3KN3A 4MHFA 2DDKA 3I5OA 5FHNA 3A3CA 1NV1A 4PDDA 3SEUA 1OQGA 3RT6B 3VVDA 5I7IA 4Q8RA 1SW4A 5EHMA 5I56A 1AIVA 4DCYA 1FQBA 4NAPA 2CEXA 4POWA 2I3VA 2H99A 5ICTA 4GVOA 3BIHA 1NFTA 4PC9A 1MG1A 4F22A 3IOTA 3LC8A 1MXZA 2GRVA 3PUZE 4F19A 4WKMA 1TFDA 3P7IA 3PUVE 1FBEA 2Q2CA 4PDHA 2ALUA 3MPLA 2I0CA 4Z0IA 1Y9UA 1MY4A 4NHBA 2XXVA 4KYSA 1NNKA 3O28A 1JVXA 2VOZA 1YAEA 3ZKLA 3S9NC 1FTJA 3I3VA 3IO6A 3SEWA 2O84X 3HPIA 2YLNA 3FVNA 1ZJLA 2Z8DA 4IY5A 3MYUA 4KCCA 1Y20A 3UA8A 4ZE9A 3TCHA 4FE8A 4P47A 5A5XA 5I58B 2PX1A 3TTRA 3CRBA 3CFZA 5B70A 3PMXA 4GLIA 1D9QA 5DTBA 2ZZXA 1ZLQA 2Y7PA 5CMKA 4PE3A 3LSXA 4EF2A 3QYTA 3O2AA 5T3JA 4GL0A 5JTYB 4IO3A 2DE2A 1WODA 4BDOA 1FPDA 2DVCA 2F34A 2QRYA 1S9TA 1FSAA 3OOAA 5HPQA 2V84A 3O6IA 3OO8A 4QHQA 3U94A 5CI5A 3C34A 1P1NA 1B46A 1MQIA 2Q88A 3C33A 4N6DA 4P56A 1M5BA 1ZIUA 1OLAA 4RK2A 2O7UA 5I2NB 1G0IA 1NV6A 2I3WA 2X26A 2WEFA 3IFCA 1PB9A 2W7YA 4XEQA 3S4UA 4GIZA 4YB7A 4KHZE 3EHTA 4GWZA 1SVXB 2HPGA 3ILUB 3IL1B 3FZVA 4GQOA 3IB0A 4H5GA 1I6AA 2XXWA 3OD7A 3TEPA 1DSNA 1QULA 4GXSB 1A7LA 3GXAA 2R6GE 5DVJA 4C1UA 1K9ZA 3FASA 3TELA 2KQZA 1SW5A 4P0IA 1BKAA 4ELPA 2Z22A 1FJ6A 4JWYA 4MF3A 2THIA 4OVTA 3QUFA 2WBBA 2ZYMA 3K6WA 3SERA 3PPPA 4NF4A 4OVJA 3PV0E 2XWOA 1KA1A 2DSFA 1B3GA 1MXWA 4IO6A 3UP9A 2WKYA 2UVIA 4OEUA 4KR5A 4R73A 3M3KA 2VD2A 3MC2A 1B51A 5F7VA 3KN7A 4HCYA 4LQ5A 1LFIA 5FHOA 4YKIA 4JB7A 3TPAA 4FBPA 4OVRA 2PBWA 1GGGA 4XFEA 4QFNA 1IMEA 4RPNA 1NV4A 2DXRA 4TLLB 3C32A 1B9JA 1VR5A 3MJNA 4PE5B 4OESA 3RT8A 3LBSA 4RPOA 4MMPA 5JK4A 4N6KA 1D3KA 4H0WA 3IOVA 4JBZA 1LLSA 1XC1A 2RF1A 4NF6A 1A40A 3VVEA 3C35A 3OSRA 2BJIA 5DYHA 2B3BA 1LCTA 3H03A 2E0SA 3DELB 4P3LA 3K01A 3QUJA 2Z8EA 1RDZA 1L5TA 2P3NA 3B6QA 4H65A 4GBVA 3RLFE 2UVGA 4MNPA 2HAUA 1NNTA 1LB8A 4IR8A 1MM7A 3VDFA 2P3VA 3PUYE 4PFRA 3LSWA 1OVBA 2Q8JA 5IZ3B 2AIXA 4G2ZA 4H6DA 4ZDMA 5M2VA 1LB9A 1N7XA 3QXMA 1IMFA 4OEVA 4BDNA 5ELVA 5TPAB 4MCOA 4P0GA 4R72A 2QPQA 4ZS9A 1IUDA 3H3GA 1VDWA 5DEXB 1SI0A 4R9FA 2XX9A 4GWXA 5I57A 1IXIA 2FBPA 1XT8A 4QFKA 3K1PA 4ONYA 4TLMB 5H8SA 1UIVA 5JEIA 3VXBA 2DWAA 4HE2A 5IGAA 4NWCA 1POY1 1XVYA 2YJPA 5H8NB 3KOSA 2O68A 4ECFA 4G8MA 3E4RA 1S7YA 3S9LC 2RINA 3IO4A 3G3KA 4O7IA 3TTMA 4EF1A 3USDA 4UACA 2QMWA 3LUZA 3MBPA 3VXCA 4HE0A 1OMPA 2O1LA 1N0TA 4N81A 3IB1A 3BKIB 3GLBA 1DPEA 4MLQA 5AA2A 4MFIA 3PPOA 2D21A 4FEDA 4IY6A 1N04A 1P1UA 1OQHA 1A8FA 3BFUA 3KEIA 1DCUA 4O3CA 3FVGA 2PMSA 4PFIA 3FV2A 2HZKA 2ONSA 1PC3A 1EH3A 1FPFA 1XOCA 4X9TA 5IKBA 2F78A 1FBPA 3GBBA 3CVGA 1P1OA 2QFLA 2B4MA 1FRPA 2CEYA 2E1SA 3FJGA 3QMFA 3Q25A 4O3AA 3RN8A 4XIGQ 1B1HA 4H45A 5FTHA 3ODBA 4G68A 1Y4CA 4ISUA 4N91A 4EQBA 4GX6A 2H98A 5AA4B 1NNFA 1IQ7A 3PGFA 5ET6A 4F31B 4N8GA 1OLCA 4I1DA 2FYIA 4BLAA
chains in the Genus database with same CATH topology
1VSOA 3DLNA 1RYXA 3W9WA 1JNFA 1SW1A 5H8HA 1ZBMA 4LONB 1B3EA 1B0LA 2HFBA 4DCXA 3HHFA 1HSLA 1XHYA 3PPQA 1SD3A 3KFMA 1FTLA 2ZYKA 2Y7WA 3KGCA 2ZMBA 3T9UA 2OLBA 5L9SA 5FTIA 3MVXA 3H6TA 3MP1A 1M5FA 3G3JA 4H5FA 1FTOA 5CRYA 5KCJB 1Q1KA 1QUIA 3FV1A 2NOOA 4OERA 1LBBA 1B4ZA 1Y3QA 1VFDA 1ZKBA 5AA3A 3LSLA 3CG3A 2UVHA 1QJMA 1VE4A 1SDXA 3HN0A 1URGA 4Z7EA 4ZEBA 2HAVA 3B6TA 4H67A 3O29A 1KWHA 1QKAA 2DWHA 5H8QA 3TUSA 2RKMA 4FIMA 5HBCA 5TU0A 2BJJX 3FUZA 3H7MA 4BDRA 4I9DA 3SKPA 3QIMA 1O63A 1SYHA 2QL3A 4GF8A 1LFHA 1N84A 4XXUA 3AXFA 3IX1A 2ZNSA 1R9LA 1MXYA 3TODA 2QMXA 1WVJA 3TCFA 3VVFA 2XHDA 5I59A 1ZTYA 4QSCA 1LAGE 3IJXB 1MQGA 1LCFA 2OBGA 1QUJA 3MZ9A 4ELRA 1UQWA 2O6AA 1MQHA 3EN3A 4OWDA 4Q5TA 4ZEFA 2NXOA 3C31A 5EHSA 3TQLA 1B5HA 1M5EA 4XKNA 5H8FA 3B7DA 1B3LA 4LZ8A 3C9HA 2FNCA 3MP6A 5I2KB 1NKXA 4OFLA 1MXUA 4NF8A 1SW2A 4OFJA 1O64A 4U4SA 3KN8A 3H4ZA 4NEDA 4YZZA 2I48A 3K6VA 5CMBA 3OMBA 3U93A 1FQFA 5AA1A 4G4PA 5TP9A 4LZ7A 3PD8A 4FORA 1PBQA 1ANFA 4LP2B 1N76A 3O9PA 5KDTB 1EZ9A 1EU8A 1QUKA 3U1OA 3K6UA 5ISUA 4OTEA 4X1DA 1UTHB 1DTGA 3UGWA 1YTVA 1Y3PA 4QRZA 2RCBA 1EZPA 4BDMA 4IGTA 3HV1A 4BDQA 2F6GA 1OIBA 4F2QA 4P11A 2FA7A 2H9BA 1FTKA 3K4UA 1MS7A 1GTKA 2R71A 4ELOA 3LSFB 5I84A 2QSXA 1FQDA 1UTBA 3DP8A 4RJZA 4GWOA 3FVKA 3KSJA 3V8XB 4GD5A 4QSEA 1R1NA 1P1WA 3TDJA 1JEUA 1PEBA 3HO7A 2HCAA 3FIRA 1RKMA 3IJOB 4ZE8A 3O97A 4OHNA 4WEDA 1B7ZA 1Z7NE 3KBRA 2A5TB 3RGYA 1ZMGA 1GVCA 1AOVA 1H43A 3KJTA 4IO4A 1TXFA 2V3UA 3IORA 2REGA 3ZKKA 3KZGA 3E13X 1QKBA 1Y4TA 2G93A 2VGQA 3VV5A 4XKQA 1IXGA 5I56B 4OENA 1B1XA 5CM6A 1FQEA 3H6UA 3VLWA 2OZZA 3D4CA 3TCGA 2HEUA 4F3GA 4AQ4A 1GR2A 4OYVA 1D9YA 1QW0A 4N07A 2Y84A 4EQ9A 1JEVA 4NTLA 1BIYA 1GV8A 3L6GA 1FW0A 1Z7ME 5L8DA 1LFGA 4L17A 4KYEA 4F3SA 1PB8A 3O6HA 1P1QA 4YU0A 3EQ1A 3IOWA 3TFLA 4F2OA 4JXIA 4O3BA 3IOUA 4GOTA 4LA9A 2DOJA 4R6YA 4OMBA 4NE4A 1AL3A 3G3IA 4MLVA 4R75A 1URSA 5HM4B 1MXVA 4F3PA 3VE1B 1IZ1A 2QS1A 3K02A 1M5CA 5AE4A 4DLDA 4I62A 2O1MA 4U1OA 3K00A 1NMUA 3FXUA 4K3FA 5A5XB 1MH4A 4KPTA 4C1TA 4PFTA 1FQAA 4OFOA 2RC8A 4DXBA 2GHBA 3RTFB 3B6WA 3CFXA 4TQUQ 1MM6A 1TT1A 4PFWA 2LAOA 5CC2A 3QAXA 3VFJA 1MH3A 4EUOA 3S9MC 1MQDA 2F8DA 3WAEA 1URDA 3FVOA 2F7CA 2V93A 3K1MA 3G3FA 3MPKA 1P99A 2RC7A 4R9GA 1USYH 4DIGA 1A55A 3OO6A 4WXJA 3RTWB 4KD5A 4QFPA 2I6EA 2I0BA 1IIWA 2V3TA 1DOTA 3U8QA 1LBCA 2V25A 4X48A 3K2DA 1I6BA 4EQ7A 2OJTA 2AL4A 4RA1A 4H8IA 4ND9A 1B3FA 4BDLA 1NL5A 2VD3A 3A09A 4RK9A 3UN6A 4FEBA 2DE4A 2OK2A 5DT6A 3N26A 4EDPA 3FJ7A 4YMAA 1H44A 3MWBA 4KQPA 3S2VA 5I58A 3SDFA 3SEYA 1BTJA 4KCDA 5K2YA 1LSTA 2XX7A 3T93B 3M3FA 4G8HA 3RQTA 3H6WA 2ESNA 2DVZA 4JSDA 4QF9A 1LAXA 4F3BA 1CE2A 4FECA 5JTYA 1O7TA 3W15C 4NWDA 5LOMA 3E3KA 3OEKA 1MXXA 4RY1A 3TTNA 3T96B 3S9EA 2VHAA 4KFQA 2O51A 1FCKA 1N3XA 3FJMA 1TFAA 3KOTA 1IXCA 4JSOA 4KI0E 2GHAA 5AA2D 4IGRA 5I2NA 1IITA 3UK4A 1SQYA 1ELJA 4XKRA 4JWOA 1SBPA 1TWYA 3N6TA 1B5JA 2Q89A 4NF6B 3VLUA 3TKDA 2IA4A 5BUUA 3G7WA 3CG1A 2YPNA 3N5LA 2XXRA 3ONMA 5FHMA 2I4BA 2D5WA 2F36A 4NF5B 2F35A 3OEMA 3SESA 3HHGA 3U72A 1B2HA 3M3LA 3FGSA 4IO7A 1IXHA 3GZGA 3W9VA 5L9OA 1A8EA 4R2BA 2O7IA 3FXQA 3PD9A 4YKKA 4MH5A 2H4IA 1XVXA 1H45A 2QS3A 4F1YA 3SETA 3R7XA 4DDDA 3CSBA 2XD2A 1H76A 4AB6A 4XTCQ 2D3IA 2QJEA 2NWJA 1WDNA 3RY3A 3EHUA 4F1VA 2NVUB 4F1UA 4QSDA 1MY1A 4PETA 4YAHX 5I57B 4H1XA 1US4A 2AL5A 1R9QA 3JZJA 3SEXA 2H25A 3KJ7A 2XXYA 2DP8A 2DQVA 1B5IA 3T9XB 3EPEA 3MVYA 2ZYNA 4OQOA 4YKJA 1HSEA 2ZNUA 2UYFA 2ABHA 2PVUA 1S50A 4M4GA 1US5A 4JDFA 3Q28A 2F5XA 4YKPA 1B4HA 3ILTB 4YB6A 3M8UA 4U21A 2OWSA 4IO5A 4OETA 5AA2B 5B7DA 1DPPA 3V89B 3N6UA 2G29A 1FQCA 2PT1A 4LVQA 1PBPA 2F7AA 1PB7A 1AH5A 3IR1A 4DXCA 4N13A 4U2RA 5CBSA 4M1VA 5TPAA 4OZ9A 3KG2A 3CSGA 5EYFA 1F9BA 2ZXTA 1B05A 2XXUA 3K6XA 3G3HA 3MW0A 4HCWA 5DEXA 2XXPA 1I69A 3DP6A 2ANJA 2AYSA 3PUWE 1JQFA 3CFLA 4G68B 3FD3A 4LATA 1M5DA 5ITPA 3JYRA 4LUBA 5H8NA 3BFTA 4GL8A 5CMCA 2PT2A 3FATA 2GH9A 3T66A 3TTKA 3LUYA 3EHSA 2HXWA 5H8HB 4ZEDA 1B52A 3MP8A 2ONRA 3RNNA 1MDP1 2XX8A 3BBRA 1JW1A 3TZAA 4RYAA 4F39A 3IK6B 2UXAA 2V3QA 1BLFA 3SEVA 4WEPA 3HSTA 2O69A 2F6PA 1USYE 3OELA 4U4XA 4ESWA 1CB6A 1HSJA 2Y7IA 3TYHA 2X7QA 4HW8A 4DE8A 2CMOA 1JVYA 3PMVA 2ONKE 2RCAA 1D9VA 1N7WA 4Q0CA 3OXNA 3DP4A 4YMBA 5H8QB 3F11A 3ZS6A 3QK6A 1YPNA 5F1QA 5CBRA 2HQ0A 3ZSFA 3QSLA 1Y3NA 1N3WA 1T0KA 3RPWA 4GXAA 2H5YA 3U92A 2I49A 5AA4A 3R26A 2VP1A 1XS5A 3FXRA 3VLVA 1H3DA 3DM0A 3V5AA 4F29A 4DXUA 5I59B 2Z23A 3Q26A 1B7UA 3E9XA 3MQ9A 3Q27A 1Q35A 3HCQA 2Y7KA 4ZEKA 4U22A 4R2FA 2NUVA 1Y1MA 1SI1A 1JETA 3EF7A 1UIUA 2XXXA 2XD3A 4ZECA 4E0WA 3CR9A 1LGBC 1MY3A 2OCUA 1NH8A 2UVJA 1JW4A 3PUXE 3O6GA 3THIA 3V83A 2Z8FA 1BP5A 1QVSA 3K0VA 2DS9A 3H6VA 4AB5A 2DWJA 1J1NA 5KCJA 5H8FB 4ZZAA 2DYXA 2GFEA 4EXLA 4NF8B 4PFUA 4DZ1A 4NF5A 4I8CA 1LAHE 4X1BA 2IEEA 3C36A 5DVFA 5BWJA 4FJPA 4PQJA 3IB2A 3N94A 4F18A 2PYYA 1MPBA 1NNPA 2B65A 1POTA 4RXLA 3LR1A 1A54A 5TP9B 2XXHA 5CMMA 1LAFE 4E0XA 3H06B 4JWXA 2DE3A 4R6HA 3Q29A 1B32A 4XKPA 4TOZA 4YB5A 2P0SA 1IEJA 2A5SA 3GBAA 2OWTA 3MVWA 4R74A 1ZU0A 4LQ2A 2R9JA 1MPDA 4HS7A 1DTZA 3T22A 4GRKA 1RYOA 4HTGA 3G3GA 4GFRA 2F7BA 3PU5A 3A3UA 3C4MA 1Y1ZA 1VFEA 4THIA 5DVIA 1II5A 1AMFA 1B3HA 2Q9TA 3TAJA 4OXVA 1I6QA 3R6UA 1UTBB 1B40A 5L9MA 3WAFA 4QFOA 5I2KA 1MRPA 3IAZA 3TQWA 3OSQA 4PP0A 3CI8A 1B7HA 3ECRA 2Q2AA 1ATGA 3MUQA 1R6ZA 2REJA 1PDAA 2B3FA 1MY2A 2ZYOA 2ZNTA 3MZ1A 4Q30B 2DXYA 4H8JA 4NF4B 2XXTA 4G77A 1JW5A 5IAIA 4UA8A 5KDTA 3CIJA 3TMGA 3MVZA 4RNSA 1B0HA 3O66A 2M8CA 4IO2A 1DMBA 2P1SA 4ZZEA 2KLFA 1UTHA 1EZOA 1D4NA 3KSXA 2XXIA 4FATA 4R6KA 3T9VA 3UIFA 4ELQA 1FTMA 1B6HA 4MBPA 3D4GA 3PMWA 4NMYA 2I58A 2Y7RA 1OVTA 3JV9A 4QFLA 2CZLA 4YICA 1MQJA 2I4CA 3OENA 5ITOA 4G8NA 1MPCA 3MAMA 4N6PA 3T9HB 3OO9A 3UORA 1MDQA 2DWIA 2RC9A 2UYEA 3MZBA 2QS2A 3OO7A 5J1DA 1A99A 4U1ZA 4LZ5A 2X7PA 2XXQA 2HZLA 2F97A 3I6VA 3TTLA 5ICQA 5K2XA 2P2AA 4U23A 3K1NA 4ZEIA 4KYDA 1SYIA 4ESXA 1YCJA 4PFYA 2QS4A 4POXA 2A5TA 4IB2A 3RUMA 4C0RA 4EXKA 1B58A 5KZTA 3PPNA 4FAJA 1MY0A 3L6HA 4G68C 3PPRA 1NH7A 3KN3A 3I5OA 5FHNA 3A3CA 3SEUA 1OQGA 3RT6B 3VVDA 4Q8RA 1SW4A 5EHMA 5I56A 1AIVA 4DCYA 1FQBA 4POWA 2I3VA 2H99A 5ICTA 4GVOA 1NFTA 1MG1A 4F22A 3IOTA 3LC8A 1MXZA 2GRVA 3PUZE 4F19A 4WKMA 1TFDA 3P7IA 3PUVE 2Q2CA 2ALUA 3MPLA 2I0CA 4Z0IA 1Y9UA 1MY4A 2XXVA 4KYSA 1NNKA 3O28A 1JVXA 2VOZA 1YAEA 3ZKLA 3S9NC 1FTJA 3I3VA 3IO6A 3SEWA 2O84X 3HPIA 2YLNA 3FVNA 1ZJLA 2Z8DA 4IY5A 4KCCA 1Y20A 3UA8A 4ZE9A 3TCHA 4FE8A 5A5XA 5I58B 2PX1A 3TTRA 3CRBA 3CFZA 5B70A 3PMXA 4GLIA 5DTBA 1ZLQA 2Y7PA 5CMKA 3LSXA 4EF2A 3QYTA 3O2AA 4GL0A 5JTYB 4IO3A 2DE2A 1WODA 4BDOA 2DVCA 2F34A 2QRYA 1S9TA 3OOAA 5HPQA 2V84A 3O6IA 3OO8A 4QHQA 3U94A 5CI5A 3C34A 1P1NA 1B46A 1MQIA 2Q88A 3C33A 1M5BA 1ZIUA 1OLAA 4RK2A 2O7UA 5I2NB 2I3WA 2X26A 1PB9A 2W7YA 3S4UA 4GIZA 4YB7A 4KHZE 3EHTA 1SVXB 3ILUB 3IL1B 3FZVA 4GQOA 3IB0A 4H5GA 1I6AA 2XXWA 3OD7A 3TEPA 1DSNA 1QULA 4GXSB 1A7LA 3GXAA 2R6GE 5DVJA 4C1UA 3FASA 3TELA 1SW5A 4P0IA 1BKAA 4ELPA 2Z22A 4JWYA 4MF3A 2THIA 3QUFA 2ZYMA 3K6WA 3SERA 3PPPA 4NF4A 4OVJA 3PV0E 2DSFA 1B3GA 1MXWA 4IO6A 3UP9A 2WKYA 2UVIA 4OEUA 4KR5A 4R73A 3M3KA 2VD2A 3MC2A 1B51A 5F7VA 3KN7A 4HCYA 4LQ5A 1LFIA 5FHOA 4YKIA 4JB7A 3TPAA 2PBWA 1GGGA 4QFNA 4RPNA 2DXRA 4TLLB 3C32A 1B9JA 1VR5A 3MJNA 4PE5B 4OESA 3RT8A 3LBSA 4RPOA 5JK4A 1D3KA 4H0WA 3IOVA 4JBZA 1LLSA 1XC1A 2RF1A 4NF6A 1A40A 3VVEA 3C35A 3OSRA 5DYHA 2B3BA 1LCTA 3H03A 2E0SA 3DELB 3K01A 3QUJA 2Z8EA 1L5TA 3B6QA 4H65A 3RLFE 2UVGA 2HAUA 1NNTA 1LB8A 1MM7A 3VDFA 3PUYE 3LSWA 1OVBA 2Q8JA 2AIXA 4G2ZA 4H6DA 4ZDMA 5M2VA 1LB9A 1N7XA 3QXMA 4OEVA 4BDNA 5ELVA 5TPAB 4P0GA 4R72A 2QPQA 4ZS9A 1IUDA 3H3GA 5DEXB 1SI0A 4R9FA 2XX9A 5I57A 1IXIA 1XT8A 4QFKA 3K1PA 4ONYA 4TLMB 5H8SA 1UIVA 5JEIA 3VXBA 2DWAA 4NWCA 1POY1 1XVYA 2YJPA 5H8NB 3KOSA 2O68A 4ECFA 4G8MA 3E4RA 1S7YA 3S9LC 2RINA 3IO4A 3G3KA 3TTMA 4EF1A 3USDA 4UACA 2QMWA 3MBPA 3VXCA 1OMPA 2O1LA 1N0TA 3IB1A 3BKIB 3GLBA 1DPEA 4MLQA 5AA2A 4MFIA 3PPOA 2D21A 4FEDA 4IY6A 1N04A 1P1UA 1OQHA 1A8FA 3BFUA 3KEIA 4O3CA 3FVGA 2PMSA 3FV2A 2HZKA 2ONSA 1PC3A 1EH3A 1XOCA 4X9TA 5IKBA 2F78A 3GBBA 3CVGA 1P1OA 2E1SA 3FJGA 3Q25A 4O3AA 3RN8A 4XIGQ 1B1HA 5FTHA 3ODBA 4G68A 1Y4CA 4ISUA 4EQBA 2H98A 5AA4B 1NNFA 1IQ7A 3PGFA 4F31B 1OLCA 4I1DA 2FYIA 4BLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSO A;  3DLN A;  1RYX A;  3W9W A;  1JNF A;  1SW1 A;  5H8H A;  1ZBM A;  4LON B;  1B3E A;  1B0L A;  2HFB A;  4DCX A;  3HHF A;  1HSL A;  1XHY A;  3PPQ A;  1SD3 A;  3KFM A;  1FTL A;  2ZYK A;  2Y7W A;  3KGC A;  2ZMB A;  3T9U A;  2OLB A;  5L9S A;  5FTI A;  3MVX A;  3H6T A;  3MP1 A;  1M5F A;  3G3J A;  4H5F A;  1FTO A;  5CRY A;  5KCJ B;  1Q1K A;  1QUI A;  3FV1 A;  2NOO A;  4OER A;  1LBB A;  1B4Z A;  1Y3Q A;  1VFD A;  1ZKB A;  5AA3 A;  3LSL A;  3CG3 A;  2UVH A;  1QJM A;  1VE4 A;  1SDX A;  3HN0 A;  1URG A;  4Z7E A;  4ZEB A;  2HAV A;  3B6T A;  4H67 A;  3O29 A;  1KWH A;  1QKA A;  2DWH A;  5H8Q A;  3TUS A;  2RKM A;  4FIM A;  5HBC A;  5TU0 A;  2BJJ X;  3FUZ A;  3H7M A;  4BDR A;  4I9D A;  3SKP A;  3QIM A;  1O63 A;  1SYH A;  2QL3 A;  4GF8 A;  1LFH A;  1N84 A;  4XXU A;  3AXF A;  3IX1 A;  2ZNS A;  1R9L A;  1MXY A;  3TOD A;  2QMX A;  1WVJ A;  3TCF A;  3VVF A;  2XHD A;  5I59 A;  1ZTY A;  4QSC A;  1LAG E;  3IJX B;  1MQG A;  1LCF A;  2OBG A;  1QUJ A;  3MZ9 A;  4ELR A;  1UQW A;  2O6A A;  1MQH A;  3EN3 A;  4OWD A;  4Q5T A;  4ZEF A;  2NXO A;  3C31 A;  5EHS A;  3TQL A;  1B5H A;  1M5E A;  4XKN A;  5H8F A;  3B7D A;  1B3L A;  4LZ8 A;  3C9H A;  2FNC A;  3MP6 A;  5I2K B;  1NKX A;  4OFL A;  1MXU A;  4NF8 A;  1SW2 A;  4OFJ A;  1O64 A;  4U4S A;  3KN8 A;  3H4Z A;  4NED A;  4YZZ A;  2I48 A;  3K6V A;  5CMB A;  3OMB A;  3U93 A;  1FQF A;  5AA1 A;  4G4P A;  5TP9 A;  4LZ7 A;  3PD8 A;  4FOR A;  1PBQ A;  1ANF A;  4LP2 B;  1N76 A;  3O9P A;  5KDT B;  1EZ9 A;  1EU8 A;  1QUK A;  3U1O A;  3K6U A;  5ISU A;  4OTE A;  4X1D A;  1UTH B;  1DTG A;  3UGW A;  1YTV A;  1Y3P A;  4QRZ A;  2RCB A;  1EZP A;  4BDM A;  4IGT A;  3HV1 A;  4BDQ A;  2F6G A;  1OIB A;  4F2Q A;  4P11 A;  2FA7 A;  2H9B A;  1FTK A;  3K4U A;  1MS7 A;  1GTK A;  2R71 A;  4ELO A;  3LSF B;  5I84 A;  2QSX A;  1FQD A;  1UTB A;  3DP8 A;  4RJZ A;  4GWO A;  3FVK A;  3KSJ A;  3V8X B;  4GD5 A;  4QSE A;  1R1N A;  1P1W A;  3TDJ A;  1JEU A;  1PEB A;  3HO7 A;  2HCA A;  3FIR A;  1RKM A;  3IJO B;  4ZE8 A;  3O97 A;  4OHN A;  4WED A;  1B7Z A;  1Z7N E;  3KBR A;  2A5T B;  3RGY A;  1ZMG A;  1GVC A;  1AOV A;  1H43 A;  3KJT A;  4IO4 A;  1TXF A;  2V3U A;  3IOR A;  2REG A;  3ZKK A;  3KZG A;  3E13 X;  1QKB A;  1Y4T A;  2G93 A;  2VGQ A;  3VV5 A;  4XKQ A;  1IXG A;  5I56 B;  4OEN A;  1B1X A;  5CM6 A;  1FQE A;  3H6U A;  3VLW A;  2OZZ A;  3D4C A;  3TCG A;  2HEU A;  4F3G A;  4AQ4 A;  1GR2 A;  4OYV A;  1D9Y A;  1QW0 A;  4N07 A;  2Y84 A;  4EQ9 A;  1JEV A;  4NTL A;  1BIY A;  1GV8 A;  3L6G A;  1FW0 A;  1Z7M E;  5L8D A;  1LFG A;  4L17 A;  4KYE A;  4F3S A;  1PB8 A;  3O6H A;  1P1Q A;  4YU0 A;  3EQ1 A;  3IOW A;  3TFL A;  4F2O A;  4JXI A;  4O3B A;  3IOU A;  4GOT A;  4LA9 A;  2DOJ A;  4R6Y A;  4OMB A;  4NE4 A;  1AL3 A;  3G3I A;  4MLV A;  4R75 A;  1URS A;  5HM4 B;  1MXV A;  4F3P A;  3VE1 B;  1IZ1 A;  2QS1 A;  3K02 A;  1M5C A;  5AE4 A;  4DLD A;  4I62 A;  2O1M A;  4U1O A;  3K00 A;  1NMU A;  3FXU A;  4K3F A;  5A5X B;  1MH4 A;  4KPT A;  4C1T A;  4PFT A;  1FQA A;  4OFO A;  2RC8 A;  4DXB A;  2GHB A;  3RTF B;  3B6W A;  3CFX A;  4TQU Q;  1MM6 A;  1TT1 A;  4PFW A;  2LAO A;  5CC2 A;  3QAX A;  3VFJ A;  1MH3 A;  4EUO A;  3S9M C;  1MQD A;  2F8D A;  3WAE A;  1URD A;  3FVO A;  2F7C A;  2V93 A;  3K1M A;  3G3F A;  3MPK A;  1P99 A;  2RC7 A;  4R9G A;  1USY H;  4DIG A;  1A55 A;  3OO6 A;  4WXJ A;  3RTW B;  4KD5 A;  4QFP A;  2I6E A;  2I0B A;  1IIW A;  2V3T A;  1DOT A;  3U8Q A;  1LBC A;  2V25 A;  4X48 A;  3K2D A;  1I6B A;  4EQ7 A;  2OJT A;  2AL4 A;  4RA1 A;  4H8I A;  4ND9 A;  1B3F A;  4BDL A;  1NL5 A;  2VD3 A;  3A09 A;  4RK9 A;  3UN6 A;  4FEB A;  2DE4 A;  2OK2 A;  5DT6 A;  3N26 A;  4EDP A;  3FJ7 A;  4YMA A;  1H44 A;  3MWB A;  4KQP A;  3S2V A;  5I58 A;  3SDF A;  3SEY A;  1BTJ A;  4KCD A;  5K2Y A;  1LST A;  2XX7 A;  3T93 B;  3M3F A;  4G8H A;  3RQT A;  3H6W A;  2ESN A;  2DVZ A;  4JSD A;  4QF9 A;  1LAX A;  4F3B A;  1CE2 A;  4FEC A;  5JTY A;  1O7T A;  3W15 C;  4NWD A;  5LOM A;  3E3K A;  3OEK A;  1MXX A;  4RY1 A;  3TTN A;  3T96 B;  3S9E A;  2VHA A;  4KFQ A;  2O51 A;  1FCK A;  1N3X A;  3FJM A;  1TFA A;  3KOT A;  1IXC A;  4JSO A;  4KI0 E;  2GHA A;  5AA2 D;  4IGR A;  5I2N A;  1IIT A;  3UK4 A;  1SQY A;  1ELJ A;  4XKR A;  4JWO A;  1SBP A;  1TWY A;  3N6T A;  1B5J A;  2Q89 A;  4NF6 B;  3VLU A;  3TKD A;  2IA4 A;  5BUU A;  3G7W A;  3CG1 A;  2YPN A;  3N5L A;  2XXR A;  3ONM A;  5FHM A;  2I4B A;  2D5W A;  2F36 A;  4NF5 B;  2F35 A;  3OEM A;  3SES A;  3HHG A;  3U72 A;  1B2H A;  3M3L A;  3FGS A;  4IO7 A;  1IXH A;  3GZG A;  3W9V A;  5L9O A;  1A8E A;  4R2B A;  2O7I A;  3FXQ A;  3PD9 A;  4YKK A;  4MH5 A;  2H4I A;  1XVX A;  1H45 A;  2QS3 A;  4F1Y A;  3SET A;  3R7X A;  4DDD A;  3CSB A;  2XD2 A;  1H76 A;  4AB6 A;  4XTC Q;  2D3I A;  2QJE A;  2NWJ A;  1WDN A;  3RY3 A;  3EHU A;  4F1V A;  2NVU B;  4F1U A;  4QSD A;  1MY1 A;  4PET A;  4YAH X;  5I57 B;  4H1X A;  1US4 A;  2AL5 A;  1R9Q A;  3JZJ A;  3SEX A;  2H25 A;  3KJ7 A;  2XXY A;  2DP8 A;  2DQV A;  1B5I A;  3T9X B;  3EPE A;  3MVY A;  2ZYN A;  4OQO A;  4YKJ A;  1HSE A;  2ZNU A;  2UYF A;  2ABH A;  2PVU A;  1S50 A;  4M4G A;  1US5 A;  4JDF A;  3Q28 A;  2F5X A;  4YKP A;  1B4H A;  3ILT B;  4YB6 A;  3M8U A;  4U21 A;  2OWS A;  4IO5 A;  4OET A;  5AA2 B;  5B7D A;  1DPP A;  3V89 B;  3N6U A;  2G29 A;  1FQC A;  2PT1 A;  4LVQ A;  1PBP A;  2F7A A;  1PB7 A;  1AH5 A;  3IR1 A;  4DXC A;  4N13 A;  4U2R A;  5CBS A;  4M1V A;  5TPA A;  4OZ9 A;  3KG2 A;  3CSG A;  5EYF A;  1F9B A;  2ZXT A;  1B05 A;  2XXU A;  3K6X A;  3G3H A;  3MW0 A;  4HCW A;  5DEX A;  2XXP A;  1I69 A;  3DP6 A;  2ANJ A;  2AYS A;  3PUW E;  1JQF A;  3CFL A;  4G68 B;  3FD3 A;  4LAT A;  1M5D A;  5ITP A;  3JYR A;  4LUB A;  5H8N A;  3BFT A;  4GL8 A;  5CMC A;  2PT2 A;  3FAT A;  2GH9 A;  3T66 A;  3TTK A;  3LUY A;  3EHS A;  2HXW A;  5H8H B;  4ZED A;  1B52 A;  3MP8 A;  2ONR A;  3RNN A;  1MDP 1;  2XX8 A;  3BBR A;  1JW1 A;  3TZA A;  4RYA A;  4F39 A;  3IK6 B;  2UXA A;  2V3Q A;  1BLF A;  3SEV A;  4WEP A;  3HST A;  2O69 A;  2F6P A;  1USY E;  3OEL A;  4U4X A;  4ESW A;  1CB6 A;  1HSJ A;  2Y7I A;  3TYH A;  2X7Q A;  4HW8 A;  4DE8 A;  2CMO A;  1JVY A;  3PMV A;  2ONK E;  2RCA A;  1D9V A;  1N7W A;  4Q0C A;  3OXN A;  3DP4 A;  4YMB A;  5H8Q B;  3F11 A;  3ZS6 A;  3QK6 A;  1YPN A;  5F1Q A;  5CBR A;  2HQ0 A;  3ZSF A;  3QSL A;  1Y3N A;  1N3W A;  1T0K A;  3RPW A;  4GXA A;  2H5Y A;  3U92 A;  2I49 A;  5AA4 A;  3R26 A;  2VP1 A;  1XS5 A;  3FXR A;  3VLV A;  1H3D A;  3DM0 A;  3V5A A;  4F29 A;  4DXU A;  5I59 B;  2Z23 A;  3Q26 A;  1B7U A;  3E9X A;  3MQ9 A;  3Q27 A;  1Q35 A;  3HCQ A;  2Y7K A;  4ZEK A;  4U22 A;  4R2F A;  2NUV A;  1Y1M A;  1SI1 A;  1JET A;  3EF7 A;  1UIU A;  2XXX A;  2XD3 A;  4ZEC A;  4E0W A;  3CR9 A;  1LGB C;  1MY3 A;  2OCU A;  1NH8 A;  2UVJ A;  1JW4 A;  3PUX E;  3O6G A;  3THI A;  3V83 A;  2Z8F A;  1BP5 A;  1QVS A;  3K0V A;  2DS9 A;  3H6V A;  4AB5 A;  2DWJ A;  1J1N A;  5KCJ A;  5H8F B;  4ZZA A;  2DYX A;  2GFE A;  4EXL A;  4NF8 B;  4PFU A;  4DZ1 A;  4NF5 A;  4I8C A;  1LAH E;  4X1B A;  2IEE A;  3C36 A;  5DVF A;  5BWJ A;  4FJP A;  4PQJ A;  3IB2 A;  3N94 A;  4F18 A;  2PYY A;  1MPB A;  1NNP A;  2B65 A;  1POT A;  4RXL A;  3LR1 A;  1A54 A;  5TP9 B;  2XXH A;  5CMM A;  1LAF E;  4E0X A;  3H06 B;  4JWX A;  2DE3 A;  4R6H A;  3Q29 A;  1B32 A;  4XKP A;  4TOZ A;  4YB5 A;  2P0S A;  1IEJ A;  2A5S A;  3GBA A;  2OWT A;  3MVW A;  4R74 A;  1ZU0 A;  4LQ2 A;  2R9J A;  1MPD A;  4HS7 A;  1DTZ A;  3T22 A;  4GRK A;  1RYO A;  4HTG A;  3G3G A;  4GFR A;  2F7B A;  3PU5 A;  3A3U A;  3C4M A;  1Y1Z A;  1VFE A;  4THI A;  5DVI A;  1II5 A;  1AMF A;  1B3H A;  2Q9T A;  3TAJ A;  4OXV A;  1I6Q A;  3R6U A;  1UTB B;  1B40 A;  5L9M A;  3WAF A;  4QFO A;  5I2K A;  1MRP A;  3IAZ A;  3TQW A;  3OSQ A;  4PP0 A;  3CI8 A;  1B7H A;  3ECR A;  2Q2A A;  1ATG A;  3MUQ A;  1R6Z A;  2REJ A;  1PDA A;  2B3F A;  1MY2 A;  2ZYO A;  2ZNT A;  3MZ1 A;  4Q30 B;  2DXY A;  4H8J A;  4NF4 B;  2XXT A;  4G77 A;  1JW5 A;  5IAI A;  4UA8 A;  5KDT A;  3CIJ A;  3TMG A;  3MVZ A;  4RNS A;  1B0H A;  3O66 A;  2M8C A;  4IO2 A;  1DMB A;  2P1S A;  4ZZE A;  2KLF A;  1UTH A;  1EZO A;  1D4N A;  3KSX A;  2XXI A;  4FAT A;  4R6K A;  3T9V A;  3UIF A;  4ELQ A;  1FTM A;  1B6H A;  4MBP A;  3D4G A;  3PMW A;  4NMY A;  2I58 A;  2Y7R A;  1OVT A;  3JV9 A;  4QFL A;  2CZL A;  4YIC A;  1MQJ A;  2I4C A;  3OEN A;  5ITO A;  4G8N A;  1MPC A;  3MAM A;  4N6P A;  3T9H B;  3OO9 A;  3UOR A;  1MDQ A;  2DWI A;  2RC9 A;  2UYE A;  3MZB A;  2QS2 A;  3OO7 A;  5J1D A;  1A99 A;  4U1Z A;  4LZ5 A;  2X7P A;  2XXQ A;  2HZL A;  2F97 A;  3I6V A;  3TTL A;  5ICQ A;  5K2X A;  2P2A A;  4U23 A;  3K1N A;  4ZEI A;  4KYD A;  1SYI A;  4ESX A;  1YCJ A;  4PFY A;  2QS4 A;  4POX A;  2A5T A;  4IB2 A;  3RUM A;  4C0R A;  4EXK A;  1B58 A;  5KZT A;  3PPN A;  4FAJ A;  1MY0 A;  3L6H A;  4G68 C;  3PPR A;  1NH7 A;  3KN3 A;  3I5O A;  5FHN A;  3A3C A;  3SEU A;  1OQG A;  3RT6 B;  3VVD A;  4Q8R A;  1SW4 A;  5EHM A;  5I56 A;  1AIV A;  4DCY A;  1FQB A;  4POW A;  2I3V A;  2H99 A;  5ICT A;  4GVO A;  1NFT A;  1MG1 A;  4F22 A;  3IOT A;  3LC8 A;  1MXZ A;  2GRV A;  3PUZ E;  4F19 A;  4WKM A;  1TFD A;  3P7I A;  3PUV E;  2Q2C A;  2ALU A;  3MPL A;  2I0C A;  4Z0I A;  1Y9U A;  1MY4 A;  2XXV A;  4KYS A;  1NNK A;  3O28 A;  1JVX A;  2VOZ A;  1YAE A;  3ZKL A;  3S9N C;  1FTJ A;  3I3V A;  3IO6 A;  3SEW A;  2O84 X;  3HPI A;  2YLN A;  3FVN A;  1ZJL A;  2Z8D A;  4IY5 A;  4KCC A;  1Y20 A;  3UA8 A;  4ZE9 A;  3TCH A;  4FE8 A;  5A5X A;  5I58 B;  2PX1 A;  3TTR A;  3CRB A;  3CFZ A;  5B70 A;  3PMX A;  4GLI A;  5DTB A;  1ZLQ A;  2Y7P A;  5CMK A;  3LSX A;  4EF2 A;  3QYT A;  3O2A A;  4GL0 A;  5JTY B;  4IO3 A;  2DE2 A;  1WOD A;  4BDO A;  2DVC A;  2F34 A;  2QRY A;  1S9T A;  3OOA A;  5HPQ A;  2V84 A;  3O6I A;  3OO8 A;  4QHQ A;  3U94 A;  5CI5 A;  3C34 A;  1P1N A;  1B46 A;  1MQI A;  2Q88 A;  3C33 A;  1M5B A;  1ZIU A;  1OLA A;  4RK2 A;  2O7U A;  5I2N B;  2I3W A;  2X26 A;  1PB9 A;  2W7Y A;  3S4U A;  4GIZ A;  4YB7 A;  4KHZ E;  3EHT A;  1SVX B;  3ILU B;  3IL1 B;  3FZV A;  4GQO A;  3IB0 A;  4H5G A;  1I6A A;  2XXW A;  3OD7 A;  3TEP A;  1DSN A;  1QUL A;  4GXS B;  1A7L A;  3GXA A;  2R6G E;  5DVJ A;  4C1U A;  3FAS A;  3TEL A;  1SW5 A;  4P0I A;  1BKA A;  4ELP A;  2Z22 A;  4JWY A;  4MF3 A;  2THI A;  3QUF A;  2ZYM A;  3K6W A;  3SER A;  3PPP A;  4NF4 A;  4OVJ A;  3PV0 E;  2DSF A;  1B3G A;  1MXW A;  4IO6 A;  3UP9 A;  2WKY A;  2UVI A;  4OEU A;  4KR5 A;  4R73 A;  3M3K A;  2VD2 A;  3MC2 A;  1B51 A;  5F7V A;  3KN7 A;  4HCY A;  4LQ5 A;  1LFI A;  5FHO A;  4YKI A;  4JB7 A;  3TPA A;  2PBW A;  1GGG A;  4QFN A;  4RPN A;  2DXR A;  4TLL B;  3C32 A;  1B9J A;  1VR5 A;  3MJN A;  4PE5 B;  4OES A;  3RT8 A;  3LBS A;  4RPO A;  5JK4 A;  1D3K A;  4H0W A;  3IOV A;  4JBZ A;  1LLS A;  1XC1 A;  2RF1 A;  4NF6 A;  1A40 A;  3VVE A;  3C35 A;  3OSR A;  5DYH A;  2B3B A;  1LCT A;  3H03 A;  2E0S A;  3DEL B;  3K01 A;  3QUJ A;  2Z8E A;  1L5T A;  3B6Q A;  4H65 A;  3RLF E;  2UVG A;  2HAU A;  1NNT A;  1LB8 A;  1MM7 A;  3VDF A;  3PUY E;  3LSW A;  1OVB A;  2Q8J A;  2AIX A;  4G2Z A;  4H6D A;  4ZDM A;  5M2V A;  1LB9 A;  1N7X A;  3QXM A;  4OEV A;  4BDN A;  5ELV A;  5TPA B;  4P0G A;  4R72 A;  2QPQ A;  4ZS9 A;  1IUD A;  3H3G A;  5DEX B;  1SI0 A;  4R9F A;  2XX9 A;  5I57 A;  1IXI A;  1XT8 A;  4QFK A;  3K1P A;  4ONY A;  4TLM B;  5H8S A;  1UIV A;  5JEI A;  3VXB A;  2DWA A;  4NWC A;  1POY 1;  1XVY A;  2YJP A;  5H8N B;  3KOS A;  2O68 A;  4ECF A;  4G8M A;  3E4R A;  1S7Y A;  3S9L C;  2RIN A;  3IO4 A;  3G3K A;  3TTM A;  4EF1 A;  3USD A;  4UAC A;  2QMW A;  3MBP A;  3VXC A;  1OMP A;  2O1L A;  1N0T A;  3IB1 A;  3BKI B;  3GLB A;  1DPE A;  4MLQ A;  5AA2 A;  4MFI A;  3PPO A;  2D21 A;  4FED A;  4IY6 A;  1N04 A;  1P1U A;  1OQH A;  1A8F A;  3BFU A;  3KEI A;  4O3C A;  3FVG A;  2PMS A;  3FV2 A;  2HZK A;  2ONS A;  1PC3 A;  1EH3 A;  1XOC A;  4X9T A;  5IKB A;  2F78 A;  3GBB A;  3CVG A;  1P1O A;  2E1S A;  3FJG A;  3Q25 A;  4O3A A;  3RN8 A;  4XIG Q;  1B1H A;  5FTH A;  3ODB A;  4G68 A;  1Y4C A;  4ISU A;  4EQB A;  2H98 A;  5AA4 B;  1NNF A;  1IQ7 A;  3PGF A;  4F31 B;  1OLC A;  4I1D A;  2FYI A;  4BLA A; 
#chains in the Genus database with same CATH topology
 1VSO A;  3DLN A;  1RYX A;  3W9W A;  1JNF A;  1SW1 A;  5H8H A;  5J16 A;  1FBF A;  1ZBM A;  4LON B;  1FBH A;  1B3E A;  1B0L A;  3RYD A;  4JVD A;  2HFB A;  4DCX A;  3HHF A;  1HSL A;  1XHY A;  3PPQ A;  2Y5L A;  1SD3 A;  3LV0 A;  1FTL A;  2ZYK A;  3KFM A;  2Y7W A;  5ET8 A;  3KGC A;  2ZMB A;  3T9U A;  2OLB A;  5L9S A;  1SPI A;  5FTI A;  3MVX A;  3H6T A;  3MP1 A;  1M5F A;  3G3J A;  4AS4 A;  4H5F A;  1FTO A;  5CRY A;  5KCJ B;  1KA0 A;  1Q1K A;  1QUI A;  3FV1 A;  2NOO A;  4OER A;  4GX3 A;  1LBB A;  1B4Z A;  4MIJ A;  1Y3Q A;  1VFD A;  1ZKB A;  5AA3 A;  3LSL A;  3CG3 A;  2UVH A;  1QJM A;  1VE4 A;  1SDX A;  3HN0 A;  1K9Y A;  1URG A;  4Z7E A;  4ZEB A;  2HAV A;  3B6T A;  1NV7 A;  4H67 A;  3O29 A;  1KWH A;  1QKA A;  2DWH A;  4I3E A;  5IZ1 A;  5H8Q A;  3TUS A;  2RKM A;  4FIM A;  5HBC A;  5TU0 A;  2BJJ X;  3FUZ A;  3H7M A;  4BDR A;  4I9D A;  3SKP A;  3QIM A;  1O63 A;  1SYH A;  2QL3 A;  4GF8 A;  1LFH A;  1N84 A;  4XXU A;  3AXF A;  3IX1 A;  1FPL A;  2ZNS A;  1R9L A;  1MXY A;  3TOD A;  2QMX A;  1WVJ A;  3TCF A;  3VVF A;  2XHD A;  5I59 A;  1ZTY A;  4QSC A;  1LAG E;  1INP A;  3IJX B;  1MQG A;  1LCF A;  2OBG A;  1QUJ A;  3MZ9 A;  1DK4 A;  4ELR A;  1UQW A;  4LN5 A;  2O6A A;  1MQH A;  3EN3 A;  4OWD A;  4Q5T A;  4ZEF A;  4O94 A;  2NXO A;  4OVS A;  3C31 A;  5EHS A;  3TQL A;  1B5H A;  1M5E A;  4XKN A;  5H8F A;  5EQA A;  3B7D A;  1B3L A;  4LZ8 A;  2F3B A;  3C9H A;  2FNC A;  3MP6 A;  5I2K B;  1NKX A;  4OFL A;  1MXU A;  4NF8 A;  1SW2 A;  4OFJ A;  1O64 A;  4U4S A;  3KN8 A;  3H4Z A;  1NV3 A;  4NED A;  4YZZ A;  2I48 A;  3K6V A;  5CMB A;  2QVR A;  3OMB A;  3U93 A;  1FQF A;  5AA1 A;  3PTY A;  4G4P A;  5TP9 A;  4LZ7 A;  3PD8 A;  4FOR A;  1PBQ A;  1ANF A;  4LP2 B;  1N76 A;  3O9P A;  4MJO A;  5KDT B;  1EZ9 A;  5EYG A;  1DBZ A;  1EU8 A;  1QUK A;  3U1O A;  3K6U A;  4PF8 A;  5ISU A;  2B4L A;  4OTE A;  4X1D A;  1UTH B;  1DTG A;  3UGW A;  1YTV A;  1Y3P A;  4QRZ A;  2RCB A;  2OWZ A;  1EZP A;  4OVP A;  4P1E A;  4BDM A;  4IGT A;  3HV1 A;  4BDQ A;  2F6G A;  1OIB A;  5ET5 A;  4F2Q A;  1IMD A;  4P11 A;  2FA7 A;  2H9B A;  2Q8M A;  1FTK A;  4MEV A;  3K4U A;  3FBP A;  1MS7 A;  1GTK A;  2R71 A;  4ELO A;  1IMB A;  3LSF B;  5I84 A;  4NGU A;  2QSX A;  1FQD A;  3RPL B;  1UTB A;  3DP8 A;  2XWI A;  4RJZ A;  4GWO A;  5LDZ A;  3FVK A;  3KSJ A;  3V8X B;  4GD5 A;  4QSE A;  1R1N A;  1P1W A;  3TDJ A;  1JEU A;  1PEB A;  4GX4 A;  3HO7 A;  2HCA A;  3FIR A;  1RKM A;  3IJO B;  4ZE8 A;  2WYP A;  3O97 A;  4OA4 A;  4OHN A;  4WED A;  1FPJ A;  1B7Z A;  4O8M A;  1Z7N E;  3KBR A;  2A5T B;  3RGY A;  4PBQ A;  1ZMG A;  1GVC A;  1AOV A;  1H43 A;  3KJT A;  4IO4 A;  1TXF A;  2V3U A;  3IOR A;  2REG A;  4X8R A;  3ZKK A;  3KZG A;  5LTC A;  3E13 X;  1QKB A;  1Y4T A;  2G93 A;  1LBY A;  2VGQ A;  3KC0 A;  3VV5 A;  4XKQ A;  1IXG A;  3T1B A;  5I56 B;  4OEN A;  1B1X A;  5CM6 A;  1FQE A;  3H6U A;  3VLW A;  2OZZ A;  3D4C A;  3TCG A;  2HEU A;  4F3G A;  4AQ4 A;  1GR2 A;  4OYV A;  1D9Y A;  1QW0 A;  4N07 A;  5EQ8 A;  2Y84 A;  4EQ9 A;  1JEV A;  4NTL A;  2MKZ A;  1LBX A;  1KZ8 A;  1BIY A;  1GV8 A;  3L6G A;  1FW0 A;  1Z7M E;  4GBW A;  4HXV A;  1LFG A;  4L17 A;  4KYE A;  5L8D A;  1NV2 A;  2VPN A;  1LEV A;  4F3S A;  1PB8 A;  3O6H A;  1P1Q A;  4YU0 A;  3EQ1 A;  3IOW A;  3TFL A;  4F2O A;  4JXI A;  4O3B A;  3U65 A;  3IOU A;  4GOT A;  4LA9 A;  2DOJ A;  4R6Y A;  4OMB A;  1RDY A;  4NE4 A;  1AL3 A;  3G3I A;  4MLV A;  4R75 A;  1URS A;  1NUY A;  5HM4 B;  1MXV A;  4F3P A;  3VE1 B;  1IZ1 A;  2QS1 A;  5ET7 A;  3K02 A;  3IFA A;  1M5C A;  5FBP A;  5AE4 A;  4DLD A;  4I62 A;  2O1M A;  4U1O A;  3K00 A;  1NMU A;  4N4U A;  3EKI A;  3FXU A;  4DI3 D;  4K3F A;  5A5X B;  1MH4 A;  4KPT A;  4C1T A;  4PFT A;  2JJK A;  5I5P A;  1FQA A;  4OFO A;  2FHY A;  4PGP A;  2RC8 A;  1G0H A;  4DXB A;  1Q9D A;  1LBW A;  2GHB A;  3RTF B;  3B6W A;  3CFX A;  4TQU Q;  1EYK A;  1MM6 A;  1TT1 A;  4PFW A;  2LAO A;  5CC2 A;  3QAX A;  4I40 A;  3VFJ A;  1MH3 A;  4EUO A;  3S9M C;  1MQD A;  2F8D A;  3WAE A;  2CZK A;  1URD A;  3FVO A;  2F7C A;  2V93 A;  3K1M A;  3G3F A;  1YXI A;  3MPK A;  4N8Y A;  1P99 A;  2RC7 A;  4R9G A;  1USY H;  2ZZW A;  4DIG A;  4GWW A;  1A55 A;  3OO6 A;  4WXJ A;  3RTW B;  4KD5 A;  4QFP A;  2I6E A;  2I0B A;  1IIW A;  2V3T A;  1DOT A;  3U8Q A;  1LBC A;  2V25 A;  4X48 A;  3K2D A;  1I6B A;  4EQ7 A;  2OJT A;  2AL4 A;  4RA1 A;  3BIG A;  4H8I A;  4ND9 A;  2ZZV A;  1B3F A;  4BDL A;  1NL5 A;  4KXP A;  2VD3 A;  3A09 A;  4RK9 A;  3UN6 A;  4FEB A;  2DE4 A;  2OK2 A;  5DT6 A;  3N26 A;  4EDP A;  3FJ7 A;  4YMA A;  1H44 A;  3MWB A;  4KQP A;  4N15 A;  3S2V A;  5I58 A;  3SDF A;  3SEY A;  1BTJ A;  4QXD A;  4KCD A;  5K2Y A;  1LST A;  2XX7 A;  3T93 B;  3M3F A;  4G8H A;  4JVC A;  3RQT A;  3H6W A;  2ESN A;  2DVZ A;  4JSD A;  4QF9 A;  1LAX A;  4F3B A;  1CE2 A;  4PAI A;  4GWS A;  1NUX A;  4FEC A;  5JTY A;  1O7T A;  3W15 C;  4NWD A;  5LOM A;  3E3K A;  3OEK A;  1MXX A;  4RY1 A;  3A29 A;  3TTN A;  2HHM A;  3T96 B;  3S9E A;  3FXB A;  2VHA A;  4KFQ A;  2O51 A;  1FCK A;  1N3X A;  3FJM A;  1TFA A;  3KOT A;  1IXC A;  4JSO A;  4KI0 E;  1NUW A;  2GHA A;  5AA2 D;  4IGR A;  3KC1 A;  5I2N A;  1IIT A;  3UK4 A;  1SQY A;  1ELJ A;  4XKR A;  4JWO A;  1SBP A;  5A5L A;  1TWY A;  3N6T A;  2PCR A;  1B5J A;  1NV5 A;  2Q89 A;  2Q74 A;  4NF6 B;  3VLU A;  3TKD A;  4MNC A;  2IA4 A;  5BUU A;  3G7W A;  1AWB A;  3CG1 A;  2YPN A;  3N5L A;  2XXR A;  3ONM A;  5FHM A;  2I4B A;  2D5W A;  1QGX A;  2F36 A;  1FPI A;  4NF5 B;  2F35 A;  3OEM A;  3SES A;  1LBZ A;  3HHG A;  2XXK A;  4P9K A;  3U72 A;  1B2H A;  3M3L A;  3FGS A;  4IO7 A;  3MST A;  4NG7 A;  1IXH A;  2OX3 A;  3GZG A;  3W9V A;  5L9O A;  3ROJ A;  1A8E A;  4R2B A;  2O7I A;  3FXQ A;  3PD9 A;  4YKK A;  4MH5 A;  2H4I A;  1XVX A;  1H45 A;  2QS3 A;  4F1Y A;  3SET A;  3R7X A;  4DDD A;  3CSB A;  2XD2 A;  1H76 A;  4AB6 A;  4XTC Q;  1XI6 A;  2L5V A;  4X04 A;  2D3I A;  2QJE A;  2NWJ A;  1WDN A;  3RY3 A;  3EHU A;  2WYK A;  4F1V A;  2NVU B;  4F1U A;  4QSD A;  1MY1 A;  4PET A;  4YAH X;  5I57 B;  4H1X A;  1US4 A;  2PFZ A;  3HFU A;  2AL5 A;  1R9Q A;  3JZJ A;  3SEX A;  2H25 A;  4OAN A;  3KJ7 A;  2XXY A;  2KR0 A;  2DP8 A;  2DQV A;  1B5I A;  3T9X B;  1IMA A;  3B50 A;  3EPE A;  3MVY A;  1LBV A;  2ZYN A;  4AS5 A;  4OQO A;  4YKJ A;  1HSE A;  2ZNU A;  2UYF A;  1BK4 A;  2ABH A;  2PVU A;  1S50 A;  4M4G A;  1US5 A;  4JDF A;  3Q28 A;  5EQ9 A;  2F5X A;  4YKP A;  1B4H A;  3ILT B;  1FPG A;  4YB6 A;  3M8U A;  4U21 A;  2OWS A;  4IO5 A;  4OET A;  5AA2 B;  5B7D A;  1DPP A;  3V89 B;  3N6U A;  1FTA A;  5IZ3 A;  2G29 A;  3ISP A;  1FQC A;  2PT1 A;  5I3S A;  4PF6 A;  1CNQ A;  4LVQ A;  3T0J A;  1PBP A;  2F7A A;  4G61 A;  1PB7 A;  1AH5 A;  2CZH A;  3IR1 A;  4DXC A;  4N13 A;  1FBG A;  4U2R A;  5CBS A;  4M1V A;  5TPA A;  4OZ9 A;  3KG2 A;  3CSG A;  5EYF A;  1F9B A;  5IM2 A;  2ZXT A;  1FPB A;  1B05 A;  2XXU A;  3K6X A;  3G3H A;  3MW0 A;  4HCW A;  5DEX A;  2XXP A;  1I69 A;  3DP6 A;  2CZI A;  2ANJ A;  2AYS A;  3PUW E;  1JQF A;  3CFL A;  4G68 B;  3FD3 A;  4LAT A;  1M5D A;  5ITP A;  5DW8 A;  5F24 A;  3JYR A;  4LUB A;  5H8N A;  3BFT A;  4GL8 A;  5CMC A;  2PT2 A;  3FAT A;  3E78 A;  2FIE A;  2GH9 A;  3T66 A;  3TTK A;  3LUY A;  3EHS A;  2HXW A;  5H8H B;  3B8B A;  4NQ8 A;  4ZED A;  1B52 A;  3MP8 A;  2ONR A;  3RNN A;  1MDP 1;  2XX8 A;  3BBR A;  1JW1 A;  3TZA A;  2Y5K A;  4RYA A;  4PTK A;  2V4C A;  1FPK A;  4F39 A;  3IK6 B;  2UXA A;  3KBZ A;  2V3Q A;  1BLF A;  3SEV A;  4WEP A;  5EYH A;  1YZ0 A;  3HST A;  2O69 A;  2F6P A;  1USY E;  2WBD A;  3OEL A;  4U4X A;  4ESW A;  1CB6 A;  1HSJ A;  4P1L A;  2Y7I A;  3TYH A;  2X7Q A;  4HW8 A;  4DE8 A;  2CMO A;  1JVY A;  3PMV A;  1RDX A;  2ONK E;  2RCA A;  1D9V A;  1N7W A;  4Q0C A;  3OXN A;  3DP4 A;  4YMB A;  5H8Q B;  3F11 A;  3ZS6 A;  3QK6 A;  1YPN A;  5F1Q A;  5CBR A;  2HQ0 A;  3ZSF A;  3SZP A;  3QSL A;  1Y3N A;  2XA5 A;  1N3W A;  1T0K A;  3RPW A;  4GXA A;  2H5Y A;  3U92 A;  2I49 A;  5AA4 A;  3R26 A;  2VP1 A;  1XS5 A;  2FVZ A;  3FXR A;  3VLV A;  1H3D A;  3DM0 A;  3V5A A;  4F29 A;  4DXU A;  5I59 B;  2Z23 A;  2VT5 A;  3Q26 A;  1B7U A;  4NX1 A;  3E9X A;  3MQ9 A;  3Q27 A;  1Q35 A;  3HCQ A;  2Y7K A;  4ZEK A;  4U22 A;  4R2F A;  2NUV A;  3GYY A;  1Y1M A;  1SI1 A;  1JET A;  3EF7 A;  1UIU A;  2XXX A;  2XD3 A;  4MX6 A;  4ZEC A;  4E0W A;  3CR9 A;  1LGB C;  1MY3 A;  4I3Y A;  2OCU A;  1NH8 A;  2UVJ A;  1JW4 A;  3PUX E;  3O6G A;  3THI A;  3V83 A;  2Z8F A;  4PAF A;  1BP5 A;  1QVS A;  3K0V A;  2DS9 A;  3H6V A;  4AB5 A;  2DWJ A;  4GWU A;  1J1N A;  5KCJ A;  5H8F B;  4ZZA A;  2DYX A;  2GFE A;  4EXL A;  4NF8 B;  4PFU A;  4DZ1 A;  4NF5 A;  4I8C A;  1LAH E;  4X1B A;  2IEE A;  3C36 A;  5DVF A;  5BWJ A;  4FJP A;  1FBD A;  4PQJ A;  3IB2 A;  3N94 A;  4F18 A;  2PYY A;  1MPB A;  4OVQ A;  1NNP A;  2B65 A;  4HE1 A;  1POT A;  4RXL A;  3LR1 A;  1A54 A;  5TP9 B;  2XXH A;  5CMM A;  1LAF E;  4E0X A;  3H06 B;  2QVU A;  4JWX A;  2DE3 A;  4R6H A;  3Q29 A;  1B32 A;  4XKP A;  4TOZ A;  4YB5 A;  2FIX A;  4PGN A;  2P0S A;  1IEJ A;  3CHG A;  4GWY A;  4PFB A;  1FJ9 A;  2A5S A;  3GBA A;  2OWT A;  3MVW A;  1YYZ A;  4R74 A;  1ZU0 A;  3E79 A;  4LQ2 A;  1NUZ A;  2R9J A;  1MPD A;  4HS7 A;  5EQ7 A;  2HXR A;  4QBA A;  1DTZ A;  3T22 A;  4GRK A;  1RYO A;  3D1R A;  4HTG A;  2F3D A;  2GQ1 A;  3G3G A;  4GFR A;  2F7B A;  3PU5 A;  3A3U A;  3C4M A;  2XWV A;  1Y1Z A;  1VFE A;  4THI A;  5DVI A;  1II5 A;  1AMF A;  4MAG A;  1B3H A;  2Q9T A;  3TAJ A;  2QVV A;  4P8B A;  4OXV A;  4PAK A;  1I6Q A;  3R6U A;  1UTB B;  1B40 A;  5L9M A;  5IZZ A;  3WAF A;  4QFO A;  5I2K A;  1MRP A;  3IAZ A;  3TQW A;  2PFY A;  3OSQ A;  4PP0 A;  3CI8 A;  1B7H A;  3ECR A;  2Q2A A;  1ATG A;  3MUQ A;  4O7M A;  1R6Z A;  2REJ A;  1PDA A;  4DI4 B;  2B3F A;  1EYJ A;  1MY2 A;  2ZYO A;  2ZNT A;  3MZ1 A;  4Q30 B;  2DXY A;  4H8J A;  4NF4 B;  2XXT A;  4G77 A;  1JW5 A;  5IAI A;  4UA8 A;  4UAB A;  5KDT A;  3CIJ A;  2R8T A;  3TMG A;  3MVZ A;  2VPO A;  4RNS A;  3NOH A;  4MNI A;  1B0H A;  3O66 A;  2M8C A;  4IO2 A;  1DMB A;  2P1S A;  4ZZE A;  2KLF A;  1UTH A;  1EZO A;  1D4N A;  1EYI A;  3KSX A;  1FBC A;  2XXI A;  4FAT A;  4JVI A;  4R6K A;  3T9V A;  3UIF A;  1NV0 A;  4ELQ A;  1FTM A;  1B6H A;  2XWK A;  4MBP A;  1JP4 A;  3D4G A;  3PMW A;  4NMY A;  2I58 A;  2Y7R A;  1OVT A;  3JV9 A;  4QFL A;  2CZL A;  4YIC A;  1IMC A;  4N17 A;  1MQJ A;  2I4C A;  1FPE A;  3OEN A;  4H46 A;  5ITO A;  4G8N A;  3RPL A;  1MPC A;  3MAM A;  4N6P A;  3T9H B;  3OO9 A;  3UOR A;  1MDQ A;  2DWI A;  2RC9 A;  2WX9 A;  2UYE A;  3MZB A;  2QS2 A;  3OO7 A;  5J1D A;  1A99 A;  4U1Z A;  4LZ5 A;  2X7P A;  2XXQ A;  2HZL A;  2F97 A;  4PCD A;  3I6V A;  3TTL A;  5ICQ A;  4XF5 A;  5K2X A;  4NF0 A;  2P2A A;  4NN3 A;  4U23 A;  3K1N A;  4PBH A;  4ZEI A;  4KYD A;  1SYI A;  4ESX A;  1YCJ A;  4PFY A;  2QS4 A;  4POX A;  5ESY A;  2A5T A;  4IB2 A;  3RUM A;  4C0R A;  4EXK A;  1B58 A;  5KZT A;  3PPN A;  4FAJ A;  1NI9 A;  1MY0 A;  3L6H A;  4G68 C;  3PPR A;  1NH7 A;  3KN3 A;  4MHF A;  2DDK A;  3I5O A;  5FHN A;  3A3C A;  1NV1 A;  4PDD A;  3SEU A;  1OQG A;  3RT6 B;  3VVD A;  5I7I A;  4Q8R A;  1SW4 A;  5EHM A;  5I56 A;  1AIV A;  4DCY A;  1FQB A;  4NAP A;  2CEX A;  4POW A;  2I3V A;  2H99 A;  5ICT A;  4GVO A;  3BIH A;  1NFT A;  4PC9 A;  1MG1 A;  4F22 A;  3IOT A;  3LC8 A;  1MXZ A;  2GRV A;  3PUZ E;  4F19 A;  4WKM A;  1TFD A;  3P7I A;  3PUV E;  1FBE A;  2Q2C A;  4PDH A;  2ALU A;  3MPL A;  2I0C A;  4Z0I A;  1Y9U A;  1MY4 A;  4NHB A;  2XXV A;  4KYS A;  1NNK A;  3O28 A;  1JVX A;  2VOZ A;  1YAE A;  3ZKL A;  3S9N C;  1FTJ A;  3I3V A;  3IO6 A;  3SEW A;  2O84 X;  3HPI A;  2YLN A;  3FVN A;  1ZJL A;  2Z8D A;  4IY5 A;  3MYU A;  4KCC A;  1Y20 A;  3UA8 A;  4ZE9 A;  3TCH A;  4FE8 A;  4P47 A;  5A5X A;  5I58 B;  2PX1 A;  3TTR A;  3CRB A;  3CFZ A;  5B70 A;  3PMX A;  4GLI A;  1D9Q A;  5DTB A;  2ZZX A;  1ZLQ A;  2Y7P A;  5CMK A;  4PE3 A;  3LSX A;  4EF2 A;  3QYT A;  3O2A A;  5T3J A;  4GL0 A;  5JTY B;  4IO3 A;  2DE2 A;  1WOD A;  4BDO A;  1FPD A;  2DVC A;  2F34 A;  2QRY A;  1S9T A;  1FSA A;  3OOA A;  5HPQ A;  2V84 A;  3O6I A;  3OO8 A;  4QHQ A;  3U94 A;  5CI5 A;  3C34 A;  1P1N A;  1B46 A;  1MQI A;  2Q88 A;  3C33 A;  4N6D A;  4P56 A;  1M5B A;  1ZIU A;  1OLA A;  4RK2 A;  2O7U A;  5I2N B;  1G0I A;  1NV6 A;  2I3W A;  2X26 A;  2WEF A;  3IFC A;  1PB9 A;  2W7Y A;  4XEQ A;  3S4U A;  4GIZ A;  4YB7 A;  4KHZ E;  3EHT A;  4GWZ A;  1SVX B;  2HPG A;  3ILU B;  3IL1 B;  3FZV A;  4GQO A;  3IB0 A;  4H5G A;  1I6A A;  2XXW A;  3OD7 A;  3TEP A;  1DSN A;  1QUL A;  4GXS B;  1A7L A;  3GXA A;  2R6G E;  5DVJ A;  4C1U A;  1K9Z A;  3FAS A;  3TEL A;  2KQZ A;  1SW5 A;  4P0I A;  1BKA A;  4ELP A;  2Z22 A;  1FJ6 A;  4JWY A;  4MF3 A;  2THI A;  4OVT A;  3QUF A;  2WBB A;  2ZYM A;  3K6W A;  3SER A;  3PPP A;  4NF4 A;  4OVJ A;  3PV0 E;  2XWO A;  1KA1 A;  2DSF A;  1B3G A;  1MXW A;  4IO6 A;  3UP9 A;  2WKY A;  2UVI A;  4OEU A;  4KR5 A;  4R73 A;  3M3K A;  2VD2 A;  3MC2 A;  1B51 A;  5F7V A;  3KN7 A;  4HCY A;  4LQ5 A;  1LFI A;  5FHO A;  4YKI A;  4JB7 A;  3TPA A;  4FBP A;  4OVR A;  2PBW A;  1GGG A;  4XFE A;  4QFN A;  1IME A;  4RPN A;  1NV4 A;  2DXR A;  4TLL B;  3C32 A;  1B9J A;  1VR5 A;  3MJN A;  4PE5 B;  4OES A;  3RT8 A;  3LBS A;  4RPO A;  4MMP A;  5JK4 A;  4N6K A;  1D3K A;  4H0W A;  3IOV A;  4JBZ A;  1LLS A;  1XC1 A;  2RF1 A;  4NF6 A;  1A40 A;  3VVE A;  3C35 A;  3OSR A;  2BJI A;  5DYH A;  2B3B A;  1LCT A;  3H03 A;  2E0S A;  3DEL B;  4P3L A;  3K01 A;  3QUJ A;  2Z8E A;  1RDZ A;  1L5T A;  2P3N A;  3B6Q A;  4H65 A;  4GBV A;  3RLF E;  2UVG A;  4MNP A;  2HAU A;  1NNT A;  1LB8 A;  4IR8 A;  1MM7 A;  3VDF A;  2P3V A;  3PUY E;  4PFR A;  3LSW A;  1OVB A;  2Q8J A;  5IZ3 B;  2AIX A;  4G2Z A;  4H6D A;  4ZDM A;  5M2V A;  1LB9 A;  1N7X A;  3QXM A;  1IMF A;  4OEV A;  4BDN A;  5ELV A;  5TPA B;  4MCO A;  4P0G A;  4R72 A;  2QPQ A;  4ZS9 A;  1IUD A;  3H3G A;  1VDW A;  5DEX B;  1SI0 A;  4R9F A;  2XX9 A;  4GWX A;  5I57 A;  1IXI A;  2FBP A;  1XT8 A;  4QFK A;  3K1P A;  4ONY A;  4TLM B;  5H8S A;  1UIV A;  5JEI A;  3VXB A;  2DWA A;  4HE2 A;  5IGA A;  4NWC A;  1POY 1;  1XVY A;  2YJP A;  5H8N B;  3KOS A;  2O68 A;  4ECF A;  4G8M A;  3E4R A;  1S7Y A;  3S9L C;  2RIN A;  3IO4 A;  3G3K A;  4O7I A;  3TTM A;  4EF1 A;  3USD A;  4UAC A;  2QMW A;  3LUZ A;  3MBP A;  3VXC A;  4HE0 A;  1OMP A;  2O1L A;  1N0T A;  4N81 A;  3IB1 A;  3BKI B;  3GLB A;  1DPE A;  4MLQ A;  5AA2 A;  4MFI A;  3PPO A;  2D21 A;  4FED A;  4IY6 A;  1N04 A;  1P1U A;  1OQH A;  1A8F A;  3BFU A;  3KEI A;  1DCU A;  4O3C A;  3FVG A;  2PMS A;  4PFI A;  3FV2 A;  2HZK A;  2ONS A;  1PC3 A;  1EH3 A;  1FPF A;  1XOC A;  4X9T A;  5IKB A;  2F78 A;  1FBP A;  3GBB A;  3CVG A;  1P1O A;  2QFL A;  2B4M A;  1FRP A;  2CEY A;  2E1S A;  3FJG A;  3QMF A;  3Q25 A;  4O3A A;  3RN8 A;  4XIG Q;  1B1H A;  4H45 A;  5FTH A;  3ODB A;  4G68 A;  1Y4C A;  4ISU A;  4N91 A;  4EQB A;  4GX6 A;  2H98 A;  5AA4 B;  1NNF A;  1IQ7 A;  3PGF A;  5ET6 A;  4F31 B;  4N8G A;  1OLC A;  4I1D A;  2FYI A;  4BLA A; 
#chains in the Genus database with same CATH homology
 1VSO A;  3DLN A;  1RYX A;  3W9W A;  1JNF A;  1SW1 A;  5H8H A;  1ZBM A;  4LON B;  1B3E A;  1B0L A;  2HFB A;  4DCX A;  3HHF A;  1HSL A;  1XHY A;  3PPQ A;  1SD3 A;  3KFM A;  1FTL A;  2ZYK A;  2Y7W A;  3KGC A;  2ZMB A;  3T9U A;  2OLB A;  5L9S A;  5FTI A;  3MVX A;  3H6T A;  3MP1 A;  1M5F A;  3G3J A;  4H5F A;  1FTO A;  5CRY A;  5KCJ B;  1Q1K A;  1QUI A;  3FV1 A;  2NOO A;  4OER A;  1LBB A;  1B4Z A;  1Y3Q A;  1VFD A;  1ZKB A;  5AA3 A;  3LSL A;  3CG3 A;  2UVH A;  1QJM A;  1VE4 A;  1SDX A;  3HN0 A;  1URG A;  4Z7E A;  4ZEB A;  2HAV A;  3B6T A;  4H67 A;  3O29 A;  1KWH A;  1QKA A;  2DWH A;  5H8Q A;  3TUS A;  2RKM A;  4FIM A;  5HBC A;  5TU0 A;  2BJJ X;  3FUZ A;  3H7M A;  4BDR A;  4I9D A;  3SKP A;  3QIM A;  1O63 A;  1SYH A;  2QL3 A;  4GF8 A;  1LFH A;  1N84 A;  4XXU A;  3AXF A;  3IX1 A;  2ZNS A;  1R9L A;  1MXY A;  3TOD A;  2QMX A;  1WVJ A;  3TCF A;  3VVF A;  2XHD A;  5I59 A;  1ZTY A;  4QSC A;  1LAG E;  3IJX B;  1MQG A;  1LCF A;  2OBG A;  1QUJ A;  3MZ9 A;  4ELR A;  1UQW A;  2O6A A;  1MQH A;  3EN3 A;  4OWD A;  4Q5T A;  4ZEF A;  2NXO A;  3C31 A;  5EHS A;  3TQL A;  1B5H A;  1M5E A;  4XKN A;  5H8F A;  3B7D A;  1B3L A;  4LZ8 A;  3C9H A;  2FNC A;  3MP6 A;  5I2K B;  1NKX A;  4OFL A;  1MXU A;  4NF8 A;  1SW2 A;  4OFJ A;  1O64 A;  4U4S A;  3KN8 A;  3H4Z A;  4NED A;  4YZZ A;  2I48 A;  3K6V A;  5CMB A;  3OMB A;  3U93 A;  1FQF A;  5AA1 A;  4G4P A;  5TP9 A;  4LZ7 A;  3PD8 A;  4FOR A;  1PBQ A;  1ANF A;  4LP2 B;  1N76 A;  3O9P A;  5KDT B;  1EZ9 A;  1EU8 A;  1QUK A;  3U1O A;  3K6U A;  5ISU A;  4OTE A;  4X1D A;  1UTH B;  1DTG A;  3UGW A;  1YTV A;  1Y3P A;  4QRZ A;  2RCB A;  1EZP A;  4BDM A;  4IGT A;  3HV1 A;  4BDQ A;  2F6G A;  1OIB A;  4F2Q A;  4P11 A;  2FA7 A;  2H9B A;  1FTK A;  3K4U A;  1MS7 A;  1GTK A;  2R71 A;  4ELO A;  3LSF B;  5I84 A;  2QSX A;  1FQD A;  1UTB A;  3DP8 A;  4RJZ A;  4GWO A;  3FVK A;  3KSJ A;  3V8X B;  4GD5 A;  4QSE A;  1R1N A;  1P1W A;  3TDJ A;  1JEU A;  1PEB A;  3HO7 A;  2HCA A;  3FIR A;  1RKM A;  3IJO B;  4ZE8 A;  3O97 A;  4OHN A;  4WED A;  1B7Z A;  1Z7N E;  3KBR A;  2A5T B;  3RGY A;  1ZMG A;  1GVC A;  1AOV A;  1H43 A;  3KJT A;  4IO4 A;  1TXF A;  2V3U A;  3IOR A;  2REG A;  3ZKK A;  3KZG A;  3E13 X;  1QKB A;  1Y4T A;  2G93 A;  2VGQ A;  3VV5 A;  4XKQ A;  1IXG A;  5I56 B;  4OEN A;  1B1X A;  5CM6 A;  1FQE A;  3H6U A;  3VLW A;  2OZZ A;  3D4C A;  3TCG A;  2HEU A;  4F3G A;  4AQ4 A;  1GR2 A;  4OYV A;  1D9Y A;  1QW0 A;  4N07 A;  2Y84 A;  4EQ9 A;  1JEV A;  4NTL A;  1BIY A;  1GV8 A;  3L6G A;  1FW0 A;  1Z7M E;  5L8D A;  1LFG A;  4L17 A;  4KYE A;  4F3S A;  1PB8 A;  3O6H A;  1P1Q A;  4YU0 A;  3EQ1 A;  3IOW A;  3TFL A;  4F2O A;  4JXI A;  4O3B A;  3IOU A;  4GOT A;  4LA9 A;  2DOJ A;  4R6Y A;  4OMB A;  4NE4 A;  1AL3 A;  3G3I A;  4MLV A;  4R75 A;  1URS A;  5HM4 B;  1MXV A;  4F3P A;  3VE1 B;  1IZ1 A;  2QS1 A;  3K02 A;  1M5C A;  5AE4 A;  4DLD A;  4I62 A;  2O1M A;  4U1O A;  3K00 A;  1NMU A;  3FXU A;  4K3F A;  5A5X B;  1MH4 A;  4KPT A;  4C1T A;  4PFT A;  1FQA A;  4OFO A;  2RC8 A;  4DXB A;  2GHB A;  3RTF B;  3B6W A;  3CFX A;  4TQU Q;  1MM6 A;  1TT1 A;  4PFW A;  2LAO A;  5CC2 A;  3QAX A;  3VFJ A;  1MH3 A;  4EUO A;  3S9M C;  1MQD A;  2F8D A;  3WAE A;  1URD A;  3FVO A;  2F7C A;  2V93 A;  3K1M A;  3G3F A;  3MPK A;  1P99 A;  2RC7 A;  4R9G A;  1USY H;  4DIG A;  1A55 A;  3OO6 A;  4WXJ A;  3RTW B;  4KD5 A;  4QFP A;  2I6E A;  2I0B A;  1IIW A;  2V3T A;  1DOT A;  3U8Q A;  1LBC A;  2V25 A;  4X48 A;  3K2D A;  1I6B A;  4EQ7 A;  2OJT A;  2AL4 A;  4RA1 A;  4H8I A;  4ND9 A;  1B3F A;  4BDL A;  1NL5 A;  2VD3 A;  3A09 A;  4RK9 A;  3UN6 A;  4FEB A;  2DE4 A;  2OK2 A;  5DT6 A;  3N26 A;  4EDP A;  3FJ7 A;  4YMA A;  1H44 A;  3MWB A;  4KQP A;  3S2V A;  5I58 A;  3SDF A;  3SEY A;  1BTJ A;  4KCD A;  5K2Y A;  1LST A;  2XX7 A;  3T93 B;  3M3F A;  4G8H A;  3RQT A;  3H6W A;  2ESN A;  2DVZ A;  4JSD A;  4QF9 A;  1LAX A;  4F3B A;  1CE2 A;  4FEC A;  5JTY A;  1O7T A;  3W15 C;  4NWD A;  5LOM A;  3E3K A;  3OEK A;  1MXX A;  4RY1 A;  3TTN A;  3T96 B;  3S9E A;  2VHA A;  4KFQ A;  2O51 A;  1FCK A;  1N3X A;  3FJM A;  1TFA A;  3KOT A;  1IXC A;  4JSO A;  4KI0 E;  2GHA A;  5AA2 D;  4IGR A;  5I2N A;  1IIT A;  3UK4 A;  1SQY A;  1ELJ A;  4XKR A;  4JWO A;  1SBP A;  1TWY A;  3N6T A;  1B5J A;  2Q89 A;  4NF6 B;  3VLU A;  3TKD A;  2IA4 A;  5BUU A;  3G7W A;  3CG1 A;  2YPN A;  3N5L A;  2XXR A;  3ONM A;  5FHM A;  2I4B A;  2D5W A;  2F36 A;  4NF5 B;  2F35 A;  3OEM A;  3SES A;  3HHG A;  3U72 A;  1B2H A;  3M3L A;  3FGS A;  4IO7 A;  1IXH A;  3GZG A;  3W9V A;  5L9O A;  1A8E A;  4R2B A;  2O7I A;  3FXQ A;  3PD9 A;  4YKK A;  4MH5 A;  2H4I A;  1XVX A;  1H45 A;  2QS3 A;  4F1Y A;  3SET A;  3R7X A;  4DDD A;  3CSB A;  2XD2 A;  1H76 A;  4AB6 A;  4XTC Q;  2D3I A;  2QJE A;  2NWJ A;  1WDN A;  3RY3 A;  3EHU A;  4F1V A;  2NVU B;  4F1U A;  4QSD A;  1MY1 A;  4PET A;  4YAH X;  5I57 B;  4H1X A;  1US4 A;  2AL5 A;  1R9Q A;  3JZJ A;  3SEX A;  2H25 A;  3KJ7 A;  2XXY A;  2DP8 A;  2DQV A;  1B5I A;  3T9X B;  3EPE A;  3MVY A;  2ZYN A;  4OQO A;  4YKJ A;  1HSE A;  2ZNU A;  2UYF A;  2ABH A;  2PVU A;  1S50 A;  4M4G A;  1US5 A;  4JDF A;  3Q28 A;  2F5X A;  4YKP A;  1B4H A;  3ILT B;  4YB6 A;  3M8U A;  4U21 A;  2OWS A;  4IO5 A;  4OET A;  5AA2 B;  5B7D A;  1DPP A;  3V89 B;  3N6U A;  2G29 A;  1FQC A;  2PT1 A;  4LVQ A;  1PBP A;  2F7A A;  1PB7 A;  1AH5 A;  3IR1 A;  4DXC A;  4N13 A;  4U2R A;  5CBS A;  4M1V A;  5TPA A;  4OZ9 A;  3KG2 A;  3CSG A;  5EYF A;  1F9B A;  2ZXT A;  1B05 A;  2XXU A;  3K6X A;  3G3H A;  3MW0 A;  4HCW A;  5DEX A;  2XXP A;  1I69 A;  3DP6 A;  2ANJ A;  2AYS A;  3PUW E;  1JQF A;  3CFL A;  4G68 B;  3FD3 A;  4LAT A;  1M5D A;  5ITP A;  3JYR A;  4LUB A;  5H8N A;  3BFT A;  4GL8 A;  5CMC A;  2PT2 A;  3FAT A;  2GH9 A;  3T66 A;  3TTK A;  3LUY A;  3EHS A;  2HXW A;  5H8H B;  4ZED A;  1B52 A;  3MP8 A;  2ONR A;  3RNN A;  1MDP 1;  2XX8 A;  3BBR A;  1JW1 A;  3TZA A;  4RYA A;  4F39 A;  3IK6 B;  2UXA A;  2V3Q A;  1BLF A;  3SEV A;  4WEP A;  3HST A;  2O69 A;  2F6P A;  1USY E;  3OEL A;  4U4X A;  4ESW A;  1CB6 A;  1HSJ A;  2Y7I A;  3TYH A;  2X7Q A;  4HW8 A;  4DE8 A;  2CMO A;  1JVY A;  3PMV A;  2ONK E;  2RCA A;  1D9V A;  1N7W A;  4Q0C A;  3OXN A;  3DP4 A;  4YMB A;  5H8Q B;  3F11 A;  3ZS6 A;  3QK6 A;  1YPN A;  5F1Q A;  5CBR A;  2HQ0 A;  3ZSF A;  3QSL A;  1Y3N A;  1N3W A;  1T0K A;  3RPW A;  4GXA A;  2H5Y A;  3U92 A;  2I49 A;  5AA4 A;  3R26 A;  2VP1 A;  1XS5 A;  3FXR A;  3VLV A;  1H3D A;  3DM0 A;  3V5A A;  4F29 A;  4DXU A;  5I59 B;  2Z23 A;  3Q26 A;  1B7U A;  3E9X A;  3MQ9 A;  3Q27 A;  1Q35 A;  3HCQ A;  2Y7K A;  4ZEK A;  4U22 A;  4R2F A;  2NUV A;  1Y1M A;  1SI1 A;  1JET A;  3EF7 A;  1UIU A;  2XXX A;  2XD3 A;  4ZEC A;  4E0W A;  3CR9 A;  1LGB C;  1MY3 A;  2OCU A;  1NH8 A;  2UVJ A;  1JW4 A;  3PUX E;  3O6G A;  3THI A;  3V83 A;  2Z8F A;  1BP5 A;  1QVS A;  3K0V A;  2DS9 A;  3H6V A;  4AB5 A;  2DWJ A;  1J1N A;  5KCJ A;  5H8F B;  4ZZA A;  2DYX A;  2GFE A;  4EXL A;  4NF8 B;  4PFU A;  4DZ1 A;  4NF5 A;  4I8C A;  1LAH E;  4X1B A;  2IEE A;  3C36 A;  5DVF A;  5BWJ A;  4FJP A;  4PQJ A;  3IB2 A;  3N94 A;  4F18 A;  2PYY A;  1MPB A;  1NNP A;  2B65 A;  1POT A;  4RXL A;  3LR1 A;  1A54 A;  5TP9 B;  2XXH A;  5CMM A;  1LAF E;  4E0X A;  3H06 B;  4JWX A;  2DE3 A;  4R6H A;  3Q29 A;  1B32 A;  4XKP A;  4TOZ A;  4YB5 A;  2P0S A;  1IEJ A;  2A5S A;  3GBA A;  2OWT A;  3MVW A;  4R74 A;  1ZU0 A;  4LQ2 A;  2R9J A;  1MPD A;  4HS7 A;  1DTZ A;  3T22 A;  4GRK A;  1RYO A;  4HTG A;  3G3G A;  4GFR A;  2F7B A;  3PU5 A;  3A3U A;  3C4M A;  1Y1Z A;  1VFE A;  4THI A;  5DVI A;  1II5 A;  1AMF A;  1B3H A;  2Q9T A;  3TAJ A;  4OXV A;  1I6Q A;  3R6U A;  1UTB B;  1B40 A;  5L9M A;  3WAF A;  4QFO A;  5I2K A;  1MRP A;  3IAZ A;  3TQW A;  3OSQ A;  4PP0 A;  3CI8 A;  1B7H A;  3ECR A;  2Q2A A;  1ATG A;  3MUQ A;  1R6Z A;  2REJ A;  1PDA A;  2B3F A;  1MY2 A;  2ZYO A;  2ZNT A;  3MZ1 A;  4Q30 B;  2DXY A;  4H8J A;  4NF4 B;  2XXT A;  4G77 A;  1JW5 A;  5IAI A;  4UA8 A;  5KDT A;  3CIJ A;  3TMG A;  3MVZ A;  4RNS A;  1B0H A;  3O66 A;  2M8C A;  4IO2 A;  1DMB A;  2P1S A;  4ZZE A;  2KLF A;  1UTH A;  1EZO A;  1D4N A;  3KSX A;  2XXI A;  4FAT A;  4R6K A;  3T9V A;  3UIF A;  4ELQ A;  1FTM A;  1B6H A;  4MBP A;  3D4G A;  3PMW A;  4NMY A;  2I58 A;  2Y7R A;  1OVT A;  3JV9 A;  4QFL A;  2CZL A;  4YIC A;  1MQJ A;  2I4C A;  3OEN A;  5ITO A;  4G8N A;  1MPC A;  3MAM A;  4N6P A;  3T9H B;  3OO9 A;  3UOR A;  1MDQ A;  2DWI A;  2RC9 A;  2UYE A;  3MZB A;  2QS2 A;  3OO7 A;  5J1D A;  1A99 A;  4U1Z A;  4LZ5 A;  2X7P A;  2XXQ A;  2HZL A;  2F97 A;  3I6V A;  3TTL A;  5ICQ A;  5K2X A;  2P2A A;  4U23 A;  3K1N A;  4ZEI A;  4KYD A;  1SYI A;  4ESX A;  1YCJ A;  4PFY A;  2QS4 A;  4POX A;  2A5T A;  4IB2 A;  3RUM A;  4C0R A;  4EXK A;  1B58 A;  5KZT A;  3PPN A;  4FAJ A;  1MY0 A;  3L6H A;  4G68 C;  3PPR A;  1NH7 A;  3KN3 A;  3I5O A;  5FHN A;  3A3C A;  3SEU A;  1OQG A;  3RT6 B;  3VVD A;  4Q8R A;  1SW4 A;  5EHM A;  5I56 A;  1AIV A;  4DCY A;  1FQB A;  4POW A;  2I3V A;  2H99 A;  5ICT A;  4GVO A;  1NFT A;  1MG1 A;  4F22 A;  3IOT A;  3LC8 A;  1MXZ A;  2GRV A;  3PUZ E;  4F19 A;  4WKM A;  1TFD A;  3P7I A;  3PUV E;  2Q2C A;  2ALU A;  3MPL A;  2I0C A;  4Z0I A;  1Y9U A;  1MY4 A;  2XXV A;  4KYS A;  1NNK A;  3O28 A;  1JVX A;  2VOZ A;  1YAE A;  3ZKL A;  3S9N C;  1FTJ A;  3I3V A;  3IO6 A;  3SEW A;  2O84 X;  3HPI A;  2YLN A;  3FVN A;  1ZJL A;  2Z8D A;  4IY5 A;  4KCC A;  1Y20 A;  3UA8 A;  4ZE9 A;  3TCH A;  4FE8 A;  5A5X A;  5I58 B;  2PX1 A;  3TTR A;  3CRB A;  3CFZ A;  5B70 A;  3PMX A;  4GLI A;  5DTB A;  1ZLQ A;  2Y7P A;  5CMK A;  3LSX A;  4EF2 A;  3QYT A;  3O2A A;  4GL0 A;  5JTY B;  4IO3 A;  2DE2 A;  1WOD A;  4BDO A;  2DVC A;  2F34 A;  2QRY A;  1S9T A;  3OOA A;  5HPQ A;  2V84 A;  3O6I A;  3OO8 A;  4QHQ A;  3U94 A;  5CI5 A;  3C34 A;  1P1N A;  1B46 A;  1MQI A;  2Q88 A;  3C33 A;  1M5B A;  1ZIU A;  1OLA A;  4RK2 A;  2O7U A;  5I2N B;  2I3W A;  2X26 A;  1PB9 A;  2W7Y A;  3S4U A;  4GIZ A;  4YB7 A;  4KHZ E;  3EHT A;  1SVX B;  3ILU B;  3IL1 B;  3FZV A;  4GQO A;  3IB0 A;  4H5G A;  1I6A A;  2XXW A;  3OD7 A;  3TEP A;  1DSN A;  1QUL A;  4GXS B;  1A7L A;  3GXA A;  2R6G E;  5DVJ A;  4C1U A;  3FAS A;  3TEL A;  1SW5 A;  4P0I A;  1BKA A;  4ELP A;  2Z22 A;  4JWY A;  4MF3 A;  2THI A;  3QUF A;  2ZYM A;  3K6W A;  3SER A;  3PPP A;  4NF4 A;  4OVJ A;  3PV0 E;  2DSF A;  1B3G A;  1MXW A;  4IO6 A;  3UP9 A;  2WKY A;  2UVI A;  4OEU A;  4KR5 A;  4R73 A;  3M3K A;  2VD2 A;  3MC2 A;  1B51 A;  5F7V A;  3KN7 A;  4HCY A;  4LQ5 A;  1LFI A;  5FHO A;  4YKI A;  4JB7 A;  3TPA A;  2PBW A;  1GGG A;  4QFN A;  4RPN A;  2DXR A;  4TLL B;  3C32 A;  1B9J A;  1VR5 A;  3MJN A;  4PE5 B;  4OES A;  3RT8 A;  3LBS A;  4RPO A;  5JK4 A;  1D3K A;  4H0W A;  3IOV A;  4JBZ A;  1LLS A;  1XC1 A;  2RF1 A;  4NF6 A;  1A40 A;  3VVE A;  3C35 A;  3OSR A;  5DYH A;  2B3B A;  1LCT A;  3H03 A;  2E0S A;  3DEL B;  3K01 A;  3QUJ A;  2Z8E A;  1L5T A;  3B6Q A;  4H65 A;  3RLF E;  2UVG A;  2HAU A;  1NNT A;  1LB8 A;  1MM7 A;  3VDF A;  3PUY E;  3LSW A;  1OVB A;  2Q8J A;  2AIX A;  4G2Z A;  4H6D A;  4ZDM A;  5M2V A;  1LB9 A;  1N7X A;  3QXM A;  4OEV A;  4BDN A;  5ELV A;  5TPA B;  4P0G A;  4R72 A;  2QPQ A;  4ZS9 A;  1IUD A;  3H3G A;  5DEX B;  1SI0 A;  4R9F A;  2XX9 A;  5I57 A;  1IXI A;  1XT8 A;  4QFK A;  3K1P A;  4ONY A;  4TLM B;  5H8S A;  1UIV A;  5JEI A;  3VXB A;  2DWA A;  4NWC A;  1POY 1;  1XVY A;  2YJP A;  5H8N B;  3KOS A;  2O68 A;  4ECF A;  4G8M A;  3E4R A;  1S7Y A;  3S9L C;  2RIN A;  3IO4 A;  3G3K A;  3TTM A;  4EF1 A;  3USD A;  4UAC A;  2QMW A;  3MBP A;  3VXC A;  1OMP A;  2O1L A;  1N0T A;  3IB1 A;  3BKI B;  3GLB A;  1DPE A;  4MLQ A;  5AA2 A;  4MFI A;  3PPO A;  2D21 A;  4FED A;  4IY6 A;  1N04 A;  1P1U A;  1OQH A;  1A8F A;  3BFU A;  3KEI A;  4O3C A;  3FVG A;  2PMS A;  3FV2 A;  2HZK A;  2ONS A;  1PC3 A;  1EH3 A;  1XOC A;  4X9T A;  5IKB A;  2F78 A;  3GBB A;  3CVG A;  1P1O A;  2E1S A;  3FJG A;  3Q25 A;  4O3A A;  3RN8 A;  4XIG Q;  1B1H A;  5FTH A;  3ODB A;  4G68 A;  1Y4C A;  4ISU A;  4EQB A;  2H98 A;  5AA4 B;  1NNF A;  1IQ7 A;  3PGF A;  4F31 B;  1OLC A;  4I1D A;  2FYI A;  4BLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...