3TMGA

Crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
b'LKSVKIGYVNWGGETAATNVLKVVFEKMGYNAEIFSVTTSIMYQYLASGKIDGTVSSWVPTADKFYYEKLKTKFVDLGANYEGTIQGFVVPSYVPISSISELKGKGDKFKNKMIGIDAGAGTQIVTEQALNYYGLSKEYELVPSSESVMLASLDSSIKRNEWILVPLWKPHWAFSRYDIKFLDDPDLIMGGIESVHTLVRLGLENDDFDAYYVFDHFYWSDDLILPLMDKNDKEPGKEYRNAVEFVEKNKEIVKTWVPEKYKTLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine, L-proline ABC transporter, glycine/betaine/
publication title Crystal structure of Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein (ProX) from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Transport protein
total genus 98
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3tmgA01
3.40.190.100 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Glycine betaine-binding periplasmic protein; domain 2 3tmgA02
1I6BA 2V25A 2D3IA 1MG1A 4NF4A 2HZKA 3EHTA 3R26A 2DOJA 1P1OA 3ZKLA 1P1UA 3PUZE 1GV8A 5FTHA 4HCYA 4H5GA 2XXTA 3FIRA 2DWIA 1R1NA 5I56B 4IO3A 4HW8A 4F2OA 1LFHA 1B1XA 3TCFA 4O3CA 2DE2A 2AL4A 2F34A 3T9UA 1BLFA 5AA2B 1JW5A 4H0WA 1LFIA 3BKIB 5B7DA 2B3FA 3ZSFA 2UVIA 3KN7A 5F1QA 1JEVA 3OO8A 3GLBA 2ALUA 1ZBMA 3IK6B 1O7TA 1FTOA 2UXAA 3EPEA 3N6TA 1N3XA 4OFJA 3TTRA 3FXUA 4G2ZA 3KOSA 3KJTA 1AOVA 1SW4A 3UGWA 3A09A 5IKBA 1FCKA 4JSDA 1MQIA 1FQEA 1NNPA 5AA1A 2F6GA 3G3KA 4OFLA 1Y3QA 1R6ZA 4YKPA 1B4ZA 2FYIA 3UIFA 4ZEFA 2DP8A 1LSTA 2RKMA 5I2KA 2ZYOA 1B40A 2VGQA 3O6HA 2X7QA 3MC2A 1MPBA 4R6YA 3FVGA 2F36A 3CSGA 1A99A 1XOCA 1UTBB 1JEUA 3OOAA 1N84A 5H8HB 1HSJA 4R9FA 4TOZA 2X7PA 1PB8A 1MS7A 1SI0A 3ECRA 4NWCA 1IXCA 3SEXA 3K2DA 4OENA 2WKYA 2ZYMA 3MP6A 3UN6A 1NKXA 1DTZA 3KBRA 4NE4A 1DSNA 3H4ZA 1VSOA 1SVXB 1RYOA 4NWDA 3KGCA 3PMXA 4EXLA 1CE2A 2Q88A 3ONMA 2XXYA 5EHMA 1SD3A 3FVKA 2NVUB 4R72A 1UIUA 2RCAA 4IO4A 2XXPA 4R6KA 2GFEA 3W9WA 2A5TA 4OEUA 1Y1MA 3OO6A 4EQ9A 2ZMBA 3N6UA 5HM4B 3QAXA 5CMBA 4Q5TA 4F1VA 2OWSA 4PFWA 1B32A 2F7CA 2OJTA 5J1DA 3C34A 3K1PA 4ZEKA 4WEPA 2VD2A 2HAVA 3PD9A 4IGRA 2DXYA 2HXWA 2UVJA 3PUVE 4PETA 2I0BA 2GHAA 1LAFE 1EZ9A 1Q35A 1MM7A 4DLDA 4BDNA 3MP1A 4H65A 3D4CA 4G4PA 1JVYA 1PC3A 4XKQA 4ZDMA 4POXA 2ONRA 3DP4A 3TAJA 4LA9A 3OSQA 1N04A 4MH5A 2RF1A 3FV1A 3MAMA 2DSFA 3H06B 3M3LA 3C33A 1YTVA 3UORA 3KEIA 1TXFA 3U8QA 5AE4A 4ZZEA 2OBGA 3U92A 2Q89A 1B5HA 4OHNA 3TQWA 4K3FA 1M5CA 2F6PA 3K6VA 4WXJA 3F11A 2KLFA 2F7BA 4THIA 2DE3A 3KJ7A 3T9XB 4XKPA 3B6TA 5B70A 5H8SA 5CMMA 3TCGA 1TFDA 1MY0A 4IO5A 1OIBA 3GXAA 3TTNA 2DYXA 4ND9A 2HAUA 2Q2CA 1Y4TA 4WKMA 3AXFA 4R6HA 1BKAA 1SBPA 5AA2D 1EU8A 3MP8A 1A8EA 1JVXA 2XXXA 1LLSA 5CM6A 3EHSA 1SYHA 1AH5A 1IXIA 3Q25A 4N6PA 5F7VA 3IB2A 1MY4A 4LZ5A 3TZAA 1I6AA 1LFGA 5CMKA 1PBQA 3C32A 1M5BA 5K2XA 1VR5A 1SW1A 1IIWA 3RUMA 4DE8A 2NXOA 4P0IA 5DVIA 1SW5A 2DQVA 3FUZA 1PB9A 4F39A 3IJOB 2ONKE 3PMWA 2DXRA 4JWYA 5FTIA 2Y7PA 2OLBA 3PUYE 1MDP1 1MXWA 4ESWA 3TUSA 1A55A 1OLAA 2H98A 2HFBA 4G68C 1ATGA 5KDTA 5H8NB 4I1DA 3KN3A 2PYYA 2HCAA 2ABHA 5DT6A 3H03A 4DXCA 2XXRA 3GZGA 1NH8A 5CC2A 3K1MA 3UP9A 3O66A 1MPDA 4I8CA 4KCDA 1O63A 1HSLA 4RK9A 1I6QA 5TP9A 4AB5A 1XS5A 4QFPA 3KG2A 4PE5B 4KYDA 1ZU0A 3H6VA 2O7UA 5I56A 3C35A 1FW0A 2HZLA 1RYXA 5AA2A 3QUFA 4LQ2A 2Z8FA 2UYFA 4BDRA 5DEXB 4GL0A 4C1UA 1ZLQA 1S7YA 3IX1A 4DCYA 1LBCA 1AL3A 2DWAA 4ZEDA 3EQ1A 4LUBA 2I0CA 4H5FA 3FZVA 4DCXA 1R9QA 1QUKA 4DXUA 5JTYB 2HEUA 4E0XA 1FTLA 1QULA 4ZZAA 4MLQA 4XKNA 3JYRA 5DVJA 1AMFA 2XXUA 3QXMA 3SESA 2Q9TA 5K2YA 3IR1A 2Y7KA 4I9DA 3FJMA 5AA4B 2OCUA 3N94A 3H6TA 2PBWA 3RGYA 5I84A 1MM6A 1IEJA 3RT8A 5LOMA 2PT2A 2P0SA 5A5XA 1MQJA 4IY5A 1UTBA 3UA8A 4G68B 2V3QA 4LATA 4X9TA 2PX1A 3RNNA 3B6WA 4QFKA 3TTMA 2XXHA 1H43A 3VE1B 3T22A 1B0LA 4YKJA 1IXHA 1IITA 2F78A 3RTWB 1XVYA 4OFOA 5I59A 2PVUA 4QF9A 3DP8A 1NNKA 4LONB 4KQPA 1MXVA 4MLVA 5ITOA 3V8XB 1QKAA 3CI8A 5I57B 2B65A 3Q27A 1DPEA 2O7IA 2DVZA 1TFAA 1SYIA 1NNFA 2F97A 3FXQA 4YZZA 4EF2A 4G8NA 4R73A 3OENA 3K01A 1URSA 2QMXA 2NUVA 4TLMB 4RA1A 4KHZE 1OVBA 3T96B 1Y1ZA 2RC8A 3HN0A 4PP0A 4FEDA 4I62A 4L17A 4U2RA 4QFNA 3OMBA 3VDFA 3M3FA 3JV9A 1YPNA 2H5YA 4DZ1A 4ZEBA 3D4GA 3KSJA 1US4A 1MXUA 1ELJA 3CG1A 3IB0A 3MZ1A 1FQAA 5DTBA 1US5A 3EN3A 3FXRA 4OTEA 1MPCA 3LR1A 4PFYA 5EYFA 5TU0A 3M3KA 4YAHX 1GTKA 2ZYKA 4X1DA 2XXIA 4Q0CA 4HCWA 1IUDA 1B3EA 2X26A 5H8FB 3MPKA 4GF8A 4N07A 4HTGA 1MY2A 1HSEA 1R9LA 3QUJA 4JWXA 3LSWA 2REGA 4R75A 2YJPA 2I48A 1FTKA 4R2FA 3TKDA 2P1SA 4XTCQ 1B2HA 2O1MA 4JSOA 1LCFA 1QJMA 3PPOA 1H3DA 3KZGA 2RC7A 3T9VA 2D21A 1BIYA 3H7MA 2I4CA 4FIMA 2RCBA 4R74A 1WDNA 4LP2B 1OQGA 4JB7A 1N3WA 1XT8A 3MZBA 4QSEA 3K00A 2V3UA 1P99A 2H25A 5EHSA 3MJNA 3OD7A 2QJEA 4NF8B 1A7LA 4MBPA 5DVFA 2QS4A 5HBCA 3DM0A 4GXAA 4U4SA 3PUXE 3PUWE 4F29A 3FVOA 1S50A 1Y9UA 3OELA 1B1HA 3SEYA 1PDAA 1M5DA 2E0SA 1QKBA 1RKMA 1D9YA 3PMVA 2DWHA 5H8QB 2I49A 1NL5A 1FTMA 4EQ7A 2M8CA 3Q28A 4JDFA 3VV5A 3PV0E 1JETA 1ZTYA 4IB2A 3N5LA 2XXVA 1M5EA 1B46A 1B7HA 4ELPA 3FJ7A 5IAIA 5TPAB 3FATA 4KFQA 3VLUA 5H8NA 5I2NA 3DELB 3QIMA 4RXLA 2F7AA 4NF5B 4OERA 4XXUA 4QRZA 1N7XA 1IQ7A 2NWJA 4NF6B 3CSBA 3FD3A 2I58A 1EZPA 2QRYA 1MQHA 2I3VA 4DIGA 3GBBA 4Q30B 1B52A 2XD3A 3IOUA 4UA8A 4E0WA 2AYSA 3QK6A 4H6DA 3LUYA 2O68A 3SETA 1ZKBA 5FHMA 2DS9A 2RINA 5DEXA 4GXSB 3SDFA 2H4IA 2W7YA 1QUIA 3C9HA 4GL8A 1LB8A 2F8DA 3QYTA 1Z7NE 3T9HB 3O97A 4EQBA 4U1ZA 4F3BA 3MVWA 4F22A 5I58B 1SW2A 1IXGA 4JWOA 1DTGA 1FTJA 2AL5A 1B51A 4RPNA 1OVTA 3OSRA 4YMBA 3TDJA 2XX8A 4G77A 3LSFB 3E13X 1DPPA 2QS1A 3O28A 4ECFA 3BFTA 3FVNA 3LSLA 2QPQA 1MY1A 2UVHA 3L6HA 4U4XA 3B6QA 4OETA 4POWA 4MFIA 3K6XA 4GLIA 2XXQA 3HV1A 1N7WA 4QSCA 2R71A 4G8HA 2DE4A 3TQLA 3SEWA 3OEKA 3THIA 1H76A 1MY3A 5ELVA 4Z7EA 4GFRA 1CB6A 2ONSA 3Q26A 3IAZA 4X1BA 4EXKA 1D4NA 2Z8EA 2ANJA 3DP6A 4FE8A 4ZEIA 4YKIA 4LZ7A 5BWJA 3TEPA 1GVCA 3K0VA 4GD5A 4U23A 2R6GE 2UVGA 1F9BA 3A3UA 3CR9A 2ESNA 3PU5A 2PT1A 3C36A 2QSXA 1MH4A 3CFLA 3OO9A 2ZXTA 2XX9A 4GRKA 3K4UA 4IO6A 1Y4CA 1Y3NA 1QVSA 1I69A 3BFUA 1B3HA 2VD3A 3H3GA 3CFZA 1PEBA 4F2QA 3O2AA 1WODA 3RPWA 2IEEA 3G3FA 2THIA 2V84A 3MZ9A 4KYEA 4NTLA 5DYHA 3RTFB 3S2VA 3W15C 3G3JA 4ONYA 3HCQA 3H6WA 3KSXA 3K1NA 1UQWA 4OXVA 4NEDA 4IY6A 2F5XA 3A3CA 3TPAA 3JZJA 3VLVA 2O69A 2VOZA 4QSDA 3RY3A 3G3GA 5KCJB 5H8FA 3RLFE 4YICA 3MQ9A 4M4GA 3S9MC 2GRVA 3LSXA 4RYAA 2YLNA 1P1NA 1UTHB 3MVYA 3EF7A 3K6UA 4YB7A 1XVXA 2DWJA 5H8HA 3VVFA 4YKKA 1B5JA 5CI5A 3C4MA 4BLAA 4Q8RA 3S9EA 1A8FA 1URGA 3IOVA 1KWHA 2G29A 4QFLA 2XHDA 3I5OA 4BDQA 2V93A 2UYEA 3RT6B 3FJGA 3MW0A 1FQDA 3VXCA 3FGSA 1SQYA 1O64A 3VVDA 2XD2A 3G3IA 4NF8A 5TP9B 3TTKA 2F35A 1Q1KA 5AA3A 2R9JA 5L9OA 3IOWA 1UIVA 3OO7A 3DLNA 1NFTA 1B7ZA 4ISUA 3V5AA 3PPNA 4BDLA 3MWBA 2LAOA 1A40A 1AIVA 2CZLA 4ZE8A 4RNSA 5ITPA 2P2AA 4U1OA 1B0HA 2IA4A 5H8QA 4NMYA 3K02A 4F19A 1MXYA 3PPQA 3BBRA 4GQOA 3L6GA 3ZKKA 4LVQA 2ZNTA 1N76A 4C0RA 2B3BA 3TELA 1DMBA 2AIXA 3I3VA 5TPAA 2Y7IA 4C1TA 5FHNA 4YB6A 3Q29A 4NF5A 1IZ1A 3MUQA 3TYHA 2XXWA 4NF6A 4KYSA 5A5XB 1B7UA 4ZS9A 3IL1B 2A5SA 2CMOA 2G93A 1POY1 3U94A 2ZYNA 2REJA 3PPRA 4GWOA 3CRBA 3RQTA 1B3LA 1LB9A 4IO2A 2PMSA 1FQCA 4G8MA 5CMCA 1II5A 2Z22A 1NH7A 4BDOA 5I59B 1QW0A 3O6IA 4NF4B 1OQHA 1JW4A 2OZZA 4MF3A 3E4RA 3WAEA 5CBSA 4F3SA 1GGGA 3T66A 2I6EA 5I58A 2BJJX 3VLWA 1FQFA 4KD5A 1N0TA 1NMUA 1P1QA 1DOTA 4XIGQ 1USYH 4OYVA 2H99A 4LZ8A 1A54A 1LBBA 2I4BA 4FEBA 4ELQA 4F31B 4P0GA 3O29A 2DVCA 2Y7WA 3VFJA 1P1WA 3TMGA 1MXZA 3V89B 3W9VA 1B58A 3EHUA 1L5TA 4TQUQ 4XKRA 2YPNA 4ELRA 4RK2A 2QS3A 3ILUB 2QS2A 5ISUA 2Y7RA 3C31A 3CFXA 1D3KA 4OESA 3QSLA 4R2BA 1WVJA 3RN8A 1EH3A 3V83A 3O6GA 1ZJLA 5I2KB 4M1VA 3U72A 4AB6A 2RC9A 2ZNUA 1Z7ME 2ZNSA 1ZIUA 5L9MA 2Q8JA 1MH3A 3IORA 1EZOA 1VFDA 4F18A 3TTLA 1Y3PA 1NNTA 3ODBA 4JXIA 2Z23A 4OMBA 1MQDA 4ESXA 2O51A 5L9SA 1JNFA 2QL3A 4TLLB 2HQ0A 1YCJA 4OWDA 4F1UA 3HPIA 4LQ5A 3PPPA 4IGTA 1MDQA 4DXBA 1USYE 3G7WA 4ZECA 2OK2A 1B3GA 4YU0A 3CIJA 2VP1A 2O84X 4H67A 3S9NC 5JTYA 4H8IA 4GOTA 3TCHA 4DDDA 2A5TB 5FHOA 3KN8A 1TWYA 4RY1A 4OEVA 2QMWA 3R6UA 4H8JA 3S4UA 3KOTA 1S9TA 5CBRA 1MXXA 3PGFA 4KI0E 5AA4A 5M2VA 3P7IA 1PB7A 1JQFA 1B05A 1T0KA 1OLCA 1B9JA 3HSTA 3H6UA 3O9PA 3IB1A 5KCJA 3FV2A 2E1SA 3ZS6A 4FECA 3IOTA 4R9GA 4G68A 1JW1A 1PBPA 2Y84A 3UK4A 1UTHA 4QHQA 3MPLA 1OMPA 1SDXA 2VHAA 3B7DA 3K6WA 2Z8DA 1MQGA 2I3WA 4ELOA 3WAFA 3VXBA 3MVXA 3E3KA 4OQOA 4F3PA 3IO4A 4ZE9A 4GVOA 1FQBA 1LGBC 4GIZA 3MBPA 4IO7A 4KCCA 5I2NB 1VE4A 2NOOA 5HPQA 3FASA 4P11A 4U22A 4PFTA 3M8UA 1H44A 1YAEA 5I57A 4UACA 5BUUA 3IO6A 2GH9A 3CG3A 1LAXA 3TODA 3OEMA 4EF1A 1ZMGA 1LAGE 3HHGA 1D9VA 3OXNA 3SEVA 2GHBA 1URDA 3KFMA 3MVZA 2O1LA 4YMAA 3CVGA 3GBAA 3U1OA 3R7XA 1GR2A 5ICQA 2V3TA 3HHFA 4EDPA 3U93A 4RPOA 3HO7A 1VFEA 4KPTA 2FNCA 2FA7A 4FJPA 4KR5A 3USDA 4PQJA 2XX7A 2OWTA 5JK4A 4X48A 1B5IA 1XHYA 4H1XA 1XC1A 1M5FA 4O3BA 3SERA 1J1NA 4AQ4A 1H45A 3N26A 4WEDA 5ICTA 4F1YA 4HS7A 2Q2AA 1LCTA 4YB5A 4RJZA 2H9BA 5KZTA 3SEUA 2O6AA 1B4HA 3T93B 1SI1A 4F3GA 4FORA 4Z0IA 3IJXB 1Y20A 4N13A 3TFLA 1LAHE 1B6HA 4O3AA 1BTJA 1POTA 3ILTB 4OVJA 1MRPA 2D5WA 5JEIA 5CRYA 4FATA 1TT1A 3LC8A 3VVEA 4PFUA 1B3FA 3LBSA 4EUOA 1QUJA 5KDTB 4OZ9A 4BDMA 1ANFA 4QFOA 5L8DA 1BP5A 4U21A 3S9LC 3I6VA 3PD8A 4JBZA 4FAJA 3G3HA 3SKPA 3E9XA
chains in the Genus database with same CATH superfamily
1I6BA 2V25A 2D3IA 3HFUA 5DW8A 1MG1A 4NF4A 4OA4A 2HZKA 3EHTA 3R26A 2DOJA 1P1OA 3ZKLA 1P1UA 3PUZE 1GV8A 5FTHA 4HCYA 4H5GA 2XXTA 2JJKA 3FIRA 2DWIA 1R1NA 5I56B 4IO3A 4HW8A 2WYPA 4F2OA 1LFHA 4NG7A 1B1XA 3TCFA 4O3CA 2DE2A 2AL4A 2F34A 3T9UA 1BLFA 5AA2B 1JW5A 4H0WA 1LFIA 3BKIB 5B7DA 2B3FA 1KA1A 3ZSFA 2UVIA 3KN7A 1IMCA 5F1QA 1JEVA 3OO8A 3GLBA 1ZBMA 2ALUA 3IK6B 1O7TA 1FTOA 2UXAA 3EPEA 3N6TA 1N3XA 4OFJA 3TTRA 3FXUA 4G2ZA 3KOSA 3KJTA 1AOVA 1SW4A 2L5VA 3UGWA 3A09A 5IKBA 1FCKA 4JSDA 1MQIA 4N6DA 1FQEA 1IMDA 1NNPA 5AA1A 2F6GA 3G3KA 2Q8MA 4OFLA 1Y3QA 1R6ZA 4YKPA 1B4ZA 2FYIA 3UIFA 3NOHA 4ZEFA 2DP8A 1LSTA 2RKMA 5I2KA 2ZYOA 1B40A 2VGQA 3O6HA 4FBPA 2X7QA 3MC2A 1MPBA 4R6YA 4MHFA 2CEXA 3FVGA 2F36A 3CSGA 1A99A 4DI3D 1XOCA 1UTBB 1FJ9A 1JEUA 1NUYA 4MJOA 3OOAA 1N84A 5H8HB 1HSJA 4R9FA 4TOZA 2X7PA 3BIHA 1PB8A 1MS7A 1SI0A 3ECRA 4NWCA 1IXCA 3SEXA 3K2DA 4OENA 2WKYA 2ZYMA 1KZ8A 3MP6A 3UN6A 1NKXA 1DTZA 3KBRA 4NE4A 1DSNA 3H4ZA 1VSOA 1SVXB 4PFRA 1RYOA 4NWDA 3KGCA 3PMXA 4EXLA 1CE2A 2Q88A 3ONMA 2XXYA 5EHMA 1SD3A 3FVKA 2NVUB 1IMFA 4R72A 1UIUA 2RCAA 4IO4A 2XXPA 2QVUA 4R6KA 2ZZXA 2GFEA 3W9WA 2A5TA 4OEUA 1Y1MA 2PFZA 3OO6A 4NX1A 4EQ9A 2ZMBA 3N6UA 5HM4B 3ROJA 1FPKA 3QAXA 5CMBA 4Q5TA 4JVCA 4F1VA 2OWSA 4PFWA 1B32A 2F7CA 2OJTA 5I7IA 5J1DA 3C34A 2CZHA 3K1PA 4ZEKA 4WEPA 4GBWA 2VD2A 2HAVA 3PD9A 4IGRA 2DXYA 2HXWA 2UVJA 3PUVE 4PETA 5LTCA 2I0BA 2GHAA 1LAFE 1EZ9A 1Q35A 1MM7A 3LV0A 4DLDA 4BDNA 3MP1A 4H65A 3D4CA 4G4PA 1JVYA 4JVIA 1PC3A 4XKQA 4ZDMA 4PF6A 4PFIA 4POXA 2ONRA 4P1EA 3DP4A 2HXRA 3TAJA 4LA9A 3OSQA 1N04A 4MH5A 2RF1A 3FV1A 1NUZA 3MAMA 2DSFA 3H06B 3M3LA 5ET8A 3C33A 1YTVA 3UORA 3KEIA 1TXFA 3KC0A 3U8QA 5AE4A 3GYYA 4ZZEA 2OBGA 4MX6A 3U92A 2Q89A 1B5HA 4OHNA 1EYIA 3TQWA 4K3FA 1M5CA 1D9QA 2F6PA 3K6VA 4WXJA 3F11A 2KLFA 2F7BA 4THIA 2R8TA 2DE3A 3KJ7A 3T9XB 4XKPA 3B6TA 5H8SA 5CMMA 5B70A 3TCGA 1TFDA 1MY0A 4IO5A 1OIBA 4OVQA 3GXAA 3TTNA 2DYXA 4ND9A 2HAUA 2Q2CA 1Y4TA 4WKMA 3AXFA 4R6HA 4HE1A 1BKAA 1SBPA 4OANA 5AA2D 1EU8A 3MP8A 1A8EA 1JVXA 2XXXA 3IFCA 1LLSA 5CM6A 3EHSA 1SYHA 1AH5A 1IXIA 3Q25A 4N6PA 5F7VA 3IB2A 1MY4A 4LZ5A 3TZAA 1IMBA 1I6AA 1LFGA 5CMKA 1PBQA 3C32A 1M5BA 1VR5A 5K2XA 1SW1A 1EYKA 1IIWA 3RUMA 4DE8A 2NXOA 4P0IA 5DVIA 1SW5A 2DQVA 3FUZA 4PAFA 1PB9A 4F39A 3IJOB 2ONKE 5A5LA 3PMWA 2DXRA 4JWYA 5FTIA 2Y7PA 2OLBA 3PUYE 1SPIA 1MDP1 2OWZA 1MXWA 4ESWA 3TUSA 1A55A 1OLAA 2H98A 1FPFA 2HFBA 4G68C 1ATGA 5KDTA 5H8NB 2WBBA 4I1DA 3KN3A 2PYYA 1YYZA 2HCAA 2ABHA 5DT6A 3H03A 4DXCA 2XXRA 3GZGA 1NH8A 5CC2A 3K1MA 3UP9A 3O66A 4GX3A 1MPDA 4I8CA 5T3JA 4KCDA 1O63A 1FBEA 1HSLA 4RK9A 1I6QA 5TP9A 4AB5A 1XS5A 4QFPA 3KG2A 4PE5B 4KYDA 3E79A 1ZU0A 3H6VA 2O7UA 5EYHA 5I56A 2V4CA 3C35A 1FW0A 2HZLA 3FBPA 1RYXA 5AA2A 3QUFA 4LQ2A 2Z8FA 2UYFA 4BDRA 2CZIA 5DEXB 4GL0A 4C1UA 1ZLQA 1S7YA 3IX1A 4DCYA 1LBCA 1AL3A 2DWAA 4ZEDA 3B50A 3EQ1A 1FBDA 4LUBA 2I0CA 1RDXA 4H5FA 3FZVA 4DCXA 1R9QA 1QUKA 4DXUA 5JTYB 2HEUA 4E0XA 1FTLA 1QULA 4ZZAA 1LBWA 4MLQA 4XKNA 3JYRA 5DVJA 1AMFA 2XXUA 1NUXA 3QXMA 3SESA 2Q9TA 5K2YA 3IR1A 2Y7KA 5I5PA 1FBCA 4I9DA 3FJMA 4I3EA 3D1RA 5AA4B 2OCUA 3N94A 3H6TA 2PBWA 3RGYA 2PFYA 5I84A 4NQ8A 1MM6A 1IEJA 3RT8A 2FVZA 5LOMA 2PT2A 2VT5A 2XXKA 4HE0A 2P0SA 5A5XA 1MQJA 4IY5A 1UTBA 3UA8A 4G68B 1JP4A 2XWIA 2V3QA 4LATA 4X9TA 2PX1A 4PAKA 3RNNA 3B6WA 4QFKA 3TTMA 2XXHA 1H43A 3SZPA 2WEFA 3VE1B 3T22A 1B0LA 4YKJA 1IXHA 1IITA 2F78A 3RTWB 1XVYA 4OFOA 5I59A 2PVUA 4QF9A 3DP8A 1NNKA 4LONB 1DK4A 4KQPA 4H46A 1MXVA 5EQ8A 4MLVA 5ITOA 3V8XB 1QKAA 3CI8A 5I57B 2B65A 5IZZA 3Q27A 1DPEA 4PGNA 3IFAA 2O7IA 2DVZA 1TFAA 1SYIA 1NNFA 2F97A 3FXQA 4YZZA 1LBZA 4P9KA 4EF2A 2OX3A 4G8NA 4R73A 1FPDA 3OENA 3K01A 1URSA 2QMXA 2NUVA 4TLMB 4NF0A 4RA1A 4KHZE 1OVBA 3T96B 1Y1ZA 1RDZA 2RC8A 3HN0A 4PP0A 4FEDA 4I62A 4L17A 4U2RA 2KR0A 4QFNA 3OMBA 3VDFA 3M3FA 2B4LA 4HXVA 3JV9A 1YPNA 2H5YA 4DZ1A 4ZEBA 3D4GA 3KSJA 4PGPA 1US4A 4GWZA 1MXUA 3U65A 1ELJA 4PC9A 3CG1A 3IB0A 3MZ1A 1FQAA 5DTBA 1US5A 3EN3A 3FXRA 4OTEA 4N4UA 1MPCA 2BJIA 3LR1A 4PFYA 5EYFA 2FIEA 5TU0A 4PBQA 3M3KA 1FPLA 4YAHX 1GTKA 2ZYKA 4X1DA 2XXIA 4Q0CA 4HCWA 1IUDA 1B3EA 4PDHA 2X26A 5H8FB 4O94A 3MPKA 4GF8A 4N07A 4HTGA 1MY2A 1HSEA 1R9LA 3QUJA 4JWXA 3LSWA 2REGA 4R75A 2YJPA 2I48A 1FTKA 4R2FA 3TKDA 2P1SA 4XTCQ 1B2HA 2O1MA 4GX6A 4JSOA 1LCFA 1QJMA 3PPOA 1H3DA 1FPEA 3KZGA 2RC7A 3T9VA 2D21A 1BIYA 3H7MA 2I4CA 4FIMA 2DDKA 2RCBA 4R74A 1G0IA 1WDNA 4LP2B 1OQGA 1FRPA 4JB7A 1N3WA 1XT8A 3MZBA 4QSEA 3K00A 2V3UA 1P99A 4PCDA 2H25A 5EHSA 3MJNA 3OD7A 1K9ZA 2QJEA 4NF8B 1A7LA 2B4MA 4MBPA 1FBFA 5DVFA 2QS4A 5HBCA 3DM0A 4GXAA 4U4SA 3PUXE 3PUWE 4F29A 3FVOA 1S50A 1Y9UA 3OELA 1B1HA 2CZKA 3SEYA 1PDAA 1M5DA 4N8YA 4HE2A 4NGUA 2E0SA 1QKBA 1RKMA 1DBZA 1VDWA 1XI6A 1D9YA 3PMVA 2DWHA 5H8QB 2I49A 1NL5A 1FTMA 2ZZWA 4EQ7A 2M8CA 3Q28A 4JDFA 3VV5A 3KBZA 3PV0E 1JETA 1EYJA 1ZTYA 4IB2A 3N5LA 2XXVA 1M5EA 1B46A 1B7HA 5EQ7A 4ELPA 3FJ7A 2F3BA 5IAIA 5TPAB 3FATA 4KFQA 4N91A 3VLUA 5H8NA 5I2NA 3DELB 3QIMA 4RXLA 2F7AA 4NF5B 4OERA 4XXUA 4QRZA 3MYUA 1N7XA 1IQ7A 2NWJA 4NF6B 3CSBA 4PFBA 3FD3A 2I58A 1EZPA 2QRYA 4I40A 1MQHA 2I3VA 3RPLB 2ZZVA 4DIGA 3GBBA 1LBXA 4Q30B 1B52A 2XD3A 1AWBA 3IOUA 4UA8A 4E0WA 2AYSA 3QK6A 4H6DA 3LUYA 2O68A 3SETA 1ZKBA 5FHMA 1QGXA 2DS9A 2RINA 5DEXA 4GXSB 3SDFA 2H4IA 2W7YA 1QUIA 3C9HA 1INPA 4NAPA 5ET7A 4GL8A 1LB8A 2F8DA 3QYTA 4MIJA 1Q9DA 1KA0A 1Z7NE 3T9HB 3O97A 4EQBA 4U1ZA 4F3BA 3MVWA 4F22A 5I58B 1SW2A 2P3VA 1IXGA 4JWOA 1DTGA 1FTJA 2AL5A 4OVRA 1B51A 4O7IA 4GWYA 4RPNA 5F24A 1OVTA 3OSRA 4YMBA 3TDJA 4QXDA 2XX8A 4G77A 3LSFB 3E13X 1DPPA 2QS1A 3O28A 4ECFA 3BFTA 1FPGA 3FVNA 3LSLA 2QPQA 1MY1A 2UVHA 3L6HA 4U4XA 2F3DA 2XWVA 3B6QA 5EQAA 4OETA 4POWA 4MFIA 3K6XA 2KQZA 4GLIA 4NHBA 1NV5A 1NV7A 2XXQA 3HV1A 1N7WA 4QSCA 2R71A 4X8RA 2QVRA 4G8HA 2DE4A 3TQLA 4P3LA 3SEWA 3OEKA 3THIA 1H76A 1MY3A 5ELVA 4Z7EA 4GFRA 4DI4B 1CB6A 2ONSA 3Q26A 3IAZA 1FJ6A 4P56A 4X1BA 4EXKA 1D4NA 4NN3A 2Z8EA 2ANJA 1YXIA 3DP6A 4FE8A 1FBGA 4ZEIA 4X04A 4YKIA 4LZ7A 5BWJA 3TEPA 1IMAA 1LBVA 1GVCA 2HPGA 3K0VA 4GD5A 4U23A 2R6GE 2UVGA 1F9BA 3A3UA 3CR9A 5ET6A 2ESNA 3PU5A 2PT1A 3C36A 2QSXA 2PCRA 1MH4A 4AS4A 3CFLA 3OO9A 2ZXTA 2XX9A 4GRKA 3K4UA 4IO6A 1Y4CA 1Y3NA 1QVSA 1I69A 4PAIA 3BFUA 4XFEA 1B3HA 2VD3A 3H3GA 3CFZA 1PEBA 4F2QA 3O2AA 1WODA 3RPWA 2IEEA 2XWOA 4XF5A 3G3FA 2THIA 2V84A 3MZ9A 4KYEA 4NTLA 5DYHA 5IGAA 3RTFB 3S2VA 4P1LA 4OVTA 1NI9A 3W15C 3G3JA 4ONYA 3HCQA 5EQ9A 3H6WA 3KSXA 3K1NA 4P8BA 1UQWA 4NEDA 4OXVA 4IY6A 2F5XA 4OVSA 4PE3A 3A3CA 3TPAA 4O7MA 3JZJA 3VLVA 2O69A 2VOZA 4QSDA 3RY3A 3G3GA 5KCJB 5H8FA 3RLFE 4YICA 3MQ9A 4M4GA 4OVPA 3S9MC 2GRVA 3LSXA 4RYAA 2YLNA 4G61A 1P1NA 1UTHB 3MVYA 3EF7A 3K6UA 4YB7A 1XVXA 2DWJA 5H8HA 3VVFA 4YKKA 1B5JA 5CI5A 3C4MA 1YZ0A 4BLAA 4Q8RA 3S9EA 1A8FA 1URGA 3IOVA 1KWHA 2G29A 4XEQA 4QFLA 2XHDA 3I5OA 4BDQA 2V93A 2UYEA 4PBHA 3RT6B 3FJGA 3MW0A 1FQDA 3VXCA 3FGSA 1SQYA 1O64A 4JVDA 3VVDA 2XD2A 3G3IA 4NF8A 5TP9B 3TTKA 4PF8A 2F35A 1Q1KA 2WBDA 2R9JA 5AA3A 5L9OA 3IOWA 1UIVA 3OO7A 3DLNA 1NFTA 1B7ZA 4ISUA 3V5AA 3PPNA 4BDLA 3MWBA 2WYKA 2LAOA 1A40A 1AIVA 2CZLA 4ZE8A 4RNSA 2Q74A 5ITPA 2P2AA 4U1OA 1B0HA 2IA4A 5H8QA 3LUZA 4NMYA 3K02A 4MNIA 4MMPA 4F19A 1MXYA 3PPQA 3BBRA 2HHMA 4MAGA 4QBAA 4GQOA 3L6GA 5IZ3B 3ZKKA 4LVQA 2ZNTA 4H45A 1N76A 4C0RA 2B3BA 3TELA 1DMBA 2AIXA 3FXBA 3I3VA 5TPAA 2Y7IA 4C1TA 2GQ1A 3EKIA 5FHNA 4YB6A 1NV2A 3Q29A 4NF5A 1IZ1A 3MUQA 3TYHA 2XXWA 4NF6A 4KYSA 5A5XB 1B7UA 4N6KA 4ZS9A 3IL1B 2A5SA 4MCOA 2CMOA 3MSTA 2G93A 1POY1 3U94A 4N17A 3RPLA 2ZYNA 2REJA 4GWUA 3RYDA 1NV6A 3PPRA 4GWOA 5FBPA 3CRBA 3RQTA 1B3LA 1LB9A 2P3NA 4IO2A 3A29A 2PMSA 1FQCA 4G8MA 5CMCA 1II5A 2Z22A 1NH7A 4BDOA 5I59B 1QW0A 3O6IA 1FPIA 4NF4B 1OQHA 1JW4A 2OZZA 4MF3A 3E4RA 3WAEA 2XA5A 5CBSA 4F3SA 1GGGA 3T66A 1LBYA 4PTKA 2I6EA 5I58A 2BJJX 3VLWA 1FQFA 4KD5A 1N0TA 1NMUA 1P1QA 1DOTA 4XIGQ 1USYH 4GWWA 4OYVA 4IR8A 2H99A 4LZ8A 1A54A 2FBPA 1LBBA 2I4BA 1FTAA 4O8MA 4FEBA 4ELQA 1NV1A 4F31B 4P0GA 3O29A 2DVCA 2Y7WA 3VFJA 1P1WA 3TMGA 1MXZA 3V89B 3W9VA 1B58A 3EHUA 1L5TA 4TQUQ 4XKRA 2YPNA 4ELRA 4RK2A 2QS3A 3ILUB 4MNCA 2QS2A 1FPJA 5ISUA 2Y7RA 3C31A 3CFXA 3ISPA 4KXPA 1D3KA 2VPNA 4LN5A 4OESA 3QSLA 4R2BA 1WVJA 3RN8A 1EH3A 3V83A 3E78A 3O6GA 1ZJLA 1LEVA 5I2KB 4M1VA 3U72A 4AB6A 2RC9A 2ZNUA 1Z7ME 2ZNSA 1ZIUA 5L9MA 2Q8JA 1MH3A 3IORA 1EZOA 1VFDA 4F18A 3TTLA 1Y3PA 1NNTA 3ODBA 4JXIA 2Z23A 4OMBA 1MQDA 4ESXA 2O51A 5L9SA 1JNFA 2QL3A 4TLLB 2HQ0A 1YCJA 4OWDA 4F1UA 3HPIA 4LQ5A 3PPPA 4GBVA 4N15A 4IGTA 1MDQA 5IZ1A 2VPOA 4DXBA 1USYE 3G7WA 4ZECA 2OK2A 1B3GA 4PDDA 4YU0A 3CIJA 2VP1A 2O84X 4H67A 2QFLA 3S9NC 5JTYA 4H8IA 2Y5KA 2FIXA 4GOTA 3TCHA 4DDDA 2A5TB 5FHOA 3KN8A 1TWYA 2MKZA 4RY1A 4OEVA 2QMWA 3R6UA 4N8GA 1IMEA 4H8JA 3S4UA 3KOTA 1S9TA 5I3SA 5CBRA 1MXXA 3PGFA 4KI0E 5AA4A 5M2VA 3P7IA 1PB7A 1JQFA 1B05A 1RDYA 1T0KA 1OLCA 1B9JA 3T1BA 3HSTA 3H6UA 1CNQA 1FSAA 3O9PA 3IB1A 5KCJA 3FV2A 2E1SA 3ZS6A 4FECA 2Y5LA 3IOTA 4R9GA 4G68A 1JW1A 1PBPA 2Y84A 1UTHA 3UK4A 4QHQA 3MPLA 1OMPA 1SDXA 2VHAA 3B7DA 3K6WA 2Z8DA 1MQGA 2I3WA 4ELOA 3WAFA 3VXBA 3MVXA 3E3KA 4OQOA 4F3PA 3IO4A 4ZE9A 4GVOA 3T0JA 1FQBA 1NV4A 1LGBC 4GIZA 5IM2A 3MBPA 4IO7A 1FBPA 4KCCA 5I2NB 1VE4A 2NOOA 5HPQA 3FASA 4P11A 4I3YA 4U22A 5J16A 4AS5A 4PFTA 3M8UA 1H44A 1YAEA 5I57A 3BIGA 4UACA 5BUUA 4N81A 3CHGA 3IO6A 2GH9A 1BK4A 3CG3A 2QVVA 1LAXA 3TODA 1G0HA 2XWKA 3OEMA 4EF1A 4GX4A 1ZMGA 1LAGE 3HHGA 1D9VA 5ET5A 1NV0A 3OXNA 3SEVA 2FHYA 2GHBA 1URDA 3KFMA 3MVZA 2O1LA 4YMAA 3CVGA 3GBAA 1NUWA 2CEYA 3R7XA 3U1OA 4P47A 1GR2A 5ICQA 2V3TA 3HHFA 4EDPA 3U93A 4RPOA 4MNPA 3HO7A 1VFEA 4KPTA 4MEVA 2FNCA 2FA7A 4UABA 4FJPA 4KR5A 2WX9A 3USDA 4PQJA 2XX7A 5EYGA 2OWTA 5JK4A 4X48A 5IZ3A 3QMFA 4GWSA 1B5IA 4GWXA 4H1XA 1XHYA 1NV3A 1XC1A 1DCUA 1M5FA 4O3BA 3SERA 1J1NA 4AQ4A 1H45A 3N26A 4WEDA 5ICTA 4F1YA 4HS7A 2Q2AA 1LCTA 4YB5A 4RJZA 2H9BA 5KZTA 3SEUA 3KC1A 2O6AA 1B4HA 3T93B 1SI1A 4F3GA 5ESYA 4FORA 4Z0IA 3IJXB 1Y20A 4N13A 3TFLA 5LDZA 1LAHE 1B6HA 4O3AA 1BTJA 1POTA 3ILTB 4OVJA 1MRPA 2D5WA 5JEIA 5CRYA 4FATA 1TT1A 3LC8A 3VVEA 4PFUA 1B3FA 3LBSA 4EUOA 1QUJA 5KDTB 1K9YA 4OZ9A 1ANFA 4BDMA 4QFOA 5L8DA 1BP5A 3PTYA 4U21A 3S9LC 3I6VA 3B8BA 3PD8A 4JBZA 1FBHA 4FAJA 1FPBA 3G3HA 3SKPA 3E9XA
chains in the Genus database with same CATH topology
1I6BA 2V25A 2D3IA 1MG1A 4NF4A 2HZKA 3EHTA 3R26A 2DOJA 1P1OA 3ZKLA 1P1UA 3PUZE 1GV8A 5FTHA 4HCYA 4H5GA 2XXTA 3FIRA 2DWIA 1R1NA 5I56B 4IO3A 4HW8A 4F2OA 1LFHA 1B1XA 3TCFA 4O3CA 2DE2A 2AL4A 2F34A 3T9UA 1BLFA 5AA2B 1JW5A 4H0WA 1LFIA 3BKIB 5B7DA 2B3FA 3ZSFA 2UVIA 3KN7A 5F1QA 1JEVA 3OO8A 3GLBA 2ALUA 1ZBMA 3IK6B 1O7TA 1FTOA 2UXAA 3EPEA 3N6TA 1N3XA 4OFJA 3TTRA 3FXUA 4G2ZA 3KOSA 3KJTA 1AOVA 1SW4A 3UGWA 3A09A 5IKBA 1FCKA 4JSDA 1MQIA 1FQEA 1NNPA 5AA1A 2F6GA 3G3KA 4OFLA 1Y3QA 1R6ZA 4YKPA 1B4ZA 2FYIA 3UIFA 4ZEFA 2DP8A 1LSTA 2RKMA 5I2KA 2ZYOA 1B40A 2VGQA 3O6HA 2X7QA 3MC2A 1MPBA 4R6YA 3FVGA 2F36A 3CSGA 1A99A 1XOCA 1UTBB 1JEUA 3OOAA 1N84A 5H8HB 1HSJA 4R9FA 4TOZA 2X7PA 1PB8A 1MS7A 1SI0A 3ECRA 4NWCA 1IXCA 3SEXA 3K2DA 4OENA 2WKYA 2ZYMA 3MP6A 3UN6A 1NKXA 1DTZA 3KBRA 4NE4A 1DSNA 3H4ZA 1VSOA 1SVXB 1RYOA 4NWDA 3KGCA 3PMXA 4EXLA 1CE2A 2Q88A 3ONMA 2XXYA 5EHMA 1SD3A 3FVKA 2NVUB 4R72A 1UIUA 2RCAA 4IO4A 2XXPA 4R6KA 2GFEA 3W9WA 2A5TA 4OEUA 1Y1MA 3OO6A 4EQ9A 2ZMBA 3N6UA 5HM4B 3QAXA 5CMBA 4Q5TA 4F1VA 2OWSA 4PFWA 1B32A 2F7CA 2OJTA 5J1DA 3C34A 3K1PA 4ZEKA 4WEPA 2VD2A 2HAVA 3PD9A 4IGRA 2DXYA 2HXWA 2UVJA 3PUVE 4PETA 2I0BA 2GHAA 1LAFE 1EZ9A 1Q35A 1MM7A 4DLDA 4BDNA 3MP1A 4H65A 3D4CA 4G4PA 1JVYA 1PC3A 4XKQA 4ZDMA 4POXA 2ONRA 3DP4A 3TAJA 4LA9A 3OSQA 1N04A 4MH5A 2RF1A 3FV1A 3MAMA 2DSFA 3H06B 3M3LA 3C33A 1YTVA 3UORA 3KEIA 1TXFA 3U8QA 5AE4A 4ZZEA 2OBGA 3U92A 2Q89A 1B5HA 4OHNA 3TQWA 4K3FA 1M5CA 2F6PA 3K6VA 4WXJA 3F11A 2KLFA 2F7BA 4THIA 2DE3A 3KJ7A 3T9XB 4XKPA 3B6TA 5B70A 5H8SA 5CMMA 3TCGA 1TFDA 1MY0A 4IO5A 1OIBA 3GXAA 3TTNA 2DYXA 4ND9A 2HAUA 2Q2CA 1Y4TA 4WKMA 3AXFA 4R6HA 1BKAA 1SBPA 5AA2D 1EU8A 3MP8A 1A8EA 1JVXA 2XXXA 1LLSA 5CM6A 3EHSA 1SYHA 1AH5A 1IXIA 3Q25A 4N6PA 5F7VA 3IB2A 1MY4A 4LZ5A 3TZAA 1I6AA 1LFGA 5CMKA 1PBQA 3C32A 1M5BA 5K2XA 1VR5A 1SW1A 1IIWA 3RUMA 4DE8A 2NXOA 4P0IA 5DVIA 1SW5A 2DQVA 3FUZA 1PB9A 4F39A 3IJOB 2ONKE 3PMWA 2DXRA 4JWYA 5FTIA 2Y7PA 2OLBA 3PUYE 1MDP1 1MXWA 4ESWA 3TUSA 1A55A 1OLAA 2H98A 2HFBA 4G68C 1ATGA 5KDTA 5H8NB 4I1DA 3KN3A 2PYYA 2HCAA 2ABHA 5DT6A 3H03A 4DXCA 2XXRA 3GZGA 1NH8A 5CC2A 3K1MA 3UP9A 3O66A 1MPDA 4I8CA 4KCDA 1O63A 1HSLA 4RK9A 1I6QA 5TP9A 4AB5A 1XS5A 4QFPA 3KG2A 4PE5B 4KYDA 1ZU0A 3H6VA 2O7UA 5I56A 3C35A 1FW0A 2HZLA 1RYXA 5AA2A 3QUFA 4LQ2A 2Z8FA 2UYFA 4BDRA 5DEXB 4GL0A 4C1UA 1ZLQA 1S7YA 3IX1A 4DCYA 1LBCA 1AL3A 2DWAA 4ZEDA 3EQ1A 4LUBA 2I0CA 4H5FA 3FZVA 4DCXA 1R9QA 1QUKA 4DXUA 5JTYB 2HEUA 4E0XA 1FTLA 1QULA 4ZZAA 4MLQA 4XKNA 3JYRA 5DVJA 1AMFA 2XXUA 3QXMA 3SESA 2Q9TA 5K2YA 3IR1A 2Y7KA 4I9DA 3FJMA 5AA4B 2OCUA 3N94A 3H6TA 2PBWA 3RGYA 5I84A 1MM6A 1IEJA 3RT8A 5LOMA 2PT2A 2P0SA 5A5XA 1MQJA 4IY5A 1UTBA 3UA8A 4G68B 2V3QA 4LATA 4X9TA 2PX1A 3RNNA 3B6WA 4QFKA 3TTMA 2XXHA 1H43A 3VE1B 3T22A 1B0LA 4YKJA 1IXHA 1IITA 2F78A 3RTWB 1XVYA 4OFOA 5I59A 2PVUA 4QF9A 3DP8A 1NNKA 4LONB 4KQPA 1MXVA 4MLVA 5ITOA 3V8XB 1QKAA 3CI8A 5I57B 2B65A 3Q27A 1DPEA 2O7IA 2DVZA 1TFAA 1SYIA 1NNFA 2F97A 3FXQA 4YZZA 4EF2A 4G8NA 4R73A 3OENA 3K01A 1URSA 2QMXA 2NUVA 4TLMB 4RA1A 4KHZE 1OVBA 3T96B 1Y1ZA 2RC8A 3HN0A 4PP0A 4FEDA 4I62A 4L17A 4U2RA 4QFNA 3OMBA 3VDFA 3M3FA 3JV9A 1YPNA 2H5YA 4DZ1A 4ZEBA 3D4GA 3KSJA 1US4A 1MXUA 1ELJA 3CG1A 3IB0A 3MZ1A 1FQAA 5DTBA 1US5A 3EN3A 3FXRA 4OTEA 1MPCA 3LR1A 4PFYA 5EYFA 5TU0A 3M3KA 4YAHX 1GTKA 2ZYKA 4X1DA 2XXIA 4Q0CA 4HCWA 1IUDA 1B3EA 2X26A 5H8FB 3MPKA 4GF8A 4N07A 4HTGA 1MY2A 1HSEA 1R9LA 3QUJA 4JWXA 3LSWA 2REGA 4R75A 2YJPA 2I48A 1FTKA 4R2FA 3TKDA 2P1SA 4XTCQ 1B2HA 2O1MA 4JSOA 1LCFA 1QJMA 3PPOA 1H3DA 3KZGA 2RC7A 3T9VA 2D21A 1BIYA 3H7MA 2I4CA 4FIMA 2RCBA 4R74A 1WDNA 4LP2B 1OQGA 4JB7A 1N3WA 1XT8A 3MZBA 4QSEA 3K00A 2V3UA 1P99A 2H25A 5EHSA 3MJNA 3OD7A 2QJEA 4NF8B 1A7LA 4MBPA 5DVFA 2QS4A 5HBCA 3DM0A 4GXAA 4U4SA 3PUXE 3PUWE 4F29A 3FVOA 1S50A 1Y9UA 3OELA 1B1HA 3SEYA 1PDAA 1M5DA 2E0SA 1QKBA 1RKMA 1D9YA 3PMVA 2DWHA 5H8QB 2I49A 1NL5A 1FTMA 4EQ7A 2M8CA 3Q28A 4JDFA 3VV5A 3PV0E 1JETA 1ZTYA 4IB2A 3N5LA 2XXVA 1M5EA 1B46A 1B7HA 4ELPA 3FJ7A 5IAIA 5TPAB 3FATA 4KFQA 3VLUA 5H8NA 5I2NA 3DELB 3QIMA 4RXLA 2F7AA 4NF5B 4OERA 4XXUA 4QRZA 1N7XA 1IQ7A 2NWJA 4NF6B 3CSBA 3FD3A 2I58A 1EZPA 2QRYA 1MQHA 2I3VA 4DIGA 3GBBA 4Q30B 1B52A 2XD3A 3IOUA 4UA8A 4E0WA 2AYSA 3QK6A 4H6DA 3LUYA 2O68A 3SETA 1ZKBA 5FHMA 2DS9A 2RINA 5DEXA 4GXSB 3SDFA 2H4IA 2W7YA 1QUIA 3C9HA 4GL8A 1LB8A 2F8DA 3QYTA 1Z7NE 3T9HB 3O97A 4EQBA 4U1ZA 4F3BA 3MVWA 4F22A 5I58B 1SW2A 1IXGA 4JWOA 1DTGA 1FTJA 2AL5A 1B51A 4RPNA 1OVTA 3OSRA 4YMBA 3TDJA 2XX8A 4G77A 3LSFB 3E13X 1DPPA 2QS1A 3O28A 4ECFA 3BFTA 3FVNA 3LSLA 2QPQA 1MY1A 2UVHA 3L6HA 4U4XA 3B6QA 4OETA 4POWA 4MFIA 3K6XA 4GLIA 2XXQA 3HV1A 1N7WA 4QSCA 2R71A 4G8HA 2DE4A 3TQLA 3SEWA 3OEKA 3THIA 1H76A 1MY3A 5ELVA 4Z7EA 4GFRA 1CB6A 2ONSA 3Q26A 3IAZA 4X1BA 4EXKA 1D4NA 2Z8EA 2ANJA 3DP6A 4FE8A 4ZEIA 4YKIA 4LZ7A 5BWJA 3TEPA 1GVCA 3K0VA 4GD5A 4U23A 2R6GE 2UVGA 1F9BA 3A3UA 3CR9A 2ESNA 3PU5A 2PT1A 3C36A 2QSXA 1MH4A 3CFLA 3OO9A 2ZXTA 2XX9A 4GRKA 3K4UA 4IO6A 1Y4CA 1Y3NA 1QVSA 1I69A 3BFUA 1B3HA 2VD3A 3H3GA 3CFZA 1PEBA 4F2QA 3O2AA 1WODA 3RPWA 2IEEA 3G3FA 2THIA 2V84A 3MZ9A 4KYEA 4NTLA 5DYHA 3RTFB 3S2VA 3W15C 3G3JA 4ONYA 3HCQA 3H6WA 3KSXA 3K1NA 1UQWA 4OXVA 4NEDA 4IY6A 2F5XA 3A3CA 3TPAA 3JZJA 3VLVA 2O69A 2VOZA 4QSDA 3RY3A 3G3GA 5KCJB 5H8FA 3RLFE 4YICA 3MQ9A 4M4GA 3S9MC 2GRVA 3LSXA 4RYAA 2YLNA 1P1NA 1UTHB 3MVYA 3EF7A 3K6UA 4YB7A 1XVXA 2DWJA 5H8HA 3VVFA 4YKKA 1B5JA 5CI5A 3C4MA 4BLAA 4Q8RA 3S9EA 1A8FA 1URGA 3IOVA 1KWHA 2G29A 4QFLA 2XHDA 3I5OA 4BDQA 2V93A 2UYEA 3RT6B 3FJGA 3MW0A 1FQDA 3VXCA 3FGSA 1SQYA 1O64A 3VVDA 2XD2A 3G3IA 4NF8A 5TP9B 3TTKA 2F35A 1Q1KA 5AA3A 2R9JA 5L9OA 3IOWA 1UIVA 3OO7A 3DLNA 1NFTA 1B7ZA 4ISUA 3V5AA 3PPNA 4BDLA 3MWBA 2LAOA 1A40A 1AIVA 2CZLA 4ZE8A 4RNSA 5ITPA 2P2AA 4U1OA 1B0HA 2IA4A 5H8QA 4NMYA 3K02A 4F19A 1MXYA 3PPQA 3BBRA 4GQOA 3L6GA 3ZKKA 4LVQA 2ZNTA 1N76A 4C0RA 2B3BA 3TELA 1DMBA 2AIXA 3I3VA 5TPAA 2Y7IA 4C1TA 5FHNA 4YB6A 3Q29A 4NF5A 1IZ1A 3MUQA 3TYHA 2XXWA 4NF6A 4KYSA 5A5XB 1B7UA 4ZS9A 3IL1B 2A5SA 2CMOA 2G93A 1POY1 3U94A 2ZYNA 2REJA 3PPRA 4GWOA 3CRBA 3RQTA 1B3LA 1LB9A 4IO2A 2PMSA 1FQCA 4G8MA 5CMCA 1II5A 2Z22A 1NH7A 4BDOA 5I59B 1QW0A 3O6IA 4NF4B 1OQHA 1JW4A 2OZZA 4MF3A 3E4RA 3WAEA 5CBSA 4F3SA 1GGGA 3T66A 2I6EA 5I58A 2BJJX 3VLWA 1FQFA 4KD5A 1N0TA 1NMUA 1P1QA 1DOTA 4XIGQ 1USYH 4OYVA 2H99A 4LZ8A 1A54A 1LBBA 2I4BA 4FEBA 4ELQA 4F31B 4P0GA 3O29A 2DVCA 2Y7WA 3VFJA 1P1WA 3TMGA 1MXZA 3V89B 3W9VA 1B58A 3EHUA 1L5TA 4TQUQ 4XKRA 2YPNA 4ELRA 4RK2A 2QS3A 3ILUB 2QS2A 5ISUA 2Y7RA 3C31A 3CFXA 1D3KA 4OESA 3QSLA 4R2BA 1WVJA 3RN8A 1EH3A 3V83A 3O6GA 1ZJLA 5I2KB 4M1VA 3U72A 4AB6A 2RC9A 2ZNUA 1Z7ME 2ZNSA 1ZIUA 5L9MA 2Q8JA 1MH3A 3IORA 1EZOA 1VFDA 4F18A 3TTLA 1Y3PA 1NNTA 3ODBA 4JXIA 2Z23A 4OMBA 1MQDA 4ESXA 2O51A 5L9SA 1JNFA 2QL3A 4TLLB 2HQ0A 1YCJA 4OWDA 4F1UA 3HPIA 4LQ5A 3PPPA 4IGTA 1MDQA 4DXBA 1USYE 3G7WA 4ZECA 2OK2A 1B3GA 4YU0A 3CIJA 2VP1A 2O84X 4H67A 3S9NC 5JTYA 4H8IA 4GOTA 3TCHA 4DDDA 2A5TB 5FHOA 3KN8A 1TWYA 4RY1A 4OEVA 2QMWA 3R6UA 4H8JA 3S4UA 3KOTA 1S9TA 5CBRA 1MXXA 3PGFA 4KI0E 5AA4A 5M2VA 3P7IA 1PB7A 1JQFA 1B05A 1T0KA 1OLCA 1B9JA 3HSTA 3H6UA 3O9PA 3IB1A 5KCJA 3FV2A 2E1SA 3ZS6A 4FECA 3IOTA 4R9GA 4G68A 1JW1A 1PBPA 2Y84A 3UK4A 1UTHA 4QHQA 3MPLA 1OMPA 1SDXA 2VHAA 3B7DA 3K6WA 2Z8DA 1MQGA 2I3WA 4ELOA 3WAFA 3VXBA 3MVXA 3E3KA 4OQOA 4F3PA 3IO4A 4ZE9A 4GVOA 1FQBA 1LGBC 4GIZA 3MBPA 4IO7A 4KCCA 5I2NB 1VE4A 2NOOA 5HPQA 3FASA 4P11A 4U22A 4PFTA 3M8UA 1H44A 1YAEA 5I57A 4UACA 5BUUA 3IO6A 2GH9A 3CG3A 1LAXA 3TODA 3OEMA 4EF1A 1ZMGA 1LAGE 3HHGA 1D9VA 3OXNA 3SEVA 2GHBA 1URDA 3KFMA 3MVZA 2O1LA 4YMAA 3CVGA 3GBAA 3U1OA 3R7XA 1GR2A 5ICQA 2V3TA 3HHFA 4EDPA 3U93A 4RPOA 3HO7A 1VFEA 4KPTA 2FNCA 2FA7A 4FJPA 4KR5A 3USDA 4PQJA 2XX7A 2OWTA 5JK4A 4X48A 1B5IA 1XHYA 4H1XA 1XC1A 1M5FA 4O3BA 3SERA 1J1NA 4AQ4A 1H45A 3N26A 4WEDA 5ICTA 4F1YA 4HS7A 2Q2AA 1LCTA 4YB5A 4RJZA 2H9BA 5KZTA 3SEUA 2O6AA 1B4HA 3T93B 1SI1A 4F3GA 4FORA 4Z0IA 3IJXB 1Y20A 4N13A 3TFLA 1LAHE 1B6HA 4O3AA 1BTJA 1POTA 3ILTB 4OVJA 1MRPA 2D5WA 5JEIA 5CRYA 4FATA 1TT1A 3LC8A 3VVEA 4PFUA 1B3FA 3LBSA 4EUOA 1QUJA 5KDTB 4OZ9A 4BDMA 1ANFA 4QFOA 5L8DA 1BP5A 4U21A 3S9LC 3I6VA 3PD8A 4JBZA 4FAJA 3G3HA 3SKPA 3E9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6B A;  2V25 A;  2D3I A;  1MG1 A;  4NF4 A;  2HZK A;  3EHT A;  3R26 A;  2DOJ A;  1P1O A;  3ZKL A;  1P1U A;  3PUZ E;  1GV8 A;  5FTH A;  4HCY A;  4H5G A;  2XXT A;  3FIR A;  2DWI A;  1R1N A;  5I56 B;  4IO3 A;  4HW8 A;  4F2O A;  1LFH A;  1B1X A;  3TCF A;  4O3C A;  2DE2 A;  2AL4 A;  2F34 A;  3T9U A;  1BLF A;  5AA2 B;  1JW5 A;  4H0W A;  1LFI A;  3BKI B;  5B7D A;  2B3F A;  3ZSF A;  2UVI A;  3KN7 A;  5F1Q A;  1JEV A;  3OO8 A;  3GLB A;  2ALU A;  1ZBM A;  3IK6 B;  1O7T A;  1FTO A;  2UXA A;  3EPE A;  3N6T A;  1N3X A;  4OFJ A;  3TTR A;  3FXU A;  4G2Z A;  3KOS A;  3KJT A;  1AOV A;  1SW4 A;  3UGW A;  3A09 A;  5IKB A;  1FCK A;  4JSD A;  1MQI A;  1FQE A;  1NNP A;  5AA1 A;  2F6G A;  3G3K A;  4OFL A;  1Y3Q A;  1R6Z A;  4YKP A;  1B4Z A;  2FYI A;  3UIF A;  4ZEF A;  2DP8 A;  1LST A;  2RKM A;  5I2K A;  2ZYO A;  1B40 A;  2VGQ A;  3O6H A;  2X7Q A;  3MC2 A;  1MPB A;  4R6Y A;  3FVG A;  2F36 A;  3CSG A;  1A99 A;  1XOC A;  1UTB B;  1JEU A;  3OOA A;  1N84 A;  5H8H B;  1HSJ A;  4R9F A;  4TOZ A;  2X7P A;  1PB8 A;  1MS7 A;  1SI0 A;  3ECR A;  4NWC A;  1IXC A;  3SEX A;  3K2D A;  4OEN A;  2WKY A;  2ZYM A;  3MP6 A;  3UN6 A;  1NKX A;  1DTZ A;  3KBR A;  4NE4 A;  1DSN A;  3H4Z A;  1VSO A;  1SVX B;  1RYO A;  4NWD A;  3KGC A;  3PMX A;  4EXL A;  1CE2 A;  2Q88 A;  3ONM A;  2XXY A;  5EHM A;  1SD3 A;  3FVK A;  2NVU B;  4R72 A;  1UIU A;  2RCA A;  4IO4 A;  2XXP A;  4R6K A;  2GFE A;  3W9W A;  2A5T A;  4OEU A;  1Y1M A;  3OO6 A;  4EQ9 A;  2ZMB A;  3N6U A;  5HM4 B;  3QAX A;  5CMB A;  4Q5T A;  4F1V A;  2OWS A;  4PFW A;  1B32 A;  2F7C A;  2OJT A;  5J1D A;  3C34 A;  3K1P A;  4ZEK A;  4WEP A;  2VD2 A;  2HAV A;  3PD9 A;  4IGR A;  2DXY A;  2HXW A;  2UVJ A;  3PUV E;  4PET A;  2I0B A;  2GHA A;  1LAF E;  1EZ9 A;  1Q35 A;  1MM7 A;  4DLD A;  4BDN A;  3MP1 A;  4H65 A;  3D4C A;  4G4P A;  1JVY A;  1PC3 A;  4XKQ A;  4ZDM A;  4POX A;  2ONR A;  3DP4 A;  3TAJ A;  4LA9 A;  3OSQ A;  1N04 A;  4MH5 A;  2RF1 A;  3FV1 A;  3MAM A;  2DSF A;  3H06 B;  3M3L A;  3C33 A;  1YTV A;  3UOR A;  3KEI A;  1TXF A;  3U8Q A;  5AE4 A;  4ZZE A;  2OBG A;  3U92 A;  2Q89 A;  1B5H A;  4OHN A;  3TQW A;  4K3F A;  1M5C A;  2F6P A;  3K6V A;  4WXJ A;  3F11 A;  2KLF A;  2F7B A;  4THI A;  2DE3 A;  3KJ7 A;  3T9X B;  4XKP A;  3B6T A;  5B70 A;  5H8S A;  5CMM A;  3TCG A;  1TFD A;  1MY0 A;  4IO5 A;  1OIB A;  3GXA A;  3TTN A;  2DYX A;  4ND9 A;  2HAU A;  2Q2C A;  1Y4T A;  4WKM A;  3AXF A;  4R6H A;  1BKA A;  1SBP A;  5AA2 D;  1EU8 A;  3MP8 A;  1A8E A;  1JVX A;  2XXX A;  1LLS A;  5CM6 A;  3EHS A;  1SYH A;  1AH5 A;  1IXI A;  3Q25 A;  4N6P A;  5F7V A;  3IB2 A;  1MY4 A;  4LZ5 A;  3TZA A;  1I6A A;  1LFG A;  5CMK A;  1PBQ A;  3C32 A;  1M5B A;  5K2X A;  1VR5 A;  1SW1 A;  1IIW A;  3RUM A;  4DE8 A;  2NXO A;  4P0I A;  5DVI A;  1SW5 A;  2DQV A;  3FUZ A;  1PB9 A;  4F39 A;  3IJO B;  2ONK E;  3PMW A;  2DXR A;  4JWY A;  5FTI A;  2Y7P A;  2OLB A;  3PUY E;  1MDP 1;  1MXW A;  4ESW A;  3TUS A;  1A55 A;  1OLA A;  2H98 A;  2HFB A;  4G68 C;  1ATG A;  5KDT A;  5H8N B;  4I1D A;  3KN3 A;  2PYY A;  2HCA A;  2ABH A;  5DT6 A;  3H03 A;  4DXC A;  2XXR A;  3GZG A;  1NH8 A;  5CC2 A;  3K1M A;  3UP9 A;  3O66 A;  1MPD A;  4I8C A;  4KCD A;  1O63 A;  1HSL A;  4RK9 A;  1I6Q A;  5TP9 A;  4AB5 A;  1XS5 A;  4QFP A;  3KG2 A;  4PE5 B;  4KYD A;  1ZU0 A;  3H6V A;  2O7U A;  5I56 A;  3C35 A;  1FW0 A;  2HZL A;  1RYX A;  5AA2 A;  3QUF A;  4LQ2 A;  2Z8F A;  2UYF A;  4BDR A;  5DEX B;  4GL0 A;  4C1U A;  1ZLQ A;  1S7Y A;  3IX1 A;  4DCY A;  1LBC A;  1AL3 A;  2DWA A;  4ZED A;  3EQ1 A;  4LUB A;  2I0C A;  4H5F A;  3FZV A;  4DCX A;  1R9Q A;  1QUK A;  4DXU A;  5JTY B;  2HEU A;  4E0X A;  1FTL A;  1QUL A;  4ZZA A;  4MLQ A;  4XKN A;  3JYR A;  5DVJ A;  1AMF A;  2XXU A;  3QXM A;  3SES A;  2Q9T A;  5K2Y A;  3IR1 A;  2Y7K A;  4I9D A;  3FJM A;  5AA4 B;  2OCU A;  3N94 A;  3H6T A;  2PBW A;  3RGY A;  5I84 A;  1MM6 A;  1IEJ A;  3RT8 A;  5LOM A;  2PT2 A;  2P0S A;  5A5X A;  1MQJ A;  4IY5 A;  1UTB A;  3UA8 A;  4G68 B;  2V3Q A;  4LAT A;  4X9T A;  2PX1 A;  3RNN A;  3B6W A;  4QFK A;  3TTM A;  2XXH A;  1H43 A;  3VE1 B;  3T22 A;  1B0L A;  4YKJ A;  1IXH A;  1IIT A;  2F78 A;  3RTW B;  1XVY A;  4OFO A;  5I59 A;  2PVU A;  4QF9 A;  3DP8 A;  1NNK A;  4LON B;  4KQP A;  1MXV A;  4MLV A;  5ITO A;  3V8X B;  1QKA A;  3CI8 A;  5I57 B;  2B65 A;  3Q27 A;  1DPE A;  2O7I A;  2DVZ A;  1TFA A;  1SYI A;  1NNF A;  2F97 A;  3FXQ A;  4YZZ A;  4EF2 A;  4G8N A;  4R73 A;  3OEN A;  3K01 A;  1URS A;  2QMX A;  2NUV A;  4TLM B;  4RA1 A;  4KHZ E;  1OVB A;  3T96 B;  1Y1Z A;  2RC8 A;  3HN0 A;  4PP0 A;  4FED A;  4I62 A;  4L17 A;  4U2R A;  4QFN A;  3OMB A;  3VDF A;  3M3F A;  3JV9 A;  1YPN A;  2H5Y A;  4DZ1 A;  4ZEB A;  3D4G A;  3KSJ A;  1US4 A;  1MXU A;  1ELJ A;  3CG1 A;  3IB0 A;  3MZ1 A;  1FQA A;  5DTB A;  1US5 A;  3EN3 A;  3FXR A;  4OTE A;  1MPC A;  3LR1 A;  4PFY A;  5EYF A;  5TU0 A;  3M3K A;  4YAH X;  1GTK A;  2ZYK A;  4X1D A;  2XXI A;  4Q0C A;  4HCW A;  1IUD A;  1B3E A;  2X26 A;  5H8F B;  3MPK A;  4GF8 A;  4N07 A;  4HTG A;  1MY2 A;  1HSE A;  1R9L A;  3QUJ A;  4JWX A;  3LSW A;  2REG A;  4R75 A;  2YJP A;  2I48 A;  1FTK A;  4R2F A;  3TKD A;  2P1S A;  4XTC Q;  1B2H A;  2O1M A;  4JSO A;  1LCF A;  1QJM A;  3PPO A;  1H3D A;  3KZG A;  2RC7 A;  3T9V A;  2D21 A;  1BIY A;  3H7M A;  2I4C A;  4FIM A;  2RCB A;  4R74 A;  1WDN A;  4LP2 B;  1OQG A;  4JB7 A;  1N3W A;  1XT8 A;  3MZB A;  4QSE A;  3K00 A;  2V3U A;  1P99 A;  2H25 A;  5EHS A;  3MJN A;  3OD7 A;  2QJE A;  4NF8 B;  1A7L A;  4MBP A;  5DVF A;  2QS4 A;  5HBC A;  3DM0 A;  4GXA A;  4U4S A;  3PUX E;  3PUW E;  4F29 A;  3FVO A;  1S50 A;  1Y9U A;  3OEL A;  1B1H A;  3SEY A;  1PDA A;  1M5D A;  2E0S A;  1QKB A;  1RKM A;  1D9Y A;  3PMV A;  2DWH A;  5H8Q B;  2I49 A;  1NL5 A;  1FTM A;  4EQ7 A;  2M8C A;  3Q28 A;  4JDF A;  3VV5 A;  3PV0 E;  1JET A;  1ZTY A;  4IB2 A;  3N5L A;  2XXV A;  1M5E A;  1B46 A;  1B7H A;  4ELP A;  3FJ7 A;  5IAI A;  5TPA B;  3FAT A;  4KFQ A;  3VLU A;  5H8N A;  5I2N A;  3DEL B;  3QIM A;  4RXL A;  2F7A A;  4NF5 B;  4OER A;  4XXU A;  4QRZ A;  1N7X A;  1IQ7 A;  2NWJ A;  4NF6 B;  3CSB A;  3FD3 A;  2I58 A;  1EZP A;  2QRY A;  1MQH A;  2I3V A;  4DIG A;  3GBB A;  4Q30 B;  1B52 A;  2XD3 A;  3IOU A;  4UA8 A;  4E0W A;  2AYS A;  3QK6 A;  4H6D A;  3LUY A;  2O68 A;  3SET A;  1ZKB A;  5FHM A;  2DS9 A;  2RIN A;  5DEX A;  4GXS B;  3SDF A;  2H4I A;  2W7Y A;  1QUI A;  3C9H A;  4GL8 A;  1LB8 A;  2F8D A;  3QYT A;  1Z7N E;  3T9H B;  3O97 A;  4EQB A;  4U1Z A;  4F3B A;  3MVW A;  4F22 A;  5I58 B;  1SW2 A;  1IXG A;  4JWO A;  1DTG A;  1FTJ A;  2AL5 A;  1B51 A;  4RPN A;  1OVT A;  3OSR A;  4YMB A;  3TDJ A;  2XX8 A;  4G77 A;  3LSF B;  3E13 X;  1DPP A;  2QS1 A;  3O28 A;  4ECF A;  3BFT A;  3FVN A;  3LSL A;  2QPQ A;  1MY1 A;  2UVH A;  3L6H A;  4U4X A;  3B6Q A;  4OET A;  4POW A;  4MFI A;  3K6X A;  4GLI A;  2XXQ A;  3HV1 A;  1N7W A;  4QSC A;  2R71 A;  4G8H A;  2DE4 A;  3TQL A;  3SEW A;  3OEK A;  3THI A;  1H76 A;  1MY3 A;  5ELV A;  4Z7E A;  4GFR A;  1CB6 A;  2ONS A;  3Q26 A;  3IAZ A;  4X1B A;  4EXK A;  1D4N A;  2Z8E A;  2ANJ A;  3DP6 A;  4FE8 A;  4ZEI A;  4YKI A;  4LZ7 A;  5BWJ A;  3TEP A;  1GVC A;  3K0V A;  4GD5 A;  4U23 A;  2R6G E;  2UVG A;  1F9B A;  3A3U A;  3CR9 A;  2ESN A;  3PU5 A;  2PT1 A;  3C36 A;  2QSX A;  1MH4 A;  3CFL A;  3OO9 A;  2ZXT A;  2XX9 A;  4GRK A;  3K4U A;  4IO6 A;  1Y4C A;  1Y3N A;  1QVS A;  1I69 A;  3BFU A;  1B3H A;  2VD3 A;  3H3G A;  3CFZ A;  1PEB A;  4F2Q A;  3O2A A;  1WOD A;  3RPW A;  2IEE A;  3G3F A;  2THI A;  2V84 A;  3MZ9 A;  4KYE A;  4NTL A;  5DYH A;  3RTF B;  3S2V A;  3W15 C;  3G3J A;  4ONY A;  3HCQ A;  3H6W A;  3KSX A;  3K1N A;  1UQW A;  4OXV A;  4NED A;  4IY6 A;  2F5X A;  3A3C A;  3TPA A;  3JZJ A;  3VLV A;  2O69 A;  2VOZ A;  4QSD A;  3RY3 A;  3G3G A;  5KCJ B;  5H8F A;  3RLF E;  4YIC A;  3MQ9 A;  4M4G A;  3S9M C;  2GRV A;  3LSX A;  4RYA A;  2YLN A;  1P1N A;  1UTH B;  3MVY A;  3EF7 A;  3K6U A;  4YB7 A;  1XVX A;  2DWJ A;  5H8H A;  3VVF A;  4YKK A;  1B5J A;  5CI5 A;  3C4M A;  4BLA A;  4Q8R A;  3S9E A;  1A8F A;  1URG A;  3IOV A;  1KWH A;  2G29 A;  4QFL A;  2XHD A;  3I5O A;  4BDQ A;  2V93 A;  2UYE A;  3RT6 B;  3FJG A;  3MW0 A;  1FQD A;  3VXC A;  3FGS A;  1SQY A;  1O64 A;  3VVD A;  2XD2 A;  3G3I A;  4NF8 A;  5TP9 B;  3TTK A;  2F35 A;  1Q1K A;  5AA3 A;  2R9J A;  5L9O A;  3IOW A;  1UIV A;  3OO7 A;  3DLN A;  1NFT A;  1B7Z A;  4ISU A;  3V5A A;  3PPN A;  4BDL A;  3MWB A;  2LAO A;  1A40 A;  1AIV A;  2CZL A;  4ZE8 A;  4RNS A;  5ITP A;  2P2A A;  4U1O A;  1B0H A;  2IA4 A;  5H8Q A;  4NMY A;  3K02 A;  4F19 A;  1MXY A;  3PPQ A;  3BBR A;  4GQO A;  3L6G A;  3ZKK A;  4LVQ A;  2ZNT A;  1N76 A;  4C0R A;  2B3B A;  3TEL A;  1DMB A;  2AIX A;  3I3V A;  5TPA A;  2Y7I A;  4C1T A;  5FHN A;  4YB6 A;  3Q29 A;  4NF5 A;  1IZ1 A;  3MUQ A;  3TYH A;  2XXW A;  4NF6 A;  4KYS A;  5A5X B;  1B7U A;  4ZS9 A;  3IL1 B;  2A5S A;  2CMO A;  2G93 A;  1POY 1;  3U94 A;  2ZYN A;  2REJ A;  3PPR A;  4GWO A;  3CRB A;  3RQT A;  1B3L A;  1LB9 A;  4IO2 A;  2PMS A;  1FQC A;  4G8M A;  5CMC A;  1II5 A;  2Z22 A;  1NH7 A;  4BDO A;  5I59 B;  1QW0 A;  3O6I A;  4NF4 B;  1OQH A;  1JW4 A;  2OZZ A;  4MF3 A;  3E4R A;  3WAE A;  5CBS A;  4F3S A;  1GGG A;  3T66 A;  2I6E A;  5I58 A;  2BJJ X;  3VLW A;  1FQF A;  4KD5 A;  1N0T A;  1NMU A;  1P1Q A;  1DOT A;  4XIG Q;  1USY H;  4OYV A;  2H99 A;  4LZ8 A;  1A54 A;  1LBB A;  2I4B A;  4FEB A;  4ELQ A;  4F31 B;  4P0G A;  3O29 A;  2DVC A;  2Y7W A;  3VFJ A;  1P1W A;  3TMG A;  1MXZ A;  3V89 B;  3W9V A;  1B58 A;  3EHU A;  1L5T A;  4TQU Q;  4XKR A;  2YPN A;  4ELR A;  4RK2 A;  2QS3 A;  3ILU B;  2QS2 A;  5ISU A;  2Y7R A;  3C31 A;  3CFX A;  1D3K A;  4OES A;  3QSL A;  4R2B A;  1WVJ A;  3RN8 A;  1EH3 A;  3V83 A;  3O6G A;  1ZJL A;  5I2K B;  4M1V A;  3U72 A;  4AB6 A;  2RC9 A;  2ZNU A;  1Z7M E;  2ZNS A;  1ZIU A;  5L9M A;  2Q8J A;  1MH3 A;  3IOR A;  1EZO A;  1VFD A;  4F18 A;  3TTL A;  1Y3P A;  1NNT A;  3ODB A;  4JXI A;  2Z23 A;  4OMB A;  1MQD A;  4ESX A;  2O51 A;  5L9S A;  1JNF A;  2QL3 A;  4TLL B;  2HQ0 A;  1YCJ A;  4OWD A;  4F1U A;  3HPI A;  4LQ5 A;  3PPP A;  4IGT A;  1MDQ A;  4DXB A;  1USY E;  3G7W A;  4ZEC A;  2OK2 A;  1B3G A;  4YU0 A;  3CIJ A;  2VP1 A;  2O84 X;  4H67 A;  3S9N C;  5JTY A;  4H8I A;  4GOT A;  3TCH A;  4DDD A;  2A5T B;  5FHO A;  3KN8 A;  1TWY A;  4RY1 A;  4OEV A;  2QMW A;  3R6U A;  4H8J A;  3S4U A;  3KOT A;  1S9T A;  5CBR A;  1MXX A;  3PGF A;  4KI0 E;  5AA4 A;  5M2V A;  3P7I A;  1PB7 A;  1JQF A;  1B05 A;  1T0K A;  1OLC A;  1B9J A;  3HST A;  3H6U A;  3O9P A;  3IB1 A;  5KCJ A;  3FV2 A;  2E1S A;  3ZS6 A;  4FEC A;  3IOT A;  4R9G A;  4G68 A;  1JW1 A;  1PBP A;  2Y84 A;  3UK4 A;  1UTH A;  4QHQ A;  3MPL A;  1OMP A;  1SDX A;  2VHA A;  3B7D A;  3K6W A;  2Z8D A;  1MQG A;  2I3W A;  4ELO A;  3WAF A;  3VXB A;  3MVX A;  3E3K A;  4OQO A;  4F3P A;  3IO4 A;  4ZE9 A;  4GVO A;  1FQB A;  1LGB C;  4GIZ A;  3MBP A;  4IO7 A;  4KCC A;  5I2N B;  1VE4 A;  2NOO A;  5HPQ A;  3FAS A;  4P11 A;  4U22 A;  4PFT A;  3M8U A;  1H44 A;  1YAE A;  5I57 A;  4UAC A;  5BUU A;  3IO6 A;  2GH9 A;  3CG3 A;  1LAX A;  3TOD A;  3OEM A;  4EF1 A;  1ZMG A;  1LAG E;  3HHG A;  1D9V A;  3OXN A;  3SEV A;  2GHB A;  1URD A;  3KFM A;  3MVZ A;  2O1L A;  4YMA A;  3CVG A;  3GBA A;  3U1O A;  3R7X A;  1GR2 A;  5ICQ A;  2V3T A;  3HHF A;  4EDP A;  3U93 A;  4RPO A;  3HO7 A;  1VFE A;  4KPT A;  2FNC A;  2FA7 A;  4FJP A;  4KR5 A;  3USD A;  4PQJ A;  2XX7 A;  2OWT A;  5JK4 A;  4X48 A;  1B5I A;  1XHY A;  4H1X A;  1XC1 A;  1M5F A;  4O3B A;  3SER A;  1J1N A;  4AQ4 A;  1H45 A;  3N26 A;  4WED A;  5ICT A;  4F1Y A;  4HS7 A;  2Q2A A;  1LCT A;  4YB5 A;  4RJZ A;  2H9B A;  5KZT A;  3SEU A;  2O6A A;  1B4H A;  3T93 B;  1SI1 A;  4F3G A;  4FOR A;  4Z0I A;  3IJX B;  1Y20 A;  4N13 A;  3TFL A;  1LAH E;  1B6H A;  4O3A A;  1BTJ A;  1POT A;  3ILT B;  4OVJ A;  1MRP A;  2D5W A;  5JEI A;  5CRY A;  4FAT A;  1TT1 A;  3LC8 A;  3VVE A;  4PFU A;  1B3F A;  3LBS A;  4EUO A;  1QUJ A;  5KDT B;  4OZ9 A;  4BDM A;  1ANF A;  4QFO A;  5L8D A;  1BP5 A;  4U21 A;  3S9L C;  3I6V A;  3PD8 A;  4JBZ A;  4FAJ A;  3G3H A;  3SKP A;  3E9X A; 
#chains in the Genus database with same CATH topology
 1I6B A;  2V25 A;  2D3I A;  3HFU A;  5DW8 A;  1MG1 A;  4NF4 A;  4OA4 A;  2HZK A;  3EHT A;  3R26 A;  2DOJ A;  1P1O A;  3ZKL A;  1P1U A;  3PUZ E;  1GV8 A;  5FTH A;  4HCY A;  4H5G A;  2XXT A;  2JJK A;  3FIR A;  2DWI A;  1R1N A;  5I56 B;  4IO3 A;  4HW8 A;  2WYP A;  4F2O A;  1LFH A;  4NG7 A;  1B1X A;  3TCF A;  4O3C A;  2DE2 A;  2AL4 A;  2F34 A;  3T9U A;  1BLF A;  5AA2 B;  1JW5 A;  4H0W A;  1LFI A;  3BKI B;  5B7D A;  2B3F A;  1KA1 A;  3ZSF A;  2UVI A;  3KN7 A;  1IMC A;  5F1Q A;  1JEV A;  3OO8 A;  3GLB A;  1ZBM A;  2ALU A;  3IK6 B;  1O7T A;  1FTO A;  2UXA A;  3EPE A;  3N6T A;  1N3X A;  4OFJ A;  3TTR A;  3FXU A;  4G2Z A;  3KOS A;  3KJT A;  1AOV A;  1SW4 A;  2L5V A;  3UGW A;  3A09 A;  5IKB A;  1FCK A;  4JSD A;  1MQI A;  4N6D A;  1FQE A;  1IMD A;  1NNP A;  5AA1 A;  2F6G A;  3G3K A;  2Q8M A;  4OFL A;  1Y3Q A;  1R6Z A;  4YKP A;  1B4Z A;  2FYI A;  3UIF A;  3NOH A;  4ZEF A;  2DP8 A;  1LST A;  2RKM A;  5I2K A;  2ZYO A;  1B40 A;  2VGQ A;  3O6H A;  4FBP A;  2X7Q A;  3MC2 A;  1MPB A;  4R6Y A;  4MHF A;  2CEX A;  3FVG A;  2F36 A;  3CSG A;  1A99 A;  4DI3 D;  1XOC A;  1UTB B;  1FJ9 A;  1JEU A;  1NUY A;  4MJO A;  3OOA A;  1N84 A;  5H8H B;  1HSJ A;  4R9F A;  4TOZ A;  2X7P A;  3BIH A;  1PB8 A;  1MS7 A;  1SI0 A;  3ECR A;  4NWC A;  1IXC A;  3SEX A;  3K2D A;  4OEN A;  2WKY A;  2ZYM A;  1KZ8 A;  3MP6 A;  3UN6 A;  1NKX A;  1DTZ A;  3KBR A;  4NE4 A;  1DSN A;  3H4Z A;  1VSO A;  1SVX B;  4PFR A;  1RYO A;  4NWD A;  3KGC A;  3PMX A;  4EXL A;  1CE2 A;  2Q88 A;  3ONM A;  2XXY A;  5EHM A;  1SD3 A;  3FVK A;  2NVU B;  1IMF A;  4R72 A;  1UIU A;  2RCA A;  4IO4 A;  2XXP A;  2QVU A;  4R6K A;  2ZZX A;  2GFE A;  3W9W A;  2A5T A;  4OEU A;  1Y1M A;  2PFZ A;  3OO6 A;  4NX1 A;  4EQ9 A;  2ZMB A;  3N6U A;  5HM4 B;  3ROJ A;  1FPK A;  3QAX A;  5CMB A;  4Q5T A;  4JVC A;  4F1V A;  2OWS A;  4PFW A;  1B32 A;  2F7C A;  2OJT A;  5I7I A;  5J1D A;  3C34 A;  2CZH A;  3K1P A;  4ZEK A;  4WEP A;  4GBW A;  2VD2 A;  2HAV A;  3PD9 A;  4IGR A;  2DXY A;  2HXW A;  2UVJ A;  3PUV E;  4PET A;  5LTC A;  2I0B A;  2GHA A;  1LAF E;  1EZ9 A;  1Q35 A;  1MM7 A;  3LV0 A;  4DLD A;  4BDN A;  3MP1 A;  4H65 A;  3D4C A;  4G4P A;  1JVY A;  4JVI A;  1PC3 A;  4XKQ A;  4ZDM A;  4PF6 A;  4PFI A;  4POX A;  2ONR A;  4P1E A;  3DP4 A;  2HXR A;  3TAJ A;  4LA9 A;  3OSQ A;  1N04 A;  4MH5 A;  2RF1 A;  3FV1 A;  1NUZ A;  3MAM A;  2DSF A;  3H06 B;  3M3L A;  5ET8 A;  3C33 A;  1YTV A;  3UOR A;  3KEI A;  1TXF A;  3KC0 A;  3U8Q A;  5AE4 A;  3GYY A;  4ZZE A;  2OBG A;  4MX6 A;  3U92 A;  2Q89 A;  1B5H A;  4OHN A;  1EYI A;  3TQW A;  4K3F A;  1M5C A;  1D9Q A;  2F6P A;  3K6V A;  4WXJ A;  3F11 A;  2KLF A;  2F7B A;  4THI A;  2R8T A;  2DE3 A;  3KJ7 A;  3T9X B;  4XKP A;  3B6T A;  5H8S A;  5CMM A;  5B70 A;  3TCG A;  1TFD A;  1MY0 A;  4IO5 A;  1OIB A;  4OVQ A;  3GXA A;  3TTN A;  2DYX A;  4ND9 A;  2HAU A;  2Q2C A;  1Y4T A;  4WKM A;  3AXF A;  4R6H A;  4HE1 A;  1BKA A;  1SBP A;  4OAN A;  5AA2 D;  1EU8 A;  3MP8 A;  1A8E A;  1JVX A;  2XXX A;  3IFC A;  1LLS A;  5CM6 A;  3EHS A;  1SYH A;  1AH5 A;  1IXI A;  3Q25 A;  4N6P A;  5F7V A;  3IB2 A;  1MY4 A;  4LZ5 A;  3TZA A;  1IMB A;  1I6A A;  1LFG A;  5CMK A;  1PBQ A;  3C32 A;  1M5B A;  1VR5 A;  5K2X A;  1SW1 A;  1EYK A;  1IIW A;  3RUM A;  4DE8 A;  2NXO A;  4P0I A;  5DVI A;  1SW5 A;  2DQV A;  3FUZ A;  4PAF A;  1PB9 A;  4F39 A;  3IJO B;  2ONK E;  5A5L A;  3PMW A;  2DXR A;  4JWY A;  5FTI A;  2Y7P A;  2OLB A;  3PUY E;  1SPI A;  1MDP 1;  2OWZ A;  1MXW A;  4ESW A;  3TUS A;  1A55 A;  1OLA A;  2H98 A;  1FPF A;  2HFB A;  4G68 C;  1ATG A;  5KDT A;  5H8N B;  2WBB A;  4I1D A;  3KN3 A;  2PYY A;  1YYZ A;  2HCA A;  2ABH A;  5DT6 A;  3H03 A;  4DXC A;  2XXR A;  3GZG A;  1NH8 A;  5CC2 A;  3K1M A;  3UP9 A;  3O66 A;  4GX3 A;  1MPD A;  4I8C A;  5T3J A;  4KCD A;  1O63 A;  1FBE A;  1HSL A;  4RK9 A;  1I6Q A;  5TP9 A;  4AB5 A;  1XS5 A;  4QFP A;  3KG2 A;  4PE5 B;  4KYD A;  3E79 A;  1ZU0 A;  3H6V A;  2O7U A;  5EYH A;  5I56 A;  2V4C A;  3C35 A;  1FW0 A;  2HZL A;  3FBP A;  1RYX A;  5AA2 A;  3QUF A;  4LQ2 A;  2Z8F A;  2UYF A;  4BDR A;  2CZI A;  5DEX B;  4GL0 A;  4C1U A;  1ZLQ A;  1S7Y A;  3IX1 A;  4DCY A;  1LBC A;  1AL3 A;  2DWA A;  4ZED A;  3B50 A;  3EQ1 A;  1FBD A;  4LUB A;  2I0C A;  1RDX A;  4H5F A;  3FZV A;  4DCX A;  1R9Q A;  1QUK A;  4DXU A;  5JTY B;  2HEU A;  4E0X A;  1FTL A;  1QUL A;  4ZZA A;  1LBW A;  4MLQ A;  4XKN A;  3JYR A;  5DVJ A;  1AMF A;  2XXU A;  1NUX A;  3QXM A;  3SES A;  2Q9T A;  5K2Y A;  3IR1 A;  2Y7K A;  5I5P A;  1FBC A;  4I9D A;  3FJM A;  4I3E A;  3D1R A;  5AA4 B;  2OCU A;  3N94 A;  3H6T A;  2PBW A;  3RGY A;  2PFY A;  5I84 A;  4NQ8 A;  1MM6 A;  1IEJ A;  3RT8 A;  2FVZ A;  5LOM A;  2PT2 A;  2VT5 A;  2XXK A;  4HE0 A;  2P0S A;  5A5X A;  1MQJ A;  4IY5 A;  1UTB A;  3UA8 A;  4G68 B;  1JP4 A;  2XWI A;  2V3Q A;  4LAT A;  4X9T A;  2PX1 A;  4PAK A;  3RNN A;  3B6W A;  4QFK A;  3TTM A;  2XXH A;  1H43 A;  3SZP A;  2WEF A;  3VE1 B;  3T22 A;  1B0L A;  4YKJ A;  1IXH A;  1IIT A;  2F78 A;  3RTW B;  1XVY A;  4OFO A;  5I59 A;  2PVU A;  4QF9 A;  3DP8 A;  1NNK A;  4LON B;  1DK4 A;  4KQP A;  4H46 A;  1MXV A;  5EQ8 A;  4MLV A;  5ITO A;  3V8X B;  1QKA A;  3CI8 A;  5I57 B;  2B65 A;  5IZZ A;  3Q27 A;  1DPE A;  4PGN A;  3IFA A;  2O7I A;  2DVZ A;  1TFA A;  1SYI A;  1NNF A;  2F97 A;  3FXQ A;  4YZZ A;  1LBZ A;  4P9K A;  4EF2 A;  2OX3 A;  4G8N A;  4R73 A;  1FPD A;  3OEN A;  3K01 A;  1URS A;  2QMX A;  2NUV A;  4TLM B;  4NF0 A;  4RA1 A;  4KHZ E;  1OVB A;  3T96 B;  1Y1Z A;  1RDZ A;  2RC8 A;  3HN0 A;  4PP0 A;  4FED A;  4I62 A;  4L17 A;  4U2R A;  2KR0 A;  4QFN A;  3OMB A;  3VDF A;  3M3F A;  2B4L A;  4HXV A;  3JV9 A;  1YPN A;  2H5Y A;  4DZ1 A;  4ZEB A;  3D4G A;  3KSJ A;  4PGP A;  1US4 A;  4GWZ A;  1MXU A;  3U65 A;  1ELJ A;  4PC9 A;  3CG1 A;  3IB0 A;  3MZ1 A;  1FQA A;  5DTB A;  1US5 A;  3EN3 A;  3FXR A;  4OTE A;  4N4U A;  1MPC A;  2BJI A;  3LR1 A;  4PFY A;  5EYF A;  2FIE A;  5TU0 A;  4PBQ A;  3M3K A;  1FPL A;  4YAH X;  1GTK A;  2ZYK A;  4X1D A;  2XXI A;  4Q0C A;  4HCW A;  1IUD A;  1B3E A;  4PDH A;  2X26 A;  5H8F B;  4O94 A;  3MPK A;  4GF8 A;  4N07 A;  4HTG A;  1MY2 A;  1HSE A;  1R9L A;  3QUJ A;  4JWX A;  3LSW A;  2REG A;  4R75 A;  2YJP A;  2I48 A;  1FTK A;  4R2F A;  3TKD A;  2P1S A;  4XTC Q;  1B2H A;  2O1M A;  4GX6 A;  4JSO A;  1LCF A;  1QJM A;  3PPO A;  1H3D A;  1FPE A;  3KZG A;  2RC7 A;  3T9V A;  2D21 A;  1BIY A;  3H7M A;  2I4C A;  4FIM A;  2DDK A;  2RCB A;  4R74 A;  1G0I A;  1WDN A;  4LP2 B;  1OQG A;  1FRP A;  4JB7 A;  1N3W A;  1XT8 A;  3MZB A;  4QSE A;  3K00 A;  2V3U A;  1P99 A;  4PCD A;  2H25 A;  5EHS A;  3MJN A;  3OD7 A;  1K9Z A;  2QJE A;  4NF8 B;  1A7L A;  2B4M A;  4MBP A;  1FBF A;  5DVF A;  2QS4 A;  5HBC A;  3DM0 A;  4GXA A;  4U4S A;  3PUX E;  3PUW E;  4F29 A;  3FVO A;  1S50 A;  1Y9U A;  3OEL A;  1B1H A;  2CZK A;  3SEY A;  1PDA A;  1M5D A;  4N8Y A;  4HE2 A;  4NGU A;  2E0S A;  1QKB A;  1RKM A;  1DBZ A;  1VDW A;  1XI6 A;  1D9Y A;  3PMV A;  2DWH A;  5H8Q B;  2I49 A;  1NL5 A;  1FTM A;  2ZZW A;  4EQ7 A;  2M8C A;  3Q28 A;  4JDF A;  3VV5 A;  3KBZ A;  3PV0 E;  1JET A;  1EYJ A;  1ZTY A;  4IB2 A;  3N5L A;  2XXV A;  1M5E A;  1B46 A;  1B7H A;  5EQ7 A;  4ELP A;  3FJ7 A;  2F3B A;  5IAI A;  5TPA B;  3FAT A;  4KFQ A;  4N91 A;  3VLU A;  5H8N A;  5I2N A;  3DEL B;  3QIM A;  4RXL A;  2F7A A;  4NF5 B;  4OER A;  4XXU A;  4QRZ A;  3MYU A;  1N7X A;  1IQ7 A;  2NWJ A;  4NF6 B;  3CSB A;  4PFB A;  3FD3 A;  2I58 A;  1EZP A;  2QRY A;  4I40 A;  1MQH A;  2I3V A;  3RPL B;  2ZZV A;  4DIG A;  3GBB A;  1LBX A;  4Q30 B;  1B52 A;  2XD3 A;  1AWB A;  3IOU A;  4UA8 A;  4E0W A;  2AYS A;  3QK6 A;  4H6D A;  3LUY A;  2O68 A;  3SET A;  1ZKB A;  5FHM A;  1QGX A;  2DS9 A;  2RIN A;  5DEX A;  4GXS B;  3SDF A;  2H4I A;  2W7Y A;  1QUI A;  3C9H A;  1INP A;  4NAP A;  5ET7 A;  4GL8 A;  1LB8 A;  2F8D A;  3QYT A;  4MIJ A;  1Q9D A;  1KA0 A;  1Z7N E;  3T9H B;  3O97 A;  4EQB A;  4U1Z A;  4F3B A;  3MVW A;  4F22 A;  5I58 B;  1SW2 A;  2P3V A;  1IXG A;  4JWO A;  1DTG A;  1FTJ A;  2AL5 A;  4OVR A;  1B51 A;  4O7I A;  4GWY A;  4RPN A;  5F24 A;  1OVT A;  3OSR A;  4YMB A;  3TDJ A;  4QXD A;  2XX8 A;  4G77 A;  3LSF B;  3E13 X;  1DPP A;  2QS1 A;  3O28 A;  4ECF A;  3BFT A;  1FPG A;  3FVN A;  3LSL A;  2QPQ A;  1MY1 A;  2UVH A;  3L6H A;  4U4X A;  2F3D A;  2XWV A;  3B6Q A;  5EQA A;  4OET A;  4POW A;  4MFI A;  3K6X A;  2KQZ A;  4GLI A;  4NHB A;  1NV5 A;  1NV7 A;  2XXQ A;  3HV1 A;  1N7W A;  4QSC A;  2R71 A;  4X8R A;  2QVR A;  4G8H A;  2DE4 A;  3TQL A;  4P3L A;  3SEW A;  3OEK A;  3THI A;  1H76 A;  1MY3 A;  5ELV A;  4Z7E A;  4GFR A;  4DI4 B;  1CB6 A;  2ONS A;  3Q26 A;  3IAZ A;  1FJ6 A;  4P56 A;  4X1B A;  4EXK A;  1D4N A;  4NN3 A;  2Z8E A;  2ANJ A;  1YXI A;  3DP6 A;  4FE8 A;  1FBG A;  4ZEI A;  4X04 A;  4YKI A;  4LZ7 A;  5BWJ A;  3TEP A;  1IMA A;  1LBV A;  1GVC A;  2HPG A;  3K0V A;  4GD5 A;  4U23 A;  2R6G E;  2UVG A;  1F9B A;  3A3U A;  3CR9 A;  5ET6 A;  2ESN A;  3PU5 A;  2PT1 A;  3C36 A;  2QSX A;  2PCR A;  1MH4 A;  4AS4 A;  3CFL A;  3OO9 A;  2ZXT A;  2XX9 A;  4GRK A;  3K4U A;  4IO6 A;  1Y4C A;  1Y3N A;  1QVS A;  1I69 A;  4PAI A;  3BFU A;  4XFE A;  1B3H A;  2VD3 A;  3H3G A;  3CFZ A;  1PEB A;  4F2Q A;  3O2A A;  1WOD A;  3RPW A;  2IEE A;  2XWO A;  4XF5 A;  3G3F A;  2THI A;  2V84 A;  3MZ9 A;  4KYE A;  4NTL A;  5DYH A;  5IGA A;  3RTF B;  3S2V A;  4P1L A;  4OVT A;  1NI9 A;  3W15 C;  3G3J A;  4ONY A;  3HCQ A;  5EQ9 A;  3H6W A;  3KSX A;  3K1N A;  4P8B A;  1UQW A;  4NED A;  4OXV A;  4IY6 A;  2F5X A;  4OVS A;  4PE3 A;  3A3C A;  3TPA A;  4O7M A;  3JZJ A;  3VLV A;  2O69 A;  2VOZ A;  4QSD A;  3RY3 A;  3G3G A;  5KCJ B;  5H8F A;  3RLF E;  4YIC A;  3MQ9 A;  4M4G A;  4OVP A;  3S9M C;  2GRV A;  3LSX A;  4RYA A;  2YLN A;  4G61 A;  1P1N A;  1UTH B;  3MVY A;  3EF7 A;  3K6U A;  4YB7 A;  1XVX A;  2DWJ A;  5H8H A;  3VVF A;  4YKK A;  1B5J A;  5CI5 A;  3C4M A;  1YZ0 A;  4BLA A;  4Q8R A;  3S9E A;  1A8F A;  1URG A;  3IOV A;  1KWH A;  2G29 A;  4XEQ A;  4QFL A;  2XHD A;  3I5O A;  4BDQ A;  2V93 A;  2UYE A;  4PBH A;  3RT6 B;  3FJG A;  3MW0 A;  1FQD A;  3VXC A;  3FGS A;  1SQY A;  1O64 A;  4JVD A;  3VVD A;  2XD2 A;  3G3I A;  4NF8 A;  5TP9 B;  3TTK A;  4PF8 A;  2F35 A;  1Q1K A;  2WBD A;  2R9J A;  5AA3 A;  5L9O A;  3IOW A;  1UIV A;  3OO7 A;  3DLN A;  1NFT A;  1B7Z A;  4ISU A;  3V5A A;  3PPN A;  4BDL A;  3MWB A;  2WYK A;  2LAO A;  1A40 A;  1AIV A;  2CZL A;  4ZE8 A;  4RNS A;  2Q74 A;  5ITP A;  2P2A A;  4U1O A;  1B0H A;  2IA4 A;  5H8Q A;  3LUZ A;  4NMY A;  3K02 A;  4MNI A;  4MMP A;  4F19 A;  1MXY A;  3PPQ A;  3BBR A;  2HHM A;  4MAG A;  4QBA A;  4GQO A;  3L6G A;  5IZ3 B;  3ZKK A;  4LVQ A;  2ZNT A;  4H45 A;  1N76 A;  4C0R A;  2B3B A;  3TEL A;  1DMB A;  2AIX A;  3FXB A;  3I3V A;  5TPA A;  2Y7I A;  4C1T A;  2GQ1 A;  3EKI A;  5FHN A;  4YB6 A;  1NV2 A;  3Q29 A;  4NF5 A;  1IZ1 A;  3MUQ A;  3TYH A;  2XXW A;  4NF6 A;  4KYS A;  5A5X B;  1B7U A;  4N6K A;  4ZS9 A;  3IL1 B;  2A5S A;  4MCO A;  2CMO A;  3MST A;  2G93 A;  1POY 1;  3U94 A;  4N17 A;  3RPL A;  2ZYN A;  2REJ A;  4GWU A;  3RYD A;  1NV6 A;  3PPR A;  4GWO A;  5FBP A;  3CRB A;  3RQT A;  1B3L A;  1LB9 A;  2P3N A;  4IO2 A;  3A29 A;  2PMS A;  1FQC A;  4G8M A;  5CMC A;  1II5 A;  2Z22 A;  1NH7 A;  4BDO A;  5I59 B;  1QW0 A;  3O6I A;  1FPI A;  4NF4 B;  1OQH A;  1JW4 A;  2OZZ A;  4MF3 A;  3E4R A;  3WAE A;  2XA5 A;  5CBS A;  4F3S A;  1GGG A;  3T66 A;  1LBY A;  4PTK A;  2I6E A;  5I58 A;  2BJJ X;  3VLW A;  1FQF A;  4KD5 A;  1N0T A;  1NMU A;  1P1Q A;  1DOT A;  4XIG Q;  1USY H;  4GWW A;  4OYV A;  4IR8 A;  2H99 A;  4LZ8 A;  1A54 A;  2FBP A;  1LBB A;  2I4B A;  1FTA A;  4O8M A;  4FEB A;  4ELQ A;  1NV1 A;  4F31 B;  4P0G A;  3O29 A;  2DVC A;  2Y7W A;  3VFJ A;  1P1W A;  3TMG A;  1MXZ A;  3V89 B;  3W9V A;  1B58 A;  3EHU A;  1L5T A;  4TQU Q;  4XKR A;  2YPN A;  4ELR A;  4RK2 A;  2QS3 A;  3ILU B;  4MNC A;  2QS2 A;  1FPJ A;  5ISU A;  2Y7R A;  3C31 A;  3CFX A;  3ISP A;  4KXP A;  1D3K A;  2VPN A;  4LN5 A;  4OES A;  3QSL A;  4R2B A;  1WVJ A;  3RN8 A;  1EH3 A;  3V83 A;  3E78 A;  3O6G A;  1ZJL A;  1LEV A;  5I2K B;  4M1V A;  3U72 A;  4AB6 A;  2RC9 A;  2ZNU A;  1Z7M E;  2ZNS A;  1ZIU A;  5L9M A;  2Q8J A;  1MH3 A;  3IOR A;  1EZO A;  1VFD A;  4F18 A;  3TTL A;  1Y3P A;  1NNT A;  3ODB A;  4JXI A;  2Z23 A;  4OMB A;  1MQD A;  4ESX A;  2O51 A;  5L9S A;  1JNF A;  2QL3 A;  4TLL B;  2HQ0 A;  1YCJ A;  4OWD A;  4F1U A;  3HPI A;  4LQ5 A;  3PPP A;  4GBV A;  4N15 A;  4IGT A;  1MDQ A;  5IZ1 A;  2VPO A;  4DXB A;  1USY E;  3G7W A;  4ZEC A;  2OK2 A;  1B3G A;  4PDD A;  4YU0 A;  3CIJ A;  2VP1 A;  2O84 X;  4H67 A;  2QFL A;  3S9N C;  5JTY A;  4H8I A;  2Y5K A;  2FIX A;  4GOT A;  3TCH A;  4DDD A;  2A5T B;  5FHO A;  3KN8 A;  1TWY A;  2MKZ A;  4RY1 A;  4OEV A;  2QMW A;  3R6U A;  4N8G A;  1IME A;  4H8J A;  3S4U A;  3KOT A;  1S9T A;  5I3S A;  5CBR A;  1MXX A;  3PGF A;  4KI0 E;  5AA4 A;  5M2V A;  3P7I A;  1PB7 A;  1JQF A;  1B05 A;  1RDY A;  1T0K A;  1OLC A;  1B9J A;  3T1B A;  3HST A;  3H6U A;  1CNQ A;  1FSA A;  3O9P A;  3IB1 A;  5KCJ A;  3FV2 A;  2E1S A;  3ZS6 A;  4FEC A;  2Y5L A;  3IOT A;  4R9G A;  4G68 A;  1JW1 A;  1PBP A;  2Y84 A;  1UTH A;  3UK4 A;  4QHQ A;  3MPL A;  1OMP A;  1SDX A;  2VHA A;  3B7D A;  3K6W A;  2Z8D A;  1MQG A;  2I3W A;  4ELO A;  3WAF A;  3VXB A;  3MVX A;  3E3K A;  4OQO A;  4F3P A;  3IO4 A;  4ZE9 A;  4GVO A;  3T0J A;  1FQB A;  1NV4 A;  1LGB C;  4GIZ A;  5IM2 A;  3MBP A;  4IO7 A;  1FBP A;  4KCC A;  5I2N B;  1VE4 A;  2NOO A;  5HPQ A;  3FAS A;  4P11 A;  4I3Y A;  4U22 A;  5J16 A;  4AS5 A;  4PFT A;  3M8U A;  1H44 A;  1YAE A;  5I57 A;  3BIG A;  4UAC A;  5BUU A;  4N81 A;  3CHG A;  3IO6 A;  2GH9 A;  1BK4 A;  3CG3 A;  2QVV A;  1LAX A;  3TOD A;  1G0H A;  2XWK A;  3OEM A;  4EF1 A;  4GX4 A;  1ZMG A;  1LAG E;  3HHG A;  1D9V A;  5ET5 A;  1NV0 A;  3OXN A;  3SEV A;  2FHY A;  2GHB A;  1URD A;  3KFM A;  3MVZ A;  2O1L A;  4YMA A;  3CVG A;  3GBA A;  1NUW A;  2CEY A;  3R7X A;  3U1O A;  4P47 A;  1GR2 A;  5ICQ A;  2V3T A;  3HHF A;  4EDP A;  3U93 A;  4RPO A;  4MNP A;  3HO7 A;  1VFE A;  4KPT A;  4MEV A;  2FNC A;  2FA7 A;  4UAB A;  4FJP A;  4KR5 A;  2WX9 A;  3USD A;  4PQJ A;  2XX7 A;  5EYG A;  2OWT A;  5JK4 A;  4X48 A;  5IZ3 A;  3QMF A;  4GWS A;  1B5I A;  4GWX A;  4H1X A;  1XHY A;  1NV3 A;  1XC1 A;  1DCU A;  1M5F A;  4O3B A;  3SER A;  1J1N A;  4AQ4 A;  1H45 A;  3N26 A;  4WED A;  5ICT A;  4F1Y A;  4HS7 A;  2Q2A A;  1LCT A;  4YB5 A;  4RJZ A;  2H9B A;  5KZT A;  3SEU A;  3KC1 A;  2O6A A;  1B4H A;  3T93 B;  1SI1 A;  4F3G A;  5ESY A;  4FOR A;  4Z0I A;  3IJX B;  1Y20 A;  4N13 A;  3TFL A;  5LDZ A;  1LAH E;  1B6H A;  4O3A A;  1BTJ A;  1POT A;  3ILT B;  4OVJ A;  1MRP A;  2D5W A;  5JEI A;  5CRY A;  4FAT A;  1TT1 A;  3LC8 A;  3VVE A;  4PFU A;  1B3F A;  3LBS A;  4EUO A;  1QUJ A;  5KDT B;  1K9Y A;  4OZ9 A;  1ANF A;  4BDM A;  4QFO A;  5L8D A;  1BP5 A;  3PTY A;  4U21 A;  3S9L C;  3I6V A;  3B8B A;  3PD8 A;  4JBZ A;  1FBH A;  4FAJ A;  1FPB A;  3G3H A;  3SKP A;  3E9X A; 
#chains in the Genus database with same CATH homology
 1I6B A;  2V25 A;  2D3I A;  1MG1 A;  4NF4 A;  2HZK A;  3EHT A;  3R26 A;  2DOJ A;  1P1O A;  3ZKL A;  1P1U A;  3PUZ E;  1GV8 A;  5FTH A;  4HCY A;  4H5G A;  2XXT A;  3FIR A;  2DWI A;  1R1N A;  5I56 B;  4IO3 A;  4HW8 A;  4F2O A;  1LFH A;  1B1X A;  3TCF A;  4O3C A;  2DE2 A;  2AL4 A;  2F34 A;  3T9U A;  1BLF A;  5AA2 B;  1JW5 A;  4H0W A;  1LFI A;  3BKI B;  5B7D A;  2B3F A;  3ZSF A;  2UVI A;  3KN7 A;  5F1Q A;  1JEV A;  3OO8 A;  3GLB A;  2ALU A;  1ZBM A;  3IK6 B;  1O7T A;  1FTO A;  2UXA A;  3EPE A;  3N6T A;  1N3X A;  4OFJ A;  3TTR A;  3FXU A;  4G2Z A;  3KOS A;  3KJT A;  1AOV A;  1SW4 A;  3UGW A;  3A09 A;  5IKB A;  1FCK A;  4JSD A;  1MQI A;  1FQE A;  1NNP A;  5AA1 A;  2F6G A;  3G3K A;  4OFL A;  1Y3Q A;  1R6Z A;  4YKP A;  1B4Z A;  2FYI A;  3UIF A;  4ZEF A;  2DP8 A;  1LST A;  2RKM A;  5I2K A;  2ZYO A;  1B40 A;  2VGQ A;  3O6H A;  2X7Q A;  3MC2 A;  1MPB A;  4R6Y A;  3FVG A;  2F36 A;  3CSG A;  1A99 A;  1XOC A;  1UTB B;  1JEU A;  3OOA A;  1N84 A;  5H8H B;  1HSJ A;  4R9F A;  4TOZ A;  2X7P A;  1PB8 A;  1MS7 A;  1SI0 A;  3ECR A;  4NWC A;  1IXC A;  3SEX A;  3K2D A;  4OEN A;  2WKY A;  2ZYM A;  3MP6 A;  3UN6 A;  1NKX A;  1DTZ A;  3KBR A;  4NE4 A;  1DSN A;  3H4Z A;  1VSO A;  1SVX B;  1RYO A;  4NWD A;  3KGC A;  3PMX A;  4EXL A;  1CE2 A;  2Q88 A;  3ONM A;  2XXY A;  5EHM A;  1SD3 A;  3FVK A;  2NVU B;  4R72 A;  1UIU A;  2RCA A;  4IO4 A;  2XXP A;  4R6K A;  2GFE A;  3W9W A;  2A5T A;  4OEU A;  1Y1M A;  3OO6 A;  4EQ9 A;  2ZMB A;  3N6U A;  5HM4 B;  3QAX A;  5CMB A;  4Q5T A;  4F1V A;  2OWS A;  4PFW A;  1B32 A;  2F7C A;  2OJT A;  5J1D A;  3C34 A;  3K1P A;  4ZEK A;  4WEP A;  2VD2 A;  2HAV A;  3PD9 A;  4IGR A;  2DXY A;  2HXW A;  2UVJ A;  3PUV E;  4PET A;  2I0B A;  2GHA A;  1LAF E;  1EZ9 A;  1Q35 A;  1MM7 A;  4DLD A;  4BDN A;  3MP1 A;  4H65 A;  3D4C A;  4G4P A;  1JVY A;  1PC3 A;  4XKQ A;  4ZDM A;  4POX A;  2ONR A;  3DP4 A;  3TAJ A;  4LA9 A;  3OSQ A;  1N04 A;  4MH5 A;  2RF1 A;  3FV1 A;  3MAM A;  2DSF A;  3H06 B;  3M3L A;  3C33 A;  1YTV A;  3UOR A;  3KEI A;  1TXF A;  3U8Q A;  5AE4 A;  4ZZE A;  2OBG A;  3U92 A;  2Q89 A;  1B5H A;  4OHN A;  3TQW A;  4K3F A;  1M5C A;  2F6P A;  3K6V A;  4WXJ A;  3F11 A;  2KLF A;  2F7B A;  4THI A;  2DE3 A;  3KJ7 A;  3T9X B;  4XKP A;  3B6T A;  5B70 A;  5H8S A;  5CMM A;  3TCG A;  1TFD A;  1MY0 A;  4IO5 A;  1OIB A;  3GXA A;  3TTN A;  2DYX A;  4ND9 A;  2HAU A;  2Q2C A;  1Y4T A;  4WKM A;  3AXF A;  4R6H A;  1BKA A;  1SBP A;  5AA2 D;  1EU8 A;  3MP8 A;  1A8E A;  1JVX A;  2XXX A;  1LLS A;  5CM6 A;  3EHS A;  1SYH A;  1AH5 A;  1IXI A;  3Q25 A;  4N6P A;  5F7V A;  3IB2 A;  1MY4 A;  4LZ5 A;  3TZA A;  1I6A A;  1LFG A;  5CMK A;  1PBQ A;  3C32 A;  1M5B A;  5K2X A;  1VR5 A;  1SW1 A;  1IIW A;  3RUM A;  4DE8 A;  2NXO A;  4P0I A;  5DVI A;  1SW5 A;  2DQV A;  3FUZ A;  1PB9 A;  4F39 A;  3IJO B;  2ONK E;  3PMW A;  2DXR A;  4JWY A;  5FTI A;  2Y7P A;  2OLB A;  3PUY E;  1MDP 1;  1MXW A;  4ESW A;  3TUS A;  1A55 A;  1OLA A;  2H98 A;  2HFB A;  4G68 C;  1ATG A;  5KDT A;  5H8N B;  4I1D A;  3KN3 A;  2PYY A;  2HCA A;  2ABH A;  5DT6 A;  3H03 A;  4DXC A;  2XXR A;  3GZG A;  1NH8 A;  5CC2 A;  3K1M A;  3UP9 A;  3O66 A;  1MPD A;  4I8C A;  4KCD A;  1O63 A;  1HSL A;  4RK9 A;  1I6Q A;  5TP9 A;  4AB5 A;  1XS5 A;  4QFP A;  3KG2 A;  4PE5 B;  4KYD A;  1ZU0 A;  3H6V A;  2O7U A;  5I56 A;  3C35 A;  1FW0 A;  2HZL A;  1RYX A;  5AA2 A;  3QUF A;  4LQ2 A;  2Z8F A;  2UYF A;  4BDR A;  5DEX B;  4GL0 A;  4C1U A;  1ZLQ A;  1S7Y A;  3IX1 A;  4DCY A;  1LBC A;  1AL3 A;  2DWA A;  4ZED A;  3EQ1 A;  4LUB A;  2I0C A;  4H5F A;  3FZV A;  4DCX A;  1R9Q A;  1QUK A;  4DXU A;  5JTY B;  2HEU A;  4E0X A;  1FTL A;  1QUL A;  4ZZA A;  4MLQ A;  4XKN A;  3JYR A;  5DVJ A;  1AMF A;  2XXU A;  3QXM A;  3SES A;  2Q9T A;  5K2Y A;  3IR1 A;  2Y7K A;  4I9D A;  3FJM A;  5AA4 B;  2OCU A;  3N94 A;  3H6T A;  2PBW A;  3RGY A;  5I84 A;  1MM6 A;  1IEJ A;  3RT8 A;  5LOM A;  2PT2 A;  2P0S A;  5A5X A;  1MQJ A;  4IY5 A;  1UTB A;  3UA8 A;  4G68 B;  2V3Q A;  4LAT A;  4X9T A;  2PX1 A;  3RNN A;  3B6W A;  4QFK A;  3TTM A;  2XXH A;  1H43 A;  3VE1 B;  3T22 A;  1B0L A;  4YKJ A;  1IXH A;  1IIT A;  2F78 A;  3RTW B;  1XVY A;  4OFO A;  5I59 A;  2PVU A;  4QF9 A;  3DP8 A;  1NNK A;  4LON B;  4KQP A;  1MXV A;  4MLV A;  5ITO A;  3V8X B;  1QKA A;  3CI8 A;  5I57 B;  2B65 A;  3Q27 A;  1DPE A;  2O7I A;  2DVZ A;  1TFA A;  1SYI A;  1NNF A;  2F97 A;  3FXQ A;  4YZZ A;  4EF2 A;  4G8N A;  4R73 A;  3OEN A;  3K01 A;  1URS A;  2QMX A;  2NUV A;  4TLM B;  4RA1 A;  4KHZ E;  1OVB A;  3T96 B;  1Y1Z A;  2RC8 A;  3HN0 A;  4PP0 A;  4FED A;  4I62 A;  4L17 A;  4U2R A;  4QFN A;  3OMB A;  3VDF A;  3M3F A;  3JV9 A;  1YPN A;  2H5Y A;  4DZ1 A;  4ZEB A;  3D4G A;  3KSJ A;  1US4 A;  1MXU A;  1ELJ A;  3CG1 A;  3IB0 A;  3MZ1 A;  1FQA A;  5DTB A;  1US5 A;  3EN3 A;  3FXR A;  4OTE A;  1MPC A;  3LR1 A;  4PFY A;  5EYF A;  5TU0 A;  3M3K A;  4YAH X;  1GTK A;  2ZYK A;  4X1D A;  2XXI A;  4Q0C A;  4HCW A;  1IUD A;  1B3E A;  2X26 A;  5H8F B;  3MPK A;  4GF8 A;  4N07 A;  4HTG A;  1MY2 A;  1HSE A;  1R9L A;  3QUJ A;  4JWX A;  3LSW A;  2REG A;  4R75 A;  2YJP A;  2I48 A;  1FTK A;  4R2F A;  3TKD A;  2P1S A;  4XTC Q;  1B2H A;  2O1M A;  4JSO A;  1LCF A;  1QJM A;  3PPO A;  1H3D A;  3KZG A;  2RC7 A;  3T9V A;  2D21 A;  1BIY A;  3H7M A;  2I4C A;  4FIM A;  2RCB A;  4R74 A;  1WDN A;  4LP2 B;  1OQG A;  4JB7 A;  1N3W A;  1XT8 A;  3MZB A;  4QSE A;  3K00 A;  2V3U A;  1P99 A;  2H25 A;  5EHS A;  3MJN A;  3OD7 A;  2QJE A;  4NF8 B;  1A7L A;  4MBP A;  5DVF A;  2QS4 A;  5HBC A;  3DM0 A;  4GXA A;  4U4S A;  3PUX E;  3PUW E;  4F29 A;  3FVO A;  1S50 A;  1Y9U A;  3OEL A;  1B1H A;  3SEY A;  1PDA A;  1M5D A;  2E0S A;  1QKB A;  1RKM A;  1D9Y A;  3PMV A;  2DWH A;  5H8Q B;  2I49 A;  1NL5 A;  1FTM A;  4EQ7 A;  2M8C A;  3Q28 A;  4JDF A;  3VV5 A;  3PV0 E;  1JET A;  1ZTY A;  4IB2 A;  3N5L A;  2XXV A;  1M5E A;  1B46 A;  1B7H A;  4ELP A;  3FJ7 A;  5IAI A;  5TPA B;  3FAT A;  4KFQ A;  3VLU A;  5H8N A;  5I2N A;  3DEL B;  3QIM A;  4RXL A;  2F7A A;  4NF5 B;  4OER A;  4XXU A;  4QRZ A;  1N7X A;  1IQ7 A;  2NWJ A;  4NF6 B;  3CSB A;  3FD3 A;  2I58 A;  1EZP A;  2QRY A;  1MQH A;  2I3V A;  4DIG A;  3GBB A;  4Q30 B;  1B52 A;  2XD3 A;  3IOU A;  4UA8 A;  4E0W A;  2AYS A;  3QK6 A;  4H6D A;  3LUY A;  2O68 A;  3SET A;  1ZKB A;  5FHM A;  2DS9 A;  2RIN A;  5DEX A;  4GXS B;  3SDF A;  2H4I A;  2W7Y A;  1QUI A;  3C9H A;  4GL8 A;  1LB8 A;  2F8D A;  3QYT A;  1Z7N E;  3T9H B;  3O97 A;  4EQB A;  4U1Z A;  4F3B A;  3MVW A;  4F22 A;  5I58 B;  1SW2 A;  1IXG A;  4JWO A;  1DTG A;  1FTJ A;  2AL5 A;  1B51 A;  4RPN A;  1OVT A;  3OSR A;  4YMB A;  3TDJ A;  2XX8 A;  4G77 A;  3LSF B;  3E13 X;  1DPP A;  2QS1 A;  3O28 A;  4ECF A;  3BFT A;  3FVN A;  3LSL A;  2QPQ A;  1MY1 A;  2UVH A;  3L6H A;  4U4X A;  3B6Q A;  4OET A;  4POW A;  4MFI A;  3K6X A;  4GLI A;  2XXQ A;  3HV1 A;  1N7W A;  4QSC A;  2R71 A;  4G8H A;  2DE4 A;  3TQL A;  3SEW A;  3OEK A;  3THI A;  1H76 A;  1MY3 A;  5ELV A;  4Z7E A;  4GFR A;  1CB6 A;  2ONS A;  3Q26 A;  3IAZ A;  4X1B A;  4EXK A;  1D4N A;  2Z8E A;  2ANJ A;  3DP6 A;  4FE8 A;  4ZEI A;  4YKI A;  4LZ7 A;  5BWJ A;  3TEP A;  1GVC A;  3K0V A;  4GD5 A;  4U23 A;  2R6G E;  2UVG A;  1F9B A;  3A3U A;  3CR9 A;  2ESN A;  3PU5 A;  2PT1 A;  3C36 A;  2QSX A;  1MH4 A;  3CFL A;  3OO9 A;  2ZXT A;  2XX9 A;  4GRK A;  3K4U A;  4IO6 A;  1Y4C A;  1Y3N A;  1QVS A;  1I69 A;  3BFU A;  1B3H A;  2VD3 A;  3H3G A;  3CFZ A;  1PEB A;  4F2Q A;  3O2A A;  1WOD A;  3RPW A;  2IEE A;  3G3F A;  2THI A;  2V84 A;  3MZ9 A;  4KYE A;  4NTL A;  5DYH A;  3RTF B;  3S2V A;  3W15 C;  3G3J A;  4ONY A;  3HCQ A;  3H6W A;  3KSX A;  3K1N A;  1UQW A;  4OXV A;  4NED A;  4IY6 A;  2F5X A;  3A3C A;  3TPA A;  3JZJ A;  3VLV A;  2O69 A;  2VOZ A;  4QSD A;  3RY3 A;  3G3G A;  5KCJ B;  5H8F A;  3RLF E;  4YIC A;  3MQ9 A;  4M4G A;  3S9M C;  2GRV A;  3LSX A;  4RYA A;  2YLN A;  1P1N A;  1UTH B;  3MVY A;  3EF7 A;  3K6U A;  4YB7 A;  1XVX A;  2DWJ A;  5H8H A;  3VVF A;  4YKK A;  1B5J A;  5CI5 A;  3C4M A;  4BLA A;  4Q8R A;  3S9E A;  1A8F A;  1URG A;  3IOV A;  1KWH A;  2G29 A;  4QFL A;  2XHD A;  3I5O A;  4BDQ A;  2V93 A;  2UYE A;  3RT6 B;  3FJG A;  3MW0 A;  1FQD A;  3VXC A;  3FGS A;  1SQY A;  1O64 A;  3VVD A;  2XD2 A;  3G3I A;  4NF8 A;  5TP9 B;  3TTK A;  2F35 A;  1Q1K A;  5AA3 A;  2R9J A;  5L9O A;  3IOW A;  1UIV A;  3OO7 A;  3DLN A;  1NFT A;  1B7Z A;  4ISU A;  3V5A A;  3PPN A;  4BDL A;  3MWB A;  2LAO A;  1A40 A;  1AIV A;  2CZL A;  4ZE8 A;  4RNS A;  5ITP A;  2P2A A;  4U1O A;  1B0H A;  2IA4 A;  5H8Q A;  4NMY A;  3K02 A;  4F19 A;  1MXY A;  3PPQ A;  3BBR A;  4GQO A;  3L6G A;  3ZKK A;  4LVQ A;  2ZNT A;  1N76 A;  4C0R A;  2B3B A;  3TEL A;  1DMB A;  2AIX A;  3I3V A;  5TPA A;  2Y7I A;  4C1T A;  5FHN A;  4YB6 A;  3Q29 A;  4NF5 A;  1IZ1 A;  3MUQ A;  3TYH A;  2XXW A;  4NF6 A;  4KYS A;  5A5X B;  1B7U A;  4ZS9 A;  3IL1 B;  2A5S A;  2CMO A;  2G93 A;  1POY 1;  3U94 A;  2ZYN A;  2REJ A;  3PPR A;  4GWO A;  3CRB A;  3RQT A;  1B3L A;  1LB9 A;  4IO2 A;  2PMS A;  1FQC A;  4G8M A;  5CMC A;  1II5 A;  2Z22 A;  1NH7 A;  4BDO A;  5I59 B;  1QW0 A;  3O6I A;  4NF4 B;  1OQH A;  1JW4 A;  2OZZ A;  4MF3 A;  3E4R A;  3WAE A;  5CBS A;  4F3S A;  1GGG A;  3T66 A;  2I6E A;  5I58 A;  2BJJ X;  3VLW A;  1FQF A;  4KD5 A;  1N0T A;  1NMU A;  1P1Q A;  1DOT A;  4XIG Q;  1USY H;  4OYV A;  2H99 A;  4LZ8 A;  1A54 A;  1LBB A;  2I4B A;  4FEB A;  4ELQ A;  4F31 B;  4P0G A;  3O29 A;  2DVC A;  2Y7W A;  3VFJ A;  1P1W A;  3TMG A;  1MXZ A;  3V89 B;  3W9V A;  1B58 A;  3EHU A;  1L5T A;  4TQU Q;  4XKR A;  2YPN A;  4ELR A;  4RK2 A;  2QS3 A;  3ILU B;  2QS2 A;  5ISU A;  2Y7R A;  3C31 A;  3CFX A;  1D3K A;  4OES A;  3QSL A;  4R2B A;  1WVJ A;  3RN8 A;  1EH3 A;  3V83 A;  3O6G A;  1ZJL A;  5I2K B;  4M1V A;  3U72 A;  4AB6 A;  2RC9 A;  2ZNU A;  1Z7M E;  2ZNS A;  1ZIU A;  5L9M A;  2Q8J A;  1MH3 A;  3IOR A;  1EZO A;  1VFD A;  4F18 A;  3TTL A;  1Y3P A;  1NNT A;  3ODB A;  4JXI A;  2Z23 A;  4OMB A;  1MQD A;  4ESX A;  2O51 A;  5L9S A;  1JNF A;  2QL3 A;  4TLL B;  2HQ0 A;  1YCJ A;  4OWD A;  4F1U A;  3HPI A;  4LQ5 A;  3PPP A;  4IGT A;  1MDQ A;  4DXB A;  1USY E;  3G7W A;  4ZEC A;  2OK2 A;  1B3G A;  4YU0 A;  3CIJ A;  2VP1 A;  2O84 X;  4H67 A;  3S9N C;  5JTY A;  4H8I A;  4GOT A;  3TCH A;  4DDD A;  2A5T B;  5FHO A;  3KN8 A;  1TWY A;  4RY1 A;  4OEV A;  2QMW A;  3R6U A;  4H8J A;  3S4U A;  3KOT A;  1S9T A;  5CBR A;  1MXX A;  3PGF A;  4KI0 E;  5AA4 A;  5M2V A;  3P7I A;  1PB7 A;  1JQF A;  1B05 A;  1T0K A;  1OLC A;  1B9J A;  3HST A;  3H6U A;  3O9P A;  3IB1 A;  5KCJ A;  3FV2 A;  2E1S A;  3ZS6 A;  4FEC A;  3IOT A;  4R9G A;  4G68 A;  1JW1 A;  1PBP A;  2Y84 A;  3UK4 A;  1UTH A;  4QHQ A;  3MPL A;  1OMP A;  1SDX A;  2VHA A;  3B7D A;  3K6W A;  2Z8D A;  1MQG A;  2I3W A;  4ELO A;  3WAF A;  3VXB A;  3MVX A;  3E3K A;  4OQO A;  4F3P A;  3IO4 A;  4ZE9 A;  4GVO A;  1FQB A;  1LGB C;  4GIZ A;  3MBP A;  4IO7 A;  4KCC A;  5I2N B;  1VE4 A;  2NOO A;  5HPQ A;  3FAS A;  4P11 A;  4U22 A;  4PFT A;  3M8U A;  1H44 A;  1YAE A;  5I57 A;  4UAC A;  5BUU A;  3IO6 A;  2GH9 A;  3CG3 A;  1LAX A;  3TOD A;  3OEM A;  4EF1 A;  1ZMG A;  1LAG E;  3HHG A;  1D9V A;  3OXN A;  3SEV A;  2GHB A;  1URD A;  3KFM A;  3MVZ A;  2O1L A;  4YMA A;  3CVG A;  3GBA A;  3U1O A;  3R7X A;  1GR2 A;  5ICQ A;  2V3T A;  3HHF A;  4EDP A;  3U93 A;  4RPO A;  3HO7 A;  1VFE A;  4KPT A;  2FNC A;  2FA7 A;  4FJP A;  4KR5 A;  3USD A;  4PQJ A;  2XX7 A;  2OWT A;  5JK4 A;  4X48 A;  1B5I A;  1XHY A;  4H1X A;  1XC1 A;  1M5F A;  4O3B A;  3SER A;  1J1N A;  4AQ4 A;  1H45 A;  3N26 A;  4WED A;  5ICT A;  4F1Y A;  4HS7 A;  2Q2A A;  1LCT A;  4YB5 A;  4RJZ A;  2H9B A;  5KZT A;  3SEU A;  2O6A A;  1B4H A;  3T93 B;  1SI1 A;  4F3G A;  4FOR A;  4Z0I A;  3IJX B;  1Y20 A;  4N13 A;  3TFL A;  1LAH E;  1B6H A;  4O3A A;  1BTJ A;  1POT A;  3ILT B;  4OVJ A;  1MRP A;  2D5W A;  5JEI A;  5CRY A;  4FAT A;  1TT1 A;  3LC8 A;  3VVE A;  4PFU A;  1B3F A;  3LBS A;  4EUO A;  1QUJ A;  5KDT B;  4OZ9 A;  4BDM A;  1ANF A;  4QFO A;  5L8D A;  1BP5 A;  4U21 A;  3S9L C;  3I6V A;  3PD8 A;  4JBZ A;  4FAJ A;  3G3H A;  3SKP A;  3E9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...